5HNHA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 107
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnhA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnhA02
2VLAA 5HNFA 5HLTA 5HNHA
chains in the Genus database with same CATH superfamily
1S7AA 1TTYA 4HX8A 3ZQQA 1P4WA 2CO5A 4YIRX 2E1OA 1W5SA 2W1OA 3JRCA 3J81Z 1ETYA 1ULYA 2VC0A 3CCQI 3FMRA 3ZHYA 2JUGA 3QOEA 5E3NA 4XMXA 3FXRA 1WI3A 5EGOA 2ZNYA 3SJMA 3LL7A 4BJTA 2J5PA 4BL0B 1VQLI 4A5NA 3AU8A 1JT6A 4HQEA 1MMDA 1G59A 1U6GA 1WVRA 4F91B 3IWZA 4M9ZA 1TL8A 4MQVA 4KYWA 2JT1A 2EFWA 5ED4A 1LJ9A 1XMXA 3PJRA 2NS0A 3VEPA 3DQVC 3FU6A 2EBIA 2BVLA 4C2UA 4NQWB 1QZEA 3KYDB 4XN9A 2JD2A 2IA1A 2YX7A 1X4PA 3ZRGA 2DLLA 1OR7C 1Z67A 5LGTA 2A05A 5DM6F 2VOOA 1R9TJ 1MBJA 1O7FA 2F4MB 2K9QA 3VYRB 3S15J 2XPWA 2LG4A 2VUMJ 2OQGA 1IN8A 3CDIA 4MFDA 2JQ7A 2HS5A 3LOCA 3OIOA 4FHTA 4KN7X 4CCKA 3FUDA 3BT9A 3TO7A 1PVEA 1Q1HA 2LSOA 4MQ9F 1DP7P 5K1YA 1MW7A 3FXMA 4B3AA 3ML6A 3ULQB 5DS9A 1JUPA 1XDUA 3B02A 3MEXA 3IWFA 3BG3A 1FT9A 2MYSA 4QPEA 1X3UA 5DV5A 2MAOA 4CCJA 2LREA 3S2WA 4KIBA 4KISA 2DPUA 1FTZA 5DD4A 2Y1EA 2EV6A 4XOPA 2NS7A 2DCEA 2Y31A 2X6OA 3GFJA 2FBIA 1ZYRF 1JTXA 1MSEC 2OCCH 4RGRA 3W6VA 1OQYA 4AIKA 4BDZA 3AG1H 2LTPA 3NEUA 3T1BA 4A3JJ 3GZNB 1T1RA 1RESA 4FE4A 3GEZA 4XM3A 3KP5A 1I1SA 3M8FA 1KU2A 4BY7J 3BZCA 2P0WA 2XAHA 2JA5J 1TWCJ 1R22A 1IDYA 4HF2A 3DKYA 3EETA 3I3LA 1X3ZA 3SDGA 1SD5A 5CLSA 3O3KA 4ZYDA 1WZ2A 2GOMA 2PMHA 3G73A 3Q44A 5JMPA 3R0AA 1XX5A 4HEA2 4BHCA 2WWYA 3BG6A 5K7FA 4IOAF 3ZMTA 3MKZA 5HDNA 3HOUJ 1F5TA 3K4CA 3ZQIA 1YFHA 1V5GA 3CCVI 1O3SA 1H89C 3V7CA 4A3IJ 3T5XA 2HR3A 4S0HB 4IF4A 3S93A 5CPRB 2GOXB 2KRFA 3D5SC 3FBIB 3B2XA 1R7JA 2FOWA 3QP5A 1TQIA 1WQ2A 1ZREA 2IS4A 2L9VA 3DKXA 2F5EA 3L2QA 3ASNH 3GX4X 1NK2P 5IYDJ 2K3PA 3AL0C 2DPDA 4WXCA 4BHPA 5FKMA 5GAEJ 1R5HA 2OC6A 4JNDA 2DQMA 3RI4A 2VLAA 2FEZA 4KMFA 3LAPA 3F8NA 2BY0A 3HJEA 1XDSA 2IGMA 4RGUA 4XLAA 3BLYA 3LSTA 1SMTA 4K5LA 2W82A 1MNEA 3E6CC 2JTVA 3JRFA 2P6SA 2YUSA 4DGWB 2MC4A 3DU6A 3L09A 2YR2A 4BKXA 2O8KA 4P5OA 1H3LA 5JR3A 3R61A 3K9TA 1YIOA 4KUMA 2O8XA 3BR5A 1BR1A 4QTRA 4M74A 1STZA 3IL2A 1FX7A 2LF8A 5LFAA 1YJWI 3HUGB 4FT8A 1SFOJ 2EINH 2KDOA 4F93B 4ZTFA 1BC7C 4P9UA 3C1DA 5FJ8J 2ZXIA 2X6YA 1FZPB 2DA5A 3GF2A 1HC8A 2E1MB 2IGOA 4HDUA 3FXUA 2M34A 1ZG5A 3BCBA 3C2BA 5E20A 3QOPA 1H9TA 2XF7A 5F1JA 3I4MJ 4MEXF 1SFXA 3B3BA 3DEEA 4IHTA 2UXNA 3LFKA 2R72A 1IXRC 2MGQA 4UB6C 1ETVA 3BP8A 2V1XA 1OISA 4YFNF 1Z9CA 2KFDA 4FETA 3ZQFA 2BEOA 2OPTA 2Y30A 5EF6A 5HDKA 1LDJA 3TW6A 4HLXA 1D8JA 4EV0A 2KIUA 3CCMI 2K9SA 5AIPA 1IV6A 3AKZA 1MMGA 1IGNA 1FOWA 1ZR2A 4II3A 4PSXA 5D6EA 1W4MA 4A3GJ 5F0FA 3TP3A 3JW4A 1YHQI 4FE7A 2M2EA 1TC3C 3HZJA 3FUKA 2A3SA 3NARA 2Z16A 3MVPA 3OY9A 4LD5A 4ZJZA 3PM1A 2FBHA 2VJ4A 4FCYA 2YX4A 1B8IB 1FEXA 4I09A 3PO2J 3ANLA 3OYKA 4M3FA 5IOZA 5DYFA 4V19K 3OIPA 4FLRA 3ZMVA 3E6MA 3CHQA 2IA2A 1Y1VJ 5HS9A 3F8FA 4PW4A 3A2KA 4I2OA 2KRHA 4PJ0C 3KLNA 4HOBA 4PJJA 3VDXA 2D1VA 3KYCB 4XSZF 3ZMDA 2PJRB 3HIFA 1X3WB 2DBBA 3I0TA 5IY5H 4FCAA 3LA7A 2BXYA 2W24A 2UWMA 4WF2A 2PGGA 2W7NA 2P7CB 2QBYA 2MC3A 3W6JB 5HS8A 1VQ7I 3DKWA 3U9GA 2XB0X 3CC2I 2E1CA 2BY2A 2H09A 1J0RA 4OMZA 3H5AA 2L9SA 4E70A 2LYCA 2ACJA 2W85A 3QRFF 1Z6TA 2PMUA 2FJ1A 2ISZA 2GXAA 4MEYF 5H2FC 1RI7A 2HYGD 3H92A 3HOYJ 4L9TA 1JGSA 3RCOA 3JTHA 1F36A 2XAUA 3O6BB 2Y1CA 1RNLA 1KGSA 2ZXGA 3QJXA 5IPAA 1RC9A 5H20A 3DPTA 1X1DA 3CC7I 1R23A 1GT0C 4IEJA 5E8GA 2JD0A 3HDDA 4HW0A 5E18F 2EZKA 2EFNA 2LF7A 1BBYA 3MKLA 1JGGA 4M9XA 5B5EC 3HEFA 2NAZA 1USTA 3LSIA 3VSLA 2L7MP 3SZPA 2M7BA 4B43A 1QVUA 1VF9A 2JK3A 3FK6A 5FKNA 4XN7A 4XLCA 1SD4A 1IN4A 2O7OA 2HPMA 4WXDA 3BDDA 1BW6A 1R58A 1FMWA 1MNDA 2OZ6A 2WBMA 2A6EF 2VE8A 3FTZA 4KIGA 1XSXA 2COMA 3TDZC 1ZGWA 3RDIA 3N4MA 3C18A 1U5TA 1K6OA 1EH8A 4KA4A 1ZLKA 2RV8A 2MAPA 4RCVA 1I3QJ 3E6DA 4MHGA 1ZRFA 3M07A 1PUFB 1WWXA 4M6VA 3L1PA 2A61A 3DTEA 1S46A 2HQ5A 3FZVA 3CIAA 5GP9A 3RJPA 1U0JA 1R1UA 3Q9SA 1G3SA 4AIJA 1YJNI 3FXLA 2LRDA 3MMYB 3TOAA 2IGKA 4HF1A 1AU7A 1WCMJ 1B72B 1YE9A 3TP0A 5HODA 3S1MJ 1MD0A 2W48A 2DFEA 2V4JC 2QCOA 1AWCA 1I1GA 3M9AA 3QPHA 2QQ8A 2M4KA 2XROA 1ZN2A 3EUAA 4BUPA 3HKZN 1K78A 4F52A 1X2NA 2CRGA 2ZXWH 1ETOA 4XKCA 4BJ5C 5JHFA 1UCRA 1VFCA 3Q0WA 2Z3YA 3PNVA 5HLIA 4ZX6A 1XSVA 1OR7A 1Y0UA 3I59A 3K7AJ 3OL3A 2CV2A 2L4AA 3ABUA 1REPC 2R3SA 3ZHZA 3GCMA 4Q47A 4CICA 3K69A 1POGA 3S1QJ 2LR8A 1R0KA 1QRYA 4RAFA 1LPQA 3ZPLA 4K5OA 3BTJA 2R7VA 4LGWA 4LLNA 4E7ZA 3FXJA 2E35A 1YRNA 3U9WA 1TP4A 3JRAA 2C5ZA 2Z33A 2DT5A 4RGSA 1KYWA 3KP3A 2ZJPF 1WJBA 4AR8A 1ETWA 1LEBA 2XHKA 4BS9A 2NXNB 5FLVA 4LK0F 2VE9A 2XPYA 2F48A 4YIFA 4XICA 1ZHFA 5FFZA 2R5ZB 1HKQA 2WAQN 3C2GA 3M1CA 2EGHA 3MN2A 4BACA 4AUXA 3VODA 5JI6A 3I9V2 2E1MC 3OWTA 3ZQHA 5HNFA 3L2CA 4XN1A 2JVHA 3G6EI 3JAMK 2HVSA 4OIQF 4MLOA 4W97A 2B63J 1VI0A 2KMUA 4XN2A 2B0LA 3B37A 2QYOA 3WTYC 2C82A 4ZQGA 4ZX3A 1FYLA 4LG0B 1SD6A 3IRQA 4IZZA 3CMEI 2XRNA 4BE2A 1BR4A 1QPIA 2FUG2 1B4AA 2MABA 2EIKH 3EYYA 5C3EJ 3VSKA 1MW2A 2R7DA 4RB2C 1O57A 2ZFWA 5D5XB 4AD9A 5FKKA 3QPLA 4HA8A 5H6RA 3J7ZI 2B61A 4WX9A 3BWGA 1BI1A 1KA8A 2KT0A 2QQBA 4B3XA 1U8BA 3AG3H 4IO9F 2DODA 2VKHA 1QNTA 5CVVA 3RKYA 4NDLA 2BYVE 3QU6A 2I10A 2JRTA 1N75A 2KZVA 4P1WA 5LRSA 4B4CA 2RJIA 3KZIC 1MIJA 2FNPA 3CZGA 4EATA 3M7GA 1YI2I 4R7LA 1T8IA 2VASA 2F5DA 2VKEA 5CJ9A 2M8GX 5C4XJ 1BI3A 3WTTC 3HGGA 5F0CA 2X85A 4ENJA 3OYIA 1OCCH 4Y6SA 3KP7A 2GXGA 3IV5A 2OTJI 3KCCA 4BU2A 2DMPA 4M9SA 2DA7A 2CSOA 3EDPA 3F8MA 4ESBA 2MH2A 1UB9A 1JJ8C 1UMQA 2CUFA 3IHUA 2EZIA 3G4SI 4XR6A 5F27A 1K83J 3DPLC 5LD2C 4XMUA 3KX2A 5FKOA 2ECBA 3Q0VA 1O3RA 3P9KA 3BTIA 4XKWA 4HLYA 4HDVA 1RR8C 2HGCA 5J40A 1X1BA 4EJWA 4YFXF 4R5XA 5TRDA 2KPMA 1JKRC 2ZC2A 1GVJA 5F08A 2PG4A 1BI0A 2XPZA 4A12A 2JA8J 4B48A 1ON1A 4Q4ZF 5EYRA 3FTSA 4WWCA 4PU2A 2F5VA 2M9HA 1S7OA 3G1LA 3BPXA 4R1HA 4A5MA 1CQTA 5KK1A 3BJAA 2A69F 2R7RA 4J01A 1H0MA 1B9NA 1R6RA 2DDBA 4DYQA 3ZN0A 2DQRA 2EIMH 1P9QC 3DEWA 4MTDA 4QIRA 3WE3A 1LKXA 2NVXJ 4IRHA 3GTQJ 1W7PB 4QPOA 2FMLA 2CFOA 1JHFA 1VQKI 2ZSIB 1E3PA 2LY2A 3RZDJ 3MKWB 2EQRA 1T0FC 3HKZA 3QODA 4L0YB 3PFYA 3A0HC 4Y6RA 1F9NA 3O8GA 2GLOA 2VJIA 3ZP5A 3A02A 2K86A 4G8XA 2HOEA 1ZRCA 2K9MA 1MW3A 1TT0A 5FO5A 3FM3A 1R0LA 3R0IA 2R4GA 1KU7A 1XN7A 4ZQFA 3IH2A 3R60A 4LLGF 5M5YJ 5EZHA 5ILSA 4L5EA 2A07F 1QGPA 2DAOA 2JSPA 3LQQA 3DXJF 5KHDA 2FRHA 4BQOA 1X1PA 4LIUA 4Y4RA 2IS2A 1WHUA 5A2QK 5HS7A 1O3QA 2O7GA 2FNAA 3JRGA 1S72I 3G71I 2FXAA 3KLOA 4BHBA 2ZJRF 2HKOA 3CMMA 4U87A 3WTSC 4HX7A 2CYYA 3GXOA 5HLTA 4Y6PA 4EM1A 3HOZJ 2WAQA 1PP8F 4YRVA 5IT9Z 3BQYA 3IAS2 5D8KB 3BG9A 2DTZA 1BC8C 3GWZA 5FD6A 5LLQA 3LSRA 3A0BC 2RNGA 3CMAI 3R6SA 3HHHA 3I4PA 4DYCA 3S3MA 2QENA 4LB5A 4LJZF 2VJ8A 2KL4A 1XCVA 4XKBA 5E3OA 1DQUA 2BHZA 4AYBA 2ZCWA 3DF8A 2KZGA 3H1CA 5FRMA 4JX5A 4CDGA 1E17A 1MJAA 3H35A 5F6FA 3HTSB 1Z21A 1IW7F 5FFXA 2IGNA 2NVTJ 3EUHC 2FQ4A 1R1VA 1ZG1A 1QQIA 3G1OA 2QGUA 2A7OA 5D5WB 1RUOA 5FROA 3F21A 3CP8A 1I6XA 1V5FA 1ZGJA 4PJMA 4I01A 3ROUA 1O3TA 4XNDA 1FPQA 1FC3A 2ZJ2A 4A3KJ 4G94A 1MDMB 2JWTA 1ITYA 1WRJA 1XTAA 2DJNA 3FWEA 2V26A 2DDAA 3K70D 2JN6A 1K4SA 4U0WA 3PO3J 4E7KA 3K4MA 2BE5F 1QU3A 4A3CJ 3EPZA 4I7HA 5LGNA 1EF4A 1U9OA 1VQ9I 4CCMA 2K02A 3OYEA 1ZRDA 5K5OA 3FBNB 1U2WA 2K40A 2KIQA 2LK2A 2WTEA 2KJCA 3AAFA 4NHJA 2LBFA 4A3EJ 3ZQLA 2M0CA 2X48A 1T33A 4HBLA 1LDDA 4DZPA 2XC7A 1FJLA 1YYVA 1YX5A 4OIPF 3B73A 4B09A 1I6HJ 1SAUA 1D5YA 2W84A 2ZMEB 3CCLI 3DBLB 3UKGA 3RSNA 1YO5C 3PSFA 4E7SA 4E7HA 1DGRM 2XIGA 3CDHA 4BNCA 4F55A 2RNJA 3DU5A 4ESFA 3I58A 3HRSA 3MWMA 1KQ8A 2W25A 2D5VA 3S1NJ 1ZKGA 2E2IJ 4GGGA 3KEYA 2XAJA 3OYFA 5DCMB 3JSOA 2HTJA 1Y6IA 3KEOA 4FQGA 4C3JJ 3P5JA 1H9GA 2RC4A 4OINF 3CCEI 1DPUA 3S3OA 1Y8QB 4IKFA 2V9KA 4L9NA 4X1EA 1J5YA 6PAXA 1OCOH 3CLQA 5BS6A 2HOTA 2IJLA 3BJ6A 4IHWA 1JVSA 1ZG3A 2DT6A 1W36D 1WH5A 2C6YA 2CW7A 3MKYB 1TLHB 4DNCA 3RPUA 4HYEA 2QKLB 1RUNA 3WTUC 4EGYA 2CJJA 1W0TA 4KDPA 2EFQA 4M3DA 2DMNA 4M3EA 1ONVA 1KONA 4U0YA 4JX4A 2WZGA 2FE3A 5B66C 1D8KA 4ZQHA 4XN3A 5ERIA 2HXIA 2IT0A 2R70A 3VOEA 3PIOF 1VQNI 4XQFA 4A3BJ 4XLFA 1ACIA 2STTA 1Z77A 3KETA 3S17J 3A01A 4M73A 4B8XA 2DMQA 2XV4S 1V4RA 3J80K 2E36A 2HQRA 4G6TB 2H27A 2LOOA 2OA4A 2E7WA 4BQNA 3EQLF 2HZTA 1R5GA 1XGMA 1HXDA 2ZXJA 3BQZA 3CESA 3O8HA 2E60A 4BQQA 1LQ1A 3GFMA 1JTYA 4KMUX 2NNYA 3EBHA 2DA3A 5F64A 3CUQB 4X6AJ 2PUSA 5H6QA 2VT3A 2AS5F 3ZQCA 3U1DA 1ZAOA 1MJBA 3OSGA 1Z91A 3GFLA 2N8GA 1S9HA 1WJFA 1H8AC 2P5VA 1D0YA 1DP3A 2WB1N 2VB6A 5JO0A 1XGOA 2FQ3A 2QQ9A 2R7FA 3CJTB 5GAGJ 2R5YA 2Y1FA 3ZGKA 1B9MA 4ITVA 4ZX4A 1MMSA 3OYHA 