2YH1A

Model of human u2af65 tandem rrm1 and rrm2 domains with eight-site uridine binding
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A02
1X4AA 4IO9Q 3S8SA 2LEBA 1M5PC 1FXLA 2K3KA 2O3DA 1QVFR 1SJRA 1HL6A 2OTJS 2L41A 2F9JA 2KXNB 2VONA 2JRSA 2DNRA 2KG0A 2CQ4A 2X1GA 2X1AA 1QVGR 1D9AA 1N52B 1VQLS 2DNQA 3THPA 1N8RT 4W90B 2YKAA 1X0FA 2MGZB 3H2UB 2LEAA 3OW2R 2MMYA 2CQ2A 2MY8A 1W2BR 1X4BA 2AYGA 1VQMS 3CCES 1FO1A 2DNYA 1DZ5A 2DIUA 1N54B 3FEYB 2MPUA 2OJ3A 2DB1A 1X5TA 5LJ5Y 1FJ7A 1D8ZA 3TP2A 3VALA 2B0GA 2FHOB 2XNQA 1N88A 1FJEB 1JJHA 2YH1A 3CCMS 2PEHA 4F25A 4WF9Q 4V19X 3G96A 1A9NB 2EK1A 2Q79A 2MKJA 2CPJA 3SMZA 1YIJS 2KU7A 3CC4S 3ZZZA 3K0JA 2DHAA 2M9KA 2F3JA 2DGSA 2OIHA 3VAIA 3VAHA 2A3JA 3CCVS 2ADCA 2DGWA 1K73T 2KN4A 3CMES 3Q2TC 2V94A 2KM8B 2RQCA 2RU3A 1H2VZ 4J5OA 2XS5A 2CQDA 3H2VE 2SXLA 3UD4P 5H1SV 2M70A 2U1AA 4TU8A 4F02A 1O0PA 1VQ8S 1BY9A 2MJNA 2MQNA 3UWTA 4PR6A 1U6BA 1H2TZ 1R8PA 2DNKA 1K8AT 2LXUA 2CQ1A 2X1BA 1M5OC 1S72S 3NNCA 4IOAQ 4WFAQ 1YJ9S 3VAKA 1UFWA 5DDOC 2M8DB 4QU6A 1DHMA 3L3CA 2CQ3A 2DGOA 5LSOA 2HGNA 3B4MA 2RVJA 3BS9A 1X4GA 1R8HA 4YB1P 1NJIT 2DH9A 2XNRA 1X4FA 1VQ6S 2J8AA 2KRRA 4CH1A 2DNPA 2OSQA 2HVZA 4OZ1A 2EVZA 1VBXA 4ERDA 2HYIB 2DK2A 5GAGU 2E5JA 2BZ2A 3RW6A 4CQ1A 2MQMA 3Q2SC 5LJ3Y 4U67Q 2M4MA 2QA4S 2KXHA 4ED5A 3MURP 4WFBQ 1U1MA 2K8GA 2MHNA 3EGZA 5DDRC 3SDEB 1FHTA 1U1LA 5GAEU 1YTYA 5IQQA 1CVJA 3LQVA 1X4DA 4YUDA 2DNMA 2DH7A 3UE2A 3DLLQ 2D9OA 2MZJA 1JJ4A 2KFYA 5CXTA 2MKHA 4Y0FA 1IQTA 3CCLS 2LA4A 4BS2A 2ADBA 2RS8A 3S7RA 3PIOQ 3BO2A 2XS2A 3CTRA 1RK8A 2WBRA 1X4CA 2MKKA 1U6FA 4YOEA 2E5HA 2MYFA 4F26A 2LXIA 1FT8A 1WHYA 3CPWR 1P27B 2XB2D 1YHQS 5HL7Q 4C4WA 4QU7A 2MKSA 3J7YU 1VQ5S 5IFMA 2ZJPQ 2CQ0A 5D78A 1YITS 3MDFA 3IRWP 2L08A 2KYXA 3CC2S 3R1HA 2HGMA 3NMRA 1WG5A 2MXYA 1URNA 3G6ES 3THTA 3VAMA 1OIAA 3P5TL 2AD9A 4UY8T 2E44A 2DGQA 2M88A 2MZTA 3VAJA 1AUDA 1JMTA 4TLQA 3BO4A 3SXLA 1FNXH 3CF5Q 2J0SD 3P49B 2MQQA 2DNLA 2CQIA 2DGXA 2DHSA 2N3OA 2JWNA 1G2EA 1M5KC 3MI7X 3MOJB 2RNEA 1HD1A 2KVIA 2DHXA 2CQHA 3US5A 1SJ3P 2F9DA 3G9CA 1VC0A 3IWNC 1Q82T 2RRBA 5DDQC 1SJ4P 2MQOA 2RT3A 2RUGA 2KXFA 2LA6A 2BOPA 1WF1A 1WEXA 2M7SA 1B7FA 2E5GA 2KT5A 5GMKa 3G4SS 2RS2A 2DH8A 2LECA 3P6YC 2YTCA 1XN9A 2MB0B 2MZRA 1VQOS 5DM7Q 2HGLA 1VQKS 4W92B 2FPHX 3NNAA 2GHPA 3EX7B 1JJ2R 2VOOA 2OTLS 3SDEA 1WF2A 1YJWS 4RU2A 1VQNS 2G4BA 2E5IA 2LMIA 2D3OR 1WF0A 1SJFA 1U1PA 2CQGA 5LXYA 1ZZNA 1OPIA 3U1LA 3JB9k 1Q7YT 2DO4A 5LXRA 3B4DA 1VC5A 2FC9A 2MJUA 5IM0B 2CPDA 2CPIA 2MQPA 2MZQA 1OO0B 1KC8T 1SXLA 1WG4A 1ZZFA 2DHGA 2DITA 3VAGA 1WWHA 2NLWA 1QM9A 1L3KA 2U2FA 1UAWA 2MZ1A 2LKZA 3BO3A 2OSRA 2CPXA 2MGZA 1U1QA 2L9WA 1H2UX 1S79A 1U2FA 3MD3A 5GVQA 2HZCA 3V4MA 5D77A 2CPHA 2AYMA 2RRAA 2N7CA 2CQPA 3CCRS 3HI9A 2MSSA 3MXHP 1FJCA 3VF0B 3CCQS 1KD1T 2CPYA 1X5OA 2JX2A 2MKCA 2J0QD 2JVRA 1DRZA 2I38A 4Z2XA 1K9MT 2DO0A 1UP1A 2DNHA 3CCJS 1HD0A 3R1LA 3VAFA 1KOOA 3FEXB 4C0OC 2LYVA 3CULA 2GO9A 2M0GB 1VQ4S 1F9FA 2CPEA 5CA5A 4P6QA 5DETA 3CCSS 1VQ9S 2XSFA 3CXCR 4Y00A 3EGNA 1SJQA 4TU7A 4CH0S 3ULHA 1DBDA 1OWXA 2JVOA 3DXBA 1KQSR 1H6KX 5GAHU 3CD6S 3UCUP 4QQBA 1YJNS 3TYTA 3MUVP 3S01A 5DDPC 1WEZA 2AYEA 3CCUS 1P1TA 4TU9A 2CJKA 5LSLA 2FY1A 4PKDB 3MUMP 1X5SA 1VC6A 1WI8A 2CPZA 2DGTA 2DISA 5BJRA 2I2YA 5GADU 3S6EA 1U1KA 1WELA 3NS6A 5EN1A 3PIPQ 2YH0A 2LCWA 2QEXS 1X5PA 5DM6Q 1X4EA 2KM8C 2ERRA 4FXVA 2FC8A 4LIRA 2CPFA 2DGVA 4FXWA 2KRBA 4WCEQ 2AYBA 2MSTA 4WFNQ 3N9UC 1Q81T 2ZJQQ 1PO6A 2G0CA 4IUFA 2KH9A 3I55S 3ZZYA 3CC7S 2QFJA 1WEYA 3MD1A 3NS5A 4CIOA 2MZSA 4EGLA 4IOCQ 3U1MA 5JVGQ 1YI2S 2EK6A 3LPYA 1U1OA 4C7QA 3D2WA 1U1RA 3TO8A 2XS7A 5JVHQ 1HA1A 2DNOA 3R27A 5FJ4A 5CYJA 3MUTP 4PRFA 5ITHA 2CQCA 2G1DA 2CQBA 1WI6A 1VBZA 2DIVA 4LJMA 1NU4A 2KG1A 5IM0A 2N3LA 5HO4A 2KI2A 2RQ4A 2X1FA 3G8TA 3UCGA 2ZJRQ 2MKIA 2M2BA 2MY7A 1PGZA 1WHWA 1M90T 3NNHA 1UW4A 2VODA 2D9PA 2KHCA 2DNNA 4LMZA 3CUNA 2UP1A 3HHNB 3UCZP 5MLCV 1ZH5A 2PE8A 2DNZA 1X4HA 4OZ0A 4QPTA 2NZ4A 1RKJA 3CMAS 2J76E 1Q86T 1WHXA 2YWKA 1VQ7S 3P3DA 3J7ZT 1NO8A 4M5DB 1A7GE 2M52A 2N82B 4WIIA 1WG1A 2DGUA 2MQLA 1KOHA 2DNGA 1WTBA 1VBYA 1VQPS 1U1NA 3G8SA 3RW7A 2LQ5A 3BEGB 4A8XA 1YWXA 4UQTA 1M1KT 2M8HA 3I56S 1WHVA 3UD3P 1M5VC 4ZKAA 4WKRA 3G71S 2VOPA
chains in the Genus database with same CATH superfamily
3OQ2A 2XC9A 2DR9A 2AEMA 3WC2A 2K3KA 5IZHA 4C8OA 3DRXA 4KB7A 3GFZA 3GIKA 1N52B 1RT1B 2DR8A 1BXNA 4ECXA 2OMOA 1HW8A 2MEWA 4JI0J 2YKAA 4ZCIA 1AB8A 4B08A 2AJFE 1DZ5A 2YWGA 4X4TA 4MIBA 1Y10A 2YKPA 3MPUB 4YHHJ 3VALA 2B0GA 2XHCA 3VGTA 4NMXA 2NREA 2OPQA 2V2VA 1BE4A 3QWUA 5KFLA 1EETB 1XNRF 3P5BP 3GV8B 4DJBA 3K0JA 1TL5A 2H3EB 4BCAA 2DKOB 3VAHA 3R2DJ 1EARA 3KJQB 4LF5F 1Q16B 3ZZRA 4B3RF 1BUXA 3H2VE 2KO1A 2V8GA 2X1BA 4JI3J 4GKKF 5K8MA 4I6YA 3KG1A 2M8DB 4USKA 5GMEA 3I0SB 4N56A 4N41A 2HQDA 2KHDA 4USUA 1FTCA 5KOXA 5IT9Y 3DOKB 5J2NA 2DH9A 3EJMA 1HWIA 1S6QB 4NLSA 2GQ2A 1L3VA 1NSKL 2JDJA 4RW8B 5L1KA 2QX0A 3EGZA 5F0UA 1U45A 3SDEB 2CJAA 3CDEA 1GXTA 3UE2A 1PC4A 4XK8C 4N8OA 1Y5LB 3BM7A 3D3CJ 3DM2B 1QAIA 2CZVC 3KLGA 2FZGB 2YKNA 5KG0A 2LQ9A 5E33A 2V6AA 2OUGA 2KKHA 3GG1A 1RU1A 1D8YA 