1A0OB

Chey-binding domain of chea in complex with chey
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chemotaxis
molecule keywords CHEY
publication title Structure of the CheY-binding domain of histidine kinase CheA in complex with CheY.
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 70
sequence length 70
chains with identical sequence D, F, H
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1a0oB00
2LP4A 1FWPA 1FFWB 1A0OB 1EAYC 1FFGB 1FFSB
chains in the Genus database with same CATH superfamily
2XS5A 2IMWP 4X66F 4BC9A 1U47A 1FTRA 3GV8B 5H9EJ 4BS2A 1TKXA 1W7WA 1U6BA 3W3SA 2ZH7A 4DSEA 5HO4A 3FMBA 4Q2MA 3Q0AA 2OPQA 1P1TA 3VQSA 2GVDB 5DDOC 1MSWD 5J2QA 2CQ3A 2G13A 4P7TA 2AGPA 2DO4A 2YX4A 5GADU 4M1KA 3I9V9 5HJXA 4ZS6A 4C7QA 1TELA 2VG6A 5KFOA 2HQ3A 4UOGA 1T02A 4X65J 2HIQA 3TUPA 5E5NA 2CKWA 4ILMA 4DUZF 4B9SA 1C0UA 2EFVA 2R8JA 4E0DA 4DR1F 4ED3A 1REVB 3UCGA 2X1FA 4IG0B 5DDRC 4PG4A 2PI5A 3EE3A 2GAGC 2H9ZA 2HHQA 5BYRA 3NMRA 3MMBB 3BGLA 4DV1F 2G0IA 2RT3A 1EQ0A 1S79A 1M5SA 3NAHA 3TEGA 5KFUA 3DKDA 5LOQA 1HW8A 1EJ7L 2YKNA 1PBAA 3FGVA 4TY9A 4KKOB 4KSEB 3TEHB 2M88A 1NNDA 2CQ4A 1WC1A 3HHLC 1S9EB 1OQ3A 4RNOA 1HNZF 4UY85 2ZKTA 3UW1A 5LJ5Y 2XSFA 4ECVA 2PD1A 2C3YA 4ALZA 3OQ2A 1FJ7A 4F4KA 2P8IA 1U1KA 5D3GB 3MMCA 4QW8A 2MHNA 3OLBA 5K9FA 1U7LA 2CQIA 1WHVA 2ACYA 4RWWA 4ETXA 4U7UK 1QSLA 5CZVA 4DXLA 1I51B 1AUDA 1XMBA 3UDLA 1RWOB 4G1PA 1VDHA 5A6PA 1VQYA 2W2OP 2F63A 4WP9A 4WU2A 1Y0HA 3FKBA 2D69A 4DQSA 1N34F 4CH1A 1JLBB 4LFCF 1KHVA 3J81U 1UVMA 4YR2A 4UZBA 4QBUA 1SVDA 1JXLA 1RADB 2BE7D 2Y0BB 1JNRB 5DQGA 2C28A 1KNZA 4I6YA 2RQ4A 3VVTA 2R7VA 4TY8B 3M1VB 5J1PA 3Q22A 2O66A 4FXVA 1PC5A 5J2NA 3K17A 4URQU 4DFPA 2ASDA 3CC2S 2HIYA 1EAYC 1SJRA 4WFXA 3NKYA 1AA1B 2Z2MA 3DOKB 3TQEA 1YJVA 3VTIA 1FWKA 4DHVA 2B0GA 1U4BA 3N6MA 4LF2A 2ZZNA 3SSSA 5GAEI 3QZ8A 3BSNA 4DFJA 3G6YA 1UA1A 4UF4A 4A8XA 2EBGA 2ZEJA 2Y1IA 2CPZA 2XY7A 3J7YU 4Y28C 1V5VA 3HHNB 1S9GA 3KJQB 3M8PA 3RGIA 4PXCA 3DI6A 1KFDA 1RTHB 3RUBL 1UPPA 4RJVA 3DLEA 4WKYA 4DFKA 4DPUA 4CO0A 3H40A 5FJ4A 1HL6A 2W8KA 3FUYA 3Q83A 2WK4A 1TP7A 1FRMA 3F56A 3C6UA 2MZJA 3Q8RB 2PA8D 1JX4A 4DZDA 2J5AA 2FJBB 1HNXJ 3DLLQ 1FDNA 2DCUB 4GC7A 2MZTA 4MMOA 1Z2ZA 3SIPB 3T3FA 4JI7J 3P5BP 3R6GB 1NJWA 2F4FA 4HLBA 4CDIA 4UZCA 4J9PA 3T1YF 3O44A 1OPIA 4PXBA 4K4XA 4DUYF 5KFTA 2ZDOA 2NZ4A 1HPZB 2MXYA 2H54B 1G6BA 2QZ8A 1UWAA 5FLXY 2J6UA 2Q6BA 3NL0A 3H8YA 1UAWA 2AX1A 1VRQC 5G4DA 4Z7CA 4DR6F 1OIAA 3GYXB 1Z1ZA 3RR7A 1TK8A 5F9NA 4Q0BA 4RR5A 1RTZA 4F3QA 1MW7A 2HHPA 4N8NA 3D67A 3R2DJ 5FIIA 4NYZA 4OZ3A 3JYTA 1XJWB 4HDGA 5HP1B 1JQGA 1ACMB 4ZIVA 1RAIB 3SYZA 3K5MA 3AOBA 3J7A1 2HVDA 1CS4B 1S0NA 2CQ0A 4CTAA 2CNLB 2HZVA 3QZ7A 2DH7A 4NA2A 4Y2CA 4LF5J 5E7OB 1U2FA 3E51A 3K0JA 1ZM3A 4JP8A 5KG3A 2UXCF 4QR0A 2F5GA 4CO4A 2M52A 2QLFB 2JL9A 1S1UA 1XQIA 4AL7A 2VC0A 1H2TZ 4LSNA 3OV7A 4USUA 3ZTPA 2IYIA 2CA9A 3PYDA 1S1XB 2FHJA 2OAUA 2C2OB 3CO9A 3Q2TC 4RNMA 3EPIA 1VFJA 2FHJD 2CYYA 2HNZA 1U49A 1RYSA 4MIWA 3IP0A 2BE2A 2R8HA 3BO4A 4TN2A 1H6KX 4BBYA 2Y1JA 3FDSA 1G4CA 1A0OB 3UVJB 2LU2A 3DGPB 2ZNYA 4QZVB 2Y1RI 1RAFB 1EB0A 2MMYA 1N5SA 2LFVA 1BY9A 2ALYB 4YQWA 1HBMA 1VS3A 4CRJA 1S4EA 2AD9A 2CQGA 3F0NA 2UUCJ 4J9VA 1RZMA 4KIAA 4AYBD 2UXDF 5CABA 4ZHRA 1RSCA 4UUWA 1SH0A 3M32A 1FVSA 1RP5A 2HFNA 1HI8A 2HKEA 2DNPA 3PJXA 4NXMJ 3M2UB 4EZ9A 2HG4A 3KG1A 3B54A 2KFNA 1LOUA 3UN2A 4CZCA 3SQGB 4QOTA 3NOCA 3H59A 4O3PA 2HLUA 3P6YC 1HA1A 2B7CB 4QW9A 1F9EB 2K3KA 4OZ5A 1YJWS 1SI9A 2ZJPQ 2HPUA 1NB2A 2B6AB 1YVFA 1RYRA 4Y2IA 5LXYA 2NREA 2RD5C 2ZBQA 5KFDA 3IRWP 1SH3A 1QVGR 4OYBA 2R7WA 1S72S 2LA4A 3KUHA 1WELA 2XCAA 4DCPB 3UDCA 1CC8A 1L3KA 1XN9A 3MM6B 1TKTB 2EFOA 2FYXA 2D1CA 4CLYA 3KHRA 1VQ9S 4ED5A 3PACA 1UEUA 4YUDA 3R5CA 2L08A 4IG3A 3CMQA 3W65A 5HBMB 2KRRA 4TU8A 2C2DA 1HBNA 1UW4A 4L74A 2ZHBA 4KH1B 5H9FJ 5GAGI 2GVZB 4LF7F 2JC0A 2NPFA 2NXUA 4N5SA 2J0XA 1GXUA 4PUOA 3V6KA 3M9OB 3OBIA 2NXJA 4FYVB 4KB7A 1RKJA 1IWGA 3ZNJ1 2GX8A 4USTA 2P6SA 3T9NA 3HKWA 5L46A 5C42A 2KXFA 3PW7A 4MTPA 5M2PA 5EX0A 1TV6B 1T9XA 1WI8A 3DOMB 5GAHI 2QLWA 4O3QA 1K8AT 2ILZA 4J9KA 3Q8VA 2KDOA 3AH6A 4UTGA 4AT1B 2XC9A 3M8SA 1TKXB 2HBQB 1HNWJ 3RBDA 2RQMA 3GWCA 5L9NA 1FCAA 2GMHA 1W2BR 2DO0A 3TR5A 4I69A 1WC0A 2OPQB 3D5MA 3M9NB 3PG9A 1VGYA 1N33F 5I3QA 2BJ7A 2EVZA 5J2QB 2UV8A 2DR8A 2IYGA 4U7CA 2RE1A 1O5JA 3VGUA 5C2GA 4H4KC 2HFOA 4PQUA 4Q45A 3SEOA 2SXLA 2VG6B 5HAOA 4DR4J 2OMOA 5B09A 2O1PA 1PYTA 4G65A 3D28A 2YTCA 4LIWA 1C0UB 4X4RA 2BW2A 3KKFA 2QT7A 4DV4J 1EHWA 1SQEA 2QA2A 5JMNA 3MF5A 2QMUB 3KHLA 1PBUA 1RT1A 4BHQA 4PCQA 4I1TA 1S57A 2YH0A 1SL0A 3N4WA 4JUZA 4V1Ak 2NXNA 4JI1J 2YKNB 2MZSA 2HHWA 3MOZA 5CAAA 1I94F 5B0EA 4R0JA 4OYIA 1WDDA 1U8SA 1FK9A 3FFIA 4DCOB 2CNKB 3TANA 4MKBA 4X4TA 2V5HG 3RRKA 2V2QA 1RU1A 3FCVA 3JS9A 2U1AA 3Q8YA 1KDNA 3FVYA 1YBAA 4DPTA 4LF9J 3FQKA 1YDLA 3DXBA 3MMCB 1RHJB 3N6NA 4DEZA 2IBOA 2NZCA 3FC9A 4X4VA 2XSJA 3TX8A 2DEJA 4N77A 1UZDA 3FK4A 5ITHA 3D0GE 3W7BA 2QTWA 4LF4J 2HHXA 1FERA 3N6LA 3IWLA 3PR4A 2ZJRQ 1MWYA 4PWDA 2QYCA 2AGOA 3VWSA 4CO1A 3FEYB 1IUJA 4J9MA 2FPHX 3ZZ0A 1XEZA 1WACA 4IQXA 3BSAA 2DVIA 1KVIA 2C1EB 3K59A 4LIRA 2CNNB 2OLWA 5DG8A 3UPFA 5J2NB 3N0VA 4P74A 2IFXA 1RAHB 2GHVC 2J6TA 1NZ8A 2C42A 2BJ3A 3M6XA 4EGLA 2XQCA 1IR0A 4JV5F 2B9EA 4GVBA 4FKXA 3I87A 3MPYA 1U0HA 5AT1B 3CTRA 5DJBA 4ITSA 2MZ1A 2IM0A 3MFIA 4NXNJ 4RW6A 2J7UA 3VAHA 1O51A 2HGLA 4EUVA 2P9CA 2KU7A 4OYPA 1PJ7A 4D3HA 2M8DB 4I2QA 3BN7A 3UD5A 2OKQA 5F9LA 4ECSA 4DSKA 1RQ0A 1M1KT 2VUGA 1AYEA 2GC8A 4Q8FA 4IUFA 5EWFA 1S9GB 3M8PB 3OL7A 4ZPVR 2KG1A 3J7ZT 4ED7A 2DHXA 2DRDA 3DI6B 1U8WA 1K47A 1J5EF 2C3PA 2Y9HA 4I2PA 3DLEB 2A2DA 4MKAA 2QA4S 4EWTA 2Y8YA 2BKPA 1QLNA 1Y00A 3OSNA 2BOPA 2VOPA 2G9OA 1O8BA 1NZAA 5I3UA 3C6UB 1HQEA 4A8SA 3QGGA 1UVLA 3PX0A 4NRTA 2WVBA 2CJQA 1LK7A 4IYQA 3T41A 1KBRA 4QIWD 3WHIA 3BO2A 3BH7B 4ZVRB 1NK5A 3CC4S 2C3MA 1S1WA 3GR1A 4X65F 2AJ1A 4AL5A 4ID5A 1JMTA 4WKRA 3KDNA 5F41A 4YY3J 4CIOA 1LWFA 1PILA 5FLXU 2DRAA 1M1GA 2FGCA 3DRXA 4FNIA 3KJVA 4GRSA 2IC3A 2XYGB 1N36J 1OJ4A 3NXZA 2XMWA 4YFUA 2ASJA 2XB2D 2KJWA 2LQ8A 2OH2A 2ROPA 4Q0BB 3A8IA 1UWBA 4YB7A 3VZIA 4Q2LA 3JYTB 1J27A 2HFVA 4U7UD 4WIQA 4U8VA 3CUNA 5BYSA 4DR7J 3GYGA 4RNHA 3MUTP 3PRVA 2K3IA 2ZE2A 2MQQA 5B0BA 2B5JA 3VAJA 3RAQA 4CTAB 2AJFE 2KT2A 1S48A 1SJQA 2AJ4A 1QY7A 5F8LA 4LREA 3V81A 3IC1A 2X51A 1KR4A 2JWNA 3T19A 1NDLA 2JEGA 3K8WA 2VBXA 1SJ3P 1NK8A 1S1UB 3HSZA 3OFHA 2BA9A 2HS4A 4RW4A 3FSIA 1YWXA 2NLWA 4DV7F 1UEKA 4IFVA 1KVJA 3ENWA 2ADBA 1UPMB 4TKTA 4TNOA 2HNZB 2OTLS 3BDEA 2BE2B 4DV0J 4BWMA 2BKOA 3HFKA 2CZ4A 4ZA1A 4J37A 4LRBA 5DS7A 2CDQA 3LGMA 2FLNA 4TLQA 3QIDA 2Q43A 1SUQA 3IAS9 4ZVPB 4CYUA 5HK4A 3T5KA 4FPIA 4ID8A 3TAPA 1HBMB 2BXJA 1UCNA 3O5TB 2UUWA 2XYHB 1VC0A 4FZVA 2I5JA 4ZHRB 3M32B 2CPJA 4QPTA 3D1OA 3ZZTA 2XI3A 3CDAA 1FX2A 4KHPJ 2QMWA 1WHYA 3BBCA 3FBBA 1D9AA 3IRXA 1BMQB 2D3OR 4GO5X 1T8EA 2FJVA 5F3TA 4DX5A 1RT5B 4NRUA 1VR6A 1T9VA 3IGVA 5L38A 1NKBA 3OUYA 2IDEA 2GJFA 3C6TA 3IR5B 1HLWA 1LQ9A 1FE4A 1U6ZA 3OL6A 3DHWC 4QR1A 5HLFA 3MZIA 1ZZFA 5B0DA 5B0AA 1IBCB 3UQSA 2V34A 1WJ9A 5DETA 2B9XA 2LMIA 2ZH4A 4YN3B 1HNXF 2BJ1A 3TQ1A 5DRKA 2AKWB 4ANCA 2KT5A 4IG3B 4RW8A 4Z2XA 1VC5A 1LWEA 2VQFJ 3HHKA 1HBNB 3UNYA 3IM9A 4WE1A 5KFLA 4JI7F 3NS6A 1D8ZA 4KAIA 1X31C 4PUOB 2A0FB 1J2VA 2A1BA 4ZITA 5FD1A 1M0SA 3PRDA 2VPXB 2DITA 1WF2A 2B4UA 5F8JA 5C42B 2CRLA 2QO3A 4MJKA 1FTCA 2V4JA 4HT7A 4RUCA 3QWPA 2QJ3A 2JEJA 4C8KA 1OSDA 5DGAA 1JXVA 2QGFB 2DIVA 2Z58B 3P45B 2KZZA 3N01A 4EFAC 3DDKA 1TR0A 2DIUA 4USHA 1ZAWA 2CQBA 4B3RJ 3CCZA 4OQJA 2ZH2A 2EK1A 4OV6A 1F9HA 4M5DA 5F8NA 1LWCA 5LM7E 3TX0A 3KMSA 4DMZA 1TAUA 1RWXB 4WFZA 1RWWB 3QWUA 4FF2A 1WOPA 4RUHA 3MUMP 3MAHA 4GKKJ 4LF5F 3GLJA 1TL5A 2JLFA 4PQUB 2WONA 3TARA 4F0KA 1YKWA 3MOJB 2HMIA 2PC6A 1NK9A 1JIHA 2YNGA 1XMOJ 3BGOP 5D0GA 3EXCX 2A6OA 4MFBA 2ZJQQ 2VONA 3NRBA 3OT9A 2QIFA 2B9WA 4CI0B 3RAMA 3BS9A 3DLBA 1VLOA 1W2IA 2J7WA 4DR2J 2IVFB 3BSOA 2XZWA 2DPIA 3QGPA 3NG8A 1RT1B 2AZ1A 2V8PA 3TZWA 4XIUA 3QGHA 1U0SA 1W25A 2DGSA 2A10A 5A76A 3H90A 4JI5J 1FK9B 3FFIB 1TQLA 3VCDA 1JJHA 4FKYA 4A8FA 4YMEA 3DGVA 2UUCF 2WBRA 3R1LA 3TI0A 2FJXA 3D0IE 3EM1A 2CJKA 3CJSA 2C3OA 2KT3A 2ZNZA 4I6AA 4Y34A 1HBOA 2PA3A 1X9MA 4NXMF 2XSJB 5HMWA 3DXSX 2FD2A 4ZLLA 3VHQA 2CPEA 4DF8A 2F4VJ 1Q5VA 2BR0A 4KH0B 2QL9B 1WKJA 2W7PA 1EX8A 4RLEA 2FVSA 1SXLA 4PWDB 2V8VA 3NWRA 3POTA 3EYZA 2RJZA 3HVRA 4QIEA 1AFIA 2O01C 5A0YA 3AOCA 1Y7PA 3NCRA 3VZHA 2IRXA 1CSJA 3B6BA 3OFFA 1T7PA 3WDOA 5BR8J 2DGQA 1DAXA 1SKRA 2DNQA 3UNGC 3P4UB 1SH2A 1HHQA 2D7SA 4IH6A 2G2OA 1U2CA 2Z8QA 2H4WB 2BABA 5CXTA 5F0WA 1QAXA 2FVQA 3O8WA 1ROFA 1UKUA 1CJVA 4GVBB 5EHHA 3T1HJ 2EFNA 1U0HB 1XR6A 4F36A 1F3VA 4ED2A 1VYAA 3GIRA 4LF6J 2E7WA 4S0MA 2Z30B 4RW6B 5ETQA 2DHHA 3OTDA 5CQGA 4J9SA 2DB1A 4KJIA 1Q8BA 1V3SA 5EUHA 2EBEA 4PPDA 2D9PA 4EI2A 3HD2A 2C2RA 2GJ2A 4I2QB 5D0EA 2DD8S 3Q8SB 3IFEA 1T95A 3RB4A 2R7SA 1EP4A 2E44A 4D3GA 2CQPA 2RUSA 1HNIA 3KK2A 2Z0GA 2FIUA 3AQPA 3VGVA 1C4AA 4I2PB 2NSCA 4NLGA 4KGMA 3RRGA 2V9WA 3OVSA 2Q1LA 2M2BA 2AWZA 1HNWF 5EGYA 5I3UB 4CO5A 2DEIA 2H1YA 1HQEB 1VHFA 3DLJA 1TK0A 4F67A 3SV4A 1BXNA 4ZP6A 4QIGA 1HYSA 3UCUP 3FCHA 2KXHA 4ZVSB 4GMKA 4H54A 5K8PA 3QT7A 3DLHA 3GJQB 4DR4F 1YJ7A 5DLGA 1S1WB 1WF0A 4ID5B 2CZ9A 3ZO7A 1YRTA 3F41A 4DV4F 1FX4A 1LWFB 1C0TA 2W9BA 4NLVA 4V19X 3ZC4A 4P72A 3KJVB 2F8MA 2IC3B 1IKWA 1F6TA 4TYBA 3OL8A 2HRTA 3IBFB 5HANA 3ZTSA 5E2QA 4JI1F 2OMLA 1UWBB 4RW7A 4F2SA 3G8SA 1S12A 1X4BA 2GQQA 3G82A 4ZVUB 3M7VA 4DQIA 1T05A 4CLWA 3HHDA 3S01A 2J0QD 3UI3A 4LF9F 2MLZA 2L9WA 2ZE2B 2YH1A 2B5JB 3US5A 4P2FA 1ZZNA 1SL1A 6FDRA 5KFHA 2FB0A 4B08A 4X84A 1WC3A 3M4XA 2R2SA 2VODA 4USIA 3V81B 1HQ2A 4LF4F 1K0TA 2PO4A 2P6TA 1R27B 5GMDA 2DH8A 3GJTB 2L48A 5H9EK 4RW4B 1FEHA 2NPIA 4K0KJ 1YBTA 1HWKA 3H4DA 3CCWA 2GW8A 1MN9A 4IFVB 1F9FA 2DCLA 2MKHA 3C8YA 2CXEA 4ELUA 4FDFA 3EGNA 4PXDA 2XMJA 3MXHP 2N4DA 1R0BG 5LSLA 2RHSB 3CCSS 3WC0A 4Q44A 2PFFB 2L3MA 1LW0A 1R6YA 4WTYA 3SFUA 3UD4P 3R1HA 2KM8B 1SUQB 4CYUB 3T5LA 3G96A 2MZRA 2QMXA 1Y3JA 2HHUA 1VBKA 1K1QA 5E3AA 2X1BA 2H3EB 2I5JB 2F8HA 