4HT5A

Co2 concentrating mechanism protein p, ccmp form 1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO2 concentrating mechanism protein P
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Protein binding
total genus 65
structure length 204
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht5A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht5A02
5SUHA 3GFHA 3F56A 3I87A 3I82A 5LT5A 3U27A 5L39A 3FCHA 5LSRA 4HT7A 4HT5A 3MPVA
chains in the Genus database with same CATH superfamily
2ZH2A 5KG3A 2DHHA 4UZCA 1HI0P 2QA1A 1U1RA 3CE8A 3VAHA 4YEAA 3N28A 4LT6A 1VDHA 4PPDA 4AD6A 2MQQA 4DU7A 2B8QA 2BVZA 2ACYA 3OR2B 3MR2A 4RNFA 1X4AA 3MMBA 2RU3A 4JV5J 2K7KA 3OSNA 1UTAA 4N8OA 4OLPA 3BGRB 4DL7A 3HX9A 4ZDNA 4OI4A 2NQPA 1AUSL 2MJNA 3M8QA 3VGSA 4LRFA 3T9NA 4MKVA 3FDSA 2JC1A 2J76E 4WFXA 1VQYA 5LJ5Y 1D8ZA 3H40A 1X9MA 4NLTA 2ZH8A 1X60A 3PTWA 5C2CA 1SC3B 3M1VB 5ETNA 4A4JA 4RU2A 2BJ1A 2EFNA 3FC9A 1FEEA 2F8HA 5AE3A 2VKZG 1KHWA 4O4GA 4C0HA 2XY5A 1X9WA 1QE1B 2BKNA 2F63A 2RH3A 4DR2J 2BMBA 1U24A 2JC0A 2GHWA 2DHGA 4RZRA 1MG7A 2DGVA 3T1HF 2NXEA 2VZ9A 3A3OB 1FRHA 2NSCA 1SBRA 2H48B 1A6LA 2VBZA 5K14A 3NGSA 3BJYA 4MH8A 1J5OB 1IKVA 5EHHA 1HLWA 1IR0A 4WTYA 1RT7B 2ZOMA 2V8GA 1NNDA 2PDAA 3TZWA 2DXEA 3LW5C 2V8PA 3TOQA 2KFYA 2OEMA 3OTOJ 1BWVA 1JWWA 2JEIA 2CQPA 4DL4A 1JLCA 4JYAJ 4XIUA 2NYHA 2J8SA 2W25A 4RUHA 3JTNA 4LF4F 1YVFA 1LWCA 5KFVA 2A1BA 4YN3B 2HURA 2ZBRA 2ZJPQ 2XMKA 4Q7AA 3O3LA 4DCJB 4LSZB 1SJ3P 3LANA 1T0TV 2AJ0A 3WQPA 1SH0A 5F8MA 1FRMA 4C97A 1C1CB 4MFBB 3SFUA 1EP4B 3QRRA 4Y2MA 4OLOA 4DPTA 3EXCX 2GO8A 4JI1F 1XTZA 3A1YG 4CQ1A 4YR3A 2KRRA 4P6QA 3SDEA 4QIVA 5ETVA 1VISA 4NMXA 4ES2A 2LLZA 1S99A 2CQ2A 1MNEA 3D6FB 3ZTOA 2QL9B 4DV2J 2CPZA 1VJWA 1S0NA 4UY85 2KFZA 3IC1A 2E1MC 3IGNA 4RNHA 3Q8VA 2E44A 3EM1A 5E3QA 4U95A 2DK2A 1XNQF 3DRRA 3J81Y 3H59A 4OJ1A 1VK3A 2CQGA 2YX1A 2W9CA 3MZIA 3KJVA 2UXBF 3PEHA 3CGIA 2CJYB 4JI4J 5KFGA 4DSJA 3FMWA 4WFYA 2CAJA 1OSDA 4NE9C 2XO7A 2BUNA 4H4MA 1Q5YA 2OSRA 1BY9A 3G9CA 2B9YA 3POTA 3Q8RB 1JKHA 3DRSB 3I4PA 3NMAA 2ZVIA 5FLXU 4CLFA 1KFSA 4M5GA 1TKZB 1D09B 4FVCA 5CCLA 2BJEA 5B0CA 1NDKA 4WYLA 1WTFA 5B0EA 5C25B 4F50A 2JH3A 4NX9A 3FBCA 1EHWA 2WVDA 4ICLA 2H1YA 5E5NA 4XDCA 1BWEA 4DV1J 1U0HA 4RU9A 2FY1A 2B4UA 2RRAA 3C2PA 2DR7A 4FF3A 3CJQA 3KJQB 2XLJA 4UTGA 4J9SA 4TN2A 3J80Y 1RYRA 1WORA 3AY0A 1FKOA 2J7UA 3NBPB 4B3MF 3OXFA 4XPCA 2MQNA 4OX9J 1IKYB 3HFZB 2YWEA 2W2NP 4DLEA 2ZITA 1KTQA 4USWA 4ELTA 1Q1KA 2QIFA 4U7UD 2OPQB 2MEWA 1RAOA 3KUHA 4L76A 2W2MP 2AGOA 2GAGC 1S1TB 1NKBA 3PX0A 1NUEA 2HQFA 3OFEA 3BDPA 3P6YC 3LA0A 1RE1B 2XC9A 3GWCA 1GEHA 3MHYA 2HIQA 3M8ZA 5F0WA 4I2PA 2OD4A 2P8IA 3BO4A 4LF6F 5IQ6A 4NLSA 5J2NA 4FNHA 3BQ2A 3HFVA 4J37A 3ZNUA 2WB1D 3OSPA 3PRBA 1KN6A 4LF8F 2YWKA 3BGLA 3NGTA 1JK9B 1SQEA 1UW4A 4USHA 2YKMA 3CJ3A 4I6YA 4QR2A 1SIZA 2L41A 1B64A 2HFSA 3ILOA 4M1KA 5MAOA 2MPUA 4IOAQ 4AT1B 2OPRA 1SV5B 3UDEA 1I51B 2WBMA 2J0SD 3GIMA 3CCTA 3AJ1A 4L74A 6AT1B 1RHJB 1KVJA 1NB7A 5LMNJ 4MTPA 3QJLA 3KMSA 3D3CJ 4J9QA 2AZ3A 1GT8A 1A9NB 4X4TA 3PFOA 5H9FJ 2J9CA 2HBQB 3M9MB 4QIFA 4WU2A 4I1TA 1IXKA 2KYZA 2AZ1A 1TL7B 3AD8C 1LNQA 4IYQA 1YZ6A 4TLQA 1DQ9A 4DR4J 4DZDA 2MQ8A 1FJCA 4OYMA 3ETOA 2PFDA 2K3IA 3JSYA 3CCVS 1W26A 1RHKB 3VAJA 3K5OA 2OFGX 1BQXA 3AOAA 1M5OC 1RT3A 4ETZA 2ZBQA 1NM2A 5F8LA 4C3MA 5K8OA 1HQUA 4Q43A 1Z2ZA 3E01A 2RHSB 2XMAA 3CD7A 1X5SA 3G86A 1ZZNA 3EE3A 3HMJG 1NPPA 2FLPA 2I6WA 4FZVA 4LF6J 4WBFA 3ZTRA 4IRKA 5HJXA 5ETRA 3R1LA 2AF6A 3D1QA 1IM6A 4K59A 1Q79A 4DCPB 3TWZA 2Z2ZA 1CJKA 4RW7A 1BGXT 2R3VA 1XNRJ 6FD1A 2MLXA 1NDCA 4TYAA 1Q16B 1N52B 3B54A 1AT1B 4OHWA 2OEJA 4ZIVA 3W8PA 5AT1B 1IBCB 3TZZA 4ETXA 4DG1A 5IM0B 2MQPA 3F44A 3CCSS 1Y9OA 5HP1A 1I6JA 2EK1A 1JJ2R 1LK5A 3AT1B 4IRCA 4OZ5A 3UVJB 4RPFA 2PFFB 4EYHB 1HBNB 5F8NA 3ZZUA 3K7RA 3V4IA 1UVJA 1XWLA 4QZVB 2BV3A 5L1KA 1S1VA 3IAM9 4HHHA 1JJCB 3PKYA 4DPXA 4ENOA 3VWSA 2YNFB 2VV5A 2B0GA 2K2PA 2POKA 2Y0BB 2HFVA 1WHVA 1RWPB 2QMUB 4DSFA 3OJUA 3GU0A 1I5OB 3BF4A 4NA3A 2BR0A 3MOJB 4E8UA 2UXDF 4WWSA 1UWBA 3QJPA 3OHAA 3CDEA 3PRDA 4NPOA 3HVWA 3KLEA 3R1HA 2XHCA 2I5JB 1RT4A 4KPYA 2RIJA 4WYWA 4Y0FA 1S76D 1X31C 3TO8A 1KEKA 3H42A 1R89A 2JL9A 4ER8A 4Y2CA 2QL7B 4ZCMA 5HK4A 4A8XA 4O3OA 2GHVC 3QGIA 5L39A 4Q8FA 2HGMA 1T9XA 1SJ1A 4IQXA 5DRKA 4RKUC 3SV4A 2QC3A 1RJJA 3DOKB 4DJBA 4WJBA 4C0OC 1S77D 2ZWOA 2L9DA 3OTCA 2MDAA 3MD1A 4PQUA 3CMQA 4R5PB 3MEEA 1J5EF 4X65F 2RUGA 4OHZA 5GMKa 5A8KB 3WIUA 4X2BA 2XLIA 4YUDA 2HZCA 4KAIA 4RW4B 2DR6A 1UJ6A 3CF5Q 1X4EA 1ICEB 1WKLA 4O44A 2QSFA 2DH8A 3W3SA 3JS9A 3S7RA 3F0NA 2CNNB 4UOHA 2ILYA 1NBEB 2A18A 3CULA 1BHNA 3J81U 1PBUA 4IG0B 2EI5A 1B0PA 2NZCA 4WCEQ 3ZXWA 2FVPA 4N76A 5AXNA 2M9KA 2GIQA 1PJ6A 3Q89A 4ZVHA 3SV3A 4ED4A 2OPPB 1S12A 4FKXA 2AJQA 3O6QA 2M0GB 1WELA 3HHEA 1R43A 2E5LJ 4MK9A 4J91A 2LQJA 2OUGA 3PM9A 1HBOA 4Y65A 2HYIB 3R27A 4RNOA 1DARA 3W2VB 4PG4A 2QLWA 1JQGA 3SIPB 3WC0A 3W2WB 1REGX 1TR0A 2LCWA 3RBXA 1H0HB 5IWAJ 4LR9A 4Z7YA 1EQMA 5BR8J 4H4KC 3J80U 2WVBA 4LMZA 3H5YA 2FJAB 1XQIA 2UUAJ 2OMLA 1RT2B 3THVA 2RNEA 3ILIA 4NI2B 1ZTTA 3V2UC 3SQOP 5I3UB 1S6UA 3N6NA 2IC3B 3EMTA 2BKOA 1N56A 