1A0OB

Chey-binding domain of chea in complex with chey
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
b'PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEY
publication title Structure of the CheY-binding domain of histidine kinase CheA in complex with CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
total genus 17
structure length 70
sequence length 70
chains with identical sequence D, F, H
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1a0oB00
1FFSB 1FFWB 1A0OB 1EAYC 2LP4A 1FFGB 1FWPA
chains in the Genus database with same CATH superfamily
2OH2A 1EHWA 2F65A 3HHDA 2L48A 2EBGA 4ZVOB 3GG1A 1QAJA 3CCTA 3PRBA 3NMAA 1LW0A 3AJ1A 3TX8A 3QRPA 1SV5B 3PJXA 1U09A 2PC6A 3LH2S 5DO2A 4E2FB 2Y1IA 5ETQA 3MR2A 5B08A 4QU7A 1HQEB 4DMZA 1Q86T 3IG1B 2GMJA 3IO1A 4Y2IA 2HNYB 1FKAF 1HNXF 1HBNA 2J8AA 2RVJA 1YQHA 3R97A 1G7CB 2BE9B 2ZD1A 3OXFA 1XEZA 2C2RA 1GEHA 3KXDA 4CO5A 5JMNA 1IKVB 3K0JA 3HMJG 4MFBB 4DU8A 1BWEA 3V6JA 1LQ9A 5DGBA 5DM6Q 4IG0A 5B0EA 1Y4ZB 4LR9A 1ELOA 4D3HA 5DQHA 4HL9A 1FFWB 3MPDA 1JLBA 2AP6A 3PX0A 2XSJB 1D8ZA 4TU8A 5HQ8A 3UDLA 2MTLA 2E5LF 2V2KA 2R7QA 3E51A 4OJGA 4DSIA 4ECWA 3OFEA 3I0RB 1WC3A 2H3EB 5HO4A 2KZZA 2DNHA 4ECUA 2E5LJ 1UL3A 2BKOA 3M6XA 3POTB 2KXNB 3AOBA 1PO6A 1FRIA 2OD4A 1TMMA 3TJ9A 5JVHQ 1P9YA 3OD2A 1RP5A 3PR5B 2J0XA 1MMLA 2YQ3A 3VAMA 1LK7A 2LA6A 5KG7A 1GQEA 3SCIE 4NXMJ 1E6YA 3JAMU 4WZQA 5L9XA 2IC3A 2V8GA 4UT4A 3FZBA 1ICEB 3EXYA 1FVQA 2FB0A 4OIXA 3KK3B 1EIYB 4YY3F 4C8NA 1ZOTA 5KFQA 2M8DB 3HD2A 2NCKL 4NLXA 3CDUA 4XPEA 1U6ZA 3DN9A 4WFBQ 3HT3A 5ETKA 1VS3A 1N34F 2FVPA 2GJFA 4NEYA 2F3JA 4DCOB 1UMJA 4CCHA 1FRKA 4LBPA 2XO6A 1L3SA 2NLWA 1GXTA 3HT0A 4PG7A 1T0TV 3D1HA 4Y0FA 2ALZA 3KHHA 1N34J 1HR0F 3M2RA 5EWGA 4ALZA 2R8IA 1SL0A 2YWWA 3P4UB 5KFAA 4FYXB 1UPMB 4E98A 2YWKA 1HWUA 3GCXP 1XIQA 1N36F 1JX4A 2QO3A 2RRNA 2AT1B 2ATCB 2HBZB 1EP4A 4DQSA 2K7KA 2RDIA 2UP1A 2XBPA 4OZJA 1N36J 4EBEA 3LF0A 4YOEA 2F8MA 2XWYA 3CJ2A 4DQQA 4P52A 2RKIA 3M8RA 1IWAA 4L3NA 3DRPB 1HIYA 3SQGB 3ILJA 3CCMS 4JV2A 4I67A 4CO4A 5HN0A 3FSXA 4I2QA 4WE1B 1Y7PA 4ZLLA 5AXKA 5KT6A 2DNMA 4M5GA 5D3GB 3PKYA 5J2PB 4U96A 3JSMA 4Q0BB 2KT5A 1T7PA 1WKKA 1QJHA 4EK2A 4CO3A 2QLFB 3ETOA 3R5DA 5KFSA 2RT3A 1LW2A 5EX3A 3L09A 1C1BB 4QPTA 4F4KA 3PRDA 3R27A 4WTOB 5GAEI 1FF2A 4ZJQA 4PXEA 4Y2AA 1YBAA 5A76A 3T6BA 1RXOB 1CPZA 4LRAA 2LEBA 1VQ5S 1GT8A 4ZN1A 1JMTA 4F50A 1Q8IA 1RB0A 2Y1LB 2YKNB 4H4MB 3M6UA 5LJ3Y 3FQLA 4ECRA 3BZQA 5AJ3F 2PI4A 4ZS6A 3BSCA 3H42A 4FPRA 3ITHB 3NAIA 5IM0B 2HHVA 2KL8A 2V6AA 5IS2A 4M5DA 1Y0HA 4NLUA 5AJ3J 1V6HA 4YB6A 4NLDA 4DR6F 4DV1J 4PZVA 2BXJA 2OPQB 2XI3A 1PSDA 2NSCA 3G71S 3SDEA 2VD3A 1Z1ZA 2YKOA 2VDHA 4DEZA 4ZA1A 3W63A 2K06A 2PGCA 1HBUA 2MMYA 2KG0A 4DR6J 3KK1B 3LQVA 2HHQA 4ZIWA 2KVQE 3NGDA 1S99A 3C19A 4X62J 3BR9A 5J1NA 2EXUA 4FN5A 2K1RA 5FJ4A 2IM0A 3V81A 3R5JB 3DM2A 2HEKA 2K2PA 4QIGA 2VQFF 1S79A 4WWSA 3UDEA 2KM8B 1MROB 2Y1RI 1TKXB 4K0KJ 3A3OB 1XQIA 3EMTA 2DNRA 2XY5A 1KONA 3VAKA 3DLGB 2VQFJ 3CSKA 3MECB 4U95A 2IYGA 1YI2S 3OTOF 1IBLF 2ZDPA 2R8JA 2NREA 2B5JB 4OHWA 2BE2A 3I0SA 3J7YI 4L72B 1RABB 4OLOA 3CC4S 4DV3F 5C5JA 1IBLJ 1K0VA 3D1QA 2MZSA 4DFKA 5K5MA 4X64F 1SH0A 2W25A 4PR6A 2E1RA 3GB0A 4DV3J 3UN3A 2UVWA 2QT7A 1CJVB 1X5OA 3CCJS 2HNDB 4KGXB 2FPHX 4X64J 3ENWA 1S97A 3V4IA 3TQ1A 5T41A 3JB9k 2YX4A 2KYXA 3PVXA 5KFYA 1S9GB 3T9ZA 2ASLA 1XWLA 4DL5A 2B6AA 2NUHA 2K3IA 2J9EA 1JLQA 3LWLA 4K4SA 4ED3A 2N7CA 1B64A 1CJKB 1G4CA 4UUXA 3CMES 3NNCA 1RTHA 3T19A 2V8HA 2H5JB 2JNJA 1U02A 1TKDA 3TJ8A 4USWA 4CNYA 3IBCB 4I6WA 3V6DA 4GC6A 1E6VA 3L9ZA 2ZE2A 4ZP7A 3O2IA 4KO0B 3W8GA 3ICLA 1WOOA 1SB6A 1C4CA 1NK5A 2BV3A 4P6QA 2AEJA 2R7WA 4LSNA 4O3SA 3JTPA 1KOHA 3UN5A 3FBEA 2O1PA 2ZOMA 2Z2LA 3U27A 1NSKL 2C3OA 3IFEA 1QM9A 4ZVUB 1N4LA 2BA9A 2QG9B 4J9VA 1WHWA 4KPYA 1RGVA 3K7RA 4OHYA 4O3PA 4RW8B 2UUAF 2RILA 3RB0A 1TKZA 3G87A 2RU3A 4RW7A 4A46A 1S7IA 4URSA 2MSTA 2QA4G 2UUAJ 3OBIA 1VRUA 3N0VA 3LGNA 1U1LA 3VAGA 1UVNA 2XMAA 1SUQB 1RLCL 1Q5YA 1D09B 1PJ6A 3Q86A 1T02A 3EDRB 3UD5A 1T8EA 1RHUB 1F9FA 5KFKA 3GJRB 3HVWA 5KFWA 5F8LA 2WSEC 2DKOB 3CO0P 2MPUA 2M88A 4DDFA 5LSOA 4Q43A 1HWKA 3RAMA 2PO4A 3ZTQA 4JOUA 3KFWX 4GO5X 4YP3A 5FDLA 2LMIA 2PA3A 1K1QA 5E2QA 2VU5A 2X1AA 1EAYC 1O0PA 2XQCA 3C6UB 3O6QA 3D6FB 2SXLA 3LP2A 2ZUAA 1J2VA 2DB1A 1YJTA 2HPUA 3K2YA 1IJFB 4N5SA 4LF9F 1S1TA 3UNGC 5KFUA 1MN9A 4LRBA 4JI0J 4P72A 2B4VA 2XGPA 3OR2B 3C3LA 2HRYA 2HS0A 2IRUA 3OQ2A 3VGUA 4OQJA 3G82A 5D8HB 2F8HA 3FDSA 1UEVA 4LF9J 3DRXA 3MEDB 4F4YA 3IN5A 1B70B 3BH7B 2CG4A 4V1Ak 2VFVA 4DF4A 3HSJA 3QIPB 5E3CA 4WKYA 1HWIA 2DISA 2V68A 3DRSB 5D6GA 1U0HB 4UTGA 5JJBA 3DLEA 3GIKA 3TVKA 4DPXA 2B9EA 1UWBA 3HHNB 2EVZA 4FKXA 2DNLA 1S0VA 4EO6A 2I0XA 3OTCA 3IR5B 3KNAA 4JV1A 3QFHA 4USTA 5G0RA 5IV3A 2Z58B 5K14A 4WU2A 1XR6A 1NNDA 2YKPA 4DSKA 2Q3PA 4B9NA 3LP0A 3TJAA 1FE4A 4Y2CA 4IG3A 4MYUA 2XZWA 4NLVA 3GSIA 4R8UB 3T6JA 1VJQA 3OL8A 4I2PA 1B0PA 2BRKA 5HATA 2VHGA 3DOKA 2XMUA 2MKSA 2C3UA 4PWWA 4OFZA 4CIOA 3UVJB 1OIAA 1TL1A 2DEJA 3D6HB 4NCGA 1WF2A 3D0GE 1N52B 4HDGA 1RT1A 2QA2A 2OI2A 1MG7A 1CG2A 4Z7YA 3A3NB 2CJYB 5D0EA 1DTTA 2Y9HA 5T7LB 2Z56B 4P2FA 2UZAA 4OYBA 3BKTA 4KYZA 3AA8A 1JLBB 2IY5B 2YY3A 3KNGA 4PABA 2HFNA 5ETLA 2RHSB 2JLFA 1YBTA 2PMHA 2V69A 2O01C 3PHEA 4PYAA 2YTCA 3KLGA 1HNVB 1S1VA 2G9OA 4ED0A 1XR7A 3MCSA 1B7YB 4DX8H 3CTRA 2FUG9 4X4PA 5HMWA 4M5JA 1X9SA 5J2MA 3S8SA 1CS4B 3VAJA 3CB4A 1HBMA 3VWSA 1D8YA 3BN4A 3LANA 1T9VA 2B4UA 3EICA 1ZZNA 3QGIA 2YKMB 1RWXB 2HVZA 4P2MA 5DG7A 1VGYA 2XYPB 4O0NA 3A3PB 3H2LA 1YJRA 5B0AA 3RU0A 1KTQA 3DKDA 5D0HA 1FDNA 2YKAA 4OMFG 4KHPF 4HH1A 2GAHC 3TAQA 4ZN3A 1HARA 3QGPA 4N7TA 4DQRA 4HTIA 3H20A 4KHPJ 2BZ2A 3MMJA 1U1RA 2AZ1A 1WHVA 1VHFA 1S6OA 2IJNA 4RWWA 2VFRA 4I7FA 2PSZA 4I6YA 4PQAA 1RHJB 1K44A 4OHXA 4RW6B 3KDNA 4PRFA 2C2NA 3THPA 4N8OA 2E66A 3QQCD 3D3BJ 3GJQB 1MU2A 3JS9A 3NCRA 1GTEA 5HLFB 4RNHA 2IYIA 5L1LA 2PEHA 3A8KA 4CLWA 5H9EJ 3BBFA 3VHQA 1X4EA 1WC5A 2O5DA 3SSSA 5IOLA 2KXHA 2ZNZA 1IWGA 1HNIA 1RK8A 4PWDB 2BKPA 3T1AA 3AHPA 3DI6A 3B78A 5AXMA 2N4DA 2C2OB 1XMOF 2RUGA 2W8KA 1TR0A 5C25A 2VBZA 2R8GA 2B51A 1A6LA 4BLGA 3NCPA 4C3KA 1RA7A 4MKVA 2QV6A 1F9EB 1XMOJ 2B7CB 3Q8RB 5B0BA 3DLHA 1RBOB 1X4AA 3M2UA 2H4WB 4CDIA 2O3DA 1T03A 1LWCA 2ZBCA 2E9RX 1BC6A 4KKOB 2HQFA 3HLUA 2WRMA 3FZ2A 2FHMA 4LF7J 1NRKA 3G6ES 4IRCA 1S0NA 2OTLS 4RW4B 2E1AA 4KR0B 1BQNA 1KLNA 2V2VA 4OYWA 2NS1B 4L3KA 3WIVA 4DXLA 1KQFB 4Y6IA 2Y1JA 3KMSA 4Q5VA 3DRRA 4NASA 3JSRA 2BJEA 2V2QA 2NXNA 2DPIA 2YH1A 3PZPA 4M5DB 5C42A 2OKQA 5M2RA 4IRDA 1BUXA 1V3SA 2W2MP 3ZNUA 1TK5A 1YGYA 3MMBB 2DHXA 4ENOA 3WX4A 3EX7B 3KHGA 2IA0A 3TW0A 4UUWA 2DR6A 3MI7X 3HVTB 1C1CA 5C24B 5D77A 3EZ5A 4MK8A 4DCPB 4HACB 4ZDNA 3U1MA 2K1RB 2C22A 3CCQS 3QLHA 2QLBB 1NDKA 3CXCR 1WKLA 2HNZB 4DPWA 3L7PA 5CABA 1OSDA 3AY0A 1QVGR 3NG8A 3ET6A 1CULA 3KLEB 3WX8A 1SPBP 4Z37A 1GTHA 2DNZA 1BLUA 2BABA 1RT4B 1XK8A 3ZXWA 2BE2B 5ETTA 3UWTA 2NPFA 4Y3CA 4QR0A 3BH6B 3V6KA 1FX2A 4F02A 1U8WA 1RT2B 4RU2A 1F9HA 4ID5B 1X9WA 4YFUA 2JLGA 4FXWA 2AGOA 4RWXA 2EC2A 2CNLB 3TUPA 2W4DA 2OELA 3DYAB 3K5MA 1U6FA 3HJVA 3AD8C 1KVIA 2HAFA 3DMJA 1V9OA 3MAAA 1KRPA 1F2GA 3V4IB 3MCOA 1X4CA 3HZGA 1HQ2A 3Q8VA 4IFYA 2CUYA 2XCPA 4ES3A 2LQBA 1BWVA 3DNCA 4DUZF 2HFVA 3J80Y 1TL4A 1VIOA 3D66A 1G6BA 4NLQA 1HMVA 2K7JA 2KJVA 2CPEA 5CYQA 1R8AA 3T5HA 4DUZJ 4KC5A 4H4KA 3TAMB 4AL6A 1IKYA 3P6YC 1IKWB 2LQ9A 3LAMA 2CADA 2AJQA 3JQJA 4MIBA 2GV1A 5A8WA 2RQKA 3ULHA 1S49A 1TP7A 2CAJA 2R8HA 4X4VA 2OIHA 5CD4H 2ABYA 2PMWA 2FJEB 4ZIVA 3D28A 4RBTA 3IA0A 2IVFB 1ACMB 1AUSL 2G13A 2DNKA 3CDBA 3BBCA 2GGPA 1TL7B 4RW9A 3LPYA 4LSNB 3IBWA 2OHDA 3HJFA 5F0WA 2HHSA 3DGPB 3EVMA 2M5YA 1NK0A 2AGQA 1FERA 3D68A 1P27B 3GMGA 3PFEA 1D0EA 3PW7A 4LQ9A 3PEHA 5DQIA 3LTOA 4AXJA 2BMBA 1QD1A 3UFCX 4ZJOA 1U7LA 2YNGB 4Q8FA 5HMZA 2Y8YA 4HT5A 3DHWC 1H72C 4PCQA 1HFEL 3I9V9 2CQBA 3CCWA 4OX6A 2KJWA 2I6WA 1QUPA 2HVDA 5CYMA 3KJQB 5ETVA 1L3VA 1SC3B 2MY8A 4CNZA 1FD8A 2VIHA 2LA4A 3WIUA 1RAIB 2D3OR 1FEHA 1FT8A 2J9CA 4DR1F 5FDLB 1DFDA 2HSEB 3MURP 2R7UA 2J7UA 2YWFA 2QYGA 3W8PA 2V34A 1RHQB 2DNYA 4C3LA 3OJUA 3FKBA 2HGLA 1LWXA 2QMWA 1TV6B 5KG4A 1VQSA 2ZH6A 4IUFA 3AQOA 2DH9A 4OI4A 2J9DE 2XZTB 2Q79A 2ZC4A 2UXDF 3IRXB 2QLWA 1MMNA 3QJLA 1U1QA 3MEKA 5HVGA 1VC6A 3QAUA 2UXDJ 3DCAA 2HHPA 3LP1B 4MJKA 2BANB 2HW3A 2I5JA 3TZZA 2D9PA 1GFWB 3P49B 3G86A 4K4YA 3D0HE 3FJ2A 3Q2SC 5EX0A 1MN7A 4O3QA 2XMTA 3TX0A 2H51B 4NLSA 2ZH5A 2IM1A 5K14B 4U9RA 3MMCA 2UUBF 3AD7C 1AROP 3QFWA 3ZTPA 2RAQA 4DL4A 5MAOA 1HPZA 2NXJA 3SIPB 3A4TA 4JI8F 3LP0B 4MTPA 1RWWB 1SH3A 4QIWD 4K50A 2XMVA 3KLFB 2QN6B 5K8PA 2UUBJ 2VG7A 2JC1A 3TUJC 3TUIC 1JNZB 2AQ4A 2DCLA 4JI8J 1PC5A 3BGRA 2WVDA 4A8FA 4I2PB 3MEGB 1ITPA 2CJKA 1NKEA 3DOKB 4WK3A 3EZOA 4O3OA 1NJIT 5HSPA 4WZMA 4B3OA 1ZPVA 2RQCA 1Y9OA 2XG8A 2YBVA 1S9EA 4GMKA 2FJAB 2FJVA 4U7UK 1ZBTA 4QU6A 5K8MA 2CQ0A 4LVNP 2J7WA 4PPDA 4M5LA 5GAHU 8ATCB 4FS2A 5F9NA 1LWEB 4QJVA 2EFGA 1NK4A 2I2YA 2QA4S 3A13A 2FD2A 2BJ1A 4B9LA 3H98A 2GJ2A 4ECXA 2ZH8A 2OGUA 1WDTA 3C46A 4FVCA 3CDEA 3PW5A 5J2MB 4X4OA 2A18A 4FXDA 3EJMA 1R27B 1ZAWA 2DGQA 2H65B 2ACYA 3MWBA 5KFIA 4RR5A 3KLHB 3HKZD 3TAPA 3G96A 2GHPA 4C48A 2FJDB 2H1YA 1IBKF 4F0KA 2OMLA 5HBMB 1WC1A 4IYQA 1FNMA 4C2MA 3CJKB 3J81U 5GVQA 3H2VE 2HQCA 1AZSA 4N56A 1IJEB 3H5YA 4NA3A 1IBKJ 2DPJA 1VYAA 4P71A 5EN1A 2A0FB 1KN6A 3I5BA 3K57A 3W62A 3EYZA 2J6TA 1CQMA 4JV0A 2ZH7A 3GV7B 4G1QA 2QLXA 4WPAA 4YDDB 3KOAA 5K8OA 3NGUA 1T9WA 5KG0A 2IAJA 1S6PB 4WTYA 2AX1A 4KH1B 4USUA 2U2FA 2ZBPA 2WVFA 1OS5A 2AMCB 4F4WA 1WI8A 4KT0C 4R25A 2B7BB 1F60B 1BXNA 3IWLA 3EE3A 1YKWA 5D0RA 2XY6A 3LOUA 2M52A 2G0IA 3HULA 1V5IB 2OPSB 4B9TA 2YWGA 2CDQA 3HZEA 2D69A 3S7RA 2FZGB 3GFHA 5J2QA 1Q8BA 2LU2A 4J9MA 3GWCA 2IDEA 2XB2D 3EPGA 1SL1A 5JVGQ 1HNIB 4CLFA 2LXFA 4DR5J 2AEFA 1XR5A 2CNKB 2PEBA 5A2QY 2VFTA 4LBHA 1S9FA 2ALYB 4K4WA 2VA2A 5C25B 3GYGA 2OUGA 2B3TB 1SV5A 2EG2A 1S1WA 3NEKA 3IG1A 4YHHF 3M2UB 5KOWA 4QYZJ 2V2ZA 1EARA 2HNYA 4YR3A 5AE1A 4TYBA 2VJUA 2R4FA 2LQJA 2RMLA 3DC2A 3HD1A 4ZCIA 1HI0P 5IT9U 4YHHJ 4FBTA 2MKIA 3T5JA 3M8QA 2RSQA 4DV0F 1S7HA 3SSQA 