5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
5HLTA 2VLAA 5HNFA 5HNHA
chains in the Genus database with same CATH superfamily
5F27A 4XLNF 4RDUA 1FMWA 3CDHA 1J59A 3BG5A 4IOCF 4BY1J 2OU2A 2DQRA 1VNDA 1J0RA 2EA2A 3C3WA 4U0WA 2R5ZB 4JQFA 2JUGA 3HSFA 1WCMJ 2DJNA 2UXNA 1YJNI 1YYVA 2FFLA 4HEA2 3A14A 2FQ4A 2Y0MA 2QF7A 4CCKA 1DP7P 5JR3A 2KRFA 1S7OA 3E7LA 2FF4A 2DN0A 1USSA 5M5WJ 1OMIA 1HC8A 2AXLA 2E1CA 2O8KA 2X85A 2B7EA 2I10A 3S16J 3F22A 1NK2P 1AKHB 2TDXA 3FUNA 1S7AA 2IA2A 4A2UA 2HTJA 4CCMA 5GP9A 4A3GJ 3GF2A 4EJOA 4WCGA 3FBIB 4AIHA 2NRAC 4ZX6A 3A0HC 3OSFA 4BAYA 2VJ5A 3KP3A 4M72A 5D6EA 5A2QK 3CCMI 3S1QJ 5ICEA 3DTKA 2RJIA 1DGRM 1V5EA 2M7BA 4ZYGA 3JSOA 3H9JA 1P2FA 4HX4A 2M3AA 4AUXA 5HLTA 4UUSA 4A3CJ 3M1EA 3JRDA 2HDCA 3K1MA 3B7SA 3GMEA 4HYEA 2FMYA 5FD6A 2CW0F 3I71A 2XHKA 5FFXA 4Y33A 4HA8A 3FMQA 1YITI 3T8VA 1Z3YA 1GDTA 3QPTA 5BPDA 4XN4A 3VOEA 5BS6A 2VBWA 1JT0A 1AOYA 2CWEA 4ZZDA 2Z33A 3ABLH 4XR6A 3QPLA 1S8NA 3G1MA 4I98B 4UV9A 4C2MJ 2ZXIA 4E7SA 1IRFA 2LKXA 3BP8A 4JP0A 4YG2F 1V3FA 2EV0A 2VXDA 1SVMA 3ZQIA 4B47A 3KEDA 4BDZA 1H0MA 4HV5A 1U78A 1OYYA 5B1AH 5F64A 1I27A 2L7MP 1A04A 4RGRA 3VVMA 3AG2H 2VBYA 1HF0A 4ZYAA 3FF5A 3U2RA 2VOOA 4AYBA 1JUSA 4DIQA 4UY8I 3B34A 4KIBA 4W1UA 4DZJA 1IN7A 4XNFA 2UUZA 3WTTC 4E6KG 1X1PA 4V2GA 2XAQA 3TQNA 2QVWA 4LIUA 4G7ZF 2I8DA 1W1WE 1IAWA 1VFCA 1R58A 5K1YA 4EGZA 3LAPA 3HPHA 4BJTA 2A5YB 2V6CA 2LY9A 2JA8J 5DCMB 3CMYA 3A01B 1IDZA 4A3JJ 3H5RA 4CCLA 3FXKA 1LE8A 3FXQA 2FUG2 1IN5A 2H27A 3GTPJ 3ELKA 2EFWA 2ZC2A 3HHHA 3I58A 1YRNA 4EV0A 3ABTA 1XGSA 2A69F 3B7UX 2QJ1A 3AUAA 2BXZA 4BACA 4E7HA 2Y9YA 5KVRA 2W24A 3LFKA 2YX7A 5CVJA 2VT2A 4RGUA 2A68F 4YIIA 1ENHA 4BBSJ 1ETWA 3LMMA 1F5TA 4Y6SA 2ETHA 2H6CA 1IV8A 2B0LA 2Y0SN 1B6AA 4ZQHA 3QP5A 2VKEA 1JHHA 4CZZA 1AU7A 2WV1A 3ANLA 5LGNA 4AR8A 2DK5A 3GLXA 1HKTA 3FU0A 1U8BA 1GHCA 3PFIA 3OV8A 5E17F 1MMAA 1TT5B 4KMFA 4IRGA 1U2WA 5FLMJ 3KP2A 3D5SC 3IHUA 2LF7A 5H6RA 4E4HA 1MD0A 1QPIA 4Q4IA 2EZKA 4C3HJ 2OTJI 1SQMA 4ZYDA 4BHCA 5HS9A 1P9QC 2F5EA 1I39A 4IQJA 1XMXA 3TOAA 1VQKI 3N4MA 1MW1A 4ZW6A 1XN7A 3ZRGA 2R7FA 1AWCA 3E1SA 1FT9A 3S1RJ 4PUSA 1MJBA 1Y56A 1MSFC 4M74A 3R0AA 3ONQA 4BQAA 1LNWA 2JRTA 3S17J 1Z6TA 3SZPA 1SFOJ 3DU5A 4UXNA 4AIDA 1WH7A 3GZNB 1MBGA 3BROA 2IA1A 1MNDA 2XPZA 2O0YA 2M4KA 1Q0LA 5GTIC 2Y31A 2OZ6A 2ZB9A 3BC8A 3JSPA 1EH8A 3H9QA 1YJ9I 2Z2SB 2BOLA 4NDLA 3K4NA 4ZH4F 1IN6A 5LRRA 1ULYA 2QEXI 3MKLA 1KYWA 1G2HA 2QENA 3GEZA 2PLYA 2RVCA 4LUPA 4A0YA 1RP3A 4C3IJ 3A2KA 3FWEA 3MVPA 4D5FA 3ZMSA 1KU9A 1WJ5A 3QWLA 1JG9A 2EILH 2DDAA 2K85A 1YJWI 3HHGA 3MMYB 1Q1HA 2HXOA 2XKOA 1MMGA 2WTEA 3OYHA 1SD4A 3ECOA 1MZBA 3O2PE 4P55A 5FD5A 3UKGA 1HS6A 3FULA 1BR1A 1P6RA 3LQQA 2YU9J 4DYRA 2X6YA 1LFPA 4QPOA 3HOSA 3H1CA 4XLCA 3DEEA 1VQ5I 1T6SA 1T8IA 3DKXA 3EYYA 3JSZA 1QHHD 4XMWA 4E7LA 5KAFC 3IAM2 2A6EF 2P5VA 4PSXA 2K9QA 3KCCA 1K61A 3KETA 3DU6A 3B7RL 1FC3A 2ZO4A 4IKFA 1R5HA 3K10A 4DYQA 4OIPF 3H0GJ 3VDXA 1FWZA 2F4IA 2PEXA 2DMUA 2V79A 1PP8F 3OYBA 2FBHA 3RYPA 2VJ8A 2RNGA 5HNHA 3RASA 1HW1A 2CQKA 3EBGA 1MW7A 1QA6A 3JREA 2VJIA 1Z3XA 3ZR8X 4DYCA 4DBRA 2QWWA 3OYJA 1KONA 1APLC 1J09A 3BCBA 3Q0VA 2UV1A 1ONNA 4LJZF 4EJWA 3OYDA 1XSDA 1WWXA 2XPUA 1O7LA 3WG9A 1RUNA 1RESA 5FGMA 2JJ7A 3SJMA 4HNTA 3PUUA 2EQRA 4QPEA 1LUJB 2HI3A 5F1JA 1D8JA 4QHPA 1YQAA 2JMWA 5J1UA 1ON2A 4BHPA 3WTWC 1V5GA 2BV6A 1V55H 2QZ8A 2CQNA 5E3MA 2L02A 4A5NA 3WGIA 4XN0A 2HYGD 2DI3A 2COMA 4P9UA 1OCPA 4ZDOA 4ZQFA 5ICCA 1XDUA 3CUOA 1N78A 4FCYA 2R4GA 4Y7NJ 3HOTA 1XC5A 4Q4ZF 1A36A 3CLOA 3E5QA 2DXIA 5M5YJ 2NVQJ 1ZARA 1DPUA 1R1UA 5FO5A 4II2A 4Y4RA 1A31A 4L5JA 1Z67A 3IUOA 3OL4A 5AIQA 5HVQC 1IO2A 3Q9SA 2OCCH 4QPQA 1JGGA 3D1NI 5E1ZB 2DFFA 4XN8A 2XASA 1TQMA 1VQPI 2DBBA 4MEXF 2IS1A 4XM3A 1TQIA 4HLXA 4I2OA 3X2QH 4LMYA 4XRFA 2HGCA 2P5KA 1HCRA 3CZ6A 4ENNA 2QQ9A 4XRMA 4XORA 1FMVA 4A3LJ 5GAGJ 1G59A 4FHTA 2XC7A 2A61A 1KGSA 1UJ8A 2HOEA 4DGWB 2ZXWH 2AXTC 3FK7A 4ENJA 1ZREA 1T1SA 2M30A 3O6BB 2CQQA 2MGQA 4C9YA 5IP7J 1ERDA 2ZNYA 4G6QA 2KLOA 2VQCA 4BXUA 3MZHA 2BW3A 2EFPA 2JCYA 3LSJA 2R7SA 3EBHA 1GVJA 2H6BA 2EFOA 2IGMA 3PNTA 4BEHA 2EIMH 1SAUA 2IA0A 2B63J 3OR2C 1G3WA 1D1AA 3PUBA 1W5CC 4YFKF 2O7OA 2KIQA 1M1EB 1T98A 2VT3A 2B61A 5EEGA 3K70C 3E0JB 5IY5H 1B9MA 4I6ZA 2NNYA 3LSTA 5FLXZ 1T38A 1HOMA 3U9WA 1Q1VA 1IXRC 4PVBA 3I9V2 5ICGA 1FBQA 4PCQA 5IT9K 2KZGA 1XGMA 1FLIA 2Z99A 3UERA 3ZMZA 2VQGA 2VPLA 4M71A 2RV8A 4RMNA 5IPAA 2IRFG 3EQLF 1R5GA 4M9SA 4W97A 3RCOA 5D4SA 3OIQA 2J5OA 5E20A 1PVEA 3GWZA 1EKEA 4EM2A 4P1WA 2GBYA 2STWA 3J7ZI 4KISA 3QU3A 1YX3A 2JK3A 3L09A 3QYBA 1LJ9A 1EV7A 2L9RA 4LLGF 2BY1A 1GUUA 1U3EM 3VODA 4NQWB 2F2EA 1U5TA 2XAGA 3IWFA 3V7CA 2GM4A 4Y13A 4PU2A 2UWMA 2XF6A 4QLCU 2MC3A 2PMHA 1UAAA 1MIJA 4HF0A 4XNBA 3DEWA 2BYVE 2XGCA 1XTAA 2L0KA 3IKTA 3DPTA 1KU7A 4ZQEA 5AENA 4YEJA 4HG2A 5K5QA 3MKYB 3BCAA 5L3FA 4AIKA 3S15J 1JJ6C 1O3SA 1OKRA 4DQ2A 1KU3A 3F0CA 3GTGJ 5EGOB 3H5AA 3WTZA 3FTVA 2BGCA 1LKXA 4C2UA 3JRAA 4FX4A 5KAIC 1X1DA 9ANTA 4FLOA 4OIQF 1ONPA 1JHFA 1MSEC 2EZLA 3HOVJ 5EYRA 1TWFJ 2VC0A 2E5NA 4PJ0C 3CHRA 3L9FA 2D2WA 1SVOA 5HLHA 1BBYA 2E60A 4MEYF 6PAXA 4CHUA 4K5NA 3LSKA 4HLYA 2D45A 1H9GA 2OA4A 5IP6A 3V8JA 3HOWJ 4K5PA 1KA8A 4NNJA 2PBIA 4A3BJ 2ISYA 5JVGF 5JC1A 1YIOA 3PO3J 2PL5A 1R22A 1Q0HA 1LEAA 3ZN0A 4S0HB 3L1PA 1MH4A 3PJRA 1FY7A 3ZQFA 5ED4A 4EEFG 3M8JA 1JT6A 2CUZA 1FYMA 4E7ZA 5LHGA 5E3NA 1NG6A 5J6XA 3HW2A 1W0TA 1OR7A 1X3ZB 3FHNA 4M9ZA 2L54A 3WTYC 4IHSA 2ZKZA 3RJPA 1GV2A 1BOBA 1W36D 3CHPA 3ZQHA 3I59A 3L2WA 2R7VA 2P4WA 4Y52J 4AR9A 2K4JA 5DD8A 3QJXA 2FU4A 1YFHA 4PFPA 3PIPF 2HDWA 5GTHC 3VYSB 3BR0A 3CDIA 1WVRA 2OBPA 1QZZA 5HODA 5EDNA 3V4GA 2MC4A 2YSRA 3OYGA 2MA3A 3KX2A 1R00A 1BR4A 3G1OA 4MFEA 3HKZN 4HQMA 3GTKJ 2W1OA 2WAFA 3OYIA 4R5TA 5DULA 3QYFA 3SZGA 1TWHJ 2MBFA 1RPWA 2X1DA 3F8BA 4G9YA 4L2LA 1BW6A 3KZYA 2LYCA 1R7JA 2R7QA 4IXAA 2BVMA 1FBUA 2WAQN 4G6DA 3ULQB 2EIKH 5EF6A 1J5YA 4BE1A 1BOAA 4IHWA 1OCOH 1ZLKA 3B37A 2Z1DA 3H35A 4LK1F 4GYIA 3T8RA 1PP7U 2JVHA 3K4KA 1G5AA 3ZI0A 3M1CA 4KITB 4UUVA 5D4RA 1CQTA 3VWBA 3OYCA 1J2XA 3KYLA 1A6QA 2LK2A 1UHWA 3J7AY 2DODA 3O8GA 4LFUA 2LKPA 4UUSB 2GXGA 1R23A 3PNVA 4XKWA 5HLGA 4E7IA 1D8KA 2CJJA 3HXLA 3HRSA 3OL3A 3CCRI 1MW2A 1MW0A 3ZXSA 4CSWA 5B3SH 1XGNA 2WWYA 1T1RA 3WQRA 5H2FC 5J1YA 5JMWA 3LA3A 1IW7F 3OYNA 3HBLA 1SFEA 4KT6A 1XMKA 5BNGA 4MQVA 3MAJA 2AHQA 1R6RA 2VKHA 4MNUA 3JAMK 4XQFA 2XSDC 3QYEA 5DDGA 5LFAA 1JXSA 4IRIA 4IF4A 2IP2A 4OU0A 1W5SA 1XGOA 1BI1A 1R71A 5B1BH 5E3OA 5J4VA 1IG7A 4D9JA 1ETXA 5CVRA 1HQCA 2W48A 5J40A 4HX8A 2HU9A 2JSPA 5F1RA 2CSOA 3ZMTA 1SANA 2O03A 1Z1DA 3MZ8A 2EV6A 1USTA 3ZQ7A 4LLLA 3H5NA 3AL0C 2K7LA 3NWSA 4M3BA 1T33A 2F5CA 5KNLA 3CHQA 3B6CA 2E1MB 2XAHA 5LBQA 2MABA 2VE9A 2G7UA 2NVYJ 5K7ZA 2DA1A 3ZMDA 4XRSG 5IT3A 2VC1A 1U5TC 1VQ7I 2L9VA 2LTPA 3KLOA 1W5TA 4D7NA 4QTRA 4BE2A 4E7JA 3PL8A 3UCQA 2L7FP 1LE8B 2A3SA 3RPQA 5LEJA 2V1NA 4XONA 3WU1B 2PG4A 1CGPA 4A3DJ 2V7FA 4CCOA 1YRNB 2HTSA 2OQRA 3OOUA 2ESNA 2VJ4A 4KT5C 1OFCX 2HKXA 1IXSB 4XSXF 2XQ0A 4WF2A 4HBLA 4ZDLA 4RCVA 3MD2A 2Y48A 4IPAA 4RGXA 5HDKA 2BZTA 3FH8A 1BIAA 2CUFA 2MG4A 4L0YB 3WQQA 1D1BA 3PIOF 1KQ0A 3TKYA 1TWGJ 1V5FA 2P6TA 4Z6YA 2ZFUA 2IJLA 2K4BA 3I53A 1JUPA 3JR9A 2HVRA 3BTIA 5JNLA 2QBYA 4MTDA 3RQIA 2AQEA 4XKBA 4CO8A 3DTIA 5TISC 3HC7A 1TP4A 4HNVA 1WSUA 3FTUA 2OAZA 3W2WA 1U9NA 3CUQA 1UHMA 4GFBA 4OIRF 1LFUP 2VPRA 4U0VA 1S46A 2CG4A 3C2HA 3KZIC 2X6WA 3VYRB 5LGUA 1OQYA 3ABKH 3U21A 2MAPA 4F55A 4B44A 4DPRA 2HQ5A 4YELA 3F8NA 1ZAOA 2WY8Q 2F5FA 2XRNA 5DYMA 2OC6A 1OR7C 2DK8A 1UZCA 4GDFA 2DT7B 5D5WB 3AFHA 1NK3P 5E8GA 3WG7H 4FETA 4QUOA 2MD0A 5E1WA 2BE5F 3BOQA 1U0JA 2HYFA 4BHBA 4CCJA 2E7XA 1JTYA 1PJRA 2ZCWA 3FUFA 1XDSA 4PFOA 3L2UA 1X1AA 2M8GX 1RZ4A 4UB6C 1G3TA 2QSHX 2EFQA 5M3MJ 4RB2C 1ZK8A 1YS7A 3ZMUA 1TW2A 2XKPA 1U9OA 3KIOA 2EWNA 3CC7I 1T95A 3C1DA 5D5VB 4J01A 4A03A 1ETOA 1RI7A 1TTYA 4CUGA 3FU3A 2PUSA 3BG7A 2V26A 4FLRA 3DCFA 1SG7A 5AIPA 3O8HA 2L2OA 4I09A 1TC3C 4XMVA 3J80Z 5EZHA 5IOYA 2LG4A 1MNEA 1MKMA 3VFZA 3CHSA 3DLLF 3Q0UA 2HOTA 1K6YA 5HS8A 1T56A 4JX5A 3GXOA 3WODF 4J3BA 4NC7A 3P5JA 5DM6F 3ASOH 4FLSA 2JT1A 4XLFA 5DM7F 3SYTA 2LFBA 2ID3A 2CMPA 1STZA 2K86A 3IWZA 4XMYA 1G3YA 3RDIA 3GVAA 4BXXJ 3E6MA 3D5RC 3HOZJ 5FFZA 1OLTA 2XPWA 2M87A 3OIOA 1J9IA 1IF1A 3J7AO 2KIUA 1FIPA 3DV8A 2G7HA 2XDVA 3CESA 4JX6A 1F9NA 1Z7LA 1WI9A 2LY1A 2CQ7A 1S6LA 2P5LC 3LSMA 1WJAA 1B4AA 2UXXA 3GTJJ 1JKPC 2M7AA 1TZLA 3KYCB 3OYAA 3I3LA 3HDDA 4HRIA 1TT0A 1X1CA 2ELJA 3ML6A 3CCVI 2AO9A 1D0XA 4O6JA 2DU9A 3B3BA 1H8AC 2A05A 