3IM9A 1LFWA 1UWAA 5C7PA 3JTPA 3DGPB 5ETTA 4USVA 3LGMA 1NB2A 3N6LA 2WSEC 2YWFA 4ATNA 1XR5A 4K4WA 2MKKA 4NYOA 3DLGA 2HFZA 4KV8A 1JLAB 3UFCX 1IJFB 4KFBA 1DTQB 3AXMA 2Q1LA 3TEHB 4OI1A 4DEZA 5ETPA 1S5ZA 1IKWB 2M8HA 1QAIA 1TU0B 3LUYA 2UUBF 5KFAA 1N32J 1SI9A 4X4QA 2QRRA 4G3IA 4EFAC 2J6TA 4DU8A 1JLEB 5L46A 4ZN3A 3GIRA 2NPFA 1T9TA 2LP4A 4USMA 4FNIA 5DQHA 4GRSA 3S6EA 2FJBB 1TK5A 3IN5A 5BYQA 1F6TA 1HI1A 2YX7A 3UW1A 2MHEA 3H25A 2XMWA 2KI2A 2FLNA 4WXWA 4ZJLA 1S6QA 4ED0A 1ACMB 3KDNA 4DPUA 3D5MA 4OYIA 1DZ5A 3HPOA 4A8QA 3DU6A 3TEGA 2KXNB 3MM7B 4DXLA 2OMOA 4I2QB 4C4WA 1N5YA 1HNVB 3C46A 2Z57B 2EPIA 4BBYA 1FRJA 3A8IA 1OY6A 5F8JA 1JLFA 4RUAA 2WSFC 3I9V9 3KHGA 1WI6A 1PYSB 5GVQA 2CPDA 3UN2A 4CYUA 1FWPA 2RF2B 5CAAA 1RWMB 4URGA 1ULRA 3MAAA 2LFVA 4ZHRB 2HAFA 4C0BA 1IWGA 5CQGA 4CRJA 2W4PA 2VG6A 3NOCA 1RYSA 2PIIA 4ZCKA 2WVEA 1YX2A 5E41A 4USIA 4H4OB 4ZCIA 3W5XA 3HKZD 5KFTA 2RQCA 3P5TL 2LQ9A 4ZN1A 1F3VA 1K1SA 1E6YA 3AJ2A 4KO0A 2RQ4A 4HL9A 2WSCC 5G0RB 3LP0A 4DV3J 4B3SJ 4GMKA 2IM2A 4G1PA 4OYPA 4B3OA 2AV5A 1PC5A 1WNEA 1Q82T 4K4XA 3BSOA 3EGWB 1Y3KA 2UZAA 4ELVA 1EZZB 1RUSA 4F4YA 2XI3A 3LAMA 2HPUA 5EX0A 1RTIB 3R2DJ 1F5BA 4DSKA 1R8BA 2YPYA 1WC5A 2MGZA 2MZSA 3M9NB 3BEGB 4LF9F 3W1YC 4B9UA 4WIQA 2D1CA 3R5JB 1DURA 1R3NA 4DV7F 4F26A 3CD5A 3PO5A 4JBCA 3B4DA 2VFVA 4DR3F 2W1BA 2C2RA 1NK6A 2WBRA 5EX3A 1KQKA 5LSLA 1DLOB 1OWXA 1SC4B 5K8NA 4F3MA 4RL1A 1NKEA 4P7TA 4I64A 1DFDA 2O1PA 1DTTA 2VONA 2HVZA 1SKRA 2HHSA 2FVCA 2P9EA 1QE1A 1SJQA 4W98A 3R8YA 2EVZA 3MEDB 4HDGA 3Q22A 4I6WA 3KK3B 4B3RJ 3ZTSA 1L3VA 1R27B 2DO4A 1OQ6A 3EGVA 3TQEA 1DJ0A 1LFPA 1UEVA 5KOWA 2XYGB 2JLGA 2LA4A 3EGZA 1VQMS 3P49B 1IQTA 3ZC4A 5KFXA 1S10A 5D0RA 3CCES 3N0VA 3PIOQ 1F3FA 3BPSP 2LU1A 3KHLA 3J7Z5 2CPFA 4ZPTR 2DRBA 4Y6IA 1S97A 3T41A 2HNDB 3VGVA 1E6VA 2ADBA 4IR9A 1HNWF 5HVFA 2MZRA 3K5PA 2XM3A 1U1KA 4RO0A 2OIHA 2XWYA 5DETA 2F4VF 1GMUA 5LXYA 4F0HA 1ITPA 5M2RA 4DV6F 4UOCA 4DR6F 4QIGA 1MROA 3KK1A 3NNAA 4OZNA 4O3QA 1CULB 5GADU 4A8FA 3RR7A 4F4XA 3I0SA 3HVRA 2HHQA 1RTDA 2QLFB 3CMAS 4DFMA 1F5CA 5FDLB 3ZFVA 1GNKA 2KVQE 4OQJA 2J9DA 3R5DA 3BSNA 2C3OA 5EWFA 4ED6A 2BE7D 2IIHA 2BANA 5GAHU 1T05A 3W9JA 2ZC4A 3IRWP 5HROB 1CPZA 2WCXA 4OIXA 5F9NA 3OTEA 4JI6F 5DDQC 4OJ3A 1X9SA 3H8YA 2ZHBA 4DLGA 4CLSA 5KG4A 2MKSA 4Y00A 3TNVA 3ENAA 1Z4UA 3D0HE 4ZVQB 2M3DA 4A8KA 1BD6A 1MMNA 3I32A 2PSZA 3NS7B 4BC7A 2BXJA 1TTHB 4QW9A 5HMZA 3JQKA 3TANA 1RA6A 2I1RA 2DEIA 1V9OA 1RT1A 1NJXA 1YRUA 3W65A 3GFXA 3ZZTA 3HDSA 2MB0B 3K8WA 1K0VA 2BYCA 1W7WA 4ECTA 1RADB 1RAEB 3C15A 3UDLA 2B51A 1RKJA 1EARA 1U45A 1CS4A 1YTYA 3BQ0A 4F8RA 1F9FA 4RLEA 1RCOB 1MN9A 2K8GA 3KNGA 2FGCA 3CJ0A 3MMBB 4P9SA 1QY7A 2G2YA 3KLFB 2MKCA 5DZ7A 3C14A 1JNZB 2NSBA 4QOTA 1JXEA 3M8QB 3ENWA 2BACA 1HI8A 2VJUA 1RTZA 3N9UC 3R5GA 4QIWD 2HAIA 3TUIC 2V5HG 1T03A 4X4VA 4C3LA 4U7CA 1BQNA 1GTEA 1WG1A 1U26A 1VRUA 3H4DA 4J9MA 2CJAA 4M5LA 2Y8WA 2DR8A 4XK8C 2V2KA 5DLFA 3CUNA 1MU2A 3QFHA 2YH1A 4DSIA 4G65A 4O4GB 1TVRA 1U6ZA 3UQSA 2P9GA 4HHUA 3DDIA 4ED3A 3HD2A 2RDIA 4NLQA 2IBKA 2IRYA 1FWKA 2DNMA 4ILMA 1QD1A 2BKPA 4U7UK 3IR5B 1O51A 2FVQA 1JMTA 1WF1A 4GO5X 4LFCJ 4LRAA 2FC8A 3G6YA 3PX6A 5KFWA 1AW0A 3PW2A 3ZZ0A 3NCRA 4CO3A 1RWVB 1W2IA 1FEHA 1HBMA 3R3TA 4JI6J 4ELUA 1HWIA 3BS9A 1UFKA 4B9TA 2KXHA 2GW8A 2HK3A 5K14B 1D3WA 1IKVB 1LW2A 3WBZA 2JJ4D 2IHR1 5HATA 3ADAC 5B09A 3G82B 2YKOA 1WI8A 2FIUA 3Q2TC 3AHPA 2GMHA 1HBUA 4KE5A 4DV5J 5JVHQ 3DCAA 2CNKB 4U67Q 4JI8F 2ASLA 2C3YA 4LSNA 4PCQA 1XERA 1NJWA 1Q7LB 1JLCB 4DN0A 3C16B 4N8NA 3HXMA 1O0PA 2XI2A 2JEFA 3S8SA 2CJXB 2KG0A 2CPJA 2EK6A 5A8RA 3JSBA 4Q8EA 2AYBA 1LWCB 4LRBA 4JI7F 2V4QA 4NXNJ 2CPHA 1HARA 4LVOP 2ASYA 1P27B 2DR9A 4WU3A 3SFGA 4KGVB 4C8MA 3CVKA 2ZUAA 5H1SV 5LXRA 5SUHA 4KHPJ 3CJ4A 3VCDA 3MM5A 1RT5A 2AYEA 3CXCR 4ECUA 2RILA 3CCUS 2KHCA 2O3DA 1IQZA 1HMVA 1NJIT 4YB6A 4L3KA 1MLAA 2FHMA 5E3AA 3OLBA 2DISA 1ZETA 1K73T 5C24A 1AZSA 3SDEB 3C8YA 2ZH7A 4ECXA 3RAXA 3FEYB 1FCAA 1D9FA 1SQFA 3GZ7A 4KKOA 4DL5A 2ZE2A 2RAQA 2V6AA 2VPYB 2DGXA 3G87A 2V4RA 3Q86A 4MJKA 2PEBA 1FXLA 1LW0A 3PO4A 3DRRB 2CJKA 4B9VA 1LQ9A 2EG2A 2LU2A 1W25A 4OZ2A 2B4VA 2GZOA 1TL5A 4CIOA 2HHPA 3PV8A 2V8VA 1Q8IA 3BQ1A 4K4TA 3D9BA 3RU0A 1K9MT 3EDQB 3GIIA 4AQYF 1NCLA 4DR5F 1Y00A 1EIYB 3MTJA 1K8AT 2KFNA 5JJBA 4JOUA 5T14A 4H4MB 2J9EA 2ZKTA 2CG8A 2LDYA 1KOOA 3POTB 4TQRA 1JKHB 4ZVFA 3E3XA 3M8YA 5B0AA 1S9EA 4NA2A 2LKZA 3QWPA 4J5OA 2B4PA 3AODA 5AXKA 2ZH1A 3SBMA 2OI2A 3IWXA 4JI8J 2FJWA 4ICLB 2CQ1A 1WC6A 2C2EA 2F4FA 5E0OA 5BYRA 4C98A 4NOHA 1QSYA 5IOLA 5BYSA 3TRGA 1LWEB 3W66A 2V2QA 2DGOA 1HYSA 1ZYQA 4JI7J 2HS3A 4LF7F 2Y8YA 1H2UX 1SPBP 1U49A 1KFDA 3NP5A 3TA2A 3OLAA 4CO4A 2CNOB 4U8YA 2YNHA 4C9DA 1FERA 3NRBA 1RTHA 2MSSA 1OY8A 5L8RC 5KFEA 2CUYA 2YTCA 3AD9C 3M2RA 4RNNA 4P7VA 2CQHA 1A0OB 4EU0A 1WHWA 2AJFE 3A12A 4HI2A 1QUPA 2BOAA 1GXUA 3M32A 1KWMA 3BBFA 1PJ5A 1UPMB 2G1HA 4R8UA 3WIVA 2W01A 2WRMA 3MCSA 1KLMA 2DITA 4K2JA 1Y5NB 2EBEA 4YB1P 3GR1A 1WOPA 1UVMA 3DLLQ 2I0XA 4I2PB 1UVNA 4KHRA 2Q3PA 4OHVA 1NJYA 2DNHA 1FRXA 1HQEB 4G6VB 1V3ZA 4ED1A 2BQ3A 3GP9A 1RBLA 4E2FB 5J2NB 4F3QA 3WDOA 4YHHF 4XAKA 2HHHJ 3EUNA 3J7YU 1OPZA 3KUEA 