5HNFA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 108
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnfA02
2VLAA 5HNHA 5HNFA 5HLTA
chains in the Genus database with same CATH superfamily
2EWNA 3V42A 4KMFA 4AYBA 4A0YA 1Y8RB 2R7RA 1OYWA 1MBJA 3G1OA 3G4SI 1FYMA 1ZRDA 2A68F 3UCQA 3HC7A 3TL4X 2H27A 2BW3B 4KN7X 2JCYA 1MBGA 3IWZA 4EMSA 2EQRA 2YU3A 2XPVA 4Y17A 3IHUA 1I6HJ 2F5EA 1RR8C 4YFNF 2FOWA 3BZKA 3MQ0A 2MSYA 3HOVJ 3H1CA 4V19K 3U1DA 1X1BA 4ZDLA 3LA2A 4GFBA 3OV8A 2R3SA 2K86A 5FLXK 4KFCA 1QNTA 5E3MA 3CHRA 3P9IA 4N9HA 4IRIA 3ZMSA 4RVBA 1JJ8C 3RJPA 5EGOA 1U5TB 3GBGA 4HSRA 3K1NA 3VODA 2PJRA 4JOMA 2FRHA 2M34A 3ZQLA 1Z6RA 4X6AJ 2WY8Q 2B61A 1Y6IA 4PGGA 3NEUA 2R7SA 2K3FA 1P7JA 1VQ5I 3ABKH 1G3TA 1XN7A 3FM5A 2G0EA 3FXJA 2CQXA 2UWMA 4KITB 4AIHA 3QPHA 2V1DA 4WF2A 4QPEA 5JHUA 1T1SA 2XPZA 2Z99A 1ORKA 1W5TA 3RKYA 2PN6A 1WZ2A 3HUGB 2M87A 3I0TA 3F23A 5AIQA 1SMTA 2DT7B 2QSHX 4RM2A 2HYGD 1YI2I 2FNAA 2K85A 4J19A 1MW7A 1S6LA 2H6BA 3OIOA 4X0GA 1QHGA 1OR7C 2ZXJA 4GAAA 1FTZA 1R58A 1YTYA 2V1NA 5BQTA 5LD2C 3E7LA 2BVLA 3QPTA 3WU1B 2LY2A 3GW2A 2DBBA 5FKKA 1RETA 2D1VA 2JCXA 1WHUA 2W4SA 3ZGKA 1XSDA 4RBOA 3JTGA 2TRTA 2EA2A 1I1SA 1MW0A 3NARA 3ZXSA 4ZJZA 3A01B 5D8LB 4XLAA 4MLOA 3RTRA 3PUUA 4E7KA 4EM1A 4ZZDA 4HA8A 3LL7A 1OR7A 3CMEI 1Y56A 4LLNA 4E7ZA 1LKXA 4QPOA 3G71I 3WQQA 5F08A 4ZTFA 1MNDA 4ZDPA 5B5EC 5IPAA 2K9LA 1GT0C 2LK2A 1S3JA 5LRRA 3DP7A 3MKWB 3W6JB 1R22A 2V6CA 1MSFC 1Z05A 1TQIA 3A4CA 4I6ZA 2AHQA 4PZJA 1MMDA 3WG9A 4RAZA 4BGDA 2KJBA 3EBHA 2BVMA 4O6JA 2FBHA 4C30A 1G2HA 4B4CA 2QYOA 1FTTA 1C0WA 1VI0A 3SFZA 3H0GJ 4IZZA 1KGSA 1IJWC 2UXNA 2IA1A 3GXOA 4UNOA 1IAWA 4UUSB 3RI4A 3GFLA 5HS7A 2DMNA 4D7NA 1IRZA 2EV5A 4W1UA 3ZQCA 4TV7A 2M7BA 3OYMA 3P5JA 4MFEA 3OR1C 4IQJA 1ZKGA 4BNCA 1U9NA 1LE8B 5ICCA 3H92A 2CSOA 1KYZA 1TC3C 2KRFA 3T1BA 2FBKA 5IYDJ 2MH9A 1D1AA 1MH4A 2DYSH 1VQMI 5M5YJ 1S72I 4OIQF 3ANNA 4Y52J 5FROA 2ELJA 3DLLF 1BI3A 4N0BA 3VVLA 2OU2A 1X1CA 4ZYDA 3S3NA 4CGZA 1A35A 3AUAA 1VQOI 2WAQA 2CS3A 3OSGA 3C1DA 5EZHA 2KRHA 3V7SA 4XQFA 1J9IA 4II3A 1OPCA 5D5UB 3S1NJ 3OYEA 3TMOA 2L7KA 4DYCA 4PVBA 1G8XA 2XF5A 4ZYGA 2W85A 3M3YJ 3V8JA 1Z9CA 2EZIA 5J4VA 4DZPA 2R5YA 1F43A 2R7QA 4IPAA 3GFMA 1T38A 2EPFA 4BE0A 4L9JA 3CCRI 2ZFWA 2ZMEB 3EETA 1B72A 4Y67A 3ZMUA 3IKTA 3NRVA 2IXSA 3ZHZA 2IA2A 4UVBA 2D2WA 2KDZA 4XN9A 3CLOA 1VQKI 2CFXA 5CVIA 3W2AA 1VFCA 1PUEE 1ZGAA 2DQRA 3VWBA 3FTUA 1S46A 3DKXA 2VE9A 1TQMA 2PMHA 5DUKA 4ZYEA 3FUDA 1YFHA 4R7LA 4NUBA 4CDGA 2A61A 1Z3XA 3EUHC 2Y0SA 1X2MA 1UAAA 2B0LA 2JA2A 3SEQA 2EJRA 5CYVA 2VE8A 1AKHA 3PQKA 1TWHJ 4J00A 4B43A 2AS5F 3F8BA 2I8DA 3R0AA 1H9TA 3TQNA 2XASA 1ODDA 1OLTA 3SEZA 3R6SA 4XN8A 4XRSA 2E1OA 1SAUA 2NS7A 4HDVA 4MS6A 1WPKA 3HZJA 2KIFA 2Y9YA 4AYBN 3MEXA 3L00A 1GW6A 2F4IA 3M07A 3EUHA 2J5PA 4CCMA 4BY1J 1JE8A 4QTRA 3CCSI 3FHZA 1MH3A 3OMYA 3CUQC 5J8FA 5CQGA 1CF7A 1BR2A 3O8HA 4GXOA 2DDBA 5FFZA 4C2TA 3HYIA 1HXDA 1W5CC 3SXYA 2RDPA 2WY7Q 1R36A 2LKPA 3VPRA 4PJ0C 1XCBA 3OS1A 3CZLA 4E70A 4HF2A 1I5ZA 3KP5A 3CZGA 3LFUA 4XO5A 3FTWA 4Y3OA 1Z0XA 2KFDA 1H89C 2KT0A 2PG4A 5J1UA 1FIPA 2X4HA 4CA0A 2FX0A 3WE2A 5E8IA 4IRHA 3CUQA 5D4RA 2QJ1A 3FUFA 1Z3YA 2HEOA 4LIUA 2O7GA 2QVOA 4CCOA 1TW2A 2JVHA 2L7MP 3X2QH 5EEHA 1KU9A 1JI8A 1I3AA 1ZR2A 2IGOA 3KP3A 3SJMA 2HZDA 2OZ6A 5EEAA 2HZTA 1B6AA 2PQ8A 1J75A 1VQ8I 4HBLA 5EEGA 3LNQA 1YX5A 4RB2C 3ONQA 4BXFA 3JRBA 2V6EA 5D6EA 4B1RA 4EQQA 4A3GJ 4KT5C 3DU5A 2A7OA 1MJ9A 3NWTA 5CPRB 1ITYA 3GX4X 1ETOA 5B1BH 3L2VA 2IGMA 4Y13A 2KKOA 2R7OA 4EGYA 4EM2A 4FASD 1MBFA 1JKOC 1KQ0A 2HKOA 2XPWA 1EV7A 3LSHA 3A2KA 3M4OJ 1PUFA 1Y0NA 2ZO4A 3IKVA 4UB6C 2DXIA 2L02A 2R7XA 1QZZA 4EJUA 1R5ID 3BJAA 1QO0D 4ZW5A 1QBJA 3JSZA 3H5NA 3B34A 2VIXA 1IV6A 1YJ9I 2AQFA 2LC2A 2F48A 5D6FA 5DCMB 4RMNA 5F1JA 3QP5A 2NS0A 1Q0LA 2H1LA 2IT0A 1MSEC 3Q0UA 3F8CA 5H6RA 2JWTA 2ZNYA 4S05A 4WWCA 4XN4A 4DPRA 5C4JJ 1G59A 2OV7A 2RQQA 3FU3A 2VKVA 2M1BA 4AWXB 1J0RA 2IA0A 2XAJA 4M9ZA 3SYTA 2HPIA 1BJAA 4D1QA 3EYIA 4BQAA 2JMWA 1TP4A 2X48A 1KA8A 2XAGA 1P6RA 1T6SA 3MZHA 1YIJI 2GXGA 2M2EA 2E19A 5M3FJ 4CSWA 2EB7A 3CZKA 2M30A 3JTHA 4U0YA 3EYYA 2P6SA 3I56I 4GDFA 1ONNA 1HQCA 1MJAA 1YE9A 5KK1A 2XQ0A 1ETKA 2CV2A 3CF5F 2AO9A 4C2MJ 2M7AA 3FXRA 2LYCA 2WA0A 3FBIB 4BEHA 1ZREA 2AXLA 4YEJA 3FMSA 1MD0A 3FX3A 3KZIC 3CJNA 4UVAA 3CCMI 2DO7A 3ZRGA 2M4KA 2R7DA 5EGOB 1A5JA 2DA1A 3HGGA 5EYRA 3R0IA 4BQNA 2WAQN 4OAZA 5BS6A 3OYIA 2H6CA 4LG0B 5FKMA 4Y15A 3BT9A 1IZ1A 4XMXA 4PK4A 5JFRA 3CP2A 1EKEA 1OCZH 4ZN6A 4CYDA 3D5LA 4R5XA 2Z5UA 4XLPF 2M45A 2PX9A 2VXDA 3S1QJ 2NNNA 4G12A 3FTSA 2A6HF 1TT0A 4KA4A 1ZLKA 1OKRA 3I4MJ 3RZOJ 4ZW3A 3PNVA 3I3LA 2VKDA 4CXFA 2HI3A 3HPGA 2QSGX 4DYQA 3FTVA 3CZ6A 2G7HA 2L3DA 1HBXG 4HDUA 4BHBA 3HDDA 2Y1EA 4XORA 3OYBA 5K5RA 5DLLA 1ZRFA 5GTHC 2E2IJ 3CHOA 1K83J 4OIPF 1T33A 1KZHA 4FLRA 1BIBA 2BY1A 2NS8A 4QPQA 4IQ4A 3FKIJ 1LEAA 3BG5A 1FBUA 1HKQA 1YS7A 2LY1A 3PSIA 4LGWA 1LJ9A 3ECOA 2DT5A 3RYRA 3WE3A 4A3FJ 3VB2A 1ZELA 3LSKA 1D8KA 2CWEA 5E8GA 2PLYA 5FB2A 1WGXA 2Q2EA 4FQGA 4RS8A 2M3AA 2Q8KA 3AG1H 4OIOF 3COAC 4ZQHA 4II2A 3J7ZI 1Z1DA 2XAFA 5CQEA 3VOEA 2P7CB 3AU8A 2RVCA 2X9DA 4P96A 4ENNA 1LVAA 3DCFA 1A6IA 1F1ZA 3KYCB 1J09A 3GLXA 3S2HJ 4B48A 3M1CA 2KISA 1QQIA 5LHHA 1OCOH 2CUEA 2HTSA 2ZFUA 1W7PD 1B4AA 3HTSB 2L9NA 3CMYA 2JPCA 3LSJA 1V4RA 3L9FA 5GAGJ 2LP0A 4G7ZF 4UY8I 2DFEA 2LKSA 2ECBA 1U78A 3OYNA 2DMTA 3IH2A 3O3KA 1KONA 2E2JJ 1IDZA 4YFXF 2VJ4A 1MIJA 3BPVA 1SEUA 2HPMA 1TLHB 2JA8J 4XN5A 4KUMA 1RRJA 4BH9A 3KP2A 3IC7A 5E18F 2B63J 2WZFA 3BCBA 1JGGA 3HW2A 2UUZA 3DEEA 2VONA 2EFPA 4I0AA 4AVZA 4PJNA 2QSFX 4LOCA 2C5ZA 2RNJA 1R49A 3BTLA 1LDDA 3PNYA 3WHBA 2QM3A 2JD1A 3QYBA 2V1UA 4IHXA 3DPLC 3G3ZA 3KFWX 1T95A 1FLIA 4A6DA 2FQ4A 3OSFA 3Q43A 5JC1A 3FULA 1T8IA 4ESJA 2YX4A 5E79C 4QIWN 1D0ZA 5HLTA 4IHYA 2HU9A 4HQMA 4IVNA 2VLAA 1R0KA 1JKRC 4U0WA 3OYFA 3DF8A 2ISYA 1S7OA 2WBMA 4F55A 3N4MA 4AR1A 1FOWA 1I50J 5FKNA 2VASA 2EINH 1IRGA 5J4YA 2DMQA 3K4JA 4Y6PA 2XROA 2FMYA 2D45A 2LDUA 5HVQC 5A2QK 1X3UA 3FUHA 2WTEA 3TW6A 2CW7A 5JR3A 1P4AA 1OCRH 1BJZA 1I39A 1WSUA 1HC8A 4RB3C 5DDGA 5K5OA 1TT5B 1FT9A 3MMYB 1R4NB 1K6OA 2VJ5A 3K4MA 2VQCA 3DKWA 3JRDA 4U88A 3RQIA 3REOA 4YIFA 1SFXA 3H9QA 3QYEA 3B7TA 2LH9A 3GTPJ 2VUMJ 4QSHA 4XRMA 4BBSJ 3WTSC 3CJQB 4E7JA 1WH5A 1WJAA 1AKHB 1PDNC 4K2EA 1I6XA 3U9GA 2DN0A 4XNAA 3S93A 5IY5H 1FOYA 2YUSA 4IL6C 3U2RA 2HPTA 4XL9A 2MG4A 4XIDA 4A0ZA 1ON2A 5C3EJ 5JI6A 3BC8A 3HEFA 1JGSA 4KN4X 1UZCA 3V8KA 1XG1A 3VSLA 4AIDA 2MYSA 3U1KA 2L4MA 4MQVA 2PFBA 1ETXA 1NH3A 4K5OA 2LRDA 2EZLA 2Y9ZA 1WJ5A 2E36A 4N9IA 2BV6A 1UFMA 4WX9A 1G3SA 2M8GX 3NQOA 1Y1VJ 1Y39A 5IYCJ 1YYVA 4C2UA 3HOZJ 4ANJA 1YW7A 2CH0A 5JLXA 2JTVA 1WFXA 3JR9A 3S14J 2JJ7A 1MBKA 2ACJA 1MDMA 2Y30A 3T0YA 1GV5A 1XMAA 4XMZA 2IRFG 5K7FA 2PMZA 4OMYA 3B37A 2OD5A 5BPPA 4UB8C 2DA5A 3W2VA 4FCYA 2HQNA 3ERMA 2BXYA 2ME6A 4U0VA 2RC4A 1XMXA 5E20A 4AICA 4HAMA 3CCYA 3IV5A 3GTJJ 4LG3A 4NB5A 1BC8C 1R0LA 2MA3A 1RKWA 5ILSA 1BR1A 1JTYA 1TQPA 3HOWJ 3ZPLA 3JRIA 2EIJH 1H9GA 1P92A 2YU9J 2E60A 2P5VA 3LSGA 3OL3A 2BY2A 4DIQA 2GXBA 3WU0A 3BR1A 4R5VA 4GO1A 2L9SA 3A02A 2XRNA 3AFHA 5DD8A 4KISA 3J7AY 4XRFA 3VEPA 1MMAA 2X0LA 5CVRA 1IF1A 4FLOA 2IEKA 1B9MA 1R7JA 4R1HA 2NXNB 2V9PA 4DNCA 1QZYA 2E71A 3E6CC 1U6GA 2NOJB 2JT1A 3UKGA 3FH5A 2DDAA 1L0OC 3HOUJ 3Q5FA 4D5CA 3EBGA 2CFOA 5IP9J 3VYTB 1PUFB 5JMWA 1MBHA 2MABA 3WODF 4V2GA 1R1TA 2PMUA 3CDLA 2PJPA 5D5VB 2OAZA 2LREA 5GPCA 4LK0F 2W82A 2QQAA 5B1AH 3QOPA 2Y1GA 2K4JA 2JD2A 2DI3A 4OOFA 2OBPA 2OTLI 4XKCA 1FEXA 4YELA 3F22A 3DTEA 3S32A 3GCMA 3LSMA 5C44J 1GVJA 1X4PA 2FA5A 4G94A 2XRLA 1TWAJ 3KX2A 4S0HB 4XMTA 3RPUA 1YRNA 3JRCA 1WQ2A 1G3WA 1A31A 1HKTA 1K78B 2HDCA 3BR2A 2VL8A 3CLQA 2NVUB 4OIRF 1JKQC 1MNEA 2VODA 1TTYA 4HQEA 4CCKA 3A06A 3HG9A 1SFEA 3E97A 1O4XA 1ONOA 2E35A 2WB1A 1E3HA 4BEHB 4FX4A 1JHHA 5ICGA 1RIOH 1R71A 1YG2A 2E34A 1R4MB 1O7FA 3FKJA 4AUXA 4G8XA 1LVKA 4RM3A 2A05A 1X19A 3OYDA 3IIEA 1BOAA 2IP2A 2IS6A 2JRTA 1WH7A 3WGGA 2Y48A 4XN7A 1LFPA 5BPIA 2WAFA 1ACIA 1ULYA 3GTGJ 2MC3A 1DP7P 3RC8A 1JG9A 3U21A 2A3SA 2ZXIA 3FZVA 3ECHA 3K4KA 4HNUA 4YRVA 4I2OA 3ZN1A 4G6QA 5FGMA 2JUCA 5FJ8J 3E6BA 4A5NA 2RAEA 1HKSA 3C3WA 5B66C 2GOMA 3CCEI 1NTCA 4G9YA 5IT3A 1ZHFA 3TO7A 3F21A 4B09A 3J7AO 4DGWB 3VDXA 2ECCA 4D9JA 2DQMA 1GV2A 4OMZA 3BG6A 4WXHA 4XNFA 3TBIA 1HDPA 2BZTA 4IEJA 1FP1D 3CJRB 3FWEA 3W6KB 4F3QA 4F93B 3K4LA 2DQ6A 3EQLF 4DYRA 1F9NA 1QHHD 1W7PB 1OYIA 3DV8A 2QENA 3KIOA 1IV8A 5F0HA 4RLQA 4EGZA 1GLNA 5DUIA 2Z33A 2ICWG 1IGNA 1V3FA 1YQAA 5CKTA 4IHTA 3OYKA 3CIAA 