2YH1A

Model of human u2af65 tandem rrm1 and rrm2 domains with eight-site uridine binding
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A02
2MQNA 2DNGA 5JVGQ 1K73T 1OPIA 1O0PA 2CPIA 4QU6A 2BZ2A 2LQ5A 2M70A 2KH9A 2JVRA 2FC9A 4IUFA 3P49B 4ZKAA 2EVZA 2CPZA 1WF2A 2DO0A 5CXTA 4ERDA 1H2VZ 3OW2R 3MUVP 2DH7A 3RW7A 1R8PA 2LA6A 4IOCQ 1DBDA 3HI9A 2MKSA 2DHGA 1WHXA 2DGSA 2E5JA 1P27B 2CPEA 1U1OA 1H6KX 2DITA 1AUDA 2XS2A 1VC6A 3ZZYA 2BOPA 2YH0A 4WCEQ 2X1GA 3NMRA 2RT3A 1X4CA 2AYGA 2FHOB 3R1LA 1VQ4S 1WF1A 2F3JA 2DHSA 3G96A 5DDPC 2N7CA 3H2UB 1RK8A 2DNPA 2Q79A 2K8GA 2J76E 2KFYA 2MZTA 2DNLA 2JWNA 3TP2A 5DETA 2MKIA 3TYTA 2LMIA 3J7YU 2CPYA 2ADBA 3G9CA 1HA1A 4QPTA 4W90B 5LSLA 4YB1P 2DNHA 2RU3A 3BO3A 1VBZA 2L9WA 2X1FA 3P5TL 2MQMA 2EK1A 1X0FA 5H1SV 5GAEU 1VQNS 1HD0A 2CQGA 1X5TA 3FEYB 1S72S 3BEGB 1KQSR 1F9FA 3DXBA 1M5PC 1WEZA 5D78A 1N54B 2ZJRQ 3EGNA 1X4EA 2E5IA 2RS2A 1FJ7A 2CPFA 1G2EA 4TU8A 5IFMA 3CMAS 4YUDA 2JVOA 3VALA 3G6ES 4OZ1A 4TLQA 3UWTA 4CQ1A 3U1LA 1VQ7S 1WHWA 3CD6S 3R27A 1U1NA 4C0OC 3NS6A 2KVIA 4W92B 2DNKA 2KG0A 3VAIA 1KOHA 1UFWA 3EX7B 1JJ4A 4Z2XA 2QA4S 1YITS 3NNAA 2XNQA 3PIOQ 1FO1A 1L3KA 4YOEA 4WIIA 1X4BA 3D2WA 3CMES 5ITHA 4Y0FA 2VOPA 2DHAA 2HGMA 1KD1T 2DHXA 4RU2A 3CUNA 1QM9A 1U1KA 4WKRA 4ED5A 2DGOA 3NS5A 1WG5A 5IM0B 1WHYA 2A3JA 1B7FA 1YI2S 4CH1A 2UP1A 1VQOS 2MKJA 3UCUP 5EN1A 1U6FA 2DGQA 4F26A 5IQQA 1K9MT 2DNZA 2ERRA 2VONA 1WG1A 4C7QA 2M2BA 3SXLA 2MZQA 3S7RA 3CCLS 2DISA 3G8TA 4WF9Q 2MZ1A 4WFAQ 1X4DA 2XSFA 1WG4A 4QQBA 5CA5A 2KYXA 2J8AA 3CCVS 2MKKA 1H2UX 2ADCA 2MQLA 1VBXA 1JMTA 2M8DB 2N3LA 3CCQS 3R1HA 2FPHX 1Q86T 2M88A 1YHQS 3VAGA 1U1RA 2MXYA 4U67Q 4QU7A 4Y00A 1FXLA 1U1QA 2MZJA 1VQ9S 2CQIA 1URNA 3S8SA 3BO4A 1YIJS 2CQBA 1A7GE 1WELA 2CQDA 2MHNA 2VOOA 4V19X 4OZ0A 3JB9k 5GVQA 1QVFR 2MGZB 2KXFA 2OTLS 4TU7A 2KRRA 2MZRA 3EGZA 1WI6A 1FJCA 3HHNB 1M1KT 2E5HA 2KM8C 2EK6A 1FHTA 5GADU 3G8SA 1RKJA 2MQOA 2N82B 2DGWA 1ZH5A 2XS5A 2QEXS 2AYMA 5JVHQ 5HO4A 2MQPA 2LXIA 2CQ3A 3P6YC 2LKZA 4PKDB 3MXHP 5LXRA 2YH1A 4C4WA 1UP1A 3NNCA 1Q7YT 4UQTA 1D8ZA 2CQHA 3N9UC 4FXVA 2LCWA 2D9OA 4WFBQ 4A8XA 2KI2A 2KXHA 2E5GA 3MD1A 2FC8A 2GHPA 1SJ4P 3UD4P 4J5OA 2DIUA 2X1BA 2OSRA 2G0CA 1YTYA 5GAHU 1OIAA 2I38A 4TU9A 3Q2SC 1PGZA 1YJWS 2RS8A 2CQ0A 3MUTP 1U6BA 1YWXA 2M8HA 2MYFA 1N52B 1X5SA 3VAJA 1ZZNA 2MJNA 2KG1A 2F9DA 5IM0A 3G71S 1YJNS 2D3OR 2YWKA 5BJRA 5LJ3Y 1K8AT 2J0SD 1XN9A 1VQ5S 4P6QA 2CPJA 2SXLA 3B4MA 2PEHA 3CCES 1VQKS 1H2TZ 1X4GA 2GO9A 1VBYA 3ZZZA 1A9NB 2DNOA 1SJRA 3UCGA 3J7ZT 5MLCV 2MY8A 5LSOA 2M9KA 3CPWR 2LEAA 3CCSS 1X5OA 2OSQA 2DGUA 2DNRA 1WI8A 1D9AA 2KT5A 2OJ3A 5DM6Q 1VQLS 2NZ4A 3CC4S 3CCUS 2LXUA 1SJ3P 2J0QD 2YTCA 3S6EA 1WF0A 2XB2D 1YJ9S 1NJIT 1UW4A 2CJKA 1R8HA 1P1TA 2O3DA 2QFJA 1S79A 2DNNA 2JRSA 2KRBA 1VC5A 1ZZFA 2DIVA 2D9PA 2X1AA 3BS9A 1JJ2R 1VQ6S 2XS7A 1NO8A 2WBRA 2DK2A 3CCRS 1UAWA 3UCZP 2N3OA 2VODA 4CH0S 4CIOA 3LPYA 3CC2S 1DHMA 3PIPQ 3MUMP 1U1LA 4M5DB 2ZJQQ 2DGXA 1VQ8S 2CPHA 5DDOC 2HGNA 3SDEB 1DZ5A 3I56S 3U1MA 2G4BA 1FJEB 2CQPA 5LXYA 2DNQA 2CQ4A 2KHCA 2MMYA 2DGVA 2I2YA 3RW6A 1X5PA 5FJ4A 1SJQA 2MPUA 2DH8A 1WHVA 3US5A 3VAHA 1FT8A 2V94A 3UE2A 2MSTA 3IRWP 3BO2A 1X4HA 2DH9A 3CXCR 2HVZA 4EGLA 2M52A 2LECA 3B4DA 2KN4A 1Q81T 2CPXA 1U1MA 5DDRC 2F9JA 1Q82T 1JJHA 1SJFA 2M4MA 1QVGR 3FEXB 1N8RT 2OTJS 2KXNB 2G1DA 2U2FA 3VF0B 2YKAA 1VQMS 2MSSA 1FNXH 4BS2A 1M5VC 3THPA 3L3CA 1WEXA 3IWNC 3CCMS 2AYEA 3V4MA 1X4AA 2LYVA 1KC8T 1KOOA 4IOAQ 3NNHA 2RRAA 2L41A 2MQQA 3VAKA 1WEYA 1IQTA 3G4SS 5LJ5Y 1X4FA 2E44A 1NU4A 1M5KC 3MD3A 1SXLA 2LEBA 5CYJA 3DLLQ 3CTRA 2KM8B 5DDQC 4FXWA 3H2VE 1PO6A 2KU7A 2K3KA 2L08A 3LQVA 1VQPS 1OO0B 2HYIB 3CC7S 3K0JA 1HD1A 5DM7Q 4IO9Q 1DRZA 3MDFA 1VC0A 3Q2TC 2NLWA 1WWHA 2CQCA 3UD3P 2MKHA 4F02A 2CPDA 1N88A 2MJUA 2DB1A 2DO4A 2ZJPQ 3ULHA 2RVJA 1U2FA 2DNYA 4LJMA 3I55S 3P3DA 2M7SA 2CQ2A 1CVJA 2MZSA 4LMZA 2DNMA 3CF5Q 2RQCA 4WFNQ 3MURP 1BY9A 3MOJB 4F25A 5D77A 2MY7A 2RQ4A 5GAGU 3S01A 2B0GA 3TO8A 2MB0B 1W2BR 2AYBA 5GMKa 2FY1A 4UY8T 4PRFA 2PE8A 3VAMA 2DGTA 1WTBA 2RUGA 2U1AA 1OWXA 1HL6A 2MGZA 2HGLA 3SDEA 1M5OC 3VAFA 2RRBA 2OIHA 3SMZA 2MKCA 1U1PA 2M0GB 2AD9A 2CQ1A 2RNEA 2HZCA 3CULA 2LA4A 2XNRA 3CCJS 4PR6A 1M90T 3THTA 4LIRA 2JX2A 5HL7Q 3MI7X
chains in the Genus database with same CATH superfamily
2RF2B 1RT2A 2OO4A 2Z0GA 5I3UB 2CPIA 4B9MA 2BZ2A 4USKA 2KH9A 2JVRA 2FC9A 4IUFA 4Y28C 2W9CB 2J9DE 4ZKAA 4DR5J 3QJPA 1S99A 1NZ8A 1WF2A 4QWEA 4P2FA 2DO0A 2VA2A 2VFTA 1H2VZ 2EBEA 3HZEA 3V2UC 4J9MA 4ED8A 4USMA 1SQEA 1FWKA 4O4RA 2QT7A 9ATCB 2EFVA 2DH7A 4JV2A 4NYPA 1KLMA 5D4PA 2HVIA 5T41A 1PYTA 4L76A 4CO0A 1V3RA 4XO0A 4Q8EA 2ZBQA 4IFVA 1DFDA 5C25A 3TQ1A 2DHGA 4USJC 3MM5B 1XMQF 1WHXA 1F9EB 1P8GA 2W7PA 1CC7A 1RKIA 4B3TF 1RHRB 3KKFA 4FXDA 3OTDA 5FIIA 4X4VA 2RDDA 4L75A 4N76A 3AFGA 3GIKA 4EFAC 5EX3A 2OEJA 3TA1A 2IJNA 3NXZA 3C19A 5KFQA 1VC6A 1HARA 3M8ZA 4WCEQ 4DHVA 4EO6A 1R8CA 3EVOA 5KTQA 5KFLA 4LSLB 2MLYA 1J27A 2XCPA 2ZHOA 4M5MA 4KE5A 4DSFA 2AQ4A 3IRXA 3D1HA 4ED5A 3MEEB 2F3JA 2BR0A 4F8RA 1U02A 1UZHA 2DHSA 2B9YA 3RB6A 4FP9A 3OR1B 1LW2B 4R0EA 2Q79A 5IWAJ 4LF7J 2VQFF 3MR3A 