4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
molecule keywords Ribonuclease
molecule tags Hydrolase/dna/rna
source organism Thermovibrio ammonificans
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
3VQ6A 5KRSA 3OYLA 1ZBFA 3KK2A 1N5YA 5SWMA 4OLBA 4AHTA 4BE2A 2QXFA 3TAMA 5FROA 3TANA 1SKSA 1N6QA 1NVPA 1KY7A 3QNNA 2D0BA 1NKCA 1YTUA 3M8PA 4FVMA 4ID1A 2D0AA 4PWDA 2Z1IA 5EU7A 5T7BA 1BL3A 1VRUA 3LP1A 2FBXA 4FLYA 1U4BA 2HHVA 4OKJA 3VQ9A 2VWJA 1XI1A 3V1RA 2X74A 3LDSA 3CG7A 4DTUA 2P1JA 3NF8A 4KAZA 4Z4HA 3DOLA 1QHTA 1JXEA 1CLQA 1TAUA 1YVUA 4HCBA 3OY9A 1S9GA 1BHLA 3RMAA 3NH0A 4LH4A 4B8CA 4E7KA 4DSLA 1WSEA 3V9UA 2IDOA 3VQ7A 2BANA 4DSKA 1WSGA 3HK2A 1JKHA 2ZQBA 3VQBA 4CJFA 3T19A 1X9WA 1NJWA 1NK7A 2P5GA 4KTQA 1TKDA 3OC3C 1QNBA 5J2MA 4OKEA 4W5RA 4FZZA 1X9MA 4FJHA 2KTQA 4DMNA 1LV5A 3IAYA 3KJVA 1UWBA 4B9UA 1WN7A 1S6QA 4FW1A 4C8KA 3OYNA 1TKTA 2P51A 3MAQA 1LWFA 1S6PA 3B6OA 4MFBA 4Q0BA 2KFNA 1LW0A 1RT5A 1S5JA 3MEGA 1RT2A 4I9LA 2O4GA 4E89A 1SL0A 2O4IA 4FJNA 1C1BA 4DF8A 3QIPA 4F4KA 3LPUA 1Z25A 3L2WA 1R0AA 4WE1A 1FK9A 2X78A 1IO2A 3KKRA 4AHUA 3ZCMA 1KLNA 3M8RA 3O3HA 5KGXA 3MXMA 3S3MA 3QINA 2IV9A 2NUBA 1K6YA 3VQ5A 4AHCA 4CFAA 4ZHRA 4E7LA 1XHZA 3EY1A 2OPQA 3DM2A 4AILC 3S9HA 2GBZA 3OYKA 4E7JA 4B9TA 4E0DA 1NK6A 4NCAA 1U47A 1QN8A 5KGWA 1J53A 4QCLA 4F3TA 3MXJA 3ZSXA 2HNDA 1RTIA 1W9HA 5FDLA 3WNEA 2PY5A 4K8XA 4FK0A 3TAEA 2G30A 2DFFA 4DFMA 4J2EA 5IYDP 3EZ5A 1RTJA 4DU4A 2Z8UA 4FJLA 3PY8A 5IYBP 2HHWA 4DTNA 3NGYA 3PX4A 3ASMA 1I39A 1AISA 3DLGA 1D3UA 1ITGA 2FC0A 4KTZA 5CYQA 5K14A 4DTRA 4ICLA 3S3OA 3CFRA 4HTUA 2G8UA 4FZXC 1NK9A 1HJRA 3CFPA 1R4XA 3OVNA 3NHGA 1KSPA 2F8TA 3ZT2A 3DOKA 3QIOA 5J1EA 3V81A 3OYBA 3MXIA 1VOKA 2OPRA 4JS4A 1T7PA 3RR7A 3RWUA 2HVIA 4BWJA 4FK4A 1WAJA 4KFBA 3EYZA 3SYZA 4M45A 3ZT0A 2HHXA 1T8EA 4M41A 4OGEA 1HNIA 1WLJA 1ASWA 1D8YA 2XY5A 1GOBA 4FLWA 5DK5A 1CZ9A 2OPPA 3U3YA 3S3NA 4R5PA 2KFZA 1BI4B 3WNFA 4RODB 1FXXA 4KRFA 1HNVA 4E3SA 4YFUA 3ALYA 4HUGA 2YNGA 4DS4A 3BDPA 2I5JA 3QEPA 1KTQA 2ATQA 2VG6A 2IGIA 3OJSA 3V9SA 4QOZB 1UAXA 2DFHA 1KLMA 1JLCA 4MQ3A 4CEQA 3NH1A 4CJKA 3V6DA 4PQUA 5I42A 3H08A 1Z26A 1RTHA 4PA1A 4CF1A 4CK3A 3FFIA 1REVA 4DLEA 4E7IA 4KB1A 4RW4A 4CJ5A 1QN6A 3QLHA 4OPJA 1RDBA 4CHZA 4DTSA 4GW6A 3TAPA 1JLGA 3DRPA 1MP9A 1BCOA 2HNYA 4M3YA 2HHQA 4FJKA 1U04A 3QNOA 2D0CA 1CZBA 1RBRA 2G8WA 3O4NA 1IKYA 2G8HA 3HP6A 5HRSA 3ZSWA 3RMCA 4CJTA 2WONA 1BIZA 1ASVA 4DFKA 3TAQA 1VK0A 4M3UA 1QS4A 5FRNA 2Y1JA 2YKMA 1LAVA 2YNIA 1CXQA 3AVLA 1BIUA 4PUOA 3IRXA 2OYQA 4GMJB 1B9FA 1C0UA 4CCHA 4CHNA 4CFCA 1SL2A 4IFVA 1DTTA 3KLGA 4HUEA 3CM5A 4I9QA 4ELVA 1EXQA 1SUQA 3MEDA 3SUNA 4Y1CA 4FJ8A 1I3AA 1RM1A 2JGUA 3U3GA 1TVRA 3DLKA 3AVKA 4KKOA 1QSSA 4GVMA 1VSIA 4Z4FA 4Z0UA 1QTMA 4ELUA 2DY4A 4W5TA 1A5WA 4OPKA 1HMVA 2Z1HA 5CZ1A 1NH2A 1WAFA 4N47A 3RTVA 2BDPA 2HVHA 3SZ2A 1X9SA 4EP5A 3OYAA 4ELTA 4B9VA 2HHTA 1YTFA 3CQ8A 4B08A 3DLHA 5HBMA 4W5QA 3AV9A 4C8LA 4C8OA 4CJEA 3QEXA 1RTDA 5IYCP 4FLZA 1PCZA 1WSHA 3K5OA 3SV4A 1U49A 4FZYA 3QERA 2G8VA 4AH9A 2B5JA 3CM6A 1NJXA 4KHNA 1NKBA 1HRHA 3K5NA 3NDKA 4E7HA 1RCHA 4CE9A 3SQ4A 3HT3A 1QTSA 2YNHA 1WSFA 1D9FA 3LWLA 3L8BA 1F21A 3AA2A 4KO0A 1YT3A 2HHUA 1L3SA 1XWLA 4B9MA 1XHXA 3QETA 2VJ0A 4DQPA 1A5XA 3VQDA 2JLEA 3RMBA 4J2AA 3NCIA 3DMJA 1JLFA 2XRIA 4IFYA 4N76A 1VSHA 3K5LA 1NK4A 4M3WA 1ZBIA 1J5OA 4CJQA 4O55A 4LSLA 3KIOA 4C8NA 3KLEA 1BCMA 4OLAA 3TARA 4JRPA 3LP0A 1HQEA 3P83D 1U45A 3ZSVA 4HUFA 4H8KA 1JLQA 3TI0A 4F2RA 4KHSA 3CYMA 2GV9A 1NKEA 1JXBA 2OZSA 3AVNA 2A1RA 1C6VA 1C1CA 5KI6A 4F3OA 1JLEA 1JFIC 4DQRA 4C8MA 3NF6A 3OYJA 2ETJA 3A2FA 1EX4A 1BQNA 3AVMA 3DRRA 2RPIA 3DYAA 3HP9A 3HSTB 4CGIA 4CHOA 3KK3A 1VTOA 3C94A 4FW2A 1VOLB 4RW7A 2QKKA 3LP2A 3HVTA 4HHTA 1L5UA 3ZSQA 3O3GA 1Y97A 2FBVA 4DU1A 2HMIA 4IDKA 3SI6A 1J54A 2XO7A 4DSIA 3AA3A 4JLHA 1TL1A 1C0MA 5J2NA 3E01A 3OYDA 2ITGA 3V9WA 2BGGA 3AVAA 1TGOA 3MECA 4FM2A 4ID5A 2KZMA 3AO5A 3IS9A 4KPYA 1VTLE 3VQPA 3UIQA 3HO1A 4OJRA 4RW9A 1CXUA 1TKZA 3V9XA 2D5RA 1KYUA 1NK5A 3C95A 3ITHA 4Y1DA 3OYCA 4RG8A 3VN5A 3LALA 4EP4A 4E1NA 4FJIA 1IKWA 3SPYA 4DTXA 3PO4A 2X6NA 3M8QA 1X1PA 2MJ7A 4AHRA 1EP4A 4FM1A 3SUQA 5I3UA 4CERA 4DSEA 3AVCA 4LSNA 4Z4CA 2E6LA 3OYMA 3DLRA 3HPHA 3DRSA 3LPTA 4CEFA 4BDZA 4FCYA 4CEOA 4DTPA 4CF8A 1SKRA 4BE1A 3O4QA 1KFDA 5HRNA 3K2PA 3BGRA 4KV8A 1NK8A 4M3XA 2ZD1A 3OYFA 2OA8A 4RW8A 3NFAA 4CEAA 3KD5E 4KHQA 1RBTA 2PYJA 3AVHA 2DFEA 3AVFA 2R7YA 1QQCA 4FK2A 4M3ZA 3K57A 1S1TA 1MU2A 1KCFA 1RNHA 4DWIA 4KI4A 3THVA 3RRGA 2G8KA 1IKVA 1QTPA 4FLVA 4CGFA 3RRHA 3SUPA 3K5MA 3HL8A 4M3TA 1TK0A 3G0ZA 1TK5A 1L3TA 4WZSD 3NAEA 4CF0A 1XC9A 4CHPA 4CJ4A 1RDCA 4EZ9A 1C1AA 1S1VA 3VQ8A 4CJVA 4H4OA 3NGIA 4DTMA 4KB0A 1SV5A 2IV8A 1SL1A 3LP3A 4KTWA 2ZE2A 1QN9A 4CEEA 2IAJA 1KY6A 1FKPA 3ZT4A 3B6PA 3LZIA 4KREA 4CHYA 3SQ2A 1BQMA 3ZSYA 1QN5A 1RBSA 4BDYA 1UA1A 3P1GA 1HQUA 1B9KA 3HS8A 3ZSRA 4E1MA 4DLGA 4NYNA 1U48A 3V4IA 1QSYA 4BDPA 1FKOA 4W5OA 5J2PA 4N41A 1CDWA 1C9BB 3KD1E 4CJWA 4JRQA 1VSLA 4LY7A 4CECA 3WNGA 1B92A 3AVGA 4CEZA 1VSDA 2GUIA 3I0RA 3RMDA 4CIEA 1TAQA 3L2RA 4FXDA 3AA5X 4DFPA 2YV0X 5DMRA 3JYTA 1TV6A 3AO4A 4AHSA 1NOYA 4TSXA 3L2VA 4CHQA 3F73A 2QKBA 4I2PA 1D9DA 3C6UA 4BACA 1L3UA 1KYFA 4FJ5A 3AVIA 3LANA 3D0PA 4QAGA 4J2DA 3SQ0A 1ZBHA 2BE2A 4DF4A 2LSNA 3JSMA 2AJQA 1E42A 2XY8A 3OS1A 4ROEB 4CGDA 4B0AA 3HXMA 4I7FA 5JS2A 2E4LA 3KKSA 3DLBA 3EIKA 1S1UA 2A1SA 3AVBA 3NBPA 3IG1A 3OYGA 5FRMA 1ZBUA 5HRRA 3K59A 3NH2A 4AHVA 1LAWA 3V9ZA 4E19A 5HRPA 1HYSA 3OYEA 1S1WA 1VSMA 5C42A 3I0SA 1QN7A 3QO9A 4DTJA 2G8FA 1WSJA 4CGHA 1JLBA 1PZDA 1JL2A 4G1QA 4YNQA 4JS5A 4DU3A 1ZBLA 2RN2A 3LAKA 1IH7A 4XIUA 3RR8A 3CFOA 3VQQA 4CIFA 2FBTA 2OZMA 1LW2A 3AO2A 2B6AA 2RF2A 1NJZA 4B3OA 2VG7A 3G10A 2IOCA 1S1XA 3SPZA 1HPZA 2YKNA 3T1AA 5HROA 3QEVA 3SQ1A 1RT6A 1TL3A 1BGXT 4FJ9A 1JLAA 1QN4A 1G15A 1QE1A 4O5BA 4N56A 4Z4EA 1KRPA 4OVLA 4I2QA 4FJJA 1RDAA 4FLUA 3QEIA 1QNCA 3OYHA 3HM9A 2EHGA 3QESA 4KHWA 1TBAB 5CYMA 3V1QA 1QSLA 2W42A 4BWMA 4FLXA 2X6SA 3KLHA 2G8IA 3KLFA 1WNSA 3L2UA 2IC3A 1BISA 3KLIA 3PX6A 2F8SA 1RT1A 1GOCA 3VQEA 3MEEA 3WNHA 1YTAA 3AO1A 3DLEA 4B8AB 4CESA 1W80A 2Z1GA 3O3FA 3ZSZA 1DTQA 3OS0A 3HS9A 5C25A 5E41A 3OS2A 4L8RB 4NCGA 1VSFA 4Z4IA 4H4MA 4KI6A 4CK2A 4LD0A 3OCIA 4IG0A 3KK1A 2HHSA 1J9AA 3TAFA 1RILA 3SCXA 3LZJA 1RT4A 2Q3SA 4HVJA 1T05A 2PYLA 1Q9XA 4FJXA 4KHYA 4DSJA 3F9KA 1SKWA 4KHUA 4PY5A 3VQ4A 1KYDA 1GOAA 4CF9A 4DS5A 4Z4GA 2KW4A 1UA0A 5SZTA 2HB5A 3VA3A 4CFBA 1L3VA 2EX3A 1LWEA 2YNFA 1D5AA 3VQAA 3U6FA 2VWKA 2YHAA 3OYIA 4O44A 4NCBA 1RT7A 4FJ7A 3ULDA 4IKFA 1BI4A 4CJRA 3HPOA 3AA4A 3NF9A 5CZ2A 3ISNC 3NGZA 3SNNA 1ZYQA 3PX0A 3D45A 1KFSA 1S9EA 4CIGA 3LAMA 4LH5A 1VSJA 3AO3A 1TK8A 1LWCA 4CFDA 2Y1IA 4EZ6A 1HYVA 4UQGA 2XY7A 5KTQA 2FBYA 3QEWA 1RBUA 5J2QA 4FJMA 4CJLA 2PZSA 5HP1A 1JL1A 3PUFA 4ROCB 4DSFA 1EKEA 4CJSA 1QN3A 3LWMA 3NE6A 4B9SA 2QK9A 5JS1A 1VRTA 1EETA 1HYZA 3L3VA 3ZSOA 4FM0A 4B9LA 4O0IA 5D3GA 3AVJA 1RBVA 1WSIA 3HPGA 3L2QA 1ASUA 1NGMA 4CEBA 3PV8A 1IG9A 4F2SA 1Q8IA 4OGCA 4RW6A 4ZTJA 2KZZA 3OJUA 2HNZA 3DI6A 1KVAA 4FLTA 1IKXA 4M3RA 4IBNA 3SV3A 3TWHA 2WOMA 4Q5VA 3C6TA 2KQ2A 2F96A 1NOZA 4W5NA 1W0HA 4CJ3A 4M42A 4DFJA 3T3FA 4DQIA 1TKXA 4DQSA 1KVCA 2B4JA 3P5JA 4NYFA 1NK0A 3HJFA 1YTBA 2IS3A 4O4GA 4BE0A 3M8SA 3KTQA 3VA0A 4DG1A 3HVRA 3PO5A 2YHBA 4CF2A 2XHBA 1TGHA 2P5OA 4FYDA 2HW3A 2Z1JA 3ZT3A 4CEDA 3K58A 1RT3A 1QNAA 4CK1A 3HYFA 4F8RA 1O1WA 1A5VA 1VSEA 3VQCA 4CJUA 1TBPA 3TABA 4OKKA 5C24A 4CGJA 2XY6A 1T03A 1Q9YA 4ZTFA 2E6MA 4J2BA 5HLFA 1UOCA 3V1OA 4IG3A 1QNEA 4CJPA 4DQQA 4HCCA 4K8ZA 5CY4A 3SUOA 1NJYA 2OPSA 3ZT1A 1C0TA 2RKIA 3TAGA 1DLOA 2VG5A 1RDDA 3H1ZA 3SJJA 1B9DA 4O0JA 1KVBA 3TR8A 4B9NA 4CGGA 1VSKA 4N5SA 3I8DA 4DTOA 4FJGA 2DTUA 5KRTA 3L3UA 3NF7A
chains in the Genus database with same CATH superfamily
2HBMA 4AHTA 3EL2A 3TTDA 1SKSA 1N6QA 1K8AO 3WQUA 1MA9B 4X66K 4ID1A 3OLPA 4PWDA 1YQMA 1U4BA 2FBXA 3VQ9A 2VWJA 4KAZA 2P1JA 4WFBL 3DOLA 1YVUA 5EX5A 1S9GA 3A5OC 3RMAA 4B8CA 4BRQA 1VQ4N 4Q11A 1VHXA 4DSKA 3VQBA 1X9WA 4KH4A 3H46O 1NK7A 4KTQA 2QRCA 1C4GA 2O8BB 3OC3C 1QNBA 5J2MA 4FJHA 4YOUA 5KPZA 3IAYA 3CCRN 3RPJA 4FW1A 2P51A 3B6OA 4MFBA 1WOQA 4DKWA 1RT5A 2E5LK 1BOTO 3O08A 1C1BA 3W0LA 4CBWA 3QFPA 3LPUA 4WE1A 4IO8A 3ZCMA 1KLNA 3S3MA 3QINA 4AHCA 1YQLA 4CFAA 2JWLA 4AILC 4JKEA 4E7JA 1U47A 1QN8A 3MXJA 1RTIA 4DV0K 4FK0A 2G30A 4BQZA 3DWLA 4FJLA 2Z8UA 4FWPA 3PX4A 1U6ZA 1T6AA 2E88A 3DLGA 1D3UA 4KTZA 2FC0A 2G8UA 4HTUA 3CFPA 1R4XA 2YH5A 5CE3A 4DV3K 4IEEA 5J1EA 4X64K 3V81A 3MXIA 3DAWA 4JS4A 1TYQB 4BWJA 3ID6A 4FOEA 4KFBA 5M1PA 1WLJA 4I6MB 3O80A 2QWQA 4LF6K 1HNVA 3R6MA 4YFUA 3ALYA 3BDPA 3ULEB 1UT4A 2NOHA 3QEPA 3AAQA 2IGIA 3V9SA 4MQ3A 4CEQA 3NH1A 4QS8A 1N36K 3H08A 4PA1A 3FFIA 4RW4A 4OPJA 1RDBA 4CHZA 4DTSA 4PKIA 4KH5A 5KQDA 2HNYA 2NRTA 3PSFA 3QNOA 5TKYA 1J3MA 4JD2A 5TKWA 2NWVA 3RMCA 4CJTA 3E9PA 3R8EA 2Y8LA 1K8KA 1VK0A 2H5AX 5F2RA 2Y1JA 3MN6A 1LAVA 1CXQA 4PUOA 1BIUA 4GMJB 4FWOA 4CFCA 1SL2A 1DTTA 3MEDA 3AGRA 4GVMA 4JI2K 4JKGB 1X9SA 3SAHA 1J5EK 3IFRA 4ELTA 2ZJRL 4IXCA 1BU6O 4AQYK 5HBMA 4C8OA 3SV4A 1U49A 2G8VA 2B5JA 3ID8A 4CZGA 3NVKA 4KHNA 1HRHA 1RGIA 3D7EO 3NDKA 2HBKA 3SQ4A 3CWTA 3HT3A 1QTSA 2YHWA 1WSFA 1D9FA 1F21A 2HHUA 4DR2K 1L3SA 2I7NA 1XHXA 2VJ0A 2XRIA 1MDUB 2W6LA 3LL3A 3H3NO 3DPTA 2GEMA 1BDGA 3KLEA 4HTLA 3LP0A 4KHSA 4HUFA 1JXBA 3AVNA 5AQTA 1C6VA 1C1CA 5EOYA 2A1RA 3AVMA 4CGIA 3BUZB 3PX0A 4XH5A 3BZKA 3M1FA 1E4GT 4RW7A 1DKGD 1RDUA 3HVTA 3LP2A 4MDAA 3VEWA 1UT7A 3SI6A 4M7YA 2A3ZA 5ADXH 3CCLN 3WXIA 3NMUA 4JI4K 4BGBA 3OYDA 3CCVN 5DM7L 4DHYA 5LJWA 3AVAA 1TGOA 3MECA 5KPTA 4FM2A 1CXUA 1DGKN 3C95A 3ITHA 4KH6A 4FJIA 4E1NA 1IKWA 1YJNN 2X6NA 5FLXO 2MJ7A 4AHRA 1EP4A 2P9SB 4LSNA 3OYMA 3VTHA 4LFAK 1CLQA 1K35A 4KV8A 2ZD1A 3OYFA 3KD5E 5EXWA 4MDBA 5BPMA 2DFEA 3AVFA 2R7YA 1S1TA 1EQYA 1XSZA 3L6QA 2QWLA 