1A0OB

Chey-binding domain of chea in complex with chey
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEY
publication title Structure of the CheY-binding domain of histidine kinase CheA in complex with CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
total genus 17
structure length 70
sequence length 70
chains with identical sequence D, F, H
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1a0oB00
1FFWB 1FWPA 1EAYC 1FFGB 1A0OB 2LP4A 1FFSB
chains in the Genus database with same CATH superfamily
2CJQA 4LF4F 3SEOA 3AA8A 1X8DA 1QJHA 3GQCA 3M9NB 4AD6A 3NAIA 5IZHA 2RRNA 2CNLB 5A76A 4N76A 2W8LA 4C8LA 1BWVA 1G1XA 3CCTA 2MZTA 3TW0A 5MLCV 3G82A 3KYLA 3M8RA 4M8LA 2ZC4A 3CDEA 2BRLA 1X4AA 4KGZB 5H9FJ 1Q4RA 2QG9B 3HSZA 2CDRB 3QZ8A 4ED5A 3Q0AA 3C66A 5LOQA 4FBUA 4RUHA 2VFRA 3GONA 4PG5A 3OTOJ 5KFYA 3B6BA 3LWMA 4JI4F 1HQ2A 3C6TB 4B9LA 3UDEA 3Q8PB 3AFGA 3VCDA 4WFYA 1EP4B 3UQSA 2Y0BB 3PRBA 1HNIA 3LH2S 4I64A 1N33J 3VAFA 5IT9U 3RAXA 4ZVHA 5GVQA 4LR8A 2HEKA 3AODA 1NRKA 3FSYA 4OHXA 2VF3A 5I4MA 1YX2A 3DLKB 3GSDA 3QGHA 1JKHA 2DBBA 2QN6B 1N36F 3D1QA 4CO4A 2BKNA 2HMIA 1CJVA 2V2VA 4USVA 1YJTA 3EGWB 1DTTA 3OD2A 3MCSA 1XNQF 2GHPA 1VQNS 2D7SA 4DQIA 2OJ3A 4MK9A 2JOQA 5CCMA 1S97A 2HHQA 2XNRA 3G6VA 2N4CA 4JI3F 5J1EB 5AXMA 3MF5A 1VISA 4LQ9A 3T1YJ 4Q43A 2GAGC 2W2OP 3ZFVA 3DGPB 2RS8A 1K44A 4C8KA 1FXDA 2ASJA 3B78A 2VG7B 4GKJJ 1UVJA 4DI6A 4IFYB 3R1LA 2ZHAA 2ZHOA 3MUVP 3EGZA 2BABA 5JUMA 4J9NA 2CFXA 2D41A 4RW8A 4UZBA 4ICLB 3HZGA 1ZZFA 4HYKA 3D2WA 1NLKL 3CJ2A 2H65B 2PFDA 1JLFA 1NSKL 4F0MA 3HO1A 2YNHB 3D54A 2X1BA 3M9OB 2DHSA 2V94A 3BSNA 1QD1A 4JYAJ 1R0CB 4IH6A 1WC0A 4LSLA 1S1TA 2K7KA 2COLA 1R89A 2H5IB 3HSGA 1ULRA 2CQ2A 1K0TA 5D3GA 1CVJA 3ZZTA 3VF0B 4FYYB 3RU0A 1XMOF 2DHGA 1DBDA 4K5RA 3M7VA 5T14A 1WKKA 1SXLA 3DOMA 2VU5A 2NR0A 5EWFA 1SJ3P 2OIHA 2GIQA 2C28A 1KQKA 4CLUA 1XR5A 4AT1B 4MFBA 1TQLA 3PIOQ 2R2UA 3MMCB 2EC0A 4TY8A 1JLGB 5D4LA 4WPAA 3CPWR 1HBNA 3RYLA 3AB2B 2M8DB 3QFWA 1KFDA 1S77D 4KIAA 1NHVA 3MM6A 4KJIA 3FEXB 2L3MA 4P6QA 1S79A 1IJEB 2GV1A 2HRTA 3IBWA 3RB4A 3PX6A 1SJ1A 2GVDA 2C2KB 4L76A 1PYOB 1H72C 1GX5A 2B3TB 2MJUA 3H59A 4IDKA 1DHMA 3N0VA 3ENAA 2Q79A 5C25A 3NWGA 1QE1A 4PYAA 3I4HX 1KHVA 5AE1A 2DGVA 4NCGB 1HNWJ 2FJVA 2KM8C 2AIRB 2KT5A 3M8QB 4OI3A 5KFHA 2DNGA 2MKJA 2BEFA 4YY3J 3KKFA 3ZTQA 2IA0A 2WVDA 4ZJLA 5KFTA 3V6KA 1LOUA 1MNEA 4OJHA 2B9YA 2I6WA 4PAAA 3RB6A 2OPPA 2HVIA 3IM8A 3EVOA 1RAGB 3GILA 2YKQA 5C7PA 4U7CA 2GQCA 4TKTA 2HRUA 5J2MA 3PX0A 1KNZA 5D78A 7FD1A 5CXTA 4FXDA 3RR8A 2XB2D 2AQ4A 3A8JA 4G65A 3G8TA 4R8UA 4LT6A 3C16A 3CO9A 1APSA 2DR5A 3M8YA 1EQMA 3LP1B 4X65J 3AT1B 4QJVA 3KLHA 1IJFB 4P10A 2HHPA 4K7QA 2KT2A 1Q0NA 2QRRA 1KC8T 1E6YA 3D66A 4OFZA 4DU8A 1UFKA 4Q44A 1XC9A 2FHJD 4I6WA 3PYGA 3GIJA 3QZ7A 1M1HA 2VQEJ 5ETVA 4MMOA 4EWTA 5E3RA 2AZ3A 3I56S 1SQFA 2ZNZA 4ZVGA 3UDLA 1YKWA 1NKCA 3LP0A 1AA1B 3N6LA 3QIPA 3DU5A 3NGKA 1URNA 2RSQA 2KU7A 1GTHA 2BQUA 4DX5A 2FHKA 2HNYA 2FGOA 2ZITA 2MZ1A 4XIUA 4NMLA 3BYPA 3MM7A 4B3SJ 4Q5VA 4KV8A 3TANA 4EUVA 4OZJA 1NMEB 2I9SA 2B0GA 2EFGA 4Y2KA 3MHYA 4NLXA 3LP2B 1HBUA 5CYMB 4P9SA 4LRBA 2XGPA 4B9UA 3VALA 3SXLA 4O44B 2CQBA 3OSNA 2XI3A 2QLBB 2QLFB 1N54B 3BYRA 2MLYA 4DV6J 3K89A 2OD6A 2X51A 4ANCA 4F25A 3R1HA 2V69A 3MCNA 4Z7YA 1FO1A 1Q95G 4YUDA 1Q8BA 4RNFA 3OUYB 4O3QA 3ZZ0A 4ZIWA 3ITHB 4QWAA 2BUNA 1O5JA 1RWPB 4CP5A 5K5MA 1PG5B 1OY8A 4MKYA 1NKBA 1X4HA 5JVGQ 2XSJA 2E5LF 1VLOA 3ELHA 4YP3A 1LW2B 2KXFA 3RW6A 4CLWA 4YB1P 5GAHU 1D9DA 1IBLF 1SUQB 2UV8A 1U25A 1C1CB 2H4YB 4NLWA 1NKEA 1CC7A 2I0XA 3TAMA 4FKYA 4O3PA 4PR6A 3IO1A 2V5HG 4NRTA 1YWXA 4OYIA 1S6QA 3GYNA 3DRSA 4KGMA 2KJWA 1Q8KA 2B6AB 2ACYA 4I4BA 1C0TA 4QIGA 2WW8A 1HNVB 2EFNA 2AWZA 1LK5A 4ES3A 5THWA 3QIDA 3MEEB 4DF4A 1HI1A 4HHUA 1S4FA 2JVOA 2WBRA 4TU7A 2V4RA 2N82B 2NPFA 3QSIA 1S1WA 2X1AA 2XCPA 2HGNA 2KO1A 5L9NA 1MSWD 2FJWA 2HURA 4DFMA 3Q8SB 1R27B 2MY8A 4X4OA 4DN9A 2C2DA 3H2LA 2G0IA 2OP5A 3AHPA 3OTOF 3LF0A 2M5YA 4NE9C 2RQCA 5AXLA 5CA5A 3QJJA 3C3LA 2QLXA 2WW4A 1VOMA 4USHA 4IG0B 2H5JB 2DGOA 1N33F 1Q86T 1HD0A 1GXUA 1LXNA 1Y11A 4QWEA 2BJ8A 3N79A 2HVHA 3W5ZA 1Q16B 1P1TA 4K2JA 1U1LA 2HAFA 3QGIA 2JLEA 2OMOA 3FVYA 3OR2B 4W90B 1FRMA 3PYEA 5BYQA 3DOKB 1R8PA 2OAUA 2IM0A 3I0RA 3I32A 2CIMA 2R7TA 2AX0A 3EPGA 1U2RA 3CMQA 5DM6Q 1JLQA 3BO4A 1RT6A 3A4TA 4G3IA 1YRUA 4DOZA 1IR1A 4DR7J 3V6HA 2WOMB 3V5RA 1TKZA 3T41A 2DISA 2WB1D 2ZBQA 1DY3A 3US5A 5A0YB 4DV0J 1ZBTA 3VAMA 3NGTA 5ETPA 5ETQA 4KRWA 3J7A1 2D3O1 2NCKL 3D4JA 1FFWB 5RUBA 1FKOB 5C24B 2AKWB 1FRKA 1PJ7A 3IR5B 4X4UA 5I42A 2EK6A 2WSEC 1RB0A 1NJXA 4Q0BB 5ADZA 2ZH8A 2EKYA 2FUG9 2K2PA 1WSRA 4FYXB 4RW4B 3FSIA 4ZVSB 3QYYA 4F4KA 1RYRA 4J9SA 2ZUGA 4P72A 2K3KA 3EJMA 1FVSA 1HMVB 4JYAF 1PYSB 1JNZB 1LKZA 3JB9k 3KMSA 2Z30B 3W3SA 1REGX 1HD1A 3J7AN 4RUCA 4DXLA 2C42A 4ZPAA 2BJEA 4NI2A 2FTRA 1KHWA 2UU9J 1HBMB 1AFJA 2C3UA 4C8NA 3EUNA 5FJ4A 4OZ5A 2R2SA 3OV7A 3T6JA 1UZDA 1Y7PA 3RBXA 1CJUA 1SH3A 1YTYA 5AJ3J 5JVHQ 3RBEA 2CPFA 2XMUA 3BQ1A 4ECYA 2LEPA 3MM8B 1M5HA 3L7OA 4I7FB 5ETNA 1S72S 2DGTA 3BH6B 1WNEA 1SC6A 4X4PA 3UD5A 2MTLA 3QAEA 2ROEA 3E01B 1CJKA 2V8VA 2RIJA 2R7SA 2HFUA 5C42B 1TKXA 5KG3A 1UVMA 1ZETA 2DHHA 2HRYA 3P8BB 1S1VA 3EGNA 2YNGB 2Y9HA 1SQEA 1B64A 3PDNA 4ZIVA 5E3PA 3W2WB 1U1KA 3RG6A 3KLIA 2PA8D 2XYGB 3LGMA 1NH8A 1BQMB 2VPYB 2E9RX 1WORA 1U1MA 4JI0J 3SDEB 2CRLA 3HT0A 3IC1A 2FZKB 4USKA 1P8GA 2F63A 1TFWA 4DL4A 4YY3F 3NWRA 2P6TA 2PMHA 2XG8A 1IR0A 3QT8A 3M2RB 5KFQA 2CNKB 4ECWA 3IXQA 1CJTA 3HCXA 1PYTA 1VBKA 1UCNA 5KFEA 1NNDA 2Z2LA 4QOTA 1MN7A 4WYWA 2FD2A 3BF4A 2WHOA 2VC0A 5CYQB 2ZEJA 4J9QA 2KHDA 4AXJA 1FKPA 3GJRB 1R7IA 1K0VA 2MMYA 3J81j 2H4WB 1U7LA 2Y1LB 5FIIA 4B3OB 2KYZA 2YWFA 2MZSA 1VK3A 2HQIA 1DAXA 3PX4A 1CG2A 3BEGB 2CYYA 4X65F 4HI1A 4YS2A 1RLDA 3OTBA 1SI9A 3AOBA 2Z56B 2B4PA 1H7XA 1EHWA 4N7TA 1QTMA 1S49A 1EJ7L 2B8PA 1RAEB 4LF5F 2DT9A 5CHCB 3C6TA 1OQ6A 5GMKa 2VQEF 1EP4A 1JJ4A 1R31A 5F8JA 4V1Ak 3DLEB 4YDXA 5CABA 2N4DA 2PE8A 2YQ1A 4RUAA 2XY5A 3F44A 1IWAA 2FHJA 5J2PB 3DLKA 5A8RB 2H51B 1AB8A 3MPVA 2D9PA 4CTAB 1W7WA 2JZ5A 5K8MA 4UQGA 1WOPA 2XYPB 4DSFA 5HROB 4CO0A 2QL7B 4B3SF 2XCAA 2PDAA 1TMJA 5KT7A 4C6AA 4EO6A 5J1EA 1B0VA 1SJ4P 4ZHRA 4OJ3A 1B7YB 2DTJA 1QAYA 4WP9A 2VC1A 4I56A 4DZDA 2IVFB 1R6YA 3CEDA 4BHQA 1EB0A 2VG7A 3M30B 3K17A 2RAQA 2AP6A 1X9SA 4DV6F 1V3RA 1L3UA 4IFYA 4KPCA 4YDDB 4PQUB 4URQU 3IS9B 1VGYA 3N5FA 4CLTA 2D3OR 4W98A 4USMA 2PI4A 4NWBA 4NXNJ 2LVWA 2FLOA 2ILYA 3G4SS 3HPOA 4CZCA 4ED7A 4U96A 5LM7E 1JNRB 2BW7A 1S7IA 4DV1J 1H2VZ 2YNHA 1T94A 2YNIB 4BWMA 3BR9A 3NS5A 3GFHA 3W63A 2PI5A 1YLXA 4R25A 1S9EA 2Z2ZA 3KLEA 2MKYA 4Z7CA 4NCAA 1VQLS 4OHVA 4CYUB 3DRPB 3AXMA 1S1UB 3B4DA 1S76D 2VPXB 1W25A 4ZVPB 2FY1A 2IDLA 3BH7B 4WKRA 2IBOA 3TNVA 4H4KA 5IFMA 2E7XA 2JDJA 2NXUA 3MMCA 1GEHA 1JLGA 5KFSA 2V9WA 3SCIE 3HF5A 2W01A 4DR1F 4F4AA 3CCJS 3LPYA 1ZAXA 4IKAA 2AF6A 2XS7A 2ASYA 2LMIA 3MOZA 2CJBA 2UUTA 2BJ7A 3JAMU 4OX6A 3OL9A 2HVEA 1NPKA 2EXUA 3NGUA 3Q8VA 4QZVB 1UA0A 4MJKA 1FJ7A 4ELUA 1FEEA 3BGLA 3MEGA 3CD5A 5DZ7A 2BANB 3MWBA 4AE5A 3MUTP 3BQ2A 2K1RA 1RK8A 1PSDA 4HKQA 2IPOB 3SYZA 6FD1A 1VHIA 1HFEL 4NCGA 4WWSA 3CGIA 1AUSL 4I2PB 2I38A 3M8QA 2ZD1A 3SQOP 3KNAA 1JQGA 1ZA2B 2MHEA 2W1BA 2RHQB 1W2BR 1RADB 3CDBA 3W9JA 3CIZA 4KC5A 3BGOP 4YOEA 1S7HA 3TUPA 3QMQA 1FVQA 3IR6B 2HBQB 3TEHB 4ZCKA 1J5EJ 4X62F 2GX8A 3LGHA 4Q2LA 2V8GA 3OSPA 4LF6J 1PBAA 2CG8A 2F40A 3DC2A 4PABA 2C2OB 2XLIA 4K4SA 3LP1A 3LA0A 1YIJS 1S6OA 3J80U 4MYTA 2KN4A 1FX4A 2POKA 4DR7F 3MCMA 4QYZK 3WC2A 3OXLA 1H6KX 5AE3A 4IQMA 4P71A 4CLSA 3JQMA 2KG0A 2YH1A 3J81Y 2DHXA 1U26A 3M8PA 2B9EA 4X4SA 2KVIA 5J2NB 4HTIA 4J9KA 4ZPDA 3RAMA 2LXFA 4ZCMA 2OKQA 3A12A 3VAHA 3PJ9A 4J91A 3R97A 1LNQA 4KSEB 3B54A 4FXWA 3M32B 4TQRA 4FF3A 3M2VB 4DV7F 1NB2A 1UA1A 1N6QB 4DV3F 4I2QB 3FSXA 4J9PA 2V2QA 4FXVA 1EAYC 2AGQA 4RO0A 1H0HB 1KWMA 1RWKB 5BJRA 1NJYA 3FBBA 2R4FA 3T9NA 3EE3A 2E9TA 1I1GA 1YQHA 2UU9F 2LXIA 4DSIA 3G8QA 3M05A 5D77A 3LP2A 1N0UA 1RTHA 2F7VA 2AJ0A 1M5OC 3CT9A 4U67Q 1WHYA 5F8IA 1HPZB 4O44A 4TYBA 4WFNQ 3TQEA 4DR6J 4KHPF 5AJ3F 4YR0A 2V4JB 4LSNB 4L74A 1WHWA 2V8DA 3K8WA 2OEKA 4RPFA 5D0GA 3BKFA 4PUOB 1KOOA 3SFGA 4OI6A 2FIUA 2DR6A 1UWBB 4J7CA 2MGZB 4TYAA 1X4CA 2ERRA 1I51B 3KHLA 5ETOA 3CE8A 1LW2A 3DM2A 2FYXA 2ALZA 3SSSA 4F4ZA 1FE0A 1SUQA 3DMJB 4FS1A 1R0AB 1C1CA 5CZXA 5LSRA 2WBMA 3PHTA 5GAHI 3TEGA 3HZEA 2W9BB 1EKSA 2E7VA 1MWQA 4EBDA 4EYHB 2FZCB 1IKYB 4OL8A 4LFBF 1YGYA 5L46A 4OI1A 4JI0F 1WF0A 2DD8S 1GAOA 3T19A 2RDIA 4XK8C 3HDSA 1X4DA 2B6AA 5CCLA 4C11B 4QU6A 2R8IA 3QJLA 2DH9A 4BC9A 3OT9A 2XO6A 1B0PA 4IRDA 4ID8A 1X0PA 2ROPA 5E33A 1JLAB 3MEEA 5B0EA 2JJ4D 1V6HA 3G9CA 3VVTA 3G2XA 3MAQA 1S4EA 4NLVA 2VIHA 2ZOFA 1ZH5A 5DGAA 2BMBA 5LXYA 4A8KA 3E51A 3O8WA 4CM2A 1RAJA 3DXBA 5B0DA 2XSFA 5CYJA 4O4GA 4PG6A 4IUFA 3TUZC 1U45A 1S9GB 3SV4A 4WXWA 3SI8A 1S12A 2L08A 2HFVA 5HMYA 4C8ZA 1SBRA 3W1YC 1S6PB 3A3OB 2ZH4A 4UW2A 1JK9B 4OZ3A 1JXVA 3MEDB 4A8SA 3QT7A 1X60A 4WZMA 2QA4S 4XPCA 1DRZA 3PG9A 4TNOA 4IG0A 2VOPA 1MROB 1JLBB 1IUJA 5DDPC 1TVRA 4OYAA 3HXMA 2NREA 3T6BA 2H3EB 1HW9A 1SC4B 4YB7A 2HS3A 2GQ2A 4QYRA 5KFXA 3Q86A 4EGLA 5KT5A 1T3OA 3W7BA 3N6MA 1GX6A 2MKKA 1AZSB 4LF2A 2CQ0A 3DOKA 3UNGC 5F8NA 2KG1A 2B4VA 1TV6B 3NCPA 4DSEA 5IT9Y 2PIIA 2LFVA 3KHRA 2BYCA 3I6PA 3CW2C 1RT7B 1V5VA 2WONB 3AJDA 4IR9A 2H54B 2J9CA 4FBTA 1OQ3A 1ACMB 2JNJA 2VONA 4ECQA 5DGBA 2VB6A 1V9OA 2E5JA 2JEFA 3RW7A 3PYFA 5ITHA 1A9NB 1UFWA 3BO2A 4UQTA 3OPKA 4GKKJ 4TU8A 2DVIA 3HLUA 3DRRA 1M0SA 1UJ6A 1QTNB 4CCHA 4TXSA 2OEMA 2RJZA 1ROFA 4DL3A 3UI3A 1FKOA 1NK8A 3DN9A 3HT3A 3UN3A 3HK2A 4YQWA 2IAJA 3R5CA 1MMDA 4Q0BA 3LTOA 4NXNF 2RS2A 1M1KT 1KVJA 1Y0HA 2VFVA 3MZIA 2PMZD 1VCTA 4DV1F 3M6VA 4C0HA 2QLJB 3EMTA 2VKZG 1HMVA 2ZC3A 1U47A 2RKIB 2U2FA 2IC3B 2XWYA 1G3OA 1X5PA 4WJBA 1IKVB 4MYUA 3K5NA 1HBMA 2ZFHA 2R7VA 3HULA 4KPYA 2DR8A 4BDPA 4OZ0A 4NLPA 3AD9C 1YI2S 2IIHA 2Z4PA 1T9TA 1SJQA 3O44A 4ER8A 1KR4A 4ZN1A 2UP1A 4CLFA 3J7YU 3MM8A 4GC6A 4I7FA 2LCWA 3OXFA 5E7OB 4ZPWR 3K0JA 1NPPA 2OGUA 2PT0A 1S9FA 4RNNA 2RVJA 3PR4A 3E01A 2MKHA 3LANA 3HKZD 5IM0B 3DLGA 