3DM2B 2KFYA 1U4BA 4Q0BA 1HIYA 1LV5A 2DNLA 5A6PA 3TP2A 1F6TA 5DQGA 4PAAA 1UW9A 1ZAVA 2AJ0A 1SV5A 3T6JA 2VD3A 3W1YC 5A6WA 3TYTA 5LT5A 4X64J 4DSKA 2YXLA 3J7YU 2NS1B 2KZMA 2HWTA 4F50A 1FX2A 4DR2F 3EM1A 1HBNB 1O6XA 2ZE2A 3IFEA 2XEXA 4ITSA 4OX7A 1JLEB 3DHWC 2VJVA 4CM0A 4DCJB 4ZVGA 3DFEA 1VBZA 4NLGA 1F60B 1SCJB 1N0VC 3KUEA 2ZUAA 2ZNYA 1GXUA 3Q8YA 2LVWA 2HK2A 3GJRB 4BWJA 3QFHA 3MCNA 3FEYB 2VF3A 1S72S 1KQSR 1M5PC 1IKWA 3MMBB 1WEZA 4LRDA 3A8JA 5KFYA 5DQIA 3FSXA 2ZJRQ 2E5IA 4TQSA 3E3XA 3G86A 2OH2A 3PO4A 4KJIA 3OBIA 5IT9Y 3KHGA 3PY8A 1AXQA 1GXTA 2DKOB 4HT7A 5IFMA 3CMAS 4JI5J 1ITPA 4NZ0A 1RDRA 4C6AA 4OYBA 3CO0P 1RWUA 5ETMA 3BGRA 3WC0A 1Q0NA 1JLFB 1FEHA 4JBCA 4F0MA 3FCHA 2VH7A 3M2VB 4TLQA 4WJBA 1TKXB 1VQ7S 1WHWA 3CD6S 4P7TA 4RUBA 1U1NA 1S1WA 1NJXA 3I32A 4DG1B 2AU0A 4ID5A 2VG5B 1TK5A 5EGYA 3D0HE 5K8NA 1FRIA 3VR1A 2HWIA 2KVQE 3VAIA 4Z2XA 2J0QD 2HNZA 3K59A 2QA4S 2JEFA 2ILZA 3PIOQ 4CCHA 3DLEB 1KRPA 2JEGA 2AX0A 4R8UB 4DV6F 2HFVA 4PUOA 1C1CB 1UJ4A 3HD2A 1X4BA 3D6TB 5HMWA 3K57A 1TU0B 2P9EA 3CMES 1E6YA 4Y0FA 1X9WA 3OTOJ 4Q0BB 1BC6A 2DHAA 2QLWA 2R7OA 3D6MB 4C11A 3CUNA 1Q1KA 1Q95G 3IAM9 3QFWA 4KPCA 4NLTA 3PRBA 2D3ZA 4J37A 4EYHB 2J9DA 1U48A 4HHHA 2DXEA 2N7YA 5F8GA 2COLA 3KG4A 5KFNA 1F3FA 1WHYA 2BKPA 3FNNA 4TYAA 2RILA 2WONB 1V5IB 1B7FA 3C16B 1RABB 4CH1A 3JS9A 2AGPA 2UP1A 4ZCKA 3KLIA 2FYXA 2YX7A 4F26A 1UEVA 2G13A 2KDOA 1VGYA 2PSZA 5IQQA 4YDXA 4A8OA 5HQMA 3NL0A 3MAAB 1S1TB 3OFHA 1IKVB 1VRUA 4HI2A 3T1AA 4EWTA 5KT7A 3DDNA 4WP8A 2G0JA 1HNVA 2M5YA 3CCLS 4UUWA 4CLYA 5M2RA 2B9EA 4YR0A 3FSIA 1BMQB 2CWXA 2F4VJ 3G8TA 1OQ6A 4O0IA 2OAUA 2YBVA 4WF9Q 4RW7A 1XMQJ 1AZSA 4WFAQ 2ZH3A 1X4DA 1S7IA 1XEZA 2EFPA 4KO0B 2HBQB 4K0KF 1SBRA 4OYOA 4ETXA 3CCVS 4DV5F 4RNOA 4ED7A 3AJ1A 3FJ2A 2MKKA 1H2UX 4LSLA 3E2EA 3LW5C 2MQLA 1JLAB 4AE5A 3AODA 1JMTA 4JV1A 4ZIWA 1Q86T 3I5AA 4NL5A 2FLOA 3NGKA 1FX4A 4ZVQB 3HSZA 1YKWA 3LP2A 3HSGA 3W62A 4WYWA 1U1RA 2LU2A 3P5BP 2J9EA 3C6UA 3GFYA 3W61A 2Z2ZA 5IWAF 4U67Q 3MR5A 3OPKA 4KIAA 3NOGA 4X2BA 3GCXP 1MLAA 2BJ3A 4MKBA 4F3QA 4DF8A 1ZA2B 1VQ9S 2IBOA 4P2XA 2CQIA 2GVZB 4X64F 1KTQA 1RACB 1TMMA 1WC3A 2KO1A 4O4GB 4F4YA 5IXUA 4JI4J 4LF9F 1URNA 2YY3A 3LAKA 4DWIA 2APOA 5KG1A 1IKXB 1CJVA 1XMBA 1WELA 2C42A 4CTAA 1YIJS 4V19X 2VOOA 1RTIA 2YKNA 3ILOA 4A8WA 3TUIC 1OYDA 4O44B 2KXFA 2OTLS 3RAXA 3AJDA 5K14A 4WP3A 2MZRA 1Y9OA 2XYPB 3V4IA 4PUOB 3SCJE 5KFSA 3QPIA 3ZC4A 3NAHA 1WI6A 5DO2A 3QJJA 4IH5A 4FNHA 1TVRA 5J1EB 2XGPA 3BKUA 4OZLA 2ZKTA 4RNFA 2CJBA 4RUCA 3BB5A 3SCKE 5KFEA 1VQSA 3LA0A 2P9GA 3MTKA 1HBOB 1NEEA 4CLSA 1NHVA 3DDKA 4P71A 1OSCA 1NDCA 3EICA 3EYZA 4DR3J 4JV5J 4LT6A 1RBOB 1RTJA 5KT2A 1DLOB 1RAFB 1HNIB 1IJFB 5LMUF 3TW0A 2ZNZA 3ISNC 4DV1J 5LXRA 2UUBJ 7AT1B 4OZNA 1D8ZA 3DC2A 2IA6A 1CJTB 4OI2A 4FXVA 3CJ8A 2C3UA 4X66J 1WC1A 3T6BA 3TJ8A 2JEJA 3DNCA 4ZLNA 3LTOA 2CJQA 2GGPB 3TX0A 4J5OA 4U9RA 5AXMA 2WCXA 4DOZA 5F8NA 2DIUA 4A8MP 4XPCA 1XIQA 3PYFA 2HHWA 3OTBA 3TUZC 3CWJA 1YTYA 1OS5A 3ISND 4O3RA 2BMBA 2I38A 3CD0A 3H5SA 3ILLA 4TU9A 2GA7A 3LWMA 2RAQA 3MPDA 1KFDA 3NWRA 4J9PA 1EKRA 3Q2SC 1ZPVA 5B0EA 1UPPA 1YJWS 1F2GA 3M6WA 3UO0A 5A8RB 1SC3B 3L7PA 1T3OA 3P8BB 1YWXA 3E51A 4R0JA 4U8YA 1N52B 1X5SA 2XLIA 3Q8PB 1SL0A 2MJNA 4XIUA 3FRZA 3K2YA 4LFBF 4G1PA 2IM3A 4S0MA 3NEKA 2A1BA 3KNAA 3V4IB 2R2RA 1EB0A 2D3OR 4ED2A 3EXCX 5BJRA 2PEBA 3BQ0A 2XQCA 1K8AT 3PKMA 1UEUA 3MM6A 2Y3YA 3D66A 1YGYA 3WX4A 5KFJA 1BUXA 3DLGB 2PEHA 2VU5A 4LSZB 4ZN3A 2DPJA 4MK9A 5KFGA 4HKQA 3D5MA 4Q2LA 1A9NB 2HBYB 3AQPA 2XZWA 4OHVA 5ETRA 3TVKA 3DI6B 3ZFVA 3MR6A 2R2TA 3DRPB 3PG9A 3UCGA 3KUGA 5CZXA 4LBHA 2AJ2A 2GVZA 4WXWA 2BE2B 2ZOMA 5E3RA 5MLCV 2MY8A 2BJ7A 3GONA 5KFDA 1U0HB 4GO5X 2M9KA 2RMLA 1JLCB 4I2PB 3TZZA 3K5OA 2VQEJ 3CCSS 3GCWP 5L1KA 2FZGB 4DV5J 3FSYA 2Y1IA 1F0XA 1WI8A 2KT5A 2JZ5A 4M1KA 2W1BA 2QMUB 4OQJA 4DPXA 1HKAA 2FVCA 2IDEA 4QR1A 5DM6Q 1DTQA 3D9BA 3M8WA 1BHNA 1M0SA 4H4MB 2K7JA 3QJLA 2VPYB 5C25B 2R7WA 3BH6B 1SJ3P 1HHQA 4KC5A 2YTCA 2Z56B 2LQJA 3MCMA 4I2PA 3S6EA 3TJAA 2V8VA 2XB2D 1HMVB 1YJ9S 4YB7A 3J7AN 2EBGA 3Q24A 1MWYA 2CJKA 1R8HA 3LP0B 1LWEA 3BR9A 1P1TA 3WDOA 3NKYA 2EWHA 2F40A 2Q3PA 2QX0A 2AT1B 2Q6BA 4QYRA 4N5SA 4USTA 1S76D 1N32F 2DNNA 2KRBA 2R8IA 4OIXA 5KFBA 4DV7F 2DIVA 3JTPA 1CJVB 4JI1J 5A8KA 3KK2B 4IG3B 1CQMA 2X1AA 1N5SA 4ZPBA 4K50A 4OI4A 3M8SA 4P74A 4C48A 5B0CA 4OI0A 4QIFA 1RBAA 1NNDA 3AB2B 3BREA 2WBRA 2W25A 2JLFA 2ZKUA 4P7VA 3CCRS 1NPRA 1MG7A 2V5HG 3BM7A 3P96A 4DJBA 1TL1A 2CNOB 3FGVA 3I4PA 1YRUA 4CIOA 3GIJA 4ANCA 4CO4A 1DHMA 3QAEA 1EQMA 4TNOA 5ADZA 2WTFA 1HNWF 2Q43A 4YB6A 2GIRA 1AUSL 3GWCA 3M8YA 3GPAA 3TNVA 4Q7AA 3I4HX 2DXFA 1ELOA 2QL7B 4NI2B 5T7LA 1QLNA 4M5DB 2DGXA 1FKOB 1PJ6A 2FZKB 2VICA 4CI0B 3KMSA 4RW8A 5J2MB 2QL5B 4O3PA 4PG4A 2Z4PA 4WE1B 2KHCA 2MMYA 2Q66A 2HHTA 2FHMA 3K5MA 4ED3A 1XR7A 4NLSA 4NYZA 2W4DA 2Y1RI 4EBDA 3GYGA 2DH8A 4LRCA 3EPIA 3US5A 3EXYA 2GIFA 2CKWA 2L9NA 4ZVTB 2YVSA 1RT1B 3UE2A 3GYXB 1HHTP 2HHVA 2QLBB 1YJRA 3NGDA 4L6V3 1FDBA 1H7WA 3V6DB 3BBCA 2ZBCA 2C2EA 3DLKB 2I8EA 4NXNJ 4U6PA 1E6VA 4G1QA 1D0EA 4YP3A 2AX1A 5B09A 1Q16B 3CJ3A 5DDRC 1TK8A 2E9TA 3PVXA 4RBVA 