4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
source organism Cupriavidus metallidurans ch34
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
4HDVA 3KLOA 2VE9A 2O0YA 3DEUA 4PDKA 3C18A 3I64A 2CWEA 5H6RA 1IUYA 3V7RA 4ETSA 1SFEA 4RGSA 1LDJA 2BBYA 3RKYA 2HTSA 3ECOA 3RASA 3ZI0A 3CO6C 1IXSB 3WTTC 2MH2A 4O5VA 4LJZF 3IL2A 5E17F 2F2EA 5BPIA 2ZJ2A 1R23A 2LF8A 1STZA 3TOAA 1ZS2A 3W6JB 1KGSA 4L18B 3BJ6A 3BY6A 1ZG5A 4EM2A 5LBQA 5J6XA 2XAJA 5DCMA 2W24A 3WTZA 2Y1CA 4G7ZF 5DD8A 4OMZA 2YU3A 3E6CC 1ZN2A 2QUFA 2RVCA 3LA7A 3J80Z 2XIGA 3Q5FA 2VBZA 4M9ZA 5JI6A 3KP6A 2EWNA 1TBXA 5ERIA 3ML6A 4Y67A 3ANNA 4R1HA 1JG9A 3LA2A 4S05A 2DQLA 1XCVA 2QENA 1BBYA 4RAYA 1FBUA 1ZRFA 3FX3A 2H09A 2XV4S 2PFBA 4M72A 2GQQA 3FXUA 2K4BA 2QBYA 2PJPA 1U8RA 4EV0A 3VFZA 1ZG1A 4ZQGA 1J2XA 1RUNA 1TQIA 4R8HA 1TNSA 5K5QA 3P7NA 1U5TC 3HRUA 4FX4A 3BZ6A 1FY7A 2FBKA 4UVAA 3ECHA 5DEQA 1FBSA 2ZMEB 2KRFA 3ZP5A 1J75A 5J8CA 1TNTA 5FGMA 2DPUA 3ANLA 5FLXZ 2K7LA 2NYXA 4FX0A 2ACJA 3T8RA 3SXYA 3RTRA 1U3EM 2QM3A 3LSTA 4N9HA 3GW2A 2Q0OA 3WGIA 2HZTA 3KP2A 4GXOA 3DFGA 3S2WA 4HV6A 5ICFA 4UVCA 3VEPA 2W85A 3BDDA 4OOFA 4BHCA 3ZPLA 1T98A 1Z91A 4WCGA 4FT8A 1ZLKA 3REOA 4HQMA 1GXPA 2CG4A 4KUMA 3KP5A 1Z6RA 1ZGJA 3CZLA 1PP7U 3CDHA 1H0MA 2PMUA 3HSFA 3HOSA 3NQOA 1LDDA 4K2EA 1KU2A 3R61A 3O2PE 2EV0A 2JCXA 2A3SA 4Q4ZF 3I71A 5L3DA 2MLGA 3IIEA 2KJBA 1S46A 4Y15A 1YG2A 3J81K 3BPXA 2HR3A 4KICA 5JNLA 5JR3A 4FHTA 4R79A 3RKWA 5K5RA 2IRFG 5L3GA 1YO5C 2QQ9A 3WTSC 2V1XA 4KA4A 2ZNYA 5LEJA 1RZ4A 2MC3A 1FYMA 4FLRA 3CUQA 4LB6B 4MEXF 1QPMA 3TO6A 5HLGA 3B73A 1R22A 1JE8A 3KP4A 2IT0A 1GVJA 1WSUA 2DQRA 2XAFA 5JFRA 1QBJA 2P5KA 5CVIA 5H20A 4Q5SF 1U78A 1X3UA 4ZZLA 2BV6A 5CVUA 3W6KB 3IKVA 5HS9A 2FE3A 4KMFA 1JVSA 2JD1A 5IT3A 4JBAA 5JBIA 2ZKZA 1BM9A 3EYIA 3IWFA 4LGWA 3K0LA 1MZBA 4OOIA 3SZTA 5LLQA 1I1SA 3EDPA 2GZWA 1O3SA 3E6MA 3DF8A 3BJAA 3NEUA 4L0ZB 3GWZA 2Y48A 4FLOA 4AYSA 4MQVA 3V7SA 2ADUA 1KYWA 1FYLA 2DW4A 1P4XA 3V8LA 5FD5A 5AIQA 1J0RA 3QOPA 3EYYA 1O3TA 4M6YA 1T38A 1ONNA 1Y0UA 3A06A 2IVMA 2UWMA 1KQ8A 2VC1A 5DCMB 1XGSA 3F23A 4IRGA 3CLOA 4MEYF 3I59A 3ISPA 2JCVA 1Q0QA 2WPGA 3EETA 2VT2A 4ZQHA 4KIGA 3LWFA 2PMHA 4M6XA 4HDUA 4UV8A 2J5PA 2PBIA 4ZN6A 4XSXF 4N9IA 2E7WA 1HBXG 2FU4A 1IRGA 4GAEA 3ZMDA 4RS8A 1XMKA 4ZQEA 1IN8A 3HHGA 5JMPA 1TW2A 2QBYB 2FMYA 2P6TA 4EJUA 4EM0B 2A6HF 4CZZA 3L9FA 5LEKA 3TKYA 4LB5A 1XGNA 4P96A 4M9XA 2VOOA 4NB5A 3F8BA 4AWXB 1Z6TA 1H9GA 5A2QK 4F7ZA 3WGGA 5ICGA 3N97A 1R7JA 4NQWA 1AWCA 4XRFA 2M1BA 2W84A 4S04A 1ZLJA 4PGHA 2GA1A 2HYFA 2F5DA 5CJ9A 2UXNA 1ONOA 2NAZA 1BC7C 5D5XB 1IRFA 3WTVC 4P55A 2FMLA 2RKHA 4M74A 2HDCA 4KNYA 3HRMA 2JZYA 4KDPA 3OOPA 3U2RA 1HQCA 3T8TA 2GIVA 4G7OF 3ZHYA 3FHZA 5HS7A 3GO5A 1B59A 3BPVA 3JW4A 3QP5A 4FLQA 2ISZA 1MW2A 1WI9A 2PG4A 1FBQA 4EJVA 3R6SA 3K1NA 4U0VA 2KIUA 1REPC 2VBWA 5TJJA 3K9TA 3R60A 4RCVA 2KKOA 5E1XA 1XGMA 2R7FA 3CUQB 3QPTA 2H27A 2A68F 2GXGA 1S29A 3KZZA 3V7CA 3GEZA 5ICCA 4ENNA 1HXDA 1YW8A 1FZPB 1MGTA 1D3YA 1CF7A 2G9WA 1WWXA 5FB2A 4MGRA 3P9KA 1IXCA 1UHMA 1YW7A 2XUBA 1R5HA 1SMTA 1WQ2A 2PQ8A 4RB2C 1R0KA 2VBYA 4I01A 4A5NA 1MW3A 2G7UA 2RN7A 5ILSA 2NNYA 2BE5F 3U9GA 1XB4A 1SD5A 4EGYA 3QRFF 5F6FA 2OD5A 4Y13A 3TO9A 4Y17A 4Q47A 1W5SA 3FMRA 2UZKA 2ZNZA 4AD9A 4XSZF 5IT9Z 2FEZA 2B0LA 4CO8A 3KE2A 3E5QA 3KEOA 4BQAA 4KP7A 3ERED 5FFXA 4ZYEA 1QGPA 5E8IA 3LAPA 2L3DA 2XRNA 5CLSA 3HTSB 5ICEA 1YIOA 2PN6A 1XDUA 3E6DA 3I59B 4UV9A 2NRAC 1I1GA 2QQAA 4IPAA 4G6QA 2HQRA 3TO7A 2M8EA 4MTDA 3K2ZA 1BOAA 4EJOA 1IN6A 2EV5A 2L01A 1YS7A 1HW5A 1TW3A 3WODF 2ZBKA 1RIOH 2XHKA 4UUVA 1RUOA 3KETA 3I58A 4ESBA 5FD6A 2CW0F 1IF1A 2IJLA 1DPRA 2L54A 2XKPA 2V1UA 3D5LA 1WKMA 5D4SA 1OYYA 3RIRA 4ZH4F 3M7GA 1KQ0A 4HZFA 3JSPA 4EGZA 1J59A 1G3SA 1ODDA 4A6DA 2P5LC 5DCFA 5ED4A 2ESHA 2Y1DA 2F5FA 1SD7A 1MD0A 2D45A 3EQLF 2ESNA 2HTJA 4RB1A 3CO7C 1G3WA 2KIMA 3V8JA 2K27A 3F3XA 5CVVA 3T5XA 4I0BA 4I7HA 2JD2A 2MBFA 2XAGA 3FXQA 2HOEA 4IHTA 4OU0A 2HEOA 3F22A 2Z99A 4G6DA 3AAFA 1JHFA 2D1VA 1D5VA 2RGVA 3QU3A 1SFXA 1LJ9A 4G94A 4CDGA 1G5AA 3L00A 3PQJA 2QZ8A 4MNUA 3PFIA 3T1BA 3ZHXA 2IW5A 1D8JA 1OPCA 4U88A 3CZGA 4YFXF 2O8XA 2QQBA 5CVRA 4L9NA 1K5HA 3JTGA 5D6FA 1FNNA 4BNCA 4B8XA 3GFIA 4OIOF 2X4HA 4UXNA 4EMSA 4EJWA 4DNCA 1E17A 2Y0MA 1YS6A 4WXDA 1ZYRF 3TGNA 1BI1A 2DPDA 2STTA 5LRSA 1CF7B 1O3RA 2QLZA 2IA0A 5H6QA 3BJOA 4MQ9F 2QYOA 1Q0HA 2JT1A 2JCYA 2Y1EA 5D5UB 5AIPA 4HF1A 3ZN0A 4Q48A 3WE3A 4HX4A 2MLKA 2P7VB 1ZHFA 2YX4A 3BROA 1V4RA 2HWVA 2RDPA 3HRSA 5L3FA 3DPLC 5LHHA 3WU0A 1XDSA 2WWYA 3FMSA 1PP8F 5E18F 1BI0A 3M8FA 2E1NA 3C3WA 1MDMA 3HTUA 4KN7X 3JSOA 4U0YA 2XAQA 3HSEA 5LRRA 3ZMSA 5HVQC 5F1RA 1WRJA 1Q0LA 4MTEA 1E2XA 1BJAA 5EEGA 2OZ6A 3F8NA 3WTXC 3FM5A 1R1VA 4HYEA 2E1CA 1J7KA 2HKOA 2FNPA 4HF2A 4LK0F 4XLPF 1YYVA 4FLSA 3RDIA 1XD7A 3DPTA 4HBLA 1HSJA 3VB2A 3P9IA 3HOTA 1BN5A 3F8FA 3LA3A 3TOBA 5JO0A 3FMQA 4ZYGA 1LDKB 3HHHA 2L4AA 1T1RA 3H3ZA 3I5UA 4BYYA 4YG2F 3DV8A 5HS8A 4ENKA 3MFKA 1ZGAA 4WWCA 1HKQA 5HDGA 4LFUA 4D0PA 1SC5A 3RJPA 3WGHA 5D6EA 2V79A 1J9IA 3WG9A 3GFMA 1QQIA 3V4GA 4OOEA 2Y1FA 4KIBA 1FLIA 3ELKA 2FNAA 4HV5A 4ON0A 1HKTA 