1DQ8A 1DJ0A 1Q8IA 2AEFA 1S9FA 4Y6IA 5KFWA 3KTQA 1JB0C 4NXNF 3TJ9A 1LXNA 5AE3A 1X4GA 2XZDB 1AZSA 4PAAA 4ER8A 3MPWA 2DNHA 2JRSA 4FF4A 3CCUS 2EKYA 2R7OA 4DR3J 1F5CA 3OTEA 3IRXB 4USVA 5BYQA 4LRCA 3W9JA 4N41A 2Z57B 5A8KA 1FRLA 3SZ2A 1RT4A 4DSJA 2WVFA 1YBUA 2DXDA 1FF2A 2PEBA 2HQFA 4FVMA 1VBYA 4NLTA 3OTCA 3IR7B 1D1UA 4IRCA 3OUYB 4XDDA 3C6TB 4NCGA 3GV7B 2R3VA 3MM8A 4Y2MA 2HQCA 3MPUB 2EFGA 5IC6B 3SXLA 5HLFB 4DBQA 1IQTA 4KGXB 2RF2A 3KDOA 3SDEA 1P27B 1YJUA 2KRBA 1IVZA 4HH0A 3G87A 1NLKL 3ZFVA 2MB0B 3NP5A 2QL5B 2ZUAA 4HVZA 1LWEB 3AD9C 4F0HA 2KYZA 4WE1B 1KTVA 4EMDA 3FSYA 4J90A 4HYKA 1T03A 4P9SA 2WVEA 2DNKA 2HVEA 4YY3F 3GPAA 3BZQA 1HFEL 1C4CA 3W63A 2V4JB 2VV5A 8AT1B 2OI2A 4XPEA 1N36F 1NDPA 3W8GA 5CD4H 5U47A 5KFFA 3EDRB 3VQTA 4KO0A 1YJ9S 1B0VA 3T6BA 4C11A 1NHUA 1OWXA 4USMA 1N88A 2GQCA 3GIMA 2GNKA 3NEKA 3ZNUA 3M2VA 3ILIA 2VHGA 5DLFA 4LBPA 2DT9A 2ATCB 4M5DB 1UW9A 1LWCB 1FRHA 3PIOQ 2FJAB 4DR7F 2N7YA 4QQBA 3WIVA 5KFRA 4DPWA 5K8OA 4PKDB 3PDNA 3GJRB 1UJ4A 2ABYA 2VFTA 1EETA 2AV5A 3CJ5A 1H0HB 2AEMA 2WONB 3MR3A 4MK9A 2HMIB 2HFUA 4WYLA 4MIAA 3TJAA 4ELVA 2IJNA 1JLEA 2YNGB 3DYAA 3SBMA 3RRHA 4MFBB 2WVCA 3KMQA 1VIOA 1AFJA 2B51A 5MLCV 1U02A 4M95A 4AXIA 4X4NA 2ZOMA 4IR9A 4P6QA 1YSJA 2ZVSA 3NGKA 1OYDA 1ZM4A 4DV0F 4NLYA 4Q43A 3C66A 3CDUA 1NK0A 5KOWA 2VDHA 1MMDA 2CQDA 1QE1A 5DG7A 1FKOA 3B78A 2BRLA 3UR3C 4XTTA 1HHTP 5CA5A 4DN0A 3NS5A 4L6V3 3P49B 1NJIT 1M5VC 1XNQJ 4OYZA 2ZH1A 4RPFA 4ECYA 3CWJA 2WSFC 3GFZA 3PNIA 2HS0A 2ACMA 2WB1D 1IXKA 1S99A 3MURP 2FZCB 2RU3A 1HBOB 2UU9J 3QIPA 2J0WA 4WPAA 2RNEA 2ZFHA 1LXJA 2V8HA 1VISA 1FD8A 1XNRJ 3ISNC 3HVWA 2FUG9 2AX0A 1CG2A 2XMVA 1T9TA 1LFPA 3POTB 2HVZA 1CBKA 4B02A 2AF6A 4K5RA 5A0YB 9RUBA 3UE2A 3TZZA 5MAOA 2YWGA 4LRAA 4B17A 2UUAJ 4M5JA 4FP9A 3CDEA 2YNHA 4LQ9A 4MAKA 1SIZA 4NX9A 3JSMA 1S5ZA 1KQFB 1X0PA 1TUGB 3KLVA 2AJ2A 2MKSA 1BC6A 4DL5A 1H38A 1T94A 1B7FA 2DGTA 1RHQB 3EZUA 4Y65A 1CJVB 2CVEA 1XK8A 3Q2SC 3I6PA 2UVUA 3QT6A 5BXIA 3MDFA 3CJ8A 1M1HA 4OYAA 2VQFF 4ILRA 3ENVA 5ETRA 3BQ2A 2BW7A 4HL9A 3AB2B 4A8WA 4Y2KA 2KHCA 4NMXA 2OO4A 3OHAA 2I9SA 3DU5A 4P52A 4WWSA 4CT9A 1EP4B 2GO8A 2R2RA 1DLOA 2M3DA 1HNIB 3KK2B 4CM0A 1KLMA 1U1NA 1M5KC 1KQKA 1JJ4A 2YKAA 5GAEU 2DHGA 2Z56B 3DM2A 4HT5A 1NKCA 3AXKA 2DHSA 1X7VA 4CNZA 3VAKA 1I6JA 2HS3A 4OX7A 2OSRA 1FRIA 3CJKA 2XLJA 3CC7S 4KFBA 4DX8H 1UJ6A 4DR5J 2O3DA 2EK6A 3DLKA 4B3RF 3GFHA 3NCQA 4JV0A 4WZQA 4C3LA 4K2JA 5KFIA 2HWHA 4NEZA 1GK8A 4LRDA 4U95A 3K8VA 5CYQA 1F1BB 3DNCA 4QWBA 4GKKF 1HYSB 2J9DA 5HATA 3TVZA 1VQ4S 2AIRB 1FNMA 4XDCA 1F5BA 3EX7B 2UVRA 3SCJE 3GB0A 1TL1A 1WKLA 4HKQA 1NHVA 6AT1B 2Z2YB 1XMOF 1YLXA 3HM9A 4NLUA 3LGNA 1C0TB 4W92B 2OD6A 2W9BB 2XEXA 1VIXA 4X4UA 2YKMA 2KG0A 3HLUA 2E5HA 3R5DA 2OPSA 3BKFA 2XWYA 3C15A 3HZEA 5J1EA 1IKWB 4DR2F 2D3O1 2HHHJ 2I2YA 4DF4A 3QMQA 2IBKA 3GCXP 4DL6A 1HI1A 4X64J 1N5YA 5H9FK 2QYGA 4DX7A 1KFSA 2LKZA 4RW7B 3N9UC 1AT1B 1U25A 4JI5F 3LANA 3G82B 1QUPA 2DJWA 2RDDA 3P8BB 1T0TV 4YR3A 2VB6A 1T05B 1BQXA 3JAMY 3D54A 2KVQE 3MAAA 2ZBPA 5KAKA 1UVIA 3QAUA 2XY5A 3SCLE 3RAXA 1DY3A 2GJIA 1Q8KA 1WG4A 1MMLA 1NKEA 4ZMMA 5BJRA 2W4CA 3B82A 4M5HA 3KK1A 1N0UA 2CADA 2F4VF 3NAIA 1VBZA 1HNVA 1GTEA 3A3NB 1Q82T 3UD3P 2FY8A 1C2PA 4ICLA 5IS2A 5L1JA 4TLRA 4ZLPA 2W9AA 1UZHA 2BJ9A 1ZAXA 4HACA 2GHPA 4WCEQ 2EWHA 4FBTA 1WOSA 1L3TA 3LPYA 4B9NA 5BR8F 5D6GA 2HQIA 1LW0B 4K4ZA 4OI6A 1N56A 2AYEA 5F0UA 2IY5B 4WYWA 1Q53A 4P2XA 4TU9A 3TA1A 5I3PA 1QUVA 1RJJA 3ICLA 1Y5LB 5E41A 1PAUB 3T1HF 5K14A 1YX2A 2DR9A 4JB8B 4K4WA 1WC5A 4L73A 4LF6F 5HJYA 3CMES 1CC7A 4DZ6A 1NRKA 2HURA 1AZSB 2K06A 1S6PA 5KFGA 2DGVA 4XPCA 5L8RC 5EDWA 4K50A 2IJRA 4JBCA 5A8KB 3ET6A 1RT4B 3ZTOA 2ZITA 4J7CA 1H98A 2ZD1A 4PYAA 4E98A 1SC1B 3KHHA 2UV8G 5ETVA 2KYXA 2WSEC 4NCGB 4ZPTR 1FWLA 1VRUA 3MM8B 3W9IA 3C16A 4W90B 1UA0A 2HYIB 3A8EA 3ADAC 3W62A 4I67A 2M4MA 4KYZA 5GMKa 5D78A 1RWPB 2RF2B 4ZPDA 1CJKA 1V5IB 3SDEB 4LQ3A 4R0EA 1VHIA 4OX9J 3CJQA 2DGUA 1SKUB 3HVAA 2E7XA 3MCOA 4MKVA 3QFHA 3H2UB 4KTQA 1X8DA 5B0GA 1DQ9A 1RB0A 3PW0A 4PG7A 2XO6A 1RWKB 2W8LA 4X2BA 3JSYA 1GMUA 3AQOA 2QFIA 4IRDA 3MEKA 2F40A 5JVHQ 3PYEA 1PSDA 1KHWA 2PN6A 1T03B 1BHNA 3R7BB 4K4UA 2R7TA 4P73A 4J9OA 1HWLA 4OZNA 3NCPA 4YB5A 4C0OC 4CCHA 1PCAA 4OZJA 3Q89A 2BJEA 1LW2A 1ZOTA 5HQMA 2BOAA 4KO0B 4C11B 3MR7A 2B7BB 4O23A 5KFNA 4I6WA 4MH8A 1MROA 4HI1A 3BEGB 1ZS6A 5DM6Q 3IS9A 3M2VB 4FS2A 1F5AA 2E9TA 3V5RA 1TL4A 1YK9A 1SIWB 3FMWA 1X4FA 5GAHU 2CFXA 4LFBJ 1WG1A 3H20A 5CH7B 1ZBTA 2W1BA 2YBVA 1EETB 2VF3A 3ZZRA 4OLPA 2CJXB 4RU9A 1T9WA 4CLUA 3RBEA 1JLEB 1AUSL 3H5UA 3DYAB 2BJDA 4BDPA 2L41A 4K0KF 2V2KA 3M8ZA 1V3ZA 2ZZTA 3MM5A 1FKPA 2LEAA 3QRPA 4DS4A 3H2LA 1TMMA 3HKZD 1FDDA 4OX6A 3KWMA 5IXUA 1NBEB 3J7Z5 3BM7A 2JZ5A 1P9YA 1QE1B 1FKOB 1YJNS 3ZZUA 4OYOA 4ANDA 5J2PA 1NB7A 4WXOA 1WUUA 3PIPQ 1GXLA 1SB6A 1WOOA 2ZZMA 3GFXA 2IVMA 3D6TB 4F4YA 4B3MJ 1U1PA 4O3SA 3QIPB 2POKA 3JSBA 2R2UA 3LP0A 2N3OA 1RABB 1Q78A 4PEOA 2Z2ZA 4DR3F 1YHQS 1S1VA 4N56A 4R8UA 1V3RA 1YJTA 3NLCA 3KNAA 5CCMA 1S0VA 2MTLA 1A6LA 2XZTB 1S4FA 3BQ1A 1EKSA 1TL7A 4OJ1A 2CPHA 1SQFA 1VMBA 2EC0A 2H48B 2VG7A 4U6PA 1Q86T 2ERRA 3E3XA 2IDLA 2B56A 4PWWA 5KFMA 4B9TA 2YNHB 2ALZA 1EZZB 4OJGA 3GU0A 3JSMB 1N32J 3U7JA 2MPUA 3EDQB 3ISND 1SL2A 2KH9A 1HKAA 3PO5A 3PFOA 3HMJG 2RVJA 4M94A 4OHWA 1QDUB 1FKAF 5C7PA 3BJYA 1IBKJ 2J8SA 4G1IA 5D4NA 2VPYB 2AP6A 3SSQA 2N82B 2JSXA 5KG7A 4QWAA 5HMYA 1KS2A 4JI3J 3PFEA 3L4BC 1T11A 5C24B 1DLOB 1VJWA 3MWBA 1RT2A 3BQ0A 3HT3A 3H98A 3J80Y 3V6JA 1KLMB 1IBMJ 3DN9A 4M5KA 4XK8C 1T9YA 3DM2B 2R7RA 2K8GA 2RS2A 1N5QA 2CDRB 2V6AA 3FEZA 3SCIE 3CJKB 2L9NA 2M0GB 2ZH3A 3W61A 5KOXA 4ZLNA 1B7YB 4KFBB 3BB5A 2MLXA 3WX4A 4BCAA 3DLKB 3RTVA 2M9KA 2O67A 3ZTQA 1KOOA 2I6WA 2AYGA 5DO2A 4IO1A 4ECTA 4OHVA 3PW5A 3CW2C 1S6QA 3EVMA 2M8HA 1U1RA 3LWLA 3O2IA 4QR2A 4DL3A 5CYQB 2HK3A 2UVVA 2KFZA 2WW8A 3OTBA 2J7KA 2QA1A 3QAEA 5CYJA 3QT8A 2ZH5A 3AOAA 1TL1B 1HR0J 4J91A 1Q79A 4KQZA 3NMAA 3T6JA 2YWHA 3PVXA 4LT6A 3QQCD 4K4SA 4WK1A 4WIIA 3D6FB 1JK9B 3A13A 3MAQA 1X5SA 4F2RA 2YKMB 1QSYA 1S7IA 3KLFA 2OPSB 2HNDA 3C15B 5J1EB 4OHYA 1N5YB 1FFSB 3KFWX 1U1QA 2LQBA 1IM6A 2KVIA 2KB2A 2ASLA 2BUNA 3GR0A 4OJ3A 2CQ2A 4ZJLA 3JAMU 2FVCA 1XNQF 2LXUA 1WORA 3A8JA 3VGTA 3O6QA 1NK4A 3R97A 5KFCA 1TUWA 3AAWB 1HWIA 3MAAB 4X4PA 3KLIA 2C2NA 2UU9F 1XNRF 3PM9A 3L7PA 2Z2LA 2R8KA 3KK1B 1RISA 3DRRA 4L76A 4G1QA 1HNVB 2OGUA 2YVSA 1DARA 3EGWB 2XS7A 4HDHA 2IPOB 4DV6J 4RU2A 4ICLB 2I38A 2XBPA 4YHHJ 1DURA 2DRBA 2WW4A 2V68A 3U27A 4LF8J 4HACB 4P2MA 4LSZB 2B4PA 4UOFA 4NASA 3BBBA 4PG6A 2UUAF 2E1PA 4Z7YA 3MHYA 1XERA 2VL1A 3PTWA 3PJ9A 2NYIA 4GVLA 3DDIA 1MN7A 2QEXS 4Q7AA 3UO0A 4NCBA 1L3UA 3PZPA 1WTFA 2HVIA 2FZGB 5I42A 4AD6A 5D77A 3H5SA 3IA0A 5A8WA 3BSCA 1C1BB 1X5PA 4X4OA 2XMTA 2C2KB 3NGRA 5K14B 4FNHA 4C9DA 1BLUA 2HGNA 3W66A 3PW4A 3BKUA 3TUZC 2XMUA 4DDFA 5LSRA 4L72B 3TOQA 1PJ6A 3NY0A 2ROGA 4ECZA 3ONQA 2JHEA 1E6YA 5G0RA 1S6PB 1F60B 4C2MA 3CMAS 1F2GA 1GX6A 3U1MA 3TZXA 2A18A 4ZVFA 3VV2B 5LL6d 1B4SA 1UVKA 1XIQA 3ET6B 2KTQA 2EEYA 4M5NA 2FQQB 4A4JA 2ZD1B 2VH7A 1ZPVA 2YQ3A 3M2RA 4HEA9 5J2MA 3GCWP 1VRUB 3MEEA 3TUIC 3C16B 1R0AA 1S10A 3BGFA 1K1SA 2RKIA 3CJ3A 4DR5F 2BX6A 3OPKA 3J7AN 4QWCA 3OXFA 5IV3A 4DPXA 4NI2A 3TYTA 1CJKB 3CD7A 1BGXT 4K5SA 2VU5A 3HK2A 2H65B 3PCOB 2BQUA 4RW9A 3HULA 3MPDA 2R8IA 2K7JA 1PG5B 2E5IA 2CAJA 4FYXB 2LQJA 3DCAA 1SCJB 3EGZA 5THWA 1RT3A 5AXKA 2V94A 4I68A 1N52B 4ED6A 1OMSA 2A3JA 3CD0A 2MJNA 1A9NB 3K7RA 1ZTWA 2MDAA 3W9HA 2MKIA 1VCTA 1OQ6A 2HQDA 3SI8A 5CYMA 3M8QA 4MK8A 5A6WA 2YNFA 1FHTA 4WFBQ 1Q16B 3LAKA 2HHHF 1LW2B 3A8KA 4F02A 1KC8T 4DLGA 4DFMA 1RLCL 4X64F 1U26A 1VQLS 3MR5A 1RU2A 1JLQA 3I82A 1MROB 1FFGB 5K20B 2VDIA 3X1LB 2VBYA 3IS9B 1VQ8S 1WG5A 5KG6A 2R8GA 5IQ6A 3RR8A 4ED1A 2JFKA 3GTYX 1M5HA 2EC2A 3L9ZA 4FXDA 2QRRA 1WC6A 4ETZA 4EO6A 1N4LA 1ELOA 4OI2A 4M5LA 1UTAA 1NJYA 4YOEA 4Q8EA 2IAJA 4GO7X 2OELA 2L9DA 2LDYA 1XBWA 3D3BJ 5E0OA 2HRUA 2WRMA 3D0HE 1SJ1A 4DS5A 1PAEX 3W8PA 2MZQA 3K5PA 1HIYA 3CCLS 1GMWA 1S6OA 4AE5A 3I56S 2FY1A 1GMWD 2PDAA 1XWLA 4UOHA 3MM5B 3CD5A 2DNMA 3CJ0A 1FKPB 2RS8A 3PR5B 4MKYA 3CCRS 2EFQA 1N5TA 3QT5A 3VVUA 1CEZA 1IQZA 2Y3YA 3MI7X 4GKJJ 3CIZA 1KD1T 3I0SA 5LMUJ 4O44A 1APSA 2YWWA 3C14A 3THPA 2B8PA 5AE1A 1DTTA 5J2PB 1M5PC 2HFZA 3EGVA 2RDIA 4LSLA 5M2UA 3PRBA 3G8QA 2R9LA 1R8BA 2K7KA 2F9JA 1HBUA 3MTKA 1IBLJ 3FQLA 4N76A 1DTQA 1FT8A 2IRUA 3WZ0A 3ILLA 3OFEA 2YPZA 1S76D 1FXRA 1PO6A 4A8KA 3LP0B 1R8PA 1TL3A 2NUHA 2DK2A 4C48A 1K44A 2CNOB 4P10A 1FEEA 5L1LA 3OJSA 4EZ6A 2JLGA 4P75A 1Q95G 1VQ5S 3HHLA 5F8GA 3UWTA 3BR8A 1KWMA 1S1VB 2IM1A 1RTJA 4R8UB 4RL1A 3HHLD 2J9EA 2ZVIA 2R2TA 2GHWA 3ZZOA 4C0HA 1TL7B 5RUBA 3T9ZA 5KG5A 2IA0A 2VG7B 1BE4A 2U2FA 2E9RX 2MKJA 4C98A 3K2YA 1ZM2A 4TYAA 4ZP7A 1O0PA 4KRWA 3GSDA 2C22A 5IQQA 1RTDA 2IIHA 2MSTA 2WOMA 4OX9F 4K7QA 3MTJA 1G1XA 4H4OA 4JV2A 3AXMA 3SSRA 2MY8A 4WTOB 2GIRA 1UJ5A 3E2EA 2AYBA 4I64A 3KLHA 2I1RA 4DWIA 2CG8A 1A7GE 3QJJA 3LOUA 1RK8A 1TFWA 3HFZB 2M70A 4OZ1A 1FRXA 3DDNA 1YIJS 4O4GA 2PGCA 2G1HA 5IV4A 3J80U 4ZP9A 4DL4A 2B4OA 3QNWB 1RT2B 2EG1A 1VJQA 2DHAA 3IM8A 1LFWA 3A3PB 2ZKUA 2K1RA 5SUHA 3SFGA 2VJVA 1Q1KA 2E1MC 5D0RA 1V9OA 3KXDA 3EXYA 3K57A 2VBZA 3WQPA 5KG4A 2QG9B 4F50A 2YKQA 2HAFA 5B08A 1RHMB 2VFSA 2YWFA 2MKYA 3JQKA 1L3SA 3VALA 4OZ0A 2VJUA 5L39A 4CP5A 1S6QB 3UDEA 2RRBA 3TP2A 4DN9A 1RAAB 4LFBF 3SQOP 3GIIA 2JH3A 4J9QA 4WU3A 1TTHB 2BM0A 3CCMS 2ZC4A 4U96A 1H72C 1GT8A 3GV5B 4WF9Q 2WZ1A 5IT4A 4OZ2A 1FRKA 3RZAA 2N4CA 2DGOA 3MUVP 2MJUA 4JI6J 3KLFB 3UN3A 2HNDB 1NM2A 1CJUA 5HI7A 1C1CA 2ZBCA 2WTFA 1YGYA 5DM7Q 3CF5Q 3D6MB 2QL7B 4J9LA 1DQAA 3LQVA 1RWNB 2G4BA 3TNVA 4PXEA 2B4VA 4QIVA 1RUSA 2PI4A 1R43A 2IMOA 2DNOA 3ENQA 4HTJA 2HQGA 5D4PA 4WXWA 3PHTA 4MIBA 3U1NA 1MU2A 1QTNB 7FDRA 3KLIB 2BVZA 4RBVA 4B3MF 1WF1A 4RX6A 4OFZA 5EX3A 3TA0A 1IWAA 3ZTRA 3G8TA 2CZVC 3EPGA 3UCZP 2CVIA 2GIFA 3FZBA 2JC1A 2DTJA 2ZM6J 3AFGA 1H3DA 3DRRB 3NNCA 2OEJA 4G1QB 4LSNB 1YJRA 2VKZG 3AA9A 5LMNJ 4NL5A 4KPCA 8RUCA 4XO0A 4HHHA 2DNZA 1NSQA 5EN1A 1NU4A 1YQHA 2IM2A 3UN5A 3W2VA 2BV3A 3VAFA 5SZTA 1RWUA 1I5OB 2BKNA 2EFPA 3LALA 2RRAA 4NLOA 