5C42A 2FLPA 2AX1A 4MIAA 3GIMA 2YNGA 4FNHA 2PA3A 3V81B 3M1VB 4K4TA 2M8HA 3W2WA 3OJSA 3O6QA 4M94A 4NCBA 1TAUA 3HVTB 2BQ3A 3RJMB 5CH7B 2MPUA 4NX9A 4B02A 1HNZJ 2HG4A 2KZZA 3SDEA 2IMWP 2AZ1A 3PO5A 2KRRA 3IWXA 2DGUA 2YNFB 3QRRA 1PAEX 1FXRA 1S6UA 1LWEB 5B0CA 2HHUA 2YPZA 2W25A 5HQMA 2FJAB 2YQ0A 1S0MA 2G1HA 1VQ8S 2ZH5A 5CYQA 3C14B 3R7SB 1WC6A 4CQ1A 2GMLA 4FZVA 1J5EF 2A3JA 4FDFA 2ZH1A 2JC1A 3PY8A 2KHCA 4QCLA 4B3RJ 4U8VA 1F1BB 3D5MA 3UFCX 4B3OA 2VBYA 2DKOB 3IMQJ 3NCRA 4LF6F 1NK4A 3N28A 4WTYA 4OZ2A 2OSQA 1EARA 1LWXA 3KG1A 2FC9A 4ES1A 3Q8YA 4LBPA 1TL3A 3BGRB 3HSJA 1R8CA 4B08A 4L72B 4ECXA 1T9WA 4MK8A 3GIKA 3F41A 4WTOB 4K4XA 1LXJA 4WIQA 4KGXB 3GE9A 3MGJA 4LIRA 3K7RA 2PC6A 2VDIA 2LEAA 2WVFA 2DNQA 3O3LA 2BXJA 2CQIA 1LK7A 4OX8A 3EX7B 2VFTA 1BQNB 3ETMA 2HK3A 2BACA 3KK3B 5J2PA 3PRVA 4XTTA 5A8RA 4CTAA 4EZ6A 4USUA 3UVJB 3QATA 4F2SA 1RU2A 2GJFA 3EZOA 3L09A 5HROA 4ZVQB 4WYLA 3KLFA 2NXJA 1EX8A 1PJ6A 3QSYB 3T5LA 1NH7A 3Q2TC 3HHLB 4OYOA 2MSSA 1REVB 2ATCB 1KRPA 4ZLPA 2BV3A 4I1TA 1DFDA 3QQCD 3HHEA 4DPYA 3CO0P 4RBVA 1VI7A 4X2BA 2C3YA 3KJFB 1NCLA 4DR6F 4FP9A 1FFSB 3M30A 3CCWA 1Q7YT 5T41A 2GNKA 4OQJA 1NJWA 2XY7A 4PQUA 3H90A 1IKWB 3FBCA 3D0IE 1IKXB 1F9FA 1KP6A 4IFVB 1HLWA 4GVLA 5HBMB 5KFIA 2R3VA 2YWKA 1VQSA 1UMJA 2J6TA 1NJIT 3BN7A 4NA3A 1G6BA 1I3OB 1K73T 3A13A 3KDOA 4E0DA 4CLKA 4IO1A 2CA9A 2JH3A 4F3QA 2XO7A 4FYVB 1OMSA 4I0WA 4CM0A 1ZPVA 1P9YA 1CS4B 3PFEA 1NDKA 3CVKA 3DRPA 4KGKA 2KT3A 5HVFA 1S1UA 3S7RA 3OHBA 4LF9J 1Z4UA 4XO0A 2YKNA 4P73A 3GJTB 3AH6A 1RCXB 3QJPA 2MDAA 4W92B 5M2UA 4AQYJ 4K0KJ 1RT3B 4A47A 1O51A 1RAHB 5KTQA 4I6AA 4F2RA 1E6VB 2HW3A 3TA0A 4KGVB 3ZTSA 1N56A 2Q66A 4WFZA 5G0RB 5HMZA 3PKYA 3KUHA 1WKJA 1TL1B 3BQ0A 1F3VA 3L3CA 1VQ6S 1HHTP 5HJYA 2RT3A 8AT1B 1N32J 2OTLS 2KFZA 4C4WA 3OFFA 2YVSA 4MT1A 3SCJE 2FVQA 4UZCA 1HQEB 1OSCA 4WK3A 3RRHA 2E1MC 5BYRA 4O3OA 4C98A 3PV8A 3H42A 1QSSA 5F3ZA 4WU2A 2WVEA 4C48A 1JXEA 1JJ2R 2OTJS 3UCGA 2CQ1A 2CZVC 3MPUB 3N9UC 2OHDA 5EWGA 2P9EA 2I5JB 4QU7A 1TUVA 1BUXA 2F8EX 3CF5Q 1T03A 1ZA1B 1RSCA 5AE2A 3VAIA 4OI2A 1RI7A 2C1EB 3DFEA 5GAGI 4URSA 3WDOA 2VBXA 3D9BA 3M2UA 4DZ6A 3ILOA 3L7PA 3QRQA 4DEZA 3PACA 3IN5A 2LKZA 3PEHA 4LFCJ 4Y3CA 4PPDA 4M5LA 2L9DA 5JMNA 1FTCA 1O8BA 4GKKF 1YBUA 3ENQA 4J9RA 3QNWB 3G87A 3R6LB 4HI2A 5J2NA 1RAAB 3KLVA 3RZAA 1VQYA 1HKAA 5DJBA 3GYGA 2V68A 2NYHA 1ZZNA 2XMTA 3TUJC 1ELOA 2FB0A 3HHLD 3M32A 1NDCA 2APOA 3M2VA 2MZRA 1FESA 2V67A 5DQIA 2Q6CA 2HZVA 2KTQA 3M6UA 2OPQB 5KG5A 1N6QA 1T3NA 2D69A 4UTGA 1M5SA 2E29A 1PGZA 2MEWA 4CO1A 5B0BA 3AB4B 4WE1A 2BE2B 4CT9A 1WG5A 2DNLA 2H9ZA 1KQSR 4UOHA 1RU1A 3PEJA 4TQSA 2LQ8A 1MU2A 4HACA 4UOGA 2ZH6A 3JXOA 4QPXA 4DR2J 5HMWA 2QIFA 1MG7A 1QLNA 1RT5A 4IO9Q 3P4UB 4OI0A 3OFHA 3K5LA 2K06A 3UCUP 2UZAA 2LQJA 2CKWA 3KXDA 1HPZA 1NBEB 1OIAA 1A0OB 2AEFA 1NJZA 2X1GA 4LSNA 4ZP9A 3CNQP 1SJFA 2DNHA 3PW5A 3U1NA 2J9EA 4DL0C 2L48A 4PUOA 1UWBA 3UN5A 3K5MA 3CIMA 4DL6A 3WX8A 3BSAA 4NA2A 2OEJA 3A8KA 4FYDA 2E5HA 3IG1B 1RZMA 1SC3B 3DHWC 3D6HB 4OIXA 4YB6A 1TL7B 1G2EA 1F3FA 1SL0A 3DMJA 3GU0A 5ETKA 1R0AA 3TVZA 3OVAA 4QR0A 3KK2B 5GAEI 2J8SA 2QMXA 2AT1B 3TI0A 1F5CA 2W9BA 3BZQA 2PEHA 1YZ7A 4P7TA 2ZJPQ 1IKYA 1HNZF 4H4OB 2EW9A 2ZM6J 1VBZA 4KKOB 4Y2MA 5E5NA 4F26A 2R8KA 4KB7A 2M88A 4RWXA 3MR2A 3ILIA 4HVZA 1GQEA 4JUZA 3HSDA 3GR1A 3JYTA 3D28A 4D3HA 2BKPA 4NLDA 3H5SA 4ZVTB 3UE2A 4O3RA 1Q7LB 2F9DA 1JLAA 3G8SA 3EVWA 5KOXA 2DGXA 1K1SA 2QL5B 5B09A 1BMQB 2B43A 1FK9B 1RWUA 1WF1A 4JV2A 3D1HA 2MZJA 4JI5J 5KFCA 1IM6A 3Q83A 1GNKA 3FCVA 1KLNA 3QLHB 3I0SB 1ZTTA 2C2RA 2NUUG 1XK8A 4H4MB 5KT4A 4PXDA 3OW2R 4QYZJ 3PW2A 2UVUA 3A1YG 2J76E 2DGQA 1CSJA 1KLMB 3P45B 1UVLA 5H1SV 1S1XA 4F36A 1M5PC 2FHMA 2W7AA 4FS2A 2HS4A 2JX2A 4DDFA 4ZCIA 3BBFA 4ZVFA 1OPZA 1S6PA 2AJQA 2W2MP 3HHKA 3I5CA 3MM9A 4R5PB 2OPRB 2BBEA 3MEDA 1G7CB 4S0MA 4ILLA 4K2XA 4RW6B 2F8MA 4OMFG 4V19J 3R7BB 4JI2J 1JLBA 1N5YB 1WC5A 1XBWA 2IVMA 3JQKA 2RRBA 4KO0B 3UR0A 1HYSB 3TX8A 2DNNA 1WG4A 1WG1A 1RBLA 2OI2A 4X4RA 3KUEA 2D3UA 3G86A 3CC2S 3V4IB 4JI8J 2VG6A 3H20A 1TV6A 1RA7A 3MM5A 1ZTWA 3MTJA 7FDRA 2CQPA 4PWDB 1UPMB 4ZOSA 2GJIA 1RT7A 4DPXA 1UETA 2MKCA 2YKOA 2AEMA 2WCXA 3GV8B 1Z2ZA 4JI1J 2JL9A 3OJUA 1RA6A 1DTQB 2R7WA 3BM7A 4QQBA 1VC0A 2C3PA 2HHSA 1I94J 5L1IA 3MURP 5I3UB 3DI6B 4K4UA 2J8AA 5DO2A 1GMUA 1XQIA 4AUKA 4WFXA 4ZLNA 4Y00A 1NM2A 2FC8A 5IC6B 4MKAA 3W8PA 4IOCQ 2R9LA 1U1PA 4EK2A 4ATNA 3QGGA 4HDGA 2J0QD 3BSCA 1OY6A 3C46A 1NXIA 2ZOMA 4OV6A 4A8QA 2OMLA 2XY6A 3PYDA 3ZZYA 5HVGA 3JSMB 3EVMA 5KFNA 2RKIA 4F67A 2DXEA 2IC3A 2J9DE 2NZCA 4IOAQ 4K4VA 4HR2A 1JLCB 1S59A 1IKVA 1RKJA 4LF9F 3OFGA 2ZOGA 4RBTA 1CJVB 5B0GA 4NYZA 2QSWA 3K57A 3MR3A 4EZ9A 1DTTB 1UL3A 4B9VA 2B4UA 4DSLA 5J1PA 3W9HA 3KUGA 2RILA 3QPIA 5HN0A 1RHQB 3L95X 4OI4A 1ZAWA 1LQ9A 2AGOA 3J7YI 4LBHA 5HL7Q 3P5BP 1RKIA 1ZM3A 2HFSA 3W5YA 4B9NA 1FA0A 4WBFA 2WVBA 1S0OA 3D3CJ 1Q79A 1SC1B 1LV5A 2QL9B 3LUYA 1FEHA 3G71S 1VQ7S 1Y3KA 4ZJOA 3UPFA 4ED2A 4K50A 3D3BJ 2LLZA 3V81A 8RUCA 1AFIA 1N32F 5C2CA 1RTDB 2EG1A 5M2RA 4B9SA 4DR4J 3W2VB 3JSBA 3HFVA 3JAMY 2U1AA 3HVTA 4G6VB 1HQUB 1C1BB 5KG1A 3CJKB 4P2SA 4USTA 2QMWA 1EZZB 2V4QA 3RB3A 1QAXA 3E3XA 4ITSA 1N34J 5L8RC 2YNFA 4EI2A 3R5BA 1LWEA 2Q43A 4Q8EA 4GMKA 3CCZA 5CAAA 1YHQS 1HR0J 4NLTA 3DKDA 4OLOA 3OL6A 4LFAJ 5D8HB 1VIOA 3C14A 2CNNB 4ZVRB 4EFAC 4OJ1A 4XDCA 2DR9A 2MQOA 2MSTA 2ZJRQ 3PO4A 1F60B 2DHAA 1S0NA 1ZS6A 3NS6A 3GJQB 4TY8B 3LO3A 2C2ZB 5T7LB 3SSRA 3VGTA 4ZN3A 5DQHA 4NZ6A 2HS0A 4ES2A 4WP8A 1FRLA 2EK1A 2XHCA 4F4YA 4K8RA 1T9YA 3KK1B 4KBIA 4I67A 4NLGA 3BGRA 1BY9A 4R0EA 1V3ZA 3MM6B 4YFUA 4C9DA 1TKDA 1DURA 4LFCF 1VJQA 2FLNA 1YJUA 1YJNS 2DR7A 3FZBA 1GMWD 3R2CJ 1RWWB 3VHQA 1T9UA 4ETXA 4LJMA 3IRWP 2OH2A 4IDKB 4ZP7A 3J80Y 1RHKB 5FLXU 3FEZA 4BLGA 1QE1B 2LA4A 1JIHA 3K59A 2HSEB 2UXBJ 1BQNA 4ZJQA 3KFWX 3NGRA 3KK3A 3JTNA 1UZHA 2ATLA 2FZGB 3CC7S 3UVJA 2ZBIA 4CNYA 3I5AA 3SBMA 1NSAA 3PHEA 3GCWP 4ZA1A 2YBVA 2PMWA 4D3GA 3HKWA 3FJ2A 2J5AA 4DX7A 1RWXB 2OPPB 3HHLA 1GFWB 1T95A 2HHTA 3T3FA 2DCUB 2NLWA 3UN2A 1REVA 4QR1A 4DR2F 4OX9J 4LRAA 3OXGA 2CADA 2YH0A 1NDPA 4J9UE 3CDAA 1BD6A 5HAOA 1SKSA 1UVKA 4MTPA 2W7PA 1Y00A 4YR3A 2AW0A 2VD3A 2DNPA 3CWJA 3U1LA 4QWCA 2B56A 5LMNJ 3NP5A 2E5IA 3KLHB 1TU0B 1VJWA 2NXNA 4PG7A 4Y28C 4JP8A 2CQDA 1IKXA 5E0OA 4IFVA 3EZUA 3TOQA 3GFZA 2F8HA 2CWKA 3ZZRA 3GV5B 3ZNJ1 3W62A 3H5XA 2CPYA 4LF7F 4LRFA 3VGVA 3DGVA 4OZLA 4UOFA 1P1LA 2HYIB 4TLRA 4J9OA 2KKHA 3WHIA 2ZDPA 2RUSA 4Z37A 4DCJB 4G1PA 3IFEA 1CS4A 3LP0B 1N5TA 3H40A 1RYSA 3FUYA 3QIPB 4JB8B 5F8MA 1ICEB 2ASDA 2EI5A 2HWIA 2HNYB 3ZZPA 4C3LA 2IYGA 2ZM6F 4H4KC 4G1QB 3IR7B 3GLJA 4K59A 1F6TA 1D0EA 2XC9A 1RT3A 4CLYA 3EYZA 3QWUA 4M5DA 2EFOA 3CDWA 3BGFA 2QEXS 1URRA 3NAHA 4JI3J 1E6VA 3K5PA 2RQKA 2V9KA 1HBUB 1U8WA 2YKMB 1KTVA 4HT7A 3MDFA 2DNZA 2EFQA 3NXZA 4FPIA 1U4BA 2V8PA 3AOAA 1UPPA 3ZO7A 2YWGA 2MY7A 2JVRA 3GIRA 5KT3A 3QFHA 5B08A 2Z2MA 2HHWA 1D8YA 4TY9A 2JEGA 1H7WA 2F9JA 3TUIC 4DL7A 1C4AA 2DPIA 2WK4A 3S8SA 2JLGA 3CJQA 2GVZB 3IRXB 3MECB 3H2UB 1HQEA 4FN5A 2IMOA 4XDDA 3OL7A 1WHVA 1KFSA 5HANA 4LMZA 4Y6IA 6FDRA 2YY3A 1H38A 3MR6A 5U47A 2G4BA 1SV5B 2EG2A 4NLUA 4JI2F 4V19X 1EQ0A 2JEJA 1I6JA 1YSJA 1H74A 1TFYA 2QC3A 2I5JA 3SFUA 3A3PB 3KG0A 2W4DA 4QIWD 1XMOJ 1N5SA 5L1KA 9RUBA 3D6TB 1X9MA 4UF4A 3CCRS 3DRSB 2VZ9A 4OZNA 1QDUB 4FF4A 5KFUA 3C2PA 2KDOA 4JI8F 5AXNA 3QT5A 2DY1A 3W5XA 1N0VC 2CQ3A 1T0TV 2VJUA 3PR5B 2A10A 1X5TA 1HW8A 5KFJA 3FQLA 3N4WA 4JI1F 4YEAA 2DNKA 4F4WA 4M5JA 1L3KA 3IP0A 1S1WB 4PKDB 1I94F 1UEUA 5DRKA 1H73A 1MMLA 1O6XA 1CC8A 1AT1B 2VG5B 1NPRA 4QWDA 1GTEA 1NU4A 1N52B 1WOOA 3BJYA 3KJQB 2GC8A 5KFPA 2NXEA 3SQGA 1NK7A 3MAAB 1YBAA 4KFBB 2E5GA 3EXCX 5EX3A 1BQXA 4WFAQ 3OVSA 2YKAA 2ZVIA 1TKTB 4U8YA 2Y1IA 4KH0B 2GMHA 1PJ5A 2ROGA 1X5OA 2H5EA 2BE2A 5KFOA 1KVIA 3T1YF 4AL7A 2O01C 4C8YA 2CAJA 2XZTB 2QFIA 4KR0B 4CO5A 1J5OB 3HM9A 3H8YA 2DO4A 2DPJA 2B8QA 2PEBA 2KFYA 4GKJF 5B0AA 4DPTA 1CULB 1U09A 3LWLA 2OLWA 3MXHP 4FF2A 4NASA 2DGSA 4DR3J 2GA7A 4U9RA 1N8RT 1U6ZA 2DEIA 1JLQB 2R8GA 1RT6B 2ZKTA 3KNGA 2NSBA 3CJRA 5DG7A 1P9QC 4NA1A 4ZVUB 3CCUS 3KJVB 1YK9A 3R9LA 3L4BC 1RHJB 2HNZA 2CPDA 5B7WA 2R7RA 3GJSB 2VODA 2Y1JA 4ETZA 2GIRA 2F5GA 3IG1A 1HBOB 1FNOA 1WOSA 4RW9B 1TL7A 4F3MA 1WDTA 2BJ1A 4DR4F 3KK2A 3BGUA 2W2PP 3C15B 3WIUA 4OYMA 4OLPA 4NYOA 4BC7A 4OHYA 4H4OA 2DRAA 3LPEA 4KKOA 2QX0A 2DITA 1U6FA 1AW0A 2RUGA 1N34F 4LVOP 5L9XA 5A2QU 2DYAA 3ZTRA 2IA6A 5KFFA 1FT8A 2BKOA 2LEBA 3FGVA 2CVEA 2HIYA 2I1RA 4L73A 1Y3JA 1QM9A 4LFAF 3OTDA 2E1PA 3UDCA 3TZYA 3OR1A 3MOJB 1EIYB 2B9XA 1F9HA 2CWXA 1MMNA 2OPSA 1WJ9A 1U0HB 4DPWA 1H98A 2A2CA 5DDRC 5FDLA 3ZC4A 3JSRA 1WI8A 3I0SA 3EPIA 4H4MA 1HNWF 3FRZA 3VAJA 5FD1A 3VAKA 3TZWA 2DNOA 1U24A 3PZPA 3CJ3A 2QGFB 2HNDB 1ZPWX 2RRAA 3MMBB 2KH9A 2OELA 1JWWA 1RTJA 4EEYA 2XZDB 4R5PA 4RU2A 2OPRA 2RNEA 4FKXA 2UUWA 2VPWB 3CD7A 1O0PA 4RW6A 1CBKA 1S57A 3ADAC 2XMAA 1VS3A 3DYAB 2CJ9A 1HYSA 2UXBF 5KT6A 4FF1A 1GMWA 4CH0S 3MEKA 3H25A 3ET6B 3IM9A 3A8IA 2XS5A 3R8YA 2IJRA 2XMVA 3BKTA 4NXMJ 4WCEQ 1KDNA 3PVXA 4R0JA 3V4IA 2WB4A 4IR1A 1HWIA 2A18A 2BZ2A 1AROP 2VDHA 2VASA 4UUXA 5KFBA 4DJBA 3OLAA 4PWDA 3ZTOA 5EDWA 2G1DA 4OHZA 3UW1A 2AJ4A 3TVKA 1FKPB 3KJNB 2HBYB 3P96A 2FGCA 2X3GA 4OX9F 2O1PA 3IWNC 2VA3A 2A0FB 2Y3YA 4B9MA 5IV3A 1DTQA 4P52A 1TTHB 3TAQA 1UVIA 4O3NA 2XQCA 2GJ2A 1F2GA 2J0XA 5I3UA 3DI6A 2C22A 1GXTA 3DLJA 2DGWA 2UXCJ 5ETSA 3DU6A 2KM8B 5LMNF 1PKUA 1RBOB 4O4RA 1MWYA 2BOPA 3PM9A 3OVBA 4DUTA 2UVRA 5F0WA 4NLOA 3GSIA 3IGVA 1SIZA 1HWLA 3TJ9A 1CPZA 1D8ZA 3EICA 4A8FA 2SXLA 1X5SA 2IVYA 3JSMA 4LF1A 3PFOA 4KHRA 1Q81T 3WX4A 2D9OA 3I9V9 3IAM9 2NSCA 3DGPA 1JLCA 3EDRB 4P2MA 1JXLA 1YG0A 4QPTA 4U6PA 3W8GA 1AYEA 4MH8A 1K1QA 1RHUB 4ZITA 2CPEA 2E9ZA 4GRSA 4ICLA 5MAOA 1U8SA 1OSDA 2LYVA 3IA0A 4EYIB 2UVWA 4F0HA 3W66A 3BO3A 1VQOS 1OS5A 3PNIA 3HI9A 2IHR1 5D15A 4DN0A 2L9WA 2LECA 1UJ5A 3CULA 2XGQA 1RT1B 4ZHRB 2HQ3A 2BOAA 2XULA 3C19A 3C6UB 4CLPA 1B70B 1FDNA 2XWXA 1H3DA 2AGPA 1RAIB 3IBCB 2KXHA 2RQMA 4LRDA 4ECZA 4ECVA 4LUBA 2OD4A 4U95A 1IXKA 2R2TA 5KG6A 2YWEA 1RTDA 4DR5J 3W2VA 2IBKA 3HHDA 4IRKA 2MQPA 1HQUA 1C1BA 2EEYA 