1A0OB

Chey-binding domain of chea in complex with chey
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the CheY-binding domain of histidine kinase CheA in complex with CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
molecule keywords CHEY
total genus 17
structure length 70
sequence length 70
chains with identical sequence D, F, H
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1a0oB00
2LP4A 1FFSB 1FFGB 1FWPA 1EAYC 1A0OB 1FFWB
chains in the Genus database with same CATH superfamily
5GAHI 5HK4A 4DQQA 3M2UB 3T9NA 2GO9A 4DX5A 3J81Y 4CH1A 5J2PA 1XMQF 3W2VA 2IMOA 4DV1F 2DRAA 2VC1A 1RT5A 3ITHA 2F7VA 2NSBA 4DV3F 1TQLA 1J5EJ 5GAEU 4RUCA 1IR1A 1WF1A 1FWPA 1RAJA 2L48A 3I96A 1U2RA 3N4WA 4DMZA 4Y0FA 5HMXA 3GV5B 2UVUA 2ERRA 4QWCA 2FD2A 2IRUA 5A8WA 2JEIA 4NZ7A 1FFSB 3AB2B 1FRIA 3DLKB 4LVOP 3VZHA 1RWVB 2E5LJ 1NCLA 4CM2A 4EWTA 4ZOSA 3A8JA 1OY6A 1VC6A 4Q0BA 3W66A 1YG0A 1DTTA 1TL1B 2DNKA 2HQ3A 2EPIA 2HBRB 3DHXA 3HHKA 5CQGA 5I42A 4PG8A 2DNQA 2B4OA 3D0HE 4QU6A 4M63A 1EB0A 1S1XA 2CQ1A 4LSNB 1HNXF 3A8KA 4ECQA 4ZPWR 1VHFA 2QIFA 5E33A 4KIAA 3MCMA 4B3MJ 1D09B 1MWZA 2MSTA 4JI0J 1WORA 2D7SA 1DJ0A 2DNGA 1G3OA 4WFXA 4X4PA 3KK2A 3SQOP 1WKJA 3SSSA 5IT9Y 3IP0A 5KG7A 2ZITA 4IOBA 3BGOP 5F3TA 4RUHA 3OFHA 2ZKUA 3BEGB 4DR4F 4DBQA 4WFBQ 1A0OB 2GJFA 3NOGA 2CQIA 3ILOA 4OJ3A 4ZPDA 4OZ0A 4R0EA 3LP0A 2DGOA 2HQDA 4QYRA 3RGIA 3N0VA 3KHRA 1R0AB 2ZKTA 3B54A 1XTZA 3OR2B 1XN9A 3EZ5A 5KFEA 3C15B 2W9AA 4E2FB 2ZBQA 2CJQA 4U9RA 3KLEB 1L3KA 2PN6A 3CJRA 3MPDA 1RLDA 4DEZA 4DG1B 2HQFA 3EDRB 3T5JA 2R8JA 2HWHA 2NXEA 2O66A 2YKPA 4QIEA 3UPFA 2GHWA 2NCKL 5KFPA 3UD3P 5EX0A 2QX0A 2B56A 4XK8C 2LA6A 1GX5A 1NBEB 1Q8IA 2BE2A 3FSYA 4FKXA 4K2XA 3M9OB 3K58A 3PNIA 4DL6A 1T05B 2I2YA 2BM0A 1UVJA 1F5BA 1RT4A 4FNHA 3MFHA 4TY9A 4EK2A 3BO2A 4NX9A 1DLOB 3HHNB 4NXNJ 2LQ8A 2BQRA 3FBCA 4O3QA 1FFGB 1NHUA 4IH7A 1FERA 4PAAA 4BCAA 1RT2A 1RA6A 1VC5A 1M5OC 3FCVA 2ASYA 4U7CA 1JJCB 2W01A 1VR6A 1F1BB 1T11A 2MKYA 2V2QA 3H5SA 3JTPA 4P71A 1KQFB 3NLCA 3KLHB 4F4ZA 4RUBA 4A8KA 1NK5A 2R7SA 1FNMA 4KPCA 4RW6A 4AXIA 1FJCA 4I1TA 2BOPA 4DR3F 3RTVA 1ELOA 1NUEA 1VBYA 4Y2MA 2F8MA 3R97A 4RU9A 1XR6A 2M8DB 3D0GE 2ATLA 3GFHA 1UJ4A 3T5HA 4EYIB 5HVHA 5F8GA 4FYYB 2AQ4A 1R7IA 3CJ5A 3GJTB 4FP9A 3DCAA 1RAIB 4ED6A 4NZ6A 1DLOA 3LW5C 5ETSA 2VG6B 3VQSA 4YY3F 4DL2A 2DGSA 2OMOA 2J7UA 4IQMA 5LMUF 3FBEA 1GXUA 2UU9F 2MKIA 3DOMB 1HBMB 4DS4A 3NGKA 2XLKA 3W3SA 2DNYA 2G13A 4YUDA 1FHTA 3EDQB 2KZZA 4LBPA 2JC1A 2W8KA 3NNAA 3PZPA 1YK9A 1RT3B 2YX4A 1WTFA 3NWRA 4H4OA 4MIAA 3W8PA 3KLIA 4RU2A 1D8YA 4OZLA 1KTQA 3C15A 4WFNQ 5DLGA 1RT1B 1C2PA 1UJ6A 5D4PA 3FQLA 3IN5A 3OR2A 5KG6A 3T5LA 1FI4A 3QT6A 1NJWA 2C3PA 2W4PA 1NK9A 4C8KA 4PUOB 1LOUA 1J2VA 1UVNA 3FZ2A 4KHPF 2H5EA 3F73A 5K8OA 4IOCQ 5KFQA 4CZCA 3G82A 2FLNA 4LFBJ 3RB6A 6FDRA 4ED3A 3GWCA 4NI2A 4I68A 3ZFVA 3OFFA 4LUBA 3MM8A 4V1Ak 3LTOA 4Y28C 3WBZA 1YRTA 2FHMA 2ASDA 4IQXA 1XNRJ 3ETOA 1BY9A 3AD9C 1X5TA 3GIRA 2M7SA 3OXGA 1TL3B 1T9YA 3W64A 2HZAA 1N5VA 4EUVA 1AYEA 2A6MA 1HNZF 1RAFB 1RTHB 4PABA 2EFNA 4A8SA 2J9EA 1FVSA 2YY3A 1P8GA 3FK4A 4WKYA 1Y00A 2QLWA 1UCNA 5C24A 2QLJB 1D0EA 2R4FA 2W8LA 1LWFB 2YX1A 4RNMA 5FJ4A 2KJWA 4OYWA 3ILJA 2KHDA 3CCMS 4A46A 3W9IA 2BYCA 4RNOA 3MAQA 3NMAA 4GO7X 3NCQA 1SH2A 3Q83A 5BYRA 5T14A 1XMOJ 1ZPVA 2JEGA 1W2IA 1NM2A 2DD8S 3DDIA 1N33J 4Y65A 4AXJA 1RTJA 2H65B 4F2RA 1CEZA 3IMQJ 2UV8G 5FLXU 1S76D 4M1KA 4JV1A 4P7VA 2GVZA 1VQPS 4C8OA 1G2EA 1RWKB 1TFYA 1JX4A 3HO1A 3ISZA 5HN0A 4B9VA 4NA3A 2OMLA 2APOA 3PJWA 3GCXP 4J9NA 1VRQC 3PW5A 4OI0A 3BH6B 1TAQA 4LRBA 2HK3A 1D1UA 3OPKA 1NHKL 2MLXA 2X3DA 3U27A 1AFIA 4X64F 4GRSA 3GIIA 2DEJA 2OPRA 5LOQA 2F4VJ 4ZVGA 3NKYA 3TUIC 1NK8A 2DR7A 4DWIA 3ZTQA 3VAMA 2ALZA 4OLPA 1MWYA 2BE9B 3TX0A 4DQIA 1IKYA 2BANA 2WB1D 2B3TB 4DL0C 3ET6B 5B0DA 1Y9OA 1SQFA 4P10A 2ZC4A 3M6WA 3TNVA 5DGAA 1FT8A 3QSIA 3O5TB 1N36J 4M95A 2IDLA 3LP1B 1JLFA 2AWZA 1D3WA 5A6WA 3OTDA 2ZH3A 1S5ZA 2B7CB 2BEFA 4NA1A 2ZM6J 3QRRA 1VRTB 1S10A 2DTJA 4FYWB 4CTAA 4OI2A 3WIVA 2HHUA 3BKFA 4GKKJ 1TKZA 2CNLB 5K8NA 4PQUA 4U95A 2W2PP 2ZJRQ 2NPFA 1PG5B 2QLFB 5HMZA 2CJKA 1REVA 1FJGF 3SEOA 3M8SA 2LLZA 1F5CA 3R8YA 1U45A 4DSJA 2EG2A 1NLKL 1RA7A 2HFVA 3B4DA 5A0YB 4KHRA 2LQ5A 5JMNA 4NMXA 3GYXB 5L1JA 4E98A 1NJYA 4H4KA 1SIZA 3KG0A 3UI3A 1X0FA 5KG1A 4RBVA 4F4KA 4O4GB 3FRYA 1OYEA 1KFDA 1O51A 3OUYA 1HYSA 1K0VA 4QU7A 1WOOA 2DNHA 1VQLS 2HHWA 3KYLA 1ZA1B 4F3OA 3GCWP 2MZJA 3TUZC 2CG4A 1WHYA 3TA2A 2MQQA 3W2WB 3M8WA 1X9SA 1IM6A 4CM0A 2RHSB 3POTA 3MWBA 4FYXB 2W7PA 2MYFA 3T1YJ 3HHLC 5E3PA 5HROA 4ELUA 4ECYA 3SSQA 5C7PA 5CD4A 5HMWA 1E6VA 3TQ1A 2HFZA 2GCFA 2W24A 1DQ9A 2QFJA 3TAPA 2MSSA 1S9FA 4IFVA 3ZTSA 1VQKS 1U6BA 1DFDA 4C4WA 3DYAA 2N82B 3ENAA 3OTCA 4USMA 4N41A 3QAEA 3IO1A 9ATCB 1AB8A 4OHXA 3NWGA 4YB1P 1CJTA 4BDPA 4DSIA 5DGBA 2WSFC 2YWHA 3I87A 3QNWB 4F8RA 1HQEB 3QO9B 3R5AA 3HLUA 3QIPB 4ED5A 1F3FA 2PMWA 2Z2LA 3P96A 2XLIA 2AKWB 1H2VZ 3RZAA 5J1EB 3HVAA 1SL1A 2F9DA 2MTLA 2YWFA 4FXVA 5KFOA 5A2QU 5L1IA 3FRZA 1S1TB 3KDOA 4CO5A 4X66F 4DV4F 3KUGA 3MEDB 3PX0A 3RB3A 1VQ8S 1L3VA 1FRHA 5IM0B 2OPSA 4JV5J 2AYEA 4RNHA 3M30A 2WTFA 2MQLA 4OX9J 2CPZA 3MPVA 3QPIA 2WVEA 4I2PB 4DPTA 1YVFA 4ER8A 1RTDA 2J8AA 2HEKA 3RBEA 2JC0A 3LGHA 3BSCA 4CWBA 1ZA2B 5DZ7A 4NEZA 1C1BB 3MPUB 2BKPA 4JI2J 3U02A 5B0CA 4W98A 4Y3CA 3MCOA 5D0GA 4ECXA 3V6DA 4P2XA 2R8KA 4I67A 1RWMB 4F67A 3UD4P 2ZBIA 3AOAA 4ELVA 2BJDA 2N3OA 1CBKA 2K1RA 3FUYA 5EWFA 3SI8A 2X7IA 1W2BR 1VQ5S 1GMWA 1EX8A 2EC2A 3ZZUA 4CO3A 4OMFG 2AX1A 3K8WA 3M8YA 1GXLA 1QD1A 2YX7A 1XBWA 2GMLA 4Y2CA 1X4CA 5CA5A 5KFJA 3MR5A 3UN3A 2HVZA 2V69A 2ZHOA 2P9EA 2Q66A 2U2FA 3G8QA 2KDOA 3R5GA 3ZNUA 1V3RA 2ZNYA 1VHIA 3DRXA 3DXSX 4J9OA 1P1LA 3O1LA 5E5NA 3LF0A 4MT1A 4EI2A 2NXNA 4QJVA 3PJ9A 2OAUA 2LA4A 4B17A 5D0HA 3BYRA 3HKWA 1UWBB 4ES1A 2D3O1 4ETZA 5C24B 2CQ0A 2QC3A 3VVTA 4PPZA 2EKNA 2MMYA 2U1AA 5KT5A 4KO0A 2BJ7A 4WK1A 1TMMA 4M8LA 3RW7A 1AW0A 1JLBB 4NCAA 1H3DA 1FK9A 1QAXA 1QDUB 2MLZA 2HHHF 2Y1IA 4J5OA 2MB0B 4ID5B 3HSGA 1UETA 3KNGA 1HMVA 1S7IA 5AXMA 2F40A 3HHLB 2FTRA 4LF2A 5KFIA 2J6UA 3KJNB 4DDFA 1DRZA 2IC3B 2FJVA 3M8PA 5KT3A 1Q53A 1MU2B 3FCWA 3O8WA 4NL5A 4Z2XA 5LMNJ 3DDNA 4ZS6A 1O8BA 4P2MA 3E2EA 1KQGB 2CADA 2CQ4A 1VMBA 3DMJA 1RACB 2WHOA 2D9PA 3ZXWA 2BQ3A 2HIYA 3IM9A 3ETMA 2RQCA 5KFNA 3H0PA 1N32J 4RBUA 3H98A 3VALA 3O2IA 1URRA 2OFHX 5A0YA 1GAOA 1WI8A 2Y0SD 3NXZA 4OI6A 3SIPB 3DXBA 4DV5F 4OHYA 2HRTA 1GQEA 5KFHA 1IKXB 3MOZA 4CIOA 2GHPA 4CLWA 3MM6B 3SSRA 2OI2A 5M2UA 5KOXA 4KGVB 2ZH7A 3BPSP 4Q2MA 2YNGA 2J6TA 4LMZA 1XR5A 1YRUA 2YPYA 3CJ0A 2UUCF 3L7PA 4C3KA 1N52B 2HQIA 2C2MB 2O67A 3DN9A 2KT3A 3CCZA 3NGSA 4J91A 2IM0A 2YKOA 2I9SA 1SH3A 4J37A 1R8PA 1OY8A 4N47A 2BE7D 5F8IA 2MGZB 2ZHAA 2VIHA 3HJVA 3BN4A 4JI1F 2IMWP 2RS8A 4AE5A 1PKUA 1Y5NB 2RRBA 4I64A 4K7QA 1LKZA 1P9YA 4Y34A 4YN3B 4I2PA 2FVCA 5KT7A 1KONA 1T9WA 3HFZB 4J9KA 3T41A 1T0TV 1XWLA 2R42A 4QZVB 5DG7A 1TR0A 3P8BB 2NSCA 4ZP8A 1H38A 3CCRS 4RUAA 3DC2A 2HAFA 1JLEB 4KBIA 1IBKF 2Z8QA 3HKZD 5IV4A 2NUHA 2DIUA 1QTNB 1H2UX 2LXUA 3ZTRA 3DGPA 3NS7B 4UW2A 3I82A 4OI4A 2QE5A 1YX2A 4OZNA 1T03A 3GTYX 4U7UK 2YKMB 4C2MA 3MR2A 4FF1A 3H2VE 4KSEB 2DHHA 7FD1A 4DUYJ 3QIPA 4OHVA 3IBFB 4KT0C 4K4VA 2LEAA 2R8IA 1ZH5A 5J2NB 2FC8A 3A3NB 2CNKB 3SV3A 1T05A 4LF8F 1RHRB 1VJWA 1RYRA 1K1QA 4Q43A 4MFBA 4JYAJ 4JI7J 2VHGA 4KHPJ 4M5NA 3JAMU 3ZZYA 2DO4A 3VAJA 4J9PA 4K50A 1LWEB 2JLEA 4ZCLA 5KG2A 2O01C 2VJUA 4IFVB 2WRMA 3EICA 2VBZA 3DOKB 1X60A 3VGTA 2HHXA 1TUVA 1FKOA 1FRMA 1Y3KA 3AD8C 1XEZA 5KFUA 1WNEA 4W4MA 5KFLA 2G2OA 2XQCA 2W2MP 4UT4A 1Q78A 1YJVA 6FD1A 4CLLA 3T1YF 2YQ1A 3TX8A 2HWIA 3U1MA 2DXDA 5C2CA 2KYXA 3W2WA 4USHA 1TL3A 4PR6A 2ZBPA 1TKTA 4RPFA 3VQTA 2KH9A 3CJQA 1FVQA 3OR1A 1FKPA 4HEA9 5KG3A 1BQNA 1RU1A 2RVJA 4RNFA 1L3UA 2VC0A 3R1HA 3R5JB 4FYVB 3CW2C 2B7BB 2DCUB 4KV8A 4OZJA 2B0GA 3CT9A 2W7OA 1PC4A 4PUOA 2XZTB 3HI9A 2YKQA 3I4HX 4KKOB 5DRKA 1GMVA 3FFIB 2R2TA 2FVPA 4JYAF 1N33F 4EO6A 3SDEB 3CDEA 2RRAA 2KXHA 3KLIB 2WOMB 3NG8A 1S1UB 4RX6A 3CF5Q 2EVZA 1DQ8A 2RHQB 3PV8A 2ZWOA 4PWWA 1G7CB 2PSZA 3CB4A 4AT1B 2YNFA 3DRPB 1QSYA 2AV5A 3SCLE 4DXLA 1UKUA 4ZHRA 3MDFA 3GJRB 4ZPVR 4DR1F 3TO8A 2GO8A 2K3IA 2F4VF 1IVZA 3VCDA 1B7YB 2IJNA 1VFJA 3ZTPA 1S6UA 4ZJOA 4OHZA 3WX8A 1N88A 2CIMA 3C14A 3W5ZA 2R2UA 4F2SA 1TKTB 3A1YG 3QZ7A 4NA2A 2C22A 1NKBA 3N28A 1UZDA 4ZVUB 3UVJA 5GADI 2DNPA 2ASLA 2Y9HA 1U48A 3TQEA 3DU6A 3M2RB 2M88A 4HR2A 4U96A 1NK4A 1B3TA 4F36A 2K7KA 2HWTA 3BN7A 1CULB 5LT5A 1EQ0A 2OPRB 4CO0A 3OJUA 3BGFA 3KK3A 3SFGA 1EZZB 2BVZA 4WIIA 1UWAA 3C66A 7AT1B 4GKKF 4RR5A 3BSAA 1HD0A 1EP4A 4OYIA 1EIYB 2AHOB 2F3JA 2HMIA 1Q0NA 4BWJA 4YDDB 2JOQA 4JP8A 3ILIA 8RUCA 4WWSA 3W1YC 2RT3A 4ZVQB 3T19A 2KT2A 1UVLA 4MK7A 5RUBA 3D3BJ 3RR7A 5HATA 1K1SA 1RTJB 1T9VA 4L6V3 1TZ0A 5ETMA 3HFVA 1U02A 1S49A 2X1AA 4DCJB 4DR2J 2HQCA 2MQMA 3IS9A 2KXFA 1NAQA 1S6PB 1PYTA 2AEFA 1Q86T 3Q2TC 3A12A 1RWOB 4MK9A 3C6TB 2W9BB 2NREA 1ITPA 4V19X 1BQXA 2HS0A 1N5TA 2MXYA 4DL7A 2VOPA 2C2NA 5G0RA 1FRKA 4DL4A 2UUBJ 2WB4A 2Z4PA 2XYGB 1EKSA 4Y2AA 2ABYA 4G1IA 1DHMA 1KHWA 5AT1B 5HROB 4C8NA 3H2UB 3GPAA 3CJ2A 5J2MA 1OWXA 2WW4A 4DV2F 1HBOA 3NCRA 1KHVA 3NCPA 1WTBA 1MG7A 2IRYA 2VFTA 4KQZA 2MHEA 1X4BA 5A8RA 3TAMB 3MMAB 4L76A 1U1KA 3RUBL 4NCBA 4UQTA 5E0OA 4USVA 2HBQB 4TLQA 3ZZOA 3A4TA 5ETLA 4X66J 2BM1A 2QRRA 3W9JA 2W9CA 2WZ1A 2X1GA 5D4NA 3QJJA 2OJ3A 4KTQA 1AXQA 4YB5A 2DCLA 1KVIA 3MOJB 2AP6A 1KOHA 1YI2S 3Q0AA 4IH6A 5C5JA 3EGZA 2NLWA 2IY5B 4Y2IA 2GVDA 4URGA 2WCXA 3BB5A 4ZJQA 4HVZA 3LOUA 1PYOB 1S1UA 4H4OB 2DR9A 3ENQA 2DR6A 3IBCB 5K20B 1H0HB 1QAJA 2XO6A 3WHIA 2ILYA 2ZOFA 2CPXA 2ILZA 1T94A 2G0CA 3FEYB 4F4AA 3ENWA 1ZZNA 4ECRA 3QT5A 1FX4A 1TUGB 4C8MA 4NLTA 1NSQA 5I3PA 3TZZA 2EBGA 2WBMA 1JIHA 1KKHA 3CPWR 3V4IA 5C42A 2KB2A 4KV8B 4CH0S 4PG7A 2FJWA 1DBDA 2VG6A 3UD5A 4FKYA 4ZKAA 3FSIA 2NZCA 4RW8A 1C1CB 3GYNA 3ILLA 4HH1A 1A6LA 4S0MA 4ITSA 1TP7A 1HBOB 2J9DE 4FBTA 4ZIVA 4TQSA 4ZVTB 1VBKA 2H1YA 3PEHA 4KHMA 2JNJA 1VOMA 1YBAA 2B4UA 4USUA 4ZCKA 3EX7B 3KHLA 2BANB 4OZ1A 1FD2A 5LL6d 2AU0A 3PDNA 1WD6A 1HNWJ 4C8ZA 4PXBA 4L74A 