1A04A 1ZLJA 2K9LA 3X2QH 2AQFA 5D6FA 2ELKA 2X1DA 3H5NA 4MO7A 3HYIA 2O5RA 2G0EA 2JCXA 3L2WA 4OOEA 2ELJA 3H0GJ 3OYJA 3HSRA 1RIOH 1HDPA 2B9SA 5E3LA 2M0MA 1MW0A 3C7JA 2EJRA 2O6GE 4PFPA 4XRSG 5CKTA 4E7IA 5ICEA 4CCLA 2EZLA 4P55A 3KYLA 1FP1D 4NC7A 3F72A 5D8LB 5E3MA 1X3WA 4XRSA 4HV5A 3SXYA 3FHZA 3FF5A 1YOVB 4DPRA 2NRAC 2MSYA 2VQCA 2HVQA 4QUOA 2PBIA 1G6NA 3K0LA 4ZH4F 1XMKA 2R7ZJ 2L4MA 4PDKA 1QO0D 4PZJA 1IXSB 3CQZJ 3L7WA 4N4OB 2LD5A 3FHEA 2PEXA 4XO3A 3HOTA 3LSHA 4PK4A 2P81A 2VONA 3QPSA 4XNAA 4A3MJ 3GMEA 1R49A 2DOAA 1FIAA 1CGPA 1K7AA 3V8KA 3FUHA 4KN4X 2PI0A 1BI2A 4ZC3A 3BR6A 3GBGA 2Y1GA 1WGXA 4PFOA 3A14A 4NC6A 1E0EA 4Y3OA 2ADUA 4K5NA 1K61A 4BEHA 4XMTA 2ZBKA 3IH4A 4UVAA 4EVIA 2GXBA 4LUPA 1MW1A 2MD5A 2OD5A 3U1KA 5FGMA 3LWFA 4NB5A 2XF5A 1T39A 3FH5A 1W5TA 3FMQA 1O7LA 3H3ZA 2E5ZA 3HRUA 5JFRA 3M8EA 3PL8A 1Z3XA 1NK3P 2VQGA 1C0WA 3WTVC 3GLLA 5IT3A 5EEHA 4XN5A 3LMMA 1OCPA 3ESWB 3H36A 4G6QA 1G3YA 3BJOA 2FF4A 1EV7A 1X3ZB 3H9JA 3LSPA 4XMVA 5CVIA 4H0EA 1UHWA 3K1NA 4Y33A 3OYBA 1MH3A 4RAGA 2V1NA 1HSTA 4MGRA 5B3SH 2D45A 3S16J 3WTXC 1R4NB 2V6EA 5LBQA 2P8TA 5GPAA 3OYAA 4RS8A 4CO8A 1PUFA 2ZMEC 5D4RA 4KNYA 3K4KA 3V8JA 5LEKA 4I02A 3AG2H 3LSGA 4CSWA 1MVYA 4A3DJ 2PX9A 3FUEA 4LK1F 1R5ID 3LSJA 2CV1A 2Y75A 3E6BA 1IZ1A 5M5WJ 3ZI0A 1IV8A 3I55I 1B72A 3I4NJ 1KZHA 4GAEA 3EYIA 3FIWA 1PYVA 5KAIC 5LRRA 1P92A 3FHNA 3WQQA 2NVQJ 4E7LA 2M7AA 1WKMA 3SFIA 4R5VA 1ETQA 2RKHA 3MAJA 1Y56A 2CW0F 2ME0A 2F6CA 4BJ6C 3C3WA 4BBRJ 2XASA 3KEQA 1A5JA 4X2UA 2P4WA 1IUFA 1LE8B 1ODDA 3COAC 3PUUA 2ZJQF 4XN0A 3S2HJ 4E7JA 4WXHA 3WTZA 2DMTA 1YX3A 3S8PA 2BVMA 1OYYA 2QZ8A 2V79A 2H6BA 3KP6A 5JVGF 2FX0A 1UHMA 4CGZA 1QVTA 4MFEA 3PNYA 4RB0A 1A6QA 1XCBA 1ONNA 3GW2A 3HOWJ 2X1EA 5DUIA 4IHSA 3E1SA 4KJZA 5KVRA 2OJED 1X1CA 2NS8A 3SDBA 3TQNA 1ZS2A 1FBQA 3CHOA 3H0DA 1EA3A 2GIZA 2YS9A 2E19A 2Q0OA 2RVCA 2LP0A 4G12A 3ZMUA 2HPIA 3FTXA 2BZTA 2QF7A 2LFBA 2YPRA 3DFGA 2DA4A 1CF7B 2P5KA 4OAZA 1XGNA 3CC4I 4BQAA 4JP0A 2LLKA 3RQIA 4RAYA 5EG0B 3TDUC 1BM9A 4XKVA 4UVCA 4ZW8A 4BAYA 5BNGA 3VVLA 5LGUA 2QA4I 4S04A 1N78A 4A6EA 1FOYA 3CUQC 4V2GA 2DMUA 5AENA 4RVBA 3FDYA 4HX4A 3G3ZA 2ZO4A 1YTYA 1IN6A 1P6RA 3ERMA 3ZQ7A 1FYKA 3KFWX 3LAJA 1IN7A 3FU3A 5L3CA 4KFCA 4L2LA 2RREA 2Q1ZB 1BL0A 4EQQA 3MZYA 2ZXHA 3DLAA 4BXFA 2LNBA 2DFFA 1LVKA 1SVOA 4U0VA 3RYRA 2OV7A 2JPBA 3DCFA 1Z7LA 2Y48A 4BBSJ 1GLNA 3CF5F 4HG2A 1H88C 2M30A 2R7OA 4HQMA 1R00A 4WK8F 3A06A 1ZH5A 2KKOA 4LG3A 5DTDA 3KP2A 2EWNA 1QA6A 5DCFA 4MNUA 1EH7A 2RDPA 1T95A 1YW7A 2HWVA 2X6WA 1EH6A 3HG9A 2VL8A 4PSWA 2WADA 4I98B 2XQ0A 1QZYA 4ZZLA 1Y8RB 3B7SA 2DQ6A 1Y1WJ 4AIDA 3V7SA 5TGTA 5IP6A 5CVJA 4ZYAA 1G8XA 2GA2A 1S8NA 4ZZDA 1NG6A 2V6CA 1WJCA 1SVMA 1WSUA 5KCMA 2K5CA 1FSHA 1HQCA 2QUFA 3JRDA 1VQPI 2Z2SB 3ASOH 3CUOA 3FXQA 3LNQA 2QBYB 2CS3A 4MKTA 3JTGA 2ELHA 3NWSA 2IP2A 2CU7A 2PL5A 3ABLH 2WV1A 1IAWA 2DA1A 1HSJA 2V7FA 2WY7Q 1YS7A 4QWQA 1N77A 4CYCA 4L9JA 1D1CA 1I27A 2NOJB 3A1YA 3E5XA 2MH9A 4IXAA 3VB2A 2KJBA 1YLFA 3BR0A 2RN7A 2BXZA 5JLXA 4ESJA 4D0PA 1OCTC 1NH3A 4LB6B 4CCOA 5BQTA 4IX7A 2H8WA 2W00A 2JD1A 2EK5A 3OOUA 3V7RA 1I3AA 2DQLA 4N9IA 1PP7U 1IRXA 3OR1C 4IOCF 4IHYA 2W4SA 1P7IA 2YU9J 2K85A 4XIDA 3HRTA 2CGPA 3RC8A 4RMNA 1FIPA 3IRRA 1R1TA 2O3FA 3TMOA 4EJVA 1FSEA 3WGGA 4XOTA 2K3FA 3SHFA 2F5FA 3CTAA 1FMVA 3DP7A 2HEOA 2EZHA 2A6HF 5IP9J 3P7NA 4I76A 4EM0B 5LEJA 3MZHA 3GTPJ 4IL6C 4N9HA 4RLQA 5IYBJ 5D5UB 1W7PA 3ONQA 1J75A 1T38A 2GTQA 4CZZA 3J7AY 5J4VA 5K7ZA 2LVSA 2QSFX 1U5TB 2CMPA 4FASD 3QQAA 3GVAA 3JAMZ 1MGTA 4M3BA 1RRJA 1G5AA 4UUSA 2AQEA 2NYXA 2OAZA 2R7XA 4QHPA 1P4XA 2BW3A 1EKEA 2HQAA 4XNFA 2RQQA 3WG7H 3K70C 1TQPA 5IOYA 5K7HA 1MZBA 4XMYA 4GCVA 1SVLA 3BCAA 2EPFA 3LSKA 1ETXA 2P6TA 4QIWN 3CHRA 1ZARA 1H19A 3GZ6A 4GAAA 4UB8C 3HHGA 3DV8A 5CQEA 2L7FP 3S2DJ 1FOXA 4II2A 4GYGA 5F0HA 1K78B 4BE0A 3H3UA 3TOBA 3CJQB 1D3YA 3IUOA 4GDFA 3IAM2 1AKHA 3KE2A 3TEDA 3T8RA 2Y1DA 2VBYA 5LHHA 2QSGX 3I59B 1JJ6C 3WU2C 3MCZA 3RKXA 1MMNA 2M87A 1FTTA 4C2MJ 4OU0A 3JRIA 2OCEA 1XGSA 2HYFA 1OLTA 3OMYA 1JKPC 3CO6C 3R4KA 3V42A 2QEXI 3FH8A 2KP6A 1A36A 1ON2A 4ZW5A 2L0KA 3E0JB 4R79A 3WU0A 2DYRH 1ZR4A 4GXOA 3S32A 4B47A 2BBYA 2LKPA 2PLYA 1P7JA 3ZR8X 5FRNA 2VIXA 3NAUA 1GUUA 5ILVA 5FLXK 4MIMA 4XO5A 1FY7A 2ZSHB 1DU6A 2R7QA 1HLVA 1BJZA 3HPHA 2X1CA 2K7LA 1TT5B 4B1RA 2JMWA 1J9IA 1X1AA 4F92B 3OYGA 3MD2A 3FULA 1MJ9A 4AWXB 4K5PA 1W36C 2ID6A 3DBHB 2B7EA 2FBKA 3RKWA 2PMZN 2XSJC 5ICCA 1TW2A 1XMAA 5FLMJ 1HOMA 1MDMA 3HOVJ 3FTYA 1WJEA 4JOMA 2L3DA 4AC0A 4O6JA 1AOYA 2R59A 3JRHA 5BMZA 2HFHA 3K6GA 2QVWA 3DWLE 3ZCOA 4C2TA 4A93J 4D7NA 2Q8KA 4PJLA 3CJRB 2O9LA 2CQKA 2CUJA 2V9PA 3UNGC 3FKIJ 3IKVA 3OIQA 3E5UA 1UZCA 2DO7A 5B1AH 3WE2A 4XMZA 2CH0A 1Y39A 1XG1A 3C2HA 2XGEA 1JKQC 1PJRA 3RTRA 2PN6A 4XLPF 3F9KA 1YJ9I 5E8IA 2Y9YA 4XL9A 3HOXJ 3CHPA 1ZQ3P 1SC7A 2R7TA 2VC1A 4MS6A 1RZ4A 2IEKA 3FUJA 1GDTA 1UG2A 4EM2A 3RPUD 4ZX5A 4UXNA 3DTIA 2E2HJ 1K4TA 2MG4A 3G2BA 2UZKA 2IPQX 1S3JA 4NQWA 5DCMA 4DBRA 5EJCA 4HNVA 5CVUA 2ZNZA 1IXCA 3JT1A 1OYIA 2XPUA 3HOSA 5DYMA 4PVBA 1TQMA 1D0XA 2L9NA 2IW5A 2Z1DA 2XSDC 3CF2A 2DK8A 3R0JA 1UJ8A 2H94A 1Q1VA 2M1BA 2XVCA 1VQMI 5F1RA 3L2UA 1JKOC 4RGXA 5A2QZ 2FOKA 2VI6A 3E97A 4Q4IA 1XB4A 3N97A 2TCTA 3M8JA 3Q43A 2LKXA 1IJWC 1QPMA 3ABTA 4D5CA 2Q2EB 3ABKH 3QU3A 4BYYA 3OS0A 1IRZA 2CFXA 2ME6A 3Q9VA 3WQRA 5HNHA 3D5LA 1I50J 3VVMA 1WFXA 3FXOA 2IS6A 4A03A 2HOSA 2VT2A 1RP3A 2KDZA 1MMAA 5DLLA 4JBAA 3RQ4A 3IC7A 3N05A 2L7KA 3D5RC 4KT6A 2UXXA 1A6IA 2JCVA 4QLCU 1P2FA 1LEAA 3VWBA 4JQFA 4XSXF 2JA7J 3HXLA 3VYUB 3ECHA 3K4NA 4YELA 5IP7J 3J81K 1HA8A 4FLSA 4Y67A 2LC2A 1FOKA 3ISPA 1YS6A 4UVBA 4AM3A 3MZ8A 1TWAJ 4MTEA 2JVGA 3BOQA 4JYKA 2NVYJ 4M72A 3B6AA 4DBQA 3DLLF 1W0UA 5J8FA 2DJIA 4P9FA 1JGIA 5K5RA 3OYCA 2GZWA 1MSFC 1MBGA 1TWGJ 2DN0A 4BDYA 4FISA 1R36A 5AIQA 1K5HA 2JRMA 4ZW6A 2VOPA 2WPGA 3GUDA 4A0YA 1MBFA 1VQ6I 1U5TC 2DFHA 2DOFA 2V1DA 3MFKA 2Y69H 1R4MB 1VQ5I 2GAUA 3CHSA 1WJAA 2VQLA 2FA5A 5L3BA 1D0ZA 4XBFA 4AYSA 2HTSA 3WU1B 3FUFA 1GHCA 3BR1A 4RSYA 2XAGA 4ABZA 2NOGA 2K27A 3CDLA 4G7ZF 4XONA 2DT7B 4HNTA 1RKTA 1APLC 2ECCA 1D5VA 2VBWA 1USSA 2DA2A 3REOA 3PUFA 2EV0A 4XLEA 1SFKA 2E7XA 1UAAA 4PJNA 1ONOA 2VN2A 1LB2A 3TKYA 3J7YJ 3VYTB 4Q48A 4UHTA 2GA1A 2STWA 2JCYA 5DDGA 2CQ7A 3NWTA 2EV5A 3GTOJ 2XAQA 2AXLA 3FTVA 5BPPA 4OOIA 1P4AA 4CUGA 3FTUA 3DTKA 3PNTA 4C3IJ 2WV0A 4WCGA 2PMZA 2X0LA 3BZ6A 2QSHX 2K4JA 1WPKA 1LFPA 5DD8A 2NNNA 3FUIA 3FUMA 4OWRB 4DOZA 4XNBA 3HUGA 5J1YA 5GAHJ 2XKPA 3CZEA 2HU9A 4ZYHA 4G7OF 4DZJA 1BN5A 2QWWA 1FNNA 1VQ4I 1Z6RA 3OOPA 1FBUA 2Y0SN 4LOCA 5ICGA 3GYHX 2DXIA 4L0ZB 5JNLA 1JHHA 1FYMA 4FLOA 1T6SA 4I0BA 2MBFA 2XGCA 1S29A 2XRLA 3A03A 4HSRA 4AVPA 3QYFA 2R7WA 4EGZA 3W2AA 4ZW7A 1BOAA 2IVMA 3PSIA 3W2WA 2MFZA 1T56A 1RKWA 2WC2A 3E5QA 3TBIA 2E2JJ 1HS6A 5GPCA 3JCUC 2EA4A 3K4JA 3HBLA 1MNMC 3L2VA 2QM3A 3FU5A 3H3VK 2OU2A 2QKMB 3HM5A 4AR1A 4AU7A 4RA2A 4YEJA 1E3HA 2ESNA 2EH3A 5LHGA 1B6AA 3BG5A 3J80Z 1LFBA 2NVUB 5GADJ 2I5UA 4M6YA 4O5VA 2LBFB 3F8BA 4PGGA 2OTLI 4BY1J 2VXDA 1MKMA 2UUZA 4ON0A 4B44A 3IIEA 5EGOB 1Q0LA 2AO9A 1B8IA 2AHQA 1ETKA 4Y52J 2P5LC 1W5CC 2JPCA 3LSMA 2R0QC 2R7UA 2HDDA 1F1ZA 2HDWA 2DI3A 3O2PE 4XLNF 3RKQA 1DUXC 2HQNA 3TO9A 2EIJH 1U78A 1BIAA 2PJRA 5FKLA 2E1NA 2OUMA 1HW1A 3T8TA 4AIHA 2BY3A 3SQNA 3B7TA 4D7MA 3UR3C 1YW9A 3HPGA 3Q0UA 3DBRB 5FWQA 1JG9A 2H1LA 4UV9A 4N0BA 2HZDA 2KRCA 2DFIA 5HVQC 5J47A 4D1QA 4EJUA 4KT5C 4GRIA 1L0OC 3CZKA 3JR9A 3D0SA 2VPRA 1Q0HA 1IG7A 1U8RA 3RC3A 5FB2A 4ENMA 1LE8A 3IH3A 5ICFA 1Z7UA 3I71A 3CLOA 3RIRA 2HDCA 4A0ZA 2IS1A 4KP7A 1XS9A 1LFUP 1W1WE 1SD7A 2RQPA 5KAFC 1QHGA 5EV7A 3RASA 3P9IA 4F3QA 2MLGA 4NUBA 4DYRA 3CO7C 1HCRA 2A5YB 1GVDA 5DEQA 5HLGA 1MH4A 5AONA 5GTHC 1HKSA 2P7VB 3A01B 4KIFA 2H8RA 4ZDPA 1YG2A 2HXOA 2LKSA 2EFPA 3WGIA 5J4YA 1KQ0A 1OKRA 3OS1A 3BY6A 2W57A 4L5JA 2K9NA 3M1EA 3SZTA 2Z99A 1AHDP 1CF7A 1IN5A 1L3LA 4IHXA 1Z1DA 4XRFA 3TGNA 4E4HA 4ZDLA 3ZXSA 1G2HA 5EG0A 3RZOJ 4A69C 3W3CA 2F4OB 2IA0A 2DTRA 5JBIA 1OMIA 3KZYA 1JE8A 2L01A 3FXKA 4ZW3A 3FMSA 1T0FA 2XGXA 1UELB 2KISA 2WY8Q 1S5LC 4Y7NJ 2KIMA 2HKXA 3E3VA 1NHAA 5TJJA 3WHBA 5HLHA 2G9WA 4G6DA 4S05A 2GQQA 2FU4A 5JVTA 5EDNA 3GTMJ 2R7SA 4BXUA 1XC5A 4IQJA 5EEAA 1B59A 3CCUI 2R5YB 3DPUA 2QQAA 4LMYA 4ANJA 4J19A 3ANMA 1U9NA 2I8DA 2GIVA 2LY1A 1M1EB 3HSFA 3HB9A 5E17F 3ZMSA 4GFBA 3L2RA 2ZFUA 1T1SA 4RB3C 2VKDA 1HW2A 1TNTA 3B34A 2KQRA 4NBQA 3FM5A 3JREA 2A6TA 1I39A 1PDNC 3CZLA 4L5IA 2G7HA 1MBHA 1JI8A 3K4LA 5HOOA 2WAEA 3F22A 2Y0SA 3KPHA 4ZQTA 4YFKF 3QP6A 2CG4A 2L02A 4A3LJ 1F43A 2L7ZA 3HRMA 4Q4EA 2A68F 