4PZVA 1GXTA 3QSIA 3GIJA 2B3TB 4AQYJ 4GO7X 2LQ8A 2YKMB 1RT6A 4YB5A 2SXLA 4PPZA 3NCPA 2HZVA 4OI0A 1WC1A 1H2TZ 2OPRB 2N3LA 4HT5A 2VD3A 2C22A 3M6XA 2H5IB 4CLKA 2WTFA 2YPZA 4QPXA 1RB0A 2VQEF 1ZTWA 2CG4A 1HNXF 2BQRA 2R7VA 2BOPA 2EXUA 1SH2A 3NAHA 1IVZA 2EEYA 3ENQA 1RXOB 4UW2A 2ZNZA 4XO0A 2RQKA 3CO9A 5KG0A 2W9BB 1HHSA 5KFJA 2QSWA 3GB0A 5LSRA 3CJ5A 3R6LB 4PG8A 2HVEA 2YXLA 4PWDA 5T41A 4DN9A 3NGRA 1Q0NA 5LT5A 2IMOA 3MFHA 3GYXB 3M4XA 3IA0A 2ASDA 1KKHA 4AXIA 2XMMA 2NYIA 4HDHA 2VIHA 4ZJOA 2E29A 1HFEL 3R5BA 3DGVA 4Q45A 1T9VA 5RUBA 1HD0A 2ZM6F 2DT9A 3GCWP 3MF5A 5ETSA 3P4UB 4QWAA 4ECSA 3FBFA 3EZUA 4NLRA 1IBMF 4USKA 2NR0A 1UP1A 1HNZJ 3KLIA 4CM2A 1MMLA 3NGKA 3LOUA 5KT3A 2IJRA 2DY9A 4X62J 3QT7A 3MEGA 4DFJA 2JVOA 3IR7B 1U6FA 1RT3B 1TKDA 5D15A 2CJ9A 3W63A 3M9OB 1S1XA 1FTCA 1WHXA 1HQUB 2VG5A 3E01B 3VHQA 3P96A 4K4SA 4MIAA 1FI4A 2ZKUA 3W2VA 2OPSA 1D1UA 4OX6A 2FLLA 1GFWB 4PXDA 4RUBA 4WE1A 5L38A 3R7BB 3HKWA 4YHHJ 4FPIA 2AQ4A 4CH0S 2MYFA 4ZP8A 4CM0A 4CLWA 5CHCB 2OTLS 2R7XA 2IMWP 3FCHA 2E5GA 3R9LA 2CDRB 3Q8SB 3GJTB 2F1FA 4RW7B 4NI2A 4NMLA 4FF4A 1CEZA 2LVWA 1VC6A 2G9OA 4ZPCA 2L9NA 1I3OB 3DGPA 2GC8A 2V2VA 2OO4A 2MQLA 4DG1B 2AYGA 3HVAA 2M2BA 5HP1B 4F0MA 3BKTA 3SQGB 1TL3B 4UZBA 1JLAA 4UY8T 3V4IB 2H4YB 4QPTA 3EWGA 2IVMA 4ID8A 1Y0HA 4WP3A 2B6AA 2Z2YB 1NK8A 4AL7A 3TJ8A 3HHLD 1HWLA 4QBUA 1HPZA 2MLZA 4CLLA 2B4OA 2V2ZA 2I8EA 4I0WA 1RI7A 4WIIA 4ANDA 4C8YA 4PYDA 4TNOA 4DQQA 3UCZP 2DD8S 3KUGA 1HD1A 4ID5A 1QVGR 4ZLNA 1EB0A 1IBMJ 3BGOP 2V50A 1UWBB 2CKWA 1VQKS 2BBEA 2BRKA 1ZM9A 1S57A 3KLEB 2HS4A 2F8EX 3GV5B 3KG4A 3QZ8A 4A8YA 3C6UA 2UVWA 3HCXA 4Y3CA 3O1LA 4EK2A 3MM7A 2CPEA 2QFIA 1QAJA 1FFWB 3FRZA 3MAHA 2MTLA 4M5MA 2W8KA 2XLKA 2E5JA 4DS5A 4LF2A 1FO1A 1VQ8S 1I94J 1HNIA 5F8GA 4PQUB 4DL6A 3MEEB 5FJ4A 4TY8B 2X1GA 5D78A 4ZLJA 3OBIA 4ZS6A 1BQMA 2BJDA 3TI0A 4DUZF 1WOOA 1T9WA 3RRKA 2QLXA 2XWXA 5KFOA 4K0KF 3PHEA 2XO6A 3MXHP 4O44B 5L1LA 3WC2A 2ZOGA 1O6XA 3G71S 4N77A 2X3DA 4WFZA 3HHNB 7AT1B 2CQCA 4DX6A 1WF2A 2DNQA 2QX0A 4DFPA 2CJQA 3M8SA 4IKAA 1B0TA 4UOGA 4JI5J 4ZLLA 3X3UA 4IO9Q 4N56A 3CPWR 1N36J 3KFWX 4U96A 5FLXY 3HP6A 2BZ2A 5KFYA 4A8OA 3BM7A 3F56A 1YQHA 4XTTA 1DAXA 4Y28C 2I9SA 3MCNA 1XR7A 4CO1A 4K7QA 1HBOB 3Q8PB 2EFPA 1HA1A 3CCLS 1Q78A 1NK5A 2UUCJ 3H0PA 4JUZA 2J7KA 3H4BA 2F65A 2VB6A 1L5UA 4MYTA 1QTNB 1Q8KA 4ILRA 4PG5A 2MY7A 2OAUA 1TK8A 3NGUA 3K5NA 1NH8A 2E9ZA 1HWUA 5ETQA 4CZCA 2X7IA 1L3KA 3SMZA 4NLDA 1CJTA 3ZTQA 3C66A 4Z37A 4K2XA 3HHLC 3MECA 2A6MA 5FD1A 1IN0A 4XPEA 4FF1A 4GKJJ 4MKBA 3AAWB 5IC6B 4K50A 1KVKA 3UO0A 2C1EB 2VH7A 3DHXA 4ZK7M 5IS2A 1U2CA 2CQBA 3U1LA 4C8NA 4Y2IA 1EAYC 5HI7A 3DLGB 2PE8A 4KV8B 2IM1A 1FESA 4DUZJ 1V3RA 4IH7A 1N33F 1R6YA 4KFBB 1N34F 3PCOB 4K0KJ 3MR3A 1C0UA 5L9NA 1VIOA 4W92B 2OEKA 4A46A 4PEOA 1UETA 1L3TA 4O3NA 2MZQA 5ETMA 2KZZA 1QAXA 2KB2A 3GTYX 3KG0A 2JX2A 2QN6B 3OHBA 1DRZA 1H72C 3UI3A 4LR7A 1U2RA 1QSSA 3FQKA 1GMWD 2M70A 1TUWA 4NXMF 5HAOA 1Y5IB 3IBWA 2DO0A 5K20B 3BYPA 1C1BB 1WEZA 3HI9A 5JVGQ 5DDRC 3IBFB 1CULA 2ERRA 2W9AA 5K9FA 2RUSA 4ZKAA 1C4AA 3VZIA 1X4DA 1YJTA 2DNGA 1S6QB 4U9RA 2KG1A 2V8DA 3KYLA 3MUTP 3T1YJ 1U6BA 4PWUA 4P2MA 2HK2A 3I96A 2NUHA 1Z1ZA 5D4OA 2WHOA 1N6QA 1N5YB 3QGPA 4WKYA 4UUWA 5A6PA 4QYZK 1JLFB 2B7CB 2RQMA 3KDOA 2UUWA 3RW6A 4F04B 1C0TB 1NDPA 1VC5A 1WC3A 2H51B 4CYUB 4MK7A 2CPXA 2MXYA 1U8WA 1H2VZ 1KS2A 3MAAB 5ETLA 1NEEA 1P1LA 1VBYA 4FYWB 2VG6B 2CZ9A 5J1EA 4ANCA 1SUQB 4F25A 3TZXA 4YFUA 1F9HA 1CJVA 2XB2D 3ENVA 3DHWC 1B70B 5CZXA 3UR3C 1E6YB 2HQGA 1YJRA 1U1MA 3VAMA 3LP0B 3L3CA 2EFVA 1KNZA 4B3OB 4NRTA 2V94A 1X0PA 3NWRA 3AQPA 1N33J 5HJYA 2NXUA 3CJKA 2EFGA 4DR1F 2E1RA 1LWXA 5GAGU 2VQFF 4CO0A 3BV8A 5CXTA 2R9LA 2IY5B 2E5HA 2G0JA 4Q0BA 3KLFA 2HLUA 1YSJA 2MGZB 4ED5A 2RRNA 2FLOA 1JXVA 5KG2A 1IUJA 4EGLA 4P75A 1U48A 3T3FA 4DDFA 4RBUA 4BLGA 1H98A 5HLFB 3RJMB 4LRCA 3G6ES 2ZH9A 4LR8A 3ZZPA 3U7JA 1VCTA 3HT3A 2QTWA 3PYFA 4TQSA 3RRHA 1CLFA 1Z2LA 2VBYA 1K1QA 3FBBA 1BMQB 2MQMA 3IP0A 3PRVA 2HWTA 1DTTB 2Y1RI 4K8RA 4ZVOB 3PR4A 4PYAA 1JNRB 2IAJA 2XMUA 1DY3A 1YJUA 2FHJA 5JMNA 4WZMA 3M2VA 5DJBA 4AFFA 3T9ZA 3M6VA 2UU9J 4KC5A 2YQ1A 2APOA 2VL1A 3JAMY 4ECRA 5CD4H 3HHLA 4QWBA 2ZNYA 4UQGA 1ELOA 3BSAA 3ULHA 4F4ZA 2XYPB 2HNZA 4IG3A 1GX6A 2NXNA 3G82A 4ZLPA 1FJGJ 5CZVA 3OPKA 2CPYA 1KDNA 4JI3F 2YNIA 5A2QY 3CIMA 1U25A 3QJJA 1U0SA 3TAQA 2F5GA 4NLPA 2OH2A 4GVBB 5LJ3Y 4M5IA 3BB5A 2ZZMA 1E6VB 3GFZA 2Y3YA 2L48A 3IRXA 3C16A 1VLYA 5KFQA 4TU8A 1NDLA 4USJC 3OJSA 5KFUA 3IGVA 3CMES 3NWGA 2L08A 1HKAA 3QFWA 2GJFA 3M05A 3DI6B 2LDIA 4ALZA 1MROB 2X1FA 3MFIA 2G0CA 3KK1B 1HWJA 1HW9A 3PW4A 3TVYA 3FVYA 3I0SB 1UKUA 3P45B 4P74A 1C4CA 2NS1B 3TJAA 1RTDB 3CO0P 3W5YA 1VS3A 1QTMA 2HMIA 3GCXP 3KXDA 1VQ9S 9RUBA 4DL0C 3NY0A 1URNA 4LF1A 1H74A 2BANB 1Q86T 2IRUA 3SZ2A 2HGLA 4QR1A 1T05B 1M5VC 1Q95G 4IDKB 1Q5VA 1S9FA 3KJFB 1N54B 3D2WA 3LF0A 3JSRA 4KGKA 1JLBA 4LJMA 1NSAA 1FRLA 1MWYA 2LEAA 4WTOB 3VAGA 3DDKA 3FSYA 3ZZOA 5AE2A 1EETA 4WZQA 2ROPA 1FRKA 2ZHOA 2YX4A 2N3OA 4M5DA 1AXQA 2BM1A 1IJEB 3HSZA 3MAQA 3MM9A 1RT1B 4DPYA 2PGCA 1VJQA 3R5AA 1MSWD 4QU6A 2BEFA 2R8KA 3T1HJ 1JIHA 5JXSA 4DOZA 1FK9A 2OGUA 3PFEA 3RZAA 