1B8IA 2ISZA 5JLXA 3CQZJ 1RUOA 3FM3A 2FEZA 5J8CA 2VKDA 2HZTA 5LEKA 3KEYA 3FH5A 2FOWA 3IRQA 4CZCA 2HPMA 1YLFA 2LLKA 3BR5A 4XOPA 2DDBA 1D0ZA 1FPQA 1OJLA 4M73A 4BL0B 2MW8A 4RM3A 4RVBA 4L5IA 1RRJA 3NWTA 2Y1GA 4R5XA 3BQZA 1RC9A 2ZSIB 4LG0A 3FISA 5F6FA 3E6DA 4CXFA 4Y6PA 1TWAJ 3A02A 3VB2A 4PGGA 2FXAA 4KA4A 2E36A 3RTRA 1NH3A 1E0EA 2VL8A 2QYOA 4IHVA 4XN1A 3DXJF 3R0JA 4Q4EA 5IOZA 3R6SA 3DPLC 4IO9F 3Q9VA 2LSOA 2IGOA 3ANMA 2D1HA 3G1LA 2Y1EA 3WE2A 4D5CA 1KQ8A 4JNDA 4NC8A 1T2KA 5FWQA 2DFEA 2O7GA 4DJAA 4RA2A 3TO6A 1KU2A 3E6BA 4PJNA 2JD2A 4LB5A 1TLHB 3WGHA 4R8HA 2R3SA 3CZLA 2O6GE 3TP3A 2EH3A 3JRFA 1RIOH 3CO6C 3UR3C 2WB1N 2QSGX 1ON1A 2DTRA 2WV0A 2ID6A 3WTUC 4OWRB 3VEPA 2ECBA 3S2WA 3ZQCA 1EH7A 1P92A 2DA4A 1C0WA 1U8RA 1VQMI 2CUEA 2DMTA 2M8EA 2MD5A 5K5RA 2D5VA 2A5WA 2R70A 4DZPA 4A0ZA 4XNAA 2K9LA 2H8WA 4MO7A 3G2BA 5BMZA 3COAC 3WHCA 2HPTA 2XB5A 4M9XA 3SFZA 1MBEA 2DQ6A 3JT1A 1EJ9A 2IXSA 3CUQC 4R1HA 2L4MA 1MJAA 2EIJH 2VI6A 3S8PA 3KEQA 3TMOA 2EPFA 2BW3B 4IHTA 2FA5A 5BQTA 2K9SA 3RIRA 1MW3A 3FTZA 1S5LC 1IXCA 2JPBA 4A6EA 1ZG1A 4BEHB 4UHTA 4YFXF 2VOPA 1P7JA 2F4OB 2QCOA 3OS2A 1VQOI 4AVPA 4ANJA 5GADJ 4A6DA 1VQLI 2IS2A 4WK8F 3IH4A 2VUMJ 1XD7A 5ILSA 1Y8QB 5JBIA 1I1GA 2L5QA 2ZNZA 2PFBA 1SMTA 1QNTA 3GTMJ 3PUFA 3SQNA 4MGRA 4EJUA 1WRJA 5J1RA 2A6TA 2L9SA 3DWLE 5K5OA 5HDGA 1FYLA 3Q0WA 2NXNB 1ZS2A 3K4CA 1X4OA 4U0YA 3F8MA 2FRHA 3LA7A 4ZX4A 4WWCA 2ZXJA 2HEOA 1BR2A 4CDGA 1AHDP 4LLNA 3V42A 4F91B 3CCLI 4H0EA 1WZ2A 4ARFA 1ONOA 4NUBA 3C7JA 5L3EA 2W57A 3E6CC 3K0LA 2GXAA 2QM3A 1A35A 2PMZA 3I4NJ 3CHOA 1IUYA 3FKIJ 3AL0B 1G4DA 3WU0A 3U1DA 3TGNA 1QU3A 4YIFA 2RGVA 4BE0A 3ZQQA 4OMZA 4IOAF 3L7WA 3ZN1A 3OYFA 5IP9J 2M9HA 4YIRX 1UELB 4ZC3A 4RBOA 1D0YA 3K6GA 3K4MA 1HW5A 1U5TB 3B2XA 3DP7A 1ODDA 2K3PA 2R7DA 4UVAA 2RKHA 1ZRDA 5CPRB 2COBA 3JRCA 2GAUA 3OIPA 3VVLA 1GT0C 1SD5A 2W84A 3J81K 3GTLJ 4KICA 2Q2EA 1IDYA 5A2QZ 1HSJA 1LQ1A 4QIWN 2LH9A 4HV6A 5HLIA 1L0OC 3W6KB 4KIFA 5FRNA 2NS8A 2CU7A 1MDMA 1PYVA 2BVLA 3QAHA 1OCRH 3DBLB 4RM2A 3OS0A 1NG7A 4A3IJ 4K5OA 4XN2A 3DKWA 1Y0UA 2QQBA 1Z91A 2DOAA 4MQ9F 2L4AA 2WZFA 2JUCA 4JK1X 3ZMVA 4V19K 4L9NA 5FB2A 2MH9A 2NVXJ 3M9AA 2Y69H 3ZCOA 4ASNA 5L3GA 1GVDA 3W2AA 3TO7A 1B59A 3LL7A 4KDPA 1X3WA 2PN6A 4M3FA 3M07A 4P9FA 1YOVB 1L3LA 3FXMA 4L9VA 4EATA 1BC8C 3SEQA 3HTUA 3I64A 1FP2A 2M2EA 2VB6A 2XGDA 4WXDA 3GTQJ 3BTCA 4M6XA 3FH7A 2ZMEA 2XAUA 4XNDA 4UV8A 5ILUA 3L00A 1H3LA 3HGYA 2C5ZA 4OOFA 3KEOA 3MEXA 1HBXG 2NAZA 2ECCA 4S04A 3HOXJ 4BBRJ 2X9DA 1E3HA 1ITYA 2NYXA 4IL6C 4MIMA 5F0FA 3KFWX 5EG0A 5CVVA 1BL0A 2GWRA 1OPCA 2IT0A 4EM1A 3I59B 1DU6A 3V7SA 2R92J 3IV5A 3HZJA 3LWFA 3ABMH 3W6VA 1G8XA 2XROA 2LF8A 4PGHA 4RAZA 1HW2A 4HF1A 3OYMA 4B43A 4D0PA 2JSCA 3GZ5A 5F0HA 4MS6A 3JW4A 1R9TJ 4Y17A 5FJ8J 4N9HA 1ACIA 1ZQ3P 3HOYJ 4C3JJ 4AYBN 2OQGA 4LITA 1QO0D 3FUIA 3C2GA 4FASD 3OSGA 2ADUA 4AICA 2K5CA 2OCEA 5H20A 3BY6A 5LHIA 5KHDA 1SD6A 1LDJA 3RC3A 4Y67A 3BQYA 4HQEA 3DLAA 1U6GA 3UEQA 4K2EA 1X2NA 4FCAA 1O3QA 2VQHA 1F1ZA 1VTNC 1FTZA 1R0KA 2H8RA 2HWVA 1R4NB 4FTHA 1SVLA 3WU2C 5CQGA 2OV7A 3NRVA 1CF7A 3H92A 2R5YA 1YW7A 3DBRB 4XO3A 3DFGA 4PSWA 2H1LA 3G4SI 4LGWA 4RAGA 1ZYRF 3WQSB 2BY3A 2RC4A 1MNMC 4F93B 2OPTA 2BHYA 2E34A 3CDLA 3M8EA 2KDOA 3RQ4A 3B02A 3IH3A 5IYCJ 3J7YJ 4IRHA 2ZJQF 4UNOA 2EV5A 5D6FA 3FU6A 2DYRH 2VONA 3S2HJ 2XB0X 4ESFA 3R4KA 3RKQA 4B09A 2LBFA 1TW3A 2IS4A 1MMNA 2OD5A 3VSLA 2A6HF 3KP7A 2EK5A 5ERIA 2EJRA 4NC6A 3G73A 3RPUA 1YW8A 3ISPA 1TNSA 2JZYA 3TOBA 2CH0A 2NOGA 4XBFA 3K70D 4ENMA 4EVIA 5DEQA 4GO1A 1UG0A 5BPIA 1VQ4I 4XK4A 3SDGA 1Z9CA 1FYKA 4ITVA 1OCCH 2M45A 1MJ9A 3CJTB 3WHBA 1HXDA 3P9IA 5E18F 1W0UA 2JTVA 4IZZA 2EFNA 4A12A 4A5MA 3FMSA 2UZKA 3T0YA 1K4SA 3HM5A 2LDUA 1P4XA 1BI2A 2PI0A 3CJQB 4G8XA 3M8FA 1N77A 1ZHFA 1FSHA 1WFXA 4IHYA 2QQ8A 3ECHA 3FKJA 1S72I 1K5HA 3GX4X 1GXQA 1K7AA 4BQNA 1X2MA 4WX9A 4P96A 2FOKA 2EZIA 3ABUA 1VQ6I 3S1MJ 3TDUC 2YS9A 3FX3A 1IN4A 1ZG5A 1Q0QA 2DA2A 1ONVA 3MQ0A 3GO5A 3J80K 2HQNA 2ZXHA 3QRFF 1Y0NA 2ZXGA 3FTYA 2ZSHB 2CFOA 3MFKA 1T39A 2WADA 1P4WA 2KISA 1BIBA 1DGWY 3TDZC 2Z9OA 2P7VB 5CYVA 3B2PA 2XGXA 5C3EJ 5J8FA 1YIJI 3VSKA 4KN7X 3E97A 4KIGA 4BJ6C 2CW7A 3WE3A 5DYFA 2Y30A 3HYIA 4ZZLA 3LNQA 5DLLA 2R93J 3DEUA 3EUKL 3EUHA 3CCQI 1V54H 1K78A 3BG3A 2BBYA 5IYBJ 3BZ6A 3OY9A 4Q47A 1OYIA 2MFZA 3P9CA 1FZPB 2QBYB 2R7RA 2Y0SA 2OF7A 2LOOA 4AM3A 4D7MA 2AQFA 2BY0A 4LOCA 3CCYA 2XV4S 4UVCA 1SFKA 2L9NA 1ETKA 4QSHA 3CUQB 2QUFA 3EBIA 3CCUI 3FXOA 2ZMEC 4CGZA 1O57A 1A5JA 4IVNA 2BHZA 3OOPA 5CKTA 5LGTA 3HB9A 1LEBA 2YX4A 2WPGA 3B73A 4FQGA 4HPQA 3KZZA 3LQRA 2QA4I 2GIZA 3FZVA 4L9JA 5D8KB 2F4MB 2JA2A 1BJAA 4WXCA 3RC8A 4AR1A 2N8GA 5JMPA 3QOEA 4PJJA 2PJPA 2DO7A 2F48A 5EEHA 4QIRA 2EGHA 4BNCA 3UNGC 4X6AJ 4R7LA 3BWGA 3SDBA 3FU5A 4EJVA 4M6YA 5LRSA 2HYJA 3OWTA 3H3VK 2DPDA 3FK6A 4E7KA 3F72A 1WJBA 3HUGB 1T0FA 4QWQA 1WQ2A 1HKQA 1F43A 1JVSA 2L01A 3T8TA 3I4PA 2JA7J 3BR1A 4BQQA 2FNAA 3ZOBA 3RYRA 2X51A 4ETSA 2GLOA 4HSTA 4LG3A 4BY7J 2CQXA 3SEZA 1UG2A 2PJRA 4XIDA 2R7WA 3H3UA 5DUIA 1WJFA 3CD6I 4KP7A 1D1CA 2KL4A 2LNBA 2LY2A 2ESHA 1IRXA 2X0LA 2X6XA 3QU6A 4I01A 2KHMA 4R5VA 4HX7A 1F36A 3CZEA 3NAUA 4RGSA 4K5LA 1BJZA 3HSRA 1V4RA 2MYSA 3AU9A 1MGTA 1ZELA 3M3YJ 1FX7A 3FMRA 3BG6A 3F6VA 4KUMA 2EBIA 2XGEA 3FXJA 1W7PB 3IH2A 1R4MB 4A3KJ 4I0AA 2WY7Q 5E8IA 3CC4I 2WBMA 2VODA 5EV7A 2HVSA 4AVZA 1J7KA 5L3DA 4OINF 2I5UA 1MH3A 1X3UA 4XLAA 1MVYA 2R7TA 2H09A 5M5XJ 3LFUA 1Y8RB 4CYCA 5E1XA 2RAEA 5DV5A 2FBIA 2DMPA 5FKNA 2QKLB 4NBQA 1I50J 2XUBA 3LA2A 3FXRA 4IEJA 4OMYA 2DA5A 3BPXA 4YFNF 2R7XA 1X4PA 2DCEA 2GIVA 5K7HA 4MHGA 1NHAA 3NARA 2Q8KA 4ZQTA 4ZX5A 1I3AA 4I7HA 3F23A 1B8IB 3N05A 1FTTA 3K69A 1RR7A 1D5VA 3KE2A 1XCBA 4ZW5A 2LD5A 1S3JA 3CCJI 2P0WA 3FTSA 2DMQA 3TBIA 4ESJA 1KZHA 3IRRA 2BXYA 4A3MJ 4ZW3A 5JAZA 1H19A 2W82A 5M3FJ 5C4XJ 5IT9Z 2VE8A 4BS9A 3VYTB 3FDYA 1B9NA 1Z0XA 2QLZA 4L9TA 4IX7A 4U87A 5KCMA 4LG0B 1I6HJ 3O3KA 4KYWA 1LB2A 3OYEA 2A07F 4ZJZA 3HPGA 2ME0A 3RKXA 4XLEA 3N97A 2OZUA 4BQOA 1FSEA 2DFIA 4RB3C 2ZJRF 2JWTA 5LLQA 4XMXA 1POGA 1J75A 4F7ZA 4Z2YA 4ZTJA 1R1VA 1IUFA 1MBJA 2IVMA 2LREA 2M0MA 3JRBA 2CYYA 2NS0A 3LSRA 3C18A 2O61A 2JD1A 2CW8A 3IC7A 2WC2A 2V9VA 3HIFA 4A69C 4S05A 3CCSI 3RZDJ 3HJEA 3AG3H 3JRIA 3L2VA 3RPUD 5D5UB 3LAJA 1WJCA 3U9GA 5C4JJ 2NVTJ 1TWCJ 2E1NA 4LD5A 3ERED 2DTZA 3EUHC 3GUDA 4M3EA 5JVTA 3KP5A 4M3DA 2ICWG 3HUGA 2OTLI 4GAAA 4A3FJ 3LOCA 2FD5A 1H88C 1XCVA 2KJCA 4XMUA 2HVQA 1XX5A 2XF5A 3IKVA 1O3TA 1XG1A 1ETYA 3IIEA 1FOYA 5TGTA 2KIMA 4MKTA 2FSWA 4GGGA 1B72A 4OAYA 2XPYA 3WGGA 3GW2A 4LK0F 3SHFA 5FLVA 3CF2A 4XICA 3QP6A 4L18B 2HFHA 3GFJA 3S3MA 3B7TA 4II3A 3E5XA 1KYZA 5J4YA 2E2IJ 2ACJA 1YX5A 4XKVA 3KLNA 3U1KA 5E3LA 4HNUA 5K7FA 4M6VA 3BR6A 4PJLA 1RKWA 3AAFA 2MLGA 1W7PA 1QQIA 1P7IA 3F8CA 4GXOA 5GPAA 4XRSA 1HLVA 3OMYA 1IJWC 3CZKA 3MWMA 4XN9A 5DS9A 3LSIA 1BW5A 1T0FC 3AG4H 3HRMA 1SD7A 2HDDA 2ZJ2A 3L2QA 2RDPA 1D5YA 2K9NA 2FE3A 3RKWA 4BXFA 3FXUA 2M34A 3A1YA 2O9LA 3M7GA 2V6EA 1XB4A 4AU7A 4MLOA 1WPKA 1IZ1A 2QKMB 4XOTA 3BG9A 4TV7A 2FJ1A 1TBXA 2XAJA 1BN5A 2M5WA 2VASA 3TP0A 3F21A 4MTEA 4B3XA 5CJ9A 5JHFA 2H94A 4B1RA 1XS9A 4BKXA 4BDYA 4G6TB 3OYKA 3HG9A 4XN7A 1JKOC 1IRZA 3BZCA 4B48A 3SFIA 4PJMA 3CZGA 2Q1ZB 3TW6A 4AIJA 5HOOA 3C2BA 5TRDA 1YW9A 2E35A 5H6QA 4U88A 2W00A 3BTLA 4ZDPA 4IJAA 1ZRCA 3CO7C 1ETQA 5GAHJ 2E5ZA 2IGKA 3KYDB 4N0BA 2H1KA 5FLXK 2CFXA 2IGNA 1PUFA 2Q0OA 4CH7A 2HR3A 3FTWA 1LVKA 4ZYEA 3G6EI 3K4JA 5KK1A 4Y3OA 2DQLA 4F3QA 2HS5A 3OS1A 4GCVA 2JN6A 2Q2EB 1ZTRA 2PGGA 2XRLA 2BY2A 3B6AA 3MCZA 3PO2J 3QPSA 1K83J 3H0DA 5JFRA 2DAOA 2TCTA 1G6NA 3JRGA 1MDMB 3G71I 4BGDA 4GYGA 4HF2A 3V8LA 2KIFA 2R5ZA 1Z6RA 2L3DA 1Y39A 2V1UA 1RR8C 2DFHA 5B5EC 2KRCA 1VQ9I 4PZJA 4G12A 2KT0A 1LVAA 2MAOA 2Z16A 5EEAA 2GTQA 2F5DA 1X3WB 3GTOJ 4NHJA 2K40A 4P5OA 3JAMZ 5C44J 4M3GA 4KNYA 5F04A 3L2CA 1GXPA 3CTAA 2F6CA 1TL8A 5LHHA 1AKHA 2ZMEB 5JI6A 3BJOA 4LB6B 4GRIA 3AKZA 3OYLA 2KP6A 2E7WA 4KMUX 3RSNA 2VQLA 1HDDC 3CMMA 3FUHA 5FKMA 1BI0A 4HOBA 3QPHA 3CJNA 3EETA 2V1XA 4ENKA 5EG0B 1UFMA 1YG2A 1S29A 1SAXA 2Y9ZA 3BLYA 4OIOF 2XF7A 4XMTA 2FX0A 2LP0A 2JVGA 4FISA 4L5EA 3K1NA 1EA3A 2XIGA 1MBHA 1E3PA 4RLFA 1DPRA 3HRUA 3V7RA 3DPUA 3T1BA 4CICA 4EM0B 2IW5A 1Y1VJ 1PUEE 4IHXA 3AU8A 1WJEA 1IRGA 3DTEA 1YHQI 3BR2A 5FRMA 2C6YA 1DU0A 1X58A 1YE9A 1BI3A 4RS8A 4BH9A 4PDKA 4AYSA 5JLWA 3EUAA 2Y75A 3DF8A 5FKOA 4OOIA 2MLKA 2EINH 3FUEA 3RKYA 1R1TA 2KRHA 3HKZA 4DBQA 2LMDA 1FOKA 1ZGAA 1JUMA 2X1CA 2DA3A 4EGYA 1HKSA 1E3OC 2R7UA 1FBSA 1W4MA 2K02A 2QSFX 4BJ5C 2Y1CA 1LDDA 4HW0A 3FUJA 2Z3YA 