2H1YA 3FMBA 3CJKA 1KKHA 4OZ1A 2MZQA 1C0UB 2XI2A 2HIQA 2GIFA 4E8UA 4O0IA 4Y2IA 2HQFA 2BVZA 2IYIA 1ITPA 1S9EB 3KLEB 5CD4H 2R7OA 2N7YA 3I55S 3K58A 1IBMJ 4CT8A 1WKLA 1Y5LB 2XMJA 2W4CA 1KTQA 3N5BA 1VRTB 5C2GA 1RWNB 2XLJA 3V6JA 1IR2A 1U6BA 3ZNUA 5T7LA 1XEZA 2N3LA 4QW8A 4DV2J 4KE5A 1LFPA 1HHSA 3LGNA 1X9WA 4LREA 2KRBA 5A6WA 3HD2A 3RRGA 3HFZB 4N8OA 3KK1A 2HQGA 3VR1A 3H4BA 1NDLA 2QMUB 2RD5C 3SZ2A 2ZDOA 1YJ7A 4QWBA 5KFWA 3MEGB 4F0KA 5D4NA 1RHMB 3SIPB 4LR9A 3NMRA 4NLYA 2K1RB 1UFLA 4WZQA 3EDQB 3LOUA 3VAGA 2ADBA 2QJ3A 2MLZA 2ABYA 2ZD1B 2VICA 1RJJA 1R8AA 2V34A 2J6UA 4FPRA 2MKIA 4O0NA 3AJ2A 3RUBL 2QTWA 3NCQA 3POTB 1X4FA 1K47A 3B8HA 1RTZA 4DV0F 4LBIA 5JXSA 3GWCA 1L3SA 2VFUA 1L5UA 1FE4A 2LU1A 5AXKA 2QZ8A 4J90A 1QY7A 5E3CA 4DR3F 5KFAA 5K14B 1WDDA 2FVSA 2B5JB 2HHVA 3ZZZA 3EZ5A 2G0JA 2V6AA 2HQDA 3M6XA 1SKUB 6AT1B 1QVFR 3HJFA 1ZOTA 2LDYA 4RJVA 2HLUA 2IDEA 3D0GE 2Z0GA 3CTRA 1TL4A 2JFDA 1C2PA 3JS9A 3PXGa 3FKBA 3TP2A 2IFXA 2MQQA 3X1LB 2D1CA 5EWEA 3AAWB 4LF5J 4U7UK 3QT6A 1D1UA 3M8PB 5F9LA 2G9OA 3E8OA 1FJGJ 5DZ6A 3D68A 2XBPA 5KFGA 5CYMA 4PG4A 4OYPA 2J6SA 1FNMA 4KTQA 4MIWA 1T11A 1FNXH 3T5HA 2B7CB 4HH0A 2UUBJ 2Q3PA 1Y5IB 2AYBA 1RABB 3OL8A 4B3TJ 4G1QA 2A2DA 4M95A 2VBWA 2RU3A 3RBDA 4NEYA 3OUYA 5IWAJ 1IBCB 3CJTA 3ITHA 3AJ1A 1U48A 3OLBA 2XMMA 5KFLA 4ED6A 1HHQA 3ISNC 4CLLA 3EWGA 1BWEA 5HP1B 2MHNA 1VHFA 4ZLLA 1F2HA 2ZH7A 1N4LA 2YKMA 1RTHB 2M52A 1B0TA 3CJ0A 1PC4A 1CQNA 3UNYA 1RLCL 1WSVA 2GGPB 2I2YA 3I4PA 2LQ9A 2VBZA 4PZVA 1DARA 1Y9OA 2DK2A 4NL5A 1KONA 4ZP6A 2HHXA 3KDNA 3ISND 2AHOB 4WIIA 3CCES 1VRUB 5HI7A 3V2UC 3QAUA 3SCKE 2HPUA 4Y34A 1HNVA 2GVZA 3IRXA 3MECA 2QFJA 2K7JA 3GTYX 1UAWA 4HDHA 3AD8C 3K8VA 2E66A 2GO9A 4DX8H 1IM4A 4C3KA 3DM2B 2HFZA 2PSZA 3VZIA 1SV5A 1FFGB 5HJXA 4ECUA 1NZ8A 4TN2A 2IM1A 1DQAA 1MN9A 2BX6A 5J2QB 3AY0A 4ZPCA 2O3DA 2YWWA 4CIOA 4NXMF 5A8WB 3R5AA 2C3OA 4URGA 3KMQA 5KG4A 4ZK7M 4QIEA 3TR5A 2JEIA 2F4FA 5F0UA 1R8BA 5IQQA 5LJ5Y 1YRXA 4XAKA 5F8HA 1BE4A 1ZM4A 4DR1J 2JFKA 2MQ8A 4L6V3 3ILJA 2UXDJ 1JB0C 2PGCA 2CNOB 1XWLA 1RAOA 3U7JA 4ENOA 3TJ8A 1Q5YA 2DRDA 2EBGA 2GCFA 4O4GB 1Y5NB 1S48A 1WUUA 2HBRB 1RE1B 3D6MB 2VG5A 3OR2A 4EBCA 2UXCF 3OTCA 4X84A 1GMVA 5GMDA 5E41A 1XMBA 3MAAA 2D74B 4KFBA 3LAMA 2FJEB 3CCMS 1TKTA 4QBUA 2X7IA 4X66J 3S01A 2WOMA 1TVRB 2LP4A 2J0WA 2QYCA 4KY3A 4ZVOB 5A0YA 2EKNA 2B4OA 1KEKA 4KAIA 1J5OA 3H7HB 2FQQB 5DLGA 4HL9A 1CULA 1SH0A 3R6GB 4GVBB 2G2YA 4X62J 2K8GA 5C24A 2R7QA 1IQTA 2W7OA 2M3DA 3CDUA 5E3AA 1YJ9S 4W4MA 3RBZA 2XMKA 1RTIB 4LIWA 4RW4A 4Q45A 2XM3A 3NRBA 5KG0A 1S10A 2DNRA 3W61A 5L1LA 3CXCR 3HFKA 3KJVA 3BR8A 2MQMA 1NHKL 3P49B 4OJGA 1RT2B 5DLFA 4CNZA 3FCWA 3R5JB 3X3UA 3A3NB 3TJAA 4ED3A 3I96A 3DRRB 3T1HJ 4LR7A 4IG3B 1KOHA 1WD6A 1JJCB 2VH7A 3L9ZA 1HBOA 3F56A 3PJWA 1SH2A 2Y8YA 5GMEA 5D4OA 4RW9A 4UY8T 1VC5A 1X7VA 2MLXA 1WWHA 1S0VA 1FDAA 2IAJB 1FD2A 4DR5F 4DMZA 5LT5A 3C15A 4DV7J 3NEKA 2CPHA 2AEJA 4DV3J 5EN1A 5GADU 1ZM2A 3T5JA 2GZOA 4ZVEA 2VUGA 2CPXA 2P2CB 4ANDA 1R6VA 4K4WA 1KBRA 4FVCA 1GT8A 4ILRA 1P6TA 1F0XA 4Q2MA 1RT4B 3CSKA 1X4BA 1IBMF 5IQ6A 4OX7A 4JI7J 4GO7X 2DIUA 4M63A 4BS2A 2CJKA 3DXSX 4GC7A 4CO3A 3OHAA 1U0HA 4DWIA 2P9CA 4KHPJ 4ERDA 5C5JA 4DHVA 4PPZA 1BQMA 4DV2F 1XERA 1SL2A 4O3SA 4DBQA 2BA9A 3QWPA 1YRTA 2DXDA 2MJNA 2PO4A 2NPIA 2LDIA 2FJXA 3BDPA 4J9LA 3D6FB 1NEEA 2HNDA 1JLEB 5CZVA 3M2RA 3ZZOA 3MMBA 2FDNA 4RL1A 3RB0A 3DLGB 2AYEA 2V50A 4KHMA 1FKAF 5D0HA 2IRYA 2HBZB 4LRCA 4KT0C 2XNQA 4Y2CA 2ZUAA 5D6GA 4RKUC 3THTA 3DYAA 4ZKAA 1UTAA 2IRXA 4G1IA 5IS2A 4LFBJ 3AA9A 3HVRA 1U0SA 1T9XA 2P9GA 4NLSA 3ET6A 4DFJA 2E1RA 4NMXA 1LWFB 3HX9A 5FLXY 5L38A 3DLHA 1KN6A 3NMAA 5K20B 2MQNA 1IWGA 1VYAA 3O1LA 2NYIA 2VHGA 1U2FA 4RR5A 4EMDA 3JQJA 2HZAA 1SB6A 4CH7A 2UV8G 3HVWA 2B7BB 4DL2A 4NOHA 3TAPA 1TK5A 5A8KB 3BSOA 3TQ1A 3DLEA 4B3MJ 2DEJA 1GH8A 3CCLS 2HWHA 5J1NA 3SMZA 1WEXA 2J7KA 4HTJA 5IT4A 1TK8A 5CQGA 2RH3A 1PO6A 2GHVC 1TL3B 4DFKA 2NZ4A 5A6PA 1SCJB 2BM1A 2F4VJ 1NSQA 3GYXB 3ICLA 5LMUJ 3MI7X 5KFKA 1LFWA 2R42A 2F3JA 1RWMB 8ATCB 2ZZNA 2DH7A 2DNYA 2O66A 1FJGF 2PFFB 2JWNA 5H9EK 4L75A 2W9AA 3U02A 2V8HA 2C2EA 1DZ5A 3CC4S 1EETB 1VC6A 2UUBF 4ED0A 3IS9A 4JBCA 2G2OA 4B3TF 1H2TZ 2Q1LA 3KLFB 2X3DA 5K8OA 4J9MA 1PAUB 5IWAF 3M9MB 1R8HA 3UO0A 3MPDA 4ED4A 4GO5X 4ILMA 4F7VA 3I5BA 3UDVA 4IRCA 2YNIA 5K8NA 3AD7C 5IOLA 1XR6A 4RW7B 1NO8A 2V2KA 1M90T 1RT1A 4DG1B 3C6UA 5D4PA 2DH8A 2FJDB 5D0RA 1TAQA 4WF9Q 4DV4J 3T5KA 4CYUA 4KYZA 3V6DB 4CI0B 3NGSA 3U27A 3FFIB 1KQFB 1U49A 3FQKA 2HHHJ 1FDDA 4HH1A 2GMJA 1XJWB 3VQTA 2JSXA 1WEZA 1FXLA 1VMBA 1Q82T 1UKUA 5DG9A 1FD8A 1B4SA 5HATA 2B9WA 3BDEA 5K9FA 2AJFE 4C97A 2GW8A 2A1BA 1C0UA 5LJ3Y 1B99A 1M5KC 5D0EA 2PN6A 2ZJQQ 2W4PA 3M6WA 1QUPA 3F0NA 2Y8WA 1BGXT 3PKMA 3CCQS 2NS1B 2MYFA 3M4XA 4DUYJ 4ED1A 5G4DA 1P27B 3MR7A 4ZMMA 2DNMA 1RXOB 1YVFA 5BXIA 2YKNB 1OO0B 1XMQJ 1VRTA 3IAS9 4EBEA 1QUVA 1VIXA 2BANA 4RZRA 3NLCA 2KXNB 2GS8A 1NZAA 3NNAA 2BRKA 3UWTA 3P3DA 3DOLB 4AFFA 2CQ4A 1D3WA 1FRHA 4PWUA 2EVZA 1RP5A 4I2PA 1HA1A 3UR3C 2I8EA 4ZDNA 2VPZB 3MTKA 3I31A 4ID5B 2UXDF 3O5TB 4QIFA 4JV5J 4DCOB 5HO4A 1VRQC 2LQBA 4B17A 4X4NA 4KH1B 4NZ0A 4DLEA 4HHJA 3BN4A 3OBIA 2IJFA 1TMMA 1NK5A 4X4TA 1U2CA 3NL0A 3HMJG 3TWZA 3SV3A 1VDHA 2WSFC 5HQ8A 5ETRA 1XNRJ 2J7WA 1SKWA 2RHSB 5KOWA 4RUBA 1CEZA 3DDKA 1RWVB 1YJVA 4NLRA 1ZAVA 1I5OB 1J2VA 1QVGR 4JOUA 3KG4A 4EO8A 4NEZA 4X66F 1LWCB 1KS2A 5KFVA 1QAJA 2VOOA 3HHLC 5K8PA 4DQSA 4A8XA 3POTA 2W9CB 2QE5A 3GB0A 4QW9A 3U1MA 3PTWA 1K8AT 1T03B 1IN0A 3BS9A 5HVHA 1X4GA 3GR0A 3PJXA 1T05B 1UW4A 2J7UA 2JRSA 5GAGU 3FBEA 5AT1B 1UEVA 4QIVA 4Q8FA 1DQ8A 1RCOB 4USIA 2MXYA 2XLKA 1RACB 5K14A 3GCXP 3M2UB 2B5JA 5HQLA 3FEYB 4NPOA 2CDQA 1AUDA 3Q24A 1Q5VA 3PW0A 1B7FA 3O2IA 3QO9B 4HLBA 4OYWA 3KOAA 1VK8A 1D9FA 4I2QA 2OFHX 1LW0B 2RF2B 1Z1ZA 5DS7A 2M2BA 2GHWA 3MMAB 4C8MA 2ACMA 2VQFJ 3HP6A 4C2MA 2RMLA 3R27A 1SKRA 2C2MB 4JI6J 1UJ4A 3T1HF 2XYHB 3D1OA 3H0PA 1RUSA 1NHUA 4DPOA 4BBYA 1VQMS 2IM3A 4L3NA 5I3PA 2PD1A 1Q78A 3JTPA 2IY5B 1A7GE 2M70A 3T9ZA 4A4JA 2V4JA 2YWHA 1WC1A 3B82A 4ALZA 1BC6A 2R7UA 4CRJA 5KFZA 3R2DJ 1U02A 4A48A 2GFFA 2J0SD 1OYEA 4P74A 1WF2A 5DDOC 4Y2AA 3I87A 4HHHA 4WE1B 4WXOA 3KLGB 4ZPBA 1BLUA 1HNXJ 2MGZA 1YJRA 3DCAA 2FY8A 2EFPA 3VVUA 5H9FK 3BB5A 1ZM9A 3J7ZT 1FTRA 1MU2B 4HACB 2CQCA 2CJXB 3VGSA 4DV5J 3NG8A 1U1RA 3BBBA 4P2XA 5HLFB 5HP1A 1QAIA 1RT5B 4NZ7A 4JI7F 5DETA 2EBEA 5B0FA 1WTBA 2QT7A 2DO0A 2A6MA 1X4EA 4ELVA 5A2QY 2CZ4A 2ZZTA 2MQLA 4OYXA 3PIPQ 1RDRA 2WSCC 3TARA 3CJSA 4Y65A 2HKEA 2GGPA 1RISA 2DXFA 4ELTA 1F5AA 2HLTA 1NK0A 3THPA 5DM7Q 4ZS6A 4ED8A 3RGIA 1WEYA 3D67A 1VRUA 2W2QP 4RLEA 4PWWA 4C11A 1UW9A 3LALA 4C0OC 4F4XA 1OYDA 2RDJA 2ZE2B 1HI0P 4AYBD 1VQ4S 2FVPA 2DB1A 1M1GA 2VV5A 4IYQA 3BPDA 3CD6S 3CCVS 1K9MT 4K5SA 2HGLA 5GAEU 2D3ZA 2CXEA 2K3IA 2N3OA 3JSYA 3WZ0A 4PXBA 4E98A 1IBKJ 2UUCJ 2ILZA 2M7SA 3NS7B 1XIQA 4PRFA 3PW4A 1DLOB 2HZCA 1TL5A 3F73A 5SUHA 1W26A 4B3RF 2YX4A 4HT5A 5J2QA 4DUZJ 1QSYA 2FPHX 4I6YA 4Q7AA 5A8WA 2BM0A 4Y0FA 4TU9A 3KWMA 3NBPB 3HD1A 3AXKA 3FZ2A 1S9GA 2RB7A 3JYTB 3D0HE 4CWBA 2ZWPA 5EUHA 1TUGB 4M5HA 2X1FA 1VQ9S 4MKBA 1RAFB 1IVZA 3ZTPA 5F9NA 4O23A 1MROA 2AYGA 2BE9B 4B3MF 3TO8A 2UUAJ 2CPIA 5IV4A 3Q2SC 2Z8QA 1NB7A 5M2PA 2ZNYA 3T1AA 1RHRB 3TA1A 5DQGA 1S1XB 4FNIA 1AZSA 5L39A 4UY85 3Q8RB 4BWJA 3CUNA 4F04B 1NAQA 4XPEA 3TYTA 2F4VF 4B9TA 3MM9B 2F1FA 2YX1A 5LMUF 4YHHJ 4OHWA 2WONA 4DF8A 2BDPA 3NY0A 1FWKA 2RU9A 2Y1RI 2E7WA 2HWTA 1GK8A 3CD0A 3L7UA 3H98A 4KQZA 4CO2A 3TX0A 4A8MP 3CJ4A 2V63A 4OYBA 2DJWA 3G82B 5KG2A 1VQKS 2P5VA 3N6NA 1EKRA 2HVDA 4MK7A 4GVBA 4IQXA 4M5GA 4ECSA 3W64A 3MD1A 1NK6A 2VG6B 3MM5B 5ETMA 3P5TL 2HAIA 3H4DA 4DQPA 4K4YA 5ETTA 1RTIA 2JLFA 3ILLA 1TR0A 3DDNA 3TRGA 3PRDA 2QSFA 1HNIB 4RNOA 2W24A 1YZ6A 4I69A 1RT2A 4LF8J 3A8EA 4DV4F 3IBFB 1JKHB 4IG3A 3AQOA 3I82A 3VV2B 3BV8A 5KAKA 2QYGA 2HMIB 4J9VA 1HWUA 2HHHF 2EFVA 2ZHBA 3ENWA 2N7CA 1PC5A 4LQ3A 3K5OA 1FWLA 4DLGA 4UT4A 3R5DA 4PXCA 4AQYF 4K0KF 3VTIA 2KJVA 3ETOA 4H54A 2RDDA 4AL6A 5CD4A 1Q1KA 1V5IB 2O67A 2RQ4A 5GADI 2QA4G 2E1CA 1VR6A 1F5BA 1DQ9A 1NUEA 3FCHA 3FK4A 3DLBA 4RU9A 3PCOB 3G6YA 4AL5A 4J37A 5IM0A 2MB0B 4DUYF 3W9IA 1RT4A 1NSPA 2KZMA 1N5VA 4DSKA 5EGYA 1FWPA 1SPBP 3CMES 2XHWA 3M1VA 3W60A 1XMQF 2Q6BA 4RW8B 2YPYA 2CJAA 4LVNP 3NNHA 4N56A 1M5VC 2J9DA 9ATCB 4DSJA 3HHNB 1JLFB 5L1JA 4RNHA 3M8SA 2LQ5A 3NOCA 1L3TA 2HFOA 1SVDA 4LSLB 3H5UA 1S1TB 5F41A 4JV5F 5BR8J 1JLEA 1D09B 4A8YA 1VBXA 1WELA 1FRJA 5LXRA 3IGNA 3WIVA 5D3GB 2DCLA 4I68A 2P6SA 4OV1A 4X4QA 1WTFA 3AOCA 3DOMB 2ZH3A 3CJ8A 3QRPA 3ZXWA 2NUHA 4MKVA 4MFBB 1XNRF 4RNMA 3KHGA 1YITS 5JJBA 3WQPA 1HBNB 3PW7A 4C0BA 1SL1A 3MUMP 3GP9A 1LWFA 1HWJA 3BKUA 1WC3A 1LEOA 3GMGA 3RTVA 4X64J 2DRBA 4PXEA 4WP3A 4BCAA 2GVDB 4F50A 3CMAS 1U1OA 3HVAA 1FF2A 5KFDA 4YB5A 4FYWB 2FVCA 1OPIA 3AQPA 3MAHA 5A8KA 1WHXA 2VKRA 2WZ1A 1OJ4A 5C25B 5F3TA 1JMTA 2CPZA 3RRKA 3G96A 2R8JA 3VGUA 3DLLQ 3G6XA 1QSLA 1A6LA 5F8LA 2BJ3A 2OFGX 4DS4A 1UEKA 4MIBA 1FRIA 2YX7A 1TUWA 2VQFF 4LF4J 2VL1A 4JI6F 4DU7A 2H48B 3ISZA 2KVQE 1S5ZA 2EC2A 3Q23A 4ZLJA 5J2MB 2NQPA 1Y10A 4R8UB 3FDSA 4PEOA 3C16B 3FMWA 1Z2LA 4K4ZA 1OY9A 5IT0A 1H2UX 1EETA 5KFRA 3TVYA 3WBZA 4YR2A 4LSZB 3DHXA 1IKWA 1VBYA 5F8GA 5IC4B 4F8RA 2WVCA 1FCAA 1E6YB 1HNXF 5HBMA 2HQCA 4M1KA 3N01A 2JC0A 4JI4J 1AXQA 2EWHA 2BJ9A 1KQGB 4DV5F 4DQQA 2OUGA 2FHOB 1PIEA 3EM1A 2KYXA 5EX0A 4RW7A 4CLZA 4DG1A 1Y4ZB 4P2FA 3G6ES 3ENVA 1T9VA 1Q8IA 3GIIA 2XTJP 1KVKA 2ALYB 2IRUA 1N36J 4WKYA 3V6DA 4PCQA 3HJVA 3FFIA 1PILA 5SZTA 1F9EB 1WC4A 4ECRA 2LXUA 1XNQJ 3S1TA 2BE7D 1TK0A 4ZPVR 3NNCA 3MM7B 3LAKA 4KV8B 3H5YA 3GV7B 1MLAA 5IXUA 3R3TA 1BHNA 4J5OA 4M5IA 3SCLE 1WACA 2AMCB 3QBCA 2QA1A 3D7SB 5E3QA 3Q22A 1FHTA 2C2NA 2R8HA 4RWWA 5G0RA 5KG7A 4U7UD 3SSQA 3H2VE 1IBKF 2UUCF 1CLFA 1N5QA 4JI5F 1TL1A 3OTEA 1SQGA 4DUZF 4PG8A 2ADCA 4N41A 4DCPB 2OO4A 1UWAA 1J27A 1DJ0A 1VQ5S 3BPSP 3R5GA 3MFHA 2ZBRA 1RBAA 1W2IA 3S6EA 1T8EA 4A8OA 2CQHA 3MPWA 3DDIA 3C8YA 1BXNA 3DOLA 3Q8UA 4M5DB 4C3MA 2YQ3A 3CJ5A 4UUWA 3ZZUA 2DY9A 4USJC 2XSJB 1HWKA 2CJYB 2R7XA 3TZXA 4ECTA 1YJWS 2KI2A 1HL6A 1JX4A 1JJHA 3LW5C 4ID5A 4NRUA 4Z2XA 2G0CA 