4PRFA 4ID8A 2IA6A 4DS5A 2WW8A 3GR1A 3BZQA 4B9NA 3CE8A 3N6NA 2VJVA 3K5PA 2C28A 3B82A 3NGUA 4WXWA 3OL7A 3J80Y 1U25A 4IKAA 3AHPA 3KJFB 1VBZA 3P49B 3JB9k 3LP2A 2ROEA 3DKDA 3N9UC 4ATNA 4LFAF 4DV1J 3Q8VA 5J2NA 3CJTA 4J7CA 1Y5IB 3IGVA 5AXNA 4XDDA 4KJIA 4NPOA 1FWLA 1S57A 2HMIB 2PI4A 4V19J 3MM7A 4BHQA 2Q3PA 2Z57B 3CCWA 3TI0A 1OS5A 1FCAA 1C4AA 1R27B 2YBVA 4X62J 4WBFA 4U6PA 3KLEA 1RXOB 5JVGQ 1LWFA 3GZ7A 3V6DB 4GO5X 5IS2A 2GZOA 3KHHA 4AFFA 4HKQA 4LSLA 3K5NA 2I8EA 1X4EA 2ROGA 4KH0B 1TFWA 4I7FA 4QW9A 2B9YA 2FLPA 2DGVA 1WELA 2JDJA 4JB8B 4USTA 5E3RA 2HHHJ 4HH0A 2RB7A 3PRBA 5HO4A 1RAAB 2EEYA 3QWUA 4EEYA 4M5HA 5DM7Q 2HNDB 5H9FK 2C1EB 4DSKA 1SIWB 2CPJA 2JZ5A 3DU5A 1I94J 4P73A 2AZ3A 3G82B 4MK8A 7FDRA 5LSOA 1S1VA 4FS2A 3V4IB 1S1TA 1S97A 4MKBA 1KOOA 3QT8A 2UXDF 4CO2A 5KFRA 1FKAF 4LIRA 3RB0A 4Q44A 2GAHC 2V8VA 2HRYA 3EZUA 3R6GB 1XNQF 1JWWA 4ALZA 2KKHA 1KLMB 1NJIT 3CDBA 2WOMA 4F3QA 1FEHA 1R8AA 4PG5A 3OV7A 2D1CA 2V4QA 2ATCB 3DLJA 3N01A 4TKTA 4HT5A 5ETQA 2R2SA 2HBYB 1GK8A 3HX9A 1D9DA 3GYGA 2FY8A 3DLGA 2OPQB 5KG4A 1RADB 1ZM9A 5IOLA 1EQMA 1PC5A 2HNYA 1MU2A 4PCQA 1S6QA 3T9ZA 4JUZA 2KRRA 3PXGa 4DR5J 1J5OA 1YJUA 2VBWA 1WEYA 1MWQA 2ZDPA 2ZUGA 4FNIA 1S1WB 4DN0A 1SUQB 1CG2A 1VK8A 2BJ3A 4HI1A 1WC4A 4PEOA 4CO4A 1U2FA 2MY7A 2ZBRA 2CG8A 4J9UE 5J2MB 1VLOA 1S0MA 3POTB 3M05A 2VICA 2P6TA 4HI2A 2E1CA 1UMJA 2XYPB 3S8SA 1U1RA 3PW0A 5EDWA 5L9XA 3B8HA 3MR7A 2C3OA 2EFGA 3ZZRA 1U6ZA 4WJBA 4DV0F 4HTJA 1S7HA 3HDSA 2HPUA 4RW6B 3TW0A 3VR1A 1A7GE 2KU7A 2MZRA 3C6TA 3QQCD 4YY3J 2CVEA 3OUYB 2W9BA 3H25A 2BKNA 3BQ2A 1A9NB 2CWXA 1FDAA 5KFCA 1WI6A 1YTYA 2CQCA 2MLYA 4NOHA 2PMHA 3RAXA 2JL9A 5K8MA 5AJ3J 1C0UA 4MAKA 5AE1A 4IRKA 1MROA 2QL5B 3L4BC 3VAGA 2F1FA 3MPWA 1RT4B 2CPYA 3QGGA 5CXTA 2E1RA 5GADU 4J9RA 3LA0A 4KE5A 1R89A 3RRHA 1Q8KA 1RHQB 2DHSA 3M1VB 3L7UA 1EJ7L 4HACA 4HDHA 4ETXA 3BQ0A 5F0WA 3BSNA 4JBCA 1EP4B 3OTOF 2UUAJ 5DDRC 5HP1B 1V3ZA 2ZH8A 5B08A 3R5CA 4QR0A 1JLEA 3GMGA 2CQDA 1N48A 2HLTA 3DOLA 2M0GB 3EPGA 3CDUA 4CCHA 2E44A 1KLNA 4K4UA 3KG1A 2B5JA 3D9BA 2W2QP 4ZMMA 1M1KT 3UVJB 2ZZMA 1HIYA 2QYCA 1RTDB 4FDFA 3G86A 2LVWA 3LAKA 4OYBA 1YDLA 3C14B 1FXRA 3FGVA 2BBEA 4ZLLA 5GAHU 5E2QA 3LWMA 2B8PA 4DLEA 2QSFA 5BJRA 1RI7A 1Q16B 3FC9A 1LWCB 1PILA 4DV7J 4QPTA 3CJKB 4TQRA 2DGTA 2V8PA 2IYGA 4DR1J 4CNZA 4OYMA 1CSJA 1XMOF 1CS4A 2IM1A 3D66A 2XGQA 4URQU 3DM2A 3TARA 3ONQA 3R6LB 2N7YA 5F9LA 1VS3A 1YJNS 3DLLQ 2NXUA 3PW2A 2E5GA 4C3MA 1FE0A 5B7WA 5CABA 3KHGA 1WKLA 3MF5A 1DTTB 1TL1A 2EI5A 2XEXA 1SJ3P 1CJTB 3GG1A 4GKJF 1OJ4A 4M5GA 4BS2A 4IUFA 3H2LA 4CLZA 2QA2A 1JLAA 4JI8J 2RAQA 3US5A 3F44A 3EPIA 4XAKA 3DLKA 1VBXA 2OP5A 4YEAA 5A8WB 2AW0A 2R7OA 3CVKA 1CC7A 1V5VA 3HD2A 2IC3A 3UDLA 3UO0A 2VQFJ 1FKPB 2B9XA 3PYDA 4X64J 4B3TF 2NUUG 3RB4A 1B7FA 5JXSA 1ZTTA 1HBUA 2NYIA 3JSYA 4LVNP 4NLWA 1K73T 2P6SA 3GJQB 1N6QB 1KRPA 2E1MC 3H5XA 1YITS 4ECSA 3ITHB 4YQWA 1YJ7A 4ZP9A 5GAEI 2IDEA 3GIMA 2W4CA 5KFGA 4QWEA 1LWCA 2LDYA 3C3LA 2FHKA 2WBRA 3MMJA 5F8HA 4X65J 5HANA 2ZM6F 1BE4A 2ZBCA 3AOBA 3TEHB 2KTQA 3J7YU 1LWEA 3AT1B 1EHWA 3HSZA 1HKAA 1RCXB 4FXDA 4DPUA 1Q5YA 1DY3A 2A6OA 1E6YB 3GLJA 4OYZA 2H48B 2HAIA 2MJUA 2OO4A 4MKAA 2A2DA 1UEUA 3D6MB 4YB7A 5DO2A 5IT0A 3H4BA 3DOLB 3ELHA 1RLCL 1C0TA 1PBAA 4KRWA 2JRSA 5KT2A 1BQMB 3D68A 1RT3A 3RRKA 4DN9A 2AJ4A 2D3ZA 2IAJA 1QAYA 4B3RF 2RQKA 4C8YA 1MSWD 1VCTA 1NHVA 2GQCA 5ETOA 3W60A 2CQGA 2YPZA 3C6UB 4HACB 2ZH1A 3BO4A 3DGPB 1HD1A 2B43A 1URNA 4RO0A 2AD9A 2XZWA 1M5KC 4J9SA 1UFWA 1M1GA 4G1QB 4I4BA 1U1NA 2O5DA 3NS5A 4DR7J 5DS7A 1RKJA 1C0UB 2FB0A 3I9ZA 5E7OB 2RDIA 1IBMF 3VHQA 3GE9A 4ZCIA 4RKUC 5L1KA 1Z2LA 3IG1B 1N5YA 3CC7S 3WX4A 1JK9B 3D28A 3FJ2A 1F9HA 2EFQA 1PIEA 4QWDA 4ED7A 3SQGB 3EZOA 1TL7A 1ICEB 2OGUA 2LU1A 1M90T 2BW7A 1G1XA 3RBXA 3UE2A 1BUXA 1NZ8A 2H5JB 4UF4A 5HJYA 2HLUA 5J1EA 3ISNC 3MFIA 4OYOA 1SUQA 4ANEA 1SJRA 3HK2A 2BW2A 2AX0A 3NNCA 1PSDA 2NXCA 2HS3A 1S6QB 3KXDA 2F65A 2E1AA 4P7TA 3OSNA 1MNEA 2FJXA 3HCXA 5I4MA 2IYIA 2B6AB 4IDKA 4IFYB 3K5LA 3MEKA 2LXIA 4WE1B 3PR4A 3I0RA 2B4PA 3CCTA 1VQ7S 2HS4A 1WG1A 4Q45A 2JWNA 1UW9A 4G65A 4EBDA 1Y7PA 4FZVA 1U1LA 3GJSB 1AA1B 4DG1A 2M8HA 2XMUA 1FXDA 2DJWA 3MM5B 5DZ6A 1CLFA 3BKTA 3MECB 2H51B 3DRRB 3I56S 3LO3A 2IRXA 2VA3A 5IV3A 4EO8A 4DL3A 2MKJA 3IRXB 1N34F 2FDNA 1B0VA 1T3NA 4G6VB 3OTBA 1YSJA 1FK9B 2XHWA 1IWGA 1EARA 1PJ7A 5IQQA 4DI6A 2KG1A 2L3MA 4DV0J 1N5QA 3IA0A 4KFBB 1YJRA 4C0OC 4ANCA 5AE3A 1JJ2R 2V8HA 1VQ9S 2NS1B 2ZH6A 2EK1A 4NLYA 1RDRA 3DI6B 3V6KA 1PAUB 1QY7A 1WC0A 2MKCA 4X4SA 4DV4J 3FEZA 1AROP 1NK6A 1HYSB 3P6YC 2G9OA 5DDQC 1LW2A 1XQIA 4CI0B 1CVJA 2CPHA 3MXHP 5DQHA 1KP6A 1NZAA 3MZIA 4JV5F 1K0TA 3CIZA 2N7CA 2KG0A 1NKCA 1CC8A 2VB6A 4N8OA 1T02A 3LH2S 2VPWB 3NAHA 5KFFA 2X51A 4YHHJ 3R2CJ 1QTMA 1RCOB 1S48A 2GGPA 2LEPA 2V8DA 1YJTA 2R2RA 2B9WA 2FGCA 3VF0B 2HNZA 1D8ZA 5I42B 3OTOJ 3R27A 1U26A 2BR0A 1HHTP 5ETRA 2MEWA 2DXEA 1I94F 2KHCA 2VKZG 1HPZB 3W5XA 3KJVB 4NLSA 4NYPA 2RS2A 4ZP6A 1SBRA 5H9FJ 3NEKA 2KL8A 2ZZTA 1RWUA 2HGMA 3HVWA 3E01A 4D3GA 4N5SA 2MKKA 3BGRA 4I2QB 3SFUA 2CA9A 1RT7A 4P52A 3OVAA 2J8SA 4O44A 1R0BG 1RHKB 4CYUB 1RWXB 1HLWA 1RT5B 3QT7A 2FC9A 3C19A 5H9EK 3JSRA 2OIHA 2RRNA 5I3UB 2AJ0A 2IJFA 1RISA 2W2OP 3D4JA 1NH7A 2LYVA 1LFWA 1Q1KA 2CQBA 2YKNB 2PEBA 4QWAA 3VZIA 1WG5A 3KNAA 3NMRA 4JI6J 2HVEA 3FBBA 4NLXA 1UW4A 2UXDJ 4ZVSB 1HI1A 1V6HA 3DGVA 4DSFA 1U0HB 5CD4H 1N6QA 4M94A 3L95X 3MM9A 1VGYA 2AGQA 4ECWA 1I3OB 2GW8A 3JYTA 1J5OB 2NR0A 3I4PA 4PG6A 3BSOA 1FFWB 4ECUA 5D0EA 2IBKA 1K9MT 1WSRA 4KYZA 3G71S 1TMJA 1U8SA 3PYFA 3Q86A 1HNIA 2PMZD 2FLOA 2GNKA 1HBNA 1I5OB 1TV6B 3TAQA 1X9WA 2VBYA 4JI8F 3PVXA 3I0RB 4PXEA 2ADBA 1S9GA 5DM6Q 3HVRA 2XY5A 5KFBA 3BREA 3K5OA 4IFYA 4UOCA 3PX4A 5G4DA 2BZ2A 2AJQA 1OSDA 5LXRA 2KJVA 1WKKA 2XZDB 1JLCA 2DRDA 2YQ3A 3PFOA 5ETVA 2GVDB 1RB0A 3IR6B 4OX6A 4H4KC 1WACA 1KQKA 5AJ3F 2XBPA 3DM2B 5H9EJ 2ZEJA 1JJHA 2VKRA 3I55S 3J7YI 2W4DA 3C2PA 1G6BA 1Q7YT 3KJQB 3TZXA 1RWWB 4EMDA 2XNRA 2E7WA 3W62A 1ZM2A 5A6PA 1N0VC 2V4JA 4QOTA 3L3CA 1IM4A 4B02A 3C16A 5E41A 1X5PA 2ZVIA 4AL5A 4LF7J 4NI2B 3TWZA 2ZUAA 4F25A 3PJXA 4USWA 4DX6A 1I51B 2FVSA 2E66A 4KY3A 5CAAA 1NXIA 1WHXA 2AT1B 1RBLA 2X3GA 3MTKA 3CJSA 2QG9B 2XWYA 3DLEA 1RBOB 1F2GA 4I7FB 1FO1A 4O0NA 3MEGB 1U2CA 2AIRB 4YMEA 3K7RA 1WC6A 3MD1A 5ETPA 2I5JB 5B0FA 5G0RB 3VVUA 3NY0A 4P75A 5HL7Q 3GONA 3BBFA 5L1LA 4HT7A 5DLFA 3D1QA 2IVFB 2WONB 2VZ9A 2XI3A 2CPDA 2IM2A 5CCLA 4LF6F 4LRDA 2Q43A 4H4MA 2CXEA 4TYAA 2Z2YB 3CJ3A 5CCMA 4RLEA 4O23A 3PW4A 2RF2A 1Q4RA 1RAEB 4NLGA 2K06A 1UL3A 4NCGB 1C0TB 4DR7F 3OFGA 1UZHA 3AH6A 3DHWC 3JYTB 3T6JA 3WDOA 3M6VA 1RU2A 1MW7A 3UR0A 2OD4A 4LF1A 3UW1A 4DPWA 2KM8B 1WWHA 1QVFR 4U7UD 3OJSA 2JHEA 2YQ0A 2MQOA 3J7AN 4Z7CA 3MMCB 2CFXA 2ZFHA 3KK3B 2GX8A 4ED8A 4GKJJ 3Q8UA 3AD7C 2AJ1A 3TVYA 1OPZA 4TLRA 4DOZA 3NNHA 4EYHB 2O1PA 1TVRB 4DCPB 4YP3A 2HHPA 1DAXA 5FIIA 2OH2A 2D69A 2WSCC 2XMVA 4JI0F 1IXKA 1P27B 3EGVA 3MR6A 4L3NA 4R0JA 4O3NA 3L9ZA 2XLJA 2QT7A 2VV5A 3IM8A 2XHCA 1KEKA 3DNCA 4Q5VA 1RSCA 4RW9B 4ZLPA 2GS8A 2J6SA 2GHVC 3HULA 2H4WB 4QIWD 1RGVA 4R5PB 2R3VA 4R25A 5K14A 1UPMB 3R7SB 1TL5A 2MZ1A 4GC6A 4WF9Q 2DH8A 1BWVA 2GIFA 2IHR1 2ACMA 2OEMA 2OPPA 3I5CA 4H4MB 3BQ1A 1WF0A 2CWKA 2ROPA 2V0NA 2FY1A 4Q8EA 4B3OA 4XIUA 3IGNA 1SH0A 1SVDA 4CP5A 3G87A 4UZCA 2MQ8A 3A8EA 3T5KA 4B3TJ 3SDEA 2UXCJ 4IYQA 3ZTOA 1AUDA 3G96A 5LXYA 2HGLA 3OL8A 2PGCA 2JLFA 4LRAA 2ALYB 2Y1RI 1CJVA 1IKWA 3U7JA 1UA1A 3UWTA 1T3OA 5THWA 4HLBA 2P9GA 2RU3A 3CO0P 4DV3J 3QRPA 4L75A 3RR8A 5AE2A 2JEFA 2HBZB 3NGDA 4B3RJ 4PYDA 2UUWA 1HFEL 1FWKA 2HNDA 2DNLA 3FNNA 3CC2S 3EUNA 3TAMA 2LKZA 3UCGA 4PZVA 4N77A 5F8NA 2E5HA 2V4JB 3K0JA 2FZCB 3KLGA 2WSEC 3AXMA 3S6EA 2BA9A 3LPEA 2FJEB 2VFSA 1H2TZ 3IRWP 3MD3A 4KPYA 1NRKA 2DGQA 3FSXA 2CRLA 4CDIA 2QMXA 2EFVA 3AB4B 4YHHF 2ZH5A 1HR0F 4FPIA 4L72B 5HLFB 1LK5A 4F4WA 1FDNA 1O5JA 2DH7A 3MCNA 3THPA 4DUYF 2B8QA 3RYLA 4WFYA 4IO9Q 4OFZA 1REGX 1RP5A 1XIQA 2NPIA 2AJFE 3G8SA 1FESA 1UVKA 1GH8A 1KFSA 1RHMB 3CDWA 3FQKA 3HZGA 3QGHA 4LF8J 3ZC4A 3FMWA 3BGUA 2RKIB 5F41A 1M5PC 2FZGB 3QFWA 4C6AA 4RW9A 1NB7A 1CJKA 3N6LA 2FVRA 1MROB 1HNVB 4ZLNA 3NRBA 1M5HA 3MM9B 3J7A1 3TVKA 4LR7A 4WYWA 2PI5A 4ENOA 2YKMA 3KTQA 1BHNA 1V9OA 2PA8D 2UU9J 3PHTA 4P2FA 3R2DJ 1V5IB 3FEXB 1LEOA 3VTIA 2F8HA 3GR0A 5HVGA 1U47A 2RMLA 1YZ6A 2HFOA 5EWGA 1H7WA 3SQGA 2AZ1A 3QIDA 2OTLS 2L9NA 1N54B 1IKVB 4MYTA 4NEYA 4J9LA 3CUNA 2PA3A 4CLPA 4QIVA 2QJ3A 4ZLJA 5D6GA 1FE4A 3KLHA 2D3UA 4CYUA 4M5MA 2C2RA 2CPEA 3BGRB 4I2QA 1U49A 2K8GA 1S1WA 1LK7A 1M0SA 3E01B 3QZ8A 1UVIA 1KVJA 3OXFA 4OX7A 2VFRA 2MQNA 1WSVA 3I5AA 2LP4A 1TL4A 2V63A 2MKHA 4IG3A 4DPOA 2KRBA 5C25A 4MMOA 3NGTA 2V94A 3KUHA 4NXNF 4HYKA 1NEEA 1SJ1A 2YNGB 3J81j 4IRCA 1HWUA 2XSFA 3BF4A 4LBIA 3CGIA 1ZM3A 3SBMA 1X5SA 4M5JA 4LF5J 3TP2A 3CCUS 2AJ2A 3GFXA 5J2QA 2COLA 5DDPC 2DY9A 3QFHA 4HHHA 5FD1A 1YGYA 3M6UA 4ZITA 2YWKA 2V2KA 5CYQB 3DMJB 5DDOC 3KUEA 4N56A 2R7VA 4B9LA 1HQUA 2CNNB 2G2ZA 1GMWD 2ZE2B 5CZXA 2HFNA 1KD1T 4B08A 2BRKA 2J0XA 4KR0B 2VL1A 1HARA 2QFIA 1Q7LB 4WK3A 4F4XA 4JV0A 1RYSA 2V67A 4LF7F 3C16B 4ES3A 3Q22A 1B70B 2DGWA 5CYJA 3GB0A 1QE1B 3I0SB 3KLVA 4ILMA 4K5RA 1EETA 1P9QC 3ADAC 2LFVA 4WCEQ 3KK2B 4WU2A 4E0DA 4LJMA 5F8JA 2Q6BA 4N8NA 2CAJA 5HQMA 4DFMA 4JI4J 1WDDA 2CYYA 1FTRA 1UEKA 4AL7A 1RAHB 5KFWA 1S1XB 1R43A 1NSAA 4LFAJ 4DZDA 1B64A 2E9ZA 4ICLA 2VG5B 1RTIB 3QLHA 5IWAF 1KR4A 2DXFA 3CDAA 2CNOB 2QA4G 3IXQA 4BC9A 3LQVA 1IBCB 4MKYA 2VPYB 2DKOB 5KFVA 2YWEA 4EZ9A 1ZAVA 1HA1A 2ZNZA 1HNWF 3NL0A 1L5UA 3AA8A 2GJIA 4C3LA 1VQ6S 5B0GA 3OLBA 1GFWB 1VRUA 4NLQA 2BJEA 2DO0A 2UP1A 1Y11A 2G0JA 4ED1A 1ZM4A 1RWNB 1HWJA 3S01A 4C7QA 4MIBA 1T03B 1NSPA 2VPXB 4FF2A 1FEEA 2FJDB 3Q8SB 1Y5LB 4OV1A 2KFYA 4J90A 4BWMA 3VWSA 2UUCJ 4K4SA 5DJBA 2RNEA 3M2UA 5J2PB 1TL7B 1CULA 2WVCA 3ICLA 1FX2A 4JOUA 1ZTWA 1RQ0A 1YIJS 1TK8A 3PO5A 1S6OA 3TA0A 3PRVA 5IFMA 1NPRA 3HHLD 2GV1A 2ZDOA 3KWMA 1M1HA 1SPBP 5FDLB 4AQYF 2KVIA 4NRTA 4JI6F 4A8FA 4QYZK 3UNYA 1HHQA 4XTTA 4WKRA 1FRXA 3G6YA 4ZVHA 4DV6J 3O3LA 2C2DA 4NXMF 1QLNA 3GQCA 1C1CA 1UAWA 3M8ZA 4OV6A 4J9QA 3PY8A 1JMTA 2NQPA 2XC9A 1GNKA 4G1QA 2DR8A 