2YH1A

Model of human u2af65 tandem rrm1 and rrm2 domains with eight-site uridine binding
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
b'ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
molecule tags Transcription
source organism Homo sapiens
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh1A02
1KD1T 2CPJA 2RNEA 2KG0A 2CPIA 5JVGQ 3D2WA 1UW4A 2XS5A 1U1NA 4EGLA 1FJEB 2MXYA 2L41A 2QA4S 2D9OA 2CQ3A 1DZ5A 3Q2SC 1BY9A 1KC8T 2K8GA 2MZJA 2EK6A 1X5TA 2JVRA 3B4MA 1O0PA 1KOHA 1IQTA 3CMES 5LXRA 2MZSA 1SXLA 5LSLA 2J0SD 4W90B 2J0QD 2ZJQQ 2AYMA 2I2YA 1W2BR 2DHAA 3H2VE 1X0FA 2LEAA 2DGQA 3H2UB 1X4EA 3VF0B 2EK1A 1WI8A 2G0CA 2MHNA 4QPTA 2L08A 4TU7A 1VBYA 2KFYA 2MKKA 2WBRA 2KVIA 2LYVA 2XNQA 2YTCA 3CTRA 4UQTA 1M5PC 3G8SA 1H2UX 5IM0A 3MUTP 2AYGA 2DGXA 2KU7A 3CCMS 1FXLA 2JVOA 2HVZA 3ZZYA 2MY8A 3CXCR 1D8ZA 2G4BA 3MOJB 1Q7YT 2YH1A 4PKDB 2PEHA 1U6FA 3MUVP 3VAKA 1ZH5A 5DDRC 2DHGA 3I55S 3VAHA 2DGOA 3G8TA 3RW6A 1SJRA 2DISA 2MQPA 3IWNC 3VAJA 4WFNQ 2LCWA 2DGSA 2MKCA 3DXBA 3VALA 1X4CA 3J7ZT 1YI2S 2M9KA 3B4DA 1A9NB 2F9JA 1G2EA 1VBZA 4PR6A 4TU8A 3CCSS 1RK8A 2CQ1A 2ERRA 1B7FA 2DNPA 3PIPQ 4IOAQ 3ULHA 2MGZB 3FEXB 1YJ9S 4Y00A 4OZ1A 2N3OA 4C0OC 3G9CA 4YOEA 3U1MA 1KQSR 1JJ2R 3SDEB 2CPZA 1NJIT 3MI7X 3THPA 4CH0S 2GHPA 2UP1A 3R1HA 2VOOA 2QEXS 2N3LA 1WHWA 3UWTA 2NLWA 3VAGA 2MSSA 1OIAA 1U1LA 4LMZA 3FEYB 1QM9A 4WIIA 1DRZA 2N7CA 3MD1A 1FJCA 1CVJA 2M52A 1VQ5S 2FC9A 1VQ8S 3BO3A 1SJ4P 2RRAA 1H2VZ 3CCLS 1SJ3P 2CQCA 3CUNA 2JRSA 3EGNA 4A8XA 2CJKA 1X5OA 1YHQS 2M4MA 2RS2A 2MJUA 1K9MT 1R8PA 3DLLQ 2I38A 2MQMA 2MZ1A 4WF9Q 2DNOA 1X4BA 1U1MA 3N9UC 1M1KT 1WHVA 3NS6A 2VONA 3CC2S 1URNA 1N88A 2CQBA 3SMZA 3P3DA 1P1TA 5HO4A 3VAIA 2OSQA 5GMKa 1X5PA 2DNYA 2CQ4A 4J5OA 3PIOQ 4WFAQ 3CCES 2XS2A 4Y0FA 1VC0A 3MDFA 2SXLA 3THTA 1K8AT 1YJWS 1FO1A 2KXNB 3CCJS 2DNGA 2ADBA 2LXIA 3ZZZA 3NNCA 1ZZFA 2J8AA 1P27B 5DDOC 4TU9A 3CC4S 1VC5A 2LMIA 1VQLS 2OSRA 3BEGB 2OIHA 2OTJS 2MYFA 1SJFA 3CCQS 2KHCA 2DB1A 2DK2A 2MQLA 5DDPC 4WFBQ 2F9DA 5CA5A 4F26A 2E5GA 4FXVA 3CD6S 1WEYA 4QU6A 2KI2A 2CPYA 3TO8A 2KM8C 1WI6A 1DBDA 2DGVA 2JWNA 2RRBA 2RVJA 4Z2XA 5MLCV 2KT5A 4F02A 3CMAS 2MKHA 2X1BA 2RU3A 4LJMA 5DM6Q 2M8HA 3G71S 2M88A 2V94A 3P6YC 3NMRA 3V4MA 2DNQA 1FT8A 2A3JA 1M5OC 1UP1A 2HGLA 3SXLA 2VOPA 3S7RA 1WHYA 1F9FA 2N82B 1VQ7S 3P5TL 1DHMA 1OO0B 3JB9k 2VODA 5CXTA 2CPHA 2KM8B 4V19X 2DITA 4ZKAA 4CQ1A 2YH0A 2MB0B 1N54B 2D9PA 3L3CA 2EVZA 2OJ3A 4LIRA 1WG1A 4WCEQ 1VQ6S 3CCUS 4PRFA 2MQNA 1VQ9S 2YWKA 2HYIB 2AYEA 2PE8A 1S79A 2E5HA 1S72S 1SJQA 2LEBA 4IUFA 3CCRS 1JJ4A 2KRRA 2X1GA 2G1DA 2MZTA 2X1AA 3NNHA 3P49B 1N52B 2M0GB 2YKAA 2XNRA 1WWHA 1YITS 1Q82T 1YIJS 4U67Q 2GO9A 3BO4A 5H1SV 5CYJA 2NZ4A 1WG4A 1WEZA 2M8DB 2RQ4A 2LKZA 2FPHX 2MKJA 1VQPS 1HA1A 4F25A 2FHOB 2LA4A 2DGWA 1WF2A 4M5DB 3MXHP 2DIVA 1VQOS 1D9AA 5EN1A 2J76E 1AUDA 2DNMA 2RT3A 2O3DA 3Q2TC 1R8HA 5DDQC 2KRBA 5D77A 1VQMS 1YJNS 3HHNB 1JMTA 2MQOA 2XSFA 2ADCA 2Q79A 2DNLA 2M7SA 2OTLS 2DGUA 1VC6A 2DIUA 1X5SA 2CQ2A 2D3OR 4UY8T 5LXYA 3S01A 3CPWR 3G6ES 2LA6A 4QU7A 5BJRA 2KXHA 5HL7Q 3NS5A 2DGTA 1H6KX 2DNNA 5GAGU 3MUMP 3LQVA 1U6BA 3TYTA 2BZ2A 3R27A 3VAMA 3UCZP 2MMYA 4W92B 2ZJRQ 1WF0A 3K0JA 5GAHU 2HZCA 1X4DA 4QQBA 1RKJA 1HD1A 4C7QA 1FHTA 2CQ0A 4ED5A 3UE2A 3RW7A 2DO0A 5LJ5Y 2CQDA 3S6EA 2FC8A 3MURP 1HL6A 4OZ0A 1FJ7A 4C4WA 2M2BA 2BOPA 2X1FA 2MSTA 2HGMA 4FXWA 2CQGA 3U1LA 5GAEU 2DHXA 2MQQA 2MJNA 4YUDA 2HGNA 3EX7B 1WELA 2CQHA 2B0GA 2XS7A 5JVHQ 3CF5Q 1M5KC 4BS2A 2MPUA 5FJ4A 2RS8A 1YTYA 1Q86T 3TP2A 2KXFA 1WHXA 2CPDA 2KG1A 2RQCA 3G96A 1X4GA 5GVQA 1A7GE 5IM0B 3R1LA 3LPYA 1UAWA 1WG5A 2DNKA 1YWXA 2QFJA 2FY1A 1U1RA 3BS9A 3HI9A 5LJ3Y 1OWXA 1VQNS 2CPEA 5GADU 2E44A 1N8RT 3CC7S 2AYBA 1U1PA 2F3JA 1QVGR 3CCVS 2CQPA 2JX2A 2KYXA 2MZRA 1WEXA 3MD3A 3US5A 1NO8A 3J7YU 1U1QA 1U2FA 2DNHA 3UD4P 2DO4A 1Q81T 1ZZNA 1HD0A 2DH9A 3UCUP 2E5IA 3UCGA 4CIOA 2CPXA 2M70A 2DNRA 3IRWP 4ERDA 5LSOA 5D78A 2MKSA 2ZJPQ 1OPIA 2MY7A 2U2FA 4IOCQ 5IFMA 3OW2R 1WF1A 1VQ4S 3VAFA 5IQQA 2U1AA 3SDEA 4YB1P 2MKIA 1VBXA 2CQIA 1QVFR 5DM7Q 1M5VC 5DETA 1WTBA 2LQ5A 2AD9A 2DH8A 5ITHA 1PO6A 1UFWA 2K3KA 4P6QA 2E5JA 1XN9A 3S8SA 2MZQA 1X4HA 4IO9Q 4RU2A 3G4SS 1VQKS 3UD3P 1KOOA 2L9WA 3BO2A 1U1OA 4CH1A 1U1KA 1H2TZ 1L3KA 2MGZA 2XB2D 1X4AA 1X4FA 2LXUA 2DHSA 4TLQA 1PGZA 1FNXH 2KH9A 2CPFA 3I56S 1K73T 1M90T 2LECA 3NNAA 1JJHA 3CULA 2RUGA 1NU4A 3EGZA 2DNZA 2KN4A 4WKRA 2DH7A
chains in the Genus database with same CATH superfamily