3RRHA 5EY4A 2V8QA 1YXQA 2IVPA 2P9LA 1TK5A 3NAEA 1M3QA 2E2PA 3VQ8A 4H4OA 3ZETA 2V9JA 1TUYA 5BPLA 2ZE2A 4C1NK 5CR4A 2IAJA 1KY6A 1Q7YO 1GLLO 2D4WA 1E3MA 3P1GA 2P9PA 2WBNA 4E1MA 3A5MC 4CFFA 1QSYA 1FKOA 3DXMB 3HRGA 4JRQA 1NGIA 4D7RA 3SAGA 4LY7A 3VESA 1B92A 3CF5L 4YORA 3RMDA 4CIEA 3L2RA 2DKAA 2QLVA 1HX1A 3B8AX 4AHSA 3L2VA 1YIJN 2QKBA 1P5DX 3WUHA 1L3UA 1GLJO 1KYFA 4FJ5A 3DXKB 1T6CA 3CI5A 4IFEA 2UUBK 1E42A 3OS1A 4B0AA 4Z94A 3HXMA 4I7FA 5JS2A 2O8BA 3EIKA 1KXPA 4IJAA 3OYGA 1FW6A 1ZBUA 1PVSA 4DR3K 4IZ9A 4E19A 1BWFO 5FPDA 3QBWA 1VSMA 3E9OA 4DTJA 1QN7A 3LDOA 4YHHK 4CGHA 1TUOA 2NLVA 3OH6A 5AZIA 2VGNA 4YNQA 1ZBLA 4DR4K 3LAKA 3C7NB 1IH7A 2OZMA 4D7QA 3MN9A 3SPZA 1S1XA 2FLOA 2YKNA 3T1AA 3QEVA 3SQ1A 1TL3A 3CPWM 1LCUA 4EAHD 3CJBA 1G15A 4FJJA 4BJUA 1ZC6A 1KFIA 3QICA 2O3OA 1QSLA 2W42A 4BWMA 5BN8A 4X62K 2X6SA 3KLHA 3CCQN 4GNIA 2CGJA 3L2UA 5JMVA 3THYA 3KLIA 4GV3A 3H6EA 1R59O 3WNHA 1W80A 5C12A 1DEJA 4CVNE 4L8RB 3KK1A 4CZHA 3TAFA 1RILA 3SCXA 1T05A 2PYLA 2A6AA 3CVSA 4EFHA 4KHUA 1O13A 3SNSA 1YJ9N 4R79A 5SZTA 1TYQA 4CFBA 2YNFA 4I8OA 1DIZA 4K25A 3J8AA 1BA1A 4YY3K 4I6MA 1WBBA 3CJ9A 3VGLA 5AQWA 1FN7A 3NGZA 3SNNA 3C65A 1KFSA 3CJCA 1S9EA 3ULEA 3OTOK 3BZCA 4CFDA 4CZIA 1RBUA 5J2QA 4YDUC 4FVUA 4DV4K 5AQHA 3VF6A 5BMNA 3LWMA 1VRTA 3L3VA 3ZSOA 4PKGA 1IG9A 5BRHA 3FR0A 4RW6A 4ZTJA 3DI6A 3GL1A 1IBLK 1IKXA 4M3RA 4PL7A 4IBNA 3VF4A 3SV3A 4LF8K 1HKGA 4JHDB 5LJVA 4CZLA 2NOIA 4BRCA 1NOZA 1QZ5A 4CJ3A 4W5NA 4M42A 4DFJA 5AQNA 3T3FA 4NYFA 3HJFA 4O4GA 4GV6A 4BE0A 4DG1A 3PO5A 2F4VK 3O6WA 1TGHA 3K58A 3UE5A 2QW9A 5C15A 4CJUA 3TABA 4JKGA 1TBPA 1T6DA 4OKKA 4CGJA 2XY6A 1T03A 2QWMA 4ZTFA 5GIOA 2GWJA 1N3CA 1UOCA 3ATUA 4IG3A 4DQQA 4JN4A 5CY4A 1NJYA 2OPSA 1C0TA 2OTJN 1DLOA 1B9DA 4O0JA 3TR8A 4V19S 4FJGA 4L3QA 3L3UA 3D2FB 3NF7A 3TU5A 3KK2A 4WQ4C 2YHYA 1N5YA 1NGAA 4BE2A 2QXFA 5FROA 4BREA 4DUZK 1NKCA 3ZEUB 5FPNA 1ATSA 5EU7A 1BL3A 3LP1A 4JK8A 1LWYA 1XI1A 2NNWA 4DTUA 2X74A 3CG7A 3OSTA 1QHTA 1JXEA 4MLEA 1TAUA 4HCBA 5AQJA 3PLAA 4DSLA 1WSEA 4QS9A 2BANA 1HKBA 3HK2A 5I9EB 3T19A 2ASMA 5C2DA 4IOAL 4W5RA 1X9MA 2KTQA 4NXMK 1LV5A 3KJVA 1S6QA 4Q0BA 3MAQA 1RFQA 3TSQA 1VQ6N 3C04A 1S5JA 1LOTB 4E89A 1I94K 3HBTA 4FJNA 4DF8A 3ENOA 3F5TA 3QIPA 1Z25A 2HF3A 1FK9A 3KKRA 4AHUA 2V7YA 5KGXA 3MXMA 4DV2K 3VQ5A 4ZHRA 4E7LA 3FZLA 3EY1A 1NK6A 4QCLA 4K42A 5HOOA 4F3TA 2DKCA 1W9HA 2P9SA 3TAEA 3CXCM 4J2EA 4AF1A 1RTJA 5IYBP 2GELA 4KBOA 3NGYA 3ASMA 3CCMN 1AISA 5AQGA 5CYQA 3S3OA 4JKHA 3CFRA 3J7ZO 3DOKA 3QIOA 2ASPA 3RWUA 2HVIA 4FK4A 4LC9B 3ZT0A 4U67L 1ATRA 1HNIA 4DR5K 1CZ9A 2OPPA 3QB0A 4GVEA 4CW7B 4R5PA 4E1JA 4RODB 4KRFA 4B3TK 3EE8A 5IT9O 4FL9A 4CZMA 4B1VA 2BUPA 2ATQA 4OPAA 3WEEB 1UAXA 1KLMA 4CJKA 3V6DA 3R9PA 4KB1A 1REVA 4CJ5A 1QN6A 3DXMA 2QA4N 3D2EB 1JLGA 4BRNA 4DCHA 1BCOA 4FWQA 3FE1A 1HJOA 2G8WA 3O4NA 1VQLN 2WONA 1BIZA 1ASVA 1QHAA 4WQ5A 4RWTA 1QS4A 5FRNA 4A57A 2ZGZA 2UXBK 1QQNA 5F0XA 3AVLA 3CVTA 3O4WA 3IRXA 1X9JA 1OH5A 1B9FA 4CHNA 3DXKA 4HUEA 4I9QA 3CM5A 3P4IA 3KVGA 3OHRA 4A62A 3SUNA 3I0WA 1I3AA 3O8MA 1TVRA 1QSSA 1C0FA 2E1ZA 4CBXA 4Z4FA 1MPGA 4DV7K 1OH6A 1HMVA 5CZ1A 1NH2A 4N47A 3SZ2A 5KQ8A 4EP5A 2JPIA 1WJWA 1YTFA 3RSEB 4B08A 3DLHA 3E66A 3DJCA 3C7NA 3AV9A 2PBDA 3O9RA 4CJEA 1RTDA 3FGUA 4O8UA 3KK7A 3QERA 4FZYA 1NJIO 2YJFA 1NJXA 4E7HA 1RCHA 4JEPA 3U9ZA 3SAFA 1XNRK 5JLHA 1YT3A 1XWLA 3QETA 3CWAA 3UB5A 1A5XA 2JLEA 3RMBA 4J2AA 3NCIA 4GY2B 1JLFA 2FGTA 3EKUA 5LMNK 4N76A 3P39A 3K5LA 4M3WA 2NOEA 1J5OA 4CJQA 3TARA 4J8FA 1U45A 3ZSVA 1JLQA 3EN9A 3VEZA 4F2RA 2GV9A 4ISEA 2OZSA 4F3OA 1JLEA 4C8MA 5J2PA 2ETJA 5JS1A 4CHOA 3KK3A 2RPIA 3H45C 4MO5A 4FW2A 4A61A 1VQ5N 3O9TA 4HHTA 2IVOA 2YA3A 3G4SN 4DU1A 3NVMA 3ZX3A 2CGKA 1J54A 3AA3A 3K9KA 3V9WA 1WQAA 2BGGA 3BF1A 3AO5A 3IS9A 1VTLE 2HOEA 4WF9L 3HOSA 3UIQA 4RW9A 1NK5A 3V9XA 2D5RA 1XQSC 2GWKA 4YOVA 1XMOK 1RDWX 4JKFA 4LF4K 2QM1A 4DTXA 3PO4A 4F9OA 3NA5A 3R1XA 5HL7L 3TSPA 1NMNA 4CERA 2EHBD 2P9UB 3T1YK 3DLRA 3HPHA 5AR0A 3U8XA 1QVGM 3RR7A 4Z4GA 5FPMA 1SKRA 3K2PA 5JN5A 4JHDA 2OA8A 4CEAA 3SBGA 1RBTA 4U7BA 4O8KA 1QQCA 5AQYA 3OSEA 3K57A 1MU2A 4B9QA 1KCFA 2KKZA 3HM8A 4KI4A 3THVA 2I7PA 1V4SA 3P38A 1GLBG 4M3TA 3CMEN 3HTVA 4IO9L 1OH8A 4CHPA 4YOWA 4CJ4A 4EZ9A 1C1AA 1S1VA 1VQNN 5AQPA 1LWVA 3CCEN 2IV8A 3EEQA 3LP3A 3LDLA 4CEEA 4B1ZA 2FSJA 3K9JA 3ZSYA 4BVPA 2GUPA 3MWTA 1N39A 3HS8A 4DLGA 3AGKA 3ATVA 1K73O 4CJWA 3D2FA 4H0PA 1VSLA 5M1OA 4KHPK 3AVGA 4CEZA 1VSDA 3OH9A 3I0RA 1GLCG 4FPBA 4FXDA 3ZEUA 3VETA 3QFUA 2YV0X 5DMRA 1TV6A 2QWNA 1LXTA 1YJWN 1OVQA 4TSXA 2QEXN 1JCFA 4CHQA 1JJ2M 1HR0K 3O9SA 3HOTA 2HZSA 4RTFD 4BY9C 1HNWK 3WQTA 4J2DA 3SQ0A 4LF9K 2P9NB 4DF4A 2Q1NA 1VQ9N 4ROEB 4EAGA 3O1BA 3FZKA 2IVNA 3KKSA 5LL6Z 1NGGA 1S1UA 3NBPA 3K59A 3NH2A 1LAWA 5HRPA 3L0QA 1S1WA 3OYEA 3EE9A 3I0SA 1JLBA 1EWQA 1GLDG 4G1QA 3RR8A 3VQQA 2FBTA 1N34K 5JVGL 1SAZA 5AQKA 2RF2A 3G10A 2IOCA 1HPZA 2A5XA 4IWVA 1BGXT 1JLAA 3FZMA 2I5WA 4O5BA 1HUXA 2ZJPL 4I2QA 4DV6K 3QEIA 2KHOA 1ZXOA 1TBAB 4NO7A 2G8IA 3O1WA 2UXDK 1M5Q1 1BISA 1Q82O 4B8AB 3QEWA 4CESA 4KPYA 4MLHA 3DLEA 3RSMA 3ZSZA 1H1VA 2AP1A 5C25A 4H4MA 3T69A 4KI6A 4LD0A 2HHSA 1J9AA 3CWUA 3CCJN 4CD3A 1Q9XA 1YITN 4DSJA 5F9CA 5C2FA 1SKWA 3M3ZA 3TDHA 2V52B 4DS5A 5AQXA 3G71N 2KW4A 1GLEG 2P9KB 1LWEA 4XH4A 5LY3A 2F7LA 2CGLA 1Q9UA 4PL8A 3U6FA 4ILJA 3OYIA 4NCBA 4IKFA 5A2QO 3AA4A 5CZ2A 3ISNC 2W40A 4XH1A 5BRDA 1HLUA 3LAMA 4LH5A 1TK8A 3SBTA 2XY7A 5KTQA 2FBYA 3WEEA 2WTUA 3CMAN 1IG8A 4CJLA 2NOFA 3TSUA 5AQOA 4DSFA 5AQUA 2RE2A 3NE6A 2QK9A 4EJZA 1EETA 3D2EA 5GAGP 3MN5A 4GKJK 4B9LA 4O0IA 1RBVA 1YQKA 1NGMA 4CEBA 3F2KA 2QRDA 5JVHL 2KZZA 1KVAA 4NLBA 3SK3A 4DV5K 2F96A 2NRHA 5AQLA 3LM9A 1TKXA 2LAEA 2B4JA 4WFNL 1NGDA 4BRGA 2O8DB 4UY8O 3A5NC 1NK0A 4FPAA 4K0KK 3VA0A 2YHBA 4CF2A 4JKDA 2HW3A 4CEDA 2E2QA 4HWIA 1QNAA 3VPZA 3HYFA 2YI1A 4BRKA 1M1KO 3MX2A 5HLFA 4WYBA 1T44A 4HCCA 4K8ZA 3LDNA 3SUOA 3RSEA 3ZT1A 2QR1A 1ESVA 2HZMA 5GADP 1KVBA 3K0SA 2DTUA 1NM1A 4DTOA 3CQYA 5MLCQ 5BREA 4BC3A 3VQ6A 4FWRA 1PCMX 1ZBFA 3TAMA 3TANA 1ILYA 2D0BA 1YTUA 3CERA 3M8PA 2P9IB 2D0AA 5AQIA 5T7BA 2AJQA 3PSIA 3UW2A 1VRUA 4AM7A 2HHVA 2H3GX 2YHXA 4OKJA 3CC2N 3Q7BA 3V1RA 4DV1K 4Z4HA 3IH7A 3OA9A 2AA4A 1S3XA 2FF3B 5M1FA 1NGJA 2ZJQL 4OKEA 3L4IA 1E4FT 4B9UA 4EHTA 3OYNA 1TKTA 4C8KA 1LW0A 1RT2A 1KD1O 3TPQA 4I9LA 1SL0A 2O4IA 2F9TA 3UKUB 4F4KA 1WB9A 5E26A 2Q97A 1IO2A 5F1XA 3M8RA 3M5RA 3O3HA 4DQ8A 2NUBA 1K6YA 5EVZA 2OPQA 3DM2A 2GBZA 4B9TA 5KGWA 1J53A 2NRRA 2NOLA 1YAGA 3ZSXA 2HNDA 1NU0A 5FDLA 2PY5A 4K8XA 3CETA 4JI8K 3RVCA 2P9UA 5CHIA 1HPMA 5IYDP 4DU4A 1S22A 2YX6A 5K14A 3ENHA 4ICLA 4FZXC 1KSPA 3OYBA 1VOKA 2OPRA 1W2BM 1YHQN 1WAJA 2Q0UA 4BGAA 4M45A 3UKRB 2ASOA 4M63C 5GAEP 4OGEA 3BF3A 2PAVA 5DK5A 1V5SA 4FLWA 3U3YA 3S3NA 3I8BA 2KFZA 1BI4B 1FXXA 3KRMA 4YOYA 4DS4A 2I5JA 1Z6RA 2Q36A 1JLCA 5I42A 4CF1A 4CK3A 4DLEA 3VGKA 4GW6A 4M3YA 2HHQA 2D0CA 1CZBA 2MZ8A 1RBRA 2BTFA 1IKYA 2G8HA 5HRSA 1IBMK 1QZ6A 3ZSWA 5IWAK 3T7ZA 3KTUA 1XMQK 3DLLL 4M3UA 2A42A 2YNIA 3ENBA 3J81O 2OYQA 1C0UA 4CCHA 3AARA 4YOTA 3KLGA 2NRXA 4JNEA 2DKDA 5C0YA 1EXQA 4Y1CA 2E8AA 4B1WB 3E9LA 3U3GA 3DLKA 4BR0A 3AVKA 4KKOA 2JHJA 2NOBA 4Z0UA 1QTMA 4ELUA 4EAIA 1A5WA 2QWOA 4B3RK 2Z1HA 2ZM6K 2BDPA 4DR1K 2A41A 5KPRA 3OGDA 3TTFA 4B9VA 2HKPA 2NLXA 4DR6K 4W5QA 5AFUA 4GV9A 3KHYA 1PCZA 1WSHA 4AH9A 4JI0K 3CM6A 5BR9A 4QS7A 3IDHA 2QTDA 1NKBA 3ENCA 5AZJB 4H0TB 4BQLA 3LWLA 3L8BA 3AA2A 1NG9A 3VENA 4B9MA 2VGMA 1X3NA 1NGBA 3VQDA 5JLFA 3DMJA 1N33K 2HHHK 1VSHA 4G9ZA 1ZBIA 4LSLA 3KIOA 4OLAA 1BCMA 4JRPA 3P83D 3MDQA 2A40A 1NKEA 2KLAA 1IBKK 2NVMA 3G25A 3NF6A 3OYJA 3HSTB 3EZ5A 1EX4A 1BQNA 3DRRA 3HP9A 2NOZA 3S41A 1VOLB 2P9KA 1L5UA 1BUPA 3ZSQA 2IIRA 3O3GA 4H0XB 4IDKA 2XO7A 4DSIA 4JLHA 3J7YP 1C0MA 4PHTX 3E01A 2ITGA 3VEXA 4M7XA 4ID5A 2V51B 1KFQA 3VQPA 3HO1A 4OJRA 3CC4N 1TKZA 4NLCA 1VKLA 4Y1DA 4A2AA 3OYCA 4RG8A 1SS6A 3LALA 4K41A 4EP4A 3BP8A 3H3OB 3M8QA 4FM1A 4BRLA 5I3UA 1X3MA 4DSEA 3AVCA 4Z4CA 1D8YA 3LPTA 3DRSA 4CEFA 4DTPA 4CF8A 4BE1A 5HRNA 1KFDA 4WX8A 4M3XA 3D6RA 3VEVA 4RW8A 3NFAA 4KHQA 1Z05A 1IV0A 4JK7A 3CJ1A 2DPNA 4BR2A 3MMVA 1NLVA 3AVHA 2PYJA 4ILHA 4M3ZA 2OOXA 3ZX2A 5AQVA 4DWIA 2O8DA 3A0IX 2G8KA 1IKVA 2O8CB 4FLVA 4CGFA 1Q18A 3K5MA 3G0ZA 1L3TA 2JOIA 4WZSD 4YDUA 1NMDA 1RDCA 2CH5A 4CJVA 4OPHA 3NGIA 4CI6A 3CQXA 1YQRA 4KTWA 1IJJA 4EIAA 1QN9A 4FWNA 4IL8A 1YI2N 3B6PA 4CHYA 2GX9A 4ISFA 1UA1A 3PIPL 1HQUA 1B9KA 3ZSRA 3P31A 4NYNA 3V4IA 3KD1E 4CZEA 4H5WA 4H5TA 3WNGA 4A59A 2VQEK 4DFPA 1Y64A 2P9IA 3AO4A 1QQMA 2EWSA 4IDHA 3F73A 4I2PA 1KAXA 3AVIA 3D0PA 1Q86O 1ZBHA 3Q7CA 1HKCA 3WXLA 3JSMA 3TTCA 5AQSA 1NGCA 2UYTA 3LDQA 4OO1J 4JK9A 2E4LA 3DLBA 3DPUA 2A1SA 3AVBA 3IG1A 1QQOA 4AHVA 2Z0FA 3JS6A 3BEXA 4WQ4A 2G8FA 3MCPA 3QO9A 3GDQA 2HBLA 1JL2A 4NB4A 1JCEA 3CFOA 4CIFA 3UKUA 4BRDA 1NJZA 2FF6A 1U2VB 5HROA 1RT6A 5M1NA 4FJ9A 3F10A 3VEYA 3OSMA 4Z4EA 4BG8A 4N56A 1EO1A 4BROA 4BRIA 4FLUA 1VQ8N 1QNCA 4KHWA 3LM2A 4FSVA 1K9MO 4DULA 2Y8QA 4NXNK 1WNSA 5AZIB 3CW7A 2IC3A 2ITMA 3PX6A 1EWRA 1RT1A 3VOVA 3VQEA 4A2BA 4MRQA 1YTAA 4A5BA 3O3FA 3SPYA 3OS0A 3I3WA 1DTQA 3OS2A 3HS9A 5E41A 1NGHA 2Q31A 4Z4IA 3CJAA 5AQZA 4CK2A 3OCIA 1VQON 1RT4A 4HVJA 4KHYA 4CZJA 3T4NA 3VQ4A 2W6KA 1KYDA 4CF9A 3SJHA 1L3VA 3O9UA 3VA3A 2VWBA 2EX3A 1J6ZA 3UKRA 5GINA 2VWKA 1VQMN 4FJ7A 3THYB 2UU9K 3ULDA 1HU0A 1BI4A 4CZKA 1EBMA 3H1VX 4CIGA 2Y1IA 1HYVA 4UQGA 3MCAB 1KC8O 3A5LC 2PZSA 5HP1A 1JL1A 3PUFA 1KAZA 4ROCB 2UXCK 1EKEA 4B1UB 1QN3A 4B1YB 1W7AA 5D3GA 2Q2RA 1WSIA 1ASUA 5KL0A 2OCEA 2VCPA 5AQRA 2HNZA 2V7ZA 4BC4A 3TWHA 3IMXA 2WOMA 4Q5VA 2KQ2A 3JXUA 4BR9A 1MWKA 1W0HA 3BY5A 3FZFA 4DQSA 3P5JA 2HBJA 4BC2A 1QVFM 1JCGA 2P5OA 1C0GA 3O5BA 3VMFB 1A5VA 1VSEA 2QXLA 3W3DA 1U48A 5C24A 4JI5K 1N3AA 2E6MA 4JI1K 4J2BA 5ADXA 3R3LA 1QNEA 4CJPA 1VQKN 4H0VB 1PCJX 3HI0A 4EALA 1HNXK 2UUAK 2VG5A 1RDDA 3H1ZA 5BPNA 3THXB 4CGGA 