4HT5A

Co2 concentrating mechanism protein p, ccmp form 1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO2 concentrating mechanism protein P
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Protein binding
total genus 65
structure length 204
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht5A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht5A02
3I87A 4HT7A 3GFHA 5LT5A 5SUHA 3FCHA 5L39A 3F56A 4HT5A 3MPVA 3U27A 3I82A 5LSRA
chains in the Genus database with same CATH superfamily
3EJMA 1KBRA 1N36F 1HBOA 3NAIA 4QIGA 2QTWA 5D78A 5D0EA 3CC4S 4NMLA 1NPPA 1L3UA 5ETLA 4ZITA 3IRWP 1PO6A 1A7GE 1S0OA 1AT1B 2RHSB 2ERRA 2YNFB 5HVHA 2HNDA 5HMZA 3IM9A 3OL9A 1ZM3A 4DR6J 2RHQB 1CULB 5IS2A 4FF2A 2CADA 3WBZA 1U0SA 2C2NA 3HZEA 2GQQA 1XNRF 1F3FA 2R2TA 2E5HA 1EX8A 3HSJA 2DNLA 1RTZA 2RRNA 2KVIA 3KJNB 3GG1A 4OX6A 1S6QB 1S0NA 2W2QP 2DBBA 4DCPB 1SIZA 1SKUB 3W9JA 1T3NA 1FFGB 2K7JA 1QUPA 1SL1A 2PC6A 2LYVA 3AT1B 4OYAA 1JJCB 2J9DA 3S1TA 3IM8A 2UP1A 4DSLA 4RWWA 4A8SA 4IR9A 2FHMA 1WJ9A 2QEXS 4DSFA 3FBBA 2V8VA 2HGLA 5KFYA 4CZCA 1BUXA 4HT5A 1SJ4P 2AF6A 3P45B 1NM2A 4KYZA 4OI0A 1KDNA 2YXLA 4NXNF 1U7LA 3DMJA 1B7FA 4QYZK 5DLGA 1UW9A 3SQGB 4ZVGA 4LUBA 2H9ZA 3PJ9A 4K0KF 2LDYA 1LWFA 1WF0A 2YX7A 3FK4A 1NZAA 3KK1A 2YVSA 2K3KA 2LQBA 1M1HA 3W8GA 2FLPA 5L1KA 2HWTA 1ZZFA 1NJWA 4ZVHA 2CZ4A 3GLJA 3KK3A 1P6TA 3NGTA 4CLFA 4P2SA 2IRXA 4FS2A 5ETOA 3GJQB 4IG3A 1T02A 2ZOMA 1R0BG 4CLYA 4ZLPA 4FVCA 3DXBA 2BRLA 3DDIA 2MKHA 2DPIA 1Y5LB 1TFYA 1NDPA 4NWBA 2J0WA 3MR5A 1NK0A 2NXEA 1QD1A 2BE2B 5KT2A 3U02A 2HBRB 4ZPAA 2DR9A 1N52B 2DXEA 4X66J 3GFZA 3JXOA 2K2PA 1X4BA 1HNWF 2YBVA 1QE1A 3V4IB 4F3QA 1RUSA 5A6PA 4P9SA 5KT6A 4ZVTB 3NY0A 1DLOB 4LF6F 3W1YC 2JRSA 3HHLC 5KFVA 1GTHA 4B9SA 1HBMB 2D3UA 1BWVA 4DQIA 4PAAA 1UEUA 3ISND 4UY85 3MEKA 4FXWA 1UVNA 1TVRA 2RDJA 1RT2A 3R5BA 1JLEA 4CLZA 3J80U 4CLLA 1TL1B 4I69A 2F4VF 1GMUA 4HACA 2I8EA 3V81A 4IO9Q 4NLYA 2R7QA 2B5JA 3HCXA 1UVMA 2PT0A 4M95A 4CLUA 3T41A 2YWHA 2RILA 2IAJA 1UVLA 2DB1A 2OAUA 5B08A 4JI1F 2HVHA 3OR1A 3JSRA 2QO3A 4IQMA 3JQMA 3IG1B 4FPRA 3WDOA 2WVFA 3NGDA 4ECVA 1X0PA 1GMVA 5DGBA 1MNEA 2NXNA 2JFDA 4LSLB 4Y2IA 1SJ3P 3I87A 2NYHA 3SSRA 2AWZA 1T7PA 4P71A 2FDNA 1O6XA 4TQSA 4DN0A 3OXGA 2EFOA 4JI3J 2YKAA 2C22A 2ZH7A 3Q8QB 1T9TA 2FVCA 4DX7A 3LAKA 4DV5J 3LGMA 2C3PA 2MLZA 3FGVA 5BR8F 4ALZA 4OYIA 1WC5A 4A8XA 1HQ2A 3N01A 4C3LA 2MQQA 4AD6A 5CD4H 3PEJA 4RW4B 5FD1A 3MGJA 5IT9Y 4DR3F 2FVQA 2AGOA 5G4DA 3CCSS 2W8KA 3HDSA 5E3AA 5CAAA 3QSIA 3R5AA 4OZ1A 2IRUA 5CABA 2M8HA 2VF3A 3KJFB 1S9GB 4RNNA 8ATCB 2OMLA 1EQ0A 2Z2ZA 3M2RA 2FPHX 2EFGA 2VFSA 2NPFA 5HMXA 2X3GA 3QT6A 3FVYA 3PX6A 3C16A 3I9V9 2R9LA 1KEKA 1APSA 3D6HB 4PUOB 1S97A 1UVKA 4KGVB 4HKQA 3ZTQA 2Z8QA 1FX2A 3N9UC 3G6VA 4HTJA 3AXMA 3ET6B 3I4PA 3MM8A 5IV4A 3VHQA 4B3SJ 4U9RA 4Y6IA 2QYGA 4OJ1A 1XR5A 4UT4A 1RT5B 2QL7B 2JHEA 2H5JB 2CPXA 3Q22A 4RW6B 5J2PA 1ZS6A 4ZKAA 4YB5A 2U2FA 1FWKA 2I2YA 5BYRA 1HBNB 1NDLA 3D3CJ 3PYFA 2YPYA 1CJTA 2MQLA 2RIJA 4K2JA 1SV5A 4TXSA 1VIXA 3SCKE 4Q8FA 4LJMA 5KG4A 4P7VA 3RZAA 4DG1B 2BJ1A 3TP2A 2VD3A 4K2XA 5BYQA 3PO5A 4I7FB 2QJ3A 2Q3PA 3MM7A 5HL7Q 4DFJA 2EK1A 4QYZJ 2L3MA 2CWXA 2XYGB 4L75A 2B6AA 2Y1JA 1OY9A 4HTIA 4F4AA 2YWWA 4E2FB 4LREA 2UVUA 4ICLA 4KSEB 4NCGB 3DLKA 2HNZA 3U1LA 1VRTB 4WBFA 1IKXB 1U45A 3VF0B 3UCUP 1QAJA 4TNOA 4W98A 3DI6B 3IBFB 4NRUA 2O5DA 4OIXA 4OYBA 4ZMMA 2P2CB 1CJVB 5KFLA 5KFFA 3FZBA 2GA7A 4CQ1A 4OJGA 2BYCA 4LRBA 3HHEA 3EPGA 2BM0A 4C48A 3W7BA 3DLGB 1XN9A 4ID5A 1UCNA 1GAOA 1HNVB 3VAHA 2MMYA 2ZH2A 2VG7B 3PFEA 1NKBA 3C14B 4F8RA 4ECXA 2DGOA 4WIQA 2D41A 2RQCA 4OI2A 1VDHA 5A8RB 2BDPA 1R8BA 5DDOC 4DUYJ 1LOUA 4DV1F 2VC1A 2I0XA 1MG7A 4IOAQ 1F5BA 5LL6d 2PMWA 1NK5A 1E6VB 5AXKA 4H4MA 3TA2A 2G13A 3ZTRA 2O01C 4YB6A 1BQMA 4V19J 1HR0J 3TW0A 1S0VA 1EARA 1O5JA 1XERA 1AZSA 1UZDA 1EB0A 4EYIB 3L09A 2IMWP 1X9MA 1NJIT 3AB4B 5JVHQ 4DWIA 4LFAJ 3M05A 1DQAA 3E3XA 3MUMP 5F3TA 4WYWA 1FRLA 1QM9A 1OY6A 5I4MA 1V3RA 2NZCA 3RTVA 2DNYA 4HLBA 4F25A 3QATA 2B9YA 1RAIB 4PG5A 3CDEA 3QGPA 1RLDA 1S57A 4BC9A 2PA8D 2OIHA 1YIJS 1YRUA 2ZE2B 3BR8A 5DS7A 1U2FA 2D7SA 5JUMA 5HK4A 3I5CA 2UUBJ 1FXDA 4MT1A 4DFKA 5KTQA 2DYAA 3ISNC 4WKRA 3MFIA 3CO9A 2RUGA 1SKWA 3HSGA 1E6YA 1OO0B 4DR2J 4RU2A 4OYZA 1YI2S 2IC3A 5HJYA 1WEYA 3M8PA 1P27B 1TKTA 