1WI9A 3GLXA 3SFZA 5GTIC 3PQJA 4G9YA 1K6YA 2CUEA 2V1UA 2LMDA 3ECOA 1RR7A 2YSRA 3PFIA 2RAEA 4RLFA 3GZ5A 2PFBA 1Z3YA 5HDGA 4X0GA 3B7RL 2XGDA 1WH7A 2BOLA 4IQ4A 4HF0A 4C9YA 2XB5A 3RPQA 4ASNA 1K79A 2WB1A 2Y0MA 3CP2A 3K10A 3OYLA 3BZKA 2CQQA 1YQAA 3EUHA 3OSFA 4QSHA 1S6LA 1TWFJ 3H9QA 3TW7A 2V9VA 1HF0A 2IBDA 1ZGAA 5CYVA 1W7PD 1FLIA 1WJ5A 3SEZA 2L54A 2TRTA 1V54H 4HSTA 1JUSA 4U7DA 2R5ZA 3B2PA 1SFUA 2M5WA 3EBIA 4ZQEA 4NC8A 5LHIA 4AVZA 2O0YA 3TO6A 1KYZA 4JK1X 1KU9A 4BEHB 2RGVA 1HKTA 1GV2A 1U3EM 3FH7A 5JC1A 3ZQGA 3F6OA 3CCRI 1X2MA 4UV8A 5F04A 1VQ8I 5E1ZB 4QMEA 4KICA 1GXPA 4OMYA 1ORKA 1OPCA 1GV5A 3GFIA 1B1BA 4LG0A 2VODA 1IC8A 1UHSA 3LA2A 2H6CA 5E79C 2M3AA 3UERA 3LFUA 4F7ZA 1X4OA 2LY9A 4Z2YA 4OAYA 1DU0A 2MW8A 2ISYA 2F2EA 3AUAA 2JJ7A 4L18B 4EJTA 1JT0A 1G4DA 5L3DA 4BGDA 1T2KA 5TISC 2KHMA 4CZCA 2DOEA 3IP4B 4UUTA 1X19A 3WGHA 3WG9A 3L00A 4Y17A 1VNDA 3I5UA 4C3HJ 3WTWC 3M3YJ 3ZHXA 4CXFA 1GXQA 2L2OA 4RM3A 1G3WA 1F4KA 4C30A 3KIOA 3U2RA 3FU0A 3H9GA 1T98A 2M4GA 4BE1A 3ZOBA 1E3OC 4O3MA 5BPIA 1WJDA 1SANA 2JSCA 3OYMA 1QZZA 3NRVA 4OIOF 1LUJB 2JZYA 2IAIA 4YG2F 1Y0NA 3FKJA 4DW6A 2E5NA 3FK7A 2VJJA 4ETSA 1DDNA 4FTHA 3CCYA 2BGCA 4DJAA 3LA3A 1TWHJ 3W6KB 1ERDA 2HNHA 2X51A 2HI3A 4KITB 3F3XA 3K1PA 1OFCX 3QAHA 3CXBA 3GTGJ 3K1MA 1JXSA 4RM2A 2VXZA 1UG0A 2QJ1A 3T0YA 4E6KG 4J3BA 3QYBA 2K4BA 4IJAA 1XPXA 4R8HA 5CQGA 3K2AA 4PCQA 4G7HF 4ZTJA 2CW8A 4ZYGA 4ENNA 1HBXG 3BROA 4FX4A 1IRFA 1ZELA 3KZZA 4EMSA 5KNLA 3JSPA 3G1MA 1SEUA 3PIPF 5DM7F 1ZTRA 2D2WA 5E1XA 1V3FA 1YITI 3ABMH 3GTJJ 1J59A 3FTWA 4IHVA 3HC7A 4XO4A 2BV6A 2FSWA 3S14J 3WHCA 1MBEA 3MQ0A 2IRFG 1XSDA 5B1BH 4DIQA 3UCQA 4HV6A 2TDXA 1IDZA 1SMYF 2MLKA 3QWLA 2XUBA 4L9VA 2GM4A 3V8LA 4I0AA 1BJAA 5J1RA 1IRGA 2HPOA 5BOXA 1T08B 4RBOA 2BY1A 2MD0A 2E34A 4PGHA 5M5XJ 5C44J 5C4JJ 4Q5SF 5CVRA 4ZN6A 2MA3A 3I53A 1TBXA 5JLWA 1LNWA 1HW5A 4JX6A 2F4IA 4FX0A 4K2EA 4AR9A 4A3FJ 3BTLA 5M3FJ 1DPRA 4EJOA 1Z0XA 3QPTA 2PQ8A 1S7EA 4AYBN 5J6XA 4HAMA 4RDUA 3OYNA 4I99C 5BPDA 3OL4A 3A4CA 4XK4A 2HYJA 4HZFA 1J09A 2CUZA 1J2XA 4U7BA 3HSEA 2VQHA 1TW3A 2EILH 2ESHA 1SQMA 1LDKB 3Q5FA 2CWEA 3WODF 2VBXA 1RPWA 3M4OJ 1BA5A 5K5QA 1FBSA 2DU9A 3OYDA 4LIVA 5L3GA 3VYSB 2CV0A 1I5ZA 4M6XA 3K2ZA 4H4KC 3HW2A 2O61A 2DA6A 2F5CA 1OCRH 2KLOA 2XDVA 4ENKA 3BC8A 1NTCA 4N4NB 4NNJA 1NG7A 4YIIA 1VZ0A 2X9DA 3NQOA 4CCNA 5E1WA 5EZGA 4EEFG 4RAZA 2Z5UA 4V2FA 4W1UA 3HL2A 4TV7A 3W2VA 2VBZA 1V5EA 4J00A 1OYWA 1IO2A 2KIFA 4CHUA 3CCJI 5J1UA 1R71A 3VFZA 3J7AO 1D1AA 1G3TA 2ETHA 3B6CA 1YRNB 1RETA 5J3LA 2QLZA 1IUYA 1X58A 4CYCB 1O4XA 3UEQA 2OQRA 1IF1A 2R92J 4UY8I 1E2XA 4IPAA 4DQ2A 2FFLA 1Q0QA 2EB7A 3ZN1A 2LDUA 1Z05A 3ELKA 4PUSA 1OCZH 2Q2EA 2JA6J 2JV7A 3Q3SA 4IRGA 3GTLJ 4U88A 2HPTA 4XN8A 3FX3A 3KEDA 3ZMZA 2ZB9A 3PQKA 3LQRA 1VQOI 4XLHA 1J7KA 1TNSA 2M8EA 1YW8A 1HDDC 1YIJI 2UV1A 3VPRA 2CQNA 2L5QA 4A2UA 2XKOA 3BR2A 3E7LA 1VTNC 2WA0A 5FLXZ 3EUKL 5M3MJ 4LITA 3ERED 2JUCA 3V4GA 3B7UX 5EEGA 4R5TA 2D1HA 4K5MA 2JA2A 3I54A 4OIRF 5JMWA 1BR2A 1ZK8A 2QVOA 1SFEA 3PUBA 3CJNA 3CCSI 3H5RA 4M3GA 4ZDOA 3JSZA 2ZMEA 3BR3A 4P96A 4GO1A 1LVAA 2M45A 5D4SA 4UUSB 3D1NI 1EJ9A 1SG7A 3HTUA 2WZFA 2OBPA 3U21A 5IT9K 5J8CA 1SC5A 2BW3B 4XN4A 3WQSB 5L3FA 4CA0A 3FUNA 2EA2A 1JUMA 3F8CA 3SZGA 3JRBA 2A5WA 3P9CA 3F6VA 4M71A 2VKVA 1AA7A 3AL0B 3AFHA 3SYTA 2IXSA 2G7UA 2OZUA 2Y2ZA 2VJ5A 2OF7A 3AG4H 4D9JA 2LH9A 4UUVA 1SAXA 5L3EA 4D5FA 4BH9A 3BG7A 3F0CA 2Z9OA 1ENHA 1GW6A 1UFMA 3CMYA 1AKHB 1KU3A 2XAFA 5D5VB 4XRMA 5FD5A 4GYIA 3AU9A 1BIBA 5ILUA 5DUKA 2FMYA 4XMWA 2J5OA 3S3NA 2AXTC 1BW5A 4QPQA 1DGWY 2EFOA 2XF6A 3HGYA 4BXXJ 3KP4A 4CYDA 4CH7A 4A6DA 4I6ZA 3T8VA 4IRIA 4RB1A 1OJLA 2Y9ZA 4UNOA 2ID3A 4HPQA 4Y13A 3K4BA 1FP2A 4ARFA 2XPVA 2X6XA 2DK5A 2GBYA 4ZYEA 2YU3A 3OS2A 1MBKA 3SEQA 2O03A 5DULA 2FD5A 2HOAA 2X4HA 3CZ6A 5JHUA 4FLQA 3GTKJ 4LLLA 1QHHD 4HRIA 1N25A 1TZLA 2DW4A 9ANTA 1V55H 3L9FA 3CD6I 3FISA 1XD7A 1D1BA 3I56I 1ONPA 4IVNA 2PJPA 4A0XA 2ICWG 3DEUA 3CUQA 3QYEA 1A31A 2VPLA 1FWZA 2BHYA 3I64A 3OR2C 3EBGA 4LFUA 1KQ9A 2R93J 2L9RA 3ANNA 4Y15A 3RYPA 5IYCJ 2ZKZA 1QBJA 3GO5A 4OOFA 3S1RJ 4Z6YA 1PUEE 3IKTA 3F23A 3BPVA 2COBA 1A35A 4HNUA 5JAZA 2E71A 4XORA 2H1KA 2HVRA 1BOBA 2GWRA 2WAFA 3OV8A 3BTCA 2CQXA 2DYSH 3TL4X 4AICA
chains in the Genus database with same CATH topology
3ZQQA 2ZXHA 3DLAA 4BXFA 4XKWA 2IS1A 2W1OA 1LVKA 4KP7A 2OV7A 1X1BA 1Z7LA 1GLNA 1QHGA 5EV7A 2JUGA 3QOEA 4HG2A 2R7OA 3RASA 3ZHYA 4F3QA 4R5XA 4NUBA 4XMXA 2KPMA 3A06A 3LL7A 4BJTA 4LG3A 4BL0B 3AU8A 2XPZA 1G59A 1MMDA 4B48A 3FTSA 4ZDPA 4F91B 4PU2A 2F5VA 1T95A 2X6WA 3HG9A 4J01A 2VL8A 4PSWA 2R7RA 2WADA 3PJRA 2XQ0A 3OS1A 3DQVC 3FU6A 2BVLA 1R6RA 3B7SA 4C2UA 2DQ6A 4NQWB 5TGTA 4XN9A 4E4HA 1P9QC 4ZYAA 1G8XA 4ZDLA 3ZXSA 2JD2A 4QIRA 1LKXA 1NG6A 3W3CA 1WJCA 1X4PA 3ZRGA 5JBIA 1OR7C 4ZW3A 5KCMA 2K5CA 4QPOA 2CFOA 2ZSIB 2Z2SB 1UELB 2LY2A 2CS3A 2WY8Q 4MKTA 3MKWB 3VYRB 3NWSA 1T0FC 2LG4A 2PL5A 3HKZA 3QODA 4Y6RA 3PFYA 4CCKA 3FUDA 2V7FA 2VJIA 2WY7Q 1N77A 2R7SA 1D1CA 2NOJB 3A1YA 2K9MA 4IQJA 1MW3A 1TT0A 1MW7A 3DPUA 4ANJA 1R0LA 3ANMA 3R0IA 2I8DA 2LY1A 2R4GA 2MYSA 4QPEA 4ZQFA 2MAOA 4CCJA 2LREA 4KISA 3L2RA 2ZFUA 1T1SA 4CCOA 2VKDA 3B34A 4IX7A 2JSPA 2KQRA 2W00A 2Y1EA 5KHDA 2JD1A 4XOPA 4BQOA 2A6TA 2DCEA 3OOUA 4LIUA 3CZLA 4Y4RA 2IS2A 1IRXA 3OR1C 1JI8A 2W4SA 3K4LA 4BDZA 2O7GA 5HOOA 2WAEA 3RC8A 2Y0SA 4RMNA 1T1RA 4ZQTA 2RREA 3TMOA 4XM3A 3CMMA 4U87A 4XOTA 5HLTA 4Q4EA 4Y6PA 1FMVA 2WAQA 4YRVA 3IAS2 1K6YA 2P0WA 4RLQA 3DKYA 4RLFA 2RNGA 3I3LA 3ONQA 1X3ZA 1Z3YA 4X0GA 2GTQA 3S3MA 3B7RL 3J7AY 2BOLA 4IQ4A 2GOMA 4C9YA 2VJ8A 3Q44A 5JMPA 2CMPA 2KL4A 4FASD 2WB1A 3CP2A 4HEA2 3K10A 4XKBA 3OYLA 1DQUA 1G5AA 3BG6A 2AQEA 4AYBA 3MKZA 5FRMA 2R7XA 3H9QA 3K4CA 4QHPA 3H35A 2BW3A 1Z21A 2HQAA 2IGNA 1V5GA 2RQQA 3EUHC 4XNFA 3K70C 1WJ5A 3S93A 3SEZA 4HSTA 2GOXB 3D5SC 3FBIB 5CPRB 4XMYA 2A7OA 3B2XA 3B2PA 3EBIA 5FROA 4ZQEA 3LSKA 3BCAA 4NC8A 3CP8A 1V5FA 4PJMA 4AVZA 3CHRA 4XNDA 2IS4A 4BEHB 1H19A 3DKXA 3L2QA 2K3PA 3AL0C 3FH7A 5JC1A 4GAAA 2OC6A 4JNDA 2DQMA 5CQEA 2V26A 3K70D 4II2A 2VLAA 4E7KA 3K4MA 4BE0A 1QU3A 4QMEA 3EPZA 3CJQB 3IUOA 3IAM2 2IGMA 4XLAA 4CCMA 3BLYA 2Y1DA 4K5LA 2W82A 1MNEA 3OYEA 2M3AA 3UERA 3LFUA 3FBNB 4DGWB 1MMNA 1X4OA 2MC4A 3DU6A 4OAYA 2LBFA 4BKXA 4P5OA 1H3LA 3AUAA 1OLTA 3OMYA 2XC7A 4BGDA 1YX5A 3V42A 1BR1A 2KHMA 1SAUA 4CZCA 3FH8A 3IP4B 2KP6A 1X19A 5LFAA 4ZW5A 3HUGB 3E0JB 4R79A 2KDOA 4F93B 3S32A 4ZTFA 4B47A 3RSNA 5FRNA 3PSFA 3ZHXA 4E7SA 3ZR8X 2VIXA 4E7HA 4CXFA 4XO5A 1DGRM 2L2OA 2ZSHB 4RM3A 2ZXIA 2X6YA 4F55A 2R7QA 3DU5A 3HPHA 2X1CA 2E1MB 2IGOA 4C30A 3BCBA 3KEYA 3OYFA 1X1AA 4F92B 3H9GA 3OYGA 1Y6IA 3MD2A 2M4GA 2XF7A 3FU0A 4BE1A 3FULA 4K5PA 1W36C 3S3OA 3DEEA 1WJDA 3OYMA 2XSJC 4IKFA 2R72A 3FTYA 2V9KA 1WJEA 4JOMA 3FKJA 4FETA 2E5NA 2R59A 2VJJA 3K6GA 4DJAA 2QVWA 3DWLE 3ZCOA 4C2TA 1JVSA 1ERDA 2HNHA 2DT6A 2X51A 4KITB 3AKZA 1W36D 1MMGA 4PJLA 3CJRB 4II3A 2CW7A 2CUJA 4PSXA 3MKYB 3UNGC 3OIQA 4RM2A 2VXZA 2QKLB 1UG0A 2QJ1A 3T0YA 4E6KG 4J3BA 3QYBA 5CQGA 4XMZA 1KONA 2CH0A 2CW8A 4ZTJA 2WZGA 3C2HA 4ZQHA 3FUKA 2Z16A 4XN3A 3OY9A 4ZJZA 2VJ4A 1PJRA 2R70A 3RTRA 4XQFA 1ZELA 4XLFA 3F9KA 5KNLA 4XL9A 3ANLA 3OYKA 5DYFA 3CHPA 3OIPA 4FLRA 2R7TA 4MS6A 3CHQA 3FUJA 3FTWA 3HC7A 4PW4A 3RPUD 3A2KA 4XO4A 4G6TB 2KRHA 4ZX5A 4PJJA 3DTIA 2LOOA 3VDXA 4BQNA 4DIQA 3UCQA 3G2BA 4BQQA 3CESA 4NQWA 2E60A 2PJRB 4FCAA 4DBRA 3EBHA 2PUSA 3JT1A 2UWMA 2HPOA 2PGGA 2W7NA 2MD0A 3HOSA 4ZN6A 4PVBA 1D0XA 2L9NA 2Z1DA 3CF2A 1S9HA 1WJFA 2F4IA 4AR9A 1D0YA 1DP3A 3L2UA 3H5AA 2L9SA 2VB6A 2LYCA 5JO0A 4Q4IA 2Y1FA 3ZGKA 3M8JA 3OYNA 3Q43A 3OL4A 4ITVA 4ZX4A 3A4CA 3RCOA 3OYHA 2Q2EB 1J09A 2CUZA 3OS0A 4U7BA 3WQRA 2K9LA 2XAUA 5HNHA 3D5LA 2Y1CA 3VVMA 1WFXA 2AQFA 2VQHA 2ZXGA 2X1DA 2IS6A 1SQMA 1LDKB 3H5NA 3QJXA 4A03A 1RP3A 2O5RA 3DPTA 1X1DA 2JCXA 3L2WA 4OOEA 1MMAA 2JD0A 2ELJA 3OYJA 3RQ4A 5DLLA 3N05A 2L7KA 3D5RC 4KT6A 2JCVA 3OYDA 4LIVA 3VWBA 2M0MA 4JQFA 3VYSB 1MW0A 2CV0A 3HXLA 3VYUB 3K4NA 4PFPA 3LSIA 3VSLA 5CKTA 4E7IA 4H4KC 4CCLA 2M7BA 4B43A 4YELA 1HA8A 2KLOA 2XDVA 3KYLA 3BC8A 4FLSA 4N4NB 4Y67A 4NC7A 4NNJA 1NG7A 2LC2A 4XLCA 4XN7A 1VZ0A 4CCNA 1X3WA 4DPRA 2HPMA 2JVGA 4DBQA 3HL2A 2VQCA 3W2VA 1V5EA 1FMWA 2HVQA 2DJIA 1MNDA 4J00A 4QUOA 2WBMA 1JGIA 3OYCA 4BDYA 3FTZA 1D1AA 4N4OB 1K5HA 3FHEA 4ZW6A 2WPGA 2MAPA 4RCVA 4XO3A 3HOTA 3UEQA 3LSHA 4PK4A 3DTEA 4XNAA 1S46A 3CIAA 2DOAA 2FFLA 1U0JA 3CHSA 1WJAA 1Q0QA 3FUHA 2VQLA 2LRDA 3MMYB 2IGKA 4PUSA 4ZC3A 1D0ZA 2JV7A 3GBGA 2Y1GA 4PFOA 4AYSA 3A14A 1YE9A 1E0EA 3FUFA 4Y3OA 4K5NA 4RSYA 2HPTA 2V4JC 