4N5SA 5KRTA 4H5VA 5KRSA 3OYLA 4OLBA 4GKKK 5SWMA 5AZJA 2PWWA 1NVPA 1SZ2A 4IOCL 1KY7A 4DB3A 3QNNA 1OH7A 4FVMA 2Z1IA 4FLYA 4JI3K 4IJNA 3LDSA 3NF8A 3J7AP 5BRFA 2RHKA 3OY9A 1BHLA 3IUCA 3NH0A 4LH4A 4E7KA 4FWLA 3V9UA 2IDOA 3VQ7A 1WSGA 1JKHA 2ZQBA 2WUSA 2JHNA 4CJFA 3J80O 1NJWA 2P5GA 1TKDA 4JYAK 1OVYA 4FZZA 3C6HA 4DMNA 3I55N 1UWBA 4AM6A 3CD6N 1WN7A 4ISGA 2F9WA 1LWFA 1S6PA 2KFNA 3D7QA 3MEGA 5AJ3K 2O4GA 4LFCK 1KO9A 3L2WA 1VQPN 3A8YA 5M1KA 1R0AA 2X78A 4CJ7A 2HMPA 2IV9A 3F0ZA 1XHZA 4YOXA 5EPCA 3EO3A 1LWWA 3S9HA 4NCAA 3OYKA 4E0DA 5E84A 5AQFA 3D4VA 3WNEA 3HSCA 4XEIA 2DFFA 4DFMA 5FPEA 2JWKA 3KZBA 1NBWA 3PY8A 2HHWA 4DTNA 3F9MA 4JKCA 2HSTA 1I39A 3HZ6A 2W41A 4JKBA 3CCSN 1ITGA 2QWPA 4DTRA 3ZX0A 3VGMA 1N32K 1NK9A 1HJRA 3OVNA 5ELZA 3G6EN 3NHGA 2F8TA 3ZT2A 4DR7K 1T7PA 2NRWA 2O8CA 2O8EB 3EYZA 3SYZA 2HHXA 1T8EA 3FZHA 4M41A 4JI6K 1ASWA 2XY5A 1GOBA 2HL9A 3WNFA 4E3SA 4HUGA 2YNGA 1KTQA 2VG6A 3OJSA 4QOZB 5C10A 4WFAL 2DFHA 4PQUA 1DT9A 1Z26A 1RTHA 4QG5A 4H0OA 4FWMA 4E7IA 4BR4A 2QWRA 3QLHA 4BVOA 3TAPA 3DRPA 1MP9A 4FJKA 1U04A 1NWKA 2F7TA 5DM6L 3HP6A 4TPSA 3CC7N 2GTDA 1XUPO 3M6GA 1P8ZA 2E20A 4DFKA 3TAQA 4IOXA 4DUYK 3ZLJA 2YKMA 1KAYA 2BH1A 2HF4A 4IFVA 5GIPA 3WT0A 4ELVA 1SUQA 4FJ8A 1RM1A 2JGUA 2NRVA 4BG9A 2O8FB 3ULXA 1CZAN 1VSIA 3PMGA 2NZTA 2DY4A 4W5TA 4OPKA 3RTVA 1WAFA 2HVHA 5HSHA 3OYAA 2ZWHA 4BR7A 5M1QA 2HHTA 3CQ8A 2ZFDB 4HJHA 3MWPA 4C8LA 3QEXA 1D4XA 5IYCP 4FLZA 3K5OA 3H1QA 1U2VA 3THWB 2WFBA 3K5NA 4CE9A 3KWGA 2YNHA 1GLFO 4KO0A 3CJ7A 3ENOC 4DQPA 3AY9A 3SMSA 4IFYA 5H1SQ 1NK4A 4H5NA 4LFBK 4O55A 4ILGB 4C8NA 4CD1A 1HQEA 3TI0A 4H8KA 4JAXA 4C1NI 3CYMA 4BR5A 1BA0A 5KI6A 1JFIC 4DQRA 1NNEA 3WXJA 3M8SA 3A2FA 3DYAA 1MWMA 3FFKB 4OX9K 1VTOA 3C6AA 3C94A 4BC5A 2QKKA 1Y97A 2FBVA 2HMIA 4JKAA 1YUWA 1TL1A 5J2NA 1VAZA 3CHWA 3GBTA 3FLCO 4H5RA 1UL7A 1EUVA 1KYUA 3VN5A 4A5AA 1X1PA 3SUQA 4EAJA 4B3OA 2E6LA 2KZMA 4FCYA 4BDZA 4CEOA 3O4QA 1NK8A 3BGRA 3OW2M 2ZF5O 4BRHA 1P90A 2D0OA 4FK2A 1N8RO 3BKQX 1SQKA 1RNHA 3PIOL 3RRGA 1QTPA 5GAHP 1XC3A 4WQ5C 4LF5K 3SUPA 2FUVA 3HL8A 1TK0A 4EJYA 2Q0RA 4CF0A 1T3VA 1XC9A 1XNQK 4CZFA 5BR8K 4DTMA 3WXKA 4KB0A 2YCHA 3EKSA 1SV5A 5BN9A 1SL1A 1WBDA 4JV5K 4B1XB 4PKHA 1FKPA 4Y0WA 3ZT4A 3LZIA 4KREA 3SQ2A 1BQMA 1QN5A 1RBSA 4FOIA 4BDYA 3N4QA 5JICA 2VYPA 3THXA 4BDPA 2P9NA 2R5XA 4W5OA 4N41A 1CDWA 1C9BB 2FSNA 3VERA 4CECA 3I0XA 2GUIA 4H03B 1P5GX 1TAQA 4JD2B 3JAMO 4BRPA 2OTLN 3AA5X 1K8KB 3JYTA 1NOYA 3MX5A 2CH6A 3QBXA 1NGFA 3N4PA 4FWSA 4BRMA 2HL8A 3GOIA 1D9DA 3C6UA 4BACA 1ZBSA 2H4LX 1BG3A 3LANA 3LDPA 4QAGA 2NRZA 2J4RA 2BE2A 2LSNA 2XHIA 3O9QA 2XY8A 1TUUA 4CGDA 4EAKA 2WC9A 5FRMA 5HRRA 4X65K 3V9ZA 2OOYA 4LF7K 1HYSA 5C42A 2UUCK 3CPEA 3T1HK 1WSJA 4O5FA 1PZDA 2E2NA 4JS5A 4DU3A 3I33A 4IEIA 4C23A 2RN2A 4RCHA 4XIUA 2E1YA 3OBWA 1LW2A 3AO2A 2B6AA 2VG7A 4CBUA 4K43A 2D1KA 3SMPA 1QN4A 1QE1A 4MO4A 1KRPA 4OVLA 1RDAA 3HM9A 3OYHA 2EHGA 3QESA 5CYMA 3V1QA 2V92A 4FLXA 1YF5L 1W97L 3KLFA 1K2YX 3I56N 2F8SA 4FWKA 3KWIA 1GOCA 3MEEA 3AO1A 1GLAG 2YJEA 2Z1GA 3CWSA 4WXAA 4NCGA 1VSFA 3N89A 3QMLA 4IG0A 3LZJA 2Q3SA 4FJXA 4H0YB 3F9KA 4JI7K 4PY5A 1JDYA 2FKMX 5BMPA 1BO5O 1GOAA 1G99A 3GG4A 4B3SK 1UA0A 2O8EA 2HB5A 1D5AA 3EZWA 3VQAA 4BRAA 2YHAA 3PDKA 4O44A 5AN4A 1RT7A 4CJRA 3HPOA 1FJGK 3CCUN 2D0PA 3NF9A 1HNZK 3U9DA 1ZYQA 3D45A 1V4TA 3WXMB 1VSJA 1WUAA 3AO3A 1LWCA 3MK6A 5AFUH 4EZ6A 2OANA 1KQSM 4FJMA 2QI2A 3SLCA 2ZGYA 3VF2A 3ZYYX 2VQFK 3C0BA 4CJSA 1VQ7N 4B9SA 1HYZA 2FSKA 4FM0A 3AVJA 3HPGA 3L2QA 4B3MK 3PV8A 4F2SA 1Q8IA 3MN7A 4OGCA 3VTIA 3OJUA 3AAPA 4FLTA 5AQMA 3TE5A 1Q81O 3C6TA 3IKMA 3OBYA 3GE1A 4DQIA 4FO0A 2FXUA 3VEOA 1KVCA 1YTBA 2IS3A 3CIPA 1C47A 2O8FA 3KTQA 3HVRA 5LMUK 4WCEL 2XHBA 1M3HA 4FYDA 2P9LB 2Z1JA 3ZT3A 4EHUA 1S72N 1RT3A 4CK1A 4F8RA 1O1WA 2PFUA 3VQCA 4C7PA 3EAYA 1ATNA 1Q9YA 1M90O 2QREA 1YVNA 3E1YA 3ZETB 3V1OA 5B8HA 1OKJA 1NGEA 2E2OA 4BRFA 5JMVD 2RKIA 5AQQA 3TAGA 3SJJA 2P9PB 3U4LA 4B9NA 2FKFA 1VSKA 3I8DA 3QDKA 3L4QA 3THWA
chains in the Genus database with same CATH topology
3VQ6A 5KRSA 3OYLA 1ZBFA 3KK2A 1N5YA 5SWMA 4OLBA 4AHTA 4BE2A 2QXFA 3TAMA 5FROA 3TANA 1SKSA 1N6QA 1NVPA 1KY7A 3QNNA 2D0BA 1NKCA 1YTUA 3M8PA 4FVMA 4ID1A 2D0AA 4PWDA 2Z1IA 1YQMA 5EU7A 1BL3A 1VRUA 3LP1A 2FBXA 5T7BA 1LWYA 4FLYA 4OKJA 3VQ9A 2VWJA 1XI1A 2HHVA 3V1RA 2X74A 3LDSA 3CG7A 3OSTA 2P1JA 3NF8A 4DTUA 4Z4HA 3DOLA 3IH7A 1JXEA 1QHTA 4KAZA 1CLQA 1TAUA 1YVUA 4HCBA 3OY9A 1S9GA 1BHLA 3RMAA 3NH0A 4LH4A 4B8CA 4E7KA 4DSLA 1WSEA 3V9UA 2IDOA 4Q11A 3VQ7A 2BANA 4DSKA 1WSGA 3HK2A 1JKHA 2ZQBA 3VQBA 4CJFA 3T19A 1X9WA 1NJWA 1NK7A 2P5GA 4KTQA 1TKDA 3OC3C 1QNBA 5J2MA 4OKEA 4W5RA 4FZZA 1X9MA 4FJHA 2KTQA 4DMNA 1LV5A 3IAYA 3KJVA 1UWBA 3RPJA 4B9UA 1WN7A 1S6QA 4FW1A 4C8KA 3OYNA 1TKTA 2P51A 3MAQA 1LWFA 1S6PA 3B6OA 4MFBA 4Q0BA 2KFNA 1LW0A 1RT5A 1S5JA 3MEGA 1RT2A 4I9LA 2O4GA 4E89A 1SL0A 2O4IA 4FJNA 1KO9A 1C1BA 4DF8A 3QIPA 4F4KA 3LPUA 1Z25A 3L2WA 1R0AA 4WE1A 1FK9A 2X78A 1IO2A 3KKRA 4AHUA 3ZCMA 1KLNA 3M8RA 3O3HA 5KGXA 3MXMA 3S3MA 3QINA 2IV9A 2NUBA 3F0ZA 1YQLA 1K6YA 3VQ5A 4AHCA 4CFAA 4ZHRA 4E7LA 1XHZA 3EY1A 2OPQA 1LWWA 3DM2A 4AILC 2GBZA 3OYKA 4E7JA 3S9HA 4B9TA 1NK6A 4E0DA 1U47A 1QN8A 5KGWA 1J53A 4QCLA 4F3TA 2NOLA 3MXJA 3ZSXA 2HNDA 1RTIA 1W9HA 5FDLA 3WNEA 2PY5A 4K8XA 4FK0A 3TAEA 2G30A 2DFFA 4DFMA 4J2EA 5IYDP 3EZ5A 1RTJA 4DU4A 2Z8UA 4FJLA 3PY8A 5IYBP 2HHWA 4DTNA 3NGYA 3PX4A 3ASMA 1I39A 1AISA 3DLGA 1D3UA 1ITGA 2FC0A 4KTZA 5CYQA 5K14A 4DTRA 4ICLA 3S3OA 3CFRA 4HTUA 2G8UA 4FZXC 1NK9A 1HJRA 3CFPA 1R4XA 3OVNA 2YH5A 3NHGA 1KSPA 3ZT2A 3DOKA 3QIOA 5J1EA 3V81A 3OYBA 3MXIA 1VOKA 2OPRA 4JS4A 1T7PA 3RR7A 3RWUA 2HVIA 4BWJA 4FK4A 1WAJA 4KFBA 3EYZA 3SYZA 4M45A 3ZT0A 2HHXA 1T8EA 4M41A 4OGEA 1HNIA 1WLJA 1ASWA 1D8YA 2XY5A 1GOBA 4FLWA 5DK5A 1CZ9A 2OPPA 3U3YA 3S3NA 4R5PA 2KFZA 1BI4B 3WNFA 4RODB 1FXXA 4KRFA 3KRMA 1HNVA 4E3SA 4YFUA 3ALYA 4HUGA 2YNGA 4DS4A 3BDPA 2I5JA 1UT4A 2NOHA 3QEPA 1KTQA 2ATQA 2VG6A 2IGIA 3OJSA 3V9SA 4QOZB 1UAXA 2DFHA 1KLMA 1JLCA 4MQ3A 4CEQA 3NH1A 4CJKA 3V6DA 4PQUA 5I42A 3H08A 1Z26A 1RTHA 4PA1A 4CF1A 4CK3A 3FFIA 1REVA 4DLEA 4E7IA 4KB1A 4RW4A 4CJ5A 1QN6A 3QLHA 4OPJA 1RDBA 4CHZA 4DTSA 4GW6A 3TAPA 1JLGA 3DRPA 1MP9A 1BCOA 2HNYA 4M3YA 2HHQA 4FJKA 1U04A 3QNOA 2D0CA 1CZBA 2MZ8A 1RBRA 2G8WA 3O4NA 1IKYA 2G8HA 3HP6A 2F8TA 4TPSA 5HRSA 3ZSWA 3RMCA 4CJTA 2WONA 1BIZA 1ASVA 4DFKA 3TAQA 3KTUA 1VK0A 4M3UA 1QS4A 3HSTB 5FRNA 2Y1JA 2YKMA 1LAVA 2YNIA 1CXQA 3AVLA 1BIUA 4PUOA 3IRXA 2OYQA 4GMJB 1B9FA 1C0UA 4CCHA 4CHNA 4CFCA 1SL2A 4IFVA 1DTTA 3KLGA 4HUEA 3CM5A 4I9QA 4ELVA 1EXQA 1SUQA 3MEDA 3SUNA 4Y1CA 4FJ8A 3I0WA 1I3AA 1RM1A 2JGUA 3U3GA 1TVRA 3DLKA 3AVKA 3ULXA 4KKOA 1QSSA 4GVMA 1VSIA 2NOBA 4Z4FA 4Z0UA 1QTMA 4ELUA 2DY4A 4W5TA 1A5WA 4OPKA 1HMVA 2Z1HA 5CZ1A 1NH2A 1WAFA 4N47A 3RTVA 2BDPA 2HVHA 3SZ2A 1X9SA 4EP5A 3OYAA 4ELTA 4B9VA 2HHTA 1YTFA 3CQ8A 4B08A 3DLHA 5HBMA 4W5QA 3AV9A 4C8LA 4C8OA 4CJEA 3QEXA 1RTDA 5IYCP 4FLZA 1PCZA 1WSHA 3K5OA 3SV4A 1U49A 4FZYA 3QERA 2G8VA 4AH9A 2B5JA 3CM6A 1NJXA 4KHNA 1NKBA 1HRHA 3K5NA 3NDKA 4E7HA 1RCHA 4CE9A 3SQ4A 3HT3A 1QTSA 2YNHA 1WSFA 1D9FA 3LWLA 3L8BA 1F21A 3AA2A 4KO0A 1YT3A 2HHUA 1L3SA 1XWLA 4B9MA 1XHXA 3QETA 2VJ0A 4DQPA 1A5XA 3VQDA 2JLEA 3RMBA 4J2AA 3NCIA 3DMJA 1JLFA 2XRIA 2FGTA 4IFYA 4N76A 1VSHA 3K5LA 1NK4A 4M3WA 2NOEA 1ZBIA 3DPTA 1J5OA 4CJQA 4O55A 4LSLA 3KIOA 4C8NA 3KLEA 1BCMA 4OLAA 3TARA 4JRPA 3LP0A 1HQEA 3P83D 1U45A 3ZSVA 4HUFA 4H8KA 1JLQA 3TI0A 4F2RA 4KHSA 3CYMA 2GV9A 1NKEA 1JXBA 2OZSA 3AVNA 2A1RA 1C6VA 1C1CA 5KI6A 4F3OA 1JLEA 1JFIC 4DQRA 4C8MA 3NF6A 3OYJA 2ETJA 3A2FA 1EX4A 1BQNA 3AVMA 3DRRA 2RPIA 2NOZA 3DYAA 3HP9A 4CGIA 4CHOA 3KK3A 1VTOA 3C94A 4FW2A 1VOLB 4RW7A 2QKKA 3LP2A 3HVTA 4HHTA 1L5UA 3ZSQA 3O3GA 1Y97A 2FBVA 4DU1A 1U4BA 1UT7A 2HMIA 4IDKA 3SI6A 1J54A 2XO7A 4DSIA 3AA3A 4JLHA 1TL1A 1C0MA 5J2NA 3E01A 3OYDA 2ITGA 3V9WA 2BGGA 3AVAA 1TGOA 3MECA 4FM2A 4ID5A 2KZMA 3AO5A 3IS9A 4KPYA 1VTLE 3VQPA 3UIQA 3HO1A 4OJRA 4RW9A 1CXUA 1TKZA 3V9XA 2D5RA 1KYUA 1NK5A 3C95A 3ITHA 4Y1DA 3OYCA 4RG8A 3VN5A 3LALA 4EP4A 4E1NA 4FJIA 1IKWA 3SPYA 4DTXA 3PO4A 2X6NA 3M8QA 1X1PA 2MJ7A 4AHRA 1EP4A 4FM1A 3SUQA 5I3UA 4CERA 4DSEA 3AVCA 4LSNA 4Z4CA 2E6LA 3OYMA 3DLRA 3HPHA 3DRSA 3LPTA 4CEFA 4BDZA 4FCYA 4CEOA 4DTPA 4CF8A 1SKRA 4BE1A 3O4QA 1KFDA 5HRNA 3K2PA 3BGRA 4KV8A 1NK8A 4M3XA 2ZD1A 3OYFA 2OA8A 4RW8A 3NFAA 4CEAA 3KD5E 4KHQA 1RBTA 2PYJA 3AVHA 2DFEA 3AVFA 2R7YA 1QQCA 4FK2A 4M3ZA 3K57A 1S1TA 1MU2A 1KCFA 1RNHA 4DWIA 4KI4A 3THVA 3RRGA 2G8KA 1IKVA 1QTPA 4FLVA 4CGFA 3RRHA 3SUPA 3K5MA 3HL8A 4M3TA 1TK0A 4EJYA 3G0ZA 1TK5A 2JOIA 4WZSD 3NAEA 1M3QA 1L3TA 4CF0A 1XC9A 4CHPA 4CJ4A 1RDCA 4EZ9A 1C1AA 1S1VA 3VQ8A 4CJVA 4H4OA 1LWVA 3NGIA 4DTMA 4KB0A 1SV5A 2IV8A 1YQRA 1SL1A 3LP3A 4KTWA 2ZE2A 1QN9A 4CEEA 2IAJA 1KY6A 1FKPA 3ZT4A 3B6PA 3LZIA 4KREA 4CHYA 3SQ2A 1BQMA 3ZSYA 1QN5A 1RBSA 4BDYA 1UA1A 3P1GA 1HQUA 1N39A 1B9KA 3HS8A 3ZSRA 4E1MA 4DLGA 4NYNA 1U48A 3V4IA 1QSYA 4BDPA 1FKOA 4W5OA 5J2PA 4N41A 1CDWA 1C9BB 3KD1E 4CJWA 4JRQA 1VSLA 4LY7A 3I0XA 4CECA 3WNGA 1B92A 3AVGA 4CEZA 1VSDA 2GUIA 3I0RA 3RMDA 4CIEA 1TAQA 3L2RA 4FXDA 3AA5X 4DFPA 4NCAA 2YV0X 5DMRA 3JYTA 1TV6A 3AO4A 4AHSA 1NOYA 4TSXA 3L2VA 4CHQA 3F73A 2QKBA 4I2PA 1D9DA 2HZSA 3C6UA 4BACA 1L3UA 1KYFA 4FJ5A 3AVIA 3LANA 3D0PA 4QAGA 4J2DA 3SQ0A 1ZBHA 2BE2A 4DF4A 2LSNA 3JSMA 2AJQA 1E42A 2XHIA 2XY8A 3OS1A 4ROEB 4CGDA 4B0AA 3HXMA 4I7FA 5JS2A 2E4LA 3KKSA 3DLBA 3EIKA 3DPUA 1S1UA 2A1SA 3AVBA 3IG1A 3NBPA 3OYGA 5FRMA 1ZBUA 5HRRA 3K59A 3NH2A 4AHVA 1LAWA 3V9ZA 4E19A 5HRPA 1HYSA 3OYEA 1S1WA 1VSMA 5C42A 3I0SA 1QN7A 3QO9A 4DTJA 2G8FA 1WSJA 4CGHA 1JLBA 1PZDA 1JL2A 4G1QA 4YNQA 4JS5A 4DU3A 1ZBLA 2RN2A 3LAKA 1IH7A 4XIUA 3RR8A 3CFOA 3VQQA 4CIFA 2FBTA 2OZMA 1LW2A 3AO2A 2B6AA 2RF2A 1NJZA 4B3OA 2VG7A 3G10A 2IOCA 1S1XA 3SPZA 1HPZA 2YKNA 3T1AA 5HROA 3QEVA 3SQ1A 