1Z7UA 4XO4A 4B8XA 2WAQA 1R36A 5LD2C 1UHSA 3ZPLA 3H36A 1JGIA 5F08A 2DOFA 1CF7B 1S7EA 1MMDA 1FIAA 2R5YB 1YTYA 1KQ9A 3I54A 3ANNA 2ELKA 2CS3A 1UCRA 2CV2A 4K5MA 4ZW7A 2JA6J 1R49A 2LR8A 5DCMA 4HAMA 3ZHZA 3A01A 1E17A 1IGNA 1YO5C 2HQRA 1RNLA 2FQ3A 4N4NB 5EJCA 2LVSA 3GFIA 1QZYA 3K2AA 1BC7C 3PSIA 4CCNA 2LRDA 2LBFB 4ESBA 1FOWA 2NVUB 3A4CA 3F3XA 1I1SA 3HOUJ 4AWXB 4U7BA 1QBJA 1DP3A 3BR3A 3DKYA 4EJTA 1JI8A 1ZKGA 3HSEA 3CCEI 1ZGWA 4AC0A 2RNJA 5L3BA 3KPHA 2DQMA 2R59A 4X1EA 2X48A 3F6OA 2IPQX 5AONA 2LKSA 2KMUA 1AA7A 4FE4A 1ZLJA 1O3RA 3DQVC 1VZ0A 4L0ZB 1T08B 4Q48A 2E1MC 1ZG3A 5JO0A 1NTCA 3RZOJ 4Y15A 1Y6IA 5CVUA 5GPCA 1N25A 3MN2A 2Y2ZA 4U7DA 3TW7A 2VKVA 2JPCA 2CRGA 2M1BA 1WJDA 4C2TA 2M0CA 3TL4X 1GW6A 1IV6A 1W7PD 1JGSA 2GA2A 2YU3A 2BEOA 3F8FA 1JE8A 2E2HJ 3CP8A 1ZH5A 1O7FA 3H3ZA 4XL9A 1Z21A 1JKRC 4QMEA 1D3YA 3IL2A 4I0BA 1BA5A 3FUKA 4LIVA 2WA0A 2RQQA 1PDNC 3CXBA 1X1BA 2VJJA 1MBKA 2JV7A 3FUDA 3JCUC 5DCFA 3MKWB 3GFLA 3LSPA 3CIAA 3CLQA 1K79A 4G7HF 1WH5A 2GZWA 3P7NA 3S32A 3EYIA 4O3MA 4IQ4A 3S3OA 3R0IA 3R61A 2CGPA 1LDKB 4A0XA 3JRHA 2P81A 3S93A 1K78B 1ZGJA 2PX9A 3BTJA 4HSRA 3GFMA 4JX4A 3HL2A 2IS6A 2R7OA 1MBFA 2HQAA 2GOMA 4HDVA 2Y1FA 3Q44A 3K1PA 3V8KA 2V4JC 3PQJA 4FT8A 4EMSA 2O5RA 1OCZH 3FXLA 3P9KA 3FIWA 3I55I 3W2VA 2W7NA 3JTGA 2YPRA 3KP6A 4XSZF 4F52A 3EPZA 1GV5A 1Z05A 1H9TA 2EA4A 2J5PA 3T5XA 3ZQLA 5J47A 3D0SA 3F9KA 1G3SA 1QRYA 3GBGA 2KQRA 3S14J 2W25A 2IEKA 2XAFA 2KZVA 4ON0A 1VF9A 3BZKA 2Y1DA 2NOJB 3FHEA 1WKMA 3Q5FA 2QGUA 1SFUA 1EF4A 4XO5A 2HPOA 3ASNH 1VQ8I 3ZGKA 2KPMA 3M4OJ 3BPVA 1R5ID 3L2RA 1TQPA 4MFDA 3PNYA 1ZR4A 3A03A 4BU2A 4X0GA 2OJED 2FNPA 3S3NA 4UUTA 2QQAA 2XSJC 1DQUA 1QVTA 3QOPA 4OAZA 2JD0A 5HDNA 4Q5SF 1XSVA 2X6OA 3EDPA 2ELHA 3PM1A 2XPVA 2PJRB 2DA7A 4E70A 2FMLA 1I3QJ 4RB0A 4UB8C 2V1DA 4J00A 1ZRFA 1OCTC 4B4CA 4I76A 3D5LA 5CLSA 2KKOA 3BJ6A 3IP4B 4RLQA 3AG1H 4G94A 1R0LA 4JOMA 3Q43A 4X2UA 2L7KA 5DUKA 2V9PA 1F4KA 1OISA 1QPMA 1UB9A 2DLLA 1QGPA 4XMZA 5FROA 2G0EA 4O5VA 2EZHA 3A0BC 2GA1A 1LPQA 1JJ8C 2JCXA 2P6SA 3ZHYA 1VQNI 4JYKA 5ICFA 2FBKA 3HEFA 2DPUA 2JQ7A 4PW4A 1W36C 4ZTFA 1K4TA 1RKTA 2DYSH 4ZW8A 2L7ZA 1OYWA 4CYCB 2D1VA 2DA6A 1I5ZA 1SC5A 1SFXA 5EZGA 4V2FA 2K27A 3W3CA 4RB1A 3VPRA 4DNCA 2E2JJ 4I02A 2HOAA 4WXHA 2WZGA 2GOXB 2IAIA 3Q3SA 2NS7A 2C82A 3GCMA 2VXZA 4KFCA 3E5UA 3TO9A 2KFDA 1WGXA 2HNHA 4UVBA 5HNFA 4ZQGA 3WTSC 2RN7A 3QODA 3PSFA 3W6JB 5DTDA 1WHUA 4FX0A 1ZN2A 4ZX3A 3I56I 1O4XA 3MKZA 3I4MJ 1FP1D 2GQQA 4FLQA 1BM9A 4R79A 5BOXA 3ZP5A 2JRMA 2YR2A 4RAFA 5F0CA 2E19A 4XLHA 3H9GA 2LC2A 1IN8A 2DW4A 1P4AA 3R60A 3REOA 1XPXA 2HXIA 3RI4A 3K2ZA 4KN4X 5D8LB 3ZHXA 5HS7A 3CC2I 4BUPA 3SXYA 3SZTA 5CQEA 1HDPA 4ZYHA 2WAEA 4YRVA 1XSXA 5L3CA 2VBZA 2EB7A 2W4SA 3CMAI 2MH2A 2TRTA 3G3ZA 2R7ZJ 1IC8A 4N4OB 3WTVC 2JA5J 5CVIA 3S1NJ 2MSYA 3I5UA 4I99C 3K9TA 2B9SA 2G9WA 5ILVA 2VBXA 4B3AA 3IAS2 2V9KA 2X4HA 4RAYA 1FNNA 3K4LA 2XVCA 1QVUA 2DOEA 2HZDA 2RREA 1SEUA 1H89C 2YUSA 4DW6A 3ERMA 2A7OA 2M4GA 4N9IA 1WI3A 1RETA 2PMZN 3J81Z 1SC7A 4NB5A 2QVOA 2PMUA 1FEXA 1A6IA 3HRTA 2E1OA 3PQKA 4CYDA 4ABZA 4RSYA 2WB1A 4KJZA 4C30A 4HZFA 4DOZA 2VIXA 1HA8A 3GLLA 1LFBA 3FTXA 2AS5F 1VI0A 1B72B 2STTA 2R72A 1QHGA 1ETVA 3K4BA 3MZYA 5JHUA 3GYHX 1DDNA 2W85A 3OR1C 3WTXC 2DT5A 4XLPF 2DMNA 5B66C 4ZN6A 3GZ6A 1GLNA 1FJLA 5BPPA 2X1EA 4XN5A 4NQWA 2ZJPF 4A93J 1UMQA 2ZFWA 4H4KC 3TEDA 3S2DJ 4PK4A 2O3FA 3CF5F 1XMAA 1Z77A 5FKLA 4GAEA 4Y6RA 2PQ8A 5E79C 3K7AJ 3E3VA 5FKKA 1ORKA 2NNNA 2KJBA 3VYUB 5DD4A 2P7CB 1YS6A 2OUMA 4XN3A 2ME6A 3HGGA 2HOSA 2K3FA 3FHZA 5EGOA 4D1QA 2O8XA 4JBAA 1DUXC 1REPC 2R0QC 2VN2A 5TJJA 5GAEJ 5J3LA 1FOXA 1JTXA 4HDUA 1QZEA 2K9MA 3KP4A 4EQQA 3NQOA 3CMEI 5IYDJ 5D5XB 1Y1WJ 3FUMA 3BJAA 2HKOA 1TNTA 4CA0A 2Z5UA 3NEUA 2CV0A 2VLAA 3FM5A 3JTHA 1B1BA 1ZR2A 3QQAA 4F92B 3HTSB 1HSTA 1X19A 2RQPA 4J19A 3BT9A 1EH6A 4OOEA 3ZQGA 3ROUA 2KDZA 1SMYF 4FE7A 1MMSA 2CUJA 3CP2A 4A3EJ 3CJRB 2CV1A 4BYYA 3LSHA 3ESWB 1K6OA 1JKQC 2P8TA 3LSGA 3FBNB 1S9HA 2F5VA 1X3ZA 2E71A 2IBDA 1PUFB 2GXBA 2HPIA 1N75A 1E2XA 1I6XA 2DT6A 2CO5A 2DJIA 2ZBKA 3DBHB 4XKCA 3PFYA 3I0TA 3BDDA 3A06A 2JCVA 1YI2I 4AD9A 4G7OF
chains in the Genus database with same CATH topology
3JSZA 2VB6A 4E7ZA 1NG6A 1FMWA 2KRCA 3FHNA 1OR7A 3FH7A 2XAUA 2MAOA 2Z16A 4XNDA 2GTQA 1BOBA 1W36D 2C5ZA 3CHPA 4OOFA 4P5OA 4JQFA 2JUGA 3L2WA 2R7VA 4AR9A 3QJXA 2FFLA 4HEA2 3A14A 4PFPA 4CCKA 2F6CA 2HDWA 3VYSB 4GRIA 3AKZA 3OYLA 2KP6A 2MC4A 3OYGA 3RSNA 2VQLA 3KX2A 1BR4A 3CMMA 3FUHA 2X85A 2W1OA 2WAFA 3OYIA 4R5TA 5DULA 3QYFA 3SZGA 1G8XA 3FUNA 2X1DA 4L2LA 3BLYA 2LYCA 3OYMA 2XF7A 2R7QA 4B43A 4XMTA 4MS6A 4CCMA 2BVMA 2JVGA 4ZX6A 3FBIB 1EA3A 2VJ5A 4RLFA 3DPUA 4BE1A 3DTKA 2RJIA 1DGRM 1V5EA 2M7BA 3B37A 2Z1DA 3H35A 4LITA 3H9JA 3FUIA 2JVHA 2M3AA 3C2GA 3K4KA 4FASD 5HLTA 1G5AA 3AU8A 1WJEA 3ZI0A 4AICA 3M1CA 3DTEA 2K5CA 4KITB 5FRMA 3VWBA 5KHDA 3OYCA 1YE9A 3B7SA 4AYSA 3KYLA 3RC3A 3EUAA 3J7AY 4Y67A 4Y33A 3T8VA 3DLAA 3UEQA 1Z3YA 4FCAA 2VQHA 4XN4A 3FUEA 1R0KA 2KRHA 3HKZA 3PNVA 4XKWA 4XR6A 4DBQA 4E7IA 3HXLA 2ZXIA 3OL3A 5CQGA 2OV7A 2X1CA 4E7SA 1MW0A 3ZXSA 1MW2A 4CSWA 2VXDA 2R7UA 4BJ5C 2Y1CA 4B47A 3KEDA 4XO3A 1T1RA 3WQRA 4BDZA 5JMWA 4PSWA 3FUJA 3OYNA 4KT6A 4XO4A 2WAQA 3WQSB 5LD2C 1JGIA 4F93B 1R6RA 2VKHA 3RQ4A 2KDOA 4XQFA 3QYEA 5LFAA 3VVMA 1MMDA 4ZYAA 3FU6A 4AYBA 4DIQA 3ANNA 2CS3A 2CV2A 3B34A 4K5MA 4ZW7A 2LBFA 2UUZA 4XNFA 1MMNA 2IS4A 3VSLA 4E6KG 3ZHZA 4D9JA 2QVWA 2HU9A 2JSPA 4LIUA 4N4NB 2I8DA 2CH0A 3K70D 3HPHA 3PSIA 4BJTA 4CCNA 2LRDA 3H5NA 2LBFB 1UG0A 3AL0C 3NWSA 4ITVA 3A4CA 3CHQA 3H5RA 4CCLA 5KNLA 4U7BA 2E1MB 1DP3A 3DKYA 2MABA 2FUG2 1JI8A 4IZZA 3T0YA 2DQMA 3B7UX 2QJ1A 3AUAA 2R59A 3CJQB 4BACA 4E7HA 1N77A 1WFXA 4E7JA 4BE2A 3PL8A 3UCQA 3FKJA 2KMUA 1AA7A 1K5HA 2V1NA 4XONA 3DQVC 3LMMA 1VZ0A 2V7FA 4CCOA 4Y6SA 4BQNA 3OOUA 2E1MC 2VJ4A 4ZQHA 5JO0A 2XQ0A 1Y6IA 4ZDLA 4RCVA 4AR8A 3MD2A 3ANLA 1Q0QA 3FH8A 3FU0A 2ZXHA 2ZXGA 3WQQA 1D1BA 3FTYA 2ZSHB 2CFOA 1V5FA 1WJDA 2WADA 2ZFUA 1MMAA 4C2TA 1DGWY 3TL4X 1GW6A 3D5SC 2HVRA 3B2PA 4E4HA 5JNLA 3VSKA 3CP8A 4BJ6C 4QMEA 4XL9A 4Q4IA 1Z21A 2CW7A 1SQMA 1P9QC 2AQEA 4XKBA 5DYFA 3FUKA 4LIVA 3DTIA 3EUKL 4IQJA 5DLLA 3HC7A 2WA0A 2RQQA 3FTUA 3OY9A 1X1BA 3W2WA 2VJJA 2JV7A 3FUDA 2MFZA 3MKWB 1MW1A 4ZW6A 4XN2A 1S46A 3CIAA 2R7RA 2Y0SA 3ZRGA 3C2HA 2LOOA 2X6WA 3VYRB 2MAPA 3S32A 3U21A 2AQFA 4F55A 4B44A 3E1SA 4DPRA 4IQ4A 3S3OA 3R0IA 4YELA 4PUSA 1LDKB 2WY8Q 1SFKA 1Y56A 3S93A 2L9NA 2IS6A 3ONQA 4HSRA 3HL2A 2R7OA 2HQAA 1OR7C 2OC6A 3EBIA 2GOMA 2DT7B 2Y1FA 3AFHA 3Q44A 5CKTA 3DU5A 2V4JC 4FETA 2O5RA 1MNDA 2XPZA 4QUOA 2M4KA 3W2VA 2WPGA 2MD0A 2W7NA 1Q0LA 4HPQA 1U0JA 3BC8A 4CCJA 3FUFA 1PJRA 4F52A 3EPZA 3H9QA 4PFOA 3L2UA 1X1AA 2JA2A 4KP7A 2Z2SB 3RC8A 2BOLA 3K4NA 4AR1A 5JMPA 3F9KA 3QOEA 4PJJA 3GBGA 2KQRA 4QIRA 2EGHA 3UNGC 1H3LA 4R7LA 1T95A 2KZVA 4J01A 4A03A 3SDBA 3FU5A 3FU3A 4CUGA 4LUPA 2PUSA 3BG7A 2NOJB 1RP3A 2Y1DA 2V26A 3OWTA 3A2KA 3FHEA 4FLRA 1SG7A 2L2OA 4E7KA 4XO5A 1WJBA 3HUGB 2HPOA 1WJ5A 3ZGKA 1JG9A 2KPMA 1JVSA 4XMVA 2LG4A 3MMYB 4BQQA 1MNEA 1MMGA 2X51A 3CHSA 3L2RA 4HSTA 4LG3A 3OYHA 3SEZA 1HS6A 2PJRA 3FULA 2R7WA 3PNYA 1BR1A 2X6YA 1K6YA 1LFPA 1WJFA 4QPOA 3HOSA 1D1CA 2KL4A 3DEEA 2LY2A 4XLCA 1IRXA 3DKXA 2X6XA 4BU2A 4X0GA 1QHHD 2KHMA 3S3NA 4E7LA 4R5VA 4XMWA 3IAM2 3CZEA 2XSJC 1DQUA 4PSXA 4NC7A 4OAZA 2JD0A 4K5LA 4J3BA 4FLSA 4XLFA 3DU6A 3B7RL 2PJRB 3SYTA 2MYSA 3AU9A 1ZELA 2CMPA 4XMYA 4J00A 4IKFA 3D5RC 3K10A 3D5LA 3BG6A 1OLTA 3VDXA 2F4IA 3IP4B 3OYBA 2WY7Q 4RLQA 2VJ8A 2RNGA 2WBMA 1R0LA 4JOMA 2XDVA 3CESA 5HNHA 2HVSA 3Q43A 4X2UA 4AVZA 5EV7A 1Z7LA 3EBGA 2L7KA 1MW7A 2LY1A 2VJIA 1Z3XA 3ZR8X 4DBRA 4XLAA 3LSMA 3OYJA 1KONA 1MVYA 1WJAA 1J09A 5FROA 2R7TA 3BCBA 4XMZA 2UV1A 3LFUA 1ONNA 3OYDA 2M7AA 1TZLA 3OYAA 2JCXA 3ZHYA 3I3LA 4HRIA 1TT0A 1X1CA 2ELJA 4PW4A 1D0XA 1W36C 4ZTFA 4HNTA 2QKLB 4ZW8A 3B3BA 3PUUA 4QPEA 4QHPA 2VKDA 1V5GA 3KEYA 2R7XA 3FH5A 2HPMA 4CZCA 1SC5A 1X4PA 2DCEA 4XN0A 4XOPA 4ZQFA 4ZDOA 4ZQTA 4ZX5A 1D0ZA 1N78A 3W3CA 4BL0B 2R4GA 3N05A 3HOTA 4RM3A 4RVBA 3RASA 2WZGA 2GOXB 4ZW5A 3NWTA 2Y1GA 2DXIA 2P0WA 3FTSA 4R5XA 2ZSIB 2C82A 3TBIA 2VXZA 4CXFA 4Y6PA 5HNFA 2HNHA 4ZQGA 4II2A 4Y4RA 4ZW3A 3QODA 1H19A 5JAZA 3PSFA 3RTRA 2W82A 3IUOA 3OL4A 2VL8A 5HVQC 1E0EA 4ZX3A 4XN1A 4BS9A 4QPQA 3VYTB 3MKZA 4Q4EA 3FDYA 3DPLC 4IX7A 4XN8A 4U87A 5KCMA 4FLQA 4R79A 2IGOA 3ANMA 2IS1A 4XM3A 3OYEA 2Y1EA 4JNDA 4ZJZA 3HPGA 4NC8A 4XLHA 4XLEA 5FWQA 4BQOA 3H9GA 2O7GA 4DJAA 2LC2A 3CZ6A 4PJNA 2JD2A 4XMXA 4XORA 1FMVA 4ZTJA 1G59A 2XC7A 3CZLA 