2YH1A

Model of human u2af65 tandem rrm1 and rrm2 domains with eight-site uridine binding
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A02
3UWTA 2KHCA 1F9FA 1VC0A 1IQTA 2DNHA 2CQ1A 3MUMP 2DHXA 2KRRA 1A9NB 1VQKS 3NMRA 1U1OA 4RU2A 1N52B 1P27B 3THPA 1WF2A 5CA5A 2LEAA 2DH8A 1YIJS 2OIHA 1DBDA 2MKSA 3H2VE 3V4MA 3ZZZA 2KFYA 1OO0B 1VQNS 4P6QA 2MKHA 1U2FA 2OTJS 2DIVA 1SJFA 1URNA 3LPYA 2DNZA 2MZRA 2RT3A 1U1LA 2MJNA 2MQNA 2M52A 2MQOA 1VQLS 1VC6A 1X4EA 5GAGU 3NNAA 5JVHQ 2JVOA 2ZJPQ 1G2EA 2KT5A 2KN4A 4PRFA 3VAIA 5LXYA 2M4MA 5GVQA 2XSFA 2MKJA 5EN1A 1X4GA 2F9JA 3UCUP 3PIOQ 1YI2S 3DLLQ 4WFBQ 2RQCA 2RQ4A 1WEYA 1FHTA 3MI7X 1WELA 2BZ2A 2ERRA 1WF1A 2OJ3A 2HGNA 3NS6A 2L41A 4LIRA 4TU8A 2CQPA 2OSRA 1WHYA 3MUTP 2FC8A 3MXHP 3G4SS 1R8HA 1WHXA 2CPHA 2QA4S 3MDFA 1WHVA 1VC5A 2X1AA 2ZJRQ 2DO4A 1X5TA 3CPWR 2O3DA 2DGUA 3THTA 1HA1A 1UP1A 3VAJA 1WI8A 3EGZA 1X5PA 4W90B 3CCLS 2DGQA 2MPUA 2KRBA 2CQIA 3VALA 1RK8A 1X5OA 3VF0B 1HD1A 5FJ4A 3CCSS 1SJRA 3JB9k 1VQ8S 1M5VC 3SXLA 1WI6A 3J7ZT 2MB0B 3IWNC 2CQ3A 2KM8B 1PO6A 2MZTA 3CXCR 1YJNS 3CD6S 2KG0A 1R8PA 2KXFA 2YH0A 2XS2A 2DNYA 1FT8A 2HGMA 1OPIA 3CCVS 5LXRA 1AUDA 1U1KA 3US5A 1X4AA 2CQHA 4BS2A 3CC4S 5BJRA 2MJUA 2F3JA 1L3KA 1X4BA 3MD1A 1U1NA 3CULA 2DGVA 5DDQC 2ZJQQ 2AYGA 4F25A 2DISA 1X5SA 3CC2S 5IM0B 3S7RA 3BEGB 1QM9A 3BS9A 2RU3A 3CCMS 3RW6A 5H1SV 2E5GA 3LQVA 3CTRA 5LSLA 3G71S 5GMKa 2MQQA 3UCGA 2VODA 2F9DA 2X1BA 1SJ4P 4YOEA 2KM8C 3B4MA 3P5TL 1U6BA 1VQ6S 2U1AA 2D9PA 2N7CA 2MHNA 2D3OR 4Y00A 3G96A 2RRAA 4LJMA 1K8AT 1SJQA 1FJCA 1U1PA 4FXWA 2KH9A 2CQBA 4TU7A 2MSTA 2MGZB 3CC7S 2MKCA 3N9UC 3FEYB 4PR6A 4FXVA 1W2BR 1D9AA 3CCJS 2MY8A 2CPEA 2J0QD 1WG4A 5CXTA 1WWHA 3B4DA 2DNPA 3I55S 2VOPA 2MQPA 2G1DA 5GAHU 1YHQS 2KG1A 2LQ5A 5CYJA 3Q2SC 1O0PA 1FJEB 2FPHX 2CQDA 4TLQA 4A8XA 1S79A 2DGXA 1JJHA 2DHSA 1NU4A 2LEBA 5MLCV 1UFWA 3SDEA 2M0GB 2MMYA 1X4FA 3BO4A 1VQ4S 2KVIA 3UCZP 1KQSR 1DHMA 3VAKA 2J8AA 1KOHA 5LJ5Y 1XN9A 1X0FA 1H6KX 2RVJA 1M90T 3CMES 2DGTA 2KI2A 1P1TA 3L3CA 5IFMA 2D9OA 2MKIA 2L08A 5IQQA 3U1MA 3BO2A 4QQBA 1WEXA 1WF0A 1KOOA 4OZ0A 1JJ2R 3NNHA 2CQ0A 3DXBA 2M8DB 2MZSA 2CPZA 1FO1A 2MQLA 2PE8A 5LSOA 2JWNA 4Y0FA 1VBZA 2E5HA 1OIAA 1Q81T 3U1LA 2E44A 2PEHA 3IRWP 1UAWA 3MURP 2CQ4A 2DNGA 2B0GA 2CPYA 2U2FA 4V19X 2YKAA 2L9WA 1WEZA 5DDOC 1HL6A 1H2UX 4PKDB 1DRZA 2X1FA 3NNCA 1KD1T 2GO9A 1N88A 3TP2A 5JVGQ 3SMZA 2EK6A 4IOAQ 2KU7A 2DNKA 2BOPA 2AYEA 2QEXS 4ED5A 4J5OA 3HHNB 1YJ9S 2DH9A 4WCEQ 1N54B 3G8SA 2XNRA 1WTBA 4CQ1A 2LMIA 1OWXA 1VBYA 1VQ9S 2MZ1A 1U1QA 2MSSA 2AYMA 2MY7A 2LA6A 2LCWA 2G4BA 2KXNB 1VQ5S 2XS7A 2X1GA 3S8SA 2LECA 1YWXA 2XS5A 1DZ5A 2CPJA 2M88A 1D8ZA 3K0JA 2DO0A 2LKZA 2I2YA 2NLWA 2M8HA 5DETA 1JMTA 2DNOA 2N82B 2DGOA 2DHGA 5D77A 2LYVA 1SXLA 3R27A 1KC8T 3H2UB 3CF5Q 1K9MT 1H2VZ 3CCES 2K8GA 1YITS 2Q79A 4TU9A 2KYXA 2M70A 3G6ES 5LJ3Y 2MXYA 3EX7B 2YWKA 2MKKA 1ZZFA 3FEXB 1YTYA 1SJ3P 2DNLA 1K73T 5DM7Q 4C7QA 4U67Q 2E5IA 2HGLA 2RNEA 4UY8T 2DNQA 2GHPA 3S01A 5HL7Q 1JJ4A 2LA4A 1M5PC 2JX2A 2CPFA 2MZJA 5D78A 4CH0S 2LXIA 2YH1A 3RW7A 2J0SD 3TO8A 5DDPC 2XNQA 4ERDA 4WKRA 4WF9Q 2CQGA 3MOJB 3ULHA 2KXHA 2QFJA 2K3KA 5GAEU 4C4WA 1Q7YT 2G0CA 1X4HA 2MZQA 2CQCA 2RRBA 2E5JA 4WFNQ 3J7YU 3UD4P 2DNNA 3VAHA 1Q86T 2NZ4A 4F26A 2MQMA 2CPIA 2JVRA 2RUGA 1N8RT 3MD3A 5DDRC 4CH1A 3I56S 2A3JA 2DGSA 3TYTA 1RKJA 1WHWA 1VQPS 3P6YC 3CCUS 2V94A 1CVJA 2CPXA 3ZZYA 2CQ2A 1B7FA 2AYBA 2N3OA 3PIPQ 3SDEB 4YB1P 2HVZA 3R1LA 2M7SA 3G8TA 1S72S 2DNMA 4OZ1A 1WG1A 3UE2A 1U1MA 2RS2A 1U6FA 2OSQA 2I38A 2DB1A 2JRSA 1M5KC 1VQMS 2DGWA 3VAGA 3OW2R 3BO3A 2N3LA 1HD0A 2DH7A 2EK1A 4IUFA 1VQOS 2FC9A 2J76E 2SXLA 1PGZA 4F02A 3VAFA 3MUVP 1FNXH 3CMAS 1FXLA 4WFAQ 4QU6A 4QU7A 1ZZNA 5GADU 1WG5A 3G9CA 1NJIT 3S6EA 2CPDA 4YUDA 3HI9A 3NS5A 4EGLA 3CCQS 4Z2XA 1M1KT 3CCRS 1VQ7S 1QVGR 1VBXA 5IM0A 2LXUA 3P49B 4ZKAA 4M5DB 2VONA 2UP1A 2FHOB 2DK2A 1ZH5A 2VOOA 2ADBA 4CIOA 3UD3P 2M2BA 1X4DA 2M9KA 2XB2D 1UW4A 2EVZA 2AD9A 1QVFR 4WIIA 3R1HA 1Q82T 2HZCA 2OTLS 2CJKA 3EGNA 2DNRA 1A7GE 1NO8A 2DIUA 2WBRA 3D2WA 1YJWS 2RS8A 3VAMA 1FJ7A 1H2TZ 2YTCA 4C0OC 4IOCQ 3Q2TC 5DM6Q 3CUNA 3P3DA 4W92B 1BY9A 5ITHA 2FY1A 4LMZA 2DITA 2MYFA 1X4CA 4UQTA 2DHAA 5HO4A 4IO9Q 2HYIB 2MGZA 2ADCA 1U1RA 4QPTA 1M5OC
chains in the Genus database with same CATH superfamily
4OYZA 1XNRF 2XC9A 2IA6A 1UTAA 4FF3A 4IFVB 2MKSA 3H2VE 4JV0A 3LAMA 2BM0A 3NAHA 4B02A 3I32A 2EG2A 3Q8SB 3NL0A 3NNAA 4DXLA 2JVOA 5A8KB 4IH7A 5KT7A 4P72A 1S7HA 4AL6A 1XR7A 3PNIA 1IKXB 3EYZA 4QYRA 2J0XA 1PKUA 2UU9J 4R0JA 4KO0A 2DPJA 2QG9B 1H73A 3J81Y 4ED2A 1UVNA 2C3UA 1PCAA 3JSBA 4TY9A 3BB5A 3CD6S 4A8KA 2V8GA 4QOTA 1U47A 2V8DA 2UXDJ 2CNOB 3BBCA 4DDFA 1KR4A 2DEIA 2GA7A 2XQCA 5C5JA 3J7Z5 1S1XA 3I96A 4YR3A 2DGVA 1RU1A 5HN0A 1FEHA 1FKPA 3BEGB 1QM9A 2W25A 1LWFA 4KGZB 2BEFA 3GFYA 4A4JA 2RQKA 3AAWB 4QR0A 2D9PA 4Y00A 4DR1F 3HCXA 3R97A 4UZBA 1U1PA 4MK9A 3BPSP 3CC7S 3LPEA 4N5SA 1EAYC 1Y10A 3KNGA 4X4VA 1I3OB 3M9MB 2ZVIA 1YVFA 2D7SA 2CRLA 2V4JB 3OFHA 4XIUA 3IGVA 2KG1A 4ZP9A 3A1YG 4K4XA 2W24A 3HULA 2IPOB 3HSZA 3NGSA 5HAOA 4XDCA 1JXEA 1RACB 4U7CA 4WPAA 1N4LA 1RDRA 1T3NA 2QA2A 