2IM0A 2RNEA 4M5MA 2CPIA 3DRRA 3D2WA 4N77A 3BGLA 2JLEA 2JEJA 1U2CA 2VPWB 1K47A 3DYAA 3CJSA 3K2YA 4DOZA 2R2TA 4DR5F 2AJ1A 3D3BJ 5KT6A 4QIVA 2D3O1 5B0GA 5KFZA 1BY9A 3UR0A 2BJ3A 1KC8T 1MSWD 2PN6A 2XHWA 2XMWA 4ICLA 1X5TA 4WP8A 4Y28C 3I0RB 3HHKA 4HACB 5LXRA 3CO0P 2VJVA 1URRA 1HQUB 4NZ6A 3NG8A 4O44A 2BJ7A 1RKIA 3DOLA 1HNZJ 3FRZA 1ZTWA 2OELA 4W90B 1F5AA 1XNQJ 1QSLA 1RT7B 3MCMA 2ZJQQ 2HRYA 2CJBA 1YSJA 1B7YB 1P9QC 1RT4B 2AYMA 2I2YA 4UY85 4R8UA 2G2OA 3AAWB 3KLEB 1BGXT 3H2VE 4BWJA 3H2UB 1OPZA 2AJFE 1S6OA 3VF0B 1WI8A 1VCTA 4OMFG 9RUBA 2VG7A 4LF5J 2V34A 3ICLA 4F36A 4B9NA 3M30B 4TU7A 4DV0J 1RHQB 3R7BB 3WHIA 2FGOA 4IFVA 2BOAA 4ELUA 2ZZNA 4HKQA 2WW8A 2XNQA 3KLIA 4MYUA 5A2QU 3BKUA 4I2PA 1NK5A 3VHQA 5KOWA 1FX4A 2W2NP 3SSRA 4LF1A 3D6HB 1BQMA 4ZP6A 1JKHA 5IM0A 3QIPA 4X64J 2DGXA 1NK8A 2KU7A 4FYWB 2FJEB 2V2ZA 4A8WA 4Y65A 3CCES 2EBGA 2HWTA 4EO6A 4ED2A 3CXCR 3R7NB 4Q2LA 4HHJA 1HFEL 1GT8A 3BSCA 2WVEA 1P1LA 1E6YB 1HBMA 1LNQA 3DOLB 5K8PA 3HMJG 1DAXA 2E7WA 2YH1A 3HO1A 2VQEJ 2CWXA 2E66A 1ZH5A 3AQOA 1CG2A 1G4CA 1IKWB 1TKTB 3PR5B 3OD2A 2DR6A 1J5EF 5IT9Y 1T05A 3RW6A 1SJRA 1U7LA 1TELA 3KK1A 3D0HE 1S1TA 3BGRB 2MLXA 4ED0A 1GMVA 2LCWA 2V50A 3K5OA 4X84A 4X62J 2GX8A 2YKMA 3HKZD 1KVIA 3L7PA 1RYRA 2B51A 2JLFA 2V8GA 1T02A 2M9KA 2R4FA 2ZHOA 4ZPTR 3RAMA 2ZFHA 3W64A 4QWAA 2C22A 1KFSA 4KJIA 5A8KA 3OHAA 1NZ8A 2XBPA 3HSJA 4KC5A 1RHKB 2GMHA 2ZZTA 4K5RA 4RW7A 1GX5A 3SBMA 3D28A 3IWLA 5K8MA 3WZ0A 1RK8A 1EIYB 2E9RX 3GTYX 5ETSA 4EK2A 2ZOFA 4CLFA 3PIPQ 3OQ2A 2MGZB 2UVWA 3W62A 1AUSL 1S4EA 2F65A 1HW9A 4L76A 5J2NB 3U1MA 3T1YJ 4O3RA 2Y1IA 1TQLA 2QTWA 1Q78A 3V6HA 4CH0S 2UP1A 1OYDA 1S57A 3SV3A 2QEXS 4KTQA 1XTZA 5HVHA 4NL5A 2XLJA 1C1CA 1F60B 1NCLA 3BN4A 3DHXA 2PSZA 4F4KA 2NREA 2YNHB 5B0CA 6FDRA 5DZ7A 5DQGA 4NI2B 4ZP7A 1XMOF 2OPSB 3KLHA 3MFHA 1DQAA 2VFUA 1VIOA 5LMUF 4DV1F 1T0TV 1OJ4A 2XY7A 2HHVA 4CDIA 3OUYB 4H4KA 4YN3B 2C42A 1C0UA 5I3UA 3PO5A 3ENQA 5KG6A 3NGKA 2YWWA 1K0VA 3GCWP 4USKA 5A8KB 2BEFA 5KFDA 1VQYA 2V2VA 3M8ZA 1S0OA 4ECYA 4FKYA 3RBZA 1VQ5S 1IBMF 4JV5J 3RRKA 2C2NA 1B0TA 3CJ8A 5CH7B 4I2QA 4OHZA 1S77D 1H2VZ 1NSKL 2A2DA 4AT1B 3CCLS 2YWHA 4P72A 2AQ4A 5LMUJ 3MM7A 3EICA 1RU2A 4A4JA 2N4CA 4HI1A 4O3PA 2JRSA 3EGNA 2IDLA 4X62F 2CJKA 1KEKA 1HPZA 2M4MA 3NLCA 2E29A 3KUEA 2HFOA 1UPPA 4OYBA 1MROB 3M2RA 2E1RA 5ETMA 3SQOP 1Y10A 2XO6A 2RS2A 1HNXJ 3EZUA 3HD2A 4YHHF 3G82B 1U26A 4JI7J 2GZOA 4I0WA 4YY3J 2BQ3A 4B08A 1R6YA 5KFRA 4YEAA 3PRBA 5E3PA 1AROP 5B0BA 2OEKA 1RT1A 4WF9Q 2RHQB 3U27A 1R0BG 1GXLA 3OFEA 2ZH7A 3OTDA 1BQNA 2LDIA 3HSGA 2AEFA 3BGOP 1C0TA 2BMBA 3CD0A 3PVXA 1GEHA 3CSKA 2KYZA 4QOTA 1IKYB 4O0NA 3N9UC 1M1KT 4F4AA 3DGVA 3FDSA 4HT5A 1JLGB 4LREA 2VONA 3NMAA 4KY3A 3CC2S 1JB0C 3IRXA 4CRJA 4KGMA 2RF2B 3QT7A 1NLKL 2CQBA 4ECZA 1RE1B 3POTA 1P1TA 3GJTB 3RB3A 3I87A 2CNLB 3FRYA 4HYKA 2H54B 2B6AA 5D4NA 3RBXA 3UPFA 1T9VA 4FNHA 2CQ4A 2RMLA 2A2CA 5KT4A 4WFXA 4IFYB 4DS4A 5KFCA 4LF5F 3KMSA 1FD8A 1HQUA 2J9DE 2HBRB 3MTKA 5K14B 3UDEA 5C24B 4WKRA 4OYIA 5KFKA 4WP3A 1N32J 1H72C 2GQCA 3VQSA 3WX4A 4CLPA 1UEKA 5DGAA 4KKOA 3JSRA 1AT1B 1FFWB 1RT7A 3M6UA 2KXNB 3DRSA 3HHEA 3CCJS 5GMEA 3ZZZA 3PW5A 4XPEA 3R8YA 2AW0A 3QPIA 3G6XA 5THWA 1LWEB 1P27B 1O6XA 3A8JA 4DG1A 5E7OB 1NDPA 2R7TA 5J2QA 4U95A 1VQLS 4A48A 2OSRA 3A12A 3SZ2A 4CO0A 2XHCA 4C8KA 1U6BA 3F56A 4A8SA 1Y5LB 2RHSB 1EARA 2DK2A 4DR5J 4Q8EA 4ZVUB 5L39A 1H98A 2YKQA 4TVAB 5J2PB 1A6LA 2AGPA 4LF7J 1LV5A 1SUQA 2HS0A 3DLGB 3NS7B 4RPFA 5I3PA 1X60A 2IRUA 3HSZA 2WHOA 2XMUA 2ZM6F 1XK8A 1Y7PA 1EJ7L 2B7CB 2W1BA 4DR2F 1WI6A 2JWNA 2DGVA 4Z2XA 5HSPA 1XNRF 4L75A 2YQ0A 4HR2A 4NXMF 2HAFA 2V5HG 4KFBA 3PY8A 1UVIA 2YY3A 4NYOA 2MKHA 2ZBRA 4P52A 2P5VA 3TUJC 4DR3J 2YKOA 3TAPA 4V1Ak 2V94A 3OLBA 3TWZA 2DNQA 3V4MA 4OZNA 3S7RA 2UUAF 1NDCA 1WHYA 4ILRA 4P74A 4C3MA 3FJ2A 4M5LA 1Q8KA 2OD4A 2C3OA 1GXTA 4YFUA 3X1LB 3VVTA 2B4UA 2VV5A 4MKAA 2DR5A 2VU5A 3P5TL 5D4OA 1VLYA 3JB9k 3BBBA 3SSQA 4URQU 2PI4A 3Q22A 4ZKAA 2CA9A 2R42A 4OX9J 1QJHA 2ZE2B 4K7QA 1SUQB 1HR0J 4JYAF 2IMOA 4OI3A 2GHVC 4CQ1A 1RAJA 4IRDA 1SL1A 3U1NA 4MTPA 4CTAA 3Q8SB 1NB2A 3ZZTA 1J5OA 1WG1A 4ZCKA 4WCEQ 4ZOSA 3E8OA 1KHVA 1VQ6S 1S6QB 1FEEA 2AU0A 3PTWA 3CCUS 4PRFA 4K2XA 4DCPB 1VQ9S 1BWVA 1HHSA 4KPCA 2JFKA 3EE3A 2YWKA 4KAIA 5BYSA 2HYIB 4Q0BB 2BX6A 2YNIB 2C3YA 2AYEA 4CNZA 4MYTA 1FKOB 5DRKA 2E5HA 2UU9F 1DFDA 3GU0A 1C4CA 4FF2A 4A8QA 2LEBA 4KHMA 1HYSB 2GVDA 4DUYF 2KRRA 2X1GA 2EG1A 3CVKA 3T5HA 2G1DA 3UN5A 4DJBA 5HROA 2DR9A 2X1AA 4PZVA 1N52B 1TUGB 1KVKA 3DRYA 3MZIA 4ZITA 1Q82T 4A8OA 1UTAA 2ZH4A 3UO0A 2P2CB 2A18A 3PJXA 2BV3A 3M32B 2CADA 2VPXB 3QYYA 3D6FB 5HMZA 3T1HF 1SIZA 3I5CA 3E51A 4QZVB 2B9EA 1SQGA 1HQEB 2FQQB 1Y5IB 4KHRA 1B4SA 1WEZA 5M2RA 3T1AA 3M2RB 5KFQA 1N0VC 3EDRB 1HHQA 5FDLB 3GB0A 1U8WA 2HIYA 2RQ4A 3UVJA 3K57A 1SB6A 2NSBA 2RDDA 1FNOA 2WRMA 4NLPA 3QGHA 4DQPA 5KFIA 4UQGA 1S1XB 3GG0A 1RT1B 3KFWX 4H4OA 4PWUA 3TZZA 4B3MF 5IC6B 2FHOB 2LA4A 2ROGA 2DGWA 3ELHA 2AWZA 1JLQA 1DARA 2QA2A 3G82A 1T03B 4XPCA 1OSDA 4RWXA 1VQOS 4LBPA 1A9NB 4DL2A 4IDKA 1G6BA 2J0XA 3GSDA 3DLHA 1YJTA 5EN1A 2J76E 2V9KA 1UVKA 1VRUB 3HFVA 4F4ZA 1AUDA 5KG2A 3KLGB 2RT3A 2Q6CA 3ET6A 1AZSB 2FB0A 2DJWA 2RSQA 1RWNB 2WBMA 1NHVA 1VMBA 1TL3A 2COLA 3IRXB 4OZ2A 4RNHA 5D77A 2VZ9A 1YJNS 2Y8YA 1ULRA 1UJ4A 1VOMA 3NGDA 2FVPA 2CJXB 3IXQA 2W9BA 1HMVA 2KT3A 4DEZA 2W2PP 3C14B 4RNOA 2M7SA 2OTLS 1NRKA 4O0IA 2HBQB 2VB6A 4KGVB 3QRPA 3OFGA 4FVCA 1RLCL 2LA6A 4P75A 3KNGA 4QU7A 3AODA 3C16A 1RT5B 3WDOA 1FXDA 2HVDA 4WYLA 1SI9A 3ENVA 5BJRA 1L3UA 4PPZA 4A47A 1B0VA 4L6V3 4RUHA 1HNWJ 2JSXA 3NS5A 2DGTA 4Q5VA 1NKBA 1H6KX 2V2KA 1FD2A 3HHDA 2KT2A 2J6SA 3DDNA 1FWKA 2HK3A 3OXLA 4DSJA 3D66A 3GONA 3BSAA 2BZ2A 3R27A 1FE4A 5C42B 2ZBQA 3AA8A 3FSXA 3ITHB 3RZAA 1EHWA 3B54A 3JYTA 4W92B 4PQAA 5CD4A 4KBIA 4OZLA 5K5MA 3WC0A 