5HJXA 1RWUA 1PAUB 2CPEA 2GQCA 4ETXA 3ZTOA 2FD2A 2GVDA 3X3UA 2HFNA 4KHRA 3MD3A 1UWAA 3BM7A 1RT1B 3IRXB 5KFUA 4OI3A 2DHHA 5HQLA 1BY9A 1ZPWX 3MCOA 5JXSA 2ATCB 4GO5X 4CYUB 2WSCC 1FEHA 2EG2A 3HF5A 3W61A 3V6KA 4NI2B 1HBOB 2H54B 1R8CA 4KC5A 3QMQA 3KUGA 2PI5A 2UUTA 1CJUB 5GAGU 3K58A 3DRPA 1X4DA 2V8DA 4NLOA 1YRTA 1T9UA 1RABB 3CDWA 1M1GA 2H65B 2B56A 4WTOB 5IWAJ 2A6OA 4CH0S 3GV8B 3G71S 5J2MB 3M30B 2KYXA 4OQJA 4NLRA 1SXLA 4DR7F 4RW8A 5B7WA 1NKEA 2VFVA 1FO1A 3H2LA 1U1RA 1OYDA 4WP9A 3KLVA 5BYSA 3OL8A 2HVEA 2DXFA 3POTA 1ZBTA 5HROB 5DZ7A 3HT3A 3PFOA 4RU9A 5GVQA 2VFRA 2ZBCA 1FJEB 4F67A 3HX9A 4NZ0A 3SZ2A 3J80Y 2XS7A 5F9LA 1NNDA 3G6XA 5DDQC 1D8ZA 4F04B 1RT6B 1U2RA 2EBEA 1VQ4S 1UFWA 1LXJA 3CEDA 4KIAA 4Z7CA 2M88A 4WPAA 5L9NA 1YTYA 5CZVA 2OTLS 1RK8A 3RYLA 1SKSA 4Q7AA 1ZM4A 3KNAA 3RRHA 3NNAA 2QYCA 1H7XA 1BQNB 4NYOA 3EVOA 3V2UC 3DMJB 1TL3A 4EEYA 5F8LA 4ED3A 2HHTA 2QL5B 5A8WB 3KLEB 3H59A 1T3OA 2YKNA 2OEKA 2VPXB 4DUTA 2RJZA 1TKZA 5J1EB 3KOAA 5F3ZA 2E1CA 3UI3A 2WOMB 2RKIB 1B70B 4CLSA 1GXUA 2UVRA 4CM0A 5HLFA 2KT5A 1FNOA 3LP0A 1WUUA 4KB7A 1YLXA 1LKZA 1Q5YA 3GU0A 2ADCA 4P2MA 4P75A 3L4BC 3TJ8A 3LALA 4YP3A 2YH0A 2XMAA 1N4LA 4JV5F 5DM7Q 1N54B 3BQ1A 4DQRA 2E1RA 4WE1B 1HI1A 3E2EA 3HSDA 1LWCA 2HFZA 3I6PA 1X4GA 1N0UA 3T1YJ 5I3PA 3M8YA 5B0DA 2CQGA 1IQTA 4GVBB 1UKUA 1RACB 2YKPA 5F8JA 4ZVRB 2N4DA 2CG8A 1SH3A 4F7VA 2X3DA 3PY8A 1URRA 2CWKA 2VBZA 1HNXF 4K59A 1I94J 2V9KA 3FEYB 3UVJB 2HBZB 1W2BR 4TYAA 1L5UA 3LP2B 4C3MA 4WIIA 4Y2MA 4DEZA 4PG6A 2DR5A 1PJ7A 1TVRB 1RT2B 2XLKA 4NLWA 2V8HA 1JLEB 3G8QA 2ASDA 1X60A 1X4EA 2D3O1 4WFNQ 4DL3A 1U1QA 2EI5A 5KFBA 4JI0F 2B5JB 4LSNB 1RKIA 1ZETA 1V5IB 4FNHA 4X64F 2QIFA 1HARA 1UPMB 4OHXA 1UJ4A 5AE3A 2CPFA 2AW0A 2R7TA 5ADZA 2G1DA 3N6NA 2N82B 2FHKA 3TQ1A 4LF5J 4W90B 3BV8A 2WK4A 3MEDA 5DLFA 2MDAA 2NXCA 2W7OA 3KK2B 2HHHJ 3GIJA 1WNEA 3W62A 1DARA 1DRZA 1IKYA 2QA1A 1PCAA 2J7UA 2D74B 2HQIA 1QJHA 3OTOJ 1Q53A 4KPYA 3IS9B 3KJVA 2WVCA 3T1AA 5LM7E 4L6V3 2PMZD 5LMUJ 3WZ0A 1CC7A 1S4FA 1V3SA 4ED6A 3FEZA 3EM1A 1X4FA 2WVDA 1WD6A 4UQGA 2OO4A 1FK9A 1SL2A 4IH7A 3F0NA 2DRBA 3MAAA 4NX9A 3GSDA 3AJDA 2ZM6F 2E5JA 2JC1A 2MQ8A 3DDNA 2BJEA 1Q8IA 3IR5B 2NQPA 4RUBA 2VKRA 4O0NA 4USHA 1D09B 5JMNA 4MKYA 1D9AA 4K4UA 2ALYB 3P5BP 4PXBA 1HBUA 1N33J 3JSYA 3DLEA 2UXBJ 4DR1F 4RNMA 1FTCA 3J7YU 4X2BA 1NSQA 3H8YA 3G82A 3MM8B 4ATNA 1RTHA 1HMVA 2JNJA 1VHFA 3O1LA 3D66A 2ACMA 3D6MB 3RG6A 3MPVA 4ELVA 2Y1LB 3SCJE 3Q8PB 3HMJG 4HL9A 3Q86A 1U48A 3MXHP 3UCGA 1JLCA 4OZ5A 2KN4A 2GO9A 3JAMY 1M5SA 2L08A 2GIQA 3TEHB 1ZA2B 5H9FK 1LW2A 2BBEA 1FDBA 2XMUA 2IVMA 4KR0B 2Y8YA 2C2ZB 3TAMA 4I1TA 4FPIA 3I5BA 1UWBB 3DNCA 1G6BA 3MAHA 2P9EA 1S1TA 1UEVA 2OHDA 3N5BA 1Q7YT 3LGNA 1FKOB 2HPUA 2OPQB 3Q89A 2AT1B 4OX9F 4NE9C 5KFHA 2FTRA 2X1FA 3MWBA 4KY3A 3R7SB 4X4UA 1T11A 4Y34A 2MZRA 1Q95G 1A0OB 4QIWD 5L1IA 1Q8KA 4PWWA 2LEBA 2ZOFA 5EWFA 1WORA 4LVNP 2DEIA 4I2PB 5E41A 3Q2SC 2HQGA 1AXQA 4TLRA 3ISZA 4OYWA 3LP1A 3TZZA 3GG0A 3W9HA 2WSFC 3CIMA 1PYOB 2ZBRA 1BD6A 4C8NA 3GCXP 3J7Z5 3CXCR 2FHJD 4LRFA 2EKNA 5I3UA 4B3OA 4Y0FA 5LT5A 4OYOA 3U1MA 1IBLJ 3T6BA 1NHKL 2FYXA 2O3DA 1V5VA 3GJSB 2HBYB 1N5QA 2R42A 3CDAA 4PYAA 2RAQA 5KOXA 2KFYA 4AL7A 3QPIA 2CJKA 3RB4A 4DX8H 1NBEB 5KFWA 1B3TA 5K5MA 1X31C 3RBDA 3MEGA 3US5A 1RU2A 3PKMA 1JLFA 1RAAB 4O44B 4YR3A 3ZO7A 1S77D 3MMBB 1Y7PA 4WFXA 1NJZA 1FD2A 2EBGA 3BBFA 2KHCA 2O1PA 2HURA 3ONQA 5MAOA 4I4BA 2W01A 2CRLA 3BQ0A 3MM9B 1ZM2A 1MWYA 2KRBA 4JI5J 3KKFA 1KTVA 4B9TA 1K47A 2DCUB 1NMEB 2AYEA 1JLBA 1V6HA 5E5NA 1ZH5A 2RQMA 3KLGA 4LSZB 4CWBA 2GX8A 2MGZB 1U0HA 2X1AA 5IC6B 1CBKA 1WDDA 1FRMA 1X5OA 3OT9A 2AZ1A 4N56A 4FBUA 3LA0A 2EK6A 2Z30B 4DDFA 5F8GA 2IMOA 3HVTB 3UPFA 2X51A 4AQYF 1NK6A 1C0TA 2E5IA 2BE9B 2CQ0A 4CI0B 1C2PA 2ZDPA 4J37A 1HIYA 1R43A 4C8ZA 2FC9A 2HS4A 2OD6A 1TK5A 3RRKA 4K5RA 2ZFHA 3PW7A 1DHMA 2RD5C 3I82A 5T7LB 3KHLA 2XSJB 1I1GA 3UNGC 2HGNA 4U7CA 4ZPWR 3MMAA 2WVEA 4TVAB 2W7AA 1E6YB 2V6AA 4DZDA 2B7BB 4EYHB 2CJ9A 2M9KA 4QCLA 3P8BB 2Q1LA 2IPOB 4LF9J 4X4RA 4KHPJ 5GADU 3BH7B 3VR1A 2HFUA 3PIPQ 4ZP6A 5AE1A 5RUBA 3KWMA 1FNMA 4IFYB 1JLGA 4GKJJ 2HVDA 2PA3A 1HW8A 1VRQC 4IQXA 2FIUA 4X65F 3FRZA 4USWA 4FNIA 3JYTB 5KG1A 3NMAA 1MMLA 3KG0A 2E5LJ 1RAHB 2J76E 3TUJC 1AYEA 4YHHF 2YNHB 4JV1A 2LP4A 1Q82T 4KHMA 2B4PA 2PE8A 1N8RT 1FDAA 2AYMA 2VQEF 