5KG4A 1WACA 4OJHA 2M4MA 3VZIA 3FEXB 2OTJS 1VJWA 2F7VA 3C16A 2KXNB 1Q4RA 4F2RA 1MMNA 2JFDA 3HLUA 1ZA1B 3LH2S 1VQMS 5DJBA 2XYHB 3ICLA 2ZHAA 4B9UA 3UR0A 1YBTA 3DRYA 3DRSB 4ECWA 2C2KB 3POTA 2GAGC 4DV4F 3IWNC 4CTAB 1Y11A 5L1JA 3LP1B 4ZLLA 1DLOA 3F44A 3KG0A 2AYEA 2V69A 5CZVA 2WOMB 1JKHA 3IM8A 3M6VA 3QYYA 2RB7A 3CJQA 4RUHA 1O5JA 2LYVA 3IGVA 9RUBA 3O2IA 1KC8T 2UXCJ 2H48B 2I9SA 3A8EA 2ROPA 3DU6A 1AROP 3H90A 5D6GA 1X9SA 3KK3B 4NCBA 2Z58B 5ETSA 4RNHA 4NASA 3THVA 3VAKA 5U47A 1IQTA 3G4SS 2XMUA 1MNEA 3I9ZA 1SV5B 2E44A 3D28A 3DXSX 4LF8J 2GMJA 2O01C 2JC0A 3D1OA 1LXJA 2MLXA 1VISA 3ZTOA 2LEBA 2L3MA 1XMOJ 1K1QA 4Y2IA 2WSCC 4FXWA 2OELA 1PO6A 2L08A 1CBKA 5EX0A 3VHQA 4HDGA 1HYSB 2HEKA 1UJ5A 1Q79A 1QD1A 2CJYB 4K5SA 4C98A 3KLGA 2HMIA 1JQGA 2HSEB 2LQBA 4MFBA 1DRZA 2AGOA 3MEEA 2RQKA 3DLLQ 1TKZB 2V2QA 2FUG9 3QZ8A 1G6BA 4DFPA 1WWHA 1IKWB 3MMBA 2E9RX 3J7A1 1AZSB 3UDLA 4CLLA 2VHGA 4UOGA 2IPOB 2DPIA 2VBXA 1Z2LA 3G87A 4ZP7A 5DZ6A 4K4UA 2QLFB 2GNKA 1FRJA 3MPYA 3R6LB 2UUCF 4LSNB 2GX8A 4ZVUB 1LKZA 3GR1A 3IR7B 4USVA 4TN2A 4AYBD 1NJZA 4DV7J 2R8JA 2DNMA 3BBBA 1T0TV 3KHLA 2RQCA 3R5BA 3MOJB 1MMLA 3PRDA 1IR2A 4ZVOB 1KLMB 3W5YA 3MCSA 2V4QA 1TKDA 3C46A 2B0GA 3GIIA 2V9KA 4GC7A 2AJFE 1EHWA 2XTJP 2OMLA 4DR1J 1UEKA 4R25A 2ZH7A 3PEHA 5ETLA 3KDNA 2C3OA 4IH7A 2ZH6A 4DSLA 4PRFA 1VDHA 3OT9A 2DGTA 3BYRA 1WTBA 4NXNF 2U1AA 1B4SA 5F8LA 2VDHA 3Q22A 2FLLA 4AL5A 3SMZA 2ZOGA 1PSDA 3HJVA 2CQ1A 4KQZA 2HZCA 5EWGA 4U8VA 3CULA 2VJUA 1ZM4A 1NK4A 4ZIVA 3M7VA 1LFPA 3DHXA 5CH7B 4PR6A 5IC4B 3AY0A 4MK8A 3GV7B 3OXGA 3TAPA 3SSRA 4A8QA 2VKRA 4DV3J 2GHVC 1I5OB 4NA2A 5KT5A 4DFKA 4LF4J 3KLIB 5KG0A 5HL7Q 3MI7X 4LFCJ 2XMKA 5JVGQ 2DNGA 1JNRB 5C24B 1OPIA 3QO9B 3NGUA 4IRDA 3HPOA 1AT1B 2DBBA 2BVZA 1GK8A 1L3TA 2V8DA 1D3WA 3P49B 3VQTA 3TQEA 3J81U 4KGKA 1VLYA 4BDPA 1SUQB 2EC0A 5KFWA 4LR9A 4ZPWR 3SZ2A 3VTIA 4MJKA 2BM1A 4NA3A 5B0FA 4Q45A 1I3OB 4IG0A 4I6AA 2HPUA 5C2CA 3LGNA 2UXDF 1FD2A 1WTFA 3W2WB 4A4JA 4IOCQ 1DBDA 1ZS6A 3OXFA 1T9UA 3K8VA 5L9XA 1OY9A 1RHUB 1HQEA 2E5JA 1SI9A 2WW8A 4HT5A 4B17A 4DUZF 1RCXB 1RA7A 1UJ6A 2BE9B 1TKTA 3EUNA 3KK1A 5F8JA 3TUPA 2JNJA 4DZ6A 1U1OA 2BM0A 1FRHA 4FN5A 5B0DA 3PW2A 3M8RA 5HROA 1KR4A 2HAFA 1SKRA 2CG4A 3T9NA 4X4SA 1BXNA 3T19A 1RT1A 2MKYA 2WAQD 1XBWA 1DTTB 2BXJA 1NHUA 2X1GA 2YQ0A 3OD2A 3JYTB 2FJDB 2N4CA 1B0TA 2YX4A 2RT3A 1NLKL 4DCOB 3A13A 2FHOB 4MIBA 2UUCJ 4C8LA 4Q8FA 1RJJA 1F5BA 3M8QA 1B70B 3BDEA 5DDPC 4DSEA 4WKYA 1RK8A 3EJMA 3IXQA 2DNPA 2QRRA 3PJXA 3R5JB 3W7BA 2K8GA 5B7WA 3OUYB 2J76E 5A2QY 2R9LA 1FJGF 2XWYA 1TL4A 1VRQC 2EFGA 2XBPA 1C1CA 2PMZD 5F8MA 3OSPA 3W8PA 1NDKA 5K8PA 4DS4A 2RKIA 4OL8A 2KTQA 4ZPDA 3UW1A 1UWBB 4FVMA 3CDUA 2ASJA 3CJ5A 3M8PB 4PABA 1CSJA 4QPTA 5IS2A 2ADBA 2V9WA 3G9CA 4LRAA 4OFZA 3DRRA 4ED6A 3R8YA 1R0AB 1FERA 3OHAA 1EQ0A 1QAYA 2YKOA 3K8WA 5E33A 1XR6A 2L9WA 3ELHA 3JQMA 3DKDA 4K59A 2ZHBA 1S9FA 3P5TL 4JI5F 2MQMA 3T5KA 1N5VA 1FEEA 2OI2A 1H72C 2JLGA 2AJ4A 4LR7A 3TX8A 4B02A 4DUTA 2HFSA 5CYQB 2C2MB 3BEGB 4YY3F 3JXOA 4IG0B 4QJVA 2QN6B 2XY5A 1UVLA 1ZM9A 1DQAA 2IMWP 4QIWD 3D6HB 4CDIA 1EETA 2OGUA 3MAHA 3MM7B 1N36J 4OZJA 2XULA 3HHEA 4L3KA 1N6QA 1RHQB 1S49A 3TVYA 2GMHA 2WVFA 1G2EA 1LWCB 4LF2A 5CYQA 1V3ZA 4FYWB 3LP0A 3VALA 3R7NB 4DR1F 4LR8A 3G6ES 4OZ1A 2YX1A 3ZZPA 2J7KA 4DV6J 1R0CB 1TELA 4QCLA 1RAHB 3UWTA 3BQ2A 4CQ1A 2R7VA 4I7FA 4DL0C 3C15B 3OTOF 4FKYA 4BLGA 4NE9C 4C0OC 3M05A 3NS6A 1IXKA 4WZMA 2QE5A 1CLFA 2MDAA 4W92B 3PX4A 3EDRB 1X60A 2EFOA 2KG0A 2W2MP 3UNYA 2HVDA 2YQ1A 3NMRA 1KKHA 2YKQA 3BGRB 3PRVA 2XNQA 1KLNA 5D4NA 4R5PA 4MKYA 1YJTA 4CLKA 1TUVA 3OUYA 1RAGB 3MECA 3LUYA 3B54A 3U1NA 2XYGB 3N6NA 3KLHB 4DX6A 5AE2A 4FYVB 5KT3A 3BJYA 2HIQA 1QDUB 3W63A 4LF4F 1R3NA 2QL9B 1RWWB 2CDRB 4WPAA 1FKOA 1QE1A 3IN5A 4M5DA 3SV3A 1VK3A 2E5LF 4O4GA 3QWPA 1YI2S 1C2PA 4MK7A 3OVBA 1T11A 1WKJA 2MKJA 5EN1A 2FHKA 4U7UK 5A8WB 2R2SA 1FRMA 4G6VB 2BEFA 1RXOB 4B3OB 1PJ5A 1NB2A 2P6SA 3NP5A 5HQ8A 2EXUA 2ERRA 1WG1A 4RX6A 2M2BA 3LP2B 4P2MA 3RRKA 2FIUA 3W66A 3HHLB 4C7QA 2EEYA 2IBKA 4G3IA 3M2VA 2A6MA 4MTPA 2ZH2A 4B9NA 2HWHA 3Q0AA 3V6DA 1W2IA 4IFVB 3QT8A 3N6LA 5CCMA 1N34J 5D0EA 5HLFB 2R42A 4I69A 3AT1B 4OI6A 4CZCA 4K4XA 4F4ZA 2MZ1A 4LUBA 1T03A 3SI8A 3TANA 1CS4A 2VG7A 2XZTB 4ZS6A 2OUGA 1FNMA 1P9QC 1YRXA 1RUSA 1UL3A 4RW9B 4F36A 2D7SA 3EZ5A 5L46A 4FS1A 3M9OB 2ADCA 3MMCA 4M63A 4DUYF 4C9DA 1S59A 2O67A 5E7OB 2JLEA 5L9NA 2NREA 2DR8A 4JI6J 1VBXA 5IOLA 2VG6A 3QO9A 1IR0A 4X4RA 3HKZD 2G0IA 2GS8A 1EP4A 4ZP8A 4HVZA 3KLEB 4IQXA 3PJ9A 3VAGA 3D7SB 3QWUA 1N36F 4LBPA 2MXYA 5B0GA 2JH3A 1FJGJ 2CJAA 2RH3A 1KS2A 4Y00A 1VHIA 1IBCB 5BYRA 1RLCL 4J9OA 5H9EK 1U1QA 2B6AA 3L95X 5KFAA 3GG1A 4OYAA 4YHHJ 1TFYA 4MAKA 1Q8KA 3K5LA 2AJ1A 2G9OA 1R0BG 2ZD1B 1I94J 1HQUB 2QYGA 2RRNA 3HHLD 2FGOA 4C0HA 1PAUB 2B51A 4J9VA 3CJKB 1K47A 2CQBA 2MHNA 1LOUA 2A10A 3FCVA 4X4TA 3QSIA 1ZM3A 4OI3A 5J1PA 3W9HA 1S97A 1S0OA 2UXCF 1Z1ZA 4CH7A 2R8KA 1P9YA 1S9GA 1Q78A 1WKLA 5T7LB 3F56A 4R5PB 5KFMA 1M1KT 3DYAB 3DLJA 5HVFA 2IVYA 1N5TA 3R5DA 4Y6IA 2XLJA 2F8EX 2XI2A 1UCNA 5GADU 4DV0F 1SKSA 1FHTA 1KP6A 2WVBA 3HHLC 2FVSA 2UUBF 5CYMA 4PYDA 