1ZGJA 3KZZA 4Q48A 1IXRC 2X51A 2Q2EB 3G1LA 5HDNA 4AIKA 2K02A 4PGHA 3HRMA 5H6QA 1Z7LA 1YX3A 3CZEA 1K5HA 2XF7A 1OMIA 5TJJA 2L9RA 2ZBKA 3FK6A 5K1YA 4HX8A 1XGMA 2TCTA 5JMPA 3ZI0A 4D5FA 4KNYA 5LEKA 4K5MA 3A1YA 1M1EB 2LOOA 3CUOA 4G6TB 2MH2A 2MD0A 2GWRA 5F1RA 4UUVA 1SC5A 3V4GA 3ZQHA 3L2CA 4CYCA 1X1PA 2XPYA 1IN8A 3L2QA 2JD0A 4E7IA 2JA6J 1XGNA 3AAFA 1E3OC 4EJWA 2FXAA 1OCCH 4XLFA 4ASNA 3CO6C 1VTNC 1YIOA 3SDGA 4HF1A 4LB6B 5IP6A 5HLHA 2YSRA 1ENHA 3BJOA 3ML6A 1J7KA 1O3QA 4G7OF 2HQRA 2A5YB 4A5MA 3D0SA 3F6VA 3P9CA 3MKLA 3ABMH 3BJ6A 3B6CA 2X6WA 2W00A 5IT9K 2COBA 2VBYA 3ANLA 4HG2A 2MFZA 1IXSB 1MZBA 2GM4A 3RDIA 3I59B 2JV7A 1MBEA 1JTXA 2IPQX 3K70C 4XLCA 3BDDA 3SZPA 5CVJA 3J80K 3WTWC 4CO8A 2OQRA 2W48A 1YW9A 1I3QJ 4NQWB 4XMYA 3ZHXA 3PFYA 3FH7A 2WAEA 5L3GA 3DTIA 1REPC 5FRNA 2LFBA 4WCGA 4WXDA 2LVSA 2UV1A 5CVUA 2YR2A 3CF2A 3TW7A 3I4NJ 4H0EA 1WI3A 1WWXA 5F04A 2A6TA 2KRCA 3FUJA 3MD2A 4BL0B 3K2ZA 3HHGA 2R5ZA 4RGRA 4BAYA 2W24A 2YPRA 4M6XA 3L09A 2FFLA 1SANA 4UHTA 3HOXJ 1U8BA 2ELKA 2VT3A 4Q5SF 4M74A 4X1EA 4LD5A 5ILUA 2F5VA 4L2LA 2CV0A 2O0YA 3QODA 4IF4A 3OYCA 5IT9Z 1E0EA 1ZG1A 4KIGA 2QBYB 3GF2A 2ZSIB 3M9AA 4ZDOA 2DK5A 2RNGA 2L7FP 2P7VB 3O6BB 2FOKA 1FZPB 1VQNI 1X3WB 5HNFA 3C2HA 4MQ9F 2ZCWA 3J80Z 2KIUA 5FFXA 1WJDA 4EVIA 2ZB9A 2XC7A 1IN7A 1UG2A 3G2BA 5GADJ 3K70D 3ZQQA 2KHMA 1T39A 5JAZA 2O6GE 4FX0A 1W0UA 1HW5A 4Y7NJ 3KZYA 4PW4A 2BHZA 3K6GA 2HXOA 4P9UA 1I27A 2VKHA 1NK2P 1Z91A 3M7GA 3S1MJ 1B8IA 2X6XA 5L3EA 2XVCA 3DBLB 4BQOA 4F92B 2LBFB 3K4NA 2ZJQF 2R92J 2AQEA 2NVQJ 4RB0A 2RV8A 1MVYA 2GAUA 2R72A 5HODA 2NVXJ 3JSPA 3DLAA 3AG3H 3F3XA 4GRIA 2DAOA 4HNTA 1MDMB 3FTXA 5HDKA 4S04A 4BDZA 5L3DA 4LLLA 3EBIA 2F4OB 3MZ8A 4XN0A 4ETSA 1BR4A 1RR7A 1H3LA 5CJ9A 2QGUA 1AOYA 3HRTA 4A6EA 1SG7A 1PVEA 4AVPA 1BW6A 2DOAA 2ESHA 5LGNA 2XKPA 3MCZA 2M5WA 1SVOA 2XDVA 3WTTC 1WJBA 3JAMK 1JGIA 4QMEA 1Y8QB 2TDXA 3F9KA 5FD5A 3CHQA 1CGPA 1T98A 4ZX5A 3ZCOA 2MAPA 3C2BA 1V54H 2DOEA 2V26A 4QLCU 2BW3A 3H9JA 2R7ZJ 1WCMJ 1MMNA 1D0XA 3PL8A 4P55A 1DGWY 4M72A 3PFIA 4AIJA 2V9VA 1RKTA 2QLZA 1O57A 6PAXA 1WKMA 2X1CA 1USSA 4LITA 4Q4ZF 1KU7A 1DP3A 3ABTA 4IHSA 1A04A 2DU9A 3K2AA 4A69C 5LFAA 3HSFA 2GXAA 1WVRA 1U5TA 2DA3A 3IL2A 2MBFA 3QRFF 3CMAI 1HDDC 4A93J 3FU6A 2FEZA 4PUSA 3BR3A 2R0QC 3EUAA 2VOPA 3CESA 2UZKA 2JSCA 1S9HA 2R7VA 4C3JJ 3ZN0A 5FLMJ 3DEWA 1X1DA 2P8TA 2CG4A 3ZMVA 3JAMZ 2VBXA 4IKFA 1Q0QA 5LGUA 2PJRB 3HUGA 1D5VA 3K0LA 4JX6A 2J5OA 3T8TA 2Q1ZB 2V1XA 5K7ZA 1YJWI 2Y2ZA 4HYEA 2GA2A 4M3BA 3ZMZA 2ZXHA 3LQRA 2FU4A 2VJ8A 2QQBA 5DS9A 3K1PA 1DU6A 4PJLA 2DMUA 4W97A 2X85A 3F6OA 4I02A 3TO9A 1JVSA 4PU2A 3CCQI 1K4TA 5LRSA 1VQ7I 4MTEA 2O9LA 3BG7A 2V79A 1LB2A 3AU9A 1MW3A 4M3EA 2C82A 1P9QC 3JW4A 1YOVB 2VC1A 3K10A 4H4KC 1S29A 3BOQA 4BKXA 1UHMA 2L01A 3BQZA 4CCLA 2NYXA 3WTZA 3PSFA 3A01A 3HB9A 4A3JJ 1OISA 4AR9A 2MAOA 1IW7F 1VQ4I 5BPDA 3W3CA 2O3FA 4IXAA 1S5LC 4BXUA 3PIPF 2X6YA 5IOYA 1RI7A 2HQAA 2K9MA 3B7RL 1FYLA 3CCJI 3S2WA 3O2PE 2NVTJ 1SQMA 2Y0SN 2PEXA 1GXPA 3JRAA 4ESFA 2DYRH 4XLNF 3T5XA 5M5XJ 3KE2A 2K3PA 1VQPI 4XNBA 4PDKA 2HOEA 3LFKA 5FO5A 3DBHB 2EILH 3FBNB 4YFKF 2GOXB 3ROUA 2A07F 2YS9A 1DUXC 2Y69H 3OWTA 4BDYA 3FH8A 3RQ4A 5KAFC 3ZP5A 3R4KA 2GZWA 3B6AA 4F52A 3E0JB 3BTJA 1ON1A 3A0BC 2XHKA 5ILVA 3CCLI 4L0YB 3F8MA 4E4HA 3GTQJ 1NK3P 2JN6A 4BUPA 3L2WA 1WRJA 4ENKA 1RESA 5DCFA 4DQ2A 2LY9A 1ZYRF 4RAFA 2MLGA 5GPAA 1R23A 1UCRA 2JZYA 4PCQA 4XKBA 3CDIA 1LE8A 1HCRA 3B7SA 4JQFA 4O5VA 3KETA 2OCCH 1N78A 3RYPA 4F7ZA 3LAPA 1XGSA 1TW3A 5EV7A 1S7AA 2Y31A 3Q9VA 4HLXA 3FUNA 4IO9F 2RJIA 3F0CA 3TP3A 4XBFA 2M9HA 3CCVI 3Q0WA 1R6RA 2HOTA 5KVRA 2XKOA 4MHGA 5L3FA 3MKYB 5HLIA 1XX5A 4KIBA 4IOAF 2FMLA 2UXXA 5LEJA 3GMEA 2ZKZA 1Z67A 1K4SA 1MW1A 3I4PA 4Y6SA 1KYWA 1ONVA 2P81A 3OY9A 4XO4A 2EH3A 3S1RJ 2YX7A 4FLSA 3BR0A 1FYKA 1XDUA 4DZJA 1IDYA 4XO3A 3HBLA 3MKZA 2KL4A 4KICA 1WJFA 2Z1DA 3I9V2 3SZGA 4XICA 4UV9A 1Z21A 3L2UA 1T0FC 4HLYA 4FT8A 1AU7A 2CV1A 2VC0A 3GZ6A 3UNGC 1I1GA 1A6QA 1S8NA 2ZJ2A 1ETWA 2ZMEA 2QA4I 5CVVA 3CCUI 2DFHA 4DBRA 4UVCA 4A3MJ 5FRMA 1G3YA 4N4NB 2DFFA 3K7AJ 4XMWA 5KNLA 4KDPA 5DM7F 2JQ7A 3E5UA 2ZNZA 4EV0A 3TGNA 2R5YB 1FJLA 1TBXA 3FUEA 4M73A 1ZRCA 5FLVA 2VT2A 1FMVA 2KZGA 2L7ZA 2QVWA 1B72B 2XAQA 5FWQA 4M3DA 1GDTA 3CTAA 4A3EJ 2Z9OA 2IGNA 4Z2YA 3ZMTA 1SD5A 1SMYF 2I10A 1T0FA 3KEQA 4EJTA 1BI1A 3SZTA 3FIWA 2HVRA 3BTCA 4CZCA 2F5DA 5D4SA 2DK8A 1N25A 1R00A 3BP8A 5H20A 2IGKA 1SFUA 3IRQA 5JNLA 1ZGWA 3MVPA 1X3ZA 1DGRM 4E6KG 4NNJA 2EV6A 4BBRJ 1EH7A 2EIMH 2BBYA 4A3BJ 1B1BA 1LQ1A 4R8HA 1X58A 1U8RA 2STWA 1VNDA 2W57A 3DTKA 4XR6A 2XAHA 5AENA 3VSKA 2VQHA 1A36A 3J81K 5DM6F 4XN2A 4FTHA 5AONA 4LLGF 1ONPA 2NOGA 1IC8A 3Q0VA 2KPMA 3KP6A 3NAUA 5M5WJ 4GGGA 4HF0A 2KQRA 3QU3A 2ZSHB 3HIFA 4FE7A 1HLVA 1USTA 2KIQA 1H19A 1ZG5A 5DD4A 4C9YA 1U9OA 2PUSA 1CF7B 3ZHYA 3L1PA 3KLOA 2OCEA 4M6YA 2H94A 1IXCA 2HVQA 1ETVA 1RC9A 4PJMA 2NRAC 2WPGA 3R60A 3SHFA 4NHJA 2F5CA 5EZGA 2ZC2A 1W0TA 4MEYF 3KYLA 1D1BA 2R7WA 4HEA2 5E1WA 5HS8A 2HOSA 4ZC3A 1MNMC 4QWQA 3ASNH 1IG7A 5JVGF 1FX7A 1D1CA 2W84A 3CUQB 4L5IA 3B3BA 2DQLA 2B7EA 2RQPA 3DKYA 3J81Z 3WTVC 4CCNA 4Y4RA 1JJ6C 3TDUC 1LNWA 1FIAA 3QWLA 3BG3A 2STTA 4G7HF 2K4BA 2DA2A 2FE3A 3GTKJ 1ZG3A 3GZ5A 3FXKA 4RCVA 3G73A 3JT1A 1ZH5A 2F4MB 2RREA 2H8WA 3MWMA 3WGHA 4EJOA 3BR6A 2P4WA 4YIIA 2HNHA 1OFCX 2NVYJ 4OINF 2OUMA 1YW8A 2WADA 4RGUA 2G7UA 3Q44A 3HOTA 4ESBA 3FK7A 3K1MA 3HOSA 4GCVA 2LF7A 2L4AA 5IYBJ 3SQNA 3ZOBA 3HSEA 3FTYA 1Y0UA 5DULA 5DCMA 1Q0HA 4CH7A 1LFUP 1E2XA 3TOBA 3CHSA 4A3DJ 2WC2A 1IRFA 3OYLA 1LDJA 2GA1A 4PFOA 3TDZC 2JA7J 1HF0A 2LMDA 1SD4A 2D5VA 4RGSA 2GLOA 2PBIA 4IJAA 5D8KB 5F27A 1ERDA 4XM3A 3ZQFA 2X6OA 3ASOH 4M3GA 2CQ7A 4AD9A 1HW1A 2ESNA 3QU6A 1FOKA 3MN2A 1HSTA 2BY0A 3OIPA 1ZAOA 2D1HA 5TGTA 1YLFA 4AYSA 2VB6A 1UHWA 3RKWA 3FM3A 4MTDA 5L3BA 2B9SA 2IJLA 2XV4S 2Q0OA 1ZK8A 3QOEA 5D5WB 1IUYA 3E5QA 4L5EA 4OU0A 5TRDA 2EFWA 1RPWA 4D7MA 5J6XA 5E1XA 2EFQA 3N05A 2ADUA 4JX5A 4DJAA 1ETYA 5EJCA 1GHCA 3K4CA 5JLWA 2BE5F 4BS9A 4P9FA 2PGGA 4LG0A 2E1MC 5IOZA 3KEDA 1FBSA 2QKMB 3HM5A 5FKOA 3PQJA 2HVSA 1V5FA 2CW8A 2FSWA 3GTOJ 4HV6A 3RPUD 3ABUA 2IBDA 5DTDA 3A14A 3HRUA 3L2RA 2DJIA 4B3XA 2MLKA 1RP3A 3WQSB 3H36A 3C18A 3E6MA 1U0JA 3QJXA 1SD6A 1DPUA 3M1EA 2XIGA 2Y75A 4CUGA 1B59A 2VI6A 3LAJA 3CD6I 2RGVA 3S15J 3ZR8X 3RIRA 4QHPA 1DDNA 3RC3A 4NC8A 2P6TA 4L18B 3E6DA 4Q4EA 2WV1A 3MZYA 4P5OA 3KP7A 4LK1F 3RCOA 5LHGA 3GFJA 4IHVA 4BYYA 5ED4A 3OYGA 1XCVA 2O7OA 2DOFA 2IS2A 3VYSB 4FETA 2JK3A 4U7DA 5FLXZ 2HWVA 2RKHA 3CJTB 4XKVA 4A2UA 1D8JA 5IP7J 2FD5A 5JHFA 3H3VK 5EG0A 2NAZA 4ZQGA 2LSOA 2WWYA 2KIMA 2GTQA 2HKXA 1CQTA 2XSJC 4XSXF 4I7HA 5FKLA 1EA3A 4C3IJ 1JUSA 4GAEA 3DBRB 3D5SC 4XMUA 1APLC 1SC7A 4ZW8A 1MW2A 3SDBA 5KAIC 3FUKA 1ZLJA 3OYAA 1Z7UA 1G5AA 5BMZA 4XN1A 2E2HJ 1Q1VA 4A03A 4RGXA 3B2XA 4ZYHA 1VF9A 2CQQA 4OAYA 2EIKH 4BE1A 1IUFA 2W1OA 1SVMA 2W25A 3ANMA 3WTXC 5C4XJ 2VJIA 3RSNA 3TOAA 5H2FC 1W5SA 4NC7A 2IS4A 3BY6A 4XNDA 5B3SH 3O8GA 1QVUA 2CW0F 2LD5A 4A0XA 4HX4A 3P7NA 2BHYA 1X1AA 3RKXA 1VQ9I 3GTLJ 2XAUA 3BTIA 3EUKL 3M8FA 1HOMA 3AG4H 2FF4A 4MGRA 1J2XA 4FLQA 3AL0C 3QAHA 4ZTJA 2HS5A 1D5YA 2K40A 3FHEA 1AWCA 2R93J 1KQ9A 2OQGA 3FU5A 1TWFJ 1FOXA 3BCAA 1FP2A 4EEFG 1SD7A 3FMQA 1K7AA 3CC2I 1WJCA 1MKMA 1SVLA 3TO6A 2L54A 2QF7A 1W36C 4PJJA 2ID3A 2Z2SB 2PMZN 3H35A 3B73A 3I64A 1Z6TA 3A03A 4ZH4F 3HL2A 2MD5A 5BOXA 1STZA 4KJZA 1BC7C 1EH8A 2FUG2 3B7UX 2KDOA 3H5AA 5J8CA 2L5QA 1S7EA 1RUNA 1HSJA 1KU2A 3BZ6A 4M9XA 3JCUC 2KLOA 4M71A 4U7BA 1XSVA 1X2NA 1AHDP 2CGPA 4P1WA 4XOPA 3OYJA 1QU3A 4F91B 3DU6A 1Y1WJ 2A69F 2LG4A 1QA6A 1UELB 3ABLH 2L2OA 3QPSA 4X2UA 2FBIA 4O3MA 4ENJA 1HA8A 4ZX3A 2GIVA 1QVTA 5J1YA 2VBWA 2AXTC 4ITVA 2RN7A 1R9TJ 3HTUA 3ESWB 3I55I 1BM9A 2VPRA 1JT0A 3GLLA 4M3FA 2LR8A 3S2DJ 2Y1DA 1U3EM 3FHNA 2QEXI 1FPQA 4IX7A 4ZX4A 1ZARA 5K7HA 5LGTA 1P2FA 3IUOA 1TZLA 2WZGA 2EFOA 3ZMDA 2K5CA 3FXMA 1NG7A 2CQNA 4BHCA 3LSRA 1KQ8A 3FUIA 2BGCA 5HNHA 1UJ8A 3P9KA 1WJEA 1SFOJ 2HOAA 3HKZA 3JRGA 3E3VA 2Y1CA 3NWSA 1X3ZB 3I58A 3CP8A 3OIQA 3FUMA 2F2EA 1UMQA 2DCEA 1W36D 1ZS2A 2BY3A 4BJTA 5HLGA 2F5FA 2QCOA 3KCCA 4XLEA 3PJRA 1IO2A 1PP8F 2DA4A 3D5RC 5ICFA 2JRMA 2V7FA 3QPLA 2JSPA 3HGYA 4M6VA 1WI9A 4PFPA 5D5XB 1KU3A 2CRGA 3DEUA 1YS6A 1ZR4A 3PO3J 4ZQFA 1OJLA 2BEOA 5GP9A 2ETHA 3BG9A 4ARFA 1T56A 2VPLA 2O5RA 1VQ6I 2PI0A 2N8GA 1JHFA 4OOIA 3U9WA 3CC7I 4UV8A 4AR8A 2CO5A 4Z6YA 4BXXJ 3IWFA 1K6YA 5E17F 2VJJA 4OWRB 3GFIA 3BWGA 1ETQA 2C6YA 2CQKA 1T1RA 3KLNA 3N97A 5E3LA 1FBQA 3W2WA 2VKEA 4L0ZB 1H0MA 2E5NA 1HW2A 2WB1N 2EBIA 2CUJA 2X1DA 5DEQA 1TL8A 