2FYXA 3QSYB 1UVKA 3C15B 1TKTA 3V5RA 5IC4B 1CS4B 2J6SA 2RB7A 1IBKF 2ALZA 2R8JA 2PI4A 4FDFA 1NU4A 2D41A 2WOMA 4YR2A 2YWGA 1T95A 5FIIA 1UMJA 5IZHA 3BN7A 1RQ0A 3C14B 1LWEA 1PYOB 4LF4J 1AFJA 4OYBA 1T03B 3KHRA 2RS2A 1BQNB 4NZ0A 3HSJA 2JDJA 2PMHA 1VRUB 5KAKA 2P5VA 2OELA 1YBUA 3U02A 2W7OA 4R25A 3TX0A 4ZVTB 3KLGA 1RAIB 1QM9A 2HFNA 1MU2B 5KFNA 4P72A 3PJWA 1TVRB 2GQCA 4OFZA 2XY7A 1Y5LB 1QJHA 2G1DA 5GAEU 3MM8B 5DGAA 4B3TF 4JI1J 1S0MA 2OSQA 1NSKL 2YKNA 5EUHA 2KKHA 4NLUA 3QATA 3D0IE 4NA1A 4RUCA 3KK2A 2AJ4A 1L3UA 3MTKA 3D68A 1N5VA 2IPOB 3NGDA 1HBMB 5B0GA 2W2QP 2E66A 4FVMA 1LXNA 4MK8A 1F9EB 1ROFA 4IQMA 3PZPA 2XG8A 1LW2B 5LOQA 1HIYA 1HQEA 2JOQA 2HBYB 1HHTP 1XNQJ 1KTVA 3US5A 3L7UA 2IM3A 2WZ1A 3L7PA 2DPIA 2K7JA 1PJ7A 1GMWA 1HBUB 4EWTA 4P2SA 4AXJA 4QW8A 1YJ9S 2UXBJ 5I42B 3GV7B 3QT8A 3QGGA 4J90A 4LSNB 4AL5A 4A8SA 1XMQF 2VFUA 4OI6A 3NL0A 3KG1A 1WJ9A 4DR7F 5KT2A 5A8RB 8AT1B 2J8AA 4PAAA 1VRTA 1WG4A 2VICA 3TZYA 2Z2MA 2M88A 1YITS 1AYEA 4MAKA 4QU7A 5KOXA 1UZHA 3ZZYA 8RUCA 1YDLA 4WPAA 4C8ZA 3I5AA 3MM5B 1RT5B 2C2OB 5KG7A 4CCHA 4I6AA 2MLYA 4C11A 1BC6A 5DO2A 1JX4A 2UVUA 4J9VA 2XMTA 2W9BA 4FXVA 2OHDA 1D9DA 2MHNA 3LQVA 1HMVB 2LXFA 2FJEB 2DNRA 2B8PA 1U1PA 4IFYA 2XS5A 5C24B 1AZSB 1NSQA 4B3MJ 4LF5F 1UL3A 3LO3A 4A48A 2PT0A 2XY6A 1TAUA 4KKOB 4OMFG 2YQ3A 1RWKB 1FDDA 2ZE2B 1R6VA 2FY8A 2N4DA 3K5MA 1KBRA 2JVRA 4B3TJ 1S49A 4HTJA 3PIPQ 1LW0B 4U8VA 3LTOA 2IVFB 4M63A 2DIVA 1XMOF 4JI0F 1T9YA 4I56A 2IA0A 2FVRA 1WOSA 4DSEA 2XYHB 2VPWB 3FFIA 2IJNA 4DQPA 2QMXA 2HHWA 4NCGA 1RACB 1KVIA 4RR5A 3QYYA 2E7WA 3RUBL 2IBOA 2F40A 5HQ8A 5ADZA 1ZOTA 2Z58B 1MWQA 1B7YB 1FT8A 2YWHA 3PYGA 3TP2A 2D3ZA 2VG7A 3G8QA 4DUTA 3TUJC 1FFSB 1S9EB 2EC2A 1SQGA 1U02A 2FJVA 3OT9A 1CC7A 5DQIA 4LF8J 3AA8A 4FYDA 3FZ2A 5LMUF 1HYSB 2ZJRQ 2AT1B 2O66A 2CIMA 4OV6A 3V6JA 3PYEA 2R42A 2E1AA 3CDBA 5I3PA 3CC7S 4MKAA 5E33A 2DB1A 3EICA 3U27A 1VQNS 2KL8A 1NPRA 2ZDOA 2YNHB 3OVBA 1RTHB 4DF8A 4WK1A 3SQGA 3SSRA 1TL3A 1ZPWX 2GGPA 2QE5A 3QGHA 1X5PA 2AEFA 3M2RB 1ZBTA 2EW9A 4ECZA 2AKWB 3JAMU 1VQ6S 4FBTA 2HVHA 2RS8A 1T3NA 2D3UA 5C42A 2ZWPA 1SIWB 3M32B 4X84A 3LPEA 2R2UA 4J9UE 4R8UB 2K06A 3IG1A 4O0NA 2R7RA 1KLMB 2FC9A 2CWXA 4YY3F 4G1QB 2GA7A 1HQ2A 4Q44A 3RB6A 3MR6A 1VR6A 2WW8A 1VI7A 3KOAA 4PABA 4HLBA 3EPIA 3NS5A 5A2QU 1RWXB 2E9RX 4ZPWR 3CIZA 4ZPDA 5IT9Y 2XSFA 3DLEA 2PEHA 1P9YA 3ISZA 4R0EA 1XMOJ 1V5VA 5DGBA 3DLKB 3HF5A 3SCKE 4DFKA 2GFFA 1WTBA 4X4SA 4PQAA 1VQ4S 4CO5A 1Q53A 3ICLA 1RT6B 3O2IA 1SCJB 5D0HA 3DU5A 4QYZJ 1TKXA 1V5IB 5D4NA 2E7XA 3K58A 4ECWA 1S72S 3TAMA 4I7FA 4OL8A 3TUZC 5LSOA 1YKWA 4J9LA 1VBZA 4IH5A 2DVIA 1DQ8A 2FJXA 3FSIA 1N8RT 2LXUA 4TY8A 2OKQA 3IS9A 4P71A 1KQFB 1S4EA 2BDPA 5KTQA 3BYRA 1SKUB 3S1TA 1KR4A 2EWHA 2DPJA 3KLHA 5KFDA 3QO9A 4PWDB 4GVLA 3C19A 1SVDA 2XZDB 3IR6B 1YHQS 1MWZA 5CYJA 1ZA2B 3DM2A 4J9PA 4DV0F 2ZH6A 3T19A 2VC1A 3UDVA 3GFHA 4MYUA 2HBZB 2PA3A 1BE4A 1PO6A 5CABA 2Y1LB 3NLCA 4DHVA 1TUGB 3FQLA 1Q81T 4CP5A 3CDUA 1H7XA 3KLIB 4EMDA 3I31A 3V6HA 4JV5F 5L1JA 3NOGA 3UDCA 1RCXB 3MEGB 5DG7A 1PILA 5KG1A 3H5UA 1XMBA 1NPKA 3OL9A 3JXOA 4IO1A 4WKRA 4M94A 1S1UA 2GCFA 3MPDA 3VQSA 3G2XA 3O5TB 1S1XB 3RBZA 2V63A 3I87A 2VG5B 4RW9A 3OVSA 1Y10A 4UOFA 4KIAA 3FRYA 3AD7C 1CQMA 1R8PA 2DGUA 3N79A 2UXDJ 1GTHA 2YVSA 4ZVUB 2RKIA 2OPSB 2C3MA 4UT4A 2LEBA 1P9QC 3UCUP 1FJ7A 3RB4A 2HIYA 3GJRB 4WE1B 1DBDA 4BWMA 1HR0F 1XJWB 3D1HA 3CW2C 4KH1B 3PX4A 3K2YA 1PBAA 5IT0A 1KHVA 3ONQA 3B6BA 1RZMA 3I55S 1B99A 4DR2F 3A3PB 3Q23A 2DKOB 2RVJA 2G0IA 3MUMP 2C3UA 1S48A 2X1AA 1AA1B 4RW6A 4A47A 5G4DA 4V1Ak 4F4KA 2IDEA 4UF4A 3CCWA 1J5EJ 2KJWA 5HBMA 4X65J 1YK9A 2ZHAA 3J7AN 3RYLA 2VBWA 3V6DA 4OZ0A 2NPIA 2Z56B 2HEKA 2ROGA 3CJRA 4DMZA 1IKXA 5HVGA 2C28A 2VF3A 3Q0AA 2B6AB 5IQQA 3UE2A 3JSMA 4ZVEA 3FK4A 2U2FA 4F3OA 3HSDA 4ANEA 4BS2A 3OTOF 2PD1A 1HPZB 2FJDB 2DH7A 4DV0J 4AYBD 3P5BP 1SH3A 2AU0A 3K57A 3RAQA 2FB0A 5F3TA 3DYAB 2MKIA 2KU7A 4RBVA 5HANA 3AB2B 2RDJA 4WXOA 5F9LA 2QV6A 3PNIA 3T5KA 1RU1A 4ID5B 3H90A 1C1BA 2BRLA 3DRPB 1JLQA 2ZVSA 1MMDA 1Q7YT 4DX8H 4CLPA 1LK7A 5CYMA 2Q43A 3IMQJ 4KB7A 3C6UB 4LFAF 5D4LA 1H3DA 3PYDA 4ZIWA 1FVSA 2DNNA 4OYZA 4LQ3A 3LP2A 1RGVA 4OYXA 4ITSA 2C2DA 1FF2A 5K8PA 2QA2A 2EKYA 4QWEA 1R8AA 2WW4A 3H7HB 4UQTA 1MN7A 5DDOC 1TP7A 4K5SA 4EZ6A 3H2LA 2N82B 2ZFHA 2DR5A 1HR0J 2RDDA 1HNIB 3I4HX 3PW7A 3VALA 4BDPA 1VOMA 1C0TA 3K89A 1CBKA 2HQCA 4DV2F 3BR9A 1Y3JA 3UD4P 1BQMB 1FXRA 4E0DA 1M90T 4IR1A 4ECVA 1S6OA 1SUQA 1VIXA 1RWUA 2BJ7A 5L1IA 1QLNA 4ZPVR 4M5KA 4JI4F 1YWXA 1CJUA 2BM0A 3HO1A 2GJIA 4PG7A 2GMLA 4OV1A 2KZMA 1NHVA 1VBXA 2ZD1A 3TJ9A 2DJWA 1X8DA 1F0XA 3QAUA 1FVQA 5D3GA 1H7WA 1Q8LA 4I68A 4P73A 2HHXA 2YKPA 2RT3A 2QL5B 5A0YA 4P2XA 2XMVA 2AYMA 3CJSA 1APSA 1FKAF 3U1NA 4DS4A 5J2PA 4WFNQ 2HZAA 3PACA 4ZA1A 2UUBJ 3VR1A 1VQLS 3L4BC 4OI2A 4DV1F 5HLFA 1X5TA 3N5BA 6FDRA 4GC6A 1YGYA 1RABB 2ZDPA 1LWFA 4DQSA 3CC2S 4QR0A 4JV0A 2ASJA 1ZM3A 2XMJA 3D67A 1RLCL 2F9DA 2OLWA 3FBEA 4OX9F 3VQTA 3PR5B 4YS2A 4L73A 1YRTA 4LFAJ 2NZ4A 4BCAA 2FZKB 4O3SA 4DX7A 2CRLA 2A6OA 5KFLA 3OV7A 4OX8A 3HVTA 2E1CA 1CJTB 3CEDA 1NAQA 3CJ2A 3MECB 4BWJA 1EX8A 4H4KA 1P1TA 2CFXA 4J9NA 2R7OA 5KFFA 3H5SA 4KYZA 