2X7IA 1V3SA 4FN5A 1P27B 3R5CA 4NOHA 1TL1B 1F2GA 3NEKA 1SH0A 1FRLA 3AB4B 3HJFA 3THTA 2E7VA 3FJ2A 2JH3A 2EC0A 2E44A 2VKRA 2IJRA 2AJQA 2NXJA 3SCKE 4PUOA 2C2EA 2YBVA 3CJSA 1FX4A 2PEBA 4F2RA 4X66F 1Z2LA 4NLYA 1J5OB 3MM5A 1RTHB 3RUBL 2V2QA 4M5GA 3M9OB 5LL6d 1N56A 4OI3A 2RE1A 1LK7A 1SJ4P 2DR6A 4QIVA 3T5JA 3GR0A 3K17A 5KG7A 2GIQA 1WF1A 5B0AA 1B7FA 1XN9A 1LWFA 3W63A 2G13A 4Q8FA 4Q45A 2WCXA 4RU2A 1TFYA 3VV2B 2E5IA 3JQMA 3ZZ0A 3JB9k 3TQEA 4NLUA 1WWHA 1L3KA 4MKBA 1FE0A 2R7OA 2LQJA 4H4KC 3D7SB 2AYMA 3GJRB 4NASA 1FJCA 4HI1A 3HSDA 1P9QC 2ZM6J 5HROB 4IOBA 4OYPA 4ED4A 5CA5A 4RBVA 2B4OA 4DL4A 5C42A 4ZMMA 4M63A 1KN6A 3CDAA 4C8KA 3M05A 3NS7B 1TR0A 4Q8EA 1UJ4A 3H25A 4M5NA 4UUWA 1VHIA 1WI8A 1FWLA 4G1QA 1WSRA 4TQSA 1RU2A 4M94A 3E8OA 1T7PA 4R8UA 3J80Y 3I82A 2ZJQQ 5CCMA 3T5HA 2XULA 2IRXA 5JVGQ 4DV3J 2L3MA 4MKYA 1ZAXA 4KGVB 2CJ9A 5DRKA 4XPCA 1RT3A 5KFSA 4DV6F 2HHHJ 1Q5VA 1OSCA 4N7TA 3IBCB 2KG1A 4ZIVA 3DNCA 4PAAA 4Y6IA 2M2BA 1WHWA 3NNHA 1ZH5A 2J5AA 2ZC4A 3AJDA 3D54A 3L9ZA 3DI6A 3SZ2A 3C15B 1Q86T 2UVVA 4A8WA 1HQUA 1HNIA 4JI7J 2XZDB 4UF4A 3MFIA 2IM3A 4WXWA 1U1NA 1NK6A 1XR5A 2D1CA 4FVMA 5THWA 1JLQA 3F0NA 4LFBF 2MLXA 4ZVOB 2XMMA 3OSNA 1IBMJ 1DTQA 4J9RA 3S8SA 2YX4A 3KXDA 3HHDA 5BR8F 3WDOA 4X84A 2PIIA 3QNWB 2V8PA 1M5SA 2DYAA 3H2UB 2VC1A 2LEAA 3DHXA 1UETA 3T1YJ 2Z57B 2E9ZA 1OYEA 3UD5A 2DNYA 4RW7B 3MCNA 2ZZMA 2FJVA 1JXVA 1U25A 2ZHOA 2VA3A 1UZDA 4LQ9A 1B99A 2YH1A 3R8YA 4P72A 3ET6A 3I9V9 1T9XA 2V9WA 2K3IA 2COLA 2FDNA 2E9TA 4K50A 4CNZA 4PWWA 4QYZK 2W2OP 2KL8A 2BVZA 3J81Y 2ILZA 2VPXB 2M70A 4YY3F 2Q66A 2FB0A 3OBIA 3PTWA 3K7RA 2MHEA 2KB2A 1ZYQA 1YJ9S 5M2RA 4QU6A 2XTJP 4CLYA 1VRQC 5KFUA 3TUZC 2GIRA 3J7YI 4GKJJ 4O4GB 1XERA 2A2CA 4ATNA 3JYTB 2B43A 1SCJB 4FXDA 2W9CA 2CIMA 1RBOB 1HMVA 1S1UB 1N36F 3LQVA 1EX8A 2DNMA 3MMBB 3F56A 2EFGA 3B82A 4RPFA 5CXTA 2R7SA 3P45B 2J9CA 2FIUA 2C2MB 4UOCA 3F41A 3CPWR 3C8YA 2DR7A 2VFSA 4Q0BA 4DUZF 4QU7A 3HFVA 2JLEA 2R2TA 3I0RA 4AE5A 3JQJA 5C24A 2MXYA 4ZPDA 3J81j 4BWJA 3VVUA 4UTGA 5EDWA 1CJKB 2IC3A 1S1WA 2UUAJ 4DG1B 4WKYA 5C25B 3V4IB 2EFPA 4Y2CA 3CF5Q 1UVMA 2FJXA 2VG6B 4K2XA 4ECVA 3KLIB 3ZZOA 4P2MA 1KQGB 5E3PA 4URGA 5F8MA 4ED1A 2DHXA 2XI2A 3R3TA 4OYWA 4PG4A 2BXJA 2V4JB 3D6FB 3HZEA 5DLFA 4DV2F 1S0VA 3K8VA 2PO4A 1NK5A 2DH8A 3LGMA 1VQKS 4W92B 3BF4A 1TAQA 3I87A 2EEYA 4RW4A 2QL5B 1JQGA 4ZOSA 4F0MA 2R8HA 2GAGC 4CLZA 3TAQA 3OXGA 5IM0B 2C3YA 1M1GA 2OEMA 4KY3A 3FGVA 1OO0B 5LMNJ 3EE3A 3KOAA 3OTEA 2CPXA 5GVQA 3HVTB 4J9QA 2IRUA 3W2WA 3CCRS 1IBLJ 4ZP8A 3FQLA 2HZAA 2C2OB 2CPYA 2JX2A 1UFKA 1K9MT 1RT4B 4C8NA 4HYKA 1YZ6A 5BYSA 4GVBA 4JUZA 3CXCR 3VZHA 4CH0S 2VJVA 2GC8A 3DMJB 3UCUP 2GVDB 1DLOB 4CLSA 4ECYA 4WWSA 3MUMP 4K7QA 1X5SA 1IQZA 5F0WA 3E3XA 1KKHA 3V5RA 4LF7J 5EHHA 2BYCA 2F1FA 2FC8A 2KRBA 4ZN1A 3PNIA 1Y3KA 3N5FA 3D68A 1VIOA 1IKWA 2GZOA 4OI1A 2E5LF 2V5HG 4J9OA 4WFXA 2DNOA 4KO0A 2QLXA 1GFWB 4NEYA 2VHGA 4RUCA 4OI0A 1JLGA 4U7UK 3X3UA 1ROFA 3UFCX 3O8WA 4J9KA 2FJWA 2EBGA 2B4VA 1C0TA 4DSKA 1CS4B 5IT9U 2QN6B 2VJUA 2IMOA 3HKWA 3OL6A 3UCZP 4RU9A 1OMSA 3C14B 4G1PA 2Z30B 1OS5A 4C3MA 3VCDA 2CNOB 3T1HF 3KHLA 1IKYB 4ED7A 1WTBA 3A3PB 3EICA 1O6XA 1UEVA 3RW7A 2LQ5A 3H5XA 1TKTA 4KT0C 4CDIA 4KGKA 2ZUGA 3MAAB 1TP7A 4IKAA 4CLFA 2K06A 4M5HA 3SCIE 4CLWA 3ILIA 5J1PA 1XTZA 2XWYA 4LR9A 3RGIA 1XWLA 3QO9B 1S1XA 3LP1A 1UPPA 2GFFA 2GNKA 4YFUA 2OJ3A 2RJZA 3DRRB 1X5TA 4D3GA 2OFHX 2VDIA 3TUIC 2HVIA 2DRBA 1FI4A 3MM9B 4K2JA 3G96A 1K44A 2ASJA 3M8QB 4ZJQA 2DGSA 2LFVA 2B5JB 1OJ4A 3NP5A 3SQGB 5KFWA 4DV1F 4KPYA 2RQCA 2RU3A 3KUEA 2YNHA 3LAMA 2XSJB 3BSOA 3T9NA 4KHPF 4WU3A 4JV5F 4J37A 1BWVA 1RTJA 2RAQA 3DDIA 4NLQA 3LANA 5HMWA 4PG6A 3D0HE 3CJKA 2BW7A 4LBHA 4UOHA 1Q95G 3KNAA 5E3QA 4NCGB 3R7SB 1R8HA 5D4PA 2XNRA 1LW2B 1VQ6S 2AEJA 2PA3A 2D7SA 2EVZA 1T11A 1FRMA 5ETKA 2H48B 1FF2A 2M4MA 4N77A 2CRLA 5KTQA 4LSNA 2BDPA 2BJ8A 3AHPA 2W2MP 2KFYA 4PG8A 3GG0A 3BBCA 1IQTA 4CO0A 1AW0A 4WFYA 2IVYA 2KJWA 3PIOQ 2LXFA 2QRRA 2CNKB 2NPIA 2YKMB 8ATCB 3QJPA 1T94A 1K0TA 2AGQA 2XCPA 2EW9A 1RI7A 3BPDA 3FVYA 3EGWB 3NGDA 3NGUA 3QLHA 2GAHC 3J80U 1PYSB 2JC0A 2HNYB 3UR3C 1AUDA 2MZTA 1WNEA 2EFOA 4PQUA 3TANA 4IFYB 3LH2S 1C4CA 2JWNA 1R6YA 2VFTA 4QWBA 1RT7B 4DPOA 3ISZA 5DZ6A 3OVAA 1T3OA 3DN9A 4F0KA 5KAKA 1XBWA 1FK9B 4CT9A 2XMAA 1NK8A 2WW8A 1KFSA 3KLFA 1FRKA 1BWEA 2DT9A 5I42A 1JJ2R 1RTZA 1VQNS 4P9SA 2GQCA 1T95A 4WP3A 3RAMA 4ZLNA 2DO4A 2HHUA 2CPDA 4WPAA 1HBUA 2HKEA 1UAWA 2HNDA 1U1QA 1WC5A 3MD3A 2HZCA 3WQPA 5D77A 1MN7A 1IM6A 2FQQB 5H9FK 3MEEA 2HZVA 3R1LA 2BJ9A 2ROEA 2LYVA 2VPWB 1HBMA 4DPTA 5DETA 3CCSS 1HR0F 4TYBA 4RW9A 1OQ6A 5KFJA 4MAKA 4KR0B 3UDLA 1LXNA 4USIA 1NKBA 4HTJA 3IGVA 3PIPQ 4QWAA 4H4OB 2ERRA 4OZ2A 4RR5A 4CRJA 1DJ0A 4DS4A 3CC7S 3NS5A 3J81U 2JOQA 2CA9A 3W9HA 1YI2S 4I68A 4ELUA 3PACA 2HFSA 5FJ4A 4RNHA 4C3LA 2CQBA 2KT3A 4P7TA 1EHWA 4PPZA 1VLYA 2ZBCA 2V2ZA 3KK2B 4EBCA 4DFMA 1YBAA 2QL9B 3GU0A 3NMAA 1U2RA 3W9JA 4O23A 3M6UA 4JYAJ 5D0RA 4QWEA 3DM2A 1RKJA 3OLBA 3H4BA 4LF1A 4X4SA 1FKPA 3J7ZT 3C66A 4B3OB 2N82B 4ZLJA 2DGUA 3DLKB 3V6DB 2ZOMA 2C2KB 2HQFA 3WZ0A 2M8HA 2Z2ZA 3QT6A 2WZ1A 3AOCA 4CYUA 4RLEA 