4AE5A 2PDAA 3CCZA 2RF2A 5EHHA 4M5DB 3F41A 3SSSA 2YH1A 2YNIB 2KDOA 4TYBA 2QT7A 2ALZA 4YR2A 2ABYA 3CMES 2XMVA 1RTIA 1DJ0A 4QBUA 3QZ8A 3MCMA 1HWIA 1FI4A 3THTA 1H98A 2CA9A 4QQBA 2ASJA 3RAXA 1T03A 3SCIE 1I51B 4GRSA 1FT8A 3G96A 1C1BA 1WELA 1YVFA 2V9WA 3NGUA 2COLA 1VLOA 4DQSA 2WCXA 2CIMA 1WSRA 4NLXA 1U47A 4OLOA 3C6UB 3D0HE 1FD8A 5D4OA 4OV1A 4DX5A 1Y11A 3ZZUA 1H2UX 1T05A 3IR7B 4NEYA 3UCZP 2DGSA 1YHQS 5H9FJ 4F0HA 3EUNA 5E3RA 3NL0A 1WOPA 4BCAA 2XLJA 1IJEB 1H0HB 2BJ8A 3QZ7A 4O3PA 3C15B 1S1WA 1L3SA 2M3DA 3CIZA 1K44A 3O5TB 4ENOA 3CW2C 3MOZA 1VQOS 4U95A 1RHRB 5FDLB 5BJRA 4CLTA 4EUVA 2MQMA 3JSMB 2FVSA 3A4TA 1N5VA 3P3DA 2NYIA 1U24A 1VRUB 3FKBA 5F9NA 4HEA9 4LBPA 1PYTA 5DETA 2HQCA 2MJNA 1HD0A 5A8KB 4MFBB 1U4BA 3VGVA 2C28A 2R7VA 1SQEA 3WX4A 1QAIA 3NWGA 2WSEC 2CVIA 1K8AT 2XMMA 3HFKA 4ED1A 3EICA 3BN4A 3MEEB 3IR6B 3D0IE 1NB2A 2ZJPQ 3PCOB 4J9SA 1LFWA 1EHWA 1EKRA 3SBMA 2IJRA 2DNNA 1SJRA 4UZBA 2SXLA 3FFIB 4U8VA 3D1OA 2V34A 4HI1A 1VC5A 5J2QA 3J81Y 3K59A 4QW9A 2GAGC 3ZZ0A 3LPEA 4ERDA 5B0CA 2I9SA 4PABA 4PCQA 5KG2A 4N7TA 3VAFA 3W2VA 4PPZA 4X62F 4ZCMA 2QC3A 2AGQA 1VLYA 4HH1A 1U1MA 1IKVA 5ETKA 3R8YA 5CA5A 3M4XA 4F2RA 4JYAF 4ZP7A 3CJSA 1RWKB 1ULRA 2WW8A 3HJVA 3N6LA 3CMQA 1OJ4A 4M5HA 4P74A 4RWXA 2C3MA 5LXYA 3UR0A 1W2IA 3CCWA 1RT7A 8RUCA 3Q24A 2BANA 3QJLA 3GYXB 1RTDB 2MLXA 4FYXB 3NGSA 3FSIA 3GR0A 2PN6A 4CO3A 4R8UB 3BO2A 5GMDA 3C2PA 4KE5A 2XS2A 2V2ZA 2DIUA 2FLNA 5L8RC 3ZZPA 5KG0A 2DY1A 3VZHA 4DR5F 4O3QA 2XNRA 1GFWB 5IM0B 4RBVA 3TRGA 1C0UB 1QAYA 4O4GA 5CZXA 1G7CB 2ZNZA 3L95X 2DHAA 1XMOJ 1MU2B 4DV4J 2HNYB 3KDNA 2MQOA 3OL6A 3Q8YA 2KI2A 2KG1A 1K9MT 2RU3A 2E7XA 1DURA 1R27B 3H5YA 1S9EA 3GJTB 2V63A 2KZMA 3W5YA 2ZHBA 3BDEA 1HWKA 3KG4A 1CJKB 4OHZA 2CQ2A 2FY8A 1TTHB 2W9CA 1RYRA 1OPIA 3KJQB 1UVJA 3PXGa 2GGPB 4USJC 1Y5NB 2HHUA 3VVUA 2XCPA 3OJUA 3GIKA 4NEZA 2N4CA 4URGA 2DR6A 2V67A 3TYTA 4ZHRB 4F02A 1LXNA 4ED8A 2R7XA 4JI4F 4CT8A 1RZMA 4JI6F 2ZZMA 1DZ5A 2DEJA 4I2QB 2K1RB 4M5JA 1N34F 4JI2F 2U1AA 5DG9A 4ECUA 2AJ1A 3G6YA 4YEAA 3F73A 5KFAA 3M7VA 1FXRA 3WIVA 2WZ1A 3EZUA 3FQLA 1GQEA 1NJYA 3PW0A 1NHUA 2CJBA 4I56A 2KJVA 2IJNA 1CVJA 3IGNA 3CJ5A 2UUCJ 5L46A 1AUSL 4DUZJ 2V4JB 1JLAB 4IR1A 1FWPA 3WIUA 3Q8RB 4DBQA 1S99A 2AYGA 3SV3A 4LF8J 2GIRA 2A0FB 3DC2A 4USVA 1F9EB 4Y2CA 3VAMA 4CDIA 3MURP 4OZLA 3DN9A 3SDEB 1N5YB 3R1HA 3QLHA 5I3QA 4G1QA 4N8NA 2D1CA 3BEGB 1C4CA 2MKSA 6FDRA 5KG5A 1Z4UA 3PG9A 4DV3F 1QY7A 4NRTA 3TZXA 3FCWA 3T6JA 2DO0A 4NLDA 1EJ7L 1MN7A 3OTBA 2HFVA 1VBYA 1A9NB 1NDKA 4J9UE 5G0RA 5DQIA 1Q78A 3N0VA 4MYUA 4C8OA 3OSNA 3GFHA 4FF3A 2ZEJA 3BKFA 1DTTA 1WC0A 2RDIA 1LW0A 1WG4A 3LUYA 1WF1A 5C42B 1HYSA 2EPIA 4LQ9A 2M8DB 2AKWB 5A0YB 3ZNUA 4AUKA 3R6GB 4UTGA 3E8OA 1VS3A 1T94A 1QTMA 2BW7A 4KGXB 5DDRC 1CC8A 5B0AA 5HSPA 3NAHA 1RKJA 5KG6A 1IBKJ 5E7OB 4DPUA 4G1IA 1S49A 3EMTA 1TQLA 3ILOA 2G0IA 4DV6J 2RVJA 3K2YA 3A3OB 2VL1A 2CQHA 2AQ4A 2VQFJ 5I3UB 5AT1B 1H72C 4CO0A 3V6DA 1HL6A 4CH7A 1KLMA 3CJKB 1HQUB 4L3KA 1KNZA 2QRRA 4DQQA 2W2NP 1M1KT 2QX0A 1WHWA 1GMWD 4IUFA 1XMOF 2G0JA 4YS2A 3HI9A 4WXOA 2HHVA 3H98A 2CNNB 2P9CA 2CXEA 2AU0A 1V9OA 4DL0C 2RS2A 4HYKA 2VZ9A 1AFJA 4DCJB 4ILMA 3GB0A 2APOA 4OMFG 4LFBJ 3QAUA 4U8YA 5F0WA 2V2KA 4KFBA 3U1NA 3F56A 1FJGJ 2GMLA 4E0DA 1EP4B 4RBTA 3LWMA 1WG5A 3HM9A 5F8HA 3IGVA 2VB6A 4H4OB 2FZKB 4IG0B 4IDKA 2CQ4A 4NCBA 3A3NB 3W63A 3H5SA 4DV7J 2CQ1A 2YKMA 4RO0A 2W2PP 2RB7A 4KBIA 2MSSA 1C0TB 3D1HA 1DTQA 4KO0A 1K0VA 3RW7A 2GMHA 3QFWA 4QWDA 2JH3A 2AEJA 3ADAC 1TK0A 4WJBA 2BKNA 3M9MB 1GX5A 1JXVA 2FZGB 3T1HF 2OELA 4Q8EA 3U27A 5HBMB 4M5KA 4WWSA 3THPA 4NLUA 4ZPVR 1UVIA 4J9LA 4AL5A 4W4MA 1RT4A 2EFNA 1QSLA 4EGLA 1SIWB 3GFYA 3CDBA 4WZQA 4ED4A 3LWLA 1IBMJ 3DOKA 3MR3A 2OD4A 2POKA 1N5TA 4DV2J 1JLGB 2HRTA 2XMKA 4JB8B 1MMNA 2PFFB 1XMQF 2B4OA 4LF1A 1S9FA 4UY8T 3O8WA 4OZNA 2E5GA 3TJ9A 2Y9HA 4FP9A 4KV8B 4Q2MA 2IDEA 2H51B 4F0MA 3ZFVA 5GAGI 1YITS 1DQ9A 1VQKS 3RRGA 3MMCA 3PZPA 3O6QA 1S72S 1V3ZA 4RNHA 1D9DA 3R7NB 4C98A 5J2NA 3CCQS 4WP8A 1TR0A 2JEGA 1JWWA 1Q8BA 1RQ0A 2R2UA 3B78A 1MW7A 5DQGA 1SBRA 1XJWB 3R3TA 3NCPA 2Q6BA 2K06A 1TL7B 2MY8A 4L76A 1RA6A 2CPZA 1PKUA 1RBLA 3CCRS 4OLPA 3PNIA 4FVMA 2RUSA 2BW2A 4KRWA 4H4KA 1RXOB 3H40A 4LQ3A 2F8HA 1Y10A 1WI6A 3MPWA 2W25A 5F8IA 4YY3F 2CDRB 4PWDA 2DNQA 1K1SA 3BGFA 2LEPA 4C0HA 2F5GA 1YJNS 5HQ8A 