1B0VA 1NK8A 2WRMA 2XS5A 2HKEA 2QEXS 2NXCA 2OPSB 5JVHQ 4YR2A 3C14B 4NLWA 3C15A 4UOCA 3EVMA 1WKKA 4WFYA 3PYGA 1FNOA 1N0UA 1U0HA 3KJVB 5KFIA 5J1EA 3B6BA 2CJXB 3JTNA 2W9BA 4ECXA 1S10A 1QTMA 1I6JA 1C4CA 4YR3A 1CJKB 1DJ0A 4ILLA 4Y65A 3NNCA 1HWLA 4ZJOA 1Q7YT 4LF5J 4UQTA 2CQHA 3G6YA 2ZZNA 3R5GA 4ECSA 1EX8A 1FFGB 1RWVB 3RB4A 5ETPA 3NBPB 4ED0A 1Y5NB 1JIHA 3I31A 4WFBQ 1S6UA 1IBMF 5J2MA 2FVQA 4ELUA 3J7YI 1X0PA 2FC8A 4I68A 4X84A 5CHCB 2W9BB 3UD4P 2DR9A 3N0VA 1HMVA 1RHMB 2N4DA 4KH1B 1FXRA 2J6TA 2J6UA 1FE0A 2X1BA 1UVKA 5JXSA 4L72B 2IDLA 5A76A 5E3CA 1C0TB 1J5OB 2VUGA 4XDDA 2CZVC 4ID8A 4GVLA 1BQMB 2Y0SD 1C1BA 2RSQA 3NG8A 1FDDA 4ZCMA 3PW4A 3TI0A 2QJ3A 2RS8A 2GJFA 3TZWA 3LGMA 5HJXA 2VQFJ 1S0MA 2HAIA 3H8YA 4KH0B 2M8HA 2MYFA 3CD5A 4RO0A 4ECVA 3M8PA 1ZZNA 3R7SB 4PCQA 1ZTWA 1URRA 2IM2A 2WOMA 3EZOA 3GJTB 3CJTA 3SQOP 2Y8WA 2GJIA 2CADA 3A3PB 4WU3A 4D3HA 1RAAB 4NLRA 5HBMA 4DPTA 5IM0A 2V63A 3AD8C 1IWAA 4FDFA 5DGAA 2V4JA 3DGPA 5LJ3Y 4YFUA 1TAUA 1S5ZA 2R8HA 3NNHA 2ILYA 2FJBB 4IFYB 2CPJA 2HHUA 3B4MA 3W65A 1X4GA 3N5BA 1T02A 4NOHA 3ETMA 2Z30B 3HP6A 1FTRA 3D4JA 2DNOA 4J9SA 4DV3F 3SV4A 1UA1A 1HNZF 4NI2A 2JEIA 4MMOA 3HSDA 3Q23A 3TZXA 2OKQA 3J7ZT 1EIYB 2BW7A 2W24A 5HMYA 2AEJA 2QTWA 3M1VA 3ZZOA 4UQGA 4J9NA 3FBFA 2NCKL 2LXFA 3BN4A 2QSWA 4NYOA 4HHUA 3HMJG 2OSQA 3MMJA 4YQWA 3M9NB 3IG1A 1WC4A 4DUYJ 4P10A 3ZNUA 2OJ3A 2HVHA 1YK9A 4U7CA 2DHHA 1VQLS 1NSKL 4OLPA 3LGHA 1LWFA 1IBLJ 4QWAA 3R2DJ 3IR5B 5FDLB 2BJ8A 1XQIA 4ZVRB 1U49A 4YMEA 1LEOA 3GE9A 4ECRA 2O3DA 2AW0A 1Q7LB 2P5VA 1VFJA 1S79A 2G2YA 3B78A 3H59A 2VC1A 4EUVA 5KT4A 5D3GB 2HBZB 2ZITA 3BDPA 2NQPA 2OHDA 3U02A 1ZZFA 4C3LA 1Y0HA 5FDLA 4ALZA 3JQKA 3MM8A 1SC1B 2POKA 4N47A 1CJUA 2MQ8A 3PR5B 2K1RA 4B9TA 1QTNB 4F2SA 5C24A 3W9IA 4ED1A 1VQ6S 4FF2A 4NX9A 3X1LB 3WIUA 4QPXA 5LOQA 2DK2A 3FK4A 5H9FK 5HK4A 1B7YB 5J2PA 4LF5F 1NH8A 3UCZP 4ZLPA 3CJSA 4RWWA 3HVTA 2XMAA 5HATA 2WSFC 3N6MA 2J5AA 3FQKA 1KHWA 3BBFA 4HDHA 4UZCA 2K2PA 5DZ7A 3EVWA 2BBEA 4ES2A 1RE1B 1T9YA 2CNKB 2O66A 2XG8A 3K5PA 1NSQA 3PIPQ 1WDTA 3MUMP 3T1YJ 1NSPA 4F3OA 1ULRA 2R7RA 4P52A 1IBKJ 1HR0F 1S1UA 4ELTA 1UETA 3CCWA 1K0VA 2C22A 2CPHA 2KJVA 1IUJA 4BC9A 3QIDA 2OD6A 2J9CA 3U1MA 2OPRB 2CQPA 4N56A 5AE3A 5LXYA 1SL1A 1Q8LA 3PTWA 4AL7A 2ATCB 1T9XA 2CQ4A 3GJQB 3PEJA 2K06A 4ANDA 2DGVA 4X62F 2I2YA 3RW6A 1X5PA 1LWEB 2FZCB 2RHQB 3S1TA 3G6XA 1WHVA 3AH6A 3C6TB 4GKKF 2E29A 5L39A 3IMQJ 3PYDA 1BQNB 4NMLA 4RNMA 1HHSA 2MSTA 2V50A 2QA1A 1X4HA 2I0XA 3QBCA 5IC6B 4K0KJ 4C8MA 2DH9A 3CXCR 2HVZA 4DZDA 4EGLA 3O5TB 2UXBJ 4WXOA 2LECA 3MF5A 2R7TA 2YPYA 2DEIA 4USIA 2KN4A 1IKVA 1C0TA 1VRUB 2CPXA 5HP1B 4DR4F 3O44A 2W4CA 1KDNA 3LWLA 1Q82T 2KB2A 4RR5A 4I6YA 3BGFA 3NGRA 3CDBA 1DAXA 4OZ5A 1WSVA 2IRUA 3DYAA 1QVGR 2W2OP 4AFFA 3OTEA 2DYAA 5G0RA 3EGWB 3MR2A 2AJQA 3MOZA 2W4PA 4DV2F 3ZTPA 5E0OA 2FB0A 5IT0A 2FJEB 3TVZA 1LW2A 1TL7B 5JJBA 4UTGA 3THPA 1SUQA 2V4JB 3DGPB 3EDQB 5AXNA 4DL5A 1TMJA 3MZIA 4AQYF 5KFKA 3GTYX 1LWFB 1RYRA 3V4MA 3TAMA 1DURA 4DPUA 2BW2A 4NRUA 1XC9A 4KV8A 2OD4A 4DR5F 4U95A 3DRXA 5FD1A 5KOXA 3FQLA 4UOHA 2ZZTA 3GYNA 2IA0A 1MU2A 2CIMA 2BJ1A 1Y7PA 4JB8B 3PJWA 4I56A 2RRAA 2MQQA 1KQFB 1WEYA 4F04B 1HNZJ 1FE4A 1U25A 1X4FA 4M5JA 3KOAA 1NU4A 2AMCB 1WSRA 1UWBA 3GJSB 3Q83A 3MD3A 4PZVA 4I67A 5IT9U 3KG1A 2FJXA 5CYJA 1JKHB 1T94A 3DN9A 2KM8B 1S9EB 5IV3A 3M9MB 1Y4ZB 3N5FA 3NLCA 4TKTA 1WJ9A 3MPVA 4JV0A 3BKTA 1Y5IB 4FNIA 2QLXA 3MMAA 4KGMA 3CC7S 1HD1A 3K5NA 1S48A 2XWXA 1ZETA 2OPQB 4IO9Q 4JV5F 1E6YB 2B3TB 3MDFA 3CSKA 4DQRA 1VC0A 5D0RA 4CP5A 3MTJA 4ZPAA 1CS4B 2NLWA 2VG7B 3H7HB 2IC3A 2DT9A 1M1HA 3B8HA 2Z2LA 3HM9A 3OFFA 4DDFA 1MROA 1RCOB 3ULHA 1YQHA 5A0YB 1VCTA 2F63A 1RT6B 1RWXB 1S1XB 2KL8A 3FRYA 4GO7X 4DR6J 2H9ZA 2D3UA 2QA2A 1UFKA 2Q1LA 2XO7A 2HQGA 3DOLB 4LMZA 3CF5Q 2HNYB 2JSXA 2F4FA 4J9UE 1S0VA 4ECUA 1XJWB 5HMZA 2MY7A 3CCZA 3QMQA 4E98A 5GAGU 3S01A 4DSJA 3W2WA 5L1IA 5LL6d 1U45A 2BKOA 3HCXA 1W2BR 4KFBB 3SCLE 4GVBB 3U7JA 1NZAA 2G1HA 2GC8A 5GMKa 4IQMA 2UXBF 1TZ0A 2DXDA 2PE8A 1NH7A 2MHEA 1RT3B 3N01A 1H3DA 3NCRA 5K20B 3HFVA 3VAMA 1RISA 2ZUGA 2MGZA 4DL6A 4DL2A 3W3SA 5LM7E 1APSA 1SQFA 4DQIA 2HBRB 4ZLJA 4K7QA 2W9CA 2EFQA 3CD7A 2RRBA 3PDNA 1MSWD 2PA3A 1HQUA 2PC6A 3RBDA 2OIHA 2A2DA 5HI7A 2AD9A 1U0SA 1YRTA 5F41A 5KFOA 3D68A 2K7KA 2VC0A 3IBWA 4PEOA 1QAXA 2GQCA 3H20A 4NLDA 2W01A 2AV5A 1QSSA 2E7XA 1F2HA 3V6HA 2FLNA 1H7XA 3CCJS 5KFXA 4CLWA 4QWBA 1REVB 1M90T 2E1CA 2XMTA 4X62J 4LIRA 1T05A 2R3VA 5CD4A 3N28A 1HW9A 1RAEB 2LLZA 3R6GB 4WFZA 4HI1A 5AJ3F 3MM5A 1KFSA 3A4TA 1K73T 2L48A 2BACA 3I82A 2EKNA 4F0HA 2EPIA 4OHWA 3CO9A 3TAMB 2PI5A 2M70A 3FMBA 3ENAA 5CAAA 4U7UD 2VG6B 3LALA 4RBUA 1T3NA 4HEA9 2HHXA 3W5ZA 2EVZA 2CPZA 1WOOA 4AXJA 3RR8A 2NYIA 1I1GA 1OJ4A 3M30A 3DU5A 3CT9A 3IWXA 3UDVA 1JB0C 2YNFA 3ZXWA 4V19J 3FBBA 3HT3A 4ERDA 3GLJA 2CAJA 2G2OA 3BGOP 1TQLA 4B3RF 2BE7D 3ETOA 2Y8YA 1AFJA 1A0OB 2IJFA 5B0BA 5A2QU 3D6FB 4LRFA 1H73A 1RT5B 3MUVP 4QOTA 1OMSA 4NXMF 1JNZB 1RWPB 1JLBA 2IRXA 4ZVEA 3WBZA 5CQGA 3F73A 3QT6A 2BJEA 3FC9A 1GT8A 2RF2A 2RJZA 4OJGA 2XO6A 1WD6A 4DR7J 4B3OA 1VOMA 5C42B 2DITA 3C8YA 2E7VA 3CDWA 1LNQA 