2UVVA 3IR5B 3RAQA 4ZHRB 1K8AT 3T6BA 2ZD1A 2DISA 3QATA 2G1DA 2RSQA 2Z56B 4OHWA 2Z2MA 4A47A 3KK1B 2ZH9A 1SL2A 3BKUA 1HI8A 2ZC3A 4NYZA 1L3TA 3D2WA 4B9UA 5T41A 1KN6A 2BKOA 5K9FA 2HNZB 1CPZA 1W26A 3TZYA 4PWDB 1JLQA 3CD5A 2AF6A 8ATCB 2BJ9A 2BXJA 5ETKA 1IBLJ 2X1BA 2KXNB 3MAAA 2L41A 2C42A 2XY6A 1RJJA 3DFEA 3FFIA 3MEGA 2CQHA 4F3MA 3AY0A 1MLAA 3TR5A 1IUJA 2M2BA 2R7UA 1FTCA 1WOSA 2IFXA 1B4SA 4FVMA 2YNHA 4TYBA 2YH0A 5CH7B 1KS2A 1JLGB 2HGNA 3AAWB 3K17A 3R5DA 4TNOA 4WPAA 3JQMA 1ZS6A 5HI7A 5HJXA 1GTHA 4RW4B 2PE8A 3D3CJ 2AEJA 4Y2KA 1FNOA 4KFBA 4F02A 3H4DA 1GT8A 4K0KJ 2ZOMA 2VQEJ 2BMBA 5GMKa 4ECZA 1FD8A 2B9EA 3UNGC 2FYXA 3WQPA 2CDQA 2FGOA 3IRXA 4ZDNA 2FHOB 2M9KA 5A2QY 2XGPA 1FKOB 3CXCR 4OJHA 3BH7B 1GEHA 3CMQA 3MECA 4RWWA 2LEBA 5LJ3Y 4MJKA 2CUYA 1TKXB 4JI3J 2F63A 1S9GB 4USKA 1P1TA 2EW9A 1Z4UA 2PC6A 2FJAB 1F6TA 1YKWA 1HNIB 1YJ9S 3EM1A 2H3EB 3EGWB 1IJFB 2IM3A 3AJ1A 4MYUA 3BO3A 2H5IB 2QLXA 3M4XA 5IQ6A 3CIMA 2DYAA 4U67Q 2J0QD 1REVB 3MAHA 2VU5A 2KI2A 5H1SV 2Y1JA 2N4CA 2ZWPA 2OTJS 1TKZB 1S79A 1YWXA 1FDDA 4M5KA 3LANA 3TVZA 4LF4F 4A8YA 3P3DA 3O6QA 1FNXH 2E9TA 3J81U 4EZ6A 3PG9A 4C0BA 4TVAB 1OO0B 2C3MA 2L9DA 1JLFB 2YWWA 3OTEA 4QR2A 3H20A 4DLGA 4IR9A 5AXKA 4NRUA 4CT8A 2HIQA 2FZKB 2R7XA 5B0AA 3MEEA 2VONA 1U1QA 4FYDA 5D0RA 2V4RA 4ILLA 4IOAQ 4UOGA 4F04B 2WK4A 3CCJS 2I6WA 2QYGA 4ZN1A 2MGZA 4P9SA 5HQ8A 4LSLB 2AEMA 4FF4A 2V50A 3O44A 4K4ZA 5KFDA 2AYMA 3V81B 1XNQJ 2DPJA 4O3OA 1OIAA 3IAS9 2ZOGA 1NDLA 2HHSA 2HSEB 2J9DA 4OYPA 4U8VA 1X4AA 1VC0A 3ULHA 4EBCA 1AFJA 1FDBA 1HWIA 4MH8A 4DF4A 3MM6A 2BV3A 1U1MA 1OY9A 4HDGA 1IKXA 2HW3A 2KN4A 3RU0A 2Q6CA 1ZPWX 5SZTA 2OUGA 2HZCA 4LSZB 4QIGA 1T95A 2DPIA 4M5LA 5CZVA 3EVWA 3KOAA 2WVDA 2Q1LA 2DNOA 1W7WA 3KMQA 2A1BA 1UA0A 5J1NA 1VDHA 1E6YA 4KKOA 4OX9F 5DQGA 3JQKA 3KLFA 3QSYB 4FF3A 2YNIB 3B4MA 1VI7A 1HWKA 3MMBA 1TK0A 2M4MA 4ICLB 3H40A 2ZHBA 1BQNB 3FVYA 4LT6A 1X31C 2A2CA 2J7WA 2V2ZA 3ZZ0A 3UR3C 3HMJG 4DV5J 4IG0B 3D0IE 2BJ1A 1MN9A 4KGXB 4I56A 2YTCA 1WG4A 1DTQA 3R7BB 2F8EX 3W61A 4DX8H 2GIQA 2W2NP 3LUYA 3UDEA 1QUPA 3ZNJ1 1EETB 3P4UB 4A8XA 1NK0A 2RH3A 3KDNA 2UUBF 5ETTA 4DQPA 2XNQA 5K8PA 3DRRA 2E1PA 4C98A 2PEHA 5F8LA 3MUVP 1OMSA 2DY1A 2NZ4A 1JQGA 1LW0B 4G3IA 1H74A 4L3KA 4ZVOB 3SCKE 2UVWA 3OBIA 4M5IA 2BJ8A 2YXLA 4H54A 3UN2A 3LGNA 3M9MB 2PFFB 4N76A 3VGUA 2LECA 4ECTA 4F4YA 4WE1A 3V2UC 3PIPQ 3W63A 2E5IA 4BC7A 4TU8A 3PIOQ 3MAAB 4X65F 4TN2A 4NLRA 3TOQA 4DFKA 5M2PA 2MZQA 4YDXA 4O3RA 4NLUA 3THTA 4F50A 1H7XA 2R8HA 1B99A 3QAUA 5B09A 4X4VA 3OL9A 3TUJC 2V9WA 3H5UA 2NXJA 3OFEA 2AGOA 1CS4B 1R6YA 4NLDA 3F41A 1TK5A 2DK2A 4UUXA 5I3QA 1IBMJ 2FVQA 2ZJQQ 2A18A 3UFCX 2XMAA 3NBPA 3PKMA 1HNXJ 1LFPA 3SCJE 2MKSA 2M3DA 3MTJA 2QZ8A 3IWXA 3GIKA 2OLWA 3KKFA 2OSQA 2FPHX 2Y0BB 2QGFB 3BGLA 4GMKA 3W8GA 4E8UA 2A10A 4LF5F 1RKIA 2LXFA 1RTZA 2V6AA 4FVCA 4DV6F 4EGLA 4ZPAA 2LMIA 5FDLA 1HWLA 4OJGA 5KG0A 5L9NA 4YR2A 4DUZJ 4DV7F 4IR1A 4GVBB 1IKYB 2B5JB 4TU9A 4B9SA 2UXBJ 4OJ1A 3W9HA 5IC4B 4LBHA 3U1NA 4OI1A 4FS1A 5IM0A 3TANA 4X4NA 1K44A 2KFZA 4Q7AA 1DQAA 1WEZA 1O6XA 2VF3A 2VDHA 2MDAA 3C6UA 1V3SA 3MM7B 3THVA 1ZBTA 3TRGA 2IAJB 4W90B 2EFPA 4C97A 3L09A 3CCLS 1X7VA 3NOCA 5HBMA 3T1AA 2EG1A 4C0HA 2RKIA 2K7JA 1JKHA 2RUGA 3M2VB 2Y8WA 2F9JA 1NSKL 4DR6J 1GTEA 1Z2ZA 2BE2B 3D6HB 5KFXA 3R1LA 1X4FA 1ACMB 3N79A 3A8IA 2XB2D 2CJAA 3HPOA 1SC3B 1U1OA 3K89A 5D3GA 2HHTA 2CZVC 4DPXA 3BS9A 2P8IA 1J27A 4K4TA 4QR1A 1T8EA 2M52A 4NE9C 2Z30B 1TU0B 3CC4S 4EBEA 4J9VA 4ID5A 2EXUA 3M2RA 4LQ3A 2XS7A 2CVIA 3JAMY 3UQSA 2OEKA 2K3KA 4RL1A 4YB6A 2M70A 3CD6S 1YJWS 4F26A 3IBWA 3LAMA 2GFFA 3OHAA 4DFJA 1HBUB 4IG0A 3CULA 3VAHA 3EE3A 1NMEB 2VDIA 3BR8A 4RW4A 1Q82T 3DRYA 3B78A 2HG4A 1IN0A 2EKYA 2HNYB 1JNZB 1KVKA 3MMBB 5ETNA 3RAMA 2GA7A 4F0KA 4ECVA 4DL5A 1N8RT 4O4GA 2LQ9A 2XM3A 5JVHQ 4LQ9A 2POKA 4PKDB 1CJVB 4JI7F 1S0VA 4WP8A 5CYQA 5EWEA 4NASA 4ZVRB 4ZVPB 3RJMB 2Q79A 4TY8B 4LRFA 4ZVEA 1PAEX 4LSNA 2ZZNA 5BYQA 5EX3A 1Z1ZA 3SXLA 3V6JA 1M5VC 1KLMA 1YBUA 3AFGA 4TY8A 3CD0A 4PXCA 3E3XA 4Q0BB 2E7VA 2OPPB 4OIXA 4QYZJ 4O0IA 2D9OA 2MY8A 3FMBA 4CTAB 3QJPA 4WFZA 1TTHB 1Y10A 3HHEA 3GSIA 3LPYA 4O3SA 4Q8FA 1SKUB 4AUKA 1MN7A 2XI2A 4ELTA 3D7SB 5A8RB 3H8YA 2WVFA 3OXLA 3PYEA 1H6KX 1ZAWA 3BDEA 4PYAA 4KGZB 4CQ1A 1H72C 3D6TB 3HFKA 2QV6A 3MEEB 4A8WA 4QWBA 2BQUA 1RZMA 4JI5J 4NWBA 1IKVA 1UP1A 3M32A 4Q2LA 4ZIWA 3Q2SC 4LFCF 1UVMA 2VOOA 3HSDA 3Q8QB 1Y3JA 2CQ2A 2I38A 3AQOA 4UY85 2V2VA 2HQGA 3IR7B 2XMMA 1VJQA 1T9TA 1UTAA 2P2CB 2RQMA 1RHJB 1RAOA 3G6ES 2QN6B 3G6XA 4MTPA 3IS9B 4LRCA 2YKAA 3M9NB 4CLFA 1SCJB 3OSPA 2MPUA 4LF9F 4DR4J 2IIHA 2UZAA 2BACA 2QMUB 3M1VA 4K0KF 3V5RA 2DEIA 1JKHB 2FHJA 2XYHB 4DJBA 4KB7A 5D15A 4ES2A 1XJWB 5HBMB 1IBLF 1WUUA 1N0UA 3LP2B 1U1PA 4B3SF 4C9DA 4QCLA 4ZPCA 2J0WA 4WP3A 1SC1B 1D9AA 2KVQE 3JS9A 4OI3A 4F0MA 5HSPA 4HHJA 1SKWA 1WHWA 4QIFA 1N34J 2CZ9A 1W25A 5LJ5Y 1SKSA 5HLFA 3W5YA 1RABB 2PT0A 3WIUA 2EC0A 2HK2A 3BM7A 3B6BA 3MPYA 2JEJA 3TA1A 2H4YB 3R7NB 2RDDA 3CCES 3BJYA 4GVBA 1QJHA 3M8RA 3V6HA 2FHJD 3GG0A 3E8OA 1JB0C 1FA0A 3EMTA 3R9LA 3KLGB 3BYPA 1YRXA 2CZ4A 3CJKA 4K4XA 4DF8A 4AYBD 1PBUA 2E5LF 3ENVA 3QBCA 2B51A 3FBFA 1HW9A 1HQ2A 1NDKA 3I5BA 4DU7A 2HHQA 2FIUA 4B9TA 2DR5A 2DRBA 4XDCA 4OYAA 2YNHB 3D6FB 4DQSA 4WZQA 1WDTA 1Q79A 2QLBB 3MCSA 1N36F 1VLYA 3DLGB 5KFAA 4LF6J 3PM9A 5DQIA 4UUWA 2J7KA 3U1LA 4LFBF 4ILRA 4FPRA 3CJ8A 1LNQA 4WTOB 4U8YA 5J2QB 4CO1A 3OVSA 2C2KB 4PWDA 3D1HA 2VASA 5F0UA 2MQPA 2R7TA 1WC3A 3FZBA 3P5BP 1SQGA 1X4DA 3HXMA 2LCWA 4EU0A 1H73A 5DETA 5KOWA 1WC1A 2KM8C 2LQBA 4NYOA 4O4RA 1R3NA 3BR9A 5J1PA 1S0OA 1XK8A 3W65A 1HHSA 4ZA1A 2G4BA 2NYHA 4WYLA 3AODA 3ZZZA 3JSMA 3PCOB 1NDCA 3EGNA 1IR2A 3H42A 4O3PA 1HI0P 3H5YA 1TVRA 1S9EB 1DTQB 2M5YA 2LDIA 2GMHA 4C8LA 2PO4A 2QSWA 2IBOA 3TYTA 1IR0A 3CMAS 2V68A 3IC1A 1S72S 1TAUA 1UWBA 3R5BA 4RZRA 2C2OB 5LSLA 1XERA 3PTWA 4UTGA 4WU3A 3BV8A 1WEXA 5E3CA 5A8KB 2E9RX 1Y4ZB 3PEJA 5EUHA 1HNZJ 2UXCF 1IWAA 2GMJA 3EVMA 4ZP7A 2DB1A 3EJMA 1EAYC 5AXLA 5GMEA 5IC6B 3RW6A 2OEJA 4DUTA 1F5AA 1NPKA 4TXSA 2W1BA 3CNQP 2GQQA 4LR8A 1D9FA 2V8GA 5KTQA 5LSRA 4P74A 2R9LA 1VQSA 2QA4S 4DX7A 3I9V9 2R7WA 1IQZA 3NP5A 2H9ZA 2MHNA 2J9CA 2PD1A 1QVGR 5ITHA 3OHBA 1GXTA 2DHGA 2I5JA 1C1BA 3JTNA 1OPIA 2J5AA 8AT1B 5EHHA 3PYGA 3MR3A 4LREA 4B9MA 4DSLA 2OFGX 3M32B 1S9EA 1VK3A 3ZZPA 3JSBA 5KT6A 1HL6A 4OYXA 3I0SA 2Z2ZA 3HSJA 3TEGA 2F5GA 3TJAA 4ZCMA 3NGRA 3M30B 4A8MP 1VQOS 2OD6A 4XPEA 1WF2A 4DR5F 2OPSB 2RJZA 3GSDA 3NS6A 1RWPB 4ZVFA 1NJXA 3BBBA 2P5VA 1IQTA 2IVYA 2XMKA 2RILA 3NAIA 2JX2A 1U4BA 1ULRA 4PG4A 2J0SD 1Q8LA 4P6QA 1S0NA 2MJNA 2RQ4A 2XMJA 2PIIA 2ZJPQ 1I1GA 3G8TA 3SYZA 2IPOB 4Z7YA 2I0XA 1JLCB 2G1HA 1JXVA 3GFYA 3FKBA 1GX6A 1YQHA 4DUZF 1RE1B 5D77A 4B3MF 2CDRB 3GILA 3Q24A 3DOMA 4M5DA 2QMWA 1XNRF 3CSKA 5IWAJ 1U24A 4K4YA 4R5PA 1GMUA 2HHVA 4IG3B 1APSA 1Y0HA 1NU4A 3M8PB 4NLPA 5L8RC 3MMAA 2UVRA 2RDJA 3OR1B 3G6VA 1HMVB 2XO7A 1U6FA 2EK6A 1S99A 3EVOA 1KWMA 3P45B 3VAIA 5DG9A 2V9KA 4JI5F 3CCVS 2Y1LB 1LV5A 1VYAA 1KSPA 3P5TL 4A8OA 4DR6F 4ZN3A 1PJ5A 2GQ2A 2PFDA 2CJXB 2HYIB 5CYMA 3DOKA 4YS2A 5I3UA 4OZ5A 3G2XA 3PO4A 2JVRA 3SMZA 5D3GB 2D41A 3H59A 1RT7B 1XC9A 4HHUA 2ZH4A 1BLUA 2CPIA 4MFBB 1RT2B 4HTIA 3RG6A 3LWLA 5IZHA 3HP6A 3I6PA 4IO1A 1SC4B 2OSRA 3M2VA 1R8CA 2GAGC 5JUMA 4WTYA 3F56A 2KFNA 1P6TA 2RF2B 3HT0A 3A3OB 2AMCB 3FCHA 1R31A 3OW2R 2JJ4D 3UN5A 2H54B 4I69A 3VGSA 4OZ2A 1AUSL 5KFKA 1U7LA 4TU7A 4PQUB 3WZ0A 4Y00A 3G4SS 2GGPB 2N4DA 4DU8A 2XS2A 3BDPA 3OL6A 1F9EB 3SV4A 3H90A 4UZBA 1UEVA 2DGXA 2XULA 4KC5A 3HF5A 2EBEA 5BR8J 1SQEA 4D3HA 4ED4A 4R8UB 5KT4A 2QA1A 3H7HB 3DLEB 3T1HF 3CD7A 3SZ2A 4N7TA 2P9CA 1PJ6A 2N3LA 1OQ3A 2VFUA 2R7QA 3ET6A 4DCOB 3HT3A 3F0NA 1NK7A 5K5MA 4UQGA 2VQFF 2IA0A 2KZMA 5JJBA 1ZZFA 2MZSA 1JXEA 4CLTA 1FJEB 4YR3A 1R8BA 4ANDA 1HR0J 5IT9U 4WZMA 2DIVA 2VFVA 3D1OA 2RE1A 2DNMA 1Q95G 4A4JA 1J5EF 2XCAA 2UUAF 3KG4A 2YNFB 3DRPA 2DITA 3I32A 2J76E 2JSXA 5E3AA 1IBKJ 4MIWA 2IJRA 4JI2F 3K59A 3AJDA 3KFWX 1VRUB 4A48A 3R3TA 1F2HA 2GVZB 2B4VA 1QM9A 3MM5A 1NJZA 1TKDA 4LFCJ 5KFYA 1U0SA 1WHVA 2Y3YA 3JQJA 5F8MA 4X4QA 1F60B 3OQ2A 4JI4F 3OT9A 3K2YA 4XO0A 3D54A 4RW7B 4ERDA 4J9MA 2HFSA 1VIXA 1XMQJ 1JJ4A 2B6AA 4IDKB 3PR5B 3DYAB 4UOFA 4K59A 1VQMS 3SCIE 1N56A 3QLHB 2VA2A 1LW0A 1WJ9A 4JI3F 1X4HA 3PHEA 5L46A 1HW8A 2KT5A 1RK8A 2AGPA 4OZ3A 1UJ5A 2VG7A 3HHLA 4NZ0A 3MHYA 1U0HA 3EXYA 4K2JA 2DHAA 2A0FB 2Z58B 3LALA 5KFSA 4C48A 1T9XA 4X4RA 3DLHA 1KQSR 4IH5A 4AQYJ 3WC2A 4QPXA 4W92B 4I0WA 2WAQD 1KTVA 1F3VA 3AA9A 3D5MA 2YKNA 4B3SJ 1RT6B 1RUSA 3MUMP 2HURA 3M8QB 4USJC 1F9FA 4USIA 1N32F 2CQ3A 5IXUA 4URSA 3M7VA 1ZYQA 4CLUA 1JLGA 4LF4J 1PGZA 1N5YB 3Q8YA 4O44B 2OKQA 2YNIA 1HQUB 3D67A 2OELA 2YVSA 1R0CB 3VGVA 2ZH2A 5A76A 4UOHA 1M5SA 1SV5B 1VIOA 5KFZA 1RT1A 3GFZA 5KG5A 1S59A 5LMNF 2XSJB 3HVTA 1KC8T 4OL8A 4X84A 3UDVA 3LGMA 3A3PB 4YFUA 3WC0A 4NXMJ 4WXOA 5HP1A 4QBUA 2HRUA 2I1RA 5KAKA 3S1TA 1FXLA 1SI9A 5BYSA 3J80U 1KNZA 1HBMA 2XS5A 1RHUB 2CJBA 2D74B 1CQMA 4F0HA 2E29A 4ZK7M 4K8RA 3KMSA 2A3JA 3DDKA 4WIQA 4CNYA 1X9MA 4X4UA 3X1LB 3V81A 2BRLA 2MZTA 2C3YA 3AXKA 1VQ4S 4UY8T 5GAGI 4NMLA 2BX6A 4OQJA 4KGKA 1NKEA 1LW2B 4RBTA 3OLAA 4G1PA 2DT9A 1SB6A 3QYYA 2D3OR 5D4OA 3DI6A 3K5MA 2JVOA 2DNRA 3A13A 1JNRB 5CYMB 2FUG9 4DR3J 3M8QA 3DLBA 1LQ9A 4FXWA 3QGIA 3TJ8A 4PPDA 3CCQS 5SUHA 3NBPB 3OVBA 1MMDA 1NDPA 2XWXA 3VAKA 3RRGA 1VISA 1LXNA 1PO6A 2W7AA 4X4TA 2VG7B 3QRQA 3IFEA 4YR0A 5KFMA 1XMBA 1HQEA 3QO9A 3QWPA 1L3SA 3C8YA 1SL0A 3CWJA 2IVMA 1T7PA 2OPQA 2QO3A 3W7BA 5FLXY 5L39A 3TUPA 5F3ZA 1NH8A 1PYSB 3DRSA 1SJFA 4GVLA 2UV8A 1TV6A 3PFEA 3ISND 4LR9A 2GC8A 3RBDA 3N5FA 5B0EA 3Q89A 5HQLA 1U09A 2VG5A 1F0XA 5MAOA 3EWGA 2X1FA 2R7RA 4X2BA 4CH7A 5F9NA 2Y8YA 4ZJLA 3EYZA 1QSSA 3BPDA 1IJEB 1ZAXA 2RD5C 3E51A 4FN5A 3EXCX 1R0AA 4CT9A 1Q5VA 2HVDA 3LP0B 1WC5A 1NO8A 1Q8BA 4KH1B 1S1VB 1X0PA 1JLBA 5HVFA 2E7XA 3N6MA 3CMES 1U8WA 1DURA 1UFKA 5ADZA 5EGYA 4KO0B 5LMUJ 1PCAA 4A8QA 2XTJP 3UCZP 2HZVA 5HMYA 3MM8B 2ADCA 1OSCA 1SJQA 4PWUA 3MURP 4K4WA 1Q81T 2DNZA 2VPZB 3CEDA 4I6YA 1ZETA 3IWLA 4ZPBA 3X3UA 4DV2J 4JV2A 1S77D 2ZE2A 1SJ4P 3HM9A 5GMDA 1X8DA 4DHVA 2V5HG 3KLFB 