4XN8A 3KEDA 4BEHA 4XMTA 4XONA 2DT7B 2M4KA 4HNTA 4XLHA 3EUAA 4BUPA 4LUPA 1MW1A 4F52A 4BJ5C 5JHFA 2XF5A 4XKCA 4XLEA 1SFKA 1UAAA 3FH5A 4PJNA 2UV1A 1ONOA 2L5QA 3VYTB 3PNVA 2JCYA 4ZX6A 2E5ZA 2WA0A 3NWTA 1OR7A 3EUKL 1Z3XA 3PL8A 2VQGA 4LITA 3OL3A 3FTVA 2CV2A 5BPPA 4CUGA 4XN5A 3FTUA 3LMMA 3DTKA 3B7UX 3PNTA 4R5TA 5JMWA 4K5MA 2JA2A 3ZHZA 1BR2A 2PMZA 3H9JA 3PUBA 1R0KA 4XMVA 1LFPA 4K5OA 2R7VA 3H5RA 3FUIA 4E7ZA 4ZDOA 4Y33A 3OYBA 3FUMA 3U9WA 2V1NA 4OWRB 3JSZA 4DOZA 4XNBA 2V6EA 2C5ZA 3OYAA 2HU9A 3CZEA 1SG7A 2WZFA 1WJBA 4AR8A 3U21A 3K4KA 1SC5A 2BW3B 3LSGA 4BS9A 4XN4A 4CSWA 1MVYA 3WQSB 2DXIA 4CA0A 2XPYA 3FUNA 5JNLA 4FLOA 3SZGA 3FUEA 2A5WA 4HSRA 2CV1A 3ZI0A 3C2GA 3QYFA 2R7WA 3M1CA 3W2AA 2EGHA 4ZW7A 4BACA 1AA7A 3AL0B 3AFHA 3PSIA 3I9V2 2E1MC 3OWTA 3SYTA 3W2WA 1PYVA 5HNFA 2IXSA 4GAEA 2MFZA 3FHNA 4XN1A 3WQQA 2JVHA 2VJ5A 4D9JA 3TBIA 2M7AA 2LH9A 4E7LA 2HVSA 1HS6A 4MLOA 4R5VA 2KMUA 4XN2A 3K4JA 1Y56A 3BG7A 2F6CA 3B37A 4BJ6C 3L2VA 3FU5A 2C82A 2QKMB 1GW6A 4ZQGA 4ZX3A 4AR1A 4AU7A 4IZZA 4YEJA 3AU9A 4XMWA 4X2UA 4BE2A 1BR4A 3S3NA 2FUG2 2MABA 3PUUA 4XN0A 4QPQA 3VSKA 1DGWY 2LBFB 1MW2A 4E7JA 2XF6A 1YX3A 3S8PA 2BVMA 4CH7A 2VXDA 3T8VA 2UUZA 4B44A 2B61A 3IIEA 1Q0LA 4B3XA 3PNYA 4HPQA 3K4BA 1ONNA 4ARFA 2X6XA 2X1EA 2VKHA 3E1SA 4KJZA 3OS2A 3SEQA 1X1CA 3SDBA 1ZS2A 3CHOA 1N75A 2KZVA 4P1WA 1EA3A 3CZ6A 3H0DA 5DULA 4FLQA 3LSMA 1QHHD 4HRIA 2R7UA 1TZLA 2HDWA 3FTXA 2HPIA 2RJIA 3B3BA 1D1BA 4OAZA 1ONPA 2PJRA 3CZGA 4EATA 4R7LA 2OUMA 4XKVA 3QYEA 2VASA 4ZW8A 3B7TA 2VPLA 3VVLA 3UR3C 3OR2C 3HPGA 1N78A 3EBGA 2X85A 5FWQA 3OYIA 1JG9A 3ANNA 4Y6SA 5AENA 4RVBA 4BU2A 3FDYA 4OOFA 2HZDA 2KRCA 5HVQC 3CZKA 5JAZA 4HNUA 4D1QA 4GRIA 4XORA 2HVRA 1BOBA 2WAFA 4XR6A 1Q0HA 3DPLC 3FU3A 5LD2C 3TL4X 4XMUA 3RC3A 3KX2A 4L2LA 4AICA 2Q1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNF A;  5HLT A;  5HNH A; 
#chains in the Genus database with same CATH topology
 1S7A A;  1TTY A;  4HX8 A;  3ZQQ A;  1P4W A;  2CO5 A;  4YIR X;  2E1O A;  1W5S A;  2W1O A;  3JRC A;  3J81 Z;  1ETY A;  1ULY A;  2VC0 A;  3CCQ I;  3FMR A;  3ZHY A;  2JUG A;  3QOE A;  5E3N A;  4XMX A;  3FXR A;  1WI3 A;  5EGO A;  2ZNY A;  3SJM A;  3LL7 A;  4BJT A;  2J5P A;  4BL0 B;  1VQL I;  4A5N A;  3AU8 A;  1JT6 A;  4HQE A;  1MMD A;  1G59 A;  1U6G A;  1WVR A;  4F91 B;  3IWZ A;  4M9Z A;  1TL8 A;  4MQV A;  4KYW A;  2JT1 A;  2EFW A;  5ED4 A;  1LJ9 A;  1XMX A;  3PJR A;  2NS0 A;  3VEP A;  3DQV C;  3FU6 A;  2EBI A;  2BVL A;  4C2U A;  4NQW B;  1QZE A;  3KYD B;  4XN9 A;  2JD2 A;  2IA1 A;  2YX7 A;  1X4P A;  3ZRG A;  2DLL A;  1OR7 C;  1Z67 A;  5LGT A;  2A05 A;  5DM6 F;  2VOO A;  1R9T J;  1MBJ A;  1O7F A;  2F4M B;  2K9Q A;  3VYR B;  3S15 J;  2XPW A;  2LG4 A;  2VUM J;  2OQG A;  1IN8 A;  3CDI A;  4MFD A;  2JQ7 A;  2HS5 A;  3LOC A;  3OIO A;  4FHT A;  4KN7 X;  4CCK A;  3FUD A;  3BT9 A;  3TO7 A;  1PVE A;  1Q1H A;  2LSO A;  4MQ9 F;  1DP7 P;  5K1Y A;  1MW7 A;  3FXM A;  4B3A A;  3ML6 A;  3ULQ B;  5DS9 A;  1JUP A;  1XDU A;  3B02 A;  3MEX A;  3IWF A;  3BG3 A;  1FT9 A;  2MYS A;  4QPE A;  1X3U A;  5DV5 A;  2MAO A;  4CCJ A;  2LRE A;  3S2W A;  4KIB A;  4KIS A;  2DPU A;  1FTZ A;  5DD4 A;  2Y1E A;  2EV6 A;  4XOP A;  2NS7 A;  2DCE A;  2Y31 A;  2X6O A;  3GFJ A;  2FBI A;  1ZYR F;  1JTX A;  1MSE C;  2OCC H;  4RGR A;  3W6V A;  1OQY A;  4AIK A;  4BDZ A;  3AG1 H;  2LTP A;  3NEU A;  3T1B A;  4A3J J;  3GZN B;  1T1R A;  1RES A;  4FE4 A;  3GEZ A;  4XM3 A;  3KP5 A;  1I1S A;  3M8F A;  1KU2 A;  4BY7 J;  3BZC A;  2P0W A;  2XAH A;  2JA5 J;  1TWC J;  1R22 A;  1IDY A;  4HF2 A;  3DKY A;  3EET A;  3I3L A;  1X3Z A;  3SDG A;  1SD5 A;  5CLS A;  3O3K A;  4ZYD A;  1WZ2 A;  2GOM A;  2PMH A;  3G73 A;  3Q44 A;  5JMP A;  3R0A A;  1XX5 A;  4HEA 2;  4BHC A;  2WWY A;  3BG6 A;  5K7F A;  4IOA F;  3ZMT A;  3MKZ A;  5HDN A;  3HOU J;  1F5T A;  3K4C A;  3ZQI A;  1YFH A;  1V5G A;  3CCV I;  1O3S A;  1H89 C;  3V7C A;  4A3I J;  3T5X A;  2HR3 A;  4S0H B;  4IF4 A;  3S93 A;  5CPR B;  2GOX B;  2KRF A;  3D5S C;  3FBI B;  3B2X A;  1R7J A;  2FOW A;  3QP5 A;  1TQI A;  1WQ2 A;  1ZRE A;  2IS4 A;  2L9V A;  3DKX A;  2F5E A;  3L2Q A;  3ASN H;  3GX4 X;  1NK2 P;  5IYD J;  2K3P A;  3AL0 C;  2DPD A;  4WXC A;  4BHP A;  5FKM A;  5GAE J;  1R5H A;  2OC6 A;  4JND A;  2DQM A;  3RI4 A;  2VLA A;  2FEZ A;  4KMF A;  3LAP A;  3F8N A;  2BY0 A;  3HJE A;  1XDS A;  2IGM A;  4RGU A;  4XLA A;  3BLY A;  3LST A;  1SMT A;  4K5L A;  2W82 A;  1MNE A;  3E6C C;  2JTV A;  3JRF A;  2P6S A;  2YUS A;  4DGW B;  2MC4 A;  3DU6 A;  3L09 A;  2YR2 A;  4BKX A;  2O8K A;  4P5O A;  1H3L A;  5JR3 A;  3R61 A;  3K9T A;  1YIO A;  4KUM A;  2O8X A;  3BR5 A;  1BR1 A;  4QTR A;  4M74 A;  1STZ A;  3IL2 A;  1FX7 A;  2LF8 A;  5LFA A;  1YJW I;  3HUG B;  4FT8 A;  1SFO J;  2EIN H;  2KDO A;  4F93 B;  4ZTF A;  1BC7 C;  4P9U A;  3C1D A;  5FJ8 J;  2ZXI A;  2X6Y A;  1FZP B;  2DA5 A;  3GF2 A;  1HC8 A;  2E1M B;  2IGO A;  4HDU A;  3FXU A;  2M34 A;  1ZG5 A;  3BCB A;  3C2B A;  5E20 A;  3QOP A;  1H9T A;  2XF7 A;  5F1J A;  3I4M J;  4MEX F;  1SFX A;  3B3B A;  3DEE A;  4IHT A;  2UXN A;  3LFK A;  2R72 A;  1IXR C;  2MGQ A;  4UB6 C;  1ETV A;  3BP8 A;  2V1X A;  1OIS A;  4YFN F;  1Z9C A;  2KFD A;  4FET A;  3ZQF A;  2BEO A;  2OPT A;  2Y30 A;  5EF6 A;  5HDK A;  1LDJ A;  3TW6 A;  4HLX A;  1D8J A;  4EV0 A;  2KIU A;  3CCM I;  2K9S A;  5AIP A;  1IV6 A;  3AKZ A;  1MMG A;  1IGN A;  1FOW A;  1ZR2 A;  4II3 A;  4PSX A;  5D6E A;  1W4M A;  4A3G J;  5F0F A;  3TP3 A;  3JW4 A;  1YHQ I;  4FE7 A;  2M2E A;  1TC3 C;  3HZJ A;  3FUK A;  2A3S A;  3NAR A;  2Z16 A;  3MVP A;  3OY9 A;  4LD5 A;  4ZJZ A;  3PM1 A;  2FBH A;  2VJ4 A;  4FCY A;  2YX4 A;  1B8I B;  1FEX A;  4I09 A;  3PO2 J;  3ANL A;  3OYK A;  4M3F A;  5IOZ A;  5DYF A;  4V19 K;  3OIP A;  4FLR A;  3ZMV A;  3E6M A;  3CHQ A;  2IA2 A;  1Y1V J;  5HS9 A;  3F8F A;  4PW4 A;  3A2K A;  4I2O A;  2KRH A;  4PJ0 C;  3KLN A;  4HOB A;  4PJJ A;  3VDX A;  2D1V A;  3KYC B;  4XSZ F;  3ZMD A;  2PJR B;  3HIF A;  1X3W B;  2DBB A;  3I0T A;  5IY5 H;  4FCA A;  3LA7 A;  2BXY A;  2W24 A;  2UWM A;  4WF2 A;  2PGG A;  2W7N A;  2P7C B;  2QBY A;  2MC3 A;  3W6J B;  5HS8 A;  1VQ7 I;  3DKW A;  3U9G A;  2XB0 X;  3CC2 I;  2E1C A;  2BY2 A;  2H09 A;  1J0R A;  4OMZ A;  3H5A A;  2L9S A;  4E70 A;  2LYC A;  2ACJ A;  2W85 A;  3QRF F;  1Z6T A;  2PMU A;  2FJ1 A;  2ISZ A;  2GXA A;  4MEY F;  5H2F C;  1RI7 A;  2HYG D;  3H92 A;  3HOY J;  4L9T A;  1JGS A;  3RCO A;  3JTH A;  1F36 A;  2XAU A;  3O6B B;  2Y1C A;  1RNL A;  1KGS A;  2ZXG A;  3QJX A;  5IPA A;  1RC9 A;  5H20 A;  3DPT A;  1X1D A;  3CC7 I;  1R23 A;  1GT0 C;  4IEJ A;  5E8G A;  2JD0 A;  3HDD A;  4HW0 A;  5E18 F;  2EZK A;  2EFN A;  2LF7 A;  1BBY A;  3MKL A;  1JGG A;  4M9X A;  5B5E C;  3HEF A;  2NAZ A;  1UST A;  3LSI A;  3VSL A;  2L7M P;  3SZP A;  2M7B A;  4B43 A;  1QVU A;  1VF9 A;  2JK3 A;  3FK6 A;  5FKN A;  4XN7 A;  4XLC A;  1SD4 A;  1IN4 A;  2O7O A;  2HPM A;  4WXD A;  3BDD A;  1BW6 A;  1R58 A;  1FMW A;  1MND A;  2OZ6 A;  2WBM A;  2A6E F;  2VE8 A;  3FTZ A;  4KIG A;  1XSX A;  2COM A;  3TDZ C;  1ZGW A;  3RDI A;  3N4M A;  3C18 A;  1U5T A;  1K6O A;  1EH8 A;  4KA4 A;  1ZLK A;  2RV8 A;  2MAP A;  4RCV A;  1I3Q J;  3E6D A;  4MHG A;  1ZRF A;  3M07 A;  1PUF B;  1WWX A;  4M6V A;  3L1P A;  2A61 A;  3DTE A;  1S46 A;  2HQ5 A;  3FZV A;  3CIA A;  5GP9 A;  3RJP A;  1U0J A;  1R1U A;  3Q9S A;  1G3S A;  4AIJ A;  1YJN I;  3FXL A;  2LRD A;  3MMY B;  3TOA A;  2IGK A;  4HF1 A;  1AU7 A;  1WCM J;  1B72 B;  1YE9 A;  3TP0 A;  5HOD A;  3S1M J;  1MD0 A;  2W48 A;  2DFE A;  2V4J C;  2QCO A;  1AWC A;  1I1G A;  3M9A A;  3QPH A;  2QQ8 A;  2M4K A;  2XRO A;  1ZN2 A;  3EUA A;  4BUP A;  3HKZ N;  1K78 A;  4F52 A;  1X2N A;  2CRG A;  2ZXW H;  1ETO A;  4XKC A;  4BJ5 C;  5JHF A;  1UCR A;  1VFC A;  3Q0W A;  2Z3Y A;  3PNV A;  5HLI A;  4ZX6 A;  1XSV A;  1OR7 A;  1Y0U A;  3I59 A;  3K7A J;  3OL3 A;  2CV2 A;  2L4A A;  3ABU A;  1REP C;  2R3S A;  3ZHZ A;  3GCM A;  4Q47 A;  4CIC A;  3K69 A;  1POG A;  3S1Q J;  2LR8 A;  1R0K A;  1QRY A;  4RAF A;  1LPQ A;  3ZPL A;  4K5O A;  3BTJ A;  2R7V A;  4LGW A;  4LLN A;  4E7Z A;  3FXJ A;  2E35 A;  1YRN A;  3U9W A;  1TP4 A;  3JRA A;  2C5Z A;  2Z33 A;  2DT5 A;  4RGS A;  1KYW A;  3KP3 A;  2ZJP F;  1WJB A;  4AR8 A;  1ETW A;  1LEB A;  2XHK A;  4BS9 A;  2NXN B;  5FLV A;  4LK0 F;  2VE9 A;  2XPY A;  2F48 A;  4YIF A;  4XIC A;  1ZHF A;  5FFZ A;  2R5Z B;  1HKQ A;  2WAQ N;  3C2G