2ZH9A 2DD8S 2LXIA 5F8NA 1OPZA 1WF2A 3QWPA 1S1WB 1VQ9S 2VG6A 2VA2A 3FZ2A 1YKWA 5KFOA 2XWXA 3AJ2A 1NHVA 1H2VZ 3K8WA 3IFEA 2JVRA 4MK8A 4A46A 5K14B 4F4KA 1RGVA 1DFDA 1SCJB 3HHLA 5ETRA 3PRBA 2IM1A 3WHIA 5KAKA 3NMRA 4P73A 2UUAJ 1TUGB 1X5TA 3LF0A 1H73A 1SH2A 4DL4A 5DG8A 4N47A 2DGQA 4O3NA 4GKKJ 3UO0A 4OI1A 3PW5A 4LF7J 3UN5A 1TELA 1KVIA 5C24A 1CS4A 3QJJA 4NL5A 1TL4A 3TO8A 3I96A 3IMQJ 3DGPA 2BKOA 2LA4A 2Q6CA 2HZVA 4WTYA 1N32J 4DLEA 5J1PA 1NKCA 2M7SA 1J5OA 2LLZA 3KNGA 2HS3A 3KTQA 2AJQA 3UW1A 3I5AA 2XO7A 1F0XA 5IZHA 4B3MF 1IN0A 1LWEA 4HVZA 3AD7C 4FBTA 3R27A 3QGIA 4DV7F 4TY8A 1B7YB 4UOFA 1C1CB 1RLCL 2GVZA 5D8HB 3RGIA 5CYQA 5KFTA 3VALA 5L38A 5LMNJ 3BREA 5E3PA 4ECRA 2ZHOA 5T14A 1IM6A 5HP1B 6AT1B 3VVTA 4BDPA 3SEOA 1HPZB 2ZDOA 1J5EF 2PD1A 2UV8G 2DNHA 3DRXA 2NCKL 3TAPA 2HHQA 4ZVQB 3I0SA 3MR2A 3VGUA 3KXDA 2XY5A 2NXUA 3JSBA 1XBWA 4Q0BB 2R8KA 2AD9A 3RR8A 3OR2B 3UNYA 3FC9A 3S7RA 2OPPA 5F41A 3OHBA 2FJXA 1U1PA 2AYBA 1NRKA 1M5PC 1JNRB 5IQQA 2LECA 4L74A 2LXFA 1NSKL 4A8WA 2J6UA 3OJSA 3W2WA 2W9BA 3H5UA 1ZAVA 3EGZA 4CTAA 2B9EA 1RT3A 2XLIA 3C19A 4B3TJ 1VIOA 3S8SA 4CCHA 3EGWB 1R0AA 3QT7A 4MTPA 4J9NA 2HRYA 4S0MA 2PMHA 4KGZB 1RWXB 3EE3A 3VGSA 1TAQA 5CYMA 4UOCA 5HATA 4NXMJ 2QMXA 4P10A 4UQTA 1QLNA 2BA9A 2CJQA 4KKOB 1U02A 1TMJA 1T9YA 1RB0A 3BGRB 2BQUA 2DY9A 2RE1A 1TKXB 2KT2A 5K8MA 2WBMA 4YMEA 3TR5A 4NZ6A 1BWEA 4ECYA 2OLWA 2F40A 4C7QA 3PRVA 3QO9B 1LK5A 4TLQA 2Y3YA 4RLEA 4WYLA 3NLCA 1RHKB 2BV3A 3PDNA 2JLEA 2MB0B 1SQGA 2LDIA 1S1UA 5CYJA 3HO1A 1G2EA 1RE1B 2IVFB 4OX8A 1U49A 4Y65A 5ETSA 3J7YI 1D0EA 4QR1A 2VJVA 4JI8F 2FHOB 1FRHA 4C97A 2HZCA 5KFCA 5I42B 4CLKA 1Q16B 1U6FA 3BR9A 1RA7A 2E66A 4C8KA 3OQ2A 5BXIA 2QFJA 4B3RF 4FYWB 4ER8A 1REVB 4GKKF 3KLIA 3OUYA 4RUAA 1JMTA 2YPZA 4PQUB 4DR4J 3LH2S 5HVFA 3VAGA 4ZOSA 1VQ7S 2XYHB 2CQIA 4EZ6A 1RTJA 3TANA 2OPSB 2EFPA 2HLUA 1N6QA 2R7WA 4TQRA 2WBRA 4CT9A 4G1QB 3DOLA 3NGRA 3SSQA 1YK9A 2VC0A 5B0GA 3MECB 3TA1A 1AFIA 1AW0A 3LGHA 1VHIA 5H9EK 4LIRA 3PYDA 4ED0A 3FMWA 1NK4A 3I56S 3HZGA 2K7KA 1Q0NA 3DM2B 4K5SA 1KFSA 3NOGA 2V4RA 3DRSB 4LBHA 2IJFA 2HAIA 4I6YA 3BF4A 3ZZYA 1JJ4A 5KFPA 3Q83A 3J7A1 4YB1P 3AOAA 2A2DA 2AIRB 3SQOP 3TUZC 2YNFA 1CSJA 2UU9J 2HWHA 1XMBA 5AJ3F 1F60B 2Z58B 3BJYA 2B9XA 4J7CA 4DOZA 5EWEA 3M2VB 3DRRB 3A12A 4QJVA 5ETMA 1VC6A 3MM6B 5K8PA 5C7PA 2IVYA 3HFVA 2A6MA 4JI7J 3BB5A 3DU5A 4NLGA 2QE5A 2DGXA 1MROB 4DL2A 2CNLB 3B8HA 2VJUA 5THWA 1S6QA 4QWEA 1W7WA 3FUYA 3KLFB 4LBIA 1BE4A 2VOPA 4FYVB 2EC0A 1SJFA 1OQ3A 1SUQB 1N88A 1LFPA 3GIMA 2VICA 2H5IB 2HFOA 3FBFA 4DR6F 5JVGQ 1M5OC 3NS5A 2YQ3A 1S6UA 1YGYA 3HLUA 6FD1A 1DAXA 4EMDA 1HNIB 1NDCA 4ED7A 4C9DA 2VA3A 4OZ3A 3CJRA 2KH9A 2F63A 2XNQA 4OHVA 4LF4J 4NA3A 4URSA 4RW9B 3MR6A 3MPYA 4MAKA 4NCAA 4Q45A 2R8HA 4EBDA 3EDQB 3J7AN 2CPIA 5HI7A 4K4TA 1OMSA 4KFBB 3CD0A 5SUHA 4YUDA 2BRKA 3CJ2A 3MMJA 1Y4ZB 4ZCKA 3JB9k 3SQGA 4ZCLA 3B4DA 3GV7B 4IDKB 3NNCA 2HSEB 1EIYB 4BS2A 1WC1A 2Y8WA 3R9LA 4GVLA 3G9CA 2D3OR 1X4HA 1TUVA 2PEHA 4KO0B 1FKPB 4K50A 3CULA 2W4PA 3MTJA 1RHMB 3VQSA 4LFCJ 4USKA 4DSJA 4IRDA 2XZDB 1YJRA 4F36A 3OFGA 3HD2A 2BE2A 4QR0A 2M52A 2FLLA 3I31A 1S6PB 1M90T 1J27A 3K89A 1FNXH 3TVZA 4L73A 1N5SA 1RT4B 1YDLA 3W5XA 2VFTA 4ELUA 2CPDA 3AQPA 5GADI 2XS5A 1T9WA 3N28A 1S1XB 5H1SV 1IM4A 4F4YA 3HSZA 3V4IA 2Q79A 3VQTA 4XPEA 3D6FB 4QIFA 1IWGA 4A8MP 5D0HA 2ZD1A 2ZC4A 4DL6A 4G6VB 4OZ0A 2N7YA 4MK7A 2MEWA 1FRXA 1YBUA 4ZCIA 1HBMA 4NASA 4K4VA 3O44A 4RPFA 2LU1A 2HS0A 1HHQA 4LR7A 5IOLA 2RU9A 3OL7A 3CJ0A 1JKHB 4CO5A 2ASLA 2ZWOA 5AE2A 1XK8A 1TL1A 1RWOB 3C6TB 4OYXA 1XWLA 4X66F 2BJ7A 2P9GA 3OPKA 2OSRA 4K4WA 2M5YA 3M6VA 5J1NA 3KLHB 4LMZA 1Z2ZA 3RJMB 2VOOA 2HEKA 3CJ3A 2XBPA 3A8IA 2RQ4A 2CQBA 3BGLA 2W1BA 3H4BA 1RU1A 2W8LA 2I38A 2V8GA 3NKYA 3IG1A 3UD5A 4QU6A 1FRKA 2FZCB 3N4WA 2MHNA 2JEJA 3DDKA 1LQ9A 1I3OB 5CCLA 4AYBD 4X4VA 5KFMA 3ETOA 4Z7YA 4IH6A 4I67A 1GT8A 1M5HA 2XSFA 4LSLA 3RB6A 1RCXB 2HZAA 2ZWPA 1W25A 3AXKA 1IVZA 4B9UA 5LJ5Y 3P6YC 2VH7A 4N77A 1TV6B 3QAEA 1S1VB 1EZZB 1KP6A 2FB0A 3MUVP 2IBOA 2FGOA 4IH5A 1HNZJ 4MKBA 3D4JA 4RJVA 2JEIA 3EXYA 2VG5B 3KYLA 4IFVB 4RW4A 4C11A 1EQMA 3M1VA 1JLQB 3PKYA 1VBXA 3QYYA 1VC0A 5E33A 3JAMU 1S9GA 1IKWB 1PJ6A 3THVA 1ELOA 2OPRB 1B0PA 3B54A 4JI3F 1EAYC 2N3OA 2KL8A 3NRBA 3FQKA 2J6TA 4R0JA 4PUOA 2F8MA 4RW7B 4DV5F 2AJ4A 3B82A 3V4MA 