5EN1A 1QAIA 1RBAA 9RUBA 2BUNA 4R8UA 2V34A 4CLKA 1AZSA 1CJUB 2EFOA 4NLOA 4HL9A 3GV8B 3PACA 5B0BA 2JFDA 1FRJA 3CO9A 2AYGA 5C2GA 4LIWA 1BC6A 1JLQB 1HPZA 1MMLA 3KJVA 2UXBF 2L08A 2DH9A 4MKVA 1TELA 4RJVA 2VUGA 4BLGA 2DNNA 2BABA 3K8VA 3GU0A 1O0PA 1NB2A 4C11B 1VQNS 1AT1B 1QSLA 2K1RB 1KDNA 3M6XA 4C11A 2LQJA 1YHQS 2QEXS 1RAGB 2ZD1B 3KK1A 5K14B 4JI1J 2JFKA 1BQMA 4L73A 1VRTA 4Y6IA 5BR8F 3C46A 3G9CA 3MI7X 1BWEA 4DZ6A 1AZSB 1CJUA 1SV5A 1YZ7A 2CKWA 1X5OA 2XG8A 3MGJA 3QGPA 1N5SA 4I6WA 4QQBA 3T3FA 2C3UA 3JXOA 3TJ9A 1JXLA 1X4GA 3VV2B 2VQEF 2FLLA 1B0TA 2XCPA 2CPFA 4KAIA 1SXLA 3S7RA 1XR7A 4ED0A 1LWXA 5D78A 3Q8PB 4FBUA 2HVHA 1RT6A 1TUWA 1OYDA 1QUVA 2RU9A 3RBZA 2C2EA 2W25A 3MEDA 4ZPTR 1S12A 3MMCA 2SXLA 4KGMA 2O3DA 1FF2A 3K57A 3J7Z5 2F4FA 3PW7A 2KO1A 3HHDA 1I6JA 3MUTP 3JSMB 2AYBA 2DVIA 1NPPA 2HVIA 4P2SA 3QMQA 4BBYA 4CLYA 4X4OA 4P72A 1HNVA 4RW8B 2RUSA 1YBTA 1CJKB 2RIJA 3N5BA 2DBBA 4F7VA 4NCGA 3IWNC 5C42B 3CTRA 3VAFA 3Q8RB 1G4CA 3TZWA 2Z0GA 3DRSB 3GP9A 1JLAB 4OLOA 1OQ6A 3ZZTA 4RW7A 5HAOA 4M5DB 5D4LA 3PKYA 1LXJA 1R6VA 4XPCA 4K5SA 2HFUA 1UFLA 2VODA 2C2ZB 3FDSA 4Z37A 2YH1A 4GC7A 1TKXA 2XMWA 3AQPA 3AOCA 2QTWA 2WONA 1RTIA 4RWXA 4ED2A 2FQQB 2QL9B 1B0PA 5MLCV 1E6VB 4RNNA 4WFAQ 5T7LA 4YOEA 2GIRA 6AT1B 2CJ9A 1S4FA 2WVBA 5E3QA 5IT4A 3JTOA 4DSEA 1RTHA 3J7ZT 4X62F 4DR2F 1EKRA 1NNDA 2OHDA 2XMTA 4OX8A 5DG8A 1BD6A 1R8HA 2HKEA 3HZEA 5BXIA 1QE1A 2W9CB 5D8HB 2G2YA 2L9WA 5CHCB 2R8GA 3QJLA 2K2PA 1CQNA 3CJ4A 2ZVSA 5LM7E 1MMNA 2YWGA 1KBRA 4I6AA 3UDCA 1FJGJ 1ZOTA 2JLGA 3I31A 3IG1A 2VBXA 3BBCA 2VD3A 4PQAA 5U47A 1IKWB 3UCUP 4AL6A 1ROFA 3OD2A 2XY7A 2JH3A 3AJ2A 4PXDA 2G0IA 1C4CA 1DARA 5T7LB 3GV7B 3V4MA 1SKRA 3Q23A 1YLXA 4NLVA 4WP9A 1N4LA 1FRLA 1T9UA 4EFAC 5GAGU 5L38A 4QW8A 4IRDA 2E5JA 1K47A 1S6PA 3IAM9 3HJFA 4B3OB 3HD1A 1FJ7A 2FJBB 2BDPA 3ZO7A 4DFPA 1BMQB 5M2RA 4AD6A 3CCSS 2LU2A 1BGXT 4DPYA 3L7OA 1HBNB 2UUTA 2PDAA 2EWHA 5C25B 2GJ2A 2XSJA 3HVTB 3GIJA 4DQRA 3PRDA 5KFTA 4LF9J 3LP1A 1VQYA 2VH7A 1S4EA 2CJYB 2BOAA 3T1HJ 1BXNA 4CLSA 3PX6A 2CQPA 4CRJA 2KYZA 5A8KA 1UPPA 2DGUA 5GVQA 2QL7B 3W2VB 2ASJA 1DZ5A 2DHXA 1H98A 1WOPA 2ACYA 1SC6A
chains in the Genus database with same CATH topology
2LP4A 1FFSB 1FFGB 1FWPA 1EAYC 1A0OB 1FFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  1FFS B;  1FFG B;  1FWP A;  1EAY C;  1A0O B;  1FFW B; 
#chains in the Genus database with same CATH topology
 5GAH I;  5HK4 A;  4DQQ A;  3M2U B;  3T9N A;  2GO9 A;  4DX5 A;  3J81 Y;  4CH1 A;  5J2P A;  1XMQ F;  3W2V A;  2IMO A;  4DV1 F;  2DRA A;  2VC1 A;  1RT5 A;  3ITH A;  2F7V A;  2NSB A;  4DV3 F;  1TQL A;  1J5E J;  5GAE U;  4RUC A;  1IR1 A;  1WF1 A;  1FWP A;  1RAJ A;  2L48 A;  3I96 A;  1U2R A;  3N4W A;  4DMZ A;  4Y0F A;  5HMX A;  3GV5 B;  2UVU A;  2ERR A;  4QWC A;  2FD2 A;  2IRU A;  5A8W A;  2JEI A;  4NZ7 A;  1FFS B;  3AB2 B;  1FRI A;  3DLK B;  4LVO P;  3VZH A;  1RWV B;  2E5L J;  1NCL A;  4CM2 A;  4EWT A;  4ZOS A;  3A8J A;  1OY6 A;  1VC6 A;  4Q0B A;  3W66 A;  1YG0 A;  1DTT A;  1TL1 B;  2DNK A;  2HQ3 A;  2EPI A;  2HBR B;  3DHX A;  3HHK A;  5CQG A;  5I42 A;  4PG8 A;  2DNQ A;  2B4O A;  3D0H E;  4QU6 A;  4M63 A;  1EB0 A;  1S1X A;  2CQ1 A;  4LSN B;  1HNX F;  3A8K A;  4ECQ A;  4ZPW R;  1VHF A;  2QIF A;  5E33 A;  4KIA A;  3MCM A;  4B3M J;  1D09 B;  1MWZ A;  2MST A;  4JI0 J;  1WOR A;  2D7S A;  1DJ0 A;  2DNG A;  1G3O A;  4WFX A;  4X4P A;  3KK2 A;  3SQO P;  1WKJ A;  3SSS A;  5IT9 Y;  3IP0 A;  5KG7 A;  2ZIT A;  4IOB A;  3BGO P;  5F3T A;  4RUH A;  3OFH A;  2ZKU A;  3BEG B;  4DR4 F;  4DBQ A;  4WFB Q;  1A0O B;  2GJF A;  3NOG A;  2CQI A;  3ILO A;  4OJ3 A;  4ZPD A;  4OZ0 A;  4R0E A;  3LP0 A;  2DGO A;  2HQD A;  4QYR A;  3RGI A;  3N0V A;  3KHR A;  1R0A B;  2ZKT A;  3B54 A;  1XTZ A;  3OR2 B;  1XN9 A;  3EZ5 A;  5KFE A;  3C15 B;  2W9A A;  4E2F B;  2ZBQ A;  2CJQ A;  4U9R A;  3KLE B;  1L3K A;  2PN6 A;  3CJR A;  3MPD A;  1RLD A;  4DEZ A;  4DG1 B;  2HQF A;  3EDR B;  3T5J A;  2R8J A;  2HWH A;  2NXE A;  2O66 A;  2YKP A;  4QIE A;  3UPF A;  2GHW A;  2NCK L;  5KFP A;  3UD3 P;  5EX0 A;  2QX0 A;  2B56 A;  4XK8 C;  2LA6 A;  1GX5 A;  1NBE B;  1Q8I A;  2BE2 A;  3FSY A;  4FKX A;  4K2X A;  3M9O B;  3K58 A;  3PNI A;  4DL6 A;  1T05 B;  2I2Y A;  2BM0 A;  1UVJ A;  1F5B A;  1RT4 A;  4FNH A;  3MFH A;  4TY9 A;  4EK2 A;  3BO2 A;  4NX9 A;  1DLO B;  3HHN B;  4NXN J;  2LQ8 A;  2BQR A;  3FBC A;  4O3Q A;  1FFG B;  1NHU A;  4IH7 A;  1FER A;  4PAA A;  4BCA A;  1RT2 A;  1RA6 A;  1VC5 A;  1M5O C;  3FCV A;  2ASY A;  4U7C A;  1JJC B;  2W01 A;  1VR6 A;  1F1B B;  1T11 A;  2MKY A;  2V2Q A;  3H5S A;  3JTP A;  4P71 A;  1KQF B;  3NLC A;  3KLH B;  4F4Z A;  4RUB A;  4A8K A;  1NK5 A;  2R7S A;  1FNM A;  4KPC A;  4RW6 A;  4AXI A;  1FJC A;  4I1T A;  2BOP A;  4DR3 F;  3RTV A;  1ELO A;  1NUE A;  1VBY A;  4Y2M A;  2F8M A;  3R97 A;  4RU9 A;  1XR6 A;  2M8D B;  3D0G E;  2ATL A;  3GFH A;  1UJ4 A;  3T5H A;  4EYI B;  5HVH A;  5F8G A;  4FYY B;  2AQ4 A;  1R7I A;  3CJ5 A;  3GJT B;  4FP9 A;  3DCA A;  1RAI B;  4ED6 A;  4NZ6 A;  1DLO A;  3LW5 C;  5ETS A;  2VG6 B;  3VQS A;  4YY3 F;  4DL2 A;  2DGS A;  2OMO A;  2J7U A;  4IQM A;  5LMU F;  3FBE A;  1GXU A;  2UU9 F;  2MKI A;  3DOM B;  1HBM B;  4DS4 A;  3NGK A;  2XLK A;  3W3S A;  2DNY A;  2G13 A;  4YUD A;  1FHT A;  3EDQ B;  2KZZ A;  4LBP A;  2JC1 A;  2W8K A;  3NNA A;  3PZP A;  1YK9 A;  1RT3 B;  2YX4 A;  1WTF A;  3NWR A;  4H4O A;  4MIA A;  3W8P A;  3KLI A;  4RU2 A;  1D8Y A;  4OZL A;  1KTQ A;  3C15 A;  4WFN Q;  5DLG A;  1RT1 B;  1C2P A;  1UJ6 A;  5D4P A;  3FQL A;  3IN5 A;  3OR2 A;  5KG6 A;  3T5L A;  1FI4 A;  3QT6 A;  1NJW A;  2C3P A;  2W4P A;  1NK9 A;  4C8K A;  4PUO B;  1LOU A;  1J2V A;  1UVN A;  3FZ2 A;  4KHP F;  2H5E A;  3F73 A;  5K8O A;  4IOC Q;  5KFQ A;  4CZC A;  3G82 A;  2FLN A;  4LFB J;  3RB6 A;  6FDR A;  4ED3 A;  3GWC A;  4NI2 A;  4I68 A;  3ZFV A;  3OFF A;  4LUB A;  3MM8 A;  4V1A k;  3LTO A;  4Y28 C;  3WBZ A;  1YRT A;  2FHM A;  2ASD A;  4IQX A;  1XNR J;  3ETO A;  1BY9 A;  3AD9 C;  1X5T A;  3GIR A;  2M7S A;  3OXG A;  1TL3 B;  1T9Y A;  3W64 A;  2HZA A;  1N5V A;  4EUV A;  1AYE A;  2A6M A;  1HNZ F;  1RAF B;  1RTH B;  4PAB A;  2EFN A;  4A8S A;  2J9E A;  1FVS A;  2YY3 A;  1P8G A;  3FK4 A;  4WKY A;  1Y00 A;  2QLW A;  1UCN A;  5C24 A;  2QLJ B;  1D0E A;  2R4F A;  2W8L A;  1LWF B;  2YX1 A;  4RNM A;  5FJ4 A;  2KJW A;  4OYW A;  3ILJ A;  2KHD A;  3CCM S;  4A46 A;  3W9I A;  2BYC A;  4RNO A;  3MAQ A;  3NMA A;  4GO7 X;  3NCQ A;  1SH2 A;  3Q83 A;  5BYR A;  5T14 A;  1XMO J;  1ZPV A;  2JEG A;  1W2I A;  1NM2 A;  2DD8 S;  3DDI A;  1N33 J;  4Y65 A;  4AXJ A;  1RTJ A;  2H65 B;  4F2R A;  1CEZ A;  3IMQ J;  2UV8 G;  5FLX U;  1S76 D;  4M1K A;  4JV1 A;  4P7V A;  2GVZ A;  1VQP S;  4C8O A;  1G2E A;  1RWK B;  1TFY A;  1JX4 A;  3HO1 A;  3ISZ A;  5HN0 A;  4B9V A;  4NA3 A;  2OML A;  2APO A;  3PJW A;  3GCX P;  4J9N A;  1VRQ C;  3PW5 A;  4OI0 A;  3BH6 B;  1TAQ A;  4LRB A;  2HK3 A;  1D1U A;  3OPK A;  1NHK L;  2MLX A;  2X3D A;  3U27 A;  1AFI A;  4X64 F;  4GRS A;  3GII A;  2DEJ A;  2OPR A;  5LOQ A;  2F4V J;  4ZVG A;  3NKY A;  3TUI C;  1NK8 A;  2DR7 A;  4DWI A;  3ZTQ A;  3VAM A;  2ALZ A;  4OLP A;  1MWY A;  2BE9 B;  3TX0 A;  4DQI A;  1IKY A;  2BAN A;  2WB1 D;  2B3T B;  4DL0 C;  3ET6 B;  5B0D A;  1Y9O A;  1SQF A;  4P10 A;  2ZC4 A;  3M6W A;  3TNV A;  5DGA A;  1FT8 A;  3QSI A;  3O5T B;  1N36 J;  4M95 A;  2IDL A;  3LP1 B;  1JLF A;  2AWZ A;  1D3W A;  5A6W A;  3OTD A;  2ZH3 A;  1S5Z A;  2B7C B;  2BEF A;  4NA1 A;  2ZM6 J;  3QRR A;  1VRT B;  1S10 A;  2DTJ A;  4FYW B;  4CTA A;  4OI2 A;  3WIV A;  2HHU A;  3BKF A;  4GKK J;  1TKZ A;  2CNL B;  5K8N A;  4PQU A;  4U95 A;  2W2P P;  2ZJR Q;  2NPF A;  1PG5 B;  2QLF B;  5HMZ A;  2CJK A;  1REV A;  1FJG F;  3SEO A;  3M8S A;  2LLZ A;  1F5C A;  3R8Y A;  1U45 A;  4DSJ A;  2EG2 A;  1NLK L;  1RA7 A;  2HFV A;  3B4D A;  5A0Y B;  4KHR A;  2LQ5 A;  5JMN A;  4NMX A;  3GYX B;  5L1J A;  4E98 A;  1NJY A;  4H4K A;  1SIZ A;  3KG0 A;  3UI3 A;  1X0F A;  5KG1 A;  4RBV A;  4F4K A;  4O4G B;  3FRY A;  1OYE A;  1KFD A;  1O51 A;  3OUY A;  1HYS A;  1K0V A;  4QU7 A;  1WOO A;  2DNH A;  1VQL S;  2HHW A;  3KYL A;  1ZA1 B;  4F3O A;  3GCW P;  2MZJ A;  3TUZ C;  2CG4 A;  1WHY A;  3TA2 A;  2MQQ A;  3W2W B;  3M8W A;  1X9S A;  1IM6 A;  4CM0 A;  2RHS B;  3POT A;  3MWB A;  4FYX B;  2W7P A;  2MYF A;  3T1Y J;  3HHL C;  5E3P A;  5HRO A;  4ELU A;  4ECY A;  3SSQ A;  5C7P A;  5CD4 A;  5HMW A;  1E6V A;  3TQ1 A;  2HFZ A;  2GCF A;  2W24 A;  1DQ9 A;  2QFJ A;  3TAP A;  2MSS A;  1S9F A;  4IFV A;  3ZTS A;  1VQK S;  1U6B A;  1DFD A;  4C4W A;  3DYA A;  2N82 B;  3ENA A;  3OTC A;  4USM A;  4N41 A;  3QAE A;  3IO1 A;  9ATC B;  1AB8 A;  4OHX A;  3NWG A;  4YB1 P;  1CJT A;  4BDP A;  4DSI A;  5DGB A;  2WSF C;  2YWH A;  3I87 A;  3QNW B;  4F8R A;  1HQE B;  3QO9 B;  3R5A A;  3HLU A;  3QIP B;  4ED5 A;  1F3F A;  2PMW A;  2Z2L A;  3P96 A;  2XLI A;  2AKW B;  1H2V Z;  3RZA A;  5J1E B;  3HVA A;  1SL1 A;  2F9D A;  2MTL A;  2YWF A;  4FXV A;  5KFO A;  5A2Q U;  5L1I A;  3FRZ A;  1S1T B;  3KDO A;  4CO5 A;  4X66 F;  4DV4 F;  3KUG A;  3MED B;  3PX0 A;  3RB3 A;  1VQ8 S;  1L3V A;  1FRH A;  5IM0 B;  2OPS A;  4JV5 J;  2AYE A;  4RNH A;  3M30 A;  2WTF A;  2MQL A;  4OX9 J;  2CPZ A;  3MPV A;  3QPI A;  2WVE A;  4I2P B;  4DPT A;  1YVF A;  4ER8 A;  1RTD A;  2J8A A;  2HEK A;  3RBE A;  2JC0 A;  3LGH A;  3BSC A;  4CWB A;  1ZA2 B;  5DZ7 A;  4NEZ A;  1C1B B;  3MPU B;  2BKP A;  4JI2 J;  3U02 A;  5B0C A;  4W98 A;  4Y3C A;  3MCO A;  5D0G A;  4ECX A;  3V6D A;  4P2X A;  2R8K A;  4I67 A;  1RWM B;  4F67 A;  3UD4 P;  2ZBI A;  3AOA A;  4ELV A;  2BJD A;  2N3O A;  1CBK A;  2K1R A;  3FUY A;  5EWF A;  3SI8 A;  2X7I A;  1W2B R;  1VQ5 S;  1GMW A;  1EX8 A;  2EC2 A;  3ZZU A;  4CO3 A;  4OMF G;  2AX1 A;  3K8W A;  3M8Y A;  1GXL A;  1QD1 A;  2YX7 A;  1XBW A;  2GML A;  4Y2C A;  1X4C A;  5CA5 A;  5KFJ A;  3MR5 A;  3UN3 A;  2HVZ A;  2V69 A;  2ZHO A;  2P9E A;  