1HWLA 3LPEA 4JI3F 4ZPCA 2FJBB 4DS5A 4OI0A 2R2UA 2EFQA 2IIHA 2V0NA 2MLYA 2MZTA 4CLKA 2W2PP 5L46A 1IKVA 1WDDA 4JI3J 3QZ7A 4MFBA 4DJBA 4DU7A 1U48A 1HNZF 1H3DA 4KGKA 3CF5Q 4MH8A 1IN0A 2X1BA 2CPJA 4L73A 2FZKB 4B3RF 1RTDB 4U6PA 4LF8F 2ZH3A 1WOSA 5GADI 2JLEA 1HNZJ 1X4HA 4B3RJ 1UW4A 4LF8J 3K58A 1FFGB 3I0RA 3D6TB 2HZCA 3CJRA 2MKJA 1FJGF 3GFXA 1RLDA 3POTA 1WHXA 1KBRA 2Q66A 1RT5B 1PC4A 5EHHA 1FJGJ 2JSXA 1AYEA 2RDDA 5I42B 4J5OA 1F6TA 3OT9A 1UCNA 5A8RB 2UUCF 1P9QC 4BWJA 1B3TA 4U7UD 3KK3A 3N6MA 4KV8B 4QR1A 1T95A 1AT1B 2HBQB 3P5TL 2E9TA 2ZEJA 1JJCB 2UUCJ 2MQMA 4V19X 4P7TA 4I64A 1IQZA 1VOMA 4NA1A 3CCVS 1NMEB 1W2IA 3CJ4A 2BKNA 4WCEQ 5LSRA 4P74A 2NXCA 1H7XA 4UOGA 1RACB 5LSLA 3AB4B 3LGMA 3T41A 2VICA 1P8GA 4FPIA 4Y00A 3ENVA 1UETA 5KG5A 2KT3A 4F04B 2OPPB 4Q45A 4FP9A 2GMLA 4ECZA 5GMKa 1NO8A 2QJ3A 2BJ3A 2BW2A 3MPWA 4AL5A 3CUNA 1M5SA 4KB7A 4HI1A 3NMRA 3QO9B 5AT1B 2ZJRQ 3DMJB 2HQDA 5D4OA 3CCSS 2FLPA 4PQUA 2WONA 8AT1B 2WOMB 4CM2A 2KU7A 2EWHA 1KQKA 4E8UA 2LU1A 4UZBA 2C1EB 4ATNA 2ZWOA 2JFDA 3EXCX 1DLOB 3UDVA 1R0AB 5D78A 2PT0A 4YQWA 3JQMA 3I56S 1NDLA 4X66F 2Y0BB 3EGVA 2FJWA 3DLKB 5L8RC 3SQGA 1IKYB 3PIPQ 4J9QA 1I3OB 5KFPA 2Y8WA 4GVLA 3HCXA 3E2EA 4FKYA 4X66J 2XHCA 4WE1A 2PN6A 5LXYA 2GVDB 4OV6A 3BS9A 4N77A 5D3GA 3R6GB 5J2PA 2IDLA 4Q0BA 3NOGA 4IO9Q 4GVBB 3GQCA 1HHTP 3I5CA 1UVMA 3NCQA 4KE5A 4RW9B 2R42A 3UCUP 1C1BA 1QLNA 3W5XA 2ZHAA 2AGPA 2YNFB 4FYDA 2BEFA 3BQ0A 4N76A 2HQIA 4P2SA 4CLUA 4UF4A 3OFGA 1RHRB 1X7VA 2ZM6F 4DS4A 2DIVA 2CYYA 1QAIA 3EPIA 1FNXH 2KXFA 4H4MA 2YKNA 3UE2A 8RUCA 1CC7A 2QFIA 2ZM6J 1YJ7A 1TU0B 4HI2A 3VAHA 3GJTB 3OTDA 1IBMF 4DV7F 4DF8A 3UQSA 5IM0A 4N8NA 2MJNA 3U1LA 2B43A 3MM9B 2AU0A 1RWVB 2Z30B 1YRXA 2H5IB 5EWFA 3CDWA 2Q6CA 1IBMJ 1S4FA 5FLXU 4DV7J 4N41A 2LKZA 4G1IA 5CYMB 5BXIA 2JEFA 2ROGA 5DRKA 2OPQA 2FHJA 4A8YA 5MLCV 3I9ZA 4LVOP 5IC4B 2HG4A 1Q0NA 2V4QA 3KK1A 4BWMA 5IWAF 2X3DA 4K5RA 5DG8A 2DEIA 2GZOA 3QSIA 1JLGB 2L08A 4ZVFA 3MR6A 4DV4J 1RDRA 4ZHRB 4MIAA 2BJ7A 1HD0A 1RTIB 5IWAJ 3TQEA 1OMSA 4PAAA 1RWPB 2KZMA 1JJ4A 1OPZA 1HI8A 3UD4P 1TKXA 3N79A 3D67A 3DLGA 3MECA 3U1NA 2IM2A 2CJ9A 2ZFHA 4LRFA 2ZJQQ 2MZRA 1RA6A 4R0EA 4GKJJ 1J5EF 4Q44A 2FIUA 2AV5A 3NGKA 1N5TA 1QTNB 4NMLA 3B4DA 4QWEA 4C7QA 4B9UA 3TEGA 4B02A 2QL5B 3CJ8A 2VG5B 1J5EJ 3EGZA 3QJPA 1AFIA 4V19J 5DGAA 2A10A 2VBWA 2XLJA 2C28A 3AD9C 2MJUA 2MQ8A 3P3DA 4LIWA 2CWKA 1CJTA 1M5KC 2HNDA 1HQUB 4F0HA 4RNMA 3G6VA 4DSJA 2LYVA 2HRUA 3FC9A 3AOAA 1JK9B 4X4QA 4Y28C 2R7RA 1S9GA 3GR0A 2CDRB 2OD6A 2AYEA 4DZDA 2RF2B 2WZ1A 3PR4A 1KFSA 1JWWA 3AOCA 3HM9A 5KFTA 2BQRA 4UQTA 4OZLA 2AF6A 4YUDA 2QRRA 2KI2A 4NCAA 1BQMB 2VQEF 2HURA 3DDNA 3LO3A 4Y2MA 2ZBQA 5HL7Q 1CJKA 1YRUA 4USMA 4J9RA 2EFPA 1Q53A 2R2TA 4C6AA 3MHYA 4R5PB 4TKTA 2DNOA 3HFVA 4NOHA 1TK8A 2EK1A 4OX9F 1GMUA 2X7IA 4IR9A 2BQ3A 1YJVA 2GQ2A 2HMIB 4ED1A 4C11B 3JAMY 2V4JB 1QTMA 5B0GA 3RGIA 4OX9J 2XYGB 1MW7A 1T94A 3M6VA 5DETA 1RZMA 1J27A 3OFHA 4ER8A 4A8SA 1R0BG 1R0CB 3CDAA 4CLYA 2IVYA 2MYFA 5CD4A 4FF1A 3V2UC 4C8MA 1IM4A 2CPXA 4C4WA 4RW8A 3KTQA 3NP5A 3ZC4A 1B0VA 3BF4A 3AJ2A 3PYGA 1TTHB 1AUDA 1R8CA 4K4VA 4JI2F 1D9FA 2DRBA 2DRDA 5B0FA 1S10A 1EKRA 1H2UX 3HSGA 2NYIA 2MXYA 2RJZA 1GAOA 4JI2J 4J90A 1KC8T 2XMJA 1D1UA 2V9WA 3NL0A 4JBCA 2GHVC 4G1PA 3CCES 4WIQA 1UEUA 5HP1B 1H74A 1PJ5A 4XK8C 2NYHA 2HVHA 2WB1D 1NKBA 4C97A 4PEOA 5J1EB 1F0XA 3C14B 3EZUA 1Y5NB 3B82A 2G2OA 3EVOA 3IM9A 3C6UA 1RU2A 3MM7A 4LSZB 2CZVC 4LREA 1QE1B 4K8RA 1XNQJ 1K9MT 3ZZ0A 2WHOA 2APOA 4CT8A 3CULA 2F40A 3DOLB 4RZRA 5DJBA 3OR2A 1IR2A 5BYSA 4QWDA 5GAGU 3MEDA 1VK3A 1YK9A 1NAQA 4NZ7A 4FZVA 1SKRA 3BQ2A 4OYPA 1MSWD 3RUBL 5F8IA 3QIPA 2HYIB 1X4GA 5J2QB 3DRSA 1NZ8A 1U0HA 3V4MA 1VQ8S 2Z2ZA 3G8TA 5HQLA 3FSIA 3UR3C 2MLXA 4ILRA 3FEYB 3THVA 1RQ0A 4I4BA 1YVFA 2FLOA 1JLFB 4I56A 3TWZA 4LFCF 1S1WB 1TAUA 1QY7A 3PX4A 2ADCA 1VJWA 4ED2A 3KDOA 1RAHB 3W64A 1UPPA 1F2HA 2GA7A 4CRJA 2L9DA 1Q8LA 2HBRB 3MM8B 3A1YG 4LFCJ 1T05B 1VC0A 4R8UA 3RRHA 1NJYA 3G9CA 5ETSA 2XO7A 1APSA 5E33A 1YX2A 4A8MP 3M8QB 3UVJA 2A3JA 5DQGA 1WOPA 2RE1A 5DDQC 4O23A 2HZAA 4B3SJ 1RWNB 5GAHI 2MB0B 3MR7A 2MSSA 3GLJA 4ANCA 1N48A 4QYRA 4ES1A 2AW0A 2BJDA 1DQ9A 5T7LA 3MR3A 2CJAA 4IFVB 1NKCA 4MKAA 4MK9A 3M30A 2QGFB 1QVFR 1T3OA 1VQPS 3PHTA 1JNRB 1M1KT 1TKTB 3SFGA 3D0IE 1SBRA 2JL9A 3A8IA 3RG6A 3SCLE 3NY0A 5ETMA 2AZ3A 1AW0A 2YX7A 1HNVA 2KKHA 3I55S 4DSLA 1HHQA 3CIMA 1FRLA 3BREA 5F8GA 1U1PA 4NXMF 3IBFB 1HLWA 2CZ9A 1YG0A 3K5PA 2RUSA 1P1LA 5E5NA 2DHHA 1CS4A 3KUHA 3ZZUA 3FVYA 5I3UB 2GVZB 4E0DA 2YKMA 4UOCA 4X4NA 3TUZC 4A4JA 3NNAA 4IOBA 4LSLB 3PCOB 1WACA 1FO1A 2CNNB 4GC7A 1YZ7A 2RS8A 1YZ6A 4KIAA 3VVTA 2MQPA 2BBEA 4PG6A 3OXLA 4C9DA 4FVMA 2OTJS 3MM6B 3H4BA 4ZLJA 3HHKA 4R0JA 2F9DA 2YNIB 4WP3A 1L3KA 3QYYA 4RW6A 2P9GA 1JLCB 2VBYA 2VA3A 3GP9A 4WP9A 4PQUB 1M5OC 2WONB 3OLAA 2H54B 5A0YB 1W26A 5HLFA 3A8EA 3EWGA 5KFOA 2ILYA 1LFWA 4CLPA 2DR8A 1WEYA 2OMOA 2CJXB 4JYAF 2PIIA 4NLWA 3PXGa 4UZCA 3GSDA 2D7SA 2CXEA 2W9AA 3M2VB 1PBUA 1NHVA 2GC8A 4PG5A 5KFHA 3IR6B 1RHKB 3WC2A 1NK7A 2DO4A 3T9NA 1QAXA 3I32A 4JYAJ 1Q95G 4PWDA 2Z4PA 1WORA 3TO8A 1KD1T 1HBOB 1S1XB 4NCBA 2DT9A 2E1CA 4FYYB 2A1BA 3DLJA 2DRAA 5I4MA 1L3TA 5DDRC 2E1MC 1FDDA 4OI1A 2DCUB 3JTNA 3CD7A 2QMUB 4FYVB 3CT9A 2NPIA 1C0UA 1NBEB 3V5RA 2AJFE 2J8SA 4KKOA 4TNOA 2EFOA 3M8PB 4DQIA 3MMAB 5GAEU 4ZOSA 1VRTB 4PG8A 4EZ6A 2LQ8A 1WSRA 2ZKUA 4RW4A 3ELHA 3EM1A 1RWKB 1N54B 4K2JA 3KG1A 2OAUA 4JI6J 2OO4A 4DWIA 2UXCF 3TVYA 4I69A 2KB2A 3C16B 4DL7A 4ZCMA 4QWBA 4RLEA 1OJ4A 5KG2A 5ITHA 4ECTA 4NZ6A 1XBWA 5EGYA 4OI2A 4DV1F 1XTZA 2UXCJ 4ZJLA 2B9WA 3RAXA 1NHUA 3BQ1A 1NHKL 4ETZA 2DR5A 3RBEA 1N5SA 3MMBA 3G8SA 3GV8B 5DZ7A 2HZVA 1R31A 4X62F 1TL3A 5CQGA 3HF5A 1LK5A 3VAFA 1S57A 5LMNF 3HVTA 5C24A 3OR1B 4Z2XA 3MF5A 1RAEB 4PUOB 4M94A 1AA1B 3ETMA 3DHXA 1H2TZ 2WB4A 4CLZA 4K0KF 4HACA 2H48B 5KFCA 3R3TA 4B3MF 2M2BA 2VC1A 2AIRB 5LMNJ 3K89A 2B4OA 1KP6A 1JXEA 4F0MA 1WNEA 3W2VB 1OYEA 2HNZA 1RWUA 4B3MJ 1KFDA 1U1NA 3KLEA 1TUVA 1FHTA 2ZC3A 2G1DA 3OL9A 3Q24A 2WW4A 1RT4A 1UZDA 2W24A 4CZCA 3M8WA 3W2WB 3P8BB 2J76E 1YTYA 1O51A 5AE2A 1RT2A 1NM2A 4M5IA 3S6EA 3QIDA 4ID5A 2DNGA 2X1FA 1YHQS 4ES2A 3CD6S 5CZVA 1VQNS 3MD1A 4OI6A 3DYAA 1CJTB 2P6SA 2YQ1A 3GFYA 1TMJA 2XLKA 3SV3A 1SC4B 1K47A 4CM0A 4MT1A 3OHAA 2FDNA 3TI0A 2W2QP 5F8HA 3NLCA 5SZTA 3OXGA 1CJUB 2MKCA 2IRXA 1EETB 1NCLA 3QSYB 3KG4A 2MGZB 2Z0GA 2B8QA 3GONA 1YJNS 1FWKA 3E8OA 3BO4A 3TAMA 4HDHA 2HHTA 2LXUA 1IKWA 4CLSA 2VPZB 4ZMMA 4IO1A 3W66A 2HIYA 2KTQA 2ZHBA 4ZVQB 3HKWA 2KDOA 3MR5A 4I1TA 1XMQF 2CPDA 3SZ2A 2HK2A 1SCJB 3PM9A 1YITS 1TL7A 4X2BA 1U49A 2N3OA 1XMQJ 1R6VA 4QBUA 4L75A 1D9AA 4QPXA 3CCLS 2OFHX 5F0UA 3DGPA 2KT2A 1RTJA 2RQMA 2VPYB 1FD2A 1N6QB 3IXQA 3H4DA 2ASYA 2O66A 3J7Z5 2ZH4A 4CLLA 1QSLA 1F5AA 3UW1A 3N4WA 5IC6B 4RBVA 3HXMA 2YNGA 4KGMA 2DTJA 4O44B 1TFWA 3TA0A 5F41A 1OSCA 3F56A 3F73A 1GXUA 1X4DA 2VB6A 3RBXA 1M90T 1FK9B 4LT6A 3HPOA 2VKRA 4LMZA 5IQQA 4QW9A 1ZAVA 4AUKA 4CT9A 1Q79A 1VQYA 3DGVA 3VZIA 2CPHA 4ECSA 3UO0A 3PEJA 2MZQA 1BQXA 3Q8YA 3NS6A 1JLEB 2ILZA 3TA1A 3M8YA 3MPUB 4NEZA 5B09A 1X9MA 2DR7A 4JI0F 4QYZK 1EB0A 3SXLA 2F5GA 3MM7B 5DLFA 5BR8F 1TV6A 2OEMA 3C66A 5L39A 1LXJA 3PFOA 2DR9A 2IJFA 1QDUB 5KFNA 1UVKA 3KYLA 4OJ3A 5BR8J 3G6XA 3IRXA 3VF0B 3K8WA 4F67A 2A6OA 4XAKA 5THWA 1RT6B 2P2CB 2E29A 1RUSA 5K8NA 2EC0A 3LP1A 1ZZFA 2FGOA 2BANA 1U0SA 4EEYA 2VFUA 3N01A 4LJMA 3PJWA 4FF2A 3M8ZA 3M32B 4OZ3A 2U1AA 3CC7S 1MMDA 3BDEA 4DPTA 4ZP9A 2HS3A 3JSBA 2GQCA 3IGNA 1NUEA 2B0GA 3KK2B 1HL6A 3AQPA 2A2CA 1V5VA 4ELTA 2XM3A 4FF4A 1A9NB 1ZM9A 5E3RA 4TYAA 1JXLA 5KFMA 4CQ1A 4NI2B 3GIRA 3RR7A 2DH8A 2FJXA 4WYWA 3BKUA 5D15A 2B8PA 1PCAA 3KLFA 1DQ8A 1Q7LB 2ZOFA 3MEGA 3NS7B 2GJIA 2QC3A 5HJYA 3C6TB 2HHWA 1N5VA 1F3FA 3LALA 1X5PA 3VAIA 1R8PA 3QPIA 2F4VF 1SQEA 4KFBB 1RWOB 2IVMA 4U7CA 2WBRA 5U47A 1NPPA 1RBLA 2ZH2A 2JDJA 3TARA 4H4OB 1S6QB 4KAIA 3PW2A 3W5YA 1HA1A 3M30B 4OYAA 2F4VJ 2QX0A 2OPRA 3RB3A 2YKQA 1D3WA 1HYSB 2RDJA 1DY3A 1LWEA 5DS7A 5HQMA 4QW8A 2OJ3A 2MEWA 1SL2A 1X8DA 1U1MA 1FKOA 2YH0A 3H5SA 7FDRA 1A0OB 4QIFA 1AXQA 1PGZA 1ZA2B 3AODA 5J2NB 2DVIA 4WFAQ 4ZPAA 2XNRA 1B4SA 4OJ1A 4OHZA 1KOOA 2PFDA 2KN4A 2HFUA 4ZP6A 3NAHA 2CQ4A 2RIJA 4M5HA 1X5SA 3NGSA 3KLHA 2KRBA 1URRA 2RQ4A 1U2FA 4RUAA 3CGIA 2G0JA 1VQOS 5HBMA 1K8AT 5D4LA 3Q23A 2A2DA 2MQOA 3CJKA 3ILIA 3M05A 3IRWP 4P2XA 4DHVA 3B6BA 7AT1B 5CZXA 3TRGA 4ZITA 2J7KA 5KFBA 1N0VC 3E3XA 1M1HA 2BW7A 3Q8PB 1F5CA 3ZZOA 1FJCA 3OW2R 2L41A 2IJRA 3BSAA 2POKA 3W5ZA 3L95X 3O8WA 2ZZTA 3KJVB 4GKKF 1S6PA 1LEOA 3ZFVA 1U2RA 3WHIA 2GQQA 2CQPA 3DDIA 3AH6A 3X3UA 5B0CA 2C3YA 5KT5A 4EFAC 4GKKJ 4MIWA 3PDNA 1RADB 3AFGA 4J9NA 3DLLQ 2P9EA 2DNQA 2QTWA 2CVEA 2OPSA 1SIZA 2QIFA 3IAM9 2JJ4D 2C2DA 1KS2A 4XPCA 3DRYA 3EGWB 4TU9A 2J5AA 4XDDA 2HKEA 3MTJA 4ED8A 2E5JA 3BPSP 1S6UA 2QE5A 1MLAA 1Q7YT 3HI9A 1UJ6A 3PTWA 1YRTA 2N4CA 5LM7E 4LIRA 1F5BA 3FRZA 4ZCLA 3OVSA 2M3DA 4HHHA 1VQ6S 1UVLA 2W7AA 2KYZA 2MHEA 3L4BC 1KQSR 2JHEA 3T3FA 2WTFA 1M5VC 1GMVA 3IS9B 2HWTA 1VBXA 4I68A 3BR8A 4HR2A 4B9VA 4LF7F 2LP4A 1C0UB 3CW2C 1GNKA 2C3MA 1HNXJ 4HT7A 3PO4A 3O3LA 1DARA 3NGTA 5IT0A 4Y34A 4OJHA 1WTBA 2HHXA 3DU5A 4UW2A 4UY85 4QCLA 2RU9A 3GIIA 1WUUA 3OHBA 3KLIB 5CCLA 4A48A 2DGSA 4ZVRB 2YWHA 2BYCA 1ZYQA 2IFXA 3M6WA 1V3ZA 3UN2A 1RTDA 2J9DA 4UOHA 3F0NA 2ZH9A 3KKFA 4DPUA 5HVFA 3K59A 2FY8A 2UVRA 4RX6A 4CO2A 2EBEA 4KJIA 4CH0S 4QIEA 3PYFA 4A8OA 2B56A 2E1PA 4TQSA 1TL3B 1NK9A 3GR1A 2RD5C 1YIJS 4EGLA 3ILOA 1Y5LB 1RT5A 2KG1A 4OV1A 3TZWA 1VMBA 1RT7B 3MM5B 1Y10A 1Y11A 3CC2S 1RKIA 1MNEA 1CBKA 5I42A 1TAQA 1RT3B 1UVJA 4CTAB 3CCZA 3LAKA 3U02A 4DV2F 5A8RA 3R9LA 4W92B 2DNPA 4YY3J 5F9LA 5KFLA 2DXFA 4KV8A 3RTVA 1NSPA 2NSBA 4DV2J 1CVJA 3PO5A 2XS5A 4HTJA 5ADZA 2JVOA 4PYDA 3PRVA 1HR0J 3BBBA 2V8DA 2L3MA 4DR7F 3TP2A 3A12A 2OPPA 3JXOA 5KOXA 1O8BA 4KGZB 3BGFA 1RAGB 3LA0A 4WXOA 2QYCA 1WG5A 4DR7J 1KQGB 1SKWA 2B4PA 3QO9A 3OVAA 2V5HG 4ELVA 3RW7A 1UA0A 4USHA 3CCRS 2GS8A 4IOAQ 4C0OC 1P1TA 3R5BA 3FK4A 2WOMA 4OZNA 1JJHA 2Z2MA 1NJWA 4LFAF 5L1JA 1DLOA 1RTZA 2VF3A 4C3MA 2OSQA 1R0AA 1DRZA 2EKYA 1DZ5A 2FHOB 2I38A 2JOQA 2MZ1A 5DM7Q 3VZHA 3DLKA 3W1YC 