2Z2YB 4AXIA 4PYDA 1IQZA 3CB4A 2HVZA 2AD9A 2R2RA 3UD3P 3TAMB 5E2QA 1FJCA 3THVA 3ONQA 2GO8A 2GQQA 4M5NA 5ETLA 4A46A 2UUAF 3ULHA 1S6QB 2XEXA 5LSLA 2F65A 2ASLA 5DDQC 3NKYA 4QR2A 2YKPA 2C3MA 1C0TB 1YBTA 3QGPA 1FERA 1G4CA 1HARA 4WFBQ 1Q8LA 3TA2A 2VFSA 1XR7A 2NXCA 4YHHF 3MR5A 2ZBPA 2CUYA 1B3TA 5H9EJ 3I9ZA 4N47A 3V4MA 3UD4P 3DNCA 1LWCA 3MPYA 4E2FB 1NK9A 4IH5A 2KB2A 4USWA 2CZ9A 3Q89A 2AV5A 1X0FA 2HK2A 2W9CA 3BREA 3J7Z5 4C8OA 1FI4A 3OFEA 3JTOA 2HGMA 2HFNA 1T05A 2QA2A 3NOGA 2ZWOA 4F3OA 4DFPA 2M0GB 3M8WA 2GAHC 2CG4A 2E1AA 1KD1T 4DX6A 1KSPA 2FVRA 2BJDA 3OQ2A 4CH1A 2L41A 2OSRA 1RQ0A 1RWOB 3QO9A 1TZ0A 2VJVA 2CQGA 2OPQA 2QV6A 4ANEA 1L3VA 1TP7A 3LQVA 1LW0A 2RF2A 5DG8A 3MMAA 2WTFA 1C4CA 4F02A 3VQSA 4UOCA 2ZVSA 1RGVA 3GG1A 3GFXA 4NYPA 4LF8F 4WU3A 4P7VA 3GZ7A 3MCOA 4JV0A 2LA6A 2XS2A 2YTCA 4N8NA 4RX6A 3DRXA 4OYZA 4TLQA 2G13A 4ZCLA 1PCAA 2P8IA 3SQGB 3I0RB 4DPUA 2FJBB 3J81U 3CCSS 3E2EA 3DRYA 2V2ZA 4X4VA 2O5DA 5KFMA 2M4MA 1HIYA 1SIWB 2BW2A 4EU0A 1CQMA 3Q8QB 3BBCA 2XMWA 2ZH2A 1TKZB 3KLGA 1HI8A 2AJ1A 5BYSA 2Z57B 1S99A 2EPIA 1WI6A 1R3NA 2CVIA 1D9AA 1FRXA 5I3QA 3FBFA 1MWZA 1R43A 2W8KA 5HLFA 4M5KA 2ZZMA 4PQAA 2WAQD 2G2ZA 4JV1A 4IOBA 3M8ZA 3GG0A 3VZHA 5I42B 4WK1A 3W65A 3KTQA 1TELA 3RR7A 3MD3A 3R7NB 4P75A 2WRMA 1YDLA 5HSPA 2KFNA 2Y0SD 2UVVA 2QLWA 1XTZA 1MW7A 5BR8F 1T7PA 2B51A 1XN9A 2HNZB 3P6YC 2ZE2A 4LF7J 2KL8A 1HR0F 3IWLA 4NI2B 2AU0A 3FRYA 3EXYA 1SJRA 3UCZP 3VWSA 4HEA9 2Z58B 2VA2A 3TZZA 2XZWA 1VFJA 4RBUA 1PBUA 4TVAB 4N77A 1FK9A 4C7QA 1CJUB 3EGVA 4DL5A 1N88A 1UP1A 3K2YA 3MFIA 1U1QA 1T02A 3B4MA 1DLOA 1X31C 3WC0A 3QLHA 4L3KA 2JHEA 2AJ2A 5HK4A 5LL6d 2FLLA 1OWXA 2W2NP 2CPJA 2A6OA 4YMEA 1V3SA 4MAKA 1KLMA 2E44A 4NLQA 3NBPA 1CJKB 4IH7A 1R0BG 1VQPS 2IJNA 2L9NA 3FC9A 4DQRA 2BR0A 4X64F 1U1NA 1TKXB 2E5LJ 4CDIA 5EHHA 4M5MA 2LU2A 1S1VB 5HMXA 4FVMA 1FJEB 3OR1B 1Q53A 1UVNA 1IBLJ 4ZP8A 1ZYQA 2OPSB 2YXLA 5LSOA 2IM2A 3KLIB 1FX2A 4ZPTR 1VLYA 1N5YA 3KHHA 2QO3A 2V0NA 5FDLB 3RAQA 3GFYA 7AT1B 4DS5A 4KO0A 2M9KA 2ZH9A 2BQRA 4A8WA 2MKSA 3MMJA 3NGDA 3FNNA 3GPAA 2AYMA 1GXLA 5KT2A 4YN3B 2RE1A 4N5SA 1CJTB 2ZKUA 2ZBCA 1N48A 1FDBA 1RTJB 2DIVA
chains in the Genus database with same CATH topology
1FFWB 1FWPA 1EAYC 1FFGB 1A0OB 2LP4A 1FFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFW B;  1FWP A;  1EAY C;  1FFG B;  1A0O B;  2LP4 A;  1FFS B; 
#chains in the Genus database with same CATH topology
 2CJQ A;  4LF4 F;  3SEO A;  3AA8 A;  1X8D A;  1QJH A;  3GQC A;  3M9N B;  4AD6 A;  3NAI A;  5IZH A;  2RRN A;  2CNL B;  5A76 A;  4N76 A;  2W8L A;  4C8L A;  1BWV A;  1G1X A;  3CCT A;  2MZT A;  3TW0 A;  5MLC V;  3G82 A;  3KYL A;  3M8R A;  4M8L A;  2ZC4 A;  3CDE A;  2BRL A;  1X4A A;  4KGZ B;  5H9F J;  1Q4R A;  2QG9 B;  3HSZ A;  2CDR B;  3QZ8 A;  4ED5 A;  3Q0A A;  3C66 A;  5LOQ A;  4FBU A;  4RUH A;  2VFR A;  3GON A;  4PG5 A;  3OTO J;  5KFY A;  3B6B A;  3LWM A;  4JI4 F;  1HQ2 A;  3C6T B;  4B9L A;  3UDE A;  3Q8P B;  3AFG A;  3VCD A;  4WFY A;  1EP4 B;  3UQS A;  2Y0B B;  3PRB A;  1HNI A;  3LH2 S;  4I64 A;  1N33 J;  3VAF A;  5IT9 U;  3RAX A;  4ZVH A;  5GVQ A;  4LR8 A;  2HEK A;  3AOD A;  1NRK A;  3FSY A;  4OHX A;  2VF3 A;  5I4M A;  1YX2 A;  3DLK B;  3GSD A;  3QGH A;  1JKH A;  2DBB A;  2QN6 B;  1N36 F;  3D1Q A;  4CO4 A;  2BKN A;  2HMI A;  1CJV A;  2V2V A;  4USV A;  1YJT A;  3EGW B;  1DTT A;  3OD2 A;  3MCS A;  1XNQ F;  2GHP A;  1VQN S;  2D7S A;  4DQI A;  2OJ3 A;  4MK9 A;  2JOQ A;  5CCM A;  1S97 A;  2HHQ A;  2XNR A;  3G6V A;  2N4C A;  4JI3 F;  5J1E B;  5AXM A;  3MF5 A;  1VIS A;  4LQ9 A;  3T1Y J;  4Q43 A;  2GAG C;  2W2O P;  3ZFV A;  3DGP B;  2RS8 A;  1K44 A;  4C8K A;  1FXD A;  2ASJ A;  3B78 A;  2VG7 B;  4GKJ J;  1UVJ A;  4DI6 A;  4IFY B;  3R1L A;  2ZHA A;  2ZHO A;  3MUV P;  3EGZ A;  2BAB A;  5JUM A;  4J9N A;  2CFX A;  2D41 A;  4RW8 A;  4UZB A;  4ICL B;  3HZG A;  1ZZF A;  4HYK A;  3D2W A;  1NLK L;  3CJ2 A;  2H65 B;  2PFD A;  1JLF A;  1NSK L;  4F0M A;  3HO1 A;  2YNH B;  3D54 A;  2X1B A;  3M9O B;  2DHS A;  2V94 A;  3BSN A;  1QD1 A;  4JYA J;  1R0C B;  4IH6 A;  1WC0 A;  4LSL A;  1S1T A;  2K7K A;  2COL A;  1R89 A;  2H5I B;  3HSG A;  1ULR A;  2CQ2 A;  1K0T A;  5D3G A;  1CVJ A;  3ZZT A;  3VF0 B;  4FYY B;  3RU0 A;  1XMO F;  2DHG A;  1DBD A;  4K5R A;  3M7V A;  5T14 A;  1WKK A;  1SXL A;  3DOM A;  2VU5 A;  2NR0 A;  5EWF A;  1SJ3 P;  2OIH A;  2GIQ A;  2C28 A;  1KQK A;  4CLU A;  1XR5 A;  4AT1 B;  4MFB A;  1TQL A;  3PIO Q;  2R2U A;  3MMC B;  2EC0 A;  4TY8 A;  1JLG B;  5D4L A;  4WPA A;  3CPW R;  1HBN A;  3RYL A;  3AB2 B;  2M8D B;  3QFW A;  1KFD A;  1S77 D;  4KIA A;  1NHV A;  3MM6 A;  4KJI A;  3FEX B;  2L3M A;  4P6Q A;  1S79 A;  1IJE B;  2GV1 A;  2HRT A;  3IBW A;  3RB4 A;  3PX6 A;  1SJ1 A;  2GVD A;  2C2K B;  4L76 A;  1PYO B;  1H72 C;  1GX5 A;  2B3T B;  2MJU A;  3H59 A;  4IDK A;  1DHM A;  3N0V A;  3ENA A;  2Q79 A;  5C25 A;  3NWG A;  1QE1 A;  4PYA A;  3I4H X;  1KHV A;  5AE1 A;  2DGV A;  4NCG B;  1HNW J;  2FJV A;  2KM8 C;  2AIR B;  2KT5 A;  3M8Q B;  4OI3 A;  5KFH A;  2DNG A;  2MKJ A;  2BEF A;  4YY3 J;  3KKF A;  3ZTQ A;  2IA0 A;  2WVD A;  4ZJL A;  5KFT A;  3V6K A;  1LOU A;  1MNE A;  4OJH A;  2B9Y A;  2I6W A;  4PAA A;  3RB6 A;  2OPP A;  2HVI A;  3IM8 A;  3EVO A;  1RAG B;  3GIL A;  2YKQ A;  5C7P A;  4U7C A;  2GQC A;  4TKT A;  2HRU A;  5J2M A;  3PX0 A;  1KNZ A;  5D78 A;  7FD1 A;  5CXT A;  4FXD A;  3RR8 A;  2XB2 D;  2AQ4 A;  3A8J A;  4G65 A;  3G8T A;  4R8U A;  4LT6 A;  3C16 A;  3CO9 A;  1APS A;  2DR5 A;  3M8Y A;  1EQM A;  3LP1 B;  4X65 J;  3AT1 B;  4QJV A;  3KLH A;  1IJF B;  4P10 A;  2HHP A;  4K7Q A;  2KT2 A;  1Q0N A;  2QRR A;  1KC8 T;  1E6Y A;  3D66 A;  4OFZ A;  4DU8 A;  1UFK A;  4Q44 A;  1XC9 A;  2FHJ D;  4I6W A;  3PYG A;  3GIJ A;  3QZ7 A;  1M1H A;  2VQE J;  5ETV A;  4MMO A;  4EWT A;  5E3R A;  2AZ3 A;  3I56 S;  1SQF A;  2ZNZ A;  4ZVG A;  3UDL A;  1YKW A;  1NKC A;  3LP0 A;  1AA1 B;  3N6L A;  3QIP A;  3DU5 A;  3NGK A;  1URN A;  2RSQ A;  2KU7 A;  1GTH A;  2BQU A;  4DX5 A;  2FHK A;  2HNY A;  2FGO A;  2ZIT A;  2MZ1 A;  4XIU A;  4NML A;  3BYP A;  3MM7 A;  4B3S J;  4Q5V A;  4KV8 A;  3TAN A;  4EUV A;  4OZJ A;  1NME B;  2I9S A;  2B0G A;  2EFG A;  4Y2K A;  3MHY A;  4NLX A;  3LP2 B;  1HBU A;  5CYM B;  4P9S A;  4LRB A;  2XGP A;  4B9U A;  3VAL A;  3SXL A;  4O44 B;  2CQB A;  3OSN A;  2XI3 A;  2QLB B;  2QLF B;  1N54 B;  3BYR A;  2MLY A;  4DV6 J;  3K89 A;  2OD6 A;  2X51 A;  4ANC A;  4F25 A;  3R1H A;  2V69 A;  3MCN A;  4Z7Y A;  1FO1 A;  1Q95 G;  4YUD A;  1Q8B A;  4RNF A;  3OUY B;  4O3Q A;  3ZZ0 A;  4ZIW A;  3ITH B;  4QWA A;  2BUN A;  1O5J A;  1RWP B;  4CP5 A;  5K5M A;  1PG5 B;  1OY8 A;  4MKY A;  1NKB A;  1X4H A;  5JVG Q;  2XSJ A;  2E5L F;  1VLO A;  3ELH A;  4YP3 A;  1LW2 B;  2KXF A;  3RW6 A;  4CLW A;  4YB1 P;  5GAH U;  1D9D A;  1IBL F;  1SUQ B;  2UV8 A;  1U25 A;  1C1C B;  2H4Y B;  4NLW A;  1NKE A;  1CC7 A;  2I0X A;  3TAM A;  4FKY A;  4O3P A;  4PR6 A;  3IO1 A;  2V5H G;  4NRT A;  1YWX A;  4OYI A;  1S6Q A;  3GYN A;  3DRS A;  4KGM A;  2KJW A;  1Q8K A;  2B6A B;  2ACY A;  4I4B A;  1C0T A;  4QIG A;  2WW8 A;  1HNV B;  2EFN A;  2AWZ A;  1LK5 A;  4ES3 A;  5THW A;  3QID A;  3MEE B;  4DF4 A;  1HI1 A;  4HHU A;  1S4F A;  2JVO A;  2WBR A;  4TU7 A;  2V4R A;  2N82 B;  2NPF A;  3QSI A;  1S1W A;  2X1A A;  2XCP A;  2HGN A;  2KO1 A;  5L9N A;  1MSW D;  2FJW A;  2HUR A;  4DFM A;  3Q8S B;  1R27 B;  2MY8 A;  4X4O A;  4DN9 A;  2C2D A;  3H2L A;  2G0I A;  2OP5 A;  3AHP A;  3OTO F;  3LF0 A;  2M5Y A;  4NE9 C;  2RQC A;  5AXL A;  5CA5 A;  3QJJ A;  3C3L A;  2QLX A;  2WW4 A;  1VOM A;  4USH A;  4IG0 B;  2H5J B;  2DGO A;  1N33 F;  1Q86 T;  1HD0 A;  1GXU A;  1LXN A;  1Y11 A;  4QWE A;  2BJ8 A;  3N79 A;  2HVH A;  3W5Z A;  1Q16 B;  1P1T A;  4K2J A;  1U1L A;  2HAF A;  3QGI A;  2JLE A;  2OMO A;  3FVY A;  3OR2 B;  4W90 B;  1FRM A;  3PYE A;  5BYQ A;  3DOK B;  1R8P A;  2OAU A;  2IM0 A;  3I0R A;  3I32 A;  2CIM A;  2R7T A;  2AX0 A;  3EPG A;  1U2R A;  3CMQ A;  5DM6 Q;  1JLQ A;  3BO4 A;  1RT6 A;  3A4T A;  4G3I A;  1YRU A;  4DOZ A;  1IR1 A;  4DR7 J;  3V6H A;  2WOM B;  3V5R A;  1TKZ A;  3T41 A;  2DIS A;  2WB1 D;  2ZBQ A;  1DY3 A;  3US5 A;  5A0Y B;  4DV0 J;  1ZBT A;  3VAM A;  3NGT A;  5ETP A;  5ETQ A;  4KRW A;  3J7A 1;  2D3O 1;  2NCK L;  3D4J A;  1FFW B;  5RUB A;  1FKO B;  5C24 B;  2AKW B;  1FRK A;  1PJ7 A;  3IR5 B;  4X4U A;  5I42 A;  2EK6 A;  2WSE C;  1RB0 A;  1NJX A;  4Q0B B;  5ADZ A;  2ZH8 A;  2EKY A;  2FUG 9;  2K2P A;  1WSR A;  4FYX B;  4RW4 B;  3FSI A;  4ZVS B;  3QYY A;  4F4K A;  1RYR A;  4J9S A;  2ZUG A;  4P72 A;  2K3K A;  3EJM A;  1FVS A;  1HMV B;  4JYA F;  1PYS B;  1JNZ B;  1LKZ A;  3JB9 k;  3KMS A;  2Z30 B;  3W3S A;  1REG X;  1HD1 A;  3J7A N;  4RUC A;  4DXL A;  2C42 A;  4ZPA A;  2BJE A;  4NI2 A;  2FTR A;  1KHW A;  2UU9 J;  1HBM B;  1AFJ A;  2C3U A;  4C8N A;  3EUN A;  5FJ4 A;  4OZ5 A;  2R2S A;  3OV7 A;  3T6J A;  1UZD A;  1Y7P A;  3RBX A;  1CJU A;  1SH3 A;  1YTY A;  5AJ3 J;  5JVH Q;  3RBE A;  2CPF A;  2XMU A;  3BQ1 A;  4ECY A;  2LEP A;  3MM8 B;  1M5H A;  3L7O A;  4I7F B;  5ETN A;  1S72 S;  2DGT A;  3BH6 B;  1WNE A;  1SC6 A;  4X4P A;  3UD5 A;  2MTL A;  3QAE A;  2ROE A;  3E01 B;  1CJK A;  2V8V A;  2RIJ A;  2R7S A;  2HFU A;  5C42 B;  1TKX A;  5KG3 A;  1UVM A;  1ZET A;  2DHH A;  2HRY A;  3P8B B;  1S1V A;  3EGN A;  2YNG B;  2Y9H A;  1SQE A;  1B64 A;  3PDN A;  4ZIV A;  5E3P A;  3W2W B;  1U1K A;  3RG6 A;  3KLI A;  2PA8 D;  2XYG B;  3LGM A;  1NH8 A;  1BQM B;  2VPY B;  2E9R X;  1WOR A;  1U1M A;  4JI0 J;  3SDE B;  2CRL A;  3HT0 A;  3IC1 A;  2FZK B;  4USK A;  1P8G A;  2F63 A;  1TFW A;  4DL4 A;  4YY3 F;  3NWR A;  2P6T A;  2PMH A;  2XG8 A;  1IR0 A;  3QT8 A;  3M2R B;  5KFQ A;  2CNK B;  4ECW A;  3IXQ A;  1CJT A;  3HCX A;  1PYT A;  1VBK A;  1UCN A;  5KFE A;  1NND A;  2Z2L A;  4QOT A;  1MN7 A;  4WYW A;  2FD2 A;  3BF4 A;  2WHO A;  2VC0 A;  5CYQ B;  2ZEJ A;  4J9Q A;  2KHD A;  4AXJ A;  1FKP A;  3GJR B;  