4U8VA 4IRKA 5F9LA 2HLUA 2ZHBA 1S57A 4RUBA 2B9EA 5KFPA 2DNQA 1HWLA 2X51A 4LFAJ 1YRUA 4OYOA 4PXDA 1U49A 5G0RB 1IUJA 3HPOA 2RF2B 4K5RA 4A8SA 2C3PA 1IKVA 4A8OA 1WDDA 4YR0A 1SH3A 2DXFA 4MKVA 1HIYA 2BA9A 3MEDA 2D41A 2QGFB 1RGVA 1UVNA 4JI8J 4A48A 2UZAA 2DHAA 1JNZB 5HBMB 3I32A 3A12A 1NHUA 4J91A 4RWXA 1M5HA 1QSSA 2GMLA 3DDNA 5L1IA 2WONA 1X7VA 1FEHA 3Q2TC 3FRZA 4DL3A 1KHVA 2C1EB 4URQU 3HSZA 2SXLA 3IS9B 1ITPA 3BGRA 3GZ7A 1U6BA 2LLZA 3QBCA 1D9FA 3KHGA 1TFWA 3TOQA 3D1OA 4ECUA 1R8BA 2HSEB 4NXMF 2RMLA 1FXRA 1KP6A 3EGVA 4BC9A 1JLEB 4A8FA 2CZ4A 4DX6A 1NJIT 9ATCB 1S6UA 4CLTA 3OVBA 3IR5B 1RT2B 1FRJA 4ED5A 3OJUA 3RAXA 2Y1RI 1R6VA 2GIFA 1ZM9A 5CAAA 5HATA 2DH7A 1YQHA 4KFBB 3ETMA 5A8KA 2XMTA 1HYSB 3MOZA 4BS2A 4MYTA 2ADBA 4FS1A 2J7WA 3IO1A 5L1JA 3PZPA 1VJWA 3QAEA 4NE9C 4TXSA 3QGIA 5D3GB 4OJGA 4XDCA 1YDLA 2E1MC 1XMOF 2BANA 1G1XA 4FYXB 3SYZA 1RT5A 3JAMY 3KG4A 1JX4A 4UQGA 1F9EB 4ETXA 4K4XA 4KPCA 4DUTA 3CJ0A 3U02A 1TVRB 3SXLA 4NXNF 2F4FA 4ED3A 4Q7AA 1OYDA 2J6SA 3K5OA 4TQRA 3KKFA 4DBQA 2VH7A 2IJNA 2EFNA 3RB0A 4AFFA 4B3SF 3VR1A 1ZAWA 1NEEA 3QRQA 2B4PA 2PFDA 4WZMA 2MQOA 4ZP9A 3G6YA 3CGIA 1IKXB 5T14A 4KTQA 2CYYA 2VG5B 4DF8A 2MZRA 1UA0A 3W2VB 3NNAA 3EX7B 3T6BA 2DTJA 5C7PA 2DCLA 2XY5A 4LF9J 3WC0A 1VC5A 1PJ5A 4OYIA 3KTQA 1TK5A 2KFNA 2UUBJ 1U2FA 4EO6A 3KHHA 3M9MB 3MXHP 4DR6J 3C6TA 4USTA 2YQ0A 5L38A 3FMWA 2M0GB 3T9ZA 1F5AA 3NWRA 4YDXA 3CT9A 3BZQA 4OIXA 2IAJB 1XNQF 3L7OA 4NI2B 3PFOA 1RCXB 3SBMA 4TU9A 3MCSA 3RRHA 2AT1B 4JBCA 3NS6A 1PBAA 1K1SA 5CHCB 2Y0SD 3D1QA 4Y2AA 2GO8A 4MIAA 4QW9A 2IA0A 3EVWA 1NSAA 3MM8A 4ZA1A 5HVGA 3WIUA 3NWGA 3I55S 2ZE2B 1QAYA 3KUHA 4M5LA 4IOCQ 4DSFA 2XS7A 1R0CB 4OYXA 3SFUA 3LW5C 5ITHA 2QLJB 4GC7A 3PX4A 3I96A 3IR6B 3KWMA 2ACYA 1K47A 3Q8PB 1KR4A 3IP0A 4FS2A 4CO5A 2ZH7A 3DLBA 3OHAA 2RQ4A 2ZC3A 3G8TA 1S1UA 2PI5A 1EAYC 1GNKA 2VODA 2FHKA 4ZP6A 3MMAA 5K14A 1EB0A 1X4HA 3BKFA 4KHPJ 5KG3A 1C1CB 4AXJA 3UQSA 2DRAA 2LDYA 4JI1F 2CKWA 1UWBA 1KOHA 4Z7YA 2XGPA 1RAGB 4MT1A 4Z37A 1S59A 3I5BA 3TWZA 1WJ9A 3C3LA 2R9LA 4WBFA 1SH2A 2DJWA 1NDKA 1HL6A 2OTJS 1U0HA 4ZIWA 1NHVA 4ZN3A 1I51B 2OGUA 1J5EF 2BE2A 2CFXA 4CO3A 1OY6A 3NAIA 1VQLS 1VRUB 1FVSA 2MGZB 3HHLC 4X2BA 4ES3A 5HI7A 3RBEA 3VQTA 3FEYB 2MPUA 4FBTA 4LBIA 1FJ7A 3UO0A 1SBRA 4C98A 3UPFA 1TKZB 1QD1A 1R3NA 2ZDPA 2Q79A 4OHZA 3SEOA 4GMKA 5D0GA 3CCVS 3ZZTA 3WHIA 4ZPVR 2B9WA 2OAUA 2G2ZA 2HBZB 4IR1A 4FZVA 3UWTA 1N6QB 5HK4A 4DZDA 3PR5B 1S72S 4WFAQ 3JSMB 4EZ9A 1UFWA 1PBUA 1HKAA 4P7VA 1S4EA 1NZAA 3IBFB 1Q8BA 1S9EA 4M5MA 1TUVA 4IH7A 1RT4A 3UNYA 2AGOA 3BDPA 2MQMA 2PN6A 3DMJA 2E29A 3GWCA 3ZTRA 5DDRC 2NS1B 1YTYA 5DQHA 4DR4J 2WHOA 4WYLA 4ZVSB 2QSFA 3CCLS 2CG4A 3KMQA 3IWLA 3G8QA 3N0VA 2JFKA 2W8KA 3K57A 1BQMB 1O5JA 1U6FA 4YN3B 1S97A 1CC8A 1TKXA 3KK3B 1VR6A 4RW6B 4DS5A 4I2QB 1RZMA 2B6AA 1PYOB 2QSWA 2I5JB 3T5KA 3R1HA 3VAMA 4URSA 4KYZA 2APOA 1W2IA 3OXLA 4P75A 4OX7A 1KNZA 3MR7A 3M8ZA 4E98A 2QC3A 1VQYA 4RUHA 1JKHB 2NPFA 1Y00A 5DJBA 5SUHA 4OZ3A 5D8HB 1BHNA 2EI5A 2HHTA 3IWNC 2BJDA 1TZ0A 2E1AA 4R5PB 2E5GA 3G6VA 4K4ZA 1NAQA 1VYAA 3ZZUA 1D09B 1CULA 2VBYA 1R7IA 5M2PA 1HBNB 4L75A 2IVMA 3U7JA 2DHHA 1LWCB 1U8SA 3HJVA 3B4DA 4J7CA 1U48A 4QR1A 1LEOA 2OPPA 2OLWA 2C3OA 3IRXB 4GO5X 3SI8A 3M30A 2AX1A 1TV6A 3PKMA 4KE5A 2ZWPA 3CJ5A 2B51A 2HBRB 3CCJS 4R0JA 4IG0A 3CJ2A 4PYAA 1N34F 5IOLA 2XSFA 3M8QA 2GGPB 3IG1A 3EGNA 2J7KA 3CDWA 2FLOA 2NXNA 4U9RA 2RIJA 3IBWA 2FHJD 2B5JA 5LSLA 3MM7B 2CPZA 5KG4A 4O3RA 4DR7F 1WELA 1FKOB 1H7XA 5EN1A 3GCWP 2QEXS 1TL7B 2RU9A 3F73A 2RD5C 2YX7A 2R2SA 3M4XA 4FKYA 2J8SA 3KLHB 4C2MA 2AQ4A 2WVBA 2IBOA 3GQCA 2IYIA 5CYJA 1TTHB 4PRFA 1SC1B 2DPJA 1LW2A 3GPAA 2GHVC 5M2UA 3D1HA 1FFGB 3QGHA 4ILLA 1QUPA 2LEPA 5LM7E 3UCGA 4OHYA 3FK4A 3ITHB 1RB0A 2D9PA 2PD1A 3CUNA 3HHNB 4J9MA 1JLFA 1W25A 1B4SA 2UUTA 1A7GE 5A8WA 5A8RB 2VQFF 3BBBA 2GCFA 3DDKA 3G82A 1CJVA 1JJCB 5HQ8A 5ETQA 3GILA 4FYDA 2FY8A 3M2RB 2EG2A 4IO9Q 2GV1A 4TLRA 2L41A 2VONA 1NBEB 2E66A 4GC6A 4JI0F 2VUGA 2CQ4A 2H54B 2XMUA 3MPDA 5KT3A 3CVKA 3JAMU 4LRDA 4RO0A 2MY8A 3MAQA 3MZIA 2UUCJ 5CD4A 3GFXA 4YHHF 2OD4A 2V63A 1IWGA 3GCXP 1WORA 4J9UE 4F25A 1RAEB 1YSJA 2HMIA 3Q24A 4DEZA 5SZTA 2VASA 3AJ1A 2JEGA 3JTNA 3K58A 1EP4B 5F8JA 1R27B 5B0GA 1RAAB 3JXOA 2KN4A 5F8HA 4WIQA 3W60A 3A4TA 4XAKA 2C2NA 2OO4A 2XEXA 4JI3F 3TUJC 4TU8A 2DR5A 1H2TZ 2DNKA 2F65A 1H0HB 1RUSA 3MECA 1PSDA 4L72B 3VAKA 4JI4J 4QBUA 4DUYJ 3NGTA 3BJYA 4JI6J 3FBFA 3NY0A 1FERA 4ANDA 5RUBA 3W5ZA 2JNJA 1X4GA 4MK9A 2YNGA 2GHWA 2D3O1 4CNYA 3K5MA 3KK1B 4CP5A 1REGX 3BYPA 1IR1A 1IN0A 2UXBJ 5DQIA 1WUUA 4IDKB 4CM0A 2HHQA 3QFWA 4EI2A 2CUYA 5AXMA 5KFVA 3QT5A 2E5HA 2B7BB 2A6OA 2CVEA 5DQGA 4U6PA 2XYGB 4A47A 1SUQA 2Z58B 2BKPA 3NMRA 2HGMA 2BW2A 1X9SA 4FNHA 2M88A 1DTTA 2VQEJ 3PJWA 3BH7B 3O3LA 1GT8A 2CJBA 3PW7A 1DFDA 3P49B 3TZZA 2BKNA 2DNLA 2HNZA 3OUYA 3BQ2A 4C11A 2IHR1 4ICLB 3IR7B 3D9BA 2WB1D 3UR0A 4AD6A 1OPZA 3G9CA 3MTJA 3H5SA 1RWKB 2FHJA 2EBEA 2WSEC 2KZMA 1RWVB 3V6DA 2G2YA 3Q83A 2YTCA 4TN2A 3FRYA 4NZ7A 3OV7A 4DMZA 3C6UA 3DRPB 3M32A 3CIMA 3M2UB 1EQ0A 4LVOP 2QZ8A 1GX5A 1WF0A 1HNVB 1OPIA 5K9FA 3H40A 4AQYF 4ECRA 4JV0A 3QT7A 