2Q66 A;  2U2F A;  3G8Q A;  2KDO A;  3R5G A;  3ZNU A;  1V3R A;  2ZNY A;  1VHI A;  3DRX A;  3DXS X;  4J9O A;  1P1L A;  3O1L A;  5E5N A;  3LF0 A;  4MT1 A;  4EI2 A;  2NXN A;  4QJV A;  3PJ9 A;  2OAU A;  2LA4 A;  4B17 A;  5D0H A;  3BYR A;  3HKW A;  1UWB B;  4ES1 A;  2D3O 1;  4ETZ A;  5C24 B;  2CQ0 A;  2QC3 A;  3VVT A;  4PPZ A;  2EKN A;  2MMY A;  2U1A A;  5KT5 A;  4KO0 A;  2BJ7 A;  4WK1 A;  1TMM A;  4M8L A;  3RW7 A;  1AW0 A;  1JLB B;  4NCA A;  1H3D A;  1FK9 A;  1QAX A;  1QDU B;  2MLZ A;  2HHH F;  2Y1I A;  4J5O A;  2MB0 B;  4ID5 B;  3HSG A;  1UET A;  3KNG A;  1HMV A;  1S7I A;  5AXM A;  2F40 A;  3HHL B;  2FTR A;  4LF2 A;  5KFI A;  2J6U A;  3KJN B;  4DDF A;  1DRZ A;  2IC3 B;  2FJV A;  3M8P A;  5KT3 A;  1Q53 A;  1MU2 B;  3FCW A;  3O8W A;  4NL5 A;  4Z2X A;  5LMN J;  3DDN A;  4ZS6 A;  1O8B A;  4P2M A;  3E2E A;  1KQG B;  2CAD A;  2CQ4 A;  1VMB A;  3DMJ A;  1RAC B;  2WHO A;  2D9P A;  3ZXW A;  2BQ3 A;  2HIY A;  3IM9 A;  3ETM A;  2RQC A;  5KFN A;  3H0P A;  1N32 J;  4RBU A;  3H98 A;  3VAL A;  3O2I A;  1URR A;  2OFH X;  5A0Y A;  1GAO A;  1WI8 A;  2Y0S D;  3NXZ A;  4OI6 A;  3SIP B;  3DXB A;  4DV5 F;  4OHY A;  2HRT A;  1GQE A;  5KFH A;  1IKX B;  3MOZ A;  4CIO A;  2GHP A;  4CLW A;  3MM6 B;  3SSR A;  2OI2 A;  5M2U A;  5KOX A;  4KGV B;  2ZH7 A;  3BPS P;  4Q2M A;  2YNG A;  2J6T A;  4LMZ A;  1XR5 A;  1YRU A;  2YPY A;  3CJ0 A;  2UUC F;  3L7P A;  4C3K A;  1N52 B;  2HQI A;  2C2M B;  2O67 A;  3DN9 A;  2KT3 A;  3CCZ A;  3NGS A;  4J91 A;  2IM0 A;  2YKO A;  2I9S A;  1SH3 A;  4J37 A;  1R8P A;  1OY8 A;  4N47 A;  2BE7 D;  5F8I A;  2MGZ B;  2ZHA A;  2VIH A;  3HJV A;  3BN4 A;  4JI1 F;  2IMW P;  2RS8 A;  4AE5 A;  1PKU A;  1Y5N B;  2RRB A;  4I64 A;  4K7Q A;  1LKZ A;  1P9Y A;  4Y34 A;  4YN3 B;  4I2P A;  2FVC A;  5KT7 A;  1KON A;  1T9W A;  3HFZ B;  4J9K A;  3T41 A;  1T0T V;  1XWL A;  2R42 A;  4QZV B;  5DG7 A;  1TR0 A;  3P8B B;  2NSC A;  4ZP8 A;  1H38 A;  3CCR S;  4RUA A;  3DC2 A;  2HAF A;  1JLE B;  4KBI A;  1IBK F;  2Z8Q A;  3HKZ D;  5IV4 A;  2NUH A;  2DIU A;  1QTN B;  1H2U X;  2LXU A;  3ZTR A;  3DGP A;  3NS7 B;  4UW2 A;  3I82 A;  4OI4 A;  2QE5 A;  1YX2 A;  4OZN A;  1T03 A;  3GTY X;  4U7U K;  2YKM B;  4C2M A;  3MR2 A;  4FF1 A;  3H2V E;  4KSE B;  2DHH A;  7FD1 A;  4DUY J;  3QIP A;  4OHV A;  3IBF B;  4KT0 C;  4K4V A;  2LEA A;  2R8I A;  1ZH5 A;  5J2N B;  2FC8 A;  3A3N B;  2CNK B;  3SV3 A;  1T05 A;  4LF8 F;  1RHR B;  1VJW A;  1RYR A;  1K1Q A;  4Q43 A;  4MFB A;  4JYA J;  4JI7 J;  2VHG A;  4KHP J;  4M5N A;  3JAM U;  3ZZY A;  2DO4 A;  3VAJ A;  4J9P A;  4K50 A;  1LWE B;  2JLE A;  4ZCL A;  5KG2 A;  2O01 C;  2VJU A;  4IFV B;  2WRM A;  3EIC A;  2VBZ A;  3DOK B;  1X60 A;  3VGT A;  2HHX A;  1TUV A;  1FKO A;  1FRM A;  1Y3K A;  3AD8 C;  1XEZ A;  5KFU A;  1WNE A;  4W4M A;  5KFL A;  2G2O A;  2XQC A;  2W2M P;  4UT4 A;  1Q78 A;  1YJV A;  6FD1 A;  4CLL A;  3T1Y F;  2YQ1 A;  3TX8 A;  2HWI A;  3U1M A;  2DXD A;  5C2C A;  2KYX A;  3W2W A;  4USH A;  1TL3 A;  4PR6 A;  2ZBP A;  1TKT A;  4RPF A;  3VQT A;  2KH9 A;  3CJQ A;  1FVQ A;  3OR1 A;  1FKP A;  4HEA 9;  5KG3 A;  1BQN A;  1RU1 A;  2RVJ A;  4RNF A;  1L3U A;  2VC0 A;  3R1H A;  3R5J B;  4FYV B;  3CW2 C;  2B7B B;  2DCU B;  4KV8 A;  4OZJ A;  2B0G A;  3CT9 A;  2W7O A;  1PC4 A;  4PUO A;  2XZT B;  3HI9 A;  2YKQ A;  3I4H X;  4KKO B;  5DRK A;  1GMV A;  3FFI B;  2R2T A;  2FVP A;  4JYA F;  1N33 F;  4EO6 A;  3SDE B;  3CDE A;  2RRA A;  2KXH A;  3KLI B;  2WOM B;  3NG8 A;  1S1U B;  4RX6 A;  3CF5 Q;  2EVZ A;  1DQ8 A;  2RHQ B;  3PV8 A;  2ZWO A;  4PWW A;  1G7C B;  2PSZ A;  3CB4 A;  4AT1 B;  2YNF A;  3DRP B;  1QSY A;  2AV5 A;  3SCL E;  4DXL A;  1UKU A;  4ZHR A;  3MDF A;  3GJR B;  4ZPV R;  4DR1 F;  3TO8 A;  2GO8 A;  2K3I A;  2F4V F;  1IVZ A;  3VCD A;  1B7Y B;  2IJN A;  1VFJ A;  3ZTP A;  1S6U A;  4ZJO A;  4OHZ A;  3WX8 A;  1N88 A;  2CIM A;  3C14 A;  3W5Z A;  2R2U A;  4F2S A;  1TKT B;  3A1Y G;  3QZ7 A;  4NA2 A;  2C22 A;  1NKB A;  3N28 A;  1UZD A;  4ZVU B;  3UVJ A;  5GAD I;  2DNP A;  2ASL A;  2Y9H A;  1U48 A;  3TQE A;  3DU6 A;  3M2R B;  2M88 A;  4HR2 A;  4U96 A;  1NK4 A;  1B3T A;  4F36 A;  2K7K A;  2HWT A;  3BN7 A;  1CUL B;  5LT5 A;  1EQ0 A;  2OPR B;  4CO0 A;  3OJU A;  3BGF A;  3KK3 A;  3SFG A;  1EZZ B;  2BVZ A;  4WII A;  1UWA A;  3C66 A;  7AT1 B;  4GKK F;  4RR5 A;  3BSA A;  1HD0 A;  1EP4 A;  4OYI A;  1EIY B;  2AHO B;  2F3J A;  2HMI A;  1Q0N A;  4BWJ A;  4YDD B;  2JOQ A;  4JP8 A;  3ILI A;  8RUC A;  4WWS A;  3W1Y C;  2RT3 A;  4ZVQ B;  3T19 A;  2KT2 A;  1UVL A;  4MK7 A;  5RUB A;  3D3B J;  3RR7 A;  5HAT A;  1K1S A;  1RTJ B;  1T9V A;  4L6V 3;  1TZ0 A;  5ETM A;  3HFV A;  1U02 A;  1S49 A;  2X1A A;  4DCJ B;  4DR2 J;  2HQC A;  2MQM A;  3IS9 A;  2KXF A;  1NAQ A;  1S6P B;  1PYT A;  2AEF A;  1Q86 T;  3Q2T C;  3A12 A;  1RWO B;  4MK9 A;  3C6T B;  2W9B B;  2NRE A;  1ITP A;  4V19 X;  1BQX A;  2HS0 A;  1N5T A;  2MXY A;  4DL7 A;  2VOP A;  2C2N A;  5G0R A;  1FRK A;  4DL4 A;  2UUB J;  2WB4 A;  2Z4P A;  2XYG B;  1EKS A;  4Y2A A;  2ABY A;  4G1I A;  1DHM A;  1KHW A;  5AT1 B;  5HRO B;  4C8N A;  3H2U B;  3GPA A;  3CJ2 A;  5J2M A;  1OWX A;  2WW4 A;  4DV2 F;  1HBO A;  3NCR A;  1KHV A;  3NCP A;  1WTB A;  1MG7 A;  2IRY A;  2VFT A;  4KQZ A;  2MHE A;  1X4B A;  5A8R A;  3TAM B;  3MMA B;  4L76 A;  1U1K A;  3RUB L;  4NCB A;  4UQT A;  5E0O A;  4USV A;  2HBQ B;  4TLQ A;  3ZZO A;  3A4T A;  5ETL A;  4X66 J;  2BM1 A;  2QRR A;  3W9J A;  2W9C A;  2WZ1 A;  2X1G A;  5D4N A;  3QJJ A;  2OJ3 A;  4KTQ A;  1AXQ A;  4YB5 A;  2DCL A;  1KVI A;  3MOJ B;  2AP6 A;  1KOH A;  1YI2 S;  3Q0A A;  4IH6 A;  5C5J A;  3EGZ A;  2NLW A;  2IY5 B;  4Y2I A;  2GVD A;  4URG A;  2WCX A;  3BB5 A;  4ZJQ A;  4HVZ A;  3LOU A;  1PYO B;  1S1U A;  4H4O B;  2DR9 A;  3ENQ A;  2DR6 A;  3IBC B;  5K20 B;  1H0H B;  1QAJ A;  2XO6 A;  3WHI A;  2ILY A;  2ZOF A;  2CPX A;  2ILZ A;  1T94 A;  2G0C A;  3FEY B;  4F4A A;  3ENW A;  1ZZN A;  4ECR A;  3QT5 A;  1FX4 A;  1TUG B;  4C8M A;  4NLT A;  1NSQ A;  5I3P A;  3TZZ A;  2EBG A;  2WBM A;  1JIH A;  1KKH A;  3CPW R;  3V4I A;  5C42 A;  2KB2 A;  4KV8 B;  4CH0 S;  4PG7 A;  2FJW A;  1DBD A;  2VG6 A;  3UD5 A;  4FKY A;  4ZKA A;  3FSI A;  2NZC A;  4RW8 A;  1C1C B;  3GYN A;  3ILL A;  4HH1 A;  1A6L A;  4S0M A;  4ITS A;  1TP7 A;  1HBO B;  2J9D E;  4FBT A;  4ZIV A;  4TQS A;  4ZVT B;  1VBK A;  2H1Y A;  3PEH A;  4KHM A;  2JNJ A;  1VOM A;  1YBA A;  2B4U A;  4USU A;  4ZCK A;  3EX7 B;  3KHL A;  2BAN B;  4OZ1 A;  1FD2 A;  5LL6 d;  2AU0 A;  3PDN A;  1WD6 A;  1HNW J;  4C8Z A;  4PXB A;  4L74 A;  4PRF A;  4ID8 A;  2IA6 A;  4DS5 A;  2WW8 A;  3GR1 A;  3BZQ A;  4B9N A;  3CE8 A;  3N6N A;  2VJV A;  3K5P A;  2C28 A;  3B82 A;  3NGU A;  4WXW A;  3OL7 A;  3J80 Y;  1U25 A;  4IKA A;  3AHP A;  3KJF B;  1VBZ A;  3P49 B;  3JB9 k;  3LP2 A;  2ROE A;  3DKD A;  3N9U C;  4ATN A;  4LFA F;  4DV1 J;  3Q8V A;  5J2N A;  3CJT A;  4J7C A;  1Y5I B;  3IGV A;  5AXN A;  4XDD A;  4KJI A;  4NPO A;  1FWL A;  1S57 A;  2HMI B;  2PI4 A;  4V19 J;  3MM7 A;  4BHQ A;  2Q3P A;  2Z57 B;  3CCW A;  3TI0 A;  1OS5 A;  1FCA A;  1C4A A;  1R27 B;  2YBV A;  4X62 J;  4WBF A;  4U6P A;  3KLE A;  1RXO B;  5JVG Q;  1LWF A;  3GZ7 A;  3V6D B;  4GO5 X;  5IS2 A;  2GZO A;  3KHH A;  4AFF A;  4HKQ A;  4LSL A;  3K5N A;  2I8E A;  1X4E A;  2ROG A;  4KH0 B;  1TFW A;  4I7F A;  4QW9 A;  2B9Y A;  2FLP A;  2DGV A;  1WEL A;  2JDJ A;  4JB8 B;  4UST A;  5E3R A;  2HHH J;  4HH0 A;  2RB7 A;  3PRB A;  5HO4 A;  1RAA B;  2EEY A;  3QWU A;  4EEY A;  4M5H A;  5DM7 Q;  2HND B;  5H9F K;  2C1E B;  4DSK A;  1SIW B;  2CPJ A;  2JZ5 A;  3DU5 A;  1I94 J;  4P73 A;  2AZ3 A;  3G82 B;  4MK8 A;  7FDR A;  5LSO A;  1S1V A;  4FS2 A;  3V4I B;  1S1T A;  1S97 A;  4MKB A;  1KOO A;  3QT8 A;  2UXD F;  4CO2 A;  5KFR A;  1FKA F;  4LIR A;  3RB0 A;  4Q44 A;  2GAH C;  2V8V A;  2HRY A;  3EZU A;  3R6G B;  1XNQ F;  1JWW A;  4ALZ A;  2KKH A;  1KLM B;  1NJI T;  3CDB A;  2WOM A;  4F3Q A;  1FEH A;  1R8A A;  4PG5 A;  3OV7 A;  2D1C A;  2V4Q A;  2ATC B;  3DLJ A;  3N01 A;  4TKT A;  4HT5 A;  5ETQ A;  2R2S A;  2HBY B;  1GK8 A;  3HX9 A;  1D9D A;  3GYG A;  2FY8 A;  3DLG A;  2OPQ B;  5KG4 A;  1RAD B;  1ZM9 A;  5IOL A;  1EQM A;  1PC5 A;  2HNY A;  1MU2 A;  4PCQ A;  1S6Q A;  3T9Z A;  4JUZ A;  2KRR A;  3PXG a;  4DR5 J;  1J5O A;  1YJU A;  2VBW A;  1WEY A;  1MWQ A;  2ZDP A;  2ZUG A;  4FNI A;  1S1W B;  4DN0 A;  1SUQ B;  1CG2 A;  1VK8 A;  2BJ3 A;  4HI1 A;  1WC4 A;  4PEO A;  4CO4 A;  1U2F A;  2MY7 A;  2ZBR A;  2CG8 A;  4J9U E;  5J2M B;  1VLO A;  1S0M A;  3POT B;  3M05 A;  2VIC A;  2P6T A;  4HI2 A;  2E1C A;  1UMJ A;  2XYP B;  3S8S A;  1U1R A;  3PW0 A;  5EDW A;  5L9X A;  3B8H A;  3MR7 A;  2C3O A;  2EFG A;  3ZZR A;  1U6Z A;  4WJB A;  4DV0 F;  4HTJ A;  1S7H A;  3HDS A;  2HPU A;  4RW6 B;  3TW0 A;  3VR1 A;  1A7G E;  2KU7 A;  2MZR A;  3C6T A;  3QQC D;  4YY3 J;  2CVE A;  3OUY B;  2W9B A;  3H25 A;  2BKN A;  3BQ2 A;  1A9N B;  2CWX A;  1FDA A;  5KFC A;  1WI6 A;  1YTY A;  2CQC A;  2MLY A;  4NOH A;  2PMH A;  3RAX A;  2JL9 A;  5K8M A;  5AJ3 J;  1C0U A;  4MAK A;  5AE1 A;  4IRK A;  1MRO A;  2QL5 B;  3L4B C;  3VAG A;  2F1F A;  3MPW A;  1RT4 B;  2CPY A;  3QGG A;  5CXT A;  2E1R A;  5GAD U;  4J9R A;  3LA0 A;  4KE5 A;  1R89 A;  3RRH A;  1Q8K A;  1RHQ B;  2DHS A;  3M1V B;  3L7U A;  1EJ7 L;  4HAC A;  4HDH A;  4ETX A;  3BQ0 A;  5F0W A;  3BSN A;  4JBC A;  1EP4 B;  3OTO F;  2UUA J;  5DDR C;  5HP1 B;  1V3Z A;  2ZH8 A;  5B08 A;  3R5C A;  4QR0 A;  1JLE A;  3GMG A;  2CQD A;  1N48 A;  2HLT A;  3DOL A;  2M0G B;  3EPG A;  3CDU A;  4CCH A;  2E44 A;  1KLN A;  4K4U A;  3KG1 A;  2B5J A;  3D9B A;  2W2Q P;  4ZMM A;  1M1K T;  3UVJ B;  2ZZM A;  1HIY A;  2QYC A;  1RTD B;  4FDF A;  3G86 A;  2LVW A;  3LAK A;  4OYB A;  1YDL A;  3C14 B;  1FXR A;  3FGV A;  2BBE A;  4ZLL A;  5GAH U;  5E2Q A;  3LWM A;  2B8P A;  4DLE A;  2QSF A;  5BJR A;  1RI7 A;  1Q16 B;  3FC9 A;  1LWC B;  1PIL A;  4DV7 J;  4QPT A;  