1R7I A;  1K0V A;  2MMY A;  3J81 j;  2H4W B;  1U7L A;  2Y1L B;  5FII A;  4B3O B;  2KYZ A;  2YWF A;  2MZS A;  1VK3 A;  2HQI A;  1DAX A;  3PX4 A;  1CG2 A;  3BEG B;  2CYY A;  4X65 F;  4HI1 A;  4YS2 A;  1RLD A;  3OTB A;  1SI9 A;  3AOB A;  2Z56 B;  2B4P A;  1H7X A;  1EHW A;  4N7T A;  1QTM A;  1S49 A;  1EJ7 L;  2B8P A;  1RAE B;  4LF5 F;  2DT9 A;  5CHC B;  3C6T A;  1OQ6 A;  5GMK a;  2VQE F;  1EP4 A;  1JJ4 A;  1R31 A;  5F8J A;  4V1A k;  3DLE B;  4YDX A;  5CAB A;  2N4D A;  2PE8 A;  2YQ1 A;  4RUA A;  2XY5 A;  3F44 A;  1IWA A;  2FHJ A;  5J2P B;  3DLK A;  5A8R B;  2H51 B;  1AB8 A;  3MPV A;  2D9P A;  4CTA B;  1W7W A;  2JZ5 A;  5K8M A;  4UQG A;  1WOP A;  2XYP B;  4DSF A;  5HRO B;  4CO0 A;  2QL7 B;  4B3S F;  2XCA A;  2PDA A;  1TMJ A;  5KT7 A;  4C6A A;  4EO6 A;  5J1E A;  1B0V A;  1SJ4 P;  4ZHR A;  4OJ3 A;  1B7Y B;  2DTJ A;  1QAY A;  4WP9 A;  2VC1 A;  4I56 A;  4DZD A;  2IVF B;  1R6Y A;  3CED A;  4BHQ A;  1EB0 A;  2VG7 A;  3M30 B;  3K17 A;  2RAQ A;  2AP6 A;  1X9S A;  4DV6 F;  1V3R A;  1L3U A;  4IFY A;  4KPC A;  4YDD B;  4PQU B;  4URQ U;  3IS9 B;  1VGY A;  3N5F A;  4CLT A;  2D3O R;  4W98 A;  4USM A;  2PI4 A;  4NWB A;  4NXN J;  2LVW A;  2FLO A;  2ILY A;  3G4S S;  3HPO A;  4CZC A;  4ED7 A;  4U96 A;  5LM7 E;  1JNR B;  2BW7 A;  1S7I A;  4DV1 J;  1H2V Z;  2YNH A;  1T94 A;  2YNI B;  4BWM A;  3BR9 A;  3NS5 A;  3GFH A;  3W63 A;  2PI5 A;  1YLX A;  4R25 A;  1S9E A;  2Z2Z A;  3KLE A;  2MKY A;  4Z7C A;  4NCA A;  1VQL S;  4OHV A;  4CYU B;  3DRP B;  3AXM A;  1S1U B;  3B4D A;  1S76 D;  2VPX B;  1W25 A;  4ZVP B;  2FY1 A;  2IDL A;  3BH7 B;  4WKR A;  2IBO A;  3TNV A;  4H4K A;  5IFM A;  2E7X A;  2JDJ A;  2NXU A;  3MMC A;  1GEH A;  1JLG A;  5KFS A;  2V9W A;  3SCI E;  3HF5 A;  2W01 A;  4DR1 F;  4F4A A;  3CCJ S;  3LPY A;  1ZAX A;  4IKA A;  2AF6 A;  2XS7 A;  2ASY A;  2LMI A;  3MOZ A;  2CJB A;  2UUT A;  2BJ7 A;  3JAM U;  4OX6 A;  3OL9 A;  2HVE A;  1NPK A;  2EXU A;  3NGU A;  3Q8V A;  4QZV B;  1UA0 A;  4MJK A;  1FJ7 A;  4ELU A;  1FEE A;  3BGL A;  3MEG A;  3CD5 A;  5DZ7 A;  2BAN B;  3MWB A;  4AE5 A;  3MUT P;  3BQ2 A;  2K1R A;  1RK8 A;  1PSD A;  4HKQ A;  2IPO B;  3SYZ A;  6FD1 A;  1VHI A;  1HFE L;  4NCG A;  4WWS A;  3CGI A;  1AUS L;  4I2P B;  2I38 A;  3M8Q A;  2ZD1 A;  3SQO P;  3KNA A;  1JQG A;  1ZA2 B;  2MHE A;  2W1B A;  2RHQ B;  1W2B R;  1RAD B;  3CDB A;  3W9J A;  3CIZ A;  4KC5 A;  3BGO P;  4YOE A;  1S7H A;  3TUP A;  3QMQ A;  1FVQ A;  3IR6 B;  2HBQ B;  3TEH B;  4ZCK A;  1J5E J;  4X62 F;  2GX8 A;  3LGH A;  4Q2L A;  2V8G A;  3OSP A;  4LF6 J;  1PBA A;  2CG8 A;  2F40 A;  3DC2 A;  4PAB A;  2C2O B;  2XLI A;  4K4S A;  3LP1 A;  3LA0 A;  1YIJ S;  1S6O A;  3J80 U;  4MYT A;  2KN4 A;  1FX4 A;  2POK A;  4DR7 F;  3MCM A;  4QYZ K;  3WC2 A;  3OXL A;  1H6K X;  5AE3 A;  4IQM A;  4P71 A;  4CLS A;  3JQM A;  2KG0 A;  2YH1 A;  3J81 Y;  2DHX A;  1U26 A;  3M8P A;  2B9E A;  4X4S A;  2KVI A;  5J2N B;  4HTI A;  4J9K A;  4ZPD A;  3RAM A;  2LXF A;  4ZCM A;  2OKQ A;  3A12 A;  3VAH A;  3PJ9 A;  4J91 A;  3R97 A;  1LNQ A;  4KSE B;  3B54 A;  4FXW A;  3M32 B;  4TQR A;  4FF3 A;  3M2V B;  4DV7 F;  1NB2 A;  1UA1 A;  1N6Q B;  4DV3 F;  4I2Q B;  3FSX A;  4J9P A;  2V2Q A;  4FXV A;  1EAY C;  2AGQ A;  4RO0 A;  1H0H B;  1KWM A;  1RWK B;  5BJR A;  1NJY A;  3FBB A;  2R4F A;  3T9N A;  3EE3 A;  2E9T A;  1I1G A;  1YQH A;  2UU9 F;  2LXI A;  4DSI A;  3G8Q A;  3M05 A;  5D77 A;  3LP2 A;  1N0U A;  1RTH A;  2F7V A;  2AJ0 A;  1M5O C;  3CT9 A;  4U67 Q;  1WHY A;  5F8I A;  1HPZ B;  4O44 A;  4TYB A;  4WFN Q;  3TQE A;  4DR6 J;  4KHP F;  5AJ3 F;  4YR0 A;  2V4J B;  4LSN B;  4L74 A;  1WHW A;  2V8D A;  3K8W A;  2OEK A;  4RPF A;  5D0G A;  3BKF A;  4PUO B;  1KOO A;  3SFG A;  4OI6 A;  2FIU A;  2DR6 A;  1UWB B;  4J7C A;  2MGZ B;  4TYA A;  1X4C A;  2ERR A;  1I51 B;  3KHL A;  5ETO A;  3CE8 A;  1LW2 A;  3DM2 A;  2FYX A;  2ALZ A;  3SSS A;  4F4Z A;  1FE0 A;  1SUQ A;  3DMJ B;  4FS1 A;  1R0A B;  1C1C A;  5CZX A;  5LSR A;  2WBM A;  3PHT A;  5GAH I;  3TEG A;  3HZE A;  2W9B B;  1EKS A;  2E7V A;  1MWQ A;  4EBD A;  4EYH B;  2FZC B;  1IKY B;  4OL8 A;  4LFB F;  1YGY A;  5L46 A;  4OI1 A;  4JI0 F;  1WF0 A;  2DD8 S;  1GAO A;  3T19 A;  2RDI A;  4XK8 C;  3HDS A;  1X4D A;  2B6A A;  5CCL A;  4C11 B;  4QU6 A;  2R8I A;  3QJL A;  2DH9 A;  4BC9 A;  3OT9 A;  2XO6 A;  1B0P A;  4IRD A;  4ID8 A;  1X0P A;  2ROP A;  5E33 A;  1JLA B;  3MEE A;  5B0E A;  2JJ4 D;  1V6H A;  3G9C A;  3VVT A;  3G2X A;  3MAQ A;  1S4E A;  4NLV A;  2VIH A;  2ZOF A;  1ZH5 A;  5DGA A;  2BMB A;  5LXY A;  4A8K A;  3E51 A;  3O8W A;  4CM2 A;  1RAJ A;  3DXB A;  5B0D A;  2XSF A;  5CYJ A;  4O4G A;  4PG6 A;  4IUF A;  3TUZ C;  1U45 A;  1S9G B;  3SV4 A;  4WXW A;  3SI8 A;  1S12 A;  2L08 A;  2HFV A;  5HMY A;  4C8Z A;  1SBR A;  3W1Y C;  1S6P B;  3A3O B;  2ZH4 A;  4UW2 A;  1JK9 B;  4OZ3 A;  1JXV A;  3MED B;  4A8S A;  3QT7 A;  1X60 A;  4WZM A;  2QA4 S;  4XPC A;  1DRZ A;  3PG9 A;  4TNO A;  4IG0 A;  2VOP A;  1MRO B;  1JLB B;  1IUJ A;  5DDP C;  1TVR A;  4OYA A;  3HXM A;  2NRE A;  3T6B A;  2H3E B;  1HW9 A;  1SC4 B;  4YB7 A;  2HS3 A;  2GQ2 A;  4QYR A;  5KFX A;  3Q86 A;  4EGL A;  5KT5 A;  1T3O A;  3W7B A;  3N6M A;  1GX6 A;  2MKK A;  1AZS B;  4LF2 A;  2CQ0 A;  3DOK A;  3UNG C;  5F8N A;  2KG1 A;  2B4V A;  1TV6 B;  3NCP A;  4DSE A;  5IT9 Y;  2PII A;  2LFV A;  3KHR A;  2BYC A;  3I6P A;  3CW2 C;  1RT7 B;  1V5V A;  2WON B;  3AJD A;  4IR9 A;  2H54 B;  2J9C A;  4FBT A;  1OQ3 A;  1ACM B;  2JNJ A;  2VON A;  4ECQ A;  5DGB A;  2VB6 A;  1V9O A;  2E5J A;  2JEF A;  3RW7 A;  3PYF A;  5ITH A;  1A9N B;  1UFW A;  3BO2 A;  4UQT A;  3OPK A;  4GKK J;  4TU8 A;  2DVI A;  3HLU A;  3DRR A;  1M0S A;  1UJ6 A;  1QTN B;  4CCH A;  4TXS A;  2OEM A;  2RJZ A;  1ROF A;  4DL3 A;  3UI3 A;  1FKO A;  1NK8 A;  3DN9 A;  3HT3 A;  3UN3 A;  3HK2 A;  4YQW A;  2IAJ A;  3R5C A;  1MMD A;  4Q0B A;  3LTO A;  4NXN F;  2RS2 A;  1M1K T;  1KVJ A;  1Y0H A;  2VFV A;  3MZI A;  2PMZ D;  1VCT A;  4DV1 F;  3M6V A;  4C0H A;  2QLJ B;  3EMT A;  2VKZ G;  1HMV A;  2ZC3 A;  1U47 A;  2RKI B;  2U2F A;  2IC3 B;  2XWY A;  1G3O A;  1X5P A;  4WJB A;  1IKV B;  4MYU A;  3K5N A;  1HBM A;  2ZFH A;  2R7V A;  3HUL A;  4KPY A;  2DR8 A;  4BDP A;  4OZ0 A;  4NLP A;  3AD9 C;  1YI2 S;  2IIH A;  2Z4P A;  1T9T A;  1SJQ A;  3O44 A;  4ER8 A;  1KR4 A;  4ZN1 A;  2UP1 A;  4CLF A;  3J7Y U;  3MM8 A;  4GC6 A;  4I7F A;  2LCW A;  3OXF A;  5E7O B;  4ZPW R;  3K0J A;  1NPP A;  2OGU A;  2PT0 A;  1S9F A;  4RNN A;  2RVJ A;  3PR4 A;  3E01 A;  2MKH A;  3LAN A;  3HKZ D;  5IM0 B;  3DLG A;  5C42 A;  2FLP A;  2AX1 A;  4MIA A;  3GIM A;  2YNG A;  4FNH A;  2PA3 A;  3V81 B;  3M1V B;  4K4T A;  2M8H A;  3W2W A;  3OJS A;  3O6Q A;  4M94 A;  4NCB A;  1TAU A;  3HVT B;  2BQ3 A;  3RJM B;  5CH7 B;  2MPU A;  4NX9 A;  4B02 A;  1HNZ J;  2HG4 A;  2KZZ A;  3SDE A;  2IMW P;  2AZ1 A;  3PO5 A;  2KRR A;  3IWX A;  2DGU A;  2YNF B;  3QRR A;  1PAE X;  1FXR A;  1S6U A;  1LWE B;  5B0C A;  2HHU A;  2YPZ A;  2W25 A;  5HQM A;  2FJA B;  2YQ0 A;  1S0M A;  2G1H A;  1VQ8 S;  2ZH5 A;  5CYQ A;  3C14 B;  3R7S B;  1WC6 A;  4CQ1 A;  2GML A;  4FZV A;  1J5E F;  2A3J A;  4FDF A;  2ZH1 A;  2JC1 A;  3PY8 A;  2KHC A;  4QCL A;  4B3R J;  4U8V A;  1F1B B;  3D5M A;  3UFC X;  4B3O A;  2VBY A;  2DKO B;  3IMQ J;  3NCR A;  4LF6 F;  1NK4 A;  3N28 A;  4WTY A;  4OZ2 A;  2OSQ A;  1EAR A;  1LWX A;  3KG1 A;  2FC9 A;  4ES1 A;  3Q8Y A;  4LBP A;  1TL3 A;  3BGR B;  3HSJ A;  1R8C A;  4B08 A;  4L72 B;  4ECX A;  1T9W A;  4MK8 A;  3GIK A;  3F41 A;  4WTO B;  4K4X A;  1LXJ A;  4WIQ A;  4KGX B;  3GE9 A;  3MGJ A;  4LIR A;  3K7R A;  2PC6 A;  2VDI A;  2LEA A;  2WVF A;  2DNQ A;  3O3L A;  2BXJ A;  2CQI A;  1LK7 A;  4OX8 A;  3EX7 B;  2VFT A;  1BQN B;  3ETM A;  2HK3 A;  2BAC A;  3KK3 B;  5J2P A;  3PRV A;  4XTT A;  5A8R A;  4CTA A;  4EZ6 A;  4USU A;  3UVJ B;  3QAT A;  4F2S A;  1RU2 A;  2GJF A;  3EZO A;  3L09 A;  5HRO A;  4ZVQ B;  4WYL A;  3KLF A;  2NXJ A;  1EX8 A;  1PJ6 A;  3QSY B;  3T5L A;  1NH7 A;  3Q2T C;  3HHL B;  4OYO A;  2MSS A;  1REV B;  2ATC B;  1KRP A;  4ZLP A;  2BV3 A;  4I1T A;  1DFD A;  3QQC D;  3HHE A;  4DPY A;  3CO0 P;  4RBV A;  1VI7 A;  4X2B A;  2C3Y A;  3KJF B;  1NCL A;  4DR6 F;  4FP9 A;  1FFS B;  3M30 A;  3CCW A;  1Q7Y T;  5T41 A;  2GNK A;  4OQJ A;  1NJW A;  2XY7 A;  4PQU A;  3H90 A;  1IKW B;  3FBC A;  3D0I E;  1IKX B;  1F9F A;  1KP6 A;  4IFV B;  1HLW A;  4GVL A;  5HBM B;  5KFI A;  2R3V A;  2YWK A;  1VQS A;  1UMJ A;  2J6T A;  1NJI T;  3BN7 A;  4NA3 A;  1G6B A;  1I3O B;  1K73 T;  3A13 A;  3KDO A;  4E0D A;  4CLK A;  4IO1 A;  2CA9 A;  2JH3 A;  4F3Q A;  2XO7 A;  4FYV B;  1OMS A;  4I0W A;  4CM0 A;  1ZPV A;  1P9Y A;  1CS4 B;  3PFE A;  1NDK A;  3CVK A;  3DRP A;  4KGK A;  2KT3 A;  5HVF A;  1S1U A;  3S7R A;  3OHB A;  4LF9 J;  1Z4U A;  4XO0 A;  2YKN A;  4P73 A;  3GJT B;  3AH6 A;  1RCX B;  3QJP A;  2MDA A;  4W92 B;  5M2U A;  4AQY J;  4K0K J;  1RT3 B;  4A47 A;  1O51 A;  1RAH B;  5KTQ A;  4I6A A;  4F2R A;  1E6V B;  2HW3 A;  3TA0 A;  4KGV B;  3ZTS A;  1N56 A;  2Q66 A;  4WFZ A;  5G0R B;  5HMZ A;  3PKY A;  3KUH A;  1WKJ A;  1TL1 B;  3BQ0 A;  1F3V A;  3L3C A;  1VQ6 S;  1HHT P;  5HJY A;  2RT3 A;  8AT1 B;  1N32 J;  2OTL S;  2KFZ A;  4C4W A;  3OFF A;  2YVS A;  4MT1 A;  3SCJ E;  2FVQ A;  4UZC A;  1HQE B;  1OSC A;  4WK3 A;  3RRH A;  2E1M C;  5BYR A;  4O3O A;  4C98 A;  3PV8 A;  3H42 A;  1QSS A;  5F3Z A;  4WU2 A;  2WVE A;  4C48 A;  1JXE A;  1JJ2 R;  2OTJ S;  3UCG A;  2CQ1 A;  2CZV C;  3MPU B;  3N9U C;  2OHD A;  5EWG A;  2P9E A;  2I5J B;  4QU7 A;  1TUV A;  1BUX A;  2F8E X;  3CF5 Q;  1T03 A;  1ZA1 B;  1RSC A;  5AE2 A;  3VAI A;  4OI2 A;  1RI7 A;  2C1E B;  3DFE A;  5GAG I;  4URS A;  3WDO A;  2VBX A;  3D9B A;  3M2U A;  4DZ6 A;  3ILO A;  3L7P A;  3QRQ A;  4DEZ A;  3PAC A;  3IN5 A;  2LKZ A;  3PEH A;  4LFC J;  4Y3C A;  4PPD A;  4M5L A;  2L9D A;  5JMN A;  1FTC A;  1O8B A;  4GKK F;  1YBU A;  3ENQ A;  4J9R A;  3QNW