2Q1LA 4RNOA 4LFAJ 1VQ7S 5HROA 1U1KA 1IR1A 3KJNB 2YPYA 3BGOP 4OZ2A 5HI7A 1VHIA 2PD1A 4DL2A 3DXBA 2UXBF 3VQSA 1AB8A 2GVDA 1NU4A 2CFXA 1CC8A 2V67A 4ZCKA 3FRYA 2ZHOA 3BO2A 3NWGA 3J81j 5IZHA 2UXBJ 4GVBA 3MXHP 2P5VA 3S1TA 3CMAS 3RRGA 1JKHA 1BD6A 3C15B 5IT4A 3N9UC 2GMHA 4M95A 2B9YA 3LWMA 2JEGA 1N5YB 4A8WA 2YNFA 2Z2YB 2CPIA 4ZPDA 1RTJB 3J81Y 4I0WA 2QZ8A 2BQUA 2H9ZA 2KRRA 3I4HX 2CQDA 3MPYA 3HSDA 5M2UA 2GX8A 1NSQA 2C2ZB 3WZ0A 3T1YF 1KDNA 2XLIA 3DU6A 3OSPA 4C8OA 1EX8A 1OY8A 2BOAA 2IMOA 3KMQA 2JZ5A 3T1YJ 1R3NA 1I51B 5KFVA 3PYEA 1ZTTA 1O6XA 4AFFA 2CPZA 3MM9A 2G4BA 1NH8A 2GIQA 3RBDA 1TQLA 4W90B 4RUHA 2BRLA 1DBDA 3I6PA 3BPDA 3FCVA 2UV8A 1Q81T 1LWFB 4U8VA 1ZAXA 2AD9A 4DLEA 4DPYA 4RU9A 2AX0A 1H73A 1L5UA 3Q0AA 2FY1A 2D74B 1U47A 4L6V3 4ICLB 1F1BB 1FTCA 2VL1A 3CVKA 2F1FA 1FDBA 1JLGA 1OWXA 4ZHRA 3K5OA 1PBAA 4WKRA 1RTIA 1BGXT 2W9CB 1VQLS 4EUVA 2DY1A 1X5TA 3FEXB 4K4ZA 3C8YA 3D2WA 3TANA 5KFXA 1IQTA 4WYLA 2W9BB 3UCZP 3HHLB 3OTOJ 1KLMB 4IRKA 3G4SS 1N8RT 1X0PA 4AE5A 4RUBA 4WXWA 3FBFA 1HKAA 4ZVPB 3PYDA 4X4UA 2EK6A 2X1GA 1RAJA 4ZP8A 3UPFA 5KFDA 2R8KA 3CJ3A 4L74A 1KHVA 2ZITA 2VG5A 4X4TA 3NNHA 2XI2A 2VOPA 1ZM3A 4DL3A 2HVEA 5IT9Y 2HFOA 4KPCA 5KFRA 3T5KA 1OQ6A 1UTAA 1GH8A 4OYZA 2XY7A 4QOTA 3QT8A 2NUUG 1HQUA 5HAOA 3JQKA 2WAQD 1XERA 4DG1B 4ZLNA 3H59A 1Q4RA 2PA8D 3KG0A 3OUYB 2RF2A 1WG4A 2R3VA 2HK3A 4G6VB 2VG6B 4QWAA 4NE9C 3WDOA 5DDOC 2RHQB 4Y2KA 2E5IA 2VPWB 3PV8A 4DSEA 3NRBA 1BQMA 2W7OA 1J5OB 4YR0A 3VGTA 1FX4A 1HW8A 3FFIB 4JI4F 4JUZA 3HX9A 4ZPVR 4XO0A 4O3NA 3CJTA 3NKYA 1N33F 2MQQA 2RB7A 1S59A 2HS4A 4TY8B 1FRMA 5A8KB 4R5PA 4JI4J 2ZH1A 4WIIA 3SI8A 3SYZA 1N33J 2DD8S 4NYOA 2I9SA 4HH0A 2P6TA 2HMIA 2IBKA 2CQIA 6FD1A 4C11A 3VGSA 1WTFA 1NDPA 2V4JA 3BSOA 3J7ZT 1I1GA 4U67Q 3FCHA 4DFJA 3M4XA 3MD3A 2OPRB 4K4TA 1WD6A 3R1LA 3DLBA 3PNIA 4PKDB 3MPVA 1XC9A 1RCXB 4OYOA 1NJXA 4RL1A 2FLNA 2MLZA 1FKOB 2FTRA 4DR4F 3TYTA 5KAKA 1H2VZ 4RUCA 4OX7A 4XDCA 2DITA 2VUGA 1Z4UA 5A6WA 2GCFA 2AEMA 5HVHA 4DR4J 2P9CA 2Q43A 1WKJA 1VQ9S 3E01B 1FKPB 1Q8KA 3D3CJ 4U8YA 3G2XA 5ETPA 3DFEA 4EYHB 2AJ1A 3BKFA 1SJ4P 3EDQB 4A8XA 1DURA 2HHHF 2R2SA 2ZUGA 2ZVIA 3IMQJ 2D3ZA 2MHNA 1HW9A 3MEEB 4EO8A 2W1BA 2MQLA 4YB1P 3FEZA 2OSRA 2D3UA 1GX5A 3FMWA 2HHHJ 1UJ5A 1UP1A 4ELUA 2FZCB 3GIMA 4AQYF 1RYRA 1RU1A 3BJYA 5HP1A 4CYUB 3CJSA 3I5AA 1VQKS 1RI7A 1VBYA 1LV5A 3AXKA 5J1EA 3NXZA 4LR8A 2YNHB 1U45A 2WCXA 6AT1B 4YMEA 4O4GA 3GTYX 4JI5F 4AQYJ 3C14A 3DOMB 1WF1A 1FEEA 4HEA9 2FLLA 2G0CA 5AE3A 1XN9A 4DCJB 3WQPA 4YEAA 4J7CA 2AYGA 3SCKE 3N6LA 1QE1A 4MKBA 4JI5J 1VLOA 4LF4F 2LEAA 5J1PA 4F2RA 5AXLA 1I94F 3DOLA 2O67A 4EU0A 2BM1A 1L3UA 2W2OP 2NR0A 1DJ0A 4ECQA 1ZETA 2M70A 2V63A 2KVIA 4LF4J 2FYXA 1TL5A 1DTQB 1I94J 1IXKA 3M1VA 4BC9A 3OTBA 1T9XA 4XTTA 4HVZA 4K4XA 2V8VA 1R6YA 3LW5C 1NB7A 1MWZA 1PJ7A 4DR5F 2C2MB 3GV5B 3UR0A 2HQGA 2W7PA 2EFVA 4A47A 1LW0B 1T9TA 1FFSB 2FVRA 5K9FA 3SV4A 2FVSA 4BC7A 4OZ0A 2BDPA 1JLFA 2OLWA 1C4AA 3FMBA 5C2GA 3SCJE 5H1SV 2HVIA 4J9PA 1U1OA 4G65A 3OSNA 3QGGA 1VBZA 1CQNA 1HBNB 2JH3A 2BUNA 4B08A 2BJ9A 4ITSA 1C0TA 2NZ4A 3MM8A 1GX6A 3B4MA 1PILA 1R7IA 5I3PA 1T05A 4A8KA 2ZD1B 5FLXY 3ZTSA 2WK4A 3G6YA 4J91A 3O44A 4ZPBA 1JJ2R 2EEYA 4ED5A 4IG0B 3AXMA 4HYKA 2CNOB 2IA6A 1VLYA 1U26A 1FDAA 5B7WA 2JC0A 4J9SA 4UQGA 5KTQA 4YR2A 4DX7A 1VCTA 1JQGA 1R8BA 4FBUA 4IFVA 3U7JA 2JX2A 4KBIA 1NK6A 4HLBA 4Z7CA 5GADU 1U6BA 2VBXA 1TKTA 2RH3A 1SC6A 3NGRA 2FVCA 4OI3A 3TEHB 5I3QA 1WEXA 3R5GA 2DO0A 5KFJA 1WEZA 4ERDA 2YWEA 3AJDA 2GNKA 2IBOA 4NLOA 1XJWB 3NBPA 3QT7A 3L7UA 3M9MB 2HGNA 1E6YB 5K20B 1FI4A 1SQFA 2IC3B 2VH7A 2G2YA 4X65F 3OL6A 2K3KA 1UKUA 3CD0A 3QNWB 5CHCB 3GZ7A 1HI1A 3K5NA 1K73T 3I4PA 1N88A 5I3UA 3N6NA 3NWRA 4X65J 3SSRA 2GVZA 2ZNYA 1VBKA 3US5A 3EVWA 5JXSA 9RUBA 5KG3A 2Y3YA 4LSLA 3KUGA 2BM0A 4BHQA 3MAHA 1JXVA 1FXLA 3I31A 2HQ3A 3R5CA 1V3RA 2QL9B 2CPFA 4DL0C 2IM3A 4TLRA 1RAAB 5L1IA 3VALA 3M2RB 1SKUB 2NQPA 1SI9A 2F7VA 4M1KA 3MGJA 2GIRA 3IM8A 4C8YA 4CO0A 3QT5A 2CQ1A 3MM6A 3QZ8A 1G3OA 4IR1A 3HFKA 3AA9A 3FCWA 1FXRA 2CQ3A 4JI1F 1AFJA 1EQMA 3F41A 2YNIA 2YQ0A 1NPRA 1EP4B 1NSAA 2KFYA 1JLCA 3R7BB 4ZVGA 5CXTA 2DGVA 1LKZA 2UUWA 2ASDA 1FJEB 4YB7A 4JI1J 2MY7A 3VTIA 2HFZA 2RKIB 1ZH5A 5A0YA 3BDPA 4RBUA 3H0PA 1Q5VA 2VZ9A 4GRSA 4DUYF 4O3RA 1XMBA 2V8PA 4KTQA 4I2QB 3M2VA 4IDKA 2C2KB 2KFZA 3RAQA 5F3ZA 1U8SA 4PXCA 2VASA 4DUYJ 4J37A 5HROB 1VRQC 4DQPA 4NA2A 5HMYA 3JSMB 1REGX 2ERRA 1HBOA 2R2RA 1S1XA 2GAGC 3TR5A 3H40A 4OHVA 3BO3A 4A8QA 4FDFA 2JEIA 1PG5B 2GO9A 3SMZA 4KY3A 4UY8T 1LW2B 4F8RA 2ZBRA 1UW9A 3Q8QB 1NEEA 2W4CA 4WK1A 1JKHB 3BV8A 3K17A 3Q22A 3QWPA 3M8PA 3MMAA 5DZ6A 3PY8A 3OVBA 4QZVB 1R89A 1VRTA 4NLTA 2CVIA 1Q1KA 3D1OA 2DY9A 4F36A 4NRTA 1SJQA 3N28A 2BVZA 3C16A 5F8MA 2FGCA 4OYIA 2LCWA 4DSFA 4DPOA 4DFMA 1ZTWA 3OTEA 3SDEB 4NXNF 3QRQA 1IKXA 2FC8A 3IAS9 4NMXA 4USVA 5L9NA 1HBUB 2DGXA 2XYHB 5KFEA 2GO8A 5IV4A 4NXNJ 3R8YA 3CO9A 4TN2A 3W9IA 3V81B 4F26A 3DM2B 1X31C 3QMQA 3A8JA 2PFFB 3S01A 1ZM2A 5D4NA 2CKWA 4DV4F 1G1XA 1PYOB 2V94A 3OR1A 1SJ1A 4FF3A 2CRLA 4PUOA 2J0SD 3C2PA 4YS2A 1W2BR 4DI6A 1ULRA 4H54A 5C2CA 2OEJA 4LQ3A 2Z57B 3W2VA 4Q8EA 3NOCA 2HIQA 3I0SB 4GKJF 3HVAA 3P5BP 5EUHA 3QT6A 2GFFA 4CWBA 4AXIA 4LRDA 4Q2MA 4KHRA 1DHMA 1S0MA 2NXEA 3EUNA 1H6KX 1RWMB 2R7SA 1RAFB 3W2WA 2EG1A 2XMKA 4AD6A 1RYSA 1I5OB 1H0HB 4M5NA 5KT7A 3X1LB 3GG0A 1S12A 2ROEA 2BACA 2R7VA 2VODA 1ROFA 1VC5A 3RZAA 2XHWA 2FHKA 2QFJA 2XCAA 3BM7A 2EI5A 2VC0A 4JV5F 3MFIA 1T9UA 2YPZA 1WC0A 2B6AB 4RNFA 3MUMP 3Q8SB 4NYPA 1VIXA 4ED6A 1JLQB 1CJUA 5HK4A 4JV5J 4FXVA 4P10A 1EETA 2JEJA 3HHEA 5H9FK 2UV8G 1W7WA 3WC0A 1RTHB 2H4YB 2MGZA 3CCUS 2YX1A 1U25A 1X4BA 2Y0SD 2CZ4A 4W98A 3PX6A 5ETOA 2RRBA 3SBMA 4ZPTR 1VQ4S 1Q82T 4B9MA 1WJ9A 2AYMA 3BSNA 5SUHA 2UVUA 3V6DB 1E6VB 2ZE2B 4IKAA 2CIMA 4KQZA 5G4DA 2XS7A 1GXLA 4H4KC 2GW8A 3CJ0A 2P8IA 4EWTA 3H8YA 1LFPA 3P96A 3VGVA 5LXRA 2ZWPA 1SJ3P 2FQQB 3FNNA 2WSFC 5RUBA 1EJ7L 2WVCA 1X0FA 2LLZA 3MZIA 3B8HA 5HANA 2R7OA 4YN3B 1SH2A 2G1HA 5KT3A 1TKZB 4M5KA 2HWHA 4RW7B 2XC9A 2OEKA 3FUYA 1N6QA 1S76D 1KEKA 1TUWA 5JUMA 2IHR1 3R5AA 1VRUB 2HLUA 4ZVHA 4MK7A 3CIZA 2G2ZA 3W9JA 1WC4A 1FWLA 4G3IA 4DR3F 4QWCA 4ZK7M 4ILMA 1NK8A 4J9UE 1NLKL 2MQNA 2I8EA 1VI7A 3RJMB 4O44A 2QSFA 3AAWB 1VFJA 3HP6A 1EKSA 4DZ6A 4DR3J 2OP5A 1HD1A 1RBAA 1FK9A 4F4ZA 2CWXA 2N7YA 3NS5A 1WF0A 2ZJPQ 1RJJA 1JLAA 4M8LA 4C98A 3MUTP 4OZ1A 3BB5A 4DV6F 4UOFA 1K1SA 3D54A 3CEDA 3GU0A 1OYDA 9ATCB 5BYRA 1LXNA 3LP2B 4C0BA 3SEOA 5LJ5Y 4DR1J 3MOZA 1S48A 1JLEA 4K2XA 5LT5A 4DV6J 4N47A 5EWEA 2V9KA 4O4GB 1S1TB 2F9JA 1R43A 1XNQF 1P6TA 3RB6A 1WSVA 3MCNA 2NZCA 3G82B 2NXUA 4WFYA 3W7BA 3IWNC 2ADBA 2D3O1 1S1UA 2QSWA 4DN9A 1S0OA 2JWNA 5KFZA 3PKMA 2WBMA 1RT6A 4DX5A 3DLEB 2HRTA 1NH7A 3H2UB 1LNQA 5KG6A 1UWBB 3MFHA 3M1VB 1TVRA 2VJVA 1QSYA 3OV7A 3D5MA 3THTA 1JIHA 2ZKTA 3RRKA 5ETNA 1TUGB 3QJJA 5G0RB 3M32A 4WJBA 3H5XA 1O5JA 1WWHA 4TY9A 2JVRA 4K59A 1OY9A 2XZDB 5F8JA 4RPFA 4DOZA 3KK2A 4IG3B 2D41A 1T3NA 4ZVEA 1NZAA 1RHMB 4NI2A 1N32F 1C0TB 5LL6d 2AYBA 4RJVA 1TL1B 2DXEA 6FDRA 1B0TA 2MKHA 4NCGB 1HNWF 3H5UA 2DHAA 4JP8A 1RT1B 4B3SF 1N32J 1Q78A 2E7XA 4OZ5A 1U2CA 4HHJA 4AYBD 3GIJA 1DTTB 1PIEA 3N5FA 1T11A 3C6TA 5EDWA 1M5HA 1U4BA 4TVAB 4DLGA 1HNWJ 4EBCA 1QUVA 4CI0B 3J80U 3UCGA 3QATA 1IR0A 3R6LB 3GPAA 1RAOA 3PJ9A 1I6JA 3ZNJ1 2ATLA 4KFBA 3OPKA 3AT1B 3IC1A 4WFXA 3PW4A 2J6SA 3MOJB 4FS1A 4IH5A 4H4OA 2AHOB 1FRXA 1S6QA 2MZJA 1Y00A 4O4RA 3CD5A 4NZ0A 1T9YA 3LUYA 1EQ0A 2DBBA 1SJFA 3KLGB 5E41A 3QBCA 1S1VB 4JB8B 2F8EX 1HYSA 3JSYA 4ZLPA 5KFGA 4OYMA 4K7QA 4Y65A 3FSYA 2KHDA 3D4JA 1PYTA 2LEPA 3BGUA 2ASJA 2LXIA 1UFKA 3VVUA 2E5HA 2IRYA 3NBPB 4Q2LA 5HJXA 4P75A 5J2NA 1HBMB 1UEKA 5ETRA 1UFLA 5C7PA 1Z2LA 3W9HA 4W4MA 3JYTA 2MKYA 4M63A 2XGQA 2WW8A 3CJ5A 3GFZA 1VDHA 4F3OA 3W65A 2VKZG 3HVRA 2DNNA 1JB0C 4F3MA 3KWMA 5L38A 5CH7B 4IH7A 4LF1A 1YJ9S 3CJQA 2KH9A 4J9OA 3ILLA 1CSJA 2RNEA 1S72S 5KFFA 2QLJB 2QA1A 2CQGA 2ZDOA 3ZZZA 2W01A 4QR2A 1YSJA 4KRWA 4WF9Q 4CO1A 3HSZA 2DGWA 1BE4A 5CCMA 3FBCA 2F63A 2ZZMA 4I7FB 1PAUB 2V50A 2XEXA 1UVIA 4URQU 4ED7A 4ZKAA 4DFPA 2LDYA 1REVA 3CE8A 2R7XA 3H7HB 1MU2B 3BN7A 3KJVA 1M5PC 3FBBA 3Q83A 1Y3KA 4USJC 2COLA 2M4MA 3GILA 5KG1A 5DG9A 4USKA 1N5QA 3B54A 4DBQA 3DDKA 3TZYA 4CLTA 3KUEA 3PACA 3BYRA 4EMDA 4DV5F 2LDIA 3CNQP 1Z2ZA 1K0TA 5AXNA 3DI6B 7FD1A 2FVQA 2FC9A 1FRJA 4DV5J 1UJ4A 3KJFB 4IDKB 3UI3A 5F3TA 3TNVA 5IFMA 3K8VA 4KSEB 2W2NP 1SJRA 2V4RA 1FTRA 1HQEA 1SC1B 2E5GA 1Y3JA 2IPOB 1RE1B 3OJSA 2PMZD 2R9LA 2WVBA 1T03B 1LWCB 3WBZA 3I96A 4WFZA 4CP5A 3G8QA 3BYPA 3IS9A 2F4FA 2KFNA 1LOUA 3HDSA 4ZPWR 1NXIA 1B99A 1W25A 4LBIA 1CLFA 5E7OB 3AB2B 2XMMA 1BQNB 4YDXA 4MMOA 4BS2A 4DV0J 1FJ7A 4C8KA 4JI6F 2KHCA 2PE8A 3R2DJ 1KWMA 2HFSA 1UAWA 5M2PA 3RBZA 3DRRB 3MDFA 1RKJA 3KLIA 2ROPA 5FIIA 4KHMA 1VQMS 4B3TF 2XSJA 1BHNA 5C42B 3MTKA 4M5MA 1Y5IB 1FWPA 2LVWA 1VISA 2VONA 3KHLA 5F8NA 4NWBA 4B3TJ 2M8HA 4PXDA 3N5BA 1SIWB 4DUTA 4LF6F 1BY9A 1IKXB 1FA0A 2E7VA 4WBFA 4ILLA 1UWAA 3ADAC 2Z8QA 1C1CB 1KKHA 2E7WA 5HMXA 3K5LA 2M7SA 4ID8A 1OO0B 4LF6J 1H98A 4LUBA 4P7VA 3OFFA 5E0OA 3ZZYA 1ZS6A 4NLPA 1KVKA 4X4SA 3QLHB 1S77D 1DQAA 3GE9A 5E3QA 4WFNQ 4EYIB 5CYJA 1KNZA 1FCAA 1RT7A 3MM5A 2HHUA 5DLGA 3ET6B 3HK2A 3FGVA 4ED4A 1CULB 4FNIA 3TOQA 2LECA 1RT3A 4NLGA 1IUJA 4CTAA 4BBYA 3BEGB 2JRSA 3CWJA 4ZVTB 1SVDA 2CA9A 3M7VA 1H7WA 1WHYA 5D0GA 1TELA 5GMDA 2X51A 2DH7A 3J7YU 4ECYA 2CQCA 3IP0A 4PPZA 2LFVA 4URGA 2VV5A 2WVEA 1CEZA 1HHSA 2RRAA 1FVSA 3MAAB 4NRUA 5LMUF 4S0MA 1NB2A 1GMWA 5D4PA 4DN0A 1M1GA 1BMQB 4IFYB 2RS2A 4MKYA 3RB4A 2DK2A 5LMUJ 2EFNA 2B9XA 3TVZA 1YBUA 1HMVB 5GMEA 4LRCA 5CYQB 4FYWB 3Q89A 2VPXB 2EPIA 1YLXA 2QMXA 3DRPA 2I1RA 2D1CA 4I6AA 4YB5A 4NYZA 4RO0A 1QAYA 3FQKA 4IQXA 5A8WB 1S5ZA 2HWIA 3JTOA 2HGMA 2OFGX 2ACMA 2C42A 1X60A 2IMWP 4C8LA 2D9OA 4MAKA 1WC6A 4WU3A 3MCMA 2GGPB 3I82A 3CMQA 5KT4A 4C0HA 1OQ3A 2DHGA 4Q7AA 5KT2A 4J9LA 3W60A 4OLPA 3HFZB 1SKSA 2E44A 3D7SB 4NLRA 2J0QD 3C15A 1S4EA 4QIVA 5A2QU 4PXBA 4KH0B 1KVJA 1N5YA 2XULA 4X4RA 4EBDA 2LQ5A 1TK0A 3D9BA 1IM6A 4HHUA 4ECVA 3W3SA 3PW0A 1QSSA 3PG9A 1F3VA 1YJWS 5E3AA 4JI7F 3L7OA 3ITHA 3ZTRA 2ZOGA 2X3GA 4NX9A 