1RT6A 1TL3A 1BGXT 4FJ9A 1JLAA 2I5WA 3F10A 1QN4A 3OSMA 1G15A 1QE1A 4O5BA 4N56A 1KRPA 4Z4EA 4OVLA 4I2QA 4FJJA 1RDAA 4FLUA 3QEIA 1QNCA 3OYHA 3HM9A 2O3OA 2EHGA 3QESA 4KHWA 1TBAB 5CYMA 3V1QA 1QSLA 4DULA 4BWMA 2W42A 4FLXA 2X6SA 3KLHA 2G8IA 3KLFA 1WNSA 3L2UA 2IC3A 1BISA 3KLIA 3PX6A 2F8SA 1RT1A 1GOCA 3VQEA 3MEEA 3WNHA 1YTAA 3AO1A 3DLEA 4B8AB 4CESA 1W80A 2Z1GA 3O3FA 3ZSZA 1DTQA 3OS0A 3HS9A 5C25A 5E41A 3OS2A 4L8RB 4NCGA 1VSFA 4Z4IA 4H4MA 4KI6A 4CK2A 3N89A 3OCIA 4IG0A 4LD0A 3KK1A 1J9AA 3TAFA 1RILA 3SCXA 3LZJA 2HHSA 1RT4A 2Q3SA 4HVJA 1T05A 2PYLA 1Q9XA 4FJXA 4KHYA 4DSJA 3F9KA 1SKWA 4KHUA 4PY5A 3VQ4A 1KYDA 3SNSA 1GOAA 4CF9A 4DS5A 4Z4GA 2KW4A 1UA0A 5SZTA 2HB5A 3VA3A 4CFBA 1L3VA 2EX3A 4I8OA 1LWEA 1D5AA 2YNFA 3VQAA 3U6FA 2VWKA 2YHAA 3OYIA 4O44A 5AN4A 4NCBA 1RT7A 4FJ7A 3ULDA 1HU0A 4IKFA 1BI4A 4CJRA 3HPOA 3AA4A 3NF9A 1FN7A 3ISNC 5CZ2A 3NGZA 3SNNA 1EBMA 3PX0A 3D45A 1ZYQA 1KFSA 1S9EA 4CIGA 3LAMA 4LH5A 1VSJA 3AO3A 1TK8A 1LWCA 4CFDA 2Y1IA 4EZ6A 1HYVA 4UQGA 2XY7A 5KTQA 2FBYA 3QEWA 1RBUA 5J2QA 4FJMA 4CJLA 2NOFA 2PZSA 5HP1A 1JL1A 3PUFA 4ROCB 4DSFA 1EKEA 4CJSA 1QN3A 3LWMA 3NE6A 4B9SA 2QK9A 5JS1A 1VRTA 4EJZA 1EETA 1HYZA 3L3VA 3ZSOA 4FM0A 4B9LA 4O0IA 5D3GA 3AVJA 1RBVA 1WSIA 1YQKA 3HPGA 3L2QA 1ASUA 1NGMA 4CEBA 3PV8A 1IG9A 4F2SA 1Q8IA 4OGCA 4RW6A 4ZTJA 2KZZA 3OJUA 2HNZA 3DI6A 1KVAA 4FLTA 1IKXA 4M3RA 4IBNA 3SV3A 3TWHA 2WOMA 4Q5VA 3C6TA 2KQ2A 2F96A 2NOIA 1NOZA 4W5NA 1W0HA 4CJ3A 4M42A 4DFJA 3T3FA 4DQIA 1TKXA 2LAEA 4DQSA 1KVCA 2B4JA 3P5JA 4NYFA 1NK0A 3HJFA 1YTBA 2IS3A 4O4GA 4BE0A 3M8SA 3KTQA 3VA0A 4DG1A 3HVRA 3PO5A 2YHBA 4CF2A 2XHBA 1M3HA 1TGHA 2P5OA 4FYDA 2Z1JA 3ZT3A 4CEDA 2HW3A 3K58A 1RT3A 1QNAA 4CK1A 3HYFA 4F8RA 1O1WA 1A5VA 1VSEA 3VQCA 4CJUA 1TBPA 3TABA 4OKKA 5C24A 4CGJA 2XY6A 1T03A 1Q9YA 4ZTFA 1N3AA 2E6MA 4J2BA 5HLFA 1N3CA 1UOCA 3V1OA 4IG3A 1QNEA 4CJPA 4DQQA 4HCCA 4K8ZA 5CY4A 3SUOA 1NJYA 2OPSA 3ZT1A 1C0TA 2RKIA 3TAGA 1DLOA 2VG5A 1RDDA 3H1ZA 2HZMA 3SJJA 1B9DA 4O0JA 1KVBA 3TR8A 4B9NA 4CGGA 1VSKA 4N5SA 3I8DA 4DTOA 4FJGA 2DTUA 5KRTA 3L3UA 3NF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ6 A;  5KRS A;  3OYL A;  1ZBF A;  3KK2 A;  1N5Y A;  5SWM A;  4OLB A;  4AHT A;  4BE2 A;  2QXF A;  3TAM A;  5FRO A;  3TAN A;  1SKS A;  1N6Q A;  1NVP A;  1KY7 A;  3QNN A;  2D0B A;  1NKC A;  1YTU A;  3M8P A;  4FVM A;  4ID1 A;  2D0A A;  4PWD A;  2Z1I A;  5EU7 A;  5T7B A;  1BL3 A;  1VRU A;  3LP1 A;  2FBX A;  4FLY A;  1U4B A;  2HHV A;  4OKJ A;  3VQ9 A;  2VWJ A;  1XI1 A;  3V1R A;  2X74 A;  3LDS A;  3CG7 A;  4DTU A;  2P1J A;  3NF8 A;  4KAZ A;  4Z4H A;  3DOL A;  1QHT A;  1JXE A;  1CLQ A;  1TAU A;  1YVU A;  4HCB A;  3OY9 A;  1S9G A;  1BHL A;  3RMA A;  3NH0 A;  4LH4 A;  4B8C A;  4E7K A;  4DSL A;  1WSE A;  3V9U A;  2IDO A;  3VQ7 A;  2BAN A;  4DSK A;  1WSG A;  3HK2 A;  1JKH A;  2ZQB A;  3VQB A;  4CJF A;  3T19 A;  1X9W A;  1NJW A;  1NK7 A;  2P5G A;  4KTQ A;  1TKD A;  3OC3 C;  1QNB A;  5J2M A;  4OKE A;  4W5R A;  4FZZ A;  1X9M A;  4FJH A;  2KTQ A;  4DMN A;  1LV5 A;  3IAY A;  3KJV A;  1UWB A;  4B9U A;  1WN7 A;  1S6Q A;  4FW1 A;  4C8K A;  3OYN A;  1TKT A;  2P51 A;  3MAQ A;  1LWF A;  1S6P A;  3B6O A;  4MFB A;  4Q0B A;  2KFN A;  1LW0 A;  1RT5 A;  1S5J A;  3MEG A;  1RT2 A;  4I9L A;  2O4G A;  4E89 A;  1SL0 A;  2O4I A;  4FJN A;  1C1B A;  4DF8 A;  3QIP A;  4F4K A;  3LPU A;  1Z25 A;  3L2W A;  1R0A A;  4WE1 A;  1FK9 A;  2X78 A;  1IO2 A;  3KKR A;  4AHU A;  3ZCM A;  1KLN A;  3M8R A;  3O3H A;  5KGX A;  3MXM A;  3S3M A;  3QIN A;  2IV9 A;  2NUB A;  1K6Y A;  3VQ5 A;  4AHC A;  4CFA A;  4ZHR A;  4E7L A;  1XHZ A;  3EY1 A;  2OPQ A;  3DM2 A;  4AIL C;  3S9H A;  2GBZ A;  3OYK A;  4E7J A;  4B9T A;  4E0D A;  1NK6 A;  4NCA A;  1U47 A;  1QN8 A;  5KGW A;  1J53 A;  4QCL A;  4F3T A;  3MXJ A;  3ZSX A;  2HND A;  1RTI A;  1W9H A;  5FDL A;  3WNE A;  2PY5 A;  4K8X A;  4FK0 A;  3TAE A;  2G30 A;  2DFF A;  4DFM A;  4J2E A;  5IYD P;  3EZ5 A;  1RTJ A;  4DU4 A;  2Z8U A;  4FJL A;  3PY8 A;  5IYB P;  2HHW A;  4DTN A;  3NGY A;  3PX4 A;  3ASM A;  1I39 A;  1AIS A;  3DLG A;  1D3U A;  1ITG A;  2FC0 A;  4KTZ A;  5CYQ A;  5K14 A;  4DTR A;  4ICL A;  3S3O A;  3CFR A;  4HTU A;  2G8U A;  4FZX C;  1NK9 A;  1HJR A;  3CFP A;  1R4X A;  3OVN A;  3NHG A;  1KSP A;  2F8T A;  3ZT2 A;  3DOK A;  3QIO A;  5J1E A;  3V81 A;  3OYB A;  3MXI A;  1VOK A;  2OPR A;  4JS4 A;  1T7P A;  3RR7 A;  3RWU A;  2HVI A;  4BWJ A;  4FK4 A;  1WAJ A;  4KFB A;  3EYZ A;  3SYZ A;  4M45 A;  3ZT0 A;  2HHX A;  1T8E A;  4M41 A;  4OGE A;  1HNI A;  1WLJ A;  1ASW A;  1D8Y A;  2XY5 A;  1GOB A;  4FLW A;  5DK5 A;  1CZ9 A;  2OPP A;  3U3Y A;  3S3N A;  4R5P A;  2KFZ A;  1BI4 B;  3WNF A;  4ROD B;  1FXX A;  4KRF A;  1HNV A;  4E3S A;  4YFU A;  3ALY A;  4HUG A;  2YNG A;  4DS4 A;  3BDP A;  2I5J A;  3QEP A;  1KTQ A;  2ATQ A;  2VG6 A;  2IGI A;  3OJS A;  3V9S A;  4QOZ B;  1UAX A;  2DFH A;  1KLM A;  1JLC A;  4MQ3 A;  4CEQ A;  3NH1 A;  4CJK A;  3V6D A;  4PQU A;  5I42 A;  3H08 A;  1Z26 A;  1RTH A;  4PA1 A;  4CF1 A;  4CK3 A;  3FFI A;  1REV A;  4DLE A;  4E7I A;  4KB1 A;  4RW4 A;  4CJ5 A;  1QN6 A;  3QLH A;  4OPJ A;  1RDB A;  4CHZ A;  4DTS A;  4GW6 A;  3TAP A;  1JLG A;  3DRP A;  1MP9 A;  1BCO A;  2HNY A;  4M3Y A;  2HHQ A;  4FJK A;  1U04 A;  3QNO A;  2D0C A;  1CZB A;  1RBR A;  2G8W A;  3O4N A;  1IKY A;  2G8H A;  3HP6 A;  5HRS A;  3ZSW A;  3RMC A;  4CJT A;  2WON A;  1BIZ A;  1ASV A;  4DFK A;  3TAQ A;  1VK0 A;  4M3U A;  1QS4 A;  5FRN A;  2Y1J A;  2YKM A;  1LAV A;  2YNI A;  1CXQ A;  3AVL A;  1BIU A;  4PUO A;  3IRX A;  2OYQ A;  4GMJ B;  1B9F A;  1C0U A;  4CCH A;  4CHN A;  4CFC A;  1SL2 A;  4IFV A;  1DTT A;  3KLG A;  4HUE A;  3CM5 A;  4I9Q A;  4ELV A;  1EXQ A;  1SUQ A;  3MED A;  3SUN A;  4Y1C A;  4FJ8 A;  1I3A A;  1RM1 A;  2JGU A;  3U3G A;  1TVR A;  3DLK A;  3AVK A;  4KKO A;  1QSS A;  4GVM A;  1VSI A;  4Z4F A;  4Z0U A;  1QTM A;  4ELU A;  2DY4 A;  4W5T A;  1A5W A;  4OPK A;  1HMV A;  2Z1H A;  5CZ1 A;  1NH2 A;  1WAF A;  4N47 A;  3RTV A;  2BDP A;  2HVH A;  3SZ2 A;  1X9S A;  4EP5 A;  3OYA A;  4ELT A;  4B9V A;  2HHT A;  1YTF A;  3CQ8 A;  4B08 A;  3DLH A;  5HBM A;  4W5Q A;  3AV9 A;  4C8L A;  4C8O A;  4CJE A;  3QEX A;  1RTD A;  5IYC P;  4FLZ A;  1PCZ A;  1WSH A;  3K5O A;  3SV4 A;  1U49 A;  4FZY A;  3QER A;  2G8V A;  4AH9 A;  2B5J A;  3CM6 A;  1NJX A;  4KHN A;  1NKB A;  1HRH A;  3K5N A;  3NDK A;  4E7H A;  1RCH A;  4CE9 A;  3SQ4 A;  3HT3 A;  1QTS A;  2YNH A;  1WSF A;  1D9F A;  3LWL A;  3L8B A;  1F21 A;  3AA2 A;  4KO0 A;  1YT3 A;  2HHU A;  1L3S A;  1XWL A;  4B9M A;  1XHX A;  3QET A;  2VJ0 A;  4DQP A;  1A5X A;  3VQD A;  2JLE A;  3RMB A;  4J2A A;  3NCI A;  3DMJ A;  1JLF A;  2XRI A;  4IFY A;  4N76 A;  1VSH A;  3K5L A;  1NK4 A;  4M3W A;  1ZBI A;  1J5O A;  4CJQ A;  4O55 A;  4LSL A;  3KIO A;  4C8N A;  3KLE A;  1BCM A;  4OLA A;  3TAR A;  4JRP A;  3LP0 A;  1HQE A;  3P83 D;  1U45 A;  3ZSV A;  4HUF A;  4H8K A;  1JLQ A;  3TI0 A;  4F2R A;  4KHS A;  3CYM A;  2GV9 A;  1NKE A;  1JXB A;  2OZS A;  3AVN A;  2A1R A;  1C6V A;  1C1C A;  5KI6 A;  4F3O A;  1JLE A;  1JFI C;  4DQR A;  4C8M A;  3NF6 A;  3OYJ A;  2ETJ A;  3A2F A;  1EX4 A;  1BQN A;  3AVM A;  3DRR A;  2RPI A;  3DYA A;  3HP9 A;  3HST B;  4CGI A;  4CHO A;  3KK3 A;  1VTO A;  3C94 A;  4FW2 A;  1VOL B;  4RW7 A;  2QKK A;  3LP2 A;  3HVT A;  4HHT A;  1L5U A;  3ZSQ A;  3O3G A;  1Y97 A;  2FBV A;  4DU1 A;  2HMI A;  4IDK A;  3SI6 A;  1J54 A;  2XO7 A;  4DSI A;  3AA3 A;  4JLH A;  1TL1 A;  1C0M A;  5J2N A;  3E01 A;  3OYD A;  2ITG A;  3V9W A;  2BGG A;  3AVA A;  1TGO A;  3MEC A;  4FM2 A;  4ID5 A;  2KZM A;  3AO5 A;  3IS9 A;  4KPY A;  1VTL E;  3VQP A;  3UIQ A;  3HO1 A;  4OJR A;  4RW9 A;  1CXU A;  1TKZ A;  3V9X A;  2D5R A;  1KYU A;  1NK5 A;  3C95 A;  3ITH A;  4Y1D A;  3OYC A;  4RG8 A;  3VN5 A;  3LAL A;  4EP4 A;  4E1N A;  4FJI A;  1IKW A;  3SPY A;  4DTX A;  3PO4 A;  2X6N A;  3M8Q A;  1X1P A;  2MJ7 A;  4AHR A;  1EP4 A;  4FM1 A;  3SUQ A;  5I3U A;  4CER A;  4DSE A;  3AVC A;  4LSN A;  4Z4C A;  2E6L A;  3OYM A;  3DLR A;  3HPH A;  3DRS A;  3LPT A;  4CEF A;  4BDZ A;  4FCY A;  4CEO A;  4DTP A;  4CF8 A;  1SKR A;  4BE1 A;  3O4Q A;  1KFD A;  5HRN A;  3K2P A;  3BGR A;  4KV8 A;  1NK8 A;  4M3X A;  2ZD1 A;  3OYF A;  2OA8 A;  4RW8 A;  3NFA A;  4CEA A;  3KD5 E;  4KHQ A;  1RBT A;  2PYJ A;  3AVH A;  2DFE A;  3AVF A;  2R7Y A;  1QQC A;  4FK2 A;  4M3Z A;  3K57 A;  1S1T A;  1MU2 A;  1KCF A;  1RNH A;  4DWI A;  4KI4 A;  3THV A;  3RRG A;  2G8K A;  1IKV A;  1QTP A;  4FLV A;  4CGF A;  3RRH A;  3SUP A;  3K5M A;  3HL8 A;  4M3T A;  1TK0 A;  3G0Z A;  1TK5 A;  1L3T A;  4WZS D;  3NAE A;  4CF0 A;  1XC9 A;  4CHP A;  4CJ4 A;  1RDC A;  4EZ9 A;  1C1A A;  1S1V A;  3VQ8 A;  4CJV A;  4H4O A;  3NGI A;  4DTM A;  4KB0 A;  1SV5 A;  2IV8 A;  1SL1 A;  3LP3 A;  4KTW A;  2ZE2 A;  1QN9 A;  4CEE A;  2IAJ A;  1KY6 A;  1FKP A;  3ZT4 A;  3B6P A;  3LZI A;  4KRE A;  4CHY A;  3SQ2 A;  1BQM A;  3ZSY A;  1QN5 A;  1RBS A;  4BDY A;  1UA1 A;  3P1G A;  1HQU A;  1B9K A;  3HS8 A;  3ZSR A;  4E1M A;  4DLG A;  4NYN A;  1U48 A;  3V4I A;  1QSY A;  4BDP A;  1FKO A;  4W5O A;  5J2P A;  4N41 A;  1CDW A;  1C9B B;  3KD1 E;  4CJW A;  4JRQ A;  1VSL A;  4LY7 A;  4CEC A;  3WNG A;  1B92 A;  3AVG A;  4CEZ A;  1VSD A;  2GUI A;  3I0R A;  3RMD A;  4CIE A;  1TAQ A;  3L2R A;  4FXD A;  3AA5 X;  4DFP A;  2YV0 X;  5DMR A;  3JYT A;  1TV6 A;  3AO4 A;  4AHS A;  1NOY A;  4TSX A;  3L2V A;  4CHQ A;  3F73 A;  2QKB A;  4I2P A;  1D9D A;  3C6U A;  4BAC A;  1L3U A;  1KYF A;  4FJ5 A;  3AVI A;  3LAN A;  3D0P A;  4QAG A;  4J2D A;  3SQ0 A;  1ZBH A;  2BE2 A;  4DF4 A;  2LSN A;  3JSM A;  2AJQ A;  1E42 A;  2XY8 A;  3OS1 A;  4ROE B;  4CGD A;  4B0A A;  3HXM A;  4I7F A;  5JS2 