B;  3G87 A;  3R6L B;  4HI2 A;  5J2N A;  1RAA B;  3KLV A;  3RZA A;  1VQY A;  1HKA A;  5DJB A;  3GYG A;  2V68 A;  2NYH A;  1ZZN A;  2XMT A;  3TUJ C;  1ELO A;  2FB0 A;  3HHL D;  3M32 A;  1NDC A;  2APO A;  3M2V A;  2MZR A;  1FES A;  2V67 A;  5DQI A;  2Q6C A;  2HZV A;  2KTQ A;  3M6U A;  2OPQ B;  5KG5 A;  1N6Q A;  1T3N A;  2D69 A;  4UTG A;  1M5S A;  2E29 A;  1PGZ A;  2MEW A;  4CO1 A;  5B0B A;  3AB4 B;  4WE1 A;  2BE2 B;  4CT9 A;  1WG5 A;  2DNL A;  2H9Z A;  1KQS R;  4UOH A;  1RU1 A;  3PEJ A;  4TQS A;  2LQ8 A;  1MU2 A;  4HAC A;  4UOG A;  2ZH6 A;  3JXO A;  4QPX A;  4DR2 J;  5HMW A;  2QIF A;  1MG7 A;  1QLN A;  1RT5 A;  4IO9 Q;  3P4U B;  4OI0 A;  3OFH A;  3K5L A;  2K06 A;  3UCU P;  2UZA A;  2LQJ A;  2CKW A;  3KXD A;  1HPZ A;  1NBE B;  1OIA A;  1A0O B;  2AEF A;  1NJZ A;  2X1G A;  4LSN A;  4ZP9 A;  3CNQ P;  1SJF A;  2DNH A;  3PW5 A;  3U1N A;  2J9E A;  4DL0 C;  2L48 A;  4PUO A;  1UWB A;  3UN5 A;  3K5M A;  3CIM A;  4DL6 A;  3WX8 A;  3BSA A;  4NA2 A;  2OEJ A;  3A8K A;  4FYD A;  2E5H A;  3IG1 B;  1RZM A;  1SC3 B;  3DHW C;  3D6H B;  4OIX A;  4YB6 A;  1TL7 B;  1G2E A;  1F3F A;  1SL0 A;  3DMJ A;  3GU0 A;  5ETK A;  1R0A A;  3TVZ A;  3OVA A;  4QR0 A;  3KK2 B;  5GAE I;  2J8S A;  2QMX A;  2AT1 B;  3TI0 A;  1F5C A;  2W9B A;  3BZQ A;  2PEH A;  1YZ7 A;  4P7T A;  2ZJP Q;  1IKY A;  1HNZ F;  4H4O B;  2EW9 A;  2ZM6 J;  1VBZ A;  4KKO B;  4Y2M A;  5E5N A;  4F26 A;  2R8K A;  4KB7 A;  2M88 A;  4RWX A;  3MR2 A;  3ILI A;  4HVZ A;  1GQE A;  4JUZ A;  3HSD A;  3GR1 A;  3JYT A;  3D28 A;  4D3H A;  2BKP A;  4NLD A;  3H5S A;  4ZVT B;  3UE2 A;  4O3R A;  1Q7L B;  2F9D A;  1JLA A;  3G8S A;  3EVW A;  5KOX A;  2DGX A;  1K1S A;  2QL5 B;  5B09 A;  1BMQ B;  2B43 A;  1FK9 B;  1RWU A;  1WF1 A;  4JV2 A;  3D1H A;  2MZJ A;  4JI5 J;  5KFC A;  1IM6 A;  3Q83 A;  1GNK A;  3FCV A;  1KLN A;  3QLH B;  3I0S B;  1ZTT A;  2C2R A;  2NUU G;  1XK8 A;  4H4M B;  5KT4 A;  4PXD A;  3OW2 R;  4QYZ J;  3PW2 A;  2UVU A;  3A1Y G;  2J76 E;  2DGQ A;  1CSJ A;  1KLM B;  3P45 B;  1UVL A;  5H1S V;  1S1X A;  4F36 A;  1M5P C;  2FHM A;  2W7A A;  4FS2 A;  2HS4 A;  2JX2 A;  4DDF A;  4ZCI A;  3BBF A;  4ZVF A;  1OPZ A;  1S6P A;  2AJQ A;  2W2M P;  3HHK A;  3I5C A;  3MM9 A;  4R5P B;  2OPR B;  2BBE A;  3MED A;  1G7C B;  4S0M A;  4ILL A;  4K2X A;  4RW6 B;  2F8M A;  4OMF G;  4V19 J;  3R7B B;  4JI2 J;  1JLB A;  1N5Y B;  1WC5 A;  1XBW A;  2IVM A;  3JQK A;  2RRB A;  4KO0 B;  3UR0 A;  1HYS B;  3TX8 A;  2DNN A;  1WG4 A;  1WG1 A;  1RBL A;  2OI2 A;  4X4R A;  3KUE A;  2D3U A;  3G86 A;  3CC2 S;  3V4I B;  4JI8 J;  2VG6 A;  3H20 A;  1TV6 A;  1RA7 A;  3MM5 A;  1ZTW A;  3MTJ A;  7FDR A;  2CQP A;  4PWD B;  1UPM B;  4ZOS A;  2GJI A;  1RT7 A;  4DPX A;  1UET A;  2MKC A;  2YKO A;  2AEM A;  2WCX A;  3GV8 B;  1Z2Z A;  4JI1 J;  2JL9 A;  3OJU A;  1RA6 A;  1DTQ B;  2R7W A;  3BM7 A;  4QQB A;  1VC0 A;  2C3P A;  2HHS A;  1I94 J;  5L1I A;  3MUR P;  5I3U B;  3DI6 B;  4K4U A;  2J8A A;  5DO2 A;  1GMU A;  1XQI A;  4AUK A;  4WFX A;  4ZLN A;  4Y00 A;  1NM2 A;  2FC8 A;  5IC6 B;  4MKA A;  3W8P A;  4IOC Q;  2R9L A;  1U1P A;  4EK2 A;  4ATN A;  3QGG A;  4HDG A;  2J0Q D;  3BSC A;  1OY6 A;  3C46 A;  1NXI A;  2ZOM A;  4OV6 A;  4A8Q A;  2OML A;  2XY6 A;  3PYD A;  3ZZY A;  5HVG A;  3JSM B;  3EVM A;  5KFN A;  2RKI A;  4F67 A;  2DXE A;  2IC3 A;  2J9D E;  2NZC A;  4IOA Q;  4K4V A;  4HR2 A;  1JLC B;  1S59 A;  1IKV A;  1RKJ A;  4LF9 F;  3OFG A;  2ZOG A;  4RBT A;  1CJV B;  5B0G A;  4NYZ A;  2QSW A;  3K57 A;  3MR3 A;  4EZ9 A;  1DTT B;  1UL3 A;  4B9V A;  2B4U A;  4DSL A;  5J1P A;  3W9H A;  3KUG A;  2RIL A;  3QPI A;  5HN0 A;  1RHQ B;  3L95 X;  4OI4 A;  1ZAW A;  1LQ9 A;  2AGO A;  3J7Y I;  4LBH A;  5HL7 Q;  3P5B P;  1RKI A;  1ZM3 A;  2HFS A;  3W5Y A;  4B9N A;  1FA0 A;  4WBF A;  2WVB A;  1S0O A;  3D3C J;  1Q79 A;  1SC1 B;  1LV5 A;  2QL9 B;  3LUY A;  1FEH A;  3G71 S;  1VQ7 S;  1Y3K A;  4ZJO A;  3UPF A;  4ED2 A;  4K50 A;  3D3B J;  2LLZ A;  3V81 A;  8RUC A;  1AFI A;  1N32 F;  5C2C A;  1RTD B;  2EG1 A;  5M2R A;  4B9S A;  4DR4 J;  3W2V B;  3JSB A;  3HFV A;  3JAM Y;  2U1A A;  3HVT A;  4G6V B;  1HQU B;  1C1B B;  5KG1 A;  3CJK B;  4P2S A;  4UST A;  2QMW A;  1EZZ B;  2V4Q A;  3RB3 A;  1QAX A;  3E3X A;  4ITS A;  1N34 J;  5L8R C;  2YNF A;  4EI2 A;  3R5B A;  1LWE A;  2Q43 A;  4Q8E A;  4GMK A;  3CCZ A;  5CAA A;  1YHQ S;  1HR0 J;  4NLT A;  3DKD A;  4OLO A;  3OL6 A;  4LFA J;  5D8H B;  1VIO A;  3C14 A;  2CNN B;  4ZVR B;  4EFA C;  4OJ1 A;  4XDC A;  2DR9 A;  2MQO A;  2MST A;  2ZJR Q;  3PO4 A;  1F60 B;  2DHA A;  1S0N A;  1ZS6 A;  3NS6 A;  3GJQ B;  4TY8 B;  3LO3 A;  2C2Z B;  5T7L B;  3SSR A;  3VGT A;  4ZN3 A;  5DQH A;  4NZ6 A;  2HS0 A;  4ES2 A;  4WP8 A;  1FRL A;  2EK1 A;  2XHC A;  4F4Y A;  4K8R A;  1T9Y A;  3KK1 B;  4KBI A;  4I67 A;  4NLG A;  3BGR A;  1BY9 A;  4R0E A;  1V3Z A;  3MM6 B;  4YFU A;  4C9D A;  1TKD A;  1DUR A;  4LFC F;  1VJQ A;  2FLN A;  1YJU A;  1YJN S;  2DR7 A;  3FZB A;  1GMW D;  3R2C J;  1RWW B;  3VHQ A;  1T9U A;  4ETX A;  4LJM A;  3IRW P;  2OH2 A;  4IDK B;  4ZP7 A;  3J80 Y;  1RHK B;  5FLX U;  3FEZ A;  4BLG A;  1QE1 B;  2LA4 A;  1JIH A;  3K59 A;  2HSE B;  2UXB J;  1BQN A;  4ZJQ A;  3KFW X;  3NGR A;  3KK3 A;  3JTN A;  1UZH A;  2ATL A;  2FZG B;  3CC7 S;  3UVJ A;  2ZBI A;  4CNY A;  3I5A A;  3SBM A;  1NSA A;  3PHE A;  3GCW P;  4ZA1 A;  2YBV A;  2PMW A;  4D3G A;  3HKW A;  3FJ2 A;  2J5A A;  4DX7 A;  1RWX B;  2OPP B;  3HHL A;  1GFW B;  1T95 A;  2HHT A;  3T3F A;  2DCU B;  2NLW A;  3UN2 A;  1REV A;  4QR1 A;  4DR2 F;  4OX9 J;  4LRA A;  3OXG A;  2CAD A;  2YH0 A;  1NDP A;  4J9U E;  3CDA A;  1BD6 A;  5HAO A;  1SKS A;  1UVK A;  4MTP A;  2W7P A;  1Y00 A;  4YR3 A;  2AW0 A;  2VD3 A;  2DNP A;  3CWJ A;  3U1L A;  4QWC A;  2B56 A;  5LMN J;  3NP5 A;  2E5I A;  3KLH B;  1TU0 B;  1VJW A;  2NXN A;  4PG7 A;  4Y28 C;  4JP8 A;  2CQD A;  1IKX A;  5E0O A;  4IFV A;  3EZU A;  3TOQ A;  3GFZ A;  2F8H A;  2CWK A;  3ZZR A;  3GV5 B;  3ZNJ 1;  3W62 A;  3H5X A;  2CPY A;  4LF7 F;  4LRF A;  3VGV A;  3DGV A;  4OZL A;  4UOF A;  1P1L A;  2HYI B;  4TLR A;  4J9O A;  2KKH A;  3WHI A;  2ZDP A;  2RUS A;  4Z37 A;  4DCJ B;  4G1P A;  3IFE A;  1CS4 A;  3LP0 B;  1N5T A;  3H40 A;  1RYS A;  3FUY A;  3QIP B;  4JB8 B;  5F8M A;  1ICE B;  2ASD A;  2EI5 A;  2HWI A;  2HNY B;  3ZZP A;  4C3L A;  2IYG A;  2ZM6 F;  4H4K C;  4G1Q B;  3IR7 B;  3GLJ A;  4K59 A;  1F6T A;  1D0E A;  2XC9 A;  1RT3 A;  4CLY A;  3EYZ A;  3QWU A;  4M5D A;  2EFO A;  3CDW A;  3BGF A;  2QEX S;  1URR A;  3NAH A;  4JI3 J;  1E6V A;  3K5P A;  2RQK A;  2V9K A;  1HBU B;  1U8W A;  2YKM B;  1KTV A;  4HT7 A;  3MDF A;  2DNZ A;  2EFQ A;  3NXZ A;  4FPI A;  1U4B A;  2V8P A;  3AOA A;  1UPP A;  3ZO7 A;  2YWG A;  2MY7 A;  2JVR A;  3GIR A;  5KT3 A;  3QFH A;  5B08 A;  2Z2M A;  2HHW A;  1D8Y A;  4TY9 A;  2JEG A;  1H7W A;  2F9J A;  3TUI C;  4DL7 A;  1C4A A;  2DPI A;  2WK4 A;  3S8S A;  2JLG A;  3CJQ A;  2GVZ B;  3IRX B;  3MEC B;  3H2U B;  1HQE A;  4FN5 A;  2IMO A;  4XDD A;  3OL7 A;  1WHV A;  1KFS A;  5HAN A;  4LMZ A;  4Y6I A;  6FDR A;  2YY3 A;  1H38 A;  3MR6 A;  5U47 A;  2G4B A;  1SV5 B;  2EG2 A;  4NLU A;  4JI2 F;  4V19 X;  1EQ0 A;  2JEJ A;  1I6J A;  1YSJ A;  1H74 A;  1TFY A;  2QC3 A;  2I5J A;  3SFU A;  3A3P B;  3KG0 A;  2W4D A;  4QIW D;  1XMO J;  1N5S A;  5L1K A;  9RUB A;  3D6T B;  1X9M A;  4UF4 A;  3CCR S;  3DRS B;  2VZ9 A;  4OZN A;  1QDU B;  4FF4 A;  5KFU A;  3C2P A;  2KDO A;  4JI8 F;  5AXN A;  3QT5 A;  2DY1 A;  3W5X A;  1N0V C;  2CQ3 A;  1T0T V;  2VJU A;  3PR5 B;  2A10 A;  1X5T A;  1HW8 A;  5KFJ A;  3FQL A;  3N4W A;  4JI1 F;  4YEA A;  2DNK A;  4F4W A;  4M5J A;  1L3K A;  3IP0 A;  1S1W B;  4PKD B;  1I94 F;  1UEU A;  5DRK A;  1H73 A;  1MML A;  1O6X A;  1CC8 A;  1AT1 B;  2VG5 B;  1NPR A;  4QWD A;  1GTE A;  1NU4 A;  1N52 B;  1WOO A;  3BJY A;  3KJQ B;  2GC8 A;  5KFP A;  2NXE A;  3SQG A;  1NK7 A;  3MAA B;  1YBA A;  4KFB B;  2E5G A;  3EXC X;  5EX3 A;  1BQX A;  4WFA Q;  3OVS A;  2YKA A;  2ZVI A;  1TKT B;  4U8Y A;  2Y1I A;  4KH0 B;  2GMH A;  1PJ5 A;  2ROG A;  1X5O A;  2H5E A;  2BE2 A;  5KFO A;  1KVI A;  3T1Y F;  4AL7 A;  2O01 C;  4C8Y A;  2CAJ A;  2XZT B;  2QFI A;  4KR0 B;  4CO5 A;  1J5O B;  3HM9 A;  3H8Y A;  2DO4 A;  2DPJ A;  2B8Q A;  2PEB A;  2KFY A;  4GKJ F;  5B0A A;  4DPT A;  1CUL B;  1U09 A;  3LWL A;  2OLW A;  3MXH P;  4FF2 A;  4NAS A;  2DGS A;  4DR3 J;  2GA7 A;  4U9R A;  1N8R T;  1U6Z A;  2DEI A;  1JLQ B;  2R8G A;  1RT6 B;  2ZKT A;  3KNG A;  2NSB A;  3CJR A;  5DG7 A;  1P9Q C;  4NA1 A;  4ZVU B;  3CCU S;  3KJV B;  1YK9 A;  3R9L A;  3L4B C;  1RHJ B;  2HNZ A;  2CPD A;  5B7W A;  2R7R A;  3GJS B;  2VOD A;  2Y1J A;  4ETZ A;  2GIR A;  2F5G A;  3IG1 A;  1HBO B;  1FNO A;  1WOS A;  4RW9 B;  1TL7 A;  4F3M A;  1WDT A;  2BJ1 A;  4DR4 F;  3KK2 A;  3BGU A;  2W2P P;  3C15 B;  3WIU A;  4OYM A;  4OLP A;  4NYO A;  4BC7 A;  4OHY A;  4H4O A;  2DRA A;  3LPE A;  4KKO A;  2QX0 A;  2DIT A;  1U6F A;  1AW0 A;  2RUG A;  1N34 F;  4LVO P;  5L9X A;  5A2Q U;  2DYA A;  3ZTR A;  2IA6 A;  5KFF A;  1FT8 A;  2BKO A;  2LEB A;  3FGV A;  2CVE A;  2HIY A;  2I1R A;  4L73 A;  1Y3J A;  1QM9 A;  4LFA F;  3OTD A;  2E1P A;  3UDC A;  3TZY A;  3OR1 A;  3MOJ B;  1EIY B;  2B9X A;  1F9H A;  2CWX A;  1MMN A;  2OPS A;  1WJ9 A;  1U0H B;  4DPW A;  1H98 A;  2A2C A;  5DDR C;  5FDL A;  3ZC4 A;  3JSR A;  1WI8 A;  3I0S A;  3EPI A;  4H4M A;  1HNW F;  3FRZ A;  3VAJ A;  5FD1 A;  3VAK A;  3TZW A;  2DNO A;  1U24 A;  3PZP A;  3CJ3 A;  2QGF B;  2HND B;  1ZPW X;  2RRA A;  3MMB B;  2KH9 A;  2OEL A;  1JWW A;  1RTJ A;  4EEY A;  2XZD B;  4R5P A;  4RU2 A;  2OPR A;  2RNE A;  4FKX A;  2UUW A;  2VPW B;  3CD7 A;  1O0P A;  4RW6 A;  1CBK A;  1S57 A;  3ADA C;  2XMA A;  1VS3 A;  3DYA B;  2CJ9 A;  1HYS A;  2UXB F;  5KT6 A;  4FF1 A;  1GMW A;  4CH0 S;  3MEK A;  3H25 A;  3ET6 B;  3IM9 A;  3A8I A;  2XS5 A;  3R8Y A;  2IJR A;  2XMV A;  3BKT A;  4NXM J;  4WCE Q;  1KDN A;  3PVX A;  