3S17J 2CMPA 4A3LJ 1W4MA 2DLLA 1BN5A 1U2WA 3BZCA 1IN4A 1MMGA 2L0KA 3LSIA 4I99C 3V7CA 1D0YA 2DFIA 1O7LA 3I53A 5HS9A 2VQGA 2GIZA 4YG2F 4ENMA 2E1NA 1FMWA 4AM3A 5ERIA 3SFIA 1MJBA 3RPQA 3WTUC 5E3NA 2KP6A 1OCPA 2VN2A 3F8NA 4LFUA 5E1ZB 4JX4A 4B44A 3LSPA 3V8LA 3H3ZA 3LOCA 2M8EA 4E7HA 1EJ9A 1W1WE 4XMVA 3ZQGA 9ANTA 4BE2A 4M9SA 2QKLB 4IRGA 2Y0MA 3FF5A 3TKYA 2K27A 1LPQA 2R70A 1FY7A 4DW6A 4K5PA 4A12A 1F4KA 2H1KA 3IH4A 3OYHA 4ZX6A 2K9SA 4RLFA 4HZFA 4HOBA 1U5TC 1RZ4A 3E1SA 3FU0A 4MIMA 4FCAA 4A3IJ 3S3OA 4IHWA 1SAXA 1YJNI 2DT6A 2VQLA 3CQZJ 3S8PA 1GUUA 1BI0A 1V5GA 4XONA 4RSYA 3I71A 3K4BA 3S3MA 3HHHA 4R5TA 3J7YJ 1YHQI 1RNLA 2JPBA 1T08B 1PJRA 3T8RA 5K5QA 2R7UA 3BPXA 2CYYA 4XOTA 2NNYA 3M8JA 2QQ9A 4HRIA 4EATA 4I76A 5FD6A 4KP7A 2QWWA 1O3SA 5JBIA 3LA7A 1X4OA 4J01A 1H8AC 1VZ0A 1UHSA 4E7LA 4E7SA 5ICEA 3OS0A 1BW5A 4NC6A 1JKPC 2BYVE 5F0FA 4CICA 1K78A 4WXCA 1UB9A 2MW8A 5JO0A 4B3AA 3LMMA 1QPIA 3FMRA 2E7WA 3KP4A 5J3LA 4JK1X 4A3KJ 3C7JA 4KYWA 3R61A 2DTZA 3PO2J 1TWCJ 2E1CA 1E3PA 2CUZA 1P4XA 3K69A 1YRNB 4J3BA 2ZXWH 2WV0A 4N4OB 4HSTA 3Q3SA 2HDDA 3BLYA 2Y1FA 3KEOA 4AU7A 2DPUA 3VYUB 1R5GA 2O8KA 4GYIA 3RZDJ 3H3UA 3AKZA 4AC0A 4ON0A 5AIPA 4JYKA 1PYVA 4RA2A 1EF4A 3B2PA 2MC4A 4IOCF 2IAIA 2L9VA 2K9NA 2LKXA 3UR3C 1K61A 3A0HC 1PP7U 3IH3A 2HYFA 3AG2H 3FTZA 2CU7A 4G6DA 5F64A 4WK8F 4RAGA 5M3MJ 1TNTA 2H8RA 2LTPA 4FE4A 3RKQA 4HPQA 2HXIA 3DQVC 3JSOA 4RAYA 2F6CA 1V5EA 2VBZA 5CLSA 1N75A 2KMUA 4XKWA 3HXLA 4C3HJ 3K9TA 3C2GA 4Q47A 5E3OA 3WTYC 2ZJRF 1XS9A 2OTJI 3CDHA 4XK4A 3CMMA 4EJVA 5KCMA 2HFHA 3FDYA 2LF8A 2JUGA 3EDPA 5GTIC 1OYYA 2BXZA 3PUBA 2EK5A 3OL4A 2VXZA 4KIFA 4L9VA 1OCTC 2E1MB 5EF6A 2ZJPF 4JBAA 1EH6A 3FXLA 1XPXA 1UG0A 3GWZA 3BROA 3WG7H 2MGQA 4QIRA 2K7LA 4L9NA 4HNVA 3TP0A 3PM1A 4Q4IA 3M8EA 1OQYA 1W7PA 2XUBA 5HOOA 4HW0A 4UUSA 5EG0B 3KEYA 4NBQA 1BL0A 3WHCA 3S16J 4LJZF 1XB4A 3LA3A 2V9KA 4XLHA 5J47A 3HKZN 4KMUX 5GAHJ 2JA5J 4Y6RA 4ZQTA 3I5UA 1QZEA 4ZZLA 3R0JA 3HOYJ 3G1MA 3VFZA 4XN3A 4CHUA 5BNGA 2Z3YA 3FXQA 2JVGA 2EFNA 3H5RA 4V2FA 2EZKA 3I54A 1XSXA 3QYFA 1FSEA 2M0MA 4FHTA 1XGOA 4LB5A 4BJ6C 2ZMEC 3HSRA 3GO5A 3GTMJ 2DPDA 3CC4I 2ID6A 3DXJF 3FISA 4B47A 2ISZA 4BJ5C 2P5KA 2O03A 5DYMA 5L3CA 3MFKA 3WQRA 4HX7A 3LWFA 4XSZF 1N77A 1XD7A 2HGCA 4XRSG 1TWGJ 4K5NA 2KJCA 3H9GA 2DODA 3OOPA 3HRSA 2BOLA 3GUDA 1Z77A 1XC5A 2ELHA 5KHDA 5J1RA 4CYCB 3JRFA 2V4JC 2QUFA 2R7TA 3OOUA 1FNNA 1GVDA 1LDKB 1MGTA 1E17A 2HDWA 4KT6A 2M0CA 1IRXA 2CJJA 4PSXA 2HYJA 1NG6A 5LLQA 1ZTRA 2HTJA 3GVAA 4U87A 4OOEA 5DV5A 2XGXA 3QP6A 1R5HA 2IVMA 4YIRX 1AA7A 2DTRA 3T8VA 2XB5A 2OF7A 2EZHA 3I59A 3D1NI 1L3LA 4QUOA 3UEQA 2R4GA 3IP4B 3FXOA 5TISC 1GXQA 1P7IA 3OS2A 3PUFA 1J5YA 2QZ8A 3JREA 3W6VA 4NQWA 3GZNB 2X1EA 3WU2C 1V55H 2GQQA 4BHPA 4LMYA 3AL0B 4ZW6A 2O8XA 1NHAA 1HS6A 4GYGA 4CZZA 2M4GA 1R1VA 3ZQ7A 3IAM2 4I01A 1POGA 2HR3A 4MKTA 3G6EI 1F36A 3IAS2 3DFGA 4EM0B 1LUJB 4B8XA 1IN6A 5HDGA 1ZN2A 2OZUA 1BIAA 1DU0A 3H0DA 3F8FA 4JP0A 2EA4A 3DPTA 1QPMA 4I0BA 3JRHA 3VYRB 1Q1HA 3ULQB 3QQAA 2R5ZB 4A3CJ 1FSHA 3PNTA 5LHIA 4L5JA 2XGEA 1R1UA 1RUOA 3CHPA 2W7NA 2QBYA 1J59A 3IRRA 1DPRA 1FWZA 3Q9SA 2QQ8A 1IN5A 3DWLE 4HV5A 2HPOA 1X3WA 4MFDA 1QGPA 1YITI 2GBYA 2FJ1A 3FXUA 4PSWA 3DPUA 2XSDC 1G4DA 4LUPA 2HQ5A 1JXSA 3WGIA 5JVTA 2I5UA 1XDSA 4K5LA 4ZQEA 5GAEJ 2DJNA 2ZXGA 4I09A 2FQ3A 2R7FA 4MO7A 4MNUA 4LIVA 2R59A 4Y33A 5A2QZ 2COMA 2IS1A 5EDNA 2XGCA 1O3TA 2LNBA 4BU2A 4NDLA 2PL5A 1XTAA 4UXNA 1K79A 2KZVA 1BBYA 2LBFA 4UUTA 2Z16A 1FC3A 3HPHA 2FNPA 1JUPA 2A6EF 1JUMA 1F5TA 2OJED 4I98B 1DQUA 2OPTA 2DW4A 2P5LC 4FISA 5F0CA 2DA7A 4BQQA 4ZYAA 3PIOF 2ME0A 2XF6A 3E5XA 1O3RA 4JNDA 3CXBA 1MMSA 3GYHX 4L9TA 1VQLI 1BA5A 3OR2C 5DYFA 3GEZA 1XMKA 1B8IB 1LEBA 3LQQA 3CO7C 3EPZA 3ZQIA 2K9QA 2O61A 3V7RA 3VVMA 3KPHA 4D0PA 3KYDB 1D3YA 5F6FA 1LFBA 1SFKA 2H09A 2P0WA 3TEDA 1JT6A 1TNSA 2OC6A 2EV0A 1T2KA 4R79A 1YO5C 3ELKA 1H88C 1BOBA 3BQYA 2XPUA 4DBQA 4RDUA 2LLKA 4RB1A 2EGHA 1ZQ3P 3RASA 2IW5A 3ERED 1BI2A 1G6NA 2G9WA 3L7WA 2VOOA 4ABZA 1QRYA 3BR5A 3F72A 4BACA 2DA6A 1P4WA 3B02A 4CCJA 2A5WA 4DOZA 3HJEA 4BY7J 3UERA 5LBQA 2E5ZA 2CUFA 2E7XA 4ZW7A 3MAJA 1B9NA 5J40A 2DMPA 3LSTA 3ISPA 2JCVA 2XGDA 2XB0X 4MEXF 2OA4A
chains in the Genus database with same CATH topology
1DGWY 3V42A 4AYBA 2R7RA 3Q43A 5JC1A 3FULA 3UCQA 3HC7A 3TL4X 2JCYA 2BW3B 3HL2A 4KJZA 1D0ZA 2X1CA 4LITA 2FUG2 3B7UX 5HLTA 2KDOA 2HU9A 3H5AA 2L5QA 1DP3A 2KLOA 2VLAA 5LFAA 4U7BA 1X1BA 4ZDLA 1R0KA 3OYFA 2WBMA 4F55A 3FU6A 4PUSA 4AR1A 3CHRA 4P1WA 4XOPA 3OYJA 2VASA 1QU3A 4F91B 3DU6A 4RVBA 3EUAA 2LG4A 3CESA 3GBGA 1UELB 3K4JA 1S9HA 2L2OA 4HSRA 4JOMA 5HVQC 2R7VA 3FUHA 4X2UA 2WY8Q 2B61A 4ZX3A 2CW7A 1Y6IA 1HA8A 1X1DA 2R7SA 4ITVA 4IKFA 1Q0QA 2PJRB 2UWMA 4KITB 2Y1DA 4QPEA 2Q1ZB 3MMYB 3FHNA 1T1SA 2XPZA 2VJ5A 3K4MA 4IX7A 2VQCA 4ZX4A 2WZGA 3IUOA 1TZLA 3HUGB 2ZXHA 3H9QA 2DT7B 2K5CA 3QYEA 2VJ8A 3B7TA 2LH9A 1NG7A 4RM2A 3FUIA 4PJLA 2X85A 1MW7A 5HNHA 1JVSA 4X0GA 1WJEA 4PU2A 1QHGA 1OR7C 3HKZA 3CJQB 4GAAA 2Y1CA 3NWSA 2V1NA 3BG7A 3CP8A 3OIQA 4E7JA 2DCEA 1WJAA 1W36D 5LD2C 1MW3A 3AU9A 3FUMA 1ZS2A 2C82A 1P9QC 2BVLA 4BJTA 2LY2A 4XLEA 4H4KC 3K10A 3PJRA 4XNAA 4BKXA 4CCLA 3D5RC 3S93A 2V7FA 2JCXA 2JSPA 2W4SA 3PSFA 3ZGKA 2HPTA 4XL9A 4PFPA 4AR9A 2MAOA 4ZQFA 1MW0A 3ZXSA 4ZJZA 3BC8A 3W3CA 2PJRA 4XLAA 4MLOA 2X6YA 4ARFA 3RTRA 2HQAA 2K9MA 2O5RA 2MYSA 3VSLA 4E7KA 2VPLA 3PUUA 4K5OA 2LRDA 3LL7A 1OR7A 1Y56A 4E7ZA 1SQMA 3U9WA 1LKXA 4AR8A 1WJ5A 1K6YA 4QPOA 3WQQA 2VJJA 4OWRB 4ZTFA 2K3PA 4XNBA 1MNDA 1T1RA 4ZDPA 2K9LA 3FBNB 3W2WA 3MKWB 2E5NA 2GOXB 2X1DA 4C2UA 2CUJA 4ANJA 2CMPA 3A4CA 2CH0A 3OWTA 4BDYA 3FH8A 3RQ4A 1MMDA 1WFXA 4BGDA 3EBHA 4F52A 3E0JB 2BVMA 4C30A 3T0YA 4E4HA 1MMGA 4XMZA 3LSIA 2CV1A 1D0YA 2PMZA 4BUPA 3L2WA 2VQGA 4IZZA 3B37A 5BPPA 3W2VA 1FMWA 4XKBA 2KP6A 4B44A 3B7SA 4AICA 4JQFA 2M7BA 3OYMA 3OR1C 4E7HA 4IQJA 4XMVA 4LG3A 1R0LA 1N78A 4BE2A 2QKLB 5EV7A 1BR1A 3FUNA 2RJIA 2R70A 3ANNA 1D1AA 1R6RA 2E60A 3LSGA 3OL3A 4K5PA 3MKYB 3OYEA 5FROA 3OYHA 2ELJA 4ZX6A 4RLFA 4DIQA 3E1SA 3FU0A 4FCAA 4R5VA 2L9SA 3AFHA 3VVLA 3S3NA 1X1CA 3S3OA 4KISA 3J7AY 1MMAA 1MW1A 4FLOA 4Y6SA 3AUAA 3OY9A 2DT6A 2VQLA 4XO4A 2WAQA 3S8PA 2CS3A 2NOJB 1V5GA 4XONA 3FH5A 2KRHA 4XQFA 4FLSA 4RSYA 3K4BA 3S3MA 3EBGA 2CFOA 4II3A 4XO3A 3MKZA 3VYTB 2KL4A 4R5TA 5JMWA 1WJFA 2MABA 2Z1DA 2L7KA 3I9V2 3SZGA 1Z21A 3TMOA 1T0FC 1PJRA 1G8XA 2XF5A 3L2UA 2R7UA 4PVBA 2LREA 3UNGC 4XOTA 2W82A 3M8JA 4DBRA 4HRIA 2Y1GA 4EATA 2R7QA 4KP7A 5FRMA 4N4NB 2JD2A 5JBIA 1X4OA 4OOFA 4BE0A 4J01A 5KNLA 4Y67A 4XKCA 4XMWA 1VZ0A 4YELA 4E7LA 4E7SA 3DTEA 3S32A 3OS0A 3FUEA 2IXSA 3LSMA 3ZHZA 1X4PA 1FMVA 2QVWA 5JO0A 4XN9A 5FWQA 3KX2A 3LMMA 4XMTA 3W2AA 2IGNA 3VWBA 3FTUA 1S46A 3DKXA 3FUDA 2VL8A 2HVRA 4R7LA 2CUZA 4NUBA 4CZCA 1Z3XA 3EUHC 2Y0SA 4J3BA 2IGKA 1UAAA 5JNLA 1MNEA 4N4OB 4HSTA 1X3ZA 2JA2A 3BLYA 3SEQA 2Y1FA 4CCKA 1DGRM 4AU7A 4E6KG 3VYUB 4NNJA 4J00A 3A06A 4B43A 3HG9A 2I8DA 3AKZA 1ONOA 2WB1A 4BEHB 1PYVA 1OLTA 3FKJA 3B2PA 2MC4A 3SEZA 1LVKA 4RM3A 4XN8A 3DTKA 1SAUA 1X19A 3UR3C 3OYDA 1W36C 3IIEA 4XR6A 2IS6A 4MS6A 3VSKA 5AENA 2VQHA 3FTZA 4XN2A 4XN7A 1ONPA 1GW6A 1LFPA 2KPMA 2F4IA 2WAFA 4CCMA 4HPQA 3DQVC 2KQRA 2ZSHB 3OMYA 2F6CA 1V5EA 5CQGA 1BR2A 1H19A 4C2TA 3RC8A 1JG9A 3U21A 2ZXIA 1N75A 2KMUA 3K4KA 3HXLA 4XKWA 4C9YA 3C2GA 3B7RL 4HNUA 4YRVA 2PUSA 3CMMA 2WY7Q 3ZHYA 5KCMA 3FDYA 2JUGA 2HVQA 3PUBA 3OL4A 4PJMA 2VXZA 3OS1A 2WPGA 3CZLA 2E1MB 3CZGA 3LFUA 4XO5A 2GOMA 3FTWA 4Y3OA 1UG0A 3KYLA 1D1BA 2R7WA 4CA0A 4HEA2 4QIRA 4DGWB 3VDXA 2QJ1A 3FUFA 4D9JA 4Q4IA 1Z3YA 4ZC3A 2DQMA 3BG6A 3TBIA 4XNFA 4LIUA 5HOOA 4F93B 4F3QA 3KEYA 3CJRB 2O7GA 4CCOA 1D1CA 3K4LA 2JVHA 2DQ6A 1JI8A 3B3BA 2IGOA 1QHHD 2V9KA 4XLHA 2HZDA 3DKYA 4RLQA 4Y6RA 1GLNA 4ZQTA 4CCNA 4Y4RA 1YX5A 5CKTA 3ONQA 3OYKA 4BXFA 3CIAA 2V6EA 4XN3A 3H5RA 2JVGA 2X51A 3DU5A 2A7OA 2Q2EB 3NWTA 5CPRB 3QYFA 2M0MA 3L2VA 2IGMA 4RCVA 3JT1A 2RREA 2R7OA 4BJ6C 1Z7LA 1YX3A 4FASD 3CZEA 1K5HA 2XF7A 2HNHA 2OUMA 2WADA 4B47A 5JMPA 4BJ5C 3ZI0A 4K5MA 3A1YA 2LOOA 3Q44A 4G6TB 3WQRA 2MD0A 3HOTA 3LSHA 3A2KA 3HOSA 2R7XA 2DXIA 1N77A 1SC5A 3FTYA 4K5NA 3H9GA 2XPYA 3L2QA 5DULA 4ZW5A 1Q0HA 2JD0A 4E7IA 3JSZA 4CH7A 3H5NA 3B34A 2BOLA 3CHSA 2VIXA 5KHDA 3OYLA 2AQFA 2LC2A 2V4JC 4PFOA 4RMNA 4XLFA 2R7TA 3OOUA 1Q0LA 1LDKB 2HDWA 4KT6A 1ERDA 1IRXA 3PL8A 4PSXA 4XM3A 1NG6A 4XN4A 4DPRA 4U87A 3OIPA 1G59A 3FU3A 2OV7A 2RQQA 4OOEA 5TGTA 4AYSA 2VB6A 3SYTA 2HPIA 1AA7A 4D1QA 2X6WA 2W00A 3T8VA 4QUOA 3UEQA 2R4GA 3IP4B 3QOEA 4CSWA 3OS2A 3ANLA 4HG2A 3CZKA 2MFZA 2JV7A 1ONNA 