4CNYA 5D0HA 4U67Q 1UETA 1NEEA 2DYAA 3FJ2A 6FD1A 3ZZZA 4QYZJ 1N32F 2OPPA 3BN4A 1AXQA 4ES2A 2CG4A 3HX9A 5I42B 1Y11A 1S59A 2VFVA 3FRYA 1Q7LB 4OIXA 5A8WB 5DDPC 3MR2A 3U02A 5FDLA 3FBCA 1P9QC 4I7FA 1WD6A 1FJEB 1WWHA 1ZPWX 1R8HA 2OSQA 3TZYA 5B7WA 1IBKF 1OS5A 2CJBA 4ZN3A 1GQEA 2MQOA 5L1KA 1RAJA 1SPBP 3MD1A 3CD6S 2UXBJ 3OVAA 3H5YA 4ECUA 1CLFA 3QLHA 1F3FA 3M30A 4CQ1A 1E6YB 5G0RB 4ELTA 4JI3F 4DV7J 5HQLA 2OEMA 3QJPA 3R5JB 3IR6B 4ENOA 1NJZA 1RGVA 1IBMF 4ZLJA 4DL2A 4LBIA 2ZUGA 4DPYA 4P7VA 4QIFA 3M2RB 1FA0A 1TKZA 2GO9A 4H4MA 4M5GA 5J2MB 1MWQA 1NSPA 3PX4A 1P8GA 3MEEB 2G2YA 3P3DA 1R0AB 4DQPA 5KFYA 2RKIB 4CH7A 4C0BA 5IM0A 1VK8A 1VLYA 4NI2B 4NLRA 3RW7A 5AE2A 4ED8A 4EO8A 4K2XA 2HAIA 4RW9B 1OYEA 1Z4UA 2YX1A 3JB9k 2BACA 1KSPA 3Q8PB 3R2CJ 3O3LA 3R6LB 2RQCA 3K5LA 5CZXA 1X5OA 2JNJA 1T3NA 4G3IA 1RT3B 4B9UA 1HR0F 4C8NA 4B9VA 2JJ4D 2Q3PA 3BPSP 2ZH9A 1RACB 3PHEA 3Q23A 3K58A 1CJTA 3FRZA 4DSFA 1WEYA 3OSPA 3DRSA 5CYMB 3M8QB 2M7SA 5ETKA 1TK5A 2F9DA 2YNFB 2BYCA 3D2WA 3H0PA 4C6AA 2XY6A 3LW5C 3KYLA 5M2RA 4ZVOB 5ADZA 4ES1A 1GXTA 4FS1A 3C2PA 1UEVA 1UP1A 1RCOB 1NSKL 1QD1A 1JLQB 2UP1A 3C3LA 2HHTA 4B9MA 3OLAA 4CLFA 2XGPA 3AT1B 2MGZA 2COLA 1VRTA 4PR6A 4KR0B 4CH0S 1NAQA 1TVRA 1LNQA 3ILJA 2W25A 3BPDA 1D3WA 3BGRA 1IKXA 4A8QA 5KFZA 4QJVA 2IAJB 1X4DA 4B3OA 2FC8A 2CPIA 1AROP 1D9FA 1PJ5A 4FYYB 2VFUA 3D4JA 4R25A 4K59A 4DV5J 1WSVA 1U09A 1IKVA 2VG5A 4DV6F 2CWXA 1DBDA 2OFGX 4YHHF 4ZIWA 2HBRB 3V2UC 3GILA 3ELHA 2C2EA 2LYVA 4LF8F 4OYXA 1HD0A 3U1LA 4H4KA 3RB3A 2ZHAA 2QE5A 3G6ES 2OHDA 4DOZA 2CQHA 4ZDNA 2Q79A 1TKDA 3QO9A 3I0SB 4O44B 2QFJA 2GA7A 2HGMA 4CM2A 4WZMA 1Y4ZB 3C14B 1L3VA 1CPZA 1DTTB 5IT0A 4EEYA 1EARA 2KJVA 4F0MA 2DY1A 3H7HB 4LSLB 1KKHA 1Z2LA 4LFAJ 2XCPA 2Q6CA 4TVAB 1NH8A 4RBUA 1HBUB 1FD2A 5H1SV 3M8RA 2B8QA 3TRGA 2EW9A 1B70B 1DTQB 1UFWA 1ICEB 4JV1A 1TUVA 1TL3B 2UUBJ 2KM8C 1G7CB 2VASA 2FVRA 3HVTA 4N8OA 1N54B 2F7VA 3WX8A 3DC2A 2GGPA 3GFYA 3HHLB 3HI9A 1RTJB 2RIJA 1DZ5A 2FLPA 2HHVA 1Y9OA 3SV3A 4LBHA 3MCMA 4USWA 2W2PP 4RNFA 2W2MP 2XO7A 4PPZA 4M63A 1SBRA 5HVHA 1W26A 2ZBIA 2WAQD 3AD8C 1RTDB 2V50A 9ATCB 2EXUA 1URNA 3LF0A 2G2ZA 4LR7A 2WOMB 5KTQA 3RJMB 1CQMA 4ATNA 3OR2A 4JI4J 4ZJQA 2OJ3A 1K73T 2HK2A 4H4OB 1R7IA 1D09B 4RWXA 4RO0A 1WSRA 5F8HA 2LU1A 3KLHB 4OZLA 4NWBA 2HWTA 3N5BA 5A8RA 3PEJA 2R7UA 1HW9A 1FDBA 1L5UA 4ES3A 3D7SB 2Z4PA 2Y1LB 1VK3A 3H42A 2HVHA 1YI2S 4PYDA 4CLLA 5LT5A 4C8LA 4O4GB 2X7IA 5DZ6A 1RT5A 2QC3A 3DRYA 5KG2A 2K1RB 3TAMA 3RG6A 1BQNA 4IO9Q 3LP1A 2XWXA 2OTJS 3DFEA 5B0CA 2E1RA 3NS7B 4AQYJ 4QYRA 2G0CA 3GP9A 2DNGA 5T14A 4F3MA 5ETTA 2R42A 2HHSA 5CCLA 5C25A 1VBXA 1Y5IB 4OHXA 4PZVA 4PABA 4CLTA 2CQCA 2R7XA 4JYAJ 1XMQJ 3DLGA 3HF5A 2CPYA 1WTBA 1ZH5A 2K2PA 3MM7A 3C46A 2EPIA 1NDKA 2FVPA 1FJGJ 3TVYA 2LEPA 2W01A 3LP2A 3S1TA 3CCES 4O4RA 3MFHA 5GADI 2J6SA 2JEIA 2WB4A 1FJCA 1N6QA 1TZ0A 1CJUB 5AXLA 1C1CB 4RBTA 3VAMA 3OW2R 4IKAA 3QYYA 4CLSA 2VA2A 2YWEA 4GKJF 4A8YA 4NE9C 5LMUF 4KGVB 3D1HA 1SC6A 2VA3A 3MECA 4ECXA 2HSEB 4L75A 2QA4G 4WP3A 3MCSA 3PXGa 1GMVA 3KUEA 1U45A 4NCAA 2NSBA 4RNNA 1IBLF 1MU2B 2MQ8A 3I0RA 4OI4A 1YRUA 1R89A 1FRJA 5EWGA 4I4BA 3GG0A 2RSQA 1EIYB 4JI8J 1YZ7A 1RHUB 1KRPA 4YEAA 3HP6A 4C3KA 4B3SJ 1GNKA 3HO1A 2W4PA 4NLXA 4N47A 3HT0A 1RLDA 4WJBA 3NNHA 3W2VB 1ZAVA 2D9OA 4DX6A 2HW3A 2W24A 3DMJA 4CO3A 4ED4A 4YB6A 4ZCLA 2OPPB 4NMLA 3H5XA 3CDWA 3MEGA 4NLDA 3BR9A 5ETPA 3LTOA 4C8MA 2V8DA 1IKYA 3W5YA 3IN5A 5FDLB 4PG8A 3OHBA 4I7FB 3KNGA 2VICA 1PC4A 4R5PA 5KFEA 1JJCB 2RB7A 1RAEB 2E5LJ 3ZXWA 1VQNS 3CJTA 3A12A 1TAQA 5C5JA 2B43A 1WDTA 3QLHB 3HZGA 2DKOB 3M30B 4M5MA 3PY8A 4TQSA 4DQRA 1GAOA 1Y5NB 4NA3A 3OL9A 1LV5A 3HSDA 1YITS 2IRYA 4M8LA 2VOOA 1U1MA 1OO0B 1HWJA 4IQMA 1JLFA 1VOMA 4CT8A 4X62J 1TKZB 4H4MB 3CVKA 3I4PA 2HNYA 5ETSA 2ZH6A 1GFWB 1FXDA 3NGTA 3CCVS 3J7YI 2HLTA 3B8HA 5IM0B 4ZPAA 1FWPA 3OTOJ 2JEFA 4C97A 2WCXA 1UMJA 2D3ZA 4RW8B 3FEXB 3ZZPA 2OFHX 3HFVA 4ZCIA 1U2RA 2VQEJ 1ZTTA 3CJ2A 3OJUA 3L95X 4NYOA 3KLGA 2DISA 3HCXA 3CJ4A 3CPWR 5J1NA 1S1TA 4URGA 1PYSB 1NDCA 4DI6A 1LKZA 4ZVHA 2OD4A 3BYRA 1CJTB 4YR0A 1KQSR 4AFFA 2ZWPA 4X4QA 3DRSB 2E1CA 3IO1A 4JI6F 2KL8A 2WHOA 2PEHA 3ZZYA 4I0WA 3G2XA 4ZPWR 3V6HA 4UY8T 2MEWA 4DSLA 4EYIB 1B0TA 1ZM9A 2R4FA 2XHCA 4Z37A 1NH7A 4FF1A 1SJ4P 2VC1A 1VC6A 3R3TA 2MGZB 4WFAQ 3QATA 4KPYA 3R9LA 1VRTB 3I9ZA 1NJXA 2NCKL 1N0VC 1RTIA 2DNRA 1TVRB 4NLWA 3BGUA 2UZAA 3BGRB 1IKXB 3M6WA 2FGOA 4QU7A 3W5ZA 4ERDA 1HMVA 1XTZA 2BDPA 1I3OB 4B3OB 4ED0A 3NBPA 2ZM6F 3QBCA 3TO8A 2V4QA 1RAOA 5JXSA 3RYLA 4G6VB 1IKVB 1JLCA 2VG5B 5LMNF 1FNXH 2EG2A 1S7HA 4LJMA 2HBYB 3PW2A 4OX8A 2F8EX 3M8YA 3MPVA 1REGX 1JWWA 2FHKA 2B3TB 1DFDA 1QVFR 4TQRA 4MK7A 5ETNA 1WKKA 3G6XA 4KT0C 3KK3A 5ETMA 3D66A 3A3OB 4C8ZA 3QO9B 5D4OA 3F44A 2AT1B 2AMCB 2BANA 4DV2J 1X0FA 2ZOGA 5KFBA 2ZWOA 1M90T 2X3DA 3KJNB 4IH7A 1RWMB 3LWMA 3JQJA 5EWEA 2ATLA 3THVA 1QAJA 3R7NB 5KFAA 3EMTA 4ZVEA 4KHPF 3A1YG 5LXRA 2Y8WA 5CHCB 2UXBF 1NSAA 1N8RT 4UQGA 5I4MA 3HVTB 1X9WA 3VF0B 2V2VA 1LK5A 3WC2A 2VKRA 2GGPB 5AJ3J 2V69A 2DY9A 2QLJB 4AXJA 4O3RA 1RI7A 2GV1A 1J5OA 2FDNA 1SKWA 1U6FA 2ZBRA 2D41A 2PSZA 2PIIA 3K5OA 2F3JA 3I32A 3HPOA 4ZJOA 3G71S 3ITHA 1B99A 3V6DA 1R3NA 2RQKA 4KBIA 3Q86A 2LDIA 3IBCB 5KT7A 3JTPA 1IR1A 3HD1A 3QRRA 4QWDA 3VR1A 2V63A 3CE8A 3J81j 3FBEA 3OR2B 4NOHA 2LLZA 3IGNA 2V67A 3DRPA 3PX6A 5HMZA 5A8RB 3PO4A 2PMZD 1H7WA 5F8IA 3NNAA 3Q8QB 1S97A 1ULRA 3HXMA 2FLLA 3RU0A 2G1DA 2E5JA 2D74B 2OIHA 3TVKA 4F8RA 3R8YA 3IBWA 4DL0C 2YNIA 4QPXA 3OXGA 1MG7A 3ILOA 1RE1B 2XMAA 3MD3A 2W9CA 3TAMB 3GYNA 3S8SA 7FD1A 4C8OA 3NGDA 4GC6A 3N79A 5DQHA 1BQNB 1RA6A 5HVGA 3LP1B 2DR6A 2JVRA 1RT7A 4LRFA 4DG1A 4FPRA 4EYHB 1PYOB 2VPWB 1H73A 1X60A 5HROA 3FSXA 5B0FA 3E01A 3RBXA 3LGHA 1OPZA 4F4WA 5C25B 2HWIA 1G3OA 1Q5YA 4OI1A 4A48A 3QRQA 2XTJP 3UR0A 3B4MA 3A4TA 1S0MA 1RCXB 3GG1A 3DLGB 2FJEB 4DV5F 2MLYA 3BV8A 5DZ7A 2BRKA 3MM7B 2NR0A 3MGJA 2H5JB 2NXEA 4NLQA 1KONA 1H2VZ 5GMEA 2CQ1A 3G4SS 4K8RA 4RUBA 4JOUA 3LP2B 3X3UA 4KC5A 2GAHC 1N6QB 3R27A 4B9LA 2IJFA 3CCJS 3GMGA 3L7UA 2QV6A 1T3OA 3ULHA 5F3ZA 2E66A 1GH8A 2BE9B 3L09A 5L1IA 4DUTA 4KHMA 3MECB 2VIHA 3IWXA 3TA2A 4DV3J 1Q81T 4E8UA 4LFAF 2MHEA 3VAGA 4B3TJ 4LR9A 2RMLA 1G2EA 4ZVQB 3DHXA 2XMKA 4RUAA 2CPFA 3O1LA 2KXNB 1Q8LA 1WC4A 1U24A 4NZ0A 3I0RB 3TWZA 3GJSB 3W2WA 1SV5A 1KP6A 2UUBF 4LR8A 2JLEA 2DXEA 5GVQA 3S6EA 5DG9A 3CB4A 4IH5A 3G86A 1WI6A 2RH3A 1PKUA 2X3GA 3MM9A 3M05A 1NO8A 2YX7A 1FO1A 3HSJA 3CNQP 1UFLA 1OY9A 4JI2J 2LQ9A 3DMJB 3I31A 3AB4B 4F4ZA 3MCNA 1AB8A 4F4XA 4Y0FA 4ECQA 3JSRA 2A6MA 2RRNA 2AJ0A 1HI0P 2EI5A 3CSKA 2JOQA 2BM1A 5DDQC 3R7SB 3MEGB 4JI4F 1I1GA 4DJBA 3AD7C 1HQUA 4ZPCA 1IKYB 4CLKA 1CULA 2MYFA 1QM9A 4R5PB 3M6VA 2MKKA 1R31A 4PWUA 1CQNA 4ZCKA 5KFSA 2YQ0A 2UUTA 1JLGA 4NYPA 4QWEA 5D15A 4Y2AA 3NGSA 2JFDA 5KT5A 4A47A 2J9DE 1FVQA 5ETLA 2DR5A 3R5BA 4ZCMA 3WBZA 1URRA 2VPZB 5IWAJ 2YY3A 1JLFB 4FYWB 4UUXA 2NYHA 4EBDA 1JKHA 5IFMA 1S77D 2HNYB 1BUXA 1X4AA 4AQYF 3I4HX 4JI0J 2APOA 1MLAA 2KKHA 2MKCA 2ZHOA 2PE8A 3EZ5A 4M5IA 1KVKA 2YKPA 2JX2A 3K89A 1X5TA 1UL3A 3THTA 2NQPA 1RXOB 4X4SA 3KOAA 1H2UX 4A46A 1RHKB 4IFYA 4IDKA 3KLGB 2KN4A 4JYAF 4UQTA 4USJC 1XMQF 4Q5VA 1WHWA 2YXLA 3AHPA 2FJWA 1S1TB 5HL7Q 2LXIA 4HTIA 1D9DA 2AGQA 3KHGA 2D3UA 2LXFA 1FJGF 2HBZB 2AZ3A 5KG0A 3EWGA 1DRZA 2LP4A 2GZOA 2H5EA 5DGBA 3PJWA 3I5AA 2AEJA 2E1AA 2KZMA 1KN6A 2AU0A 4XAKA 4U8YA 3KUGA 2PMHA 3IG1A 1WHXA 3CDBA 3UFCX 1Y10A 3H4BA 3RB0A 2DGWA 1KOHA 3LO3A 2QX0A 2LEBA 1F0XA 3SMZA 1LEOA 3EVOA 3GQCA 3AJ2A 4FN5A 2CIMA 4W4MA 1M5OC 2PFDA 3VGSA 1RTIB 1WNEA 4WFYA 1JNZB 4IOBA 3ISZA 1X4EA 1HD1A 3E8OA 1RHRB 5IOLA 1YTYA 1UFKA 4NLPA 1HMVB 3NBPB 4JI8F 4I56A 1LWXA 3DU6A 2FHMA 4B3SF 1JLCB 4LMZA 2BEFA 3WIUA 4J5OA 2QLBB 4P2SA 4NPOA 5IC4B 3L7OA 3H25A 3JQMA 1WEXA 4X66J 1OY8A 5E3QA 4NLSA 1IJFB 1BQMA 2DH9A 3KK3B 3EVWA 2CJYB 4O0IA 7AT1B 2NS1B 2KHDA 4ZVTB 4YS2A 2RDJA 3KG4A 2BANB 3FBFA 2VBWA 4HHUA 2Y0SD 2C2MB 4DU8A 4LUBA 4K4YA 2GCFA 4J9UE 2FLOA 4BLGA 3CIMA 1BWEA 3BREA 3QPIA 4OJHA 2Q66A 3KLEA 2E5LF 3DOLA 5T7LA 4DUZJ 4K4TA 4F4AA 2GS8A 2WSCC 2FTRA 4DR1J 4V19J 3NWGA 4J9NA 2V4RA 2IM3A 1EKRA 3D6HB 4ANEA 1JLAA 3MMAA 1RAGB 4UT4A 1J5OB 3CULA 2AHOB 4DV1J 3M9MB 4KV8A 1SJFA 5LSOA 2I8EA 2AYMA 2V0NA 4W98A 4X62F 4HI2A 3ITHB 1E6VA 3V6DB 2FC9A 1SKSA 3PYFA 2E5GA 3BF4A 1HNZJ 3BH6B 4NZ7A 3OVBA 2DBBA 4RKUC 2QN6B 3OTOF 1P6TA 1FESA 1Y3KA 2QLXA 2YPYA 2VQEF 1HARA 5LJ3Y 3DRPB 1S0OA 1FE0A 3I5BA 2OP5A 1R8CA 2IHR1 3CO0P 5DQIA 3HDSA 5KT3A 2BMBA 4LF1A 4OHZA 4ZKAA 4EBCA 2VZ9A 4CO2A 5K8NA 1N34J 4QYZK 4ZK7M 4LFCJ 2PT0A 4KY3A 1ZYQA 1UVNA 2UVWA 2F65A 2YNIB 3RW6A 4OYWA 3I5CA 3EZOA 2W9CB 2N3LA 1VQSA 2OPRA 4KGZB 5KFJA 5IT9Y 8ATCB 3V4IA 1NPRA 5HVFA 4CLPA 4U9RA 1RT7B 3MEDA 2H51B 4NA1A 4DQQA 4OI0A 4DG1B 2W7AA 3IXQA 3MR6A 3OR1A 5HROB 1R0CB 3QSIA 3E01B 5JVGQ 4PG5A 5A2QY 5ETOA 3W5XA 5HMXA 2W2QP 2C2ZB 1QSSA 4OL8A 2BBEA 1RT6A 2FZKB 3HSGA 2B9YA 2XNRA 3MMJA 2MSSA 2GIQA 2W4DA 3D3CJ 2YQ1A 3V4MA 1KQGB 2ZH8A 4DLEA 4OV1A 1PGZA 2GMLA 4EBEA 3M6UA 1VQ6S 5K5MA 5D4LA 3KJFB 4FVCA 2E29A 1B0PA 2XS2A 5K8MA 2ZC3A 1QTMA 1RBLA 4YP3A 1YRXA 1IR2A 1NCLA 2DPJA 1MMNA 2ADCA 3HJFA 2ZOFA 2GVDA 3W60A 2DGXA 3Q8UA 5KT4A 4DV2F 4IRKA 2OUGA 3HHEA 4K4VA 1ZA2B 2LECA 1P1LA 2E7VA 2DNYA 1VQMS 2GMJA 2MQLA 2X1AA 3T1YJ 3W2WB 2FJDB 2N7CA 2MQNA 5C2CA 1SV5B 4BC7A 2HRYA 1REVA 4IG0A 4DUYJ 3L3CA 3GIJA 2MQMA 2RU9A 5AJ3F 1SC4B 2DXFA 3MMBA 3VAIA 3EICA 1KLNA 1DHMA 3MM9B 1UVJA 3EUNA 4ZN1A 1U48A 3CCTA 3CT9A 4DR6J 4NZ6A 3W1YC 4YDXA 3OD2A 2XYPB 1BD6A 2LVWA 3JXOA 3NGUA 2WBMA 4KKOA 1VQOS 2ASYA 2IVYA 4LVOP 2XM3A 2QSWA 3NOGA 1S9EA 1VQKS 3PYGA 3K5NA 1K9MT 2H4YB 4NEYA 4WBFA 3GZ7A 3BBFA 4ZP8A 1YZ6A 3D1QA 5D3GA 1TFYA 4ECWA 1HQUB 3ENAA 5JJBA 2J0SD 1Q7YT 2P5VA 1OY6A 4QCLA 5AXNA 1CULB 2NXCA 1U1OA 1FXLA 3LAMA 2LCWA 2UXCJ 1NHKL 2DNLA 2AJQA 1JLGB 3N5FA 4C8YA 2DR7A 3R5GA 1JLBA 2VD3A 1R8AA 3BO3A 2O5DA 5E3PA 4O3NA 5JUMA 4MYUA 4IOAQ 5KFKA 2A2CA 4USKA 5L9XA 2DNNA 3J81Y 2ZDPA 1RBOB 2XLKA 4TY8A 3M1VA 4BWJA 3M8WA 1Q4RA 1ZA1B 1GX5A 2BJ8A 4FYDA 4ZPBA 1JKHB 2VFRA 2W2NP 2CJAA 1R6VA 3DOKA 4HHJA 2P9GA 1IJEB 1VI7A 3RB6A 1JXEA 2UXDJ 1NK6A 