2IYIA 4QQBA 1UZDA 4OL8A 5G4DA 4NLQA 4WZQA 3IBWA 2MZSA 2ZVSA 2VBXA 2PE8A 1NB2A 3K58A 4P7VA 1UAWA 2LDIA 1RABB 4OZLA 3KTQA 2JC0A 5L9NA 3QJLA 2CXEA 2JFKA 2F4VJ 3MR3A 3BKUA 4M5MA 3CT9A 3CB4A 2BOPA 3DRSB 1DY3A 2HHQA 3GZ7A 4X4PA 1I1GA 4ILRA 1VFJA 2VPZB 1Q7LB 1NUEA 5JUMA 2LCWA 4J9SA 1YK9A 2CWKA 3NCQA 3IBCB 3BJYA 1DJ0A 3BBFA 2VKRA 4UOCA 1T9TA 3NBPA 5DETA 4QPXA 2EC2A 5J2PA 1S1TA 2X7IA 4ECYA 3G6ES 1TKZA 4LSNA 3T19A 4ZPBA 1FK9A 4KTQA 2XMKA 2DNQA 4RW8B 4U9RA 3FBEA 1HR0F 4LSZB 2GMHA 4AD6A 3EXYA 2HRTA 4DV3J 3GILA 1WC0A 3IO1A 2UUWA 2Z4PA 3HHLB 1UEVA 2LP4A 5LL6d 1R3NA 3J7YU 5HP1A 3DRPB 3CJ2A 2F4FA 4DUYJ 5KOXA 3KHGA 3UNYA 2YNFB 3I0SB 4Y2AA 4CYUB 1SKRA 6FDRA 2BACA 1RWUA 1GXUA 2AKWB 2KVQE 2V2VA 4LF5F 1HNIB 4E98A 1FE4A 1EZZB 1NJYA 1EETB 3D6HB 1YRUA 1FFGB 2J76E 1UJ4A 1SUQA 3KFWX 4IR1A 3S6EA 3LP2A 4JI2J 3M6UA 2LXUA 1ZS6A 5LM7E 4B9TA 2XB2D 2JLFA 4DEZA 1B7YB 2CJKA 2BE2B 3WZ0A 2YY3A 4JI8F 4O0IA 4NA2A 3L09A 4CNZA 2A1BA 3FBFA 1SB6A 3JTOA 1X4CA 4Y2MA 1P9YA 3MUMP 2KRRA 3ZZTA 1VQKS 2C3OA 5CYQB 1N33J 2XZWA 2R7OA 4YY3F 3KK2A 2I5JA 1BLUA 1OPZA 3W9HA 1URNA 1U48A 2RT3A 3AQOA 1YJVA 2XSJA 1FRIA 3CIMA 4MT1A 2AV5A 3MEDA 4TY8A 4CM2A 1MWQA 2MKJA 3PJ9A 2IAJA 2XI2A 1U0HB 4KHPJ 3CJ5A 3KJVB 4WFYA 1HBMB 4M5HA 1CJUA 3IC1A 2AZ1A 3IBFB 2KT2A 4ALZA 1HA1A 5K14B 1X5PA 4F2SA 5C25A 1S6QA 5HANA 3GIIA 3ELHA 2MB0B 2P5VA 4OYMA 2KG0A 1QLNA 3ITHB 1FEEA 3E51A 2WRMA 4OV1A 1CG2A 4PQUB 2W01A 4FF2A 1RBLA 4QIVA 4USVA 2IJNA 1N34J 3MD1A 1FCAA 2HFNA 1WSRA 3I5CA 5IM0B 3T6BA 4ZPVR 3Q83A 1JLCB 4F67A 4A8SA 2XMMA 3HD1A 4QW8A 3R5JB 3CGIA 2J9DE 2L3MA 5T14A 3QGGA 3FK4A 2ZBPA 2N7CA 5KFLA 2VASA 3UDVA 5KFCA 5CQGA 2QLFB 1NJWA 2D41A 1OS5A 4USMA 1XJWB 2YXLA 5ETVA 2HWHA 5K8MA 1G4CA 4C6AA 2AJ4A 7FD1A 2DR6A 1Y5LB 4ZMMA 2EPIA 1QY7A 4NZ7A 5FIIA 4DV2J 2J0WA 2HVDA 4G65A 3MEKA 3H98A 3MM8A 5B7WA 1VRTA 1FXRA 1MROA 4N76A 4B3SF 1DARA 3ZTOA 4L72B 4K0KJ 2MMYA 3SEOA 2R8IA 1XN9A 2LQ9A 4LT6A 3H90A 3CMES 4LF8J 1WOSA 4CLTA 2H4YB 3RB3A 1U2RA 2CQ0A 4OI0A 2WVDA 4X4RA 1S0OA 3AJDA 3OPKA 3BKFA 2B56A 3OVSA 2H54B 2CPYA 2UXCJ 3IWXA 4LR7A 2FJAB 2W4DA 4I6AA 5DLFA 3MZIA 4ED1A 2E9ZA 2KU7A 2J7KA 1LFWA 3HHNB 1IN0A 3QRQA 1OWXA 4OHZA 4DU8A 1C1CA 4RUBA 2ASDA 1SL2A 1S1XB 4N56A 4KPYA 3F73A 2V4QA 2C28A 1VISA 5KG6A 1FKPB 2CPJA 4YMEA 4RR5A 1LWFB 4RU9A 3EXCX 5GAHI 4CCHA 1SKWA 3R27A 1K9MT 1H2VZ 4JI5J 2QTWA 2AGOA 4EZ6A 1ZM3A 3A12A 4PCQA 4KT0C 5M2UA 1V6HA 5D78A 3P8BB 4IYQA 4KY3A 4Y28C 5IT0A 1R8BA 5ETRA 4DV5F 1FX4A 1R43A 1MMLA 3DU6A 4ZLLA 5CZXA 1UVMA 4DQQA 4C8NA 4CDIA 1HBOA 4H54A 2MQMA 1S97A 4R8UA 5ETTA 4UOFA 2CPXA 1UKUA 2I9SA 2W9BA 2FY8A 3FRZA 4QIGA 1XR6A 1RE1B 4CLSA 1JKHA 4LF4J 4ZVEA 4F02A 2ZWPA 4P7TA 5DG8A 3TARA 3EM1A 3QIPA 2NS1B 5D4OA 4PYDA 5HQLA 3OR2A 3A3PB 3KJQB 3W1YC 5DQHA 5F8HA 2Q1LA 2KZMA 2IDLA 1IBLF 4LFCJ 3T1HJ 3FFIA 4BHQA 2DK2A 3H4BA 3FCWA 2YKMA 1JLQA 2OUGA 4ZCLA 1UW4A 1VLYA 1Q82T 3H5SA 1IJFB 3LF0A 3NOCA 2DIUA 2KFZA 2ZBIA 1KHWA 2IMOA 3V4IA 8RUCA 3R5DA 1JIHA 4DR7J 2RU9A 2DITA 3VHQA 4A8MP 1M0SA 2MGZA 3MM9A 4M1KA 1U1RA 2B8PA 4OZ3A 2ZE2A 4GC7A 1AZSA 2GMLA 3R9LA 3NBPB 1GAOA 2HRUA 1S1TB 4CT8A 3RYLA 1GNKA 1UVJA 1KHVA 1TKZB 4LSNB 2XY6A 1FK9B 3ZXWA 1RT7A 3C16A 4E2FB 4UY85 5A2QY 4AXJA 4OI6A 3PR5B 4ED3A 2W2NP 3Q8RB 2L41A 3DXSX 3SZ2A 1NK9A 2ZBCA 1JNZB 2J6TA 2LEPA 3T1YF 4CLKA 4DV0J 2X1AA 5HP1B 3AHPA 1JB0C 1NHUA 3VALA 3ISNC 1RK8A 3GFXA 3RRKA 2BV3A 2UUAJ 1XC9A 4F0HA 1KEKA 2DY1A 3WC0A 1I5OB 3IN5A 1FRKA 1NHKL 5C42B 2YH0A 4RUAA 1TKTA 3PG9A 3FC9A 3UR3C 4ANCA 4LFAF 3IA0A 3CC4S 1SUQB 2OELA 2AYGA 3BGFA 8ATCB 2R8KA 2J9DA 4K4VA 4UTGA 1LXNA 2AGQA 5E5NA 1QUPA 1U6BA 3KMQA 5GMDA 3OVAA 1YKWA 3GMGA 2W7OA 3PX4A 2RRAA 1KS2A 3KJNB 1ZTTA 2PMWA 2NSCA 1UETA 3R5CA 1K1SA 2CFXA 2E1MC 3NP5A 2J0QD 1IM6A 3GJQB 4XAKA 3KK2B 5J2MA 2R8JA 2I5JB 1GMUA 3TX0A 2Z2YB 4M5KA 3H59A 1RB0A 2CVIA 3MECA 4ZPWR 4NLWA 2XSJB 4ECVA 4OZ5A 3MEDB 4TY8B 2ZZMA 2BQUA 2IRXA 2J8AA 4OYAA 5LJ5Y 2IAJB 1FNOA 2ZH9A 3NCPA 3PYDA 3LW5C 2FJWA 5E7OB 1UEKA 1CJUB 2FZCB 4L73A 1RWPB 3W60A 4F4KA 5F41A 1FDNA 5C25B 1S6QB 3ZZOA 2UZAA 1DRZA 5KAKA 2XZDB 3OHAA 4MIWA 4DF8A 3ONQA 2W1BA 1RWWB 1BQMA 2I6WA 4X84A 3N0VA 3GB0A 2ZH2A 2NXCA 3TOQA 2LFVA 3VQTA 5KFXA 3Q86A 3KYLA 1VQ5S 3V5RA 2HHWA 2MLXA 1NJZA 5DJBA 2G13A 2ZNZA 2E5LJ 3HFKA 2H9ZA 3PYEA 2YNHA 3GTYX 3GONA 5HQMA 3I0RA 2C3MA 1UVLA 4M5JA 4CNYA 1TL4A 1IVZA 3MMJA 2ZUGA 4I64A 3M9NB 1PG5B 2PMHA 1T05A 2K3KA 5D8HB 4C4WA 2VPXB 2G1HA 1Q7YT 3IG1A 2E5JA 3NRBA 2DKOB 2FJEB 3MD3A 5DDRC 3LTOA 4DV7J 3MM8B 5L38A 1VRTB 1MROB 2CJYB 4CI0B 4JV2A 2V68A 4OHWA 2OFGX 4WXOA 1HNZF 1S72S 1NKCA 1SVDA 2D69A 2VG5A 1KTVA 1SH3A 3D1QA 3M9OB 2E1RA 1OY6A 3IAM9 2HVHA 2R2SA 2BABA 5L1LA 5BR8J 1FNXH 3CMAS 3TQEA 1RT2A 2EW9A 1WG5A 1SKSA 1UA0A 3PKYA 4DV1J 1NRKA 1G7CB 2PI4A 2B3TB 3D0GE 2VONA 4F4XA 4ECWA 1L3SA 4V1Ak 2VOOA 1X9SA 2J8SA 4DCPB 4C8YA 4TQSA 2HS4A 1NO8A 4WXWA 5IT4A 2H3EB 5DLGA 1LK5A 2IDEA 1P1LA 3M8ZA 1C1CB 3BYRA 4I0WA 5D4PA 2B4OA 4CO1A 3OL8A 3LWLA 4LMZA 2MYFA 3PX6A 2A18A 5ETKA 1RAEB 4DS4A 1SJ1A 2VFRA 4ETXA 5ADZA 2Z56B 3EPIA 1HQEA 1OO0B 1RWVB 3FCVA 3IP0A 4ZVTB 4DCOB 3QRPA 4DR4F 