A;  2E4L A;  3KKS A;  3DLB A;  3EIK A;  1S1U A;  2A1S A;  3AVB A;  3NBP A;  3IG1 A;  3OYG A;  5FRM A;  1ZBU A;  5HRR A;  3K59 A;  3NH2 A;  4AHV A;  1LAW A;  3V9Z A;  4E19 A;  5HRP A;  1HYS A;  3OYE A;  1S1W A;  1VSM A;  5C42 A;  3I0S A;  1QN7 A;  3QO9 A;  4DTJ A;  2G8F A;  1WSJ A;  4CGH A;  1JLB A;  1PZD A;  1JL2 A;  4G1Q A;  4YNQ A;  4JS5 A;  4DU3 A;  1ZBL A;  2RN2 A;  3LAK A;  1IH7 A;  4XIU A;  3RR8 A;  3CFO A;  3VQQ A;  4CIF A;  2FBT A;  2OZM A;  1LW2 A;  3AO2 A;  2B6A A;  2RF2 A;  1NJZ A;  4B3O A;  2VG7 A;  3G10 A;  2IOC A;  1S1X A;  3SPZ A;  1HPZ A;  2YKN A;  3T1A A;  5HRO A;  3QEV A;  3SQ1 A;  1RT6 A;  1TL3 A;  1BGX T;  4FJ9 A;  1JLA A;  1QN4 A;  1G15 A;  1QE1 A;  4O5B A;  4N56 A;  4Z4E A;  1KRP A;  4OVL A;  4I2Q A;  4FJJ A;  1RDA A;  4FLU A;  3QEI A;  1QNC A;  3OYH A;  3HM9 A;  2EHG A;  3QES A;  4KHW A;  1TBA B;  5CYM A;  3V1Q A;  1QSL A;  2W42 A;  4BWM A;  4FLX A;  2X6S A;  3KLH A;  2G8I A;  3KLF A;  1WNS A;  3L2U A;  2IC3 A;  1BIS A;  3KLI A;  3PX6 A;  2F8S A;  1RT1 A;  1GOC A;  3VQE A;  3MEE A;  3WNH A;  1YTA A;  3AO1 A;  3DLE A;  4B8A B;  4CES A;  1W80 A;  2Z1G A;  3O3F A;  3ZSZ A;  1DTQ A;  3OS0 A;  3HS9 A;  5C25 A;  5E41 A;  3OS2 A;  4L8R B;  4NCG A;  1VSF A;  4Z4I A;  4H4M A;  4KI6 A;  4CK2 A;  4LD0 A;  3OCI A;  4IG0 A;  3KK1 A;  2HHS A;  1J9A A;  3TAF A;  1RIL A;  3SCX A;  3LZJ A;  1RT4 A;  2Q3S A;  4HVJ A;  1T05 A;  2PYL A;  1Q9X A;  4FJX A;  4KHY A;  4DSJ A;  3F9K A;  1SKW A;  4KHU A;  4PY5 A;  3VQ4 A;  1KYD A;  1GOA A;  4CF9 A;  4DS5 A;  4Z4G A;  2KW4 A;  1UA0 A;  5SZT A;  2HB5 A;  3VA3 A;  4CFB A;  1L3V A;  2EX3 A;  1LWE A;  2YNF A;  1D5A A;  3VQA A;  3U6F A;  2VWK A;  2YHA A;  3OYI A;  4O44 A;  4NCB A;  1RT7 A;  4FJ7 A;  3ULD A;  4IKF A;  1BI4 A;  4CJR A;  3HPO A;  3AA4 A;  3NF9 A;  5CZ2 A;  3ISN C;  3NGZ A;  3SNN A;  1ZYQ A;  3PX0 A;  3D45 A;  1KFS A;  1S9E A;  4CIG A;  3LAM A;  4LH5 A;  1VSJ A;  3AO3 A;  1TK8 A;  1LWC A;  4CFD A;  2Y1I A;  4EZ6 A;  1HYV A;  4UQG A;  2XY7 A;  5KTQ A;  2FBY A;  3QEW A;  1RBU A;  5J2Q A;  4FJM A;  4CJL A;  2PZS A;  5HP1 A;  1JL1 A;  3PUF A;  4ROC B;  4DSF A;  1EKE A;  4CJS A;  1QN3 A;  3LWM A;  3NE6 A;  4B9S A;  2QK9 A;  5JS1 A;  1VRT A;  1EET A;  1HYZ A;  3L3V A;  3ZSO A;  4FM0 A;  4B9L A;  4O0I A;  5D3G A;  3AVJ A;  1RBV A;  1WSI A;  3HPG A;  3L2Q A;  1ASU A;  1NGM A;  4CEB A;  3PV8 A;  1IG9 A;  4F2S A;  1Q8I A;  4OGC A;  4RW6 A;  4ZTJ A;  2KZZ A;  3OJU A;  2HNZ A;  3DI6 A;  1KVA A;  4FLT A;  1IKX A;  4M3R A;  4IBN A;  3SV3 A;  3TWH A;  2WOM A;  4Q5V A;  3C6T A;  2KQ2 A;  2F96 A;  1NOZ A;  4W5N A;  1W0H A;  4CJ3 A;  4M42 A;  4DFJ A;  3T3F A;  4DQI A;  1TKX A;  4DQS A;  1KVC A;  2B4J A;  3P5J A;  4NYF A;  1NK0 A;  3HJF A;  1YTB A;  2IS3 A;  4O4G A;  4BE0 A;  3M8S A;  3KTQ A;  3VA0 A;  4DG1 A;  3HVR A;  3PO5 A;  2YHB A;  4CF2 A;  2XHB A;  1TGH A;  2P5O A;  4FYD A;  2HW3 A;  2Z1J A;  3ZT3 A;  4CED A;  3K58 A;  1RT3 A;  1QNA A;  4CK1 A;  3HYF A;  4F8R A;  1O1W A;  1A5V A;  1VSE A;  3VQC A;  4CJU A;  1TBP A;  3TAB A;  4OKK A;  5C24 A;  4CGJ A;  2XY6 A;  1T03 A;  1Q9Y A;  4ZTF A;  2E6M A;  4J2B A;  5HLF A;  1UOC A;  3V1O A;  4IG3 A;  1QNE A;  4CJP A;  4DQQ A;  4HCC A;  4K8Z A;  5CY4 A;  3SUO A;  1NJY A;  2OPS A;  3ZT1 A;  1C0T A;  2RKI A;  3TAG A;  1DLO A;  2VG5 A;  1RDD A;  3H1Z A;  3SJJ A;  1B9D A;  4O0J A;  1KVB A;  3TR8 A;  4B9N A;  4CGG A;  1VSK A;  4N5S A;  3I8D A;  4DTO A;  4FJG A;  2DTU A;  5KRT A;  3L3U A;  3NF7 A; 
#chains in the Genus database with same CATH topology
 2HBM A;  4AHT A;  3EL2 A;  3TTD A;  1SKS A;  1N6Q A;  1K8A O;  3WQU A;  1MA9 B;  4X66 K;  4ID1 A;  3OLP A;  4PWD A;  1YQM A;  1U4B A;  2FBX A;  3VQ9 A;  2VWJ A;  4KAZ A;  2P1J A;  4WFB L;  3DOL A;  1YVU A;  5EX5 A;  1S9G A;  3A5O C;  3RMA A;  4B8C A;  4BRQ A;  1VQ4 N;  4Q11 A;  1VHX A;  4DSK A;  3VQB A;  1X9W A;  4KH4 A;  3H46 O;  1NK7 A;  4KTQ A;  2QRC A;  1C4G A;  2O8B B;  3OC3 C;  1QNB A;  5J2M A;  4FJH A;  4YOU A;  5KPZ A;  3IAY A;  3CCR N;  3RPJ A;  4FW1 A;  2P51 A;  3B6O A;  4MFB A;  1WOQ A;  4DKW A;  1RT5 A;  2E5L K;  1BOT O;  3O08 A;  1C1B A;  3W0L A;  4CBW A;  3QFP A;  3LPU A;  4WE1 A;  4IO8 A;  3ZCM A;  1KLN A;  3S3M A;  3QIN A;  4AHC A;  1YQL A;  4CFA A;  2JWL A;  4AIL C;  4JKE A;  4E7J A;  1U47 A;  1QN8 A;  3MXJ A;  1RTI A;  4DV0 K;  4FK0 A;  2G30 A;  4BQZ A;  3DWL A;  4FJL A;  2Z8U A;  4FWP A;  3PX4 A;  1U6Z A;  1T6A A;  2E88 A;  3DLG A;  1D3U A;  4KTZ A;  2FC0 A;  2G8U A;  4HTU A;  3CFP A;  1R4X A;  2YH5 A;  5CE3 A;  4DV3 K;  4IEE A;  5J1E A;  4X64 K;  3V81 A;  3MXI A;  3DAW A;  4JS4 A;  1TYQ B;  4BWJ A;  3ID6 A;  4FOE A;  4KFB A;  5M1P A;  1WLJ A;  4I6M B;  3O80 A;  2QWQ A;  4LF6 K;  1HNV A;  3R6M A;  4YFU A;  3ALY A;  3BDP A;  3ULE B;  1UT4 A;  2NOH A;  3QEP A;  3AAQ A;  2IGI A;  3V9S A;  4MQ3 A;  4CEQ A;  3NH1 A;  4QS8 A;  1N36 K;  3H08 A;  4PA1 A;  3FFI A;  4RW4 A;  4OPJ A;  1RDB A;  4CHZ A;  4DTS A;  4PKI A;  4KH5 A;  5KQD A;  2HNY A;  2NRT A;  3PSF A;  3QNO A;  5TKY A;  1J3M A;  4JD2 A;  5TKW A;  2NWV A;  3RMC A;  4CJT A;  3E9P A;  3R8E A;  2Y8L A;  1K8K A;  1VK0 A;  2H5A X;  5F2R A;  2Y1J A;  3MN6 A;  1LAV A;  1CXQ A;  4PUO A;  1BIU A;  4GMJ B;  4FWO A;  4CFC A;  1SL2 A;  1DTT A;  3MED A;  3AGR A;  4GVM A;  4JI2 K;  4JKG B;  1X9S A;  3SAH A;  1J5E K;  3IFR A;  4ELT A;  2ZJR L;  4IXC A;  1BU6 O;  4AQY K;  5HBM A;  4C8O A;  3SV4 A;  1U49 A;  2G8V A;  2B5J A;  3ID8 A;  4CZG A;  3NVK A;  4KHN A;  1HRH A;  1RGI A;  3D7E O;  3NDK A;  2HBK A;  3SQ4 A;  3CWT A;  3HT3 A;  1QTS A;  2YHW A;  1WSF A;  1D9F A;  1F21 A;  2HHU A;  4DR2 K;  1L3S A;  2I7N A;  1XHX A;  2VJ0 A;  2XRI A;  1MDU B;  2W6L A;  3LL3 A;  3H3N O;  3DPT A;  2GEM A;  1BDG A;  3KLE A;  4HTL A;  3LP0 A;  4KHS A;  4HUF A;  1JXB A;  3AVN A;  5AQT A;  1C6V A;  1C1C A;  5EOY A;  2A1R A;  3AVM A;  4CGI A;  3BUZ B;  3PX0 A;  4XH5 A;  3BZK A;  3M1F A;  1E4G T;  4RW7 A;  1DKG D;  1RDU A;  3HVT A;  3LP2 A;  4MDA A;  3VEW A;  1UT7 A;  3SI6 A;  4M7Y A;  2A3Z A;  5ADX H;  3CCL N;  3WXI A;  3NMU A;  4JI4 K;  4BGB A;  3OYD A;  3CCV N;  5DM7 L;  4DHY A;  5LJW A;  3AVA A;  1TGO A;  3MEC A;  5KPT A;  4FM2 A;  1CXU A;  1DGK N;  3C95 A;  3ITH A;  4KH6 A;  4FJI A;  4E1N A;  1IKW A;  1YJN N;  2X6N A;  5FLX O;  2MJ7 A;  4AHR A;  1EP4 A;  2P9S B;  4LSN A;  3OYM A;  3VTH A;  4LFA K;  1CLQ A;  1K35 A;  4KV8 A;  2ZD1 A;  3OYF A;  3KD5 E;  5EXW A;  4MDB A;  5BPM A;  2DFE A;  3AVF A;  2R7Y A;  1S1T A;  1EQY A;  1XSZ A;  3L6Q A;  2QWL A;  3RRH A;  5EY4 A;  2V8Q A;  1YXQ A;  2IVP A;  2P9L A;  1TK5 A;  3NAE A;  1M3Q A;  2E2P A;  3VQ8 A;  4H4O A;  3ZET A;  2V9J A;  1TUY A;  5BPL A;  2ZE2 A;  4C1N K;  5CR4 A;  2IAJ A;  1KY6 A;  1Q7Y O;  1GLL O;  2D4W A;  1E3M A;  3P1G A;  2P9P A;  2WBN A;  4E1M A;  3A5M C;  4CFF A;  1QSY A;  1FKO A;  3DXM B;  3HRG A;  4JRQ A;  1NGI A;  4D7R A;  3SAG A;  4LY7 A;  3VES A;  1B92 A;  3CF5 L;  4YOR A;  3RMD A;  4CIE A;  3L2R A;  2DKA A;  2QLV A;  1HX1 A;  3B8A X;  4AHS A;  3L2V A;  1YIJ N;  2QKB A;  1P5D X;  3WUH A;  1L3U A;  1GLJ O;  1KYF A;  4FJ5 A;  3DXK B;  1T6C A;  3CI5 A;  4IFE A;  2UUB K;  1E42 A;  3OS1 A;  4B0A A;  4Z94 A;  3HXM A;  4I7F A;  5JS2 A;  2O8B A;  3EIK A;  1KXP A;  4IJA A;  3OYG A;  1FW6 A;  1ZBU A;  1PVS A;  4DR3 K;  4IZ9 A;  4E19 A;  1BWF O;  5FPD A;  3QBW A;  1VSM A;  3E9O A;  4DTJ A;  1QN7 A;  3LDO A;  4YHH K;  4CGH A;  1TUO A;  2NLV A;  3OH6 A;  5AZI A;  2VGN A;  4YNQ A;  1ZBL A;  4DR4 K;  3LAK A;  3C7N B;  1IH7 A;  2OZM A;  4D7Q A;  3MN9 A;  3SPZ A;  1S1X A;  2FLO A;  2YKN A;  3T1A A;  3QEV A;  3SQ1 A;  1TL3 A;  3CPW M;  1LCU A;  4EAH D;  3CJB A;  1G15 A;  4FJJ A;  4BJU A;  1ZC6 A;  1KFI A;  3QIC A;  2O3O A;  1QSL A;  2W42 A;  4BWM A;  5BN8 A;  4X62 K;  2X6S A;  3KLH A;  3CCQ N;  4GNI A;  2CGJ A;  3L2U A;  5JMV A;  3THY A;  3KLI A;  4GV3 A;  3H6E A;  1R59 O;  3WNH A;  1W80 A;  5C12 A;  1DEJ A;  4CVN E;  4L8R B;  3KK1 A;  4CZH A;  3TAF A;  1RIL A;  3SCX A;  1T05 A;  2PYL A;  2A6A A;  3CVS A;  4EFH A;  4KHU A;  1O13 A;  3SNS A;  1YJ9 N;  4R79 A;  5SZT A;  1TYQ A;  4CFB A;  2YNF A;  4I8O A;  1DIZ A;  4K25 A;  3J8A A;  1BA1 A;  4YY3 K;  4I6M A;  1WBB A;  3CJ9 A;  3VGL A;  5AQW A;  1FN7 A;  3NGZ A;  3SNN A;  3C65 A;  1KFS A;  3CJC A;  1S9E A;  3ULE A;  3OTO K;  3BZC A;  4CFD A;  4CZI A;  1RBU A;  5J2Q A;  4YDU C;  4FVU A;  4DV4 K;  5AQH A;  3VF6 A;  5BMN A;  3LWM A;  1VRT A;  3L3V A;  3ZSO A;  4PKG A;  1IG9 A;  5BRH A;  3FR0 A;  4RW6 A;  4ZTJ A;  3DI6 A;  3GL1 A;  1IBL K;  1IKX A;  4M3R A;  4PL7 A;  4IBN A;  3VF4 A;  3SV3 A;  4LF8 K;  1HKG A;  4JHD B;  5LJV A;  4CZL A;  2NOI A;  4BRC A;  1NOZ A;  1QZ5 A;  4CJ3 A;  4W5N A;  4M42 A;  4DFJ A;  5AQN A;  3T3F A;  4NYF A;  3HJF A;  4O4G A;  4GV6 A;  4BE0 A;  4DG1 A;  3PO5 A;  2F4V K;  3O6W A;  1TGH A;  3K58 A;  3UE5 A;  2QW9 A;  5C15 A;  4CJU A;  3TAB A;  4JKG A;  1TBP A;  1T6D A;  4OKK A;  4CGJ A;  2XY6 A;  1T03 A;  2QWM A;  4ZTF A;  5GIO A;  2GWJ A;  1N3C A;  1UOC A;  3ATU A;  4IG3 A;  4DQQ A;  4JN4 A;  5CY4 A;  1NJY A;  2OPS A;  1C0T A;  2OTJ N;  1DLO A;  1B9D A;  4O0J A;  3TR8 A;  4V19 S;  4FJG A;  4L3Q A;  3L3U A;  3D2F B;  3NF7 A;  3TU5 A;  3KK2 A;  4WQ4 C;  2YHY A;  1N5Y A;  1NGA A;  4BE2 A;  2QXF A;  5FRO A;  4BRE A;  4DUZ K;  1NKC A;  3ZEU B;  5FPN A;  1ATS A;  5EU7 A;  1BL3 A;  3LP1 A;  4JK8 A;  1LWY A;  1XI1 A;  2NNW A;  4DTU A;  2X74 A;  3CG7 A;  3OST A;  1QHT A;  1JXE A;  4MLE A;  1TAU A;  4HCB A;  5AQJ A;  3PLA A;  4DSL A;  1WSE A;  4QS9 A;  2BAN A;  1HKB A;  3HK2 A;  5I9E B;  3T19 A;  2ASM A;  5C2D A;  4IOA L;  4W5R