4DV2F 1RWOB 1ZOTA 4AQYF 3TANA 4IR9A 1N5SA 2B5JA 3Q8UA 3MTJA 3CNQP 3PW2A 2WZ1A 3DMJB 3AA9A 2ZD1A 4RW6B 2B8QA 4DQQA 1N5TA 4P2FA 3A8IA 3EVWA 1VRTB 2UV8A 3VVUA 5KFSA 5ETNA 1PYTA 2R7SA 4YMEA 2HGMA 2ZHBA 1PIEA 1WKLA 1VFJA 2ACYA 2ROEA 3M8QA 4FXWA 4WWSA 2HQFA 1RTHA 2VUGA 1S1VA 2Z4PA 4UUWA 4YR0A 1Y00A 1RT5A 4ZS6A 4NA2A 1UVNA 2ZDOA 1S9EB 2AF6A 2AJ4A 2OPPB 3M1VA 5KT2A 3EX7B 4KV8B 2XYGB 2B0GA 3GCXP 4CLLA 2K1RA 2P9EA 1JXLA 3QJJA 4Y2CA 4HHHA 3CF5Q 2BQRA 1KTVA 2ZVSA 2VC0A 3H5YA 2J7UA 4NYZA 5IWAF 3PKYA 4J9RA 4B3SJ 1JLAB 2RS8A 4ZCIA 1QTNB 3TP2A 2KXFA 1DTTB 4ZPWR 3TZYA 2GMJA 1MW7A 3SV4A 2KG1A 1Y0HA 3LAMA 2HWHA 5KG5A 1LW2A 1CS4A 2ZUGA 3LP2B 1PAEX 1V6HA 1X4GA 3OXFA 4RNMA 1CQMA 2Y1RI 1WKKA 2WVDA 5IM0B 2JJ4D 4XDDA 4ER8A 1LWCB 4QIEA 4J37A 1CJKB 5KFGA 1Q95G 2ZWPA 3OTOF 4JOUA 4LSLB 1VK3A 2YWGA 1QAYA 3CMQA 2KFNA 3FBFA 1X9WA 2FY1A 3UDCA 3HI9A 4LF6J 1YZ7A 3QAEA 1VQNS 2DXDA 3UFCX 2CPEA 3R6GB 5LOQA 5GADU 1N8RT 1RAAB 3JSYA 3VV2B 4DCOB 1LK5A 2XMMA 3BF4A 1RHRB 2ZBCA 3NCQA 4EWTA 3PHTA 4JV0A 2MZRA 4PG7A 1R6VA 3I5AA 5D15A 1RGVA 3MCSA 3US5A 2V68A 4ATNA 3CEDA 1YBAA 3CJ5A 5AXMA 2DNHA 2HHHJ 5I42B 2V9WA 3LOUA 3HJVA 4ZVOB 5ADZA 1KKHA 2VC1A 2D3ZA 4OI1A 3W2VB 2K7JA 5KFJA 3PW4A 4G1QA 1HD0A 2BE2A 2IVMA 4Y2AA 4EYIB 4PQUB 4WU3A 2QZ8A 3L7UA 2ZKTA 4JB8B 1JLFB 2AJQA 4J9SA 2XMVA 2CPXA 5FD1A 5LSOA 4QCLA 3NCRA 4JI4J 4NLWA 1KN6A 5C2GA 4KYZA 1HIYA 2HBYB 1JLCA 1OPIA 3C19A 4QYZJ 2I5JB 4MK7A 2VA2A 1HI1A 1WF1A 2FVCA 3TNVA 4ZPVR 3JSMB 1VQ4S 3TUPA 3F73A 2MKIA 5DM7Q 1R0AA 3GFZA 4EEYA 2VQEF 3OL8A 4B9LA 2F8EX 4WXOA 2DH8A 4YHHJ 2EXUA 4ZP9A 4JI0F 3T5LA 4M1KA 3O44A 2B9YA 2E5JA 3CDWA 3CWJA 1FKAF 1I1GA 3AB2B 1RYSA 3LALA 5DLFA 1APSA 4PWWA 1ITPA 3KHHA 2QGFB 1O5JA 2AHOB 2W2QP 2YQ1A 3FFIA 3HCXA 2G9OA 1XR7A 4KH0B 1BE4A 2GAGC 2QRRA 2HFSA 1H7WA 2B3TB 3LGMA 1KOOA 3MAAB 4KRWA 1U1OA 1NKCA 1N34J 2LQBA 3GMGA 3VGSA 3KK3A 2Z58B 2XZTB 1V9OA 5RUBA 5E3QA 3D6TB 4F4WA 4FPIA 1JLFA 3PFOA 4P71A 2XWXA 4NA1A 3TUIC 3FSIA 4KGKA 2OI2A 1FNXH 2DR7A 3RRHA 2CPFA 3I56S 1OS5A 4DR1J 1FK9B 2GIQA 2QL5B 3R6LB 5C25B 4USWA 4V19J 2W9AA 2GVZA 1JJHA 1LFWA 4B3MJ 2VFSA 4ED7A 3NNAA 3KKFA 4U96A 2ZWOA 4MFBA 5H9EK 1ZYQA 3DNCA 1K1SA 2W4CA 1HI8A 2KN4A 2HURA 4RBUA 4CWBA 5B09A 4OLOA 4OX6A 3BR8A 3HVAA 3CCZA 5KOXA 1RQ0A 3D7SB 3EYZA 2CVIA 4YB7A 2Z56B 3KK1B 3MMAA 4DUZF 2XS5A 1U1NA 5GAGI 4LRCA 4EGLA 4QYRA 1YG0A 4CLZA 1HR0F 4JYAJ 2L41A 3DN9A 2QA4S 2YKMB 2GGPB 2HAIA 4F4YA 4CT8A 2CQ3A 5J2PA 3JSBA 2PA3A 3Q2SC 1WOOA 2FY8A 3R2DJ 4YDDB 5H9FK 3BDEA 2K8GA 3E3XA 3PYEA 3KDNA 2X3DA 4WBFA 4CYUB 1KOHA 1QAIA 2KZZA 3WC2A 2BM0A 2V8DA 2AEJA 3MMJA 1SXLA 2IC3A 5LSLA 5IT9U 4NEYA 4ANCA 1JXVA 3BPDA 1U2RA 1UKUA 4C48A 3EUNA 2J0QD 1EP4A 1KBRA 2IM2A 4USMA 2HHXA 3AH6A 5F8MA 3RB6A 4O3SA 4K8RA 4DDFA 2XCAA 3M2UB 1X0FA 1JLAA 2R8KA 4HTIA 1RAOA 2BKNA 4MIBA 2MHNA 2P8IA 4NLXA 3KLVA 4IOBA 3I9V9 5E2QA 1FKPB 2E5LJ 2FLLA 5CYQA 1T9TA 1VBYA 4WZQA 4QIGA 2WBRA 2KVIA 1HNVB 1TUWA 3OFHA 2BR0A 2UZAA 3CJRA 2YTCA 4OYAA 2AGOA 2GS8A 1C0UB 2HSEB 3IWXA 4KIAA 1AXQA 1WC5A 4UQTA 3RUBL 4C97A 1H2UX 2AYGA 2VKZG 2YNGA 2XYPB 3Q23A 2C3MA 1RJJA 1DTQB 2JEFA 1E6YA 3CCMS 3D0IE 2JVOA 2Z0GA 1WSRA 1MU2B 1S97A 2MY8A 1SQFA 1S0NA 4WIQA 2IYIA 2BUNA 2XZDB 3C6UA 4I6WA 2A6OA 2Y1JA 4CCHA 3N0VA 1HQ2A 2NXEA 3MM7B 1HWJA 1U6FA 2BJEA 2VKRA 3VAKA 1TVRA 3VAHA 1YDLA 4X4VA 2EFNA 4RNNA 3W5YA 4TQSA 4DR1F 1HNWF 5F8JA 2HNZA 3G8TA 5D6GA 4J9QA 3QGPA 4URSA 1RWPB 2DISA 3JTNA 4ZVTB 3HFZB 5KT3A 4I7FA 2Y8WA 4F3QA 3VAJA 4WFNQ 5DG9A 1RBOB 1WACA 2DGSA 2AGQA 3GV7B 3CIMA 5CABA 3VALA 1FE0A 1X4CA 2W7AA 4TNOA 4QWBA 1SKWA 1P9YA 5BXIA 2C2RA 2AIRB 1N6QB 1IBMJ 4PR6A 3FCVA 1UVMA 1I94F 1UWAA 1SH3A 1DJ0A 1IWGA 1NDLA 4AFFA 3TAMB 4B3TF 3SQGA 4IOAQ 3ULHA 1YJ9S 4X2BA 3AXKA 4Y00A 4MKVA 4OZ1A 1EKSA 1RTJA 4C0OC 5KAKA 4AL7A 1J5OB 1RTDB 3G9CA 2HW3A 4YOEA 3ILLA 4NZ0A 4CH7A 2CPZA 4DSEA 1NJIT 3MI7X 4ZMMA 5HVGA 2GHPA 3M8WA 4WFZA 4JI7F 3JXOA 1XWLA 1S5ZA 1N5YA 4RBVA 2Y0BB 2PO4A 2HNZB 4B3RJ 1MWQA 2F8MA 1CEZA 5ETLA 1JWWA 2XC9A 2NPIA 4ES2A 2Z2MA 3OL6A 2CNOB 5K20B 1U1LA 1XJWB 2O1PA 1QM9A 3H42A 3FSYA 3EDQB 5AT1B 3OR2A 2N7CA 4UF4A 2DPIA 1CSJA 1QTMA 4ITSA 3MD1A 1W2IA 3WIUA 1ZBTA 2YX4A 1TAUA 2H3EB 3OSPA 1FJCA 3QFWA 1N6QA 1FCAA 1RHUB 3C14A 1AB8A 3HVWA 4OI6A 1CVJA 1CC8A 5AE3A 5GMDA 4WFYA 3KHLA 2LQ9A 3BM7A 4H4MA 1SJ4P 3OSNA 2RRAA 4A8FA 1FVQA 3IAM9 2V4RA 3OR1B 1SJ3P 1R8AA 2B9WA 2IJNA 1LWFA 1KNZA 3CUNA 2DPJA 2YX7A 3D1HA 2G1HA 4K59A 4JI0J 1BLUA 3L09A 4HI2A 4RW9A 2VPYB 1OQ6A 3G6VA 3LAKA 4WPAA 3T6JA 3GIJA 1Y3KA 4OV1A 5DQHA 2H5IB 1T03A 3R5DA 3EMTA 4ZVPB 4NXMJ 4IDKB 2ZNYA 1K0TA 1NHKL 1RP5A 1VJQA 1NXIA 4IFVB 4AL6A 5C5JA 1A0OB 2MLZA 3QLHB 1RB0A 1U1MA 2DVIA 4JI2J 3IC1A 4Y6IA 1WHVA 2CNNB 4F0KA 1EX8A 2EFOA 1N36F 3KLIB 2DXFA 3TJ8A 3BV8A 3A3NB 4CYUA 1CBKA 3G4SS 3LO3A 3RGIA 4ZP8A 3QJPA 1NPRA 3DDIA 1M0SA 4ID8A 4X4NA 3VAIA 2OSQA 1YGYA 2OMLA 4WE1B 4M5IA 1S1UA 4R0JA 3BQ0A 3SYZA 1NEEA 4DCJB 2UVRA 4JV1A 4OHYA 4DV1J 3PIOQ 3W66A 1PJ6A 3FEZA 2UXDJ 4J9MA 3M8YA 3QIPB 4WFAQ 3S1TA 4GKJJ 3MDFA 1T95A 1KQKA 7AT1B 3QWPA 1YJWS 1T9YA 4NOHA 4DV6F 4C0HA 2PI5A 2DNGA 3EVOA 3T9ZA 1VHIA 1HBNA 4YDXA 2I1RA 