1PAEX 4IQMA 1OY6A 2M0GB 4JI7J 4B9SA 2EW9A 2CJQA 5CAAA 1R8HA 1TFYA 4F2SA 2J6UA 2K8GA 1NJZA 1A7GE 3ZTOA 2BOPA 1N0UA 3ZO7A 1YDLA 4CH7A 3RYLA 1PKUA 3ENQA 2L9NA 2CQ2A 2YXLA 5B0DA 1SQGA 2GHWA 1LWFA 2Q6BA 3T5LA 1JLAB 5LOQA 3VV2B 1YWXA 3F44A 4ANDA 3V6HA 1YJUA 2DGOA 1MROA 2PDAA 3D6MB 3T1HF 4D3GA 4ICLA 1FXDA 3P45B 4BCAA 3MAQA 2C3PA 3UD3P 3J7A1 4P9SA 1MWYA 1RCOB 4NLYA 2C2EA 3T1HJ 4OX8A 2W9CA 4XIUA 4IH6A 2B5JA 3BGLA 1M0SA 4K4UA 4HKQA 1S1UB 2R7TA 3ZZPA 2W9BA 3M8SA 3QAEA 3HHLA 1KLMA 1NPKA 3VQTA 3SQOP 2KM8C 2I5JB 1XNRF 4F25A 1RSCA 1KHWA 4ETXA 3EGNA 1FNOA 1TVRB 1CJVA 2DHSA 1UA1A 1GMWD 1XNRJ 5BJRA 2UVVA 4C8ZA 2GIFA 3ISNC 3OL7A 2DGTA 4WP8A 3MUVP 4GO7X 3MMCB 2HAIA 3ENAA 1HWJA 2QL7B 3HHLC 1G2EA 1KSPA 1HPZB 1SXLA 3QGHA 1PYSB 1VK8A 4DX6A 4DG1A 2CQHA 2UU9F 2W4PA 4EI2A 1ZM4A 1Q16B 2VG7B 3OUYA 2MDAA 4F3QA 4EZ9A 3IR7B 3BGRB 2VG6A 2UU9J 4L76A 2VDIA 1RISA 4BDPA 2VQEJ 2AJ4A 4B3OB 3I87A 1WELA 2VOOA 4DR2F 3H25A 1J5OA 3FFIA 1S9EB 3M9NB 3DXSX 1TZ0A 3OLBA 2PI5A 1WG1A 4KO0A 1FRHA 4DR2J 4TY8A 5A8KA 4O0IA 3LGHA 4RKUC 3O5TB 5A6PA 1UFWA 4NL5A 4K5SA 3GYNA 3W61A 4ZVSB 4OL8A 4DL6A 3IGVA 4F4XA 1FESA 2EKNA 5L1KA 3ONQA 2BX6A 5FD1A 1EZZB 3QWUA 2BE7D 3R1HA 2WSCC 2XS2A 5DDPC 2M9KA 1KTVA 2XMWA 4TU7A 1WI6A 2CJBA 3R7NB 4OYXA 1IVZA 3UDCA 2A6MA 4IOCQ 1H38A 1D9DA 2AKWB 3ZZTA 1NDCA 5H9EK 3QRRA 1KR4A 2ZVSA 3R7SB 3PIOQ 1SUQA 2HBYB 2AJ2A 1U24A 2CPYA 2QEXS 4LR7A 2ZZNA 5E3PA 2FHJD 1OPIA 2N82B 3E01A 1GK8A 5H9FJ 3JYTB 2DIUA 1FKPA 3VCDA 1ZA1B 4AT1B 3TA2A 3UNYA 3KHRA 3KLVA 3J7AN 1AZSB 5T14A 2AJ0A 2BJ8A 2DGUA 3R2CJ 3M9OB 3MEEA 1UZHA 2DJWA 3GYXB 1URNA 3H90A 2ZBIA 2L9WA 2W8LA 2UUTA 2H5EA 4X84A 4TXSA 1ZPWX 4RNNA 2XNQA 2XWXA 3IWXA 4LFBF 3HO1A 2BR0A 4CYUA 3GCWP 4J9KA 4NPOA 4F7VA 2KO1A 2MKKA 4G1QB 2YNHA 3Q8UA 4AL7A 1X4FA 4CH1A 3DOMA 2IAJB 2YVSA 5IQ6A 3ISND 3SFUA 4LFBJ 4TLQA 3ZZRA 4LF2A 4PG4A 3RR8A 4QQBA 2XSFA 3O1LA 2N3LA 2DYAA 5BYQA 1DAXA 3ISZA 2AWZA 3TZXA 2CG8A 1MWQA 2HLTA 3HHLD 2JFKA 4MYTA 3RW6A 1REVB 2DXDA 3Q2TC 5GAGI 1VR6A 4F4AA 1FE0A 4B17A 4USIA 4LF5F 1B7FA 2VFSA 4TQRA 4P73A 2J0WA 3GJSB 3CPWR 5IXUA 1N56A 3L3CA 4KGVB 1DTQA 2XTJP 5CA5A 4ANEA 1IBCB 1C2PA 2E9ZA 4LF5J 3VR1A 4PWUA 4FNHA
chains in the Genus database with same CATH topology
1FFSB 1FFWB 1A0OB 1EAYC 2LP4A 1FFGB 1FWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFS B;  1FFW B;  1A0O B;  1EAY C;  2LP4 A;  1FFG B;  1FWP A; 
#chains in the Genus database with same CATH topology
 2OH2 A;  1EHW A;  2F65 A;  3HHD A;  2L48 A;  2EBG A;  4ZVO B;  3GG1 A;  1QAJ A;  3CCT A;  3PRB A;  3NMA A;  1LW0 A;  3AJ1 A;  3TX8 A;  3QRP A;  1SV5 B;  3PJX A;  1U09 A;  2PC6 A;  3LH2 S;  5DO2 A;  4E2F B;  2Y1I A;  5ETQ A;  3MR2 A;  5B08 A;  4QU7 A;  1HQE B;  4DMZ A;  1Q86 T;  3IG1 B;  2GMJ A;  3IO1 A;  4Y2I A;  2HNY B;  1FKA F;  1HNX F;  1HBN A;  2J8A A;  2RVJ A;  1YQH A;  3R97 A;  1G7C B;  2BE9 B;  2ZD1 A;  3OXF A;  1XEZ A;  2C2R A;  1GEH A;  3KXD A;  4CO5 A;  5JMN A;  1IKV B;  3K0J A;  3HMJ G;  4MFB B;  4DU8 A;  1BWE A;  3V6J A;  1LQ9 A;  5DGB A;  5DM6 Q;  4IG0 A;  5B0E A;  1Y4Z B;  4LR9 A;  1ELO A;  4D3H A;  5DQH A;  4HL9 A;  1FFW B;  3MPD A;  1JLB A;  2AP6 A;  3PX0 A;  2XSJ B;  1D8Z A;  4TU8 A;  5HQ8 A;  3UDL A;  2MTL A;  2E5L F;  2V2K A;  2R7Q A;  3E51 A;  4OJG A;  4DSI A;  4ECW A;  3OFE A;  3I0R B;  1WC3 A;  2H3E B;  5HO4 A;  2KZZ A;  2DNH A;  4ECU A;  2E5L J;  1UL3 A;  2BKO A;  3M6X A;  3POT B;  2KXN B;  3AOB A;  1PO6 A;  1FRI A;  2OD4 A;  1TMM A;  3TJ9 A;  5JVH Q;  1P9Y A;  3OD2 A;  1RP5 A;  3PR5 B;  2J0X A;  1MML A;  2YQ3 A;  3VAM A;  1LK7 A;  2LA6 A;  5KG7 A;  1GQE A;  3SCI E;  4NXM J;  1E6Y A;  3JAM U;  4WZQ A;  5L9X A;  2IC3 A;  2V8G A;  4UT4 A;  3FZB A;  1ICE B;  3EXY A;  1FVQ A;  2FB0 A;  4OIX A;  3KK3 B;  1EIY B;  4YY3 F;  4C8N A;  1ZOT A;  5KFQ A;  2M8D B;  3HD2 A;  2NCK L;  4NLX A;  3CDU A;  4XPE A;  1U6Z A;  3DN9 A;  4WFB Q;  3HT3 A;  5ETK A;  1VS3 A;  1N34 F;  2FVP A;  2GJF A;  4NEY A;  2F3J A;  4DCO B;  1UMJ A;  4CCH A;  1FRK A;  4LBP A;  2XO6 A;  1L3S A;  2NLW A;  1GXT A;  3HT0 A;  4PG7 A;  1T0T V;  3D1H A;  4Y0F A;  2ALZ A;  3KHH A;  1N34 J;  1HR0 F;  3M2R A;  5EWG A;  4ALZ A;  2R8I A;  1SL0 A;  2YWW A;  3P4U B;  5KFA A;  4FYX B;  1UPM B;  4E98 A;  2YWK A;  1HWU A;  3GCX P;  1XIQ A;  1N36 F;  1JX4 A;  2QO3 A;  2RRN A;  2AT1 B;  2ATC B;  2HBZ B;  1EP4 A;  4DQS A;  2K7K A;  2RDI A;  2UP1 A;  2XBP A;  4OZJ A;  1N36 J;  4EBE A;  3LF0 A;  4YOE A;  2F8M A;  2XWY A;  3CJ2 A;  4DQQ A;  4P52 A;  2RKI A;  3M8R A;  1IWA A;  4L3N A;  3DRP B;  1HIY A;  3SQG B;  3ILJ A;  3CCM S;  4JV2 A;  4I67 A;  4CO4 A;  5HN0 A;  3FSX A;  4I2Q A;  4WE1 B;  1Y7P A;  4ZLL A;  5AXK A;  5KT6 A;  2DNM A;  4M5G A;  5D3G B;  3PKY A;  5J2P B;  4U96 A;  3JSM A;  4Q0B B;  2KT5 A;  1T7P A;  1WKK A;  1QJH A;  4EK2 A;  4CO3 A;  2QLF B;  3ETO A;  3R5D A;  5KFS A;  2RT3 A;  1LW2 A;  5EX3 A;  3L09 A;  1C1B B;  4QPT A;  4F4K A;  3PRD A;  3R27 A;  4WTO B;  5GAE I;  1FF2 A;  4ZJQ A;  4PXE A;  4Y2A A;  1YBA A;  5A76 A;  3T6B A;  1RXO B;  1CPZ A;  4LRA A;  2LEB A;  1VQ5 S;  1GT8 A;  4ZN1 A;  1JMT A;  4F50 A;  1Q8I A;  1RB0 A;  2Y1L B;  2YKN B;  4H4M B;  3M6U A;  5LJ3 Y;  3FQL A;  4ECR A;  3BZQ A;  5AJ3 F;  2PI4 A;  4ZS6 A;  3BSC A;  3H42 A;  4FPR A;  3ITH B;  3NAI A;  5IM0 B;  2HHV A;  2KL8 A;  2V6A A;  5IS2 A;  4M5D A;  1Y0H A;  4NLU A;  5AJ3 J;  1V6H A;  4YB6 A;  4NLD A;  4DR6 F;  4DV1 J;  4PZV A;  2BXJ A;  2OPQ B;  2XI3 A;  1PSD A;  2NSC A;  3G71 S;  3SDE A;  2VD3 A;  1Z1Z A;  2YKO A;  2VDH A;  4DEZ A;  4ZA1 A;  3W63 A;  2K06 A;  2PGC A;  1HBU A;  2MMY A;  2KG0 A;  4DR6 J;  3KK1 B;  3LQV A;  2HHQ A;  4ZIW A;  2KVQ E;  3NGD A;  1S99 A;  3C19 A;  4X62 J;  3BR9 A;  5J1N A;  2EXU A;  4FN5 A;  2K1R A;  5FJ4 A;  2IM0 A;  3V81 A;  3R5J B;  3DM2 A;  2HEK A;  2K2P A;  4QIG A;  2VQF F;  1S79 A;  4WWS A;  3UDE A;  2KM8 B;  1MRO B;  2Y1R I;  1TKX B;  4K0K J;  3A3O B;  1XQI A;  3EMT A;  2DNR A;  2XY5 A;  1KON A;  3VAK A;  3DLG B;  2VQF J;  3CSK A;  3MEC B;  4U95 A;  2IYG A;  1YI2 S;  3OTO F;  1IBL F;  2ZDP A;  2R8J A;  2NRE A;  2B5J B;  4OHW A;  2BE2 A;  3I0S A;  3J7Y I;  4L72 B;  1RAB B;  4OLO A;  3CC4 S;  4DV3 F;  5C5J A;  1IBL J;  1K0V A;  3D1Q A;  2MZS A;  4DFK A;  5K5M A;  4X64 F;  1SH0 A;  2W25 A;  4PR6 A;  2E1R A;  3GB0 A;  4DV3 J;  3UN3 A;  2UVW A;  2QT7 A;  1CJV B;  1X5O A;  3CCJ S;  2HND B;  4KGX B;  2FPH X;  4X64 J;  3ENW A;  1S97 A;  3V4I A;  3TQ1 A;  5T41 A;  3JB9 k;  2YX4 A;  2KYX A;  3PVX A;  5KFY A;  1S9G B;  3T9Z A;  2ASL A;  1XWL A;  4DL5 A;  2B6A A;  2NUH A;  2K3I A;  2J9E A;  1JLQ A;  3LWL A;  4K4S A;  4ED3 A;  2N7C A;  1B64 A;  1CJK B;  1G4C A;  4UUX A;  3CME S;  3NNC A;  1RTH A;  3T19 A;  2V8H A;  2H5J B;  2JNJ A;  1U02 A;  1TKD A;  3TJ8 A;  4USW A;  4CNY A;  3IBC B;  4I6W A;  3V6D A;  4GC6 A;  1E6V A;  3L9Z A;  2ZE2 A;  4ZP7 A;  3O2I A;  4KO0 B;  3W8G A;  3ICL A;  1WOO A;  1SB6 A;  1C4C A;  1NK5 A;  2BV3 A;  4P6Q A;  2AEJ A;  2R7W A;  4LSN A;  4O3S A;  3JTP A;  1KOH A;  3UN5 A;  3FBE A;  2O1P A;  2ZOM A;  2Z2L A;  3U27 A;  1NSK L;  2C3O A;  3IFE A;  1QM9 A;  4ZVU B;  1N4L A;  2BA9 A;  2QG9 B;  4J9V A;  1WHW A;  4KPY A;  1RGV A;  3K7R A;  4OHY A;  4O3P A;  4RW8 B;  2UUA F;  2RIL A;  3RB0 A;  1TKZ A;  3G87 A;  2RU3 A;  4RW7 A;  4A46 A;  1S7I A;  4URS A;  2MST A;  2QA4 G;  2UUA J;  3OBI A;  1VRU A;  3N0V A;  3LGN A;  1U1L A;  3VAG A;  1UVN A;  2XMA A;  1SUQ B;  1RLC L;  1Q5Y A;  1D09 B;  1PJ6 A;  3Q86 A;  1T02 A;  3EDR B;  3UD5 A;  1T8E A;  1RHU B;  1F9F A;  5KFK A;  3GJR B;  3HVW A;  5KFW A;  5F8L A;  2WSE C;  2DKO B;  3CO0 P;  2MPU A;  2M88 A;  4DDF A;  5LSO A;  4Q43 A;  1HWK A;  3RAM A;  2PO4 A;  3ZTQ A;  4JOU A;  3KFW X;  4GO5 X;  4YP3 A;  5FDL A;  2LMI A;  2PA3 A;  1K1Q A;  5E2Q A;  2VU5 A;  2X1A A;  1EAY C;  1O0P A;  2XQC A;  3C6U B;  3O6Q A;  3D6F B;  2SXL A;  3LP2 A;  2ZUA A;  1J2V A;  2DB1 A;  1YJT A;  2HPU A;  3K2Y A;  1IJF B;  4N5S A;  4LF9 F;  1S1T A;  3UNG C;  5KFU A;  1MN9 A;  4LRB A;  4JI0 J;  4P72 A;  2B4V A;  2XGP A;  3OR2 B;  3C3L A;  2HRY A;  2HS0 A;  2IRU A;  3OQ2 A;  3VGU A;  4OQJ A;  3G82 A;  5D8H B;  2F8H A;  3FDS A;  1UEV A;  4LF9 J;  3DRX A;  3MED B;  4F4Y A;  3IN5 A;  1B70 B;  3BH7 B;  2CG4 A;  4V1A k;  2VFV A;  4DF4 A;  3HSJ A;  3QIP B;  5E3C A;  4WKY A;  1HWI A;  2DIS A;  2V68 A;  3DRS B;  5D6G A;  1U0H B;  4UTG A;  5JJB A;  3DLE A;  3GIK A;  3TVK A;  4DPX A;  2B9E A;  1UWB A;  3HHN B;  2EVZ A;  4FKX A;  2DNL A;  1S0V A;  4EO6 A;  2I0X A;  3OTC A;  3IR5 B;  3KNA A;  4JV1 A;  3QFH A;  4UST A;  5G0R A;  5IV3 A;  2Z58 B;  5K14 A;  4WU2 A;  1XR6 A;  1NND A;  2YKP A;  4DSK A;  2Q3P A;  4B9N A;  3LP0 A;  3TJA A;  1FE4 A;  4Y2C A;  4IG3 A;  4MYU A;  2XZW A;  4NLV A;  3GSI A;  4R8U B;  3T6J A;  1VJQ A;  3OL8 A;  4I2P A;  1B0P A;  2BRK A;  5HAT A;  2VHG A;  3DOK A;  2XMU A;  2MKS A;  2C3U A;  4PWW A;  4OFZ A;  4CIO A;  3UVJ B;  1OIA A;  1TL1 A;  2DEJ A;  3D6H B;  4NCG A;  1WF2 A;  3D0G E;  1N52 B;  4HDG A;  1RT1 A;  2QA2 A;  2OI2 A;  1MG7 A;  1CG2 A;  4Z7Y A;  3A3N B;  2CJY B;  5D0E A;  1DTT A;  2Y9H A;  5T7L B;  2Z56 B;  4P2F A;  2UZA A;  4OYB A;  3BKT A;  4KYZ A;  3AA8 A;  1JLB B;  2IY5 B;  2YY3 A;  3KNG A;  4PAB A;  2HFN A;  5ETL A;  2RHS B;  2JLF A;  1YBT A;  2PMH A;  2V69 A;  2O01 C;  3PHE A;  4PYA A;  2YTC A;  3KLG A;  1HNV B;  1S1V A;  2G9O A;  4ED0 A;  1XR7 A;  3MCS A;  1B7Y B;  4DX8 H;  3CTR A;  2FUG 9;  4X4P A;  5HMW A;  4M5J A;  1X9S A;  5J2M A;  3S8S A;  1CS4 B;  3VAJ A;  3CB4 A;  1HBM A;  3VWS A;  1D8Y A;  3BN4 A;  3LAN A;  1T9V A;  2B4U A;  3EIC A;  1ZZN A;  3QGI A;  2YKM B;  1RWX B;  2HVZ A;  4P2M A;  5DG7 A;  1VGY A;  2XYP B;  4O0N A;  3A3P B;  3H2L A;  1YJR A;  5B0A A;  3RU0 A;  1KTQ A;  3DKD A;  5D0H A;  1FDN A;  2YKA A;  4OMF G;  4KHP F;  4HH1 A;  2GAH C;  3TAQ A;  4ZN3 A;  1HAR A;  3QGP A;  4N7T A;  4DQR A;  4HTI A;  3H20 A;  4KHP J;  