1G6NA 4PZJA 3RYRA 1HW1A 3MZHA 2O3FA 3SHFA 3UEQA 3ZMTA 1K7AA 5LHIA 1ON2A 3JAMK 2AXLA 3GVAA 4RB3C 5EEHA 2CQKA 3J81Z 2FBIA 1Z05A 1C0WA 4M9SA 3RKXA 5L3EA 4EQQA 3MWMA 4LMYA 3E97A 4A5MA 3ZHZA 2WTEA 4HLYA 4U0WA 3L7WA 1IXRC 1R00A 4ZZDA 1XCBA 4UHTA 1FSEA 2EFNA 3CUOA 3AUAA 3L09A 3R0IA 2O61A 3DQVC 2J5OA 4N0BA 1B6AA 3QU6A 1MW0A 1H3LA 2FOKA 1QZYA 1A04A 5D5VB 3K1MA 2H6CA 5D8KB 2JPCA 2P7CB 2C6YA 2PLYA 2ZXJA 2FQ3A 4ENJA 1S3JA 2Z3YA 3KZYA 5AONA 1EH7A 3KLNA 2Q8KA 4HA8A 1JXSA 3SFZA 4KT5C 1JHHA 1YLFA 4LG0A 3HUGA 2E7XA 1IN4A 4PCQA 4U7BA 1QO0D 3HSRA 4KN4X 5ILUA 1ON1A 2IA2A 4IRIA 2L02A 5HOOA 4BH9A 3U1DA 1KQ9A 3GUDA 2OQRA 3ROUA 2RC4A 1YFHA 1USSA 1KU3A 2EFWA 1Q1HA 4BHPA 1Z7UA 1MDMB 3GFJA 2P5VA 5LGUA 3N4MA 4OMYA 4YFKF 3FWEA 3LFKA 2IA1A 4WXHA 2JPBA 2PEXA 3KFWX 4CICA 4A12A 3E3VA 3BWGA 2STWA 4PGGA 4EVIA 1S6LA 5HLIA 4Y6PA 1R5GA 1V3FA 2K4JA 2K86A 1BI2A 1FYKA 1LVAA 4ZYHA 2JSCA 2XROA 5E1WA 4QLCU 2F5CA 4L5JA 4A2UA 2BEOA 4LLLA 4AIJA 3RI4A 3IWZA 4Y6RA 1O7LA 4MHGA 1MKMA 4HQEA 1J5YA 1U6GA 1EH6A 5A2QZ 1BIBA 2ZO4A 2LF7A 1D8KA 4WK8F 2GWRA 4YFNF 3GZ6A 3ABTA 2P6SA 1P2FA 3M9AA 1XSVA 2VN2A 2LNBA 3J80K 5DUKA 1ZRDA 5JC1A 1UFMA 4LLNA 1XMAA 4KYWA 3BP8A 3IRRA 4IHSA 2A07F 1T0FA 5HDNA 2VBXA 3PQKA 3ZMZA 2OAZA 1LQ1A 2JTVA 4AVPA 4M73A 4CGZA 5LGTA 1TTYA 4LLGF 2ZCWA 1MVYA 4KFCA 1EH8A 4P5OA 2OBPA 3CZEA 3TDZC 5HLHA 2VE8A 3TDUC 1U2WA 1FOKA 2O7GA 3MEXA 2O6GE 2W25A 3IKTA 2A5YB 2MA3A 2VT3A 2XAHA 4I0AA 2YSRA 5FLXK 1SFUA 2R7DA 3SQNA 3WU1B 4ZQFA 2LDUA 2DI3A 5KK1A 3QPHA 2FRHA 4TV7A 2C82A 1P4AA 4AICA 2XASA 4A0YA 3GYHX 1I27A 2AS5F 1O7FA 4XBFA 2CO5A 3H92A 1FP1D 2QVOA 3TQNA 4OIPF 1BIAA 1ZG3A 4L9JA 2HKXA 4RAZA 3LQRA 1UCRA 1F1ZA 2CGPA 1LB2A 1KU7A 1PDNC 2OU2A 4HF0A 2DLLA 3R0JA 1T1SA 2Z5UA 2RV8A 3WQQA 2EA4A 1OMIA 1P92A 2UXXA 3WE2A 4CXFA 1P6RA 2D2WA 5DYMA 3M1EA 2DO7A 2YX7A 4BAYA 3M8EA 2IPQX 5L3BA 1YQAA 4DQ2A 4ENMA 1XSXA 3E5UA 1ZREA 2VODA 3GF2A 3KCCA 5K1YA 1MJ9A 1IN7A 4LG0B 1LNWA 4GYIA 1I6XA 1S8NA 4UVBA 4RGRA 2P4WA 1DUXC 1OYIA 2O03A 1DDNA 3P9CA 1KYZA 4I98B 1T39A 4WXCA 4BHBA 1FSHA 1JGIA 2GA2A 1OKRA 3T0YA 5ILVA 1MW1A 2FF4A 1I5ZA 1DP7P 2MAPA 3Q9SA 5F64A 3KP3A 1OYWA 2VOPA 1SMYF 2COMA 5BMZA 1ZAOA 3QAHA 2Z33A 3E6BA 3NRVA 1K78B 3RPQA 1F5TA 3F8CA 5BS6A 2IP2A 3K69A 2FBHA 1SD6A 1MJAA 3HYIA 1R1UA 2V6CA 2DU9A 1FC3A 1ULYA 5E1ZB 2MD5A 3F72A 3GZ5A 4I09A 1BI3A 2KIFA 5D5WB 5HDKA 3B02A 1U5TA 3HIFA 3AU8A 3R0AA 3F21A 3MAJA 1ONVA 4O3MA 1W7PB 3E5XA 2OA4A 1UB9A 3ZMVA 1L3LA 2A61A 2XGXA 3CUQC 1FP2A 4CHUA 2H94A 3RYPA 3CZKA 1SD4A 3I4PA 2ZFWA 1BC8C 2M5WA 3GFLA 4Y6SA 4KMUX 4XLNF 2VC0A 2V1DA 2W57A 3VOEA 4E70A 3JTHA 5E8GA 2HYGD 2M87A 1YW9A 3FM3A 1MJBA 4AIHA 2EFOA 2OQGA 3SZPA 5DV5A 2BYVE 5BQTA 2Q2EA 3FXRA 1R36A 2DK8A 3UERA 1SAXA 3BOQA 1B4AA 5L3CA 4G7HF 1K6OA 3KEQA 1IN5A 2YR2A 4LUPA 1O3QA 4YIIA 1FX7A 2X0LA 4QWQA 1G4DA 2M45A 1R1TA 1S7OA 4OIQF 2EGHA 2D1HA 4IRHA 3ZN1A 4H0EA 3A14A 3AU9A 1Z9CA 3O6BB 2L4MA 4Z2YA 3QP6A 1FWZA 3DKWA 1USTA 3G3ZA 4YIFA 2XKOA 5CVJA 5DD4A 5DUIA 1T6SA 4IVNA 2QWWA 2CSOA 3LQQA 1XSDA 1HSTA 3MZYA 1S7AA 1W5TA 1UHWA 1EV7A 2HFHA 1CGPA 4IJAA 4A6EA 2DK5A 4NHJA 3KP7A 4JQFA 3GX4X 4O6JA 3I53A 2WC2A 2PI0A 1ONPA 2XVCA 3D0SA 3F6VA 3F8MA 4M71A 4WF2A 4IXAA 2Y1GA 3OV8A 4OINF 4A0XA 4LD5A 5LGNA 4KIFA 2A6EF 5K5OA 2HS5A 2V9VA 3CTAA 3DP7A 2FSWA 4L0YB 3DXJF 2R3SA 4GCVA 2MAOA 4ZYDA 1HW2A 5JVTA 4B09A 3WQRA 3COAC 3RPUA 2DAOA 1H9TA 1B1BA 1JGSA 1IAWA 1W7PD 4RB0A 2RNJA 1XN7A 2Z9OA 3GXOA 2FA5A 2LSOA 5J8FA 2VXZA 4I02A 3FZVA 2ISYA 4A0ZA 4AIKA 1Z1DA 1KA8A 2GAUA 1AOYA 3I54A 5JAZA 4JK1X 1OR7A 1W4MA 1QZZA 1FT9A 2F5EA 1K79A 1O57A 5BOXA 2LKPA 2CYYA 4G8XA 1TQPA 3C7JA 3R4KA 1LEAA 1FPQA 4UNOA 1YTYA 1P4WA 1DPUA 4LK1F 4EM1A 2HGCA 2RQPA 1RI7A 1RP3A 2WV0A 1GXQA 3F6OA 3WQSB 4L5IA 4G9YA 2EB7A 4GYGA 1U5TB 5JHUA 3ZMUA 5IT9K 5BPDA 3LAJA 4HX7A 2JRTA 1R0LA 3J7AO 4EJTA 2NNNA 2EA2A 3I0TA 4L9TA 4ESJA 2P8TA 2JD0A 3IRQA 5D8LB 1T2KA 2EFPA 4ESFA 2M30A 3GLXA 2EK5A 5TRDA 3K1PA 4IF4A 1F4KA 2DTRA 3JAMZ 3MQ0A 4WX9A 2DFIA 2K02A 1K78A 4A03A 1XGOA 5CYVA 2ZMEA 3C1DA 2NS0A 5JMWA 1TLHB 3MCZA 2YPRA 4HAMA 4RGUA 2EV6A 1G3TA 3ABUA 2H6BA 2DT5A 1LEBA 1L0OC 1ZH5A 3FF5A 3V8KA 1QNTA 1F9NA 5FO5A 3H3UA 2TDXA 2KJCA 2Y75A 4U7DA 1G3YA 1IZ1A 1W7PA 3CJNA 5E20A 3WTWC 4HX8A 4L9VA 3EUHA 1B9NA 1NHAA 1HKSA 3O3KA 3IHUA 4P9UA 4BXUA 2ELHA 5LHGA 5D4RA 5FFZA 2DBBA 2A69F 2FXAA 4HLXA 1ZRCA 3VODA 3G73A 4CYDA 1GHCA 5KVRA 2CFXA 2VONA 3WTYC 1PUEE 1ZARA 3WTUC 4GO1A 5DDGA 1TQMA 2MH9A 5DULA 4HW0A 6PAXA 3UCQA 3ULQB 1RNLA 4P9FA 2GXBA 3ZQ7A 4OIRF 1IW7F 1VTNC 3ANMA 3Q9VA 2EFQA 4ASNA 1R58A 2ETHA 4HOBA 3HRTA 2EJRA 4GGGA 3IC7A 2G7HA 1B9MA 2HQNA 4RGXA 2OZUA 2BGCA 3L2CA 1KU9A 4I2OA
chains in the Genus database with same CATH superfamily