3CJK B;  4TQR A;  2DGT A;  2V8P A;  2IYG A;  4DR1 J;  4CNZ A;  4OYM A;  1CSJ A;  1XMO F;  1CS4 A;  2IM1 A;  3D66 A;  2XGQ A;  4URQ U;  3DM2 A;  3TAR A;  3ONQ A;  3R6L B;  2N7Y A;  5F9L A;  1VS3 A;  1YJN S;  3DLL Q;  2NXU A;  3PW2 A;  2E5G A;  4C3M A;  1FE0 A;  5B7W A;  5CAB A;  3KHG A;  1WKL A;  3MF5 A;  1DTT B;  1TL1 A;  2EI5 A;  2XEX A;  1SJ3 P;  1CJT B;  3GG1 A;  4GKJ F;  1OJ4 A;  4M5G A;  4BS2 A;  4IUF A;  3H2L A;  4CLZ A;  2QA2 A;  1JLA A;  4JI8 J;  2RAQ A;  3US5 A;  3F44 A;  3EPI A;  4XAK A;  3DLK A;  1VBX A;  2OP5 A;  4YEA A;  5A8W B;  2AW0 A;  2R7O A;  3CVK A;  1CC7 A;  1V5V A;  3HD2 A;  2IC3 A;  3UDL A;  3UO0 A;  2VQF J;  1FKP B;  2B9X A;  3PYD A;  4X64 J;  4B3T F;  2NUU G;  3RB4 A;  1B7F A;  5JXS A;  1ZTT A;  1HBU A;  2NYI A;  3JSY A;  4LVN P;  4NLW A;  1K73 T;  2P6S A;  3GJQ B;  1N6Q B;  1KRP A;  2E1M C;  3H5X A;  1YIT S;  4ECS A;  3ITH B;  4YQW A;  1YJ7 A;  4ZP9 A;  5GAE I;  2IDE A;  3GIM A;  2W4C A;  5KFG A;  4QWE A;  1LWC A;  2LDY A;  3C3L A;  2FHK A;  2WBR A;  3MMJ A;  5F8H A;  4X65 J;  5HAN A;  2ZM6 F;  1BE4 A;  2ZBC A;  3AOB A;  3TEH B;  2KTQ A;  3J7Y U;  1LWE A;  3AT1 B;  1EHW A;  3HSZ A;  1HKA A;  1RCX B;  4FXD A;  4DPU A;  1Q5Y A;  1DY3 A;  2A6O A;  1E6Y B;  3GLJ A;  4OYZ A;  2H48 B;  2HAI A;  2MJU A;  2OO4 A;  4MKA A;  2A2D A;  1UEU A;  3D6M B;  4YB7 A;  5DO2 A;  5IT0 A;  3H4B A;  3DOL B;  3ELH A;  1RLC L;  1C0T A;  1PBA A;  4KRW A;  2JRS A;  5KT2 A;  1BQM B;  3D68 A;  1RT3 A;  3RRK A;  4DN9 A;  2AJ4 A;  2D3Z A;  2IAJ A;  1QAY A;  4B3R F;  2RQK A;  4C8Y A;  1MSW D;  1VCT A;  1NHV A;  2GQC A;  5ETO A;  3W60 A;  2CQG A;  2YPZ A;  3C6U B;  4HAC B;  2ZH1 A;  3BO4 A;  3DGP B;  1HD1 A;  2B43 A;  1URN A;  4RO0 A;  2AD9 A;  2XZW A;  1M5K C;  4J9S A;  1UFW A;  1M1G A;  4G1Q B;  4I4B A;  1U1N A;  2O5D A;  3NS5 A;  4DR7 J;  5DS7 A;  1RKJ A;  1C0U B;  2FB0 A;  3I9Z A;  5E7O B;  2RDI A;  1IBM F;  3VHQ A;  3GE9 A;  4ZCI A;  4RKU C;  5L1K A;  1Z2L A;  3IG1 B;  1N5Y A;  3CC7 S;  3WX4 A;  1JK9 B;  3D28 A;  3FJ2 A;  1F9H A;  2EFQ A;  1PIE A;  4QWD A;  4ED7 A;  3SQG B;  3EZO A;  1TL7 A;  1ICE B;  2OGU A;  2LU1 A;  1M90 T;  2BW7 A;  1G1X A;  3RBX A;  3UE2 A;  1BUX A;  1NZ8 A;  2H5J B;  4UF4 A;  5HJY A;  2HLU A;  5J1E A;  3ISN C;  3MFI A;  4OYO A;  1SUQ A;  4ANE A;  1SJR A;  3HK2 A;  2BW2 A;  2AX0 A;  3NNC A;  1PSD A;  2NXC A;  2HS3 A;  1S6Q B;  3KXD A;  2F65 A;  2E1A A;  4P7T A;  3OSN A;  1MNE A;  2FJX A;  3HCX A;  5I4M A;  2IYI A;  2B6A B;  4IDK A;  4IFY B;  3K5L A;  3MEK A;  2LXI A;  4WE1 B;  3PR4 A;  3I0R A;  2B4P A;  3CCT A;  1VQ7 S;  2HS4 A;  1WG1 A;  4Q45 A;  2JWN A;  1UW9 A;  4G65 A;  4EBD A;  1Y7P A;  4FZV A;  1U1L A;  3GJS B;  1AA1 B;  4DG1 A;  2M8H A;  2XMU A;  1FXD A;  2DJW A;  3MM5 B;  5DZ6 A;  1CLF A;  3BKT A;  3MEC B;  2H51 B;  3DRR B;  3I56 S;  3LO3 A;  2IRX A;  2VA3 A;  5IV3 A;  4EO8 A;  4DL3 A;  2MKJ A;  3IRX B;  1N34 F;  2FDN A;  1B0V A;  1T3N A;  4G6V B;  3OTB A;  1YSJ A;  1FK9 B;  2XHW A;  1IWG A;  1EAR A;  1PJ7 A;  5IQQ A;  4DI6 A;  2KG1 A;  2L3M A;  4DV0 J;  1N5Q A;  3IA0 A;  4KFB B;  1YJR A;  4C0O C;  4ANC A;  5AE3 A;  1JJ2 R;  2V8H A;  1VQ9 S;  2NS1 B;  2ZH6 A;  2EK1 A;  4NLY A;  1RDR A;  3DI6 B;  3V6K A;  1PAU B;  1QY7 A;  1WC0 A;  2MKC A;  4X4S A;  4DV4 J;  3FEZ A;  1ARO P;  1NK6 A;  1HYS B;  3P6Y C;  2G9O A;  5DDQ C;  1LW2 A;  1XQI A;  4CI0 B;  1CVJ A;  2CPH A;  3MXH P;  5DQH A;  1KP6 A;  1NZA A;  3MZI A;  4JV5 F;  1K0T A;  3CIZ A;  2N7C A;  2KG0 A;  1NKC A;  1CC8 A;  2VB6 A;  4N8O A;  1T02 A;  3LH2 S;  2VPW B;  3NAH A;  5KFF A;  2X51 A;  4YHH J;  3R2C J;  1QTM A;  1RCO B;  1S48 A;  2GGP A;  2LEP A;  2V8D A;  1YJT A;  2R2R A;  2B9W A;  2FGC A;  3VF0 B;  2HNZ A;  1D8Z A;  5I42 B;  3OTO J;  3R27 A;  1U26 A;  2BR0 A;  1HHT P;  5ETR A;  2MEW A;  2DXE A;  1I94 F;  2KHC A;  2VKZ G;  1HPZ B;  3W5X A;  3KJV B;  4NLS A;  4NYP A;  2RS2 A;  4ZP6 A;  1SBR A;  5H9F J;  3NEK A;  2KL8 A;  2ZZT A;  1RWU A;  2HGM A;  3HVW A;  3E01 A;  4D3G A;  4N5S A;  2MKK A;  3BGR A;  4I2Q B;  3SFU A;  2CA9 A;  1RT7 A;  4P52 A;  3OVA A;  2J8S A;  4O44 A;  1R0B G;  1RHK B;  4CYU B;  1RWX B;  1HLW A;  1RT5 B;  3QT7 A;  2FC9 A;  3C19 A;  5H9E K;  3JSR A;  2OIH A;  2RRN A;  5I3U B;  2AJ0 A;  2IJF A;  1RIS A;  2W2O P;  3D4J A;  1NH7 A;  2LYV A;  1LFW A;  1Q1K A;  2CQB A;  2YKN B;  2PEB A;  4QWA A;  3VZI A;  1WG5 A;  3KNA A;  3NMR A;  4JI6 J;  2HVE A;  3FBB A;  4NLX A;  1UW4 A;  2UXD J;  4ZVS B;  1HI1 A;  1V6H A;  3DGV A;  4DSF A;  1U0H B;  5CD4 H;  1N6Q A;  4M94 A;  3L95 X;  3MM9 A;  1VGY A;  2AGQ A;  4ECW A;  1I3O B;  2GW8 A;  3JYT A;  1J5O B;  2NR0 A;  3I4P A;  4PG6 A;  3BSO A;  1FFW B;  4ECU A;  5D0E A;  2IBK A;  1K9M T;  1WSR A;  4KYZ A;  3G71 S;  1TMJ A;  1U8S A;  3PYF A;  3Q86 A;  1HNI A;  2PMZ D;  2FLO A;  2GNK A;  1HBN A;  1I5O B;  1TV6 B;  3TAQ A;  1X9W A;  2VBY A;  4JI8 F;  3PVX A;  3I0R B;  4PXE A;  2ADB A;  1S9G A;  5DM6 Q;  3HVR A;  2XY5 A;  5KFB A;  3BRE A;  3K5O A;  4IFY A;  4UOC A;  3PX4 A;  5G4D A;  2BZ2 A;  2AJQ A;  1OSD A;  5LXR A;  2KJV A;  1WKK A;  2XZD B;  1JLC A;  2DRD A;  2YQ3 A;  3PFO A;  5ETV A;  2GVD B;  1RB0 A;  3IR6 B;  4OX6 A;  4H4K C;  1WAC A;  1KQK A;  5AJ3 F;  2XBP A;  3DM2 B;  5H9E J;  2ZEJ A;  1JJH A;  2VKR A;  3I55 S;  3J7Y I;  2W4D A;  3C2P A;  1G6B A;  1Q7Y T;  3KJQ B;  3TZX A;  1RWW B;  4EMD A;  2XNR A;  2E7W A;  3W62 A;  1ZM2 A;  5A6P A;  1N0V C;  2V4J A;  4QOT A;  3L3C A;  1IM4 A;  4B02 A;  3C16 A;  5E41 A;  1X5P A;  2ZVI A;  4AL5 A;  4LF7 J;  4NI2 B;  3TWZ A;  2ZUA A;  4F25 A;  3PJX A;  4USW A;  4DX6 A;  1I51 B;  2FVS A;  2E66 A;  4KY3 A;  5CAA A;  1NXI A;  1WHX A;  2AT1 B;  1RBL A;  2X3G A;  3MTK A;  3CJS A;  2QG9 B;  2XWY A;  3DLE A;  1RBO B;  1F2G A;  4I7F B;  1FO1 A;  4O0N A;  3MEG B;  1U2C A;  2AIR B;  4YME A;  3K7R A;  1WC6 A;  3MD1 A;  5ETP A;  2I5J B;  5B0F A;  5G0R B;  3VVU A;  3NY0 A;  4P75 A;  5HL7 Q;  3GON A;  3BBF A;  5L1L A;  4HT7 A;  5DLF A;  3D1Q A;  2IVF B;  2WON B;  2VZ9 A;  2XI3 A;  2CPD A;  2IM2 A;  5CCL A;  4LF6 F;  4LRD A;  2Q43 A;  4H4M A;  2CXE A;  4TYA A;  2Z2Y B;  3CJ3 A;  5CCM A;  4RLE A;  4O23 A;  3PW4 A;  2RF2 A;  1Q4R A;  1RAE B;  4NLG A;  2K06 A;  1UL3 A;  4NCG B;  1C0T B;  4DR7 F;  3OFG A;  1UZH A;  3AH6 A;  3DHW C;  3JYT B;  3T6J A;  3WDO A;  3M6V A;  1RU2 A;  1MW7 A;  3UR0 A;  2OD4 A;  4LF1 A;  3UW1 A;  4DPW A;  2KM8 B;  1WWH A;  1QVF R;  4U7U D;  3OJS A;  2JHE A;  2YQ0 A;  2MQO A;  3J7A N;  4Z7C A;  3MMC B;  2CFX A;  2ZFH A;  3KK3 B;  2GX8 A;  4ED8 A;  4GKJ J;  3Q8U A;  3AD7 C;  2AJ1 A;  3TVY A;  1OPZ A;  4TLR A;  4DOZ A;  3NNH A;  4EYH B;  2O1P A;  1TVR B;  4DCP B;  4YP3 A;  2HHP A;  1DAX A;  5FII A;  2OH2 A;  2D69 A;  2WSC C;  2XMV A;  4JI0 F;  1IXK A;  1P27 B;  3EGV A;  3MR6 A;  4L3N A;  4R0J A;  4O3N A;  3L9Z A;  2XLJ A;  2QT7 A;  2VV5 A;  3IM8 A;  2XHC A;  1KEK A;  3DNC A;  4Q5V A;  1RSC A;  4RW9 B;  4ZLP A;  2GS8 A;  2J6S A;  2GHV C;  3HUL A;  2H4W B;  4QIW D;  1RGV A;  4R5P B;  2R3V A;  4R25 A;  5K14 A;  1UPM B;  3R7S B;  1TL5 A;  2MZ1 A;  4GC6 A;  4WF9 Q;  2DH8 A;  1BWV A;  2GIF A;  2IHR 1;  2ACM A;  2OEM A;  2OPP A;  3I5C A;  4H4M B;  3BQ1 A;  1WF0 A;  2CWK A;  2ROP A;  2V0N A;  2FY1 A;  4Q8E A;  4B3O A;  4XIU A;  3IGN A;  1SH0 A;  1SVD A;  4CP5 A;  3G87 A;  4UZC A;  2MQ8 A;  3A8E A;  3T5K A;  4B3T J;  3SDE A;  2UXC J;  4IYQ A;  3ZTO A;  1AUD A;  3G96 A;  5LXY A;  2HGL A;  3OL8 A;  2PGC A;  2JLF A;  4LRA A;  2ALY B;  2Y1R I;  1CJV A;  1IKW A;  3U7J A;  1UA1 A;  3UWT A;  1T3O A;  5THW A;  4HLB A;  2P9G A;  2RU3 A;  3CO0 P;  4DV3 J;  3QRP A;  4L75 A;  3RR8 A;  5AE2 A;  2JEF A;  2HBZ B;  3NGD A;  4B3R J;  4PYD A;  2UUW A;  1HFE L;  1FWK A;  2HND A;  2DNL A;  3FNN A;  3CC2 S;  3EUN A;  3TAM A;  2LKZ A;  3UCG A;  4PZV A;  4N77 A;  5F8N A;  2E5H A;  2V4J B;  3K0J A;  2FZC B;  3KLG A;  2WSE C;  3AXM A;  3S6E A;  2BA9 A;  3LPE A;  2FJE B;  2VFS A;  1H2T Z;  3IRW P;  3MD3 A;  4KPY A;  1NRK A;  2DGQ A;  3FSX A;  2CRL A;  4CDI A;  2QMX A;  2EFV A;  3AB4 B;  4YHH F;  2ZH5 A;  1HR0 F;  4FPI A;  4L72 B;  5HLF B;  1LK5 A;  4F4W A;  1FDN A;  1O5J A;  2DH7 A;  3MCN A;  3THP A;  4DUY F;  2B8Q A;  3RYL A;  4WFY A;  4IO9 Q;  4OFZ A;  1REG X;  1RP5 A;  1XIQ A;  2NPI A;  2AJF E;  3G8S A;  1FES A;  1UVK A;  1GH8 A;  1KFS A;  1RHM B;  3CDW A;  3FQK A;  3HZG A;  3QGH A;  4LF8 J;  3ZC4 A;  3FMW A;  3BGU A;  2RKI B;  5F41 A;  1M5P C;  2FZG B;  3QFW A;  4C6A A;  4RW9 A;  1NB7 A;  1CJK A;  3N6L A;  2FVR A;  1MRO B;  1HNV B;  4ZLN A;  3NRB A;  1M5H A;  3MM9 B;  3J7A 1;  3TVK A;  4LR7 A;  4WYW A;  2PI5 A;  4ENO A;  2YKM A;  3KTQ A;  1BHN A;  1V9O A;  2PA8 D;  2UU9 J;  3PHT A;  4P2F A;  3R2D J;  1V5I B;  3FEX B;  1LEO A;  3VTI A;  2F8H A;  3GR0 A;  5HVG A;  1U47 A;  2RML A;  1YZ6 A;  2HFO A;  5EWG A;  1H7W A;  3SQG A;  2AZ1 A;  3QID A;  2OTL S;  2L9N A;  1N54 B;  1IKV B;  4MYT A;  4NEY A;  4J9L A;  3CUN A;  2PA3 A;  4CLP A;  4QIV A;  2QJ3 A;  4ZLJ A;  5D6G A;  1FE4 A;  3KLH A;  2D3U A;  4CYU A;  4M5M A;  2C2R A;  2CPE A;  3BGR B;  4I2Q A;  1U49 A;  2K8G A;  1S1W A;  1LK7 A;  1M0S A;  3E01 B;  3QZ8 A;  1UVI A;  1KVJ A;  3OXF A;  4OX7 A;  2VFR A;  2MQN A;  1WSV A;  3I5A A;  2LP4 A;  1TL4 A;  2V63 A;  2MKH A;  4IG3 A;  4DPO A;  2KRB A;  5C25 A;  4MMO A;  3NGT A;  2V94 A;  3KUH A;  4NXN F;  4HYK A;  1NEE A;  1SJ1 A;  2YNG B;  3J81 j;  4IRC A;  1HWU A;  2XSF A;  3BF4 A;  4LBI A;  3CGI A;  1ZM3 A;  3SBM A;  1X5S A;  4M5J A;  4LF5 J;  3TP2 A;  3CCU S;  2AJ2 A;  3GFX A;  5J2Q A;  2COL A;  5DDP C;  2DY9 A;  3QFH A;  4HHH A;  5FD1 A;  1YGY A;  3M6U A;  4ZIT A;  2YWK A;  2V2K A;  5CYQ B;  3DMJ B;  5DDO C;  3KUE A;  4N56 A;  2R7V A;  4B9L A;  1HQU A;  2CNN B;  2G2Z A;  1GMW D;  2ZE2 B;  5CZX A;  2HFN A;  1KD1 T;  4B08 A;  2BRK A;  2J0X A;  4KR0 B;  2VL1 A;  1HAR A;  2QFI A;  1Q7L B;  4WK3 