2VFRA 9ATCB 4X4OA 1KOHA 1CC8A 1NJZA 2BABA 4F4WA 1ZM2A 3GSIA 2V68A 2FUG9 1M1KT 2RRBA 2COLA 1IBLF 2QZ8A 4CLZA 4DPOA 4KH0B 3DNCA 3G8TA 1C0UB 4FP9A 2M52A 1XK8A 1SKWA 4GVBA 4WFAQ 3PVXA 5DZ6A 3AOBA 3FKBA 2B43A 1T7PA 1KQSR 2ADCA 4RNMA 4NCAA 2V0NA 1R0BG 1ZPVA 4PWWA 5IT9U 3RRGA 2LA6A 4DV4F 3THPA 1YBTA 4G1IA 1RTJA 3L9ZA 3RR8A 3DI6A 3QMQA 4R0JA 2D9PA 1YLXA 2J0XA 2QA4G 3QRPA 1YIJS 3GPAA 4LVNP 2AX0A 4LF9J 4X4RA 1F2GA 4X64F 1M1GA 1KC8T 5LMNF 3CD0A 2O01C 3UD3P 4DV7J 3KTQA 1U8SA 3DOLA 3GLJA 3FEXB 4DR3J 1N6QB 4HH0A 4DUYF 4EO8A 2WAQD 4L72B 3GYNA 3R7NB 1Y4ZB 2HQIA 3FUYA 3VTIA 2D7SA 4IDKA 1LXJA 2VJVA 3X1LB 3M8PA 5EWGA 1V3SA 3IWNC 3RG6A 3LH2S 1WEXA 5HL7Q 2CWKA 3I5CA 1FX4A 2C42A 2C2MB 1FD8A 2IYGA 4PKDB 1UAWA 2O5DA 1B0VA 4DR4F 4DBQA 4A8WA 1OO0B 2B5JA 2QMWA 2IJFA 4F36A 2Y1JA 5J1EB 3IM8A 1CJVB 2DRDA 1V6HA 4ED8A 1OJ4A 2AD9A 2J7WA 2N7CA 4HR2A 4FXWA 2BE2A 2KM8C 1T8EA 3UCGA 3MURP 3A8KA 3HD1A 1IBLJ 4F4AA 4ZPBA 2Z30B 1XN9A 5D77A 5A8WA 1KP6A 3ZNJ1 2JLFA 3T6BA 1VQOS 2GIRA 3CJKB 4NZ6A 1X5OA 2NLWA 4EI2A 2DBBA 2PMZD 4ES1A 4Q0BB 3PXGa 4JV2A 2FQQB 1HNWJ 4ZOSA 4NZ7A 2F8MA 4IFVA 4B9LA 2F7VA 3DKDA 4LBPA 1FKPB 2F4VJ 2DH9A 1XNRF 4QWDA 4DV4J 3EYZA 2FGOA 4DSLA 1SJRA 4DV6J 4DR6J 4O4RA 7FDRA 4CH1A 2N7YA 1S0VA 4LBHA 5KFHA 1RISA 3MM6B 3CCMS 3FMBA 1FJEB 1L3SA 4X64J 2U1AA 2IAJB 1YJNS 4AL6A 1LKZA 2XHWA 4Y2KA 4K4ZA 2XULA 3MM8A 1B4SA 2PC6A 2JRSA 3KMQA 1S79A 4K4VA 3M2VB 2UXCF 4BHQA 4DUYJ 1GAOA 3WHIA 1GMVA 2BX6A 5KFPA 5F3ZA 4KRWA 2XQCA 1UZDA 2GJ2A 3MPYA 3HULA 3DOMB 3HHLB 4ED7A 1A7GE 4GC7A 3RTVA 1S9GA 2BJ3A 2DGQA 1X7VA 2Z4PA 3BR8A 3DDNA 2AJ1A 2HNZB 4IG3B 5DQGA 2HBRB 4ILLA 4OX7A 3EZ5A 4FN5A 1WKKA 1AFIA 1F2HA 3BO2A 1QSLA 2GQQA 3BH6B 2NXJA 2A10A 3K0JA 3EVMA 1CSJA 2YNIB 4P2FA 3HJFA 4TKTA 5I42A 3S01A 1UFLA 1Q4RA 1YJ7A 2CVIA 3IRXB 5EDWA 3D6TB 2VBXA 1OIAA 5AXMA 1UA0A 1S1WA 1TL4A 3OL7A 2R8IA 2V4JA 3Q2SC 3U1MA 4RX6A 1SL1A 4X4NA 4V19J 4JV1A 5AE1A 4O0IA 1SB6A 1NSPA 4E98A 1P6TA 4I4BA 4NLGA 1TL1A 4FF2A 2HVDA 3EXYA 2HMIB 3TR5A 3EJMA 1FFGB 3RW7A 1RAJA 3IWLA 4QYRA 4P52A 2DHXA 2ZBIA 4MIBA 1J27A 1GXLA 3CWJA 1M1HA 1N0VC 3OW2R 1DQAA 4OHYA 1WSVA 1JLGA 1RLDA 5D4PA 1JLBB 2KN4A 3D54A 3QBCA 3PHTA 2L9WA 3K5LA 2GS8A 3QLHA 4KQZA 4CT9A 1EETB 4HACA 4C8OA 4FKYA 1WDTA 4U6PA 3MMCA 2XGQA 2GAHC 2UXCJ 4M5DB 3UN5A 3QIPA 2H65B 1G1XA 4Z7CA 3MM9B 2O67A 3N5FA 2JZ5A 2UP1A 1LOUA 3CDWA 4QCLA 1FK9B 2YKQA 2E1PA 5GMEA 2E5LF 4W90B 3TW0A 1QVFR 1OQ3A 3G4SS 4IUFA 3M2UA 1OYEA 2BJ9A 2DGSA 1AUDA 1TKTB 1KSPA 4RW8A 3RGIA 4MMOA 3DMJA 2GVDA 5T7LA 2V69A 4RWXA 5ETOA 2A3JA 2YNGA 2HHVA 3Q8QB 1HHQA 5E3PA 4OI3A 2BA9A 1ZH5A 2WOMB 5IWAF 5DS7A 2Q79A 2LQ5A 4F2SA 4KTQA 3R97A 1P8GA 5BR8F 3T6JA 4W4MA 4WK3A 2D3OR 2XS7A 1NK7A 3ITHA 4ZVGA 5DG8A 3C6TA 3GILA 2UUAF 3HHKA 1T9UA 3OXLA 1OMSA 1UW9A 1FE4A 1IWAA 4CTAA 3I82A 4DL2A 5H9EK 4FYXB 3BSCA 3THTA 3I0RA 3HSGA 2R7WA 4JB8B 4M5NA 3FJ2A 3ZZRA 3HLUA 3KLGB 4KSEB 1QDUB 4LRDA 1U1NA 4KY3A 3GQCA 3ZTPA 5KFZA 2FHKA 3O44A 2JFKA 2V9WA 5HMYA 2CYYA 2YKNB 4CWBA 2W4DA 4AUKA 5KFMA 1U1QA 3MWBA 1KD1T 3KK2B 2HNYA 4MKYA 2K1RB 4HYKA 2QA4S 2D69A 1N32F 4G1QA 4DWIA 3OFHA 3UD5A 5KT6A 4FPRA 1RWWB 4YDDB 5ETKA 2Q6CA 1FA0A 3W9IA 2WONA 2HVIA 4S0MA 2AW0A 2DYAA 2W8LA 3FCVA 1WKJA 4F2RA 4Q2LA 4B9NA 3FZBA 2BJ8A 5A76A 3BBBA 2CQIA 4PUOA 1REVA 3DLKA 1ZZFA 3OR1B 2DIUA 4ZVSB 1U1OA 1WHYA 1K0TA 5GADI 2HG4A 4DR5J 3A4TA 3TVZA 2IM0A 4KHMA 1VRTB 3AB4B 1N48A 2VHGA 4IOCQ 4YR0A 1R0AA 5D0GA 3MPVA 4N7TA 1VRQC 1FD2A 3QNWB 2QGFB 5KG6A 1M5SA 2HGNA 1FTRA 2J6UA 5KT5A 2MQOA 5D0EA 4QWCA 2AJ2A 3VV2B 2R4FA 5AXLA 2E5IA 2HWIA 2GVZA 3OQ2A 5GAHI 4C11B 4NYZA 3CCJS 1RAAB 2Z2LA 2AIRB 3HT0A 4FYVB 4L3NA 4ZMMA 2C2NA 4LF7J 2VA3A 3SI8A 5KFKA 4IFYB 3A8JA 1I1GA 3NAIA 2H9ZA 3JTOA 3CD6S 2MY8A 2GO9A 2QEXS 4NLXA 3I9ZA 3NEKA 1HW8A 3LP1A 3JYTA 3W8GA 4DV3F 2HWHA 4B3SF 2LEPA 3BGUA 3V81A 4O3RA 1FWLA 1WUUA 3VZHA 1R8CA 4M5JA 2G2ZA 1XR6A 2J9DE 5DM6Q 1B3TA 2I2YA 1NK4A 1JJHA 2VOOA 2VDIA 2RU9A 2W7PA 1TV6A 5J2QA 2JEGA 3FFIB 1XEZA 1G6BA 1U09A 2XSJA 4NCGB 1XC9A 3GR0A 4ZP7A 2AEMA 3OUYA 3UN3A 4MIWA 4ERDA 3D28A 2RJZA 4ES3A 4KGMA 3JB9k 2UUTA 1URRA 3D6MB 5K8MA 3OFFA 2IFXA 1S6PA 3LWLA 2ZOFA 2VG7B 2L3MA 3D7SB 3HM9A 1RAGB 4EO6A 3E2EA 3UR0A 3T1AA 4C3KA 5BXIA 2JNJA 1N5SA 1YRXA 5CYQB 5J2MB 4RJVA 3MPWA 4B9SA 5EN1A 2NREA 2ZJQQ 1NXIA 4CT8A 1G3OA 2BQUA 3M30A 3EDRB 2EG1A 2KXFA 4YMEA 4ZP6A 3G96A 2CXEA 2CQ0A 4ED2A 4LSLA 4B3RF 4OYWA 5CCMA 1WSRA 4HTIA 3MUVP 2VQEJ 3MR5A 1YJWS 1HNXJ 2UVRA 2LYVA 2H3EB 1TMJA 2B9EA 2YWWA 2GGPB 4PXCA 3CCRS 3ET6A 4IH6A 1JB0C 4ZP9A 5KFRA 2Q6BA 1X4FA 3GG1A 3MPUB 5C42B 1EKRA 2KRBA 3O8WA 3IG1B 2XCPA 4CH7A 5C2GA 5KFCA 2FVSA 3PJ9A 3GG0A 3QAEA 3D6HB 2GV1A 2GMJA 1PYTA 1VHIA 3DYAA 3UPFA 2ZM6J 2ZC3A 2QLBB 2LQBA 4USTA 4ECQA 3W61A 2QT7A 4HI1A 3DRPA 5U47A 3OR2A 3M6WA 4DL3A 2FPHX 3DLEB 1TUVA 2X51A 4IRDA 3BGRA 3LGHA 4LQ9A 3N4WA 2PMWA 2I38A 1GQEA 3C3LA 2A2DA 4OHXA 3GJSB 4I67A 4ZVRB 1WC4A 2PA8D 1ZS6A 3GV8B 3CC4S 4TYBA 2CVEA 4YOEA 1TKXB 1VYAA 1FNXH 3L95X 3RAMA 2KYXA 1UA1A 4TU7A 3TAMB 3MMAB 3ETMA 3M1VA 4Y34A 4I7FB 2MZ1A 1M5KC 1X4HA 1N5TA 3EVOA 2ROEA 3VVUA 3CT9A 3GFYA 3IS9B 1PGZA 3PW0A 2KT2A 2W2OP 