2GFFA 3D68A 3RBZA 1IN0A 3BDPA 5CD4A 1CVJA 2XHWA 4HR2A 3CXCR 4MYTA 4WK3A 2RHQB 2RUGA 1Q0NA 1WEZA 1FFWB 3JTOA 4WFNQ 4DU7A 5D8HB 1FNOA 3GE9A 2E9ZA 4IFYB 3GIKA 3W64A 4IDKB 1XR7A 4A8OA 3LH2S 2QSFA 3CEDA 1RWVB 3BKTA 4EK2A 5C24A 4F25A 3AA8A 2XI2A 3GSIA 4FBUA 1RTHA 4F04B 4LVNP 4ILLA 1F2HA 2LA6A 1NPKA 1NPPA 1KEKA 1ITPA 4OMFG 1GTHA 1D8YA 1RDRA 3UDVA 2CUYA 1FDAA 2V8GA 4J9RA 2I0XA 1YG0A 2G0JA 3IG1B 3IAM9 4F7VA 4C3MA 5KFPA 1S49A 4O0NA 2XNQA 4KE5A 3D9BA 4L3KA 2CPDA 5KT2A 4UOCA 2RILA 3BYPA 1HHSA 4DV3F 1IM4A 1SC3B 2FHOB 2HZAA 2J9CA 2JDJA 4B3TF 2KO1A 4WP8A 4LF7J 3AY0A 1SQGA 3Q24A 1XR5A 4Y3CA 5KFXA 3QFWA 5KG1A 4QU6A 1K0VA 3CJRA 2PMWA 1HPZA 4AUKA 2XGQA 4Y00A 3PEHA 3PKYA 1FI4A 2RAQA 4YB1P 2MQPA 1X4CA 2C3UA 5KT6A 1NUEA 2XMMA 2IA6A 4PRFA 1KTQA 2BQ3A 4ECRA 4HH1A 4JI2F 4CWBA 1BWVA 1BQMB 3S7RA 3JTNA 3P96A 5HP1A 2XULA 1RBAA 1N5VA 4C4WA 2AW0A 5T41A 5HSPA 1QJHA 2LQ5A 3B4DA 1NXIA 4F26A 1N33J 1CS4A 4OLOA 1AW0A 5HQ8A 3GONA 1D0EA 4P71A 3C19A 4IR1A 5AXMA 1TU0B 4OI3A 2V2ZA 3H2VE 3QJLA 3QGIA 4IOCQ 4URSA 4TXSA 2ILYA 4DSIA 1N48A 3KLEB 3IWNC 4DL7A 3P5TL 3DOLB 3TAQA 1VQPS 2BQRA 3G9CA 3QSYB 5T7LB 3LPEA 1OSCA 2ROEA 2YKOA 1S6UA 2OEKA 3IMQJ 3F73A 4RZRA 4EU0A 2GQ2A 3TJ8A 3G6VA 1X9SA 1S1XA 3FCWA 1JLAB 3MMAB 4ZVGA 4KHRA 4E2FB 1XC9A 2J8AA 1H74A 2KFYA 4KV8B 5IWAF 5E3RA 3KG0A 3PV8A 4DCJB 3UVJA 3CGIA 5E3CA 1ZETA 3DGPA 1B3TA 1I94J 3ETOA 4UW2A 3PKMA 3AODA 3I55S 2V9KA 1E6VB 1TMJA 3I96A 1EQMA 4JI0F 2J76E 1RA7A 2CPXA 2XG8A 3ETMA 1C1BA 2P2CB 5E33A 3OFGA 3CCQS 2CJ9A 1T9UA 4F3OA 2KI2A 4FXWA 1B64A 3M2UA 2M5YA 3FNNA 2NUUG 3R5AA 3SQGA 2H5IB 3TUJC 2BZ2A 1GEHA 1NK7A 5KFVA 2B6AA 2YWKA 5KFQA 3TW0A 1RKIA 3LUYA 2P9EA 2EKNA 5IT9U 1QAYA 1MNEA 2OPRB 3V4IB 4O3OA 3LA0A 3MEDB 4CLZA 3MM6A 1TKTA 1HWUA 3T1AA 4MT1A 5A2QU 2HEKA 4JV5J 5IZHA 3OR1B 3SCKE 1VQ7S 1V6HA 5HBMA 2R7QA 2W7OA 1X4HA 2GVZA 3T5HA 3OXLA 4FF3A 2F1FA 1PIEA 4YDDB 3HJVA 4OYMA 1RT6B 3N28A 4TU7A 1NMEB 2JVOA 4ZOSA 1H7XA 5HN0A 3AJDA 4PQAA 4KGKA 3FZ2A 2X1GA 2HFSA 1MWZA 3AJ1A 2CWKA 2MY7A 1O6XA 1TV6A 1U1LA 3DOMA 4DPOA 4AL6A 2XLIA 1QAIA 4N7TA 1J5EJ 5F8MA 2HZCA 2WVDA 4L3NA 4A8MP 2AQ4A 1JJ2R 5GAGU 3T5JA 3EJMA
chains in the Genus database with same CATH topology
2LP4A 1FWPA 1FFWB 1A0OB 1EAYC 1FFGB 1FFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  1FWP A;  1FFW B;  1A0O B;  1EAY C;  1FFG B;  1FFS B; 
#chains in the Genus database with same CATH topology
 2XS5 A;  2IMW P;  4X66 F;  4BC9 A;  1U47 A;  1FTR A;  3GV8 B;  5H9E J;  4BS2 A;  1TKX A;  1W7W A;  1U6B A;  3W3S A;  2ZH7 A;  4DSE A;  5HO4 A;  3FMB A;  4Q2M A;  3Q0A A;  2OPQ A;  1P1T A;  3VQS A;  2GVD B;  5DDO C;  1MSW D;  5J2Q A;  2CQ3 A;  2G13 A;  4P7T A;  2AGP A;  2DO4 A;  2YX4 A;  5GAD U;  4M1K A;  3I9V 9;  5HJX A;  4ZS6 A;  4C7Q A;  1TEL A;  2VG6 A;  5KFO A;  2HQ3 A;  4UOG A;  1T02 A;  4X65 J;  2HIQ A;  3TUP A;  5E5N A;  2CKW A;  4ILM A;  4DUZ F;  4B9S A;  1C0U A;  2EFV A;  2R8J A;  4E0D A;  4DR1 F;  4ED3 A;  1REV B;  3UCG A;  2X1F A;  4IG0 B;  5DDR C;  4PG4 A;  2PI5 A;  3EE3 A;  2GAG C;  2H9Z A;  2HHQ A;  5BYR A;  3NMR A;  3MMB B;  3BGL A;  4DV1 F;  2G0I A;  2RT3 A;  1EQ0 A;  1S79 A;  1M5S A;  3NAH A;  3TEG A;  5KFU A;  3DKD A;  5LOQ A;  1HW8 A;  1EJ7 L;  2YKN A;  1PBA A;  3FGV A;  4TY9 A;  4KKO B;  4KSE B;  3TEH B;  2M88 A;  1NND A;  2CQ4 A;  1WC1 A;  3HHL C;  1S9E B;  1OQ3 A;  4RNO A;  1HNZ F;  4UY8 5;  2ZKT A;  3UW1 A;  5LJ5 Y;  2XSF A;  4ECV A;  2PD1 A;  2C3Y A;  4ALZ A;  3OQ2 A;  1FJ7 A;  4F4K A;  2P8I A;  1U1K A;  5D3G B;  3MMC A;  4QW8 A;  2MHN A;  3OLB A;  5K9F A;  1U7L A;  2CQI A;  1WHV A;  2ACY A;  4RWW A;  4ETX A;  4U7U K;  1QSL A;  5CZV A;  4DXL A;  1I51 B;  1AUD A;  1XMB A;  3UDL A;  1RWO B;  4G1P A;  1VDH A;  5A6P A;  1VQY A;  2W2O P;  2F63 A;  4WP9 A;  4WU2 A;  1Y0H A;  3FKB A;  2D69 A;  4DQS A;  1N34 F;  4CH1 A;  1JLB B;  4LFC F;  1KHV A;  3J81 U;  1UVM A;  4YR2 A;  4UZB A;  4QBU A;  1SVD A;  1JXL A;  1RAD B;  2BE7 D;  2Y0B B;  1JNR B;  5DQG A;  2C28 A;  1KNZ A;  4I6Y A;  2RQ4 A;  3VVT A;  2R7V A;  4TY8 B;  3M1V B;  5J1P A;  3Q22 A;  2O66 A;  4FXV A;  1PC5 A;  5J2N A;  3K17 A;  4URQ U;  4DFP A;  2ASD A;  3CC2 S;  2HIY A;  1EAY C;  1SJR A;  4WFX A;  3NKY A;  1AA1 B;  2Z2M A;  3DOK B;  3TQE A;  1YJV A;  3VTI A;  1FWK A;  4DHV A;  2B0G A;  1U4B A;  3N6M A;  4LF2 A;  2ZZN A;  3SSS A;  5GAE I;  3QZ8 A;  3BSN A;  4DFJ A;  3G6Y A;  1UA1 A;  4UF4 A;  4A8X A;  2EBG A;  2ZEJ A;  2Y1I A;  2CPZ A;  2XY7 A;  3J7Y U;  4Y28 C;  1V5V A;  3HHN B;  1S9G A;  3KJQ B;  3M8P A;  3RGI A;  4PXC A;  3DI6 A;  1KFD A;  1RTH B;  3RUB L;  1UPP A;  4RJV A;  3DLE A;  4WKY A;  4DFK A;  4DPU A;  4CO0 A;  3H40 A;  5FJ4 A;  1HL6 A;  2W8K A;  3FUY A;  3Q83 A;  2WK4 A;  1TP7 A;  1FRM A;  3F56 A;  3C6U A;  2MZJ A;  3Q8R B;  2PA8 D;  1JX4 A;  4DZD A;  2J5A A;  2FJB B;  1HNX J;  3DLL Q;  1FDN A;  2DCU B;  4GC7 A;  2MZT A;  4MMO A;  1Z2Z A;  3SIP B;  3T3F A;  4JI7 J;  3P5B P;  3R6G B;  1NJW A;  2F4F A;  4HLB A;  4CDI A;  4UZC A;  4J9P A;  3T1Y F;  3O44 A;  1OPI A;  4PXB A;  4K4X A;  4DUY F;  5KFT A;  2ZDO A;  2NZ4 A;  1HPZ B;  2MXY A;  2H54 B;  1G6B A;  2QZ8 A;  1UWA A;  5FLX Y;  2J6U A;  2Q6B A;  3NL0 A;  3H8Y A;  1UAW A;  2AX1 A;  1VRQ C;  5G4D A;  4Z7C A;  4DR6 F;  1OIA A;  3GYX B;  1Z1Z A;  3RR7 A;  1TK8 A;  5F9N A;  4Q0B A;  4RR5 A;  1RTZ A;  4F3Q A;  1MW7 A;  2HHP A;  4N8N A;  3D67 A;  3R2D J;  5FII A;  4NYZ A;  4OZ3 A;  3JYT A;  1XJW B;  4HDG A;  5HP1 B;  1JQG A;  1ACM B;  4ZIV A;  1RAI B;  3SYZ A;  3K5M A;  3AOB A;  3J7A 1;  2HVD A;  1CS4 B;  1S0N A;  2CQ0 A;  4CTA A;  2CNL B;  2HZV A;  3QZ7 A;  2DH7 A;  4NA2 A;  4Y2C A;  4LF5 J;  5E7O B;  1U2F A;  3E51 A;  3K0J A;  1ZM3 A;  4JP8 A;  5KG3 A;  2UXC F;  4QR0 A;  2F5G A;  4CO4 A;  2M52 A;  2QLF B;  2JL9 A;  1S1U A;  1XQI A;  4AL7 A;  2VC0 A;  1H2T Z;  4LSN A;  3OV7 A;  4USU A;  3ZTP A;  2IYI A;  2CA9 A;  3PYD A;  1S1X B;  2FHJ A;  2OAU A;  2C2O B;  3CO9 A;  3Q2T C;  4RNM A;  3EPI A;  1VFJ A;  2FHJ D;  2CYY A;  2HNZ A;  1U49 A;  1RYS A;  4MIW A;  3IP0 A;  2BE2 A;  2R8H A;  3BO4 A;  4TN2 A;  1H6K X;  4BBY A;  2Y1J A;  3FDS A;  1G4C A;  1A0O B;  3UVJ B;  2LU2 A;  3DGP B;  2ZNY A;  4QZV B;  2Y1R I;  1RAF B;  1EB0 A;  2MMY A;  1N5S A;  2LFV A;  1BY9 A;  2ALY B;  4YQW A;  1HBM A;  1VS3 A;  4CRJ A;  1S4E A;  2AD9 A;  2CQG A;  3F0N A;  2UUC J;  4J9V A;  1RZM A;  4KIA A;  4AYB D;  2UXD F;  5CAB A;  4ZHR A;  1RSC A;  4UUW A;  1SH0 A;  3M32 A;  1FVS A;  1RP5 A;  2HFN A;  1HI8 A;  2HKE A;  2DNP A;  3PJX A;  4NXM J;  3M2U B;  4EZ9 A;  2HG4 A;  3KG1 A;  3B54 A;  2KFN A;  1LOU A;  3UN2 A;  4CZC A;  3SQG B;  4QOT A;  3NOC A;  3H59 A;  4O3P A;  2HLU A;  3P6Y C;  1HA1 A;  2B7C B;  4QW9 A;  1F9E B;  2K3K A;  4OZ5 A;  1YJW S;  1SI9 A;  2ZJP Q;  2HPU A;  1NB2 A;  2B6A B;  1YVF A;  1RYR A;  4Y2I A;  5LXY A;  2NRE A;  2RD5 C;  2ZBQ A;  5KFD A;  3IRW P;  1SH3 A;  1QVG R;  4OYB A;  2R7W A;  1S72 S;  2LA4 A;  3KUH A;  1WEL A;  2XCA A;  4DCP B;  3UDC A;  1CC8 A;  1L3K A;  1XN9 A;  3MM6 B;  1TKT B;  2EFO A;  2FYX A;  2D1C A;  4CLY A;  3KHR A;  1VQ9 S;  4ED5 A;  3PAC A;  1UEU A;  4YUD A;  3R5C A;  2L08 A;  4IG3 A;  3CMQ A;  3W65 A;  5HBM B;  2KRR A;  4TU8 A;  2C2D A;  1HBN A;  1UW4 A;  4L74 A;  2ZHB A;  4KH1 B;  5H9F J;  5GAG I;  2GVZ B;  4LF7 F;  2JC0 A;  2NPF A;  2NXU A;  4N5S A;  2J0X A;  1GXU A;  4PUO A;  3V6K A;  3M9O B;  3OBI A;  2NXJ A;  4FYV B;  4KB7 A;  1RKJ A;  1IWG A;  3ZNJ 1;  2GX8 A;  4UST A;  2P6S A;  3T9N A;  3HKW A;  5L46 A;  5C42 A;  2KXF A;  3PW7 A;  4MTP A;  5M2P A;  5EX0 A;  1TV6 B;  1T9X A;  1WI8 A;  3DOM B;  5GAH I;  2QLW A;  4O3Q A;  1K8A T;  2ILZ A;  4J9K A;  3Q8V A;  2KDO A;  3AH6 A;  4UTG A;  4AT1 B;  2XC9 A;  3M8S A;  1TKX B;  2HBQ B;  1HNW J;  3RBD A;  2RQM A;  3GWC A;  5L9N A;  1FCA A;  2GMH A;  1W2B R;  2DO0 A;  3TR5 A;  4I69 A;  1WC0 A;  2OPQ B;  3D5M A;  3M9N B;  3PG9 A;  1VGY A;  1N33 F;  5I3Q A;  2BJ7 A;  2EVZ A;  5J2Q B;  2UV8 A;  2DR8 A;  2IYG A;  4U7C A;  2RE1 A;  1O5J A;  3VGU A;  5C2G A;  4H4K C;  2HFO A;  4PQU A;  4Q45 A;  3SEO A;  2SXL A;  2VG6 B;  5HAO A;  4DR4 J;  2OMO A;  5B09 A;  2O1P A;  1PYT A;  4G65 A;  3D28 A;  2YTC A;  4LIW A;  1C0U B;  4X4R A;  2BW2 A;  3KKF A;  2QT7 A;  4DV4 J;  1EHW A;  1SQE A;  2QA2 A;  5JMN A;  3MF5 A;  2QMU B;  3KHL A;  1PBU A;  1RT1 A;  4BHQ A;  4PCQ A;  4I1T A;  1S57 A;  2YH0 A;  1SL0 A;  3N4W A;  4JUZ A;  4V1A k;  2NXN A;  4JI1 J;  2YKN B;  2MZS A;  2HHW A;  3MOZ A;  5CAA A;  1I94 F;  5B0E A;  4R0J A;  4OYI A;  1WDD A;  1U8S A;  1FK9 A;  3FFI A;  4DCO B;  2CNK B;  3TAN A;  4MKB A;  4X4T A;  2V5H G;  3RRK A;  2V2Q A;  1RU1 A;  3FCV A;  3JS9 A;  2U1A A;  3Q8Y A;  1KDN A;  3FVY A;  1YBA A;  4DPT A;  4LF9 J;  3FQK A;  1YDL A;  3DXB A;  3MMC B;  1RHJ B;  3N6N A;  4DEZ A;  2IBO A;  2NZC A;  3FC9 A;  4X4V A;  2XSJ A;  3TX8 A;  2DEJ A;  4N77 A;  1UZD A;  3FK4 A;  5ITH A;  3D0G E;  3W7B A;  2QTW A;  4LF4 J;  2HHX A;  1FER A;  3N6L A;  3IWL A;  3PR4 A;  2ZJR Q;  1MWY A;  4PWD A;  2QYC A;  2AGO A;  3VWS A;  4CO1 A;  3FEY B;  1IUJ A;  4J9M A;  2FPH X;  3ZZ0 A;  1XEZ A;  1WAC A;  4IQX A;  3BSA A;  2DVI A;  1KVI A;  2C1E B;  3K59 A;  4LIR A;  2CNN B;  2OLW A;  5DG8 A;  3UPF A;  5J2N B;  3N0V A;  4P74 A;  2IFX A;  1RAH B;  2GHV C;  2J6T A;  1NZ8 A;  2C42 A;  2BJ3 A;  3M6X A;  4EGL A;  2XQC A;  1IR0 A;  4JV5 F;  2B9E A;  4GVB A;  4FKX A;  3I87 A;  3MPY A;  1U0H A;  5AT1 B;  3CTR A;  5DJB A;  4ITS A;  2MZ1 A;  2IM0 A;  3MFI A;  4NXN J;  4RW6 A;  2J7U A;  3VAH A;  1O51 A;  2HGL A;  4EUV A;  2P9C A;  2KU7 A;  4OYP A;  1PJ7 A;  4D3H A;  2M8D B;  4I2Q A;  3BN7 A;  3UD5 A;  2OKQ A;  5F9L A;  4ECS A;  4DSK A;  1RQ0 A;  1M1K T;  2VUG A;  1AYE A;  2GC8 A;  4Q8F A;  4IUF A;  5EWF A;  1S9G B;  3M8P B;  3OL7 A;  4ZPV R;  2KG1 A;  3J7Z T;  4ED7 A;  2DHX A;  2DRD A;  3DI6 B;  1U8W A;  1K47 A;  1J5E F;  2C3P A;  2Y9H A;  4I2P A;  