4DGWB 2LREA 2M0MA 3ZHXA 3UR3C 4BUPA 2JD1A 2CW8A 5CQEA 4OWRB 1T1SA 2WAEA 4YRVA 3L2VA 3RPUD 4C9YA 2W4SA 1ERDA 1WJCA 2KLOA 2A5WA 4N4OB 2VQCA 2R70A 2BW3A 4XNAA 2HPTA 2K9LA 2JCYA 3G2BA 2R7SA 3EBHA 3EUHC 3IAS2 2DQ6A 2IGMA 3PNTA 2IXSA 4BEHA 3JT1A 2V9KA 4GAAA 3K4LA 1SAUA 3S8PA 3TMOA 3OR2C 2BW3B 2HZDA 2RREA 1D1AA 3PUBA 4XMUA 2HVQA 2XF5A 2A7OA 1MW3A 3FTZA 2M4GA 3IIEA 4BEHB 5TGTA 2B61A 4MKTA 3K70C 3E0JB 4OAYA 2XPYA 3OS2A 3CF2A 4ANJA 4RSYA 3B7TA 3S3MA 2WB1A 3U9WA 4KJZA 4II3A 4C30A 4DOZA 2IS2A 2VIXA 1HA8A 4PVBA 3I9V2 3FTXA 1YX5A 4XKVA 5JBIA 2L5QA 4HNUA 3UERA 2VQGA 2VPLA 1QHGA 2R72A 3K4BA 4RMNA 4PJLA 3OR1C 2A6TA 2L9SA 3DWLE 3RCOA 3OIQA 4ZN6A 1ZS2A 3K4CA 1GLNA 1X4OA 5BPPA 3OMYA 4ZX4A 2X1EA 4XN5A 4NQWA 4P1WA 1BR2A 3V42A 4F91B 3CZKA 4H4KC 4XN9A 4ARFA 1ONOA 3LSIA 4NUBA 1T0FC 4KISA 1YX3A 3L2QA 3QYBA 4PK4A 2PMZA 4BXFA 3CHOA 4GAEA 3A1YA 4NQWB 4Y6RA 3AL0B 2V6EA 4AU7A 3VYUB 1QU3A 4MLOA 4BE0A 2QKMB 4XOTA 2OUMA 4XN3A 4PU2A 2UWMA 2XF6A 3ZQQA 2VASA 3OYFA 1UAAA 4XNBA 4B3XA 1UELB 4D1QA 5JHFA 4ZC3A 1D0YA 3K6GA 3K4MA 3B2XA 3DPTA 5AENA 4ZQEA 4BKXA 4BDYA 4G6TB 4HG2A 3HG9A 4YEJA 2K3PA 3BCAA 3OYKA 3MKYB 4XN7A 4B48A 2K9MA 4PJMA 3CZGA 2Q1ZB 5CPRB 3H5AA 3OIPA 5HOOA 3FUMA 3FTVA 3VVLA 4CA0A 1LKXA 4C2UA 2CV0A 1X1DA 2VLAA 4FLOA 2W00A 4ZDPA 1ONPA 4F92B 1X19A 2E5ZA 2IGKA 2LH9A 2IGNA 2E5NA 3CHRA 4OOEA 5FRNA 4CH7A 3FTWA 1PYVA 1LVKA 2BVLA 2E60A 3K4JA 4RM2A 3OS0A 2CUJA 1NG7A 3CP2A 4Y3OA 4K5OA 4K5NA 3CJRB 3LSKA 4F3QA 2CV1A 3LSHA 3OS1A 4K5PA 2Q2EB 2DOAA 2PGGA 2WZFA 4NNJA 5JC1A 3LSGA 3FBNB 1S9HA 2F5VA 1X3ZA 2PL5A 3H0DA 2HPIA 1N75A 3ZCOA 3W2AA 2DT6A 2DJIA 4XKCA 4BGDA 1Q0HA 3LL7A 1X3WA 3PJRA 3PFYA 3A06A 2JCVA 4EATA 3M8JA 3SEQA 2CUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLT A;  2VLA A;  5HNF A;  5HNH A; 
#chains in the Genus database with same CATH topology
 5F27 A;  4XLN F;  4RDU A;  1FMW A;  3CDH A;  1J59 A;  3BG5 A;  4IOC F;  4BY1 J;  2OU2 A;  2DQR A;  1VND A;  1J0R A;  2EA2 A;  3C3W A;  4U0W A;  2R5Z B;  4JQF A;  2JUG A;  3HSF A;  1WCM J;  2DJN A;  2UXN A;  1YJN I;  1YYV A;  2FFL A;  4HEA 2;  3A14 A;  2FQ4 A;  2Y0M A;  2QF7 A;  4CCK A;  1DP7 P;  5JR3 A;  2KRF A;  1S7O A;  3E7L A;  2FF4 A;  2DN0 A;  1USS A;  5M5W J;  1OMI A;  1HC8 A;  2AXL A;  2E1C A;  2O8K A;  2X85 A;  2B7E A;  2I10 A;  3S16 J;  3F22 A;  1NK2 P;  1AKH B;  2TDX A;  3FUN A;  1S7A A;  2IA2 A;  4A2U A;  2HTJ A;  4CCM A;  5GP9 A;  4A3G J;  3GF2 A;  4EJO A;  4WCG A;  3FBI B;  4AIH A;  2NRA C;  4ZX6 A;  3A0H C;  3OSF A;  4BAY A;  2VJ5 A;  3KP3 A;  4M72 A;  5D6E A;  5A2Q K;  3CCM I;  3S1Q J;  5ICE A;  3DTK A;  2RJI A;  1DGR M;  1V5E A;  2M7B A;  4ZYG A;  3JSO A;  3H9J A;  1P2F A;  4HX4 A;  2M3A A;  4AUX A;  5HLT A;  4UUS A;  4A3C J;  3M1E A;  3JRD A;  2HDC A;  3K1M A;  3B7S A;  3GME A;  4HYE A;  2FMY A;  5FD6 A;  2CW0 F;  3I71 A;  2XHK A;  5FFX A;  4Y33 A;  4HA8 A;  3FMQ A;  1YIT I;  3T8V A;  1Z3Y A;  1GDT A;  3QPT A;  5BPD A;  4XN4 A;  3VOE A;  5BS6 A;  2VBW A;  1JT0 A;  1AOY A;  2CWE A;  4ZZD A;  2Z33 A;  3ABL H;  4XR6 A;  3QPL A;  1S8N A;  3G1M A;  4I98 B;  4UV9 A;  4C2M J;  2ZXI A;  4E7S A;  1IRF A;  2LKX A;  3BP8 A;  4JP0 A;  4YG2 F;  1V3F A;  2EV0 A;  2VXD A;  1SVM A;  3ZQI A;  4B47 A;  3KED A;  4BDZ A;  1H0M A;  4HV5 A;  1U78 A;  1OYY A;  5B1A H;  5F64 A;  1I27 A;  2L7M P;  1A04 A;  4RGR A;  3VVM A;  3AG2 H;  2VBY A;  1HF0 A;  4ZYA A;  3FF5 A;  3U2R A;  2VOO A;  4AYB A;  1JUS A;  4DIQ A;  4UY8 I;  3B34 A;  4KIB A;  4W1U A;  4DZJ A;  1IN7 A;  4XNF A;  2UUZ A;  3WTT C;  4E6K G;  1X1P A;  4V2G A;  2XAQ A;  3TQN A;  2QVW A;  4LIU A;  4G7Z F;  2I8D A;  1W1W E;  1IAW A;  1VFC A;  1R58 A;  5K1Y A;  4EGZ A;  3LAP A;  3HPH A;  4BJT A;  2A5Y B;  2V6C A;  2LY9 A;  2JA8 J;  5DCM B;  3CMY A;  3A01 B;  1IDZ A;  4A3J J;  3H5R A;  4CCL A;  3FXK A;  1LE8 A;  3FXQ A;  2FUG 2;  1IN5 A;  2H27 A;  3GTP J;  3ELK A;  2EFW A;  2ZC2 A;  3HHH A;  3I58 A;  1YRN A;  4EV0 A;  3ABT A;  1XGS A;  2A69 F;  3B7U X;  2QJ1 A;  3AUA A;  2BXZ A;  4BAC A;  4E7H A;  2Y9Y A;  5KVR A;  2W24 A;  3LFK A;  2YX7 A;  5CVJ A;  2VT2 A;  4RGU A;  2A68 F;  4YII A;  1ENH A;  4BBS J;  1ETW A;  3LMM A;  1F5T A;  4Y6S A;  2ETH A;  2H6C A;  1IV8 A;  2B0L A;  2Y0S N;  1B6A A;  4ZQH A;  3QP5 A;  2VKE A;  1JHH A;  4CZZ A;  1AU7 A;  2WV1 A;  3ANL A;  5LGN A;  4AR8 A;  2DK5 A;  3GLX A;  1HKT A;  3FU0 A;  1U8B A;  1GHC A;  3PFI A;  3OV8 A;  5E17 F;  1MMA A;  1TT5 B;  4KMF A;  4IRG A;  1U2W A;  5FLM J;  3KP2 A;  3D5S C;  3IHU A;  2LF7 A;  5H6R A;  4E4H A;  1MD0 A;  1QPI A;  4Q4I A;  2EZK A;  4C3H J;  2OTJ I;  1SQM A;  4ZYD A;  4BHC A;  5HS9 A;  1P9Q C;  2F5E A;  1I39 A;  4IQJ A;  1XMX A;  3TOA A;  1VQK I;  3N4M A;  1MW1 A;  4ZW6 A;  1XN7 A;  3ZRG A;  2R7F A;  1AWC A;  3E1S A;  1FT9 A;  3S1R J;  4PUS A;  1MJB A;  1Y56 A;  1MSF C;  4M74 A;  3R0A A;  3ONQ A;  4BQA A;  1LNW A;  2JRT A;  3S17 J;  1Z6T A;  3SZP A;  1SFO J;  3DU5 A;  4UXN A;  4AID A;  1WH7 A;  3GZN B;  1MBG A;  3BRO A;  2IA1 A;  1MND A;  2XPZ A;  2O0Y A;  2M4K A;  1Q0L A;  5GTI C;  2Y31 A;  2OZ6 A;  2ZB9 A;  3BC8 A;  3JSP A;  1EH8 A;  3H9Q A;  1YJ9 I;  2Z2S B;  2BOL A;  4NDL A;  3K4N A;  4ZH4 F;  1IN6 A;  5LRR A;  1ULY A;  2QEX I;  3MKL A;  1KYW A;  1G2H A;  2QEN A;  3GEZ A;  2PLY A;  2RVC A;  4LUP A;  4A0Y A;  1RP3 A;  4C3I J;  3A2K A;  3FWE A;  3MVP A;  4D5F A;  3ZMS A;  1KU9 A;  1WJ5 A;  3QWL A;  1JG9 A;  2EIL H;  2DDA A;  2K85 A;  1YJW I;  3HHG A;  3MMY B;  1Q1H A;  2HXO A;  2XKO A;  1MMG A;  2WTE A;  3OYH A;  1SD4 A;  3ECO A;  1MZB A;  3O2P E;  4P55 A;  5FD5 A;  3UKG A;  1HS6 A;  3FUL A;  1BR1 A;  1P6R A;  3LQQ A;  2YU9 J;  4DYR A;  2X6Y A;  1LFP A;  4QPO A;  3HOS A;  3H1C A;  4XLC A;  3DEE A;  1VQ5 I;  1T6S A;  1T8I A;  3DKX A;  3EYY A;  3JSZ A;  1QHH D;  4XMW A;  4E7L A;  5KAF C;  3IAM 2;  2A6E F;  2P5V A;  4PSX A;  2K9Q A;  3KCC A;  1K61 A;  3KET A;  3DU6 A;  3B7R L;  1FC3 A;  2ZO4 A;  4IKF A;  1R5H A;  3K10 A;  4DYQ A;  4OIP F;  3H0G J;  3VDX A;  1FWZ A;  2F4I A;  2PEX A;  2DMU A;  2V79 A;  1PP8 F;  3OYB A;  2FBH A;  3RYP A;  2VJ8 A;  2RNG A;  5HNH A;  3RAS A;  1HW1 A;  2CQK A;  3EBG A;  1MW7 A;  1QA6 A;  3JRE A;  2VJI A;  1Z3X A;  3ZR8 X;  4DYC A;  4DBR A;  2QWW A;  3OYJ A;  1KON A;  1APL C;  1J09 A;  3BCB A;  3Q0V A;  2UV1 A;  1ONN A;  4LJZ F;  4EJW A;  3OYD A;  1XSD A;  1WWX A;  2XPU A;  1O7L A;  3WG9 A;  1RUN A;  1RES A;  5FGM A;  2JJ7 A;  3SJM A;  4HNT A;  3PUU A;  2EQR A;  4QPE A;  1LUJ B;  2HI3 A;  5F1J A;  1D8J A;  4QHP A;  1YQA A;  2JMW A;  5J1U A;  1ON2 A;  4BHP A;  3WTW C;  1V5G A;  2BV6 A;  1V55 H;  2QZ8 A;  2CQN A;  5E3M A;  2L02 A;  4A5N A;  3WGI A;  4XN0 A;  2HYG D;  2DI3 A;  2COM A;  4P9U A;  1OCP A;  4ZDO A;  4ZQF A;  5ICC A;  1XDU A;  3CUO A;  1N78 A;  4FCY A;  2R4G A;  4Y7N J;  3HOT A;  1XC5 A;  4Q4Z F;  1A36 A;  3CLO A;  3E5Q A;  2DXI A;  5M5Y J;  2NVQ J;  1ZAR A;  1DPU A;  1R1U A;  5FO5 A;  4II2 A;  4Y4R A;  1A31 A;  4L5J A;  1Z67 A;  3IUO A;  3OL4 A;  5AIQ A;  5HVQ C;  1IO2 A;  3Q9S A;  2OCC H;  4QPQ A;  1JGG A;  3D1N I;  5E1Z B;  2DFF A;  4XN8 A;  2XAS A;  1TQM A;  1VQP I;  2DBB A;  4MEX F;  2IS1 A;  4XM3 A;  1TQI A;  4HLX A;  4I2O A;  3X2Q H;  4LMY A;  4XRF A;  2HGC A;  2P5K A;  1HCR A;  3CZ6 A;  4ENN A;  2QQ9 A;  4XRM A;  4XOR A;  1FMV A;  4A3L J;  5GAG J;  1G59 A;  4FHT A;  2XC7 A;  2A61 A;  1KGS A;  1UJ8 A;  2HOE A;  4DGW B;  2ZXW H;  2AXT C;  3FK7 A;  4ENJ A;  1ZRE A;  1T1S A;  2M30 A;  3O6B B;  2CQQ A;  2MGQ A;  4C9Y A;  5IP7 J;  1ERD A;  2ZNY A;  4G6Q A;  2KLO A;  2VQC A;  4BXU A;  3MZH A;  2BW3 A;  2EFP A;  2JCY A;  3LSJ A;  2R7S A;  3EBH A;  1GVJ A;  2H6B A;  2EFO A;  2IGM A;  3PNT A;  4BEH A;  2EIM H;  1SAU A;  2IA0 A;  2B63 J;  3OR2 C;  1G3W A;  1D1A A;  3PUB A;  1W5C C;  4YFK F;  2O7O A;  2KIQ A;  1M1E B;  1T98 A;  2VT3 A;  2B61 A;  5EEG A;  3K70 C;  3E0J B;  5IY5 H;  1B9M A;  4I6Z A;  2NNY A;  3LST A;  5FLX Z;  1T38 A;  1HOM A;  3U9W A;  1Q1V A;  1IXR C;  4PVB A;  3I9V 2;  5ICG A;  1FBQ A;  4PCQ A;  5IT9 K;  2KZG A;  1XGM A;  1FLI A;  2Z99 A;  3UER A;  3ZMZ A;  2VQG A;  2VPL A;  4M71 A;  2RV8 A;  4RMN A;  5IPA A;  2IRF G;  3EQL F;  1R5G A;  4M9S A;  4W97 A;  3RCO A;  5D4S A;  3OIQ A;  2J5O A;  5E20 A;  1PVE A;  3GWZ A;  1EKE A;  4EM2 A;  4P1W A;  2GBY A;  2STW A;  3J7Z I;  4KIS A;  3QU3 A;  1YX3 A;  2JK3 A;  3L09 A;  3QYB A;  1LJ9 A;  1EV7 A;  2L9R A;  4LLG F;  2BY1 A;  1GUU A;  1U3E M;  3VOD A;  4NQW B;  2F2E A;  1U5T A;  2XAG A;  3IWF A;  3V7C A;  2GM4 A;  4Y13 A;  4PU2 A;  2UWM A;  2XF6 A;  4QLC U;  2MC3 A;  2PMH A;  1UAA A;  1MIJ A;  4HF0 A;  4XNB A;  3DEW A;  2BYV E;  2XGC A;  1XTA A;  2L0K A;  3IKT A;  3DPT A;  1KU7 A;  4ZQE A;  5AEN A;  4YEJ A;  4HG2 A;  5K5Q A;  3MKY B;  3BCA A;  5L3F A;  4AIK A;  3S15 J;  1JJ6 C;  1O3S A;  1OKR A;  4DQ2 A;  1KU3 A;  3F0C A;  3GTG J;  5EGO B;  3H5A A;  3WTZ A;  3FTV A;  2BGC A;  1LKX A;  4C2U A;  3JRA A;  4FX4 A;  5KAI C;  1X1D A;  9ANT A;  4FLO A;  4OIQ F;  1ONP A;  1JHF A;  1MSE C;  2EZL A;  3HOV J;  5EYR A;  1TWF J;  2VC0 A;  2E5N A;  4PJ0 C;  3CHR A;  3L9F A;  2D2W A;  1SVO A;  5HLH A;  1BBY A;  2E60 A;  4MEY F;  6PAX A;  4CHU A;  4K5N A;  3LSK A;  4HLY A;  2D45 A;  1H9G A;  2OA4 A;  5IP6 A;  3V8J A;  3HOW J;  4K5P A;  1KA8 A;  4NNJ A;  2PBI A;  4A3B J;  2ISY A;  5JVG F;  5JC1 A;  1YIO A;  3PO3 J;  2PL5 A;  1R22 A;  1Q0H A;  1LEA A;  3ZN0 A;  4S0H B;  3L1P A;  1MH4 A;  3PJR A;  1FY7 A;  3ZQF A;  5ED4 A;  4EEF G;  3M8J A;  1JT6 A;  2CUZ A;  1FYM A;  4E7Z A;  5LHG A;  5E3N A;  1NG6 A;  5J6X A;  3HW2 A;  1W0T A;  1OR7 A;  1X3Z B;  3FHN A;  4M9Z A;  2L54 A;  3WTY C;  4IHS A;  2ZKZ A;  3RJP A;  1GV2 A;  1BOB A;  1W36 D;  3CHP A;  3ZQH A;  3I59 A;  3L2W A;  2R7V A;  2P4W A;  4Y52 J;  4AR9 A;  2K4J A;  5DD8 A;  3QJX A;  2FU4 A;  1YFH A;  4PFP A;  3PIP F;  2HDW A;  5GTH C;  3VYS B;  3BR0 A;  3CDI A;  1WVR A;  2OBP A;  1QZZ A;  5HOD A;  5EDN A;  3V4G A;  2MC4 A;  2YSR A;  3OYG A;  2MA3 A;  3KX2 A;  1R00 A;  1BR4 A;  3G1O A;  4MFE A;  3HKZ N;  4HQM A;  3GTK J;  2W1O A;  2WAF A;  3OYI A;  4R5T A;  5DUL A;  3QYF A;  3SZG A;  1TWH J;  2MBF A;  1RPW A;  2X1D A;  3F8B A;  4G9Y A;  4L2L A;  1BW6 A;  3KZY A;  2LYC A;  1R7J A;  2R7Q A;  4IXA A;  2BVM A;  1FBU A;  2WAQ N;  4G6D A;  3ULQ B;  2EIK H;  5EF6 A;  1J5Y A;  4BE1 A;  1BOA A;  4IHW A;  1OCO H;  1ZLK A;  3B37 A;  2Z1D A;  3H35 A;  4LK1 F;  4GYI A;  3T8R A;  1PP7 U;  2JVH A;  3K4K A;  1G5A A;  3ZI0 A;  3M1C A;  4KIT B;  4UUV A;  5D4R A;  1CQT A;  3VWB A;  3OYC A;  1J2X A;  3KYL A;  1A6Q A;  2LK2 A;  1UHW A;  3J7A Y;  2DOD A;  3O8G A;  4LFU A;  2LKP A;  4UUS B;  2GXG A;  1R23 A;  3PNV A;  4XKW A;  5HLG A;  4E7I A;  1D8K A;  2CJJ A;  3HXL A;  3HRS A;  3OL3 A;  3CCR I;  1MW2 A;  1MW0 A;  3ZXS A;  4CSW A;  5B3S H;  1XGN A;  2WWY A;  1T1R A;  3WQR A;  5H2F C;  5J1Y A;  5JMW A;  3LA3 A;  1IW7 F;  3OYN A;  3HBL A;  1SFE A;  4KT6 A;  1XMK A;  5BNG A;  4MQV A;  3MAJ A;  2AHQ A;  1R6R A;  2VKH A;  4MNU A;  3JAM K;  4XQF A;  2XSD C;  3QYE A;  5DDG A;  5LFA A;  1JXS A;  4IRI A;  4IF4 A;  2IP2 A;  4OU0 A;  1W5S A;  1XGO A;  1BI1 A;  1R71 A;  5B1B H;  5E3O A;  5J4V A;  1IG7 A;  4D9J A;  1ETX A;  5CVR A;  1HQC A;  2W48 A;  5J40 A;  4HX8 A;  2HU9 A;  2JSP A;  5F1R A;  2CSO A;  3ZMT A;  1SAN A;  2O03 A;  1Z1D A;  3MZ8 A;  2EV6 A;  1UST A;  3ZQ7 A;  4LLL A;  3H5N A;  3AL0 C;  2K7L A;  3NWS A;  4M3B A;  1T33 A;  2F5C A;  5KNL A;  3CHQ A;  3B6C A;  2E1M B;  2XAH A;  5LBQ A;  2MAB A;  2VE9 A;  2G7U A;  2NVY J;  5K7Z A;  2DA1 A;  3ZMD A;  4XRS G;  5IT3 A;  2VC1 A;  1U5T C;  1VQ7 I;  2L9V A;  2LTP A;  3KLO A;  1W5T A;  4D7N A;  4QTR A;  4BE2 A;  4E7J A;  3PL8 A;  3UCQ A;  2L7F P;  1LE8 B;  2A3S A;  3RPQ A;  5LEJ A;  2V1N A;  4XON A;  3WU1 B;  2PG4 A;  1CGP A;  4A3D J;  2V7F A;  4CCO A;  1YRN B;  2HTS A;  2OQR A;  3OOU A;  2ESN A;  2VJ4 A;  4KT5 C;  1OFC X;  2HKX A;  1IXS B;  4XSX F;  2XQ0 A;  4WF2 A;  4HBL A;  4ZDL A;  4RCV A;  3MD2 A;  2Y48 A;  4IPA A;  4RGX A;  5HDK A;  2BZT A;  3FH8 A;  1BIA A;  2CUF A;  2MG4 A;  4L0Y B;  3WQQ A;  1D1B A;  3PIO F;  1KQ0 A;  3TKY A;  1TWG J;  1V5F A;  2P6T A;  4Z6Y A;  2ZFU A;  2IJL A;  2K4B A;  3I53 A;  1JUP A;  3JR9 A;  2HVR A;  3BTI A;  5JNL A;  2QBY A;  4MTD A;  3RQI A;  2AQE A;  4XKB A;  4CO8 A;  3DTI A;  5TIS C;  3HC7 A;  1TP4 A;  4HNV A;  1WSU A;  3FTU A;  2OAZ A;  3W2W A;  1U9N A;  3CUQ A;  1UHM A;  4GFB A;  4OIR F;  1LFU P;  2VPR A;  4U0V A;  1S46 A;  2CG4 A;  3C2H A;  3KZI C;  2X6W A;  3VYR B;  5LGU A;  1OQY A;  3ABK H;  3U21 A;  2MAP A;  4F55 A;  4B44 A;  4DPR A;  2HQ5 A;  4YEL A;  3F8N A;  1ZAO A;  2WY8 Q;  2F5F A;  2XRN A;  5DYM A;  2OC6 A;  1OR7 C;  2DK8 A;  1UZC A;  4GDF A;  2DT7 B;  5D5W B;  3AFH A;  1NK3 P;  5E8G A;  3WG7 H;  4FET A;  4QUO A;  2MD0 A;  5E1W A;  2BE5 F;  3BOQ A;  1U0J A;  2HYF A;  4BHB A;  4CCJ A;  2E7X A;  1JTY A;  1PJR A;  2ZCW A;  3FUF A;  1XDS A;  4PFO A;  3L2U A;  1X1A A;  2M8G X;  1RZ4 A;  4UB6 C;  1G3T A;  2QSH X;  2EFQ A;  5M3M J;  4RB2 C;  1ZK8 A;  1YS7 A;  3ZMU A;  1TW2 A;  2XKP A;  1U9O A;  3KIO A;  2EWN A;  3CC7 I;  1T95 A;  3C1D A;  5D5V B;  4J01 A;  4A03 A;  1ETO A;  1RI7 A;  1TTY A;  4CUG A;  3FU3 A;  2PUS A;  3BG7 A;  2V26 A;  4FLR A;  3DCF A;  1SG7 A;  5AIP A;  3O8H A;  2L2O A;  4I09 A;  1TC3 C;  4XMV A;  3J80 Z;  5EZH A;  5IOY A;  2LG4 A;  1MNE A;  1MKM A;  3VFZ A;  3CHS A;  3DLL F;  3Q0U A;  2HOT A;  1K6Y A;  5HS8 A;  1T56 A;  4JX5 A;  3GXO A;  3WOD F;  4J3B A;  4NC7 A;  3P5J A;  5DM6 F;  3ASO H;  4FLS A;  2JT1 A;  4XLF A;  5DM7 F;  3SYT A;  2LFB A;  2ID3 A;  2CMP A;  1STZ A;  2K86 A;  3IWZ A;  4XMY A;  1G3Y A;  3RDI A;  3GVA A;  4BXX J;  3E6M A;  3D5R C;  3HOZ J;  5FFZ A;  1OLT A;  2XPW A;  2M87 A;  3OIO A;  1J9I A;  1IF1 A;  3J7A O;  2KIU A;  1FIP A;  3DV8 A;  2G7H A;  2XDV A;  3CES A;  4JX6 A;  1F9N A;  1Z7L A;  1WI9 A;  2LY1 A;  2CQ7 A;  1S6L A;  2P5L C;  3LSM A;  1WJA A;  1B4A A;  2UXX A;  3GTJ J;  1JKP C;  2M7A A;  1TZL A;  3KYC B;  3OYA A;  3I3L A;  3HDD A;  4HRI A;  1TT0 A;  1X1C A;  2ELJ A;  3ML6 A;  3CCV I;  2AO9 A;  1D0X A;  4O6J A;  2DU9 A;  3B3B A;  1H8A C;  2A05 A;  1B8I A;  2ISZ A;  5JLX A;  3CQZ J;  1RUO A;  3FM3 A;  2FEZ A;  5J8C A;  2VKD A;  2HZT A;  5LEK A;  3KEY A;  3FH5 A;  2FOW A;  3IRQ A;  4CZC A;  2HPM A;  1YLF A;  2LLK A;  3BR5 A;  4XOP A;  2DDB A;  1D0Z A;  1FPQ A;  1OJL A;  4M73 A;  4BL0 B;  2MW8 A;  4RM3 A;  4RVB A;  4L5I A;  1RRJ A;  3NWT A;  2Y1G A;  4R5X A;  3BQZ A;  1RC9 A;  2ZSI B;  4LG0 A;  3FIS A;  5F6F A;  3E6D A;  4CXF A;  4Y6P A;  1TWA J;  3A02 A;  3VB2 A;  4PGG A;  2FXA A;  4KA4 A;  2E36 A;  3RTR A;  1NH3 A;  1E0E A;  2VL8 A;  2QYO A;  4IHV A;  4XN1 A;  3DXJ F;  3R0J A;  4Q4E A;  5IOZ A;  3R6S A;  3DPL C;  4IO9 F;  3Q9V A;  2LSO A;  2IGO A;  3ANM A;  2D1H A;  3G1L A;  2Y1E A;  3WE2 A;  4D5C A;  1KQ8 A;  4JND A;  4NC8 A;  1T2K A;  5FWQ A;  2DFE A;  2O7G A;  4DJA A;  4RA2 A;  3TO6 A;  1KU2 A;  3E6B A;  4PJN A;  2JD2 A;  4LB5 A;  1TLH B;  3WGH A;  4R8H A;  2R3S A;  3CZL A;  2O6G E;  3TP3 A;  2EH3 A;  3JRF A;  1RIO H;  3CO6 C;  3UR3 C;  2WB1 N;  2QSG X;  1ON1 A;  2DTR A;  2WV0 A;  2ID6 A;  3WTU C;  4OWR B;  3VEP A;  2ECB A;  3S2W A;  3ZQC A;  1EH7 A;  1P92 A;  2DA4 A;  1C0W A;  1U8R A;  1VQM I;  2CUE A;  2DMT A;  2M8E A;  2MD5 A;  5K5R A;  2D5V A;  2A5W A;  2R70 A;  4DZP A;  4A0Z A;  4XNA A;  2K9L A;  2H8W A;  4MO7 A;  3G2B A;  5BMZ A;  3COA C;  3WHC A;  2HPT A;  2XB5 A;  4M9X A;  3SFZ A;  1MBE A;  2DQ6 A;  3JT1 A;  1EJ9 A;  2IXS A;  3CUQ C;  4R1H A;  2L4M A;  1MJA A;  2EIJ H;  2VI6 A;  3S8P A;  3KEQ A;  3TMO A;  2EPF A;  2BW3 B;  4IHT A;  2FA5 A;  5BQT A;  2K9S A;  3RIR A;  1MW3 A;  3FTZ A;  1S5L C;  1IXC A;  2JPB A;  4A6E A;  1ZG1 A;  4BEH B;  4UHT A;  4YFX F;  2VOP A;  1P7J A;  2F4O B;  2QCO A;  3OS2 A;  1VQO I;  4AVP A;  4ANJ A;  5GAD J;  4A6D A;  1VQL I;  2IS2 A;  4WK8 F;  3IH4 A;  2VUM J;  1XD7 A;  5ILS A;  1Y8Q B;  5JBI A;  1I1G A;  2L5Q A;  2ZNZ A;  2PFB A;  1SMT A;  1QNT A;  3GTM J;  3PUF A;  3SQN A;  4MGR A;  4EJU A;  1WRJ A;  5J1R A;  2A6T A;  2L9S A;  3DWL E;  5K5O A;  5HDG A;  1FYL A;  3Q0W A;  2NXN B;  1ZS2 A;  3K4C A;  1X4O A;  4U0Y A;  3F8M A;  2FRH A;  3LA7 A;  4ZX4 A;  4WWC A;  2ZXJ A;  2HEO A;  1BR2 A;  4CDG A;  1AHD P;  4LLN A;  3V42 A;  4F91 B;  3CCL I;  4H0E A;  1WZ2 A;  4ARF A;  1ONO A;  4NUB A;  3C7J A;  5L3E A;  2W57 A;  3E6C C;  3K0L A;  2GXA A;  2QM3 A;  1A35 A;  2PMZ A;  3I4N J;  3CHO A;  1IUY A;  3FKI J;  3AL0 B;  1G4D A;  3WU0 A;  3U1D A;  3TGN A;  1QU3 A;  4YIF A;  2RGV A;  4BE0 A;  3ZQQ A;  4OMZ A;  4IOA F;  3L7W A;  3ZN1 A;  3OYF A;  5IP9 J;  2M9H A;  4YIR X;  1UEL B;  4ZC3 A;  4RBO A;  