3ET6A 5C25B 3O2IA 4DS5A 2N3LA 2MJUA 4PXDA 2FLOA 3M32B 3OVAA 4ECQA 1RT5A 2JLFA 1NB7A 1LV5A 3KUHA 4BWJA 2WRMA 1YJ7A 3KHRA 4X4SA 1N36J 3EYZA 3D0GE 2EKYA 1F9HA 4CNYA 5M2RA 3UD4P 1HBNA 4FN5A 3QBCA 3AB2B 1WOOA 1ZAWA 4ZIWA 1D9FA 2YKQA 4J9KA 2GVZB 3JQJA 5B0BA 5KFRA 4BBYA 4DU7A 5LSLA 2ILYA 4K7QA 4O0IA 3R6LB 3BPDA 3R5DA 4B3SF 3RR7A 2Z2LA 1KONA 4J9PA 3T3FA 4DG1A 2D9PA 4E98A 5E3CA 4NLPA 2IYIA 3X1LB 3CVKA 4I7FA 2R7SA 2Z0GA 3TI0A 1KVJA 1EETB 2CJXB 3W9IA 1XNRJ 1QUVA 4TY9A 4ILRA 1F1BB 2LQJA 4J9MA 3Q8VA 2F9JA 1Y00A 5CHCB 1YJVA 4DF4A 1UW4A 2XG8A 4NCGA 1FE4A 5L1JA 2OKQA 2HNDB 1VRTA 3MPDA 1PSDA 1IKXA 3QIPA 5GMKa 2DIVA 2PIIA 4RUHA 3DI6A 3FJ2A 2ZKTA 2NXJA 3J7ZT 5HN0A 1CJVA 1WHXA 3JS9A 3GPAA 1FRIA 4USUA 3UDVA 3L7OA 1TU0B 5IQ6A 4ZJOA 3DLGA 2JDJA 5DRKA 1KVKA 4R0EA 1HNVA 3JQKA 2VG7A 1SC1B 3C14A 1HLWA 2WB4A 4NXNJ 2GFFA 2Z2MA 4A8FA 5A8RA 2E7WA 4OJHA 4FYYB 2HVIA 3R2CJ 4U7UK 4EO6A 3RBZA 2EVZA 4K0KJ 5IXUA 1S6OA 3DYAA 3BYPA 3C3LA 3CGIA 5KFNA 1ZYQA 2MQNA 5KG7A 3L7PA 3UR3C 4PPDA 1GXLA 2J9DE 1FF2A 4IKAA 3QQCD 2NUHA 3M8WA 2OUGA 4I64A 3TZYA 2JLGA 1VFJA 5EX0A 2CFXA 5CCMA 3CCLS 4QW8A 3TQEA 2Y1RI 3HKWA 5HMWA 3QGGA 2CZVC 5ETTA 3M6XA 2DNGA 4NYPA 4WFYA 5L39A 3BQ2A 4DJBA 2GNKA 4XIUA 4DUYF 4R5PA 3MF5A 1F2GA 4NA2A 2LMIA 4P2FA 3NXZA 1CQNA 4FF1A 1U6ZA 1VQPS 1LWFB 3KK1B 2D3ZA 3ENAA 3BO3A 1P1LA 1UTAA 4K4YA 4UOGA 4ANDA 4ZJLA 4X4TA 5ETQA 2ZE2A 2XM3A 4KH0B 1VQSA 4IRCA 3BBCA 1S59A 3KK3B 4ES3A 3AOBA 1HR0F 2HRUA 3LOUA 4YDDB 2R7OA 4LF6J 4IG3B 3BN7A 1U1KA 5KT5A 4LFAF 4IO1A 1CEZA 4HHUA 1RTJB 4C3KA 4HDHA 1G4CA 1QDUB 4PR6A 4Y28C 3UN2A 3N79A 2F4VJ 3AD8C 4EI2A 4AXIA 2OH2A 1LWXA 1Y3JA 4K4SA 4N8OA 3IRXA 2V50A 2BXJA 1QE1B 4OYMA 4CYUA 1VYAA 1YRXA 4JV0A 2UUBF 4NI2A 2B4UA 2HVZA 1JNZB 4JI1J 5GAHU 2ZBIA 2GJFA 4C8YA 3H90A 4HDGA 2AV5A 4DR2F 5HQMA 1NO8A 1CJUA 1WC6A 2KXNB 3M8QA 4B17A 1IQZA 2J8SA 1FCAA 2G2YA 1F2HA 4HACB 1X7VA 1NH8A 3V81B 2KFNA 1FE0A 3TUIC 4F50A 5J2MA 1WKKA 3M30A 1SI9A 3DRYA 2VKZG 2IAJB 2BOAA 4M5NA 4M94A 1LEOA 3OR1B 2BJ3A 2IIHA 2EXUA 1VJQA 2QLWA 3M8RA 3N6MA 1Q79A 3UQSA 3IBCB 4ZVEA 2QZ8A 4ZPTR 2XMJA 3A8EA 5HROA 4BLGA 5BR8J 2MHEA 3SCLE 1S76D 4FYDA 1KWMA 1Y3KA 4DLGA 2ZH1A 2F7VA 4DR3J 4MH8A 1YBAA 3K57A 1XR7A 4WFAQ 2DNOA 5IWAF 3GWCA 4DI6A 1RT6A 4TN2A 2OGUA 2ZBPA 1SB6A 4NLQA 4USTA 3PRDA 2ZH6A 3WX8A 2W2MP 3FDSA 3W5ZA 4WXWA 3PR5B 3W3SA 3HHDA 4ELTA 1P9QC 3J81U 4PXEA 4WKYA 1YZ6A 3WC2A 2VASA 1XQIA 2MKIA 2HHSA 1BQNA 1BLUA 3Q2TC 5LSRA 1SC4B 2VDHA 5DO2A 1RAJA 2HHWA 1ZZNA 2DXDA 1GX6A 3PO4A 2BUNA 5A8WA 3KLEA 3NGKA 2C3OA 5J1EA 1GNKA 3BPSP 3MDFA 3M2RB 2VPWB 2WOMA 3CCUS 4ZVOB 2RKIA 2FVRA 2ZH4A 4OX7A 3C16B 2F9DA 2GZOA 3AFGA 1YBTA 1S0MA 1IR2A 1IXKA 1S7HA 1ACMB 1T95A 4H4KC 1SKRA 2XI2A 2OFHX 4W92B 1M0SA 4ZN1A 2GJIA 5HANA 1C4AA 3DCAA 3I9ZA 2YQ1A 5KFSA 4L3NA 1VK8A 4WE1A 3M6WA 5AXNA 4C8LA 3ZXWA 3PHEA 3GCWP 5HMYA 2E9ZA 2EEYA 3ITHA 5J2PB 5CH7B 1MMDA 1XEZA 5GAEU 1XTZA 4GVBA 1HA1A 3ZTSA 4NLSA 1IUJA 2GIFA 5FJ4A 2DR7A 1ZM9A 3D68A 2J0XA 1CJTB 2IM2A 3HVRA 2ZD1B 3D2WA 3UVJA 4QR2A 2H48B 1SV5B 3V6HA 4ETZA 1O0PA 1VQYA 2LU2A 3LP2A 3E51A 1NEEA 3DGVA 2MZQA 4ANCA 3UDCA 2BJDA 3CDUA 1ZA1B 2O66A 2GHVC 2PI4A 1KHVA 2K3IA 2XCAA 4B9VA 3I55S 3MM7B 3PIOQ 2QL9B 4EZ9A 4Y2AA 2ZZNA 3M2UA 3T1YF 4TU7A 3BH6B 2MKKA 2B6AB 3MI7X 4LSNA 4NLVA 4OI6A 2DH9A 5HO4A 2AHOB 1KLNA 2XY7A 4ICLB 1WC3A 1I94F 4YB7A 4P7TA 2Q66A 3DLKB 2HNZB 3CD6S 3GQCA 1LK7A 2LFVA 2H3EB 3V6JA 3B4MA 1OY8A 3M9OB 1R8HA 4Q43A 1S7IA 2VV5A 4DV1J 3MHYA 3FCVA 2DRDA 3DOMA 1X5SA 2E1MC 4AL6A 1NXIA 3KK2A 3K5OA 5B09A 3HK2A 4F0KA 3ZZOA 2P6SA 4ID5B 2DJWA 3IS9A 3OVSA 2MSTA 2GS8A 2YX1A 3I4HX 3GP9A 1WTFA 2C2DA 1B0TA 2FGCA 2R2SA 5SZTA 3GILA 4LF5F 4QOTA 2RQKA 5D0RA 3HKZD 3MD1A 5IFMA 4EBCA 2M4MA 4A48A 4H4MB 3PX4A 4HHHA 4C11B 5HAOA 4EBEA 4OHYA 3IBWA 3M1VB 3OLAA 2HHHF 3TVYA 1BQMB 1WSVA 4YR0A 1AZSB 2FHJA 3PX0A 4UUXA 1RISA 4F3OA 1UJ6A 3OTOF 2KTQA 1FEEA 2ZITA 3NG8A 2YWKA 5LMUF 3UE2A 1KOHA 1W26A 2J0SD 4X4PA 2DNKA 1D1UA 2HWIA 2RDDA 1OQ6A 2QSWA 1UL3A 2KRRA 1KRPA 4QWAA 2P6TA 2UVVA 4A47A 4C0OC 1RHQB 1WEXA 1S4EA 3DU6A 3MTKA 2J7WA 9ATCB 3NP5A 3CC2S 1YG0A 1BC6A 5L9XA 2A18A 4K4XA 2AJFE 4G1PA 3EGNA 4DS4A 1GTEA 3OBIA 1HD1A 2ZVIA 5E2QA 2MZSA 2BOPA 2IC3B 4CH1A 3M8PB 1N33F 3IN5A 1TKTB 3H2VE 4DN9A 2MXYA 3P49B 2UXBF 4ZVSB 1IBCB 3FRYA 1WHYA 2ROEA 