2XGQA 3CJ4A 2OPRA 4O44B 1KC8T 1Y11A 2ZH9A 3TEHB 2H5IB 3GJTB 4FF2A 4P74A 2IM1A 1VBKA 4K4SA 3L7UA 3OPKA 2ZM6F 1AZSB 1N5YA 4C8LA 4LSLA 1RYSA 4ZPBA 5KFOA 1K0VA 3CULA 4OJHA 2IMWP 3V6KA 5KG6A 1NKEA 4TU7A 3OL7A 1KQSR 4OX9F 5DGAA 4B9VA 3D6TB 4TVAB 4PKDB 3M6XA 4HACA 4YB6A 4LT6A 3IS9A 3GTYX 2YH0A 4XIUA 1NK9A 1SC6A 4LIRA 4WCEQ 1RLCL 3AD9C 3PO5A 2IY5B 4DV3F 2CNLB 2G0CA 1KLNA 3M9NB 5J1EB 2MZSA 3VVTA 4C7QA 1Q8KA 3QRPA 3D2WA 2HHHF 3HHKA 2WTFA 3RBDA 1KWMA 3A8KA 2FHMA 1F2HA 1RWNB 1IJEB 5K5MA 2VBZA 1VLOA 3HM9A 3LP2B 4DSIA 2X1FA 4Q2LA 3A3NB 4HVZA 2A6MA 1KVJA 2VL1A 3TVZA 1B0PA 4RJVA 1JLBB 3AH6A 1HNZJ 2KFZA 1EKSA 3KJFB 4QPTA 3W62A 1NPKA 4JI7F 3QZ8A 2J6UA 1ZM2A 3QJJA 2K7JA 2D3ZA 1WG1A 5L39A 1LNQA 2A18A 4X65J 1ZPVA 1MU2B 1RAFB 4ANEA 3PW4A 4A8XA 1IBMF 4J9VA 1FA0A 1WHVA 2E1PA 2V2KA 3ZTOA 2NSCA 1KLMA 4CTAA 1S7IA 2R7XA 3DGVA 2LEBA 3AXKA 1RQ0A 1SJRA 5F8LA 4OFZA 4ZVTB 2FGOA 4O0NA 2QE5A 4GVLA 5D4LA 3CJRA 3K5NA 1X4BA 1YJVA 1V9OA 3I9ZA 4I7FB 2V8HA 1WC1A 2WVFA 3DOLB 2O67A 3TAMB 2ASLA 3W2VA 5GAGI 3J7Z5 4IYQA 1YBUA 2AMCB 4H4MA 1GX6A 1RHMB 2KM8B 4J5OA 3GMGA 1SPBP 2CQDA 3GE9A 3OR1B 3D5MA 7FDRA 4K4VA 3TUPA 2EKNA 3BSNA 4B9NA 4V19J 2L9DA 4X4PA 5DG9A 5B0CA 4ER8A 1NJXA 4GKJF 3TNVA 3DCAA 2PGCA 5BYQA 4HH1A 5LSOA 4PXCA 3GFYA 1U02A 5HQMA 2ZD1B 2RUSA 2HQ3A 2ZITA 3M1VB 2OSQA 4KH0B 5T7LB 1S6PA 2FZCB 3Q2SC 2K8GA 4NEZA 3EVMA 2HVDA 2IAJA 4U96A 3MWBA 3BV8A 3H98A 4YP3A 3MCMA 4DX8H 4MMOA 2B4UA 1KVKA 2XS2A 4BDPA 3D6HB 5I3UB 1LK5A 3D3BJ 2FJAB 2MKKA 1QSYA 3W65A 1S1VA 2LXIA 3AOBA 2WRMA 2KYZA 5F8GA 3OXFA 1V5IB 1JLAA 3IRWP 2FGCA 2KYXA 3NBPA 2UUAF 1C0UA 2XCAA 3POTB 5HJYA 2Q3PA 2JEFA 2ZDOA 4ZVUB 2EWHA 4X4OA 1T8EA 3PJ9A 2I6WA 2MQQA 4EBDA 3KDNA 1M5KC 3MOJB 1Q79A 3OR2B 4HDGA 1Q8IA 1SIZA 2DPIA 4WU2A 1K1QA 3K5LA 2Y8YA 2NCKL 2RRBA 2DBBA 3B78A 4IO1A 2V4RA 4NYZA 5EX3A 1CJUA 1MG7A 2J9DE 2BE7D 3RTVA 3T6JA 1RT6B 4DR2J 1U0SA 4B9SA 2G4BA 1M1HA 2HHSA 5GAHI 3OTCA 1U1PA 3PYEA 5ETRA 4QPXA 2B7CB 3PYDA 2MQPA 2NXCA 2MZQA 3N01A 5L8RC 2NLWA 1N0UA 4LF8J 2MGZA 1IBLF 3MM6A 4MIWA 1MSWD 2BR0A 4JI2J 2VQFJ 3TA0A 1DRZA 1TKZA 1FRHA 1U7LA 4C97A 3R2CJ 3FEXB 1CBKA 4Y28C 3RAQA 2WSFC 3KYLA 1HW9A 3LPEA 4ALZA 4K0KF 1H6KX 1V5VA 4LIWA 3PEHA 4KV8A 4DV0J 5B7WA 4LF7F 5FDLB 3BKUA 4ZDNA 3PY8A 1HHTP 4BHQA 1X0PA 3G86A 1Y5IB 2L48A 4MKAA 2MSTA 1LV5A 4RNMA 3MEGA 3N9UC 3NKYA 2M5YA 1GK8A 3R9LA 1FKAF 1NKCA 4NX9A 3EVOA 1T03A 1Z2ZA 1R0AA 4USHA 3M8YA 2W2QP 3OVSA 4DV5J 5KT4A 2R2UA 4DFJA 2OPQB 1YZ7A 3W3SA 1WI6A 2AF6A 3PJXA 2N3LA 2XQCA 4F4XA 4TNOA 2WAQD 3GJQB 3AB2B 5IC6B 1PAUB 2POKA 5B09A 2MY7A 2YWHA 3DYAB 4KQZA 5C2GA 2KHCA 2DNNA 2WVDA 2GS8A 4NLWA 4K59A 3ZC4A 3ZNJ1 3HHLD 3KLEA 1N48A 1DY3A 1BQMA 4NRTA 3DU6A 4WIIA 1F0XA 5KFMA 1SKUB 1VRTA 4MYUA 1VQPS 4WK1A 1APSA 1BGXT 4OJ1A 3M7VA 3G71S 3MMJA 3UVJA 2C22A 5J2NB 4FKXA 1Q1KA 4I64A 1HI8A 1FXLA 2UU9F 1RTIA 4H54A 2UVRA 1FEEA 4KKOA 3FFIA 5ETPA 4DQSA 1CC7A 4W4MA 3THPA 2QMUB 2MLZA 2MMYA 1FO1A 1SB6A 4C3KA 3DRSB 2W01A 5LJ5Y 3KLGB 2YKNB 1H38A 2CAJA 2Z2YB 2ZEJA 2HQIA 2W9BA 4EYHB 2B9XA 4EZ6A 3IFEA 3KUGA 2G9OA 3PRDA 2RDJA 2OIHA 3C2PA 1S48A 1H74A 2DGWA 3HX9A 4F36A 2W2PP 2XLJA 3DGPA 2JLGA 1WC3A 1T02A 5E0OA 3L4BC 4PUOB 2AGPA 1BY9A 3QZ7A 1JK9B 5DGBA 4KBIA 4LF6J 3NAHA 3NG8A 3KG0A 3S1TA 1MNEA 5CYMA 5HANA 5JMNA 5ETVA 3C46A 3W66A 2XZTB 1FDNA 3H59A 1AFIA 1LW0B 5EWGA 5HP1A 1NJYA 2YVSA 1S0MA 1E6YA 4F50A 1LWFB 3A8IA 4DR1F 4DL2A 4AQYJ 4DXLA 2ZKUA 1YX2A 4L73A 4ZCLA 5CYQA 4OI4A 5D6GA 1UMJA 5HAOA 5IWAJ 4X62J 4Y0FA 2LA4A 4WZQA 2GVZA 1MLAA 1TL7A 3D0IE 3U27A 4ZHRB 2A0FB 3LP0B 3HF5A 3PYFA 4ITSA 1FT8A 4MH8A 2OHDA 3EDQB 1SC4B 5KFGA 4IFVA 3NCQA 3KLHA 4DN0A 2UXCF 1YJ7A 1RWMB 2ZJPQ 2DY9A 1F60B 4FPIA 3VTIA 4LF2A 4WJBA 4IR9A 2VB6A 4OX9J 3QIPA 5C42B 3OFFA 2Q6BA 4XO0A 3MTKA 1RA7A 1VS3A 4F3MA 5HMZA 2JC1A 2W4CA 1UVKA 2N3OA 1LFWA 4DWIA 1HD1A 5J2QA 5AT1B 4DPUA 2OPSA 4OLPA 1VC0A 2AHOB 4R8UB 4I1TA 3V2UC 5HSPA 3H0PA 2EKYA 2V69A 2I8EA 2BJ7A 3IAM9 3IXQA 3IA0A 2KJVA 2WOMA 4AL6A 3LUYA 5C5JA 3G4SS 3P6YC 1J2VA 1UW9A 3G87A 4HH0A 4M8LA 4QOTA 1Y3JA 3QIDA 4K4TA 3M2RA 2CJQA 5LXYA 3RRKA 3FQKA 3GYXB 1IJFB 1NSQA 5IV4A 1VJQA 2W24A 1NB2A 1H2UX 1H72C 3OFEA 1ULRA 2RRAA 3RG6A 2GQQA 5K20B 1SKSA 3NOCA 3DI6B 3A8EA 3C16A 1HQUB 2YQ3A 1HNIB 4FYYB 4G1IA 3O44A 2HK2A 1U4BA 3RYLA 4F4KA 4FNIA 1FTRA 4PWDA 4WE1A 1JLQB 4YR3A 3HHLA 2G0JA 5F41A 1DTQB 2VDHA 2XM3A 1TUWA 5HLFA 2ASYA 2I2YA 1CJTB 4N76A 3JS9A 2LCWA 3KMSA 5CD4H 3SCLE 4FXVA 2G0IA 1HBOB 2YKQA 2H5JB 4ECQA 5ETMA 4CIOA 1ZA2B 3U1MA 5IT0A 1UFLA 1U1OA 3RR7A 3R27A 1D3WA 3ET6B 2W2NP 3AQOA 4BBYA 3P96A 1E6VA 5KFTA 3TVYA 2HQCA 2I0XA 3K2YA 3MMCA 5ETTA 1LKZA 2XWXA 2ATCB 4PG7A 1ZPWX 2UXDJ 2FJEB 4JYAF 1M90T 1XJWB 2KTQA 2Z4PA 4ID5A 2C3MA 5AE1A 3JQKA 3RU0A 3P3DA 4CO2A 3TEGA 1NDCA 5HJXA 4YR2A 1AROP 4ZPCA 4ZCMA 1GEHA 3I56S 3UD3P 4LRCA 2P8IA 4P71A 1RISA 3HHEA 5BXIA 1REVA 5KFEA 2B3TB 2HHPA 1FESA 3TAPA 1YKWA 4C48A 5F3TA 4LFAF 2W9CB 5KOWA 1TELA 2DNRA 4PG5A 1HMVB 4O3SA 3W61A 4J9LA 3PRVA 1T9TA 2CQ2A 1NPPA 2HAFA 4N5SA 1FWPA 4OJ3A 2J9EA 4C8YA 2J0WA 2W8LA 5KFXA 1PKUA 1KONA 1CLFA 3KJVA 4PYDA 4CO1A 1JJHA 4JI8F 