A;  1X9M A;  2KTQ A;  4NXM K;  1LV5 A;  3KJV A;  1S6Q A;  4Q0B A;  3MAQ A;  1RFQ A;  3TSQ A;  1VQ6 N;  3C04 A;  1S5J A;  1LOT B;  4E89 A;  1I94 K;  3HBT A;  4FJN A;  4DF8 A;  3ENO A;  3F5T A;  3QIP A;  1Z25 A;  2HF3 A;  1FK9 A;  3KKR A;  4AHU A;  2V7Y A;  5KGX A;  3MXM A;  4DV2 K;  3VQ5 A;  4ZHR A;  4E7L A;  3FZL A;  3EY1 A;  1NK6 A;  4QCL A;  4K42 A;  5HOO A;  4F3T A;  2DKC A;  1W9H A;  2P9S A;  3TAE A;  3CXC M;  4J2E A;  4AF1 A;  1RTJ A;  5IYB P;  2GEL A;  4KBO A;  3NGY A;  3ASM A;  3CCM N;  1AIS A;  5AQG A;  5CYQ A;  3S3O A;  4JKH A;  3CFR A;  3J7Z O;  3DOK A;  3QIO A;  2ASP A;  3RWU A;  2HVI A;  4FK4 A;  4LC9 B;  3ZT0 A;  4U67 L;  1ATR A;  1HNI A;  4DR5 K;  1CZ9 A;  2OPP A;  3QB0 A;  4GVE A;  4CW7 B;  4R5P A;  4E1J A;  4ROD B;  4KRF A;  4B3T K;  3EE8 A;  5IT9 O;  4FL9 A;  4CZM A;  4B1V A;  2BUP A;  2ATQ A;  4OPA A;  3WEE B;  1UAX A;  1KLM A;  4CJK A;  3V6D A;  3R9P A;  4KB1 A;  1REV A;  4CJ5 A;  1QN6 A;  3DXM A;  2QA4 N;  3D2E B;  1JLG A;  4BRN A;  4DCH A;  1BCO A;  4FWQ A;  3FE1 A;  1HJO A;  2G8W A;  3O4N A;  1VQL N;  2WON A;  1BIZ A;  1ASV A;  1QHA A;  4WQ5 A;  4RWT A;  1QS4 A;  5FRN A;  4A57 A;  2ZGZ A;  2UXB K;  1QQN A;  5F0X A;  3AVL A;  3CVT A;  3O4W A;  3IRX A;  1X9J A;  1OH5 A;  1B9F A;  4CHN A;  3DXK A;  4HUE A;  4I9Q A;  3CM5 A;  3P4I A;  3KVG A;  3OHR A;  4A62 A;  3SUN A;  3I0W A;  1I3A A;  3O8M A;  1TVR A;  1QSS A;  1C0F A;  2E1Z A;  4CBX A;  4Z4F A;  1MPG A;  4DV7 K;  1OH6 A;  1HMV A;  5CZ1 A;  1NH2 A;  4N47 A;  3SZ2 A;  5KQ8 A;  4EP5 A;  2JPI A;  1WJW A;  1YTF A;  3RSE B;  4B08 A;  3DLH A;  3E66 A;  3DJC A;  3C7N A;  3AV9 A;  2PBD A;  3O9R A;  4CJE A;  1RTD A;  3FGU A;  4O8U A;  3KK7 A;  3QER A;  4FZY A;  1NJI O;  2YJF A;  1NJX A;  4E7H A;  1RCH A;  4JEP A;  3U9Z A;  3SAF A;  1XNR K;  5JLH A;  1YT3 A;  1XWL A;  3QET A;  3CWA A;  3UB5 A;  1A5X A;  2JLE A;  3RMB A;  4J2A A;  3NCI A;  4GY2 B;  1JLF A;  2FGT A;  3EKU A;  5LMN K;  4N76 A;  3P39 A;  3K5L A;  4M3W A;  2NOE A;  1J5O A;  4CJQ A;  3TAR A;  4J8F A;  1U45 A;  3ZSV A;  1JLQ A;  3EN9 A;  3VEZ A;  4F2R A;  2GV9 A;  4ISE A;  2OZS A;  4F3O A;  1JLE A;  4C8M A;  5J2P A;  2ETJ A;  5JS1 A;  4CHO A;  3KK3 A;  2RPI A;  3H45 C;  4MO5 A;  4FW2 A;  4A61 A;  1VQ5 N;  3O9T A;  4HHT A;  2IVO A;  2YA3 A;  3G4S N;  4DU1 A;  3NVM A;  3ZX3 A;  2CGK A;  1J54 A;  3AA3 A;  3K9K A;  3V9W A;  1WQA A;  2BGG A;  3BF1 A;  3AO5 A;  3IS9 A;  1VTL E;  2HOE A;  4WF9 L;  3HOS A;  3UIQ A;  4RW9 A;  1NK5 A;  3V9X A;  2D5R A;  1XQS C;  2GWK A;  4YOV A;  1XMO K;  1RDW X;  4JKF A;  4LF4 K;  2QM1 A;  4DTX A;  3PO4 A;  4F9O A;  3NA5 A;  3R1X A;  5HL7 L;  3TSP A;  1NMN A;  4CER A;  2EHB D;  2P9U B;  3T1Y K;  3DLR A;  3HPH A;  5AR0 A;  3U8X A;  1QVG M;  3RR7 A;  4Z4G A;  5FPM A;  1SKR A;  3K2P A;  5JN5 A;  4JHD A;  2OA8 A;  4CEA A;  3SBG A;  1RBT A;  4U7B A;  4O8K A;  1QQC A;  5AQY A;  3OSE A;  3K57 A;  1MU2 A;  4B9Q A;  1KCF A;  2KKZ A;  3HM8 A;  4KI4 A;  3THV A;  2I7P A;  1V4S A;  3P38 A;  1GLB G;  4M3T A;  3CME N;  3HTV A;  4IO9 L;  1OH8 A;  4CHP A;  4YOW A;  4CJ4 A;  4EZ9 A;  1C1A A;  1S1V A;  1VQN N;  5AQP A;  1LWV A;  3CCE N;  2IV8 A;  3EEQ A;  3LP3 A;  3LDL A;  4CEE A;  4B1Z A;  2FSJ A;  3K9J A;  3ZSY A;  4BVP A;  2GUP A;  3MWT A;  1N39 A;  3HS8 A;  4DLG A;  3AGK A;  3ATV A;  1K73 O;  4CJW A;  3D2F A;  4H0P A;  1VSL A;  5M1O A;  4KHP K;  3AVG A;  4CEZ A;  1VSD A;  3OH9 A;  3I0R A;  1GLC G;  4FPB A;  4FXD A;  3ZEU A;  3VET A;  3QFU A;  2YV0 X;  5DMR A;  1TV6 A;  2QWN A;  1LXT A;  1YJW N;  1OVQ A;  4TSX A;  2QEX N;  1JCF A;  4CHQ A;  1JJ2 M;  1HR0 K;  3O9S A;  3HOT A;  2HZS A;  4RTF D;  4BY9 C;  1HNW K;  3WQT A;  4J2D A;  3SQ0 A;  4LF9 K;  2P9N B;  4DF4 A;  2Q1N A;  1VQ9 N;  4ROE B;  4EAG A;  3O1B A;  3FZK A;  2IVN A;  3KKS A;  5LL6 Z;  1NGG A;  1S1U A;  3NBP A;  3K59 A;  3NH2 A;  1LAW A;  5HRP A;  3L0Q A;  1S1W A;  3OYE A;  3EE9 A;  3I0S A;  1JLB A;  1EWQ A;  1GLD G;  4G1Q A;  3RR8 A;  3VQQ A;  2FBT A;  1N34 K;  5JVG L;  1SAZ A;  5AQK A;  2RF2 A;  3G10 A;  2IOC A;  1HPZ A;  2A5X A;  4IWV A;  1BGX T;  1JLA A;  3FZM A;  2I5W A;  4O5B A;  1HUX A;  2ZJP L;  4I2Q A;  4DV6 K;  3QEI A;  2KHO A;  1ZXO A;  1TBA B;  4NO7 A;  2G8I A;  3O1W A;  2UXD K;  1M5Q 1;  1BIS A;  1Q82 O;  4B8A B;  3QEW A;  4CES A;  4KPY A;  4MLH A;  3DLE A;  3RSM A;  3ZSZ A;  1H1V A;  2AP1 A;  5C25 A;  4H4M A;  3T69 A;  4KI6 A;  4LD0 A;  2HHS A;  1J9A A;  3CWU A;  3CCJ N;  4CD3 A;  1Q9X A;  1YIT N;  4DSJ A;  5F9C A;  5C2F A;  1SKW A;  3M3Z A;  3TDH A;  2V52 B;  4DS5 A;  5AQX A;  3G71 N;  2KW4 A;  1GLE G;  2P9K B;  1LWE A;  4XH4 A;  5LY3 A;  2F7L A;  2CGL A;  1Q9U A;  4PL8 A;  3U6F A;  4ILJ A;  3OYI A;  4NCB A;  4IKF A;  5A2Q O;  3AA4 A;  5CZ2 A;  3ISN C;  2W40 A;  4XH1 A;  5BRD A;  1HLU A;  3LAM A;  4LH5 A;  1TK8 A;  3SBT A;  2XY7 A;  5KTQ A;  2FBY A;  3WEE A;  2WTU A;  3CMA N;  1IG8 A;  4CJL A;  2NOF A;  3TSU A;  5AQO A;  4DSF A;  5AQU A;  2RE2 A;  3NE6 A;  2QK9 A;  4EJZ A;  1EET A;  3D2E A;  5GAG P;  3MN5 A;  4GKJ K;  4B9L A;  4O0I A;  1RBV A;  1YQK A;  1NGM A;  4CEB A;  3F2K A;  2QRD A;  5JVH L;  2KZZ A;  1KVA A;  4NLB A;  3SK3 A;  4DV5 K;  2F96 A;  2NRH A;  5AQL A;  3LM9 A;  1TKX A;  2LAE A;  2B4J A;  4WFN L;  1NGD A;  4BRG A;  2O8D B;  4UY8 O;  3A5N C;  1NK0 A;  4FPA A;  4K0K K;  3VA0 A;  2YHB A;  4CF2 A;  4JKD A;  2HW3 A;  4CED A;  2E2Q A;  4HWI A;  1QNA A;  3VPZ A;  3HYF A;  2YI1 A;  4BRK A;  1M1K O;  3MX2 A;  5HLF A;  4WYB A;  1T44 A;  4HCC A;  4K8Z A;  3LDN A;  3SUO A;  3RSE A;  3ZT1 A;  2QR1 A;  1ESV A;  2HZM A;  5GAD P;  1KVB A;  3K0S A;  2DTU A;  1NM1 A;  4DTO A;  3CQY A;  5MLC Q;  5BRE A;  4BC3 A;  3VQ6 A;  4FWR A;  1PCM X;  1ZBF A;  3TAM A;  3TAN A;  1ILY A;  2D0B A;  1YTU A;  3CER A;  3M8P A;  2P9I B;  2D0A A;  5AQI A;  5T7B A;  2AJQ A;  3PSI A;  3UW2 A;  1VRU A;  4AM7 A;  2HHV A;  2H3G X;  2YHX A;  4OKJ A;  3CC2 N;  3Q7B A;  3V1R A;  4DV1 K;  4Z4H A;  3IH7 A;  3OA9 A;  2AA4 A;  1S3X A;  2FF3 B;  5M1F A;  1NGJ A;  2ZJQ L;  4OKE A;  3L4I A;  1E4F T;  4B9U A;  4EHT A;  3OYN A;  1TKT A;  4C8K A;  1LW0 A;  1RT2 A;  1KD1 O;  3TPQ A;  4I9L A;  1SL0 A;  2O4I A;  2F9T A;  3UKU B;  4F4K A;  1WB9 A;  5E26 A;  2Q97 A;  1IO2 A;  5F1X A;  3M8R A;  3M5R A;  3O3H A;  4DQ8 A;  2NUB A;  1K6Y A;  5EVZ A;  2OPQ A;  3DM2 A;  2GBZ A;  4B9T A;  5KGW A;  1J53 A;  2NRR A;  2NOL A;  1YAG A;  3ZSX A;  2HND A;  1NU0 A;  5FDL A;  2PY5 A;  4K8X A;  3CET A;  4JI8 K;  3RVC A;  2P9U A;  5CHI A;  1HPM A;  5IYD P;  4DU4 A;  1S22 A;  2YX6 A;  5K14 A;  3ENH A;  4ICL A;  4FZX C;  1KSP A;  3OYB A;  1VOK A;  2OPR A;  1W2B M;  1YHQ N;  1WAJ A;  2Q0U A;  4BGA A;  4M45 A;  3UKR B;  2ASO A;  4M63 C;  5GAE P;  4OGE A;  3BF3 A;  2PAV A;  5DK5 A;  1V5S A;  4FLW A;  3U3Y A;  3S3N A;  3I8B A;  2KFZ A;  1BI4 B;  1FXX A;  3KRM A;  4YOY A;  4DS4 A;  2I5J A;  1Z6R A;  2Q36 A;  1JLC A;  5I42 A;  4CF1 A;  4CK3 A;  4DLE A;  3VGK A;  4GW6 A;  4M3Y A;  2HHQ A;  2D0C A;  1CZB A;  2MZ8 A;  1RBR A;  2BTF A;  1IKY A;  2G8H A;  5HRS A;  1IBM K;  1QZ6 A;  3ZSW A;  5IWA K;  3T7Z A;  3KTU A;  1XMQ K;  3DLL L;  4M3U A;  2A42 A;  2YNI A;  3ENB A;  3J81 O;  2OYQ A;  1C0U A;  4CCH A;  3AAR A;  4YOT A;  3KLG A;  2NRX A;  4JNE A;  2DKD A;  5C0Y A;  1EXQ A;  4Y1C A;  2E8A A;  4B1W B;  3E9L A;  3U3G A;  3DLK A;  4BR0 A;  3AVK A;  4KKO A;  2JHJ A;  2NOB A;  4Z0U A;  1QTM A;  4ELU A;  4EAI A;  1A5W A;  2QWO A;  4B3R K;  2Z1H A;  2ZM6 K;  2BDP A;  4DR1 K;  2A41 A;  5KPR A;  3OGD A;  3TTF A;  4B9V A;  2HKP A;  2NLX A;  4DR6 K;  4W5Q A;  5AFU A;  4GV9 A;  3KHY A;  1PCZ A;  1WSH A;  4AH9 A;  4JI0 K;  3CM6 A;  5BR9 A;  4QS7 A;  3IDH A;  2QTD A;  1NKB A;  3ENC A;  5AZJ B;  4H0T B;  4BQL A;  3LWL A;  3L8B A;  3AA2 A;  1NG9 A;  3VEN A;  4B9M A;  2VGM A;  1X3N A;  1NGB A;  3VQD A;  5JLF A;  3DMJ A;  1N33 K;  2HHH K;  1VSH A;  4G9Z A;  1ZBI A;  4LSL A;  3KIO A;  4OLA A;  1BCM A;  4JRP A;  3P83 D;  3MDQ A;  2A40 A;  1NKE A;  2KLA A;  1IBK K;  2NVM A;  3G25 A;  3NF6 A;  3OYJ A;  3HST B;  3EZ5 A;  1EX4 A;  1BQN A;  3DRR A;  3HP9 A;  2NOZ A;  3S41 A;  1VOL B;  2P9K A;  1L5U A;  1BUP A;  3ZSQ A;  2IIR A;  3O3G A;  4H0X B;  4IDK A;  2XO7 A;  4DSI A;  4JLH A;  3J7Y P;  1C0M A;  4PHT X;  3E01 A;  2ITG A;  3VEX A;  4M7X A;  4ID5 A;  2V51 B;  1KFQ A;  3VQP A;  3HO1 A;  4OJR A;  3CC4 N;  1TKZ A;  4NLC A;  1VKL A;  4Y1D A;  4A2A A;  3OYC A;  4RG8 A;  1SS6 A;  3LAL A;  4K41 A;  4EP4 A;  3BP8 A;  3H3O B;  3M8Q A;  4FM1 A;  4BRL A;  5I3U A;  1X3M A;  4DSE A;  3AVC A;  4Z4C A;  1D8Y A;  3LPT A;  3DRS A;  4CEF A;  4DTP A;  4CF8 A;  4BE1 A;  5HRN A;  1KFD A;  4WX8 A;  4M3X A;  3D6R A;  3VEV A;  4RW8 A;  3NFA A;  4KHQ A;  1Z05 A;  1IV0 A;  4JK7 A;  3CJ1 A;  2DPN A;  4BR2 A;  3MMV A;  1NLV A;  3AVH A;  2PYJ A;  4ILH A;  4M3Z A;  2OOX A;  3ZX2 A;  5AQV A;  4DWI A;  2O8D A;  3A0I X;  2G8K A;  1IKV A;  2O8C B;  4FLV A;  4CGF A;  1Q18 A;  3K5M A;  3G0Z A;  1L3T A;  2JOI A;  4WZS D;  4YDU A;  1NMD A;  1RDC A;  2CH5 A;  4CJV A;  4OPH A;  3NGI A;  4CI6 A;  3CQX A;  1YQR A;  4KTW A;  1IJJ A;  4EIA A;  1QN9 A;  4FWN A;  4IL8 A;  1YI2 N;  3B6P A;  4CHY A;  2GX9 A;  4ISF A;  1UA1 A;  3PIP L;  1HQU A;  1B9K A;  3ZSR A;  3P31 A;  4NYN A;  3V4I A;  3KD1 E;  4CZE A;  4H5W A;  4H5T A;  3WNG A;  4A59 A;  2VQE K;  4DFP A;  1Y64 A;  2P9I A;  3AO4 A;  1QQM A;  2EWS A;  4IDH A;  3F73 A;  4I2P A;  1KAX A;  3AVI A;  3D0P A;  1Q86 O;  1ZBH A;  3Q7C A;  1HKC A;  3WXL A;  3JSM A;  3TTC A;  5AQS A;  1NGC A;  2UYT A;  3LDQ A;  4OO1 J;  4JK9 A;  2E4L A;  3DLB A;  3DPU A;  2A1S A;  3AVB A;  3IG1 A;  