2BZ2 A;  3MMJ A;  1U1R A;  2AZ1 A;  1WHV A;  1VHF A;  1S6O A;  2IJN A;  4RWW A;  2VFR A;  4I7F A;  2PSZ A;  4I6Y A;  4PQA A;  1RHJ B;  1K44 A;  4OHX A;  4RW6 B;  3KDN A;  4PRF A;  2C2N A;  3THP A;  4N8O A;  2E66 A;  3QQC D;  3D3B J;  3GJQ B;  1MU2 A;  3JS9 A;  3NCR A;  1GTE A;  5HLF B;  4RNH A;  2IYI A;  5L1L A;  2PEH A;  3A8K A;  4CLW A;  5H9E J;  3BBF A;  3VHQ A;  1X4E A;  1WC5 A;  2O5D A;  3SSS A;  5IOL A;  2KXH A;  2ZNZ A;  1IWG A;  1HNI A;  1RK8 A;  4PWD B;  2BKP A;  3T1A A;  3AHP A;  3DI6 A;  3B78 A;  5AXM A;  2N4D A;  2C2O B;  1XMO F;  2RUG A;  2W8K A;  1TR0 A;  5C25 A;  2VBZ A;  2R8G A;  2B51 A;  1A6L A;  4BLG A;  3NCP A;  4C3K A;  1RA7 A;  4MKV A;  2QV6 A;  1F9E B;  1XMO J;  2B7C B;  3Q8R B;  5B0B A;  3DLH A;  1RBO B;  1X4A A;  3M2U A;  2H4W B;  4CDI A;  2O3D A;  1T03 A;  1LWC A;  2ZBC A;  2E9R X;  1BC6 A;  4KKO B;  2HQF A;  3HLU A;  2WRM A;  3FZ2 A;  2FHM A;  4LF7 J;  1NRK A;  3G6E S;  4IRC A;  1S0N A;  2OTL S;  4RW4 B;  2E1A A;  4KR0 B;  1BQN A;  1KLN A;  2V2V A;  4OYW A;  2NS1 B;  4L3K A;  3WIV A;  4DXL A;  1KQF B;  4Y6I A;  2Y1J A;  3KMS A;  4Q5V A;  3DRR A;  4NAS A;  3JSR A;  2BJE A;  2V2Q A;  2NXN A;  2DPI A;  2YH1 A;  3PZP A;  4M5D B;  5C42 A;  2OKQ A;  5M2R A;  4IRD A;  1BUX A;  1V3S A;  2W2M P;  3ZNU A;  1TK5 A;  1YGY A;  3MMB B;  2DHX A;  4ENO A;  3WX4 A;  3EX7 B;  3KHG A;  2IA0 A;  3TW0 A;  4UUW A;  2DR6 A;  3MI7 X;  3HVT B;  1C1C A;  5C24 B;  5D77 A;  3EZ5 A;  4MK8 A;  4DCP B;  4HAC B;  4ZDN A;  3U1M A;  2K1R B;  2C22 A;  3CCQ S;  3QLH A;  2QLB B;  1NDK A;  3CXC R;  1WKL A;  2HNZ B;  4DPW A;  3L7P A;  5CAB A;  1OSD A;  3AY0 A;  1QVG R;  3NG8 A;  3ET6 A;  1CUL A;  3KLE B;  3WX8 A;  1SPB P;  4Z37 A;  1GTH A;  2DNZ A;  1BLU A;  2BAB A;  1RT4 B;  1XK8 A;  3ZXW A;  2BE2 B;  5ETT A;  3UWT A;  2NPF A;  4Y3C A;  4QR0 A;  3BH6 B;  3V6K A;  1FX2 A;  4F02 A;  1U8W A;  1RT2 B;  4RU2 A;  1F9H A;  4ID5 B;  1X9W A;  4YFU A;  2JLG A;  4FXW A;  2AGO A;  4RWX A;  2EC2 A;  2CNL B;  3TUP A;  2W4D A;  2OEL A;  3DYA B;  3K5M A;  1U6F A;  3HJV A;  3AD8 C;  1KVI A;  2HAF A;  3DMJ A;  1V9O A;  3MAA A;  1KRP A;  1F2G A;  3V4I B;  3MCO A;  1X4C A;  3HZG A;  1HQ2 A;  3Q8V A;  4IFY A;  2CUY A;  2XCP A;  4ES3 A;  2LQB A;  1BWV A;  3DNC A;  4DUZ F;  2HFV A;  3J80 Y;  1TL4 A;  1VIO A;  3D66 A;  1G6B A;  4NLQ A;  1HMV A;  2K7J A;  2KJV A;  2CPE A;  5CYQ A;  1R8A A;  3T5H A;  4DUZ J;  4KC5 A;  4H4K A;  3TAM B;  4AL6 A;  1IKY A;  3P6Y C;  1IKW B;  2LQ9 A;  3LAM A;  2CAD A;  2AJQ A;  3JQJ A;  4MIB A;  2GV1 A;  5A8W A;  2RQK A;  3ULH A;  1S49 A;  1TP7 A;  2CAJ A;  2R8H A;  4X4V A;  2OIH A;  5CD4 H;  2ABY A;  2PMW A;  2FJE B;  4ZIV A;  3D28 A;  4RBT A;  3IA0 A;  2IVF B;  1ACM B;  1AUS L;  2G13 A;  2DNK A;  3CDB A;  3BBC A;  2GGP A;  1TL7 B;  4RW9 A;  3LPY A;  4LSN B;  3IBW A;  2OHD A;  3HJF A;  5F0W A;  2HHS A;  3DGP B;  3EVM A;  2M5Y A;  1NK0 A;  2AGQ A;  1FER A;  3D68 A;  1P27 B;  3GMG A;  3PFE A;  1D0E A;  3PW7 A;  4LQ9 A;  3PEH A;  5DQI A;  3LTO A;  4AXJ A;  2BMB A;  1QD1 A;  3UFC X;  4ZJO A;  1U7L A;  2YNG B;  4Q8F A;  5HMZ A;  2Y8Y A;  4HT5 A;  3DHW C;  1H72 C;  4PCQ A;  1HFE L;  3I9V 9;  2CQB A;  3CCW A;  4OX6 A;  2KJW A;  2I6W A;  1QUP A;  2HVD A;  5CYM A;  3KJQ B;  5ETV A;  1L3V A;  1SC3 B;  2MY8 A;  4CNZ A;  1FD8 A;  2VIH A;  2LA4 A;  3WIU A;  1RAI B;  2D3O R;  1FEH A;  1FT8 A;  2J9C A;  4DR1 F;  5FDL B;  1DFD A;  2HSE B;  3MUR P;  2R7U A;  2J7U A;  2YWF A;  2QYG A;  3W8P A;  2V34 A;  1RHQ B;  2DNY A;  4C3L A;  3OJU A;  3FKB A;  2HGL A;  1LWX A;  2QMW A;  1TV6 B;  5KG4 A;  1VQS A;  2ZH6 A;  4IUF A;  3AQO A;  2DH9 A;  4OI4 A;  2J9D E;  2XZT B;  2Q79 A;  2ZC4 A;  2UXD F;  3IRX B;  2QLW A;  1MMN A;  3QJL A;  1U1Q A;  3MEK A;  5HVG A;  1VC6 A;  3QAU A;  2UXD J;  3DCA A;  2HHP A;  3LP1 B;  4MJK A;  2BAN B;  2HW3 A;  2I5J A;  3TZZ A;  2D9P A;  1GFW B;  3P49 B;  3G86 A;  4K4Y A;  3D0H E;  3FJ2 A;  3Q2S C;  5EX0 A;  1MN7 A;  4O3Q A;  2XMT A;  3TX0 A;  2H51 B;  4NLS A;  2ZH5 A;  2IM1 A;  5K14 B;  4U9R A;  3MMC A;  2UUB F;  3AD7 C;  1ARO P;  3QFW A;  3ZTP A;  2RAQ A;  4DL4 A;  5MAO A;  1HPZ A;  2NXJ A;  3SIP B;  3A4T A;  4JI8 F;  3LP0 B;  4MTP A;  1RWW B;  1SH3 A;  4QIW D;  4K50 A;  2XMV A;  3KLF B;  2QN6 B;  5K8P A;  2UUB J;  2VG7 A;  2JC1 A;  3TUJ C;  3TUI C;  1JNZ B;  2AQ4 A;  2DCL A;  4JI8 J;  1PC5 A;  3BGR A;  2WVD A;  4A8F A;  4I2P B;  3MEG B;  1ITP A;  2CJK A;  1NKE A;  3DOK B;  4WK3 A;  3EZO A;  4O3O A;  1NJI T;  5HSP A;  4WZM A;  4B3O A;  1ZPV A;  2RQC A;  1Y9O A;  2XG8 A;  2YBV A;  1S9E A;  4GMK A;  2FJA B;  2FJV A;  4U7U K;  1ZBT A;  4QU6 A;  5K8M A;  2CQ0 A;  4LVN P;  2J7W A;  4PPD A;  4M5L A;  5GAH U;  8ATC B;  4FS2 A;  5F9N A;  1LWE B;  4QJV A;  2EFG A;  1NK4 A;  2I2Y A;  2QA4 S;  3A13 A;  2FD2 A;  2BJ1 A;  4B9L A;  3H98 A;  2GJ2 A;  4ECX A;  2ZH8 A;  2OGU A;  1WDT A;  3C46 A;  4FVC A;  3CDE A;  3PW5 A;  5J2M B;  4X4O A;  2A18 A;  4FXD A;  3EJM A;  1R27 B;  1ZAW A;  2DGQ A;  2H65 B;  2ACY A;  3MWB A;  5KFI A;  4RR5 A;  3KLH B;  3HKZ D;  3TAP A;  3G96 A;  2GHP A;  4C48 A;  2FJD B;  2H1Y A;  1IBK F;  4F0K A;  2OML A;  5HBM B;  1WC1 A;  4IYQ A;  1FNM A;  4C2M A;  3CJK B;  3J81 U;  5GVQ A;  3H2V E;  2HQC A;  1AZS A;  4N56 A;  1IJE B;  3H5Y A;  4NA3 A;  1IBK J;  2DPJ A;  1VYA A;  4P71 A;  5EN1 A;  2A0F B;  1KN6 A;  3I5B A;  3K57 A;  3W62 A;  3EYZ A;  2J6T A;  1CQM A;  4JV0 A;  2ZH7 A;  3GV7 B;  4G1Q A;  2QLX A;  4WPA A;  4YDD B;  3KOA A;  5K8O A;  3NGU A;  1T9W A;  5KG0 A;  2IAJ A;  1S6P B;  4WTY A;  2AX1 A;  4KH1 B;  4USU A;  2U2F A;  2ZBP A;  2WVF A;  1OS5 A;  2AMC B;  4F4W A;  1WI8 A;  4KT0 C;  4R25 A;  2B7B B;  1F60 B;  1BXN A;  3IWL A;  3EE3 A;  1YKW A;  5D0R A;  2XY6 A;  3LOU A;  2M52 A;  2G0I A;  3HUL A;  1V5I B;  2OPS B;  4B9T A;  2YWG A;  2CDQ A;  3HZE A;  2D69 A;  3S7R A;  2FZG B;  3GFH A;  5J2Q A;  1Q8B A;  2LU2 A;  4J9M A;  3GWC A;  2IDE A;  2XB2 D;  3EPG A;  1SL1 A;  5JVG Q;  1HNI B;  4CLF A;  2LXF A;  4DR5 J;  2AEF A;  1XR5 A;  2CNK B;  2PEB A;  5A2Q Y;  2VFT A;  4LBH A;  1S9F A;  2ALY B;  4K4W A;  2VA2 A;  5C25 B;  3GYG A;  2OUG A;  2B3T B;  1SV5 A;  2EG2 A;  1S1W A;  3NEK A;  3IG1 A;  4YHH F;  3M2U B;  5KOW A;  4QYZ J;  2V2Z A;  1EAR A;  2HNY A;  4YR3 A;  5AE1 A;  4TYB A;  2VJU A;  2R4F A;  2LQJ A;  2RML A;  3DC2 A;  3HD1 A;  4ZCI A;  1HI0 P;  5IT9 U;  4YHH J;  4FBT A;  2MKI A;  3T5J A;  3M8Q A;  2RSQ A;  4DV0 F;  1S7H A;  3SSQ A;  1HWL A;  3LPE A;  4JI3 F;  4ZPC A;  2FJB B;  4DS5 A;  4OI0 A;  2R2U A;  2EFQ A;  2IIH A;  2V0N A;  2MLY A;  2MZT A;  4CLK A;  2W2P P;  5L46 A;  1IKV A;  1WDD A;  4JI3 J;  3QZ7 A;  4MFB A;  4DJB A;  4DU7 A;  1U48 A;  1HNZ F;  1H3D A;  4KGK A;  3CF5 Q;  4MH8 A;  1IN0 A;  2X1B A;  2CPJ A;  4L73 A;  2FZK B;  4B3R F;  1RTD B;  4U6P A;  4LF8 F;  2ZH3 A;  1WOS A;  5GAD I;  2JLE A;  1HNZ J;  1X4H A;  4B3R J;  1UW4 A;  4LF8 J;  3K58 A;  1FFG B;  3I0R A;  3D6T B;  2HZC A;  3CJR A;  2MKJ A;  1FJG F;  3GFX A;  1RLD A;  3POT A;  1WHX A;  1KBR A;  2Q66 A;  1RT5 B;  1PC4 A;  5EHH A;  1FJG J;  2JSX A;  1AYE A;  2RDD A;  5I42 B;  4J5O A;  1F6T A;  3OT9 A;  1UCN A;  5A8R B;  2UUC F;  1P9Q C;  4BWJ A;  1B3T A;  4U7U D;  3KK3 A;  3N6M A;  4KV8 B;  4QR1 A;  1T95 A;  1AT1 B;  2HBQ B;  3P5T L;  2E9T A;  2ZEJ A;  1JJC B;  2UUC J;  2MQM A;  4V19 X;  4P7T A;  4I64 A;  1IQZ A;  1VOM A;  4NA1 A;  3CCV S;  1NME B;  1W2I A;  3CJ4 A;  2BKN A;  4WCE Q;  5LSR A;  4P74 A;  2NXC A;  1H7X A;  4UOG A;  1RAC B;  5LSL A;  3AB4 B;  3LGM A;  3T41 A;  2VIC A;  1P8G A;  4FPI A;  4Y00 A;  3ENV A;  1UET A;  5KG5 A;  2KT3 A;  4F04 B;  2OPP B;  4Q45 A;  4FP9 A;  2GML A;  4ECZ A;  5GMK a;  1NO8 A;  2QJ3 A;  2BJ3 A;  2BW2 A;  3MPW A;  4AL5 A;  3CUN A;  1M5S A;  4KB7 A;  4HI1 A;  3NMR A;  3QO9 B;  5AT1 B;  2ZJR Q;  3DMJ B;  2HQD A;  5D4O A;  3CCS S;  2FLP A;  4PQU A;  2WON A;  8AT1 B;  2WOM B;  4CM2 A;  2KU7 A;  2EWH A;  1KQK A;  4E8U A;  2LU1 A;  4UZB A;  2C1E B;  4ATN A;  2ZWO A;  2JFD A;  3EXC X;  1DLO B;  3UDV A;  1R0A B;  5D78 A;  2PT0 A;  4YQW A;  3JQM A;  3I56 S;  1NDL A;  4X66 F;  2Y0B B;  3EGV A;  2FJW A;  3DLK B;  5L8R C;  3SQG A;  1IKY B;  3PIP Q;  4J9Q A;  1I3O B;  5KFP A;  2Y8W A;  4GVL A;  3HCX A;  3E2E A;  4FKY A;  4X66 J;  2XHC A;  4WE1 A;  2PN6 A;  5LXY A;  2GVD B;  4OV6 A;  3BS9 A;  4N77 A;  5D3G A;  3R6G B;  5J2P A;  2IDL A;  4Q0B A;  3NOG A;  4IO9 Q;  4GVB B;  3GQC A;  1HHT P;  3I5C A;  1UVM A;  3NCQ A;  4KE5 A;  4RW9 B;  2R42 A;  3UCU P;  1C1B A;  1QLN A;  3W5X A;  2ZHA A;  2AGP A;  2YNF B;  4FYD A;  2BEF A;  3BQ0 A;  4N76 A;  2HQI A;  4P2S A;  4CLU A;  4UF4 A;  3OFG A;  1RHR B;  1X7V A;  2ZM6 F;  4DS4 A;  2DIV A;  2CYY A;  1QAI A;  3EPI A;  1FNX H;  2KXF A;  4H4M A;  2YKN A;  3UE2 A;  8RUC A;  1CC7 A;  2QFI A;  2ZM6 J;  1YJ7 A;  1TU0 B;  4HI2 A;  3VAH A;  3GJT B;  3OTD A;  1IBM F;  4DV7 F;  4DF8 A;  3UQS A;  5IM0 A;  4N8N A;  2MJN A;  3U1L A;  2B43 A;  3MM9 B;  2AU0 A;  1RWV B;  2Z30 B;  1YRX A;  2H5I B;  5EWF A;  3CDW A;  2Q6C A;  1IBM J;  1S4F A;  5FLX U;  4DV7 J;  4N41 A;  2LKZ A;  4G1I A;  5CYM B;  5BXI A;  2JEF A;  2ROG A;  5DRK A;  2OPQ A;  2FHJ A;  4A8Y A;  5MLC V;  3I9Z A;  4LVO P;  5IC4 B;  2HG4 A;  1Q0N A;  2V4Q A;  3KK1 A;  4BWM A;  5IWA F;  2X3D A;  4K5R A;  5DG8 A;  2DEI A;  2GZO A;  3QSI A;  1JLG B;  2L08 A;  4ZVF A;  3MR6 A;  4DV4 J;  1RDR A;  4ZHR B;  4MIA A;  2BJ7 A;  1HD0 A;  1RTI B;  5IWA J;  3TQE A;  1OMS A;  4PAA A;  1RWP B;  2KZM A;  1JJ4 A;  1OPZ A;  1HI8 A;  3UD4 P;  1TKX A;  3N79 A;  3D67 A;  3DLG A;  3MEC A;  3U1N A;  2IM2 A;  2CJ9 A;  2ZFH A;  4LRF A;  2ZJQ Q;  2MZR A;  1RA6 A;  4R0E A;  4GKJ J;  1J5E F;  4Q44 A;  2FIU A;  2AV5 A;  3NGK A;  1N5T A;  1QTN B;  4NML A;  3B4D A;  4QWE A;  4C7Q A;  4B9U A;  3TEG A;  4B02 A;  2QL5 B;  3CJ8 A;  2VG5 B;  1J5E J;  3EGZ A;  3QJP A;  1AFI A;  4V19 J;  