2XQ0A 4NQWA 1YE9A 2CV2A 2X1EA 2M7AA 3N05A 4XLCA 2LYCA 2WA0A 3FBIB 4BEHA 4DJAA 3K70C 3AL0B 1HS6A 4ZW6A 3K4CA 4YEJA 4NQWB 4XMYA 3ZHXA 3PFYA 2M4GA 3FH7A 2WAEA 3DTIA 4BS9A 5FRNA 2PGGA 3IAM2 2E1MC 3KEDA 2QKMB 2UV1A 4MKTA 3ZRGA 2M4KA 2HVSA 1V5FA 2CW8A 3CF2A 3R0IA 4BQNA 4OAZA 3RPUD 3IAS2 3OYIA 2A6TA 2KRCA 3FUJA 3MD2A 4BL0B 3A14A 3L2RA 2DJIA 4B3XA 1RP3A 4XMXA 3WQSB 4PK4A 3H0DA 1U0JA 3QJXA 3DPTA 3CP2A 2FFLA 4CUGA 4ZN6A 3ZR8X 3VYRB 3D5LA 4QHPA 3RC3A 4R5XA 4NC8A 2VXDA 3PNTA 2F5VA 4Q4EA 4P5OA 3CHPA 3FTSA 2W7NA 4L2LA 2CV0A 1TT0A 3QODA 3RCOA 3DWLE 4ZW3A 3OYCA 1E0EA 3PNVA 2HPOA 3I3LA 2VKDA 1X3WA 4Y6PA 3HPGA 4CXFA 3OYGA 3CZ6A 2ZSIB 3FTVA 2IS2A 3VYSB 4ZDOA 4PSWA 3DPUA 2RNGA 4FETA 4PJJA 2Y1EA 4XORA 3OYBA 4LUPA 5DLLA 5HNFA 4XKVA 3C2HA 5JHFA 3CHOA 4K5LA 4ZQEA 2ZXGA 4FLRA 1WJDA 4ZQGA 2R59A 4LIVA 4Y33A 2XC7A 2GTQA 3G2BA 4QPQA 3K70D 4IQ4A 3ZQQA 2KHMA 5JAZA 2IS1A 2XSJC 2LY1A 3PSIA 4BU2A 4PW4A 2PL5A 1EA3A 1ZELA 3K6GA 3LSKA 4GAEA 2KZVA 2LBFA 3D5SC 4XMUA 2Z16A 3HPHA 2VKHA 4ZW8A 1MW2A 2M3AA 1DQUA 2X6XA 4II2A 4BQOA 3SDBA 5CQEA 4F92B 3FUKA 4ZQHA 2LBFB 3K4NA 3AU8A 4BQQA 4ZYAA 3OYAA 1G5AA 2XF6A 4JNDA 2AQEA 3OR2C 4XN1A 5DYFA 1MVYA 1J09A 4A03A 3EPZA 2R72A 4B48A 3B2XA 3VVMA 3M1CA 3DLAA 4OAYA 4BE1A 2ZFUA 1SFKA 2W1OA 4GRIA 2P0WA 4HNTA 3ANMA 3FTXA 2L9NA 4BDZA 2VJIA 3RSNA 2OC6A 4NC7A 2IS4A 3EBIA 4XN0A 4XNDA 4R79A 3OYNA 1BR4A 1H3LA 1KONA 1BOBA 1SG7A 2VJ4A 2HPMA 4DBQA 4XN5A 1X1AA 2DOAA 2XAUA 2EGHA 3EUKL 2XDVA 2WZFA 3RASA 3BCBA 1WJBA 2UUZA 1JGIA 3DEEA 4QMEA 3F9KA 4AVZA 4PJNA 4FLQA 4BACA 3CHQA 3AL0C 2C5ZA 4CCJA 2A5WA 4DOZA 4ZTJA 3FHEA 3UERA 4ZX5A 2E5ZA 3PNYA 3ZCOA 3FU5A 4ZW7A 2MAPA 3BCAA 3QYBA 2JD1A 2V26A 1WJCA 2BW3A 3H9JA 3DPLC 2JCVA 1T95A 1MMNA 1D0XA 2Z2SB 3H35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNH A;  5HNF A;  5HLT A; 
#chains in the Genus database with same CATH topology
 2EWN A;  3V42 A;  4KMF A;  4AYB A;  4A0Y A;  1Y8R B;  2R7R A;  1OYW A;  1MBJ A;  3G1O A;  3G4S I;  1FYM A;  1ZRD A;  2A68 F;  3UCQ A;  3HC7 A;  3TL4 X;  2H27 A;  2BW3 B;  4KN7 X;  2JCY A;  1MBG A;  3IWZ A;  4EMS A;  2EQR A;  2YU3 A;  2XPV A;  4Y17 A;  3IHU A;  1I6H J;  2F5E A;  1RR8 C;  4YFN F;  2FOW A;  3BZK A;  3MQ0 A;  2MSY A;  3HOV J;  3H1C A;  4V19 K;  3U1D A;  1X1B A;  4ZDL A;  3LA2 A;  4GFB A;  3OV8 A;  2R3S A;  2K86 A;  5FLX K;  4KFC A;  1QNT A;  5E3M A;  3CHR A;  3P9I A;  4N9H A;  4IRI A;  3ZMS A;  4RVB A;  1JJ8 C;  3RJP A;  5EGO A;  1U5T B;  3GBG A;  4HSR A;  3K1N A;  3VOD A;  2PJR A;  4JOM A;  2FRH A;  2M34 A;  3ZQL A;  1Z6R A;  4X6A J;  2WY8 Q;  2B61 A;  1Y6I A;  4PGG A;  3NEU A;  2R7S A;  2K3F A;  1P7J A;  1VQ5 I;  3ABK H;  1G3T A;  1XN7 A;  3FM5 A;  2G0E A;  3FXJ A;  2CQX A;  2UWM A;  4KIT B;  4AIH A;  3QPH A;  2V1D A;  4WF2 A;  4QPE A;  5JHU A;  1T1S A;  2XPZ A;  2Z99 A;  1ORK A;  1W5T A;  3RKY A;  2PN6 A;  1WZ2 A;  3HUG B;  2M87 A;  3I0T A;  3F23 A;  5AIQ A;  1SMT A;  2DT7 B;  2QSH X;  4RM2 A;  2HYG D;  1YI2 I;  2FNA A;  2K85 A;  4J19 A;  1MW7 A;  1S6L A;  2H6B A;  3OIO A;  4X0G A;  1QHG A;  1OR7 C;  2ZXJ A;  4GAA A;  1FTZ A;  1R58 A;  1YTY A;  2V1N A;  5BQT A;  5LD2 C;  3E7L A;  2BVL A;  3QPT A;  3WU1 B;  2LY2 A;  3GW2 A;  2DBB A;  5FKK A;  1RET A;  2D1V A;  2JCX A;  1WHU A;  2W4S A;  3ZGK A;  1XSD A;  4RBO A;  3JTG A;  2TRT A;  2EA2 A;  1I1S A;  1MW0 A;  3NAR A;  3ZXS A;  4ZJZ A;  3A01 B;  5D8L B;  4XLA A;  4MLO A;  3RTR A;  3PUU A;  4E7K A;  4EM1 A;  4ZZD A;  4HA8 A;  3LL7 A;  1OR7 A;  3CME I;  1Y56 A;  4LLN A;  4E7Z A;  1LKX A;  4QPO A;  3G71 I;  3WQQ A;  5F08 A;  4ZTF A;  1MND A;  4ZDP A;  5B5E C;  5IPA A;  2K9L A;  1GT0 C;  2LK2 A;  1S3J A;  5LRR A;  3DP7 A;  3MKW B;  3W6J B;  1R22 A;  2V6C A;  1MSF C;  1Z05 A;  1TQI A;  3A4C A;  4I6Z A;  2AHQ A;  4PZJ A;  1MMD A;  3WG9 A;  4RAZ A;  4BGD A;  2KJB A;  3EBH A;  2BVM A;  4O6J A;  2FBH A;  4C30 A;  1G2H A;  4B4C A;  2QYO A;  1FTT A;  1C0W A;  1VI0 A;  3SFZ A;  3H0G J;  4IZZ A;  1KGS A;  1IJW C;  2UXN A;  2IA1 A;  3GXO A;  4UNO A;  1IAW A;  4UUS B;  3RI4 A;  3GFL A;  5HS7 A;  2DMN A;  4D7N A;  1IRZ A;  2EV5 A;  4W1U A;  3ZQC A;  4TV7 A;  2M7B A;  3OYM A;  3P5J A;  4MFE A;  3OR1 C;  4IQJ A;  1ZKG A;  4BNC A;  1U9N A;  1LE8 B;  5ICC A;  3H92 A;  2CSO A;  1KYZ A;  1TC3 C;  2KRF A;  3T1B A;  2FBK A;  5IYD J;  2MH9 A;  1D1A A;  1MH4 A;  2DYS H;  1VQM I;  5M5Y J;  1S72 I;  4OIQ F;  3ANN A;  4Y52 J;  5FRO A;  2ELJ A;  3DLL F;  1BI3 A;  4N0B A;  3VVL A;  2OU2 A;  1X1C A;  4ZYD A;  3S3N A;  4CGZ A;  1A35 A;  3AUA A;  1VQO I;  2WAQ A;  2CS3 A;  3OSG A;  3C1D A;  5EZH A;  2KRH A;  3V7S A;  4XQF A;  1J9I A;  4II3 A;  1OPC A;  5D5U B;  3S1N J;  3OYE A;  3TMO A;  2L7K A;  4DYC A;  4PVB A;  1G8X A;  2XF5 A;  4ZYG A;  2W85 A;  3M3Y J;  3V8J A;  1Z9C A;  2EZI A;  5J4V A;  4DZP A;  2R5Y A;  1F43 A;  2R7Q A;  4IPA A;  3GFM A;  1T38 A;  2EPF A;  4BE0 A;  4L9J A;  3CCR I;  2ZFW A;  2ZME B;  3EET A;  1B72 A;  4Y67 A;  3ZMU A;  3IKT A;  3NRV A;  2IXS A;  3ZHZ A;  2IA2 A;  4UVB A;  2D2W A;  2KDZ A;  4XN9 A;  3CLO A;  1VQK I;  2CFX A;  5CVI A;  3W2A A;  1VFC A;  1PUE E;  1ZGA A;  2DQR A;  3VWB A;  3FTU A;  1S46 A;  3DKX A;  2VE9 A;  1TQM A;  2PMH A;  5DUK A;  4ZYE A;  3FUD A;  1YFH A;  4R7L A;  4NUB A;  4CDG A;  2A61 A;  1Z3X A;  3EUH C;  2Y0S A;  1X2M A;  1UAA A;  2B0L A;  2JA2 A;  3SEQ A;  2EJR A;  5CYV A;  2VE8 A;  1AKH A;  3PQK A;  1TWH J;  4J00 A;  4B43 A;  2AS5 F;  3F8B A;  2I8D A;  3R0A A;  1H9T A;  3TQN A;  2XAS A;  1ODD A;  1OLT A;  3SEZ A;  3R6S A;  4XN8 A;  4XRS A;  2E1O A;  1SAU A;  2NS7 A;  4HDV A;  4MS6 A;  1WPK A;  3HZJ A;  2KIF A;  2Y9Y A;  4AYB N;  3MEX A;  3L00 A;  1GW6 A;  2F4I A;  3M07 A;  3EUH A;  2J5P A;  4CCM A;  4BY1 J;  1JE8 A;  4QTR A;  3CCS I;  3FHZ A;  1MH3 A;  3OMY A;  3CUQ C;  5J8F A;  5CQG A;  1CF7 A;  1BR2 A;  3O8H A;  4GXO A;  2DDB A;  5FFZ A;  4C2T A;  3HYI A;  1HXD A;  1W5C C;  3SXY A;  2RDP A;  2WY7 Q;  1R36 A;  2LKP A;  3VPR A;  4PJ0 C;  1XCB A;  3OS1 A;  3CZL A;  4E70 A;  4HF2 A;  1I5Z A;  3KP5 A;  3CZG A;  3LFU A;  4XO5 A;  3FTW A;  4Y3O A;  1Z0X A;  2KFD A;  1H89 C;  2KT0 A;  2PG4 A;  5J1U A;  1FIP A;  2X4H A;  4CA0 A;  2FX0 A;  3WE2 A;  5E8I A;  4IRH A;  3CUQ A;  5D4R A;  2QJ1 A;  3FUF A;  1Z3Y A;  2HEO A;  4LIU A;  2O7G A;  2QVO A;  4CCO A;  1TW2 A;  2JVH A;  2L7M P;  3X2Q H;  5EEH A;  1KU9 A;  1JI8 A;  1I3A A;  1ZR2 A;  2IGO A;  3KP3 A;  3SJM A;  2HZD A;  2OZ6 A;  5EEA A;  2HZT A;  1B6A A;  2PQ8 A;  1J75 A;  1VQ8 I;  4HBL A;  5EEG A;  3LNQ A;  1YX5 A;  4RB2 C;  3ONQ A;  4BXF A;  3JRB A;  2V6E A;  5D6E A;  4B1R A;  4EQQ A;  4A3G J;  4KT5 C;  3DU5 A;  2A7O A;  1MJ9 A;  3NWT A;  5CPR B;  1ITY A;  3GX4 X;  1ETO A;  5B1B H;  3L2V A;  2IGM A;  4Y13 A;  2KKO A;  2R7O A;  4EGY A;  4EM2 A;  4FAS D;  1MBF A;  1JKO C;  1KQ0 A;  2HKO A;  2XPW A;  1EV7 A;  3LSH A;  3A2K A;  3M4O J;  1PUF A;  1Y0N A;  2ZO4 A;  3IKV A;  4UB6 C;  2DXI A;  2L02 A;  2R7X A;  1QZZ A;  4EJU A;  1R5I D;  3BJA A;  1QO0 D;  4ZW5 A;  1QBJ A;  3JSZ A;  3H5N A;  3B34 A;  2VIX A;  1IV6 A;  1YJ9 I;  2AQF A;  2LC2 A;  2F48 A;  5D6F A;  5DCM B;  4RMN A;  5F1J A;  3QP5 A;  2NS0 A;  1Q0L A;  2H1L A;  2IT0 A;  1MSE C;  3Q0U A;  3F8C A;  5H6R A;  2JWT A;  2ZNY A;  4S05 A;  4WWC A;  4XN4 A;  4DPR A;  5C4J J;  1G59 A;  2OV7 A;  2RQQ A;  3FU3 A;  2VKV A;  2M1B A;  4AWX B;  1J0R A;  2IA0 A;  2XAJ A;  4M9Z A;  3SYT A;  2HPI A;  1BJA A;  4D1Q A;  3EYI A;  4BQA A;  2JMW A;  1TP4 A;  2X48 A;  1KA8 A;  2XAG A;  1P6R A;  1T6S A;  3MZH A;  1YIJ I;  2GXG A;  2M2E A;  2E19 A;  5M3F J;  4CSW A;  2EB7 A;  3CZK A;  2M30 A;  3JTH A;  4U0Y A;  3EYY A;  2P6S A;  3I56 I;  4GDF A;  1ONN A;  1HQC A;  1MJA A;  1YE9 A;  5KK1 A;  2XQ0 A;  1ETK A;  2CV2 A;  3CF5 F;  2AO9 A;  4C2M J;  2M7A A;  3FXR A;  2LYC A;  2WA0 A;  3FBI B;  4BEH A;  1ZRE A;  2AXL A;  4YEJ A;  3FMS A;  1MD0 A;  3FX3 A;  3KZI C;  3CJN A;  4UVA A;  3CCM I;  2DO7 A;  3ZRG A;  2M4K A;  2R7D A;  5EGO B;  1A5J A;  2DA1 A;  3HGG A;  5EYR A;  3R0I A;  4BQN A;  2WAQ N;  4OAZ A;  5BS6 A;  3OYI A;  2H6C A;  4LG0 B;  5FKM A;  4Y15 A;  3BT9 A;  1IZ1 A;  4XMX A;  4PK4 A;  5JFR A;  3CP2 A;  1EKE A;  1OCZ H;  4ZN6 A;  4CYD A;  3D5L A;  4R5X A;  2Z5U A;  4XLP F;  2M45 A;  2PX9 A;  2VXD A;  3S1Q J;  2NNN A;  4G12 A;  3FTS A;  2A6H F;  1TT0 A;  4KA4 A;  1ZLK A;  1OKR A;  3I4M J;  3RZO J;  4ZW3 