A;  3M1C A;  2EGH A;  3MN2 A;  4BAC A;  4AUX A;  3VOD A;  5JI6 A;  3I9V 2;  2E1M C;  3OWT A;  3ZQH A;  5HNF A;  3L2C A;  4XN1 A;  2JVH A;  3G6E I;  3JAM K;  2HVS A;  4OIQ F;  4MLO A;  4W97 A;  2B63 J;  1VI0 A;  2KMU A;  4XN2 A;  2B0L A;  3B37 A;  2QYO A;  3WTY C;  2C82 A;  4ZQG A;  4ZX3 A;  1FYL A;  4LG0 B;  1SD6 A;  3IRQ A;  4IZZ A;  3CME I;  2XRN A;  4BE2 A;  1BR4 A;  1QPI A;  2FUG 2;  1B4A A;  2MAB A;  2EIK H;  3EYY A;  5C3E J;  3VSK A;  1MW2 A;  2R7D A;  4RB2 C;  1O57 A;  2ZFW A;  5D5X B;  4AD9 A;  5FKK A;  3QPL A;  4HA8 A;  5H6R A;  3J7Z I;  2B61 A;  4WX9 A;  3BWG A;  1BI1 A;  1KA8 A;  2KT0 A;  2QQB A;  4B3X A;  1U8B A;  3AG3 H;  4IO9 F;  2DOD A;  2VKH A;  1QNT A;  5CVV A;  3RKY A;  4NDL A;  2BYV E;  3QU6 A;  2I10 A;  2JRT A;  1N75 A;  2KZV A;  4P1W A;  5LRS A;  4B4C A;  2RJI A;  3KZI C;  1MIJ A;  2FNP A;  3CZG A;  4EAT A;  3M7G A;  1YI2 I;  4R7L A;  1T8I A;  2VAS A;  2F5D A;  2VKE A;  5CJ9 A;  2M8G X;  5C4X J;  1BI3 A;  3WTT C;  3HGG A;  5F0C A;  2X85 A;  4ENJ A;  3OYI A;  1OCC H;  4Y6S A;  3KP7 A;  2GXG A;  3IV5 A;  2OTJ I;  3KCC A;  4BU2 A;  2DMP A;  4M9S A;  2DA7 A;  2CSO A;  3EDP A;  3F8M A;  4ESB A;  2MH2 A;  1UB9 A;  1JJ8 C;  1UMQ A;  2CUF A;  3IHU A;  2EZI A;  3G4S I;  4XR6 A;  5F27 A;  1K83 J;  3DPL C;  5LD2 C;  4XMU A;  3KX2 A;  5FKO A;  2ECB A;  3Q0V A;  1O3R A;  3P9K A;  3BTI A;  4XKW A;  4HLY A;  4HDV A;  1RR8 C;  2HGC A;  5J40 A;  1X1B A;  4EJW A;  4YFX F;  4R5X A;  5TRD A;  2KPM A;  1JKR C;  2ZC2 A;  1GVJ A;  5F08 A;  2PG4 A;  1BI0 A;  2XPZ A;  4A12 A;  2JA8 J;  4B48 A;  1ON1 A;  4Q4Z F;  5EYR A;  3FTS A;  4WWC A;  4PU2 A;  2F5V A;  2M9H A;  1S7O A;  3G1L A;  3BPX A;  4R1H A;  4A5M A;  1CQT A;  5KK1 A;  3BJA A;  2A69 F;  2R7R A;  4J01 A;  1H0M A;  1B9N A;  1R6R A;  2DDB A;  4DYQ A;  3ZN0 A;  2DQR A;  2EIM H;  1P9Q C;  3DEW A;  4MTD A;  4QIR A;  3WE3 A;  1LKX A;  2NVX J;  4IRH A;  3GTQ J;  1W7P B;  4QPO A;  2FML A;  2CFO A;  1JHF A;  1VQK I;  2ZSI B;  1E3P A;  2LY2 A;  3RZD J;  3MKW B;  2EQR A;  1T0F C;  3HKZ A;  3QOD A;  4L0Y B;  3PFY A;  3A0H C;  4Y6R A;  1F9N A;  3O8G A;  2GLO A;  2VJI A;  3ZP5 A;  3A02 A;  2K86 A;  4G8X A;  2HOE A;  1ZRC A;  2K9M A;  1MW3 A;  1TT0 A;  5FO5 A;  3FM3 A;  1R0L A;  3R0I A;  2R4G A;  1KU7 A;  1XN7 A;  4ZQF A;  3IH2 A;  3R60 A;  4LLG F;  5M5Y J;  5EZH A;  5ILS A;  4L5E A;  2A07 F;  1QGP A;  2DAO A;  2JSP A;  3LQQ A;  3DXJ F;  5KHD A;  2FRH A;  4BQO A;  1X1P A;  4LIU A;  4Y4R A;  2IS2 A;  1WHU A;  5A2Q K;  5HS7 A;  1O3Q A;  2O7G A;  2FNA A;  3JRG A;  1S72 I;  3G71 I;  2FXA A;  3KLO A;  4BHB A;  2ZJR F;  2HKO A;  3CMM A;  4U87 A;  3WTS C;  4HX7 A;  2CYY A;  3GXO A;  5HLT A;  4Y6P A;  4EM1 A;  3HOZ J;  2WAQ A;  1PP8 F;  4YRV A;  5IT9 Z;  3BQY A;  3IAS 2;  5D8K B;  3BG9 A;  2DTZ A;  1BC8 C;  3GWZ A;  5FD6 A;  5LLQ A;  3LSR A;  3A0B C;  2RNG A;  3CMA I;  3R6S A;  3HHH A;  3I4P A;  4DYC A;  3S3M A;  2QEN A;  4LB5 A;  4LJZ F;  2VJ8 A;  2KL4 A;  1XCV A;  4XKB A;  5E3O A;  1DQU A;  2BHZ A;  4AYB A;  2ZCW A;  3DF8 A;  2KZG A;  3H1C A;  5FRM A;  4JX5 A;  4CDG A;  1E17 A;  1MJA A;  3H35 A;  5F6F A;  3HTS B;  1Z21 A;  1IW7 F;  5FFX A;  2IGN A;  2NVT J;  3EUH C;  2FQ4 A;  1R1V A;  1ZG1 A;  1QQI A;  3G1O A;  2QGU A;  2A7O A;  5D5W B;  1RUO A;  5FRO A;  3F21 A;  3CP8 A;  1I6X A;  1V5F A;  1ZGJ A;  4PJM A;  4I01 A;  3ROU A;  1O3T A;  4XND A;  1FPQ A;  1FC3 A;  2ZJ2 A;  4A3K J;  4G94 A;  1MDM B;  2JWT A;  1ITY A;  1WRJ A;  1XTA A;  2DJN A;  3FWE A;  2V26 A;  2DDA A;  3K70 D;  2JN6 A;  1K4S A;  4U0W A;  3PO3 J;  4E7K A;  3K4M A;  2BE5 F;  1QU3 A;  4A3C J;  3EPZ A;  4I7H A;  5LGN A;  1EF4 A;  1U9O A;  1VQ9 I;  4CCM A;  2K02 A;  3OYE A;  1ZRD A;  5K5O A;  3FBN B;  1U2W A;  2K40 A;  2KIQ A;  2LK2 A;  2WTE A;  2KJC A;  3AAF A;  4NHJ A;  2LBF A;  4A3E J;  3ZQL A;  2M0C A;  2X48 A;  1T33 A;  4HBL A;  1LDD A;  4DZP A;  2XC7 A;  1FJL A;  1YYV A;  1YX5 A;  4OIP F;  3B73 A;  4B09 A;  1I6H J;  1SAU A;  1D5Y A;  2W84 A;  2ZME B;  3CCL I;  3DBL B;  3UKG A;  3RSN A;  1YO5 C;  3PSF A;  4E7S A;  4E7H A;  1DGR M;  2XIG A;  3CDH A;  4BNC A;  4F55 A;  2RNJ A;  3DU5 A;  4ESF A;  3I58 A;  3HRS A;  3MWM A;  1KQ8 A;  2W25 A;  2D5V A;  3S1N J;  1ZKG A;  2E2I J;  4GGG A;  3KEY A;  2XAJ A;  3OYF A;  5DCM B;  3JSO A;  2HTJ A;  1Y6I A;  3KEO A;  4FQG A;  4C3J J;  3P5J A;  1H9G A;  2RC4 A;  4OIN F;  3CCE I;  1DPU A;  3S3O A;  1Y8Q B;  4IKF A;  2V9K A;  4L9N A;  4X1E A;  1J5Y A;  6PAX A;  1OCO H;  3CLQ A;  5BS6 A;  2HOT A;  2IJL A;  3BJ6 A;  4IHW A;  1JVS A;  1ZG3 A;  2DT6 A;  1W36 D;  1WH5 A;  2C6Y A;  2CW7 A;  3MKY B;  1TLH B;  4DNC A;  3RPU A;  4HYE A;  2QKL B;  1RUN A;  3WTU C;  4EGY A;  2CJJ A;  1W0T A;  4KDP A;  2EFQ A;  4M3D A;  2DMN A;  4M3E A;  1ONV A;  1KON A;  4U0Y A;  4JX4 A;  2WZG A;  2FE3 A;  5B66 C;  1D8K A;  4ZQH A;  4XN3 A;  5ERI A;  2HXI A;  2IT0 A;  2R70 A;  3VOE A;  3PIO F;  1VQN I;  4XQF A;  4A3B J;  4XLF A;  1ACI A;  2STT A;  1Z77 A;  3KET A;  3S17 J;  3A01 A;  4M73 A;  4B8X A;  2DMQ A;  2XV4 S;  1V4R A;  3J80 K;  2E36 A;  2HQR A;  4G6T B;  2H27 A;  2LOO A;  2OA4 A;  2E7W A;  4BQN A;  3EQL F;  2HZT A;  1R5G A;  1XGM A;  1HXD A;  2ZXJ A;  3BQZ A;  3CES A;  3O8H A;  2E60 A;  4BQQ A;  1LQ1 A;  3GFM A;  1JTY A;  4KMU X;  2NNY A;  3EBH A;  2DA3 A;  5F64 A;  3CUQ B;  4X6A J;  2PUS A;  5H6Q A;  2VT3 A;  2AS5 F;  3ZQC A;  3U1D A;  1ZAO A;  1MJB A;  3OSG A;  1Z91 A;  3GFL A;  2N8G A;  1S9H A;  1WJF A;  1H8A C;  2P5V A;  1D0Y A;  1DP3 A;  2WB1 N;  2VB6 A;  5JO0 A;  1XGO A;  2FQ3 A;  2QQ9 A;  2R7F A;  3CJT B;  5GAG J;  2R5Y A;  2Y1F A;  3ZGK A;  1B9M A;  4ITV A;  4ZX4 A;  1MMS A;  3OYH A;  1A04 A;  1ZLJ A;  2K9L A;  3X2Q H;  2AQF A;  5D6F A;  2ELK A;  2X1D A;  3H5N A;  4MO7 A;  3HYI A;  2O5R A;  2G0E A;  2JCX A;  3L2W A;  4OOE A;  2ELJ A;  3H0G J;  3OYJ A;  3HSR A;  1RIO H;  1HDP A;  2B9S A;  5E3L A;  2M0M A;  1MW0 A;  3C7J A;  2EJR A;  2O6G E;  4PFP A;  4XRS G;  5CKT A;  4E7I A;  5ICE A;  4CCL A;  2EZL A;  4P55 A;  3KYL A;  1FP1 D;  4NC7 A;  3F72 A;  5D8L B;  5E3M A;  1X3W A;  4XRS A;  4HV5 A;  3SXY A;  3FHZ A;  3FF5 A;  1YOV B;  4DPR A;  2NRA C;  2MSY A;  2VQC A;  2HVQ A;  4QUO A;  2PBI A;  1G6N A;  3K0L A;  4ZH4 F;  1XMK A;  2R7Z J;  2L4M A;  4PDK A;  1QO0 D;  4PZJ A;  1IXS B;  3CQZ J;  3L7W A;  4N4O B;  2LD5 A;  3FHE A;  2PEX A;  4XO3 A;  3HOT A;  3LSH A;  4PK4 A;  2P81 A;  2VON A;  3QPS A;  4XNA A;  4A3M J;  3GME A;  1R49 A;  2DOA A;  1FIA A;  1CGP A;  1K7A A;  3V8K A;  3FUH A;  4KN4 X;  2PI0 A;  1BI2 A;  4ZC3 A;  3BR6 A;  3GBG A;  2Y1G A;  1WGX A;  4PFO A;  3A14 A;  4NC6 A;  1E0E A;  4Y3O A;  2ADU A;  4K5N A;  1K61 A;  4BEH A;  4XMT A;  2ZBK A;  3IH4 A;  4UVA A;  4EVI A;  2GXB A;  4LUP A;  1MW1 A;  2MD5 A;  2OD5 A;  3U1K A;  5FGM A;  3LWF A;  4NB5 A;  2XF5 A;  1T39 A;  3FH5 A;  1W5T A;  3FMQ A;  1O7L A;  3H3Z A;  2E5Z A;  3HRU A;  5JFR A;  3M8E A;  3PL8 A;  1Z3X A;  1NK3 P;  2VQG A;  1C0W A;  3WTV C;  3GLL A;  5IT3 A;  5EEH A;  4XN5 A;  3LMM A;  1OCP A;  3ESW B;  3H36 A;  4G6Q A;  1G3Y A;  3BJO A;  2FF4 A;  1EV7 A;  1X3Z B;  3H9J A;  3LSP A;  4XMV A;  5CVI A;  4H0E A;  1UHW A;  3K1N A;  4Y33 A;  3OYB A;  1MH3 A;  4RAG A;  2V1N A;  1HST A;  4MGR A;  5B3S H;  2D45 A;  3S16 J;  3WTX C;  1R4N B;  2V6E A;  5LBQ A;  2P8T A;  5GPA A;  3OYA A;  4RS8 A;  4CO8 A;  1PUF A;  2ZME C;  5D4R A;  4KNY A;  3K4K A;  3V8J A;  5LEK A;  4I02 A;  3AG2 H;  3LSG A;  4CSW A;  1MVY A;  4A3D J;  2PX9 A;  3FUE A;  4LK1 F;  1R5I D;  3LSJ A;  2CV1 A;  2Y75 A;  3E6B A;  1IZ1 A;  5M5W J;  3ZI0 A;  1IV8 A;  3I55 I;  1B72 A;  3I4N J;  1KZH A;  4GAE A;  3EYI A;  3FIW A;  1PYV A;  5KAI C;  5LRR A;  1P92 A;  3FHN A;  3WQQ A;  2NVQ J;  4E7L A;  2M7A A;  1WKM A;  3SFI A;  4R5V A;  1ETQ A;  2RKH A;  3MAJ A;  1Y56 A;  2CW0 F;  2ME0 A;  2F6C A;  4BJ6 C;  3C3W A;  4BBR J;  2XAS A;  3KEQ A;  1A5J A;  4X2U A;  2P4W A;  1IUF A;  1LE8 B;  1ODD A;  3COA C;  3PUU A;  2ZJQ F;  4XN0 A;  3S2H J;  4E7J A;  4WXH A;  3WTZ A;  2DMT A;  1YX3 A;  3S8P A;  2BVM A;  1OYY A;  2QZ8 A;  2V79 A;  2H6B A;  3KP6 A;  5JVG F;  2FX0 A;  1UHM A;  4CGZ A;  1QVT A;  4MFE A;  3PNY A;  4RB0 A;  1A6Q A;  1XCB A;  1ONN A;  3GW2 A;  3HOW J;  2X1E A;  5DUI A;  4IHS A;  3E1S A;  4KJZ A;  5KVR A;  2OJE D;  1X1C A;  2NS8 A;  3SDB A;  3TQN A;  1ZS2 A;  1FBQ A;  