5DGA A;  2A10 A;  2VBW A;  2XLJ A;  2C28 A;  3AD9 C;  2MJU A;  2MQ8 A;  3P3D A;  4LIW A;  2CWK A;  1CJT A;  1M5K C;  2HND A;  1HQU B;  4F0H A;  4RNM A;  3G6V A;  4DSJ A;  2LYV A;  2HRU A;  3FC9 A;  3AOA A;  1JK9 B;  4X4Q A;  4Y28 C;  2R7R A;  1S9G A;  3GR0 A;  2CDR B;  2OD6 A;  2AYE A;  4DZD A;  2RF2 B;  2WZ1 A;  3PR4 A;  1KFS A;  1JWW A;  3AOC A;  3HM9 A;  5KFT A;  2BQR A;  4UQT A;  4OZL A;  2AF6 A;  4YUD A;  2QRR A;  2KI2 A;  4NCA A;  1BQM B;  2VQE F;  2HUR A;  3DDN A;  3LO3 A;  4Y2M A;  2ZBQ A;  5HL7 Q;  1CJK A;  1YRU A;  4USM A;  4J9R A;  2EFP A;  1Q53 A;  2R2T A;  4C6A A;  3MHY A;  4R5P B;  4TKT A;  2DNO A;  3HFV A;  4NOH A;  1TK8 A;  2EK1 A;  4OX9 F;  1GMU A;  2X7I A;  4IR9 A;  2BQ3 A;  1YJV A;  2GQ2 A;  2HMI B;  4ED1 A;  4C11 B;  3JAM Y;  2V4J B;  1QTM A;  5B0G A;  3RGI A;  4OX9 J;  2XYG B;  1MW7 A;  1T94 A;  3M6V A;  5DET A;  1RZM A;  1J27 A;  3OFH A;  4ER8 A;  4A8S A;  1R0B G;  1R0C B;  3CDA A;  4CLY A;  2IVY A;  2MYF A;  5CD4 A;  4FF1 A;  3V2U C;  4C8M A;  1IM4 A;  2CPX A;  4C4W A;  4RW8 A;  3KTQ A;  3NP5 A;  3ZC4 A;  1B0V A;  3BF4 A;  3AJ2 A;  3PYG A;  1TTH B;  1AUD A;  1R8C A;  4K4V A;  4JI2 F;  1D9F A;  2DRB A;  2DRD A;  5B0F A;  1S10 A;  1EKR A;  1H2U X;  3HSG A;  2NYI A;  2MXY A;  2RJZ A;  1GAO A;  4JI2 J;  4J90 A;  1KC8 T;  2XMJ A;  1D1U A;  2V9W A;  3NL0 A;  4JBC A;  2GHV C;  4G1P A;  3CCE S;  4WIQ A;  1UEU A;  5HP1 B;  1H74 A;  1PJ5 A;  4XK8 C;  2NYH A;  2HVH A;  2WB1 D;  1NKB A;  4C97 A;  4PEO A;  5J1E B;  1F0X A;  3C14 B;  3EZU A;  1Y5N B;  3B82 A;  2G2O A;  3EVO A;  3IM9 A;  3C6U A;  1RU2 A;  3MM7 A;  4LSZ B;  2CZV C;  4LRE A;  1QE1 B;  4K8R A;  1XNQ J;  1K9M T;  3ZZ0 A;  2WHO A;  2APO A;  4CT8 A;  3CUL A;  2F40 A;  3DOL B;  4RZR A;  5DJB A;  3OR2 A;  1IR2 A;  5BYS A;  4QWD A;  5GAG U;  3MED A;  1VK3 A;  1YK9 A;  1NAQ A;  4NZ7 A;  4FZV A;  1SKR A;  3BQ2 A;  4OYP A;  1MSW D;  3RUB L;  5F8I A;  3QIP A;  2HYI B;  1X4G A;  5J2Q B;  3DRS A;  1NZ8 A;  1U0H A;  3V4M A;  1VQ8 S;  2Z2Z A;  3G8T A;  5HQL A;  3FSI A;  3UR3 C;  2MLX A;  4ILR A;  3FEY B;  3THV A;  1RQ0 A;  4I4B A;  1YVF A;  2FLO A;  1JLF B;  4I56 A;  3TWZ A;  4LFC F;  1S1W B;  1TAU A;  1QY7 A;  3PX4 A;  2ADC A;  1VJW A;  4ED2 A;  3KDO A;  1RAH B;  3W64 A;  1UPP A;  1F2H A;  2GA7 A;  4CRJ A;  2L9D A;  1Q8L A;  2HBR B;  3MM8 B;  3A1Y G;  4LFC J;  1T05 B;  1VC0 A;  4R8U A;  3RRH A;  1NJY A;  3G9C A;  5ETS A;  2XO7 A;  1APS A;  5E33 A;  1YX2 A;  4A8M P;  3M8Q B;  3UVJ A;  2A3J A;  5DQG A;  1WOP A;  2RE1 A;  5DDQ C;  4O23 A;  2HZA A;  4B3S J;  1RWN B;  5GAH I;  2MB0 B;  3MR7 A;  2MSS A;  3GLJ A;  4ANC A;  1N48 A;  4QYR A;  4ES1 A;  2AW0 A;  2BJD A;  1DQ9 A;  5T7L A;  3MR3 A;  2CJA A;  4IFV B;  1NKC A;  4MKA A;  4MK9 A;  3M30 A;  2QGF B;  1QVF R;  1T3O A;  1VQP S;  3PHT A;  1JNR B;  1M1K T;  1TKT B;  3SFG A;  3D0I E;  1SBR A;  2JL9 A;  3A8I A;  3RG6 A;  3SCL E;  3NY0 A;  5ETM A;  2AZ3 A;  1AW0 A;  2YX7 A;  1HNV A;  2KKH A;  3I55 S;  4DSL A;  1HHQ A;  3CIM A;  1FRL A;  3BRE A;  5F8G A;  1U1P A;  4NXM F;  3IBF B;  1HLW A;  2CZ9 A;  1YG0 A;  3K5P A;  2RUS A;  1P1L A;  5E5N A;  2DHH A;  1CS4 A;  3KUH A;  3ZZU A;  3FVY A;  5I3U B;  2GVZ B;  4E0D A;  2YKM A;  4UOC A;  4X4N A;  3TUZ C;  4A4J A;  3NNA A;  4IOB A;  4LSL B;  3PCO B;  1WAC A;  1FO1 A;  2CNN B;  4GC7 A;  1YZ7 A;  2RS8 A;  1YZ6 A;  4KIA A;  3VVT A;  2MQP A;  2BBE A;  4PG6 A;  3OXL A;  4C9D A;  4FVM A;  2OTJ S;  3MM6 B;  3H4B A;  4ZLJ A;  3HHK A;  4R0J A;  2F9D A;  2YNI B;  4WP3 A;  1L3K A;  3QYY A;  4RW6 A;  2P9G A;  1JLC B;  2VBY A;  2VA3 A;  3GP9 A;  4WP9 A;  4PQU B;  1M5O C;  2WON B;  3OLA A;  2H54 B;  5A0Y B;  1W26 A;  5HLF A;  3A8E A;  3EWG A;  5KFO A;  2ILY A;  1LFW A;  4CLP A;  2DR8 A;  1WEY A;  2OMO A;  2CJX B;  4JYA F;  2PII A;  4NLW A;  3PXG a;  4UZC A;  3GSD A;  2D7S A;  2CXE A;  2W9A A;  3M2V B;  1PBU A;  1NHV A;  2GC8 A;  4PG5 A;  5KFH A;  3IR6 B;  1RHK B;  3WC2 A;  1NK7 A;  2DO4 A;  3T9N A;  1QAX A;  3I32 A;  4JYA J;  1Q95 G;  4PWD A;  2Z4P A;  1WOR A;  3TO8 A;  1KD1 T;  1HBO B;  1S1X B;  4NCB A;  2DT9 A;  2E1C A;  4FYY B;  2A1B A;  3DLJ A;  2DRA A;  5I4M A;  1L3T A;  5DDR C;  2E1M C;  1FDD A;  4OI1 A;  2DCU B;  3JTN A;  3CD7 A;  2QMU B;  4FYV B;  3CT9 A;  2NPI A;  1C0U A;  1NBE B;  3V5R A;  2AJF E;  2J8S A;  4KKO A;  4TNO A;  2EFO A;  3M8P B;  4DQI A;  3MMA B;  5GAE U;  4ZOS A;  1VRT B;  4PG8 A;  4EZ6 A;  2LQ8 A;  1WSR A;  2ZKU A;  4RW4 A;  3ELH A;  3EM1 A;  1RWK B;  1N54 B;  4K2J A;  3KG1 A;  2OAU A;  4JI6 J;  2OO4 A;  4DWI A;  2UXC F;  3TVY A;  4I69 A;  2KB2 A;  3C16 B;  4DL7 A;  4ZCM A;  4QWB A;  4RLE A;  1OJ4 A;  5KG2 A;  5ITH A;  4ECT A;  4NZ6 A;  1XBW A;  5EGY A;  4OI2 A;  4DV1 F;  1XTZ A;  2UXC J;  4ZJL A;  2B9W A;  3RAX A;  1NHU A;  3BQ1 A;  1NHK L;  4ETZ A;  2DR5 A;  3RBE A;  1N5S A;  3MMB A;  3G8S A;  3GV8 B;  5DZ7 A;  2HZV A;  1R31 A;  4X62 F;  1TL3 A;  5CQG A;  3HF5 A;  1LK5 A;  3VAF A;  1S57 A;  5LMN F;  3HVT A;  5C24 A;  3OR1 B;  4Z2X A;  3MF5 A;  1RAE B;  4PUO B;  4M94 A;  1AA1 B;  3ETM A;  3DHX A;  1H2T Z;  2WB4 A;  4CLZ A;  4K0K F;  4HAC A;  2H48 B;  5KFC A;  3R3T A;  4B3M F;  2M2B A;  2VC1 A;  2AIR B;  5LMN J;  3K89 A;  2B4O A;  1KP6 A;  1JXE A;  4F0M A;  1WNE A;  3W2V B;  1OYE A;  2HNZ A;  1RWU A;  4B3M J;  1KFD A;  1U1N A;  3KLE A;  1TUV A;  1FHT A;  2ZC3 A;  2G1D A;  3OL9 A;  3Q24 A;  2WW4 A;  1RT4 A;  1UZD A;  2W24 A;  4CZC A;  3M8W A;  3W2W B;  3P8B B;  2J76 E;  1YTY A;  1O51 A;  5AE2 A;  1RT2 A;  1NM2 A;  4M5I A;  3S6E A;  3QID A;  4ID5 A;  2DNG A;  2X1F A;  1YHQ S;  4ES2 A;  3CD6 S;  5CZV A;  1VQN S;  3MD1 A;  4OI6 A;  3DYA A;  1CJT B;  2P6S A;  2YQ1 A;  3GFY A;  1TMJ A;  2XLK A;  3SV3 A;  1SC4 B;  1K47 A;  4CM0 A;  4MT1 A;  3OHA A;  2FDN A;  3TI0 A;  2W2Q P;  5F8H A;  3NLC A;  5SZT A;  3OXG A;  1CJU B;  2MKC A;  2IRX A;  1EET B;  1NCL A;  3QSY B;  3KG4 A;  2MGZ B;  2Z0G A;  2B8Q A;  3GON A;  1YJN S;  1FWK A;  3E8O A;  3BO4 A;  3TAM A;  4HDH A;  2HHT A;  2LXU A;  1IKW A;  4CLS A;  2VPZ B;  4ZMM A;  4IO1 A;  3W66 A;  2HIY A;  2KTQ A;  2ZHB A;  4ZVQ B;  3HKW A;  2KDO A;  3MR5 A;  4I1T A;  1XMQ F;  2CPD A;  3SZ2 A;  2HK2 A;  1SCJ B;  3PM9 A;  1YIT S;  1TL7 A;  4X2B A;  1U49 A;  2N3O A;  1XMQ J;  1R6V A;  4QBU A;  4L75 A;  1D9A A;  4QPX A;  3CCL S;  2OFH X;  5F0U A;  3DGP A;  2KT2 A;  1RTJ A;  2RQM A;  2VPY B;  1FD2 A;  1N6Q B;  3IXQ A;  3H4D A;  2ASY A;  2O66 A;  3J7Z 5;  2ZH4 A;  4CLL A;  1QSL A;  1F5A A;  3UW1 A;  3N4W A;  5IC6 B;  4RBV A;  3HXM A;  2YNG A;  4KGM A;  2DTJ A;  4O44 B;  1TFW A;  3TA0 A;  5F41 A;  1OSC A;  3F56 A;  3F73 A;  1GXU A;  1X4D A;  2VB6 A;  3RBX A;  1M90 T;  1FK9 B;  4LT6 A;  3HPO A;  2VKR A;  4LMZ A;  5IQQ A;  4QW9 A;  1ZAV A;  4AUK A;  4CT9 A;  1Q79 A;  1VQY A;  3DGV A;  3VZI A;  2CPH A;  4ECS A;  3UO0 A;  3PEJ A;  2MZQ A;  1BQX A;  3Q8Y A;  3NS6 A;  1JLE B;  2ILZ A;  3TA1 A;  3M8Y A;  3MPU B;  4NEZ A;  5B09 A;  1X9M A;  2DR7 A;  4JI0 F;  4QYZ K;  1EB0 A;  3SXL A;  2F5G A;  3MM7 B;  5DLF A;  5BR8 F;  1TV6 A;  2OEM A;  3C66 A;  5L39 A;  1LXJ A;  3PFO A;  2DR9 A;  2IJF A;  1QDU B;  5KFN A;  1UVK A;  3KYL A;  4OJ3 A;  5BR8 J;  3G6X A;  3IRX A;  3VF0 B;  3K8W A;  4F67 A;  2A6O A;  4XAK A;  5THW A;  1RT6 B;  2P2C B;  2E29 A;  1RUS A;  5K8N A;  2EC0 A;  3LP1 A;  1ZZF A;  2FGO A;  2BAN A;  1U0S A;  4EEY A;  2VFU A;  3N01 A;  4LJM A;  3PJW A;  4FF2 A;  3M8Z A;  3M32 B;  4OZ3 A;  2U1A A;  3CC7 S;  1MMD A;  3BDE A;  4DPT A;  4ZP9 A;  2HS3 A;  3JSB A;  2GQC A;  3IGN A;  1NUE A;  2B0G A;  3KK2 B;  1HL6 A;  3AQP A;  2A2C A;  1V5V A;  4ELT A;  2XM3 A;  4FF4 A;  1A9N B;  1ZM9 A;  5E3R A;  4TYA A;  1JXL A;  5KFM A;  4CQ1 A;  4NI2 B;  3GIR A;  3RR7 A;  2DH8 A;  2FJX A;  4WYW A;  3BKU A;  5D15 A;  2B8P A;  1PCA A;  3KLF A;  1DQ8 A;  1Q7L B;  2ZOF A;  3MEG A;  3NS7 B;  2GJI A;  2QC3 A;  5HJY A;  3C6T B;  2HHW A;  1N5V A;  1F3F A;  3LAL A;  1X5P A;  3VAI A;  1R8P A;  3QPI A;  2F4V F;  1SQE A;  4KFB B;  1RWO B;  2IVM A;  4U7C A;  2WBR A;  5U47 A;  1NPP A;  1RBL A;  2ZH2 A;  2JDJ A;  3TAR A;  4H4O B;  1S6Q B;  4KAI A;  3PW2 A;  3W5Y A;  1HA1 A;  3M30 B;  4OYA A;  2F4V J;  2QX0 A;  2OPR A;  3RB3 A;  2YKQ A;  1D3W A;  1HYS B;  2RDJ A;  1DY3 A;  1LWE A;  5DS7 A;  5HQM A;  4QW8 A;  2OJ3 A;  2MEW A;  1SL2 A;  1X8D A;  1U1M A;  1FKO A;  2YH0 A;  3H5S A;  7FDR A;  1A0O B;  4QIF A;  1AXQ A;  1PGZ A;  1ZA2 B;  3AOD A;  5J2N B;  2DVI A;  4WFA Q;  4ZPA A;  2XNR A;  1B4S A;  4OJ1 A;  4OHZ A;  1KOO A;  2PFD A;  2KN4 A;  2HFU A;  4ZP6 A;  3NAH A;  2CQ4 A;  2RIJ A;  4M5H A;  1X5S A;  3NGS A;  3KLH A;  2KRB A;  1URR A;  2RQ4 A;  1U2F A;  4RUA A;  3CGI A;  2G0J A;  1VQO S;  5HBM A;  1K8A T;  5D4L A;  3Q23 A;  2A2D A;  2MQO A;  3CJK A;  3ILI A;  3M05 A;  3IRW P;  4P2X A;  4DHV A;  3B6B A;  7AT1 B;  5CZX A;  3TRG A;  4ZIT A;  2J7K A;  5KFB A;  1N0V C;  3E3X A;  1M1H A;  2BW7 A;  3Q8P B;  1F5C A;  3ZZO A;  1FJC A;  3OW2 R;  2L41 A;  2IJR A;  3BSA A;  2POK A;  3W5Z A;  3L95 X;  3O8W A;  2ZZT A;  3KJV B;  4GKK F;  1S6P A;  1LEO A;  3ZFV A;  1U2R A;  3WHI A;  2GQQ A;  2CQP A;  3DDI A;  3AH6 A;  3X3U A;  5B0C A;  2C3Y A;  5KT5 A;  4EFA C;  4GKK J;  4MIW A;  3PDN A;  1RAD B;  3AFG A;  4J9N A;  3DLL Q;  2P9E A;  2DNQ A;  2QTW A;  2CVE A;  2OPS A;  1SIZ A;  2QIF A;  3IAM 9;  2JJ4 D;  2C2D A;  1KS2 A;  4XPC A;  3DRY A;  3EGW B;  4TU9 A;  2J5A A;  4XDD A;  2HKE A;  3MTJ A;  4ED8 A;  2E5J A;  3BPS P;  1S6U A;  2QE5 A;  1MLA A;  1Q7Y T;  3HI9 A;  1UJ6 A;  3PTW A;  1YRT A;  2N4C A;  5LM7 E;  4LIR A;  1F5B A;  3FRZ A;  4ZCL A;  3OVS A;  2M3D A;  4HHH A;  1VQ6 S;  1UVL A;  2W7A A;  2KYZ A;  2MHE A;  3L4B C;  1KQS R;  2JHE A;  3T3F A;  2WTF A;  1M5V C;  1GMV A;  3IS9 B;  2HWT A;  1VBX A;  4I68 A;  3BR8 A;  4HR2 A;  4B9V A;  4LF7 F;  2LP4 A;  1C0U B;  3CW2 C;  1GNK A;  2C3M A;  1HNX J;  4HT7 A;  3PO4 