3IBFB 3RAMA 2DJWA 2XM3A 2UU9F 4NEYA 2XS2A 4KHPJ 4NLUA 4BCAA 2BOPA 2YH0A 5E3PA 4BC7A 2FJAB 4ZN1A 1NB7A 1GMVA 1T8EA 4ZVFA 3RG6A 5E5NA 1X4CA 3VV2B 4EO8A 1HWKA 4ZCIA 2JFKA 2AYGA 1VQ4S 2XZDB 2B5JA 2YKMA 1N5YA 1WF1A 4E0DA 3GFZA 1HQ2A 2YWGA 3GR0A 3R97A 3UQSA 2N7CA 1BWVA 4YS2A 2I5JA 2VFVA 2YWHA 2JHEA 2QYCA 2RE1A 2JL9A 2XGQA 5IQ6A 4JYAF 1S0NA 2QO3A 4LQ3A 3H42A 2FY8A 4FYYB 1XNQJ 1C4AA 3FVYA 1AA1B 1DTTA 2JWNA 3PZPA 1PYSB 5F0WA 4ICLB 5DETA 2MKIA 3PX0A 3JSYA 3FEZA 4CLFA 1HWUA 3T5LA 1SQGA 1VS3A 4JI4F 3T1HF 1S12A 1S1TA 1HA1A 5DGBA 4W90B 2HQCA 2AWZA 1Q8BA 5ETOA 4LRBA 4ZVHA 3TWZA 5F0UA 5IT4A 3ONQA 1VIXA 3I96A 1TL1B 1TKXA 1R6YA 2AEMA 4MH8A 3PV8A 4JI7J 5F9LA 4V1Ak 3SSQA 2BRKA 2YWWA 4PXBA 4KGZB 1X5TA 2K1RB 2LDIA 5HSPA 4N77A 1BD6A 1F9FA 1RT5A 3DXBA 4JOUA 4YB5A 5EWEA 5I4MA 3EGNA 1X4EA 5EDWA 2CWKA 4PG8A 1LW0A 2HLUA 2CPFA 2VBWA 4MFBB 4M95A 1H38A 1KWMA 3C66A 4MT1A 4RW8B 5BYQA 5AJ3J 3JYTA 2MLZA 1CJKA 1Q53A 4QW9A 1NHKL 4DR3F 5HLFA 4XAKA 2JVOA 3SFUA 4GKJF 2C2DA 1HBUB 2BX6A 2HURA 5KFUA 2LQ9A 2E1MC 2ZC4A 4IDKA 3RU0A 2EC2A 3U1LA 1JWWA 2P9CA 1U24A 2PFFB 1XK8A 1S6OA 4IH6A 3KJNB 1NRKA 4DCPB 1IM4A 5F8IA 3OV7A 3CC2S 2ZM6J 5CXTA 4DL3A 3W8GA 3UN5A 5ETNA 1R43A 2GQQA 4Y2AA 1UKUA 1WC6A 4X66F 1X9MA 4C8KA 2NR0A 1UFWA 1JLBB 5CCLA 2QFIA 5E3AA 1TUWA 4KPYA 2KFZA 4YOEA 4WIIA 2VFRA 5ITHA 4NLQA 4O0NA 4OI1A 2WVDA 4DX5A 3QRPA 1R27B 3ILJA 3AOCA 1KD1T 2DHXA 5E41A 5AXKA 4RU2A 4ILMA 4CLUA 1FJCA 4CT9A 3CEDA 4C11B 1QM9A 3IRXB 3HXMA 7FD1A 1G7CB 3N4WA 1W7WA 1GH8A 1TFWA 1QJHA 1WDDA 1Z2ZA 3CDEA 1WG5A 3NS5A 5IM0B 1D09B 2A3JA 1ROFA 5DQHA 1RWNB 3T1YF 4W98A 3MM9A 2GV1A 5G4DA 1VQOS 4ELVA 4OJ3A 1RSCA 1U6FA 2OPPB 4XTTA 2DGQA 2IYGA 1N5QA 1CEZA 3W9JA 2EW9A 3CB4A 1NM2A 4X65J 1K9MT 1H98A 4HH0A 3AOBA 3A8KA 2GMLA 4NCGA 3PFOA 3S7RA 4C8OA 4OYPA 4URQU 1RZMA 4FBTA 4I7FB 3IP0A 3C2PA 1HW8A 3W5XA 1U6ZA 3OR2A 5C7PA 3J81Y 1F5CA 3M1VB 4DL7A 4KRWA 3MM8B 2R4FA 1V3SA 3D3BJ 4GKKJ 4CYUB 1CJUB 2OP5A 3AQOA 2QA4G 1CQNA 1IQZA 3ET6A 5LMNF 5DLFA 2FLPA 3HO1A 1N4LA 3TA2A 2E66A 3VGTA 4ZPTR 1FWLA 5CA5A 2JJ4D 1RP5A 2J8AA 5I3PA 4DQPA 1GQEA 4C3KA 2HMIB 1YJUA 4ZPCA 5FLXY 4NZ6A 2A18A 2BABA 1PBAA 3BQ1A 4FF3A 3M6UA 4Y3CA 1L3SA 3MM6B 5BXIA 4CYUA 4JI7F 4KHPF 2M8DB 1NUEA 3ET6B 1NDPA 3P45B 2I1RA 3R1HA 2VBYA 1KVJA 2M88A 4FPIA 1S1UB 3AXMA 3CE8A 3M32A 3QATA 3ITHB 4K5RA 5D8HB 3O6QA 1NKBA 1JLGB 2ZVIA 5JMNA 5GMEA 4DV2J 3W2VB 4ED4A 3KJQB 1WUUA 4Q44A 4OLOA 3KLFB 2A6OA 4QU7A 2NPFA 3AD9C 2R7SA 4QYZJ 1FXLA 5A8WA 2ATLA 2VBZA 3MEGB 4RLEA 5DG9A 1SH0A 2MZJA 2IAJA 2IC3B 2X3DA 3C6TA 2H51B 3QLHA 4JP8A 2ALZA 3TRGA 4J9LA 2KFNA 5B0AA 3BO4A 1A7GE 3AA9A 4ZJLA 2C3PA 1RTZA 2NYHA 4PWDB 2OFGX 3KUHA 3JB9k 3TARA 1LQ9A 1RTIB 2KYZA 2YKNB 4MKVA 3VCDA 3TEHB 2KRRA 2FQQB 1NMEB 2WBMA 3AD7C 2VDIA 1R8BA 3CJ2A 2J7WA 3MEKA 7FDRA 4QWDA 2HHQA 3A12A 5D4OA 2ZD1A 2Z57B 2E5HA 2KM8C 2EK6A 1OYEA 4HACB 2LDYA 1RKJA 3UDCA 2MQOA 1PCAA 2N82B 2DGWA 2LQ8A 3FUYA 4KB7A 3IR6B 1ZH5A 2F8HA 3DGVA 3ZO7A 1N32J 1DTQB 2AYMA 3I5BA 4NLXA 4CO5A 2RD5C 1HBOA 2GO8A 4OHYA 2HS4A 3L7UA 5HO4A 2B4VA 1QAJA 3A8IA 3GP9A 2CQ3A 2JOQA 3OFGA 1MN9A 2NSCA 3QSYB 3C3LA 3UPFA 2IMOA 5J2QA 4UUXA 4DU8A 4DV0J 2R7XA 2LKZA 1S6QA 4DUZJ 4DX7A 4ENOA 2DD8S 4NLOA 2ASDA 1TV6B 4DI6A 1RTDA 2IHR1 3HT0A 2XCAA 1EETB 5M2PA 2ASLA 3CNQP 4K2JA 4URSA 5K8OA 2QLJB 3M6XA 2V6AA 4NRTA 4A8XA 2KI2A 2KXHA 4IFYA 2IVFB 3MD1A 1HYSA 4KFBA 1SJ4P 3RB3A 4OYZA 1S6QB 1RWMB 5H9EJ 2HRTA 3L4BC 3F41A 3GIRA 3SCIE 3PFEA 1FFSB 2KZZA 1EZZB 2G0CA 3QIPB 3ZNJ1 1K44A 4OHZA 3H4DA 3GFHA 1WNEA 2D1CA 3M2RA 3HFKA 4LSNA 4B3MJ 2AZ1A 3MUTP 1JLCA 4QIGA 2FJVA 4B9VA 1YBUA 2WVCA 1FD8A 1HI1A 2RKIB 4FZVA 3VAJA 2HFZA 3BSCA 2HQ3A 3SFGA 4IRCA 1GX6A 4OMFG 2HFOA 2F9DA 2HHHJ 3N79A 3G71S 1REGX 4GRSA 1FDNA 2YWKA 1DQ8A 4X65F 1FCAA 1UTAA 2DEJA 1XN9A 1K1SA 2YPZA 1JLAA 2P6TA 1VRTB 4P6QA 2SXLA 2ZFHA 4M5GA 3UNGC 1IKXA 2B8PA 2W8KA 1VQKS 2GO9A 4M8LA 1VBYA 5HVHA 1S9EA 1R7IA 1TL3B 4K4WA 2XHCA 3BF4A 2NXNA 4Y2KA 1R31A 2IAJB 1VJQA 1RB0A 3HKWA 4HTJA 2WB1D 4M5KA 5A8RA 3FBEA 5LSOA 4LF9J 1HBMB 1OSDA 4K4ZA 4MYUA 1KNZA 4UOFA 4DG1A 4RUAA 2DNRA 3PNIA 1D9AA 3R7BB 2R8GA 2VPXB 1T9VA 1Z4UA 3UVJB 4DSIA 2NZ4A 3K89A 3LF0A 3CC4S 4CLPA 2E1PA 2GVDA 4KBIA 2NSBA 4NPOA 4YN3B 1JXVA 3A3OB 4BWMA 3SBMA 4OHXA 5HANA 1WF0A 4LF8F 2V0NA 4KKOB 4J7CA 1FESA 3HZGA 1RYSA 1UW4A 5SZTA 4FVCA 3AJ2A 3J7Z5 3V81B 3TA0A 2W7AA 4RW9A 3BGUA 2E1AA 4BBYA 2VIHA 1VC5A 4KO0A 3HHKA 3K17A 4RKUC 2ZWPA 2VFSA 3HVWA 4A47A 3BS9A 4WTYA 1NJYA 4LQ9A 3OR2B 4UT4A 4ZITA 2YNGB 1K0TA 3PXGa 3BH7B 4G1IA 4IR9A 1NDLA 4EBCA 3GSDA 4WTOB 1HPZB 2H3EB 2CYYA 2ZH9A 3IA0A 4PQUA 1RT7B 1S1VB 2ZE2B 3OJUA 2J0WA 4HLBA 4JUZA 1GXLA 4NEZA 1JXLA 1B64A 4Q43A 1G3OA 2RDIA 3NY0A 3LPYA 3IWLA 3NOCA 1PILA 2O5DA 4URGA 1VI7A 2MEWA 1FI4A 1O51A 3AAWB 5ETKA 4J9KA 3OL8A 1U1LA 4XDCA 4ZHRA 1HPZA 1WC5A 2RU9A 3ADAC 1RAIB 1TL3A 2ZJQQ 1HBUA 3CMQA 2KHDA 1D9FA 5DDOC 2QV6A 4AXIA 3SDEB 4A8FA 2YNHA 3IO1A 5A8KB 1GFWB 3D54A 1DZ5A 4X4NA 4RZRA 1IR1A 1D9DA 2R7UA 1YLXA 2DNQA 3G2XA 4J91A 4EI2A 3M8QB 3PX6A 1H74A 3D0IE 1MWZA 2UUAF 1XNRF 3HJFA 4K4YA 5IZHA 2KKHA 4C2MA 3VAHA 1Y3JA 1LK5A 