1ETVA 4HDVA 5TGTA 3KLOA 2VE9A 2O0YA 3DEUA 1KONA 1VI0A 4XO4A 4PDKA 3C18A 3I64A 2CWEA 5H6RA 4Y4RA 3I55I 1IV6A 1DU0A 1IUYA 2NVTJ 3V7RA 4ETSA 3PUFA 3C2GA 1SG7A 1SFEA 2QGUA 4ZX4A 3HGYA 4RGSA 1LDJA 4LIVA 1OCRH 1YE9A 2BXYA 2LREA 4PJNA 2W7NA 4XN5A 3CP8A 3LSRA 2A05A 2BBYA 3JRGA 3RZDJ 3A1YA 5J1RA 3RKYA 3H5AA 1OCTC 2QKMB 1HC8A 2VJ5A 2HTSA 3ECOA 1TT0A 2EIMH 4PFPA 1LE8B 1E3HA 3OSGA 3RASA 3ZI0A 3CESA 4M3DA 4GFBA 2JA7J 3GTMJ 1YI2I 1D0XA 3CO6C 2M7AA 3S3OA 3QOEA 1IXSB 3A4CA 3WTTC 1VQ6I 2MH2A 4O5VA 4XMWA 1R4MB 4LJZF 5JVGF 3IL2A 2DOEA 2VKVA 5E17F 2F2EA 2HU9A 5BPIA 2ZJ2A 1K4SA 2XQ0A 1R23A 2JMWA 2LF8A 2KIQA 1STZA 3TOAA 3VYUB 1ZS2A 3BR1A 3TMOA 3L1PA 3B7TA 3W6JB 1KGSA 2GIZA 3CCUI 4KJZA 4X1EA 3FXJA 4L18B 3BJ6A 3CZ6A 2Z16A 3BY6A 1ZG5A 4EM2A 4K5MA 5LBQA 5J6XA 2XAJA 4BBRJ 3FKJA 5DCMA 3TW7A 2W24A 3WTZA 1SFOJ 5J47A 1UG2A 2Y1CA 4ZYAA 3SDGA 5J4VA 2L0KA 4G7ZF 5DD8A 4OMZA 2HPTA 4V2FA 4CCKA 4F55A 2YU3A 3OYNA 3K70D 3E6CC 1ZN2A 4YEJA 2QUFA 2RVCA 3LA7A 3J80Z 2L2OA 2XIGA 3F9KA 3Q5FA 1SFKA 2L7ZA 1WJAA 2VBZA 4M9ZA 4W1UA 5JI6A 1TWAJ 3KP6A 4XRMA 1PYVA 2EWNA 3BT9A 4X6AJ 1TBXA 5ERIA 3FUKA 3ML6A 2DXIA 4Y67A 3ANNA 4R1HA 1JG9A 3LA2A 1M1EB 2NVUB 4S05A 2DQLA 1XCVA 2JV7A 2QENA 3KX2A 5EV7A 1BBYA 4RAYA 1FBUA 3L2UA 2CW8A 2DCEA 1ZRFA 1X4OA 3FX3A 2CQQA 2H09A 2XV4S 2PFBA 4M72A 4XLCA 1OCOH 2GQQA 3FXUA 2K4BA 4BL0B 2ZSHB 1MBEA 2VKHA 2QBYA 3H36A 2PJPA 2LC2A 4EV0A 3VFZA 1ZG1A 1U8RA 4ZQGA 1J2XA 1RUNA 1TQIA 3E7LA 1TNSA 4R8HA 5K5QA 3P7NA 4AUXA 3OS0A 2V6EA 1U5TC 3HRUA 4FX4A 4A3GJ 3BZ6A 2GXAA 1FY7A 5B3SH 2CQ7A 2DFFA 4P1WA 2FBKA 3CHSA 4UVAA 4XLFA 3PNTA 4G6TB 3ECHA 3SFIA 3S2DJ 5DEQA 1FBSA 2ZMEB 2K9MA 2KRFA 3ZP5A 1J75A 5FLVA 5J8CA 4MKTA 1DU6A 4LG3A 1TNTA 5FGMA 2B7EA 1MBGA 2ZJQF 2DPUA 3ANLA 1F43A 5FLXZ 2K7LA 4MS6A 3UNGC 4FASD 2NYXA 4FX0A 3S1NJ 1Y8QB 1BL0A 1A6QA 2ACJA 5EYRA 3T8RA 1JKQC 3SXYA 2BZTA 3RTRA 1U3EM 2QM3A 4CCJA 3PO3J 1RPWA 3LSTA 3LSPA 5F1JA 3TEDA 3GTGJ 4N9HA 4ZX3A 1RR8C 5BNGA 2PJRA 5F0FA 4BJTA 4XMXA 3VVLA 3GW2A 3DTEA 2Q0OA 4XO5A 3WGIA 2HZTA 3KP2A 4GXOA 3DFGA 3S2WA 3GBGA 4HV6A 5E3MA 5ICFA 4CZCA 4XNAA 3PNYA 4UVCA 3VEPA 4IHVA 2W85A 3BDDA 1QPIA 4BHCA 4OOFA 2L7FP 3ZPLA 2E60A 3I4MJ 3J7ZI 1T98A 1Z91A 3PUBA 4WCGA 3AFHA 4FT8A 5CQGA 1ZLKA 3REOA 4HQMA 4BBSJ 1GXPA 2CG4A 4KUMA 3KP5A 1Z6RA 1ZGJA 5J1YA 3CZLA 1PP7U 3CDHA 4Q4EA 1H0MA 3H3VK 4AYBN 2PMUA 3HSFA 3HOSA 3NQOA 1LDDA 4RMNA 1I6HJ 4K2EA 2F4OB 4RDUA 1KU2A 2VI6A 2OF7A 3R61A 3O2PE 2EV0A 2JCXA 2CFOA 3OL4A 3QYBA 1YJNI 2CMPA 4ABZA 2A3SA 1RC9A 4M3BA 4Q4ZF 2MG4A 3I71A 5L3DA 2MLGA 3L2QA 3IIEA 4K5NA 3CLQA 1UELB 5TISC 2KJBA 1S46A 4Y15A 1YG2A 3J81K 4XMZA 1WJBA 3BPXA 2HR3A 4KICA 2XSDC 5JNLA 5JR3A 4FHTA 2DA4A 4R79A 3RKWA 5K5RA 2IRFG 4ZW8A 3ONQA 5L3GA 1MMGA 5J1UA 1YO5C 2QQ9A 3WTSC 2E1MC 2V1XA 4KA4A 3PUUA 2ZNYA 3RC8A 2DT6A 3G6EI 2ZXIA 5LEJA 1RZ4A 1MNMC 1U8BA 2MC3A 1FYMA 4FLRA 3PIPF 3CUQA 4LB6B 4UY8I 4ANJA 4MEXF 1XPXA 2BY0A 1QPMA 3FKIJ 2F4MB 4DYRA 3KYLA 1R4NB 3TO6A 4XN4A 4AU7A 2P81A 3C2BA 2KP6A 4XQFA 5HLGA 1MNEA 3B73A 4XK4A 1R22A 1JE8A 3KP4A 2IT0A 2L9NA 1GDTA 1GVJA 3N05A 1WSUA 2DQRA 2XAFA 4QPQA 5JFRA 1QBJA 3FH8A 1XC5A 1XG1A 2P5KA 4F52A 5E3OA 4A3IJ 2O9LA 5CVIA 5H20A 3ZQHA 4Q5SF 1U78A 2BHZA 3EPZA 2EPFA 2WY7Q 1X3UA 3L2RA 4ZZLA 2BV6A 5CVUA 2FUG2 2RREA 3W6KB 4A3DJ 3IKVA 5HS9A 2FE3A 2PUSA 4KMFA 1JVSA 2JD1A 4XN9A 5IT3A 4JBAA 2EH3A 5DM6F 5M3MJ 5JBIA 2BY1A 2CJJA 1BM9A 2XPVA 2ZKZA 3EYIA 4XOPA 3IWFA 3BG5A 2ELKA 1SEUA 1ACIA 4LGWA 3MZ8A 3S1RJ 3K0LA 1MZBA 4OOIA 3SZTA 5LLQA 4IKFA 1I1SA 4D5FA 3EDPA 2GZWA 1X3WA 1O3SA 3E6MA 1IRZA 3FXMA 3DF8A 2LLKA 3BJAA 3NEUA 4L0ZB 3GWZA 3RQIA 2Y48A 4FLOA 2G0EA 4AYSA 4CSWA 2NOJB 4MQVA 3V7SA 2ADUA 1KYWA 1FYLA 2HXIA 3OIOA 5B66C 3RC3A 4H4KC 2DW4A 3LNQA 1P4XA 3V8LA 2DDBA 4XO3A 4XNDA 3CF2A 5FD5A 5AIQA 1J0RA 2VJ8A 4ZDLA 2ID3A 3QOPA 3B6AA 3SYTA 4IQ4A 4XN0A 3EYYA 1O3TA 4M6YA 1T38A 1Y1WJ 5M5YJ 1E3OC 1ONNA 1Y0UA 3A06A 3ZR8X 2VQHA 2IVMA 5K7FA 2UWMA 1KQ8A 2VC1A 5DCMB 2HYJA 3I3LA 1XGSA 3OSFA 5IP7J 3F23A 4IRGA 3CLOA 4MEYF 2M9HA 3CQZJ 3VSLA 4XMUA 1OR7C 3I59A 4IOCF 3ISPA 2JCVA 1Q0QA 2WPGA 3EETA 2VT2A 4C2UA 3M3YJ 1UJ8A 4ZQHA 2R59A 4F3QA 3UR3C 3ZQQA 2V9KA 4KIGA 3LWFA 4XM3A 2M0MA 2PMHA 4R5TA 1FMWA 1PUFB 4M6XA 3HZJA 4HDUA 4UV8A 3MVPA 2XGDA 2J5PA 2E5NA 1S7EA 2PBIA 1B8IA 4ZN6A 4JX4A 4XSXF 1H19A 1BW6A 4N9IA 2GM4A 3SEQA 2E7WA 1SVOA 1HBXG 1RRJA 2FU4A 3BR0A 1IRGA 4GAEA 3ZMDA 4RS8A 1XMKA 1FTTA 2E71A 2KLOA 4ZQEA 4JOMA 1IN8A 3HHGA 5JMPA 1Q1VA 1TW2A 2QBYB 3DEEA 2FMYA 3CC4I 2B63J 2P6TA 4EJUA 3K4KA 3FU3A 2EZIA 4EM0B 3G4SI 2A6HF 4CZZA 1SC7A 1ETXA 5EF6A 3BR2A 3L9FA 5LEKA 4M3FA 3TKYA 4LB5A 1XGNA 3OYEA 4P96A 4M9XA 4PU2A 2VOOA 4IL6C 4PJ0C 2BW3B 3S1QJ 4NB5A 3F8BA 4AWXB 1Z6TA 2WAQN 1H9GA 4Y3OA 3HOVJ 4X0GA 5A2QK 2COBA 3PL8A 3Q0WA 4GRIA 4F7ZA 3WGGA 5ICGA 3N97A 1JKPC 4DBQA 2DTZA 4E7KA 1R7JA 4NQWA 1AWCA 3JSZA 1ZELA 2M1BA 3HG9A 4XRFA 2W84A 4S04A 1ETKA 1ZLJA 4PGHA 2GA1A 1IO2A 2F5DA 2HYFA 2X48A 3AG3H 1U9OA 2DT7B 1LFPA 5F04A 2R7RA 5CJ9A 2UXNA 1ONOA 2KFDA 2NAZA 2V26A 1T8IA 1BC7C 4RM2A 1G2HA 5D5XB 5K7ZA 1IRFA 2JK3A 3H0GJ 3WTVC 3CC7I 4P55A 3RKQA 2D5VA 4PVBA 2FMLA 2RKHA 4M74A 2ZXHA 2HDCA 1ZQ3P 4KNYA 3HRMA 1D0YA 2F5VA 2JZYA 4KDPA 3OOPA 1XS9A 3U2RA 1HQCA 3T8TA 2GIVA 4G7OF 4RLFA 1FIAA 3KPHA 4D9JA 3CCLI 3ZHYA 3FHZA 5HS7A 3DBLB 3GO5A 2L9SA 1B59A 3BPVA 1Z21A 2IS2A 3JW4A 1YRNA 3QP5A 2E1OA 4FLQA 2XPZA 2ZJRF 2ISZA 3FTXA 1MW2A 1WI9A 2PG4A 1FBQA 3EUHC 2M0CA 1MMSA 3JRBA 1HS6A 2OV7A 4EJVA 4II3A 3R6SA 1TWFJ 4PJMA 3RSNA 