A;  3PNV A;  3I3L A;  2VKD A;  4CXF A;  2HI3 A;  3HPG A;  2QSG X;  4DYQ A;  3FTV A;  3CZ6 A;  2G7H A;  2L3D A;  1HBX G;  4HDU A;  4BHB A;  3HDD A;  2Y1E A;  4XOR A;  3OYB A;  5K5R A;  5DLL A;  1ZRF A;  5GTH C;  2E2I J;  3CHO A;  1K83 J;  4OIP F;  1T33 A;  1KZH A;  4FLR A;  1BIB A;  2BY1 A;  2NS8 A;  4QPQ A;  4IQ4 A;  3FKI J;  1LEA A;  3BG5 A;  1FBU A;  1HKQ A;  1YS7 A;  2LY1 A;  3PSI A;  4LGW A;  1LJ9 A;  3ECO A;  2DT5 A;  3RYR A;  3WE3 A;  4A3F J;  3VB2 A;  1ZEL A;  3LSK A;  1D8K A;  2CWE A;  5E8G A;  2PLY A;  5FB2 A;  1WGX A;  2Q2E A;  4FQG A;  4RS8 A;  2M3A A;  2Q8K A;  3AG1 H;  4OIO F;  3COA C;  4ZQH A;  4II2 A;  3J7Z I;  1Z1D A;  2XAF A;  5CQE A;  3VOE A;  2P7C B;  3AU8 A;  2RVC A;  2X9D A;  4P96 A;  4ENN A;  1LVA A;  3DCF A;  1A6I A;  1F1Z A;  3KYC B;  1J09 A;  3GLX A;  3S2H J;  4B48 A;  3M1C A;  2KIS A;  1QQI A;  5LHH A;  1OCO H;  2CUE A;  2HTS A;  2ZFU A;  1W7P D;  1B4A A;  3HTS B;  2L9N A;  3CMY A;  2JPC A;  3LSJ A;  1V4R A;  3L9F A;  5GAG J;  2LP0 A;  4G7Z F;  4UY8 I;  2DFE A;  2LKS A;  2ECB A;  1U78 A;  3OYN A;  2DMT A;  3IH2 A;  3O3K A;  1KON A;  2E2J J;  1IDZ A;  4YFX F;  2VJ4 A;  1MIJ A;  3BPV A;  1SEU A;  2HPM A;  1TLH B;  2JA8 J;  4XN5 A;  4KUM A;  1RRJ A;  4BH9 A;  3KP2 A;  3IC7 A;  5E18 F;  2B63 J;  2WZF A;  3BCB A;  1JGG A;  3HW2 A;  2UUZ A;  3DEE A;  2VON A;  2EFP A;  4I0A A;  4AVZ A;  4PJN A;  2QSF X;  4LOC A;  2C5Z A;  2RNJ A;  1R49 A;  3BTL A;  1LDD A;  3PNY A;  3WHB A;  2QM3 A;  2JD1 A;  3QYB A;  2V1U A;  4IHX A;  3DPL C;  3G3Z A;  3KFW X;  1T95 A;  1FLI A;  4A6D A;  2FQ4 A;  3OSF A;  3Q43 A;  5JC1 A;  3FUL A;  1T8I A;  4ESJ A;  2YX4 A;  5E79 C;  4QIW N;  1D0Z A;  5HLT A;  4IHY A;  2HU9 A;  4HQM A;  4IVN A;  2VLA A;  1R0K A;  1JKR C;  4U0W A;  3OYF A;  3DF8 A;  2ISY A;  1S7O A;  2WBM A;  4F55 A;  3N4M A;  4AR1 A;  1FOW A;  1I50 J;  5FKN A;  2VAS A;  2EIN H;  1IRG A;  5J4Y A;  2DMQ A;  3K4J A;  4Y6P A;  2XRO A;  2FMY A;  2D45 A;  2LDU A;  5HVQ C;  5A2Q K;  1X3U A;  3FUH A;  2WTE A;  3TW6 A;  2CW7 A;  5JR3 A;  1P4A A;  1OCR H;  1BJZ A;  1I39 A;  1WSU A;  1HC8 A;  4RB3 C;  5DDG A;  5K5O A;  1TT5 B;  1FT9 A;  3MMY B;  1R4N B;  1K6O A;  2VJ5 A;  3K4M A;  2VQC A;  3DKW A;  3JRD A;  4U88 A;  3RQI A;  3REO A;  4YIF A;  1SFX A;  3H9Q A;  3QYE A;  3B7T A;  2LH9 A;  3GTP J;  2VUM J;  4QSH A;  4XRM A;  4BBS J;  3WTS C;  3CJQ B;  4E7J A;  1WH5 A;  1WJA A;  1AKH B;  1PDN C;  4K2E A;  1I6X A;  3U9G A;  2DN0 A;  4XNA A;  3S93 A;  5IY5 H;  1FOY A;  2YUS A;  4IL6 C;  3U2R A;  2HPT A;  4XL9 A;  2MG4 A;  4XID A;  4A0Z A;  1ON2 A;  5C3E J;  5JI6 A;  3BC8 A;  3HEF A;  1JGS A;  4KN4 X;  1UZC A;  3V8K A;  1XG1 A;  3VSL A;  4AID A;  2MYS A;  3U1K A;  2L4M A;  4MQV A;  2PFB A;  1ETX A;  1NH3 A;  4K5O A;  2LRD A;  2EZL A;  2Y9Z A;  1WJ5 A;  2E36 A;  4N9I A;  2BV6 A;  1UFM A;  4WX9 A;  1G3S A;  2M8G X;  3NQO A;  1Y1V J;  1Y39 A;  5IYC J;  1YYV A;  4C2U A;  3HOZ J;  4ANJ A;  1YW7 A;  2CH0 A;  5JLX A;  2JTV A;  1WFX A;  3JR9 A;  3S14 J;  2JJ7 A;  1MBK A;  2ACJ A;  1MDM A;  2Y30 A;  3T0Y A;  1GV5 A;  1XMA A;  4XMZ A;  2IRF G;  5K7F A;  2PMZ A;  4OMY A;  3B37 A;  2OD5 A;  5BPP A;  4UB8 C;  2DA5 A;  3W2V A;  4FCY A;  2HQN A;  3ERM A;  2BXY A;  2ME6 A;  4U0V A;  2RC4 A;  1XMX A;  5E20 A;  4AIC A;  4HAM A;  3CCY A;  3IV5 A;  3GTJ J;  4LG3 A;  4NB5 A;  1BC8 C;  1R0L A;  2MA3 A;  1RKW A;  5ILS A;  1BR1 A;  1JTY A;  1TQP A;  3HOW J;  3ZPL A;  3JRI A;  2EIJ H;  1H9G A;  1P92 A;  2YU9 J;  2E60 A;  2P5V A;  3LSG A;  3OL3 A;  2BY2 A;  4DIQ A;  2GXB A;  3WU0 A;  3BR1 A;  4R5V A;  4GO1 A;  2L9S A;  3A02 A;  2XRN A;  3AFH A;  5DD8 A;  4KIS A;  3J7A Y;  4XRF A;  3VEP A;  1MMA A;  2X0L A;  5CVR A;  1IF1 A;  4FLO A;  2IEK A;  1B9M A;  1R7J A;  4R1H A;  2NXN B;  2V9P A;  4DNC A;  1QZY A;  2E71 A;  3E6C C;  1U6G A;  2NOJ B;  2JT1 A;  3UKG A;  3FH5 A;  2DDA A;  1L0O C;  3HOU J;  3Q5F A;  4D5C A;  3EBG A;  2CFO A;  5IP9 J;  3VYT B;  1PUF B;  5JMW A;  1MBH A;  2MAB A;  3WOD F;  4V2G A;  1R1T A;  2PMU A;  3CDL A;  2PJP A;  5D5V B;  2OAZ A;  2LRE A;  5GPC A;  4LK0 F;  2W82 A;  2QQA A;  5B1A H;  3QOP A;  2Y1G A;  2K4J A;  2JD2 A;  2DI3 A;  4OOF A;  2OBP A;  2OTL I;  4XKC A;  1FEX A;  4YEL A;  3F22 A;  3DTE A;  3S32 A;  3GCM A;  3LSM A;  5C44 J;  1GVJ A;  1X4P A;  2FA5 A;  4G94 A;  2XRL A;  1TWA J;  3KX2 A;  4S0H B;  4XMT A;  3RPU A;  1YRN A;  3JRC A;  1WQ2 A;  1G3W A;  1A31 A;  1HKT A;  1K78 B;  2HDC A;  3BR2 A;  2VL8 A;  3CLQ A;  2NVU B;  4OIR F;  1JKQ C;  1MNE A;  2VOD A;  1TTY A;  4HQE A;  4CCK A;  3A06 A;  3HG9 A;  1SFE A;  3E97 A;  1O4X A;  1ONO A;  2E35 A;  2WB1 A;  1E3H A;  4BEH B;  4FX4 A;  1JHH A;  5ICG A;  1RIO H;  1R71 A;  1YG2 A;  2E34 A;  1R4M B;  1O7F A;  3FKJ A;  4AUX A;  4G8X A;  1LVK A;  4RM3 A;  2A05 A;  1X19 A;  3OYD A;  3IIE A;  1BOA A;  2IP2 A;  2IS6 A;  2JRT A;  1WH7 A;  3WGG A;  2Y48 A;  4XN7 A;  1LFP A;  5BPI A;  2WAF A;  1ACI A;  1ULY A;  3GTG J;  2MC3 A;  1DP7 P;  3RC8 A;  1JG9 A;  3U21 A;  2A3S A;  2ZXI A;  3FZV A;  3ECH A;  3K4K A;  4HNU A;  4YRV A;  4I2O A;  3ZN1 A;  4G6Q A;  5FGM A;  2JUC A;  5FJ8 J;  3E6B A;  4A5N A;  2RAE A;  1HKS A;  3C3W A;  5B66 C;  2GOM A;  3CCE I;  1NTC A;  4G9Y A;  5IT3 A;  1ZHF A;  3TO7 A;  3F21 A;  4B09 A;  3J7A O;  4DGW B;  3VDX A;  2ECC A;  4D9J A;  2DQM A;  1GV2 A;  4OMZ A;  3BG6 A;  4WXH A;  4XNF A;  3TBI A;  1HDP A;  2BZT A;  4IEJ A;  1FP1 D;  3CJR B;  3FWE A;  3W6K B;  4F3Q A;  4F93 B;  3K4L A;  2DQ6 A;  3EQL F;  4DYR A;  1F9N A;  1QHH D;  1W7P B;  1OYI A;  3DV8 A;  2QEN A;  3KIO A;  1IV8 A;  5F0H A;  4RLQ A;  4EGZ A;  1GLN A;  5DUI A;  2Z33 A;  2ICW G;  1IGN A;  1V3F A;  1YQA A;  5CKT A;  4IHT A;  3OYK A;  3CIA A;  1ZGJ A;  3KZZ A;  4Q48 A;  1IXR C;  2X51 A;  2Q2E B;  3G1L A;  5HDN A;  4AIK A;  2K02 A;  4PGH A;  3HRM A;  5H6Q A;  1Z7L A;  1YX3 A;  3CZE A;  1K5H A;  2XF7 A;  1OMI A;  5TJJ A;  2L9R A;  2ZBK A;  3FK6 A;  5K1Y A;  4HX8 A;  1XGM A;  2TCT A;  5JMP A;  3ZI0 A;  4D5F A;  4KNY A;  5LEK A;  4K5M A;  3A1Y A;  1M1E B;  2LOO A;  3CUO A;  4G6T B;  2MH2 A;  2MD0 A;  2GWR A;  5F1R A;  4UUV A;  1SC5 A;  3V4G A;  3ZQH A;  3L2C A;  4CYC A;  1X1P A;  2XPY A;  1IN8 A;  3L2Q A;  2JD0 A;  4E7I A;  2JA6 J;  1XGN A;  3AAF A;  1E3O C;  4EJW A;  2FXA A;  1OCC H;  4XLF A;  4ASN A;  3CO6 C;  1VTN C;  1YIO A;  3SDG A;  4HF1 A;  4LB6 B;  5IP6 A;  5HLH A;  2YSR A;  1ENH A;  3BJO A;  3ML6 A;  1J7K A;  1O3Q A;  4G7O F;  2HQR A;  2A5Y B;  4A5M A;  3D0S A;  3F6V A;  3P9C A;  3MKL A;  3ABM H;  3BJ6 A;  3B6C A;  2X6W A;  2W00 A;  5IT9 K;  2COB A;  2VBY A;  3ANL A;  4HG2 A;  2MFZ A;  1IXS B;  1MZB A;  2GM4 A;  3RDI A;  3I59 B;  2JV7 A;  1MBE A;  1JTX A;  2IPQ X;  3K70 C;  4XLC A;  3BDD A;  3SZP A;  5CVJ A;  3J80 K;  3WTW C;  4CO8 A;  2OQR A;  2W48 A;  1YW9 A;  1I3Q J;  4NQW B;  4XMY A;  3ZHX A;  3PFY A;  3FH7 A;  2WAE A;  5L3G A;  3DTI A;  1REP C;  5FRN A;  2LFB A;  4WCG A;  4WXD A;  2LVS A;  2UV1 A;  5CVU A;  2YR2 A;  3CF2 A;  3TW7 A;  3I4N J;  4H0E A;  1WI3 A;  1WWX A;  5F04 A;  2A6T A;  2KRC A;  3FUJ A;  3MD2 A;  4BL0 B;  3K2Z A;  3HHG A;  2R5Z A;  4RGR A;  4BAY A;  2W24 A;  2YPR A;  4M6X A;  3L09 A;  2FFL A;  1SAN A;  4UHT A;  3HOX J;  1U8B A;  2ELK A;  2VT3 A;  4Q5S F;  4M74 A;  4X1E A;  4LD5 A;  5ILU A;  2F5V A;  4L2L A;  2CV0 A;  2O0Y A;  3QOD A;  4IF4 A;  3OYC A;  5IT9 Z;  1E0E A;  1ZG1 A;  4KIG A;  2QBY B;  3GF2 A;  2ZSI B;  3M9A A;  4ZDO A;  2DK5 A;  2RNG A;  2L7F P;  2P7V B;  3O6B B;  2FOK A;  1FZP B;  1VQN I;  1X3W B;  5HNF A;  3C2H A;  4MQ9 F;  2ZCW A;  3J80 Z;  2KIU A;  5FFX A;  1WJD A;  4EVI A;  2ZB9 A;  2XC7 A;  1IN7 A;  1UG2 A;  3G2B A;  5GAD J;  3K70 D;  3ZQQ A;  2KHM A;  1T39 A;  5JAZ A;  2O6G E;  4FX0 A;  1W0U A;  1HW5 A;  4Y7N J;  3KZY A;  4PW4 A;  2BHZ A;  3K6G A;  2HXO A;  4P9U A;  1I27 A;  2VKH A;  1NK2 P;  1Z91 A;  3M7G A;  3S1M J;  1B8I A;  2X6X A;  5L3E A;  2XVC A;  3DBL B;  4BQO A;  4F92 B;  2LBF B;  3K4N A;  2ZJQ F;  2R92 J;  2AQE A;  2NVQ J;  4RB0 A;  2RV8 A;  1MVY A;  2GAU A;  2R72 A;  5HOD A;  2NVX J;  3JSP A;  3DLA A;  3AG3 H;  3F3X A;  4GRI A;  2DAO A;  4HNT A;  1MDM B;  3FTX A;  5HDK A;  4S04 A;  4BDZ A;  5L3D A;  4LLL A;  3EBI A;  2F4O B;  3MZ8 A;  4XN0 A;  4ETS A;  1BR4 A;  1RR7 A;  1H3L A;  5CJ9 A;  2QGU A;  1AOY A;  3HRT A;  4A6E A;  1SG7 A;  1PVE