1NPRA 1S6OA 4ED4A 1URRA 2BE7D 1U6ZA 4K5RA 2YQ3A 4X66F 3M8WA 4DL6A 2Y8YA 2FC8A 3E01A 2QA4S 4LF9F 1HBOB 1UVKA 2W9AA 1UP1A 5H9EJ 4K4YA 1WI8A 2RUSA 3NY0A 4M5NA 4R8UB 3BSOA 2KRBA 5D3GA 3V6KA 3M8RA 2F8HA 3PW5A 3M6XA 4MKYA 2E66A 2EXUA 4LRCA 3GSIA 2JDJA 3DNCA 2W9BB 2ATLA 1PIEA 4I2PA 2GQCA 2V2QA 1ZM9A 4I68A 4DL5A 1JKHB 2HQGA 4Y6IA 2KDOA 1Q95G 1X4BA 1N5QA 3QIPB 3OR2B 1RTDB 1ZBTA 1RT1A 3BS9A 4JI6F 4UUXA 3FFIB 2ZH6A 1LK7A 3TI0A 1NB7A 3ADAC 3OTOJ 2FZGB 2YKMB 3IXQA 3G71S 1JLQB 1HNVA 3B4MA 3P5TL 4DJBA 3V4IB 2ILYA 3CCZA 4LFBJ 1RP5A 2E7WA 2MGZB 3MM9B 1GX6A 2JEJA 2OPRB 3MR7A 2ZE2B 1D9AA 1AZSB 3NGKA 3R5GA 3WX4A 1R31A 5FD1A 5KFZA 4OMFG 2DCLA 4J9LA 4DWIA 4RNFA 4WK3A 4JI3J 2AX1A 1RT7B 3DCAA 1TAUA 2J6SA 4DR3F 3C16B 3PR4A 1OMSA 3K7RA 3EGWB 3B8HA 1QE1A 2RVJA 4KGMA 3EMTA 4KHMA 4YB7A 2Z58B 1WEXA 1KOOA 1VQSA 4JI7F 5AJ3F 3PVXA 4DF4A 4IH6A 2MQLA 3TJAA 1IUJA 2HFVA 1EKSA 2MEWA 1QJHA 2IRUA 2QMUB 2QZ8A 1OJ4A 5I3UA 2J7UA 2NYHA 3QT6A 1HL6A 2FHMA 1KD1T 4ZLJA 1NBEB 3OXFA 3ZZRA 2CNKB 3NGUA 4HEA9 1B70B 3HKZD 1WTBA 1TKTB 2Z57B 2Q3PA 4CQ1A 2MZ1A 2DR9A 2AEMA 3ENVA 3PFOA 2ZH8A 1KSPA 4PXDA 4UZCA 5HVGA 5IWAF 1DZ5A 4OX7A 1JMTA 4KBIA 4FZVA 4AUKA 4HH1A 3KLVA 2MKKA 3BN7A 1SJ3P 5F0UA 2EI5A 1XQIA 1W2IA 2GHPA 3CDBA 2F8EX 2AX0A 2CJAA 1MMDA 4DR6F 2O5DA 5DDPC 4G1QA 4W4MA 4ERDA 5FLXY 4WKRA 4C11A 2QMWA 4GKJF 1U7LA 2C3PA 3PTWA 5J2MB 2MZQA 2JH3A 4JI4F 3HHKA 4ZCIA 1JLEA 2ASLA 1RKJA 3MECB 1AB8A 2F40A 5F8LA 1EJ7L 3UDLA 2OSQA 2JRSA 3ZZUA 1UPPA 4PWWA 2HURA 4MKBA 1H7WA 2EK1A 3PYGA 3KLIB 5KG2A 2YWFA 5DO2A 4TN2A 3HHLC 4QWAA 2CDQA 2COLA 3P4UB 4Z2XA 5DQGA 1RAGB 3CJ8A 3KLHA 3PW2A 4UOHA 2IRYA 1WOPA 3FNNA 3BQ2A 4UF4A 4DBQA 3RBDA 2KYZA 1BQMB 3NGRA 1A7GE 5KFHA 3TA1A 2HHHJ 2YTCA 5HROA 3ILIA 3PHEA 3GYGA 1FDBA 2GVDA 5DM6Q 4K4SA 1V3ZA 2DJWA 4GVBA 4NYZA 2XMAA 4QPTA 3HVRA 3MM5A 2FLPA 5F8NA 2IYGA 4YHHJ 1UL3A 3HDSA 1YIJS 1S48A 2AJ2A 1NMEB 2MKHA 1KBRA 2HHVA 2YNHB 3CJKA 4USWA 5D4LA 4ES3A 3DKDA 2ZJPQ 3JAMY 3CD7A 5F3TA 4HKQA 1MU2A 3I0RB 4OI1A 1IQZA 4K59A 4J9KA 3MI7X 3FCHA 1XBWA 1EARA 1NJXA 5H9FK 3ENAA 1T05B 4X4OA 2JSXA 1WHYA 1NSPA 3IG1B 1R8HA 4MYUA 1X5TA 1HWJA 3PYFA 2GNKA 2PA8D 4P2FA 5FJ4A 2IBOA 3SXLA 3J7ZT 5AXNA 4XTTA 2HFUA 2VG5B 1AFJA 5CCLA 3PO5A 5K9FA 1HHSA 2A0FB 4ZP8A 3UDCA 2GJFA 2OI2A 1QUVA 3ZFVA 1JLAA 4X4NA 5HVHA 2CQHA 1RT2B 3RGIA 4URQU 1LQ9A 4WWSA 4PQAA 2EFPA 5ETLA 1PBUA 3PO4A 1AUSL 5H1SV 2E5GA 1OSCA 4IG3A 5I3PA 2HQDA 2OGUA 3UQSA 4PPDA 2F7VA 5KT6A 4W98A 2PI5A 4ZA1A 1DFDA 5U47A 1HHQA 1REGX 1DTQA 4BCAA 1MWZA 2FUG9 1IJEB 1T95A 4WFZA 4IOBA 3AOBA 2WSFC 1VLOA 4FXVA 3TNVA 4JV5F 1HARA 1SQGA 2BMBA 3V2UC 1HQEB 5GAHU 1YHQS 1F3FA 1I51B 3M6WA 3W2WB 4B08A 1RLCL 2FPHX 2CQDA 4LBHA 4TLQA 1RAAB 2ZHBA 1R6YA 2DHSA 1T11A 3FJ2A 1G3OA 1NSQA 1X4FA 3BO4A 4HYKA 2KVIA 1DHMA 1HI8A 3AT1B 4DSEA 4ED0A 4YB5A 1ZAVA 4EBDA 2NSBA 1J2VA 2M8DB 2HZAA 1YBUA 3E01B 1VJQA 4GKKF 4BC9A 1G1XA 3DFEA 1S4FA 2PEHA 2NUUG 1TELA 2U2FA 5D3GB 2Q6BA 2R42A 2ZM6F 4PKDB 3T41A 1VJWA 1B64A 1BGXT 5JVGQ 3M32A 3R6LB 4I2PB 3MAAB 2C1EB 3J7A1 1N54B 4EFAC 1GTEA 4AL5A 2ZITA 1NLKL 1U1QA 2KL8A 1TQLA 2HKEA 2ZDPA 1SL0A 4OHVA 4ZP7A 3KK3A 1RT1B 5BYQA 3R8YA 2F1FA 3MEGA 5B0GA 4X64J 3R7BB 5KG0A 2P6SA 4L3NA 1YITS 1HNVB 1RWOB 4YR2A 4RNHA 2EFOA 2HBRB 1K73T 3TA2A 4RNOA 4C7QA 3FDSA 4JP8A 1JNRB 1M5PC 3GIMA 2P6TA 5EWGA 1C4CA 2J0SD 3VVUA 3UN3A 1JXLA 2QGFB 2XNQA 1GQEA 3AA9A 3ILLA 2NPFA 1Y7PA 4HT7A 2KXHA 4LF4F 3IWLA 4J91A 1YQHA 4ES2A 3QSIA 3DC2A 2QSFA 4DUZF 2RUGA 2CKWA 2R8HA 4EU0A 2EFQA 2QLWA 4HDGA 3CCUS 1NXIA 4AXIA 4A8OA 3D6FB 3DMJA 2AYBA 3NWRA 1D09B 2RB7A 2YQ0A 3O44A 2E1CA 3HM9A 2I38A 1QE1B 1Y3KA 1VR6A 1VK3A 1NDCA 4CLPA 4MKVA 1TV6A 2J9EA 3VCDA 1Q78A 3OVBA 3WHIA 3G9CA 1ZAXA 3OFFA 2ZH1A 3CCWA 5L46A 4KGVB 3KHLA 4WU2A 1UW9A 2GC8A 5I3UB 2C22A 4JB8B 1FDDA 1N48A 2VC0A 1H7XA 1UA1A 4ECQA 1R0BG 1FA0A 2LQ8A 4DV6J 2M2BA 1X4DA 5F9LA 4KR0B 3GV5B 1FERA 2GJ2A 3NXZA 3R1HA 3N01A 4C3LA 2WBRA 2ALYB 2RS8A 4FDFA 2XO6A 3V6HA 2HK3A 1BD6A 4ID5A 1KP6A 4O23A 4NI2A 1F2HA 4AFFA 1R8AA 4AQYJ 3UWTA 3DOMA 5DS7A 1A9NB 2OEJA 4FN5A 1VBKA 4KB7A 4PWDA 1RAIB 3MPDA 4YS2A 2VL1A 1FWPA 4I7FA 3MM6A 2DCUB 2ZNYA 2MQOA 1B0TA 3B54A 1AW0A 4NXMJ 3GV8B 3H2LA 2AGPA 1T9VA 2X51A 3RBXA 3Q0AA 1Q0NA 2RQCA 4G1QB 1YJUA 4ZVOB 4USHA 3BQ0A 4C11B 3BREA 4B3TF 3OBIA 4R25A 4NWBA 1K0TA 5EDWA 3EE3A 3THTA 2PD1A 4F3QA 4WU3A 2GMJA 1JLEB 2R3VA 5JXSA 1YRXA 1HD1A 1SI9A 3C14A 1WI6A 3HSJA 3QQCD 3K5PA 5D0HA 4NLTA 3JAMU 4HTJA 4I67A 2ZH7A 1X4AA 4PG5A 2F3JA 2WSCC 4WIQA 4DR5J 3LWMA 1TL5A 4EYIB 5LMUJ 4F25A 2FLNA 4ED6A 3KLHB 1T9YA 3S7RA 3VV2B 3EJMA 2FGCA 2V0NA 2V63A 3QWUA 2VQFF 3GSDA 1AYEA 3CDEA 2F9DA 1DAXA 3LO3A 2APOA 5KFYA 5IT9Y 1OQ6A 2FJXA 3QPIA 5HROB 2GVDB 1RQ0A 2XCPA 2QYGA 4DN0A 2KH9A 2HS3A 1T7PA 5KFUA 3MM5B 4WFXA 4NLPA 5KFNA 4F4AA 2DHHA 4P71A 5KFRA 2W2PP 4MAKA 4KFBA 2B5JA 4JI1J 5HATA 4FPIA 1RHKB 2ROEA 3CJKB 2HFSA 1CQMA 2OPSA 2UXBJ 3RG6A 1MU2B 4A48A 5SUHA 2BJ3A 2KI2A 1XIQA 3GU0A 1P1TA 1YZ7A 1MNEA 2MKIA 3M30A 3FUYA 2QIFA 1OSDA 4IO1A 5HJYA 4ELUA 4JYAF 1OIAA 2DRAA 2VPYB 3JQKA 2YKAA 4N8NA 3VGUA 3M2UA 3TP2A 1FJGF 4C8KA 2HS0A 4MJKA 