A;  4F4X A;  4JV0 A;  1RYS A;  2V67 A;  4LF7 F;  3C16 B;  4ES3 A;  3Q22 A;  1B70 B;  2DGW A;  5CYJ A;  3GB0 A;  1QE1 B;  3I0S B;  3KLV A;  4ILM A;  4K5R A;  1EET A;  1P9Q C;  3ADA C;  2LFV A;  4WCE Q;  3KK2 B;  4WU2 A;  4E0D A;  4LJM A;  5F8J A;  2Q6B A;  4N8N A;  2CAJ A;  5HQM A;  4DFM A;  4JI4 J;  1WDD A;  2CYY A;  1FTR A;  1UEK A;  4AL7 A;  1RAH B;  5KFW A;  1S1X B;  1R43 A;  1NSA A;  4LFA J;  4DZD A;  1B64 A;  2E9Z A;  4ICL A;  2VG5 B;  1RTI B;  3QLH A;  5IWA F;  1KR4 A;  2DXF A;  3CDA A;  2CNO B;  2QA4 G;  3IXQ A;  4BC9 A;  3LQV A;  1IBC B;  4MKY A;  2VPY B;  2DKO B;  5KFV A;  2YWE A;  4EZ9 A;  1ZAV A;  1HA1 A;  2ZNZ A;  1HNW F;  3NL0 A;  1L5U A;  3AA8 A;  2GJI A;  4C3L A;  1VQ6 S;  5B0G A;  3OLB A;  1GFW B;  1VRU A;  4NLQ A;  2BJE A;  2DO0 A;  2UP1 A;  1Y11 A;  2G0J A;  4ED1 A;  1ZM4 A;  1RWN B;  1HWJ A;  3S01 A;  4C7Q A;  4MIB A;  1T03 B;  1NSP A;  2VPX B;  4FF2 A;  1FEE A;  2FJD B;  3Q8S B;  1Y5L B;  4OV1 A;  2KFY A;  4J90 A;  4BWM A;  3VWS A;  2UUC J;  4K4S A;  5DJB A;  2RNE A;  3M2U A;  5J2P B;  1TL7 B;  1CUL A;  2WVC A;  3ICL A;  1FX2 A;  4JOU A;  1ZTW A;  1RQ0 A;  1YIJ S;  1TK8 A;  3PO5 A;  1S6O A;  3TA0 A;  3PRV A;  5IFM A;  1NPR A;  3HHL D;  2GV1 A;  2ZDO A;  3KWM A;  1M1H A;  1SPB P;  5FDL B;  4AQY F;  2KVI A;  4NRT A;  4JI6 F;  4A8F A;  4QYZ K;  3UNY A;  1HHQ A;  4XTT A;  4WKR A;  1FRX A;  3G6Y A;  4ZVH A;  4DV6 J;  3O3L A;  2C2D A;  4NXM F;  1QLN A;  3GQC A;  1C1C A;  1UAW A;  3M8Z A;  4OV6 A;  4J9Q A;  3PY8 A;  1JMT A;  2NQP A;  2XC9 A;  1GNK A;  4G1Q A;  2DR8 A;  2UVV A;  3IR5 B;  3RAQ A;  4ZHR B;  1K8A T;  3T6B A;  2ZD1 A;  2DIS A;  3QAT A;  2G1D A;  2RSQ A;  2Z56 B;  4OHW A;  2Z2M A;  4A47 A;  3KK1 B;  2ZH9 A;  1SL2 A;  3BKU A;  1HI8 A;  2ZC3 A;  4NYZ A;  1L3T A;  3D2W A;  4B9U A;  5T41 A;  1KN6 A;  2BKO A;  5K9F A;  2HNZ B;  1CPZ A;  1W26 A;  3TZY A;  4PWD B;  1JLQ A;  3CD5 A;  2AF6 A;  8ATC B;  2BJ9 A;  2BXJ A;  5ETK A;  1IBL J;  2X1B A;  2KXN B;  3MAA A;  2L41 A;  2C42 A;  2XY6 A;  1RJJ A;  3DFE A;  3FFI A;  3MEG A;  2CQH A;  4F3M A;  3AY0 A;  1MLA A;  3TR5 A;  1IUJ A;  2M2B A;  2R7U A;  1FTC A;  1WOS A;  2IFX A;  1B4S A;  4FVM A;  2YNH A;  4TYB A;  2YH0 A;  5CH7 B;  1KS2 A;  1JLG B;  2HGN A;  3AAW B;  3K17 A;  3R5D A;  4TNO A;  4WPA A;  3JQM A;  1ZS6 A;  5HI7 A;  5HJX A;  1GTH A;  4RW4 B;  2PE8 A;  3D3C J;  2AEJ A;  4Y2K A;  1FNO A;  4KFB A;  4F02 A;  3H4D A;  1GT8 A;  4K0K J;  2ZOM A;  2VQE J;  2BMB A;  5GMK a;  4ECZ A;  1FD8 A;  2B9E A;  3UNG C;  2FYX A;  3WQP A;  2CDQ A;  2FGO A;  3IRX A;  4ZDN A;  2FHO B;  2M9K A;  5A2Q Y;  2XGP A;  1FKO B;  3CXC R;  4OJH A;  3BH7 B;  1GEH A;  3CMQ A;  3MEC A;  4RWW A;  2LEB A;  5LJ3 Y;  4MJK A;  2CUY A;  1TKX B;  4JI3 J;  2F63 A;  1S9G B;  4USK A;  1P1T A;  2EW9 A;  1Z4U A;  2PC6 A;  2FJA B;  1F6T A;  1YKW A;  1HNI B;  1YJ9 S;  3EM1 A;  2H3E B;  3EGW B;  1IJF B;  2IM3 A;  3AJ1 A;  4MYU A;  3BO3 A;  2H5I B;  2QLX A;  3M4X A;  5IQ6 A;  3CIM A;  2DYA A;  4U67 Q;  2J0Q D;  1REV B;  3MAH A;  2VU5 A;  2KI2 A;  5H1S V;  2Y1J A;  2N4C A;  2ZWP A;  2OTJ S;  1TKZ B;  1S79 A;  1YWX A;  1FDD A;  4M5K A;  3LAN A;  3TVZ A;  4LF4 F;  4A8Y A;  3P3D A;  3O6Q A;  1FNX H;  2E9T A;  3J81 U;  4EZ6 A;  3PG9 A;  4C0B A;  4TVA B;  1OO0 B;  2C3M A;  2L9D A;  1JLF B;  2YWW A;  3OTE A;  4QR2 A;  3H20 A;  4DLG A;  4IR9 A;  5AXK A;  4NRU A;  4CT8 A;  2HIQ A;  2FZK B;  2R7X A;  5B0A A;  3MEE A;  2VON A;  1U1Q A;  4FYD A;  5D0R A;  2V4R A;  4ILL A;  4IOA Q;  4UOG A;  4F04 B;  2WK4 A;  3CCJ S;  2I6W A;  2QYG A;  4ZN1 A;  2MGZ A;  4P9S A;  5HQ8 A;  4LSL B;  2AEM A;  4FF4 A;  2V50 A;  3O44 A;  4K4Z A;  5KFD A;  2AYM A;  3V81 B;  1XNQ J;  2DPJ A;  4O3O A;  1OIA A;  3IAS 9;  2ZOG A;  1NDL A;  2HHS A;  2HSE B;  2J9D A;  4OYP A;  4U8V A;  1X4A A;  1VC0 A;  3ULH A;  4EBC A;  1AFJ A;  1FDB A;  1HWI A;  4MH8 A;  4DF4 A;  3MM6 A;  2BV3 A;  1U1M A;  1OY9 A;  4HDG A;  1IKX A;  2HW3 A;  2KN4 A;  3RU0 A;  2Q6C A;  1ZPW X;  5SZT A;  2OUG A;  2HZC A;  4LSZ B;  4QIG A;  1T95 A;  2DPI A;  4M5L A;  5CZV A;  3EVW A;  3KOA A;  2WVD A;  2Q1L A;  2DNO A;  1W7W A;  3KMQ A;  2A1B A;  1UA0 A;  5J1N A;  1VDH A;  1E6Y A;  4KKO A;  4OX9 F;  5DQG A;  3JQK A;  3KLF A;  3QSY B;  4FF3 A;  2YNI B;  3B4M A;  1VI7 A;  1HWK A;  3MMB A;  1TK0 A;  2M4M A;  4ICL B;  3H40 A;  2ZHB A;  1BQN B;  3FVY A;  4LT6 A;  1X31 C;  2A2C A;  2J7W A;  2V2Z A;  3ZZ0 A;  3UR3 C;  3HMJ G;  4DV5 J;  4IG0 B;  3D0I E;  2BJ1 A;  1MN9 A;  4KGX B;  4I56 A;  2YTC A;  1WG4 A;  1DTQ A;  3R7B B;  2F8E X;  3W61 A;  4DX8 H;  2GIQ A;  2W2N P;  3LUY A;  3UDE A;  1QUP A;  3ZNJ 1;  1EET B;  3P4U B;  4A8X A;  1NK0 A;  2RH3 A;  3KDN A;  2UUB F;  5ETT A;  4DQP A;  2XNQ A;  5K8P A;  3DRR A;  2E1P A;  4C98 A;  2PEH A;  5F8L A;  3MUV P;  1OMS A;  2DY1 A;  2NZ4 A;  1JQG A;  1LW0 B;  4G3I A;  1H74 A;  4L3K A;  4ZVO B;  3SCK E;  2UVW A;  3OBI A;  4M5I A;  2BJ8 A;  2YXL A;  4H54 A;  3UN2 A;  3LGN A;  3M9M B;  2PFF B;  4N76 A;  3VGU A;  2LEC A;  4ECT A;  4F4Y A;  4WE1 A;  3V2U C;  3PIP Q;  3W63 A;  2E5I A;  4BC7 A;  4TU8 A;  3PIO Q;  3MAA B;  4X65 F;  4TN2 A;  4NLR A;  3TOQ A;  4DFK A;  5M2P A;  2MZQ A;  4YDX A;  4O3R A;  4NLU A;  3THT A;  4F50 A;  1H7X A;  2R8H A;  1B99 A;  3QAU A;  5B09 A;  4X4V A;  3OL9 A;  3TUJ C;  2V9W A;  3H5U A;  2NXJ A;  3OFE A;  2AGO A;  1CS4 B;  1R6Y A;  4NLD A;  3F41 A;  1TK5 A;  2DK2 A;  4UUX A;  5I3Q A;  1IBM J;  2FVQ A;  2ZJQ Q;  2A18 A;  3UFC X;  2XMA A;  3NBP A;  3PKM A;  1HNX J;  1LFP A;  3SCJ E;  2MKS A;  2M3D A;  3MTJ A;  2QZ8 A;  3IWX A;  3GIK A;  2OLW A;  3KKF A;  2OSQ A;  2FPH X;  2Y0B B;  2QGF B;  3BGL A;  4GMK A;  3W8G A;  4E8U A;  2A10 A;  4LF5 F;  1RKI A;  2LXF A;  1RTZ A;  2V6A A;  4FVC A;  4DV6 F;  4EGL A;  4ZPA A;  2LMI A;  5FDL A;  1HWL A;  4OJG A;  5KG0 A;  5L9N A;  4YR2 A;  4DUZ J;  4DV7 F;  4IR1 A;  4GVB B;  1IKY B;  2B5J B;  4TU9 A;  4B9S A;  2UXB J;  4OJ1 A;  3W9H A;  5IC4 B;  4LBH A;  3U1N A;  4OI1 A;  4FS1 A;  5IM0 A;  3TAN A;  4X4N A;  1K44 A;  2KFZ A;  4Q7A A;  1DQA A;  1WEZ A;  1O6X A;  2VF3 A;  2VDH A;  2MDA A;  3C6U A;  1V3S A;  3MM7 B;  3THV A;  1ZBT A;  3TRG A;  2IAJ B;  4W90 B;  2EFP A;  4C97 A;  3L09 A;  3CCL S;  1X7V A;  3NOC A;  5HBM A;  3T1A A;  2EG1 A;  4C0H A;  2RKI A;  2K7J A;  1JKH A;  2RUG A;  3M2V B;  2Y8W A;  2F9J A;  1NSK L;  4DR6 J;  1GTE A;  1Z2Z A;  2BE2 B;  3D6H B;  5KFX A;  3R1L A;  1X4F A;  1ACM B;  3N79 A;  3A8I A;  2XB2 D;  2CJA A;  3HPO A;  1SC3 B;  1U1O A;  3K89 A;  5D3G A;  2HHT A;  2CZV C;  4DPX A;  3BS9 A;  2P8I A;  1J27 A;  4K4T A;  4QR1 A;  1T8E A;  2M52 A;  4NE9 C;  2Z30 B;  1TU0 B;  3CC4 S;  4EBE A;  4J9V A;  4ID5 A;  2EXU A;  3M2R A;  4LQ3 A;  2XS7 A;  2CVI A;  3JAM Y;  3UQS A;  2OEK A;  2K3K A;  4RL1 A;  4YB6 A;  2M70 A;  3CD6 S;  1YJW S;  4F26 A;  3IBW A;  3LAM A;  2GFF A;  3OHA A;  4DFJ A;  1HBU B;  4IG0 A;  3CUL A;  3VAH A;  3EE3 A;  1NME B;  2VDI A;  3BR8 A;  4RW4 A;  1Q82 T;  3DRY A;  3B78 A;  2HG4 A;  1IN0 A;  2EKY A;  2HNY B;  1JNZ B;  1KVK A;  3MMB B;  5ETN A;  3RAM A;  2GA7 A;  4F0K A;  4ECV A;  4DL5 A;  1N8R T;  4O4G A;  2LQ9 A;  2XM3 A;  5JVH Q;  4LQ9 A;  2POK A;  4PKD B;  1CJV B;  4JI7 F;  1S0V A;  4WP8 A;  5CYQ A;  5EWE A;  4NAS A;  4ZVR B;  4ZVP B;  3RJM B;  2Q79 A;  4TY8 B;  4LRF A;  4ZVE A;  1PAE X;  4LSN A;  2ZZN A;  5BYQ A;  5EX3 A;  1Z1Z A;  3SXL A;  3V6J A;  1M5V C;  1KLM A;  1YBU A;  3AFG A;  4TY8 A;  3CD0 A;  4PXC A;  3E3X A;  4Q0B B;  2E7V A;  2OPP B;  4OIX A;  4QYZ J;  4O0I A;  2D9O A;  2MY8 A;  3FMB A;  4CTA B;  3QJP A;  4WFZ A;  1TTH B;  1Y10 A;  3HHE A;  3GSI A;  3LPY A;  4O3S A;  4Q8F A;  1SKU B;  4AUK A;  1MN7 A;  2XI2 A;  4ELT A;  3D7S B;  5A8R B;  3H8Y A;  2WVF A;  3OXL A;  3PYE A;  1H6K X;  1ZAW A;  3BDE A;  4PYA A;  4KGZ B;  4CQ1 A;  1H72 C;  3D6T B;  3HFK A;  2QV6 A;  3MEE B;  4A8W A;  4QWB A;  2BQU A;  1RZM A;  4JI5 J;  4NWB A;  1IKV A;  1UP1 A;  3M32 A;  4Q2L A;  4ZIW A;  3Q2S C;  4LFC F;  1UVM A;  2VOO A;  3HSD A;  3Q8Q B;  1Y3J A;  2CQ2 A;  2I38 A;  3AQO A;  4UY8 5;  2V2V A;  2HQG A;  3IR7 B;  2XMM A;  1VJQ A;  1T9T A;  1UTA A;  2P2C B;  2RQM A;  1RHJ B;  1RAO A;  3G6E S;  2QN6 B;  3G6X A;  4MTP A;  3IS9 B;  4LRC A;  2YKA A;  3M9N B;  4CLF A;  1SCJ B;  3OSP A;  2MPU A;  4LF9 F;  4DR4 J;  2IIH A;  2UZA A;  2BAC A;  2QMU B;  3M1V A;  4K0K F;  3V5R A;  2DEI A;  1JKH B;  2FHJ A;  2XYH B;  4DJB A;  4KB7 A;  5D15 A;  4ES2 A;  1XJW B;  5HBM B;  1IBL F;  1WUU A;  1N0U A;  3LP2 B;  1U1P A;  4B3S F;  4C9D A;  4QCL A;  4ZPC A;  2J0W A;  4WP3 A;  1SC1 B;  1D9A A;  2KVQ E;  3JS9 A;  4OI3 A;  4F0M A;  5HSP A;  4HHJ A;  1SKW A;  1WHW A;  4QIF A;  1N34 J;  2CZ9 A;  1W25 A;  5LJ5 Y;  1SKS A;  5HLF A;  3W5Y A;  1RAB B;  2PT0 A;  3WIU A;  2EC0 A;  2HK2 A;  3BM7 A;  3B6B A;  3MPY A;  2JEJ A;  3TA1 A;  2H4Y B;  3R7N B;  2RDD A;  3CCE S;  3BJY A;  4GVB A;  1QJH A;  3M8R A;  3V6H A;  2FHJ D;  3GG0 A;  3E8O A;  1JB0 C;  1FA0 A;  3EMT A;  3R9L A;  3KLG B;  3BYP A;  1YRX A;  2CZ4 A;  3CJK A;  4K4X A;  4DF8 A;  4AYB D;  1PBU A;  2E5L F;  3ENV A;  3QBC A;  2B51 A;  3FBF A;  1HW9 A;  1HQ2 A;  1NDK A;  3I5B A;  4DU7 A;  2HHQ A;  2FIU A;  4B9T A;  2DR5 A;  2DRB A;  4XDC A;  4OYA A;  2YNH B;  3D6F B;  4DQS A;  4WZQ A;  1WDT A;  1Q79 A;  2QLB B;  3MCS A;  1N36 F;  1VLY A;  3DLG B;  5KFA A;  4LF6 J;  3PM9 A;  5DQI A;  4UUW A;  2J7K A;  3U1L A;  4LFB F;  4ILR A;  4FPR A;  3CJ8 A;  1LNQ A;  4WTO B;  4U8Y A;  5J2Q B;  4CO1 A;  3OVS A;  2C2K B;  4PWD A;  3D1H A;  2VAS A;  5F0U A;  2MQP A;  2R7T A;  1WC3 A;  3FZB A;  3P5B P;  1SQG A;  1X4D A;  3HXM A;  2LCW A;  4EU0 A;  1H73 A;  5DET A;  5KOW A;  1WC1 A;  2KM8 C;  2LQB A;  4NYO A;  4O4R A;  1R3N A;  3BR9 A;  5J1P A;  1S0O A;  1XK8 A;  3W65 A;  1HHS A;  4ZA1 A;  2G4B A;  2NYH A;  4WYL A;  3AOD A;  3ZZZ A;  3JSM A;  3PCO B;  1NDC