5LMUJ 2F8MA 2V94A 4C8YA 2W8LA 2ZBPA 3SSSA 3IS9B 3UDEA 3PHEA 3T9ZA 2CZ9A 2GVDB 4OX8A 5HP1A 4PG5A 1S6PA 2HZAA 3H5UA 3Q89A 2M52A 1S1WB 3JTOA 3M4XA 4ATNA 2VG5A 4EEYA 1HWIA 2IRYA 3B4DA 4U96A 2XY6A 1Q81T 1YX2A 5KFPA 4LVNP 3M32B 3NWGA 1SL2A 4RWXA 3A1YG 1UVNA 1QUPA 4WBFA 2DRBA 1DARA 1JJHA 1JLQA 1VBKA 3TZYA 1SJFA 5F9NA 5L1LA 1MROB 4L73A 2UU9J 1BQNA 4B3RJ 3DOKA 3UN3A 1N8RT 4RNNA 4OZ3A 2WK4A 3MM9B 3KLVA 3R2CJ 2U2FA 3VF0B 4Y2MA 3BYPA 2YKAA 1SH3A 3FMWA 3E8OA 3ZZRA 2HQDA 2X3GA 2GZOA 2MSSA 5M2UA 4N8NA 3QGPA 3M30B 2QG9B 4OZ2A 1M5VC 3L3CA 4YHHF 3MMAB 1WEXA 3ZZTA 2OPRA 3BSOA 2V8HA 5HJYA 3QGHA 2PT0A 3VGUA 3WQPA 3Q8RB 2Z8QA 1FVSA 1T7PA 4DN9A 3I87A 4LFCF 4B3SJ 3HF5A 3JSRA 4JI8F 4PPZA 4QW8A 2AIRB 1RLDA 1YVFA 1X4AA 4PQAA 2ROGA 3GILA 5I42B 2D3O1 2Y0BB 3IC1A 4PG6A 4ZHRB 5MAOA 1XR5A 3MPUB 2NXJA 2WVEA 2ZBIA 1KOOA 6FDRA 3MAAA 3PACA 3KK3A 1R0AA 3H4BA 2RQMA 1HBNA 1WOSA 5B08A 3KJVA 4IOAQ 4NWBA 2F65A 3GV8B 2PD1A 3GQCA 4B9SA 4ICLA 5KOWA 2VPZB 1BQXA 4X4QA 2PI4A 4FBUA 3IAS9 3LOUA 3TR5A 1FFWB 4OX9J 2V2KA 3MEDB 3OLAA 4TYBA 1Q5VA 2Y9HA 3MFIA 3CJRA 1C0UA 3H2VE 5K5MA 2KU7A 2K3KA 3LQVA 4OX6A 4DXLA 2BDPA 2J8SA 4UZBA 2VL1A 1OO0B 2GGPA 2HYIB 2DCLA 1F3VA 4KT0C 5BYSA 4CWBA 1QSYA 2EFNA 4ZVPB 5KG2A 5DM7Q 3CJKA 1J2VA 1DY3A 2PO4A 3MECB 1RHJB 1IM6A 5DS7A 5G0RB 3Q2TC 1PC4A 4MYTA 1TV6A 1RTDB 3BPSP 2DRAA 2CQCA 1LWXA 1SH2A 3EMTA 4M5LA 1NK5A 2MKHA 3GV5B 2FVPA 4ZMMA 3J80U 2CPDA 1N88A 4ECYA 2MJUA 2DB1A 2DO4A 2F4VF 4UF4A 3OQ2A 2Z2YB 1JLQB 1U2FA 2RVJA 4NLVA 4O3NA 2DNYA 1KQGB 2XMMA 1TKTB 3PYEA 4IKAA 5THWA 3E01A 4DL4A 3CW2C 2M7SA 3RRHA 2MZSA 2YKPA 2OPSA 2IJRA 2B9XA 4IDKB 4WFNQ 5GADI 1BY9A 5KG6A 2E1RA 1R8AA 2HQIA 3OVAA 2K3IA 2AGQA 3TO8A 4E8UA 2P8IA 4HYKA 1OY8A 2ACYA 5J2NB 2NXEA 2AYBA 2B43A 5KT6A 6AT1B 3CDAA 3HK2A 2HFUA 1TKZA 3DMJB 3OL9A 1BWEA 1TL5A 2AP6A 4RL1A 1HI8A 1FDAA 1OWXA 4O44A 4TXSA 5ETVA 3OLBA 2HGLA 1AYEA 1ZAWA 1RAJA 4A48A 2ZH8A 2GCFA 3SDEA 1V9OA 2IY5B 2V2ZA 1VK8A 1R89A 3BPDA 5K8MA 5KFRA 5HBMB 4FF1A 4O23A 4OV6A 4FS2A 1GAOA 2M0GB 2IVMA 4GVBA 4F4KA 5RUBA 3MFHA 2LA4A 3RZAA 3WC2A 3DRRB 1SKUB 2GW8A 1R6VA 3THTA 1YG0A 4F4AA 3QNWB 3HVTB 1N56A 2WB4A 2HS3A 4IR1A 1PBUA 2UUAJ 3KLEA 2BOAA 2QMXA 4F0KA 2FHJD 3PHTA 2O1PA 5C5JA 1S1XA 2MQNA 3BSAA 2HQFA 4A46A 4B3SF 3I9V9 1O0PA 5ETQA 4QIEA 4DEZA 2E5LJ 4QU6A 2YNGA 2LQ5A 1ZTTA 4P75A 1RADB 2NPIA 1FTCA 1G4CA 4RW6B 1M1GA 2DTJA 1RBLA 2H4YB 1PC5A 1RQ0A 2BANB 1P6TA 3MGJA 4PG7A 1SIZA 3W60A 2V4RA 1L3VA 3ENWA 3KXDA 5D15A 3OW2R 3AHPA 3AA8A 3J80Y 2PDAA 2OFHX 3PO5A 1YZ6A 1CULA 3MPWA 8ATCB 3RW7A 1R8PA 3MEGA 1O8BA 1YSJA 2LA6A 3UFCX 5F3TA 2ZH1A 1ZYQA 4P9SA 3H98A 2VA3A 2FGCA 2IYIA 3K0JA 3HI9A 2MKSA 4I0WA 5C2GA 4W4MA 1KVIA 2DGSA 2CZ4A 3CCTA 1VR6A 2W2PP 3TOQA 3KFWX 3ZTSA 4DV1F 4F4XA 1UA0A 3DOLA 1P27B 3O1LA 5CYMB 4AD6A 2CPEA 4ZK7M 1H6KX 2C2OB 3DLKA 4Z37A 1AUDA 4QYZK 5DG8A 4PXEA 2CRLA 3WIVA 4JYAJ 1ZBTA 3K58A 1JJCB 3ZZYA 1FVQA 3B82A 3HHDA 3KJFB 2J7UA 4OV1A 4EZ6A 5EUHA 3VWSA 2WZ1A 3VZHA 4C8NA 2BUNA 1SC4B 2VASA 3DLGA 3SIPB 4F3MA 3R1LA 3G96A 4DR2J 4ZOSA 1L5UA 4KHMA 1SKWA 4DLGA 4DPOA 1T03B 2QMWA 1IN0A 3H2UB 3RR7A 1WOPA 2YNHB 1IBKF 2AZ3A 2J0XA 1HR0J 1GNKA 4QBUA 1IKYA 2XHWA 2MZTA 2AEFA 2UVUA 5J1NA 2BQ3A 3V6JA 2H65B 4PPDA 2V8GA 2LMIA 2HHHF 2HIYA 4P2SA 1ZPWX 2CPYA 2HK3A 2HNZB 1CC8A 1Q5YA 4TY8A 1FRLA 2CFXA 4CO3A 3BV8A 2EKYA 3NAIA 5LSLA 4JI3J 4YB1P 2DNHA 1HNXJ 2CDQA 5J2PB 1C1BB 1U2CA 4OYIA 3J81j 2RU3A 4GMKA 3OSNA 3BO3A 2X1FA 1FRKA 5KFFA 4ETZA 3JAMY 1ZAXA 1XNQF 1RT6A 2D69A 2EK1A 5H1SV 5GAEU 1X0FA 4C3MA 1UPMB 1VQNS 2UVVA 3R9LA 1HD0A 3WZ0A 2CQGA 3W64A 4DQSA 4Y34A 3FCWA 4DF4A 3TJ9A 2XMWA 2FTRA 2AHOB 1KONA 2HG4A 1CULB 1FF2A 4RPFA 4K4TA 2CG8A 1Y3KA 5D78A 1N54B 1MMDA 3NBPA 5KFZA 1PAEX 4E2FB 2BA9A 2RS2A 1CJTA 4EYIB 2NXUA 3MMCB 1KSPA 1Y5LB 4UY85 1FJ7A 3AOAA 1S4FA 1X7VA 2C2NA 4TU8A 3L09A 2V8PA 3GG0A 3G6VA 3OXLA 4P72A 4WFXA 2X7IA 4YUDA 2BQUA 2HLTA 2OLWA 3HX9A 3LO3A 3Q8VA 2A0FB 2HRYA 3R5AA 5E3QA 2CNLB 1I94F 4RW4B 1UWAA 1EARA 1VLOA 3ILIA 2EI5A 3R27A 3TEGA 1PIEA 3JQJA 3O3LA 5K9FA 1HQEB 1BLUA 4L3NA 2KVIA 2LFVA 2P2CB 3IG1B 2B4UA 3Q8QB 1NJWA 2DNKA 3OL6A 2F1FA 1KOHA 3EX7B 3GU0A 3UN2A 1JJ4A 2DR5A 1NBEB 4GKJJ 5FLXU 1YITS 3NNAA 3VVUA 1SC6A 3H5YA 4DS5A 1SJ1A 1FO1A 1L3KA 1U8WA 3PM9A 4TY9A 3D2WA 1NK7A 2CNNB 1PG5B 1IKYB 4USHA 2B9WA 1N6QB 2OEMA 4MIAA 1D8YA 2VOPA 2HGMA 8RUCA 3KLGB 4DQQA 1T9WA 4JI0J 1NK9A 2ABYA 4WE1A 2KJWA 3QGIA 1U1KA 2LU1A 1ZM2A 3CJ0A 4WK3A 1C0UB 1YZ7A 1KBRA 2NUHA 2RHSB 1FRXA 4YEAA 3X3UA 4AL6A 5D3GA 3LPEA 2DGOA 4DN0A 2J6SA 4CT8A 3VQSA 3QLHB 3EWGA 1SIWB 3G82A 4X4UA 5J2NA 2B4PA 6FD1A 3EZUA 5SUHA 3FDSA 3QGGA 3T41A 4DU7A 2VV5A 4F4WA 3UCUP 1FXDA 1NK0A 4KAIA 2H5JB 1AFIA 2DNZA 4G1QB 4LIWA 3SXLA 3JSBA 2MZQA 3M2RB 1MWQA 4K8RA 3H40A 1EP4B 3HVAA 3MR7A 2DISA 3AB4B 4N41A 2GQ2A 1KQKA 2VZ9A 4ZDNA 3RBZA 2W7OA 1BGXT 1B0PA 2XI3A 3H0PA 3NCQA 4J9RA 1RT4A 1NAQA 3IBCB 3Q8SB 3M2UB 2XMVA 1EKSA 2YNIB 4MKAA 4DFJA 4NA1A 2XSFA 4USWA 1WG4A 4QQBA 3PW5A 2KYXA 3OHBA 4ZCLA 1GMWA 3RRGA 2OPQA 1XWLA 3MM7A 5CD4H 2GFFA 1SPBP 2UUTA 2BKNA 1ICEB 1GMUA 5J2QB 2GAHC 2N3LA 3M2UA 3CCQS 4FF4A 2FPHX 