3QMQA 4CO2A 4IR9A 1FI4A 3CJTA 3H42A 1JLAB 3HP6A 4ZJOA 3ETMA 4A8FA 1L3UA 2X1GA 1FFWB 1HBUB 2VIHA 4EMDA 2W7AA 2N4CA 3QT7A 4X4TA 5HJXA 2H5EA 1KVJA 5D77A 4IG3B 3GR0A 2JLEA 1IBKJ 1T0TV 3BN4A 4OI4A 5F8MA 1LOUA 3N79A 1DTQB 5A8WA 2XG8A 2FVCA 2QLBB 2CQGA 3MOJB 2HBYB 2VFUA 4LF6F 2ZH5A 3CVKA 3FMBA 4DSKA 2OKQA 2BJ7A 1S99A 3C6UA 3HVTA 4OJ1A 4OJGA 3OV7A 3GFZA 3O3LA 4R5PA 1TAQA 3RR8A 3NLCA 1UWBA 2CZ4A 4JI0F 1RT4A 1J5OA 5ETMA 1CSJA 1I94J 2JOQA 4AT1B 4NA3A 4FYYB 2O1PA 4K4ZA 1RAOA 1NDKA 3BO3A 2N3LA 4QCLA 2YBVA 5KG3A 3HD2A 2AT1B 2NXJA 3NGDA 1TP7A 2IFXA 5CHCB 2H1YA 2QT7A 3DN9A 3Q24A 2DXEA 6AT1B 5E3AA 2HVEA 2GIQA 5IC4B 1LWEA 4ZKAA 1T9WA 3PRBA 5EX3A 5IV3A 4ZHRA 1NSAA 2DD8S 3HVWA 3M32B 1S57A 1GT8A 3K2YA 1O51A 4I56A 3QO9A 1R0CB 4M8LA 3VAMA 1BQNA 3K57A 4TYAA 2GW8A 2HQIA 3P3DA 3FZ2A 5CABA 5ITHA 3FBBA 4M5IA 2WVEA 5KFGA 1F9FA 3KK3B 2DY9A 1WC3A 1SC3B 4YN3B 3QLHA 3OL9A 1PYTA 3TEGA 5GAEI 4EBEA 1N52B 3MEGB 2Z2ZA 2QLJB 3P96A 2OIHA 4NXNJ 4LBPA 2NPIA 4O4GA 2DIVA 2ROPA 2DNZA 3I5BA 4N41A 3W64A 3I31A 2V67A 4ZDNA 2F65A 4MYTA 1WOOA 4TNOA 4K2JA 1YI2S 2WCXA 2XM3A 4USKA 1IBMF 1FFSB 4RUHA 3NS6A 2UUBJ 2KO1A 4DN9A 1H72C 1GTHA 1OQ3A 2NQPA 2JEIA 1P9QC 4GVLA 1VOMA 4PEOA 3PW7A 1ZA2B 3L9ZA 4RBVA 3A8IA 3DYAA 3OFEA 4RW9A 3DMJB 2YX7A 2E7VA 3EPGA 2G0JA 1YSJA 2DRBA 3UO0A 4Q8EA 2BUNA 3KJFB 4YDXA 2FJBB 3CJSA 3OD2A 1RYRA 1SQEA 4B3MF 3RTVA 1TV6B 3PZPA 1E6VA 2UV8G 2ZWOA 5KT3A 3TW0A 1U45A 2UVRA 1FRXA 2YKQA 1U1NA 3CWJA 1TL3A 5KFIA 4NRTA 3RU0A 3DU5A 2PFFB 3CC2S 2H4WB 2GX8A 3K8WA 2C2NA 5D4NA 3DHWC 5D0RA 4CWBA 3BSCA 1BC6A 2OLWA 2U1AA 3ZTPA 1U0SA 4ID5B 3H5UA 2O67A 1K8AT 4FXWA 5HLFA 2GVZA 4NI2B 2P9CA 4ZCMA 1J5EF 3DOMB 4PWDB 3B4DA 1CULA 3BBBA 3CIZA 1T8EA 4I7FB 4L74A 2HMIA 1QSLA 3RRHA 1NU4A 1XNRJ 5IS2A 3EZ5A 2EG1A 1MN7A 3TJ8A 2PFDA 3MTJA 1VHIA 3WC2A 5IT9U 4OFZA 3BO2A 1N6QA 4RX6A 1ELOA 1FO1A 4QW9A 4JOUA 5LSOA 2RD5C 3UN2A 4CLYA 1U2CA 3MURP 4U7UD 2ILZA 1H2UX 3C14B 2BJ1A 5J2QB 4L75A 2A10A 4HHUA 3H40A 3E3XA 2B43A 5J1EA 3PRDA 1Y3JA 5AT1B 1WKLA 2E1AA 2XEXA 4OHXA 3NG8A 3HX9A 2AYMA 4CO3A 4DI6A 2AJ0A 2ZOGA 2ACMA 1EHWA 4QYZK 2RAQA 2CA9A 2LKZA 3T6JA 4YFUA 2N82B 2DHGA 2K8GA 4Q2MA 4PZVA 3UDEA 2Z30B 3TX8A 3GYNA 1FD2A 4CH0S 1NCLA 2BKPA 2LXIA 2VJUA 4LR8A 1FVQA 3L95X 2WBMA 1N0UA 2A6OA 1FVSA 3KLGA 5ETQA 2G0CA 4RBUA 4KFBB 2CQCA 2B5JB 4DR1J 4C97A 4RW4A 2JVRA 4QBUA 2B9XA 1WHWA 2EC0A 2OPSB 1CVJA 3BF4A 1BWEA 1DQ8A 4B9UA 2N3OA 1SBRA 2MTLA 1XTZA 3C19A 3HO1A 4DSLA 2PGCA 1OY8A 3KKFA 3OW2R 2DEJA 5B0CA 3BM7A 1RSCA 3M30B 2SXLA 4ZJQA 3LAKA 3DLBA 3HT0A 5E3CA 4CLLA 1ZZNA 1W26A 4YUDA 3BGLA 3DOLA 4Z7YA 1SL1A 1NH7A 1N5SA 2OD6A 4P9SA 4ZVHA 4QWEA 1FESA 3M2UB 2ADBA 2R2UA 3HJVA 2OO4A 1H74A 4C0OC 4OX9F 3UPFA 3ZTSA 3MGJA 4RU2A 2VH7A 3OUYA 1DBDA 3UN5A 4KHRA 3W2VA 1QAJA 3IRXA 4F4YA 1S6PB 2KN4A 1R27B 4FNIA 3VAIA 1FF2A 3D5MA 5A8WB 2Z8QA 2C2ZB 2RQ4A 1WEYA 4C8MA 3TEHB 2OJ3A 3SCJE 2J7WA 1JWWA 1RXOB 2OSRA 2HQFA 3PJWA 4CT9A 1NKEA 4NZ6A 1RADB 3C6UB 2CPHA 2AEJA 2XTJP 4QR1A 2DO4A 1HR0J 3HVTB 1U09A 2D1CA 4W90B 3UW1A 4R5PB 3CCSS 3NS7B 1UWBB 2ALZA 1RT4B 1J5OB 1APSA 3CXCR 1R8PA 1LWXA 2FJDB 2XS2A 2VQEF 4F3MA 3EVOA 3US5A 1S5ZA 3W3SA 4BS2A 1U25A 1L3KA 4LF5J 4B9LA 3C46A 5B0FA 2DISA 3MCMA 2JL9A 2N4DA 1WSVA 1LWEB 1NKBA 4PUOB 3P45B 5F3ZA 3TZZA 2KFNA 1ZM2A 1LKZA 2OHDA 4ZHRB 2JFDA 2MQQA 2GHVC 2B4PA 4HR2A 4IFYB 5KFOA 1NDPA 3MCNA 2OEKA 3RBEA 2CNNB 2VUGA 2BKNA 3FEYB 3A8JA 3QLHB 1QSSA 1WORA 2CJ9A 1T94A 2RILA 4DL2A 5KFQA 4O4GB 1O0PA 2FVSA 1A0OB 1Y5IB 1Q5YA 2QFIA 4U6PA 4RPFA 3QAEA 2M0GB 2VHGA 4YY3J 2V2ZA 1KQSR 5BYRA 2VFVA 4DCJB 5L1IA 4ED8A 2HW3A 3L3CA 1FXDA 1O8BA 4K4WA 1RAHB 1JJ2R 1MMNA 3PFEA 1CS4A 3IRWP 3DYAB 4Q2LA 2RQMA 4RW9B 3EDQB 3GG0A 2VJVA 2R7TA 2ATCB 4ANDA 4WP9A 4DS5A 3BGRB 2AJ1A 5KT4A 2MSSA 1E6VB 4KQZA 1WKKA 4DFKA 2QJ3A 2V34A 1B4SA 4NCGA 2AJFE 4J9PA 2BQRA 1TL3B 1KVIA 2XS5A 2M88A 3OSNA 2Y0BB 2RDDA 3BZQA 3OLBA 3MMCA 3T5HA 1PAUB 2J9CA 2QC3A 3QATA 3FSYA 1U8SA 3RB4A 2RMLA 1RTIA 3K59A 2HIYA 3DLKA 2RNEA 5KFJA 5HLFB 2GVZB 1NDLA 2YKPA 2F63A 3W62A 2B8QA 5J1NA 3M2VA 1RHJB 1V3RA 4ZVFA 2ASJA 1CULB 4K4TA 3C8YA 1XMOF 3CO9A 1N8RT 2HMIB 4CH1A 3D28A 3P6YC 4QYZJ 1WKJA 2YNIB 3QGPA 2EFNA 1S6UA 2PEBA 3EGVA 2CZVC 1RTZA 2M7SA 3G8TA 4OZ1A 3L7OA 4M5GA 2GV1A 5KOWA 2OMLA 1FDAA 4PG4A 1N6QB 1GEHA 4B3SJ 1CBKA 4HVZA 5FDLA 2YX4A 3LH2S 3W9JA 3PKMA 3WX8A 1PAEX 1V5VA 2HBQB 4OI2A 1TMJA 3T5KA 3V81A 2FHOB 3CD5A 4NCBA 4PYAA 5J1EB 2PN6A 3OL7A 1ZM4A 1FJ7A 1H2TZ 4URSA 1TFWA 2VDHA 3F41A 3SV3A 2V69A 1HWIA 1TKDA 1XK8A 1JX4A 3R3TA 2FY1A 5EHHA 4OX8A 1N5TA 3J81U 3MR2A 1IQTA 1U26A 1CQNA 1RT6A 3AJ1A 3HT3A 2GJIA 2HAIA 2BXJA 1S7IA 1JLGA 5A8RA 1RISA 3CEDA 1RT5A 2E9RX 3SCIE 1S0VA 4F0MA 3KLFA 2KFYA 1VQNS 1WDDA 4WP3A 1Y5NB 1XERA 1U1LA 3OJUA 4ILLA 2KT5A 4PRFA 1X9WA 3IS9A 2FGOA 1FHTA 3T9NA 2POKA 2ROGA 2F5GA 2Z2LA 4NYOA 1O5JA 3M8SA 3NKYA 3HMJG 2E29A 2ZJRQ 2DGUA 4RW4B 2V8PA 4LF7F 5DGAA 2AW0A 3DRRA 4XDDA 2BRKA 4WKYA 4DV5J 3JB9k 2R7WA 4XPEA 3AD9C 4D3GA 3TVYA 3W8PA 4KO0B 2VG6A 4DV4F 1NK8A 3O5TB 3M4XA 4NEZA 1F6TA 2WW8A 1S77D 1R7IA 4NMXA 2WVCA 2VZ9A 2XBPA 4I4BA 4K8RA 3GIJA 3MAQA 