3EM1A 1NDKA 4RUAA 5CCMA 2HVIA 3CC4S 4C8LA 1QAJA 4NPOA 1FF2A 1LW0A 3QT6A 2LMIA 3OHBA 1FWLA 1DQ9A 1LXNA 1RA7A 1RWMB 2OTJS 4OYWA 4LFCJ 4K0KJ 4R25A 2GV1A 2XLIA 1RUSA 3MEGB 1UWBB 1W25A 2DB1A 3SCLE 3KHRA 2QA4G 3DRXA 5F8HA 1CJKA 2KJVA 2WONA 3A13A 6AT1B 4WFBQ 3I6PA 3T9NA 4BCAA 4F26A 1MNEA 3MMBB 2E1MC 1VYAA 2E5GA 3AB4B 1WEYA 3PFEA 4FXVA 1V5IB 3M8QB 3PV8A 3CD6S 2V4JB 3TO8A 2CPYA 2DKOB 5A8WB 5DO2A 4CZCA 5MLCV 2YX1A 4DUZJ 2FJVA 3TX0A 5F0UA 3DI6A 1N4LA 4F02A 3IP0A 4MT1A 1HW8A 2X1BA 2AEMA 4LJMA 4DU8A 1Q5YA 3O6QA 2W8KA 4F2RA 4NI2A 4NX9A 4TKTA 1IM4A 2M88A 3HVRA 3SEOA 4JI6F 5AXLA 5E41A 4CP5A 2R2SA 1TFWA 3KWMA 1S1WA 1S99A 3NMRA 5J1EA 1RAEB 5E0OA 1WDTA 1RWWB 4ECUA 5DG7A 1M5OC 4FF3A 1S49A 1UVLA 2QMUB 5HP1A 1F9FA 1QUVA 1MMNA 4F7VA 4M95A 2F7VA 2UXDF 2J9CA 1VQ7S 3OL9A 3VR1A 1YRUA 2YPYA 3BR9A 3EZOA 3FCHA 4ZVRB 2OLWA 3R7SB 2DITA 1NAQA 2W9CB 2G0JA 3PR4A 4YB5A 1LXJA 1XR5A 2WONB 3D5MA 4OYXA 3FCWA 1TKXB 2HWIA 2WTFA 3PO4A 4I6YA 3P5BP 4K4UA 2K7KA 1F6TA 3JQKA 4MIAA 1IR1A 5A8WA 4KB7A 3PKMA 2D9PA 3KJNB 1JLCB 1YVFA 4FKXA 3L3CA 3ZZOA 1RHMB 1XMBA 2C28A 3UI3A 4USUA 1UW9A 3IFEA 3MEEB 2FLPA 4L74A 1JLBB 3OXGA 3BZQA 5HQMA 2FJDB 1JQGA 3I4PA 3V6DA 2XULA 1JK9B 2NUHA 2OFGX 3KOAA 1IQTA 4NXNF 2PE8A 3HM9A 4KT0C 3T5JA 1KWMA 1TAQA 3KJQB 1GTEA 1SJQA 3CCRS 4GRSA 5IXUA 2J7WA 3I31A 1PYSB 1U24A 4NA3A 3OL7A 2R7UA 2XGPA 3NNHA 1FRHA 2WOMA 3M7VA 2YKAA 1KLNA 2XNRA 2EI5A 1RLDA 1EETB 1YITS 1IBLJ 1JIHA 3KLFA 1CJVB 2RF2A 5L9XA 1H0HB 3HULA 2D7SA 4CO5A 3UVJB 5HMWA 4U67Q 3MWBA 1JKHB 4FYXB 1TL1A 5JMNA 1SV5A 2XMTA 2M8DB 5T7LB 1S0VA 3LP0B 2Z2YB 2VPZB 3POTB 2NSCA 4RLEA 4DR4F 2BQUA 1EZZB 2I8EA 4IH5A 4K5SA 2EG2A 4K4XA 1FRKA 3EPIA 2DT9A 2RILA 4ID5A 3DOMB 4F25A 4AUKA 4NLYA 2NUUG 2B4PA 3CCTA 3MEKA 2ZH5A 3MXHP 3LANA 5CHCB 5CYMB 4DU7A 1GMUA 1D9AA 2NYHA 1SVDA 2HNYA 4PG6A 2WVBA 3AY0A 2DNMA 4DR4J 1GH8A 5L8RC 1R8HA 3P49B 4YS2A 5DDQC 1UJ6A 3PJ9A 2OPQB 5DZ6A 5KG0A 4LRDA 2ZH3A 1VQMS 3CT9A 3HHNB 2HZAA 2KVQE 5HBMB 2F40A 2BKPA 3AOBA 1NJZA 2ADCA 1FFGB 3A8KA 1JNZB 2DNLA 2AX1A 3MM8B 3WX8A 4EBDA 1YKWA 2DHHA 2ZEJA 3AD7C 4N47A 3Q8RB 2DGUA 1NH7A 4NLRA 2HQCA 2D3OR 2CQ2A 2ZC4A 1NK6A 1TZ0A 1NPPA 2C2EA 3S01A 3CPWR 3N79A 2UUCJ 4DFPA 3EJMA 1D3WA 1EQ0A 2KXHA 1N33J 5C25A 4ZVGA 1Z4UA 2FJXA 1IKXA 3KXDA 2DNNA 2R2UA 3D1OA 3J80Y 5KFVA 3QMQA 4USIA 4RU9A 2I0XA 1J5EJ 1F9EB 3R5AA 1T3NA 1C1CB 3QNWB 1G3OA 1TKZA 2OHDA 3AOCA 2N4DA 1K44A 8ATCB 4X4QA 3MR6A 3UCZP 2VG6A 3MECA 2ZJRQ 2DR8A 1Q8LA 3IG1B 4LR8A 1TMJA 4I6AA 4NZ7A 4Q7AA 2OEJA 3NL0A 3SIPB 1RKJA 4M5NA 4ZDNA 5A8RB 1FHTA 2CQ0A 1HNIB 4NEZA 1NNDA 1VRTA 3UE2A 4ANDA 2CDQA 3Q8QB 3T1HJ 3S6EA 2FC8A 1VS3A 2PGCA 3MURP 4DN0A 4EZ6A 1H7XA 1IKVA 1ZPVA 3N01A 4HLBA 4ZVQB 4OZ0A 1FJ7A 1R31A 1REGX 3QAUA 3GFYA 3R5CA 3W8GA 1H3DA 5AE1A 4MKBA 4RWWA 1U8SA 3KK2A 2MSTA 3OTCA 2DY9A 5BR8F 4DSIA 1O8BA 1V5VA 4IR1A 4FDFA 4DS5A 1JNRB 2BJ9A 3UQSA 4X4TA 4FVMA 2Z8QA 1TKDA 5A0YA 3P8BB 4ETXA 4QYZK 4YUDA 5CAAA 1S1TB 3BGRA 2NXUA 4DV6J 1XIQA 2CQHA 2CXEA 4FBUA 1S1WB 2XS7A 3TW0A 1PC5A 4Y34A 2WK4A 2ALZA 5B08A 3VCDA 3GIMA 2HHSA 3NXZA 4PG5A 2QA1A 1LWXA 2OEMA 2WSFC 4LR9A 3K5LA 2ZH2A 2AX0A 4M5GA 3QO9B 4U7UK 3OTEA 1DLOA 2CUYA 3ZZUA 1HBUB 2PMZD 3IM9A 2UUCF 1KONA 4ZLLA 3W61A 1WHXA 1NK0A 1C0TB 3D68A 2O5DA 4C11B 4WK3A 4F4XA 1JXEA 2GCFA 5A76A 3G96A 2RQCA 3IO1A 5L38A 1VIXA 2OGUA 3G8QA 3Q8YA 5GVQA 4OZ3A 4C8MA 3FFIB 1IM6A 4LT6A 2J7KA 4JI2F 2IA6A 1UJ5A 2AP6A 1QLNA 1IBKF 3HHLA 1KR4A 1MU2A 3PACA 2XY5A 2CJ9A 1UAWA 1WG5A 2DNKA 2YBVA 3HDSA 3DCAA 2QFJA 2ZUAA 4DN9A 4YQWA 4F2SA 3BS9A 3HK2A 2PDAA 5LJ3Y 3GV8B 5HATA 1FDDA 1S1XA 1L3VA 1QUPA 2E44A 2KKHA 4IFYA 4F3OA 1HQEA 4CLSA 4R5PA 2CFXA 4ZJQA 3BPSP 2F3JA 1UFKA 5DQIA 1MN7A 4CO4A 4OL8A 1F1BB 5CCLA 2CQPA 2LEPA 2JX2A 5CZVA 4O3OA 2BJ1A 3QO9A 3W2VA 2HQ3A 2FYXA 1UZDA 2ZM6J 2XCPA 4U8YA 2HFVA 5F0WA 5KFAA 3UNYA 1AZSA 3ONQA 4RR5A 2ACMA 2X7IA 3MM5A 5CQGA 1Q81T 5D3GA 5KFPA 5KFEA 3J81j 3V6JA 1TV6A 2JH3A 1ZZNA 4PUOB 1HARA 2E5IA 2GFFA 3PHEA 2K3IA 4CLKA 4NXNJ 4DV5F 2HLUA 1KTQA 1SV5B 5T14A 1V3ZA 4QWEA 3RTVA 4UTGA 1AFIA 3M6XA 3C46A 4RX6A 5C7PA 4OHWA 4I2QB 4F0HA 5D78A 2XY6A 4NCGA 3SCKE 3TARA 5H9EJ 2BW2A 3FC9A 2MY7A 3LP0A 4PXBA 2H4YB 3QGIA 3TVYA 2CKWA 1GAOA 3ZC4A 3VAFA 1NK7A 1FRLA 2U1AA 3H2LA 4R0EA 3OFFA 3SDEA 4DMZA 1VBXA 1QVFR 1UMJA 4RW4A 3GIIA 4WZMA 2BRLA 3O2IA 1IKYA 1WTBA 3OBIA 2QSFA 4MJKA 4P9SA 1Q0NA 5ITHA 4TY8A 4Q44A 2K3KA 4DL6A 3IGNA 1O51A 4P6QA 1XN9A 1VRQC 1C1BA 4TYBA 3UNGC 5HN0A 1BC6A 3C2PA 3KNAA 3OR2B 1X4HA 1FX2A 4S0MA 3V6KA 4YR2A 2QYCA 1IWAA 4LF8J 5U47A 3LW5C 4RW6A 4Q43A 1D1UA 2H5JB 1M5SA 1Y5NB 4FN5A 4NRTA 4F04B 2L9WA 4J9KA 3UD3P 1VQKS 2KFZA 2IDEA 4CI0B 4U9RA 5HBMA 2IFXA 4WKYA 2BE7D 1N36J 2FHJA 2MGZA 2H9ZA 1X4AA 1X4FA 4J9VA 2D74B 2FZGB 4F50A 4ECRA 1UA1A 2W7PA 3FK4A 3W8PA 3RAQA 3CO9A 4TLQA 1PGZA 4A8MP 1YLXA 2VFRA 4MFBB 1VBKA 4OI4A 4DUYJ 1S4FA 3UW1A 3M8PA 4DR7J 1S7HA 1M90T 2P9GA 2VH7A 3RU0A 4KV8A 1E6VA 3L9ZA 1XEZA 4Z37A 2RUGA 2YNHA 4K4ZA 1NU4A 4KGXB 2XEXA 3RBEA 2QJ3A 2DNZA 2D69A 1BHNA 5IT0A 2KZMA 2DH7A 4P7TA 4DV7J 1RTIB 4TY8B 3HHLC 4HDHA 4ELVA 4B3OA 1ZM3A 2GMLA 1VQSA 2BA9A 1UW4A 4CM2A 3MCOA 3ZNJ1 