3K1NA 2LVSA 4U0VA 2KIUA 1FTZA 3JR9A 2X85A 1A36A 3LFUA 3HEFA 1QHHD 4BACA 4BE2A 3LSMA 1REPC 3E0JB 2VBWA 5TJJA 3K9TA 4BEHA 2WBMA 3R60A 4RCVA 4XLEA 2KKOA 5E1XA 1XGMA 1WI3A 2R7FA 2OJED 3CUQB 3QPTA 2H27A 2A68F 2GXGA 1S29A 3KZZA 3V7CA 2ZXGA 3GEZA 5ICCA 2WADA 4UUSA 4ENNA 1HXDA 2PMZA 4E7JA 1YW8A 1FZPB 3LOCA 2M3AA 1V5GA 1MGTA 1D3YA 1CF7A 1UHSA 4FCYA 2G9WA 1WWXA 2MC4A 2R7VA 5FB2A 4ZW6A 2VQLA 4MGRA 5KAIC 4XNBA 4ZQTA 2LKSA 4BE0A 4YRVA 3LSKA 3P9KA 1IXCA 1UHMA 3BC8A 1YW7A 3GMEA 2PGGA 3G1OA 2XUBA 4PJJA 1R5HA 3KIOA 1T33A 2VKDA 3FIWA 1SMTA 1WQ2A 3U21A 2FX0A 2XPWA 2PQ8A 4RB2C 1R0KA 2VBYA 1ENHA 4I01A 2JRMA 3H9JA 5FKNA 1G8XA 4M3GA 4A5NA 2G7UA 2RN7A 1MW3A 5ILSA 2NNYA 2KDZA 2BE5F 2DDAA 3U9GA 1XB4A 2O7OA 1SD5A 4EGYA 3IUOA 3HOWJ 3QRFF 5F6FA 1I3AA 2OD5A 3MKYB 4Y13A 4NC7A 3W2VA 3AG4H 3TO9A 1X3WB 4Y17A 1MMDA 2K3PA 4Q47A 1W5SA 2BHYA 3FMRA 2UZKA 2R5YA 2ZNZA 4AD9A 4XSZF 4CCMA 5IT9Z 3GTPJ 2FEZA 2PI0A 3IH4A 1JI8A 3G1LA 3DWLE 2B0LA 4BJ5C 1WH7A 4CO8A 4NUBA 1VQLI 3KE2A 3E5QA 3KEOA 1X1DA 4QHPA 4BQAA 4KP7A 3D1NI 2RJIA 1TWGJ 3OR2C 1W36D 1VQNI 4B43A 3ERED 5FFXA 4ZYEA 4XN1A 1QGPA 5E8IA 2XF7A 3LAPA 2QQ8A 5IOYA 2L3DA 4I76A 2XRNA 5CLSA 2XF6A 1VQOI 3HTSB 2YUSA 5ICEA 1YIOA 3OIPA 2R7UA 2EZLA 2QVWA 2PN6A 2E2IJ 1XDUA 1FJLA 5GAGJ 3OMYA 3E6DA 3I59B 2C5ZA 2ZJPF 4UV9A 2BXZA 2NRAC 3K4CA 1I1GA 2MW8A 2QQAA 2ZC2A 4IPAA 3BZKA 4G6QA 3B34A 3G2BA 2HQRA 4NC6A 2VUMJ 2HVSA 3TBIA 3TO7A 1SQMA 2M8EA 4GDFA 2L7MP 4MTDA 4BQNA 5HNFA 3K2ZA 3I4NJ 5J3LA 3S1MJ 4XRSG 1BOAA 1U9NA 4EJOA 1B8IB 3CXBA 1IN6A 2EV5A 4BDZA 2L01A 1YS7A 1RKTA 1HW5A 1VQPI 1TW3A 2MABA 3WODF 4PW4A 2ZBKA 1BA5A 1K83J 3FTUA 1RIOH 4A3CJ 2XHKA 4UUVA 1RUOA 3KETA 4K5LA 5IP9J 3FISA 3I58A 4ESBA 3TP3A 5FD6A 2CW0F 2DMNA 2X1DA 1IF1A 2K9LA 3OIQA 2QEXI 2IJLA 1DPRA 2L54A 2XKPA 2V1UA 2NVQJ 3D5LA 1WKMA 4QSHA 5D4SA 1OYYA 3RIRA 3QYFA 2BOLA 4ZH4F 3M7GA 3GTOJ 3QJXA 1KQ0A 1R6RA 3B7SA 4HZFA 2K9QA 5CKTA 3JSPA 2NXNB 4EGZA 1J59A 2HI3A 1G3SA 4M6VA 4FE4A 1ODDA 2R7QA 4A6DA 2P5LC 4A3FJ 5DCFA 3M07A 1O4XA 1YITI 1VZ0A 5ED4A 2ESHA 3AKZA 2VLAA 4KITB 2Y1DA 2F5FA 1SD7A 4J19A 2XPYA 1MD0A 4Y33A 1ORKA 4FCAA 4CA0A 1OISA 2D45A 4NQWB 3EQLF 2ESNA 2HTJA 5HNHA 1VQ5I 4RB1A 1GV2A 3CO7C 2ECCA 1G3WA 2KIMA 3V8JA 2K27A 4CYCB 3F3XA 4DJAA 5CVVA 3T5XA 3QQAA 1FOYA 1WZ2A 3BR5A 1R71A 3HDDA 4X2UA 4I0BA 2L7KA 3DKYA 3FU5A 4I7HA 2JD2A 3T8VA 1PUFA 2MBFA 2XAGA 3FXQA 4XLHA 2HOEA 4C2MJ 4IHTA 4OU0A 2HEOA 3F22A 4IHXA 2Z99A 2K85A 2X6OA 3BCBA 4DYCA 4G6DA 3DLLF 3AAFA 3W6VA 1JHFA 2D1VA 1D5VA 2TCTA 3VSKA 2RGVA 3GTLJ 3QU3A 1SFXA 1LJ9A 3D5SC 4G94A 4CDGA 1G5AA 2WAEA 3L00A 3PQJA 2QZ8A 3Q0UA 4Z6YA 4OAYA 4MNUA 3PFIA 3LSJA 2IGOA 4B47A 2MGQA 3T1BA 3ZHXA 5F08A 2IW5A 2R92J 4ITVA 1D8JA 1OPCA 4U88A 3CZGA 2DA1A 4YFXF 2O8XA 2QQBA 5CVRA 1YRNB 3S2HJ 2LY9A 2VQGA 2R7ZJ 4L9NA 4BE1A 1EA3A 2BW3A 2VB6A 3JTGA 1K5HA 1A35A 5D6FA 1FNNA 4BNCA 3BTJA 2QSHX 4B8XA 2LY1A 3GFIA 1TP4A 2K9NA 4OIOF 3SZGA 3QWLA 4HPQA 1T56A 2X4HA 4UXNA 3EUAA 3H5RA 4EMSA 1IC8A 1IV8A 3MN2A 4EJWA 3PSFA 1QVTA 3ZGKA 3FH5A 4BEHB 3LSHA 4DNCA 3DCFA 1E17A 3FTVA 2F48A 1T95A 4MIMA 3PIOF 2Y0MA 1YS6A 4WXDA 1HDDC 4AC0A 1ZYRF 5EZGA 4UUSB 4A3JJ 3TGNA 1BI1A 2DPDA 2STTA 2ID6A 3FUJA 5LRSA 3CMMA 1CF7B 1O3RA 2EQRA 2Y31A 5IYCJ 1NG6A 2QLZA 3VYTB 2R7SA 3OYMA 2IA0A 5H6QA 4XKBA 3BJOA 5HODA 3HW2A 4MQ9F 2QYOA 1Q0HA 3AG2H 2JT1A 2JCYA 2Y1EA 5C3EJ 5D5UB 2JVHA 1V5EA 3PFYA 3FBIB 5AIPA 2DMUA 4HF1A 3ZN0A 4Q48A 3K70C 3WE3A 2LK2A 4AR9A 2A5WA 4HX4A 2MLKA 2P7VB 2GTQA 1ZHFA 2YX4A 1JUMA 3H5NA 3K4JA 3BROA 1V4RA 2HWVA 2RDPA 4HSRA 2HQAA 3HRSA 5L3FA 3DPLC 3IAS2 5LHHA 3WU0A 1XDSA 3BLYA 2WAFA 3GTJJ 2WWYA 2WZGA 3A0BC 3FMSA 1PP8F 2LOOA 4EATA 5E18F 1BI0A 3AL0B 5FRMA 2CUZA 3M8FA 2E1NA 3BR6A 4D7NA 1PVEA 3C3WA 3ZXSA 1MDMA 2R5YB 3HTUA 4KN7X 3JT1A 2K40A 5GAEJ 3JSOA 1JTYA 4U0YA 2JVGA 3FH7A 2XAQA 3HSEA 5LRRA 2DQMA 2CH0A 3ZMSA 5HVQC 1WRJA 5F1RA 1Q0LA 2M4KA 4MTEA 3S8PA 5CQEA 1E2XA 4ZDPA 1Z7LA 1FOXA 4M3EA 1BJAA 1ETWA 2CUJA 5EEGA 3KYCB 4PSXA 2OZ6A 1JKOC 3F8NA 3WTXC 3FM5A 1R1VA 3W2WA 3PNVA 1WJEA 1ZKGA 4HYEA 2E1CA 1J7KA 2HKOA 2FNPA 4HF2A 4Y52J 4LK0F 4XLPF 1YYVA 3PO2J 2V7FA 2XPUA 4FLSA 1A6IA 3RDIA 1XD7A 3DPTA 4HBLA 1HSJA 3VB2A 1TL8A 2JWTA 3HOYJ 1FEXA 1X3ZA 2AQFA 1BW5A 3P9IA 5DLLA 1FOWA 2B9SA 4UUTA 2JQ7A 1X1CA 2E35A 3HOTA 1BN5A 1AKHB 3F8FA 3JRHA 4V19K 2L9RA 3LA3A 3PSIA 4ZC3A 3TOBA 3K2AA 1APLC 3FMQA 5JO0A 4ZYGA 5EG0A 1ZR4A 1LDKB 3HHHA 1X1PA 1VQKI 4AM3A 3H9GA 3BZCA 2AQEA 3B6CA 1HOMA 2L4AA 4S0HB 1T1RA 3OYKA 3H3ZA 1W0UA 3I5UA 4BYYA 4YG2F 2DA2A 3AG1H 1JGGA 1QRYA 3DV8A 2AHQA 4NC8A 5C4XJ 1ZTRA 5HS8A 4ENKA 3OS1A 3FK6A 3K4MA 3MFKA 1ZGAA 4WWCA 5GPCA 1HKQA 5HDGA 4LFUA 4XKWA 4D0PA 1LFUP 1IGNA 1AHDP 1SC5A 5EGOA 3RJPA 3WGHA 3VWBA 2HPOA 5D6EA 2V79A 1J9IA 3WG9A 1RESA 2JA8J 2FQ4A 2KRHA 3GFMA 3HPHA 1MH3A 1QQIA 3B2XA 3V4GA 4OOEA 2Y1FA 4KIBA 1MBKA 3E1SA 1FLIA 3ELKA 2R7WA 2FNAA 4KT6A 2HOTA 2K5CA 3NAUA 2GBYA 5F0HA 3CHPA 4DGWB 4HV5A 1LKXA 3HJEA 4ON0A 3K4LA 1HKTA 1D0ZA 1G6NA 4CUGA 4PZJA 4AIDA 1SANA 3RYRA 1IDYA 1HW1A 3MZHA 2XRLA 2O3FA 3SHFA 4ZW3A 3BTIA 3O8HA 3UEQA 3M4OJ 4XR6A 4BXFA 3ZMTA 1RKWA 3F0CA 