2W4CA 3DOLB 5A0YA 4DHVA 2FLOA 1N32F 2XLJA 1H0HB 5RUBA 3U7JA 1RCOB 2QN6B 5GMKa 4Y3CA 2HNDA 3TZWA 4Z7CA 1IKVA 3GJRB 1HNWF 3SQOP 2ZZNA 1N36F 4FYXB 3G96A 1IBLJ 4LJMA 1SJQA 4E8UA 2XMJA 3DRXA 3QSYB 1EKRA 2MSTA 3GFHA 4ZPDA 1T03A 5KG4A 2W2QP 4PG7A 3J80Y 4OLPA 3OUYB 3ENQA 4A8QA 4USUA 2D74B 5SZTA 1KLMA 3W2VB 3QJJA 1RAFB 2X3DA 3IRXB 4ZOSA 1KONA 1AROP 3SDEA 3KUEA 1CJKA 2AMCB 1TK0A 2OPQA 2DGTA 3TVKA 4G1IA 5KFBA 2L08A 1L3VA 3EWGA 5L39A 2YVSA 4IQXA 2KTQA 1RHMB 1EIYB 2JWNA 3H7HB 3PJXA 4FF1A 2WTFA 4V19X 1GK8A 2L9WA 5F0WA 5ETOA 4FP9A 1HNXF 3HHEA 3ENWA 1QSYA 1N88A 3T1YJ 2HHTA 4IOAQ 3GIRA 2QEXS 1NK6A 4WCEQ 4DOZA 2GFFA 1G6BA 4M63A 1HI1A 2I1RA 2KXNB 3I9V9 1Q8LA 4HL9A 3S8SA 2FJVA 3JQMA 2Y8WA 4YR0A 2I2YA 2NLWA 2M8HA 4ITSA 4DG1A 2IC3A 1KC8T 3LANA 1M5HA 3O1LA 4LFAJ 2YWKA 4ENOA 4U67Q 5J1PA 4LBIA 5HL7Q 2IBKA 2LA4A 3HVAA 5J2PB 3ZTQA 5MAOA 3U1NA 2IJRA 1D1UA 1PILA 3TAQA 3TANA 4CP5A 4BWJA 1Q8BA 2DR5A 4WF9Q 3I9ZA 2CDRB 3SIPB 1PBAA 4OJ3A 3QFHA 5KFFA 4ATNA 5GAEU 5KFEA 4J9MA 2DXFA 4H4MA 1X4HA 4B3RF 2CPIA 2ZFHA 4EO8A 3D0HE 1EETA 2A3JA 2GO8A 4LIWA 3ZZYA 2H5IB 4PG8A 1YRTA 2HPUA 4X65F 3OL6A 2C2KB 1F9HA 3POTA 4HI1A 2ZKTA 5I4MA 1VI7A 4WBFA 2EWHA 4C8LA 3I87A 1CS4B 1TFYA 1R6VA 4Q45A 3O6QA 3CCRS 4FBUA 1VBXA 4K50A 1VYAA 5KFSA 4DQSA 4OIXA 4BDPA 5IZHA 5EUHA 5L1KA 1LWCA 5C24A 1QVFR 3LP2B 3AY0A 2RHQB 3T5JA 3D2WA 3DDNA 1D9DA 1HW9A 4XO0A 1TR0A 3KUHA 3M05A 2LXFA 2GCFA 3NGTA 4X62F 2BR0A 3CUNA 4ZPAA 1BY9A 3RBZA 4NCGB 2LLZA 2EFGA 3TQ1A 4CO5A 1ROFA 3DLHA 2XHCA 1GMWD 3THPA 5E33A 1S12A 2DH8A 3MMCB 3QT8A 3C2PA 2NXEA 1U0HA 3QGIA 3IR7B 1RTIB 3SCKE 1HBMA 3DLKB 5JVHQ 4Y2CA 1RTHA 1J27A 2FB0A 3SSRA 1WUUA 2QA1A 2D3UA 3PIOQ 4LF2A 3ET6A 3HZGA 4LRAA 2RDIA 1XNQF 1X8DA 1F60B 3LGHA 1NK4A 3M2VB 4J9UE 1WHXA 5GADI 1WHVA 1VC5A 2GIRA 3PY8A 1EX8A 3M2RA 4N47A 3TRGA 2G9OA 4HHHA 2CQIA 1H38A 4ECXA 4H4KA 5E3QA 4DU7A 4IRKA 5CAAA 4V19J 2KXFA 5LXRA 4ZVGA 1IR2A 5FDLB 1HNZJ 1R0AA 4NMLA 4KGXB 4TXSA 5DDQC 2XY7A 1WNEA 2W9CA 2HBZB 3BR8A 4JV1A 2FHKA 4ED7A 3CCMS 3RW6A 3V81B 3CTRA 4DPTA 5DQIA 3LOUA 4YQWA 1A6LA 1WC6A 5GAGI 3R2DJ 4O4RA 2BYCA 2KHDA 5M2RA 3W5XA 4HDHA 1EP4A 1X0PA 1UVIA 1RT6B 4PR6A 5DRKA 2BDPA 2MY8A 3PM9A 3VGSA 1JLGB 1WWHA 2KJWA 5A8RB 2XLKA 2N7YA 1RT5B 2L9DA 4J7CA 3I55S 2WSEC 4XK8C 3RB6A 1FE0A 4Y34A 3KLFB 1YBAA 1C0TA 4CH7A 4WTOB 5JJBA 2G0IA 3I4PA 5LMNF 2DGXA 2NXUA 3G2XA 2HFZA 2LEBA 1GFWB 4EK2A 1YGYA 3IS9B 2BW7A 1KKHA 3VAKA 2LQBA 1RT3A 2FZKB 3OXLA 3D66A 2D9OA 4IRDA 5T41A 1WF0A 4DFJA 4DR4J 1P6TA 3HXMA 3PW0A 2E44A 3DRRB 2DNGA 2B0GA 3MEEA 1S1WA 2GQQA 1PSDA 5DDOC 1Y00A 3J80U 3GIKA 2CVEA 4X66J 4FNHA 2WHOA 4B3OA 4NYPA 3RUBL 3SMZA 1U4BA 4LF9J 2VG6B 4I6YA 3KG1A 3QGHA 3VZIA 2IMWP 1TU0B 4OYXA 5I42A 4FYDA 3UI3A 3CNQP 4WJBA 4C3KA 1DURA 1YWXA 5A0YB 3FSXA 3MR5A 2HQCA 1JQGA 4DR2J 2DNOA 4TLRA 1HQUA 2XULA 2XGPA 3JTNA 2HNDB 2Q79A 3QT5A 4ZPCA 3DM2A 2FVRA 1IKVB 3MTKA 1OY9A 1YLXA 4OYIA 3D3BJ 2E5IA 2IIHA 3SSSA 2UU9F 2CPFA 4P2MA 4JI6J 3T1AA 3M1VA 2WB4A 1CJVA 4WYWA 1T03B 5T7LA 2OFHX 4K5SA 2XYPB 4F50A 1UPMB 1UJ6A 2X3GA 3JXOA 3OTDA 3RAQA 1RWNB 3FMWA 5DZ6A 1UFKA 1FNMA 1HFEL 4ER8A 3R5BA 4F26A 4FF4A 3KWMA 1KLMB 5IQ6A 2Y9HA 2UXDF 3I56S 3TYTA 4A8YA 4CLZA 4NZ0A 2ZOFA 1T02A 3SDEB 1P8GA 2HVZA 3R1LA 4UT4A 1CJKB 2C42A 2W4PA 2OPQB 2Y3YA 1UEUA 4MMOA 1KVKA 4KRWA 2CUYA 3SCLE 5C2GA 4DR3J 2HHPA 3CJ4A 1FXLA 4B9NA 4KV8A 3ZTRA 1RBAA 4J9OA 3WQPA 3KG0A 2A6MA 2OAUA 3TUPA 1VIOA 1RA7A 1TKXA 5A2QU 3D67A 3IGNA 5KFPA 4JI7J 5AJ3J 3CDAA 4RW7A 9ATCB 4I1TA 1PJ6A 2DNRA 1S9FA 1ZYQA 5THWA 3T9ZA 4K2XA 2ZHAA 2BJEA 4NLSA 4NRUA 5E3PA 4UQTA 2KB2A 5EX0A 2MQ8A 2HHUA 4PXBA 4KSEB 1O6XA 3QNWB 5AXMA 4KH0B 4DG1B 5F9NA 2HAFA 1WF2A 2LEAA 2IC3B 4BLGA 2XMVA 3ZZZA 2FDNA 2PC6A 2MZRA 3I5AA 3RB0A 1VQLS 5IWAJ 3DI6A 5B0EA 1S0MA 4DQPA 3ZO7A 2B4UA 4ZVSB 3AXKA 2HHSA 2VBZA 3LALA 1WELA 1Y0HA 3D9BA 2ERRA 2HGNA 2Y1JA 4WE1A 2RSQA 2BE9B 2F4VF 4H4MB 2GAGC 1R89A 2IM1A 3MDFA 2R7SA 2O3DA 5A6WA 2D3ZA 4DR6J 4F7VA 5C42A 1IKWA 3VF0B 4GKJJ 1SJRA 3IWNC 2BJDA 2CQ3A 2KM8B 3GG1A 3KUGA 1SC4B 2VB6A 4JI4J 2E7XA 3KLEA 3POTB 4P2XA 4YP3A 2UVWA 1HWLA 1HMVA 3MMAA 3WDOA 1TTHB 2RJZA 2F8MA 1RLDA 2C2OB 4OX6A 3GCWP 2V8VA 4PG6A 2DPIA 3ZC4A 1VK8A 3SFUA 3VGVA 1H3DA 3LQVA 5AXLA 1LWCB 4DV3F 4NASA 5C24B 4NOHA 4DZDA 1RHQB 4YOEA 4ID8A 4EEYA 5GMEA 1Q8KA 4ZVRB 1C4AA 5D6GA 4DUYF 3OR1A 3RJMB 1V5IB 3CCJS 2JEGA 3OHBA 2K7JA 4ANEA 2EBEA 1VDHA 4ZK7M 1JJHA 3LP0A 4DQIA 1KQFB 2RHSB 1RTHB 3FGVA 4HACA 4CLWA 3RAXA 4TKTA 3V6JA 1VQ4S 4KYZA 2PA3A 4DPUA 4AL7A 4JI2F 1FTCA 3PW4A 3JQJA 3ET6B 1X0FA 4K4UA 5AE3A 2VBYA 5JMNA 1FKAF 1MN9A 4M95A 3KDOA 1TVRA 2P9EA 4HI2A 3QZ7A 2QX0A 2E5HA 3M2RB 3K5NA 4ZIWA 2YKOA 4ZCKA 1LNQA 3NNCA 4DFMA 3HJFA 4GO7X 5KG1A 1ZPVA 3DGPA 2XNRA 4QJVA 1N33F 1YJRA 1X7VA 1VHFA 4O3PA 3N6NA 1B0PA 1RA6A 3C15A 2GGPA 1R0AB 3AODA 1RTJA 4NLYA 4PAAA 1L5UA 3BH7B 1KQGB 3E2EA 1RYSA 2W9CB 1TK5A 1RCXB 4PPZA 3FKBA 3PRVA 2XY5A 2NXNA 3U27A 2LYVA 4KHPF 2JZ5A 2CG8A 1RWMB 4Q44A 3DGVA 5G0RA 5B09A 1B3TA 3BPDA 2ZBRA 2R7XA 2JX2A 1EP4B 3TO8A 3U02A 1YX2A 3LUYA 4OYWA 1S9GA 4IH5A 3ULHA 1SIWB 1D0EA 2ZEJA 2QFJA 3H4DA 2XMWA 3VQSA 