1QQO A;  4AHV A;  2Z0F A;  3JS6 A;  3BEX A;  4WQ4 A;  2G8F A;  3MCP A;  3QO9 A;  3GDQ A;  2HBL A;  1JL2 A;  4NB4 A;  1JCE A;  3CFO A;  4CIF A;  3UKU A;  4BRD A;  1NJZ A;  2FF6 A;  1U2V B;  5HRO A;  1RT6 A;  5M1N A;  4FJ9 A;  3F10 A;  3VEY A;  3OSM A;  4Z4E A;  4BG8 A;  4N56 A;  1EO1 A;  4BRO A;  4BRI A;  4FLU A;  1VQ8 N;  1QNC A;  4KHW A;  3LM2 A;  4FSV A;  1K9M O;  4DUL A;  2Y8Q A;  4NXN K;  1WNS A;  5AZI B;  3CW7 A;  2IC3 A;  2ITM A;  3PX6 A;  1EWR A;  1RT1 A;  3VOV A;  3VQE A;  4A2B A;  4MRQ A;  1YTA A;  4A5B A;  3O3F A;  3SPY A;  3OS0 A;  3I3W A;  1DTQ A;  3OS2 A;  3HS9 A;  5E41 A;  1NGH A;  2Q31 A;  4Z4I A;  3CJA A;  5AQZ A;  4CK2 A;  3OCI A;  1VQO N;  1RT4 A;  4HVJ A;  4KHY A;  4CZJ A;  3T4N A;  3VQ4 A;  2W6K A;  1KYD A;  4CF9 A;  3SJH A;  1L3V A;  3O9U A;  3VA3 A;  2VWB A;  2EX3 A;  1J6Z A;  3UKR A;  5GIN A;  2VWK A;  1VQM N;  4FJ7 A;  3THY B;  2UU9 K;  3ULD A;  1HU0 A;  1BI4 A;  4CZK A;  1EBM A;  3H1V X;  4CIG A;  2Y1I A;  1HYV A;  4UQG A;  3MCA B;  1KC8 O;  3A5L C;  2PZS A;  5HP1 A;  1JL1 A;  3PUF A;  1KAZ A;  4ROC B;  2UXC K;  1EKE A;  4B1U B;  1QN3 A;  4B1Y B;  1W7A A;  5D3G A;  2Q2R A;  1WSI A;  1ASU A;  5KL0 A;  2OCE A;  2VCP A;  5AQR A;  2HNZ A;  2V7Z A;  4BC4 A;  3TWH A;  3IMX A;  2WOM A;  4Q5V A;  2KQ2 A;  3JXU A;  4BR9 A;  1MWK A;  1W0H A;  3BY5 A;  3FZF A;  4DQS A;  3P5J A;  2HBJ A;  4BC2 A;  1QVF M;  1JCG A;  2P5O A;  1C0G A;  3O5B A;  3VMF B;  1A5V A;  1VSE A;  2QXL A;  3W3D A;  1U48 A;  5C24 A;  4JI5 K;  1N3A A;  2E6M A;  4JI1 K;  4J2B A;  5ADX A;  3R3L A;  1QNE A;  4CJP A;  1VQK N;  4H0V B;  1PCJ X;  3HI0 A;  4EAL A;  1HNX K;  2UUA K;  2VG5 A;  1RDD A;  3H1Z A;  5BPN A;  3THX B;  4CGG A;  4N5S A;  5KRT A;  4H5V A;  5KRS A;  3OYL A;  4OLB A;  4GKK K;  5SWM A;  5AZJ A;  2PWW A;  1NVP A;  1SZ2 A;  4IOC L;  1KY7 A;  4DB3 A;  3QNN A;  1OH7 A;  4FVM A;  2Z1I A;  4FLY A;  4JI3 K;  4IJN A;  3LDS A;  3NF8 A;  3J7A P;  5BRF A;  2RHK A;  3OY9 A;  1BHL A;  3IUC A;  3NH0 A;  4LH4 A;  4E7K A;  4FWL A;  3V9U A;  2IDO A;  3VQ7 A;  1WSG A;  1JKH A;  2ZQB A;  2WUS A;  2JHN A;  4CJF A;  3J80 O;  1NJW A;  2P5G A;  1TKD A;  4JYA K;  1OVY A;  4FZZ A;  3C6H A;  4DMN A;  3I55 N;  1UWB A;  4AM6 A;  3CD6 N;  1WN7 A;  4ISG A;  2F9W A;  1LWF A;  1S6P A;  2KFN A;  3D7Q A;  3MEG A;  5AJ3 K;  2O4G A;  4LFC K;  1KO9 A;  3L2W A;  1VQP N;  3A8Y A;  5M1K A;  1R0A A;  2X78 A;  4CJ7 A;  2HMP A;  2IV9 A;  3F0Z A;  1XHZ A;  4YOX A;  5EPC A;  3EO3 A;  1LWW A;  3S9H A;  4NCA A;  3OYK A;  4E0D A;  5E84 A;  5AQF A;  3D4V A;  3WNE A;  3HSC A;  4XEI A;  2DFF A;  4DFM A;  5FPE A;  2JWK A;  3KZB A;  1NBW A;  3PY8 A;  2HHW A;  4DTN A;  3F9M A;  4JKC A;  2HST A;  1I39 A;  3HZ6 A;  2W41 A;  4JKB A;  3CCS N;  1ITG A;  2QWP A;  4DTR A;  3ZX0 A;  3VGM A;  1N32 K;  1NK9 A;  1HJR A;  3OVN A;  5ELZ A;  3G6E N;  3NHG A;  2F8T A;  3ZT2 A;  4DR7 K;  1T7P A;  2NRW A;  2O8C A;  2O8E B;  3EYZ A;  3SYZ A;  2HHX A;  1T8E A;  3FZH A;  4M41 A;  4JI6 K;  1ASW A;  2XY5 A;  1GOB A;  2HL9 A;  3WNF A;  4E3S A;  4HUG A;  2YNG A;  1KTQ A;  2VG6 A;  3OJS A;  4QOZ B;  5C10 A;  4WFA L;  2DFH A;  4PQU A;  1DT9 A;  1Z26 A;  1RTH A;  4QG5 A;  4H0O A;  4FWM A;  4E7I A;  4BR4 A;  2QWR A;  3QLH A;  4BVO A;  3TAP A;  3DRP A;  1MP9 A;  4FJK A;  1U04 A;  1NWK A;  2F7T A;  5DM6 L;  3HP6 A;  4TPS A;  3CC7 N;  2GTD A;  1XUP O;  3M6G A;  1P8Z A;  2E20 A;  4DFK A;  3TAQ A;  4IOX A;  4DUY K;  3ZLJ A;  2YKM A;  1KAY A;  2BH1 A;  2HF4 A;  4IFV A;  5GIP A;  3WT0 A;  4ELV A;  1SUQ A;  4FJ8 A;  1RM1 A;  2JGU A;  2NRV A;  4BG9 A;  2O8F B;  3ULX A;  1CZA N;  1VSI A;  3PMG A;  2NZT A;  2DY4 A;  4W5T A;  4OPK A;  3RTV A;  1WAF A;  2HVH A;  5HSH A;  3OYA A;  2ZWH A;  4BR7 A;  5M1Q A;  2HHT A;  3CQ8 A;  2ZFD B;  4HJH A;  3MWP A;  4C8L A;  3QEX A;  1D4X A;  5IYC P;  4FLZ A;  3K5O A;  3H1Q A;  1U2V A;  3THW B;  2WFB A;  3K5N A;  4CE9 A;  3KWG A;  2YNH A;  1GLF O;  4KO0 A;  3CJ7 A;  3ENO C;  4DQP A;  3AY9 A;  3SMS A;  4IFY A;  5H1S Q;  1NK4 A;  4H5N A;  4LFB K;  4O55 A;  4ILG B;  4C8N A;  4CD1 A;  1HQE A;  3TI0 A;  4H8K A;  4JAX A;  4C1N I;  3CYM A;  4BR5 A;  1BA0 A;  5KI6 A;  1JFI C;  4DQR A;  1NNE A;  3WXJ A;  3M8S A;  3A2F A;  3DYA A;  1MWM A;  3FFK B;  4OX9 K;  1VTO A;  3C6A A;  3C94 A;  4BC5 A;  2QKK A;  1Y97 A;  2FBV A;  2HMI A;  4JKA A;  1YUW A;  1TL1 A;  5J2N A;  1VAZ A;  3CHW A;  3GBT A;  3FLC O;  4H5R A;  1UL7 A;  1EUV A;  1KYU A;  3VN5 A;  4A5A A;  1X1P A;  3SUQ A;  4EAJ A;  4B3O A;  2E6L A;  2KZM A;  4FCY A;  4BDZ A;  4CEO A;  3O4Q A;  1NK8 A;  3BGR A;  3OW2 M;  2ZF5 O;  4BRH A;  1P90 A;  2D0O A;  4FK2 A;  1N8R O;  3BKQ X;  1SQK A;  1RNH A;  3PIO L;  3RRG A;  1QTP A;  5GAH P;  1XC3 A;  4WQ5 C;  4LF5 K;  3SUP A;  2FUV A;  3HL8 A;  1TK0 A;  4EJY A;  2Q0R A;  4CF0 A;  1T3V A;  1XC9 A;  1XNQ K;  4CZF A;  5BR8 K;  4DTM A;  3WXK A;  4KB0 A;  2YCH A;  3EKS A;  1SV5 A;  5BN9 A;  1SL1 A;  1WBD A;  4JV5 K;  4B1X B;  4PKH A;  1FKP A;  4Y0W A;  3ZT4 A;  3LZI A;  4KRE A;  3SQ2 A;  1BQM A;  1QN5 A;  1RBS A;  4FOI A;  4BDY A;  3N4Q A;  5JIC A;  2VYP A;  3THX A;  4BDP A;  2P9N A;  2R5X A;  4W5O A;  4N41 A;  1CDW A;  1C9B B;  2FSN A;  3VER A;  4CEC A;  3I0X A;  2GUI A;  4H03 B;  1P5G X;  1TAQ A;  4JD2 B;  3JAM O;  4BRP A;  2OTL N;  3AA5 X;  1K8K B;  3JYT A;  1NOY A;  3MX5 A;  2CH6 A;  3QBX A;  1NGF A;  3N4P A;  4FWS A;  4BRM A;  2HL8 A;  3GOI A;  1D9D A;  3C6U A;  4BAC A;  1ZBS A;  2H4L X;  1BG3 A;  3LAN A;  3LDP A;  4QAG A;  2NRZ A;  2J4R A;  2BE2 A;  2LSN A;  2XHI A;  3O9Q A;  2XY8 A;  1TUU A;  4CGD A;  4EAK A;  2WC9 A;  5FRM A;  5HRR A;  4X65 K;  3V9Z A;  2OOY A;  4LF7 K;  1HYS A;  5C42 A;  2UUC K;  3CPE A;  3T1H K;  1WSJ A;  4O5F A;  1PZD A;  2E2N A;  4JS5 A;  4DU3 A;  3I33 A;  4IEI A;  4C23 A;  2RN2 A;  4RCH A;  4XIU A;  2E1Y A;  3OBW A;  1LW2 A;  3AO2 A;  2B6A A;  2VG7 A;  4CBU A;  4K43 A;  2D1K A;  3SMP A;  1QN4 A;  1QE1 A;  4MO4 A;  1KRP A;  4OVL A;  1RDA A;  3HM9 A;  3OYH A;  2EHG A;  3QES A;  5CYM A;  3V1Q A;  2V92 A;  4FLX A;  1YF5 L;  1W97 L;  3KLF A;  1K2Y X;  3I56 N;  2F8S A;  4FWK A;  3KWI A;  1GOC A;  3MEE A;  3AO1 A;  1GLA G;  2YJE A;  2Z1G A;  3CWS A;  4WXA A;  4NCG A;  1VSF A;  3N89 A;  3QML A;  4IG0 A;  3LZJ A;  2Q3S A;  4FJX A;  4H0Y B;  3F9K A;  4JI7 K;  4PY5 A;  1JDY A;  2FKM X;  5BMP A;  1BO5 O;  1GOA A;  1G99 A;  3GG4 A;  4B3S K;  1UA0 A;  2O8E A;  2HB5 A;  1D5A A;  3EZW A;  3VQA A;  4BRA A;  2YHA A;  3PDK A;  4O44 A;  5AN4 A;  1RT7 A;  4CJR A;  3HPO A;  1FJG K;  3CCU N;  2D0P A;  3NF9 A;  1HNZ K;  3U9D A;  1ZYQ A;  3D45 A;  1V4T A;  3WXM B;  1VSJ A;  1WUA A;  3AO3 A;  1LWC A;  3MK6 A;  5AFU H;  4EZ6 A;  2OAN A;  1KQS M;  4FJM A;  2QI2 A;  3SLC A;  2ZGY A;  3VF2 A;  3ZYY X;  2VQF K;  3C0B A;  4CJS A;  1VQ7 N;  4B9S A;  1HYZ A;  2FSK A;  4FM0 A;  3AVJ A;  3HPG A;  3L2Q A;  4B3M K;  3PV8 A;  4F2S A;  1Q8I A;  3MN7 A;  4OGC A;  3VTI A;  3OJU A;  3AAP A;  4FLT A;  5AQM A;  3TE5 A;  1Q81 O;  3C6T A;  3IKM A;  3OBY A;  3GE1 A;  4DQI A;  4FO0 A;  2FXU A;  3VEO A;  1KVC A;  1YTB A;  2IS3 A;  3CIP A;  1C47 A;  2O8F A;  3KTQ A;  3HVR A;  5LMU K;  4WCE L;  2XHB A;  1M3H A;  4FYD A;  2P9L B;  2Z1J A;  3ZT3 A;  4EHU A;  1S72 N;  1RT3 A;  4CK1 A;  4F8R A;  1O1W A;  2PFU A;  3VQC A;  4C7P A;  3EAY A;  1ATN A;  1Q9Y A;  1M90 O;  2QRE A;  1YVN A;  3E1Y A;  3ZET B;  3V1O A;  5B8H A;  1OKJ A;  1NGE A;  2E2O A;  4BRF A;  5JMV D;  2RKI A;  5AQQ A;  3TAG A;  3SJJ A;  2P9P B;  3U4L A;  4B9N A;  2FKF A;  1VSK A;  3I8D A;  3QDK A;  3L4Q A;  3THW A; 
#chains in the Genus database with same CATH homology
 3VQ6 A;  5KRS A;  3OYL A;  1ZBF A;  3KK2 A;  1N5Y A;  5SWM A;  4OLB A;  4AHT A;  4BE2 A;  2QXF A;  3TAM A;  5FRO A;  3TAN A;  1SKS A;  1N6Q A;  1NVP A;  1KY7 A;  3QNN A;  2D0B A;  1NKC A;  1YTU A;  3M8P A;  4FVM A;  4ID1 A;  2D0A A;  4PWD A;  2Z1I A;  1YQM A;  5EU7 A;  1BL3 A;  1VRU A;  3LP1 A;  2FBX A;  5T7B A;  1LWY A;  4FLY A;  4OKJ A;  3VQ9 A;  2VWJ A;  1XI1 A;  2HHV A;  3V1R A;  2X74 A;  3LDS A;  3CG7 A;  3OST A;  2P1J A;  3NF8 A;  4DTU A;  4Z4H A;  3DOL A;  3IH7 A;  1JXE A;  1QHT A;  4KAZ A;  1CLQ A;  1TAU A;  1YVU A;  4HCB A;  3OY9 A;  1S9G A;  1BHL A;  3RMA A;  3NH0 A;  4LH4 A;  4B8C A;  4E7K A;  4DSL A;  1WSE A;  3V9U A;  2IDO A;  4Q11 A;  3VQ7 A;  2BAN A;  4DSK A;  1WSG A;  3HK2 A;  1JKH A;  2ZQB A;  3VQB A;  4CJF A;  3T19 A;  1X9W A;  1NJW A;  1NK7 A;  2P5G A;  4KTQ A;  1TKD A;  3OC3 C;  1QNB A;  5J2M A;  4OKE A;  4W5R A;  4FZZ A;  1X9M A;  4FJH A;  2KTQ A;  4DMN A;  1LV5 A;  3IAY A;  3KJV A;  1UWB A;  3RPJ A;  4B9U A;  1WN7 A;  1S6Q A;  4FW1 A;  4C8K A;  3OYN A;  1TKT A;  2P51 A;  3MAQ A;  1LWF A;  1S6P A;  3B6O A;  4MFB A;  4Q0B A;  2KFN A;  1LW0 A;  1RT5 A;  1S5J A;  3MEG A;  1RT2 A;  4I9L A;  2O4G A;  4E89 A;  1SL0 A;  2O4I A;  4FJN A;  1KO9 A;  1C1B A;  4DF8 A;  3QIP A;  4F4K A;  3LPU A;  1Z25 A;  3L2W A;  1R0A A;  4WE1 A;  1FK9 A;  2X78 A;  1IO2 A;  3KKR A;  4AHU A;  3ZCM A;  1KLN A;  3M8R A;  3O3H A;  5KGX A;  3MXM A;  3S3M A;  3QIN A;  2IV9 A;  2NUB A;  3F0Z A;  1YQL A;  1K6Y A;  3VQ5 A;  4AHC A;  4CFA A;  4ZHR A;  4E7L A;  1XHZ A;  3EY1 A;  2OPQ A;  1LWW A;  3DM2 A;  4AIL C;  2GBZ A;  3OYK A;  4E7J A;  3S9H A;  4B9T A;  1NK6 A;  4E0D A;  1U47 A;  1QN8 A;  5KGW A;  1J53 A;  4QCL A;  4F3T A;  2NOL A;  3MXJ A;  3ZSX A;  2HND A;  1RTI A;  1W9H A;  5FDL A;  3WNE A;  2PY5 A;  4K8X A;  4FK0 A;  3TAE A;  2G30 A;  2DFF A;  4DFM A;  4J2E A;  5IYD P;  3EZ5 A;  1RTJ A;  4DU4 A;  2Z8U A;  4FJL A;  3PY8 A;  5IYB P;  2HHW A;  4DTN A;  3NGY A;  3PX4 A;  3ASM A;  1I39 