5C44J 2WV1A 1TC3C 2OC6A 1K7AA 5LHIA 1ON2A 3JAMK 1Y0NA 3S3MA 3CCRI 3BCAA 2AXLA 3GVAA 4BGDA 4DW6A 3OWTA 4RB3C 5EEHA 3OYHA 2CQKA 3J81Z 2E2HJ 5IY5H 4NNJA 4W97A 2FBIA 2HNHA 1Z05A 3OYJA 2DJNA 4M9SA 1C0WA 4E7LA 3RKXA 5L3EA 4EQQA 2LMDA 4BY7J 1Y39A 3MWMA 4LMYA 3E97A 4A5MA 1A5JA 3ZHZA 4C30A 2WTEA 4HLYA 2XSJC 3HKZA 4U0WA 3L7WA 1IXRC 1R00A 2IXSA 4ZZDA 1XCBA 4UHTA 1FSEA 5KNLA 4XN2A 4IHYA 2EFNA 3CUOA 3JRFA 3TP0A 3L09A 2E19A 2VL8A 4ZDOA 3AUAA 1YJWI 3OYFA 2O61A 3R0IA 4A3KJ 1ETQA 2J5OA 2NS7A 3DQVC 4N0BA 1TWHJ 1B6AA 3QPSA 2ZFUA 3QU6A 4A69C 1MW0A 1H3LA 2FOKA 1AU7A 3W2AA 3EBGA 2I5UA 1OJLA 1QZYA 3CMEI 2DA6A 2X51A 5E3LA 1A04A 5B5EC 2EINH 3DEWA 1SVMA 3EUKL 5D5VB 3K1MA 2H6CA 1G59A 5D8KB 3CJRB 4XNFA 2JPCA 3HOUJ 2QKLB 2HPIA 2P7CB 4XL9A 2C6YA 2XGEA 4QIWN 2LH9A 1H8AC 2PLYA 3M1CA 2ZXJA 1MMNA 3GTQJ 3ABMH 1BR4A 2FQ3A 1RETA 1AA7A 2I8DA 4ENJA 1S3JA 2XB5A 2Z3YA 4XN3A 3KZYA 5AONA 1DGRM 2ZXWH 1EH7A 2X1EA 1XMXA 2RAEA 2JN6A 3CJQB 3KLNA 1H89C 4K5OA 4CYCA 2Q8KA 4HA8A 2CU7A 3H1CA 1JXSA 2CRGA 2L9VA 1GLNA 5FWQA 2ZMEC 5GAHJ 2OCCH 3SFZA 4B3AA 4J3BA 2JA2A 4KT5C 2HDDA 1JHHA 5LD2C 2H1LA 2XF5A 1JKRC 1JTXA 1IUFA 2DMQA 1YLFA 3HOXJ 4HEA2 4LG0A 3C2HA 3I56I 3KZIC 2O5RA 3HUGA 4PUSA 3OOUA 2E7XA 1IN4A 2VJJA 4PCQA 2DMPA 4U7BA 3VPRA 1EF4A 2FOWA 2JUCA 1QO0D 2IS4A 3FUIA 3HSRA 4KN4X 4CCNA 4JYKA 2V9PA 2R4GA 5ILUA 1ON1A 5F0CA 2KPMA 4G12A 2IA2A 2PMZN 1R9TJ 4CH7A 2HOAA 2R5ZA 4IRIA 1WPKA 3Q43A 4J00A 2L02A 5HOOA 4BH9A 3U1DA 3BG3A 3DLAA 2FFLA 1KQ9A 2DODA 3GUDA 2OQRA 3ROUA 2RC4A 1MH4A 4OAZA 1YFHA 1D1BA 1USSA 1KU3A 2EFWA 3OS2A 3OYAA 1Q1HA 2DA7A 4BHPA 1Z7UA 2O8KA 3CMYA 1MDMB 3RZOJ 3SDBA 3GFJA 2P5VA 3CC2I 2IBDA 5LGUA 4IO9F 3N4MA 4OMYA 3DTKA 3ZQCA 2LRDA 4YFKF 3FWEA 3LFKA 4E6KG 2JUGA 3P5JA 1K61A 2IA1A 2LR8A 4WXHA 2JPBA 2PEXA 3KFWX 4CICA 4DOZA 3E3VA 4A12A 4ARFA 3BWGA 5IP6A 1LPQA 3FDYA 1Z67A 4HNTA 2STWA 4QIRA 4PGGA 3MKWB 5DS9A 2V4JC 4EVIA 1S6LA 4B3XA 5HLIA 4Y6PA 3ABLH 2Y9YA 4R5VA 1R5GA 1V3FA 1ETYA 3DBHB 2Q2EB 3S3NA 5B1AH 2K4JA 2K86A 1BI2A 4KISA 1X4PA 3RCOA 4FTHA 4B48A 3CCMI 1HF0A 3VDXA 2ELJA 1LVAA 1JUSA 3NWSA 4ZYHA 1FYKA 1DP3A 1X3ZB 2JSCA 2JJ7A 3ESWB 3DKXA 1VQMI 2XROA 5E1WA 3H0DA 3K6GA 1VQ9I 4QLCU 2F5CA 4IQJA 1B72B 4L5JA 4A2UA 3B7UX 2BEOA 4LLLA 4AIJA 4RAFA 3ZQIA 2VPRA 3RI4A 3J7YJ 1UG0A 3IWZA 2DYSH 4Y6RA 1O7LA 4MHGA 1MKMA 5EG0B 4HQEA 3S93A 1D5YA 1J5YA 1U6GA 1EH6A 5A2QZ 3CCEI 2KT0A 1BIBA 1BR1A 2ZO4A 5KAFC 2LF7A 1D8KA 4WK8F 2GWRA 4YFNF 2K3FA 2XAUA 2KDOA 3GZ6A 1K4TA 1QU3A 2X9DA 4AR1A 3ABTA 2P6SA 3WHBA 1P2FA 5HLTA 2YU9J 3M9AA 2E1MB 4I99C 1XSVA 2VN2A 1V55H 2LNBA 2DA5A 3DBRB 1VQ8I 2R72A 3JCUC 3J80K 5DUKA 2DOFA 1I3QJ 3W3CA 1ZRDA 5EGOB 5JC1A 2A6TA 1UFMA 1MBFA 1XMAA 3GLLA 3BP8A 2EZHA 3QPLA 3ZQLA 3IRRA 2LY2A 3BR3A 4KYWA 4IHSA 3FUNA 2A07F 1T0FA 3GTKJ 5HDNA 2VBXA 3PQKA 4XN7A 3ZMZA 2OAZA 1PJRA 1LQ1A 2HVQA 2JTVA 3IH3A 4D5CA 4AVPA 4C3HJ 4XIDA 3JRIA 4M73A 2H8RA 4CGZA 3FXKA 2LBFA 5LGTA 4II2A 1K6YA 2EBIA 3CCQI 1TTYA 1JUPA 5FKOA 4XONA 4LLGF 2GLOA 1GW6A 5IOZA 3OYGA 2ZCWA 1MVYA 4KFCA 1EH8A 3SEZA 4P5OA 2LD5A 3A01B 2OBPA 2I10A 3CZEA 3CF5F 3TDZC 2QJ1A 4DBRA 4CCLA 5HLHA 2VE8A 1AKHA 3TDUC 1U2WA 1FOKA 1YJ9I 2X6WA 2O7GA 3MEXA 1U0JA 1NK3P 2MFZA 2O6GE 2L5QA 5DTDA 2Q1ZB 2W25A 4DZPA 4F93B 3IKTA 1GVDA 2QSFX 2A5YB 2WA0A 5EJCA 4BY1J 1QVUA 2ME6A 2EZKA 2MA3A 3BG7A 2VT3A 2XAHA 3HB9A 4I0AA 2YSRA 5FLXK 2W48A 3B7RL 1SFUA 2R7DA 3WU2C 3LMMA 5M5XJ 3SQNA 3WU1B 4ZQFA 2IEKA 2MD0A 2LDUA 2DI3A 2NVYJ 3HPGA 5KK1A 4YIRX 1X19A 3QPHA 2FRHA 4TV7A 3TL4X 2C82A 2ECBA 1P4AA 4AICA 3QODA 2KL4A 5EZHA 1X58A 2XASA 4A0YA 3GYHX 5AENA 1I27A 2AS5F 1O7FA 4XBFA 1IG7A 2CO5A 3H92A 2R0QC 1CQTA 1QA6A 1OCCH 2NS8A 2XDVA 5BPPA 1FP1D 2QVOA 2ICWG 3TQNA 2WY8Q 2ZB9A 1X1BA 1UAAA 4OIPF 1BIAA 1W5CC 3S17J 1ZG3A 2M7BA 2XB0X 3LSIA 4L9JA 2HKXA 4HNVA 4RAZA 3LQRA 1UCRA 1F1ZA 1Y56A 3Q3SA 2CGPA 1LB2A 1KU7A 3HXLA 1PDNC 2X6YA 3MD2A 2OU2A 4HF0A 2VXDA 2DLLA 3R0JA 2JA5J 3L2VA 2Z5UA 1T1SA 2X1CA 4JP0A 2MSYA 2RV8A 3WQQA 3U1KA 5EEAA 2EA4A 2LP0A 1OMIA 1P92A 2UXXA 3WE2A 4CXFA 2M34A 1P6RA 1XTAA 1TWCJ 2D2WA 5DYMA 1ITYA 3HL2A 4Q4IA 2WZFA 3M1EA 1YIJI 2DO7A 2R7TA 2YX7A 4BAYA 1P9QC 1Y8RB 2IPQX 3M8EA 1YQAA 4LIUA 4DQ2A 5L3BA 2HVRA 1E0EA 1FMVA 4ENMA 1XSXA 3JRDA 1UMQA 4YELA 3E5UA 1ZREA 4IX7A 1W36C 1MSEC 2VODA 2CQXA 3GF2A 1I39A 2KZVA 3KCCA 3OR1C 5K1YA 3A03A 4B44A 3NARA 4D1QA 1S72I 1O3QA 5JLWA 3S14J 3HM5A 1MJ9A 1QZEA 2R7XA 3FTWA 3VVMA 1IN7A 4LG0B 5B1BH 1LNWA 4GYIA 1I6XA 1S8NA 3HUGB 4UVBA 1UZCA 2MYSA 2P4WA 4RGRA 1DUXC 1MIJA 3SJMA 1OYIA 3FHNA 2O03A 1DDNA 3P9CA 1KYZA 4I98B 1T39A 1NG7A 1OFCX 4WXCA 1JJ6C 1RR7A 4BHBA 4XMVA 2CV1A 1FSHA 1JGIA 4FISA 2GA2A 4RM3A 2HPMA 1OKRA 3ZRGA 3T0YA 3FBNB 5ILVA 4RVBA 2R5ZB 3JREA 1MW1A 2FF4A 2P0WA 4ZW7A 1I5ZA 1DP7P 3QYEA 2MAPA 1E3PA 5JLXA 3CP2A 5DM7F 4L2LA 1YOVB 2DOAA 2GOXB 3Q9SA 5F64A 3KP3A 3JRCA 1OYWA 2VOPA 2F6CA 1D1AA 2Y30A 1SMYF 2FJ1A 1W1WE 2FD5A 2COMA 2JSPA 5BMZA 4A93J 3B3BA 1ZAOA 4HSTA 3QAHA 2Z33A 3E6BA 3NRVA 3Q0VA 1K78B 4MFDA 3RPQA 2R70A 1F5TA 2W4SA 3F8CA 5BS6A 2IP2A 1OCPA 2M8GX 2FBHA 3K69A 1SD6A 1HLVA 2QA4I 1MJAA 3HYIA 1R1UA 2V6CA 2DU9A 3OY9A 