4R0J A;  3V4I A;  2WB4 A;  4IR1 A;  1HWI A;  2A18 A;  2BZ2 A;  1ARO P;  2VDH A;  2VAS A;  4UUX A;  5KFB A;  4DJB A;  3OLA A;  4PWD A;  3ZTO A;  5EDW A;  2G1D A;  4OHZ A;  3UW1 A;  2AJ4 A;  3TVK A;  1FKP B;  3KJN B;  2HBY B;  3P96 A;  2FGC A;  2X3G A;  4OX9 F;  2O1P A;  3IWN C;  2VA3 A;  2A0F B;  2Y3Y A;  4B9M A;  5IV3 A;  1DTQ A;  4P52 A;  1TTH B;  3TAQ A;  1UVI A;  4O3N A;  2XQC A;  2GJ2 A;  1F2G A;  2J0X A;  5I3U A;  3DI6 A;  2C22 A;  1GXT A;  3DLJ A;  2DGW A;  2UXC J;  5ETS A;  3DU6 A;  2KM8 B;  5LMN F;  1PKU A;  1RBO B;  4O4R A;  1MWY A;  2BOP A;  3PM9 A;  3OVB A;  4DUT A;  2UVR A;  5F0W A;  4NLO A;  3GSI A;  3IGV A;  1SIZ A;  1HWL A;  3TJ9 A;  1CPZ A;  1D8Z A;  3EIC A;  4A8F A;  2SXL A;  1X5S A;  2IVY A;  3JSM A;  4LF1 A;  3PFO A;  4KHR A;  1Q81 T;  3WX4 A;  2D9O A;  3I9V 9;  3IAM 9;  2NSC A;  3DGP A;  1JLC A;  3EDR B;  4P2M A;  1JXL A;  1YG0 A;  4QPT A;  4U6P A;  3W8G A;  1AYE A;  4MH8 A;  1K1Q A;  1RHU B;  4ZIT A;  2CPE A;  2E9Z A;  4GRS A;  4ICL A;  5MAO A;  1U8S A;  1OSD A;  2LYV A;  3IA0 A;  4EYI B;  2UVW A;  4F0H A;  3W66 A;  3BO3 A;  1VQO S;  1OS5 A;  3PNI A;  3HI9 A;  2IHR 1;  5D15 A;  4DN0 A;  2L9W A;  2LEC A;  1UJ5 A;  3CUL A;  2XGQ A;  1RT1 B;  4ZHR B;  2HQ3 A;  2BOA A;  2XUL A;  3C19 A;  3C6U B;  4CLP A;  1B70 B;  1FDN A;  2XWX A;  1H3D A;  2AGP A;  1RAI B;  3IBC B;  2KXH A;  2RQM A;  4LRD A;  4ECZ A;  4ECV A;  4LUB A;  2OD4 A;  4U95 A;  1IXK A;  2R2T A;  5KG6 A;  2YWE A;  1RTD A;  4DR5 J;  3W2V A;  2IBK A;  3HHD A;  4IRK A;  2MQP A;  1HQU A;  1C1B A;  2EEY A;  2H1Y A;  3FMB A;  3CJK A;  1KKH A;  4OZ1 A;  2MZQ A;  1C0U B;  2XI2 A;  2HIQ A;  2GIF A;  4E8U A;  4O0I A;  4Y2I A;  2HQF A;  2BVZ A;  2IYI A;  1ITP A;  1S9E B;  3KLE B;  5CD4 H;  2R7O A;  2N7Y A;  3I55 S;  3K58 A;  1IBM J;  4CT8 A;  1WKL A;  1Y5L B;  2XMJ A;  2W4C A;  1KTQ A;  3N5B A;  1VRT B;  5C2G A;  1RWN B;  2XLJ A;  3V6J A;  1IR2 A;  1U6B A;  3ZNU A;  5T7L A;  1XEZ A;  2N3L A;  4QW8 A;  4DV2 J;  4KE5 A;  1LFP A;  1HHS A;  3LGN A;  1X9W A;  4LRE A;  2KRB A;  5A6W A;  3HD2 A;  3RRG A;  3HFZ B;  4N8O A;  3KK1 A;  2HQG A;  3VR1 A;  3H4B A;  1NDL A;  2QMU B;  2RD5 C;  3SZ2 A;  2ZDO A;  1YJ7 A;  4QWB A;  5KFW A;  3MEG B;  4F0K A;  5D4N A;  1RHM B;  3SIP B;  4LR9 A;  3NMR A;  4NLY A;  2K1R B;  1UFL A;  4WZQ A;  3EDQ B;  3LOU A;  3VAG A;  2ADB A;  2QJ3 A;  2MLZ A;  2ABY A;  2ZD1 B;  2VIC A;  1RJJ A;  1R8A A;  2V34 A;  2J6U A;  4FPR A;  2MKI A;  4O0N A;  3AJ2 A;  3RUB L;  2QTW A;  3NCQ A;  3POT B;  1X4F A;  1K47 A;  3B8H A;  1RTZ A;  4DV0 F;  4LBI A;  5JXS A;  3GWC A;  1L3S A;  2VFU A;  1L5U A;  1FE4 A;  2LU1 A;  5AXK A;  2QZ8 A;  4J90 A;  1QY7 A;  5E3C A;  4DR3 F;  5KFA A;  5K14 B;  1WDD A;  2FVS A;  2B5J B;  2HHV A;  3ZZZ A;  3EZ5 A;  2G0J A;  2V6A A;  2HQD A;  3M6X A;  1SKU B;  6AT1 B;  1QVF R;  3HJF A;  1ZOT A;  2LDY A;  4RJV A;  2HLU A;  2IDE A;  3D0G E;  2Z0G A;  3CTR A;  1TL4 A;  2JFD A;  1C2P A;  3JS9 A;  3PXG a;  3FKB A;  3TP2 A;  2IFX A;  2MQQ A;  3X1L B;  2D1C A;  5EWE A;  3AAW B;  4LF5 J;  4U7U K;  3QT6 A;  1D1U A;  3M8P B;  5F9L A;  2G9O A;  3E8O A;  1FJG J;  5DZ6 A;  3D68 A;  2XBP A;  5KFG A;  5CYM A;  4PG4 A;  4OYP A;  2J6S A;  1FNM A;  4KTQ A;  4MIW A;  1T11 A;  1FNX H;  3T5H A;  2B7C B;  4HH0 A;  2UUB J;  2Q3P A;  1Y5I B;  2AYB A;  1RAB B;  3OL8 A;  4B3T J;  4G1Q A;  2A2D A;  4M95 A;  2VBW A;  2RU3 A;  3RBD A;  4NEY A;  3OUY A;  5IWA J;  1IBC B;  3CJT A;  3ITH A;  3AJ1 A;  1U48 A;  3OLB A;  2XMM A;  5KFL A;  4ED6 A;  1HHQ A;  3ISN C;  4CLL A;  3EWG A;  1BWE A;  5HP1 B;  2MHN A;  1VHF A;  4ZLL A;  1F2H A;  2ZH7 A;  1N4L A;  2YKM A;  1RTH B;  2M52 A;  1B0T A;  3CJ0 A;  1PC4 A;  1CQN A;  3UNY A;  1RLC L;  1WSV A;  2GGP B;  2I2Y A;  3I4P A;  2LQ9 A;  2VBZ A;  4PZV A;  1DAR A;  1Y9O A;  2DK2 A;  4NL5 A;  1KON A;  4ZP6 A;  2HHX A;  3KDN A;  3ISN D;  2AHO B;  4WII A;  3CCE S;  1VRU B;  5HI7 A;  3V2U C;  3QAU A;  3SCK E;  2HPU A;  4Y34 A;  1HNV A;  2GVZ A;  3IRX A;  3MEC A;  2QFJ A;  2K7J A;  3GTY X;  1UAW A;  4HDH A;  3AD8 C;  3K8V A;  2E66 A;  2GO9 A;  4DX8 H;  1IM4 A;  4C3K A;  3DM2 B;  2HFZ A;  2PSZ A;  3VZI A;  1SV5 A;  1FFG B;  5HJX A;  4ECU A;  1NZ8 A;  4TN2 A;  2IM1 A;  1DQA A;  1MN9 A;  2BX6 A;  5J2Q B;  3AY0 A;  4ZPC A;  2O3D A;  2YWW A;  4CIO A;  4NXM F;  5A8W B;  3R5A A;  2C3O A;  4URG A;  3KMQ A;  5KG4 A;  4ZK7 M;  4QIE A;  3TR5 A;  2JEI A;  2F4F A;  5F0U A;  1R8B A;  5IQQ A;  5LJ5 Y;  1YRX A;  4XAK A;  5F8H A;  1BE4 A;  1ZM4 A;  4DR1 J;  2JFK A;  2MQ8 A;  4L6V 3;  3ILJ A;  2UXD J;  1JB0 C;  2PGC A;  2CNO B;  1XWL A;  1RAO A;  3U7J A;  4ENO A;  3TJ8 A;  1Q5Y A;  2DRD A;  2EBG A;  2GCF A;  4O4G B;  1Y5N B;  1S48 A;  1WUU A;  2HBR B;  1RE1 B;  3D6M B;  2VG5 A;  3OR2 A;  4EBC A;  2UXC F;  3OTC A;  4X84 A;  1GMV A;  5GMD A;  5E41 A;  1XMB A;  3MAA A;  2D74 B;  4KFB A;  3LAM A;  2FJE B;  3CCM S;  1TKT A;  4QBU A;  2X7I A;  4X66 J;  3S01 A;  2WOM A;  1TVR B;  2LP4 A;  2J0W A;  2QYC A;  4KY3 A;  4ZVO B;  5A0Y A;  2EKN A;  2B4O A;  1KEK A;  4KAI A;  1J5O A;  3H7H B;  2FQQ B;  5DLG A;  4HL9 A;  1CUL A;  1SH0 A;  3R6G B;  4GVB B;  2G2Y A;  4X62 J;  2K8G A;  5C24 A;  2R7Q A;  1IQT A;  2W7O A;  2M3D A;  3CDU A;  5E3A A;  1YJ9 S;  4W4M A;  3RBZ A;  2XMK A;  1RTI B;  4LIW A;  4RW4 A;  4Q45 A;  2XM3 A;  3NRB A;  5KG0 A;  1S10 A;  2DNR A;  3W61 A;  5L1L A;  3CXC R;  3HFK A;  3KJV A;  3BR8 A;  2MQM A;  1NHK L;  3P49 B;  4OJG A;  1RT2 B;  5DLF A;  4CNZ A;  3FCW A;  3R5J B;  3X3U A;  3A3N B;  3TJA A;  4ED3 A;  3I96 A;  3DRR B;  3T1H J;  4LR7 A;  4IG3 B;  1KOH A;  1WD6 A;  1JJC B;  2VH7 A;  3L9Z A;  1HBO A;  3F56 A;  3PJW A;  1SH2 A;  2Y8Y A;  5GME A;  5D4O A;  4RW9 A;  4UY8 T;  1VC5 A;  1X7V A;  2MLX A;  1WWH A;  1S0V A;  1FDA A;  2IAJ B;  1FD2 A;  4DR5 F;  4DMZ A;  5LT5 A;  3C15 A;  4DV7 J;  3NEK A;  2CPH A;  2AEJ A;  4DV3 J;  5EN1 A;  5GAD U;  1ZM2 A;  3T5J A;  2GZO A;  4ZVE A;  2VUG A;  2CPX A;  2P2C B;  4AND A;  1R6V A;  4K4W A;  1KBR A;  4FVC A;  1GT8 A;  4ILR A;  1P6T A;  1F0X A;  4Q2M A;  1RT4 B;  3CSK A;  1X4B A;  1IBM F;  5IQ6 A;  4OX7 A;  4JI7 J;  4GO7 X;  2DIU A;  4M63 A;  4BS2 A;  2CJK A;  3DXS X;  4GC7 A;  4CO3 A;  3OHA A;  1U0H A;  4DWI A;  2P9C A;  4KHP J;  4ERD A;  5C5J A;  4DHV A;  4PPZ A;  1BQM A;  4DV2 F;  1XER A;  1SL2 A;  4O3S A;  4DBQ A;  2BA9 A;  3QWP A;  1YRT A;  2DXD A;  2MJN A;  2PO4 A;  2NPI A;  2LDI A;  2FJX A;  3BDP A;  4J9L A;  3D6F B;  1NEE A;  2HND A;  1JLE B;  5CZV A;  3M2R A;  3ZZO A;  3MMB A;  2FDN A;  4RL1 A;  3RB0 A;  3DLG B;  2AYE A;  2V50 A;  4KHM A;  1FKA F;  5D0H A;  2IRY A;  2HBZ B;  4LRC A;  4KT0 C;  2XNQ A;  4Y2C A;  2ZUA A;  5D6G A;  4RKU C;  3THT A;  3DYA A;  4ZKA A;  1UTA A;  2IRX A;  4G1I A;  5IS2 A;  4LFB J;  3AA9 A;  3HVR A;  1U0S A;  1T9X A;  2P9G A;  4NLS A;  3ET6 A;  4DFJ A;  2E1R A;  4NMX A;  1LWF B;  3HX9 A;  5FLX Y;  5L38 A;  3DLH A;  1KN6 A;  3NMA A;  5K20 B;  2MQN A;  1IWG A;  1VYA A;  3O1L A;  2NYI A;  2VHG A;  1U2F A;  4RR5 A;  4EMD A;  3JQJ A;  2HZA A;  1SB6 A;  4CH7 A;  2UV8 G;  3HVW A;  2B7B B;  4DL2 A;  4NOH A;  3TAP A;  1TK5 A;  5A8K B;  3BSO A;  3TQ1 A;  3DLE A;  4B3M J;  2DEJ A;  1GH8 A;  3CCL S;  2HWH A;  5J1N A;  3SMZ A;  1WEX A;  2J7K A;  4HTJ A;  5IT4 A;  1TK8 A;  5CQG A;  2RH3 A;  1PO6 A;  2GHV C;  1TL3 B;  4DFK A;  2NZ4 A;  5A6P A;  1SCJ B;  2BM1 A;  2F4V J;  1NSQ A;  3GYX B;  3ICL A;  5LMU J;  3MI7 X;  5KFK A;  1LFW A;  2R42 A;  2F3J A;  1RWM B;  8ATC B;  2ZZN A;  2DH7 A;  2DNY A;  2O66 A;  1FJG F;  2PFF B;  2JWN A;  5H9E K;  4L75 A;  2W9A A;  3U02 A;  2V8H A;  2C2E A;  1DZ5 A;  3CC4 S;  1EET B;  1VC6 A;  2UUB F;  4ED0 A;  3IS9 A;  4JBC A;  2G2O A;  4B3T F;  1H2T Z;  2Q1L A;  3KLF B;  2X3D A;  5K8O A;  4J9M A;  1PAU B;  5IWA F;  3M9M B;  1R8H A;  3UO0 A;  3MPD A;  4ED4 A;  4GO5 X;  4ILM A;  4F7V A;  3I5B A;  3UDV A;  4IRC A;  2YNI A;  5K8N A;  3AD7 C;  5IOL A;  1XR6 A;  4RW7 B;  1NO8 A;  2V2K A;  1M90 T;  1RT1 A;  4DG1 B;  3C6U A;  5D4P A;  2DH8 A;  2FJD B;  5D0R A;  1TAQ A;  4WF9 Q;  4DV4 J;  3T5K A;  4CYU A;  4KYZ A;  3V6D B;  4CI0 B;  3NGS A;  3U27 A;  3FFI B;  1KQF B;  1U49 A;  3FQK A;  2HHH J;  1FDD A;  4HH1 A;  2GMJ A;  1XJW B;  3VQT A;  2JSX A;  1WEZ A;  1FXL A;  1VMB A;  1Q82 T;  1UKU A;  5DG9 A;  1FD8 A;  1B4S A;  5HAT A;  2B9W A;  3BDE A;  5K9F A;  2AJF E;  4C97 A;  2GW8 A;  2A1B A;  1C0U A;  5LJ3 Y;  1B99 A;  1M5K C;  5D0E A;  2PN6 A;  2ZJQ Q;  2W4P A;  3M6W A;  1QUP A;  3F0N A;  2Y8W A;  1BGX T;  3PKM A;  3CCQ S;  2NS1 B;  2MYF A;  3M4X A;  4DUY J;  4ED1 A;  5G4D A;  1P27 B;  3MR7 A;  4ZMM A;  2DNM A;  1RXO B;  1YVF A;  5BXI A;  2YKN B;  1OO0 B;  1XMQ J;  1VRT A;  3IAS 9;  4EBE A;  1QUV A;  1VIX A;  2BAN A;  4RZR A;  3NLC A;  2KXN B;  2GS8 A;  1NZA A;  3NNA A;  2BRK A;  3UWT A;  3P3D A;  3DOL B;  4AFF A;  2CQ4 A;  1D3W A;  1FRH A;  4PWU A;  2EVZ A;  1RP5 A;  4I2P A;  1HA1 A;  3UR3 C;  2I8E A;  4ZDN A;  2VPZ B;  3MTK A;  3I31 A;  4ID5 B;  2UXD F;  3O5T B;  4QIF A;  4JV5 J;  4DCO B;  5HO4 A;  1VRQ C;  2LQB A;  4B17 A;  4X4N A;  4KH1 B;  4NZ0 A;  4DLE A;  4HHJ A;  3BN4 A;  3OBI A;  2IJF A;  1TMM A;  1NK5 A;  4X4T A;  1U2C A;  3NL0 A;  3HMJ G;  3TWZ A;  3SV3 A;  1VDH A;  2WSF C;  5HQ8 A;  5ETR A;  1XNR J;  2J7W A;  1SKW A;  2RHS B;  5KOW A;  4RUB A;  1CEZ A;  3DDK A;  1RWV B;  1YJV A;  4NLR A;  1ZAV A;  1I5O B;  1J2V A;  1QVG R;  4JOU A;  3KG4 A;  4EO8 A;  4NEZ A;  4X66 F;  1LWC B;  1KS2 A;  5KFV A;  1QAJ A;  2VOO A;  3HHL C;  5K8P A;  4DQS A;  4A8X A;  3POT A;  2W9C B;  2QE5 A;  3GB0 A;  4QW9 A;  3U1M A;  3PTW A;  1K8A T;  1T03 B;  1IN0 A;  3BS9 A;  5HVH A;  1X4G A;  3GR0 A;  3PJX A;  1T05 B;  1UW4 A;  2J7U A;  2JRS A;  5GAG U;  3FBE A;  5AT1 B;  1UEV A;  4QIV A;  4Q8F A;  1DQ8 A;  1RCO B;  4USI A;  2MXY A;  2XLK A;  1RAC B;  5K14 A;  3GCX P;  3M2U B;  2B5J A;  5HQL