2JLGA 1T05B 1U0HB 4EZ9A 2MXYA 2PIIA 2QLWA 4IH7A 5J2QB 2BYCA 2VQFJ 2B4OA 2IJFA 4ZIWA 3KJFB 1ZA2B 1DZ5A 4Q8FA 3H40A 1GMWA 2X51A 5GAHI 4U7UD 2MZJA 1OYEA 2VDHA 2XQCA 4ELTA 2JVRA 1T9WA 3B4MA 3WQPA 4F8RA 3FGVA 3BYRA 4UW2A 2MZSA 1PSDA 5EX3A 4EU0A 4DSFA 3RBDA 2AZ1A 2J0SD 4JI1J 3DU6A 4FYVB 3NAIA 4RBTA 2GA7A 1RBLA 3BYPA 3ZXWA 3QZ7A 3P4UB 1CJTA 4MH8A 3EPGA 3P45B 4DFMA 1F3VA 2HIQA 2HNDB 3TQEA 1S9GA 1Q8BA 2DHAA 5F8IA 5IT4A 3WBZA 4UOFA 3ETOA 4ECVA 1HNZF 2LEAA 5CD4H 2R7XA 1KP6A 1X4EA 2LQ8A 2MTLA 1TL4A 2EK1A 1IJFB 4QWDA 4NLQA 1KSPA 3NRBA 1HKAA 2NXJA 1CQNA 4NLTA 4C11A 4I69A 2AKWB 4K4SA 4L73A 2L08A 4OIXA 2GW8A 3NY0A 2MKKA 2BE2B 1FTRA 1CJUB 1RU1A 4OQJA 2E7XA 2HVEA 3MMCA 5FLXY 3J7Z5 3HHLB 1U45A 2R8JA 3TVZA 3MUTP 2H65B 3GYXB 3OPKA 3BQ2A 1NSQA 5I42A 4AE5A 3H5XA 4DQSA 4UOGA 1FXLA 2L48A 3K5MA 4HEA9 3OVSA 2F4VJ 4G1QB 4I68A 4C8YA 5LL6d 2B43A 5H9FJ 3HP6A 3MOJB 2EBEA 5HAOA 1Q7YT 4GC7A 3FZ2A 3F41A 3MEDA 4PKDB 2PEHA 5JXSA 5HQ8A 4MKYA 1RBAA 4JBCA 4CO1A 2DHGA 3I55S 1LK7A 4OI0A 2DGOA 2G2YA 4M5JA 1HPZB 2Y0SD 1XMQF 3CD7A 4JV2A 2W4PA 2RKIA 1FTCA 3W63A 3KG0A 4ZPCA 4KR0B 5I3QA 3IWNC 1BQNB 3NGTA 1MMDA 5H1SV 1AA1B 1KS2A 2IAJA 4O4GA 1UCNA 4YB6A 4QW8A 3UN2A 4QWCA 4BBYA 3V81B 1EQMA 3FVYA 1TL7A 1UETA 3B82A 2BM1A 1WD6A 2GVDB 3B4DA 2F9JA 4KQZA 3LH2S 2AZ3A 3MAAA 1G2EA 3R5JB 2XLKA 4ZVEA 4P7VA 3GFXA 4UZBA 2QV6A 1TKXA 2POKA 2W2OP 1EKRA 2E9ZA 4FS1A 2IVFB 3PX6A 4U7CA 2CQ1A 1FJGJ 4HTJA 5F41A 1S6PB 3FKBA 5AJ3F 3E01B 1XBWA 3N5FA 3V4IB 1B7FA 1WC0A 3FEXB 4ZLNA 1WOPA 1R8CA 2NZCA 3A3OB 1F0XA 1Q5VA 1JJ2R 3SDEB 1XMOJ 1KDNA 2RU9A 3THPA 1H74A 3VGUA 3R1HA 1JLBA 2N3LA 3CJ3A 3O5TB 3UWTA 5KFOA 2APOA 3K58A 2EWHA 1RWUA 5F3ZA 2AT1B 4ED8A 3K59A 3IBCB 1REVA 2NLWA 3J80U 4GKJF 1AYEA 2QE5A 5E33A 2ZNZA 1YBUA 5E3RA 2R7WA 5F8LA 1JLEB 1NZAA 2CZVC 4ZPDA 1IJEB 1TL7B 2YKNB 3QFHA 3GILA 1VRUA 4G6VB 3D54A 3GYNA 3CDEA 4CT9A 2ZH9A 3KUGA 2CDRB 4WJBA 1RT3B 3JTPA 1RT2B 3DLGA 2FZKB 2G0IA 4PXEA 5KG3A 2FC9A 2BACA 2R7RA 1VQ8S 1OMSA 1N34F 1F3FA 1LQ9A 4PPDA 3UN3A 3H98A 1S6PA 3FNNA 2J8SA 3LF0A 1WSVA 2A0FB 1ZM9A 1NB7A 3PRDA 4A8XA 1X5OA 1YHQS 3G87A 4OHVA 1Q53A 4IO1A 3ENWA 5J1PA 1GQEA 2MJUA 5D0EA 3ITHA 3M8RA 1SBRA 2XTJP 4URGA 2N7YA 1R8PA 3JYTB 3DOMA 2VIHA 3SI8A 3DLLQ 3R2CJ 4W98A 4B17A 2IMWP 2MZ1A 1OSCA 2XGQA 4DBQA 3HJFA 1VHFA 3W9IA 2C2OB 2DNOA 4DX6A 2HNYB 1RWXB 2YWEA 4DFJA 4OHXA 3IR7B 5AE2A 1AW0A 3AD8C 1I94J 2KL8A 4EO8A 3TZWA 4DV3F 3NS6A 3GQCA 4WE1A 3VGTA 1D9DA 2ZH8A 4B9UA 2VASA 2JNJA 2QL7B 3ZTOA 1URNA 1KLMA 1N88A 2UVVA 5CYQB 2V8HA 4O4RA 4ED3A 2V0NA 3P3DA 3HZEA 1U0SA 2VFTA 1S9FA 2W8LA 4ANEA 1S9EA 2OPPA 1SC3B 1QY7A 3PDNA 2DNYA 4X4PA 2RIJA 2ZE2A 4DF8A 2E5LF 1RZMA 2YNGB 1ELOA 3PYFA 4I4BA 1I3OB 3H7HB 4OI2A 4Y0FA 3R97A 2HNDA 1U02A 3THTA 1OY6A 1K8AT 1VLOA 1NH8A 4RO0A 3VZHA 3T3FA 3DLKA 2E1AA 2RDIA 4JI6J 4DL3A 4Q0BA 1GMWD 4DFKA 3D1QA 2YNIA 2LXIA 3OUYA 2ZDPA 4USTA 5IC4B 1N56A 2J8AA 3CGIA 1IBCB 3T1YF 1DLOB 1NJYA 5DDOC 1Y11A 4TU9A 2OPSA 4NASA 3GIRA 3KLHB 3PW0A 2G2ZA 1CJUA 5HVFA 3Q24A 2ROPA 2G13A 2W24A 3BEGB 2B9XA 3IR5B 4RJVA 1SJFA 4Y2MA 3ZZPA 1T7PA 1F2GA 2KHCA 1U48A 2CG8A 4NLDA 2MQLA 3GJQB 3NGUA 1VI7A 3CJTA 3H8YA 4X4OA 1RAGB 3IM8A 3B6BA 2F9DA 1ZTTA 2UXBJ 1WJ9A 4IH6A 4ECQA 4ED1A 3QRQA 4O44B 2EC2A 1OY8A 1J27A 2KI2A 2WSEC 2KM8C 4ILLA 1DBDA 2RRBA 2C1EB 3HFKA 4LSZB 4AXIA 5A0YB 2F4FA 5KG4A 2BDPA 4FF4A 4RUBA 4LBIA 2KTQA 4OZ5A 3AFGA 4TYAA 1Y3JA 3FQKA 5KFTA 2R9LA 2Q43A 1TUVA 2M8HA 1SQEA 4LSNB 4U8VA 3QBCA 3JAMU 1YZ6A 2O66A 1GX6A 4PXCA 1SIWB 3HPOA 3BSNA 2LDYA 1FT8A 3GR0A 2R3VA 3HHLD 3MM6B 2VFVA 4XK8C 2BRKA 4BDPA 2QLXA 1HWLA 4NLVA 3SXLA 4E98A 1G7CB 3PEJA 2C3PA 3QT5A 4I1TA 4IYQA 2IRXA 2ILYA 2N82B 3OTOJ 2KO1A 2RJZA 2VBZA 4JI8F 1DHMA 1OO0B 1IXKA 2YPZA 3FQLA 5KT5A 5L1KA 5E3CA 1YI2S 4V19X 2VODA 1MWZA 2RQMA 3HT0A 3I9ZA 4UOHA 2F8HA 4XTTA 1WC3A 4WU2A 4ES3A 2XMAA 1PJ5A 5A6WA 4NE9C 5BYRA 1WC6A 4F3MA 2I5JA 4L72B 1NM2A 2DRAA 3QATA 2DXEA 3ENAA 1HMVB 3CJ2A 1FESA 2FZCB 2YKPA 2DCUB 4LIRA 5G0RA 4ECXA 5F8NA 3E2EA 4QR0A 4RW8B 3M2VB 2QMWA 3ZTQA 3GSIA 4X4UA 4Q2MA 3THVA 1HBMB 3DRSB 4M8LA 4E0DA 1Q1KA 3DU5A 4N8NA 1Q16B 2RUSA 4MK8A 1S72S 1LWEA 1N48A 3GFHA 4IUFA 2H4WB 4DG1B 3MOZA 3MPDA 1BUXA 3O3LA 3KDOA 3RB4A 1K1QA 2H51B 3IA0A 2L9NA 4KGZB 3GWCA 4X66F 3HT3A 3PW7A 3KMQA 1YIJS 4HHUA 4ZJLA 3F44A 1L3TA 3R5BA 1ZM4A 4LF8F 2HVHA 3GP9A 2GO9A 3VZIA 3NAHA 1S76D 1P6TA 2EFQA 2FHMA 2I9SA 1S1UB 3DFEA 4UUXA 5CYJA 3MAQA 1ROFA 3CJKB 2RQKA 4N76A 1AFJA 1S59A 3C8YA 3IS9A 1RADB 4LVOP 4OJ3A 2BJDA 2FJBB 4LF4J 3PJWA 3M1VB 3I0SA 3ZTPA 4EMDA 5E5NA 4N7TA 4NLGA 1U09A 2LKZA 2CRLA 2FPHX 4J9PA 4OYMA 1HA1A 3LGNA 1TVRB 4TY9A 3PZPA 2AV5A 4OYPA 1VQPS 4GVLA 4GKKF 2GVZB 2A1BA 1WF2A 3H4DA 2PMWA 4DWIA 4B3OB 5B0AA 3SCJE 4GO5X 4PAAA 2DEJA 4MIWA 3EXCX 2GJIA 3TEHB 5I3UB 2UXCF 1FJGF 1UFLA 3L95X 2IA0A 5D0GA 2VJUA 1NSPA 4P2SA 4Z7YA 2ASJA 1HBUA 1FWPA 1NPKA 2KRBA 2QSWA 3KHGA 2LU2A 2C2DA 1RAFB 2VG5B 3V2UC 3MR3A 2NS1B 3CD5A 4XAKA 2MQ8A 4N5SA 4CTAB 3RAXA 1YJUA 3EGVA 4CLYA 4CLWA 1VR6A 5ETPA 4ZLJA 4UT4A 5D8HB 2OO4A 1KLMB 1VC6A 2HRUA 6FD1A 4RUCA 2XM3A 2W7OA 3UDVA 3G6YA 4OJHA 4BWMA 4OZJA 2P6SA 3X3UA 4IG0B 