A;  4AVP A;  1BW6 A;  2DOA A;  2ESH A;  5LGN A;  2XKP A;  3MCZ A;  2M5W A;  1SVO A;  2XDV A;  3WTT C;  1WJB A;  3JAM K;  1JGI A;  4QME A;  1Y8Q B;  2TDX A;  3F9K A;  5FD5 A;  3CHQ A;  1CGP A;  1T98 A;  4ZX5 A;  3ZCO A;  2MAP A;  3C2B A;  1V54 H;  2DOE A;  2V26 A;  4QLC U;  2BW3 A;  3H9J A;  2R7Z J;  1WCM J;  1MMN A;  1D0X A;  3PL8 A;  4P55 A;  1DGW Y;  4M72 A;  3PFI A;  4AIJ A;  2V9V A;  1RKT A;  2QLZ A;  1O57 A;  6PAX A;  1WKM A;  2X1C A;  1USS A;  4LIT A;  4Q4Z F;  1KU7 A;  1DP3 A;  3ABT A;  4IHS A;  1A04 A;  2DU9 A;  3K2A A;  4A69 C;  5LFA A;  3HSF A;  2GXA A;  1WVR A;  1U5T A;  2DA3 A;  3IL2 A;  2MBF A;  3QRF F;  3CMA I;  1HDD C;  4A93 J;  3FU6 A;  2FEZ A;  4PUS A;  3BR3 A;  2R0Q C;  3EUA A;  2VOP A;  3CES A;  2UZK A;  2JSC A;  1S9H A;  2R7V A;  4C3J J;  3ZN0 A;  5FLM J;  3DEW A;  1X1D A;  2P8T A;  2CG4 A;  3ZMV A;  3JAM Z;  2VBX A;  4IKF A;  1Q0Q A;  5LGU A;  2PJR B;  3HUG A;  1D5V A;  3K0L A;  4JX6 A;  2J5O A;  3T8T A;  2Q1Z B;  2V1X A;  5K7Z A;  1YJW I;  2Y2Z A;  4HYE A;  2GA2 A;  4M3B A;  3ZMZ A;  2ZXH A;  3LQR A;  2FU4 A;  2VJ8 A;  2QQB A;  5DS9 A;  3K1P A;  1DU6 A;  4PJL A;  2DMU A;  4W97 A;  2X85 A;  3F6O A;  4I02 A;  3TO9 A;  1JVS A;  4PU2 A;  3CCQ I;  1K4T A;  5LRS A;  1VQ7 I;  4MTE A;  2O9L A;  3BG7 A;  2V79 A;  1LB2 A;  3AU9 A;  1MW3 A;  4M3E A;  2C82 A;  1P9Q C;  3JW4 A;  1YOV B;  2VC1 A;  3K10 A;  4H4K C;  1S29 A;  3BOQ A;  4BKX A;  1UHM A;  2L01 A;  3BQZ A;  4CCL A;  2NYX A;  3WTZ A;  3PSF A;  3A01 A;  3HB9 A;  4A3J J;  1OIS A;  4AR9 A;  2MAO A;  1IW7 F;  1VQ4 I;  5BPD A;  3W3C A;  2O3F A;  4IXA A;  1S5L C;  4BXU A;  3PIP F;  2X6Y A;  5IOY A;  1RI7 A;  2HQA A;  2K9M A;  3B7R L;  1FYL A;  3CCJ I;  3S2W A;  3O2P E;  2NVT J;  1SQM A;  2Y0S N;  2PEX A;  1GXP A;  3JRA A;  4ESF A;  2DYR H;  4XLN F;  3T5X A;  5M5X J;  3KE2 A;  2K3P A;  1VQP I;  4XNB A;  4PDK A;  2HOE A;  3LFK A;  5FO5 A;  3DBH B;  2EIL H;  3FBN B;  4YFK F;  2GOX B;  3ROU A;  2A07 F;  2YS9 A;  1DUX C;  2Y69 H;  3OWT A;  4BDY A;  3FH8 A;  3RQ4 A;  5KAF C;  3ZP5 A;  3R4K A;  2GZW A;  3B6A A;  4F52 A;  3E0J B;  3BTJ A;  1ON1 A;  3A0B C;  2XHK A;  5ILV A;  3CCL I;  4L0Y B;  3F8M A;  4E4H A;  3GTQ J;  1NK3 P;  2JN6 A;  4BUP A;  3L2W A;  1WRJ A;  4ENK A;  1RES A;  5DCF A;  4DQ2 A;  2LY9 A;  1ZYR F;  4RAF A;  2MLG A;  5GPA A;  1R23 A;  1UCR A;  2JZY A;  4PCQ A;  4XKB A;  3CDI A;  1LE8 A;  1HCR A;  3B7S A;  4JQF A;  4O5V A;  3KET A;  2OCC H;  1N78 A;  3RYP A;  4F7Z A;  3LAP A;  1XGS A;  1TW3 A;  5EV7 A;  1S7A A;  2Y31 A;  3Q9V A;  4HLX A;  3FUN A;  4IO9 F;  2RJI A;  3F0C A;  3TP3 A;  4XBF A;  2M9H A;  3CCV I;  3Q0W A;  1R6R A;  2HOT A;  5KVR A;  2XKO A;  4MHG A;  5L3F A;  3MKY B;  5HLI A;  1XX5 A;  4KIB A;  4IOA F;  2FML A;  2UXX A;  5LEJ A;  3GME A;  2ZKZ A;  1Z67 A;  1K4S A;  1MW1 A;  3I4P A;  4Y6S A;  1KYW A;  1ONV A;  2P81 A;  3OY9 A;  4XO4 A;  2EH3 A;  3S1R J;  2YX7 A;  4FLS A;  3BR0 A;  1FYK A;  1XDU A;  4DZJ A;  1IDY A;  4XO3 A;  3HBL A;  3MKZ A;  2KL4 A;  4KIC A;  1WJF A;  2Z1D A;  3I9V 2;  3SZG A;  4XIC A;  4UV9 A;  1Z21 A;  3L2U A;  1T0F C;  4HLY A;  4FT8 A;  1AU7 A;  2CV1 A;  2VC0 A;  3GZ6 A;  3UNG C;  1I1G A;  1A6Q A;  1S8N A;  2ZJ2 A;  1ETW A;  2ZME A;  2QA4 I;  5CVV A;  3CCU I;  2DFH A;  4DBR A;  4UVC A;  4A3M J;  5FRM A;  1G3Y A;  4N4N B;  2DFF A;  3K7A J;  4XMW A;  5KNL A;  4KDP A;  5DM7 F;  2JQ7 A;  3E5U A;  2ZNZ A;  4EV0 A;  3TGN A;  2R5Y B;  1FJL A;  1TBX A;  3FUE A;  4M73 A;  1ZRC A;  5FLV A;  2VT2 A;  1FMV A;  2KZG A;  2L7Z A;  2QVW A;  1B72 B;  2XAQ A;  5FWQ A;  4M3D A;  1GDT A;  3CTA A;  4A3E J;  2Z9O A;  2IGN A;  4Z2Y A;  3ZMT A;  1SD5 A;  1SMY F;  2I10 A;  1T0F A;  3KEQ A;  4EJT A;  1BI1 A;  3SZT A;  3FIW A;  2HVR A;  3BTC A;  4CZC A;  2F5D A;  5D4S A;  2DK8 A;  1N25 A;  1R00 A;  3BP8 A;  5H20 A;  2IGK A;  1SFU A;  3IRQ A;  5JNL A;  1ZGW A;  3MVP A;  1X3Z A;  1DGR M;  4E6K G;  4NNJ A;  2EV6 A;  4BBR J;  1EH7 A;  2EIM H;  2BBY A;  4A3B J;  1B1B A;  1LQ1 A;  4R8H A;  1X58 A;  1U8R A;  2STW A;  1VND A;  2W57 A;  3DTK A;  4XR6 A;  2XAH A;  5AEN A;  3VSK A;  2VQH A;  1A36 A;  3J81 K;  5DM6 F;  4XN2 A;  4FTH A;  5AON A;  4LLG F;  1ONP A;  2NOG A;  1IC8 A;  3Q0V A;  2KPM A;  3KP6 A;  3NAU A;  5M5W J;  4GGG A;  4HF0 A;  2KQR A;  3QU3 A;  2ZSH B;  3HIF A;  4FE7 A;  1HLV A;  1UST A;  2KIQ A;  1H19 A;  1ZG5 A;  5DD4 A;  4C9Y A;  1U9O A;  2PUS A;  1CF7 B;  3ZHY A;  3L1P A;  3KLO A;  2OCE A;  4M6Y A;  2H94 A;  1IXC A;  2HVQ A;  1ETV A;  1RC9 A;  4PJM A;  2NRA C;  2WPG A;  3R60 A;  3SHF A;  4NHJ A;  2F5C A;  5EZG A;  2ZC2 A;  1W0T A;  4MEY F;  3KYL A;  1D1B A;  2R7W A;  4HEA 2;  5E1W A;  5HS8 A;  2HOS A;  4ZC3 A;  1MNM C;  4QWQ A;  3ASN H;  1IG7 A;  5JVG F;  1FX7 A;  1D1C A;  2W84 A;  3CUQ B;  4L5I A;  3B3B A;  2DQL A;  2B7E A;  2RQP A;  3DKY A;  3J81 Z;  3WTV C;  4CCN A;  4Y4R A;  1JJ6 C;  3TDU C;  1LNW A;  1FIA A;  3QWL A;  3BG3 A;  2STT A;  4G7H F;  2K4B A;  2DA2 A;  2FE3 A;  3GTK J;  1ZG3 A;  3GZ5 A;  3FXK A;  4RCV A;  3G73 A;  3JT1 A;  1ZH5 A;  2F4M B;  2RRE A;  2H8W A;  3MWM A;  3WGH A;  4EJO A;  3BR6 A;  2P4W A;  4YII A;  2HNH A;  1OFC X;  2NVY J;  4OIN F;  2OUM A;  1YW8 A;  2WAD A;  4RGU A;  2G7U A;  3Q44 A;  3HOT A;  4ESB A;  3FK7 A;  3K1M A;  3HOS A;  4GCV A;  2LF7 A;  2L4A A;  5IYB J;  3SQN A;  3ZOB A;  3HSE A;  3FTY A;  1Y0U A;  5DUL A;  5DCM A;  1Q0H A;  4CH7 A;  1LFU P;  1E2X A;  3TOB A;  3CHS A;  4A3D J;  2WC2 A;  1IRF A;  3OYL A;  1LDJ A;  2GA1 A;  4PFO A;  3TDZ C;  2JA7 J;  1HF0 A;  2LMD A;  1SD4 A;  2D5V A;  4RGS A;  2GLO A;  2PBI A;  4IJA A;  5D8K B;  5F27 A;  1ERD A;  4XM3 A;  3ZQF A;  2X6O A;  3ASO H;  4M3G A;  2CQ7 A;  4AD9 A;  1HW1 A;  2ESN A;  3QU6 A;  1FOK A;  3MN2 A;  1HST A;  2BY0 A;  3OIP A;  1ZAO A;  2D1H A;  5TGT A;  1YLF A;  4AYS A;  2VB6 A;  1UHW A;  3RKW A;  3FM3 A;  4MTD A;  5L3B A;  2B9S A;  2IJL A;  2XV4 S;  2Q0O A;  1ZK8 A;  3QOE A;  5D5W B;  1IUY A;  3E5Q A;  4L5E A;  4OU0 A;  5TRD A;  2EFW A;  1RPW A;  4D7M A;  5J6X A;  5E1X A;  2EFQ A;  3N05 A;  2ADU A;  4JX5 A;  4DJA A;  1ETY A;  5EJC A;  1GHC A;  3K4C A;  5JLW A;  2BE5 F;  4BS9 A;  4P9F A;  2PGG A;  4LG0 A;  2E1M C;  5IOZ A;  3KED A;  1FBS A;  2QKM B;  3HM5 A;  5FKO A;  3PQJ A;  2HVS A;  1V5F A;  2CW8 A;  2FSW A;  3GTO J;  4HV6 A;  3RPU D;  3ABU A;  2IBD A;  5DTD A;  3A14 A;  3HRU A;  3L2R A;  2DJI A;  4B3X A;  2MLK A;  1RP3 A;  3WQS B;  3H36 A;  3C18 A;  3E6M A;  1U0J A;  3QJX A;  1SD6 A;  1DPU A;  3M1E A;  2XIG A;  2Y75 A;  4CUG A;  1B59 A;  2VI6 A;  3LAJ A;  3CD6 I;  2RGV A;  3S15 J;  3ZR8 X;  3RIR A;  4QHP A;  1DDN A;  3RC3 A;  4NC8 A;  2P6T A;  4L18 B;  3E6D A;  4Q4E A;  2WV1 A;  3MZY A;  4P5O A;  3KP7 A;  4LK1 F;  3RCO A;  5LHG A;  3GFJ A;  4IHV A;  4BYY A;  5ED4 A;  3OYG A;  1XCV A;  2O7O A;  2DOF A;  2IS2 A;  3VYS B;  4FET A;  2JK3 A;  4U7D A;  5FLX Z;  2HWV A;  2RKH A;  3CJT B;  4XKV A;  4A2U A;  1D8J A;  5IP7 J;  2FD5 A;  5JHF A;  3H3V K;  5EG0 A;  2NAZ A;  4ZQG A;  2LSO A;  2WWY A;  2KIM A;  2GTQ A;  2HKX A;  1CQT A;  2XSJ C;  4XSX F;  4I7H A;  5FKL A;  1EA3 A;  4C3I J;  1JUS A;  4GAE A;  3DBR B;  3D5S C;  4XMU A;  1APL C;  1SC7 A;  4ZW8 A;  1MW2 A;  3SDB A;  5KAI C;  3FUK A;  1ZLJ A;  3OYA A;  1Z7U A;  1G5A A;  5BMZ A;  4XN1 A;  2E2H J;  1Q1V A;  4A03 A;  4RGX A;  3B2X A;  4ZYH A;  1VF9 A;  2CQQ A;  4OAY A;  2EIK H;  4BE1 A;  1IUF A;  2W1O A;  1SVM A;  2W25 A;  3ANM A;  3WTX C;  5C4X J;  2VJI A;  3RSN A;  3TOA A;  5H2F C;  1W5S A;  4NC7 A;  2IS4 A;  3BY6 A;  4XND A;  5B3S H;  3O8G A;  1QVU A;  2CW0 F;  2LD5 A;  4A0X A;  4HX4 A;  3P7N A;  2BHY A;  1X1A A;  3RKX A;  1VQ9 I;  3GTL J;  2XAU A;  3BTI A;  3EUK L;  3M8F A;  1HOM A;  3AG4 H;  2FF4 A;  4MGR A;  1J2X A;  4FLQ A;  3AL0 C;  3QAH A;  4ZTJ A;  2HS5 A;  1D5Y A;  2K40 A;  3FHE A;  1AWC A;  2R93 J;  1KQ9 A;  2OQG A;  3FU5 A;  1TWF J;  1FOX A;  3BCA A;  1FP2 A;  4EEF G;  1SD7 A;  3FMQ A;  1K7A A;  3CC2 I;  1WJC A;  1MKM A;  1SVL A;  3TO6 A;  2L54 A;  2QF7 A;  1W36 C;  4PJJ A;  2ID3 A;  2Z2S B;  2PMZ N;  3H35 A;  3B73 A;  3I64 A;  1Z6T A;  3A03 A;  4ZH4 F;  3HL2 A;  2MD5 A;  5BOX A;  1STZ A;  4KJZ A;  1BC7 C;  1EH8 A;  2FUG 2;  3B7U X;  2KDO A;  3H5A A;  5J8C A;  2L5Q A;  1S7E A;  1RUN A;  1HSJ A;  1KU2 A;  3BZ6 A;  4M9X A;  3JCU C;  2KLO A;  4M71 A;  4U7B A;  1XSV