1D0Y A;  3K6G A;  3K4M A;  1HW5 A;  1U5T B;  3B2X A;  3DP7 A;  1ODD A;  2K3P A;  2R7D A;  4UVA A;  2RKH A;  1ZRD A;  5CPR B;  2COB A;  3JRC A;  2GAU A;  3OIP A;  3VVL A;  1GT0 C;  1SD5 A;  2W84 A;  3J81 K;  3GTL J;  4KIC A;  2Q2E A;  1IDY A;  5A2Q Z;  1HSJ A;  1LQ1 A;  4QIW N;  2LH9 A;  4HV6 A;  5HLI A;  1L0O C;  3W6K B;  4KIF A;  5FRN A;  2NS8 A;  2CU7 A;  1MDM A;  1PYV A;  2BVL A;  3QAH A;  1OCR H;  3DBL B;  4RM2 A;  3OS0 A;  1NG7 A;  4A3I J;  4K5O A;  4XN2 A;  3DKW A;  1Y0U A;  2QQB A;  1Z91 A;  2DOA A;  4MQ9 F;  2L4A A;  2WZF A;  2JUC A;  4JK1 X;  3ZMV A;  4V19 K;  4L9N A;  5FB2 A;  2MH9 A;  2NVX J;  3M9A A;  2Y69 H;  3ZCO A;  4ASN A;  5L3G A;  1GVD A;  3W2A A;  3TO7 A;  1B59 A;  3LL7 A;  4KDP A;  1X3W A;  2PN6 A;  4M3F A;  3M07 A;  4P9F A;  1YOV B;  1L3L A;  3FXM A;  4L9V A;  4EAT A;  1BC8 C;  3SEQ A;  3HTU A;  3I64 A;  1FP2 A;  2M2E A;  2VB6 A;  2XGD A;  4WXD A;  3GTQ J;  3BTC A;  4M6X A;  3FH7 A;  2ZME A;  2XAU A;  4XND A;  4UV8 A;  5ILU A;  3L00 A;  1H3L A;  3HGY A;  2C5Z A;  4OOF A;  3KEO A;  3MEX A;  1HBX G;  2NAZ A;  2ECC A;  4S04 A;  3HOX J;  4BBR J;  2X9D A;  1E3H A;  1ITY A;  2NYX A;  4IL6 C;  4MIM A;  5F0F A;  3KFW X;  5EG0 A;  5CVV A;  1BL0 A;  2GWR A;  1OPC A;  2IT0 A;  4EM1 A;  3I59 B;  1DU6 A;  3V7S A;  2R92 J;  3IV5 A;  3HZJ A;  3LWF A;  3ABM H;  3W6V A;  1G8X A;  2XRO A;  2LF8 A;  4PGH A;  4RAZ A;  1HW2 A;  4HF1 A;  3OYM A;  4B43 A;  4D0P A;  2JSC A;  3GZ5 A;  5F0H A;  4MS6 A;  3JW4 A;  1R9T J;  4Y17 A;  5FJ8 J;  4N9H A;  1ACI A;  1ZQ3 P;  3HOY J;  4C3J J;  4AYB N;  2OQG A;  4LIT A;  1QO0 D;  3FUI A;  3C2G A;  4FAS D;  3OSG A;  2ADU A;  4AIC A;  2K5C A;  2OCE A;  5H20 A;  3BY6 A;  5LHI A;  5KHD A;  1SD6 A;  1LDJ A;  3RC3 A;  4Y67 A;  3BQY A;  4HQE A;  3DLA A;  1U6G A;  3UEQ A;  4K2E A;  1X2N A;  4FCA A;  1O3Q A;  2VQH A;  1F1Z A;  1VTN C;  1FTZ A;  1R0K A;  2H8R A;  2HWV A;  1R4N B;  4FTH A;  1SVL A;  3WU2 C;  5CQG A;  2OV7 A;  3NRV A;  1CF7 A;  3H92 A;  2R5Y A;  1YW7 A;  3DBR B;  4XO3 A;  3DFG A;  4PSW A;  2H1L A;  3G4S I;  4LGW A;  4RAG A;  1ZYR F;  3WQS B;  2BY3 A;  2RC4 A;  1MNM C;  4F93 B;  2OPT A;  2BHY A;  2E34 A;  3CDL A;  3M8E A;  2KDO A;  3RQ4 A;  3B02 A;  3IH3 A;  5IYC J;  3J7Y J;  4IRH A;  2ZJQ F;  4UNO A;  2EV5 A;  5D6F A;  3FU6 A;  2DYR H;  2VON A;  3S2H J;  2XB0 X;  4ESF A;  3R4K A;  3RKQ A;  4B09 A;  2LBF A;  1TW3 A;  2IS4 A;  1MMN A;  2OD5 A;  3VSL A;  2A6H F;  3KP7 A;  2EK5 A;  5ERI A;  2EJR A;  4NC6 A;  3G73 A;  3RPU A;  1YW8 A;  3ISP A;  1TNS A;  2JZY A;  3TOB A;  2CH0 A;  2NOG A;  4XBF A;  3K70 D;  4ENM A;  4EVI A;  5DEQ A;  4GO1 A;  1UG0 A;  5BPI A;  1VQ4 I;  4XK4 A;  3SDG A;  1Z9C A;  1FYK A;  4ITV A;  1OCC H;  2M45 A;  1MJ9 A;  3CJT B;  3WHB A;  1HXD A;  3P9I A;  5E18 F;  1W0U A;  2JTV A;  4IZZ A;  2EFN A;  4A12 A;  4A5M A;  3FMS A;  2UZK A;  3T0Y A;  1K4S A;  3HM5 A;  2LDU A;  1P4X A;  1BI2 A;  2PI0 A;  3CJQ B;  4G8X A;  3M8F A;  1N77 A;  1ZHF A;  1FSH A;  1WFX A;  4IHY A;  2QQ8 A;  3ECH A;  3FKJ A;  1S72 I;  1K5H A;  3GX4 X;  1GXQ A;  1K7A A;  4BQN A;  1X2M A;  4WX9 A;  4P96 A;  2FOK A;  2EZI A;  3ABU A;  1VQ6 I;  3S1M J;  3TDU C;  2YS9 A;  3FX3 A;  1IN4 A;  1ZG5 A;  1Q0Q A;  2DA2 A;  1ONV A;  3MQ0 A;  3GO5 A;  3J80 K;  2HQN A;  2ZXH A;  3QRF F;  1Y0N A;  2ZXG A;  3FTY A;  2ZSH B;  2CFO A;  3MFK A;  1T39 A;  2WAD A;  1P4W A;  2KIS A;  1BIB A;  1DGW Y;  3TDZ C;  2Z9O A;  2P7V B;  5CYV A;  3B2P A;  2XGX A;  5C3E J;  5J8F A;  1YIJ I;  3VSK A;  4KN7 X;  3E97 A;  4KIG A;  4BJ6 C;  2CW7 A;  3WE3 A;  5DYF A;  2Y30 A;  3HYI A;  4ZZL A;  3LNQ A;  5DLL A;  2R93 J;  3DEU A;  3EUK L;  3EUH A;  3CCQ I;  1V54 H;  1K78 A;  3BG3 A;  2BBY A;  5IYB J;  3BZ6 A;  3OY9 A;  4Q47 A;  1OYI A;  2MFZ A;  3P9C A;  1FZP B;  2QBY B;  2R7R A;  2Y0S A;  2OF7 A;  2LOO A;  4AM3 A;  4D7M A;  2AQF A;  2BY0 A;  4LOC A;  3CCY A;  2XV4 S;  4UVC A;  1SFK A;  2L9N A;  1ETK A;  4QSH A;  3CUQ B;  2QUF A;  3EBI A;  3CCU I;  3FXO A;  2ZME C;  4CGZ A;  1O57 A;  1A5J A;  4IVN A;  2BHZ A;  3OOP A;  5CKT A;  5LGT A;  3HB9 A;  1LEB A;  2YX4 A;  2WPG A;  3B73 A;  4FQG A;  4HPQ A;  3KZZ A;  3LQR A;  2QA4 I;  2GIZ A;  3FZV A;  4L9J A;  5D8K B;  2F4M B;  2JA2 A;  1BJA A;  4WXC A;  3RC8 A;  4AR1 A;  2N8G A;  5JMP A;  3QOE A;  4PJJ A;  2PJP A;  2DO7 A;  2F48 A;  5EEH A;  4QIR A;  2EGH A;  4BNC A;  3UNG C;  4X6A J;  4R7L A;  3BWG A;  3SDB A;  3FU5 A;  4EJV A;  4M6Y A;  5LRS A;  2HYJ A;  3OWT A;  3H3V K;  2DPD A;  3FK6 A;  4E7K A;  3F72 A;  1WJB A;  3HUG B;  1T0F A;  4QWQ A;  1WQ2 A;  1HKQ A;  1F43 A;  1JVS A;  2L01 A;  3T8T A;  3I4P A;  2JA7 J;  3BR1 A;  4BQQ A;  2FNA A;  3ZOB A;  3RYR A;  2X51 A;  4ETS A;  2GLO A;  4HST A;  4LG3 A;  4BY7 J;  2CQX A;  3SEZ A;  1UG2 A;  2PJR A;  4XID A;  2R7W A;  3H3U A;  5DUI A;  1WJF A;  3CD6 I;  4KP7 A;  1D1C A;  2KL4 A;  2LNB A;  2LY2 A;  2ESH A;  1IRX A;  2X0L A;  2X6X A;  3QU6 A;  4I01 A;  2KHM A;  4R5V A;  4HX7 A;  1F36 A;  3CZE A;  3NAU A;  4RGS A;  4K5L A;  1BJZ A;  3HSR A;  1V4R A;  2MYS A;  3AU9 A;  1MGT A;  1ZEL A;  3M3Y J;  1FX7 A;  3FMR A;  3BG6 A;  3F6V A;  4KUM A;  2EBI A;  2XGE A;  3FXJ A;  1W7P B;  3IH2 A;  1R4M B;  4A3K J;  4I0A A;  2WY7 Q;  5E8I A;  3CC4 I;  2WBM A;  2VOD A;  5EV7 A;  2HVS A;  4AVZ A;  1J7K A;  5L3D A;  4OIN F;  2I5U A;  1MH3 A;  1X3U A;  4XLA A;  1MVY A;  2R7T A;  2H09 A;  5M5X J;  3LFU A;  1Y8R B;  4CYC A;  5E1X A;  2RAE A;  5DV5 A;  2FBI A;  2DMP A;  5FKN A;  2QKL B;  4NBQ A;  1I50 J;  2XUB A;  3LA2 A;  3FXR A;  4IEJ A;  4OMY A;  2DA5 A;  3BPX A;  4YFN F;  2R7X A;  1X4P A;  2DCE A;  2GIV A;  5K7H A;  4MHG A;  1NHA A;  3NAR A;  2Q8K A;  4ZQT A;  4ZX5 A;  1I3A A;  4I7H A;  3F23 A;  1B8I B;  3N05 A;  1FTT A;  3K69 A;  1RR7 A;  1D5V A;  3KE2 A;  1XCB A;  4ZW5 A;  2LD5 A;  1S3J A;  3CCJ I;  2P0W A;  3FTS A;  2DMQ A;  3TBI A;  4ESJ A;  1KZH A;  3IRR A;  2BXY A;  4A3M J;  4ZW3 A;  5JAZ A;  1H19 A;  2W82 A;  5M3F J;  5C4X J;  5IT9 Z;  2VE8 A;  4BS9 A;  3VYT B;  3FDY A;  1B9N A;  1Z0X A;  2QLZ A;  4L9T A;  4IX7 A;  4U87 A;  5KCM A;  4LG0 B;  1I6H J;  3O3K A;  4KYW A;  1LB2 A;  3OYE A;  2A07 F;  4ZJZ A;  3HPG A;  2ME0 A;  3RKX A;  4XLE A;  3N97 A;  2OZU A;  4BQO A;  1FSE A;  2DFI A;  4RB3 C;  2ZJR F;  2JWT A;  5LLQ A;  4XMX A;  1POG A;  1J75 A;  4F7Z A;  4Z2Y A;  4ZTJ A;  1R1V A;  1IUF A;  1MBJ A;  2IVM A;  2LRE A;  2M0M A;  3JRB A;  2CYY A;  2NS0 A;  3LSR A;  3C18 A;  2O61 A;  2JD1 A;  2CW8 A;  3IC7 A;  2WC2 A;  2V9V A;  3HIF A;  4A69 C;  4S05 A;  3CCS I;  3RZD J;  3HJE A;  3AG3 H;  3JRI A;  3L2V A;  3RPU D;  5D5U B;  3LAJ A;  1WJC A;  3U9G A;  5C4J J;  2NVT J;  1TWC J;  2E1N A;  4LD5 A;  3ERE D;  2DTZ A;  3EUH C;  3GUD A;  4M3E A;  5JVT A;  3KP5 A;  4M3D A;  2ICW G;  3HUG A;  2OTL I;  4GAA A;  4A3F J;  3LOC A;  2FD5 A;  1H88 C;  1XCV A;  2KJC A;  4XMU A;  2HVQ A;  1XX5 A;  2XF5 A;  3IKV A;  1O3T A;  1XG1 A;  1ETY A;  3IIE A;  1FOY A;  5TGT A;  2KIM A;  4MKT A;  2FSW A;  4GGG A;  1B72 A;  4OAY A;  2XPY A;  3WGG A;  3GW2 A;  4LK0 F;  3SHF A;  5FLV A;  3CF2 A;  4XIC A;  3QP6 A;  4L18 B;  2HFH A;  3GFJ A;  3S3M A;  3B7T A;  4II3 A;  3E5X A;  1KYZ A;  5J4Y A;  2E2I J;  2ACJ A;  1YX5 A;  4XKV A;  3KLN A;  3U1K A;  5E3L A;  4HNU A;  5K7F A;  4M6V A;  3BR6 A;  4PJL A;  1RKW A;  3AAF A;  2MLG A;  1W7P A;  1QQI A;  1P7I A;  3F8C A;  4GXO A;  5GPA A;  4XRS A;  1HLV A;  3OMY A;  1IJW C;  3CZK A;  3MWM A;  4XN9 A;  5DS9 A;  3LSI A;  1BW5 A;  1T0F C;  3AG4 H;  3HRM A;  1SD7 A;  2HDD A;  2ZJ2 A;  3L2Q A;  2RDP A;  1D5Y A;  2K9N A;  2FE3 A;  3RKW A;  4BXF A;  3FXU A;  2M34 A;  3A1Y A;  2O9L A;  3M7G A;  2V6E A;  1XB4 A;  4AU7 A;  4MLO A;  1WPK A;  1IZ1 A;  2QKM B;  4XOT A;  3BG9 A;  4TV7 A;  2FJ1 A;  1TBX A;  2XAJ A;  1BN5 A;  2M5W A;  2VAS A;  3TP0 A;  3F21 A;  4MTE A;  4B3X A;  5CJ9 A;  5JHF A;  2H94 A;  4B1R A;  1XS9 A;  4BKX A;  4BDY A;  4G6T B;  3OYK A;  3HG9 A;  4XN7 A;  1JKO C;  1IRZ A;  3BZC A;  4B48 A;  3SFI A;  4PJM A;  3CZG A;  2Q1Z B;  3TW6 A;  4AIJ A;  5HOO A;  3C2B A;  5TRD A;  1YW9 A;  2E35 A;  5H6Q A;  4U88 A;  2W00 A;  3BTL A;  4ZDP A;  4IJA A;  1ZRC A;  3CO7 C;  1ETQ A;  5GAH J;  2E5Z A;  2IGK A;  3KYD B;  4N0B A;  2H1K A;  5FLX K;  2CFX A;  2IGN A;  1PUF A;  2Q0O A;  4CH7 A;  2HR3 A;  3FTW A;  1LVK A;  4ZYE A;  3G6E I;  3K4J A;  