3CHO A;  3H0D A;  1EA3 A;  2GIZ A;  2YS9 A;  2E19 A;  2Q0O A;  2RVC A;  2LP0 A;  4G12 A;  3ZMU A;  2HPI A;  3FTX A;  2BZT A;  2QF7 A;  2LFB A;  2YPR A;  3DFG A;  2DA4 A;  1CF7 B;  2P5K A;  4OAZ A;  1XGN A;  3CC4 I;  4BQA A;  4JP0 A;  2LLK A;  3RQI A;  4RAY A;  5EG0 B;  3TDU C;  1BM9 A;  4XKV A;  4UVC A;  4ZW8 A;  4BAY A;  5BNG A;  3VVL A;  5LGU A;  2QA4 I;  4S04 A;  1N78 A;  4A6E A;  1FOY A;  3CUQ C;  4V2G A;  2DMU A;  5AEN A;  4RVB A;  3FDY A;  4HX4 A;  3G3Z A;  2ZO4 A;  1YTY A;  1IN6 A;  1P6R A;  3ERM A;  3ZQ7 A;  1FYK A;  3KFW X;  3LAJ A;  1IN7 A;  3FU3 A;  5L3C A;  4KFC A;  4L2L A;  2RRE A;  2Q1Z B;  1BL0 A;  4EQQ A;  3MZY A;  2ZXH A;  3DLA A;  4BXF A;  2LNB A;  2DFF A;  1LVK A;  1SVO A;  4U0V A;  3RYR A;  2OV7 A;  2JPB A;  3DCF A;  1Z7L A;  2Y48 A;  4BBS J;  1GLN A;  3CF5 F;  4HG2 A;  1H88 C;  2M30 A;  2R7O A;  4HQM A;  1R00 A;  4WK8 F;  3A06 A;  1ZH5 A;  2KKO A;  4LG3 A;  5DTD A;  3KP2 A;  2EWN A;  1QA6 A;  5DCF A;  4MNU A;  1EH7 A;  2RDP A;  1T95 A;  1YW7 A;  2HWV A;  2X6W A;  1EH6 A;  3HG9 A;  2VL8 A;  4PSW A;  2WAD A;  4I98 B;  2XQ0 A;  1QZY A;  4ZZL A;  1Y8R B;  3B7S A;  2DQ6 A;  1Y1W J;  4AID A;  3V7S A;  5TGT A;  5IP6 A;  5CVJ A;  4ZYA A;  1G8X A;  2GA2 A;  1S8N A;  4ZZD A;  1NG6 A;  2V6C A;  1WJC A;  1SVM A;  1WSU A;  5KCM A;  2K5C A;  1FSH A;  1HQC A;  2QUF A;  3JRD A;  1VQP I;  2Z2S B;  3ASO H;  3CUO A;  3FXQ A;  3LNQ A;  2QBY B;  2CS3 A;  4MKT A;  3JTG A;  2ELH A;  3NWS A;  2IP2 A;  2CU7 A;  2PL5 A;  3ABL H;  2WV1 A;  1IAW A;  2DA1 A;  1HSJ A;  2V7F A;  2WY7 Q;  1YS7 A;  4QWQ A;  1N77 A;  4CYC A;  4L9J A;  1D1C A;  1I27 A;  2NOJ B;  3A1Y A;  3E5X A;  2MH9 A;  4IXA A;  3VB2 A;  2KJB A;  1YLF A;  3BR0 A;  2RN7 A;  2BXZ A;  5JLX A;  4ESJ A;  4D0P A;  1OCT C;  1NH3 A;  4LB6 B;  4CCO A;  5BQT A;  4IX7 A;  2H8W A;  2W00 A;  2JD1 A;  2EK5 A;  3OOU A;  3V7R A;  1I3A A;  2DQL A;  4N9I A;  1PP7 U;  1IRX A;  3OR1 C;  4IOC F;  4IHY A;  2W4S A;  1P7I A;  2YU9 J;  2K85 A;  4XID A;  3HRT A;  2CGP A;  3RC8 A;  4RMN A;  1FIP A;  3IRR A;  1R1T A;  2O3F A;  3TMO A;  4EJV A;  1FSE A;  3WGG A;  4XOT A;  2K3F A;  3SHF A;  2F5F A;  3CTA A;  1FMV A;  3DP7 A;  2HEO A;  2EZH A;  2A6H F;  5IP9 J;  3P7N A;  4I76 A;  4EM0 B;  5LEJ A;  3MZH A;  3GTP J;  4IL6 C;  4N9H A;  4RLQ A;  5IYB J;  5D5U B;  1W7P A;  3ONQ A;  1J75 A;  1T38 A;  2GTQ A;  4CZZ A;  3J7A Y;  5J4V A;  5K7Z A;  2LVS A;  2QSF X;  1U5T B;  2CMP A;  4FAS D;  3QQA A;  3GVA A;  3JAM Z;  1MGT A;  4M3B A;  1RRJ A;  1G5A A;  4UUS A;  2AQE A;  2NYX A;  2OAZ A;  2R7X A;  4QHP A;  1P4X A;  2BW3 A;  1EKE A;  2HQA A;  4XNF A;  2RQQ A;  3WG7 H;  3K70 C;  1TQP A;  5IOY A;  5K7H A;  1MZB A;  4XMY A;  4GCV A;  1SVL A;  3BCA A;  2EPF A;  3LSK A;  1ETX A;  2P6T A;  4QIW N;  3CHR A;  1ZAR A;  1H19 A;  3GZ6 A;  4GAA A;  4UB8 C;  3HHG A;  3DV8 A;  5CQE A;  2L7F P;  3S2D J;  1FOX A;  4II2 A;  4GYG A;  5F0H A;  1K78 B;  4BE0 A;  3H3U A;  3TOB A;  3CJQ B;  1D3Y A;  3IUO A;  4GDF A;  3IAM 2;  1AKH A;  3KE2 A;  3TED A;  3T8R A;  2Y1D A;  2VBY A;  5LHH A;  2QSG X;  3I59 B;  1JJ6 C;  3WU2 C;  3MCZ A;  3RKX A;  1MMN A;  2M87 A;  1FTT A;  4C2M J;  4OU0 A;  3JRI A;  2OCE A;  1XGS A;  2HYF A;  1OLT A;  3OMY A;  1JKP C;  3CO6 C;  3R4K A;  3V42 A;  2QEX I;  3FH8 A;  2KP6 A;  1A36 A;  1ON2 A;  4ZW5 A;  2L0K A;  3E0J B;  4R79 A;  3WU0 A;  2DYR H;  1ZR4 A;  4GXO A;  3S32 A;  4B47 A;  2BBY A;  2LKP A;  2PLY A;  1P7J A;  3ZR8 X;  5FRN A;  2VIX A;  3NAU A;  1GUU A;  5ILV A;  5FLX K;  4MIM A;  4XO5 A;  1FY7 A;  2ZSH B;  1DU6 A;  2R7Q A;  1HLV A;  1BJZ A;  3HPH A;  2X1C A;  2K7L A;  1TT5 B;  4B1R A;  2JMW A;  1J9I A;  1X1A A;  4F92 B;  3OYG A;  3MD2 A;  3FUL A;  1MJ9 A;  4AWX B;  4K5P A;  1W36 C;  2ID6 A;  3DBH B;  2B7E A;  2FBK A;  3RKW A;  2PMZ N;  2XSJ C;  5ICC A;  1TW2 A;  1XMA A;  5FLM J;  1HOM A;  1MDM A;  3HOV J;  3FTY A;  1WJE A;  4JOM A;  2L3D A;  4AC0 A;  4O6J A;  1AOY A;  2R59 A;  3JRH A;  5BMZ A;  2HFH A;  3K6G A;  2QVW A;  3DWL E;  3ZCO A;  4C2T A;  4A93 J;  4D7N A;  2Q8K A;  4PJL A;  3CJR B;  2O9L A;  2CQK A;  2CUJ A;  2V9P A;  3UNG C;  3FKI J;  3IKV A;  3OIQ A;  3E5U A;  1UZC A;  2DO7 A;  5B1A H;  3WE2 A;  4XMZ A;  2CH0 A;  1Y39 A;  1XG1 A;  3C2H A;  2XGE A;  1JKQ C;  1PJR A;  3RTR A;  2PN6 A;  4XLP F;  3F9K A;  1YJ9 I;  5E8I A;  2Y9Y A;  4XL9 A;  3HOX J;  3CHP A;  1ZQ3 P;  1SC7 A;  2R7T A;  2VC1 A;  4MS6 A;  1RZ4 A;  2IEK A;  3FUJ A;  1GDT A;  1UG2 A;  4EM2 A;  3RPU D;  4ZX5 A;  4UXN A;  3DTI A;  2E2H J;  1K4T A;  2MG4 A;  3G2B A;  2UZK A;  2IPQ X;  1S3J A;  4NQW A;  5DCM A;  4DBR A;  5EJC A;  4HNV A;  5CVU A;  2ZNZ A;  1IXC A;  3JT1 A;  1OYI A;  2XPU A;  3HOS A;  5DYM A;  4PVB A;  1TQM A;  1D0X A;  2L9N A;  2IW5 A;  2Z1D A;  2XSD C;  3CF2 A;  2DK8 A;  3R0J A;  1UJ8 A;  2H94 A;  1Q1V A;  2M1B A;  2XVC A;  1VQM I;  5F1R A;  3L2U A;  1JKO C;  4RGX A;  5A2Q Z;  2FOK A;  2VI6 A;  3E97 A;  4Q4I A;  1XB4 A;  3N97 A;  2TCT A;  3M8J A;  3Q43 A;  2LKX A;  1IJW C;  1QPM A;  3ABT A;  4D5C A;  2Q2E B;  3ABK H;  3QU3 A;  4BYY A;  3OS0 A;  1IRZ A;  2CFX A;  2ME6 A;  3Q9V A;  3WQR A;  5HNH A;  3D5L A;  1I50 J;  3VVM A;  1WFX A;  3FXO A;  2IS6 A;  4A03 A;  2HOS A;  2VT2 A;  1RP3 A;  2KDZ A;  1MMA A;  5DLL A;  4JBA A;  3RQ4 A;  3IC7 A;  3N05 A;  2L7K A;  3D5R C;  4KT6 A;  2UXX A;  1A6I A;  2JCV A;  4QLC U;  1P2F A;  1LEA A;  3VWB A;  4JQF A;  4XSX F;  2JA7 J;  3HXL A;  3VYU B;  3ECH A;  3K4N A;  4YEL A;  5IP7 J;  3J81 K;  1HA8 A;  4FLS A;  4Y67 A;  2LC2 A;  1FOK A;  3ISP A;  1YS6 A;  4UVB A;  4AM3 A;  3MZ8 A;  1TWA J;  4MTE A;  2JVG A;  3BOQ A;  4JYK A;  2NVY J;  4M72 A;  3B6A A;  4DBQ A;  3DLL F;  1W0U A;  5J8F A;  2DJI A;  4P9F A;  1JGI A;  5K5R A;  3OYC A;  2GZW A;  1MSF C;  1MBG A;  1TWG J;  2DN0 A;  4BDY A;  4FIS A;  1R36 A;  5AIQ A;  1K5H A;  2JRM A;  4ZW6 A;  2VOP A;  2WPG A;  3GUD A;  4A0Y A;  1MBF A;  1VQ6 I;  1U5T C;  2DFH A;  2DOF A;  2V1D A;  3MFK A;  2Y69 H;  1R4M B;  1VQ5 I;  2GAU A;  3CHS A;  1WJA A;  2VQL A;  2FA5 A;  5L3B A;  1D0Z A;  4XBF A;  4AYS A;  2HTS A;  3WU1 B;  3FUF A;  1GHC A;  3BR1 A;  4RSY A;  2XAG A;  4ABZ A;  2NOG A;  2K27 A;  3CDL A;  4G7Z F;  4XON A;  2DT7 B;  4HNT A;  1RKT A;  1APL C;  2ECC A;  1D5V A;  2VBW A;  1USS A;  2DA2 A;  3REO A;  3PUF A;  2EV0 A;  4XLE A;  1SFK A;  2E7X A;  1UAA A;  4PJN A;  1ONO A;  2VN2 A;  1LB2 A;  3TKY A;  3J7Y J;  3VYT B;  4Q48 A;  4UHT A;  2GA1 A;  2STW A;  2JCY A;  5DDG A;  2CQ7 A;  3NWT A;  2EV5 A;  3GTO J;  2XAQ A;  2AXL A;  3FTV A;  5BPP A;  4OOI A;  1P4A A;  4CUG A;  3FTU A;  3DTK A;  3PNT A;  4C3I J;  2WV0 A;  4WCG A;  2PMZ A;  2X0L A;  3BZ6 A;  2QSH X;  2K4J A;  1WPK A;  1LFP A;  5DD8 A;  2NNN A;  3FUI A;  3FUM A;  4OWR B;  4DOZ A;  4XNB A;  3HUG A;  5J1Y A;  5GAH J;  2XKP A;  3CZE A;  2HU9 A;  4ZYH A;  4G7O F;  4DZJ A;  1BN5 A;  2QWW A;  1FNN A;  1VQ4 I;  1Z6R A;  3OOP A;  1FBU A;  2Y0S N;  4LOC A;  5ICG A;  3GYH X;  2DXI A;  4L0Z B;  5JNL A;  1JHH A;  1FYM A;  4FLO A;  1T6S A;  4I0B A;  2MBF A;  2XGC A;  1S29 A;  2XRL A;  3A03 A;  4HSR A;  4AVP A;  3QYF A;  2R7W A;  4EGZ A;  3W2A A;  4ZW7 A;  1BOA A;  2IVM A;  3PSI A;  3W2W A;  2MFZ A;  1T56 A;  1RKW A;  2WC2 A;  3E5Q A;  3TBI A;  2E2J J;  1HS6 A;  5GPC A;  3JCU C;  2EA4 A;  3K4J A;  3HBL A;  1MNM C;  3L2V A;  2QM3 A;  3FU5 A;  3H3V K;  2OU2 A;  2QKM B;  3HM5 A;  4AR1 A;  4AU7 A;  4RA2 A;  4YEJ A;  1E3H A;  2ESN A;  2EH3 A;  5LHG A;  1B6A A;  3BG5 A;  3J80 Z;  1LFB A;  2NVU B;  5GAD J;  2I5U A;  4M6Y A;  4O5V A;  2LBF B;  3F8B A;  4PGG A;  2OTL I;  4BY1 J;  2VXD A;  1MKM A;  2UUZ A;  4ON0 A;  4B44 A;  3IIE A;  5EGO B;  1Q0L A;  2AO9 A;  1B8I A;  2AHQ A;  1ETK A;  4Y52 J;  2P5L C;  1W5C C;  2JPC A;  3LSM A;  2R0Q C;  2R7U A;  2HDD A;  1F1Z A;  2HDW A;  2DI3 A;  3O2P E;  4XLN F;  3RKQ A;  1DUX C;  2HQN A;  3TO9 A;  2EIJ H;  1U78 A;  1BIA A;  2PJR A;  5FKL A;  2E1N A;  2OUM A;  1HW1 A;  3T8T A;  4AIH A;  2BY3 A;  3SQN A;  3B7T A;  4D7M A;  3UR3 C;  1YW9 A;  3HPG A;  3Q0U A;  3DBR B;  5FWQ A;  1JG9 A;  2H1L A;  4UV9 A;  4N0B A;  2HZD A;  2KRC A;  2DFI A;  5HVQ C;  5J47 A;  4D1Q A;  4EJU A;  4KT5 C;  4GRI A;  1L0O C;  3CZK A;  3JR9 A;  3D0S A;  2VPR A;  1Q0H A;  1IG7 A;  1U8R A;  3RC3 A;  5FB2 A;  4ENM A;  1LE8 A;  3IH3 A;  5ICF A;  1Z7U A;  3I71 A;  3CLO A;  3RIR A;  2HDC A;  