A;  3O3L A;  1DAR A;  3NGT A;  5IT0 A;  4Y34 A;  4OJH A;  1WTB A;  2HHX A;  3DU5 A;  4UW2 A;  4UY8 5;  4QCL A;  2RU9 A;  3GII A;  1WUU A;  3OHB A;  3KLI B;  5CCL A;  4A48 A;  2DGS A;  4ZVR B;  2YWH A;  2BYC A;  1ZYQ A;  2IFX A;  3M6W A;  1V3Z A;  3UN2 A;  1RTD A;  2J9D A;  4UOH A;  3F0N A;  2ZH9 A;  3KKF A;  4DPU A;  5HVF A;  3K59 A;  2FY8 A;  2UVR A;  4RX6 A;  4CO2 A;  2EBE A;  4KJI A;  4CH0 S;  4QIE A;  3PYF A;  4A8O A;  2B56 A;  2E1P A;  4TQS A;  1TL3 B;  1NK9 A;  3GR1 A;  2RD5 C;  1YIJ S;  4EGL A;  3ILO A;  1Y5L B;  1RT5 A;  2KG1 A;  4OV1 A;  3TZW A;  1VMB A;  1RT7 B;  3MM5 B;  1Y10 A;  1Y11 A;  3CC2 S;  1RKI A;  1MNE A;  1CBK A;  5I42 A;  1TAQ A;  1RT3 B;  1UVJ A;  4CTA B;  3CCZ A;  3LAK A;  3U02 A;  4DV2 F;  5A8R A;  3R9L A;  4W92 B;  2DNP A;  4YY3 J;  5F9L A;  5KFL A;  2DXF A;  4KV8 A;  3RTV A;  1NSP A;  2NSB A;  4DV2 J;  1CVJ A;  3PO5 A;  2XS5 A;  4HTJ A;  5ADZ A;  2JVO A;  4PYD A;  3PRV A;  1HR0 J;  3BBB A;  2V8D A;  2L3M A;  4DR7 F;  3TP2 A;  3A12 A;  2OPP A;  3JXO A;  5KOX A;  1O8B A;  4KGZ B;  3BGF A;  1RAG B;  3LA0 A;  4WXO A;  2QYC A;  1WG5 A;  4DR7 J;  1KQG B;  1SKW A;  2B4P A;  3QO9 A;  3OVA A;  2V5H G;  4ELV A;  3RW7 A;  1UA0 A;  4USH A;  3CCR S;  2GS8 A;  4IOA Q;  4C0O C;  1P1T A;  3R5B A;  3FK4 A;  2WOM A;  4OZN A;  1JJH A;  2Z2M A;  1NJW A;  4LFA F;  5L1J A;  1DLO A;  1RTZ A;  2VF3 A;  4C3M A;  2OSQ A;  1R0A A;  1DRZ A;  2EKY A;  1DZ5 A;  2FHO B;  2I38 A;  2JOQ A;  2MZ1 A;  5DM7 Q;  3VZH A;  3DLK A;  3W1Y C;  2Q1L A;  4RNO A;  4LFA J;  1VQ7 S;  5HRO A;  1U1K A;  1IR1 A;  3KJN B;  2YPY A;  3BGO P;  4OZ2 A;  5HI7 A;  1VHI A;  2PD1 A;  4DL2 A;  3DXB A;  2UXB F;  3VQS A;  1AB8 A;  2GVD A;  1NU4 A;  2CFX A;  1CC8 A;  2V67 A;  4ZCK A;  3FRY A;  2ZHO A;  3BO2 A;  3NWG A;  3J81 j;  5IZH A;  2UXB J;  4GVB A;  3MXH P;  2P5V A;  3S1T A;  3CMA S;  3RRG A;  1JKH A;  1BD6 A;  3C15 B;  5IT4 A;  3N9U C;  2GMH A;  4M95 A;  2B9Y A;  3LWM A;  2JEG A;  1N5Y B;  4A8W A;  2YNF A;  2Z2Y B;  2CPI A;  4ZPD A;  1RTJ B;  3J81 Y;  4I0W A;  2QZ8 A;  2BQU A;  2H9Z A;  2KRR A;  3I4H X;  2CQD A;  3MPY A;  3HSD A;  5M2U A;  2GX8 A;  1NSQ A;  2C2Z B;  3WZ0 A;  3T1Y F;  1KDN A;  2XLI A;  3DU6 A;  3OSP A;  4C8O A;  1EX8 A;  1OY8 A;  2BOA A;  2IMO A;  3KMQ A;  2JZ5 A;  3T1Y J;  1R3N A;  1I51 B;  5KFV A;  3PYE A;  1ZTT A;  1O6X A;  4AFF A;  2CPZ A;  3MM9 A;  2G4B A;  1NH8 A;  2GIQ A;  3RBD A;  1TQL A;  4W90 B;  4RUH A;  2BRL A;  1DBD A;  3I6P A;  3BPD A;  3FCV A;  2UV8 A;  1Q81 T;  1LWF B;  4U8V A;  1ZAX A;  2AD9 A;  4DLE A;  4DPY A;  4RU9 A;  2AX0 A;  1H73 A;  1L5U A;  3Q0A A;  2FY1 A;  2D74 B;  1U47 A;  4L6V 3;  4ICL B;  1F1B B;  1FTC A;  2VL1 A;  3CVK A;  2F1F A;  1FDB A;  1JLG A;  1OWX A;  4ZHR A;  3K5O A;  1PBA A;  4WKR A;  1RTI A;  1BGX T;  2W9C B;  1VQL S;  4EUV A;  2DY1 A;  1X5T A;  3FEX B;  4K4Z A;  3C8Y A;  3D2W A;  3TAN A;  5KFX A;  1IQT A;  4WYL A;  2W9B B;  3UCZ P;  3HHL B;  3OTO J;  1KLM B;  4IRK A;  3G4S S;  1N8R T;  1X0P A;  4AE5 A;  4RUB A;  4WXW A;  3FBF A;  1HKA A;  4ZVP B;  3PYD A;  4X4U A;  2EK6 A;  2X1G A;  1RAJ A;  4ZP8 A;  3UPF A;  5KFD A;  2R8K A;  3CJ3 A;  4L74 A;  1KHV A;  2ZIT A;  2VG5 A;  4X4T A;  3NNH A;  2XI2 A;  2VOP A;  1ZM3 A;  4DL3 A;  2HVE A;  5IT9 Y;  2HFO A;  4KPC A;  5KFR A;  3T5K A;  1OQ6 A;  1UTA A;  1GH8 A;  4OYZ A;  2XY7 A;  4QOT A;  3QT8 A;  2NUU G;  1HQU A;  5HAO A;  3JQK A;  2WAQ D;  1XER A;  4DG1 B;  4ZLN A;  3H59 A;  1Q4R A;  2PA8 D;  3KG0 A;  3OUY B;  2RF2 A;  1WG4 A;  2R3V A;  2HK3 A;  4G6V B;  2VG6 B;  4QWA A;  4NE9 C;  3WDO A;  5DDO C;  2RHQ B;  4Y2K A;  2E5I A;  2VPW B;  3PV8 A;  4DSE A;  3NRB A;  1BQM A;  2W7O A;  1J5O B;  4YR0 A;  3VGT A;  1FX4 A;  1HW8 A;  3FFI B;  4JI4 F;  4JUZ A;  3HX9 A;  4ZPV R;  4XO0 A;  4O3N A;  3CJT A;  3NKY A;  1N33 F;  2MQQ A;  2RB7 A;  1S59 A;  2HS4 A;  4TY8 B;  1FRM A;  5A8K B;  4R5P A;  4JI4 J;  2ZH1 A;  4WII A;  3SI8 A;  3SYZ A;  1N33 J;  2DD8 S;  4NYO A;  2I9S A;  4HH0 A;  2P6T A;  2HMI A;  2IBK A;  2CQI A;  6FD1 A;  4C11 A;  3VGS A;  1WTF A;  1NDP A;  2V4J A;  3BSO A;  3J7Z T;  1I1G A;  4U67 Q;  3FCH A;  4DFJ A;  3M4X A;  3MD3 A;  2OPR B;  4K4T A;  1WD6 A;  3R1L A;  3DLB A;  3PNI A;  4PKD B;  3MPV A;  1XC9 A;  1RCX B;  4OYO A;  1NJX A;  4RL1 A;  2FLN A;  2MLZ A;  1FKO B;  2FTR A;  4DR4 F;  3TYT A;  5KAK A;  1H2V Z;  4RUC A;  4OX7 A;  4XDC A;  2DIT A;  2VUG A;  1Z4U A;  5A6W A;  2GCF A;  2AEM A;  5HVH A;  4DR4 J;  2P9C A;  2Q43 A;  1WKJ A;  1VQ9 S;  3E01 B;  1FKP B;  1Q8K A;  3D3C J;  4U8Y A;  3G2X A;  5ETP A;  3DFE A;  4EYH B;  2AJ1 A;  3BKF A;  1SJ4 P;  3EDQ B;  4A8X A;  1DUR A;  2HHH F;  2R2S A;  2ZUG A;  2ZVI A;  3IMQ J;  2D3Z A;  2MHN A;  1HW9 A;  3MEE B;  4EO8 A;  2W1B A;  2MQL A;  4YB1 P;  3FEZ A;  2OSR A;  2D3U A;  1GX5 A;  3FMW A;  2HHH J;  1UJ5 A;  1UP1 A;  4ELU A;  2FZC B;  3GIM A;  4AQY F;  1RYR A;  1RU1 A;  3BJY A;  5HP1 A;  4CYU B;  3CJS A;  3I5A A;  1VQK S;  1RI7 A;  1VBY A;  1LV5 A;  3AXK A;  5J1E A;  3NXZ A;  4LR8 A;  2YNH B;  1U45 A;  2WCX A;  6AT1 B;  4YME A;  4O4G A;  3GTY X;  4JI5 F;  4AQY J;  3C14 A;  3DOM B;  1WF1 A;  1FEE A;  4HEA 9;  2FLL A;  2G0C A;  5AE3 A;  1XN9 A;  4DCJ B;  3WQP A;  4YEA A;  4J7C A;  2AYG A;  3SCK E;  3N6L A;  1QE1 A;  4MKB A;  4JI5 J;  1VLO A;  4LF4 F;  2LEA A;  5J1P A;  4F2R A;  5AXL A;  1I94 F;  3DOL A;  2O67 A;  4EU0 A;  2BM1 A;  1L3U A;  2W2O P;  2NR0 A;  1DJ0 A;  4ECQ A;  1ZET A;  2M70 A;  2V63 A;  2KVI A;  4LF4 J;  2FYX A;  1TL5 A;  1DTQ B;  1I94 J;  1IXK A;  3M1V A;  4BC9 A;  3OTB A;  1T9X A;  4XTT A;  4HVZ A;  4K4X A;  2V8V A;  1R6Y A;  3LW5 C;  1NB7 A;  1MWZ A;  1PJ7 A;  4DR5 F;  2C2M B;  3GV5 B;  3UR0 A;  2HQG A;  2W7P A;  2EFV A;  4A47 A;  1LW0 B;  1T9T A;  1FFS B;  2FVR A;  5K9F A;  3SV4 A;  2FVS A;  4BC7 A;  4OZ0 A;  2BDP A;  1JLF A;  2OLW A;  1C4A A;  3FMB A;  5C2G A;  3SCJ E;  5H1S V;  2HVI A;  4J9P A;  1U1O A;  4G65 A;  3OSN A;  3QGG A;  1VBZ A;  1CQN A;  1HBN B;  2JH3 A;  2BUN A;  4B08 A;  2BJ9 A;  4ITS A;  1C0T A;  2NZ4 A;  3MM8 A;  1GX6 A;  3B4M A;  1PIL A;  1R7I A;  5I3P A;  1T05 A;  4A8K A;  2ZD1 B;  5FLX Y;  3ZTS A;  2WK4 A;  3G6Y A;  4J91 A;  3O44 A;  4ZPB A;  1JJ2 R;  2EEY A;  4ED5 A;  4IG0 B;  3AXM A;  4HYK A;  2CNO B;  2IA6 A;  1VLY A;  1U26 A;  1FDA A;  5B7W A;  2JC0 A;  4J9S A;  4UQG A;  5KTQ A;  4YR2 A;  4DX7 A;  1VCT A;  1JQG A;  1R8B A;  4FBU A;  4IFV A;  3U7J A;  2JX2 A;  4KBI A;  1NK6 A;  4HLB A;  4Z7C A;  5GAD U;  1U6B A;  2VBX A;  1TKT A;  2RH3 A;  1SC6 A;  3NGR A;  2FVC A;  4OI3 A;  3TEH B;  5I3Q A;  1WEX A;  3R5G A;  2DO0 A;  5KFJ A;  1WEZ A;  4ERD A;  2YWE A;  3AJD A;  2GNK A;  2IBO A;  4NLO A;  1XJW B;  3NBP A;  3QT7 A;  3L7U A;  3M9M B;  2HGN A;  1E6Y B;  5K20 B;  1FI4 A;  1SQF A;  2IC3 B;  2VH7 A;  2G2Y A;  4X65 F;  3OL6 A;  2K3K A;  1UKU A;  3CD0 A;  3QNW B;  5CHC B;  3GZ7 A;  1HI1 A;  3K5N A;  1K73 T;  3I4P A;  1N88 A;  5I3U A;  3N6N A;  3NWR A;  4X65 J;  3SSR A;  2GVZ A;  2ZNY A;  1VBK A;  3US5 A;  3EVW A;  5JXS A;  9RUB A;  5KG3 A;  2Y3Y A;  4LSL A;  3KUG A;  2BM0 A;  4BHQ A;  3MAH A;  1JXV A;  1FXL A;  3I31 A;  2HQ3 A;  3R5C A;  1V3R A;  2QL9 B;  2CPF A;  4DL0 C;  2IM3 A;  4TLR A;  1RAA B;  5L1I A;  3VAL A;  3M2R B;  1SKU B;  2NQP A;  1SI9 A;  2F7V A;  4M1K A;  3MGJ A;  2GIR A;  3IM8 A;  4C8Y A;  4CO0 A;  3QT5 A;  2CQ1 A;  3MM6 A;  3QZ8 A;  1G3O A;  4IR1 A;  3HFK A;  3AA9 A;  3FCW A;  1FXR A;  2CQ3 A;  4JI1 F;  1AFJ A;  1EQM A;  3F41 A;  2YNI A;  2YQ0 A;  1NPR A;  1EP4 B;  1NSA A;  2KFY A;  1JLC A;  3R7B B;  4ZVG A;  5CXT A;  2DGV A;  1LKZ A;  2UUW A;  2ASD A;  1FJE B;  4YB7 A;  4JI1 J;  2MY7 A;  3VTI A;  2HFZ A;  2RKI B;  1ZH5 A;  5A0Y A;  3BDP A;  4RBU A;  3H0P A;  1Q5V A;  2VZ9 A;  4GRS A;  4DUY F;  4O3R A;  1XMB A;  2V8P A;  4KTQ A;  4I2Q B;  3M2V A;  4IDK A;  2C2K B;  2KFZ A;  3RAQ A;  5F3Z A;  1U8S A;  4PXC A;  2VAS A;  4DUY J;  4J37 A;  5HRO B;  1VRQ C;  4DQP A;  4NA2 A;  5HMY A;  3JSM B;  1REG X;  2ERR A;  1HBO A;  2R2R A;  1S1X A;  2GAG C;  3TR5 A;  3H40 A;  4OHV A;  3BO3 A;  4A8Q A;  4FDF A;  2JEI A;  1PG5 B;  2GO9 A;  3SMZ A;  4KY3 A;  4UY8 T;  1LW2 B;  4F8R A;  2ZBR A;  1UW9 A;  3Q8Q B;  1NEE A;  2W4C A;  4WK1 A;  1JKH B;  3BV8 A;  3K17 A;  3Q22 A;  3QWP A;  3M8P A;  3MMA A;  5DZ6 A;  3PY8 A;  3OVB A;  4QZV B;  1R89 A;  1VRT A;  4NLT A;  2CVI A;  1Q1K A;  3D1O A;  2DY9 A;  4F36 A;  4NRT A;  1SJQ A;  3N28 A;  2BVZ A;  3C16 A;  5F8M A;  2FGC A;  4OYI A;  2LCW A;  4DSF A;  4DPO A;  4DFM A;  1ZTW A;  3OTE A;  3SDE B;  4NXN F;  3QRQ A;  1IKX A;  2FC8 A;  3IAS 9;  4NMX A;  4USV A;  5L9N A;  1HBU B;  2DGX A;  2XYH B;  5KFE A;  2GO8 A;  5IV4 A;  4NXN J;  3R8Y A;  3CO9 A;  4TN2 A;  3W9I A;  3V81 B;  4F26 A;  3DM2 B;  1X31 C;  3QMQ A;  3A8J A;  2PFF B;  3S01 A;  1ZM2 A;  5D4N A;  2CKW A;  4DV4 F;  1G1X A;  1PYO B;  2V94 A;  3OR1 A;  1SJ1 A;  4FF3 A;  2CRL A;  4PUO A;  2J0S D;  3C2P A;  4YS2 A;  1W2B R;  4DI6 A;  1ULR A;  4H54 A;  5C2C A;  2OEJ A;  4LQ3 A;  2Z57 B;  3W2V A;  4Q8E A;  3NOC A;  2HIQ A;  3I0S B;  4GKJ F;  3HVA A;  3P5B P;  5EUH A;  3QT6 A;  2GFF A;  4CWB A;  4AXI A;  4LRD A;  4Q2M A;  4KHR A;  1DHM A;  1S0M A;  2NXE A;  3EUN A;  1H6K X;  1RWM B;  2R7S A;  1RAF B;  3W2W A;  2EG1 A;  2XMK A;  4AD6 A;  1RYS A;  1I5O B;  1H0H B;  4M5N A;  5KT7 A;  3X1L B;  3GG0 A;  1S12 A;  2ROE A;  2BAC A;  2R7V A;  2VOD A;  1ROF A;  1VC5 A;  3RZA A;  2XHW A;  2FHK A;  2QFJ A;  2XCA A;  3BM7 A;  2EI5 A;  2VC0 A;  4JV5 F;  3MFI A;  1T9U A;  2YPZ A;  1WC0 A;  2B6A B;  4RNF A;  3MUM P;  3Q8S B;  4NYP A;  1VIX A;  4ED6 A;  1JLQ B;  1CJU A;  5HK4 A;  4JV5 J;  4FXV A;  4P10 A;  1EET A;  2JEJ A;  3HHE A;  5H9F K;  2UV8 G;  1W7W A;  3WC0 A;  1RTH B;  2H4Y B;  2MGZ A;  3CCU S;  2YX1 A;  1U25 A;  1X4B A;  2Y0S D;  2CZ4 A;  4W98 A;  3PX6 A;  5ETO A;  2RRB A;  3SBM A;  4ZPT R;  1VQ4 