3DLE B;  2A2D A;  4MKA A;  2QA4 S;  4EWT A;  2Y8Y A;  2BKP A;  1QLN A;  1Y00 A;  3OSN A;  2BOP A;  2VOP A;  2G9O A;  1O8B A;  1NZA A;  5I3U A;  3C6U B;  1HQE A;  4A8S A;  3QGG A;  1UVL A;  3PX0 A;  4NRT A;  2WVB A;  2CJQ A;  1LK7 A;  4IYQ A;  3T41 A;  1KBR A;  4QIW D;  3WHI A;  3BO2 A;  3BH7 B;  4ZVR B;  1NK5 A;  3CC4 S;  2C3M A;  1S1W A;  3GR1 A;  4X65 F;  2AJ1 A;  4AL5 A;  4ID5 A;  1JMT A;  4WKR A;  3KDN A;  5F41 A;  4YY3 J;  4CIO A;  1LWF A;  1PIL A;  5FLX U;  2DRA A;  1M1G A;  2FGC A;  3DRX A;  4FNI A;  3KJV A;  4GRS A;  2IC3 A;  2XYG B;  1N36 J;  1OJ4 A;  3NXZ A;  2XMW A;  4YFU A;  2ASJ A;  2XB2 D;  2KJW A;  2LQ8 A;  2OH2 A;  2ROP A;  4Q0B B;  3A8I A;  1UWB A;  4YB7 A;  3VZI A;  4Q2L A;  3JYT B;  1J27 A;  2HFV A;  4U7U D;  4WIQ A;  4U8V A;  3CUN A;  5BYS A;  4DR7 J;  3GYG A;  4RNH A;  3MUT P;  3PRV A;  2K3I A;  2ZE2 A;  2MQQ A;  5B0B A;  2B5J A;  3VAJ A;  3RAQ A;  4CTA B;  2AJF E;  2KT2 A;  1S48 A;  1SJQ A;  2AJ4 A;  1QY7 A;  5F8L A;  4LRE A;  3V81 A;  3IC1 A;  2X51 A;  1KR4 A;  2JWN A;  3T19 A;  1NDL A;  2JEG A;  3K8W A;  2VBX A;  1SJ3 P;  1NK8 A;  1S1U B;  3HSZ A;  3OFH A;  2BA9 A;  2HS4 A;  4RW4 A;  3FSI A;  1YWX A;  2NLW A;  4DV7 F;  1UEK A;  4IFV A;  1KVJ A;  3ENW A;  2ADB A;  1UPM B;  4TKT A;  4TNO A;  2HNZ B;  2OTL S;  3BDE A;  2BE2 B;  4DV0 J;  4BWM A;  2BKO A;  3HFK A;  2CZ4 A;  4ZA1 A;  4J37 A;  4LRB A;  5DS7 A;  2CDQ A;  3LGM A;  2FLN A;  4TLQ A;  3QID A;  2Q43 A;  1SUQ A;  3IAS 9;  4ZVP B;  4CYU A;  5HK4 A;  3T5K A;  4FPI A;  4ID8 A;  3TAP A;  1HBM B;  2BXJ A;  1UCN A;  3O5T B;  2UUW A;  2XYH B;  1VC0 A;  4FZV A;  2I5J A;  4ZHR B;  3M32 B;  2CPJ A;  4QPT A;  3D1O A;  3ZZT A;  2XI3 A;  3CDA A;  1FX2 A;  4KHP J;  2QMW A;  1WHY A;  3BBC A;  3FBB A;  1D9A A;  3IRX A;  1BMQ B;  2D3O R;  4GO5 X;  1T8E A;  2FJV A;  5F3T A;  4DX5 A;  1RT5 B;  4NRU A;  1VR6 A;  1T9V A;  3IGV A;  5L38 A;  1NKB A;  3OUY A;  2IDE A;  2GJF A;  3C6T A;  3IR5 B;  1HLW A;  1LQ9 A;  1FE4 A;  1U6Z A;  3OL6 A;  3DHW C;  4QR1 A;  5HLF A;  3MZI A;  1ZZF A;  5B0D A;  5B0A A;  1IBC B;  3UQS A;  2V34 A;  1WJ9 A;  5DET A;  2B9X A;  2LMI A;  2ZH4 A;  4YN3 B;  1HNX F;  2BJ1 A;  3TQ1 A;  5DRK A;  2AKW B;  4ANC A;  2KT5 A;  4IG3 B;  4RW8 A;  4Z2X A;  1VC5 A;  1LWE A;  2VQF J;  3HHK A;  1HBN B;  3UNY A;  3IM9 A;  4WE1 A;  5KFL A;  4JI7 F;  3NS6 A;  1D8Z A;  4KAI A;  1X31 C;  4PUO B;  2A0F B;  1J2V A;  2A1B A;  4ZIT A;  5FD1 A;  1M0S A;  3PRD A;  2VPX B;  2DIT A;  1WF2 A;  2B4U A;  5F8J A;  5C42 B;  2CRL A;  2QO3 A;  4MJK A;  1FTC A;  2V4J A;  4HT7 A;  4RUC A;  3QWP A;  2QJ3 A;  2JEJ A;  4C8K A;  1OSD A;  5DGA A;  1JXV A;  2QGF B;  2DIV A;  2Z58 B;  3P45 B;  2KZZ A;  3N01 A;  4EFA C;  3DDK A;  1TR0 A;  2DIU A;  4USH A;  1ZAW A;  2CQB A;  4B3R J;  3CCZ A;  4OQJ A;  2ZH2 A;  2EK1 A;  4OV6 A;  1F9H A;  4M5D A;  5F8N A;  1LWC A;  5LM7 E;  3TX0 A;  3KMS A;  4DMZ A;  1TAU A;  1RWX B;  4WFZ A;  1RWW B;  3QWU A;  4FF2 A;  1WOP A;  4RUH A;  3MUM P;  3MAH A;  4GKK J;  4LF5 F;  3GLJ A;  1TL5 A;  2JLF A;  4PQU B;  2WON A;  3TAR A;  4F0K A;  1YKW A;  3MOJ B;  2HMI A;  2PC6 A;  1NK9 A;  1JIH A;  2YNG A;  1XMO J;  3BGO P;  5D0G A;  3EXC X;  2A6O A;  4MFB A;  2ZJQ Q;  2VON A;  3NRB A;  3OT9 A;  2QIF A;  2B9W A;  4CI0 B;  3RAM A;  3BS9 A;  3DLB A;  1VLO A;  1W2I A;  2J7W A;  4DR2 J;  2IVF B;  3BSO A;  2XZW A;  2DPI A;  3QGP A;  3NG8 A;  1RT1 B;  2AZ1 A;  2V8P A;  3TZW A;  4XIU A;  3QGH A;  1U0S A;  1W25 A;  2DGS A;  2A10 A;  5A76 A;  3H90 A;  4JI5 J;  1FK9 B;  3FFI B;  1TQL A;  3VCD A;  1JJH A;  4FKY A;  4A8F A;  4YME A;  3DGV A;  2UUC F;  2WBR A;  3R1L A;  3TI0 A;  2FJX A;  3D0I E;  3EM1 A;  2CJK A;  3CJS A;  2C3O A;  2KT3 A;  2ZNZ A;  4I6A A;  4Y34 A;  1HBO A;  2PA3 A;  1X9M A;  4NXM F;  2XSJ B;  5HMW A;  3DXS X;  2FD2 A;  4ZLL A;  3VHQ A;  2CPE A;  4DF8 A;  2F4V J;  1Q5V A;  2BR0 A;  4KH0 B;  2QL9 B;  1WKJ A;  2W7P A;  1EX8 A;  4RLE A;  2FVS A;  1SXL A;  4PWD B;  2V8V A;  3NWR A;  3POT A;  3EYZ A;  2RJZ A;  3HVR A;  4QIE A;  1AFI A;  2O01 C;  5A0Y A;  3AOC A;  1Y7P A;  3NCR A;  3VZH A;  2IRX A;  1CSJ A;  3B6B A;  3OFF A;  1T7P A;  3WDO A;  5BR8 J;  2DGQ A;  1DAX A;  1SKR A;  2DNQ A;  3UNG C;  3P4U B;  1SH2 A;  1HHQ A;  2D7S A;  4IH6 A;  2G2O A;  1U2C A;  2Z8Q A;  2H4W B;  2BAB A;  5CXT A;  5F0W A;  1QAX A;  2FVQ A;  3O8W A;  1ROF A;  1UKU A;  1CJV A;  4GVB B;  5EHH A;  3T1H J;  2EFN A;  1U0H B;  1XR6 A;  4F36 A;  1F3V A;  4ED2 A;  1VYA A;  3GIR A;  4LF6 J;  2E7W A;  4S0M A;  2Z30 B;  4RW6 B;  5ETQ A;  2DHH A;  3OTD A;  5CQG A;  4J9S A;  2DB1 A;  4KJI A;  1Q8B A;  1V3S A;  5EUH A;  2EBE A;  4PPD A;  2D9P A;  4EI2 A;  3HD2 A;  2C2R A;  2GJ2 A;  4I2Q B;  5D0E A;  2DD8 S;  3Q8S B;  3IFE A;  1T95 A;  3RB4 A;  2R7S A;  1EP4 A;  2E44 A;  4D3G A;  2CQP A;  2RUS A;  1HNI A;  3KK2 A;  2Z0G A;  2FIU A;  3AQP A;  3VGV A;  1C4A A;  4I2P B;  2NSC A;  4NLG A;  4KGM A;  3RRG A;  2V9W A;  3OVS A;  2Q1L A;  2M2B A;  2AWZ A;  1HNW F;  5EGY A;  5I3U B;  4CO5 A;  2DEI A;  2H1Y A;  1HQE B;  1VHF A;  3DLJ A;  1TK0 A;  4F67 A;  3SV4 A;  1BXN A;  4ZP6 A;  4QIG A;  1HYS A;  3UCU P;  3FCH A;  2KXH A;  4ZVS B;  4GMK A;  4H54 A;  5K8P A;  3QT7 A;  3DLH A;  3GJQ B;  4DR4 F;  1YJ7 A;  5DLG A;  1S1W B;  1WF0 A;  4ID5 B;  2CZ9 A;  3ZO7 A;  1YRT A;  3F41 A;  4DV4 F;  1FX4 A;  1LWF B;  1C0T A;  2W9B A;  4NLV A;  4V19 X;  3ZC4 A;  4P72 A;  3KJV B;  2F8M A;  2IC3 B;  1IKW A;  1F6T A;  4TYB A;  3OL8 A;  2HRT A;  3IBF B;  5HAN A;  3ZTS A;  5E2Q A;  4JI1 F;  2OML A;  1UWB B;  4RW7 A;  4F2S A;  3G8S A;  1S12 A;  1X4B A;  2GQQ A;  3G82 A;  4ZVU B;  3M7V A;  4DQI A;  1T05 A;  4CLW A;  3HHD A;  3S01 A;  2J0Q D;  3UI3 A;  4LF9 F;  2MLZ A;  2L9W A;  2ZE2 B;  2YH1 A;  2B5J B;  3US5 A;  4P2F A;  1ZZN A;  1SL1 A;  6FDR A;  5KFH A;  2FB0 A;  4B08 A;  4X84 A;  1WC3 A;  3M4X A;  2R2S A;  2VOD A;  4USI A;  3V81 B;  1HQ2 A;  4LF4 F;  1K0T A;  2PO4 A;  2P6T A;  1R27 B;  5GMD A;  2DH8 A;  3GJT B;  2L48 A;  5H9E K;  4RW4 B;  1FEH A;  2NPI A;  4K0K J;  1YBT A;  1HWK A;  3H4D A;  3CCW A;  2GW8 A;  1MN9 A;  4IFV B;  1F9F A;  2DCL A;  2MKH A;  3C8Y A;  2CXE A;  4ELU A;  4FDF A;  3EGN A;  4PXD A;  2XMJ A;  3MXH P;  2N4D A;  1R0B G;  5LSL A;  2RHS B;  3CCS S;  3WC0 A;  4Q44 A;  2PFF B;  2L3M A;  1LW0 A;  1R6Y A;  4WTY A;  3SFU A;  3UD4 P;  3R1H A;  2KM8 B;  1SUQ B;  4CYU B;  3T5L A;  3G96 A;  2MZR A;  2QMX A;  1Y3J A;  2HHU A;  1VBK A;  1K1Q A;  5E3A A;  2X1B A;  2H3E B;  2I5J B;  2F8H A;  1DQ8 A;  1DJ0 A;  1Q8I A;  2AEF A;  1S9F A;  4Y6I A;  5KFW A;  3KTQ A;  1JB0 C;  4NXN F;  3TJ9 A;  1LXN A;  5AE3 A;  1X4G A;  2XZD B;  1AZS A;  4PAA A;  4ER8 A;  3MPW A;  2DNH A;  2JRS A;  4FF4 A;  3CCU S;  2EKY A;  2R7O A;  4DR3 J;  1F5C A;  3OTE A;  3IRX B;  4USV A;  5BYQ A;  4LRC A;  3W9J A;  4N41 A;  2Z57 B;  5A8K A;  1FRL A;  3SZ2 A;  1RT4 A;  4DSJ A;  2WVF A;  1YBU A;  2DXD A;  1FF2 A;  2PEB A;  2HQF A;  4FVM A;  1VBY A;  4NLT A;  3OTC A;  3IR7 B;  1D1U A;  4IRC A;  3OUY B;  4XDD A;  3C6T B;  4NCG A;  3GV7 B;  2R3V A;  3MM8 A;  4Y2M A;  2HQC A;  3MPU B;  2EFG A;  5IC6 B;  3SXL A;  5HLF B;  4DBQ A;  1IQT A;  4KGX B;  2RF2 A;  3KDO A;  3SDE A;  1P27 B;  1YJU A;  2KRB A;  1IVZ A;  4HH0 A;  3G87 A;  1NLK L;  3ZFV A;  2MB0 B;  3NP5 A;  2QL5 B;  2ZUA A;  4HVZ A;  1LWE B;  3AD9 C;  4F0H A;  2KYZ A;  4WE1 B;  1KTV A;  4EMD A;  3FSY A;  4J90 A;  4HYK A;  1T03 A;  4P9S A;  2WVE A;  2DNK A;  2HVE A;  4YY3 F;  3GPA A;  3BZQ A;  1HFE L;  1C4C A;  3W63 A;  2V4J B;  2VV5 A;  8AT1 B;  2OI2 A;  4XPE A;  1N36 F;  1NDP A;  3W8G A;  5CD4 H;  5U47 A;  5KFF A;  3EDR B;  3VQT A;  4KO0 A;  1YJ9 S;  1B0V A;  3T6B A;  4C11 A;  1NHU A;  1OWX A;  4USM A;  1N88 A;  2GQC A;  3GIM A;  2GNK A;  3NEK A;  3ZNU A;  3M2V A;  3ILI A;  2VHG A;  5DLF A;  4LBP A;  2DT9 A;  2ATC B;  4M5D B;  1UW9 A;  1LWC B;  1FRH A;  3PIO Q;  2FJA B;  4DR7 F;  2N7Y A;  4QQB A;  3WIV A;  5KFR A;  4DPW A;  5K8O A;  4PKD B;  3PDN A;  3GJR B;  1UJ4 A;  2ABY A;  2VFT A;  1EET A;  2AV5 A;  3CJ5 A;  1H0H B;  2AEM A;  2WON B;  3MR3 A;  4MK9 A;  2HMI B;  2HFU A;  4WYL A;  4MIA A;  3TJA A;  4ELV A;  2IJN A;  1JLE A;  2YNG B;  3DYA A;  3SBM A;  3RRH A;  4MFB B;  2WVC A;  3KMQ A;  1VIO A;  1AFJ A;  2B51 A;  5MLC V;  1U02 A;  4M95 A;  4AXI A;  4X4N A;  2ZOM A;  4IR9 A;  4P6Q A;  1YSJ A;  2ZVS A;  3NGK A;  1OYD A;  1ZM4 A;  4DV0 F;  4NLY A;  4Q43 A;  3C66 A;  3CDU A;  1NK0 A;  5KOW A;  2VDH A;  1MMD A;  2CQD A;  1QE1 A;  5DG7 A;  1FKO A;  3B78 A;  2BRL A;  3UR3 C;  4XTT A;  1HHT P;  5CA5 A;  4DN0 A;  3NS5 A;  4L6V 3;  3P49 B;  1NJI T;  1M5V C;  1XNQ J;  4OYZ A;  2ZH1 A;  4RPF A;  4ECY A;  3CWJ A;  2WSF C;  3GFZ A;  3PNI A;  2HS0 A;  2ACM A;  2WB1 D;  1IXK A;  1S99 A;  3MUR P;  2FZC B;  2RU3 A;  1HBO B;  2UU9 J;  3QIP A;  2J0W A;  4WPA A;  2RNE A;  2ZFH A;  1LXJ A;  2V8H A;  1VIS A;  1FD8 A;  1XNR J;  3ISN C;  3HVW A;  2FUG 9;  2AX0 A;  1CG2 A;  2XMV A;  1T9T A;  1LFP A;  3POT B;  2HVZ A;  1CBK A;  4B02 A;  2AF6 A;  4K5R A;  5A0Y B;  9RUB A;  3UE2 A;  3TZZ A;  5MAO A;  2YWG A;  4LRA A;  4B17 A;  2UUA J;  4M5J A;  4FP9 A;  3CDE A;  2YNH A;  4LQ9 A;  4MAK A;  1SIZ A;  4NX9 A;  3JSM A;  1S5Z A;  1KQF B;  1X0P A;  1TUG B;  3KLV A;  2AJ2 A;  2MKS A;  1BC6 A;  4DL5 A;  1H38 A;  1T94 A;  1B7F A;  2DGT A;  1RHQ B;  3EZU A;  4Y65 A;  1CJV B;  2CVE A;  1XK8 A;  3Q2S C;  3I6P A;  2UVU A;  3QT6 A;  5BXI A;  3MDF A;  3CJ8 A;  1M1H A;  4OYA A;  2VQF F;  4ILR A;  3ENV A;  5ETR A;  3BQ2 A;  2BW7 A;  4HL9 A;  3AB2 B;  4A8W A;  4Y2K A;  2KHC A;  4NMX A;  2OO4 A;  3OHA A;  2I9S A;  3DU5 A;  4P52 A;  4WWS A;  4CT9 A;  1EP4 B;  2GO8 A;  2R2R A;  1DLO A;  2M3D A;  1HNI B;  3KK2 B;  4CM0 A;  1KLM A;  1U1N A;  1M5K C;  1KQK A;  1JJ4 A;  2YKA A;  5GAE U;  2DHG A;  2Z56 B;  3DM2 A;  4HT5 A;  1NKC A;  3AXK A;  2DHS A;  1X7V A;  4CNZ A;  3VAK A;  1I6J A;  2HS3 A;  4OX7 A;  2OSR A;  1FRI A;  3CJK A;  2XLJ A;  3CC7 S;  4KFB A;  4DX8 H;  1UJ6 A;  4DR5 J;  2O3D A;  2EK6 A;  3DLK A;  4B3R F;  3GFH A;  3NCQ A;  4JV0 A;  4WZQ A;  4C3L A;  4K2J A;  5KFI A;  2HWH A;  4NEZ A;  1GK8 A;  4LRD A;  4U95 A;  3K8V A;  5CYQ A;  1F1B B;  3DNC A;  4QWB A;  4GKK F;  1HYS B;  2J9D A;  5HAT A;  3TVZ A;  1VQ4 S;  2AIR B;  1FNM A;  4XDC A;  1F5B A;  3EX7 B;  2UVR A;  3SCJ E;  3GB0 A;  1TL1 A;  1WKL A;  4HKQ A;  1NHV A;  6AT1 B;  2Z2Y B;  1XMO F;  1YLX A;  3HM9 A;  4NLU A;  3LGN A;  1C0T B;  4W92 B;  2OD6 A;  2W9B B;  2XEX A;  1VIX A;  4X4U A;  2YKM A;  2KG0 A;  3HLU A;  2E5H A;  3R5D A;  2OPS A;  3BKF A;  2XWY A;  3C15 A;  3HZE A;  5J1E A;  1IKW B;  4DR2 F;  2D3O 1;  2HHH J;  2I2Y A;  4DF4 A;  3QMQ A;  2IBK A;  3GCX P;  4DL6 A;  1HI1 A;  4X64 J;  1N5Y A;  5H9F K;  2QYG A;  4DX7 A;  1KFS A;  2LKZ A;  4RW7 B;  3N9U C;  1AT1 B;  1U25 A;  4JI5 F;  3LAN A;  3G82 B;  1QUP A;  2DJW A;  2RDD A;  3P8B B;  1T0T V;  4YR3 A;  2VB6 A;  1T05 B;  1BQX A;  3JAM Y;  3D54 A;  2KVQ E;  3MAA A;  2ZBP A;  5KAK A;  1UVI A;  3QAU A;  2XY5 A;  3SCL E;  3RAX A;  1DY3 A;  2GJI A;  1Q8K A;  1WG4 A;  1MML A;  1NKE A;  4ZMM A;  5BJR A;  2W4C A;  3B82 A;  4M5H A;  3KK1 A;  1N0U A;  2CAD A;  2F4V F;  3NAI A;  1VBZ A;  1HNV A;  1GTE A;  3A3N B;  1Q82 T;  3UD3 P;  2FY8 A;  1C2P A;  4ICL A;  5IS2 A;  5L1J A;  4TLR A;  4ZLP A;  2W9A A;  1UZH A;  2BJ9 A;  1ZAX A;  4HAC A;  2GHP A;  4WCE Q;  2EWH A;  4FBT A;  1WOS A;  1L3T A;  3LPY A;  4B9N A;  5BR8 F;  5D6G A;  2HQI A;  1LW0 B;  4K4Z A;  4OI6 A;  1N56 A;  2AYE A;  5F0U A;  2IY5 B;  4WYW A;  1Q53 A;  4P2X A;  4TU9 A;  3TA1 A;  5I3P A;  1QUV A;  1RJJ A;  3ICL A;  1Y5L B;  5E41 A;  1PAU B;  3T1H F;  5K14 A;  1YX2 A;  2DR9 A;  4JB8 B;  4K4W A;  1WC5 A;  4L73 A;  4LF6 F;  5HJY A;  3CME S;  1CC7 A;  4DZ6 A;  1NRK A;  2HUR A;  1AZS B;  2K06 A;  1S6P A;  5KFG A;  2DGV A;  4XPC A;  5L8R C;  5EDW A;  4K50 A;  2IJR A;  4JBC A;  5A8K B;  3ET6 A;  1RT4 B;  3ZTO A;  2ZIT A;  4J7C A;  1H98 A;  2ZD1 A;  4PYA A;  4E98 A;  1SC1 B;  3KHH A;  2UV8 G;  5ETV A;  2KYX A;  2WSE C;  4NCG B;  4ZPT R;  1FWL A;  1VRU A;  3MM8 B;  3W9I A;  3C16 A;  4W90 B;  1UA0 A;  2HYI B;  3A8E A;  3ADA C;  3W62 A;  4I67 A;  2M4M A;  4KYZ A;  5GMK a;  5D78 A;  1RWP B;  2RF2 B;  4ZPD A;  1CJK A;  1V5I B;  3SDE B;  4LQ3 A;  4R0E A;  1VHI A;  4OX9 J;  3CJQ A;  2DGU A;  1SKU B;  3HVA A;  2E7X A;  3MCO A;  4MKV A;  3QFH A;  3H2U B;  4KTQ A;  1X8D A;  5B0G A;  1DQ9 A;  1RB0 A;  3PW0 A;  4PG7 A;  2XO6 A;  1RWK B;  2W8L A;  4X2B A;  3JSY A;  1GMU A;  3AQO A;  2QFI A;  4IRD A;  3MEK A;  2F40 A;  5JVH Q;  3PYE A;  1PSD A;  1KHW A;  2PN6 A;  1T03 B;  1BHN A;  3R7B B;  4K4U A;  2R7T A;  4P73 A;  4J9O A;  1HWL A;  4OZN A;  3NCP A;  4YB5 A;  4C0O C;  4CCH A;  1PCA A;  4OZJ A;  3Q89 A;  2BJE A;  1LW2 A;  1ZOT A;  5HQM A;  2BOA A;  4KO0 B;  4C11 B;  3MR7 A;  2B7B B;  4O23 A;  5KFN A;  4I6W A;  4MH8 A;  1MRO A;  4HI1 A;  3BEG B;  1ZS6 A;  5DM6 Q;  3IS9 A;  3M2V B;  4FS2 A;  1F5A A;  2E9T A;  3V5R A;  1TL4 A;  1YK9 A;  1SIW B;  3FMW A;  1X4F A;  5GAH U;  2CFX A;  4LFB J;  1WG1 A;  3H20 A;  5CH7 B;  1ZBT A;  2W1B A;  2YBV A;  1EET B;  2VF3 A;  3ZZR A;  4OLP A;  2CJX B;  4RU9 A;  1T9W A;  4CLU A;  3RBE A;  1JLE B;  1AUS L;  3H5U A;  3DYA B;  2BJD A;  4BDP A;  2L41 A;  4K0K F;  2V2K A;  3M8Z A;  1V3Z A;  2ZZT A;  3MM5 A;  1FKP A;  2LEA A;  3QRP A;  4DS4 A;  3H2L A;  1TMM A;  3HKZ D;  1FDD A;  4OX6 A;  3KWM A;  5IXU A;  1NBE B;  3J7Z 5;  3BM7 A;  2JZ5 A;  1P9Y A;  1QE1 B;  1FKO B;  1YJN S;  3ZZU A;  4OYO A;  4AND A;  5J2P A;  1NB7 A;  4WXO A;  1WUU A;  3PIP Q;  1GXL A;  1SB6 A;  1WOO A;  2ZZM A;  3GFX A;  2IVM A;  3D6T B;  4F4Y A;  4B3M J;  1U1P A;  4O3S A;  3QIP B;  2POK A;  3JSB A;  2R2U A;  3LP0 A;  2N3O A;  1RAB B;  1Q78 A;  4PEO A;  2Z2Z A;  4DR3 F;  1YHQ S;  1S1V A;  4N56 A;  4R8U A;  1V3R A;  1YJT A;  3NLC A;  3KNA A;  5CCM A;  1S0V A;  2MTL A;  1A6L A;  2XZT B;  1S4F A;  3BQ1 A;  1EKS A;  1TL7 A;  4OJ1 A;  2CPH A;  1SQF A;  1VMB A;  2EC0 A;  2H48 B;  2VG7 A;  4U6P A;  1Q86 T;  2ERR A;  3E3X A;  2IDL A;  2B56 A;  4PWW A;  5KFM A;  4B9T A;  2YNH B;  2ALZ A;  1EZZ B;  4OJG A;  3GU0 A;  3JSM B;  1N32 J;  3U7J A;  2MPU A;  3EDQ B;  3ISN D;  1SL2 A;  2KH9 A;  1HKA A;  3PO5 A;  3PFO A;  3HMJ G;  2RVJ A;  4M94 A;  4OHW A;  1QDU B;  1FKA F;  5C7P A;  3BJY A;  1IBK J;  2J8S A;  4G1I A;  5D4N A;  2VPY B;  2AP6 A;  3SSQ A;  2N82 B;  2JSX A;  5KG7 A;  4QWA A;  5HMY A;  1KS2 A;  4JI3 J;  3PFE A;  3L4B C;  1T11 A;  5C24 B;  1DLO B;  1VJW A;  3MWB A;  1RT2 A;  3BQ0 A;  3HT3 A;  3H98 A;  3J80 Y;  3V6J A;  1KLM B;  1IBM J;  3DN9 A;  4M5K A;  4XK8 C;  1T9Y A;  3DM2 B;  2R7R A;  2K8G A;  2RS2 A;  1N5Q A;  2CDR B;  2V6A A;  3FEZ A;  3SCI E;  3CJK B;  2L9N A;  2M0G B;  2ZH3 A;  3W61 A;  5KOX A;  4ZLN A;  1B7Y B;  4KFB B;  3BB5 A;  2MLX A;  3WX4 A;  4BCA A;  3DLK B;  3RTV A;  2M9K A;  2O67 A;  3ZTQ A;  1KOO A;  2I6W A;  2AYG A;  5DO2 A;  4IO1 A;  4ECT A;  4OHV A;  3PW5 A;  3CW2 C;  1S6Q A;  3EVM A;  2M8H A;  1U1R A;  3LWL A;  3O2I A;  4QR2 A;  4DL3 A;  5CYQ B;  2HK3 A;  2UVV A;  2KFZ A;  2WW8 A;  3OTB A;  2J7K A;  2QA1 A;  3QAE A;  5CYJ A;  3QT8 A;  2ZH5 A;  3AOA A;  1TL1 B;  1HR0 J;  4J91 A;  1Q79 A;  4KQZ A;  3NMA A;  3T6J A;  2YWH A;  3PVX A;  4LT6 A;  3QQC D;  4K4S A;  4WK1 A;  4WII A;  3D6F B;  1JK9 B;  3A13 A;  3MAQ A;  1X5S A;  4F2R A;  2YKM B;  1QSY A;  1S7I A;  3KLF A;  2OPS B;  2HND A;  3C15 B;  5J1E B;  4OHY A;  1N5Y B;  1FFS B;  3KFW X;  1U1Q A;  2LQB A;  1IM6 A;  2KVI A;  2KB2 A;  2ASL A;  2BUN A;  3GR0 A;  4OJ3 A;  2CQ2 A;  4ZJL A;  3JAM U;  2FVC A;  1XNQ F;  2LXU A;  1WOR A;  3A8J A;  3VGT A;  3O6Q A;  1NK4 A;  3R97 A;  5KFC A;  1TUW A;  3AAW B;  1HWI A;  3MAA B;  4X4P A;  3KLI A;  2C2N A;  2UU9 F;  1XNR F;  3PM9 A;  3L7P A;  2Z2L A;  2R8K A;  3KK1 B;  1RIS A;  3DRR A;  4L76 A;  4G1Q A;  1HNV B;  2OGU A;  2YVS A;  1DAR A;  3EGW B;  2XS7 A;  4HDH A;  2IPO B;  4DV6 J;  4RU2 A;  4ICL B;  2I38 A;  2XBP A;  4YHH J;  1DUR A;  2DRB A;  2WW4 A;  2V68 A;  3U27 A;  4LF8 J;  4HAC B;  4P2M A;  4LSZ B;  2B4P A;  4UOF A;  4NAS A;  3BBB A;  4PG6 A;  2UUA F;  2E1P A;  4Z7Y A;  3MHY A;  1XER A;  2VL1 A;  3PTW A;  3PJ9 A;  2NYI A;  4GVL A;  3DDI A;  1MN7 A;  2QEX S;  4Q7A A;  3UO0 A;  4NCB A;  1L3U A;  3PZP A;  1WTF A;  2HVI A;  2FZG B;  5I42 A;  4AD6 A;  5D77 A;  3H5S A;  3IA0 A;  5A8W A;  3BSC A;  1C1B B;  1X5P A;  4X4O A;  2XMT A;  2C2K B;  3NGR A;  5K14 B;  4FNH A;  4C9D A;  1BLU A;  2HGN A;  3W66 A;  3PW4 A;  3BKU A;  3TUZ C;  2XMU A;  4DDF A;  5LSR A;  4L72 B;  3TOQ A;  1PJ6 A;  3NY0 A;  2ROG A;  4ECZ A;  3ONQ A;  2JHE A;  1E6Y A;  5G0R A;  1S6P B;  1F60 B;  4C2M A;  3CMA S;  1F2G A;  1GX6 A;  3U1M A;  3TZX A;  2A18 A;  4ZVF A;  3VV2 B;  5LL6 d;  1B4S A;  1UVK A;  1XIQ A;  3ET6 B;  2KTQ A;  2EEY A;  4M5N A;  2FQQ B;  4A4J A;  2ZD1 B;  2VH7 A;  1ZPV A;  2YQ3 A;  3M2R A;  4HEA 9;  5J2M A;  3GCW P;  1VRU B;  3MEE A;  3TUI C;  3C16 B;  1R0A A;  1S10 A;  3BGF A;  1K1S A;  2RKI A;  3CJ3 A;  4DR5 F;  2BX6 A;  3OPK A;  3J7A N;  4QWC A;  3OXF A;  5IV3 A;  4DPX A;  4NI2 A;  3TYT A;  1CJK B;  3CD7 A;  1BGX T;  4K5S A;  2VU5 A;  3HK2 A;  2H65 B;  3PCO B;  2BQU A;  4RW9 A;  3HUL A;  3MPD A;  2R8I A;  2K7J A;  1PG5 B;  2E5I A;  2CAJ A;  4FYX B;  2LQJ A;  3DCA A;  1SCJ B;  3EGZ A;  5THW A;  1RT3 A;  5AXK A;  2V94 A;  4I68 A;  1N52 B;  4ED6 A;  1OMS A;  2A3J A;  3CD0 A;  2MJN A;  1A9N B;  3K7R A;  1ZTW A;  2MDA A;  3W9H A;  2MKI A;  1VCT A;  1OQ6 A;  2HQD A;  3SI8 A;  5CYM A;  3M8Q A;  4MK8 A;  5A6W A;  2YNF A;  1FHT A;  4WFB Q;  1Q16 B;  3LAK A;  2HHH F;  1LW2 B;  3A8K A;  4F02 A;  1KC8 T;  4DLG A;  4DFM A;  1RLC L;  4X64 F;  1U26 A;  1VQL S;  3MR5 A;  1RU2 A;  1JLQ A;  3I82 A;  1MRO B;  1FFG B;  5K20 B;  2VDI A;  3X1L B;  2VBY A;  3IS9 B;  1VQ8 S;  1WG5 A;  5KG6 A;  2R8G A;  5IQ6 A;  3RR8 A;  4ED1 A;  2JFK A;  3GTY X;  1M5H A;  2EC2 A;  3L9Z A;  4FXD A;  2QRR A;  1WC6 A;  4ETZ A;  4EO6 A;  1N4L A;  1ELO A;  4OI2 A;  4M5L A;  1UTA A;  1NJY A;  4YOE A;  4Q8E A;  2IAJ A;  4GO7 X;  2OEL A;  2L9D A;  2LDY A;  1XBW A;  3D3B J;  5E0O A;  2HRU A;  2WRM A;  3D0H E;  1SJ1 A;  4DS5 A;  1PAE X;  3W8P A;  2MZQ A;  3K5P A;  1HIY A;  3CCL S;  1GMW A;  1S6O A;  4AE5 A;  3I56 S;  2FY1 A;  1GMW D;  2PDA A;  1XWL A;  4UOH A;  3MM5 B;  3CD5 A;  2DNM A;  3CJ0 A;  1FKP B;  2RS8 A;  3PR5 B;  4MKY A;  3CCR S;  2EFQ A;  1N5T A;  3QT5 A;  3VVU A;  1CEZ A;  1IQZ A;  2Y3Y A;  3MI7 X;  4GKJ J;  3CIZ A;  1KD1 T;  3I0S A;  5LMU J;  4O44 A;  1APS A;  2YWW A;  3C14 A;  3THP A;  2B8P A;  5AE1 A;  1DTT A;  5J2P B;  1M5P C;  2HFZ A;  3EGV A;  2RDI A;  4LSL A;  5M2U A;  3PRB A;  3G8Q A;  2R9L A;  1R8B A;  2K7K A;  2F9J A;  1HBU A;  3MTK A;  1IBL J;  3FQL A;  4N76 A;  1DTQ A;  1FT8 A;  2IRU A;  3WZ0 A;  3ILL A;  3OFE A;  2YPZ A;  1S76 D;  1FXR A;  1PO6 A;  4A8K A;  3LP0 B;  1R8P A;  1TL3 A;  2NUH A;  2DK2 A;  4C48 A;  1K44 A;  2CNO B;  4P10 A;  1FEE A;  5L1L A;  3OJS A;  4EZ6 A;  2JLG A;  4P75 A;  1Q95 G;  1VQ5 S;  3HHL A;  5F8G A;  3UWT A;  3BR8 A;  1KWM A;  1S1V B;  2IM1 A;  1RTJ A;  4R8U B;  4RL1 A;  3HHL D;  2J9E A;  2ZVI A;  2R2T A;  2GHW A;  3ZZO A;  4C0H A;  1TL7 B;  5RUB A;  3T9Z A;  5KG5 A;  2IA0 A;  2VG7 B;  1BE4 A;  2U2F A;  2E9R X;  2MKJ A;  4C98 A;  3K2Y A;  1ZM2 A;  4TYA A;  4ZP7 A;  1O0P A;  4KRW A;  3GSD A;  2C22 A;  5IQQ A;  1RTD A;  2IIH A;  2MST A;  2WOM A;  4OX9 F;  4K7Q A;  3MTJ A;  1G1X A;  4H4O A;  4JV2 A;  3AXM A;  3SSR A;  2MY8 A;  4WTO B;  2GIR A;  1UJ5 A;  3E2E A;  2AYB A;  4I64 A;  3KLH A;  2I1R A;  4DWI A;  2CG8 A;  1A7G E;  3QJJ A;  3LOU A;  1RK8 A;  1TFW A;  3HFZ B;  2M70 A;  4OZ1 A;  1FRX A;  3DDN A;  1YIJ S;  4O4G A;  2PGC A;  2G1H A;  5IV4 A;  3J80 U;  