2NZCA 1C0TB 2NZ4A 4LVOP 3GWCA 1S59A 2DGSA 2DRDA 4YDDB 1REVA 4LRBA 2YQ1A 2YPZA 4JV5J 3PIPQ 4O3SA 2P2CB 1F9EB 3PACA 1N34F 3H0PA 3W61A 4Q43A 2NCKL 1CJTA 2LU2A 3DOKA 3OQ2A 4LF1A 1FRJA 4DPXA 1RT3B 1FKOA 2BANA 4Q7AA 4LQ9A 1VQOS 3ILJA 1SH2A 4DL7A 1NJIT 4CRJA 3W7BA 4EGLA 1VQ7S 1IXKA 3MEEB 1S1WB 2PT0A 3OTEA 4TYBA 1D8YA 4B3OB 2FIUA 3UD3P 2EVZA 2VICA 4GKKJ 2ZD1A 1S1VA 2IHR1 4LVNP 1YDLA 1GXLA 1YJWS 3H8YA 3R5AA 4NEYA 1AFIA 2HNZA 3C6TA 5I42B 2ZM6J 3MPVA 4DV2F 6FD1A 4DX7A 5HO4A 2DHAA 4RWWA 1HHTP 2W2OP 5L1JA 4RLEA 2KHCA 3ZZPA 2C3YA 1NH8A 1S10A 4K0KF 4RL1A 1UZHA 1HQUB 4GO5X 1U2FA 2OTJS 3MM7A 4LF8F 5K8OA 3DM2B 1M1HA 2VFTA 3KK1A 2XSFA 2QMXA 1LXJA 5EN1A 2F9JA 5HI7A 4Y2KA 3AQPA 3MOZA 3M1VB 2UXCF 2GHWA 1CJVB 1WF1A 4P75A 2LU1A 4CLFA 1GMWA 5T7LB 1HPZA 2VBWA 4NCAA 1M5SA 2W8KA 4ZVQB 3MXHP 4ECUA 5HVFA 2HQ3A 2C2EA 3CPWR 3KHHA 1HQ2A 4KGKA 2QL7B 2Y1IA 3CD0A 3IFEA 2QL9B 4USTA 2MHEA 4ZS6A 4ECSA 1VQ8S 1S76D 1ICEB 3V6DA 1YJNS 2KKHA 2OMOA 1TZ0A 4DUZJ 1RTDA 3THVA 3IAS9 4NLVA 1AUDA 2I8EA 4JI5F 4KV8B 1F0XA 1PJ5A 4DMZA 3F0NA 4QR2A 4F4ZA 1K44A 1TKXB 4O44A 3BV8A 3MAHA 4CO4A 3EUNA 1SKUB 3UVJA 3UNGC 5H9EK 4RW7B 3UCGA 2BOAA 2VODA 3N6MA 2OPRA 2H5JB 4P2SA 2MHNA 2D3OR 4KH1B 3GYXB 2O01C 1Q1KA 2B7BB 2R7RA 4C2MA 1VMBA 2HLTA 1SV5A 2JLGA 1UCNA 5CYJA 4QZVB 3GP9A 5HQ8A 3VR1A 3OXGA 3I82A 7FDRA 2FVPA 1Y4ZB 4PXEA 3TR5A 3DI6B 1SC1B 5MLCV 1UFWA 4WYLA 1HIYA 4CO0A 1C0UA 2GZOA 4ZN3A 3R7SB 2BKOA 4RKUC 3DLEA 4RUCA 1OYDA 4LFCF 4WE1B 5IQQA 3T1HF 1KRPA 2K1RA 2M5YA 3K5OA 1NK7A 2IJFA 3IMQJ 4Y0FA 4FVCA 3RAMA 4L3KA 1IKWB 4D3HA 1KFSA 4B3TJ 3SQGA 4J9RA 4DR7F 3KG4A 3E8OA 1HLWA 1ZPWX 2IVMA 3CJ3A 5FLXU 1TL7A 4ED5A 5E0OA 3KLEB 3VVTA 4IG0A 2BA9A 3ISND 2HZVA 4WK1A 1VBYA 3ISZA 3G6VA 3RZAA 4MK8A 1HMVB 3MMAB 2K06A 1FD8A 1U24A 3P5BP 1PC4A 3LGNA 1UWAA 2RH3A 1D8ZA 3GV7B 3F44A 5KT2A 2DGOA 1D3WA 4N7TA 3CCES 3VTIA 4Z37A 2XWYA 2ZC4A 1MG7A 3FEXB 5KFVA 1BWVA 4KIAA 2HGLA 4DV0F 4RNNA 3FQKA 2K7KA 1JJ4A 1S9EA 4OZNA 4G1PA 3OR1B 2VQFJ 3TUJC 4USJC 2UUAF 4KC5A 4ZIVA 2LQJA 5D15A 3M8QA 4J90A 3NCRA 2BM1A 2UUCJ 3QFWA 4HHJA 4TQRA 3F56A 2WK4A 3O8WA 3D3CJ 3LP0B 4DL4A 3G82A 4MK7A 3TVZA 3KLIA 4FKYA 4HACB 4O0NA 1T3OA 2RS2A 5LOQA 4ZVPB 1K47A 2BJ9A 2DGWA 1AT1B 2DBBA 3LP1A 1MW7A 1KQKA 1TVRB 1MSWD 1PGZA 4G3IA 2DT9A 4J9QA 3M6VA 3MUVP 1F5BA 4WFAQ 4O3RA 5GADU 1KNZA 3HLUA 4L76A 5D0GA 3AH6A 3AD8C 4HT5A 4DFPA 4ECTA 3GJTB 4WP8A 1ACMB 2M9KA 2OTLS 4JYAJ 1GXTA 3NOGA 3DGPB 3Q2TC 5H9FJ 4NL5A 5DZ7A 4W92B 2V8HA 3C15B 2GGPB 3CO0P 3CJRA 1RTJB 1FJGJ 2HYIB 1QAIA 5B0BA 4C8OA 2OH2A 2DNHA 4X4UA 1DLOA 1SIZA 3NMRA 1U1OA 3AFGA 5L8RC 3KMSA 4GVBB 4N77A 2C2RA 2W2MP 3D0IE 2BJ8A 3CJ0A 1X4EA 5GAGU 1N5YA 2R7VA 2BW2A 5G0RB 2B9YA 5GVQA 3H20A 2HSEB 3FBCA 4NLUA 2NREA 3UCUP 3DLLQ 1QDUB 5CD4H 3W8GA 1S9GB 2BZ2A 2XZTB 2HNYA 3A8KA 4LIRA 5KG7A 4TU8A 4F2RA 1SH0A 4NE9C 2HIQA 1CLFA 3NAIA 3MUTP 3FEZA 4U95A 3M8PA 2XWXA 1HKAA 2DGQA 1REVB 1F1BB 1K1QA 4LF6J 1IKYA 1VQYA 4O3NA 2HK2A 1PO6A 1KLNA 2WVBA 1CJTB 3B6BA 1BMQB 3DOKB 2GIFA 3WIVA 1FKOB 2BANB 2MKYA 1FT8A 4NLXA 1U1KA 2QLXA 3M7VA 3IM9A 2E5LF 4JI0J 2NR0A 1QAYA 3K89A 1GMVA 5K20B 5CD4A 3CDUA 1X5SA 1X31C 4U8VA 3MMBA 4HLBA 3AOCA 4MKAA 2VA2A 3EVWA 5J2NA 4P74A 2L9NA 2XMUA 2ZD1B 1S1VB 2XMTA 2EFVA 3Q89A 1C1BA 1VQ6S 2H48B 2HNZB 3C6TB 2WONA 9RUBA 1F3VA 1RI7A 1SC6A 1IWAA 3X3UA 3W2WA 4DV7F 2ZZTA 5B0DA 2ZHOA 4NX9A 5HMXA 2JHEA 1T9UA 2CPEA 3DLJA 1JLBA 2OD4A 1E6YA 5K8PA 3FRYA 1N56A 2CJQA 1FWLA 1H98A 3MM7B 2QYCA 1FJEB 3QWPA 4A8XA 1NK5A 3GR1A 2VKZG 4B17A 5BR8F 2HEKA 3KK1B 2VU5A 1MLAA 1X9MA 3ETOA 1Q5VA 4DV1F 1XMQJ 1H6KX 3SI8A 2JEFA 3PDNA 3U1MA 1HPZB 4DLEA 4QIEA 4DSJA 1Q53A 3D6MB 1WD6A 2DR8A 3MAAA 1Q81T 1IBMJ 2R8GA 2CQ4A 2ZUAA 1AA1B 2RF2A 4M5DA 4DR2F 4UQGA 2X1FA 2W7PA 4NLOA 1SQFA 3BDPA 3UD5A 3V6DB 1U49A 3AOAA 4QWDA 3H5YA 4CZCA 2FD2A 5B0AA 2DH9A 4RZRA 4PABA 3G8SA 2D3O1 3G87A 2CIMA 1VQ9S 4WTYA 1PYOB 3OT9A 5L9XA 2MY7A 4X4QA 4EUVA 1S49A 2YWEA 4R0EA 5C7PA 4B3MJ 2C2DA 4O44B 2FTRA 4P73A 3B82A 3UVJB 3H2UB 4OYOA 2KYXA 2J5AA 1ZZFA 3SYZA 4EBCA 1WC4A 1V9OA 1F5AA 4UY8T 4J9NA 5F8IA 4FBTA 2CJXB 3BDEA 4IDKA 1LEOA 2EBGA 3BR9A 4EWTA 3RW7A 4U7UK 4M94A 3RRGA 4B9MA 2V2KA 3CW2C 1NZ8A 2CAJA 2EEYA 3Q8PB 1SV5B 4ECZA 1NNDA 2RRNA 2XYGB 1BXNA 4WFNQ 1LW2A 2FHJD 3VAHA 3L7UA 3A3NB 2BVZA 1J5EJ 2M3DA 2V94A 5KFWA 1FRLA 1LW0A 1B7FA 5E2QA 2LDYA 3ILOA 3PEHA 1U02A 4RW6A 1C0UB 3DLEB 2QL5B 1NM2A 4C0BA 3GCXP 3KDNA 3EVMA 1HD0A 2K1RB 1FRHA 3OTOF 2ZH3A 3CDWA 4QU7A 4QWBA 4K7QA 2YPYA 3A4TA 3JSMA 4NLRA 4ZLNA 1TUGB 2FLLA 1M1KT 4EZ9A 1QVGR 5KFKA 1HYSA 1HWUA 3PEJA 3HZEA 2CNLB 3SQGB 2B7CB 4LFBF 4E0DA 4CIOA 3J81j 2YWHA 1W7WA 4PWUA 1TL7B 2EKNA 4WIIA 4Q0BA 2AEFA 4IG0B 3PV8A 4ZITA 1CPZA 1CC8A 3TAPA 4LSLA 3GE9A 3OTCA 3T3FA 2OP5A 4JI3F 2JJ4D 2CQ1A 4RWXA 1B0VA 5ETNA 1KDNA 3ZNUA 4CTAA 3DDKA 2EKYA 2J6UA 5CA5A 1XWLA 4KPCA 4ELTA 1SJFA 3QJPA 1HWKA 1QAXA 2MJNA 1RAJA 1XMBA 3FQLA 4MIBA 1G2EA 3Q23A 4FVMA 3BH6B 1X4GA 1S9EB 5KT5A 3GPAA 2PDAA 3MM6B 4O3QA 3GQCA 2Z2MA 4OZJA 4DX5A 3M8QB 3H25A 2ABYA 2CJBA 2Y0SD 1HBNA 2CADA 3DHXA 4UUWA 3CCLS 2MPUA 4FS1A 1Y9OA 1X5OA 2UVVA 3G82B 1M5VC 4WZMA 