2EG2A 2HNDA 2BJ9A 1L3UA 1XTZA 1WORA 4H4MA 2ZBRA 3KDOA 1YHQS 3KTQA 3CIMA 1FK9A 1JK9B 1FKPA 2V34A 4H4KA 4NZ7A 5GMDA 5HN0A 4RU9A 3BSNA 2UV8G 3NMAA 5IV4A 1JLEA 4ES1A 2C2ZB 1NXIA 4TY8B 3BZQA 5E2QA 3DCAA 5CABA 2H5EA 1J5EF 2OPPA 2ZZMA 2IM1A 3JAMU 1RT7A 1S1VA 1H0HB 2CJ9A 4C97A 4KSEB 3Q86A 1GMWD 2R7QA 3QIPA 2FJWA 4PQUB 1EAYC 4I4BA 3DM2A 5AXLA 2WW4A 3DOMA 4PWWA 4PXCA 2RUSA 5D0GA 4DBQA 5AE1A 3S8SA 4EBEA 4DLEA 4ECQA 2UVRA 3QRQA 4IG3A 4H4OB 4PYAA 3PW7A 4CLZA 2Y1LB 1ZOTA 4I2QA 2C1EB 2CQDA 5H9FJ 4OYMA 4FPRA 4OZ0A 5KG5A 4WU2A 4DX8H 5GVQA 1VQYA 3KLHA 1QVFR 2D41A 2MGZB 1J5EJ 2KT3A 3L9ZA 3LAMA 4TU7A 1RT3A 1PJ7A 2PA8D 3NGTA 3EGZA 3MEDA 3I0RA 4Q2MA 1RU1A 2V67A 5JUMA 3RTVA 2ZH4A 3HHNB 2UZAA 4YY3J 3G8QA 1RTHA 1F9HA 3SYZA 2HHSA 3G8SA 1WC0A 4XPEA 4QZVB 5BR8F 4ZPVR 4H4KC 2OEKA 4ID5B 3KK1B 4TQRA 3MAQA 2ZVSA 3D1QA 4ZP9A 1REVA 4N7TA 4ER8A 1CG2A 4KV8B 2BV3A 4LF6J 4G65A 1RU2A 1TR0A 4EK2A 3HSJA 1J5OA 2DVIA 3DLHA 4LFAJ 2MQPA 3ITHA 1W25A 5KFCA 1S6PB 2LXIA 4GC6A 5HAOA 3PCOB 4I6WA 3DDIA 1S57A 1AW0A 4H54A 1YJVA 4C0BA 3P6YC 3NCPA 3I0SA 2C3YA 4PKDB 4B3TJ 1I51B 2YH1A 3MXHP 1UP1A 2HVEA 3FZ2A 3DI6A 4C4WA 4EU0A 4DR7F 2VB6A 1KTVA 3N9UC 2BQRA 2LCWA 2ALYB 2D9OA 1LW0B 3EPGA 2QZ8A 3AXKA 1KN6A 1OY6A 3CIZA 3CVKA 2YNFB 1VRTA 2CVIA 2CXEA 2E5GA 3OFEA 2GHPA 5KFVA 3PKYA 4ECZA 3DOKB 4KKOA 4LF1A 3I0SB 3HULA 3QQCD 3R5CA 3CJ4A 3GIMA 4LFBJ 2QSFA 2XSJB 3PR4A 2OSRA 3QT7A 1NKCA 4K4VA 5LSRA 3C14A 4JI0F 3HHLA 5GAHU 1NSAA 1OIAA 4IYQA 5EWFA 4HH1A 5DRKA 4RBTA 1U26A 1HNVB 2WHOA 3H25A 3KYLA 1UVIA 2BYCA 3VGSA 3HD1A 1PGZA 3KLFA 3UR3C 2CQ0A 4IO1A 2YQ3A 5A0YA 1HI0P 1U6BA 2PN6A 1RA6A 2L9DA 3KWMA 3QAUA 4HR2A 5DLGA 3KHHA 5I42A 3T5HA 3MCOA 4A8YA 3R3TA 3NRBA 2KG1A 3DRPA 3RGIA 1HFEL 1YJNS 2WONA 3TUJC 3T1HJ 2ZDPA 3I0RB 3V5RA 4DFMA 3LP1A 4EZ9A 2VQEF 4FYDA 2XC9A 3ZTRA 2ZDOA 2CUYA 4JI2F 1SVDA 1VQ5S 2J0SD 2AKWB 2RIJA 3SEOA 3FBCA 3KMQA 2VFUA 4J90A 1N5YB 4PWDA 1NPKA 3CCES 1H2TZ 1NKEA 3F0NA 4CNZA 2B5JB 2YKMB 3GSIA 3ZZZA 4CM2A 3OVSA 2IFXA 1SJRA 3BGLA 1N34F 4J9QA 3ENVA 3HFZB 3D67A 1FA0A 1Y10A 2PIIA 2XLKA 4OJ1A 2QIFA 3SQGB 1FWPA 1VMBA 1HNIA 1YDLA 3CPWR 4M94A 2LEAA 3OTCA 3Q8UA 4WK1A 3V6KA 3K7RA 3ZZ0A 4NXMJ 3C6UB 2QGFB 2PMWA 1X5OA 2DGUA 5T14A 5DG7A 2HNYA 3H2LA 1QAIA 2BJDA 1IWGA 1GTHA 4NCGB 5HMXA 5L38A 1FK9B 1FKPB 5F8HA 2B56A 2FHJA 1CPZA 4CO1A 2AF6A 5GAHI 2LXUA 2R2UA 4JI1F 3CGIA 3OJSA 2XMJA 1KHVA 4ZJQA 1NJIT 3FFIB 5D4LA 1IJEB 1ACMB 3HDSA 4ILRA 2HS0A 2UXDJ 1AB8A 1UFLA 1RWKB 3I6PA 4OYXA 3VVTA 2QFJA 3QRRA 1TL7A 1N33F 4KTQA 1KVKA 2Z2MA 2M3DA 5GAEI 3P4UB 2JRSA 4LF6F 2XY7A 5AT1B 2YWEA 2B7BB 3OL7A 4LBIA 2D74B 2JC1A 4I2QB 3FFIA 2FD2A 2D9PA 3A3NB 3UD5A 1HNWJ 2ZEJA 1LK7A 4WIQA 1RHKB 1YJ7A 2LP4A 4RW7B 5I3UA 1JJ2R 2GIQA 1S77D 4QIVA 1RT4B 4RJVA 3RYLA 2H54B 2XS7A 3HVRA 3UI3A 1NO8A 3ENQA 4N8OA 4Q5VA 1E6VB 1B99A 3KNGA 4O3QA 4YDDB 1UAWA 1T05B 4I1TA 3L7OA 4WYLA 4X4OA 4IRKA 4KY3A 1T9TA 4AT1B 2QC3A 2N3OA 2ACMA 3RBXA 4CH0S 4A8SA 1IBMJ 2VODA 3EGVA 2E7WA 1VYAA 2RDJA 3ISZA 1HBMA 1TUGB 2DCUB 4ES3A 1U7LA 1NK6A 2KT2A 4DMZA 2UVWA 2HW3A 4WP9A 4K2XA 5BR8J 4HHJA 3H5XA 5KG3A 1VQ8S 3OR1A 2HGNA 2UV8A 1HWJA 5KFHA 3DRSA 1D1UA 3I56S 4HTIA 2G4BA 1QSLA 1FJEB 3PW0A 2IIHA 4DR6F 1G1XA 1TTHB 4QWCA 5KAKA 2YWFA 4LFAF 4JI3F 3O8WA 4IOBA 3V81A 5D0HA 1B3TA 1HNXF 2I6WA 1SJQA 2MPUA 4KGVB 2A2CA 4DPWA 5FJ4A 2B4OA 4R8UA 3BN7A 1FT8A 1OPZA 3WHIA 1TAQA 3IM9A 5LMNJ 4XK8C 4I64A 3TAQA 4A8KA 2V68A 3IRWP 3BO2A 1TK0A 2IM0A 1RGVA 2HHPA 4NLYA 2PFDA 5C42A 4C8ZA 3BR8A 3RBEA 2DY1A 3FZBA 4P73A 3UVJA 2BRLA 2DRDA 1GTEA 1U1MA 4RW4A 1XNRJ 3I5CA 2F9JA 4TLRA 3SQGA 3IS9A 4B9LA 2EG1A 3MHYA 3KK2A 1QY7A 2W9AA 4JI8J 1LWCA 2V2VA 3G82B 2G1DA 2H4WB 2ZC3A 2DR6A 2ZOFA 2FVRA 1TP7A 3D3CJ 3RUBL 1U09A 4OYWA 4PXDA 1FNXH 2DR7A 4BS2A 2OMOA 4LVOP 3GMGA 2PGCA 2BANA 3D0GE 1YBAA 4KGXB 5GAGI 5EHHA 3FKBA 4L74A 4CNYA 2W2NP 4EMDA 1M5SA 4Y2CA 2B8QA 1OQ3A 4CO2A 4KHRA 4NLPA 4CRJA 3CCMS 3RB0A 1IBLF 5ETTA 3QZ7A 1V5VA 2PMHA 2VPWB 3U27A 3JSMB 1RT2B 1XMOF 4JI2J 1N33J 4X4PA 4QR0A 4CLTA 2GJ2A 3QT5A 4QR2A 1V6HA 1T95A 1MN7A 4F67A 4FKXA 1UVMA 1LFWA 1MU2B 2H1YA 2VKZG 2W2QP 3W2VA 2G2ZA 1BQMA 1S7HA 4TVAB 5LJ5Y 2L41A 2MTLA 4DV4J 4HACA 1M5KC 2CVEA 3JSMA 2DY9A 4NMXA 3WX8A 2E9ZA 1SXLA 2Q6CA 2LEPA 3BKFA 1VHFA 4KYZA 4D3GA 5I3QA 1JLFA 3CTRA 2XSJA 1QE1B 2HRUA 2X51A 4M5NA 4ZP6A 3GFXA 2HFNA 5K14B 4AUKA 5DDQC 2C28A 4PWUA 1Q8IA 3DLBA 4UW2A 1LXNA 3EE3A 3IGNA 1VQPS 1A6LA 3POTB 1JX4A 1BE4A 1PYOB 1Y00A 1RAOA 2NUUG 3VGVA 3RAQA 3DMJA 2HZVA 4WZQA 2ASYA 5HQLA 4O3OA 1U47A 5KG7A 5HVGA 3RJMB 1U8SA 1NCLA 2YNIA 3DLEA 4WWSA 4OX9F 3UD3P 1MW7A 4F02A 4NCAA 2JDJA 4ECTA 1F5AA 1UMJA 1RTJB 1EJ7L 2ROEA 4Z7YA 2ZJPQ 4O3SA 1NPPA 2VONA 3CCUS 1GEHA 2WSEC 3T5JA 1S4EA 2NZCA 4LJMA 3I55S 1U2RA 3P3DA 3ZTQA 1VIOA 1X8DA 1XERA 1RWOB 2CQ2A 4FYXB 1CVJA 5KFTA 2C2RA 3GZ7A 3MURP 2B7CB 4F7VA 2HNDB 5D77A 4F25A 4LF7F 2RQ4A 2BE2A 4B08A 2GHWA 4JI6F 4DPYA 1TVRB 2MB0B 1F1BB 1UVJA 1N48A 4WKRA 1P1LA 2FY1A 4UY8T 1W26A 4KR0B 3NGSA 4USUA 5L8RC 1PKUA 2UUWA 4B3MF 4ZVSB 1S9GB 2RUGA 2I5JB 1HL6A 1KEKA 1SB6A 4RW6A 2Y1JA 4K4SA 3MWBA 2ZM6F 1M5OC 4DR4J 3VAFA 1RI7A 3NS7B 1IVZA 2ZWOA 3DOMB 4H4OA 8AT1B 2H5IB 2MKCA 3LANA 4ZA1A 2ZH5A 1U1PA 1QUVA 2RNEA 4M5IA 1UZDA 2B6AB 1JXEA 2F5GA 2XNRA 2C3MA 5HROB 4MIWA 1M5HA 4LREA 4M5HA 4ANEA 2FDNA 3KHRA 1FKAF 1DQ9A 1JLGA 1GX5A 4BHQA 4Z7CA 1HLWA 4HL9A 3T3FA 2JX2A 1X31C 3GB0A 3ZZUA 3E01B 4AQYJ 5F3ZA 1RTHB 2CA9A