1MBHA 2WB1N 1FC3A 2E34A 1Z0XA 1ULYA 5DYFA 2ME0A 5E1ZB 4XLAA 2MD5A 4R7LA 3F72A 2CV0A 3OYLA 3GZ5A 4I09A 1R5ID 2IGKA 4BDYA 1BI3A 2KIFA 2HQ5A 2OTLI 5D5WB 5HDKA 1N78A 3B02A 3CHQA 1JJ8C 3EBIA 3FTSA 1U5TA 3HIFA 3AU8A 1VF9A 2OUMA 2Z2SB 1GUUA 1W0TA 3R0AA 3FTYA 1N75A 1WHUA 3F21A 2W82A 5LFAA 3G71I 1TT5B 3MAJA 1ONVA 2LFBA 4JX5A 1W7PB 4RA2A 5E3NA 4O3MA 1BR2A 3E5XA 5E79C 2OA4A 1WJ5A 1UB9A 3DU6A 2DMTA 4R5XA 4UB8C 3ZMVA 1L3LA 2A61A 3OYBA 2XGXA 1HCRA 4C2TA 3CUQC 1FP2A 4CHUA 4IHWA 2WB1A 2H94A 2X6XA 3RYPA 1WCMJ 3CDIA 4C9YA 2R7OA 3RPUD 3CZKA 3B2PA 1OQYA 3FULA 1WVRA 1SD4A 3HC7A 3I4PA 3ASOH 4CCOA 2ZFWA 2IS6A 4IEJA 2BVLA 1BC8C 1T08B 2M5WA 2VKEA 3GFLA 3CCVI 4Y6SA 4KMUX 1P7JA 4V2GA 4XLNF 2VC0A 2V1DA 2W57A 2VQCA 3EBHA 3VOEA 4E70A 3JTHA 5E8GA 1MW7A 1WJDA 2HYGD 2V1NA 2M87A 5FKLA 1YW9A 3FM3A 1ZGWA 3MKLA 1MJBA 3O8GA 4AIHA 2VASA 2M2EA 2VPLA 3OYIA 2EFOA 1V5FA 2HZDA 2OQGA 4PFOA 3BTLA 5J40A 2LBFB 5FROA 3SZPA 5DV5A 2HDWA 4DIQA 2BYVE 5BQTA 2Q2EA 3FXRA 1VQ7I 1R36A 2DK8A 3CHRA 3UERA 2DJIA 4AYBA 4DZJA 2NOGA 1SAXA 3BOQA 1B4AA 5L3CA 4G7HF 4JNDA 4PK4A 1K6OA 3KEQA 1IN5A 4HNUA 4AR8A 4ZJZA 2YR2A 4E7SA 1B72A 4LUPA 1X2NA 1XX5A 1EKEA 2KZGA 1FX7A 2X0LA 4QWQA 3HBLA 4YIIA 3X2QH 1G4DA 2M45A 1R1TA 1YX3A 1S7OA 1NTCA 4OIQF 2EGHA 3OYDA 2D1HA 4IRHA 3IP4B 2GOMA 3ZN1A 4H0EA 3A14A 3AU9A 1S5LC 1Z9CA 3K10A 3O6BB 1GV5A 2L4MA 3LSGA 1NH3A 3FUDA 3D5RC 4Z2YA 3H35A 3QP6A 3IV5A 1FWZA 3DKWA 4QPOA 1USTA 2DFHA 3G3ZA 1OLTA 4FQGA 4EEFG 4YIFA 2XKOA 5C4JJ 5CVJA 4XN8A 3DPUA 4XKCA 5DD4A 1FIPA 5DUIA 2CW7A 3FK7A 1T6SA 4IVNA 2QWWA 2CSOA 3LQQA 4LITA 1XSDA 1HSTA 3B37A 3MZYA 1S7AA 4A3EJ 1W5TA 1UHWA 4BUPA 3FXLA 1EV7A 5FJ8J 2HFHA 4QPEA 4OWRB 3K7AJ 3CCJI 1CGPA 2E5ZA 4IJAA 1R49A 2KISA 2TRTA 4F92B 2AO9A 1F36A 2Y2ZA 4A6EA 2UV1A 2DK5A 1POGA 4NHJA 3KP7A 5M3FJ 4JQFA 3GX4X 4O6JA 3OYCA 1MBJA 3I53A 2WC2A 5IYBJ 5GTIC 2XVCA 3D0SA 3F6VA 3F8MA 3HKZN 4M71A 1KZHA 4J01A 5H2FC 5K7HA 1NK2P 4WF2A 4IXAA 2IS1A 2LKXA 2Y1GA 5CPRB 4BQOA 4U87A 2IGMA 1ONPA 3OV8A 3U9WA 4OINF 3A01A 1H88C 2DFEA 3WHCA 4A0XA 3GCMA 4LD5A 2QCOA 4L5EA 5LGNA 3FHEA 4KIFA 3CCYA 3DTIA 4E7IA 1WGXA 2A6EF 5K5OA 2HS5A 2V9VA 3CTAA 3DP7A 2FSWA 4BS9A 3BG6A 2E2JJ 4L0YB 2H1KA 3JRAA 3DXJF 2R3SA 3I9V2 5EDNA 4GCVA 2RNGA 2MAOA 2CUFA 2PL5A 2EIJH 3ZQGA 4BKXA 2LTPA 4ZYDA 1HW2A 4C3JJ 4XOTA 4IZZA 1ZR2A 5JVTA 3G1MA 3FUFA 4B09A 3WQRA 4Y7NJ 3COAC 1Z77A 1I50J 1P7IA 3RPUA 2F4IA 2DAOA 1H9TA 4XMYA 1B1BA 1JGSA 1IAWA 3MKZA 1W7PD 4RB0A 2RNJA 1MMAA 4D7MA 2QF7A 2AXTC 3KEDA 2DQ6A 3CJTB 1XN7A 1Z3YA 2UUZA 4BQQA 2VJ4A 2Z9OA 3BQZA 1MNDA 3GXOA 2FA5A 2LSOA 5GTHC 4A3LJ 5J8FA 5IYDJ 5KHDA 2EIKH 2VXZA 4I02A 3KEYA 1BOBA 4ZX6A 4DYQA 3FZVA 2ISYA 4A0ZA 4BJ6C 4AIKA 1KA8A 1Z1DA 2GAUA 3OL3A 1LE8A 4XMTA 2RQQA 3A2KA 4XICA 1AOYA 2PX9A 3I54A 3A02A 1S9HA 2Z1DA 5JAZA 4JK1X 1OR7A 4NBQA 3S15J 3M8JA 4PJLA 1W4MA 1QZZA 4MLOA 1FT9A 2F5EA 1K79A 1O57A 5BOXA 2LKPA 2CYYA 4G8XA 1TQPA 2EILH 1QHGA 3C7JA 3R4KA 1LEAA 1FPQA 2DYRH 3GZNB 4UNOA 1YTYA 1P4WA 1DPUA 2KQRA 4HG2A 4LK1F 3HGGA 3FTZA 2OPTA 3DU5A 3K4NA 4RSYA 4EM1A 5JHFA 1ETOA 2HGCA 2H8WA 1LVKA 1A31A 2RQPA 1WJFA 2CQNA 1RI7A 3CDLA 1RP3A 2WV0A 1GXQA 4MO7A 3F6OA 2VIXA 1MSFC 2XGCA 3WQSB 3FUEA 2HOSA 4L5IA 3ZOBA 4G9YA 1WJCA 2EB7A 3LL7A 4N4OB 1VNDA 4PSWA 4GYGA 1SVLA 2JA6J 1YHQI 4A3MJ 1U5TB 2PJRB 5JHUA 3HOZJ 1ERDA 3ZMUA 2OCEA 5IT9K 4HRIA 5BPDA 3LAJA 4HX7A 4N4NB 2JRTA 1R0LA 5IPAA 3J7AO 4EJTA 2NNNA 5F27A 4LLNA 2EA2A 1N77A 3I0TA 4BXXJ 4L9TA 4ESJA 2DN0A 3CD6I 2P8TA 2WAQA 4B1RA 3VYRB 2JD0A 2K9SA 4ZTFA 4RBOA 3CHOA 3IRQA 5D8LB 1T2KA 2EFPA 3Q44A 5FRNA 4ESFA 2M30A 3GLXA 2EK5A 5TRDA 3FUMA 2HXOA 3K1PA 1HA8A 4IF4A 1F4KA 1J09A 2DTRA 5KCMA 1X2MA 2M4GA 2KMUA 3TW6A 1Y1VJ 3JAMZ 3MQ0A 4RAGA 4GAAA 4WX9A 2DFIA 2BY2A 4QUOA 3FUHA 2K02A 4QTRA 1VFCA 1K78A 4A03A 3FXOA 5FKKA 1XGOA 3PJRA 5CYVA 2ZMEA 2NVXJ 3C1DA 1VQ4I 2NS0A 3ERMA 4MFEA 3RQ4A 3FU0A 1DQUA 5JMWA 1TLHB 2BY3A 3MCZA 2YPRA 2Y9ZA 5GPAA 4HAMA 4RGUA 3CMAI 2LG4A 4E7ZA 2EV6A 1D1CA 1G3TA 3ABUA 3UKGA 3FU6A 2H6BA 4NDLA 2DT5A 1LEBA 4XORA 1L0OC 4C3IJ 2Y69H 1ZH5A 1X1AA 4FETA 3FF5A 3ABKH 3AL0C 3V8KA 1QNTA 1F9NA 5FO5A 3H3UA 1JT0A 4IOAF 2IAIA 2TDXA 2KJCA 2BVMA 2Y75A 3ASNH 4U7DA 1G3YA 1SAUA 4XRSA 3CIAA 1IRXA 1IZ1A 2OTJI 1WH5A 1N25A 1HDPA 1W7PA 3CJNA 1Y6IA 5E20A 4FE7A 3S32A 3WTWC 4I6ZA 1LFBA 1T0FC 5M5WJ 1GT0C 3ZQFA 1LUJB 4HX8A 3VYSB 2W1OA 4L9VA 2DA3A 3EUHA 5GP9A 3H9QA 1B9NA 1NHAA 1HKSA 3O3KA 4XKVA 4A3BJ 3IHUA 4P9UA 1TZLA 4BXUA 3KYDB 3L2WA 1YX5A 2LYCA 2CV2A 2CS3A 2ELHA 2E36A 4LOCA 3WG7H 5LHGA 2W00A 3CCSI 4RLQA 3PM1A 5FLMJ 5D4RA 5FFZA 2DBBA 2A69F 2FXAA 1BJZA 1DGWY 3BG9A 4BU2A 4HLXA 1WFXA 1ZRCA 2CUEA 2YS9A 3VODA 3K4BA 2IGNA 2Y0SN 3G73A 4CYDA 1GHCA 4QMEA 2VJIA 2CFXA 5KVRA 4F91B 3NWTA 4ZX5A 2VONA 3WTYC 5GADJ 1OCZH 5FKMA 4UB6C 4E7HA 1PUEE 1ZARA 2ZSIB 4E4HA 3WTUC 2R93J 9ANTA 4GO1A 5DDGA 3J7AY 3ZCOA 1TQMA 2MH9A 5DULA 2KRCA 3MMYB 4HW0A 6PAXA 1Z3XA 1JT6A 3A0HC 3UCQA 3ULQB 1RNLA 4K5PA 1V54H 2KHMA 4P9FA 4AVZA 3S16J 2GXBA 2XC7A 3ZQ7A 2QSGX 2B61A 4JX6A 4OIRF 4ZTJA 1IW7F 1VTNC 3ANMA 3Q9VA 2EFQA 3BTCA 4ASNA 1R58A 3IH2A 1ZK8A 3IAM2 1IDZA 2A7OA 2ETHA 4HOBA 3HRTA 5J4YA 2EJRA 3BQYA 4DPRA 2Y0SA 1EJ9A 4GGGA 4ZW5A 3IC7A 2G7HA 1B9MA 2HQNA 4RGXA 3V42A 2OZUA 2BGCA 3L2CA 1KU9A 4I2OA 2N8GA 4B4CA 1IJWC