2RDDA 5K8PA 4NYOA 4WF9Q 1PCAA 1ACMB 4Q0BB 4ECTA 2JFDA 4Y2MA 3I0RB 4DL7A 1SC3B 3VAIA 3P8BB 5IS2A 1SI9A 5C24B 3V81A 2ZOGA 3WIVA 1XMBA 2KDOA 2E1CA 2IC3B 3RR8A 1S1WB 1Y4ZB 3UD4P 4S0MA 1O0PA 1HQEA 3D28A 2FYXA 5HVHA 2FTRA 2HAIA 4DL6A 4NLXA 1Y7PA 4IOAQ 2BQUA 3VGVA 3N6MA 2H4WB 4IG3B 4ZPTR 4ETZA 5DDOC 3L3CA 3MPWA 2F7VA 2FVSA 3B4MA 4TY8A 4CH1A 1VBXA 2DK2A 3D0GE 4NLVA 3O2IA 2KXHA 3QRRA 2MHNA 3W9IA 1RWWB 2YXLA 4Y3CA 4I6WA 2VICA 2MKHA 4W98A 2RS8A 4YDDB 4JI5F 1F5CA 4KSEB 4C0BA 3TZYA 3SSRA 3R5JB 4K4UA 3IM8A 4F7VA 2YQ1A 2QMWA 3OTDA 2D69A 1NMEB 4AUKA 5HL7Q 3FNNA 3W2WB 2D74B 5A2QY 3BR8A 1TU0B 2C2ZB 3HSGA 1U09A 1N32J 4K0KJ 4V1Ak 1OIAA 5L9NA 2Z56B 4GVBB 3TJAA 3L09A 4ZCKA 3PHTA 1FNXH 3AA9A 4BLGA 2K1RA 4FBUA 3M2VA 1NJWA 1G2EA 3LF0A 2M3DA 2RNEA 1HHQA 1GMUA 2W7PA 4I2PB 3CB4A 4USWA 4B17A 1Q82T 1ZAVA 4MFBB 4KH1B 4KIAA 4DR5J 1IKWB 1WEXA 2HHWA 2KT5A 2RS2A 1Y0HA 1VQOS 3SV4A 4KO0B 1PILA 5L9XA 4LF9F 3OTOJ 1JLGB 3MPVA 1SJFA 4LRBA 1ZZNA 1S5ZA 2K7KA 4F4YA 2CPIA 3QT8A 2UUBF 5H9EJ 4HTIA 1RE1B 1UA1A 2U2FA 3MGJA 1EIYB 3JTPA 3NXZA 3OSPA 1T05A 4DR6F 5KT2A 4ES2A 4DLGA 4I7FA 2GX8A 2ALZA 2CNNB 1X5OA 3PO4A 1QDUB 3FMBA 3EZ5A 4Z2XA 1UP1A 2DNHA 4XTTA 1LWEA 4LFCJ 5GMDA 1KOOA 4KAIA 4NPOA 2ILYA 3CEDA 3HVWA 4F2SA 5J2MA 1ICEB 4I6AA 1DBDA 2UU9J 1YJNS 1RACB 1P1TA 2AKWB 3QYYA 5GADU 3MF5A 3V6HA 1X5PA 1X4EA 4F4AA 3PR4A 2CPFA 2DGVA 3HKZD 2ROGA 1FNMA 1S1XB 3LP1B 4IUFA 3LGNA 3ZZYA 1PG5B 1SQGA 2LU1A 3KLVA 3THVA 1V3RA 2I9SA 3LPYA 5E3AA 1U1RA 3M8PA 3MUTP 1D1UA 4LVNP 2G1DA 1PJ6A 1VBZA 5T7LA 4BC7A 2OI2A 5HO4A 4EK2A 1SQFA 3CD7A 1MWZA 2FVRA 4LRFA 2O66A 1BQNA 4EO8A 5G4DA 2ZH2A 5KFQA 1PGZA 4USVA 3QAUA 1QTMA 2PMWA 4U7UD 2YNHB 2YX1A 2YY3A 3DLJA 5GADI 2QYGA 2B9YA 1LWXA 5E41A 4AL7A 1RTJB 2QIFA 5EWFA 3KFWX 3CJKB 3QMQA 1YJRA 4B3TF 4DR1J 3HT0A 1WOSA 4LUBA 6AT1B 4RL1A 3I31A 3E01A 4F8RA 5F9NA 4HR2A 5ETNA 2X1GA 1R89A 2Q1LA 2LDIA 1ZM4A 3TJ9A 2JL9A 3PRBA 1P6TA 3T41A 2BJEA 2MLYA 3DLGA 1VQMS 3CCES 1D0EA 1KBRA 3BYRA 4NCBA 1D8ZA 1XMQJ 3TQ1A 5AE3A 1FJEB 3J7A1 4DPWA 1HWUA 3TI0A 2UXCJ 1X9MA 3VGUA 2RB7A 2ZNZA 1RTDA 3SMZA 5C2CA 2KU7A 2C2DA 2ADCA 1QTNB 1YVFA 1HARA 4NZ0A 2VFVA 1HPZA 3VHQA 2R4FA 3OHBA 4ILRA 3OL8A 4PQUB 4F02A 4OHXA 4DCPB 4NLOA 2CQ1A 2Y9HA 2RKIA 2WSCC 2VG7B 4WTOB 1U24A 1N5SA 2DGOA 2HBYB 3NLCA 2BRKA 3EZUA 3ZTSA 2P2CB 3BS9A 1C1BA 4M5IA 4U8YA 3SIPB 2XBPA 1MN9A 3ENWA 2E5JA 3KLFB 4DR4F 2JLFA 3D67A 3TJ8A 2Q43A 4DX7A 1RT1A 3QQCD 1FHTA 2F40A 5FIIA 5GAEU 5CCLA 1X4DA 3HK2A 4ED8A 2R3VA 2O5DA 2D9OA 5FDLA 4PXEA 2QFIA 1HBUB 2HNDB 2ZHAA 2LVWA 2WBRA 1X4CA 3PYGA 1B64A 2MYFA 5KFDA 1EETA 1I1GA 1PAEX 3J7AN 3ZTQA 3MEEB 2AWZA 2CQ0A 4XDDA 4CLKA 3MDFA 3ETOA 1WDTA 1EKRA 1HBMB 1FRIA 3VAJA 1VQSA 3CMQA 3CO0P 1HWJA 4RW9B 3HDSA 1LFPA 1DURA 2HQGA 2IYGA 3CD5A 3DYAA 1M0SA 5GAEI 3FBEA 3I0SA 1A6LA 3DOKA 3H42A 2KXFA 3OTBA 1S6QA 1RHQB 1S99A 3MPYA 2NYHA 4JV1A 3D6MB 2B8QA 2KZZA 1OSDA 2F4VJ 2ROPA 4HT7A 5FD1A 4AL5A 4RW8A 4RKUC 5DZ7A 3T19A 3N5BA 2R42A 3SDEA 1WF2A 2OTLS 2D3OR 4HHJA 1BC6A 4NLGA 3QGGA 1CEZA 2QA1A 1FDBA 3P4UB 1GTEA 1SXLA 1WG4A 2DHGA 3TARA 2NR0A 1YRTA 4LF4J 3BPSP 3BO3A 2OSRA 2W7AA 2WVEA 3MHYA 1TL1A 2MSSA 4UT4A 3DRSA 1FKPB 1FFWB 3RBZA 1HD0A 1FD8A 4L76A 2GO9A 5KFRA 3H8YA 4DR3F 3CO9A 4X4NA 3S01A 5IT4A 4P2FA 2AX0A 2AYEA 3IC1A 2AW0A 2ZBRA 2CJKA 1ZTWA 4CYUB 2HK3A 1J5OA 1AA1B 2DGTA 2XMWA 1RTHA 3S6EA 4A4JA 1S76D 2FLLA 1U47A 3TX0A 1Q81T 1IBKF 3PHEA 3NGKA 4EWTA 3QJLA 3T3FA 1FCAA 1IKVB 2EPIA 1NM2A 2VF3A 5HN0A 2V68A 4G6VB 5LSRA 1LW0A 3MEDB 3QSYB 2DIVA 4LJMA 2JZ5A 1NSPA 3GYNA 1UJ5A 4Q2MA 3HFKA 1Q8LA 2ZJRQ 2WONB 1T9YA 4PQAA 4NLTA 3DFEA 4DZ6A 2CWXA 2PMZD 4IRDA 1KTQA 3K59A 2FUG9 2DNZA 3BGRB 3JSYA 1VQ7S 2PA8D 5HROA 4ZHRA 1VI7A 3LP0A 2OELA 4O3OA 1DAXA 2AP6A 1VBYA 5ETSA 3BEGB 2C3UA 1HQ2A 3MCOA 2FVCA 1N33J 4O3PA 3CDUA 1X4AA 1M5PC 1L5UA 2N7YA 2KXNB 2BX6A 2OD6A 9RUBA 1HLWA 1ELOA 5A2QU 4LR8A 1WC0A 1D9AA 2UUCF 4QIEA 4ZPAA 4L6V3 3OW2R 4JI5J 4DSJA 3HFZB 5A8KB 4ZVHA 2HW3A 1FVQA 4K5SA 2E1RA 1N88A 1AFJA 1MMDA 1IBCB 2EK1A 4DCJB 2BANB 3BGUA 2M9KA 1V6HA 3FSXA 1RT5B 3DHWC 1WKJA 1GMWD 5EUHA 2MJNA 3C15A 1ZTTA 3BQ1A 4JI4F 1M5OC 4DUYF 3ENAA 1KVIA 1X31C 4JI6F 3DLHA 1DHMA 3GB0A 3GP9A 3FKBA 3C19A 2ZZTA 3T1AA 1WC4A 2RVJA 4YB1P 3KJNB 1UWAA 1BMQB 5E2QA 4CO4A 1X4FA 3OFHA 4OZ1A 2V9KA 2ZH8A 3QWPA 1DQAA 2AJ2A 2UXBF 3TRGA 5LJ3Y 4U67Q 2R8JA 1FJGJ 4FF4A 1U1LA 4F3OA 5EGYA 3EYZA 5IQQA 1KRPA 1CVJA 3BN4A 3N79A 4YEAA 4RW7A 1CJTA 2QL7B 3LAKA 1HBOA 1FNOA 1Y5NB 2XB2D 3Q8UA 1YHQS 4DN9A 1VDHA 2MKSA 3J7YU 4NWBA 2HIQA 4KGZB 5IFMA 3C6TB 2R7TA 2VQEF 3GSIA 1URNA 4J9PA 3P5TL 1JMTA 2BM0A 3CSKA 2MKYA 1OY8A 2J0SD 4DPYA 3WX8A 3TA1A 2JEIA 3UN3A 1Q78A 2H1YA 1H98A 4DU7A 4ID8A 3QATA 3HD2A 3MM8B 4O4GA 2RUGA 1LXJA 3JYTA 4HEA9 2C42A 5FLXY 8RUCA 4HHHA 3OL9A 5DM7Q 5AE2A 4NZ6A 5LOQA 3AXMA 4ED0A 2UVWA 2O1PA 2HS0A 2BJ1A 3MMBA 1F1BB 3A8JA 2DITA 2VBXA 4ZVQB 2V8VA 3MMAB 5K14B 1YK9A 2CQPA 1WKKA 1JIHA 2HFZA 1UWBB 3VAFA 4C0OC 3IMQJ 1NXIA 4B3TJ 3ISNC 1VQ9S 1CJKA 1RBAA 3Q8QB 4DG1A 5C25A 4P2SA 3V4IA 1YJUA 2OP5A 3CD6S 2F8EX 2VG6A 3MUVP 2CZ9A 1RA6A 3JSRA 1G4CA 3KLIA 3CCUS 2HRTA 1VC6A 