A;  1AIS A;  3DLG A;  1D3U A;  1ITG A;  2FC0 A;  4KTZ A;  5CYQ A;  5K14 A;  4DTR A;  4ICL A;  3S3O A;  3CFR A;  4HTU A;  2G8U A;  4FZX C;  1NK9 A;  1HJR A;  3CFP A;  1R4X A;  3OVN A;  2YH5 A;  3NHG A;  1KSP A;  3ZT2 A;  3DOK A;  3QIO A;  5J1E A;  3V81 A;  3OYB A;  3MXI A;  1VOK A;  2OPR A;  4JS4 A;  1T7P A;  3RR7 A;  3RWU A;  2HVI A;  4BWJ A;  4FK4 A;  1WAJ A;  4KFB A;  3EYZ A;  3SYZ A;  4M45 A;  3ZT0 A;  2HHX A;  1T8E A;  4M41 A;  4OGE A;  1HNI A;  1WLJ A;  1ASW A;  1D8Y A;  2XY5 A;  1GOB A;  4FLW A;  5DK5 A;  1CZ9 A;  2OPP A;  3U3Y A;  3S3N A;  4R5P A;  2KFZ A;  1BI4 B;  3WNF A;  4ROD B;  1FXX A;  4KRF A;  3KRM A;  1HNV A;  4E3S A;  4YFU A;  3ALY A;  4HUG A;  2YNG A;  4DS4 A;  3BDP A;  2I5J A;  1UT4 A;  2NOH A;  3QEP A;  1KTQ A;  2ATQ A;  2VG6 A;  2IGI A;  3OJS A;  3V9S A;  4QOZ B;  1UAX A;  2DFH A;  1KLM A;  1JLC A;  4MQ3 A;  4CEQ A;  3NH1 A;  4CJK A;  3V6D A;  4PQU A;  5I42 A;  3H08 A;  1Z26 A;  1RTH A;  4PA1 A;  4CF1 A;  4CK3 A;  3FFI A;  1REV A;  4DLE A;  4E7I A;  4KB1 A;  4RW4 A;  4CJ5 A;  1QN6 A;  3QLH A;  4OPJ A;  1RDB A;  4CHZ A;  4DTS A;  4GW6 A;  3TAP A;  1JLG A;  3DRP A;  1MP9 A;  1BCO A;  2HNY A;  4M3Y A;  2HHQ A;  4FJK A;  1U04 A;  3QNO A;  2D0C A;  1CZB A;  2MZ8 A;  1RBR A;  2G8W A;  3O4N A;  1IKY A;  2G8H A;  3HP6 A;  2F8T A;  4TPS A;  5HRS A;  3ZSW A;  3RMC A;  4CJT A;  2WON A;  1BIZ A;  1ASV A;  4DFK A;  3TAQ A;  3KTU A;  1VK0 A;  4M3U A;  1QS4 A;  3HST B;  5FRN A;  2Y1J A;  2YKM A;  1LAV A;  2YNI A;  1CXQ A;  3AVL A;  1BIU A;  4PUO A;  3IRX A;  2OYQ A;  4GMJ B;  1B9F A;  1C0U A;  4CCH A;  4CHN A;  4CFC A;  1SL2 A;  4IFV A;  1DTT A;  3KLG A;  4HUE A;  3CM5 A;  4I9Q A;  4ELV A;  1EXQ A;  1SUQ A;  3MED A;  3SUN A;  4Y1C A;  4FJ8 A;  3I0W A;  1I3A A;  1RM1 A;  2JGU A;  3U3G A;  1TVR A;  3DLK A;  3AVK A;  3ULX A;  4KKO A;  1QSS A;  4GVM A;  1VSI A;  2NOB A;  4Z4F A;  4Z0U A;  1QTM A;  4ELU A;  2DY4 A;  4W5T A;  1A5W A;  4OPK A;  1HMV A;  2Z1H A;  5CZ1 A;  1NH2 A;  1WAF A;  4N47 A;  3RTV A;  2BDP A;  2HVH A;  3SZ2 A;  1X9S A;  4EP5 A;  3OYA A;  4ELT A;  4B9V A;  2HHT A;  1YTF A;  3CQ8 A;  4B08 A;  3DLH A;  5HBM A;  4W5Q A;  3AV9 A;  4C8L A;  4C8O A;  4CJE A;  3QEX A;  1RTD A;  5IYC P;  4FLZ A;  1PCZ A;  1WSH A;  3K5O A;  3SV4 A;  1U49 A;  4FZY A;  3QER A;  2G8V A;  4AH9 A;  2B5J A;  3CM6 A;  1NJX A;  4KHN A;  1NKB A;  1HRH A;  3K5N A;  3NDK A;  4E7H A;  1RCH A;  4CE9 A;  3SQ4 A;  3HT3 A;  1QTS A;  2YNH A;  1WSF A;  1D9F A;  3LWL A;  3L8B A;  1F21 A;  3AA2 A;  4KO0 A;  1YT3 A;  2HHU A;  1L3S A;  1XWL A;  4B9M A;  1XHX A;  3QET A;  2VJ0 A;  4DQP A;  1A5X A;  3VQD A;  2JLE A;  3RMB A;  4J2A A;  3NCI A;  3DMJ A;  1JLF A;  2XRI A;  2FGT A;  4IFY A;  4N76 A;  1VSH A;  3K5L A;  1NK4 A;  4M3W A;  2NOE A;  1ZBI A;  3DPT A;  1J5O A;  4CJQ A;  4O55 A;  4LSL A;  3KIO A;  4C8N A;  3KLE A;  1BCM A;  4OLA A;  3TAR A;  4JRP A;  3LP0 A;  1HQE A;  3P83 D;  1U45 A;  3ZSV A;  4HUF A;  4H8K A;  1JLQ A;  3TI0 A;  4F2R A;  4KHS A;  3CYM A;  2GV9 A;  1NKE A;  1JXB A;  2OZS A;  3AVN A;  2A1R A;  1C6V A;  1C1C A;  5KI6 A;  4F3O A;  1JLE A;  1JFI C;  4DQR A;  4C8M A;  3NF6 A;  3OYJ A;  2ETJ A;  3A2F A;  1EX4 A;  1BQN A;  3AVM A;  3DRR A;  2RPI A;  2NOZ A;  3DYA A;  3HP9 A;  4CGI A;  4CHO A;  3KK3 A;  1VTO A;  3C94 A;  4FW2 A;  1VOL B;  4RW7 A;  2QKK A;  3LP2 A;  3HVT A;  4HHT A;  1L5U A;  3ZSQ A;  3O3G A;  1Y97 A;  2FBV A;  4DU1 A;  1U4B A;  1UT7 A;  2HMI A;  4IDK A;  3SI6 A;  1J54 A;  2XO7 A;  4DSI A;  3AA3 A;  4JLH A;  1TL1 A;  1C0M A;  5J2N A;  3E01 A;  3OYD A;  2ITG A;  3V9W A;  2BGG A;  3AVA A;  1TGO A;  3MEC A;  4FM2 A;  4ID5 A;  2KZM A;  3AO5 A;  3IS9 A;  4KPY A;  1VTL E;  3VQP A;  3UIQ A;  3HO1 A;  4OJR A;  4RW9 A;  1CXU A;  1TKZ A;  3V9X A;  2D5R A;  1KYU A;  1NK5 A;  3C95 A;  3ITH A;  4Y1D A;  3OYC A;  4RG8 A;  3VN5 A;  3LAL A;  4EP4 A;  4E1N A;  4FJI A;  1IKW A;  3SPY A;  4DTX A;  3PO4 A;  2X6N A;  3M8Q A;  1X1P A;  2MJ7 A;  4AHR A;  1EP4 A;  4FM1 A;  3SUQ A;  5I3U A;  4CER A;  4DSE A;  3AVC A;  4LSN A;  4Z4C A;  2E6L A;  3OYM A;  3DLR A;  3HPH A;  3DRS A;  3LPT A;  4CEF A;  4BDZ A;  4FCY A;  4CEO A;  4DTP A;  4CF8 A;  1SKR A;  4BE1 A;  3O4Q A;  1KFD A;  5HRN A;  3K2P A;  3BGR A;  4KV8 A;  1NK8 A;  4M3X A;  2ZD1 A;  3OYF A;  2OA8 A;  4RW8 A;  3NFA A;  4CEA A;  3KD5 E;  4KHQ A;  1RBT A;  2PYJ A;  3AVH A;  2DFE A;  3AVF A;  2R7Y A;  1QQC A;  4FK2 A;  4M3Z A;  3K57 A;  1S1T A;  1MU2 A;  1KCF A;  1RNH A;  4DWI A;  4KI4 A;  3THV A;  3RRG A;  2G8K A;  1IKV A;  1QTP A;  4FLV A;  4CGF A;  3RRH A;  3SUP A;  3K5M A;  3HL8 A;  4M3T A;  1TK0 A;  4EJY A;  3G0Z A;  1TK5 A;  2JOI A;  4WZS D;  3NAE A;  1M3Q A;  1L3T A;  4CF0 A;  1XC9 A;  4CHP A;  4CJ4 A;  1RDC A;  4EZ9 A;  1C1A A;  1S1V A;  3VQ8 A;  4CJV A;  4H4O A;  1LWV A;  3NGI A;  4DTM A;  4KB0 A;  1SV5 A;  2IV8 A;  1YQR A;  1SL1 A;  3LP3 A;  4KTW A;  2ZE2 A;  1QN9 A;  4CEE A;  2IAJ A;  1KY6 A;  1FKP A;  3ZT4 A;  3B6P A;  3LZI A;  4KRE A;  4CHY A;  3SQ2 A;  1BQM A;  3ZSY A;  1QN5 A;  1RBS A;  4BDY A;  1UA1 A;  3P1G A;  1HQU A;  1N39 A;  1B9K A;  3HS8 A;  3ZSR A;  4E1M A;  4DLG A;  4NYN A;  1U48 A;  3V4I A;  1QSY A;  4BDP A;  1FKO A;  4W5O A;  5J2P A;  4N41 A;  1CDW A;  1C9B B;  3KD1 E;  4CJW A;  4JRQ A;  1VSL A;  4LY7 A;  3I0X A;  4CEC A;  3WNG A;  1B92 A;  3AVG A;  4CEZ A;  1VSD A;  2GUI A;  3I0R A;  3RMD A;  4CIE A;  1TAQ A;  3L2R A;  4FXD A;  3AA5 X;  4DFP A;  4NCA A;  2YV0 X;  5DMR A;  3JYT A;  1TV6 A;  3AO4 A;  4AHS A;  1NOY A;  4TSX A;  3L2V A;  4CHQ A;  3F73 A;  2QKB A;  4I2P A;  1D9D A;  2HZS A;  3C6U A;  4BAC A;  1L3U A;  1KYF A;  4FJ5 A;  3AVI A;  3LAN A;  3D0P A;  4QAG A;  4J2D A;  3SQ0 A;  1ZBH A;  2BE2 A;  4DF4 A;  2LSN A;  3JSM A;  2AJQ A;  1E42 A;  2XHI A;  2XY8 A;  3OS1 A;  4ROE B;  4CGD A;  4B0A A;  3HXM A;  4I7F A;  5JS2 A;  2E4L A;  3KKS A;  3DLB A;  3EIK A;  3DPU A;  1S1U A;  2A1S A;  3AVB A;  3IG1 A;  3NBP A;  3OYG A;  5FRM A;  1ZBU A;  5HRR A;  3K59 A;  3NH2 A;  4AHV A;  1LAW A;  3V9Z A;  4E19 A;  5HRP A;  1HYS A;  3OYE A;  1S1W A;  1VSM A;  5C42 A;  3I0S A;  1QN7 A;  3QO9 A;  4DTJ A;  2G8F A;  1WSJ A;  4CGH A;  1JLB A;  1PZD A;  1JL2 A;  4G1Q A;  4YNQ A;  4JS5 A;  4DU3 A;  1ZBL A;  2RN2 A;  3LAK A;  1IH7 A;  4XIU A;  3RR8 A;  3CFO A;  3VQQ A;  4CIF A;  2FBT A;  2OZM A;  1LW2 A;  3AO2 A;  2B6A A;  2RF2 A;  1NJZ A;  4B3O A;  2VG7 A;  3G10 A;  2IOC A;  1S1X A;  3SPZ A;  1HPZ A;  2YKN A;  3T1A A;  5HRO A;  3QEV A;  3SQ1 A;  1RT6 A;  1TL3 A;  1BGX T;  4FJ9 A;  1JLA A;  2I5W A;  3F10 A;  1QN4 A;  3OSM A;  1G15 A;  1QE1 A;  4O5B A;  4N56 A;  1KRP A;  4Z4E A;  4OVL A;  4I2Q A;  4FJJ A;  1RDA A;  4FLU A;  3QEI A;  1QNC A;  3OYH A;  3HM9 A;  2O3O A;  2EHG A;  3QES A;  4KHW A;  1TBA B;  5CYM A;  3V1Q A;  1QSL A;  4DUL A;  4BWM A;  2W42 A;  4FLX A;  2X6S A;  3KLH A;  2G8I A;  3KLF A;  1WNS A;  3L2U A;  2IC3 A;  1BIS A;  3KLI A;  3PX6 A;  2F8S A;  1RT1 A;  1GOC A;  3VQE A;  3MEE A;  3WNH A;  1YTA A;  3AO1 A;  3DLE A;  4B8A B;  4CES A;  1W80 A;  2Z1G A;  3O3F A;  3ZSZ A;  1DTQ A;  3OS0 A;  3HS9 A;  5C25 A;  5E41 A;  3OS2 A;  4L8R B;  4NCG A;  1VSF A;  4Z4I A;  4H4M A;  4KI6 A;  4CK2 A;  3N89 A;  3OCI A;  4IG0 A;  4LD0 A;  3KK1 A;  1J9A A;  3TAF A;  1RIL A;  3SCX A;  3LZJ A;  2HHS A;  1RT4 A;  2Q3S A;  4HVJ A;  1T05 A;  2PYL A;  1Q9X A;  4FJX A;  4KHY A;  4DSJ A;  3F9K A;  1SKW A;  4KHU A;  4PY5 A;  3VQ4 A;  1KYD A;  3SNS A;  1GOA A;  4CF9 A;  4DS5 A;  4Z4G A;  2KW4 A;  1UA0 A;  5SZT A;  2HB5 A;  3VA3 A;  4CFB A;  1L3V A;  2EX3 A;  4I8O A;  1LWE A;  1D5A A;  2YNF A;  3VQA A;  3U6F A;  2VWK A;  2YHA A;  3OYI A;  4O44 A;  5AN4 A;  4NCB A;  1RT7 A;  4FJ7 A;  3ULD A;  1HU0 A;  4IKF A;  1BI4 A;  4CJR A;  3HPO A;  3AA4 A;  3NF9 A;  1FN7 A;  3ISN C;  5CZ2 A;  3NGZ A;  3SNN A;  1EBM A;  3PX0 A;  3D45 A;  1ZYQ A;  1KFS A;  1S9E A;  4CIG A;  3LAM A;  4LH5 A;  1VSJ A;  3AO3 A;  1TK8 A;  1LWC A;  4CFD A;  2Y1I A;  4EZ6 A;  1HYV A;  4UQG A;  2XY7 A;  5KTQ A;  2FBY A;  3QEW A;  1RBU A;  5J2Q A;  4FJM A;  4CJL A;  2NOF A;  2PZS A;  5HP1 A;  1JL1 A;  3PUF A;  4ROC B;  4DSF A;  1EKE A;  4CJS A;  1QN3 A;  3LWM A;  3NE6 A;  4B9S A;  2QK9 A;  5JS1 A;  1VRT A;  4EJZ A;  1EET A;  1HYZ A;  3L3V A;  3ZSO A;  4FM0 A;  4B9L A;  4O0I A;  5D3G A;  3AVJ A;  1RBV A;  1WSI A;  1YQK A;  3HPG A;  3L2Q A;  1ASU A;  1NGM A;  4CEB A;  3PV8 A;  1IG9 A;  4F2S A;  1Q8I A;  4OGC A;  4RW6 A;  4ZTJ A;  2KZZ A;  3OJU A;  2HNZ A;  3DI6 A;  1KVA A;  4FLT A;  1IKX A;  4M3R A;  4IBN A;  3SV3 A;  3TWH A;  2WOM A;  4Q5V A;  3C6T A;  2KQ2 A;  2F96 A;  2NOI A;  1NOZ A;  4W5N A;  1W0H A;  4CJ3 A;  4M42 A;  4DFJ A;  3T3F A;  4DQI A;  1TKX A;  2LAE A;  4DQS A;  1KVC A;  2B4J A;  3P5J A;  4NYF A;  1NK0 A;  3HJF A;  1YTB A;  2IS3 A;  4O4G A;  4BE0 A;  3M8S A;  3KTQ A;  3VA0 A;  4DG1 A;  3HVR A;  3PO5 A;  2YHB A;  4CF2 A;  2XHB A;  1M3H A;  1TGH A;  2P5O A;  4FYD A;  2Z1J A;  3ZT3 A;  4CED A;  2HW3 A;  3K58 A;  1RT3 A;  1QNA A;  4CK1 A;  3HYF A;  4F8R A;  1O1W A;  1A5V A;  1VSE A;  3VQC A;  4CJU A;  1TBP A;  3TAB A;  4OKK A;  5C24 A;  4CGJ A;  2XY6 A;  1T03 A;  1Q9Y A;  4ZTF A;  1N3A A;  2E6M A;  4J2B A;  5HLF A;  1N3C A;  1UOC A;  3V1O A;  4IG3 A;  1QNE A;  4CJP A;  4DQQ A;  4HCC A;  4K8Z A;  5CY4 A;  3SUO A;  1NJY A;  2OPS A;  3ZT1 A;  1C0T A;  2RKI A;  3TAG A;  1DLO A;  2VG5 A;  1RDD A;  3H1Z A;  2HZM A;  3SJJ A;  1B9D A;  4O0J A;  1KVB A;  3TR8 A;  4B9N A;  4CGG A;  1VSK A;  4N5S A;  3I8D A;  4DTO A;  4FJG A;  2DTU A;  5KRT A;  3L3U A;  3NF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...