2UXCJ 3G6ES 1CULB 2VD3A 4DL4A 1YRTA 4PYAA 2IC3B 5HL7Q 4DR3F 3TOQA 5HANA 1I51B 4B9MA 2FGCA 5GAGU 3LQVA 3NBPA 2LLZA 5HK4A 5D4PA 4CLTA 1R0CB 3ZTRA 3DLBA 3TYTA 2LQJA 3Q89A 2J9EA 1NJXA 5SUHA 2C2KB 3ISZA 3RG6A 4QPXA 3VAMA 2MMYA 1WF0A 3ILOA 5IQ6A 1RT6A 1HWKA 2PA8D 1X4DA 1U0HA 2IVYA 3C66A 4QQBA 2NPFA 4C7QA 1S10A 2EEYA 4ED5A 2GIFA 3RW7A 5LJ5Y 1CLFA 2CQDA 2FD2A 1R89A 4KO0B 1PAUB 4NLSA 2KHDA 5HP1B 2ASLA 1S12A 4B9VA 3M4XA 2BANA 3QRRA 1YBTA 1Y4ZB 2CJYB 4ENOA 1ZAXA 4DHVA 1TV6B 1N33F 2X1FA 2YXLA 4IG3B 2NCKL 4QJVA 1I5OB 2CQGA 3D9BA 3GYGA 5K14A 4Q45A 1CULA 2YQ3A 3JAMY 3M9OB 4PG8A 3BJYA 2P9CA 2MQQA 2J6UA 2MJNA 3CE8A 3JQMA 3GJRB 3QIDA 3MAHA 4KKOB 1KHWA 2JHEA 1FEHA 2EKNA 3M9MB 3JSMA 4TN2A 2R8IA 2QMXA 8RUCA 2ZVIA 3OLAA 5JVHQ 2RKIB 3TVKA 4BLGA 1MN9A 3DGPB 3QSIA 3VWSA 2IAJB 4O4GB 1SKSA 1XNRJ 4ZA1A 1TL3B 1SC6A 1Q86T 4Y2IA 1ACMB 3DHWC 1ZM2A 2VQFF 2FVSA 2L3MA 3KLGA 4LRFA 2NXCA 3DM2B 2RB7A 4ZPBA 4WK1A 4ZHRB 2HZVA 4RKUC 4ECWA 5KFFA 4EUVA 2IBKA 2UUBJ 2PMHA 2C2ZB 2D1CA 5AXKA 3QZ8A 1A7GE 1R43A 2Y3YA 3DOKB 2HRTA 2WVCA 3TA2A 2RDJA 3R1LA 1WORA 3WIVA 2EFGA 5EGYA 2QT7A 1EETA 2J0WA 3LPYA 1DY3A 2HFUA 4GC6A 1OY9A 1YWXA 4C2MA 4DF4A 1U6ZA 5L1IA 5FDLA 4NWBA 1XQIA 3AHPA 4OYOA 3CC7S 4IQMA 2AYBA 1TL1B 1U1PA 3C3LA 4B02A 3M2UA 4HDGA 3CCVS 4WTYA 4HVZA 3KUHA 3PYGA 3FBBA 3M30A 3KLEA 1RT4A 2KYXA 1RA6A 1WEXA 2C2MB 3MD3A 5ETQA 2WB4A 5CYMA 5HJXA 3GJSB 3H0PA 4U6PA 4DR7F 3P6YC 2YKNA 1NO8A 1U1QA 2J6TA 3UR3C 3MM9B 1U2FA 2PT0A 2IJRA 3T19A 4BHQA 4LR7A 1SKRA 4X4SA 1SL0A 1B70B 4LFBJ 2Z57B 2DO4A 2QG9B 4ZHRA 3MPWA 3HF5A 1BMQB 4NLUA 3FZBA 5J2MB 4FYYB 3UCGA 1X7VA 3JS9A 1MLAA 2IY5B 3J81Y 1LFPA 1WOSA 4CIOA 4ZVSB 1IBLF 1D9FA 1VJWA 4LF9F 4LQ3A 1BQMB 1SCJB 4FPRA 1QAXA 2QX0A 1UVJA 3NWGA 2M70A 2DNRA 2FLOA 4H4MB 4RW9B 3BBFA 1GNKA 4ALZA 3IRWP 1S6QA 4ERDA 3I0SB 3ISNC 1J2VA 2K1RB 2F63A 2JEIA 1T9XA 4Z7CA 4LVNP 4IOCQ 5KT7A 2KDOA 3O8WA 5IFMA 3KG4A 1YX2A 5D0RA 4QU6A 1VISA 2Q1LA 4YB1P 2CQIA 1JJCB 2FLNA 4PWDA 5M2PA 1F5BA 4EBEA 2Q66A 1YJ7A 2XI3A 2LQ5A 5KFHA 1S9GB 1SC4B 3KJVB 2AD9A 1PO6A 1HYSA 2B4VA 1CS4B 5K8NA 2P6TA 2MZQA 5KFXA 3PEHA 1PC4A 2ZZMA 4TXSA 4RW7B 3CDAA 1PJ7A 1H73A 4J9LA 4IO9Q 5DS7A 4O23A 4RU2A 2E9TA 4DV4J 1EB0A 1N0UA 4X66J 1KRPA 5ETKA 1YRXA 2B5JB 4DV5J 4B9SA 4OX9F 4K2JA 1R3NA 5A8RA 5J2NA 1NK4A 1WTFA 2VG5A 1L3KA 2M5YA 3TAMA 2DBBA 4IG0A 2HS3A 1B3TA 3Q83A 2XB2D 4UZCA 2R8GA 2OPRB 1F5CA 2A10A 2F1FA 2F4VF 1BWEA 1IKVB 2DHSA 2V2QA 3M8SA 3FBCA 4GO7X 3K5NA 2JZ5A 3QGGA 2R2RA 1U47A 4CNYA 4C8NA 1S1VB 1K73T 3DLKB 2Z2ZA 2EW9A 4CM0A 2DCLA 3H5SA 4ZVHA 4ED4A 3GIKA 4ECSA 2LECA 3Q8PB 4RZRA 1Q79A 1PILA 3CULA 4DLEA 4LIWA 1LOUA 1SKUB 3GPAA 4MMOA 4J91A 1F9HA 4KHPF 4PWDB 2RAQA 4FYDA 3HXMA 1WC1A 5F9LA 1ZAVA 3MEGA 1KD1T 1WDDA 1IN0A 2CPJA 3FMBA 3IR6B 3O1LA 4PXDA 4WYWA 2J5AA 2KG0A 5JVGQ 5LMNF 3MCNA 5KFUA 1TP7A 1NKEA 3IBFB 1FRJA 2EC0A 1FJEB 4C3KA 2VBXA 1RT6B 2MDAA 3V81A 1Z2ZA 3TAQA 5JJBA 4B3TJ 2D9OA 5M2UA 4E2FB 3AD9C 1HHTP 3DLEA 3DRPA 5KFYA 5LSRA 2JC1A 1UWBA 2Q6BA 4XO0A 4LF7F 4PQUA 3ET6B 2CG4A 1CJVA 1M1GA 2EK6A 4F0MA 5HJYA 2CYYA 2MHEA 1O0PA 3NKYA 3ZTSA 2CIMA 4AD6A 2DYAA 3OJSA 2OD6A 3CMES 4FF1A 1HLWA 3SQGB 4CLUA 1T9UA 4YR3A 3AQPA 4J9OA 1UEUA 4PUOA 1X0PA 4ETZA 5IZHA 3HSDA 4I67A 5EDWA 3VTIA 2W4DA 5A2QY 3AXMA 4P10A 3GV5B 2BKOA 2BVZA 2R7OA 2R8HA 2FVQA 3W9HA 4USJC 1W2BR 4ZCMA 2DGQA 2M3DA 3TUZC 4JI3F 3LWMA 3PM9A 3C15A 2G0CA 1W26A 4R5PB 4QPTA 2OFHX 3MGJA 2K2PA 3QLHA 4R8UB 2LP4A 4WXWA 1RHJB 3TA0A 2ILZA 2KFYA 4PCQA 2LYVA 3SSSA 4ZN1A 3NEKA 5D3GB 3RR8A 1MWYA 1TK8A 3CTRA 5IV4A 1M5PC 3G8SA 3CB4A 2L9DA 5DG8A 4DV4F 4JI8J 2RD5C 1RWKB 3DOKA 1RT3A 4DV3J 3W5ZA 2HVZA 4I2PB 4OYZA 2B6AB 3BGUA 3ZZYA 3C6TB 2VBYA 2H48B 4DV2J 1F2HA 1D8ZA 2CNKB 8AT1B 2G4BA 1PG5B 2QLBB 2FVRA 3J7YI 1M5HA 3SCIE 4O3NA 2XMJA 3MUVP 4DV7F 4H4OB 5DGBA 2DTJA 2H1YA 5DDRC 5FLXU 3CDBA 4DZDA 2UVUA 3MMAB 3BREA 5AXNA 1ZS6A 4KSEB 3W2WA 5CZXA 1MG7A 1FDNA 2MQPA 3FUYA 1XMQJ 1DTTA 4DR6F 2PFFB 3JQJA 3LWLA 5L9NA 2GGPA 4DPWA 5GADI 4DR2J 4ZCLA 5BYQA 3Q8VA 5E3AA 3OT9A 2MKCA 1I6JA 1EAYC 2YVSA 3DXBA 3J7ZT 1QE1A 1WUUA 3DKDA 3D0GE 4X65F 1X8DA 3RB0A 1VBZA 2DRDA 2ZBPA 3I0RA 4HACA 4TU8A 2NXNA 1XERA 3CCSS 4G1IA 1V3SA 1JX4A 2O01C 3JTOA 2NYIA 7FDRA 4C3LA 3W7BA 5T41A 2ERRA 4K50A 2DNPA 2Q3PA 3MPUB 2N3OA 5SZTA 3N4WA 5G0RB 4B3RF 1NHUA 2IM1A 3ZNUA 4OX7A 4AXJA 1HWUA 2PFDA 1KQSR 4KFBB 4PABA 5IS2A 2B8PA 4J9NA 2VOOA 3M2VA 2QC3A 1D09B 4Y3CA 1WHWA 4ZJOA 2HHPA 4KHPJ 2HK2A 2GQQA 2Z30B 5LM7E 1JLEA 4JUZA 3W9JA 2OP5A 4JI4F 4W4MA 2C3UA 4GVBA 3CW2C 4L3KA 1S7IA 2MSSA 4XIUA 3VAGA 1OIAA 1RTZA 2XMKA 3KJVA 1HWIA 1R27B 3FEYB 4XDCA 2GC8A 2ZKUA 4LMZA 2QLJB 4WIIA 3TX8A 3BSOA 1DRZA 5EWEA 4DXLA 4QIFA 1YJVA 2ZD1B 3W3SA 1VGYA 1HNVA 2GQ2A 1QD1A 3D67A 1FRXA 3L4BC 2HBZB 3T5KA 2M52A 3ILIA 1BXNA 2ZH1A 2UUTA 3CJ0A 3BO3A 2UUBF 1U25A 4O3QA 2O67A 4FS2A 4AYBD 4F67A 3PYDA 3DC2A 2CQCA 1GXUA 2LXFA 4C0BA 5LMNJ 3IS9B 4USVA 4RNFA 4NCAA 4L3NA 4DPYA 3UD4P 3BDPA 2DEIA 3AOAA 2JEGA 2V4JA 1K9MT 3NOCA 2VG6B 3MECB 4C8OA 4M5DA 5KFLA 5KG1A 4NMXA 5A6PA 2HLTA 3A3PB 3DI6B 2I38A 4ILMA 2MQMA 1Q7LB 4KPYA 4IRCA 2EKYA 3N6NA 2GO8A 4I7FB 5F9NA 2BE9B 