3CB4A 2Y0SD 2HKEA 4C8KA 3VAFA 3PJXA 3B82A 4RBTA 2X3GA 3KLHB 4KGXB 3QO9B 3PG9A 1FHTA 3SSQA 1TFWA 1NK9A 5B7WA 1CVJA 3DM2B 2KH9A 1QUVA 2H5EA 4OJHA 1FDNA 4I69A 2EKNA 1ZAVA 4HEA9 3FCWA 3DRYA 1J5OA 3W62A 2ZZNA 2WVFA 1RT7A 4NL5A 3TARA 5EWEA 1GH8A 2R7UA 5L9XA 5DLGA 1OSCA 3DLJA 3V4MA 1H6KX 1O5JA 1RDRA 2DEJA 4J9OA 5ITHA 1S1UB 3QT5A 2V67A 4X66F 5THWA 4DCOB 4RW9B 5F8HA 2CDQA 3DXSX 1G7CB 1H38A 2CZ4A 4M95A 3ILLA 2RKIB 3EPGA 5CA5A 2RHQB 2DTJA 4LIRA 4D3GA 5IV4A 2UV8A 3FSXA 2XBPA 3NG8A 2VKRA 1NHKL 3EGNA 3TVKA 5HMWA 1C1CA 4MFBA 3GONA 2YY3A 1EP4A 1T94A 2Z8QA 1WF0A 2IRXA 3DLHA 2W24A 3MR7A 1SKSA 4F02A 4L75A 5I3QA 2XNRA 2IVYA 3PEJA 3H20A 4LFCF 2CQ4A 1U7LA 3IBCB 3DFEA 1FDAA 2KO1A 3SEOA 2FD2A 4RW6B 4USUA 3OVAA 2VODA 5HBMB 2AGQA 3V6DB 1NZ8A 3N01A 4NLWA 2R7TA 2KT5A 2QO3A 3WZ0A 4TXSA 1IKXB 1TELA 2R2RA 1TAQA 1CQNA 3JSMB 5B0FA 1VGYA 2C3PA 1PCAA 4DV5F 1RHQB 1YI2S 3TA1A 1XIQA 1VQ5S 3OTDA 1VLOA 2HRUA 4C8LA 2PO4A 2Z0GA 4KJIA 2ZUGA 1NLKL 3J7YI 3DLBA 5KT7A 3W7BA 4EBDA 4NXNF 5GMDA 3DRSA 1HL6A 4OYAA 3RB0A 1JLQB 1TKZA 3GJQB 3T5HA 4LBIA 2VFTA 3D1OA 1UVLA 4J9RA 5CYMB 1LEOA 1K47A 4KHPF 5C25A 3WX4A 1NMEB 1C2PA 2ATCB 2H4WB 3KKFA 1S7HA 1QAYA 4N41A 2RE1A 2HLTA 1BXNA 3KHHA 4X66J 2XTJP 2MKHA 1BUXA 3LP2B 5F41A 3AA9A 5A6WA 3H2VE 4DF4A 4NEZA 4CO2A 4CDIA 3M8WA 4PG6A 3NBPA 1M5PC 3QIDA 1IKYA 4AE5A 3L7OA 4ZPAA 3M6UA 2N4CA 2FZCB 2CPIA 3TX8A 3TUPA 5KFSA 2OPQA 2VFSA 1Y11A 2VUGA 3CJTA 2DNYA 2DNKA 1S1TA 2D9OA 4YQWA 1U4BA 2MKYA 2DCUB 1CJUB 3HFKA 2PI5A 4ECYA 2Y1IA 2ZD1B 2DHAA 1J2VA 2ALYB 1RSCA 3IO1A 3J81j 5D3GB 1VBKA 4YP3A 4EBEA 3OL8A 1PIEA 2RMLA 1IR2A 2DXDA 2VOPA 5F8IA 4CI0B 2CZVC 1N34J 1EKSA 5A0YB 1LV5A 3QRQA 3KNAA 2ABYA 2HFUA 1MW7A 5J2PB 4TLRA 1F5AA 2C2ZB 3EX7B 4HKQA 4PRFA 2YH0A 3AOCA 1FKPA 4Y2AA 3P8BB 2CADA 4X4PA 4B02A 5H9EJ 3SCJE 1SV5A 2B7BB 4NXMJ 1LWFB 4NCBA 2D3O1 2OD6A 5D6GA 1CG2A 3I5BA 2VPXB 2R8GA 1TZ0A 3MM6A 5HQLA 2YQ0A 2NUUG 4F7VA 3FGVA 1RBOB 4Q2MA 1NRKA 1M5HA 4KT0C 4UUXA 3KLVA 5HMXA 1RHUB 3MMJA 3FEZA 3HVTB 5DDPC 2ZBCA 2P6SA 4URSA 2RD5C 1X4GA 1T3OA 2FTRA 3KJNB 4QJVA 3GYGA 3BPDA 4XDDA 3NKYA 3PDNA 2KTQA 3M7VA 3DOMA 2JWNA 2E9TA 1TL7A 5KT4A 3CCQS 3MCOA 5E3RA 3CDAA 1RK8A 4LFBF 2AWZA 4ZVPB 2GIFA 3MDFA 4URQU 2G4BA 2BW2A 2W9CB 1GK8A 3KJVB 3MGJA 3E51A 2FHOB 2HHHF 2KVIA 4QQBA 2EBGA 1KQGB 1U47A 3AFGA 2J0WA 2KDOA 3CSKA 5KFBA 2P6TA 1ZM4A 1RWNB 3IXQA 1PSDA 1RTJB 5IT4A 2R8HA 5I4MA 2DGWA 3PW5A 3CNQP 4DR1J 2YKAA 1N4LA 2VQFJ 3Q24A 2W7AA 2R2SA 3W60A 3B4MA 4ZITA 4OJGA 2GX8A 2QLJB 4Z2XA 4HH1A 3R6GB 2CQDA 2W4CA 2ZH5A 2XCAA 1HWKA 4X4UA 3D4JA 3DOLB 1U0HB 4NRUA 4NLOA 3G8SA 1PKUA 4C6AA 4WFBQ 3DRXA 2DY1A 1FKOB 3BKUA 4NYPA 4DZ6A 2ZEJA 2R7SA 5B08A 3M8PB 5SZTA 5IM0A 1RWOB 2M5YA 2ACMA 1RU2A 2MZTA 3UVJA 3AXKA 4DQRA 1HBNA 1NH7A 1RKIA 3PKMA 4HVZA 3HJVA 4DPWA 2LXIA 2J0QD 1HNZF 3ZZZA 4FYYB 2B5JB 2B56A 2P9CA 2DGTA 2YBVA 3V6KA 3DC2A 3BN4A 4PR6A 4X62F 2YNFA 1VFJA 3AJDA 3LAKA 2M4MA 4N47A 2ILZA 3HZGA 4J7CA 2B9XA 2F3JA 3MD3A 3BBCA 2AEJA 2BE2B 2FZGB 1YBAA 3MI7X 4NWBA 1SC1B 3PY8A 2VDHA 2F9JA 1RHRB 2M7SA 3RB3A 5A8WB 4DQIA 1FX2A 4C7QA 5JUMA 4LFBJ 1XBWA 2JLEA 4C48A 1NZAA 4D3HA 2HSEB 2I5JA 3J7A1 4JI3J 3P3DA 3B8HA 3UNGC 3BDEA 2H54B 4IOBA 5HVHA 2DRAA 1OY9A 2J5AA 4CLUA 3BH7B 5E3CA 2XEXA 2KHDA 1WC0A 3JQJA 4IFVB 2UV8G 2WB4A 2CA9A 1FE0A 1WD6A 1DHMA 2HHUA 1UFWA 1ZAWA 2HQDA 1S7IA 3IAS9 1SXLA 3DOKA 3NXZA 5MLCV 1RBAA 1UCNA 3M8RA 1VQ7S 5CH7B 2AP6A 2PN6A 2HFOA 4R5PA 1ZA1B 2DHSA 5A8KA 4YDXA 2DNZA 2OP5A 3EVWA 2JFDA 4FXDA 1RA7A 3DXBA 4O23A 4RW4A 3OL6A 5E2QA 2E7VA 1UVIA 2H5JB 4OZLA 4PXBA 4KPCA 3BZQA 4QIEA 5IV3A 3TA0A 1D9AA 1AB8A 2GQ2A 2DXFA 2JEJA 2XZWA 2IYIA 1Q8BA 4DX5A 7FD1A 2K1RA 3I6PA 2Y9HA 4NLVA 2HHTA 5AJ3F 1RAHB 3EZOA 1FDBA 1S9GB 3ISND 4IG0A 4NEYA 2V9KA 2XZTB 2A2CA 4NLYA 4H54A 1FNMA 2V34A 3G6VA 3OFGA 8ATCB 4K4YA 2B9WA 2OPPA 2AGPA 3N6MA 3SXLA 2ZH4A 3BGFA 3OR1A 1OPIA 1IM4A 4TY9A 3R7SB 4GKKF 1WDDA 1VK8A 1K44A 1D0EA 2P2CB 2DNOA 4WP8A 4OZ3A 4L6V3 5K5MA 1PC4A 2BE9B 3OD2A 3D3BJ 1WACA 2AHOB 1S1WB 2QYCA 2DCLA 5HO4A 4K5RA 1S0OA 4WF9Q 2DNPA 3W2WA 2V4JB 1X4BA 1IBKJ 4EEYA 2CQ3A 3LGNA 1I94F 3FNNA 5IXUA 1IR1A 2X1BA 2JHEA 3LALA 3SYZA 2ATLA 1TL1B 4V19X 1RT2A 1CJKB 1G2EA 1KRPA 2BW7A 2HW3A 5I3UA 3CTRA 2IC3A 2MZJA 3RBEA 1SJFA 1YG0A 2Q66A 1B7FA 1U1LA 2A0FB 4FS2A 3SCIE 2GNKA 3WX8A 4BC9A 2FHJD 1X0FA 1JLGB 4KR0B 3F41A 1EQ0A 4P10A 2HQ3A 1S4FA 3W5ZA 1D8YA 2VU5A 3QLHB 3MOZA 3D0GE 1WWHA 2AMCB 4HACB 2VPZB 3R2CJ 1U2FA 1S1VB 3Q8YA 3UNYA 1DTQA 5D8HB 3T5LA 4JI5F 3MMCB 1UJ4A 1WEYA 3QIPB 2EFOA 1N36F 3J7ZT 1IKWA 3TQ1A 1R8HA 3BREA 2ZBPA 5LM7E 5GAGI 3I56S 5AJ3J 3QWUA 4J9KA 3QZ7A 1N88A 3M2UB 3ILJA 1JLEA 4RW8B 4F0KA 3DMJB 2GVDB 5T7LB 2UUCF 2YNGB 1RP5A 3NS6A 5HQMA 2KM8B 3F73A 1VMBA 1F1BB 4Q5VA 5DM7Q 1TFYA 5LL6d 5F0UA 2WK4A 2V8HA 1RT4B 1VHFA 3UWTA 1YZ7A 3QPIA 3D66A 3VGUA 1NHUA 4MT1A 1SC6A 5CYQA 4JP8A 5J2MA 2JSXA 4B08A 1XMQJ 4GKKJ 3ITHB 1W2BR 2LECA 4DR7J 2G13A 1T11A 3C6TB 3VAKA 4I2QA 1HNVA 3CJ8A 5CD4A 3H5XA 2IA6A 4CTAB 4GKJF 2DNLA 4PXEA 3I0RB 1RAFB 3AH6A 2K3KA 4FS1A 3ISNC 1FRIA 5DG9A 2RF2A 2MJUA 1UJ5A 3VGTA 2LMIA 3LPYA 5B0BA 1EJ7L 1TMMA 4ZHRA 4JI2F 2HRTA 1OS5A 4N5SA 