A;  3FEY B;  4NPO A;  2CDQ A;  1AUD A;  3Q24 A;  1Q5V A;  3PW0 A;  1B7F A;  3O2I A;  3QO9 B;  4HLB A;  4OYW A;  3KOA A;  1VK8 A;  1D9F A;  4I2Q A;  2OFH X;  1LW0 B;  2RF2 B;  1Z1Z A;  5DS7 A;  2M2B A;  2GHW A;  3MMA B;  4C8M A;  2ACM A;  2VQF J;  3HP6 A;  4C2M A;  2RML A;  3R27 A;  1SKR A;  2C2M B;  4JI6 J;  1UJ4 A;  3T1H F;  2XYH B;  3D1O A;  3H0P A;  1RUS A;  1NHU A;  4DPO A;  4BBY A;  1VQM S;  2IM3 A;  4L3N A;  5I3P A;  2PD1 A;  1Q78 A;  3JTP A;  2IY5 B;  1A7G E;  2M70 A;  3T9Z A;  4A4J A;  2V4J A;  2YWH A;  1WC1 A;  3B82 A;  4ALZ A;  1BC6 A;  2R7U A;  4CRJ A;  5KFZ A;  3R2D J;  1U02 A;  4A48 A;  2GFF A;  2J0S D;  1OYE A;  4P74 A;  1WF2 A;  5DDO C;  4Y2A A;  3I87 A;  4HHH A;  4WE1 B;  4WXO A;  3KLG B;  4ZPB A;  1BLU A;  1HNX J;  2MGZ A;  1YJR A;  3DCA A;  2FY8 A;  2EFP A;  3VVU A;  5H9F K;  3BB5 A;  1ZM9 A;  3J7Z T;  1FTR A;  1MU2 B;  4HAC B;  2CQC A;  2CJX B;  3VGS A;  4DV5 J;  3NG8 A;  1U1R A;  3BBB A;  4P2X A;  5HLF B;  5HP1 A;  1QAI A;  1RT5 B;  4NZ7 A;  4JI7 F;  5DET A;  2EBE A;  5B0F A;  1WTB A;  2QT7 A;  2DO0 A;  2A6M A;  1X4E A;  4ELV A;  5A2Q Y;  2CZ4 A;  2ZZT A;  2MQL A;  4OYX A;  3PIP Q;  1RDR A;  2WSC C;  3TAR A;  3CJS A;  4Y65 A;  2HKE A;  2GGP A;  1RIS A;  2DXF A;  4ELT A;  1F5A A;  2HLT A;  1NK0 A;  3THP A;  5DM7 Q;  4ZS6 A;  4ED8 A;  3RGI A;  1WEY A;  3D67 A;  1VRU A;  2W2Q P;  4RLE A;  4PWW A;  4C11 A;  1UW9 A;  3LAL A;  4C0O C;  4F4X A;  1OYD A;  2RDJ A;  2ZE2 B;  1HI0 P;  4AYB D;  1VQ4 S;  2FVP A;  2DB1 A;  1M1G A;  2VV5 A;  4IYQ A;  3BPD A;  3CD6 S;  3CCV S;  1K9M T;  4K5S A;  2HGL A;  5GAE U;  2D3Z A;  2CXE A;  2K3I A;  2N3O A;  3JSY A;  3WZ0 A;  4PXB A;  4E98 A;  1IBK J;  2UUC J;  2ILZ A;  2M7S A;  3NS7 B;  1XIQ A;  4PRF A;  3PW4 A;  1DLO B;  2HZC A;  1TL5 A;  3F73 A;  5SUH A;  1W26 A;  4B3R F;  2YX4 A;  4HT5 A;  5J2Q A;  4DUZ J;  1QSY A;  2FPH X;  4I6Y A;  4Q7A A;  5A8W A;  2BM0 A;  4Y0F A;  4TU9 A;  3KWM A;  3NBP B;  3HD1 A;  3AXK A;  3FZ2 A;  1S9G A;  2RB7 A;  3JYT B;  3D0H E;  4CWB A;  2ZWP A;  5EUH A;  1TUG B;  4M5H A;  2X1F A;  1VQ9 S;  4MKB A;  1RAF B;  1IVZ A;  3ZTP A;  5F9N A;  4O23 A;  1MRO A;  2AYG A;  2BE9 B;  4B3M F;  3TO8 A;  2UUA J;  2CPI A;  5IV4 A;  3Q2S C;  2Z8Q A;  1NB7 A;  5M2P A;  2ZNY A;  3T1A A;  1RHR B;  3TA1 A;  5DQG A;  1S1X B;  4FNI A;  1AZS A;  5L39 A;  4UY8 5;  3Q8R B;  4BWJ A;  3CUN A;  4F04 B;  1NAQ A;  4XPE A;  3TYT A;  2F4V F;  4B9T A;  3MM9 B;  2F1F A;  2YX1 A;  5LMU F;  4YHH J;  4OHW A;  2WON A;  4DF8 A;  2BDP A;  3NY0 A;  1FWK A;  2RU9 A;  2Y1R I;  2E7W A;  2HWT A;  1GK8 A;  3CD0 A;  3L7U A;  3H98 A;  4KQZ A;  4CO2 A;  3TX0 A;  4A8M P;  3CJ4 A;  2V63 A;  4OYB A;  2DJW A;  3G82 B;  5KG2 A;  1VQK S;  2P5V A;  3N6N A;  1EKR A;  2HVD A;  4MK7 A;  4GVB A;  4IQX A;  4M5G A;  4ECS A;  3W64 A;  3MD1 A;  1NK6 A;  2VG6 B;  3MM5 B;  5ETM A;  3P5T L;  2HAI A;  3H4D A;  4DQP A;  4K4Y A;  5ETT A;  1RTI A;  2JLF A;  3ILL A;  1TR0 A;  3DDN A;  3TRG A;  3PRD A;  2QSF A;  1HNI B;  4RNO A;  2W24 A;  1YZ6 A;  4I69 A;  1RT2 A;  4LF8 J;  3A8E A;  4DV4 F;  3IBF B;  1JKH B;  4IG3 A;  3AQO A;  3I82 A;  3VV2 B;  3BV8 A;  5KAK A;  2QYG A;  2HMI B;  4J9V A;  1HWU A;  2HHH F;  2EFV A;  2ZHB A;  3ENW A;  2N7C A;  1PC5 A;  4LQ3 A;  3K5O A;  1FWL A;  4DLG A;  4UT4 A;  3R5D A;  4PXC A;  4AQY F;  4K0K F;  3VTI A;  2KJV A;  3ETO A;  4H54 A;  2RDD A;  4AL6 A;  5CD4 A;  1Q1K A;  1V5I B;  2O67 A;  2RQ4 A;  5GAD I;  2QA4 G;  2E1C A;  1VR6 A;  1F5B A;  1DQ9 A;  1NUE A;  3FCH A;  3FK4 A;  3DLB A;  4RU9 A;  3PCO B;  3G6Y A;  4AL5 A;  4J37 A;  5IM0 A;  2MB0 B;  4DUY F;  3W9I A;  1RT4 A;  1NSP A;  2KZM A;  1N5V A;  4DSK A;  5EGY A;  1FWP A;  1SPB P;  3CME S;  2XHW A;  3M1V A;  3W60 A;  1XMQ F;  2Q6B A;  4RW8 B;  2YPY A;  2CJA A;  4LVN P;  3NNH A;  4N56 A;  1M5V C;  2J9D A;  9ATC B;  4DSJ A;  3HHN B;  1JLF B;  5L1J A;  4RNH A;  3M8S A;  2LQ5 A;  3NOC A;  1L3T A;  2HFO A;  1SVD A;  4LSL B;  3H5U A;  1S1T B;  5F41 A;  4JV5 F;  5BR8 J;  1JLE A;  1D09 B;  4A8Y A;  1VBX A;  1WEL A;  1FRJ A;  5LXR A;  3IGN A;  3WIV A;  5D3G B;  2DCL A;  4I68 A;  2P6S A;  4OV1 A;  4X4Q A;  1WTF A;  3AOC A;  3DOM B;  2ZH3 A;  3CJ8 A;  3QRP A;  3ZXW A;  2NUH A;  4MKV A;  4MFB B;  1XNR F;  4RNM A;  3KHG A;  1YIT S;  5JJB A;  3WQP A;  1HBN B;  3PW7 A;  4C0B A;  1SL1 A;  3MUM P;  3GP9 A;  1LWF A;  1HWJ A;  3BKU A;  1WC3 A;  1LEO A;  3GMG A;  3RTV A;  4X64 J;  2DRB A;  4PXE A;  4WP3 A;  4BCA A;  2GVD B;  4F50 A;  3CMA S;  1U1O A;  3HVA A;  1FF2 A;  5KFD A;  4YB5 A;  4FYW B;  2FVC A;  1OPI A;  3AQP A;  3MAH A;  5A8K A;  1WHX A;  2VKR A;  2WZ1 A;  1OJ4 A;  5C25 B;  5F3T A;  1JMT A;  2CPZ A;  3RRK A;  3G96 A;  2R8J A;  3VGU A;  3DLL Q;  3G6X A;  1QSL A;  1A6L A;  5F8L A;  2BJ3 A;  2OFG X;  4DS4 A;  1UEK A;  4MIB A;  1FRI A;  2YX7 A;  1TUW A;  2VQF F;  4LF4 J;  2VL1 A;  4JI6 F;  4DU7 A;  2H48 B;  3ISZ A;  2KVQ E;  1S5Z A;  2EC2 A;  3Q23 A;  4ZLJ A;  5J2M B;  2NQP A;  1Y10 A;  4R8U B;  3FDS A;  4PEO A;  3C16 B;  3FMW A;  1Z2L A;  4K4Z A;  1OY9 A;  5IT0 A;  1H2U X;  1EET A;  5KFR A;  3TVY A;  3WBZ A;  4YR2 A;  4LSZ B;  3DHX A;  1IKW A;  1VBY A;  5F8G A;  5IC4 B;  4F8R A;  2WVC A;  1FCA A;  1E6Y B;  1HNX F;  5HBM A;  2HQC A;  4M1K A;  3N01 A;  2JC0 A;  4JI4 J;  1AXQ A;  2EWH A;  2BJ9 A;  1KQG B;  4DV5 F;  4DQQ A;  2OUG A;  2FHO B;  1PIE A;  3EM1 A;  2KYX A;  5EX0 A;  4RW7 A;  4CLZ A;  4DG1 A;  1Y4Z B;  4P2F A;  3G6E S;  3ENV A;  1T9V A;  1Q8I A;  3GII A;  2XTJ P;  1KVK A;  2ALY B;  2IRU A;  1N36 J;  4WKY A;  3V6D A;  4PCQ A;  3HJV A;  3FFI A;  1PIL A;  5SZT A;  1F9E B;  1WC4 A;  4ECR A;  2LXU A;  1XNQ J;  3S1T A;  2BE7 D;  1TK0 A;  4ZPV R;  3NNC A;  3MM7 B;  3LAK A;  4KV8 B;  3H5Y A;  3GV7 B;  1MLA A;  5IXU A;  3R3T A;  1BHN A;  4J5O A;  4M5I A;  3SCL E;  1WAC A;  2AMC B;  3QBC A;  2QA1 A;  3D7S B;  5E3Q A;  3Q22 A;  1FHT A;  2C2N A;  2R8H A;  4RWW A;  5G0R A;  5KG7 A;  4U7U D;  3SSQ A;  3H2V E;  1IBK F;  2UUC F;  1CLF A;  1N5Q A;  4JI5 F;  1TL1 A;  3OTE A;  1SQG A;  4DUZ F;  4PG8 A;  2ADC A;  4N41 A;  4DCP B;  2OO4 A;  1UWA A;  1J27 A;  1DJ0 A;  1VQ5 S;  3BPS P;  3R5G A;  3MFH A;  2ZBR A;  1RBA A;  1W2I A;  3S6E A;  1T8E A;  4A8O A;  2CQH A;  3MPW A;  3DDI A;  3C8Y A;  1BXN A;  3DOL A;  3Q8U A;  4M5D B;  4C3M A;  2YQ3 A;  3CJ5 A;  4UUW A;  3ZZU A;  2DY9 A;  4USJ C;  2XSJ B;  1HWK A;  2CJY B;  2R7X A;  3TZX A;  4ECT A;  1YJW S;  2KI2 A;  1HL6 A;  1JX4 A;  1JJH A;  3LW5 C;  4ID5 A;  4NRU A;  4Z2X A;  2G0C A;  2Z2Y B;  4AXI A;  4PYD A;  1IQZ A;  3CB4 A;  2HVZ A;  2AD9 A;  2R2R A;  3UD3 P;  3TAM B;  5E2Q A;  1FJC A;  3THV A;  3ONQ A;  2GO8 A;  2GQQ A;  4M5N A;  5ETL A;  4A46 A;  2UUA F;  3ULH A;  1S6Q B;  2XEX A;  5LSL A;  2F65 A;  2ASL A;  5DDQ C;  3NKY A;  4QR2 A;  2YKP A;  2C3M A;  1C0T B;  1YBT A;  3QGP A;  1FER A;  1G4C A;  1HAR A;  4WFB Q;  1Q8L A;  3TA2 A;  2VFS A;  1XR7 A;  2NXC A;  4YHH F;  3MR5 A;  2ZBP A;  2CUY A;  1B3T A;  5H9E J;  3I9Z A;  4N47 A;  3V4M A;  3UD4 P;  3DNC A;  1LWC A;  3MPY A;  4E2F B;  1NK9 A;  4IH5 A;  2KB2 A;  4USW A;  2CZ9 A;  3Q89 A;  2AV5 A;  1X0F A;  2HK2 A;  2W9C A;  3BRE A;  3J7Z 5;  4C8O A;  1FI4 A;  3OFE A;  3JTO A;  2HGM A;  2HFN A;  1T05 A;  2QA2 A;  3NOG A;  2ZWO A;  4F3O A;  4DFP A;  2M0G B;  3M8W A;  2GAH C;  2CG4 A;  2E1A A;  1KD1 T;  4DX6 A;  1KSP A;  2FVR A;  2BJD A;  3OQ2 A;  4CH1 A;  2L41 A;  2OSR A;  1RQ0 A;  1RWO B;  3QO9 A;  1TZ0 A;  2VJV A;  2CQG A;  2OPQ A;  2QV6 A;  4ANE A;  1L3V A;  1TP7 A;  3LQV A;  1LW0 A;  2RF2 A;  5DG8 A;  3MMA A;  2WTF A;  1C4C A;  4F02 A;  3VQS A;  4UOC A;  2ZVS A;  1RGV A;  3GG1 A;  3GFX A;  4NYP A;  4LF8 F;  4WU3 A;  4P7V A;  3GZ7 A;  3MCO A;  4JV0 A;  2LA6 A;  2XS2 A;  2YTC A;  4N8N A;  4RX6 A;  3DRX A;  4OYZ A;  4TLQ A;  2G13 A;  4ZCL A;  1PCA A;  2P8I A;  3SQG B;  3I0R B;  4DPU A;  2FJB B;  3J81 U;  3CCS S;  3E2E A;  3DRY A;  2V2Z A;  4X4V A;  2O5D A;  5KFM A;  2M4M A;  1HIY A;  1SIW B;  2BW2 A;  4EU0 A;  1CQM A;  3Q8Q B;  3BBC A;  2XMW A;  2ZH2 A;  1TKZ B;  3KLG A;  1HI8 A;  2AJ1 A;  5BYS A;  2Z57 B;  1S99 A;  2EPI A;  1WI6 A;  1R3N A;  2CVI A;  1D9A A;  1FRX A;  5I3Q A;  3FBF A;  1MWZ A;  1R43 A;  2W8K A;  5HLF A;  4M5K A;  2ZZM A;  4PQA A;  2WAQ D;  2G2Z A;  4JV1 A;  4IOB A;  3M8Z A;  3GG0 A;  3VZH A;  5I42 B;  4WK1 A;  3W65 A;  3KTQ A;  1TEL A;  3RR7 A;  3MD3 A;  3R7N B;  4P75 A;  2WRM A;  1YDL A;  5HSP A;  2KFN A;  2Y0S D;  2UVV A;  2QLW A;  1XTZ A;  1MW7 A;  5BR8 F;  1T7P A;  2B51 A;  1XN9 A;  2HNZ B;  3P6Y C;  2ZE2 A;  4LF7 J;  2KL8 A;  1HR0 F;  3IWL A;  4NI2 B;  2AU0 A;  3FRY A;  3EXY A;  1SJR A;  3UCZ P;  3VWS A;  4HEA 9;  2Z58 B;  2VA2 A;  3TZZ A;  2XZW A;  1VFJ A;  4RBU A;  1PBU A;  4TVA B;  4N77 A;  1FK9 A;  4C7Q A;  1CJU B;  3EGV A;  4DL5 A;  1N88 A;  1UP1 A;  3K2Y A;  3MFI A;  1U1Q A;  1T02 A;  3B4M A;  1DLO A;  1X31 C;  3WC0 A;  3QLH A;  4L3K A;  2JHE A;  2AJ2 A;  5HK4 A;  5LL6 d;  2FLL A;  1OWX A;  2W2N P;  2CPJ A;  2A6O A;  4YME A;  1V3S A;  4MAK A;  1KLM A;  2E44 A;  4NLQ A;  3NBP A;  1CJK B;  4IH7 A;  1R0B G;  1VQP S;  2IJN A;  2L9N A;  3FC9 A;  4DQR A;  2BR0 A;  4X64 F;  1U1N A;  1TKX B;  2E5L J;  4CDI A;  5EHH A;  4M5M A;  2LU2 A;  1S1V B;  5HMX A;  4FVM A;  1FJE B;  3OR1 B;  1Q53 A;  1UVN A;  1IBL J;  4ZP8 A;  1ZYQ A;  2OPS B;  2YXL A;  5LSO A;  2IM2 A;  3KLI B;  1FX2 A;  4ZPT R;  1VLY A;  1N5Y A;  3KHH A;  2QO3 A;  2V0N A;  5FDL B;  3RAQ A;  3GFY A;  7AT1 B;  4DS5 A;  4KO0 A;  2M9K A;  2ZH9 A;  2BQR A;  4A8W A;  2MKS A;  3MMJ A;  3NGD A;  3FNN A;  3GPA A;  2AYM A;  1GXL A;  5KT2 A;  4YN3 B;  2RE1 A;  4N5S A;  1CJT B;  2ZKU A;  2ZBC A;  1N48 A;  1FDB A;  1RTJ B;  2DIV A; 
#chains in the Genus database with same CATH homology
 1FFW B;  1FWP A;  1EAY C;  1FFG B;  1A0O B;  2LP4 A;  1FFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...