4F67A 5D0EA 1U0HB 2GJIA 1U1KA 5HMYA 3GJSB 2BE2B 4X4QA 1T9WA 3PW0A 2V4JA 3TR5A 3NOGA 3L95X 2BOAA 4IG3A 2QFJA 4OQJA 4ZJLA 4ZVPB 4DSLA 5E3RA 2CJXB 1HI1A 1VIXA 1FDDA 1GTHA 1HNXJ 5F8IA 3UDCA 2VFUA 4EEYA 3B54A 5IM0A 1WACA 2KI2A 4B9MA 3KDOA 3NL0A 3M8RA 5LMUJ 2DVIA 1TK0A 2O01C 1HNZF 4M1KA 3M6VA 5CQGA 5B0EA 3HVTA 5IC4B 2PDAA 3RJMB 3A13A 1CG2A 1WHXA 4X65F 1S77D 2IBKA 1TL3B 5D15A 2X3GA 2IM2A 3HZGA 3Q8RB 1GMWA 4NA2A 5JUMA 2B8PA 4NYPA 3G8SA 1ZS6A 2AIRB 3CCTA 1QE1B 4ZKAA 4WKRA 1KEKA 1S9EB 1KHWA 2GVDA 1DLOA 4JP8A 3AY0A 3LA0A 4KJIA 2X3DA 5CZXA 2HPUA 2XZWA 2JRSA 3UDEA 3B8HA 2NUUG 4ED6A 1S4FA 4F4ZA 5CABA 4W90B 3OT9A 4KHMA 4QIFA 2XMVA 2R8GA 4CLPA 4I2PA 4K8RA 4MFBA 2XY7A 4C8ZA 2CJYB 1TKXB 4NLDA 2B56A 1XC9A 4DDFA 1L3TA 1NNDA 3CJ3A 1UPMB 2Z2LA 4HT5A 3SFGA 2F3JA 2B6AB 2ZBPA 3CD0A 1XNRJ 1CS4A 1Q0NA 3R6GB 1P1LA 3PX0A 5KFBA 4C9DA 3C14A 2ZWOA 3CWJA 1R31A 4ECSA 4LF5J 3SCJE 4AT1B 4B3RJ 2QLBB 4C6AA 1IKYA 4LSZB 2C28A 2CADA 2AZ1A 2HIYA 3RB3A 2P6SA 5D4OA 5I3QA 4L3NA 2H51B 4GKKJ 3M8SA 2HGNA 3TZXA 4UZCA 4I56A 2OEKA 2KRRA 2WVCA 3MAAA 2DNPA 3HVAA 2ATLA 1RWOB 4J90A 2BZ2A 1CULB 4CQ1A 4X64F 4HI2A 4YUDA 3QO9A 2CVIA 1QSLA 3GLJA 1JJ4A 1N5TA 3DRRA 2VA2A 2OPPB 1MWYA 4QYRA 1CQNA 3ELHA 5KFIA 3CTRA 1GQEA 4OZNA 3MM9A 3M30B 2CDRB 3K89A 2EC2A 1TV6B 4C4WA 4I69A 2ZVSA 2Y8WA 4RX6A 5KG5A 4DQPA 4IG0B 2GMHA 4DR3J 3SQGA 4TLQA 1RAIB 3IG1B 4ZLLA 5HVFA 4OL8A 1SL1A 1Q4RA 1TQLA 2XSJA 1JNRB 3ILOA 2FVQA 3FZBA 4OHWA 3MI7X 4L3KA 3BH6B 1IBKJ 3LO3A 4X66J 1SJ3P 1C2PA 2Z8QA 1RHUB 1UVLA 2BM1A 3Q89A 5DS7A 5DDQC 4NCGA 3CIZA 3BR9A 4U95A 2BOPA 1D9DA 1RAJA 1UVJA 1U8WA 4DR2F 2J9DA 3GSDA 1LQ9A 1WKLA 3AOAA 2GHPA 1FRXA 4FVCA 3U1LA 2CXEA 2FC9A 2MJUA 4LF8F 2QV6A 1CPZA 3W64A 3VAGA 2YKMA 3H5YA 2MZ1A 3PW2A 2GMJA 1NK7A 2Y1LB 4JI2F 3NCPA 2CPHA 1VMBA 2HS3A 2BRLA 1SKRA 3ZTPA 3HO1A 1JLFB 4IRCA 2BMBA 3CCQS 1KD1T 3EPIA 3HMJG 1VFJA 2HRUA 5I3PA 2FLPA 5A8WB 3TX8A 2HNYA 1F9FA 4P6QA 1SJQA 3G82B 1OWXA 2MTLA 4DV0F 1CJVB 2W4DA 4IFYA 1RSCA 5DDPC 1WEZA 3ICLA 2PC6A 1H73A 4YQWA 2DISA 1RHJB 4CI0B 1RT7A 3MR3A 3PCOB 4QW8A 2KM8C 5DM6Q 1B70B 2AYBA 4WFNQ 4FF3A 1PO6A 1XEZA 2VG7A 1FK9A 4DV5F 4FDFA 1JWWA 1O51A 4FYVB 4DQRA 4DSEA 2Y3YA 2BUNA 4QWCA 1UJ6A 5I4MA 1KDNA 2HMIB 4DV6J 2W4PA 2ZH5A 4B02A 3LTOA 1FE4A 2UP1A 5MLCV 2PE8A 4KGMA 4ZJOA 1NCLA 4B9LA 2HFOA 3CMAS 4USMA 4KGXB 3Q22A 3R5DA 3DU5A 3MAHA 4M5DB 3MECB 4RZRA 3GV5B 1NDPA 4UQTA 1RAOA 4X4RA 2VOPA 2E9RX 2IPOB 4LFBJ 2YNGB 1RWPB 1L3SA 1QVFR 1MMLA 4HHUA 1T9UA 1U2CA 1GMVA 2Y1JA 4C0HA 3AFGA 2YNFB 1MMNA 4H4OA 2XI3A 3A1YG 1N8RT 2QTWA 5BR8J 2ZH6A 2XHWA 2R7RA 2DIUA 3N28A 2QT7A 3Q23A 1IR0A 3GYGA 1UL3A 5MAOA 1MROB 4UZBA 3BQ0A 3IAS9 3QPIA 2MKJA 2CPJA 4ZLPA 4Y65A 1ZETA 2QO3A 4R25A 2FJDB 1RADB 3IGNA 3KK2A 1SUQB 4CM2A 2XY6A 2RHSB 3CJ8A 4K4WA 3M8WA 4HL9A 1DTTB 4OYMA 1H2VZ 2DRDA 5FLXU 5JJBA 1RAHB 4LF6F 2U1AA 1N0VC 1VQ8S 4PR6A 5IQ6A 4I4BA 1F5BA 2HNZB 3L7PA 3K5PA 3OUYB 4YY3J 4B3OA 4C11B 3DLKA 2F8MA 2HFUA 2CQ3A 1S10A 1NK0A 3FC9A 3VQSA 4Q5VA 1RP5A 2VPYB 4OX6A 1SJ1A 3W5YA 1AT1B 2OKQA 3OD2A 3HT3A 4MTPA 2FVPA 3EWGA 3C6UB 4DCOB 4NCAA 1TAUA 2WW4A 5J1NA 3M32B 4WFBQ 2ZH4A 3G2XA 3FBBA 5IWAF 1SVDA 3QFHA 1PYTA 1R43A 2V50A 4X62F 5D4NA 5JXSA 2UV8A 5G0RA 2RF2A 4KRWA 4A8MP 1N36J 3EUNA 3HCXA 2OPRB 3Q8SB 4UW2A 5J2PB 4BWMA 3S7RA 1YGYA 1UCNA 4YB7A 4RNFA 1N5YB 4LSLB 1TMMA 2EG1A 5HBMA 4X4UA 1I3OB 5D78A 5B0DA 4DUZJ 1WG5A 2LU2A 1YJTA 2IFXA 1UKUA 4PEOA 4CLLA 1NLKL 4UY8T 3GONA 2GW8A 5A0YB 4D3HA 2CQIA 1A0OB 4TKTA 3GIIA 4LR7A 3BREA 3BSCA 4EBEA 4OMFG 4HACB 1F6TA 2KVIA 5K8OA 1I94F 4P10A 4ZVEA 2YKOA 5IXUA 4IH5A 4QZVB 1JLEA 3W5XA 3FUYA 4Q43A 2DXEA 3ILJA 5GMKa 4M95A 5DO2A 2HGLA 4DV2J 3E2EA 1T0TV 1RT2A 4NLPA 1VK8A 2W9AA 5LT5A 2YNIB 2CQGA 2XLKA 4KFBA 1XQIA 1RHRB 4JV2A 1HYSA 3N4WA 2BABA 2FLNA 3PFEA 3G6XA 2CDQA 2NYIA 3RRGA 2HRYA 1VISA 5D3GA 4QCLA 4AXIA 4RNNA 1B0TA 2RQMA 3IM9A 2QLWA 2N7CA 4WP8A 3AT1B 3HI9A 4XPEA 1KTVA 4DX5A 3BB5A 2I38A 2DO0A 5T41A 1JLCB 5KFYA 4CCHA 2FD2A 2DXDA 1P8GA 1WOOA 5E7OB 1TVRA 3DXSX 2QA2A 3PVXA 4A8YA 4DV4F 4QQBA 4QIGA 1KLMB 4CTAB 4Y2KA 5KT7A 2RDIA 3H90A 1HHSA 2IM0A 2FY1A 3HVRA 4QJVA 2Y0BB 2R8KA 3QSIA 3EDRB 5DG8A 3F44A 3FSYA 2AZ3A 5U47A 2P9CA 2H4YB 3T5LA 3LOUA 4AYBD 2XO7A 4FXWA 8AT1B 2ZH1A 1IKXA 4TYAA 1WEYA 1S0OA 2VG5A 3LALA 5BYRA 4JOUA 1FXDA 4QYZJ 3TO8A 5JVHQ 1HA1A 3I5AA 2E5LJ 2YPYA 4CT8A 1SV5B 4ANCA 4ZK7M 2UXDF 2HHXA 4ELTA 4NLRA 6FDRA 3PKYA 4ZP7A 1EZZB 1O8BA 2V67A 3I4HX 1KQFB 2MKIA 4H4MB 2L9NA 1F3VA 4ZPWR 1TKDA 3W7BA 2H5EA 2J76E 1S6OA 3MEKA 1NO8A 5KFHA 1S9GB 4QWDA 4YB5A 5H9EK 3T1HJ 1PIEA 1N5QA 1UTAA 4E2FB 1M5VC 3SQOP 4FPRA 3EMTA 4GRSA 2VPZB 1B0VA 1AXQA 1G6BA 4NI2A 4P73A 4PZVA 3RBXA 4DU8A 4X64J 1S6PB 2MQ8A 4OYZA 2X1AA 1QVGR 3DLEB 3TA2A 1RDRA 4QR0A 1X0FA 1GXUA 2HVEA 1W2BR 4UUXA 3OFGA 2ZE2A 2N4DA 5DG7A 2DB1A 2OMLA 2AJ0A 4NRUA 4ZS6A 1JXLA 5HQLA 2FHOB 2IRYA 1S1VB 4V19X 1VOMA 5KFKA 3H2LA 1L3UA 2XLIA 1F3FA 4ILMA 1SIWB 2JHEA 1W7WA 1XR6A 2YWWA 1VGYA 1JLAB 3UN2A 2P6TA 2A3JA 3NBPB 1H7WA 3CJTA 2QJ3A 1C0UB 4F3QA 3UN5A 4RBUA 2XS5A 1RYRA 2XMJA 2ZFHA 1S1TB 4DV1J 1S7HA 1C1CA 1UEKA 3HP6A 2LXUA 1N5VA 