2OTJS 3NCQA 4NASA 4H4OA 2C2KB 1JJ4A 5H9FK 3A13A 3B78A 2HNYB 4A8MP 4LF5J 4CNZA 1VQPS 2ZH3A 3A3NB 5BJRA 2KT3A 5G0RA 3HZEA 3QQCD 4CLTA 4CLYA 4B9MA 2WONB 1SL0A 3JQMA 1RTIA 3NNCA 4LREA 2XNQA 3GSDA 4JI0J 2WVCA 4PUOB 4EZ9A 1REVB 5HSPA 2RSQA 2OFHX 2QYGA 2FDNA 3T1YF 1Y7PA 1NK0A 2HRYA 1N0UA 1R31A 1VC0A 3NMRA 4ZCLA 1M0SA 4C2MA 4OZ1A 1X4CA 1R0AB 3OTBA 3BKFA 1KONA 1DLOA 3K17A 3MMAA 4OZJA 1FXDA 4B17A 1ZAXA 2GVZB 2UVVA 3SCLE 1YJVA 2VASA 3W64A 2NCKL 1NKCA 1G4CA 2IDLA 3GMGA 3VAIA 3A8EA 3MEDA 5C5JA 4KGZB 3LWMA 5LMUJ 3QT6A 1JXLA 4YB7A 5M2UA 4TVAB 3KK3A 4EUVA 1O8BA 3RBDA 4FBUA 5HN0A 2CNLB 4LUBA 1PG5B 3LP1B 3HHDA 3JYTB 2XGPA 3V81B 2VA2A 1AROP 4OYOA 4JI2J 1FNOA 1OYDA 4M8LA 2HNDA 3ZO7A 3W9HA 3T5JA 3AQOA 4HT7A 3VF0B 2AX1A 3H2UB 4TU9A 1TV6B 5J2QB 4YY3J 3TYTA 3GIKA 1UPPA 1GX5A 2MMYA 2CJBA 2XSJB 3BO3A 4RWWA 2D74B 3OUYB 3K8VA 1NO8A 5KG5A 5E7OB 1R0CB 4HHJA 3SSSA 2KJVA 1PAUB 1S6PB 1BLUA 3R5CA 3DN9A 1N5QA 3KWMA 1SJ4P 2OJ3A 3G6XA 1H73A 3MCMA 1TQLA 4WP9A 3MEKA 3TAPA 2EFQA 5J1NA 2R7QA 3GE9A 2ZZTA 3L09A 4EBCA 4DI6A 2GHPA 3CCZA 3K59A 1RHMB 2M8DB 5FDLA 2MKJA 2HS0A 3M30B 3Q83A 3NNHA 4ZJQA 1UEUA 1S59A 2XS2A 2UU9F 5J1PA 4EYIB 2EC0A 5GAEI 1T02A 4LSLB 2VC0A 5HROA 1UEKA 1R7IA 5IFMA 3H98A 3IFEA 4CNYA 3E8OA 2QG9B 3ELHA 3Q8UA 1WG5A 4LIWA 2QFJA 2QJ3A 2MSTA 3ET6B 5M2PA 4M5HA 1KLNA 1PAEX 5EGYA 5KFIA 3OXGA 2NXCA 3VVTA 1VQSA 1FJGF 5B0DA 4K4UA 4KBIA 1F60B 1TK0A 2R2TA 4O3PA 4F67A 2G2OA 4KO0B 2W2PP 4JYAF 3HK2A 1SL2A
chains in the Genus database with same CATH topology
2ZH2A 5KG3A 4C11A 4U7UK 3IR5B 1BC6A 5DO2A 1JX4A 2UVUA 1O51A 1HI0P 2QA1A 2VG7B 2FVQA 1JMTA 1WF1A 2XMTA 2L3MA 2W9BA 1U1RA 4FXVA 4GO5X 3CE8A 3VAHA 3HM9A 1D9DA 2MHNA 4EO6A 4YEAA 3LQVA 2FC8A 3N28A 3G6YA 3E2EA 3PX6A 1HMVB 2LXFA 3UR0A 2FJEB 3T1AA 4C3KA 4LT6A 5KFWA 3PW2A 2DNRA 1AW0A 3ZZ0A 3NCRA 4CO3A 4PPDA 1W2IA 1FEHA 1HBMA 3R3TA 2MQQA 4ELUA 1U1PA 1HWIA 2BVZA 3BS9A 1N5SA 4IFYA 2XS5A 1YRXA 4B9TA 2ACYA 5CYQB 3OR2B 5C24B 5J2MB 3MR2A 3MPWA 4B9SA 2KXHA 4RNFA 2GW8A 5K14B 1X4AA 5EN1A 2NREA 1D3WA 3MMBA 2ZJQQ 4CT8A 1UL3A 1G3OA 2RU3A 1IKVB 2BQUA 4LF5F 1LW2A 2K7KA 3M30A 3OSNA 4N8OA 4OLPA 3WBZA 3BGRB 2JJ4D 2EG1A 4DL7A 3LO3A 2IHR1 4A48A 2PT0A 2XY6A 3HX9A 2KXFA 4YMEA 4ZDNA 4ZP6A 4OI4A 4KKOB 4OMFG 2YQ3A 5B09A 3G96A 2YKOA 1TAUA 1WI8A 1FDDA 2CQ0A 2FIUA 2NQPA 2ZE2B 3Q2TC 3AHPA 2MJNA 4ED2A 3M8QA 2GMHA 4LSLA 1HBUA 4B3RF 3T9NA 4KE5A 5CCMA 3FDSA 2JC1A 2N4DA 2J76E 4WFXA 3K5MA 5JVHQ 3DCAA 4HTIA 3MUVP 4U67Q 2JVRA 1S49A 1VQYA 4HTJA 5LJ5Y 4JI8F 1D8ZA 2C3YA 4LSNA 3PIPQ 3MR5A 4PCQA 2ASLA 1YJWS 1XERA 1NJWA 2UVRA 1LW0B 1Q7LB 1JLCB 3H40A 2LYVA 4DN0A 4N8NA 2IVFB 3HXMA 1X9MA 1O0PA 4NLTA 2ZH8A 4M63A 2GGPB 2DIVA 2XI2A 2JEFA 4PXCA 3S8SA 2KG0A 3CCRS 1XMOF 2CPJA 4JI0F 3M1VB 2EK6A 4I56A 3JSBA 1JB0C 4IH6A 2IA0A 5A8RA 4Q8EA 2FVRA 4A4JA 4RU2A 2AYBA 1LWCB 2EFNA 4JI7F 2V4QA 4DSEA 4ZP9A 1FEEA 5KFRA 2CPHA 2Q6BA 2F8HA 2VPWB 1HARA 1X4FA 3FFIA 4LVOP 5AE3A 2ASYA 1KHWA 3GG1A 2VKZG 1P27B 2DR9A 4O4GA 4C0HA 2IJNA 5C42B 4DQPA 2QMXA 2HHWA 4NCGA 1KVIA 4WU3A 3QYYA 2KRBA 3SFGA 2E7WA 2IBOA 4C8MA 2XY5A 1X9WA 3CVKA 2F40A 1QE1B 5H1SV 5LXRA 5SUHA 3O8WA 5ADZA 5HQ8A 3CJ4A 3VCDA 3IG1B 3MM5A 1RT5A 2RH3A 2XCPA 1ZOTA 2AYEA 3CXCR 4ECUA 4CH7A 2RILA 5KFCA 1U24A 1FT8A 3CCUS 2JC0A 2YWHA 2FVSA 3GG0A 2KHCA 2O3DA 3QAEA 2GHWA 2GV1A 2GMJA 3TP2A 2D3ZA 2VG7A 3DYAA 2DHGA 1FXLA 3UPFA 3G8QA 4RZRA 3TUJC 1S9EB 2ZC3A 1IQZA 2FJVA 1HMVA 1NJIT 4YB6A 1CC7A 2LQBA 2DGVA 3T1HF 5DQIA 4ECQA 2VZ9A 2QT7A 4HI1A 2FHMA 5E3AA 3DRPA 3OLBA 1FRHA 2DISA 2NSCA 5U47A 3AA8A 1SBRA 1ZETA 1K73T 5C24A 1A6LA 3OR2A 3M6WA 4DL3A 2VBZA 3SDEB 2FPHX 3DLEB 1TUVA 5K14A 4FYDA 2X51A 4MH8A 3BJYA 1J5OB 3C8YA 1IKVA 3FZ2A 4IRDA 2ZH7A 4ECXA 5EHHA 3RAXA 3BGRA 1IR0A 4WTYA 1RT7B 2ZOMA 3FEYB 2V8GA 1FCAA 5LMUF 1NNDA 2PDAA 2ZJRQ 1D9FA 1HYSB 2O66A 3GZ7A 2CIMA 4KKOA 4DL5A 3V6JA 2ZE2A 3LW5C 4LQ9A 3TOQA 2E1AA 2KFYA 3N4WA 2I38A 3CDBA 1GQEA 5I3PA 3C3LA 3CC7S 4MKAA 2A2DA 5E33A 2DB1A 2VPYB 4OHXA 2DGXA 3U27A 2V4RA 1JWWA 4I67A 1VQNS 2PA8D 4MJKA 2ZDOA 2JEIA 2YNHB 3GV8B 3CC4S 2CQPA 4TYBA 1LW0A 3OVBA 4DL4A 1RTHB 1JLCA 3DRRB 2CJKA 1LQ9A 3PO4A 4B9VA 4XIUA 2CVEA 4YOEA 4DF8A 1TKXB 1FNXH 2EG2A 2LU2A 4WK1A 1W25A 3L95X 3SQGA 3SSRA 1TL3A 3RAMA 2KYXA 1ZPWX 2GGPA 1UA1A 2QE5A 2B4VA 4TU7A 3QGHA 2W25A 3TAMB 3MMAB 4Y34A 3M1VA 4RUHA 1X5PA 1TL5A 4CIOA 4I7FB 2MZ1A 1M5KC 2HHPA 3JTNA 3M2RB 3PV8A 4LF4F 1X4HA 1YVFA 1LWCA 2V8VA 1N5TA 1Q8IA 5KFVA 1ZBTA 2A1BA 2EW9A 2ROEA 4ECZA 1VQ6S 3BQ1A 4K4TA 4FBTA 2RS8A 2HVHA 2ZJPQ 3CT9A 3RU0A 3GFYA 3IS9B 1T3NA 1K9MT 3GIIA 4AQYF 2XMKA 2D3UA 5C42A 4DR5F 4Q7AA 1PGZA 3O3LA 1SIWB 1Y00A 3M32B 4X84A 3PW0A 2KT2A 3MTJA 1K8AT 2KFNA 3CB4A 5JJBA 4JOUA 2Y0SD 2R2UA 5T14A 4R8UB 4H4MB 1SJ3P 2J9EA 4C8KA 3LANA 2ZKTA 3IG1A 3VAFA 3PJXA 2R7RA 3B82A 1KLMB 2FC9A 4RBTA 2LDYA 2AJ0A 1KOOA 1SH0A 2X3GA 3POTB 4YY3F 5F8MA 1FRMA 4G1QB 4C97A 4TQRA 1JKHB 1C1CB 3QO9B 2GA7A 4MFBB 4Q44A 4ZVFA 3SFUA 3E3XA 1FHTA 3RB6A 3MR6A 3SSQA 1TFWA 2WW8A 1EP4B 5B0AA 1VI7A 1S9EA 4NA2A 2LKZA 3QWPA 4OLOA 4Y2MA 3KOAA 4J5OA 1NK9A 5B7WA 1CVJA 3DM2B 2KH9A 3EXCX 2GO8A 1QUVA 4JI1F 2B4PA 2H5EA 4HLBA 