4A0Z A;  2IS1 A;  4KP7 A;  1XS9 A;  1LFU P;  1W1W E;  1SD7 A;  2RQP A;  5KAF C;  1QHG A;  5EV7 A;  3RAS A;  3P9I A;  4F3Q A;  2MLG A;  4NUB A;  4DYR A;  3CO7 C;  1HCR A;  2A5Y B;  1GVD A;  5DEQ A;  5HLG A;  1MH4 A;  5AON A;  5GTH C;  1HKS A;  2P7V B;  3A01 B;  4KIF A;  2H8R A;  4ZDP A;  1YG2 A;  2HXO A;  2LKS A;  2EFP A;  3WGI A;  5J4Y A;  1KQ0 A;  1OKR A;  3OS1 A;  3BY6 A;  2W57 A;  4L5J A;  2K9N A;  3M1E A;  3SZT A;  2Z99 A;  1AHD P;  1CF7 A;  1IN5 A;  1L3L A;  4IHX A;  1Z1D A;  4XRF A;  3TGN A;  4E4H A;  4ZDL A;  3ZXS A;  1G2H A;  5EG0 A;  3RZO J;  4A69 C;  3W3C A;  2F4O B;  2IA0 A;  2DTR A;  5JBI A;  1OMI A;  3KZY A;  1JE8 A;  2L01 A;  3FXK A;  4ZW3 A;  3FMS A;  1T0F A;  2XGX A;  1UEL B;  2KIS A;  2WY8 Q;  1S5L C;  4Y7N J;  2KIM A;  2HKX A;  3E3V A;  1NHA A;  5TJJ A;  3WHB A;  5HLH A;  2G9W A;  4G6D A;  4S05 A;  2GQQ A;  2FU4 A;  5JVT A;  5EDN A;  3GTM J;  2R7S A;  4BXU A;  1XC5 A;  4IQJ A;  5EEA A;  1B59 A;  3CCU I;  2R5Y B;  3DPU A;  2QQA A;  4LMY A;  4ANJ A;  4J19 A;  3ANM A;  1U9N A;  2I8D A;  2GIV A;  2LY1 A;  1M1E B;  3HSF A;  3HB9 A;  5E17 F;  3ZMS A;  4GFB A;  3L2R A;  2ZFU A;  1T1S A;  4RB3 C;  2VKD A;  1HW2 A;  1TNT A;  3B34 A;  2KQR A;  4NBQ A;  3FM5 A;  3JRE A;  2A6T A;  1I39 A;  1PDN C;  3CZL A;  4L5I A;  2G7H A;  1MBH A;  1JI8 A;  3K4L A;  5HOO A;  2WAE A;  3F22 A;  2Y0S A;  3KPH A;  4ZQT A;  4YFK F;  3QP6 A;  2CG4 A;  2L02 A;  4A3L J;  1F43 A;  2L7Z A;  3HRM A;  4Q4E A;  2A68 F;  1WI9 A;  3GLX A;  3SFZ A;  5GTI C;  3PQJ A;  4G9Y A;  1K6Y A;  2CUE A;  2V1U A;  2LMD A;  3ECO A;  1RR7 A;  2YSR A;  3PFI A;  2RAE A;  4RLF A;  3GZ5 A;  2PFB A;  1Z3Y A;  5HDG A;  4X0G A;  3B7R L;  2XGD A;  1WH7 A;  2BOL A;  4IQ4 A;  4HF0 A;  4C9Y A;  2XB5 A;  3RPQ A;  4ASN A;  1K79 A;  2WB1 A;  2Y0M A;  3CP2 A;  3K10 A;  3OYL A;  3BZK A;  2CQQ A;  1YQA A;  3EUH A;  3OSF A;  4QSH A;  1S6L A;  1TWF J;  3H9Q A;  3TW7 A;  2V9V A;  1HF0 A;  2IBD A;  1ZGA A;  5CYV A;  1W7P D;  1FLI A;  1WJ5 A;  3SEZ A;  2L54 A;  2TRT A;  1V54 H;  4HST A;  1JUS A;  4U7D A;  2R5Z A;  3B2P A;  1SFU A;  2M5W A;  3EBI A;  4ZQE A;  4NC8 A;  5LHI A;  4AVZ A;  2O0Y A;  3TO6 A;  1KYZ A;  4JK1 X;  1KU9 A;  4BEH B;  2RGV A;  1HKT A;  1GV2 A;  1U3E M;  3FH7 A;  5JC1 A;  3ZQG A;  3F6O A;  3CCR I;  1X2M A;  4UV8 A;  5F04 A;  1VQ8 I;  5E1Z B;  4QME A;  4KIC A;  1GXP A;  4OMY A;  1ORK A;  1OPC A;  1GV5 A;  3GFI A;  1B1B A;  4LG0 A;  2VOD A;  1IC8 A;  1UHS A;  3LA2 A;  2H6C A;  5E79 C;  2M3A A;  3UER A;  3LFU A;  4F7Z A;  1X4O A;  2LY9 A;  4Z2Y A;  4OAY A;  1DU0 A;  2MW8 A;  2ISY A;  2F2E A;  3AUA A;  2JJ7 A;  4L18 B;  4EJT A;  1JT0 A;  1G4D A;  5L3D A;  4BGD A;  1T2K A;  5TIS C;  2KHM A;  4CZC A;  2DOE A;  3IP4 B;  4UUT A;  1X19 A;  3WGH A;  3WG9 A;  3L00 A;  4Y17 A;  1VND A;  3I5U A;  4C3H J;  3WTW C;  3M3Y J;  3ZHX A;  4CXF A;  1GXQ A;  2L2O A;  4RM3 A;  1G3W A;  1F4K A;  4C30 A;  3KIO A;  3U2R A;  3FU0 A;  3H9G A;  1T98 A;  2M4G A;  4BE1 A;  3ZOB A;  1E3O C;  4O3M A;  5BPI A;  1WJD A;  1SAN A;  2JSC A;  3OYM A;  1QZZ A;  3NRV A;  4OIO F;  1LUJ B;  2JZY A;  2IAI A;  4YG2 F;  1Y0N A;  3FKJ A;  4DW6 A;  2E5N A;  3FK7 A;  2VJJ A;  4ETS A;  1DDN A;  4FTH A;  3CCY A;  2BGC A;  4DJA A;  3LA3 A;  1TWH J;  3W6K B;  1ERD A;  2HNH A;  2X51 A;  2HI3 A;  4KIT B;  3F3X A;  3K1P A;  1OFC X;  3QAH A;  3CXB A;  3GTG J;  3K1M A;  1JXS A;  4RM2 A;  2VXZ A;  1UG0 A;  2QJ1 A;  3T0Y A;  4E6K G;  4J3B A;  3QYB A;  2K4B A;  4IJA A;  1XPX A;  4R8H A;  5CQG A;  3K2A A;  4PCQ A;  4G7H F;  4ZTJ A;  2CW8 A;  4ZYG A;  4ENN A;  1HBX G;  3BRO A;  4FX4 A;  1IRF A;  1ZEL A;  3KZZ A;  4EMS A;  5KNL A;  3JSP A;  3G1M A;  1SEU A;  3PIP F;  5DM7 F;  1ZTR A;  2D2W A;  5E1X A;  1V3F A;  1YIT I;  3ABM H;  3GTJ J;  1J59 A;  3FTW A;  4IHV A;  3HC7 A;  4XO4 A;  2BV6 A;  2FSW A;  3S14 J;  3WHC A;  1MBE A;  3MQ0 A;  2IRF G;  1XSD A;  5B1B H;  4DIQ A;  3UCQ A;  4HV6 A;  2TDX A;  1IDZ A;  1SMY F;  2MLK A;  3QWL A;  2XUB A;  4L9V A;  2GM4 A;  3V8L A;  4I0A A;  1BJA A;  5J1R A;  1IRG A;  2HPO A;  5BOX A;  1T08 B;  4RBO A;  2BY1 A;  2MD0 A;  2E34 A;  4PGH A;  5M5X J;  5C44 J;  5C4J J;  4Q5S F;  5CVR A;  4ZN6 A;  2MA3 A;  3I53 A;  1TBX A;  5JLW A;  1LNW A;  1HW5 A;  4JX6 A;  2F4I A;  4FX0 A;  4K2E A;  4AR9 A;  4A3F J;  3BTL A;  5M3F J;  1DPR A;  4EJO A;  1Z0X A;  3QPT A;  2PQ8 A;  1S7E A;  4AYB N;  5J6X A;  4HAM A;  4RDU A;  3OYN A;  4I99 C;  5BPD A;  3OL4 A;  3A4C A;  4XK4 A;  2HYJ A;  4HZF A;  1J09 A;  2CUZ A;  1J2X A;  4U7B A;  3HSE A;  2VQH A;  1TW3 A;  2EIL H;  2ESH A;  1SQM A;  1LDK B;  3Q5F A;  2CWE A;  3WOD F;  2VBX A;  1RPW A;  3M4O J;  1BA5 A;  5K5Q A;  1FBS A;  2DU9 A;  3OYD A;  4LIV A;  5L3G A;  3VYS B;  2CV0 A;  1I5Z A;  4M6X A;  3K2Z A;  4H4K C;  3HW2 A;  2O61 A;  2DA6 A;  2F5C A;  1OCR H;  2KLO A;  2XDV A;  4ENK A;  3BC8 A;  1NTC A;  4N4N B;  4NNJ A;  1NG7 A;  4YII A;  1VZ0 A;  2X9D A;  3NQO A;  4CCN A;  5E1W A;  5EZG A;  4EEF G;  4RAZ A;  2Z5U A;  4V2F A;  4W1U A;  3HL2 A;  4TV7 A;  3W2V A;  2VBZ A;  1V5E A;  4J00 A;  1OYW A;  1IO2 A;  2KIF A;  4CHU A;  3CCJ I;  5J1U A;  1R71 A;  3VFZ A;  3J7A O;  1D1A A;  1G3T A;  2ETH A;  3B6C A;  1YRN B;  1RET A;  5J3L A;  2QLZ A;  1IUY A;  1X58 A;  4CYC B;  1O4X A;  3UEQ A;  2OQR A;  1IF1 A;  2R92 J;  4UY8 I;  1E2X A;  4IPA A;  4DQ2 A;  2FFL A;  1Q0Q A;  2EB7 A;  3ZN1 A;  2LDU A;  1Z05 A;  3ELK A;  4PUS A;  1OCZ H;  2Q2E A;  2JA6 J;  2JV7 A;  3Q3S A;  4IRG A;  3GTL J;  4U88 A;  2HPT A;  4XN8 A;  3FX3 A;  3KED A;  3ZMZ A;  2ZB9 A;  3PQK A;  3LQR A;  1VQO I;  4XLH A;  1J7K A;  1TNS A;  2M8E A;  1YW8 A;  1HDD C;  1YIJ I;  2UV1 A;  3VPR A;  2CQN A;  2L5Q A;  4A2U A;  2XKO A;  3BR2 A;  3E7L A;  1VTN C;  2WA0 A;  5FLX Z;  3EUK L;  5M3M J;  4LIT A;  3ERE D;  2JUC A;  3V4G A;  3B7U X;  5EEG A;  4R5T A;  2D1H A;  4K5M A;  2JA2 A;  3I54 A;  4OIR F;  5JMW A;  1BR2 A;  1ZK8 A;  2QVO A;  1SFE A;  3PUB A;  3CJN A;  3CCS I;  3H5R A;  4M3G A;  4ZDO A;  3JSZ A;  2ZME A;  3BR3 A;  4P96 A;  4GO1 A;  1LVA A;  2M45 A;  5D4S A;  4UUS B;  3D1N I;  1EJ9 A;  1SG7 A;  3HTU A;  2WZF A;  2OBP A;  3U21 A;  5IT9 K;  5J8C A;  1SC5 A;  2BW3 B;  4XN4 A;  3WQS B;  5L3F A;  4CA0 A;  3FUN A;  2EA2 A;  1JUM A;  3F8C A;  3SZG A;  3JRB A;  2A5W A;  3P9C A;  3F6V A;  4M71 A;  2VKV A;  1AA7 A;  3AL0 B;  3AFH A;  3SYT A;  2IXS A;  2G7U A;  2OZU A;  2Y2Z A;  2VJ5 A;  2OF7 A;  3AG4 H;  4D9J A;  2LH9 A;  4UUV A;  1SAX A;  5L3E A;  4D5F A;  4BH9 A;  3BG7 A;  3F0C A;  2Z9O A;  1ENH A;  1GW6 A;  1UFM A;  3CMY A;  1AKH B;  1KU3 A;  2XAF A;  5D5V B;  4XRM A;  5FD5 A;  4GYI A;  3AU9 A;  1BIB A;  5ILU A;  5DUK A;  2FMY A;  4XMW A;  2J5O A;  3S3N A;  2AXT C;  1BW5 A;  4QPQ A;  1DGW Y;  2EFO A;  2XF6 A;  3HGY A;  4BXX J;  3KP4 A;  4CYD A;  4CH7 A;  4A6D A;  4I6Z A;  3T8V A;  4IRI A;  4RB1 A;  1OJL A;  2Y9Z A;  4UNO A;  2ID3 A;  4HPQ A;  4Y13 A;  3K4B A;  1FP2 A;  4ARF A;  2XPV A;  2X6X A;  2DK5 A;  2GBY A;  4ZYE A;  2YU3 A;  3OS2 A;  1MBK A;  3SEQ A;  2O03 A;  5DUL A;  2FD5 A;  2HOA A;  2X4H A;  3CZ6 A;  5JHU A;  4FLQ A;  3GTK J;  4LLL A;  1QHH D;  4HRI A;  1N25 A;  1TZL A;  2DW4 A;  9ANT A;  1V55 H;  3L9F A;  3CD6 I;  3FIS A;  1XD7 A;  1D1B A;  3I56 I;  1ONP A;  4IVN A;  2PJP A;  4A0X A;  2ICW G;  3DEU A;  3CUQ A;  3QYE A;  1A31 A;  2VPL A;  1FWZ A;  2BHY A;  3I64 A;  3OR2 C;  3EBG A;  4LFU A;  1KQ9 A;  2R93 J;  2L9R A;  3ANN A;  4Y15 A;  3RYP A;  5IYC J;  2ZKZ A;  1QBJ A;  3GO5 A;  4OOF A;  3S1R J;  4Z6Y A;  1PUE E;  3IKT A;  3F23 A;  3BPV A;  2COB A;  1A35 A;  4HNU A;  5JAZ A;  2E71 A;  4XOR A;  2H1K A;  2HVR A;  1BOB A;  2GWR A;  2WAF A;  3OV8 A;  3BTC A;  2CQX A;  2DYS H;  3TL4 X;  4AIC A; 
#chains in the Genus database with same CATH homology