chains in the Genus database with same CATH topology
4HDVA 3KLOA 2VE9A 2O0YA 3DEUA 4XO4A 4PDKA 3C18A 3I64A 2CWEA 5H6RA 1IUYA 3V7RA 4ETSA 1SG7A 1SFEA 4ZX4A 4RGSA 1LDJA 4XN5A 2BBYA 3RKYA 2HTSA 3ECOA 3RASA 3ZI0A 3CO6C 1IXSB 3WTTC 2MH2A 4O5VA 4XMWA 4LJZF 3IL2A 5E17F 2F2EA 5BPIA 2ZJ2A 2XQ0A 1R23A 2LF8A 1STZA 3TOAA 1ZS2A 3B7TA 3W6JB 1KGSA 4L18B 3BJ6A 3BY6A 1ZG5A 4EM2A 4K5MA 5LBQA 5J6XA 2XAJA 5DCMA 2W24A 3WTZA 2Y1CA 4G7ZF 5DD8A 4OMZA 2HPTA 2YU3A 3E6CC 1ZN2A 2QUFA 2RVCA 3LA7A 3J80Z 2XIGA 3Q5FA 2VBZA 4M9ZA 5JI6A 3KP6A 2EWNA 1TBXA 5ERIA 3FUKA 3ML6A 4Y67A 3ANNA 4R1HA 1JG9A 3LA2A 4S05A 2DQLA 1XCVA 2JV7A 2QENA 5EV7A 1BBYA 4RAYA 1FBUA 1ZRFA 3FX3A 2H09A 2XV4S 2PFBA 4M72A 2GQQA 3FXUA 2K4BA 2QBYA 2PJPA 1U8RA 4EV0A 3VFZA 1ZG1A 4ZQGA 1J2XA 1RUNA 1TQIA 4R8HA 1TNSA 5K5QA 3P7NA 1U5TC 3HRUA 4FX4A 3BZ6A 1FY7A 2FBKA 3CHSA 4UVAA 3ECHA 5DEQA 1FBSA 2ZMEB 2KRFA 3ZP5A 1J75A 5J8CA 4MKTA 1TNTA 5FGMA 2DPUA 3ANLA 5FLXZ 2K7LA 4MS6A 2NYXA 4FX0A 2ACJA 3T8RA 3SXYA 3RTRA 1U3EM 2QM3A 3LSTA 4N9HA 4ZX3A 4XMXA 3VVLA 3GW2A 2Q0OA 4XO5A 3WGIA 2HZTA 3KP2A 4GXOA 3DFGA 3S2WA 4HV6A 5ICFA 4XNAA 4UVCA 3VEPA 2W85A 3BDDA 4OOFA 4BHCA 3ZPLA 1T98A 1Z91A 4WCGA 4FT8A 1ZLKA 3REOA 4HQMA 1GXPA 2CG4A 4KUMA 3KP5A 1Z6RA 1ZGJA 3CZLA 1PP7U 3CDHA 4Q4EA 1H0MA 2PMUA 3HSFA 3HOSA 3NQOA 1LDDA 4K2EA 1KU2A 3R61A 3O2PE 2EV0A 2JCXA 2A3SA 4Q4ZF 3I71A 5L3DA 2MLGA 3IIEA 4K5NA 2KJBA 1S46A 4Y15A 1YG2A 3J81K 4XMZA 3BPXA 2HR3A 4KICA 5JNLA 5JR3A 4FHTA 4R79A 3RKWA 5K5RA 2IRFG 4ZW8A 5L3GA 1YO5C 2QQ9A 3WTSC 2V1XA 4KA4A 3PUUA 2ZNYA 3RC8A 5LEJA 1RZ4A 2MC3A 1FYMA 4FLRA 3CUQA 4LB6B 4MEXF 1QPMA 3TO6A 4XN4A 5HLGA 3B73A 1R22A 1JE8A 3KP4A 2IT0A 1GVJA 1WSUA 2DQRA 2XAFA 5JFRA 1QBJA 3FH8A 2P5KA 5CVIA 5H20A 4Q5SF 1U78A 1X3UA 4ZZLA 2BV6A 5CVUA 3W6KB 3IKVA 5HS9A 2FE3A 2PUSA 4KMFA 1JVSA 2JD1A 4XN9A 5IT3A 4JBAA 5JBIA 2ZKZA 1BM9A 3EYIA 3IWFA 4LGWA 3K0LA 1MZBA 4OOIA 3SZTA 5LLQA 1I1SA 1X3WA 3EDPA 2GZWA 1O3SA 3E6MA 3DF8A 3BJAA 3NEUA 4L0ZB 3GWZA 2Y48A 4FLOA 4AYSA 4MQVA 3V7SA 2ADUA 1KYWA 1FYLA 3RC3A 2DW4A 1P4XA 3V8LA 4XO3A 4XNDA 5FD5A 5AIQA 1J0RA 2VJ8A 3QOPA 3EYYA 1O3TA 4M6YA 1T38A 1ONNA 1Y0UA 3A06A 2IVMA 2UWMA 1KQ8A 2VC1A 5DCMB 1XGSA 3F23A 4IRGA 3CLOA 4MEYF 4XMUA 3I59A 3ISPA 2JCVA 1Q0QA 2WPGA 3EETA 2VT2A 4ZQHA 2R59A 4KIGA 3LWFA 2PMHA 4R5TA 4M6XA 4HDUA 4UV8A 2J5PA 2PBIA 4ZN6A 1H19A 4XSXF 4N9IA 2E7WA 1HBXG 2FU4A 1IRGA 4GAEA 3ZMDA 4RS8A 1XMKA 4ZQEA 1IN8A 3HHGA 5JMPA 1TW2A 2QBYB 2FMYA 2P6TA 4EJUA 3FU3A 4EM0B 2A6HF 4CZZA 3L9FA 5LEKA 3TKYA 4LB5A 1XGNA 4P96A 4M9XA 4PU2A 2VOOA 4NB5A 3F8BA 4AWXB 1Z6TA 1H9GA 5A2QK 4F7ZA 3WGGA 5ICGA 3N97A 1R7JA 4NQWA 1AWCA 3JSZA 4XRFA 2M1BA 2W84A 4S04A 1ZLJA 4PGHA 2GA1A 2HYFA 2F5DA 5CJ9A 2UXNA 1ONOA 2NAZA 1BC7C 5D5XB 1IRFA 3WTVC 4P55A 4PVBA 2FMLA 2RKHA 4M74A 2HDCA 4KNYA 3HRMA 2JZYA 4KDPA 3OOPA 3U2RA 1HQCA 3T8TA 2GIVA 4G7OF 3ZHYA 3FHZA 5HS7A 3GO5A 1B59A 3BPVA 3JW4A 3QP5A 4FLQA 2XPZA 2ISZA 3FTXA 1MW2A 1WI9A 2PG4A 1FBQA 1HS6A 4EJVA 3R6SA 3K1NA 4U0VA 2KIUA 1REPC 2VBWA 5TJJA 3K9TA 3R60A 4RCVA 2KKOA 5E1XA 1XGMA 2R7FA 3CUQB 3QPTA 2H27A 2A68F 2GXGA 1S29A 3KZZA 3V7CA 3GEZA 5ICCA 4ENNA 1HXDA 1YW8A 1FZPB 1MGTA 1D3YA 1CF7A 2G9WA 1WWXA 5FB2A 4ZW6A 4MGRA 4XNBA 4ZQTA 3P9KA 1IXCA 1UHMA 1YW7A 2PGGA 2XUBA 1R5HA 1SMTA 1WQ2A 2PQ8A 4RB2C 1R0KA 2VBYA 4I01A 4A5NA 1MW3A 2G7UA 2RN7A 5ILSA 2NNYA 2BE5F 3U9GA 1XB4A 1SD5A 4EGYA 3QRFF 5F6FA 2OD5A 4Y13A 3TO9A 4Y17A 4Q47A 1W5SA 3FMRA 2UZKA 2ZNZA 4AD9A 4XSZF 5IT9Z 2FEZA 2B0LA 4CO8A 3KE2A 3E5QA 3KEOA 4QHPA 4BQAA 4KP7A 2RJIA 3ERED 5FFXA 4ZYEA 4XN1A 1QGPA 5E8IA 3LAPA 2L3DA 2XRNA 5CLSA 3HTSB 5ICEA 1YIOA 2QVWA 2PN6A 1XDUA 3E6DA 3I59B 2C5ZA 4UV9A 2NRAC 1I1GA 2QQAA 4IPAA 4G6QA 3B34A 2HQRA 3TO7A 1SQMA 2M8EA 4MTDA 5HNFA 3K2ZA 1BOAA 4EJOA 1IN6A 2EV5A 2L01A 1YS7A 1HW5A 1TW3A 3WODF 4PW4A 2ZBKA 3FTUA 1RIOH 2XHKA 4UUVA 1RUOA 3KETA 4K5LA 3I58A 4ESBA 5FD6A 2CW0F 1IF1A 2IJLA 1DPRA 2L54A 2XKPA 2V1UA 3D5LA 1WKMA 5D4SA 1OYYA 3RIRA 4ZH4F 3M7GA 3QJXA 1KQ0A 3B7SA 4HZFA 3JSPA 4EGZA 1J59A 1G3SA 1ODDA 4A6DA 2P5LC 5DCFA 5ED4A 2ESHA 2Y1DA 2VLAA 2F5FA 1SD7A 2XPYA 1MD0A 4FCAA 2D45A 3EQLF 2ESNA 2HTJA 5HNHA 4RB1A 3CO7C 1G3WA 2KIMA 3V8JA 2K27A 3F3XA 5CVVA 3T5XA 4X2UA 4I0BA 3FU5A 4I7HA 2JD2A 3T8VA 2MBFA 2XAGA 3FXQA 2HOEA 4IHTA 4OU0A 2HEOA 3F22A 2Z99A 4G6DA 3AAFA 1JHFA 2D1VA 1D5VA 2RGVA 3QU3A 1SFXA 1LJ9A 4G94A 4CDGA 1G5AA 3L00A 3PQJA 2QZ8A 4MNUA 3PFIA 3T1BA 3ZHXA 2IW5A 1D8JA 1OPCA 4U88A 3CZGA 4YFXF 2O8XA 2QQBA 5CVRA 4L9NA 1K5HA 3JTGA 5D6FA 1FNNA 4BNCA 4B8XA 3GFIA 4OIOF 2X4HA 4UXNA 4EMSA 4EJWA 3FH5A 4DNCA 1E17A 3FTVA 2Y0MA 1YS6A 4WXDA 1ZYRF 3TGNA 1BI1A 2DPDA 2STTA 3FUJA 5LRSA 1CF7B 1O3RA 2QLZA 2IA0A 5H6QA 3BJOA 4MQ9F 2QYOA 1Q0HA 2JT1A 2JCYA 2Y1EA 5D5UB 5AIPA 4HF1A 3ZN0A 4Q48A 3WE3A 4AR9A 4HX4A 2MLKA 2P7VB 2GTQA 1ZHFA 2YX4A 3BROA 1V4RA 2HWVA 2RDPA 3HRSA 5L3FA 3DPLC 5LHHA 3WU0A 1XDSA 2WWYA 2WZGA 3FMSA 1PP8F 5E18F 1BI0A 3M8FA 2E1NA 3C3WA 