A;  1X2N A;  1AHD P;  2CGP A;  4P1W A;  4XOP A;  3OYJ A;  1QU3 A;  4F91 B;  3DU6 A;  1Y1W J;  2A69 F;  2LG4 A;  1QA6 A;  1UEL B;  3ABL H;  2L2O A;  3QPS A;  4X2U A;  2FBI A;  4O3M A;  4ENJ A;  1HA8 A;  4ZX3 A;  2GIV A;  1QVT A;  5J1Y A;  2VBW A;  2AXT C;  4ITV A;  2RN7 A;  1R9T J;  3HTU A;  3ESW B;  3I55 I;  1BM9 A;  2VPR A;  1JT0 A;  3GLL A;  4M3F A;  2LR8 A;  3S2D J;  2Y1D A;  1U3E M;  3FHN A;  2QEX I;  1FPQ A;  4IX7 A;  4ZX4 A;  1ZAR A;  5K7H A;  5LGT A;  1P2F A;  3IUO A;  1TZL A;  2WZG A;  2EFO A;  3ZMD A;  2K5C A;  3FXM A;  1NG7 A;  2CQN A;  4BHC A;  3LSR A;  1KQ8 A;  3FUI A;  2BGC A;  5HNH A;  1UJ8 A;  3P9K A;  1WJE A;  1SFO J;  2HOA A;  3HKZ A;  3JRG A;  3E3V A;  2Y1C A;  3NWS A;  1X3Z B;  3I58 A;  3CP8 A;  3OIQ A;  3FUM A;  2F2E A;  1UMQ A;  2DCE A;  1W36 D;  1ZS2 A;  2BY3 A;  4BJT A;  5HLG A;  2F5F A;  2QCO A;  3KCC A;  4XLE A;  3PJR A;  1IO2 A;  1PP8 F;  2DA4 A;  3D5R C;  5ICF A;  2JRM A;  2V7F A;  3QPL A;  2JSP A;  3HGY A;  4M6V A;  1WI9 A;  4PFP A;  5D5X B;  1KU3 A;  2CRG A;  3DEU A;  1YS6 A;  1ZR4 A;  3PO3 J;  4ZQF A;  1OJL A;  2BEO A;  5GP9 A;  2ETH A;  3BG9 A;  4ARF A;  1T56 A;  2VPL A;  2O5R A;  1VQ6 I;  2PI0 A;  2N8G A;  1JHF A;  4OOI A;  3U9W A;  3CC7 I;  4UV8 A;  4AR8 A;  2CO5 A;  4Z6Y A;  4BXX J;  3IWF A;  1K6Y A;  5E17 F;  2VJJ A;  4OWR B;  3GFI A;  3BWG A;  1ETQ A;  2C6Y A;  2CQK A;  1T1R A;  3KLN A;  3N97 A;  5E3L A;  1FBQ A;  3W2W A;  2VKE A;  4L0Z B;  1H0M A;  2E5N A;  1HW2 A;  2WB1 N;  2EBI A;  2CUJ A;  2X1D A;  5DEQ A;  1TL8 A;  3S17 J;  2CMP A;  4A3L J;  1W4M A;  2DLL A;  1BN5 A;  1U2W A;  3BZC A;  1IN4 A;  1MMG A;  2L0K A;  3LSI A;  4I99 C;  3V7C A;  1D0Y A;  2DFI A;  1O7L A;  3I53 A;  5HS9 A;  2VQG A;  2GIZ A;  4YG2 F;  4ENM A;  2E1N A;  1FMW A;  4AM3 A;  5ERI A;  3SFI A;  1MJB A;  3RPQ A;  3WTU C;  5E3N A;  2KP6 A;  1OCP A;  2VN2 A;  3F8N A;  4LFU A;  5E1Z B;  4JX4 A;  4B44 A;  3LSP A;  3V8L A;  3H3Z A;  3LOC A;  2M8E A;  4E7H A;  1EJ9 A;  1W1W E;  4XMV A;  3ZQG A;  9ANT A;  4BE2 A;  4M9S A;  2QKL B;  4IRG A;  2Y0M A;  3FF5 A;  3TKY A;  2K27 A;  1LPQ A;  2R70 A;  1FY7 A;  4DW6 A;  4K5P A;  4A12 A;  1F4K A;  2H1K A;  3IH4 A;  3OYH A;  4ZX6 A;  2K9S A;  4RLF A;  4HZF A;  4HOB A;  1U5T C;  1RZ4 A;  3E1S A;  3FU0 A;  4MIM A;  4FCA A;  4A3I J;  3S3O A;  4IHW A;  1SAX A;  1YJN I;  2DT6 A;  2VQL A;  3CQZ J;  3S8P A;  1GUU A;  1BI0 A;  1V5G A;  4XON A;  4RSY A;  3I71 A;  3K4B A;  3S3M A;  3HHH A;  4R5T A;  3J7Y J;  1YHQ I;  1RNL A;  2JPB A;  1T08 B;  1PJR A;  3T8R A;  5K5Q A;  2R7U A;  3BPX A;  2CYY A;  4XOT A;  2NNY A;  3M8J A;  2QQ9 A;  4HRI A;  4EAT A;  4I76 A;  5FD6 A;  4KP7 A;  2QWW A;  1O3S A;  5JBI A;  3LA7 A;  1X4O A;  4J01 A;  1H8A C;  1VZ0 A;  1UHS A;  4E7L A;  4E7S A;  5ICE A;  3OS0 A;  1BW5 A;  4NC6 A;  1JKP C;  2BYV E;  5F0F A;  4CIC A;  1K78 A;  4WXC A;  1UB9 A;  2MW8 A;  5JO0 A;  4B3A A;  3LMM A;  1QPI A;  3FMR A;  2E7W A;  3KP4 A;  5J3L A;  4JK1 X;  4A3K J;  3C7J A;  4KYW A;  3R61 A;  2DTZ A;  3PO2 J;  1TWC J;  2E1C A;  1E3P A;  2CUZ A;  1P4X A;  3K69 A;  1YRN B;  4J3B A;  2ZXW H;  2WV0 A;  4N4O B;  4HST A;  3Q3S A;  2HDD A;  3BLY A;  2Y1F A;  3KEO A;  4AU7 A;  2DPU A;  3VYU B;  1R5G A;  2O8K A;  4GYI A;  3RZD J;  3H3U A;  3AKZ A;  4AC0 A;  4ON0 A;  5AIP A;  4JYK A;  1PYV A;  4RA2 A;  1EF4 A;  3B2P A;  2MC4 A;  4IOC F;  2IAI A;  2L9V A;  2K9N A;  2LKX A;  3UR3 C;  1K61 A;  3A0H C;  1PP7 U;  3IH3 A;  2HYF A;  3AG2 H;  3FTZ A;  2CU7 A;  4G6D A;  5F64 A;  4WK8 F;  4RAG A;  5M3M J;  1TNT A;  2H8R A;  2LTP A;  4FE4 A;  3RKQ A;  4HPQ A;  2HXI A;  3DQV C;  3JSO A;  4RAY A;  2F6C A;  1V5E A;  2VBZ A;  5CLS A;  1N75 A;  2KMU A;  4XKW A;  3HXL A;  4C3H J;  3K9T A;  3C2G A;  4Q47 A;  5E3O A;  3WTY C;  2ZJR F;  1XS9 A;  2OTJ I;  3CDH A;  4XK4 A;  3CMM A;  4EJV A;  5KCM A;  2HFH A;  3FDY A;  2LF8 A;  2JUG A;  3EDP A;  5GTI C;  1OYY A;  2BXZ A;  3PUB A;  2EK5 A;  3OL4 A;  2VXZ A;  4KIF A;  4L9V A;  1OCT C;  2E1M B;  5EF6 A;  2ZJP F;  4JBA A;  1EH6 A;  3FXL A;  1XPX A;  1UG0 A;  3GWZ A;  3BRO A;  3WG7 H;  2MGQ A;  4QIR A;  2K7L A;  4L9N A;  4HNV A;  3TP0 A;  3PM1 A;  4Q4I A;  3M8E A;  1OQY A;  1W7P A;  2XUB A;  5HOO A;  4HW0 A;  4UUS A;  5EG0 B;  3KEY A;  4NBQ A;  1BL0 A;  3WHC A;  3S16 J;  4LJZ F;  1XB4 A;  3LA3 A;  2V9K A;  4XLH A;  5J47 A;  3HKZ N;  4KMU X;  5GAH J;  2JA5 J;  4Y6R A;  4ZQT A;  3I5U A;  1QZE A;  4ZZL A;  3R0J A;  3HOY J;  3G1M A;  3VFZ A;  4XN3 A;  4CHU A;  5BNG A;  2Z3Y A;  3FXQ A;  2JVG A;  2EFN A;  3H5R A;  4V2F A;  2EZK A;  3I54 A;  1XSX A;  3QYF A;  1FSE A;  2M0M A;  4FHT A;  1XGO A;  4LB5 A;  4BJ6 C;  2ZME C;  3HSR A;  3GO5 A;  3GTM J;  2DPD A;  3CC4 I;  2ID6 A;  3DXJ F;  3FIS A;  4B47 A;  2ISZ A;  4BJ5 C;  2P5K A;  2O03 A;  5DYM A;  5L3C A;  3MFK A;  3WQR A;  4HX7 A;  3LWF A;  4XSZ F;  1N77 A;  1XD7 A;  2HGC A;  4XRS G;  1TWG J;  4K5N A;  2KJC A;  3H9G A;  2DOD A;  3OOP A;  3HRS A;  2BOL A;  3GUD A;  1Z77 A;  1XC5 A;  2ELH A;  5KHD A;  5J1R A;  4CYC B;  3JRF A;  2V4J C;  2QUF A;  2R7T A;  3OOU A;  1FNN A;  1GVD A;  1LDK B;  1MGT A;  1E17 A;  2HDW A;  4KT6 A;  2M0C A;  1IRX A;  2CJJ A;  4PSX A;  2HYJ A;  1NG6 A;  5LLQ A;  1ZTR A;  2HTJ A;  3GVA A;  4U87 A;  4OOE A;  5DV5 A;  2XGX A;  3QP6 A;  1R5H A;  2IVM A;  4YIR X;  1AA7 A;  2DTR A;  3T8V A;  2XB5 A;  2OF7 A;  2EZH A;  3I59 A;  3D1N I;  1L3L A;  4QUO A;  3UEQ A;  2R4G A;  3IP4 B;  3FXO A;  5TIS C;  1GXQ A;  1P7I A;  3OS2 A;  3PUF A;  1J5Y A;  2QZ8 A;  3JRE A;  3W6V A;  4NQW A;  3GZN B;  2X1E A;  3WU2 C;  1V55 H;  2GQQ A;  4BHP A;  4LMY A;  3AL0 B;  4ZW6 A;  2O8X A;  1NHA A;  1HS6 A;  4GYG A;  4CZZ A;  2M4G A;  1R1V A;  3ZQ7 A;  3IAM 2;  4I01 A;  1POG A;  2HR3 A;  4MKT A;  3G6E I;  1F36 A;  3IAS 2;  3DFG A;  4EM0 B;  1LUJ B;  4B8X A;  1IN6 A;  5HDG A;  1ZN2 A;  2OZU A;  1BIA A;  1DU0 A;  3H0D A;  3F8F A;  4JP0 A;  2EA4 A;  3DPT A;  1QPM A;  4I0B A;  3JRH A;  3VYR B;  1Q1H A;  3ULQ B;  3QQA A;  2R5Z B;  4A3C J;  1FSH A;  3PNT A;  5LHI A;  4L5J A;  2XGE A;  1R1U A;  1RUO A;  3CHP A;  2W7N A;  2QBY A;  1J59 A;  3IRR A;  1DPR A;  1FWZ A;  3Q9S A;  2QQ8 A;  1IN5 A;  3DWL E;  4HV5 A;  2HPO A;  1X3W A;  4MFD A;  1QGP A;  1YIT I;  2GBY A;  2FJ1 A;  3FXU A;  4PSW A;  3DPU A;  2XSD C;  1G4D A;  4LUP A;  2HQ5 A;  1JXS A;  3WGI A;  5JVT A;  2I5U A;  1XDS A;  4K5L A;  4ZQE A;  5GAE J;  2DJN A;  2ZXG A;  4I09 A;  2FQ3 A;  2R7F A;  4MO7 A;  4MNU A;  4LIV A;  2R59 A;  4Y33 A;  5A2Q Z;  2COM A;  2IS1 A;  5EDN A;  2XGC A;  1O3T A;  2LNB A;  4BU2 A;  4NDL A;  2PL5 A;  1XTA A;  4UXN A;  1K79 A;  2KZV A;  1BBY A;  2LBF A;  4UUT A;  2Z16 A;  1FC3 A;  3HPH A;  2FNP A;  1JUP A;  2A6E F;  1JUM A;  1F5T A;  2OJE D;  4I98 B;  1DQU A;  2OPT A;  2DW4 A;  2P5L C;  4FIS A;  5F0C A;  2DA7 A;  4BQQ A;  4ZYA A;  3PIO F;  2ME0 A;  2XF6 A;  3E5X A;  1O3R A;  4JND A;  3CXB A;  1MMS A;  3GYH X;  4L9T A;  1VQL I;  1BA5 A;  3OR2 C;  5DYF A;  3GEZ A;  1XMK A;  1B8I B;  1LEB A;  3LQQ A;  3CO7 C;  3EPZ A;  3ZQI A;  2K9Q A;  2O61 A;  3V7R A;  3VVM A;  3KPH A;  4D0P A;  3KYD B;  1D3Y A;  5F6F A;  1LFB A;  1SFK A;  2H09 A;  2P0W A;  3TED A;  1JT6 A;  1TNS A;  2OC6 A;  2EV0 A;  1T2K A;  4R79 A;  1YO5 C;  3ELK A;  1H88 C;  1BOB A;  3BQY A;  2XPU A;  4DBQ A;  4RDU A;  2LLK A;  4RB1 A;  2EGH A;  1ZQ3 P;  3RAS A;  2IW5 A;  3ERE D;  1BI2 A;  1G6N A;  2G9W A;  3L7W A;  2VOO A;  4ABZ A;  1QRY A;  3BR5 A;  3F72 A;  4BAC A;  2DA6 A;  1P4W A;  3B02 A;  4CCJ A;  2A5W A;  4DOZ A;  3HJE A;  4BY7 J;  3UER A;  5LBQ A;  2E5Z A;  2CUF A;  2E7X A;  4ZW7 A;  3MAJ A;  1B9N A;  5J40 A;  2DMP A;  3LST A;  3ISP A;  2JCV A;  2XGD A;  2XB0 X;  4MEX F;  2OA4 A; 
#chains in the Genus database with same CATH homology