2JOQA 1R7IA 1P1TA 3DLBA 1YSJA 2GVDB 1UWBA 1R6YA 1REGX 2VPYB 4MK9A 3H42A 3DHXA 1TFWA 4DR7J 1SJ1A 3HPOA 1FKOA 2E29A 5LXRA 2OPQA 2HK3A 1Z2LA 1KTQA 3K8VA 2W24A 1H7WA 2VU5A 3PYEA 3IWNC 2H4YB 3RB0A 1M5VC 1B4SA 3OFHA 3UWTA 3NCRA 3EX7B 4QWCA 4Q5VA 3DRPB 4RZRA 8AT1B 1MSWD 3ENVA 2L41A 4I2PA 3AODA 3QIPB 5D15A 5JJBA 1JIHA 1WEZA 1X9SA 4KH1B 1S12A 1H3DA 2RH3A 2QA2A 4ZA1A 1UFLA 2VUGA 3BS9A 4RW8B 4M5IA 1YJUA 4PG7A 1PIEA 1Q86T 2CJAA 1T9VA 4V19X 1RCOB 3POTB 5KFQA 3CSKA 3GYNA 3K0JA 2VIHA 3PYGA 4V1Ak 4WU2A 2E44A 2UZAA 2X7IA 4ILLA 3OW2R 1YJTA 2B51A 3Q8SB 2CAJA 2Y1IA 4O44A 4B9LA 4DV0J 3MMBA 5DDPC 2DVIA 3FCHA 3H2UB 1KR4A 1OWXA 2GO8A 3CJ8A 3DYAB 3GFXA 2J0QD 1U1LA 4A8KA 2AGPA 4ES2A 5DM6Q 1IBLF 4DHVA 2RS8A 3MM5A 2VPZB 1JB0C 3MM9A 2ATLA 4A8YA 2KO1A 2OFGX 3QJPA 2ZH8A 1FJ7A 1SPBP 2Z2YB 3CD5A 5IT4A 2OMOA 2MGZA 2IM0A 2CDQA 4XK8C 4E8UA 4JV5J 1Y0HA 3K5MA 1TL3B 2D9OA 2FJWA 4R5PB 2KVQE 3HVTA 1FRJA 2EW9A 2YKNB 2XGPA 3HVWA 1TKZB 2FUG9 2VDIA 2CZ9A 3T5LA 3ENQA 4U96A 1WKLA 5LJ3Y 2NS1B 1RWPB 2MY7A 2PEBA 1HNXJ 3HHNB 5HLFB 5T7LA 4JI5F 3CNQP 4ED5A 2XSJA 3FBCA 2DNZA 3LP0B 2CPHA 3W66A 1VOMA 2HLTA 3I0RA 1R89A 5IV3A 3VAKA 4I68A 5F8MA 1BHNA 3TEGA 2IHR1 3R97A 2Z4PA 4P52A 3SYZA 2CQDA 2MTLA 4DPXA 2E1PA 2W2OP 1LWCB 4IFYA 3NEKA 1VQ8S 4JI0J 3KMSA 3ZZTA 3W8PA 2ZVSA 3JYTA 4O3SA 2KKHA 2BR0A 2KJWA 3ULHA 4DSKA 2Y0SD 4XO0A 1RAEB 5L1LA 4X64J 4LRAA 1RADB 4DL7A 3GZ7A 1KD1T 2ZJRQ 1VK3A 1HW9A 2YNHA 3SXLA 3VGTA 4DMZA 4JV2A 3L3CA 1ITPA 1TAUA 2GAHC 2IYGA 2ZNYA 3RAQA 1NAQA 1U26A 1FESA 3CWJA 4USMA 4AXJA 3SMZA 1SL0A 3QRPA 4M5DA 2YNIA 3M8QB 4LF9F 4KHPF 3NBPA 3EXCX 3CCTA 4OL8A 1VQLS 2BZ2A 4GKJF 3BDPA 3D28A 3FBEA 1NPRA 1H38A 2E5LF 3TWZA 4RR5A 1HFEL 3MR7A 3MCNA 1OIAA 1UEKA 4FS1A 3IWLA 3H0PA 3C6UA 1GK8A 4CP5A 4Y2KA 2QA4G 3OTEA 2NR0A 1KQGB 4KAIA 3IC1A 2YWGA 2HKEA 5KFDA 3MEDB 1JXLA 2BM1A 2K8GA 4N76A 3M8SA 2DHGA 4PEOA 1WC4A 4F3MA 1JJHA 1IKYB 2ZM6J 3C15A 3VZIA 1TL5A 4J90A 4F4XA 4FF4A 3KJVB 5KFGA 5KFKA 4EO8A 1JQGA 2HFSA 1U1NA 2ZKUA 2GJ2A 1XR6A 3GIIA 2KZZA 5FDLA 3OXLA 2JC0A 3D1QA 2EC2A 3PM9A 2HIYA 3OXFA 3AAWB 3JSMA 2E9TA 4O23A 3KUEA 2J7KA 4DR1J 1BXNA 1SH0A 5D77A 1FK9B 1VRUA 1U8WA 1PC5A 3C46A 3WC0A 3S6EA 1ROFA 2NZ4A 4ZDNA 3MAAB 5A8KA 4MFBA 2CJYB 3CMAS 4YN3B 2KM8B 3SV4A 3CT9A 4DV0F 4RNOA 2C42A 1UFKA 5K9FA 1FJCA 1GEHA 4ANEA 2ZHAA 2DCLA 3MEEA 1PYSB 5AXLA 5C5JA 3ELHA 5M2UA 3T9ZA 3ZNJ1 2LQ8A 3O3LA 1HBUB 5KT4A 2LQ9A 2VBYA 1UA1A 3DLEB 3FFIA 3G82B 2HAFA 4WCEQ 4DFPA 3G86A 1RTHB 2PO4A 1HMVB 2XWYA 1FVSA 3P96A 1XC9A 3Q8UA 3MUTP 1KOOA 1WHVA 3ITHB 1MLAA 3OSPA 3A1YG 7AT1B 4OX9J 2UXCJ 4OZ2A 4DPWA 1LNQA 1JLCB 4D3GA 2FC8A 4ZIVA 4KGKA 2R7UA 4XPCA 2UV8A 3DHWC 4HHJA 5FIIA 2GW8A 1LW2B 2BQ3A 3UDLA 2RNEA 4WFBQ 2BABA 1NH7A 2ZBQA 2KYZA 3CJ4A 4ZLNA 3TAMB 2DGTA 3K17A 4HR2A 3CTRA 3CJQA 3HP6A 2EG1A 1BGXT 1ZTTA 1RTDA 3CF5Q 2I6WA 1S1TB 4UW2A 3IAS9 2QG9B 3RW6A 3CJTA 1ZOTA 4F4ZA 4X4NA 4FXVA 3H4DA 1FFSB 1NSPA 4PRFA 2W4CA 3BKTA 2Z56B 2DISA 4R8UA 3M2UB 5ETPA 2R8JA 3PJXA 1RI7A 2BKPA 5IM0A 3G87A 1C0UA 2DRAA 4JOUA 2RMLA 4RNFA 3N5FA 1MU2A 2DHXA 2QLJB 2HNYA 1FX4A 2R4FA 1X4AA 1R8AA 3LP1B 2OEMA 5C2CA 1VQNS 4ZPDA 1JK9B 2QN6B 4KQZA 4CO2A 4ZJQA 3BO4A 1DY3A 3DOMB 4F4WA 2XZTB 2E9RX 3P5TL 4KJIA 4B3OB 4NA1A 3R7BB 2IFXA 3PVXA 4OZJA 1CJKA 2F4FA 2UUWA 4PG4A 4FKXA 2QLXA 3IXQA 2KG0A 4FKYA 3AD9C 4PWUA 2BEFA 4Q44A 4ZLLA 2NUUG 1HQEA 2GGPA 4DV4F 1TKDA 5B0EA 1QTNB 4ZLJA 4ZK7M 3AA9A 3MEGB 1JLFB 5A6WA 2CNOB 3C8YA 5EWGA 4DL5A 3T5KA 4AQYJ 2YNGA 1RWMB 4ZHRA 3M6UA 1S10A 3L7UA 1SJQA 1OSCA 4CRJA 3LANA 1QVGR 1Q4RA 1PBUA 1Q81T 5DG7A 5E0OA 2HQFA 2DH7A 2B8QA 4GO7X 4HT7A 4I2QA 2K1RA 1JLBB 2FVPA 1F3VA 1WG1A 2WONA 1X9WA 2CPJA 4DPTA 1VJWA 2NLWA 1X4CA 3KLGB 4K8RA 2EFQA 4QPXA 5KOWA 3NWRA 4X4QA 1U0HB 3NOCA 3GR1A 3PW4A 2J6SA 2VHGA 2C2EA 2XZWA 1GMWA 1X5PA 3OD2A 4M5MA 3D3BJ 3CC7S 2I1RA 2MYFA 1RSCA 1F5AA 3HFZB 5FLXU 2V4JA 1JLAA 4X65J 1WTBA 1VBZA 4KGMA 3NCQA 1DBDA 2IA0A 3DXSX 4YHHJ 3FMBA 4EK2A 3SDEA 1U09A 4Y00A 1N5YA 3MMAB 4WK3A 2J9CA 2VQEJ 2FJAB 2FJDB 4P2XA 3EWGA 1QVFR 1RYSA 4CIOA 5A2QU 1IJFB 3OTDA 1KHWA 4U7UD 4RBUA 2UUCF 3K7RA 4DUZF 4FDFA 1P8GA 2N7CA 4A8OA 4QIVA 3D9BA 3MAQA 4PG8A 1UPPA 4LF8F 2JSXA 2JJ4D 1I6JA 2UXCF 4EU0A 2CNKB 3EZ5A 1HHTP 4HI2A 4ZVFA 1IWAA 3WQPA 4QPTA 1ICEB 2DPJA 5C42A 2BVZA 2HHPA 1UETA 3PACA 5A0YA 