4ZP9 A;  4DL4 A;  2B4O A;  3QNW B;  1RT2 B;  2EG1 A;  1VJQ A;  2DHA A;  3IM8 A;  1LFW A;  3A3P B;  2ZKU A;  2K1R A;  5SUH A;  3SFG A;  2VJV A;  1Q1K A;  2E1M C;  5D0R A;  1V9O A;  3KXD A;  3EXY A;  3K57 A;  2VBZ A;  3WQP A;  5KG4 A;  2QG9 B;  4F50 A;  2YKQ A;  2HAF A;  5B08 A;  1RHM B;  2VFS A;  2YWF A;  2MKY A;  3JQK A;  1L3S A;  3VAL A;  4OZ0 A;  2VJU A;  5L39 A;  4CP5 A;  1S6Q B;  3UDE A;  2RRB A;  3TP2 A;  4DN9 A;  1RAA B;  4LFB F;  3SQO P;  3GII A;  2JH3 A;  4J9Q A;  4WU3 A;  1TTH B;  2BM0 A;  3CCM S;  2ZC4 A;  4U96 A;  1H72 C;  1GT8 A;  3GV5 B;  4WF9 Q;  2WZ1 A;  5IT4 A;  4OZ2 A;  1FRK A;  3RZA A;  2N4C A;  2DGO A;  3MUV P;  2MJU A;  4JI6 J;  3KLF B;  3UN3 A;  2HND B;  1NM2 A;  1CJU A;  5HI7 A;  1C1C A;  2ZBC A;  2WTF A;  1YGY A;  5DM7 Q;  3CF5 Q;  3D6M B;  2QL7 B;  4J9L A;  1DQA A;  3LQV A;  1RWN B;  2G4B A;  3TNV A;  4PXE A;  2B4V A;  4QIV A;  1RUS A;  2PI4 A;  1R43 A;  2IMO A;  2DNO A;  3ENQ A;  4HTJ A;  2HQG A;  5D4P A;  4WXW A;  3PHT A;  4MIB A;  3U1N A;  1MU2 A;  1QTN B;  7FDR A;  3KLI B;  2BVZ A;  4RBV A;  4B3M F;  1WF1 A;  4RX6 A;  4OFZ A;  5EX3 A;  3TA0 A;  1IWA A;  3ZTR A;  3G8T A;  2CZV C;  3EPG A;  3UCZ P;  2CVI A;  2GIF A;  3FZB A;  2JC1 A;  2DTJ A;  2ZM6 J;  3AFG A;  1H3D A;  3DRR B;  3NNC A;  2OEJ A;  4G1Q B;  4LSN B;  1YJR A;  2VKZ G;  3AA9 A;  5LMN J;  4NL5 A;  4KPC A;  8RUC A;  4XO0 A;  4HHH A;  2DNZ A;  1NSQ A;  5EN1 A;  1NU4 A;  1YQH A;  2IM2 A;  3UN5 A;  3W2V A;  2BV3 A;  3VAF A;  5SZT A;  1RWU A;  1I5O B;  2BKN A;  2EFP A;  3LAL A;  2RRA A;  4NLO A;  4CNY A;  5D0H A;  4U67 Q;  1UET A;  1NEE A;  2DYA A;  3FJ2 A;  6FD1 A;  3ZZZ A;  4QYZ J;  1N32 F;  2OPP A;  3BN4 A;  1AXQ A;  4ES2 A;  2CG4 A;  3HX9 A;  5I42 B;  1Y11 A;  1S59 A;  2VFV A;  3FRY A;  1Q7L B;  4OIX A;  5A8W B;  5DDP C;  3MR2 A;  3U02 A;  5FDL A;  3FBC A;  1P9Q C;  4I7F A;  1WD6 A;  1FJE B;  1WWH A;  1ZPW X;  1R8H A;  2OSQ A;  3TZY A;  5B7W A;  1IBK F;  1OS5 A;  2CJB A;  4ZN3 A;  1GQE A;  2MQO A;  5L1K A;  1RAJ A;  1SPB P;  3MD1 A;  3CD6 S;  2UXB J;  3OVA A;  3H5Y A;  4ECU A;  1CLF A;  3QLH A;  1F3F A;  3M30 A;  4CQ1 A;  1E6Y B;  5G0R B;  4ELT A;  4JI3 F;  4DV7 J;  5HQL A;  2OEM A;  3QJP A;  3R5J B;  3IR6 B;  4ENO A;  1NJZ A;  1RGV A;  1IBM F;  4ZLJ A;  4DL2 A;  4LBI A;  2ZUG A;  4DPY A;  4P7V A;  4QIF A;  3M2R B;  1FA0 A;  1TKZ A;  2GO9 A;  4H4M A;  4M5G A;  5J2M B;  1MWQ A;  1NSP A;  3PX4 A;  1P8G A;  3MEE B;  2G2Y A;  3P3D A;  1R0A B;  4DQP A;  5KFY A;  2RKI B;  4CH7 A;  4C0B A;  5IM0 A;  1VK8 A;  1VLY A;  4NI2 B;  4NLR A;  3RW7 A;  5AE2 A;  4ED8 A;  4EO8 A;  4K2X A;  2HAI A;  4RW9 B;  1OYE A;  1Z4U A;  2YX1 A;  3JB9 k;  2BAC A;  1KSP A;  3Q8P B;  3R2C J;  3O3L A;  3R6L B;  2RQC A;  3K5L A;  5CZX A;  1X5O A;  2JNJ A;  1T3N A;  4G3I A;  1RT3 B;  4B9U A;  1HR0 F;  4C8N A;  4B9V A;  2JJ4 D;  2Q3P A;  3BPS P;  2ZH9 A;  1RAC B;  3PHE A;  3Q23 A;  3K58 A;  1CJT A;  3FRZ A;  4DSF A;  1WEY A;  3OSP A;  3DRS A;  5CYM B;  3M8Q B;  2M7S A;  5ETK A;  1TK5 A;  2F9D A;  2YNF B;  2BYC A;  3D2W A;  3H0P A;  4C6A A;  2XY6 A;  3LW5 C;  3KYL A;  5M2R A;  4ZVO B;  5ADZ A;  4ES1 A;  1GXT A;  4FS1 A;  3C2P A;  1UEV A;  1UP1 A;  1RCO B;  1NSK L;  1QD1 A;  1JLQ B;  2UP1 A;  3C3L A;  2HHT A;  4B9M A;  3OLA A;  4CLF A;  2XGP A;  3AT1 B;  2MGZ A;  2COL A;  1VRT A;  4PR6 A;  4KR0 B;  4CH0 S;  1NAQ A;  1TVR A;  1LNQ A;  3ILJ A;  2W25 A;  3BPD A;  1D3W A;  3BGR A;  1IKX A;  4A8Q A;  5KFZ A;  4QJV A;  2IAJ B;  1X4D A;  4B3O A;  2FC8 A;  2CPI A;  1ARO P;  1D9F A;  1PJ5 A;  4FYY B;  2VFU A;  3D4J A;  4R25 A;  4K59 A;  4DV5 J;  1WSV A;  1U09 A;  1IKV A;  2VG5 A;  4DV6 F;  2CWX A;  1DBD A;  2OFG X;  4YHH F;  4ZIW A;  2HBR B;  3V2U C;  3GIL A;  3ELH A;  2C2E A;  2LYV A;  4LF8 F;  4OYX A;  1HD0 A;  3U1L A;  4H4K A;  3RB3 A;  2ZHA A;  2QE5 A;  3G6E S;  2OHD A;  4DOZ A;  2CQH A;  4ZDN A;  2Q79 A;  1TKD A;  3QO9 A;  3I0S B;  4O44 B;  2QFJ A;  2GA7 A;  2HGM A;  4CM2 A;  4WZM A;  1Y4Z B;  3C14 B;  1L3V A;  1CPZ A;  1DTT B;  5IT0 A;  4EEY A;  1EAR A;  2KJV A;  4F0M A;  2DY1 A;  3H7H B;  4LSL B;  1KKH A;  1Z2L A;  4LFA J;  2XCP A;  2Q6C A;  4TVA B;  1NH8 A;  4RBU A;  1HBU B;  1FD2 A;  5H1S V;  3M8R A;  2B8Q A;  3TRG A;  2EW9 A;  1B70 B;  1DTQ B;  1UFW A;  1ICE B;  4JV1 A;  1TUV A;  1TL3 B;  2UUB J;  2KM8 C;  1G7C B;  2VAS A;  2FVR A;  3HVT A;  4N8O A;  1N54 B;  2F7V A;  3WX8 A;  3DC2 A;  2GGP A;  3GFY A;  3HHL B;  3HI9 A;  1RTJ B;  2RIJ A;  1DZ5 A;  2FLP A;  2HHV A;  1Y9O A;  3SV3 A;  4LBH A;  3MCM A;  4USW A;  2W2P P;  4RNF A;  2W2M P;  2XO7 A;  4PPZ A;  4M63 A;  1SBR A;  5HVH A;  1W26 A;  2ZBI A;  2WAQ D;  3AD8 C;  1RTD B;  2V50 A;  9ATC B;  2EXU A;  1URN A;  3LF0 A;  2G2Z A;  4LR7 A;  2WOM B;  5KTQ A;  3RJM B;  1CQM A;  4ATN A;  3OR2 A;  4JI4 J;  4ZJQ A;  2OJ3 A;  1K73 T;  2HK2 A;  4H4O B;  1R7I A;  1D09 B;  4RWX A;  4RO0 A;  1WSR A;  5F8H A;  2LU1 A;  3KLH B;  4OZL A;  4NWB A;  2HWT A;  3N5B A;  5A8R A;  3PEJ A;  2R7U A;  1HW9 A;  1FDB A;  1L5U A;  4ES3 A;  3D7S B;  2Z4P A;  2Y1L B;  1VK3 A;  3H42 A;  2HVH A;  1YI2 S;  4PYD A;  4CLL A;  5LT5 A;  4C8L A;  4O4G B;  2X7I A;  5DZ6 A;  1RT5 A;  2QC3 A;  3DRY A;  5KG2 A;  2K1R B;  3TAM A;  3RG6 A;  1BQN A;  4IO9 Q;  3LP1 A;  2XWX A;  2OTJ S;  3DFE A;  5B0C A;  2E1R A;  3NS7 B;  4AQY J;  4QYR A;  2G0C A;  3GP9 A;  2DNG A;  5T14 A;  4F3M A;  5ETT A;  2R42 A;  2HHS A;  5CCL A;  5C25 A;  1VBX A;  1Y5I B;  4OHX A;  4PZV A;  4PAB A;  4CLT A;  2CQC A;  2R7X A;  4JYA J;  1XMQ J;  3DLG A;  3HF5 A;  2CPY A;  1WTB A;  1ZH5 A;  2K2P A;  3MM7 A;  3C46 A;  2EPI A;  1NDK A;  2FVP A;  1FJG J;  3TVY A;  2LEP A;  2W01 A;  3LP2 A;  3S1T A;  3CCE S;  4O4R A;  3MFH A;  5GAD I;  2J6S A;  2JEI A;  2WB4 A;  1FJC A;  1N6Q A;  1TZ0 A;  1CJU B;  5AXL A;  1C1C B;  4RBT A;  3VAM A;  3OW2 R;  4IKA A;  3QYY A;  4CLS A;  2VA2 A;  2YWE A;  4GKJ F;  4A8Y A;  4NE9 C;  5LMU F;  4KGV B;  3D1H A;  1SC6 A;  2VA3 A;  3MEC A;  4ECX A;  2HSE B;  4L75 A;  2QA4 G;  4WP3 A;  3MCS A;  3PXG a;  1GMV A;  3KUE A;  1U45 A;  4NCA A;  2NSB A;  4RNN A;  1IBL F;  1MU2 B;  2MQ8 A;  3I0R A;  4OI4 A;  1YRU A;  1R89 A;  1FRJ A;  5EWG A;  4I4B A;  3GG0 A;  2RSQ A;  1EIY B;  4JI8 J;  1YZ7 A;  1RHU B;  1KRP A;  4YEA A;  3HP6 A;  4C3K A;  4B3S J;  1GNK A;  3HO1 A;  2W4P A;  4NLX A;  4N47 A;  3HT0 A;  1RLD A;  4WJB A;  3NNH A;  3W2V B;  1ZAV A;  2D9O A;  4DX6 A;  2HW3 A;  2W24 A;  3DMJ A;  4CO3 A;  4ED4 A;  4YB6 A;  4ZCL A;  2OPP B;  4NML A;  3H5X A;  3CDW A;  3MEG A;  4NLD A;  3BR9 A;  5ETP A;  3LTO A;  4C8M A;  2V8D A;  1IKY A;  3W5Y A;  3IN5 A;  5FDL B;  4PG8 A;  3OHB A;  4I7F B;  3KNG A;  2VIC A;  1PC4 A;  4R5P A;  5KFE A;  1JJC B;  2RB7 A;  1RAE B;  2E5L J;  3ZXW A;  1VQN S;  3CJT A;  3A12 A;  1TAQ A;  5C5J A;  2B43 A;  1WDT A;  3QLH B;  3HZG A;  2DKO B;  3M30 B;  4M5M A;  3PY8 A;  4TQS A;  4DQR A;  1GAO A;  1Y5N B;  4NA3 A;  3OL9 A;  1LV5 A;  3HSD A;  1YIT S;  2IRY A;  4M8L A;  2VOO A;  1U1M A;  1OO0 B;  1HWJ A;  4IQM A;  1JLF A;  1VOM A;  4CT8 A;  4X62 J;  1TKZ B;  4H4M B;  3CVK A;  3I4P A;  2HNY A;  5ETS A;  2ZH6 A;  1GFW B;  1FXD A;  3NGT A;  3CCV S;  3J7Y I;  2HLT A;  3B8H A;  5IM0 B;  4ZPA A;  1FWP A;  3OTO J;  2JEF A;  4C97 A;  2WCX A;  1UMJ A;  2D3Z A;  4RW8 B;  3FEX B;  3ZZP A;  2OFH X;  3HFV A;  4ZCI A;  1U2R A;  2VQE J;  1ZTT A;  3CJ2 A;  3OJU A;  3L95 X;  4NYO A;  3KLG A;  2DIS A;  3HCX A;  3CJ4 A;  3CPW R;  5J1N A;  1S1T A;  4URG A;  1PYS B;  1NDC A;  4DI6 A;  1LKZ A;  4ZVH A;  2OD4 A;  3BYR A;  1CJT B;  4YR0 A;  1KQS R;  4AFF A;  2ZWP A;  4X4Q A;  3DRS B;  2E1C A;  3IO1 A;  4JI6 F;  2KL8 A;  2WHO A;  2PEH A;  3ZZY A;  4I0W A;  3G2X A;  4ZPW R;  3V6H A;  4UY8 T;  2MEW A;  4DSL A;  4EYI B;  1B0T A;  1ZM9 A;  2R4F A;  2XHC A;  4Z37 A;  1NH7 A;  4FF1 A;  1SJ4 P;  2VC1 A;  1VC6 A;  3R3T A;  2MGZ B;  4WFA Q;  3QAT A;  4KPY A;  3R9L A;  1VRT B;  3I9Z A;  1NJX A;  2NCK L;  1N0V C;  1RTI A;  2DNR A;  1TVR B;  4NLW A;  3BGU A;  2UZA A;  3BGR B;  1IKX B;  3M6W A;  2FGO A;  4QU7 A;  3W5Z A;  4ERD A;  1HMV A;  1XTZ A;  2BDP A;  1I3O B;  4B3O B;  4ED0 A;  3NBP A;  2ZM6 F;  3QBC A;  3TO8 A;  2V4Q A;  1RAO A;  5JXS A;  3RYL A;  4G6V B;  1IKV B;  1JLC A;  2VG5 B;  5LMN F;  1FNX H;  2EG2 A;  1S7H A;  4LJM A;  2HBY B;  3PW2 A;  4OX8 A;  2F8E X;  3M8Y A;  3MPV A;  1REG X;  1JWW A;  2FHK A;  2B3T B;  1DFD A;  1QVF R;  4TQR A;  4MK7 A;  5ETN A;  1WKK A;  3G6X A;  4KT0 C;  3KK3 A;  5ETM A;  3D66 A;  3A3O B;  4C8Z A;  3QO9 B;  5D4O A;  3F44 A;  2AT1 B;  2AMC B;  2BAN A;  4DV2 J;  1X0F A;  2ZOG A;  5KFB A;  2ZWO A;  1M90 T;  2X3D A;  3KJN B;  4IH7 A;  1RWM B;  3LWM A;  3JQJ A;  5EWE A;  2ATL A;  3THV A;  1QAJ A;  3R7N B;  5KFA A;  3EMT A;  4ZVE A;  4KHP F;  3A1Y G;  5LXR A;  2Y8W A;  5CHC B;  2UXB F;  1NSA A;  1N8R T;  4UQG A;  5I4M A;  3HVT B;  1X9W A;  3VF0 B;  2V2V A;  1LK5 A;  3WC2 A;  2VKR A;  2GGP B;  5AJ3 J;  2V69 A;  2DY9 A;  2QLJ B;  4AXJ A;  4O3R A;  1RI7 A;  2GV1 A;  1J5O A;  2FDN A;  1SKW A;  1U6F A;  2ZBR A;  2D41 A;  2PSZ A;  2PII A;  3K5O A;  2F3J A;  3I32 A;  3HPO A;  4ZJO A;  3G71 S;  3ITH A;  1B99 A;  3V6D A;  1R3N A;  2RQK A;  4KBI A;  3Q86 A;  2LDI A;  3IBC B;  5KT7 A;  3JTP A;  1IR1 A;  3HD1 A;  3QRR A;  4QWD A;  3VR1 A;  2V63 A;  3CE8 A;  3J81 j;  3FBE A;  3OR2 B;  4NOH A;  2LLZ A;  3IGN A;  2V67 A;  3DRP A;  3PX6 A;  5HMZ A;  5A8R B;  3PO4 A;  2PMZ D;  1H7W A;  5F8I A;  3NNA A;  3Q8Q B;  1S97 A;  1ULR A;  3HXM A;  2FLL A;  3RU0 A;  2G1D A;  2E5J A;  2D74 B;  2OIH A;  3TVK A;  4F8R A;  3R8Y A;  3IBW A;  4DL0 C;  2YNI A;  4QPX A;  3OXG A;  1MG7 A;  3ILO A;  1RE1 B;  2XMA A;  3MD3 A;  2W9C A;  3TAM B;  3GYN A;  3S8S A;  7FD1 A;  4C8O A;  3NGD A;  4GC6 A;  3N79 A;  5DQH A;  1BQN B;  1RA6 A;  5HVG A;  3LP1 B;  2DR6 A;  2JVR A;  1RT7 A;  4LRF A;  4DG1 A;  4FPR A;  4EYH B;  1PYO