3NS5A 4OJHA 1FDNA 1XTZA 5AXKA 3EPIA 3A1YG 4CQ1A 4YR3A 4I69A 2KRRA 2ZH1A 2E9RX 4ZPWR 3IWXA 4P6QA 2FJWA 3CIZA 1ZAVA 4HEA9 4ZPDA 5IT9Y 2XSFA 4ICLB 2CQ1A 3SDEA 3DLEA 4QIVA 2C2EA 5E0OA 2PEHA 5BYRA 4C98A 4NOHA 1QSYA 3DRYA 1J5OA 5BYSA 3ISZA 4R0EA 3TRGA 4ES2A 2ZZNA 1LWEB 2LLZA 1S99A 1RT7A 5DGBA 4NL5A 3TARA 2DGOA 5EWEA 3DLKB 3HF5A 1HYSA 3SCKE 2CQ2A 1GH8A 1ZYQA 4LF7F 2HS3A 4DFKA 1H2UX 1MNEA 1U49A 2GFFA 2R7UA 1WTBA 1KFDA 5L9XA 5DLGA 3NP5A 4X4SA 4PQAA 3TA2A 2CPZA 1VJWA 1S0NA 1OSCA 3DLJA 1VQ4S 4UY85 4CO5A 3OLAA 2KFZA 1Q53A 4CO4A 3V4MA 3IC1A 2E1MC 3ICLA 3IGNA 1RT6B 4RNHA 3O2IA 2E44A 2YNHA 4C9DA 5E3QA 1FERA 1H6KX 1O5JA 2DK2A 1RDRA 3DU5A 3NRBA 1RTHA 3DRRA 3J81Y 1XNQF 4QYZJ 2MSSA 3H59A 5L8RC 5KFEA 1TKXA 4OJ1A 4J9OA 1VK3A 5ITHA 5D4NA 1S1UB 2E7XA 3K58A 2CQGA 4ECWA 1S72S 4X66F 2YX1A 5THWA 2YTCA 3MZIA 3TAMA 2W9CA 4I7FA 4OL8A 4RW9B 3KJVA 2UXBF 3M2RA 3PEHA 5LSOA 3TUZC 5F8HA 3CGIA 4RNNA 2CDQA 4J9LA 4IH5A 5KFGA 4P7VA 1VBZA 2CQHA 3DXSX 4DSJA 2DVIA 1DQ8A 2FJXA 4EU0A 1WHWA 1G7CB 3FMWA 1H38A 2CZ4A 3FSIA 2AJFE 2LXUA 4HI2A 4WFYA 1N8RT 1QUPA 4M95A 4TY8A 2OKQA 3IS9A 1GXUA 1OSDA 1KQFB 2RKIB 3M32A 3EPGA 5CA5A 2XO7A 2BDPA 2DTJA 2BUNA 5KTQA 4LIRA 4D3GA 4R8UA 2UV8A 3FSXA 4H4MA 3S1TA 2WRMA 2XBPA 2OSRA 3MCSA 3NG8A 2VKRA 1BY9A 1KR4A 1KLMA 3G9CA 3EGNA 3TVKA 2EWHA 2DITA 2B9YA 5HMWA 2DPJA 3POTA 3Q8RB 3KLHA 5KFDA 1JKHA 1C1CA 3QO9A 4MFBA 3DRSB 1Y5NB 3I4PA 3NMAA 4PWDB 2YY3A 1KFSA 2EBEA 4YB1P 1TKZB 1EP4A 1T94A 3GR1A 3IR6B 1YHQS 1MWZA 2Z8QA 4FVCA 1WF0A 5CYJA 2IRXA 3DM2A 5CCLA 2BJEA 1UVMA 3DLLQ 4J9PA 5B0CA 2I0XA 4I2PB 4WYLA 4DV0F 1WTFA 3DLHA 1UVNA 4KHRA 5B0EA 5C25B 2ZH6A 2W24A 2Q3PA 3T19A 4F50A 2VC1A 4OHVA 1NJYA 2DNHA 2JH3A 1FRXA 4NX9A 1HQEB 1SKSA 4F02A 4G6VB 3GFHA 4MYUA 4ICLA 5I3QA 1V3ZA 4ED1A 2BQ3A 2XNRA 5E5NA 2IVYA 4XDCA 3PEJA 1BWEA 3H20A 2PA3A 5J2NB 2CQ4A 1U7LA 3SEOA 3DFEA 1FDAA 2KO1A 3WDOA 4F3QA 4RU9A 2B4UA 4YHHF 3NLCA 2FD2A 4RW6B 2RRAA 1PO6A 3C2PA 4XAKA 2DR7A 4FF3A 4DHVA 3EUNA 2XLJA 3J7YU 3FQLA 1OPZA 4J9SA 4TN2A 3J80Y 3OVAA 2VODA 1Q81T 3CDUA 1H7XA 5HBMB 3KLIB 1RYRA 1GXTA 3AY0A 1FKOA 3GIJA 2B3TB 3I31A 2AGQA 2J7UA 4GO7X 3V6HA 3V6DB 3NBPB 2YKMB 3N01A 4B3MF 4NLWA 2R7TA 2KT5A 1RT6A 4YB5A 4JV5F 5L1JA 2QO3A 3WZ0A 2SXLA 4PPZA 3UDCA 4TXSA 1IKXB 3MEGB 5DG7A 3NCPA 1PILA 4OI0A 3OXFA 4XPCA 5KG1A 2MQNA 3H5UA 1XMBA 2R2RA 1IKYB 1H2TZ 2OPRB 2N3LA 2YWEA 1TAQA 4HT5A 3OL9A 2VD3A 1CQNA 2C22A 3M6XA 4IO1A 4WKRA 4M94A 3JSMB 5B0FA 1S1UA 1VGYA 2GCFA 2C3PA 3VQSA 3O5TB 1S1XB 4DLEA 2WTFA 2ZITA 3I87A 2VG5B 4DV5F 4RW9A 4QPXA 1KTQA 3OVSA 4ELTA 1Q1KA 1YI2S 4KIAA 2QIFA 2VQEF 1ZTWA 2OPQB 3FRYA 3TA1A 2CG4A 1HNXF 1CQMA 1R8PA 2DGUA 2BQRA 3N79A 1VQ5S 3OTDA 1GTHA 2R7VA 2BOPA 2YVSA 1SH2A 3NAHA 2RKIA 2AGOA 2OPSB 2HRUA 3ENQA 4C8LA 2C3MA 2PO4A 1S1TB 2Z0GA 2ZNZA 4UW2A 4XO0A 2RQKA 3CO9A 5KG0A 1P9QC 2LEBA 3UCUP 2ZUGA 2W9BB 1HHSA 3PX0A 3RB4A 4WE1B 1FJ7A 5KFJA 3J7YI 3OFEA 3BDPA 2QSWA 1DBDA 3GB0A 3P6YC 5LSRA 3DLBA 3CJ5A 4BWMA 1HR0F 5KT7A 3W7BA 4EBDA 3D1HA 4NXNF 2XC9A 4PG8A 3PX4A 3GWCA 3K2YA 3DRSA 5IT0A 1KHVA 3MHYA 4PWDA 1HL6A 5T41A 4DN9A 3RB0A 3ONQA 1JLQB 1TKZA 2HIQA 3T5HA 2VFTA 3D1OA 1UVLA 4J9RA 5F0WA 5LT5A 2IMOA 5CYMB 3MFHA 4I2PA 3GYXB 3M4XA 4KHPF 3I55S 3IA0A 5C25A 3WX4A 2ASDA 2OD4A 4AXIA 2XMMA 2NYIA 4DR2F 4HDHA 1C2PA 3Q23A 3KKFA 2E29A 1HFEL 2RVJA 1S7HA 1QAYA 3R5BA 4Q45A 3BO4A 3MUMP 4LF6F 2C3UA 1S48A 4N41A 2RE1A 2HLTA 1HD0A 2ZM6F 2X1AA 2DT9A 3KHHA 5IQ6A 3MF5A 4NLSA 5J2NA 2MKHA 4QWAA 4FNHA 3BQ2A 3LP2B 4RW6A 4ECSA 5F41A 4J37A 3AA9A 4A47A 5A6WA 2WB1D 3H2VE 3OSPA 5G4DA 4F4KA 4DF4A 3EZUA 4NLRA 1IBMF 3PRBA 2NR0A 1UP1A 1KN6A 4CO2A 4LF8F 3CCWA 2KJWA 5HBMA 3KLIA 1MMLA 3NGKA 2ZHAA 2YWKA 3BGLA 3LOUA 1JK9B 3RYLA 1SQEA 1UW4A 2VBWA 4PG6A 4USHA 5KT3A 3V6DA 3NBPA 4OZ0A 2NPIA 2YKMA 3CJ3A 1M5PC 4I6YA 2ROGA 1SIZA 4QR2A 4DMZA 2L41A 1B64A 1IKXA 3MEGA 3QIDA 4DFJA 2JVOA 4M1KA 5MAOA 2MPUA 4IOAQ 2C28A 3IR7B 1U6FA 1RT3B 1IKYA 1TKDA 2OPRA 1SV5B 3Q0AA 4AE5A 2WBMA 3L7OA 4ZPAA 2B6AB 2J0SD 3M6UA 2N4CA 5IQQA 3UE2A 3GIMA 4ZVEA 3JSMA 2CJ9A 2CPIA 3TX8A 3M9OB 1S1XA 1FTCA 1WHXA 2U2FA 1HQUB 2VG5A 4F3OA 5KFSA 3E01B 4BS2A 3CCTA 3OTOF 2PD1A 3P96A 3AJ1A 1HPZB 2FJDB 2DH7A 4K4SA 2OPQA 2VFSA 4MIAA 4AYBD 1KVJA 1SH3A 2ZKUA 3W2VA 2VUGA 2AU0A 1NB7A 3K57A 3RAQA 2OPSA 1D1UA 4OX6A 2DNYA 2FLLA 2DNKA 2FB0A 4MTPA 5F3TA 1S1TA 3QJLA 2D9OA 4PXDA 4YQWA 1NKBA 3DYAB 2MKIA 2KU7A 4WE1A 5L38A 3KMSA 1U4BA 4RBVA 4J9QA 2DCUB 3AB2B 2RDJA 3HKWA 4WXOA 5F9LA 3HFKA 2PI5A 2QV6A 1GT8A 3PNIA 4ECYA 3T5KA 2AQ4A 4ID5B 4CH0S 1A9NB 2Y1IA 2ZD1B 4X4TA 2MYFA 4ZP8A 3PFOA 1C1BA 2BRLA 2DHAA 2J9CA 5H9FJ 3DRPB 1JLQA 2ZVSA 1J2VA 1MMDA 5CHCB 2OTLS 3M9MB 1Q7YT 3IO1A 4QIFA 4I1TA 4WU2A 5D3GB 2R7XA 4YP3A 4DX8H 2IMWP 3FCHA 1LK7A 2E5GA 1IXKA 5CYMA 4EBEA 3OL8A 2KYZA 2RMLA 3Q8SB 2F1FA 4RW7B 4NMLA 2Q43A 4FF4A 4KB7A 2VOPA 5F8IA 4CI0B 3C6UB 2CZVC 1CEZA 2LVWA 1VC6A 4IYQA 4LFAF 5A0YB 2G9OA 1LV5A 5D4LA 1H3DA 4ZPCA 1FVSA 2DNNA 2L9NA 3DGPA 3KNAA 2ABYA 4TLQA 4LQ3A 3LP2A 2GC8A 1DQ9A 2OO4A 1RGVA 1MW7A 2MQLA 1FJCA 4DG1B 5J2PB 4TLRA 2AYGA 4ITSA 3HVAA 1F5AA 3ETOA 2M2BA 2C2DA 1FF2A 5K8PA 5HP1B 2QA2A 2K3IA 2EKYA 4QWEA