S;  1Q82 T;  4B9M A;  1WJ9 A;  2AYM A;  3BSN A;  5SUH A;  2UVU A;  3V6D B;  1E6V B;  2ZE2 B;  4IKA A;  2CIM A;  4KQZ A;  5G4D A;  2XS7 A;  1GXL A;  4H4K C;  2GW8 A;  3CJ0 A;  2P8I A;  4EWT A;  3H8Y A;  1LFP A;  3P96 A;  3VGV A;  5LXR A;  2ZWP A;  1SJ3 P;  2FQQ B;  3FNN A;  2WSF C;  5RUB A;  1EJ7 L;  2WVC A;  1X0F A;  2LLZ A;  3MZI A;  3B8H A;  5HAN A;  2R7O A;  4YN3 B;  1SH2 A;  2G1H A;  5KT3 A;  1TKZ B;  4M5K A;  2HWH A;  4RW7 B;  2XC9 A;  2OEK A;  3FUY A;  1N6Q A;  1S76 D;  1KEK A;  1TUW A;  5JUM A;  2IHR 1;  3R5A A;  1VRU B;  2HLU A;  4ZVH A;  4MK7 A;  3CIZ A;  2G2Z A;  3W9J A;  1WC4 A;  1FWL A;  4G3I A;  4DR3 F;  4QWC A;  4ZK7 M;  4ILM A;  1NK8 A;  4J9U E;  1NLK L;  2MQN A;  2I8E A;  1VI7 A;  3RJM B;  4O44 A;  2QSF A;  3AAW B;  1VFJ A;  3HP6 A;  1EKS A;  4DZ6 A;  4DR3 J;  2OP5 A;  1HD1 A;  1RBA A;  1FK9 A;  4F4Z A;  2CWX A;  2N7Y A;  3NS5 A;  1WF0 A;  2ZJP Q;  1RJJ A;  1JLA A;  4M8L A;  4C98 A;  3MUT P;  4OZ1 A;  3BB5 A;  4DV6 F;  4UOF A;  1K1S A;  3D54 A;  3CED A;  3GU0 A;  1OYD A;  9ATC B;  5BYR A;  1LXN A;  3LP2 B;  4C0B A;  3SEO A;  5LJ5 Y;  4DR1 J;  3MOZ A;  1S48 A;  1JLE A;  4K2X A;  5LT5 A;  4DV6 J;  4N47 A;  5EWE A;  2V9K A;  4O4G B;  1S1T B;  2F9J A;  1R43 A;  1XNQ F;  1P6T A;  3RB6 A;  1WSV A;  3MCN A;  2NZC A;  3G82 B;  2NXU A;  4WFY A;  3W7B A;  3IWN C;  2ADB A;  2D3O 1;  1S1U A;  2QSW A;  4DN9 A;  1S0O A;  2JWN A;  5KFZ A;  3PKM A;  2WBM A;  1RT6 A;  4DX5 A;  3DLE B;  2HRT A;  1NH7 A;  3H2U B;  1LNQ A;  5KG6 A;  1UWB B;  3MFH A;  3M1V B;  1TVR A;  2VJV A;  1QSY A;  3OV7 A;  3D5M A;  3THT A;  1JIH A;  2ZKT A;  3RRK A;  5ETN A;  1TUG B;  3QJJ A;  5G0R B;  3M32 A;  4WJB A;  3H5X A;  1O5J A;  1WWH A;  4TY9 A;  2JVR A;  4K59 A;  1OY9 A;  2XZD B;  5F8J A;  4RPF A;  4DOZ A;  3KK2 A;  4IG3 B;  2D41 A;  1T3N A;  4ZVE A;  1NZA A;  1RHM B;  4NI2 A;  1N32 F;  1C0T B;  5LL6 d;  2AYB A;  4RJV A;  1TL1 B;  2DXE A;  6FDR A;  1B0T A;  2MKH A;  4NCG B;  1HNW F;  3H5U A;  2DHA A;  4JP8 A;  1RT1 B;  4B3S F;  1N32 J;  1Q78 A;  2E7X A;  4OZ5 A;  1U2C A;  4HHJ A;  4AYB D;  3GIJ A;  1DTT B;  1PIE A;  3N5F A;  1T11 A;  3C6T A;  5EDW A;  1M5H A;  1U4B A;  4TVA B;  4DLG A;  1HNW J;  4EBC A;  1QUV A;  4CI0 B;  3J80 U;  3UCG A;  3QAT A;  1IR0 A;  3R6L B;  3GPA A;  1RAO A;  3PJ9 A;  1I6J A;  3ZNJ 1;  2ATL A;  4KFB A;  3OPK A;  3AT1 B;  3IC1 A;  4WFX A;  3PW4 A;  2J6S A;  3MOJ B;  4FS1 A;  4IH5 A;  4H4O A;  2AHO B;  1FRX A;  1S6Q A;  2MZJ A;  1Y00 A;  4O4R A;  3CD5 A;  4NZ0 A;  1T9Y A;  3LUY A;  1EQ0 A;  2DBB A;  1SJF A;  3KLG B;  5E41 A;  3QBC A;  1S1V B;  4JB8 B;  2F8E X;  1HYS A;  3JSY A;  4ZLP A;  5KFG A;  4OYM A;  4K7Q A;  4Y65 A;  3FSY A;  2KHD A;  3D4J A;  1PYT A;  2LEP A;  3BGU A;  2ASJ A;  2LXI A;  1UFK A;  3VVU A;  2E5H A;  2IRY A;  3NBP B;  4Q2L A;  5HJX A;  4P75 A;  5J2N A;  1HBM B;  1UEK A;  5ETR A;  1UFL A;  5C7P A;  1Z2L A;  3W9H A;  4W4M A;  3JYT A;  2MKY A;  4M63 A;  2XGQ A;  2WW8 A;  3CJ5 A;  3GFZ A;  1VDH A;  4F3O A;  3W65 A;  2VKZ G;  3HVR A;  2DNN A;  1JB0 C;  4F3M A;  3KWM A;  5L38 A;  5CH7 B;  4IH7 A;  4LF1 A;  1YJ9 S;  3CJQ A;  2KH9 A;  4J9O A;  3ILL A;  1CSJ A;  2RNE A;  1S72 S;  5KFF A;  2QLJ B;  2QA1 A;  2CQG A;  2ZDO A;  3ZZZ A;  2W01 A;  4QR2 A;  1YSJ A;  4KRW A;  4WF9 Q;  4CO1 A;  3HSZ A;  2DGW A;  1BE4 A;  5CCM A;  3FBC A;  2F63 A;  2ZZM A;  4I7F B;  1PAU B;  2V50 A;  2XEX A;  1UVI A;  4URQ U;  4ED7 A;  4ZKA A;  4DFP A;  2LDY A;  1REV A;  3CE8 A;  2R7X A;  3H7H B;  1MU2 B;  3BN7 A;  3KJV A;  1M5P C;  3FBB A;  3Q83 A;  1Y3K A;  4USJ C;  2COL A;  2M4M A;  3GIL A;  5KG1 A;  5DG9 A;  4USK A;  1N5Q A;  3B54 A;  4DBQ A;  3DDK A;  3TZY A;  4CLT A;  3KUE A;  3PAC A;  3BYR A;  4EMD A;  4DV5 F;  2LDI A;  3CNQ P;  1Z2Z A;  1K0T A;  5AXN A;  3DI6 B;  7FD1 A;  2FVQ A;  2FC9 A;  1FRJ A;  4DV5 J;  1UJ4 A;  3KJF B;  4IDK B;  3UI3 A;  5F3T A;  3TNV A;  5IFM A;  3K8V A;  4KSE B;  2W2N P;  1SJR A;  2V4R A;  1FTR A;  1HQE A;  1SC1 B;  2E5G A;  1Y3J A;  2IPO B;  1RE1 B;  3OJS A;  2PMZ D;  2R9L A;  2WVB A;  1T03 B;  1LWC B;  3WBZ A;  3I96 A;  4WFZ A;  4CP5 A;  3G8Q A;  3BYP A;  3IS9 A;  2F4F A;  2KFN A;  1LOU A;  3HDS A;  4ZPW R;  1NXI A;  1B99 A;  1W25 A;  4LBI A;  1CLF A;  5E7O B;  3AB2 B;  2XMM A;  1BQN B;  4YDX A;  4MMO A;  4BS2 A;  4DV0 J;  1FJ7 A;  4C8K A;  4JI6 F;  2KHC A;  2PE8 A;  3R2D J;  1KWM A;  2HFS A;  1UAW A;  5M2P A;  3RBZ A;  3DRR B;  3MDF A;  1RKJ A;  3KLI A;  2ROP A;  5FII A;  4KHM A;  1VQM S;  4B3T F;  2XSJ A;  1BHN A;  5C42 B;  3MTK A;  4M5M A;  1Y5I B;  1FWP A;  2LVW A;  1VIS A;  2VON A;  3KHL A;  5F8N A;  4NWB A;  4B3T J;  2M8H A;  4PXD A;  3N5B A;  1SIW B;  4DUT A;  4LF6 F;  1BY9 A;  1IKX B;  1FA0 A;  2E7V A;  4WBF A;  4ILL A;  1UWA A;  3ADA C;  2Z8Q A;  1C1C B;  1KKH A;  2E7W A;  5HMX A;  3K5L A;  2M7S A;  4ID8 A;  1OO0 B;  4LF6 J;  1H98 A;  4LUB A;  4P7V A;  3OFF A;  5E0O A;  3ZZY A;  1ZS6 A;  4NLP A;  1KVK A;  4X4S A;  3QLH B;  1S77 D;  1DQA A;  3GE9 A;  5E3Q A;  4WFN Q;  4EYI B;  5CYJ A;  1KNZ A;  1FCA A;  1RT7 A;  3MM5 A;  2HHU A;  5DLG A;  3ET6 B;  3HK2 A;  3FGV A;  4ED4 A;  1CUL B;  4FNI A;  3TOQ A;  2LEC A;  1RT3 A;  4NLG A;  1IUJ A;  4CTA A;  4BBY A;  3BEG B;  2JRS A;  3CWJ A;  4ZVT B;  1SVD A;  2CA9 A;  3M7V A;  1H7W A;  1WHY A;  5D0G A;  1TEL A;  5GMD A;  2X51 A;  2DH7 A;  3J7Y U;  4ECY A;  2CQC A;  3IP0 A;  4PPZ A;  2LFV A;  4URG A;  2VV5 A;  2WVE A;  1CEZ A;  1HHS A;  2RRA A;  1FVS A;  3MAA B;  4NRU A;  5LMU F;  4S0M A;  1NB2 A;  1GMW A;  5D4P A;  4DN0 A;  1M1G A;  1BMQ B;  4IFY B;  2RS2 A;  4MKY A;  3RB4 A;  2DK2 A;  5LMU J;  2EFN A;  2B9X A;  3TVZ A;  1YBU A;  1HMV B;  5GME A;  4LRC A;  5CYQ B;  4FYW B;  3Q89 A;  2VPX B;  2EPI A;  1YLX A;  2QMX A;  3DRP A;  2I1R A;  2D1C A;  4I6A A;  4YB5 A;  4NYZ A;  4RO0 A;  1QAY A;  3FQK A;  4IQX A;  5A8W B;  1S5Z A;  2HWI A;  3JTO A;  2HGM A;  2OFG X;  2ACM A;  2C42 A;  1X60 A;  2IMW P;  4C8L A;  2D9O A;  4MAK A;  1WC6 A;  4WU3 A;  3MCM A;  2GGP B;  3I82 A;  3CMQ A;  5KT4 A;  4C0H A;  1OQ3 A;  2DHG A;  4Q7A A;  5KT2 A;  4J9L A;  3W60 A;  4OLP A;  3HFZ B;  1SKS A;  2E44 A;  3D7S B;  4NLR A;  2J0Q D;  3C15 A;  1S4E A;  4QIV A;  5A2Q U;  4PXB A;  4KH0 B;  1KVJ A;  1N5Y A;  2XUL A;  4X4R A;  4EBD A;  2LQ5 A;  1TK0 A;  3D9B A;  1IM6 A;  4HHU A;  4ECV A;  3W3S A;  3PW0 A;  1QSS A;  3PG9 A;  1F3V A;  1YJW S;  5E3A A;  4JI7 F;  3L7O A;  3ITH A;  3ZTR A;  2ZOG A;  2X3G A;  4NX9 A;  1PAE X;  4IQM A;  1OY6 A;  2M0G B;  4JI7 J;  4B9S A;  2EW9 A;  2CJQ A;  5CAA A;  1R8H A;  1TFY A;  4F2S A;  2J6U A;  2K8G A;  1NJZ A;  1A7G E;  3ZTO A;  2BOP A;  1N0U A;  3ZO7 A;  1YDL A;  4CH7 A;  3RYL A;  1PKU A;  3ENQ A;  2L9N A;  2CQ2 A;  2YXL A;  5B0D A;  1SQG A;  2GHW A;  1LWF A;  2Q6B A;  3T5L A;  1JLA B;  5LOQ A;  3VV2 B;  1YWX A;  3F44 A;  4AND A;  3V6H A;  1YJU A;  2DGO A;  1MRO A;  2PDA A;  3D6M B;  3T1H F;  4D3G A;  4ICL A;  1FXD A;  3P45 B;  4BCA A;  3MAQ A;  2C3P A;  3UD3 P;  3J7A 1;  4P9S A;  1MWY A;  1RCO B;  4NLY A;  2C2E A;  3T1H J;  4OX8 A;  2W9C A;  4XIU A;  4IH6 A;  2B5J A;  3BGL A;  1M0S A;  4K4U A;  4HKQ A;  1S1U B;  2R7T A;  3ZZP A;  2W9B A;  3M8S A;  3QAE A;  3HHL A;  1KLM A;  1NPK A;  3VQT A;  3SQO P;  2KM8 C;  2I5J B;  1XNR F;  4F25 A;  1RSC A;  1KHW A;  4ETX A;  3EGN A;  1FNO A;  1TVR B;  1CJV A;  2DHS A;  1UA1 A;  1GMW D;  1XNR J;  5BJR A;  2UVV A;  4C8Z A;  2GIF A;  3ISN C;  3OL7 A;  2DGT A;  4WP8 A;  3MUV P;  4GO7 X;  3MMC B;  2HAI A;  3ENA A;  1HWJ A;  2QL7 B;  3HHL C;  1G2E A;  1KSP A;  1HPZ B;  1SXL A;  3QGH A;  1PYS B;  1VK8 A;  4DX6 A;  4DG1 A;  2CQH A;  2UU9 F;  2W4P A;  4EI2 A;  1ZM4 A;  1Q16 B;  2VG7 B;  3OUY A;  2MDA A;  4F3Q A;  4EZ9 A;  3IR7 B;  3BGR B;  2VG6 A;  2UU9 J;  4L76 A;  2VDI A;  1RIS A;  4BDP A;  2VQE J;  2AJ4 A;  4B3O B;  3I87 A;  1WEL A;  2VOO A;  4DR2 F;  3H25 A;  1J5O A;  3FFI A;  1S9E B;  3M9N B;  3DXS X;  1TZ0 A;  3OLB A;  2PI5 A;  1WG1 A;  4KO0 A;  1FRH A;  4DR2 J;  4TY8 A;  5A8K A;  4O0I A;  3LGH A;  4RKU C;  3O5T B;  5A6P A;  1UFW A;  4NL5 A;  4K5S A;  3GYN A;  3W61 A;  4ZVS B;  4OL8 A;  4DL6 A;  3IGV A;  4F4X A;  1FES A;  2EKN A;  5L1K A;  3ONQ A;  2BX6 A;  5FD1 A;  1EZZ B;  3QWU A;  2BE7 D;  3R1H A;  2WSC C;  2XS2 A;  5DDP C;  2M9K A;  1KTV A;  2XMW A;  4TU7 A;  1WI6 A;  2CJB A;  3R7N B;  4OYX A;  1IVZ A;  3UDC A;  2A6M A;  4IOC Q;  1H38 A;  1D9D A;  2AKW B;  3ZZT A;  1NDC A;  5H9E K;  3QRR A;  1KR4 A;  2ZVS A;  3R7S B;  3PIO Q;  1SUQ A;  2HBY B;  2AJ2 A;  1U24 A;  2CPY A;  2QEX S;  4LR7 A;  2ZZN A;  5E3P A;  2FHJ D;  1OPI A;  2N82 B;  3E01 A;  1GK8 A;  5H9F J;  3JYT B;  2DIU A;  1FKP A;  3VCD A;  1ZA1 B;  4AT1 B;  3TA2 A;  3UNY A;  3KHR A;  3KLV A;  3J7A N;  1AZS B;  5T14 A;  2AJ0 A;  2BJ8 A;  2DGU A;  3R2C J;  3M9O B;  3MEE A;  1UZH A;  2DJW A;  3GYX B;  1URN A;  3H90 A;  2ZBI A;  2L9W A;  2W8L A;  2UUT A;  2H5E A;  4X84 A;  4TXS A;  1ZPW X;  4RNN A;  2XNQ A;  2XWX A;  3IWX A;  4LFB F;  3HO1 A;  2BR0 A;  4CYU A;  3GCW P;  4J9K A;  4NPO A;  4F7V A;  2KO1 A;  2MKK A;  4G1Q B;  2YNH A;  3Q8U A;  4AL7 A;  1X4F A;  4CH1 A;  3DOM A;  2IAJ B;  2YVS A;  5IQ6 A;  3ISN D;  3SFU A;  4LFB J;  4TLQ A;  3ZZR A;  4LF2 A;  4PG4 A;  3RR8 A;  4QQB A;  2XSF A;  3O1L A;  2N3L A;  2DYA A;  5BYQ A;  1DAX A;  3ISZ A;  2AWZ A;  3TZX A;  2CG8 A;  1MWQ A;  2HLT A;  3HHL D;  2JFK A;  4MYT A;  3RW6 A;  1REV B;  2DXD A;  3Q2T C;  5GAG I;  1VR6 A;  4F4A A;  1FE0 A;  4B17 A;  4USI A;  4LF5 F;  1B7F A;  2VFS A;  4TQR A;  4P73 A;  2J0W A;  3GJS B;  3CPW R;  5IXU A;  1N56 A;  3L3C A;  4KGV B;  1DTQ A;  2XTJ P;  5CA5 A;  4ANE A;  1IBC B;  1C2P A;  2E9Z A;  4LF5 J;  3VR1 A;  4PWU A;  4FNH A; 
#chains in the Genus database with same CATH homology
 1FFS B;  1FFW B;  1A0O B;  1EAY C;  2LP4 A;  1FFG B;  1FWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...