B;  2VPW B;  1H73 A;  1X60 A;  5HRO A;  3FSX A;  5B0F A;  3E01 A;  3RBX A;  3LGH A;  1OPZ A;  4F4W A;  5C25 B;  2HWI A;  1G3O A;  1Q5Y A;  4OI1 A;  4A48 A;  3QRQ A;  2XTJ P;  3UR0 A;  3B4M A;  3A4T A;  1S0M A;  1RCX B;  3GG1 A;  3DLG B;  2FJE B;  4DV5 F;  2MLY A;  3BV8 A;  5DZ7 A;  2BRK A;  3MM7 B;  2NR0 A;  3MGJ A;  2H5J B;  2NXE A;  4NLQ A;  1KON A;  1H2V Z;  5GME A;  2CQ1 A;  3G4S S;  4K8R A;  4RUB A;  4JOU A;  3LP2 B;  3X3U A;  4KC5 A;  2GAH C;  1N6Q B;  3R27 A;  4B9L A;  2IJF A;  3CCJ S;  3GMG A;  3L7U A;  2QV6 A;  1T3O A;  3ULH A;  5F3Z A;  2E66 A;  1GH8 A;  2BE9 B;  3L09 A;  5L1I A;  4DUT A;  4KHM A;  3MEC B;  2VIH A;  3IWX A;  3TA2 A;  4DV3 J;  1Q81 T;  4E8U A;  4LFA F;  2MHE A;  3VAG A;  4B3T J;  4LR9 A;  2RML A;  1G2E A;  4ZVQ B;  3DHX A;  2XMK A;  4RUA A;  2CPF A;  3O1L A;  2KXN B;  1Q8L A;  1WC4 A;  1U24 A;  4NZ0 A;  3I0R B;  3TWZ A;  3GJS B;  3W2W A;  1SV5 A;  1KP6 A;  2UUB F;  4LR8 A;  2JLE A;  2DXE A;  5GVQ A;  3S6E A;  5DG9 A;  3CB4 A;  4IH5 A;  3G86 A;  1WI6 A;  2RH3 A;  1PKU A;  2X3G A;  3MM9 A;  3M05 A;  1NO8 A;  2YX7 A;  1FO1 A;  3HSJ A;  3CNQ P;  1UFL A;  1OY9 A;  4JI2 J;  2LQ9 A;  3DMJ B;  3I31 A;  3AB4 B;  4F4Z A;  3MCN A;  1AB8 A;  4F4X A;  4Y0F A;  4ECQ A;  3JSR A;  2A6M A;  2RRN A;  2AJ0 A;  1HI0 P;  2EI5 A;  3CSK A;  2JOQ A;  2BM1 A;  5DDQ C;  3R7S B;  3MEG B;  4JI4 F;  1I1G A;  4DJB A;  3AD7 C;  1HQU A;  4ZPC A;  1IKY B;  4CLK A;  1CUL A;  2MYF A;  1QM9 A;  4R5P B;  3M6V A;  2MKK A;  1R31 A;  4PWU A;  1CQN A;  4ZCK A;  5KFS A;  2YQ0 A;  2UUT A;  1JLG A;  4NYP A;  4QWE A;  5D15 A;  4Y2A A;  3NGS A;  2JFD A;  5KT5 A;  4A47 A;  2J9D E;  1FVQ A;  5ETL A;  2DR5 A;  3R5B A;  4ZCM A;  3WBZ A;  1URR A;  2VPZ B;  5IWA J;  2YY3 A;  1JLF B;  4FYW B;  4UUX A;  2NYH A;  4EBD A;  1JKH A;  5IFM A;  1S77 D;  2HNY B;  1BUX A;  1X4A A;  4AQY F;  3I4H X;  4JI0 J;  2APO A;  1MLA A;  2KKH A;  2MKC A;  2ZHO A;  2PE8 A;  3EZ5 A;  4M5I A;  1KVK A;  2YKP A;  2JX2 A;  3K89 A;  1X5T A;  1UL3 A;  3THT A;  2NQP A;  1RXO B;  4X4S A;  3KOA A;  1H2U X;  4A46 A;  1RHK B;  4IFY A;  4IDK A;  3KLG B;  2KN4 A;  4JYA F;  4UQT A;  4USJ C;  1XMQ F;  4Q5V A;  1WHW A;  2YXL A;  3AHP A;  2FJW A;  1S1T B;  5HL7 Q;  2LXI A;  4HTI A;  1D9D A;  2AGQ A;  3KHG A;  2D3U A;  2LXF A;  1FJG F;  2HBZ B;  2AZ3 A;  5KG0 A;  3EWG A;  1DRZ A;  2LP4 A;  2GZO A;  2H5E A;  5DGB A;  3PJW A;  3I5A A;  2AEJ A;  2E1A A;  2KZM A;  1KN6 A;  2AU0 A;  4XAK A;  4U8Y A;  3KUG A;  2PMH A;  3IG1 A;  1WHX A;  3CDB A;  3UFC X;  1Y10 A;  3H4B A;  3RB0 A;  2DGW A;  1KOH A;  3LO3 A;  2QX0 A;  2LEB A;  1F0X A;  3SMZ A;  1LEO A;  3EVO A;  3GQC A;  3AJ2 A;  4FN5 A;  2CIM A;  4W4M A;  1M5O C;  2PFD A;  3VGS A;  1RTI B;  1WNE A;  4WFY A;  1JNZ B;  4IOB A;  3ISZ A;  1X4E A;  1HD1 A;  3E8O A;  1RHR B;  5IOL A;  1YTY A;  1UFK A;  4NLP A;  1HMV B;  3NBP B;  4JI8 F;  4I56 A;  1LWX A;  3DU6 A;  2FHM A;  4B3S F;  1JLC B;  4LMZ A;  2BEF A;  3WIU A;  4J5O A;  2QLB B;  4P2S A;  4NPO A;  5IC4 B;  3L7O A;  3H25 A;  3JQM A;  1WEX A;  4X66 J;  1OY8 A;  5E3Q A;  4NLS A;  1IJF B;  1BQM A;  2DH9 A;  3KK3 B;  3EVW A;  2CJY B;  4O0I A;  7AT1 B;  2NS1 B;  2KHD A;  4ZVT B;  4YS2 A;  2RDJ A;  3KG4 A;  2BAN B;  3FBF A;  2VBW A;  4HHU A;  2Y0S D;  2C2M B;  4DU8 A;  4LUB A;  4K4Y A;  2GCF A;  4J9U E;  2FLO A;  4BLG A;  3CIM A;  1BWE A;  3BRE A;  3QPI A;  4OJH A;  2Q66 A;  3KLE A;  2E5L F;  3DOL A;  5T7L A;  4DUZ J;  4K4T A;  4F4A A;  2GS8 A;  2WSC C;  2FTR A;  4DR1 J;  4V19 J;  3NWG A;  4J9N A;  2V4R A;  2IM3 A;  1EKR A;  3D6H B;  4ANE A;  1JLA A;  3MMA A;  1RAG B;  4UT4 A;  1J5O B;  3CUL A;  2AHO B;  4DV1 J;  3M9M B;  4KV8 A;  1SJF A;  5LSO A;  2I8E A;  2AYM A;  2V0N A;  4W98 A;  4X62 F;  4HI2 A;  3ITH B;  1E6V A;  3V6D B;  2FC9 A;  1SKS A;  3PYF A;  2E5G A;  3BF4 A;  1HNZ J;  3BH6 B;  4NZ7 A;  3OVB A;  2DBB A;  4RKU C;  2QN6 B;  3OTO F;  1P6T A;  1FES A;  1Y3K A;  2QLX A;  2YPY A;  2VQE F;  1HAR A;  5LJ3 Y;  3DRP B;  1S0O A;  1FE0 A;  3I5B A;  2OP5 A;  1R8C A;  2IHR 1;  3CO0 P;  5DQI A;  3HDS A;  5KT3 A;  2BMB A;  4LF1 A;  4OHZ A;  4ZKA A;  4EBC A;  2VZ9 A;  4CO2 A;  5K8N A;  1N34 J;  4QYZ K;  4ZK7 M;  4LFC J;  2PT0 A;  4KY3 A;  1ZYQ A;  1UVN A;  2UVW A;  2F65 A;  2YNI B;  3RW6 A;  4OYW A;  3I5C A;  3EZO A;  2W9C B;  2N3L A;  1VQS A;  2OPR A;  4KGZ B;  5KFJ A;  5IT9 Y;  8ATC B;  3V4I A;  1NPR A;  5HVF A;  4CLP A;  4U9R A;  1RT7 B;  3MED A;  2H51 B;  4NA1 A;  4DQQ A;  4OI0 A;  4DG1 B;  2W7A A;  3IXQ A;  3MR6 A;  3OR1 A;  5HRO B;  1R0C B;  3QSI A;  3E01 B;  5JVG Q;  4PG5 A;  5A2Q Y;  5ETO A;  3W5X A;  5HMX A;  2W2Q P;  2C2Z B;  1QSS A;  4OL8 A;  2BBE A;  1RT6 A;  2FZK B;  3HSG A;  2B9Y A;  2XNR A;  3MMJ A;  2MSS A;  2GIQ A;  2W4D A;  3D3C J;  2YQ1 A;  3V4M A;  1KQG B;  2ZH8 A;  4DLE A;  4OV1 A;  1PGZ A;  2GML A;  4EBE A;  3M6U A;  1VQ6 S;  5K5M A;  5D4L A;  3KJF B;  4FVC A;  2E29 A;  1B0P A;  2XS2 A;  5K8M A;  2ZC3 A;  1QTM A;  1RBL A;  4YP3 A;  1YRX A;  1IR2 A;  1NCL A;  2DPJ A;  1MMN A;  2ADC A;  3HJF A;  2ZOF A;  2GVD A;  3W60 A;  2DGX A;  3Q8U A;  5KT4 A;  4DV2 F;  4IRK A;  2OUG A;  3HHE A;  4K4V A;  1ZA2 B;  2LEC A;  1P1L A;  2E7V A;  2DNY A;  1VQM S;  2GMJ A;  2MQL A;  2X1A A;  3T1Y J;  3W2W B;  2FJD B;  2N7C A;  2MQN A;  5C2C A;  1SV5 B;  4BC7 A;  2HRY A;  1REV A;  4IG0 A;  4DUY J;  3L3C A;  3GIJ A;  2MQM A;  2RU9 A;  5AJ3 F;  1SC4 B;  2DXF A;  3MMB A;  3VAI A;  3EIC A;  1KLN A;  1DHM A;  3MM9 B;  1UVJ A;  3EUN A;  4ZN1 A;  1U48 A;  3CCT A;  3CT9 A;  4DR6 J;  4NZ6 A;  3W1Y C;  4YDX A;  3OD2 A;  2XYP B;  1BD6 A;  2LVW A;  3JXO A;  3NGU A;  2WBM A;  4KKO A;  1VQO S;  2ASY A;  2IVY A;  4LVO P;  2XM3 A;  2QSW A;  3NOG A;  1S9E A;  1VQK S;  3PYG A;  3K5N A;  1K9M T;  2H4Y B;  4NEY A;  4WBF A;  3GZ7 A;  3BBF A;  4ZP8 A;  1YZ6 A;  3D1Q A;  5D3G A;  1TFY A;  4ECW A;  1HQU B;  3ENA A;  5JJB A;  2J0S D;  1Q7Y T;  2P5V A;  1OY6 A;  4QCL A;  5AXN A;  1CUL B;  2NXC A;  1U1O A;  1FXL A;  3LAM A;  2LCW A;  2UXC J;  1NHK L;  2DNL A;  2AJQ A;  1JLG B;  3N5F A;  4C8Y A;  2DR7 A;  3R5G A;  1JLB A;  2VD3 A;  1R8A A;  3BO3 A;  2O5D A;  5E3P A;  4O3N A;  5JUM A;  4MYU A;  4IOA Q;  5KFK A;  2A2C A;  4USK A;  5L9X A;  2DNN A;  3J81 Y;  2ZDP A;  1RBO B;  2XLK A;  4TY8 A;  3M1V A;  4BWJ A;  3M8W A;  1Q4R A;  1ZA1 B;  1GX5 A;  2BJ8 A;  4FYD A;  4ZPB A;  1JKH B;  2VFR A;  2W2N P;  2CJA A;  1R6V A;  3DOK A;  4HHJ A;  2P9G A;  1IJE B;  1VI7 A;  3RB6 A;  1JXE A;  2UXD J;  1NK6 A;  2GFF A;  3D68 A;  3RBZ A;  1IN0 A;  3BDP A;  5CD4 A;  1CVJ A;  2XHW A;  4HR2 A;  3CXC R;  4MYT A;  4WK3 A;  2RHQ B;  2RUG A;  1Q0N A;  1WEZ A;  1FFW B;  3JTO A;  4WFN Q;  4DU7 A;  5D8H B;  1FNO A;  3GE9 A;  2E9Z A;  4IFY B;  3GIK A;  3W64 A;  4IDK B;  1XR7 A;  4A8O A;  3LH2 S;  2QSF A;  3CED A;  1RWV B;  3BKT A;  4EK2 A;  5C24 A;  4F25 A;  3AA8 A;  2XI2 A;  3GSI A;  4FBU A;  1RTH A;  4F04 B;  4LVN P;  4ILL A;  1F2H A;  2LA6 A;  1NPK A;  1NPP A;  1KEK A;  1ITP A;  4OMF G;  1GTH A;  1D8Y A;  1RDR A;  3UDV A;  2CUY A;  1FDA A;  2V8G A;  4J9R A;  2I0X A;  1YG0 A;  2G0J A;  3IG1 B;  3IAM 9;  4F7V A;  4C3M A;  5KFP A;  1S49 A;  4O0N A;  2XNQ A;  4KE5 A;  3D9B A;  4L3K A;  2CPD A;  5KT2 A;  4UOC A;  2RIL A;  3BYP A;  1HHS A;  4DV3 F;  1IM4 A;  1SC3 B;  2FHO B;  2HZA A;  2J9C A;  2JDJ A;  4B3T F;  2KO1 A;  4WP8 A;  4LF7 J;  3AY0 A;  1SQG A;  3Q24 A;  1XR5 A;  4Y3C A;  5KFX A;  3QFW A;  5KG1 A;  4QU6 A;  1K0V A;  3CJR A;  2PMW A;  1HPZ A;  4AUK A;  2XGQ A;  4Y00 A;  3PEH A;  3PKY A;  1FI4 A;  2RAQ A;  4YB1 P;  2MQP A;  1X4C A;  2C3U A;  5KT6 A;  1NUE A;  2XMM A;  2IA6 A;  4PRF A;  1KTQ A;  2BQ3 A;  4ECR A;  4HH1 A;  4JI2 F;  4CWB A;  1BWV A;  1BQM B;  3S7R A;  3JTN A;  3P96 A;  5HP1 A;  2XUL A;  1RBA A;  1N5V A;  4C4W A;  2AW0 A;  5T41 A;  5HSP A;  1QJH A;  2LQ5 A;  3B4D A;  1NXI A;  4F26 A;  1N33 J;  1CS4 A;  4OLO A;  1AW0 A;  5HQ8 A;  3GON A;  1D0E A;  4P71 A;  3C19 A;  4IR1 A;  5AXM A;  1TU0 B;  4OI3 A;  2V2Z A;  3H2V E;  3QJL A;  3QGI A;  4IOC Q;  4URS A;  4TXS A;  2ILY A;  4DSI A;  1N48 A;  3KLE B;  3IWN C;  4DL7 A;  3P5T L;  3DOL B;  3TAQ A;  1VQP S;  2BQR A;  3G9C A;  3QSY B;  5T7L B;  3LPE A;  1OSC A;  2ROE A;  2YKO A;  1S6U A;  2OEK A;  3IMQ J;  3F73 A;  4RZR A;  4EU0 A;  2GQ2 A;  3TJ8 A;  3G6V A;  1X9S A;  1S1X A;  3FCW A;  1JLA B;  3MMA B;  4ZVG A;  4KHR A;  4E2F B;  1XC9 A;  2J8A A;  1H74 A;  2KFY A;  4KV8 B;  5IWA F;  5E3R A;  3KG0 A;  3PV8 A;  4DCJ B;  3UVJ A;  3CGI A;  5E3C A;  1ZET A;  3DGP A;  1B3T A;  1I94 J;  3ETO A;  4UW2 A;  3PKM A;  3AOD A;  3I55 S;  2V9K A;  1E6V B;  1TMJ A;  3I96 A;  1EQM A;  4JI0 F;  2J76 E;  1RA7 A;  2CPX A;  2XG8 A;  3ETM A;  1C1B A;  2P2C B;  5E33 A;  3OFG A;  3CCQ S;  2CJ9 A;  1T9U A;  4F3O A;  2KI2 A;  4FXW A;  1B64 A;  3M2U A;  2M5Y A;  3FNN A;  2NUU G;  3R5A A;  3SQG A;  2H5I B;  3TUJ C;  2BZ2 A;  1GEH A;  1NK7 A;  5KFV A;  2B6A A;  2YWK A;  5KFQ A;  3TW0 A;  1RKI A;  3LUY A;  2P9E A;  2EKN A;  5IT9 U;  1QAY A;  1MNE A;  2OPR B;  3V4I B;  4O3O A;  3LA0 A;  3MED B;  4CLZ A;  3MM6 A;  1TKT A;  1HWU A;  3T1A A;  4MT1 A;  5A2Q U;  2HEK A;  4JV5 J;  5IZH A;  3OR1 B;  3SCK E;  1VQ7 S;  1V6H A;  5HBM A;  2R7Q A;  2W7O A;  1X4H A;  2GVZ A;  3T5H A;  3OXL A;  4FF3 A;  2F1F A;  1PIE A;  4YDD B;  3HJV A;  4OYM A;  1RT6 B;  3N28 A;  4TU7 A;  1NME B;  2JVO A;  4ZOS A;  1H7X A;  5HN0 A;  3AJD A;  4PQA A;  4KGK A;  3FZ2 A;  2X1G A;  2HFS A;  1MWZ A;  3AJ1 A;  2CWK A;  2MY7 A;  1O6X A;  1TV6 A;  1U1L A;  3DOM A;  4DPO A;  4AL6 A;  2XLI A;  1QAI A;  4N7T A;  1J5E J;  5F8M A;  2HZC A;  2WVD A;  4L3N A;  4A8M P;  2AQ4 A;  1JJ2 R;  5GAG U;  3T5J A;  3EJM A; 
#chains in the Genus database with same CATH homology
 2LP4 A;  1FWP A;  1FFW B;  1A0O B;  1EAY C;  1FFG B;  1FFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...