5KFEA 2ZJQQ 2A1BA 4BHQA 2RF2B 2H4WB 2X1BA 5CXTA 4OI4A 1HHSA 1UA0A 2G9OA 2J9EA 2HMIA 3ILJA 3Q0AA 1RTIB 3G8SA 3IWXA 1FTRA 1Q5VA 5EUHA 2NPIA 4MMOA 4KTQA 1AROP 3R5GA 1SVDA 2DGUA 3TX8A 2YWFA 1T03B 1PC4A 1VQ5S 7FDRA 2QMWA 1C1BB 4AFFA 2LVWA 5D3GA 2AJ2A 2ASYA 2F65A 1PAEX 4ZN3A 3CJKA 1HQUA 2HW3A 2B0GA 3RBXA 2QV6A 3D6TB 2GMJA 1I5OB 2ZZTA 2A3JA 1T05B 4O3RA 1N56A 3SIPB 2ZC3A 2JEFA 1IBKF 1YWXA 2IM3A 4DV6F 3QIDA 2AX0A 4DPYA 1FHTA 2WW4A 1NUEA 2XMWA 3D5MA 2VQFF 1MWQA 1KS2A 4XTTA 3DLLQ 3AQOA 1UAWA 4EWTA 3MM5B 4QWBA 1Q7LB 4JUZA 2HK2A 3VAIA 1NK9A 1K1QA 1EP4A 3AOCA 2KXFA 4OYPA 2C2MB 4H4OA 4IG0A 4DSIA 4IRKA 1YJWS 1UJ5A 2MPUA 5D4NA 2ZOGA 2JWNA 2XHWA 4PKDB 3AA8A 1VQ6S 4X62J 2IY5B 2EFVA 2F3JA 5ETVA 2CQCA 4JYAJ 3VAJA 1PG5B 4LFBF 3PJWA 3F44A 2AP6A 2C2RA 3G2XA 5HBMA 3IO1A 2MKCA 3PHTA 2X1GA 4GC7A 1FJGF 2F8EX 3I0RB 2ROPA 3BZQA 4LVOP 5J2QB 1J2VA 4PZVA 1VR6A 4ZVPB 5ITHA 3ZZZA 3VWSA 2I5JA 3LQVA 2CVEA 4U6PA 2XB2D 3W2VB 3MCSA 1CPZA 2W4DA 3RB3A 1P9YA 1TP7A 4QZVB 3ZC4A 4DR5J 1IKVB 1KFDA 4ECZA 2ILZA 2R8IA 2CG4A 2V68A 4KPCA 3MZIA 2MLYA 5GAHI 1HKAA 4P6QA 3KDOA 2OJ3A 4ZP8A 2L9DA 3E01A 4KV8A 4ITSA 2VODA 4LR9A 1RT7B 3CPWR 1PBAA 3PR4A 4CM2A 2BANB 2KM8C 2OEJA 4PQAA 3T19A 1IBMF 4MYTA 1NZ8A 3DLJA 1MN9A 1A6LA 1XNQJ 3NBPB 3JTNA 4J9VA 4WP3A 5KFIA 4DV2F 4CLWA 1MWZA 2DNRA 1B64A 3QT5A 3IP0A 4O4GB 1TL7A 2V69A 2R7RA 5KFJA 4B08A 2OTJS 2C3YA 3EZOA 4GC6A 3ENWA 5E3QA 2HYIB 1DQ8A 2FJEB 1GXTA 2ROGA 2DK2A 2G1HA 3HT0A 1S9EB 2L48A 3EVMA 2BX6A 2AJ0A 5EN1A 5KG3A 4JI4J 2DT9A 2P5VA 3VTIA 4JI6J 2FY1A 5KFZA 1KKHA 2W9CB 2VBWA 1N34J 4JI2J 1RWWB 3H20A 2C2KB 1ZTWA 2ZUAA 4X84A 5K14A 1TZ0A 2ACYA 4UZCA 4B02A 2YX4A 1YQHA 2B43A 3HVAA 4RL1A 3D54A 1HI0P 1VQMS 4I0WA 2QLFB 3BGUA 1XIQA 2G2ZA 2D69A 2GC8A 1YX2A 2KHDA 5DQHA 1U25A 4AT1B 1RHUB 4L72B 2A2CA 1WWHA 2OI2A 1D8YA 1VISA 2FJVA 1CLFA 4H54A 3FSYA 4NZ7A 1HWUA 1BQXA 3TX0A 4MKAA 1B99A 1AB8A 4CNZA 1M5KC 1RBOB 2MKJA 4ECWA 4DV3J 3BSCA 2WVBA 1QAXA 2DO4A 2ZH5A 3QGHA 2DNPA 4XAKA 2UUAF 1RWNB 3UN3A 2DITA 1R3NA 2GHPA 2AMCB 5D6GA 3BGOP 3RBEA 1OS5A 2H1YA 4LF7F 2XMTA 3T5JA 4LR8A 5GAEI 2QLBB 2XULA 1PGZA 1C1CA 3QRQA 7FD1A 1UMJA 3CUNA 3QLHB 1R6VA 3HULA 4M5GA 5HP1A 3RAMA 1FDDA 2V2VA 4N5SA 1RDRA 1N32F 2IA6A 2V4QA 2YY3A 4ECSA 1HPZA 1N48A 3A8JA 2IBKA 2G0CA 2UXDJ 2GQ2A 4X4OA 5DZ6A 1S79A 4DXLA 1NK8A 2HIQA 2JX2A 4Q0BA 2DGVA 1SQFA 3GMGA 1Q1KA 4QYRA 4A8QA 1FDNA 5G0RB 3OR2A 3GV5B 1O8BA 2NSBA 3BYRA 4WF9Q 1S48A 4IOBA 4WFZA 5FLXY 3BSOA 3S01A 1X8DA 2LKZA 3VCDA 3LO3A 1WDTA 3GTYX 1DTTB 3TAQA 1LW0B 2QSFA 3GYGA 5LMNF 2CYYA 4J9QA 3IAM9 1HYSB 4C4WA 1CULA 4C0BA 5A76A 4UUWA 1FVQA 1S5ZA 2ZUGA 3OFEA 1U2CA 5D4PA 3CO0P 5A2QY 1G1XA 5M2PA 3FEXB 4U67Q 2J8AA 4Z37A 4IOCQ 3CB4A 5DJBA 1XNQF 4M8LA 2YTCA 4NOHA 2RRBA 2NSCA 3V6DB 2J5AA 1KLMB 4GMKA 5GMEA 4KKOA 4DFMA 5DGAA 4ZVUB 3GONA 3BGRA 3OVBA 3R1LA 1HQEB 5B0FA 2RSQA 2R2RA 3CCES 1TKXA 2HGMA 4LIWA 2XYPB 4OFZA 3TNVA 3C66A 4QIEA 4B3TF 3HD1A 4DSEA 4ZPCA 4YOEA 1H6KX 2WB1D 4ZPBA 1TUWA 2YNGB 1U8SA 3M8ZA 3ILLA 3QO9A 4ID8A 1L3TA 1T9XA 3TUPA 2MZTA 4ECTA 1RP5A 3MOJB 2JVOA 3CE8A 4I6AA 3QSYB 4NXMF 3QWUA 3GE9A 3T1HJ 3MPUB 3DFEA 2A10A 1KQFB 2WONB 3OHAA 1EKSA 2DHSA 3PW2A 3KHHA 4C8MA 4TKTA 1F6TA 2V5HG 4O4RA 2KB2A 3K5LA 2YQ0A 4J5OA 4B9NA 5KFXA 5I42A 4QU7A 2YKMB 1Y9OA 1DTQB 4CO4A 4F2SA 2LXUA 3OFFA 1XMQJ 1REVA 2RT3A 3H7HB 2V0NA 2DR8A 4PQUA 1AA1B 4FXDA 2B8PA 2B3TB 1TMMA 3ZTPA 1JJ2R 1ZPVA 2HG4A 2W9AA 2HHXA 2OPSA 4YQWA 3EGVA 3PV8A 4DF8A 2G4BA 1U1OA 3NS7B 2ADBA 2QFIA 3T5HA 2PSZA 1KC8T 1CG2A 3MECA 5CQGA 4LRCA 2CKWA 3LW5C 3DOKB 3TA0A 2RRAA 2PFDA 2GV1A 3B6BA 3QT8A 3JTPA 3A13A 3W65A 2MZ1A 4RX6A 1FERA 1IR0A 3AH6A 1DLOA 2M0GB 3DM2A 2JL9A 2BACA 1R31A 3DRSA 3KHGA 4DR4F 1HI8A 4R25A 2LQ5A 1YJ9S 4D3HA 2GCFA 2KT3A 5U47A 2W7PA 1IR1A 5HVGA 2CQ3A 3QFHA 1NCLA 4DCOB 1U6BA 2WHOA 1F5CA 1NPKA 2OP5A 1RJJA 5D4LA 1YZ7A 1VI7A 3MMCB 2AZ3A 3JTOA 1Z1ZA 3R2DJ 3M9NB 1JX4A 2B4VA 4NLTA 3M2VA 2DGWA 3DRRA 4YY3J 2UXDF 3VV2B 3MM6A 5J2NB 2HMIB 3TARA 2C3UA 4MIWA 5K20B 3QRRA 4N41A 1RHJB 1Q8LA 3RUBL 1PILA 3CCVS 2NREA 3GIRA 1MROA 1X0FA 3T9NA 3FNNA 3OTCA 3DLHA 5D3GB 1WI8A 4ZS6A 1HWLA 3KLFA 3RU0A 3BSNA 2XC9A 3AJ1A 3ILIA 1SUQA 1RWVB 2UU9F 1L3KA 2AX1A 1WOSA 1R0CB 3R5CA 5IC4B 2B7CB 2BMBA 2DH8A 3G4SS 5ETNA 4I6WA 3EDRB 1G3OA 4OHWA 3OLBA 4URQU 4YDXA 4PWDB 