5KK1 A;  4Y3O A;  2DQL A;  4F3Q A;  2HS5 A;  3OS1 A;  4GCV A;  2JN6 A;  2Q2E B;  1ZTR A;  2PGG A;  2XRL A;  2BY2 A;  3B6A A;  3MCZ A;  3PO2 J;  3QPS A;  1K83 J;  3H0D A;  5JFR A;  2DAO A;  2TCT A;  1G6N A;  3JRG A;  1MDM B;  3G71 I;  4BGD A;  4GYG A;  4HF2 A;  3V8L A;  2KIF A;  2R5Z A;  1Z6R A;  2L3D A;  1Y39 A;  2V1U A;  1RR8 C;  2DFH A;  5B5E C;  2KRC A;  1VQ9 I;  4PZJ A;  4G12 A;  2KT0 A;  1LVA A;  2MAO A;  2Z16 A;  5EEA A;  2GTQ A;  2F5D A;  1X3W B;  3GTO J;  4NHJ A;  2K40 A;  4P5O A;  3JAM Z;  5C44 J;  4M3G A;  4KNY A;  5F04 A;  3L2C A;  1GXP A;  3CTA A;  2F6C A;  1TL8 A;  5LHH A;  1AKH A;  2ZME B;  5JI6 A;  3BJO A;  4LB6 B;  4GRI A;  3AKZ A;  3OYL A;  2KP6 A;  2E7W A;  4KMU X;  3RSN A;  2VQL A;  1HDD C;  3CMM A;  3FUH A;  5FKM A;  1BI0 A;  4HOB A;  3QPH A;  3CJN A;  3EET A;  2V1X A;  4ENK A;  5EG0 B;  1UFM A;  1YG2 A;  1S29 A;  1SAX A;  2Y9Z A;  3BLY A;  4OIO F;  2XF7 A;  4XMT A;  2FX0 A;  2LP0 A;  2JVG A;  4FIS A;  4L5E A;  3K1N A;  1EA3 A;  2XIG A;  1MBH A;  1E3P A;  4RLF A;  1DPR A;  3HRU A;  3V7R A;  3DPU A;  3T1B A;  4CIC A;  4EM0 B;  2IW5 A;  1Y1V J;  1PUE E;  4IHX A;  3AU8 A;  1WJE A;  1IRG A;  3DTE A;  1YHQ I;  3BR2 A;  5FRM A;  2C6Y A;  1DU0 A;  1X58 A;  1YE9 A;  1BI3 A;  4RS8 A;  4BH9 A;  4PDK A;  4AYS A;  5JLW A;  3EUA A;  2Y75 A;  3DF8 A;  5FKO A;  4OOI A;  2MLK A;  2EIN H;  3FUE A;  3RKY A;  1R1T A;  2KRH A;  3HKZ A;  4DBQ A;  2LMD A;  1FOK A;  1ZGA A;  1JUM A;  2X1C A;  2DA3 A;  4EGY A;  1HKS A;  1E3O C;  2R7U A;  1FBS A;  1W4M A;  2K02 A;  2QSF X;  4BJ5 C;  2Y1C A;  1LDD A;  4HW0 A;  3FUJ A;  2Z3Y A;  1Z7U A;  4XO4 A;  4B8X A;  2WAQ A;  1R36 A;  5LD2 C;  1UHS A;  3ZPL A;  3H36 A;  1JGI A;  5F08 A;  2DOF A;  1CF7 B;  1S7E A;  1MMD A;  1FIA A;  2R5Y B;  1YTY A;  1KQ9 A;  3I54 A;  3ANN A;  2ELK A;  2CS3 A;  1UCR A;  2CV2 A;  4K5M A;  4ZW7 A;  2JA6 J;  1R49 A;  2LR8 A;  5DCM A;  4HAM A;  3ZHZ A;  3A01 A;  1E17 A;  1IGN A;  1YO5 C;  2HQR A;  1RNL A;  2FQ3 A;  4N4N B;  5EJC A;  2LVS A;  3GFI A;  1QZY A;  3K2A A;  1BC7 C;  3PSI A;  4CCN A;  2LRD A;  2LBF B;  4ESB A;  1FOW A;  2NVU B;  3A4C A;  3F3X A;  1I1S A;  3HOU J;  4AWX B;  4U7B A;  1QBJ A;  1DP3 A;  3BR3 A;  3DKY A;  4EJT A;  1JI8 A;  1ZKG A;  3HSE A;  3CCE I;  1ZGW A;  4AC0 A;  2RNJ A;  5L3B A;  3KPH A;  2DQM A;  2R59 A;  4X1E A;  2X48 A;  3F6O A;  2IPQ X;  5AON A;  2LKS A;  2KMU A;  1AA7 A;  4FE4 A;  1ZLJ A;  1O3R A;  3DQV C;  1VZ0 A;  4L0Z B;  1T08 B;  4Q48 A;  2E1M C;  1ZG3 A;  5JO0 A;  1NTC A;  3RZO J;  4Y15 A;  1Y6I A;  5CVU A;  5GPC A;  1N25 A;  3MN2 A;  2Y2Z A;  4U7D A;  3TW7 A;  2VKV A;  2JPC A;  2CRG A;  2M1B A;  1WJD A;  4C2T A;  2M0C A;  3TL4 X;  1GW6 A;  1IV6 A;  1W7P D;  1JGS A;  2GA2 A;  2YU3 A;  2BEO A;  3F8F A;  1JE8 A;  2E2H J;  3CP8 A;  1ZH5 A;  1O7F A;  3H3Z A;  4XL9 A;  1Z21 A;  1JKR C;  4QME A;  1D3Y A;  3IL2 A;  4I0B A;  1BA5 A;  3FUK A;  4LIV A;  2WA0 A;  2RQQ A;  1PDN C;  3CXB A;  1X1B A;  2VJJ A;  1MBK A;  2JV7 A;  3FUD A;  3JCU C;  5DCF A;  3MKW B;  3GFL A;  3LSP A;  3CIA A;  3CLQ A;  1K79 A;  4G7H F;  1WH5 A;  2GZW A;  3P7N A;  3S32 A;  3EYI A;  4O3M A;  4IQ4 A;  3S3O A;  3R0I A;  3R61 A;  2CGP A;  1LDK B;  4A0X A;  3JRH A;  2P81 A;  3S93 A;  1K78 B;  1ZGJ A;  2PX9 A;  3BTJ A;  4HSR A;  3GFM A;  4JX4 A;  3HL2 A;  2IS6 A;  2R7O A;  1MBF A;  2HQA A;  2GOM A;  4HDV A;  2Y1F A;  3Q44 A;  3K1P A;  3V8K A;  2V4J C;  3PQJ A;  4FT8 A;  4EMS A;  2O5R A;  1OCZ H;  3FXL A;  3P9K A;  3FIW A;  3I55 I;  3W2V A;  2W7N A;  3JTG A;  2YPR A;  3KP6 A;  4XSZ F;  4F52 A;  3EPZ A;  1GV5 A;  1Z05 A;  1H9T A;  2EA4 A;  2J5P A;  3T5X A;  3ZQL A;  5J47 A;  3D0S A;  3F9K A;  1G3S A;  1QRY A;  3GBG A;  2KQR A;  3S14 J;  2W25 A;  2IEK A;  2XAF A;  2KZV A;  4ON0 A;  1VF9 A;  3BZK A;  2Y1D A;  2NOJ B;  3FHE A;  1WKM A;  3Q5F A;  2QGU A;  1SFU A;  1EF4 A;  4XO5 A;  2HPO A;  3ASN H;  1VQ8 I;  3ZGK A;  2KPM A;  3M4O J;  3BPV A;  1R5I D;  3L2R A;  1TQP A;  4MFD A;  3PNY A;  1ZR4 A;  3A03 A;  4BU2 A;  4X0G A;  2OJE D;  2FNP A;  3S3N A;  4UUT A;  2QQA A;  2XSJ C;  1DQU A;  1QVT A;  3QOP A;  4OAZ A;  2JD0 A;  5HDN A;  4Q5S F;  1XSV A;  2X6O A;  3EDP A;  2ELH A;  3PM1 A;  2XPV A;  2PJR B;  2DA7 A;  4E70 A;  2FML A;  1I3Q J;  4RB0 A;  4UB8 C;  2V1D A;  4J00 A;  1ZRF A;  1OCT C;  4B4C A;  4I76 A;  3D5L A;  5CLS A;  2KKO A;  3BJ6 A;  3IP4 B;  4RLQ A;  3AG1 H;  4G94 A;  1R0L A;  4JOM A;  3Q43 A;  4X2U A;  2L7K A;  5DUK A;  2V9P A;  1F4K A;  1OIS A;  1QPM A;  1UB9 A;  2DLL A;  1QGP A;  4XMZ A;  5FRO A;  2G0E A;  4O5V A;  2EZH A;  3A0B C;  2GA1 A;  1LPQ A;  1JJ8 C;  2JCX A;  2P6S A;  3ZHY A;  1VQN I;  4JYK A;  5ICF A;  2FBK A;  3HEF A;  2DPU A;  2JQ7 A;  4PW4 A;  1W36 C;  4ZTF A;  1K4T A;  1RKT A;  2DYS H;  4ZW8 A;  2L7Z A;  1OYW A;  4CYC B;  2D1V A;  2DA6 A;  1I5Z A;  1SC5 A;  1SFX A;  5EZG A;  4V2F A;  2K27 A;  3W3C A;  4RB1 A;  3VPR A;  4DNC A;  2E2J J;  4I02 A;  2HOA A;  4WXH A;  2WZG A;  2GOX B;  2IAI A;  3Q3S A;  2NS7 A;  2C82 A;  3GCM A;  2VXZ A;  4KFC A;  3E5U A;  3TO9 A;  2KFD A;  1WGX A;  2HNH A;  4UVB A;  5HNF A;  4ZQG A;  3WTS C;  2RN7 A;  3QOD A;  3PSF A;  3W6J B;  5DTD A;  1WHU A;  4FX0 A;  1ZN2 A;  4ZX3 A;  3I56 I;  1O4X A;  3MKZ A;  3I4M J;  1FP1 D;  2GQQ A;  4FLQ A;  1BM9 A;  4R79 A;  5BOX A;  3ZP5 A;  2JRM A;  2YR2 A;  4RAF A;  5F0C A;  2E19 A;  4XLH A;  3H9G A;  2LC2 A;  1IN8 A;  2DW4 A;  1P4A A;  3R60 A;  3REO A;  1XPX A;  2HXI A;  3RI4 A;  3K2Z A;  4KN4 X;  5D8L B;  3ZHX A;  5HS7 A;  3CC2 I;  4BUP A;  3SXY A;  3SZT A;  5CQE A;  1HDP A;  4ZYH A;  2WAE A;  4YRV A;  1XSX A;  5L3C A;  2VBZ A;  2EB7 A;  2W4S A;  3CMA I;  2MH2 A;  2TRT A;  3G3Z A;  2R7Z J;  1IC8 A;  4N4O B;  3WTV C;  2JA5 J;  5CVI A;  3S1N J;  2MSY A;  3I5U A;  4I99 C;  3K9T A;  2B9S A;  2G9W A;  5ILV A;  2VBX A;  4B3A A;  3IAS 2;  2V9K A;  2X4H A;  4RAY A;  1FNN A;  3K4L A;  2XVC A;  1QVU A;  2DOE A;  2HZD A;  2RRE A;  1SEU A;  1H89 C;  2YUS A;  4DW6 A;  3ERM A;  2A7O A;  2M4G A;  4N9I A;  1WI3 A;  1RET A;  2PMZ N;  3J81 Z;  1SC7 A;  4NB5 A;  2QVO A;  2PMU A;  1FEX A;  1A6I A;  3HRT A;  2E1O A;  3PQK A;  4CYD A;  4ABZ A;  4RSY A;  2WB1 A;  4KJZ A;  4C30 A;  4HZF A;  4DOZ A;  2VIX A;  1HA8 A;  3GLL A;  1LFB A;  3FTX A;  2AS5 F;  1VI0 A;  1B72 B;  2STT A;  2R72 A;  1QHG A;  1ETV A;  3K4B A;  3MZY A;  5JHU A;  3GYH X;  1DDN A;  2W85 A;  3OR1 C;  3WTX C;  2DT5 A;  4XLP F;  2DMN A;  5B66 C;  4ZN6 A;  3GZ6 A;  1GLN A;  1FJL A;  5BPP A;  2X1E A;  4XN5 A;  4NQW A;  2ZJP F;  4A93 J;  1UMQ A;  2ZFW A;  4H4K C;  3TED A;  3S2D J;  4PK4 A;  2O3F A;  3CF5 F;  1XMA A;  1Z77 A;  5FKL A;  4GAE A;  4Y6R A;  2PQ8 A;  5E79 C;  3K7A J;  3E3V A;  5FKK A;  1ORK A;  2NNN A;  2KJB A;  3VYU B;  5DD4 A;  2P7C B;  1YS6 A;  2OUM A;  4XN3 A;  2ME6 A;  3HGG A;  2HOS A;  2K3F A;  3FHZ A;  5EGO A;  4D1Q A;  2O8X A;  4JBA A;  1DUX C;  1REP C;  2R0Q C;  2VN2 A;  5TJJ A;  5GAE J;  5J3L A;  1FOX A;  1JTX A;  4HDU A;  1QZE A;  2K9M A;  3KP4 A;  4EQQ A;  3NQO A;  3CME I;  5IYD J;  5D5X B;  1Y1W J;  3FUM A;  3BJA A;  2HKO A;  1TNT A;  4CA0 A;  2Z5U A;  3NEU A;  2CV0 A;  2VLA A;  3FM5 A;  3JTH A;  1B1B A;  1ZR2 A;  3QQA A;  4F92 B;  3HTS B;  1HST A;  1X19 A;  2RQP A;  4J19 A;  3BT9 A;  1EH6 A;  4OOE A;  3ZQG A;  3ROU A;  2KDZ A;  1SMY F;  4FE7 A;  1MMS A;  2CUJ A;  3CP2 A;  4A3E J;  3CJR B;  2CV1 A;  4BYY A;  3LSH A;  3ESW B;  1K6O A;  1JKQ C;  2P8T A;  3LSG A;  3FBN B;  1S9H A;  2F5V A;  1X3Z A;  2E71 A;  2IBD A;  1PUF B;  2GXB A;  2HPI A;  1N75 A;  1E2X A;  1I6X A;  2DT6 A;  2CO5 A;  2DJI A;  2ZBK A;  3DBH B;  4XKC A;  3PFY A;  3I0T A;  3BDD A;  3A06 A;  2JCV A;  1YI2 I;  4AD9 A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3JSZ A;  2VB6 A;  4E7Z A;  1NG6 A;  1FMW A;  2KRC A;  3FHN A;  1OR7 A;  3FH7 A;  2XAU A;  2MAO A;  2Z16 A;  4XND A;  2GTQ A;  1BOB A;  1W36 D;  2C5Z A;  3CHP A;  4OOF A;  4P5O A;  4JQF A;  2JUG A;  3L2W A;  2R7V A;  4AR9 A;  3QJX A;  2FFL A;  4HEA 2;  3A14 A;  4PFP A;  4CCK A;  2F6C A;  2HDW A;  3VYS B;  4GRI A;  3AKZ A;  3OYL A;  2KP6 A;  2MC4 A;  3OYG A;  3RSN A;  2VQL A;  3KX2 A;  1BR4 A;  3CMM A;  3FUH A;  2X85 A;  2W1O A;  2WAF A;  3OYI A;  4R5T A;  5DUL A;  3QYF A;  3SZG A;  1G8X A;  3FUN A;  2X1D A;  4L2L A;  3BLY A;  2LYC A;  3OYM A;  2XF7 A;  2R7Q A;  4B43 