2BKOA 3B6BA 4Y34A 3DOMB 3SSSA 4FF1A 2RH3A 3R7NB 3R5BA 4JV5J 3RB4A 4B3MF 4M5JA 5AJ3F 2OFGX 1Q53A 2J8AA 5AXNA 3GV7B 2ZNYA 3W8PA 1CJUB 4DF4A 2QA4S 1J27A 3MURP 1U1MA 4L74A 1VRUA 3PXGa 3CCWA 2ASDA 1BQXA 4OYAA 2D3UA 3FZ2A 1YBTA 3GIRA 1W26A 1DQ9A 4G3IA 4B9UA 3EXYA 1TUGB 1DARA 1RK8A 4ES1A 3MM6B 1WD6A 4RBTA 1N32F 4ECZA 3E51A 2ABYA 3FCWA 1YITS 1Z4UA 3V6JA 3BKTA 1YLXA 3FBCA 1QUVA 2BQRA 1P9YA 4OI6A 4Y2IA 4E8UA 2IA6A 3ZFVA 1N6QA 3HSJA 3GIMA 4KV8B 1QAJA 1Q7LB 3JSMA 2BACA 2VV5A 3W1YC 1U26A 4DOZA 3R6LB 4PXBA 4R0EA 3US5A 2F9DA 1I6JA 4DR5F 3MEGB 2RT3A 2DY1A 1TL3A 3CE8A 4LREA 2LA6A 4OZ5A 3MFHA 1T03B 2LECA 1QLNA 3OTOF 1S0NA 1R0AB 3NRBA 1QE1A 3WX4A 2C2RA 5D0HA 2RQKA 2JEJA 1YJWS 3ISND 3Q86A 1Q7YT 4EMDA 4EUVA 4P52A 1QM9A 4H4KA 1S79A 4WP9A 3KK3A 1HNWF 1NHKL 4RW6A 4I2QA 4LFCF 3KLEB 4WK3A 2MKCA 2J0QD 3PM9A 3H5UA 2I5JA 5L1LA 3R7BB 3AAWB 1VRTB 3H7HB 1RWXB 3K8WA 4Y00A 3ZO7A 3BGLA 3ULHA 3DXBA 2WK4A 3UVJB 1QJHA 3TYTA 1RXOB 1HR0J 5ETOA 1JKHA 1RTIB 2VU5A 4J9NA 3DKDA 2G2OA 5KFZA 2QG9B 1R8AA 4KKOB 4PPDA 3FFIB 1CQMA 2A1BA 3BGOP 1QAXA 3PV8A 1UZHA 5KT6A 4ZVGA 1WC6A 4R5PA 2EK6A 4DV7F 1GAOA 1SL2A 1HBNA 2YPZA 3BBFA 2FZKB 2CQCA 5KFNA 1LWCA 3HD1A 4YS2A 2W9BB 1RCOB 4U7CA 2CG8A 1XIQA 1GH8A 1Z1ZA 3IRXA 3DGPB 3MM5B 4LMZA 4NA1A 3UDVA 4OZ0A 2JSXA 3MR2A 1TMJA 2NZ4A 4ZVFA 1YG0A 2YWKA 2I1RA 2HHVA 1WTFA 3Q8YA 4UOFA 5CYMB 2GGPA 1YWXA 4WYWA 1B3TA 5CH7B 3ONQA 1S9FA 3Q8VA 5HP1B 1PJ7A 2O3DA 5KG1A 2LP4A 2NQPA 1E6YB 3MM7A 3KNGA 3AA8A 2F9JA 4JB8B 4F04B 1IM4A 1FKOA 4HDHA 2R8IA 3SV3A 1NB7A 2HWTA 2AYGA 5CYQB 1XMQF 1BLUA 2VBWA 3BN7A 2GVZB 3OJSA 3TP2A 1WOPA 2XNQA 4DI6A 3A3OB 2RSQA 2F63A 3AQPA 1R0BG 4IFVB 3BGFA 1YIJS 3CC4S 5CZVA 5A6WA 5EWEA 1I5OB 1C4AA 4CWBA 2UUWA 3CMES 3ITHA 4C8MA 3QIPB 4G1QB 3GR1A 5H1SV 7FD1A 2YWEA 2H65B 4DHVA 5KG2A 1DQ8A 1RHKB 4DQQA 2HS4A 1T3NA 1K8AT 1S12A 2VKZG 3IWXA 3EPGA 1I94J 2Y1IA 5J2QB 4A8QA 5A8RA 2OPSB 2R7VA 3MR6A 2Z0GA 2W7OA 1NK4A 1RT3B 4NXMJ 4OV1A 1RJJA 4O3NA 2WOMB 4ERDA 2HVZA 2HYIB 2E7WA 2XYPB 3D66A 1XR7A 5H9FJ 1NDLA 2MZJA 1EQMA 2F8HA 2NUHA 4DQIA 3TW0A 3TVKA 3VGSA 2ZVIA 2VC0A 3ZZPA 2CWKA 4YOEA 3HLUA 1NJZA 2A2DA 3Q0AA 4N47A 4J9SA 2NXEA 1EP4A 3PW5A 3ZNUA 1VQ5S 3C16B 2V4QA 1XMOJ 3IN5A 2DCUB 3VZIA 2ACMA 3G6ES 4ELVA 4DV4J 2NXUA 4PWDB 4WE1B 2A10A 3BO4A 5ADZA 2R7WA 3HHLB 3AD7C 3NCRA 4ENOA 7AT1B 5L46A 3FSIA 2DHSA 2K2PA 3AODA 4M5KA 4NXNJ 4HLBA 5HLFB 2IJFA 3LWLA 2P5VA 4B3SJ 4I67A 1NRKA 4M5DA 2F4VF 3KK1A 3EZOA 2MB0B 5KFAA 4FP9A 1NH7A 3EXCX 4QR2A 2VOOA 1X8DA 1BD6A 1E6VB 4IDKA 1VCTA 2IIHA 3H4DA 3MMCB 4DFKA 1AUSL 4LF4F 5KT5A 2HWIA 3CDBA 5AXKA 2YNFA 1ZZFA 2Z2MA 2LKZA 3D4JA 2G1HA 2HFVA 2L9WA 1HFEL 4ID5B 4UOGA 3O5TB 3KHRA 4OYBA 2BBEA 2HFNA 2JVRA 2OH2A 2V8DA 1WSVA 1TL4A 1MROA 1VHFA 2VIHA 1SKWA 1VQ4S 3LWMA 2CPEA 5B08A 1ZOTA 3VWSA 1T9VA 2V34A 3DC2A 4ED2A 2JVOA 4E0DA 3NGSA 1H3DA 2BJ3A 1B7YB 3DRYA 4X4VA 1REVB 2PI4A 4ICLA 1VK3A 1XNQJ 4WFZA 3N6NA 4MK8A 3CCZA 4KC5A 3NGRA 2VFRA 3ENVA 3MD1A 2EFVA 4EGLA 2F5GA 3ADAC 4A46A 4IQMA 2PMHA 2HEKA 3UW1A 3H20A 3KJVB 3DRPA 2UVUA 3LGHA 3M2UA 3RB6A 4KHRA 3O6QA 1QY7A 1Q5YA 4EYIB 2W25A 1HNVA 4B9TA 5EX0A 2BQ3A 4NL5A 5A6PA 2BEFA 2HWHA 4O44A 3JSBA 2HVHA 3V81B 3BSAA 3X1LB 1X60A 1UW4A 2PT0A 4O4RA 1AZSA 2ZBIA 1HQEB 3CNQP 2ZBQA 3ILLA 5J2PA 1G3OA 4OLOA 4DL0C 2AV5A 3EM1A 4RUAA 4OX8A 5DLGA 2M52A 5E5NA 2QYCA 1CSJA 2MQLA 2XYHB 4B3MJ 2DNGA 5AJ3J 1N33F 4JI1J 1KFDA 4IH6A 4TY8B 4RW4B 2PSZA 1FFSB 3UNGC 2ZH3A 2LQ8A 1HI0P 4YMEA 2KG0A 4CZCA 5A0YA 4LBPA 1J5EJ 2XG8A 2NSBA 3R97A 2QMXA 3W8GA 3GIJA 1RWUA 2ZKTA 2WB4A 4I0WA 5J1EA 1N54B 4MJKA 3PDNA 5B0BA 3AD8C 4DLEA 1G7CB 5E3CA 3RZAA 1IR2A 2J6TA 3CCMS 2PEHA 4CH7A 4WXOA 4EFAC 2GJFA 2IVFB 1A9NB 2V0NA 1RLDA 3I6PA 2AJ1A 3ZZZA 4G65A 2GJ2A 3LP2A 4K4YA 1N4LA 2IDEA 5B0FA 1K73T 1MWQA 2YNIA 2H9ZA 4DPXA 2V94A 2HLTA 1JLBA 2MQNA 2QLFB 4CLUA 1R8PA 2K1RB 3M2VB 3NNCA 2AJ4A 3I5CA 1U6ZA 4RNOA 1MU2A 2AU0A 1FD2A 1NH8A 3TZWA 4N8NA 2DEJA 2ZOFA 2RILA 1F9HA 3PG9A 1OQ3A 1JLCA 2J0XA 1MW7A 1FJGF 4QIWD 3HXMA 5HMXA 5GAGU 3RW6A 2W1BA 2BV3A 1C0TB 4O3QA 1IXKA 4F0HA 4ECWA 2VD3A 3DLLQ 3HULA 2ZZNA 2ZUAA 5KFCA 1RBLA 1AYEA 4OZJA 4OV6A 1ZA1B 3BO2A 3T1YF 2WBMA 1HNWJ 1T05B 2HURA 4ZVRB 1KS2A 3DOLA 4F26A 3M6WA 1WHYA 1X9WA 3N6LA 3TAMA 4O0IA 1RABB 1UVIA 4DL5A 1TKTB 4OI2A 2AEFA 1KSPA 2OEJA 1LWEB 2L08A 3CC2S 4USJC 4A8KA 2AD9A 3PEJA 5J2MB 2DGQA 1SV5A 1UEUA 2NZCA 2MDAA 3OR1A 3U1NA 3QGPA 2LQBA 1GXLA 2DGXA 2GA7A 1Y9OA 4NA3A 2UV8G 1KQKA 3ZXWA 2CQHA 2DD8S 3WBZA 5F3ZA 2Q6CA 2ZD1A 3UI3A 3M1VA 3OLAA 4DV7J 1YRXA 3FCHA 4EU0A 1S9GA 3I4PA 2M7SA 2XMKA 3CW2C 2JJ4D 2FPHX 1IVZA 3M8PB 1XK8A 2P9EA 2LMIA 3GFHA 1ZBTA 1PC5A 4PCQA 1FX2A 4PWUA 5LXRA 2PFFB 2E7XA 4IQXA 1R8CA 1BQNB 3FEZA 1RKIA 3FDSA 3DLEA 2HG4A 4Z7CA 5I3UA 4UY85 3V4MA 2YWFA 4WTYA 2FJBB 4Q44A 1URRA 5F8NA 3VF0B 5IV3A 2KVQE 3SSQA 3PX6A 1NPRA 5A76A 6FD1A 3POTA 4GO7X 4NMLA 4LQ3A 2KT2A 2R7QA 4F4WA 1ZM3A 5GAHU 3MR5A 1N34J 2VZ9A 4LSNB 2HBQB 1V3ZA 1JXEA 4OZLA 1NZ8A 2R7UA 3OR2A 3CJQA 3FCVA 5BJRA 1FDAA 3E01B 4OHVA 4RWWA 5KFFA 1SL0A 1S1TA 1EJ7L 1S49A 1OY9A 2ALYB 1LOUA 3ENQA 2XO6A 3R5GA 4DR7J 3DLGB 4LRAA 5ETLA 2KH9A 2QA4G 1NUEA 3O1LA 3DOMA 2J7UA 2BE9B 1HNXF 3QLHB 2N4CA 1IWAA 4MK7A 1RT6A 2R2RA 1JB0C 3BDEA 4PABA 2DEIA 1RTDB 5LMUF 1NU4A 3R5AA 5AXLA 2P9GA 4P2XA 4DFPA 4HKQA 4FYWB 2IDLA 1FWKA 3AJ2A 4ZITA 1HPZB 5LMNF 4TY9A 5K8NA 1SQEA 3JTOA 2EFQA 2RKIB 2RRNA 1TK8A 1M1KT 1HWKA 5I42B 2EXUA 1C1BB 2RHQB