chains in the Genus database with same CATH topology
2RF2B 1RT2A 2OO4A 2Z0GA 5I3UB 2CPIA 4B9MA 2BZ2A 2KH9A 2JVRA 2FC9A 4IUFA 4Y28C 2W9CB 2J9DE 4ZKAA 3QJPA 1S99A 1WF2A 4QWEA 2DO0A 2VA2A 2VFTA 1H2VZ 2EBEA 3HZEA 3V2UC 4J9MA 4ED8A 1SQEA 4O4RA 2QT7A 2EFVA 2DH7A 4JV2A 4NYPA 1KLMA 5D4PA 2HVIA 5T41A 4CO0A 1V3RA 4XO0A 4Q8EA 4IFVA 1DFDA 5C25A 3TQ1A 2DHGA 4USJC 3MM5B 1XMQF 1WHXA 2W7PA 1P8GA 4B3TF 1CC7A 1RKIA 4FXDA 3KKFA 3OTDA 5FIIA 4X4VA 4N76A 3GIKA 4EFAC 5EX3A 3TA1A 2IJNA 5KFQA 1VC6A 1HARA 4WCEQ 4DHVA 4EO6A 1R8CA 5KTQA 5KFLA 4LSLB 2XCPA 2ZHOA 2AQ4A 4KE5A 4DSFA 3IRXA 3D1HA 3MEEB 2F3JA 2BR0A 4F8RA 2DHSA 2B9YA 3RB6A 4FP9A 3OR1B 1LW2B 4R0EA 2Q79A 2VQFF 3MR3A 3DM2B 2KFYA 1U4BA 4Q0BA 1LV5A 2DNLA 5A6PA 3TP2A 5DQGA 1ZAVA 2AJ0A 1SV5A 3T6JA 2VD3A 4DSKA 5A6WA 3TYTA 5LT5A 3J7YU 2NS1B 2KZMA 2HWTA 4F50A 4DR2F 1HBNB 2ZE2A 3IFEA 2XEXA 4ITSA 4OX7A 1JLEB 3DHWC 1VBZA 4ZVGA 3DFEA 4NLGA 1F60B 1N0VC 2ZNYA 1GXUA 2LVWA 4BWJA 3FEYB 1S72S 1KQSR 1M5PC 1IKWA 3MMBB 1WEZA 5KFYA 5DQIA 3FSXA 2ZJRQ 2E5IA 4TQSA 3E3XA 3G86A 2OH2A 3PO4A 4KJIA 3OBIA 5IT9Y 3KHGA 3PY8A 1AXQA 1GXTA 4HT7A 5IFMA 3CMAS 4NZ0A 1RDRA 1RWUA 3BGRA 3WC0A 1JLFB 1FEHA 4JBCA 3FCHA 2VH7A 3M2VB 4TLQA 4WJBA 1TKXB 1VQ7S 1WHWA 3CD6S 4P7TA 1U1NA 1S1WA 1NJXA 3I32A 4DG1B 2AU0A 4ID5A 2VG5B 1TK5A 5EGYA 3D0HE 5K8NA 1FRIA 3VR1A 2HWIA 3VAIA 4Z2XA 2HNZA 3K59A 2QA4S 2JEFA 2ILZA 3PIOQ 4CCHA 3DLEB 1KRPA 2JEGA 2AX0A 4R8UB 4DV6F 4PUOA 1C1CB 1UJ4A 5HMWA 1X4BA 3CMES 3HJFA 3K57A 2P9EA 4Q0BB 1E6YA 4Y0FA 1X9WA 1BC6A 2DHAA 2QLWA 2R7OA 4C11A 3CUNA 1Q1KA 3IAM9 4NLTA 3PRBA 2D3ZA 4J37A 4EYHB 2J9DA 1U48A 4ED5A 5F8GA 2N7YA 5KFNA 2COLA 3KG4A 1WHYA 3FNNA 4TYAA 2RILA 2WONB 1B7FA 4CH1A 2AGPA 2UP1A 4ZCKA 3KLIA 2YX7A 4F26A 1UEVA 2G13A 2KDOA 1VGYA 2PSZA 5IQQA 4YDXA 4A8OA 3NL0A 1S1TB 3OFHA 1IKVB 1VRUA 4HI2A 3T1AA 4EWTA 5KT7A 3DDNA 5HP1A 1HNVA 2M5YA 3CCLS 4UUWA 5M2RA 3FSIA 4YR0A 3G8TA 1OQ6A 4O0IA 2OAUA 4WF9Q 4RW7A 4WFAQ 2ZH3A 1X4DA 1XEZA 2EFPA 4KO0B 4K0KF 1SBRA 4ETXA 4DV5F 3CCVS 4RNOA 3AJ1A 3FJ2A 2MKKA 1H2UX 4LSLA 3E2EA 3LW5C 2MQLA 1JLAB 4AE5A 1JMTA 4JV1A 1Q86T 3I5AA 4NL5A 2FLOA 3NGKA 3LP2A 4WYWA 1U1RA 2LU2A 3MR5A 2J9EA 3C6UA 3GFYA 5IWAF 4U67Q 3OPKA 4KIAA 4X2BA 4MKBA 4F3QA 4DF8A 1VQ9S 2IBOA 2CQIA 4X64F 1KTQA 1URNA 2KO1A 4O4GB 4F4YA 5IXUA 4LF9F 2YY3A 3LAKA 4DWIA 2APOA 5KG1A 1IKXB 1XMBA 4CTAA 1WELA 2C42A 1YIJS 2VOOA 4V19X 1RTIA 2YKNA 4A8WA 3TUIC 4O44B 2KXFA 2OTLS 3RAXA 5K14A 2MZRA 1Y9OA 3V4IA 4PUOB 3SCJE 5KFSA 3QPIA 3ZC4A 3NAHA 1WI6A 5DO2A 3QJJA 4IH5A 4FNHA 1TVRA 5J1EB 2XGPA 4OZLA 2ZKTA 4RNFA 2CJBA 4RUCA 3BB5A 3SCKE 5KFEA 1VQSA 2P9GA 3MTKA 1HBOB 1NEEA 1NHVA 3DDKA 3EYZA 1OSCA 4LT6A 1RTJA 5KT2A 1DLOB 1HNIB 1IJFB 5LMUF 3TW0A 2ZNZA 3ISNC 5LXRA 4OZNA 1D8ZA 3DC2A 2IA6A 4OI2A 4FXVA 2C3UA 3T6BA 3DNCA 2CJQA 2GGPB 4J5OA 4U9RA 5AXMA 2WCXA 4DOZA 5F8NA 2DIUA 4A8MP 4XPCA 2HHWA 3OTBA 3TUZC 3CWJA 1YTYA 1OS5A 3ISND 4O3RA 2I38A 3CD0A 3H5SA 4TU9A 3LWMA 2GA7A 4J9PA 1KFDA 3Q2SC 1ZPVA 5B0EA 1YJWS 1F2GA 3M6WA 2JLGA 5A8RB 3L7PA 1T3OA 1YWXA 3E51A 4R0JA 1N52B 1X5SA 2XLIA 3Q8PB 1SL0A 2MJNA 4XIUA 3FRZA 3K2YA 4LFBF 4G1PA 2IM3A 2A1BA 3KNAA 3V4IB 2R2RA 2D3OR 4ED2A 3EXCX 5BJRA 3BQ0A 1K8AT 3PKMA 1UEUA 3MM6A 1YGYA 3WX4A 5KFJA 3DLGB 2DPJA 2PEHA 4MK9A 5KFGA 4HKQA 3D5MA 4Q2LA 1A9NB 3TVKA 3AQPA 2XZWA 4OHVA 2R2TA 3ZFVA 3DI6B 3MR6A 3DRPB 3UCGA 5CZXA 4WXWA 5E3RA 2BE2B 2ZOMA 5MLCV 2UU9F 2MY8A 5KFDA 4GO5X 2M9KA 2RMLA 1JLCB 4I2PB 3K5OA 3CCSS 5L1KA 2Y1IA 3FSYA 1F0XA 1WI8A 2KT5A 2JZ5A 4M1KA 4OQJA 5DM6Q 2FVCA 4QR1A 1DTQA 1M0SA 4H4MB 2K7JA 3QJLA 2VPYB 5C25B 2R7WA 1SJ3P 2J0QD 4KC5A 2YTCA 2LQJA 1RTHB 4I2PA 3S6EA 2XB2D 2V8VA 1HMVB 1YJ9S 4YB7A 2EBGA 3Q24A 1MWYA 2CJKA 1R8HA 3LP0B 1LWEA 3BR9A 1P1TA 3WDOA 3NKYA 2EWHA 2F40A 2Q3PA 4N5SA 1S76D 2Q6BA 4QYRA 1N32F 2DNNA 2KRBA 2R8IA 4OIXA 5KFBA 4DV7F 2DIVA 3JTPA 5A8KA 3KK2B 4IG3B 1CQMA 2X1AA 1N5SA 4ZPBA 4K50A 4OI4A 3M8SA 5B0CA 4OI0A 4QIFA 1NNDA 3AB2B 3BREA 2WBRA 2W25A 2JLFA 2ZKUA 4P7VA 3CCRS 2V5HG 3BM7A 3P96A 4DJBA 1TL1A 3FGVA 3I4PA 1YRUA 4CIOA 3GIJA 4CO4A 1DHMA 3QAEA 4TNOA 5ADZA 2WTFA 1HNWF 2Q43A 4YB6A 2GIRA 3TNVA 3GWCA 4Q7AA 3I4HX 1ELOA 5T7LA 4M5DB 2DGXA 1FKOB 4CI0B 3KMSA 4RW8A 5J2MB 4O3PA 4PG4A 2Z4PA 4WE1B 2KHCA 2MMYA 2Q66A 2HHTA 2FHMA 3K5MA 4ED3A 1XR7A 4NLSA 4NYZA 2W4DA 2Y1RI 4EBDA 2DH8A 3EPIA 3US5A 3EXYA 2CKWA 2L9NA 2YVSA 1RT1B 3UE2A 3GYXB 1HHTP 2HHVA 1YJRA 3NGDA 4L6V3 1FDBA 1H7WA 3V6DB 2ZBCA 2C2EA 3DLKB 2I8EA 4U6PA 1E6VA 4G1QA 1D0EA 4YP3A 2AX1A 5B09A 1Q16B 3CJ3A 5DDRC 1TK8A 2E9TA 3PVXA 4RBVA 5KG4A 1WACA 4OJHA 2M4MA 3VZIA 3FEXB 2OTJS 1VJWA 2F7VA 2KXNB 1Q4RA 4F2RA 1MMNA 2JFDA 3HLUA 3LH2S 1VQMS 5DJBA 3ICLA 4B9UA 2ZHAA 3UR0A 3DRYA 3DRSB 4ECWA 3POTA 4DV4F 3IWNC 4CTAB 5L1JA 3LP1B 1DLOA 3F44A 3KG0A 2AYEA 5CZVA 2WOMB 1JKHA 3M6VA 3QYYA</