A;  4XMT A;  4MS6 A;  4CCM A;  2BVM A;  2JVG A;  4ZX6 A;  3FBI B;  1EA3 A;  2VJ5 A;  4RLF A;  3DPU A;  4BE1 A;  3DTK A;  2RJI A;  1DGR M;  1V5E A;  2M7B A;  3B37 A;  2Z1D A;  3H35 A;  4LIT A;  3H9J A;  3FUI A;  2JVH A;  2M3A A;  3C2G A;  3K4K A;  4FAS D;  5HLT A;  1G5A A;  3AU8 A;  1WJE A;  3ZI0 A;  4AIC A;  3M1C A;  3DTE A;  2K5C A;  4KIT B;  5FRM A;  3VWB A;  5KHD A;  3OYC A;  1YE9 A;  3B7S A;  4AYS A;  3KYL A;  3RC3 A;  3EUA A;  3J7A Y;  4Y67 A;  4Y33 A;  3T8V A;  3DLA A;  3UEQ A;  1Z3Y A;  4FCA A;  2VQH A;  4XN4 A;  3FUE A;  1R0K A;  2KRH A;  3HKZ A;  3PNV A;  4XKW A;  4XR6 A;  4DBQ A;  4E7I A;  3HXL A;  2ZXI A;  3OL3 A;  5CQG A;  2OV7 A;  2X1C A;  4E7S A;  1MW0 A;  3ZXS A;  1MW2 A;  4CSW A;  2VXD A;  2R7U A;  4BJ5 C;  2Y1C A;  4B47 A;  3KED A;  4XO3 A;  1T1R A;  3WQR A;  4BDZ A;  5JMW A;  4PSW A;  3FUJ A;  3OYN A;  4KT6 A;  4XO4 A;  2WAQ A;  3WQS B;  5LD2 C;  1JGI A;  4F93 B;  1R6R A;  2VKH A;  3RQ4 A;  2KDO A;  4XQF A;  3QYE A;  5LFA A;  3VVM A;  1MMD A;  4ZYA A;  3FU6 A;  4AYB A;  4DIQ A;  3ANN A;  2CS3 A;  2CV2 A;  3B34 A;  4K5M A;  4ZW7 A;  2LBF A;  2UUZ A;  4XNF A;  1MMN A;  2IS4 A;  3VSL A;  4E6K G;  3ZHZ A;  4D9J A;  2QVW A;  2HU9 A;  2JSP A;  4LIU A;  4N4N B;  2I8D A;  2CH0 A;  3K70 D;  3HPH A;  3PSI A;  4BJT A;  4CCN A;  2LRD A;  3H5N A;  2LBF B;  1UG0 A;  3AL0 C;  3NWS A;  4ITV A;  3A4C A;  3CHQ A;  3H5R A;  4CCL A;  5KNL A;  4U7B A;  2E1M B;  1DP3 A;  3DKY A;  2MAB A;  2FUG 2;  1JI8 A;  4IZZ A;  3T0Y A;  2DQM A;  3B7U X;  2QJ1 A;  3AUA A;  2R59 A;  3CJQ B;  4BAC A;  4E7H A;  1N77 A;  1WFX A;  4E7J A;  4BE2 A;  3PL8 A;  3UCQ A;  3FKJ A;  2KMU A;  1AA7 A;  1K5H A;  2V1N A;  4XON A;  3DQV C;  3LMM A;  1VZ0 A;  2V7F A;  4CCO A;  4Y6S A;  4BQN A;  3OOU A;  2E1M C;  2VJ4 A;  4ZQH A;  5JO0 A;  2XQ0 A;  1Y6I A;  4ZDL A;  4RCV A;  4AR8 A;  3MD2 A;  3ANL A;  1Q0Q A;  3FH8 A;  3FU0 A;  2ZXH A;  2ZXG A;  3WQQ A;  1D1B A;  3FTY A;  2ZSH B;  2CFO A;  1V5F A;  1WJD A;  2WAD A;  2ZFU A;  1MMA A;  4C2T A;  1DGW Y;  3TL4 X;  1GW6 A;  3D5S C;  2HVR A;  3B2P A;  4E4H A;  5JNL A;  3VSK A;  3CP8 A;  4BJ6 C;  4QME A;  4XL9 A;  4Q4I A;  1Z21 A;  2CW7 A;  1SQM A;  1P9Q C;  2AQE A;  4XKB A;  5DYF A;  3FUK A;  4LIV A;  3DTI A;  3EUK L;  4IQJ A;  5DLL A;  3HC7 A;  2WA0 A;  2RQQ A;  3FTU A;  3OY9 A;  1X1B A;  3W2W A;  2VJJ A;  2JV7 A;  3FUD A;  2MFZ A;  3MKW B;  1MW1 A;  4ZW6 A;  4XN2 A;  1S46 A;  3CIA A;  2R7R A;  2Y0S A;  3ZRG A;  3C2H A;  2LOO A;  2X6W A;  3VYR B;  2MAP A;  3S32 A;  3U21 A;  2AQF A;  4F55 A;  4B44 A;  3E1S A;  4DPR A;  4IQ4 A;  3S3O A;  3R0I A;  4YEL A;  4PUS A;  1LDK B;  2WY8 Q;  1SFK A;  1Y56 A;  3S93 A;  2L9N A;  2IS6 A;  3ONQ A;  4HSR A;  3HL2 A;  2R7O A;  2HQA A;  1OR7 C;  2OC6 A;  3EBI A;  2GOM A;  2DT7 B;  2Y1F A;  3AFH A;  3Q44 A;  5CKT A;  3DU5 A;  2V4J C;  4FET A;  2O5R A;  1MND A;  2XPZ A;  4QUO A;  2M4K A;  3W2V A;  2WPG A;  2MD0 A;  2W7N A;  1Q0L A;  4HPQ A;  1U0J A;  3BC8 A;  4CCJ A;  3FUF A;  1PJR A;  4F52 A;  3EPZ A;  3H9Q A;  4PFO A;  3L2U A;  1X1A A;  2JA2 A;  4KP7 A;  2Z2S B;  3RC8 A;  2BOL A;  3K4N A;  4AR1 A;  5JMP A;  3F9K A;  3QOE A;  4PJJ A;  3GBG A;  2KQR A;  4QIR A;  2EGH A;  3UNG C;  1H3L A;  4R7L A;  1T95 A;  2KZV A;  4J01 A;  4A03 A;  3SDB A;  3FU5 A;  3FU3 A;  4CUG A;  4LUP A;  2PUS A;  3BG7 A;  2NOJ B;  1RP3 A;  2Y1D A;  2V26 A;  3OWT A;  3A2K A;  3FHE A;  4FLR A;  1SG7 A;  2L2O A;  4E7K A;  4XO5 A;  1WJB A;  3HUG B;  2HPO A;  1WJ5 A;  3ZGK A;  1JG9 A;  2KPM A;  1JVS A;  4XMV A;  2LG4 A;  3MMY B;  4BQQ A;  1MNE A;  1MMG A;  2X51 A;  3CHS A;  3L2R A;  4HST A;  4LG3 A;  3OYH A;  3SEZ A;  1HS6 A;  2PJR A;  3FUL A;  2R7W A;  3PNY A;  1BR1 A;  2X6Y A;  1K6Y A;  1LFP A;  1WJF A;  4QPO A;  3HOS A;  1D1C A;  2KL4 A;  3DEE A;  2LY2 A;  4XLC A;  1IRX A;  3DKX A;  2X6X A;  4BU2 A;  4X0G A;  1QHH D;  2KHM A;  3S3N A;  4E7L A;  4R5V A;  4XMW A;  3IAM 2;  3CZE A;  2XSJ C;  1DQU A;  4PSX A;  4NC7 A;  4OAZ A;  2JD0 A;  4K5L A;  4J3B A;  4FLS A;  4XLF A;  3DU6 A;  3B7R L;  2PJR B;  3SYT A;  2MYS A;  3AU9 A;  1ZEL A;  2CMP A;  4XMY A;  4J00 A;  4IKF A;  3D5R C;  3K10 A;  3D5L A;  3BG6 A;  1OLT A;  3VDX A;  2F4I A;  3IP4 B;  3OYB A;  2WY7 Q;  4RLQ A;  2VJ8 A;  2RNG A;  2WBM A;  1R0L A;  4JOM A;  2XDV A;  3CES A;  5HNH A;  2HVS A;  3Q43 A;  4X2U A;  4AVZ A;  5EV7 A;  1Z7L A;  3EBG A;  2L7K A;  1MW7 A;  2LY1 A;  2VJI A;  1Z3X A;  3ZR8 X;  4DBR A;  4XLA A;  3LSM A;  3OYJ A;  1KON A;  1MVY A;  1WJA A;  1J09 A;  5FRO A;  2R7T A;  3BCB A;  4XMZ A;  2UV1 A;  3LFU A;  1ONN A;  3OYD A;  2M7A A;  1TZL A;  3OYA A;  2JCX A;  3ZHY A;  3I3L A;  4HRI A;  1TT0 A;  1X1C A;  2ELJ A;  4PW4 A;  1D0X A;  1W36 C;  4ZTF A;  4HNT A;  2QKL B;  4ZW8 A;  3B3B A;  3PUU A;  4QPE A;  4QHP A;  2VKD A;  1V5G A;  3KEY A;  2R7X A;  3FH5 A;  2HPM A;  4CZC A;  1SC5 A;  1X4P A;  2DCE A;  4XN0 A;  4XOP A;  4ZQF A;  4ZDO A;  4ZQT A;  4ZX5 A;  1D0Z A;  1N78 A;  3W3C A;  4BL0 B;  2R4G A;  3N05 A;  3HOT A;  4RM3 A;  4RVB A;  3RAS A;  2WZG A;  2GOX B;  4ZW5 A;  3NWT A;  2Y1G A;  2DXI A;  2P0W A;  3FTS A;  4R5X A;  2ZSI B;  2C82 A;  3TBI A;  2VXZ A;  4CXF A;  4Y6P A;  5HNF A;  2HNH A;  4ZQG A;  4II2 A;  4Y4R A;  4ZW3 A;  3QOD A;  1H19 A;  5JAZ A;  3PSF A;  3RTR A;  2W82 A;  3IUO A;  3OL4 A;  2VL8 A;  5HVQ C;  1E0E A;  4ZX3 A;  4XN1 A;  4BS9 A;  4QPQ A;  3VYT B;  3MKZ A;  4Q4E A;  3FDY A;  3DPL C;  4IX7 A;  4XN8 A;  4U87 A;  5KCM A;  4FLQ A;  4R79 A;  2IGO A;  3ANM A;  2IS1 A;  4XM3 A;  3OYE A;  2Y1E A;  4JND A;  4ZJZ A;  3HPG A;  4NC8 A;  4XLH A;  4XLE A;  5FWQ A;  4BQO A;  3H9G A;  2O7G A;  4DJA A;  2LC2 A;  3CZ6 A;  4PJN A;  2JD2 A;  4XMX A;  4XOR A;  1FMV A;  4ZTJ A;  1G59 A;  2XC7 A;  3CZL A;  4DGW B;  2LRE A;  2M0M A;  3ZHX A;  3UR3 C;  4BUP A;  2JD1 A;  2CW8 A;  5CQE A;  4OWR B;  1T1S A;  2WAE A;  4YRV A;  3L2V A;  3RPU D;  4C9Y A;  2W4S A;  1ERD A;  1WJC A;  2KLO A;  2A5W A;  4N4O B;  2VQC A;  2R70 A;  2BW3 A;  4XNA A;  2HPT A;  2K9L A;  2JCY A;  3G2B A;  2R7S A;  3EBH A;  3EUH C;  3IAS 2;  2DQ6 A;  2IGM A;  3PNT A;  2IXS A;  4BEH A;  3JT1 A;  2V9K A;  4GAA A;  3K4L A;  1SAU A;  3S8P A;  3TMO A;  3OR2 C;  2BW3 B;  2HZD A;  2RRE A;  1D1A A;  3PUB A;  4XMU A;  2HVQ A;  2XF5 A;  2A7O A;  1MW3 A;  3FTZ A;  2M4G A;  3IIE A;  4BEH B;  5TGT A;  2B61 A;  4MKT A;  3K70 C;  3E0J B;  4OAY A;  2XPY A;  3OS2 A;  3CF2 A;  4ANJ A;  4RSY A;  3B7T A;  3S3M A;  2WB1 A;  3U9W A;  4KJZ A;  4II3 A;  4C30 A;  4DOZ A;  2IS2 A;  2VIX A;  1HA8 A;  4PVB A;  3I9V 2;  3FTX A;  1YX5 A;  4XKV A;  5JBI A;  2L5Q A;  4HNU A;  3UER A;  2VQG A;  2VPL A;  1QHG A;  2R72 A;  3K4B A;  4RMN A;  4PJL A;  3OR1 C;  2A6T A;  2L9S A;  3DWL E;  3RCO A;  3OIQ A;  4ZN6 A;  1ZS2 A;  3K4C A;  1GLN A;  1X4O A;  5BPP A;  3OMY A;  4ZX4 A;  2X1E A;  4XN5 A;  4NQW A;  4P1W A;  1BR2 A;  3V42 A;  4F91 B;  3CZK A;  4H4K C;  4XN9 A;  4ARF A;  1ONO A;  3LSI A;  4NUB A;  1T0F C;  4KIS A;  1YX3 A;  3L2Q A;  3QYB A;  4PK4 A;  2PMZ A;  4BXF A;  3CHO A;  4GAE A;  3A1Y A;  4NQW B;  4Y6R A;  3AL0 B;  2V6E A;  4AU7 A;  3VYU B;  1QU3 A;  4MLO A;  4BE0 A;  2QKM B;  4XOT A;  2OUM A;  4XN3 A;  4PU2 A;  2UWM A;  2XF6 A;  3ZQQ A;  2VAS A;  3OYF A;  1UAA A;  4XNB A;  4B3X A;  1UEL B;  4D1Q A;  5JHF A;  4ZC3 A;  1D0Y A;  3K6G A;  3K4M A;  3B2X A;  3DPT A;  5AEN A;  4ZQE A;  4BKX A;  4BDY A;  4G6T B;  4HG2 A;  3HG9 A;  4YEJ A;  2K3P A;  3BCA A;  3OYK A;  3MKY B;  4XN7 A;  4B48 A;  2K9M A;  4PJM A;  3CZG A;  2Q1Z B;  5CPR B;  3H5A A;  3OIP A;  5HOO A;  3FUM A;  3FTV A;  3VVL A;  4CA0 A;  1LKX A;  4C2U A;  2CV0 A;  1X1D A;  2VLA A;  4FLO A;  2W00 A;  4ZDP A;  1ONP A;  4F92 B;  1X19 A;  2E5Z A;  2IGK A;  2LH9 A;  2IGN A;  2E5N A;  3CHR A;  4OOE A;  5FRN A;  4CH7 A;  3FTW A;  1PYV A;  1LVK A;  2BVL A;  2E60 A;  3K4J A;  4RM2 A;  3OS0 A;  2CUJ A;  1NG7 A;  3CP2 A;  4Y3O A;  4K5O A;  4K5N A;  3CJR B;  3LSK A;  4F3Q A;  2CV1 A;  3LSH A;  3OS1 A;  4K5P A;  2Q2E B;  2DOA A;  2PGG A;  2WZF A;  4NNJ A;  5JC1 A;  3LSG A;  3FBN B;  1S9H A;  2F5V A;  1X3Z A;  2PL5 A;  3H0D A;  2HPI A;  1N75 A;  3ZCO A;  3W2A A;  2DT6 A;  2DJI A;  4XKC A;  4BGD A;  1Q0H A;  3LL7 A;  1X3W A;  3PJR A;  3PFY A;  3A06 A;  2JCV A;  4EAT A;  3M8J A;  3SEQ A;  2CUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...