chains in the Genus database with same CATH topology
3OQ2A 3C3LA 2XC9A 2R9LA 2DR9A 3WC2A 2YNGB 1REVA 1SH2A 2K3KA 2DJWA 5IZHA 5KFEA 1L3SA 4C8OA 2B3TB 1QVFR 1HL6A 1MMLA 1FESA 2HHPA 2OTJS 3TAPA 3DRXA 4KB7A 1NHVA 5F3TA 2Y1JA 4LFAF 3GFZA 4C0HA 2W9CB 3GIKA 1J5EF 5KOWA 2YNFB 2BE2A 2DNRA 1MMNA 2CFXA 4CO3A 4H4OA 3NAIA 1VQLS 4PG5A 1HMVB 1N52B 1RT1B 2DR8A 1VRUB 2XI3A 4O3SA 3A1YG 4ECXA 2OMOA 1HW8A 1FVSA 1N8RT 2YKAA 2MGZB 3HHLC 4J9LA 2ZH6A 4ZCIA 2CQ2A 4X2BA 4N5SA 2XHWA 4ES3A 4OJ3A 4B08A 2J9EA 5HI7A 2J0WA 4C8YA 2AJFE 1DZ5A 2R7RA 2DIUA 2W8LA 2YWGA 3FEYB 2MPUA 5KFXA 3VQTA 4X4TA 3RBEA 3N28A 2QT7A 4FBTA 4MIBA 1KONA 1CLFA 3Q23A 1IR0A 1FJ7A 2YKPA 1SBRA 4C98A 3KJVA 3VALA 2B0GA 3UPFA 1UL3A 1TKZB 4CO1A 2NREA 1JJHA 4JI8F 5MAOA 1MROB 5K8PA 3BQ0A 4NYOA 4WF9Q 1R3NA 2OPQA 3QWUA 5KFLA 1EETB 3IAS9 2ZDPA 2Q79A 2MKJA 2CPJA 3QPIA 4OHZA 4ZLPA 1XNRF 3SEOA 4Y65A 3GV8B 2JFDA 4ECTA 1ZETA 4Q0BB 4GMKA 4Y2MA 2QO3A 4DJBA 3I0RB 3K0JA 4DL7A 4R25A 2FJDB 1TL5A 3IGNA 3KK2A 4BCAA 3VAIA 1SUQB 3VAHA 5IS2A 3CCVS 1SI9A 5C24B 3ZZTA 2XY6A 3V81A 2ZOGA 4K4WA 4ZPVR 1XMBA 2KDOA 2B9WA 2E1CA 2OAUA 1DTTB 4HL9A 4LF5F 1Q16B 2IC3B 1H2VZ 3RR8A 1S1WB 3ZZRA 1Y4ZB 5JJBA 4B3RF 3H2VE 3UD4P 4IR1A 4LF6F 2U1AA 4FZVA 1N0VC 1O0PA 1VQ8S 2KO1A 3UWTA 1HQEA 3D28A 2V8GA 4PR6A 2FTRA 5IQ6A 4I4BA 1F5BA 2HNZB 3L7PA 3K5PA 1N6QB 3OUYB 2X1BA 2HAIA 4DL6A 4NLXA 1Y7PA 3PR5B 1S72S 4IOAQ 2BQUA 4WFAQ 4B3OA 4GKKF 5K8MA 4I6YA 3JSMB 4C11B 3KG1A 3N6MA 4EZ9A 4IG3B 4ZPTR 4ETZA 1UFWA 3DLKA 5DDOC 2M8DB 2F8MA 3L3CA 4N56A 3I0SB 2CQ3A 4P7VA 1S10A 1NK0A 4N41A 3MPWA 2KHDA 2F7VA 1NZAA 2FVSA 3B4MA 3VQSA 1FTCA 1Q8BA 5KOXA 5IT9Y 4Q5VA 1RP5A 3DOKB 1S9EA 5J2NA 4TY8A 1TUVA 2VPYB 4IH7A 4OX6A 2DH9A 1SJ1A 1RT4A 2OKQA 4CH1A 1HWIA 1VBXA 1S6QB 4NLSA 2AGOA 2DK2A 2GQ2A 3HT3A 4MTPA 2FVPA 3BDPA 2MQMA 3C6UB 3D0GE 4NLVA 5J1NA 1L3VA 4NCAA 1TAUA 2JDJA 3M32B 2KXHA 3O2IA 4RW8B 2PN6A 5L1KA 3DMJA 2E29A 4WFBQ 3GWCA 2ZH4A 2MHNA 3EGZA 5F0UA 5DDRC 1U45A 2NS1B 3SDEB 5IWAF 2CJAA 1YTYA 1R43A 4X62F 5DQHA 3CDEA 1GXTA 5D4NA 5JXSA 2UV8A 3UE2A 2WHOA 4Y3CA 5G0RA 1PC4A 4WYLA 2RF2A 4I6WA 2QSFA 4KRWA 2MKHA 4XK8C 4A8MP 4N8OA 3EUNA 2CG4A 3CCLS 3KMQA 1Y5LB 3BM7A 3DM2B 2OPRB 2RS8A 2CZVC 3IWLA 3Q8SB 1QAIA 4UW2A 5J2PB 3G8QA 4BWMA 3S7RA 4YDDB 4JI5F 1F5CA 3KLGA 3N0VA 4KSEB 4C0BA 3SSRA 2JFKA 2YKNA 2W8KA 5KG0A 3K57A 1BQMB 1O5JA 1YGYA 4K4UA 2LQ9A 5E33A 1U6FA 2KKHA 3GG1A 4YB7A 1D8YA 1V3SA 1CC8A 2QMWA 3OTDA 1S97A 4RNFA 1TKXA 1N5YB 4FN5A 4AUKA 3KK3B 1P27B 4LSLB 5HL7Q 3FNNA 3R5CA 3W2WB 4NOHA 1TL1B 4RW6B 1F2GA 4DS5A 4I2QB 1SH0A 2EG1A 2D74B 5A2QY 3BR8A 5HBMA 4X4UA 2B6AA 1FRLA 5D78A 5B0DA 2QSWA 3AB4B 2I5JB 3HJFA 3T5KA 3R1HA 1U09A 1WG5A 2LU2A 1YJTA 2IFXA 3THTA 3VAMA 1UKUA 1OIAA 4URSA 3FJ2A 2JH3A 5L9NA 4UY8T 2E44A 2EC0A 2VKRA 2APOA 1W2IA 3OXLA 4OX7A 3L09A 4ZCKA 1KNZA 2AJQA 3SCKE 4PUOA 1FNXH 2C2EA 2GW8A 3AA9A 4E98A 5A0YB 4D3HA 2K1RA 2CQIA 4FBUA 3M2VA 4TKTA 3GIIA 1NJWA 1VQYA 1G2EA 4RUHA 3LF0A 4F2RA 4X66F 1JKHB 2NPFA 1Z2LA 2M3DA 2RNEA 1Y00A 4NLYA 2W7PA 1J5OB 3MM5A 5DJBA 3BREA 3BSCA 4EBEA 4OMFG 5SUHA 4I2PB 1RTHB 5D8HB 2KVIA 5K8OA 3CB4A 2EI5A 3M9OB 5LL6d 2HHTA 1I94F 4B17A 1N56A 4ZVEA 2YKOA 4OI3A 3IWNC 1Q82T 2RE1A 1LK7A 1ZAVA 4MFBB 2BJDA 5IXUA 1SJ4P 4IH5A 4QZVB 1JLEA 1TZ0A 4QIVA 3T5JA 3GR0A 5KG7A 2E1AA 2GIQA 4KIAA 1IKWB 1WF1A 1WEXA 4Q43A 5B0AA 4R5PB 2E5GA 1B7FA 2KT5A 5GMKa 3G6VA 1NAQA 2RS2A 4M95A 4K4ZA 2HHWA 1XN9A 1LWFA 3ZZUA 5DO2A 1Y0HA 1VQOS 2HGLA 3SV4A 3E2EA 2VBYA 1RT2A 4NLPA 1R7IA 1VK8A 4KO0B 2W9AA 5M2PA 2G13A 1HBNB 1PILA 5L9XA 4Q45A 4LF9F 4Q8FA 2IVMA 2WCXA 5LT5A 4RU2A 1TFYA 2YNIB 3U7JA 2E5IA 1JLGB 3MPVA 1LWCB 1SJFA 2CQGA 1ZZNA 2XLKA 1U8SA 2K7KA 3ZZ0A 4F4YA 3JB9k 4KFBA 3B4DA 1U48A 4JV2A 1HYSA 4QR1A 3N4WA 2BABA 2CPIA 2UUBF 2FLNA 2OPPA 3PFEA 4NLUA 2OLWA 5H9EJ 1WWHA 2CDQA 3G6XA 1L3KA 4HTIA 2C3OA 2NYIA 1UA1A 2U2FA 3MGJA 3IRXB 4GO5X 4MKBA 3JTPA 3RRGA 1FE0A 2R7OA 2HRYA 3OSPA 1T05A 2LQJA 5D3GA 3SI8A 4QCLA 4H4KC 3M30A 4DR6F 4AXIA 5KT2A 4RNNA 1B0TA 2AX1A 2RQMA 4ES2A 2AYMA 2QLWA 2N7CA 1TV6A 4DLGA 4I7FA 3HI9A 2GX8A 4XPEA 4KE5A 1KTVA 2ALZA 3PKMA 1FJCA 4HI1A 1P9QC 1X5OA 3PO4A 5HROB 3BB5A 3FMBA 3EZ5A 2I38A 3CJ5A 4Z2XA 2B51A 4IOBA 2DO0A 1UP1A 2DNHA 1JLCB 1LWEA 5T41A 3CCJS 4R0JA 4IG0A 5KFYA 1KOOA 4KAIA 4NPOA 2ILYA 3CEDA 3CJ2A 3HVWA 4CCHA 4F2SA 2FD2A 5J2MA 5CA5A 4RBVA 1N34F 1P8GA 2XSFA 2B4OA 3M8QA 5E7OB 2GGPB 4ZMMA 5C42A 1TVRA 3IG1A 4DL4A 3EGNA 4I6AA 4M63A 2J7KA 3DXSX 1KN6A 3CDWA 3CDAA 1DBDA 2FLOA 4C8KA 3M05A 2QA2A 3PVXA 4A8YA 4U9RA 4DV4F 2RIJA 3IBWA 4QQBA 1YJNS 1TR0A 4QIGA 1KLMB 4CTAB 4Y2KA 5KT7A 2RDIA 4Q8EA 1HHSA 1UJ4A 2IM0A 1P1TA 2FHJD 2B5JA 3H25A 5LSLA 2FY1A 4UUWA 3HVRA 2KM8C 4QJVA 3MM7B 1WI8A 2CPZA 5KG4A 4G1QA 3QYYA 5GADU 4TQSA 3MF5A 4O3RA 4DR7F 1WELA 1FKOB 2R8KA 1H7XA 5DG8A