 3ZQQ A;  2ZXH A;  3DLA A;  4BXF A;  4XKW A;  2IS1 A;  2W1O A;  1LVK A;  4KP7 A;  2OV7 A;  1X1B A;  1Z7L A;  1GLN A;  1QHG A;  5EV7 A;  2JUG A;  3QOE A;  4HG2 A;  2R7O A;  3RAS A;  3ZHY A;  4F3Q A;  4R5X A;  4NUB A;  4XMX A;  2KPM A;  3A06 A;  3LL7 A;  4BJT A;  4LG3 A;  4BL0 B;  3AU8 A;  2XPZ A;  1G59 A;  1MMD A;  4B48 A;  3FTS A;  4ZDP A;  4F91 B;  4PU2 A;  2F5V A;  1T95 A;  2X6W A;  3HG9 A;  4J01 A;  2VL8 A;  4PSW A;  2R7R A;  2WAD A;  3PJR A;  2XQ0 A;  3OS1 A;  3DQV C;  3FU6 A;  2BVL A;  1R6R A;  3B7S A;  4C2U A;  2DQ6 A;  4NQW B;  5TGT A;  4XN9 A;  4E4H A;  1P9Q C;  4ZYA A;  1G8X A;  4ZDL A;  3ZXS A;  2JD2 A;  4QIR A;  1LKX A;  1NG6 A;  3W3C A;  1WJC A;  1X4P A;  3ZRG A;  5JBI A;  1OR7 C;  4ZW3 A;  5KCM A;  2K5C A;  4QPO A;  2CFO A;  2ZSI B;  2Z2S B;  1UEL B;  2LY2 A;  2CS3 A;  2WY8 Q;  4MKT A;  3MKW B;  3VYR B;  3NWS A;  1T0F C;  2LG4 A;  2PL5 A;  3HKZ A;  3QOD A;  4Y6R A;  3PFY A;  4CCK A;  3FUD A;  2V7F A;  2VJI A;  2WY7 Q;  1N77 A;  2R7S A;  1D1C A;  2NOJ B;  3A1Y A;  2K9M A;  4IQJ A;  1MW3 A;  1TT0 A;  1MW7 A;  3DPU A;  4ANJ A;  1R0L A;  3ANM A;  3R0I A;  2I8D A;  2LY1 A;  2R4G A;  2MYS A;  4QPE A;  4ZQF A;  2MAO A;  4CCJ A;  2LRE A;  4KIS A;  3L2R A;  2ZFU A;  1T1S A;  4CCO A;  2VKD A;  3B34 A;  4IX7 A;  2JSP A;  2KQR A;  2W00 A;  2Y1E A;  5KHD A;  2JD1 A;  4XOP A;  4BQO A;  2A6T A;  2DCE A;  3OOU A;  4LIU A;  3CZL A;  4Y4R A;  2IS2 A;  1IRX A;  3OR1 C;  1JI8 A;  2W4S A;  3K4L A;  4BDZ A;  2O7G A;  5HOO A;  2WAE A;  3RC8 A;  2Y0S A;  4RMN A;  1T1R A;  4ZQT A;  2RRE A;  3TMO A;  4XM3 A;  3CMM A;  4U87 A;  4XOT A;  5HLT A;  4Q4E A;  4Y6P A;  1FMV A;  2WAQ A;  4YRV A;  3IAS 2;  1K6Y A;  2P0W A;  4RLQ A;  3DKY A;  4RLF A;  2RNG A;  3I3L A;  3ONQ A;  1X3Z A;  1Z3Y A;  4X0G A;  2GTQ A;  3S3M A;  3B7R L;  3J7A Y;  2BOL A;  4IQ4 A;  2GOM A;  4C9Y A;  2VJ8 A;  3Q44 A;  5JMP A;  2CMP A;  2KL4 A;  4FAS D;  2WB1 A;  3CP2 A;  4HEA 2;  3K10 A;  4XKB A;  3OYL A;  1DQU A;  1G5A A;  3BG6 A;  2AQE A;  4AYB A;  3MKZ A;  5FRM A;  2R7X A;  3H9Q A;  3K4C A;  4QHP A;  3H35 A;  2BW3 A;  1Z21 A;  2HQA A;  2IGN A;  1V5G A;  2RQQ A;  3EUH C;  4XNF A;  3K70 C;  1WJ5 A;  3S93 A;  3SEZ A;  4HST A;  2GOX B;  3D5S C;  3FBI B;  5CPR B;  4XMY A;  2A7O A;  3B2X A;  3B2P A;  3EBI A;  5FRO A;  4ZQE A;  3LSK A;  3BCA A;  4NC8 A;  3CP8 A;  1V5F A;  4PJM A;  4AVZ A;  3CHR A;  4XND A;  2IS4 A;  4BEH B;  1H19 A;  3DKX A;  3L2Q A;  2K3P A;  3AL0 C;  3FH7 A;  5JC1 A;  4GAA A;  2OC6 A;  4JND A;  2DQM A;  5CQE A;  2V26 A;  3K70 D;  4II2 A;  2VLA A;  4E7K A;  3K4M A;  4BE0 A;  1QU3 A;  4QME A;  3EPZ A;  3CJQ B;  3IUO A;  3IAM 2;  2IGM A;  4XLA A;  4CCM A;  3BLY A;  2Y1D A;  4K5L A;  2W82 A;  1MNE A;  3OYE A;  2M3A A;  3UER A;  3LFU A;  3FBN B;  4DGW B;  1MMN A;  1X4O A;  2MC4 A;  3DU6 A;  4OAY A;  2LBF A;  4BKX A;  4P5O A;  1H3L A;  3AUA A;  1OLT A;  3OMY A;  2XC7 A;  4BGD A;  1YX5 A;  3V42 A;  1BR1 A;  2KHM A;  1SAU A;  4CZC A;  3FH8 A;  3IP4 B;  2KP6 A;  1X19 A;  5LFA A;  4ZW5 A;  3HUG B;  3E0J B;  4R79 A;  2KDO A;  4F93 B;  3S32 A;  4ZTF A;  4B47 A;  3RSN A;  5FRN A;  3PSF A;  3ZHX A;  4E7S A;  3ZR8 X;  2VIX A;  4E7H A;  4CXF A;  4XO5 A;  1DGR M;  2L2O A;  2ZSH B;  4RM3 A;  2ZXI A;  2X6Y A;  4F55 A;  2R7Q A;  3DU5 A;  3HPH A;  2X1C A;  2E1M B;  2IGO A;  4C30 A;  3BCB A;  3KEY A;  3OYF A;  1X1A A;  4F92 B;  3H9G A;  3OYG A;  1Y6I A;  3MD2 A;  2M4G A;  2XF7 A;  3FU0 A;  4BE1 A;  3FUL A;  4K5P A;  1W36 C;  3S3O A;  3DEE A;  1WJD A;  3OYM A;  2XSJ C;  4IKF A;  2R72 A;  3FTY A;  2V9K A;  1WJE A;  4JOM A;  3FKJ A;  4FET A;  2E5N A;  2R59 A;  2VJJ A;  3K6G A;  4DJA A;  2QVW A;  3DWL E;  3ZCO A;  4C2T A;  1JVS A;  1ERD A;  2HNH A;  2DT6 A;  2X51 A;  4KIT B;  3AKZ A;  1W36 D;  1MMG A;  4PJL A;  3CJR B;  4II3 A;  2CW7 A;  2CUJ A;  4PSX A;  3MKY B;  3UNG C;  3OIQ A;  4RM2 A;  2VXZ A;  2QKL B;  1UG0 A;  2QJ1 A;  3T0Y A;  4E6K G;  4J3B A;  3QYB A;  5CQG A;  4XMZ A;  1KON A;  2CH0 A;  2CW8 A;  4ZTJ A;  2WZG A;  3C2H A;  4ZQH A;  3FUK A;  2Z16 A;  4XN3 A;  3OY9 A;  4ZJZ A;  2VJ4 A;  1PJR A;  2R70 A;  3RTR A;  4XQF A;  1ZEL A;  4XLF A;  3F9K A;  5KNL A;  4XL9 A;  3ANL A;  3OYK A;  5DYF A;  3CHP A;  3OIP A;  4FLR A;  2R7T A;  4MS6 A;  3CHQ A;  3FUJ A;  3FTW A;  3HC7 A;  4PW4 A;  3RPU D;  3A2K A;  4XO4 A;  4G6T B;  2KRH A;  4ZX5 A;  4PJJ A;  3DTI A;  2LOO A;  3VDX A;  4BQN A;  4DIQ A;  3UCQ A;  3G2B A;  4BQQ A;  3CES A;  4NQW A;  2E60 A;  2PJR B;  4FCA A;  4DBR A;  3EBH A;  2PUS A;  3JT1 A;  2UWM A;  2HPO A;  2PGG A;  2W7N A;  2MD0 A;  3HOS A;  4ZN6 A;  4PVB A;  1D0X A;  2L9N A;  2Z1D A;  3CF2 A;  1S9H A;  1WJF A;  2F4I A;  4AR9 A;  1D0Y A;  1DP3 A;  3L2U A;  3H5A A;  2L9S A;  2VB6 A;  2LYC A;  5JO0 A;  4Q4I A;  2Y1F A;  3ZGK A;  3M8J A;  3OYN A;  3Q43 A;  3OL4 A;  4ITV A;  4ZX4 A;  3A4C A;  3RCO A;  3OYH A;  2Q2E B;  1J09 A;  2CUZ A;  3OS0 A;  4U7B A;  3WQR A;  2K9L A;  2XAU A;  5HNH A;  3D5L A;  2Y1C A;  3VVM A;  1WFX A;  2AQF A;  2VQH A;  2ZXG A;  2X1D A;  2IS6 A;  1SQM A;  1LDK B;  3H5N A;  3QJX A;  4A03 A;  1RP3 A;  2O5R A;  3DPT A;  1X1D A;  2JCX A;  3L2W A;  4OOE A;  1MMA A;  2JD0 A;  2ELJ A;  3OYJ A;  3RQ4 A;  5DLL A;  3N05 A;  2L7K A;  3D5R C;  4KT6 A;  2JCV A;  3OYD A;  4LIV A;  3VWB A;  2M0M A;  4JQF A;  3VYS B;  1MW0 A;  2CV0 A;  3HXL A;  3VYU B;  3K4N A;  4PFP A;  3LSI A;  3VSL A;  5CKT A;  4E7I A;  4H4K C;  4CCL A;  2M7B A;  4B43 A;  4YEL A;  1HA8 A;  2KLO A;  2XDV A;  3KYL A;  3BC8 A;  4FLS A;  4N4N B;  4Y67 A;  4NC7 A;  4NNJ A;  1NG7 A;  2LC2 A;  4XLC A;  4XN7 A;  1VZ0 A;  4CCN A;  1X3W A;  4DPR A;  2HPM A;  2JVG A;  4DBQ A;  3HL2 A;  2VQC A;  3W2V A;  1V5E A;  1FMW A;  2HVQ A;  2DJI A;  1MND A;  4J00 A;  4QUO A;  2WBM A;  1JGI A;  3OYC A;  4BDY A;  3FTZ A;  1D1A A;  4N4O B;  1K5H A;  3FHE A;  4ZW6 A;  2WPG A;  2MAP A;  4RCV A;  4XO3 A;  3HOT A;  3UEQ A;  3LSH A;  4PK4 A;  3DTE A;  4XNA A;  1S46 A;  3CIA A;  2DOA A;  2FFL A;  1U0J A;  3CHS A;  1WJA A;  1Q0Q A;  3FUH A;  2VQL A;  2LRD A;  3MMY B;  2IGK A;  4PUS A;  4ZC3 A;  1D0Z A;  2JV7 A;  3GBG A;  2Y1G A;  4PFO A;  4AYS A;  3A14 A;  1YE9 A;  1E0E A;  3FUF A;  4Y3O A;  4K5N A;  4RSY A;  2HPT A;  2V4J C;  4XN8 A;  3KED A;  4BEH A;  4XMT A;  4XON A;  2DT7 B;  2M4K A;  4HNT A;  4XLH A;  3EUA A;  4BUP A;  4LUP A;  1MW1 A;  4F52 A;  4BJ5 C;  5JHF A;  2XF5 A;  4XKC A;  4XLE A;  1SFK A;  1UAA A;  3FH5 A;  4PJN A;  2UV1 A;  1ONO A;  2L5Q A;  3VYT B;  3PNV A;  2JCY A;  4ZX6 A;  2E5Z A;  2WA0 A;  3NWT A;  1OR7 A;  3EUK L;  1Z3X A;  3PL8 A;  2VQG A;  4LIT A;  3OL3 A;  3FTV A;  2CV2 A;  5BPP A;  4CUG A;  4XN5 A;  3FTU A;  3LMM A;  3DTK A;  3B7U X;  3PNT A;  4R5T A;  5JMW A;  4K5M A;  2JA2 A;  3ZHZ A;  1BR2 A;  2PMZ A;  3H9J A;  3PUB A;  1R0K A;  4XMV A;  1LFP A;  4K5O A;  2R7V A;  3H5R A;  3FUI A;  4E7Z A;  4ZDO A;  4Y33 A;  3OYB A;  3FUM A;  3U9W A;  2V1N A;  4OWR B;  3JSZ A;  4DOZ A;  4XNB A;  2V6E A;  2C5Z A;  3OYA A;  2HU9 A;  3CZE A;  1SG7 A;  2WZF A;  1WJB A;  4AR8 A;  3U21 A;  3K4K A;  1SC5 A;  2BW3 B;  3LSG A;  4BS9 A;  4XN4 A;  4CSW A;  1MVY A;  3WQS B;  2DXI A;  4CA0 A;  2XPY A;  3FUN A;  5JNL A;  4FLO A;  3SZG A;  3FUE A;  2A5W A;  4HSR A;  2CV1 A;  3ZI0 A;  3C2G A;  3QYF A;  2R7W A;  3M1C A;  3W2A A;  2EGH A;  4ZW7 A;  4BAC A;  1AA7 A;  3AL0 B;  3AFH A;  3PSI A;  3I9V 2;  2E1M C;  3OWT A;  3SYT A;  3W2W A;  1PYV A;  5HNF A;  2IXS A;  4GAE A;  2MFZ A;  3FHN A;  4XN1 A;  3WQQ A;  2JVH A;  2VJ5 A;  4D9J A;  3TBI A;  2M7A A;  2LH9 A;  4E7L A;  2HVS A;  1HS6 A;  4MLO A;  4R5V A;  2KMU A;  4XN2 A;  3K4J A;  1Y56 A;  3BG7 A;  2F6C A;  3B37 A;  4BJ6 C;  3L2V A;  3FU5 A;  2C82 A;  2QKM B;  1GW6 A;  4ZQG A;  4ZX3 A;  4AR1 A;  4AU7 A;  4IZZ A;  4YEJ A;  3AU9 A;  4XMW A;  4X2U A;  4BE2 A;  1BR4 A;  3S3N A;  2FUG 2;  2MAB A;  3PUU A;  4XN0 A;  4QPQ A;  3VSK A;  1DGW Y;  2LBF B;  1MW2 A;  4E7J A;  2XF6 A;  1YX3 A;  3S8P A;  2BVM A;  4CH7 A;  2VXD A;  3T8V A;  2UUZ A;  4B44 A;  2B61 A;  3IIE A;  1Q0L A;  4B3X A;  3PNY A;  4HPQ A;  3K4B A;  1ONN A;  4ARF A;  2X6X A;  2X1E A;  2VKH A;  3E1S A;  4KJZ A;  3OS2 A;  3SEQ A;  1X1C A;  3SDB A;  1ZS2 A;  3CHO A;  1N75 A;  2KZV A;  4P1W A;  1EA3 A;  3CZ6 A;  3H0D A;  5DUL A;  4FLQ A;  3LSM A;  1QHH D;  4HRI A;  2R7U A;  1TZL A;  2HDW A;  3FTX A;  2HPI A;  2RJI A;  3B3B A;  1D1B A;  4OAZ A;  1ONP A;  2PJR A;  3CZG A;  4EAT A;  4R7L A;  2OUM A;  4XKV A;  3QYE A;  2VAS A;  4ZW8 A;  3B7T A;  2VPL A;  3VVL A;  3UR3 C;  3OR2 C;  3HPG A;  1N78 A;  3EBG A;  2X85 A;  5FWQ A;  3OYI A;  1JG9 A;  3ANN A;  4Y6S A;  5AEN A;  4RVB A;  4BU2 A;  3FDY A;  4OOF A;  2HZD A;  2KRC A;  5HVQ C;  3CZK A;  5JAZ A;  4HNU A;  4D1Q A;  4GRI A;  4XOR A;  2HVR A;  1BOB A;  2WAF A;  4XR6 A;  1Q0H A;  3DPL C;  3FU3 A;  5LD2 C;  3TL4 X;  4XMU A;  3RC3 A;  3KX2 A;  4L2L A;  4AIC A;  2Q1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...