A;  3EGN A;  1IR2 A;  3H42 A;  4O3P A;  1HI0 P;  3H5Y A;  1TVR A;  1S9E B;  1DTQ B;  2M5Y A;  2LDI A;  2GMH A;  4C8L A;  2PO4 A;  2QSW A;  2IBO A;  3TYT A;  1IR0 A;  3CMA S;  2V68 A;  3IC1 A;  1S72 S;  1TAU A;  1UWB A;  3R5B A;  4RZR A;  2C2O B;  5LSL A;  1XER A;  3PTW A;  4UTG A;  4WU3 A;  3BV8 A;  1WEX A;  5E3C A;  5A8K B;  2E9R X;  1Y4Z B;  3PEJ A;  5EUH A;  1HNZ J;  2UXC F;  1IWA A;  2GMJ A;  3EVM A;  4ZP7 A;  2DB1 A;  3EJM A;  1EAY C;  5AXL A;  5GME A;  5IC6 B;  3RW6 A;  2OEJ A;  4DUT A;  1F5A A;  1NPK A;  4TXS A;  2W1B A;  3CNQ P;  2GQQ A;  4LR8 A;  1D9F A;  2V8G A;  5KTQ A;  5LSR A;  4P74 A;  2R9L A;  1VQS A;  2QA4 S;  4DX7 A;  3I9V 9;  2R7W A;  1IQZ A;  3NP5 A;  2H9Z A;  2MHN A;  2J9C A;  2PD1 A;  1QVG R;  5ITH A;  3OHB A;  1GXT A;  2DHG A;  2I5J A;  1C1B A;  3JTN A;  1OPI A;  2J5A A;  8AT1 B;  5EHH A;  3PYG A;  3MR3 A;  4LRE A;  4B9M A;  4DSL A;  2OFG X;  3M32 B;  1S9E A;  1VK3 A;  3ZZP A;  3JSB A;  5KT6 A;  1HL6 A;  4OYX A;  3I0S A;  2Z2Z A;  3HSJ A;  3TEG A;  2F5G A;  3TJA A;  4ZCM A;  3NGR A;  3M30 B;  4A8M P;  1VQO S;  2OD6 A;  4XPE A;  1WF2 A;  4DR5 F;  2OPS B;  2RJZ A;  3GSD A;  3NS6 A;  1RWP B;  4ZVF A;  1NJX A;  3BBB A;  2P5V A;  1IQT A;  2IVY A;  2XMK A;  2RIL A;  3NAI A;  2JX2 A;  1U4B A;  1ULR A;  4PG4 A;  2J0S D;  1Q8L A;  4P6Q A;  1S0N A;  2MJN A;  2RQ4 A;  2XMJ A;  2PII A;  2ZJP Q;  1I1G A;  3G8T A;  3SYZ A;  2IPO B;  4Z7Y A;  2I0X A;  1JLC B;  2G1H A;  1JXV A;  3GFY A;  3FKB A;  1GX6 A;  1YQH A;  4DUZ F;  1RE1 B;  5D77 A;  4B3M F;  2CDR B;  3GIL A;  3Q24 A;  3DOM A;  4M5D A;  2QMW A;  1XNR F;  3CSK A;  5IWA J;  1U24 A;  4K4Y A;  4R5P A;  1GMU A;  2HHV A;  4IG3 B;  1APS A;  1Y0H A;  1NU4 A;  3M8P B;  4NLP A;  5L8R C;  3MMA A;  2UVR A;  2RDJ A;  3OR1 B;  3G6V A;  1HMV B;  2XO7 A;  1U6F A;  2EK6 A;  1S99 A;  3EVO A;  1KWM A;  3P45 B;  3VAI A;  5DG9 A;  2V9K A;  4JI5 F;  3CCV S;  2Y1L B;  1LV5 A;  1VYA A;  1KSP A;  3P5T L;  4A8O A;  4DR6 F;  4ZN3 A;  1PJ5 A;  2GQ2 A;  2PFD A;  2CJX B;  2HYI B;  5CYM A;  3DOK A;  4YS2 A;  5I3U A;  4OZ5 A;  3G2X A;  3PO4 A;  2JVR A;  3SMZ A;  5D3G B;  2D41 A;  3H59 A;  1RT7 B;  1XC9 A;  4HHU A;  2ZH4 A;  1BLU A;  2CPI A;  4MFB B;  1RT2 B;  4HTI A;  3RG6 A;  3LWL A;  5IZH A;  3HP6 A;  3I6P A;  4IO1 A;  1SC4 B;  2OSR A;  3M2V A;  1R8C A;  2GAG C;  5JUM A;  4WTY A;  3F56 A;  2KFN A;  1P6T A;  2RF2 B;  3HT0 A;  3A3O B;  2AMC B;  3FCH A;  1R31 A;  3OW2 R;  2JJ4 D;  3UN5 A;  2H54 B;  4I69 A;  3VGS A;  4OZ2 A;  1AUS L;  5KFK A;  1U7L A;  4TU7 A;  4PQU B;  3WZ0 A;  4Y00 A;  3G4S S;  2GGP B;  2N4D A;  4DU8 A;  2XS2 A;  3BDP A;  3OL6 A;  1F9E B;  3SV4 A;  3H90 A;  4UZB A;  1UEV A;  2DGX A;  2XUL A;  4KC5 A;  3HF5 A;  2EBE A;  5BR8 J;  1SQE A;  4D3H A;  4ED4 A;  4R8U B;  5KT4 A;  2QA1 A;  3H7H B;  3DLE B;  3T1H F;  3CD7 A;  3SZ2 A;  4N7T A;  2P9C A;  1PJ6 A;  2N3L A;  1OQ3 A;  2VFU A;  2R7Q A;  3ET6 A;  4DCO B;  3HT3 A;  3F0N A;  1NK7 A;  5K5M A;  4UQG A;  2VQF F;  2IA0 A;  2KZM A;  5JJB A;  1ZZF A;  2MZS A;  1JXE A;  4CLT A;  1FJE B;  4YR3 A;  1R8B A;  4AND A;  1HR0 J;  5IT9 U;  4WZM A;  2DIV A;  2VFV A;  3D1O A;  2RE1 A;  2DNM A;  1Q95 G;  4A4J A;  1J5E F;  2XCA A;  2UUA F;  3KG4 A;  2YNF B;  3DRP A;  2DIT A;  3I32 A;  2J76 E;  2JSX A;  5E3A A;  1IBK J;  4MIW A;  2IJR A;  4JI2 F;  3K59 A;  3AJD A;  3KFW X;  1VRU B;  4A48 A;  3R3T A;  1F2H A;  2GVZ B;  2B4V A;  1QM9 A;  3MM5 A;  1NJZ A;  1TKD A;  4LFC J;  5KFY A;  1U0S A;  1WHV A;  2Y3Y A;  3JQJ A;  5F8M A;  4X4Q A;  1F60 B;  3OQ2 A;  4JI4 F;  3OT9 A;  3K2Y A;  4XO0 A;  3D54 A;  4RW7 B;  4ERD A;  4J9M A;  2HFS A;  1VIX A;  1XMQ J;  1JJ4 A;  2B6A A;  4IDK B;  3PR5 B;  3DYA B;  4UOF A;  4K59 A;  1VQM S;  3SCI E;  1N56 A;  3QLH B;  2VA2 A;  1LW0 A;  1WJ9 A;  4JI3 F;  1X4H A;  3PHE A;  5L46 A;  1HW8 A;  2KT5 A;  1RK8 A;  2AGP A;  4OZ3 A;  1UJ5 A;  2VG7 A;  3HHL A;  4NZ0 A;  3MHY A;  1U0H A;  3EXY A;  4K2J A;  2DHA A;  2A0F B;  2Z58 B;  3LAL A;  5KFS A;  4C48 A;  1T9X A;  4X4R A;  3DLH A;  1KQS R;  4IH5 A;  4AQY J;  3WC2 A;  4QPX A;  4W92 B;  4I0W A;  2WAQ D;  1KTV A;  1F3V A;  3AA9 A;  3D5M A;  2YKN A;  4B3S J;  1RT6 B;  1RUS A;  3MUM P;  2HUR A;  3M8Q B;  4USJ C;  1F9F A;  4USI A;  1N32 F;  2CQ3 A;  5IXU A;  4URS A;  3M7V A;  1ZYQ A;  4CLU A;  1JLG A;  4LF4 J;  1PGZ A;  1N5Y B;  3Q8Y A;  4O44 B;  2OKQ A;  2YNI A;  1HQU B;  3D67 A;  2OEL A;  2YVS A;  1R0C B;  3VGV A;  2ZH2 A;  5A76 A;  4UOH A;  1M5S A;  1SV5 B;  1VIO A;  5KFZ A;  1RT1 A;  3GFZ A;  5KG5 A;  1S59 A;  5LMN F;  2XSJ B;  3HVT A;  1KC8 T;  4OL8 A;  4X84 A;  3UDV A;  3LGM A;  3A3P B;  4YFU A;  3WC0 A;  4NXM J;  4WXO A;  5HP1 A;  4QBU A;  2HRU A;  2I1R A;  5KAK A;  3S1T A;  1FXL A;  1SI9 A;  5BYS A;  3J80 U;  1KNZ A;  1HBM A;  2XS5 A;  1RHU B;  2CJB A;  2D74 B;  1CQM A;  4F0H A;  2E29 A;  4ZK7 M;  4K8R A;  3KMS A;  2A3J A;  3DDK A;  4WIQ A;  4CNY A;  1X9M A;  4X4U A;  3X1L B;  3V81 A;  2BRL A;  2MZT A;  2C3Y A;  3AXK A;  1VQ4 S;  4UY8 T;  5GAG I;  4NML A;  2BX6 A;  4OQJ A;  4KGK A;  1NKE A;  1LW2 B;  4RBT A;  3OLA A;  4G1P A;  2DT9 A;  1SB6 A;  3QYY A;  2D3O R;  5D4O A;  3DI6 A;  3K5M A;  2JVO A;  2DNR A;  3A13 A;  1JNR B;  5CYM B;  2FUG 9;  4DR3 J;  3M8Q A;  3DLB A;  1LQ9 A;  4FXW A;  3QGI A;  3TJ8 A;  4PPD A;  3CCQ S;  5SUH A;  3NBP B;  3OVB A;  1MMD A;  1NDP A;  2XWX A;  3VAK A;  3RRG A;  1VIS A;  1LXN A;  1PO6 A;  2W7A A;  4X4T A;  2VG7 B;  3QRQ A;  3IFE A;  4YR0 A;  5KFM A;  1XMB A;  1HQE A;  3QO9 A;  3QWP A;  1L3S A;  3C8Y A;  1SL0 A;  3CWJ A;  2IVM A;  1T7P A;  2OPQ A;  2QO3 A;  3W7B A;  5FLX Y;  5L39 A;  3TUP A;  5F3Z A;  1NH8 A;  1PYS B;  3DRS A;  1SJF A;  4GVL A;  2UV8 A;  1TV6 A;  3PFE A;  3ISN D;  4LR9 A;  2GC8 A;  3RBD A;  3N5F A;  5B0E A;  3Q89 A;  5HQL A;  1U09 A;  2VG5 A;  1F0X A;  5MAO A;  3EWG A;  2X1F A;  2R7R A;  4X2B A;  4CH7 A;  5F9N A;  2Y8Y A;  4ZJL A;  3EYZ A;  1QSS A;  3BPD A;  1IJE B;  1ZAX A;  2RD5 C;  3E51 A;  4FN5 A;  3EXC X;  1R0A A;  4CT9 A;  1Q5V A;  2HVD A;  3LP0 B;  1WC5 A;  1NO8 A;  1Q8B A;  4KH1 B;  1S1V B;  1X0P A;  1JLB A;  5HVF A;  2E7X A;  3N6M A;  3CME S;  1U8W A;  1DUR A;  1UFK A;  5ADZ A;  5EGY A;  4KO0 B;  5LMU J;  1PCA A;  4A8Q A;  2XTJ P;  3UCZ P;  2HZV A;  5HMY A;  3MM8 B;  2ADC A;  1OSC A;  1SJQ A;  4PWU A;  3MUR P;  4K4W A;  1Q81 T;  2DNZ A;  2VPZ B;  3CED A;  4I6Y A;  1ZET A;  3IWL A;  4ZPB A;  3X3U A;  4DV2 J;  4JV2 A;  1S77 D;  2ZE2 A;  1SJ4 P;  3HM9 A;  5GMD A;  1X8D A;  4DHV A;  2V5H G;  3KLF B;  5EN1 A;  1QAI A;  1RBA A;  9RUB A;  2BUN A;  4R8U A;  2V34 A;  4CLK A;  1AZS A;  1CJU B;  2EFO A;  4NLO A;  4HL9 A;  3GV8 B;  3PAC A;  5B0B A;  2JFD A;  1FRJ A;  3CO9 A;  2AYG A;  5C2G A;  4LIW A;  1BC6 A;  1JLQ B;  1HPZ A;  1MML A;  3KJV A;  2UXB F;  2L08 A;  2DH9 A;  4MKV A;  1TEL A;  4RJV A;  2VUG A;  4BLG A;  2DNN A;  2BAB A;  3K8V A;  3GU0 A;  1O0P A;  1NB2 A;  4C11 B;  1VQN S;  1AT1 B;  1QSL A;  2K1R B;  1KDN A;  3M6X A;  4C11 A;  2LQJ A;  1YHQ S;  2QEX S;  1RAG B;  2ZD1 B;  3KK1 A;  5K14 B;  4JI1 J;  2JFK A;  1BQM A;  4L73 A;  1VRT A;  4Y6I A;  5BR8 F;  3C46 A;  3G9C A;  3MI7 X;  1BWE A;  4DZ6 A;  1AZS B;  1CJU A;  1SV5 A;  1YZ7 A;  2CKW A;  1X5O A;  2XG8 A;  3MGJ A;  3QGP A;  1N5S A;  4I6W A;  4QQB A;  3T3F A;  2C3U A;  3JXO A;  3TJ9 A;  1JXL A;  1X4G A;  3VV2 B;  2VQE F;  2FLL A;  1B0T A;  2XCP A;  2CPF A;  4KAI A;  1SXL A;  3S7R A;  1XR7 A;  4ED0 A;  1LWX A;  5D78 A;  3Q8P B;  4FBU A;  2HVH A;  1RT6 A;  1TUW A;  1OYD A;  1QUV A;  2RU9 A;  3RBZ A;  2C2E A;  2W25 A;  3MED A;  4ZPT R;  1S12 A;  3MMC A;  2SXL A;  4KGM A;  2O3D A;  1FF2 A;  3K57 A;  3J7Z 5;  2F4F A;  3PW7 A;  2KO1 A;  3HHD A;  1I6J A;  3MUT P;  3JSM B;  2AYB A;  2DVI A;  1NPP A;  2HVI A;  4P2S A;  3QMQ A;  4BBY A;  4CLY A;  4X4O A;  4P72 A;  1HNV A;  4RW8 B;  2RUS A;  1YBT A;  1CJK B;  2RIJ A;  3N5B A;  2DBB A;  4F7V A;  4NCG A;  3IWN C;  5C42 B;  3CTR A;  3VAF A;  3Q8R B;  1G4C A;  3TZW A;  2Z0G A;  3DRS B;  3GP9 A;  1JLA B;  4OLO A;  1OQ6 A;  3ZZT A;  4RW7 A;  5HAO A;  4M5D B;  5D4L A;  3PKY A;  1LXJ A;  1R6V A;  4XPC A;  4K5S A;  2HFU A;  1UFL A;  2VOD A;  2C2Z B;  3FDS A;  4Z37 A;  2YH1 A;  4GC7 A;  1TKX A;  2XMW A;  3AQP A;  3AOC A;  2QTW A;  2WON A;  1RTI A;  4RWX A;  4ED2 A;  2FQQ B;  2QL9 B;  1B0P A;  5MLC V;  1E6V B;  4RNN A;  4WFA Q;  5T7L A;  4YOE A;  2GIR A;  6AT1 B;  2CJ9 A;  1S4F A;  2WVB A;  5E3Q A;  5IT4 A;  3JTO A;  4DSE A;  1RTH A;  3J7Z T;  4X62 F;  4DR2 F;  1EKR A;  1NND A;  2OHD A;  2XMT A;  4OX8 A;  5DG8 A;  1BD6 A;  1R8H A;  2HKE A;  3HZE A;  5BXI A;  1QE1 A;  2W9C B;  5D8H B;  2G2Y A;  2L9W A;  5CHC B;  2R8G A;  3QJL A;  2K2P A;  1CQN A;  3CJ4 A;  2ZVS A;  5LM7 E;  1MMN A;  2YWG A;  1KBR A;  4I6A A;  3UDC A;  1FJG J;  1ZOT A;  2JLG A;  3I31 A;  3IG1 A;  2VBX A;  3BBC A;  2VD3 A;  4PQA A;  5U47 A;  1IKW B;  3UCU P;  4AL6 A;  1ROF A;  3OD2 A;  2XY7 A;  2JH3 A;  3AJ2 A;  4PXD A;  2G0I A;  1C4C A;  1DAR A;  5T7L B;  3GV7 B;  3V4M A;  1SKR A;  3Q23 A;  1YLX A;  4NLV A;  4WP9 A;  1N4L A;  1FRL A;  1T9U A;  4EFA C;  5GAG U;  5L38 A;  4QW8 A;  4IRD A;  2E5J A;  1K47 A;  1S6P A;  3IAM 9;  3HJF A;  4B3O B;  3HD1 A;  1FJ7 A;  2FJB B;  2BDP A;  3ZO7 A;  4DFP A;  1BMQ B;  5M2R A;  4AD6 A;  3CCS S;  2LU2 A;  1BGX T;  4DPY A;  3L7O A;  1HBN B;  2UUT A;  2PDA A;  2EWH A;  5C25 B;  2GJ2 A;  2XSJ A;  3HVT B;  3GIJ A;  4DQR A;  3PRD A;  5KFT A;  4LF9 J;  3LP1 A;  1VQY A;  2VH7 A;  1S4E A;  2CJY B;  2BOA A;  3T1H J;  1BXN A;  4CLS A;  3PX6 A;  2CQP A;  4CRJ A;  2KYZ A;  5A8K A;  1UPP A;  2DGU A;  5GVQ A;  2QL7 B;  3W2V B;  2ASJ A;  1DZ5 A;  2DHX A;  1H98 A;  1WOP A;  2ACY A;  1SC6 A; 
#chains in the Genus database with same CATH homology
 2LP4 A;  1FFS B;  1FFG B;  1FWP A;  1EAY C;  1A0O B;  1FFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...