1NSAA 2Y9HA 4M63A 3K5PA 3IAS9 5J1NA 3W1YC 1X4BA 2QIFA 2YWFA 4X64F 3H25A 3FMWA 1NK9A 1RAIB 2RH3A 1FKPA 1P8GA 4D3GA 2HMIB 1Z2LA 2OH2A 4TLRA 5EUHA 3M9NB 1TU0B 2CWKA 3ADAC 2HS4A 5D0HA 2UXBF 4B9TA 1KQFB 2EFVA 2OAUA 3I32A 3SMZA 3M32A 4LFBF 1GFWB 4LSLA 5HMXA 5HO4A 1RCOB 3G86A 4C8ZA 5GMKa 1X5PA 2UUAJ 3W5XA 5L1LA 4J5OA 4UOCA 4CO3A 2HQIA 5IOLA 3ZZRA 2UU9J 4Y2KA 5I4MA 2XS2A 3MEDB 3NOGA 1VC0A 2SXLA 4PYDA 4ZVFA 7FD1A 1NJWA 2VHGA 2WB1D 3TZXA 2D3UA 1FO1A 3LUYA 2ADBA 1Z1ZA 2MKYA 2QFIA 3RRGA 5C24A 1TMMA 3NNCA 4RW8A 1ZZFA 3LPEA 2IM3A 4DUTA 3MEEA 3D3CJ 5DLGA 3PCOB 3BGFA 3ETMA 1VC5A 3HLUA 3NGSA 4DX5A 5EWFA 5K8OA 4A8KA 3V5RA 3L7OA 1KVJA 3DM2A 3K8WA 3LP1A 3DRRB 3G2XA 3IN5A 2OIHA 2GNKA 2MYFA 2ZOMA 1FNMA 3R3TA 1UL3A 3VGVA 2BW7A 4BC7A 4ZIVA 3CCQS 4LF9J 2BABA 2XI2A 3T6BA 3OR1A 5DDPC 3TR5A 3Q0AA 4LFAJ 3W65A 1YJRA 4PG4A 3EZ5A 3PG9A 2ABYA 4ZK7M 1GK8A 4E8UA 5CA5A 1PCAA 2IIHA 4N41A 2NZ4A 1G1XA 5F8GA 2ATCB 5EX0A 1TK0A 3LTOA 2OMOA 1RISA 3KLFB 3B78A 2IYGA 3DXSX 1CPZA 2V8VA 1MROA 4DX7A 4IQXA 2RVJA 2YNFB 3CCWA 4M94A 4G65A 2KT5A 2Z2LA 1PYOB 3CMAS 2IPOB 2W01A 3MM6A 3HVTB 4DL7A 2LFVA 2RU3A 3QSYB 2HFNA 3W2WB 3M8PB 1N5VA 4IKAA 4OLPA 5MAOA 5DM6Q 4ED6A 4H4KC 1NBEB 2H5EA 3DGPA 2A3JA 3IG1A 5C42A 4WTOB 4LF4F 1UPMB 1UP1A 2HGLA 4G3IA 2VOPA 1C2PA 2B56A 3DMJA 1HNIA 4GMKA 1HI0P 3LP1B 4A46A 4DSKA 3BQ1A 3GZ7A 4FXDA 3H4BA 4WP9A 1S6UA 1FXRA 5HQLA 1RABB 5CXTA 2CPHA 2I6WA 2KM8B 3OTBA 1QE1B 1QDUB 2CVEA 1DTQA 1L3SA 2X3GA 4LUBA 2UUWA 5G4DA 2V69A 4FNIA 1R7IA 1KFDA 3PX4A 2YH0A 3AT1B 4NLOA 1U4BA 2MB0B 4JI5J 3A4TA 3OVBA 1FVSA 4BC9A 3T41A 1N54B 3MM8A 1UEVA 2EVZA 1FK9A 4G1PA 1RSCA 2VICA 1RCXB 4RW4B 2OJ3A 2R7QA 2ASDA 1ZETA 1FDBA 4GKKJ 4ZLPA 4NCBA 3GLJA 1B0PA 3HVTA 1GTHA 3UDLA 2MQNA 1IR0A 3M6WA 4FZVA 4I56A 4J9UE 1L5UA 3C6UB 3BH6B 1S48A 2IBOA 4QBUA 4LQ9A 1DURA 1M1HA 1TKTA 2LVWA 3BKTA 3A1YG 3MF5A 3NBPB 1WKJA 1S79A 1IKXB 1C4AA 2XG8A 3M05A 3MFIA 4M5HA 4FBTA 3BH7B 1FDAA 3MM9A 1JJ4A 3MPVA 4K4TA 3M6VA 2MZTA 4MAKA 3PNIA 4I64A 4EFAC 5BR8J 2HKEA 2VF3A 5HLFA 2M0GB 1T8EA 4RL1A 2QYGA 1LW2B 2RRNA 1WWHA 3G71S 2DD8S 2XSJA 4LRAA 2FJAB 2VBWA 4K4WA 4AQYJ 1BD6A 3UD5A 3BO4A 2Y1LB 4HH0A 3F0NA 1WG4A 2FTRA 2FHKA 3MPYA 5FIIA 4N56A 4DSLA 1RDRA 1HBOB 1SH2A 2QO3A 1PKUA 1W7WA 2B7BB 3B8HA 3RJMB 2HHTA 3BKFA 4KE5A 2VDIA 4OJGA 5KFBA 3KTQA 2ZBIA 4USHA 1PBAA 2ATLA 2HHQA 3HZGA 2MKJA 2QN6B 3VQTA 3J7A1 5ETVA 3OV7A 4MK9A 4HH1A 1E6VB 3MR7A 3IGVA 3N28A 2PD1A 4M5DB 4N8OA 2FHJD 3BB5A 4OFZA 2DIVA 3TA1A 1OQ3A 2WCXA 3PXGa 4DLGA 2J9DA 2GHWA 4PEOA 3CDUA 3SFGA 3GR1A 1IBKJ 3MM5B 2HFZA 2CZ9A 2R7VA 1JLQB 1SJ1A 2AMCB 2JOQA 2O3DA 3Q2TC 3KG1A 1IUJA 2E7VA 3H5UA 5JUMA 1JLGA 1JMTA 1Q4RA 2MQOA 5F3TA 3DLJA 2W9CA 2HMIA 1TR0A 2XSFA 3H20A 2Q79A 3IBWA 2OUGA 1KQGB 2BBEA 1LWFB 5KFNA 4X65J 2D41A 1CJTB 2DIUA 5L46A 1X5SA 2JC0A 5IWAJ 4B3SF 4UY8T 1LEOA 1RXOB 3BN7A 5LXYA 3EGWB 3U7JA 1X31C 3BBCA 2QLFB 4DR6J 3N5BA 2F5GA 4DPTA 3MUMP 4X4RA 2ZOGA 3C16B 2OKQA 3HKWA 3QQCD 1TL5A 2AJ0A 3HX9A 5D4LA 2ZHAA 1DQ8A 3V6DB 4LF6F 2E1CA 2FUG9 1XNQF 1C1BB 2XWYA 3K7RA 3R5GA 1U49A 2FJWA 3K0JA 2V8PA 1REVB 5J1EB 5GAHU 4YP3A 3DYAB 4EBCA 4LSNA 2HZCA 1WC4A 3QT8A 1R8BA 4P2MA 1HD1A 2DO0A 1YK9A 5DJBA 1X9MA 4H54A 2DRBA 1LKZA 1ZAWA 1IQZA 3DRPB 1HL6A 4C4WA 1SPBP 2VA3A 3KK3B 2M2BA 4QR2A 4DV0F 3H90A 5J2MA 3C6TA 3TRGA 2BOPA 1RT2A 2WVFA 2V63A 2A6MA 3N6MA 4DL0C 3P96A 3U1LA 3U02A 5GAEU 1ZPWX 2GAHC 4DZ6A 2ZH6A 9ATCB 1VK8A 2DHXA 4FP9A 1ICEB 3NGRA 4ID5B 2V4QA 3I82A 3RYLA 5ETOA 4LF2A 4C9DA 2MLYA 1TTHB 2YNFA 2HGNA 4CO2A 2HHWA 2JFDA 3Q86A 4JI3J 1SC1B 1WELA 3I4HX 3ISND 2W25A 4NCGB 4ECTA 2ALYB 1FRIA 1M5KC 4ZN3A 4DX8H 4JI1F 2NQPA 1HNXF 4BS2A 4QR1A 2MPUA 5B0DA 3C15B 3CIZA 4DQIA 2OPQA 5K9FA 1XR6A 1SL2A 5FJ4A 1YTYA 3FBEA 1T11A 2GJ2A 2GJFA 4HT7A 1FFSB 3ZO7A 2HQGA 3J81U 1HBNB 2FIUA 1BQXA 2CPDA 2UV8G 2GIRA 3RR7A 2VG7B 4JP8A 2W9BB 2KJWA 4JV5F 1B64A 3GG1A 2WOMB 1LW0B 3CJ4A 3QWUA 3OJUA 4LFAF 1Y9OA 3MMBA 2FDNA 2LU1A 2BJ8A 2XZWA 3SFUA 4HL9A 2RE1A 3MR2A 1IR2A 1UA0A 3LP2A 3QJLA 4P2XA 5ETTA 4EYHB 1EP4B 3AJ1A 2EPIA 4LFCF 4K0KF 3GE9A 5HI7A 3CJKA 1LWCA 1U1RA 1OWXA 3PRVA 4KH1B 1IKWA 5T7LA 4YY3F 3OVAA 1RACB 1FRMA 3J7AN 5C2CA 2HHHF 1FERA 1QVGR 3CJQA 1YQHA 3LGHA 3NCPA 3NP5A 1T3OA 1MMLA 1RTIA 2XYHB 2QL9B 1N32F 2KB2A 5HLFB 2K06A 3AJ2A 3TJAA 3J7YU 2V6AA 1IVZA 3TQ1A 1CC7A 2HEKA 4C6AA 3EWGA 4NMLA 5GAEI 1N5QA 3HD1A 5HROB 5AJ3J 4ZPAA 3MMCB 2XSJB 5HMYA 4TQRA 1D0EA 3KK2B 5KFWA 4K4YA 3I5BA 1RI7A 4DI6A 2DH9A 3UCUP 3PX0A 4LRBA 1WNEA 5KTQA 3ZFVA 4J90A 4D3HA 2CJQA 3DLEB 1RTHB 1ZA1B 4M5KA 2AJ2A 5IV3A 1H38A 2VL1A 1T94A 1TFYA 4ES1A 1Q8IA 3N6LA 3EXYA 3I96A 2MKSA 4C98A 3D6MB 2ZJPQ 5LT5A 5B0FA 1RWVB 4NYPA 2PEBA 1HBOA 2U2FA 3R9LA 4J7CA 3OW2R 3TEGA 5IQQA 4OJ1A 2NR0A 1UZHA 2HPUA 4QIWD 1M5VC 5EHHA 5DETA 3DDKA 3H59A 4OV6A 4GVBB 1FI4A 1QSSA 2WW4A 1UFWA 3AJDA 3K17A 4LBHA 4NRUA 1PBUA 1FKOA 1TKZB 3IMQJ 4DPOA 4DPUA 3S8SA 4P73A 1R0AB 1D8YA 4JI5F 2WAQD 4K4VA 3K8VA 2V67A 1B99A 3NWRA 3LA0A 2XO7A 1X9SA 1FA0A 2BANB 1TK5A 3MHYA 5B7WA 3ZZ0A 2OPRA 2JL9A 3MR5A 3BO2A 2MEWA 2IHR1 4CH1A 4IG3A 1S0MA 4DQRA 3K89A 5B0EA 1U1KA 4ICLB 3KYLA 1H2TZ 3TJ9A 1V3RA 3E01A 2BXJA 5KFMA 3V4IA 4AL5A 4IRKA 5L1JA 2HG4A 4KO0A 1VDHA 2LXUA 5ETRA 4OX8A 2ZITA 1N5YB 2JDJA 3ILJA 4QW9A 2ZC3A 1RTDA 2EFPA 2W2MP 4DPXA 3W60A 2KH9A 1XC9A 2CJAA 2CAJA 2IRYA 4EI2A 5KG7A 1QSYA 2HHUA 1RTJB 2HQDA 1NUEA 4A8YA 4DL5A 2DY1A 2E1PA 3TI0A 3D4JA 2ASYA 2CZ4A 3EVMA 5EWGA 1SH0A 3EGZA 2PC6A 1RAHB 3A8EA 2WSCC 1NMEB