1CC7A 2QRRA 2V4RA 1Z2ZA 3OTBA 1PYSB 3BSNA 3MCOA 1TK8A 2HGMA 3LP1B 3N5FA 2VC1A 2YWGA 3FVYA 3I6PA 5BJRA 2MJUA 2R2RA 2ZBQA 3OJSA 4OJHA 3CJQA 2WVFA 4Y65A 4JUZA 2QO3A 4ICLA 4C3MA 3OLAA 1I6JA 3W63A 4UW2A 3D68A 5LSLA 2VA3A 3HHLD 3IR6B 3SBMA 1NPPA 2KM8C 3R2CJ 3CMQA 3QIDA 2AZ3A 1RZMA 2HLUA 4FYWB 4YB6A 1TUWA 8AT1B 1YJ7A 3N9UC 3PXGa 1RU2A 4CM0A 1DLOB 2E9TA 5AE2A 5CXTA 3JS9A 4OX9J 3K8VA 3G86A 5IOLA 4CLUA 4DPYA 1N5YB 5K5MA 1NPKA 2IA0A 3UCZP 2MLZA 2HVIA 4KJIA 2HNYB 5IFMA 4RNMA 4ZJLA 4LQ3A 2ASYA 2RIJA 4OZ0A 4OYPA 1L3TA 2CPZA 1GX5A 1UFLA 2IM2A 2B51A 3UFCX 3M8PB 2HHHF 1OYEA 1YJTA 5LT5A 4NLDA 1IKYB 1UMJA 3A13A 1RKIA 1NEEA 2DNKA 5HBMA 1UJ5A 2AYEA 2K3IA 4DQRA 1YJ9S 1HBUA 5HK4A 5DGBA 2LMIA 4ELVA 1VGYA 3KNAA 4YHHF 2LA6A 2G4BA 2XS7A 1X60A 5A76A 1LFPA 4AYBD 2PIIA 4I2QA 3TAMA 3D4JA 2VQEJ 3MMBB 4C8ZA 5J2NB 5I3QA 2IVFB 1V3SA 5E41A 4H4KC 2R4FA 1IR0A 5F8JA 3EX7B 3W5ZA 1YTYA 5E3RA 3IM8A 1C1BB 1R8CA 2WONB 1RJJA 4J37A 5KFAA 3S01A 1Y11A 1NSKL 4LR9A 1QTNB 1U8WA 2YH1A 1PJ7A 2PSZA 3GJSB 3HSGA 1ITPA 3MFHA 2DTJA 2IVYA 3HHDA 4A47A 5ETPA 1JLBB 4BWMA 5HSPA 2NUHA 5HMYA 1E6YB 5DG7A 2WOMA 4XPCA 2Y1RI 2JC1A 3HKWA 2JNJA 4ZN1A 1BUXA 2XLIA 4X2BA 2R7QA 7AT1B 1Q4RA 3D54A 1WDTA 3QRRA 1VRUA 1WJ9A 1HI0P 4U96A 2AF6A 2DB1A 2DR7A 1D9FA 4IUFA 1SCJB 2VF3A 4OV6A 2FC9A 2HHXA 3HFVA 4Q5VA 4QU6A 1JK9B 2CPDA 3CCQS 3P49B 2RF2B 1EB0A 4M5DB 1RWXB 4OYBA 3W9IA 2AHOB 1EQMA 4EI2A 4B9VA 1ULRA 4X4SA 2YKNA 2HZCA 3EGNA 2XHWA 3GLJA 4IOCQ 3QAUA 3MPWA 2B9WA 2G2ZA 1KTQA 1TL1A 3QZ8A 5BYSA 2DHXA 1RHUB 3QO9B 1BQNB 2K2PA 1JLFA 4F04B 1P27B 3IR5B 1IR1A 3J7YI 4MFBA 1B99A 2OPPA 4P6QA 1Z2LA 3O2IA 2MQNA 1VC6A 1S1UA 1F2GA 3ICLA 2FYXA 3DDIA 4QIWD 4JI8J 2VPWB 2M4MA 1RUSA 4DUTA 1QD1A 4IDKB 2UUTA 3JTPA 2CQPA 1FWKA 4AE5A 4FYVB 3G4SS 1LW2B 2V50A 2PO4A 3SSQA 3EGZA 5EGYA 2HWIA 3NEKA 2QA4G 1LW0B 3WBZA 1XEZA 5AE1A 3KHRA 1ZAWA 4URGA 4RW6B 2RKIA 2E1PA 2MZTA 5B08A 1RBOB 1XMOJ 3TZYA 4OI3A 2Q43A 2FQQB 4QWCA 3ZNJ1 2DNYA 1OPIA 4FXDA 3CCVS 4X64F 2KT3A 1SPBP 1FTRA 1TUVA 3JSMB 3AD7C 3Q8VA 3CULA 5KG5A 1N5VA 3N28A 2BBEA 2MDAA 1HYSB 1MWYA 2KZZA 2RU3A 3CSKA 2BRLA 4C9DA 2R7UA 3I4HX 3MPUB 1SJ4P 4Q0BB 2QSWA 3MWBA 2QV6A 4LREA 3DLGA 3MR6A 1FJCA 4LSLB 4UOGA 4H4OA 2CQBA 1WC5A 4TU7A 2YNGA 4OQJA 2WW4A 3HF5A 4CTAB 1FX2A 2GQ2A 1DTTA 3BQ1A 2VOPA 2MQPA 3EICA 2G1DA 1RWKB 5CZVA 3Q2SC 3OSPA 3MPYA 4YEAA 2WB1D 2B6AA 2XI3A 2PMZD 4GRSA 3G8QA 1YBTA 2Z0GA 1NK0A 1JJCB 2W8LA 2H65B 1WC1A 4KKOA 5J2QA 3C3LA 2CYYA 3NNHA 3DXBA 4DV6F 4DSFA 1BQXA 1HBNB 2OEMA 3A8EA 3AA8A 4MIAA 2UV8A 1WEZA 4O3OA 5A6PA 2GO9A 1TMMA 2EK6A 4AQYF 4ECRA 1IWGA 1GH8A 3OFGA 4J5OA 5CYMA 3N4WA 4LF7J 3W65A 3NMAA 4F8RA 4A46A 4PXCA 3JYTA 1VIXA 2CWXA 2RE1A 4F3OA 2VG7A 4FKXA 3UR0A 4NXMF 4ICLB 1CEZA 4IRCA 4DV4J 5F8GA 2NYIA 2KJVA 3J7AN 4RBTA 2HWTA 2UUCF 5KFDA 4IFVA 2G2OA 4TU9A 2M70A 2MXYA 4OZ2A 4GC6A 4P10A 4FS2A 2XO7A 3MFIA 5A8KA 1N32J 4ZP6A 2A2CA 4L6V3 2GAHC 3K5LA 3BGUA 1IKXA 2ZDOA 3C66A 2UVUA 5IXUA 2C2MB 5KFMA 3G6XA 1HNWJ 1N36J 3BKTA 4C48A 3QBCA 2RRBA 2DNNA 1Z1ZA 1F5CA 1DQ9A 1VRQC 1VQPS 4GMKA 4I69A 2IM3A 3KLGB 4YB1P 2BX6A 1XR5A 4IQMA 4DR5F 2DNMA 1WG1A 3D1OA 5LMUF 1U6FA 4C98A 1M5KC 3VAGA 2B4VA 3HPOA 5KTQA 3B78A 1BHNA 3H5XA 2DH7A 4MTPA 2HFOA 2VFSA 3S1TA 2FHJA 3SFGA 3X1LB 2YX1A 3VAFA 4USIA 3VWSA 3NS5A 3DRYA 3R6GB 2Q66A 2XGQA 3VZHA 3TZXA 2WAQD 3G6YA 3LGMA 4LRFA 5HBMB 2AD9A 3JSRA 5HMWA 3AXMA 2B9EA 4MH8A 3AB2B 3D6TB 4JI1F 1HNXJ 1LV5A 4DL0C 4IO9Q 1WACA 2QE5A 2CG4A 3M8YA 3PX0A 1VC0A 1N0VC 2UXBF 2ZH4A 3MHYA 4Y2IA 1S6PA 4I2QB 3TAMB 3AB4B 1K0VA 2V4JA 3AJ2A 5IV4A 4LUBA 2AIRB 2ZKUA 3V4MA 2R2TA 4OLOA 3MF5A 5K8NA 2H51B 3LPYA 3EZUA 3Q8QB 3CE8A 1ZTWA 1FRMA 2M52A 4J9VA 4BC7A 2VV5A 5LSRA 3VGTA 3PHTA 3TA0A 3EDRB 5LXYA 1ZA1B 5AXKA 3N6LA 4WFBQ 1ZETA 3BSAA 2P8IA 3QYYA 2DXDA 4EO6A 1PC5A 4NA1A 3R7NB 2BQ3A 4N8OA 1T9XA 2WOMB 3VAJA 1YG0A 2Q6CA 4ZLPA 3L4BC 4DL3A 3K5MA 2G2YA 5EWFA 1VRUB 3DRSA 4B3RJ 1NZAA 2R9LA 4PUOA 3SV4A 4QIFA 2GS8A 3TUIC 1C2PA 3BGOP 1IM4A 3Q8UA 2O66A 3Q22A 3Q8YA 3RR7A 4DX8H 5D0EA 1IBKF 3NWGA 2ZJQQ 4X65J 1M1GA 3N5BA 2RDJA 1ZOTA 4IFYA 5CH7B 1WTFA 5EWEA 4I6WA 2P9GA 2YKNB 2X1BA 2XCAA 4U8YA 3LA0A 3A3OB 4RW8A 4DLGA 4BBYA 2V9WA 1TL1B 1XMQF 2LVWA 1HW8A 2MKCA 1W2BR 1JLFB 1WG4A 3TJ9A 3W66A 2DNPA 3HHLA 4F0KA 4ZPTR 1I94F 4MFBB 2HRYA 4X62J 2OPPB 4Q8FA 1NAQA 2LQ5A 3DRPA 4ZVUB 1VCTA 4DPOA 1S79A 4OHYA 5BXIA 2WZ1A 2AWZA 1AXQA 1S1UB 2YNFA 2V9KA 4FPRA 3I0SA 4NLGA 4CYUA 1HNIA 4KE5A 2IY5B 2DYAA 1QTMA 1KOHA 1M90T 5M2PA 4C0HA 2Y1LB 4TVAB 4F4WA 1W25A 5IC6B 1RGVA 1VBZA 4NPOA 3U1LA 1XNQJ 4P52A 3BGRA 3L7PA 4ETZA 2RKIB 5ETSA 3TWZA 4JBCA 2BE2A 2MLYA 1EQ0A 3D7SB 3WIUA 2IM0A 4HTIA 3K17A 4ES1A 4A8WA 4NXNF 5HMZA 3MCSA 2FVQA 2LECA 5KFTA 3K0JA 2DO0A 3HK2A 5CYQA 4DX6A 1Q79A 3TUZC 4M5LA 1SXLA 3CF5Q 4DZ6A 2UUBF 5LJ3Y 1KWMA 1NHVA 2DNLA 5DM7Q 1DQAA 2DVIA 1YZ6A 1JXVA 3T5LA 3CCTA 4KAIA 2MZJA 5CCMA 1S0NA 3DLGB 2ZOMA 3FZBA 4H4OB 4DPWA 2YWWA 1Q8IA 2V5HG 2YNGB 1KFDA 2XYHB 3KJVA 3ZZ0A 2YNIA 4RJVA 2CZ9A 1DTTB 3UD4P 1Q86T 5K14A 3KOAA 4S0MA 5C2CA 4B9SA 2B6AB 2HG4A 2AJQA 4HH0A 4DSIA 2CQ2A 2AP6A 3HFZB 4F36A 3UE2A 1U1MA 1IBCB 2VDIA 2AQ4A 3ITHA 2I0XA 2ZC3A 1VQMS 3W5YA 4KKOB 3FSIA 5LMNJ 1KN6A 3PCOB 2AU0A 4PQUA 4EYHB 2A2DA 3BYPA 3HSDA 4G6VB 3HI9A 5DG9A 4ILMA 4LRDA 5IM0A 1JLCA 1RHRB 3EZOA 2UP1A 1ZH5A 1S4EA 2L48A 4RO0A 5CYMB 1Z4UA 2V6AA 2ACYA 1VS3A 3JYTB 2VD3A 3JSYA 3KXDA 1Q16B 3D1HA 1BE4A 4IKAA 2ADCA 2VG7B 1M5OC