 1DGW Y;  3V42 A;  4AYB A;  2R7R A;  3Q43 A;  5JC1 A;  3FUL A;  3UCQ A;  3HC7 A;  3TL4 X;  2JCY A;  2BW3 B;  3HL2 A;  4KJZ A;  1D0Z A;  2X1C A;  4LIT A;  2FUG 2;  3B7U X;  5HLT A;  2KDO A;  2HU9 A;  3H5A A;  2L5Q A;  1DP3 A;  2KLO A;  2VLA A;  5LFA A;  4U7B A;  1X1B A;  4ZDL A;  1R0K A;  3OYF A;  2WBM A;  4F55 A;  3FU6 A;  4PUS A;  4AR1 A;  3CHR A;  4P1W A;  4XOP A;  3OYJ A;  2VAS A;  1QU3 A;  4F91 B;  3DU6 A;  4RVB A;  3EUA A;  2LG4 A;  3CES A;  3GBG A;  1UEL B;  3K4J A;  1S9H A;  2L2O A;  4HSR A;  4JOM A;  5HVQ C;  2R7V A;  3FUH A;  4X2U A;  2WY8 Q;  2B61 A;  4ZX3 A;  2CW7 A;  1Y6I A;  1HA8 A;  1X1D A;  2R7S A;  4ITV A;  4IKF A;  1Q0Q A;  2PJR B;  2UWM A;  4KIT B;  2Y1D A;  4QPE A;  2Q1Z B;  3MMY B;  3FHN A;  1T1S A;  2XPZ A;  2VJ5 A;  3K4M A;  4IX7 A;  2VQC A;  4ZX4 A;  2WZG A;  3IUO A;  1TZL A;  3HUG B;  2ZXH A;  3H9Q A;  2DT7 B;  2K5C A;  3QYE A;  2VJ8 A;  3B7T A;  2LH9 A;  1NG7 A;  4RM2 A;  3FUI A;  4PJL A;  2X85 A;  1MW7 A;  5HNH A;  1JVS A;  4X0G A;  1WJE A;  4PU2 A;  1QHG A;  1OR7 C;  3HKZ A;  3CJQ B;  4GAA A;  2Y1C A;  3NWS A;  2V1N A;  3BG7 A;  3CP8 A;  3OIQ A;  4E7J A;  2DCE A;  1WJA A;  1W36 D;  5LD2 C;  1MW3 A;  3AU9 A;  3FUM A;  1ZS2 A;  2C82 A;  1P9Q C;  2BVL A;  4BJT A;  2LY2 A;  4XLE A;  4H4K C;  3K10 A;  3PJR A;  4XNA A;  4BKX A;  4CCL A;  3D5R C;  3S93 A;  2V7F A;  2JCX A;  2JSP A;  2W4S A;  3PSF A;  3ZGK A;  2HPT A;  4XL9 A;  4PFP A;  4AR9 A;  2MAO A;  4ZQF A;  1MW0 A;  3ZXS A;  4ZJZ A;  3BC8 A;  3W3C A;  2PJR A;  4XLA A;  4MLO A;  2X6Y A;  4ARF A;  3RTR A;  2HQA A;  2K9M A;  2O5R A;  2MYS A;  3VSL A;  4E7K A;  2VPL A;  3PUU A;  4K5O A;  2LRD A;  3LL7 A;  1OR7 A;  1Y56 A;  4E7Z A;  1SQM A;  3U9W A;  1LKX A;  4AR8 A;  1WJ5 A;  1K6Y A;  4QPO A;  3WQQ A;  2VJJ A;  4OWR B;  4ZTF A;  2K3P A;  4XNB A;  1MND A;  1T1R A;  4ZDP A;  2K9L A;  3FBN B;  3W2W A;  3MKW B;  2E5N A;  2GOX B;  2X1D A;  4C2U A;  2CUJ A;  4ANJ A;  2CMP A;  3A4C A;  2CH0 A;  3OWT A;  4BDY A;  3FH8 A;  3RQ4 A;  1MMD A;  1WFX A;  4BGD A;  3EBH A;  4F52 A;  3E0J B;  2BVM A;  4C30 A;  3T0Y A;  4E4H A;  1MMG A;  4XMZ A;  3LSI A;  2CV1 A;  1D0Y A;  2PMZ A;  4BUP A;  3L2W A;  2VQG A;  4IZZ A;  3B37 A;  5BPP A;  3W2V A;  1FMW A;  4XKB A;  2KP6 A;  4B44 A;  3B7S A;  4AIC A;  4JQF A;  2M7B A;  3OYM A;  3OR1 C;  4E7H A;  4IQJ A;  4XMV A;  4LG3 A;  1R0L A;  1N78 A;  4BE2 A;  2QKL B;  5EV7 A;  1BR1 A;  3FUN A;  2RJI A;  2R70 A;  3ANN A;  1D1A A;  1R6R A;  2E60 A;  3LSG A;  3OL3 A;  4K5P A;  3MKY B;  3OYE A;  5FRO A;  3OYH A;  2ELJ A;  4ZX6 A;  4RLF A;  4DIQ A;  3E1S A;  3FU0 A;  4FCA A;  4R5V A;  2L9S A;  3AFH A;  3VVL A;  3S3N A;  1X1C A;  3S3O A;  4KIS A;  3J7A Y;  1MMA A;  1MW1 A;  4FLO A;  4Y6S A;  3AUA A;  3OY9 A;  2DT6 A;  2VQL A;  4XO4 A;  2WAQ A;  3S8P A;  2CS3 A;  2NOJ B;  1V5G A;  4XON A;  3FH5 A;  2KRH A;  4XQF A;  4FLS A;  4RSY A;  3K4B A;  3S3M A;  3EBG A;  2CFO A;  4II3 A;  4XO3 A;  3MKZ A;  3VYT B;  2KL4 A;  4R5T A;  5JMW A;  1WJF A;  2MAB A;  2Z1D A;  2L7K A;  3I9V 2;  3SZG A;  1Z21 A;  3TMO A;  1T0F C;  1PJR A;  1G8X A;  2XF5 A;  3L2U A;  2R7U A;  4PVB A;  2LRE A;  3UNG C;  4XOT A;  2W82 A;  3M8J A;  4DBR A;  4HRI A;  2Y1G A;  4EAT A;  2R7Q A;  4KP7 A;  5FRM A;  4N4N B;  2JD2 A;  5JBI A;  1X4O A;  4OOF A;  4BE0 A;  4J01 A;  5KNL A;  4Y67 A;  4XKC A;  4XMW A;  1VZ0 A;  4YEL A;  4E7L A;  4E7S A;  3DTE A;  3S32 A;  3OS0 A;  3FUE A;  2IXS A;  3LSM A;  3ZHZ A;  1X4P A;  1FMV A;  2QVW A;  5JO0 A;  4XN9 A;  5FWQ A;  3KX2 A;  3LMM A;  4XMT A;  3W2A A;  2IGN A;  3VWB A;  3FTU A;  1S46 A;  3DKX A;  3FUD A;  2VL8 A;  2HVR A;  4R7L A;  2CUZ A;  4NUB A;  4CZC A;  1Z3X A;  3EUH C;  2Y0S A;  4J3B A;  2IGK A;  1UAA A;  5JNL A;  1MNE A;  4N4O B;  4HST A;  1X3Z A;  2JA2 A;  3BLY A;  3SEQ A;  2Y1F A;  4CCK A;  1DGR M;  4AU7 A;  4E6K G;  3VYU B;  4NNJ A;  4J00 A;  3A06 A;  4B43 A;  3HG9 A;  2I8D A;  3AKZ A;  1ONO A;  2WB1 A;  4BEH B;  1PYV A;  1OLT A;  3FKJ A;  3B2P A;  2MC4 A;  3SEZ A;  1LVK A;  4RM3 A;  4XN8 A;  3DTK A;  1SAU A;  1X19 A;  3UR3 C;  3OYD A;  1W36 C;  3IIE A;  4XR6 A;  2IS6 A;  4MS6 A;  3VSK A;  5AEN A;  2VQH A;  3FTZ A;  4XN2 A;  4XN7 A;  1ONP A;  1GW6 A;  1LFP A;  2KPM A;  2F4I A;  2WAF A;  4CCM A;  4HPQ A;  3DQV C;  2KQR A;  2ZSH B;  3OMY A;  2F6C A;  1V5E A;  5CQG A;  1BR2 A;  1H19 A;  4C2T A;  3RC8 A;  1JG9 A;  3U21 A;  2ZXI A;  1N75 A;  2KMU A;  3K4K A;  3HXL A;  4XKW A;  4C9Y A;  3C2G A;  3B7R L;  4HNU A;  4YRV A;  2PUS A;  3CMM A;  2WY7 Q;  3ZHY A;  5KCM A;  3FDY A;  2JUG A;  2HVQ A;  3PUB A;  3OL4 A;  4PJM A;  2VXZ A;  3OS1 A;  2WPG A;  3CZL A;  2E1M B;  3CZG A;  3LFU A;  4XO5 A;  2GOM A;  3FTW A;  4Y3O A;  1UG0 A;  3KYL A;  1D1B A;  2R7W A;  4CA0 A;  4HEA 2;  4QIR A;  4DGW B;  3VDX A;  2QJ1 A;  3FUF A;  4D9J A;  4Q4I A;  1Z3Y A;  4ZC3 A;  2DQM A;  3BG6 A;  3TBI A;  4XNF A;  4LIU A;  5HOO A;  4F93 B;  4F3Q A;  3KEY A;  3CJR B;  2O7G A;  4CCO A;  1D1C A;  3K4L A;  2JVH A;  2DQ6 A;  1JI8 A;  3B3B A;  2IGO A;  1QHH D;  2V9K A;  4XLH A;  2HZD A;  3DKY A;  4RLQ A;  4Y6R A;  1GLN A;  4ZQT A;  4CCN A;  4Y4R A;  1YX5 A;  5CKT A;  3ONQ A;  3OYK A;  4BXF A;  3CIA A;  2V6E A;  4XN3 A;  3H5R A;  2JVG A;  2X51 A;  3DU5 A;  2A7O A;  2Q2E B;  3NWT A;  5CPR B;  3QYF A;  2M0M A;  3L2V A;  2IGM A;  4RCV A;  3JT1 A;  2RRE A;  2R7O A;  4BJ6 C;  1Z7L A;  1YX3 A;  4FAS D;  3CZE A;  1K5H A;  2XF7 A;  2HNH A;  2OUM A;  2WAD A;  4B47 A;  5JMP A;  4BJ5 C;  3ZI0 A;  4K5M A;  3A1Y A;  2LOO A;  3Q44 A;  4G6T B;  3WQR A;  2MD0 A;  3HOT A;  3LSH A;  3A2K A;  3HOS A;  2R7X A;  2DXI A;  1N77 A;  1SC5 A;  3FTY A;  4K5N A;  3H9G A;  2XPY A;  3L2Q A;  5DUL A;  4ZW5 A;  1Q0H A;  2JD0 A;  4E7I A;  3JSZ A;  4CH7 A;  3H5N A;  3B34 A;  2BOL A;  3CHS A;  2VIX A;  5KHD A;  3OYL A;  2AQF A;  2LC2 A;  2V4J C;  4PFO A;  4RMN A;  4XLF A;  2R7T A;  3OOU A;  1Q0L A;  1LDK B;  2HDW A;  4KT6 A;  1ERD A;  1IRX A;  3PL8 A;  4PSX A;  4XM3 A;  1NG6 A;  4XN4 A;  4DPR A;  4U87 A;  3OIP A;  1G59 A;  3FU3 A;  2OV7 A;  2RQQ A;  4OOE A;  5TGT A;  4AYS A;  2VB6 A;  3SYT A;  2HPI A;  1AA7 A;  4D1Q A;  2X6W A;  2W00 A;  3T8V A;  4QUO A;  3UEQ A;  2R4G A;  3IP4 B;  3QOE A;  4CSW A;  3OS2 A;  3ANL A;  4HG2 A;  3CZK A;  2MFZ A;  2JV7 A;  1ONN A;  2XQ0 A;  4NQW A;  1YE9 A;  2CV2 A;  2X1E A;  2M7A A;  3N05 A;  4XLC A;  2LYC A;  2WA0 A;  3FBI B;  4BEH A;  4DJA A;  3K70 C;  3AL0 B;  1HS6 A;  4ZW6 A;  3K4C A;  4YEJ A;  4NQW B;  4XMY A;  3ZHX A;  3PFY A;  2M4G A;  3FH7 A;  2WAE A;  3DTI A;  4BS9 A;  5FRN A;  2PGG A;  3IAM 2;  2E1M C;  3KED A;  2QKM B;  2UV1 A;  4MKT A;  3ZRG A;  2M4K A;  2HVS A;  1V5F A;  2CW8 A;  3CF2 A;  3R0I A;  4BQN A;  4OAZ A;  3RPU D;  3IAS 2;  3OYI A;  2A6T A;  2KRC A;  3FUJ A;  3MD2 A;  4BL0 B;  3A14 A;  3L2R A;  2DJI A;  4B3X A;  1RP3 A;  4XMX A;  3WQS B;  4PK4 A;  3H0D A;  1U0J A;  3QJX A;  3DPT A;  3CP2 A;  2FFL A;  4CUG A;  4ZN6 A;  3ZR8 X;  3VYR B;  3D5L A;  4QHP A;  3RC3 A;  4R5X A;  4NC8 A;  2VXD A;  3PNT A;  2F5V A;  4Q4E A;  4P5O A;  3CHP A;  3FTS A;  2W7N A;  4L2L A;  2CV0 A;  1TT0 A;  3QOD A;  3RCO A;  3DWL E;  4ZW3 A;  3OYC A;  1E0E A;  3PNV A;  2HPO A;  3I3L A;  2VKD A;  1X3W A;  4Y6P A;  3HPG A;  4CXF A;  3OYG A;  3CZ6 A;  2ZSI B;  3FTV A;  2IS2 A;  3VYS B;  4ZDO A;  4PSW A;  3DPU A;  2RNG A;  4FET A;  4PJJ A;  2Y1E A;  4XOR A;  3OYB A;  4LUP A;  5DLL A;  5HNF A;  4XKV A;  3C2H A;  5JHF A;  3CHO A;  4K5L A;  4ZQE A;  2ZXG A;  4FLR A;  1WJD A;  4ZQG A;  2R59 A;  4LIV A;  4Y33 A;  2XC7 A;  2GTQ A;  3G2B A;  4QPQ A;  3K70 D;  4IQ4 A;  3ZQQ A;  2KHM A;  5JAZ A;  2IS1 A;  2XSJ C;  2LY1 A;  3PSI A;  4BU2 A;  4PW4 A;  2PL5 A;  1EA3 A;  1ZEL A;  3K6G A;  3LSK A;  4GAE A;  2KZV A;  2LBF A;  3D5S C;  4XMU A;  2Z16 A;  3HPH A;  2VKH A;  4ZW8 A;  1MW2 A;  2M3A A;  1DQU A;  2X6X A;  4II2 A;  4BQO A;  3SDB A;  5CQE A;  4F92 B;  3FUK A;  4ZQH A;  2LBF B;  3K4N A;  3AU8 A;  4BQQ A;  4ZYA A;  3OYA A;  1G5A A;  2XF6 A;  4JND A;  2AQE A;  3OR2 C;  4XN1 A;  5DYF A;  1MVY A;  1J09 A;  4A03 A;  3EPZ A;  2R72 A;  4B48 A;  3B2X A;  3VVM A;  3M1C A;  3DLA A;  4OAY A;  4BE1 A;  2ZFU A;  1SFK A;  2W1O A;  4GRI A;  2P0W A;  4HNT A;  3ANM A;  3FTX A;  2L9N A;  4BDZ A;  2VJI A;  3RSN A;  2OC6 A;  4NC7 A;  2IS4 A;  3EBI A;  4XN0 A;  4XND A;  4R79 A;  3OYN A;  1BR4 A;  1H3L A;  1KON A;  1BOB A;  1SG7 A;  2VJ4 A;  2HPM A;  4DBQ A;  4XN5 A;  1X1A A;  2DOA A;  2XAU A;  2EGH A;  3EUK L;  2XDV A;  2WZF A;  3RAS A;  3BCB A;  1WJB A;  2UUZ A;  1JGI A;  3DEE A;  4QME A;  3F9K A;  4AVZ A;  4PJN A;  4FLQ A;  4BAC A;  3CHQ A;  3AL0 C;  2C5Z A;  4CCJ A;  2A5W A;  4DOZ A;  4ZTJ A;  3FHE A;  3UER A;  4ZX5 A;  2E5Z A;  3PNY A;  3ZCO A;  3FU5 A;  4ZW7 A;  2MAP A;  3BCA A;  3QYB A;  2JD1 A;  2V26 A;  1WJC A;  2BW3 A;  3H9J A;  3DPL C;  2JCV A;  1T95 A;  1MMN A;  1D0X A;  2Z2S B;  3H35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...