chains in the Genus database with same CATH topology
2IM0A 2RNEA 2CPIA 3DRRA 3D2WA 4N77A 3BGLA 2JLEA 2JEJA 2VPWB 3DYAA 3K2YA 4DOZA 4DR5F 2AJ1A 5KT6A 4QIVA 5B0GA 5KFZA 1BY9A 3UR0A 1KC8T 1MSWD 2PN6A 2XHWA 2XMWA 4ICLA 1X5TA 4Y28C 3I0RB 3HHKA 5LXRA 1URRA 1HQUB 4NZ6A 3NG8A 4O44A 1RKIA 3DOLA 3FRZA 1ZTWA 4W90B 1F5AA 1QSLA 1RT7B 2ZJQQ 2HRYA 2CJBA 1YSJA 1P9QC 2AYMA 1RT4B 2I2YA 4UY85 4R8UA 3AAWB 3KLEB 1BGXT 3H2VE 4BWJA 3H2UB 1OPZA 2AJFE 1S6OA 3VF0B 1WI8A 4OMFG 2VG7A 3ICLA 4B9NA 3M30B 4TU7A 2FGOA 4IFVA 4ELUA 2ZZNA 4HKQA 2WW8A 2XNQA 3KLIA 4MYUA 1NK5A 4I2PA 5KOWA 3SSRA 4ZP6A 1BQMA 5IM0A 1JKHA 3QIPA 2DGXA 1NK8A 2KU7A 2FJEB 4A8WA 4Y65A 2EBGA 2HWTA 4EO6A 4ED2A 3CXCR 4Q2LA 4HHJA 1HFEL 1GT8A 3BSCA 5K8PA 1P1LA 1E6YB 1HBMA 3DOLB 3HMJG 2YH1A 1DAXA 2E7WA 3HO1A 2E66A 1ZH5A 3AQOA 1CG2A 1IKWB 1TKTB 3PR5B 1J5EF 5IT9Y 1T05A 3RW6A 1SJRA 1U7LA 3KK1A 3D0HE 1S1TA 3BGRB 4ED0A 2LCWA 3K5OA 4X84A 2GX8A 2YKMA 3HKZD 1KVIA 3L7PA 1RYRA 2B51A 2JLFA 2V8GA 1T02A 2M9KA 2R4FA 2ZHOA 4ZPTR 3RAMA 2ZFHA 4QWAA 2C22A 1KFSA 4KJIA 1A9NB 5A8KA 3OHAA 2XBPA 4KC5A 2GMHA 4K5RA 4RW7A 1GX5A 5K8MA 3D28A 3IWLA 2E9RX 3WZ0A 1RK8A 2ZOFA 3PIPQ 3OQ2A 2MGZB 2UVWA 4O3RA 1HW9A 5J2NB 3U1MA 2Y1IA 1TQLA 1Q78A 3V6HA 4CH0S 2UP1A 3SV3A 2QEXS 4KTQA 1XTZA 4NL5A 2XLJA 1C1CA 1F60B 3BN4A 3DHXA 2PSZA 4F4KA 2NREA 2YNHB 5B0CA 6FDRA 5DQGA 4ZP7A 1XMOF 2OPSB 3KLHA 3MFHA 1DQAA 2VFUA 1VIOA 5LMUF 4DV1F 2XY7A 2HHVA 3OUYB 4H4KA 2C42A 1C0UA 5I3UA 3PO5A 3ENQA 5KG6A 3NGKA 5A8KB 5KFDA 1VQYA 4ECYA 1VQ5S 1IBMF 3RRKA 4OHZA 1B0TA 5CH7B 1S77D 4I2QA 1H2VZ 2A2DA 3CCLS 2AQ4A 2YWHA 3MM7A 4A4JA 2N4CA 4HI1A 4O3PA 2JRSA 3EGNA 4X62F 2CJKA 1KEKA 1HPZA 2M4MA 3NLCA 2E29A 3J80Y 2HFOA 2RS2A 1MROB 3M2RA 2E1RA 3EZUA 4YHHF 1U26A 4I0WA 2BQ3A 4B08A 1R6YA 5KFRA 4YEAA 3PRBA 5E3PA 1AROP 5B0BA 1RT1A 4WF9Q 3U27A 3OFEA 1GXLA 2ZH7A 3OTDA 1BQNA 2LDIA 1C0TA 3CD0A 3PVXA 3CSKA 2KYZA 4QOTA 1IKYB 3N9UC 1M1KT 3FDSA 4HT5A 3NMAA 1JLGB 2VONA 3CC2S 1JB0C 3IRXA 4KGMA 2RF2B 2CQBA 4ECZA 3POTA 1P1TA 3RB3A 3I87A 3FRYA 4HYKA 5D4NA 2B6AA 3UPFA 4FNHA 2CQ4A 2RMLA 2A2CA 5KT4A 4WFXA 4IFYB 4DS4A 5KFCA 4LF5F 3KMSA 1FD8A 1HQUA 2J9DE 3MTKA 5K14B 5C24B 4WKRA 5KFKA 3VQSA 2GQCA 3WX4A 5DGAA 4KKOA 3JSRA 1RT7A 3M6UA 2KXNB 3CCJS 3DRSA 3HHEA 3PW5A 3ZZZA 4XPEA 2AW0A 3QPIA 3G6XA 5THWA 1LWEB 1P27B 2R7TA 4DG1A 5E7OB 5J2QA 1VQLS 4A48A 2OSRA 3SZ2A 4CO0A 4C8KA 3F56A 4A8SA 1Y5LB 2DK2A 4Q8EA 5L39A 1H98A 2YKQA 5J2PB 1A6LA 2AGPA 1LV5A 1SUQA 2HS0A 3DLGB 5I3PA 2IRUA 2WHOA 2XMUA 2ZM6F 1XK8A 1Y7PA 2B7CB 4DR2F 1WI6A 2JWNA 2DGVA 4Z2XA 1XNRF 4NXMF 2V5HG 4KFBA 3PY8A 1UVIA 2YY3A 4NYOA 2MKHA 2P5VA 3TUJC 2YKOA 3TAPA 2V94A 3OLBA 2DNQA 3V4MA 4OZNA 3S7RA 2UUAF 4ILRA 1WHYA 4C3MA 3FJ2A 2OD4A 3X1LB 2C3OA 1GXTA 4YFUA 2B4UA 2VV5A 4MKAA 2DR5A 3P5TL 5D4OA 1VLYA 3JB9k 2PI4A 3SSQA 4URQU 3Q22A 4ZKAA 1QJHA 2ZE2B 1SUQB 4JYAF 2IMOA 4OI3A 2GHVC 4CQ1A 1RAJA 4IRDA 1SL1A 3U1NA 4MTPA 4CTAA 3Q8SB 3ZZTA 1J5OA 1WG1A 4ZCKA 4WCEQ 4ZOSA 3E8OA 1KHVA 1VQ6S 1S6QB 1FEEA 2AU0A 3CCUS 4PRFA 4K2XA 1VQ9S 1HHSA 2JFKA 2YWKA 4KAIA 5BYSA 2HYIB 4Q0BB 2YNIB 2C3YA 2AYEA 4CNZA 4MYTA 1FKOB 5DRKA 2E5HA 2UU9F 1DFDA 1C4CA 4FF2A 4A8QA 2LEBA 4KHMA 1HYSB 4DUYF 2KRRA 2X1GA 2EG1A 3CVKA 3T5HA 2G1DA 4DJBA 5HROA 2DR9A 2X1AA 1N52B 3DRYA 3MZIA 1Q82T 4A8OA 2ZH4A 2A18A 3PJXA 2BV3A 3M32B 2VPXB 3QYYA 5HMZA 3T1HF 1SIZA 3I5CA 3E51A 4QZVB 4KHRA 3T1AA 1HQEB 5H1SV 1Y5IB 5M2RA 1WEZA 5KFQA 4F3OA 2NZ4A 3M2RB 1N0VC 5FDLB 3K57A 3GB0A 2RQ4A 1SB6A 2NSBA 1FNOA 2WRMA 4NLPA 3QGHA 4DQPA 5KFIA 4UQGA 1S1XB 3GG0A 1RT1B 3KFWX 4H4OA 4PWUA 4B3MF 2FHOB 2LA4A 2ROGA 2DGWA 1T03B 2QA2A 1JLQA 1DARA 2AWZA 4XPCA 1OSDA 4RWXA 1VQOS 4DL2A 4IDKA 1G6BA 2J0XA 3GSDA 3DLHA 1YJTA 5EN1A 2J76E 2V9KA 1UVKA 1VRUB 4F4ZA 1AUDA 5KG2A 3KLGB 2RT3A 2Q6CA 2WBMA 2FB0A 2DJWA 2RSQA 4WZMA 3IRXB 1NHVA 1VMBA 1TL3A 2COLA 4RNHA 1YJNS 5D77A 4ILLA 2VZ9A 1ULRA 1UJ4A 1VOMA 3NGDA 2FVPA 3IXQA 2W9BA 1HMVA 2KT3A 4DEZA 4RNOA 2M7SA 2OTLS 1NRKA 4O0IA 2VB6A 3OFGA 4FVCA 2LA6A 3KNGA 4QU7A 3WDOA 5BJRA 1RT5B 1FXDA 4IR1A 4WYLA 1SI9A 3ENVA 1L3UA 4PPZA 4A47A 1B0VA 4L6V3 4RUHA 2JSXA 3NS5A 2DGTA 4Q5VA 1NKBA 1H6KX 2V2KA 1FD2A 3HHDA 2KT2A 2J6SA 3DDNA 3OXLA 4DSJA 3BSAA 2BZ2A 3R27A 1FE4A 5C42B 3AA8A 3FSXA 3ITHB 3RZAA 3JYTA 4W92B 4PQAA 4KBIA 4OZLA 5K5MA 3WC0A 4DV2F 1ZOTA 4AQYF 3TANA 4IR9A 1N5SA 2B5JA 3MTJA 3PW2A 3DMJB 3AA9A 2ZD1A 4RW6B 4DQQA 1N5TA 1VRTB 2UV8A 5KFSA 2R7SA 4YMEA 2HGMA 2ZHBA 5C5JA 3M8QA 1VFJA 2ACYA 2ROEA 4FXWA 4DL5A 1RTHA 2VUGA 1S1VA 2Z4PA 4UUWA 4YR0A 1Y00A 1RT5A 4ZS6A 4NA2A 1UVNA 2ZDOA 2OPPB 1S9EB 2AF6A 2AJ4A 3M1VA 5KT2A 3EX7B 4KV8B 2B0GA 2K1RA 2P9EA 3QJJA 4Y2CA 3CF5Q 2BQRA 1KTVA 2ZVSA 2VC0A 3H5YA 2J7UA 4NYZA 5IWAF 3PKYA 4J9RA 1JLAB 2RS8A 4ZCIA 3TP2A 2KXFA 1DTTB 4ZPWR 2GMJA 1MW7A 3SV4A 2KG1A 1Y0HA 3LAMA