1MDMA 3HTUA 4KN7X 3JT1A 3JSOA 4U0YA 3FH7A 2XAQA 3HSEA 5LRRA 2DQMA 3ZMSA 5HVQC 5F1RA 1WRJA 1Q0LA 4MTEA 1E2XA 1BJAA 5EEGA 2OZ6A 3F8NA 3WTXC 3FM5A 1R1VA 4HYEA 2E1CA 1J7KA 2HKOA 2FNPA 4HF2A 4LK0F 4XLPF 1YYVA 4FLSA 3RDIA 1XD7A 3DPTA 4HBLA 1HSJA 3VB2A 1X3ZA 5DLLA 3P9IA 3HOTA 1BN5A 3F8FA 3LA3A 3TOBA 5JO0A 3FMQA 4ZYGA 1LDKB 3HHHA 2L4AA 1T1RA 3H3ZA 3I5UA 4BYYA 4YG2F 3DV8A 5HS8A 4ENKA 3MFKA 1ZGAA 4WWCA 1HKQA 5HDGA 4LFUA 4D0PA 1SC5A 3RJPA 3WGHA 2HPOA 5D6EA 2V79A 1J9IA 3WG9A 3GFMA 1QQIA 3B2XA 3V4GA 4OOEA 2Y1FA 4KIBA 1FLIA 3ELKA 2FNAA 3CHPA 4HV5A 4ON0A 1HKTA 1G6NA 4PZJA 3RYRA 1HW1A 3MZHA 2O3FA 3SHFA 4ZW3A 3UEQA 3ZMTA 1K7AA 5LHIA 1ON2A 3JAMK 2AXLA 3GVAA 4RB3C 5EEHA 2CQKA 3J81Z 2FBIA 1Z05A 1C0WA 4M9SA 3RKXA 5L3EA 4EQQA 3MWMA 4LMYA 3E97A 4A5MA 3ZHZA 2WTEA 4HLYA 4U0WA 3L7WA 1IXRC 1R00A 4ZZDA 1XCBA 4UHTA 1FSEA 4XN2A 2EFNA 3CUOA 3AUAA 3L09A 3R0IA 2O61A 3DQVC 2J5OA 4N0BA 1B6AA 3QU6A 1MW0A 1H3LA 2FOKA 3EBGA 1QZYA 1A04A 5D5VB 3K1MA 2H6CA 5D8KB 2JPCA 2P7CB 2C6YA 2PLYA 2ZXJA 2FQ3A 4ENJA 1S3JA 2Z3YA 3KZYA 5AONA 1EH7A 3KLNA 4K5OA 2Q8KA 4HA8A 1JXSA 5FWQA 4J3BA 3SFZA 4KT5C 1JHHA 1YLFA 4LG0A 3HUGA 2E7XA 1IN4A 4PCQA 4U7BA 1QO0D 3FUIA 3HSRA 4KN4X 5ILUA 1ON1A 2IA2A 3Q43A 4IRIA 2L02A 5HOOA 4BH9A 3U1DA 2FFLA 1KQ9A 3GUDA 2OQRA 3ROUA 2RC4A 1YFHA 1USSA 1KU3A 2EFWA 1Q1HA 4BHPA 1Z7UA 1MDMB 3GFJA 2P5VA 5LGUA 3N4MA 4OMYA 4YFKF 3FWEA 3LFKA 2IA1A 4WXHA 2JPBA 2PEXA 3KFWX 4CICA 4A12A 3E3VA 4ARFA 3BWGA 2STWA 4QIRA 4PGGA 4EVIA 1S6LA 5HLIA 4Y6PA 4R5VA 1R5GA 1V3FA 2K4JA 2K86A 1BI2A 1FYKA 1LVAA 4ZYHA 2JSCA 2XROA 5E1WA 4QLCU 2F5CA 4L5JA 4A2UA 3B7UX 2BEOA 4LLLA 4AIJA 3RI4A 3IWZA 4Y6RA 1O7LA 4MHGA 1MKMA 4HQEA 1J5YA 1U6GA 1EH6A 5A2QZ 1BIBA 2ZO4A 2LF7A 1D8KA 4WK8F 2GWRA 4YFNF 3GZ6A 4AR1A 3ABTA 2P6SA 1P2FA 5HLTA 3M9AA 1XSVA 2VN2A 2LNBA 2R72A 3J80K 5DUKA 1ZRDA 5JC1A 1UFMA 4LLNA 1XMAA 4KYWA 3BP8A 3IRRA 4IHSA 3FUNA 2A07F 1T0FA 5HDNA 2VBXA 3PQKA 4XN7A 3ZMZA 2OAZA 1LQ1A 2JTVA 4AVPA 4M73A 4CGZA 5LGTA 1TTYA 4LLGF 1GW6A 2ZCWA 1MVYA 4KFCA 1EH8A 4P5OA 2OBPA 3CZEA 3TDZC 2QJ1A 5HLHA 2VE8A 3TDUC 1U2WA 1FOKA 2O7GA 3MEXA 2O6GE 2W25A 3IKTA 2A5YB 2MA3A 2VT3A 2XAHA 4I0AA 2YSRA 5FLXK 3B7RL 1SFUA 2R7DA 3SQNA 3WU1B 4ZQFA 2LDUA 2DI3A 5KK1A 3QPHA 2FRHA 4TV7A 2C82A 1P4AA 4AICA 2XASA 4A0YA 3GYHX 5AENA 1I27A 2AS5F 1O7FA 4XBFA 2CO5A 3H92A 5BPPA 1FP1D 2QVOA 3TQNA 4OIPF 1BIAA 1ZG3A 4L9JA 2HKXA 4RAZA 3LQRA 1UCRA 1F1ZA 2CGPA 1LB2A 1KU7A 1PDNC 2OU2A 4HF0A 2DLLA 3R0JA 1T1SA 2Z5UA 2RV8A 3WQQA 2EA4A 1OMIA 1P92A 2UXXA 3WE2A 4CXFA 1P6RA 2D2WA 5DYMA 4Q4IA 2WZFA 3M1EA 2DO7A 2YX7A 4BAYA 3M8EA 2IPQX 5L3BA 1YQAA 4DQ2A 4ENMA 1XSXA 3E5UA 1ZREA 2VODA 2ZXGA 3GF2A 3KCCA 5K1YA 1MJ9A 3FTWA 3VVMA 1IN7A 4LG0B 1LNWA 4GYIA 1I6XA 1S8NA 4UVBA 4RGRA 2P4WA 1DUXC 1OYIA 2O03A 1DDNA 3P9CA 1KYZA 4I98B 1T39A 4WXCA 4BHBA 4XMVA 1FSHA 1JGIA 2GA2A 1OKRA 3T0YA 5ILVA 4RVBA 1MW1A 2FF4A 4ZW7A 1I5ZA 1DP7P 2MAPA 4L2LA 3Q9SA 5F64A 3KP3A 1OYWA 2VOPA 1SMYF 2COMA 5BMZA 3B3BA 1ZAOA 3QAHA 2Z33A 3E6BA 3NRVA 1K78B 3RPQA 2R70A 1F5TA 3F8CA 5BS6A 2IP2A 3K69A 2FBHA 1SD6A 1MJAA 3HYIA 1R1UA 2V6CA 2DU9A 1FC3A 1ULYA 5DYFA 5E1ZB 2MD5A 4R7LA 3F72A 3GZ5A 4I09A 1BI3A 2KIFA 5D5WB 5HDKA 3B02A 3CHQA 3EBIA 3FTSA 1U5TA 3HIFA 3AU8A 3R0AA 3FTYA 3F21A 3MAJA 1ONVA 4O3MA 1W7PB 3E5XA 2OA4A 1UB9A 4R5XA 3ZMVA 1L3LA 2A61A 2XGXA 3CUQC 1FP2A 4CHUA 2H94A 3RYPA 3CZKA 3B2PA 3FULA 1SD4A 3I4PA 2ZFWA 1BC8C 2M5WA 3GFLA 4Y6SA 4KMUX 4XLNF 2VC0A 2V1DA 2W57A 3EBHA 3VOEA 4E70A 3JTHA 5E8GA 2HYGD 2M87A 1YW9A 3FM3A 1MJBA 4AIHA 2EFOA 2OQGA 3SZPA 5DV5A 2BYVE 5BQTA 2Q2EA 3FXRA 1R36A 2DK8A 3CHRA 3UERA 1SAXA 3BOQA 1B4AA 5L3CA 4G7HF 4JNDA 1K6OA 3KEQA 1IN5A 4AR8A 2YR2A 4LUPA 1O3QA 4YIIA 1FX7A 2X0LA 4QWQA 1G4DA 2M45A 1R1TA 1S7OA 4OIQF 2EGHA 2D1HA 4IRHA 3ZN1A 4H0EA 3A14A 3AU9A 1Z9CA 3O6BB 2L4MA 3FUDA 4Z2YA 3QP6A 1FWZA 3DKWA 1USTA 3G3ZA 4YIFA 4XN8A 2XKOA 5CVJA 5DD4A 5DUIA 1T6SA 4IVNA 2QWWA 2CSOA 3LQQA 1XSDA 1HSTA 3B37A 3MZYA 1S7AA 1W5TA 1UHWA 1EV7A 2HFHA 4QPEA 1CGPA 4IJAA 4A6EA 2DK5A 4NHJA 3KP7A 4JQFA 3GX4X 4O6JA 3I53A 2WC2A 2PI0A 1ONPA 2XVCA 3D0SA 3F6VA 3F8MA 4M71A 4WF2A 4IXAA 2Y1GA 3OV8A 3U9WA 4OINF 4A0XA 4LD5A 5LGNA 3FHEA 4KIFA 2A6EF 5K5OA 2HS5A 2V9VA 3CTAA 3DP7A 2FSWA 4L0YB 3DXJF 2R3SA 4GCVA 2MAOA 2PL5A 4BKXA 4ZYDA 1HW2A 3FUFA 5JVTA 4B09A 3WQRA 3COAC 3RPUA 2DAOA 1H9TA 1B1BA 1JGSA 1IAWA 1W7PD 4RB0A 2RNJA 3KEDA 2DQ6A 1XN7A 2Z9OA 3GXOA 2FA5A 2LSOA 5J8FA 2VXZA 4I02A 4ZX6A 3FZVA 2ISYA 4A0ZA 4AIKA 1Z1DA 1KA8A 2GAUA 4XMTA 1AOYA 3I54A 5JAZA 4JK1X 1OR7A 1W4MA 1QZZA 1FT9A 2F5EA 1K79A 1O57A 5BOXA 2LKPA 2CYYA 4G8XA 1TQPA 3C7JA 3R4KA 1LEAA 1FPQA 4UNOA 1YTYA 1P4WA 1DPUA 4LK1F 3FTZA 4RSYA 4EM1A 2HGCA 2RQPA 1RI7A 1RP3A 2WV0A 1GXQA 3F6OA 3WQSB 3FUEA 4L5IA 4G9YA 2EB7A 4GYGA 1U5TB 5JHUA 3ZMUA 5IT9K 5BPDA 3LAJA 4HX7A 2JRTA 1R0LA 3J7AO 4EJTA 2NNNA 2EA2A 3I0TA 4L9TA 4ESJA 2P8TA 2JD0A 3CHOA 3IRQA 5D8LB 1T2KA 2EFPA 3Q44A 4ESFA 2M30A 3GLXA 2EK5A 5TRDA 3FUMA 3K1PA 4IF4A 1F4KA 2DTRA 3JAMZ 3MQ0A 4GAAA 4WX9A 2DFIA 4QUOA 3FUHA 2K02A 1K78A 4A03A 1XGOA 5CYVA 2ZMEA 3C1DA 2NS0A 3FU0A 5JMWA 1TLHB 3MCZA