chains in the Genus database with same CATH topology
3MR2A 2OH2A 4C8OA 1IQTA 2DNHA 1U26A 1CQNA 3HVRA 3MM5A 1RT6A 3AJ1A 3HT3A 4X4UA 2GJIA 2FLPA 2HAIA 1DLOA 2BXJA 1SIZA 3NMRA 1U1OA 1XNRF 5F8NA 2XC9A 1JLGA 5A8RA 1RISA 2IYGA 3CEDA 2IA6A 1RT5A 4FF3A 1UL3A 2E9RX 3SCIE 5L8RC 3HDSA 1S0VA 1YIJS 4IFVB 3KMSA 1S48A 2MKSA 3H2VE 3KLFA 2KFYA 1VQNS 4N77A 4JV0A 3LAMA 2MKHA 2BM0A 3NAHA 2C2RA 4B02A 3D0IE 1Y5NB 3CJ0A 1XERA 1U1LA 3I32A 2HHVA 3OJUA 1X4EA 2YNHB 3CJKA 5GAGU 2EG2A 5D4LA 3Q8SB 4ES3A 1N5YA 2BW2A 3NNAA 3NL0A 2JVOA 4ILLA 2R7VA 2ZJPQ 2KT5A 3CD7A 3JAMY 5G0RB 4PRFA 5A8KB 2B9YA 5F3TA 5GVQA 4IH7A 5KT7A 1X9WA 4HKQA 1MU2A 3H20A 3I0RB 4NLUA 3IS9A 2NREA 3UCUP 4OI1A 1IQZA 2FGOA 4K59A 3DLLQ 1S7HA 4J9KA 1FHTA 5CD4H 4AL6A 3T9NA 3MI7X 1S9GB 1XR7A 2BZ2A 3PNIA 3FCHA 1IKXB 1XBWA 2POKA 2HNYA 2ROGA 4LIRA 5KG7A 4TU8A 3EYZA 4F2RA 1SH0A 2Z2LA 1NJXA 2HIQA 4NYOA 1O5JA 3NAIA 2JSXA 4QYRA 4X4OA 2J0XA 1WHYA 3M8SA 3MUTP 3IG1B 1R8HA 3FEZA 3NKYA 3HMJG 2E29A 4R0JA 2ZJRQ 4MYUA 4KO0A 2DPJA 1X5TA 2DGUA 1HWJA 4RW4B 3M8PA 2XWXA 4LF7F 5DGAA 2DGQA 2AW0A 3DRRA 3J81Y 1REVB 2GNKA 2PA8D 4ED2A 4XDDA 1UVNA 1K1QA 2BRKA 4WKYA 2C3UA 5FJ4A 1IKYA 3JB9k 2IBOA 3JSBA 3SXLA 3J7ZT 2R7WA 1VQYA 4XPEA 4TY9A 5AXNA 3BB5A 4O3NA 4D3GA 1PO6A 3TVYA 4KO0B 1KLNA 2VG5B 3CD6S 1AFJA 4A8KA 2VG6A 5CCLA 2V8GA 3DOKB 3PO5A 4QOTA 5K9FA 1HHSA 1U47A 4DV4F 1FKOB 2V8DA 2BANB 1NK8A 4ZP8A 1FT8A 3UDCA 3O5TB 3M4XA 1QUVA 4NLXA 2WW8A 4DDFA 1U1KA 3ZFVA 1JLAA 1KR4A 4X4NA 2QLXA 2CQHA 2GA7A 1S77D 1R7IA 1RT2B 2E5LF 2VZ9A 2XBPA 5C5JA 3J7Z5 2NR0A 1S1XA 4I4BA 3I96A 1QAYA 4URQU 1LQ9A 4PQAA 4YR3A 2DGVA 3GIJA 3MAQA 2EFPA 5HN0A 2W4CA 3DOLB 5A0YA 3CDUA 1FEHA 1X5SA 1FKPA 4DHVA 2FLOA 3BEGB 1QM9A 2W25A 1N32F 1LWFA 3MMBA 4HLBA 4MKAA 2XLJA 1H0HB 2VA2A 3PO4A 3U7JA 5J2NA 5H1SV 3GFYA 4A4JA 2E5GA 1OSCA 4IG3A 5I3PA 2RQKA 5GMKa 4Y3CA 2HNDA 3AAWB 2L9NA 2XMUA 2ZD1B 1S1VB 2XMTA 2EFVA 3UQSA 4PPDA 2F7VA 4QR0A 5KT6A 2PI5A 1IKVA 4ZA1A 1VQ6S 1C1BA 1DFDA 2D9PA 1HNWF 2HNZB 5U47A 2ZZNA 1N36F 3C6TB 2WONA 4Y00A 1RI7A 3G96A 1DTQA 4DR1F 4LJMA 4BCAA 1SJQA 4E8UA 1MWZA 2XMJA 1U1PA 1SC6A 3DRXA 2FUG9 1IJEB 1T95A 4MK9A 3X3UA 4WFZA 4IOBA 3W2WA 4DV7F 2MSTA 2WSFC 3GFHA 5B0DA 2ZHOA 3CC7S 4ZPDA 4NX9A 1T03A 4N5SA 5HMXA 5KG4A 4FXVA 3TNVA 4JV5F 2JHEA 1HARA 2CPEA 3KNGA 4X4VA 3DLJA 1JLBA 3M9MB 4PG7A 3J80Y 3V2UC 1YVFA 1HQEB 2D7SA 4OLPA 2CRLA 2OD4A 2V4JB 3ENQA 3OUYB 1E6YA 5K8PA 3OFHA 4XIUA 3IGVA 3FRYA 4A8QA 2CJQA 1N56A 5GAHU 1YHQS 2KG1A 2D74B 3M6WA 3W2WB 1H98A 4B08A 5SZTA 3MM7B 2QYCA 4ZP9A 1FJEB 1KLMA 2FPHX 2CQDA 3QWPA 4TLQA 4A8XA 2ZHBA 3A1YG 1NK5A 3GR1A 3W2VB 3QJJA 1R6YA 2VKZG 2DHSA 4K4XA 2W24A 3IRXB 4ZOSA 1KONA 4B17A 3FJ2A 1G3OA 5BR8F 3KK1B 1AROP 3SDEA 1X4FA 3BO4A 1X9MA 3ETOA 4HYKA 2KVIA 4XDCA 1DHMA 1JXEA 1TK0A 4DV1F 4U7CA 1HI8A 1H6KX 2OPQA 1N4LA 1RDRA 1T3NA 2DGTA 4DSEA 3TVKA 4G1IA 4ED0A 3SI8A 2JEFA 4YB5A 1ZAVA 2QA2A 4EBDA 2IYIA 3PDNA 5KFBA 2L08A 1HPZB 2NSBA 3U1MA 4DLEA 1J2VA 4QQBA 1L3VA 4OL8A 5G4DA 5L39A 4NLQA 4WZQA 3IBWA 4QIEA 2YVSA 2M8DB 2MZSA 2ZVSA 4DSJA 4IQXA 2VBXA 3E01B 2KTQA 2PE8A 1Q53A 2JWNA 4GKKF 1WD6A 4BC9A 2DR8A 1G1XA 3K58A 3PJXA 4FF1A 4P7VA 1Q81T 3DFEA 1S4FA 2PEHA 2WTFA 2NUUG 2R8GA 1UAWA 2CQ4A 4V19X 2U2FA 2LDIA 5D3GB 2L9WA 2Q6BA 5F0WA 4OZLA 2RF2A 2JC0A 5L9NA 3KTQA 2ZM6F 4M5DA 4PKDB 4UQGA 4DR2F 4FP9A 3QJLA 1VJWA 2W7PA 2X1FA 1B64A 1HNXF 3HHEA 4NLOA 1BGXT 3ENWA 1QSYA 1N88A 2HHTA 3BDPA 5JVGQ 3M32A 2JFKA 4IOAQ 3MR3A 3V6DB 1U49A 4QWDA 3CT9A 4I2PB 3CB4A 2BOPA 2QEXS 3DRSB 3H5YA 4CZCA 2FD2A 5B0AA 1NK6A 2DH9A 4RZRA 3J7A1 3GZ7A 1N54B 4WCEQ 3G8SA 2HHQA 4EFAC 4X4PA 1GTEA 1I1GA 4ILRA 1VFJA 2VPZB 2CIMA 4DOZA 1VQ9S 4WTYA 2ZITA 4AL5A 1Q7LB 2GFFA 1U1QA 5JUMA 1TQLA 5L9XA 1G6BA 4M63A 2MY7A 1HI1A 2LCWA 2I1RA 2KXNB 4J9SA 2ZDPA 4X4QA 3I9V9 4EUVA 1SL0A 1S49A 2YWEA 3NCQA 1Q8LA 3BJYA 4OHVA 4HL9A 4ZP7A 1DJ0A 3S8SA 2VKRA 4R0EA 3KK3A 1RT1B 2FJVA 5BYQA 4UOCA 4YR0A 2I2YA 2NLWA 2M8HA 3NBPA 2C2DA 5DETA 4O44B 4QPXA 2F1FA 3MEGA 4ITSA 5B0GA 2FTRA 4DG1A 2IC3A 5J2PA 1S1TA 3B82A 5KG0A 1KC8T 4ECYA 3H2UB 2P6SA 3LANA 1M5HA 4L3NA 3O1LA 1YITS 2KYXA 3G6ES 1HNVB 4YR2A 4RNHA 2J5AA 2YWKA 1TKZA 4LSNA 1ZZFA 3T19A 3SYZA 4ZPBA 1FK9A 2EFOA 4EBCA 1K73T 3TA2A 4RNOA 1V9OA 4C7QA 4U67Q 4KTQA 1F5AA 3FDSA 4UY8T 2XMKA 5J1PA 1JNRB 4J9NA 2DNQA 4RW8B 5F8IA 2IBKA 5HL7Q 4FBTA 2LA4A 1M5PC 3HVAA 4U9RA 3BDEA 5J2PB 4IDKA 3GIMA 1HR0F 2P6TA 2EBGA 3U1NA 3BR9A 4EWTA 5MAOA 3RW7A 5EWGA 1C4CA 2J0SD 1JXLA 1D1UA 1PILA 2GMHA 3TAQA 4U7UK 3TANA 2XNQA 4M94A 1GQEA 3AA9A 3EXYA 4BWJA 2NPFA 1Y7PA 1Q8BA 2DR5A 4WF9Q 3I9ZA 4HT7A 3GILA 2KXHA 3RRGA 4B9MA 2V2KA 4OJ3A 4LF4F 3IWLA 3IO1A 5KFFA 2UUWA 3Q8PB 4ATNA 2Z4PA 1SV5B 5GAEU 4ECZA 3HHLB 5KFEA 1NNDA 2RRNA 1YQHA 4J9MA 1UEVA 5LL6d 4H4MA 1X4HA 4WFNQ 4ES2A 1LW2A 1R3NA 3J7YU 3DC2A