4DU8A 3SI8A 5D0GA 3HJFA 3LPYA 4LT6A 1HNIA 1GH8A 4JI7F 2PGCA 2DKOB 1D3WA 2V2QA 2E7VA 4YFUA 1PJ5A 3W64A 5H9EJ 3EPIA 5IT0A 2VG6B 3LTOA 2FQQB 4RW9A 3NS6A 2V94A 3FSXA 3SFGA 4O3OA 2XO6A 2CUYA 5LSOA 4Y3CA 4K4ZA 3HHLB 1Y5IB 2V8PA 4HH0A 3DKDA 1BMQB 4B3MJ 2VONA 4RKUC 4C6AA 2MQPA 3J81j 4G3IA 3GSIA 3TVKA 5C24B 4UF4A 1CS4B 1URNA 3BBBA 1FKPA 3DGPB 2QGFB 4LF4F 4BC7A 3K5PA 3UDEA 3BSAA 2LEAA 1J5EJ 4Z2XA 4RUCA 4XDDA 1J5OB 2DTJA 4MIAA 1S6PA 2XHCA 4NPOA 2Q43A 3D7SB 2IDLA 2YKOA 2VBXA 3NNHA 3EVWA 4RW6A 5C2GA 3A3PB 1FFWB 1LWEB 4EFAC 1AUDA 2MKYA 2CQPA 1F9FA 2C2OB 1S1XA 5K8OA 1N0VC 4WK1A 3U7JA 4MJKA 3AHPA 2I5JB 4DQPA 4TY8B 5LOQA 5CD4A 2HQDA 5CYQB 5T41A 4ES1A 2L9WA 2KXHA 2LCWA 1OSDA 2AEFA 4LFCF 3PEHA 4WZMA 3KG1A 4DPOA 1SC3B 2WTFA 1FXLA 3E01B 1B0VA 5AXMA 3SFUA 1VMBA 3TOQA 1JKHA 3I0SB 2FJBB 2OSQA 3C6TA 1RAOA 2Z57B 3QNWB 3KLHA 2ZH3A 4J9OA 2C1EB 2OPPB 1JXEA 2QMUB 2JFKA 4CO1A 4ZP9A 2XGQA 3ZZRA 4C2MA 4Q2LA 4G65A 3A8KA 4OV6A 2DNMA 1KN6A 4FZVA 2G2OA 3CD7A 4MKVA 3HHLD 1FKAF 1ZAXA 2R8GA 3MFHA 1TK8A 5IT9U 3W2WB 5KT3A 2W9BB 2P8IA 4UOHA 4BWMA 4CTAB 4DZ6A 4ED2A 1RT3B 5KT7A 3UFCX 1R0AB 1O51A 1NK7A 4OJ3A 2HQ3A 2JZ5A 3ICLA 2BQRA 3AY0A 3IA0A 3CCJS 4B9MA 3H5XA 1T8EA 4M5LA 3HHKA 1H74A 4MIBA 5MLCV 3UD3P 3W60A 5CYMB 3H25A 3TZWA 5EDWA 2CPYA 1SC6A 1TV6A 1L3VA 1S1VA 2IRYA 1KQKA 4CLPA 1UP1A 1K0TA 1NSAA 1QSSA 2XY6A 4PXCA 1CQMA 1RAFB 1QSYA 4M1KA 2XI3A 1WACA 2BE7D 2HBQB 2MZJA 4XDCA 1K73T 2VG5A 4J91A 1E6VA 4JI8J 4IFVA 1VCTA 3G6ES 2KU7A 3KMQA 2KFZA 4KT0C 1JLQA 2EWHA 4IYQA 4JBCA 4TU8A 3KFWX 4DX6A 3LAMA 3R5JB 2B9WA 4B3RJ 4LRDA 1IKWA 2H5EA 4J9RA 2OPRA 3HXMA 4M63A 1KSPA 2YWEA 2LA6A 2M2BA 1OYEA 2XEXA 3G8TA 2XQCA 1KQSR 4RW7A 1UZHA 2QA4S 4A4JA 2M70A 1S1UB 1HNZF 4WU3A 5C25A 9RUBA 2BJ9A 3M32A 2L9NA 3L9ZA 4F26A 3TJAA 1VGYA 3Q23A 1HNWJ 1H2TZ 4TU9A 2WAQD 1RAGB 1NU4A 3BKUA 1FA0A 3K5NA 1NJXA 2GHWA 2XTJP 4USIA 3GJRB 3KLIB 3OUYB 5EGYA 3V5RA 2E1AA 1RBAA 3D67A 5EX3A 2R3VA 1N6QB 2F1FA 3CCMS 3I32A 2O67A 4JP8A 3P4UB 3PTWA 4NMXA 3DOLB 2UVWA 5AJ3J 2Y0BB 4NYZA 1NLKL 2VFUA 4LF2A 1RT1A 1WKJA 1VBKA 1HWJA 3OV7A 3ETMA 5F0UA 1R8PA 4P72A 5K8NA 1T0TV 1FWLA 1EETA 2AEMA 4PYDA
chains in the Genus database with same CATH topology
1ZTTA 3TUJC 1RTDA 3CF5Q 4YHHF 1S1TB 2LU1A 2YNHB 1N36F 1HBOA 3NAIA 4UW2A 4QIGA 3IAS9 4JV1A 2HS0A 3RW6A 1ZOTA 5D78A 4F4ZA 4X4NA 4FXVA 3H4DA 3CC4S 2RU9A 3OL7A 3CJ0A 1JKHB 4NMLA 1Q82T 4PRFA 4CO5A 4KHMA 2B4PA 2ASLA 1L3UA 2W4CA 5AE2A 2PE8A 1XK8A 1N8RT 2DISA 1FDAA 1TL1A 3C6TB 4R8UA 2AYMA 2VQEF 4AE5A 1XWLA 2PDAA 3CCZA 4X66F 3IRWP 1PO6A 3M2UB 2RF2A 5EHHA 2P9GA 3OPKA 1A7GE 2OSRA 4M5DB 3F41A 3SSSA 2YH1A 1S0OA 2YNIB 4K4WA 2ERRA 2R8JA 2YNFB 3PJXA 1RI7A 2M5YA 3M6VA 5J1NA 3KLHB 4LMZA 1Z2ZA 2KDOA 4TYBA 2HNDA 2QT7A 2VOOA 5IM0A 5HMZA 1C0UA 3CJ3A 2ALZA 4YR2A 4JOUA 2DRAA 2ABYA 3CMES 3OL9A 1ZM3A 2XMVA 1RTIA 1DJ0A 4QBUA 3QZ8A 2XBPA 1HWIA 2RMLA 2RQ4A 4RNFA 2CQBA 3N5FA 5IS2A 4FF2A 1MU2A 2DHXA 3BGLA 2HNYA 3THTA 1H98A 3H4BA 4QQBA 2ASJA 2R4FA 3RAXA 1T03A 3SCIE 3WBZA 1X4AA 1R8AA 1FT8A 3G96A 2W8LA 1C1BA 1WELA 3LP1B 1YVFA 3HZEA 2I38A 2GQQA 2V8GA 3NKYA 2V9WA 3IG1A 1VQNS 4QU6A 1XNRF 2COLA 1FRKA 2R2TA 4ZPDA 4DQSA 2WCXA 1JK9B 2CIMA 2E5HA 4KQZA 4CO2A 3BO4A 3N4WA 4F4WA 4NLXA 1U47A 4OLOA 3C6UB 2E9RX 2MHNA 2DNLA 3P5TL 2JEJA 2RRNA 4KJIA 3DDKA 2KVIA 1LQ9A 3GG1A 4OX6A 3D0HE 1FD8A 5CCLA 4B3OB 5D4OA 4AYBD 1S6QB 4X4VA 4NA1A 5KFMA 2IFXA 3ETOA 1S0NA 4OV1A 4IH6A 2DBBA 3PVXA 4I67A 1GT8A 1M5HA 2XSFA 4LSLA 4OZJA 3ZZUA 1SIZA 3RB6A 1T3NA 1H2UX 1T05A 3IR7B 2UUWA 3UCZP 2K7JA 4PG4A 2DGSA 1YHQS 1QUPA 1SL1A 5H9FJ 1W25A 2PC6A 2QLXA 3IXQA 2KG0A 2LYVA 3EUNA 5E3RA 4B9UA 5LJ5Y 3P6YC 3NL0A 4BCAA 4PWUA 2VH7A 4Q44A 2J9DA 2NUUG 3S1TA 1HQEA 2XLJA 1IJEB 4N77A 1TV6B 1H0HB 2GGPA 3QZ7A 2UP1A 4DSLA 4O3PA 3QAEA 4RWWA 1S1WA 4DV4F 1TKDA 1S1VB 5B0EA 1L3SA 4A8SA 2M3DA 4IR9A 4ZK7M 3CIZA 2FHMA 2QEXS 3O5TB 2FB0A 3AA9A 3MEGB 3MUVP 2IBOA 2FGOA 4IH5A 1JLFB 4DSFA 5A6WA 3C8YA 5EWGA 2V8VA 2HGLA 4MKBA 3MOZA 4DL5A 1VQOS 5KFYA 3T5KA 5BJRA 5FDLB 4CZCA 2JEIA 2YNGA 3EXYA 2VG5B 3KYLA 4ZHRA 4IFVB 3M6UA 4HT5A 4EUVA 2MQMA 3JSMB 1S10A 4RW4A 1SJ4P 2FVSA 1N5VA 3P3DA 4C11A 1SJQA 1OSCA 2AF6A 2NYIA 3LANA 3M1VA 1QVGR 1JLQB 1Q4RA 1U24A 1VRUB 1Q81T 5DG7A 4OI0A 5F9NA 5E0OA 3PKYA 4HEA9 1VBXA 5DETA 3QYYA 1N6QA 2MJNA 2DH7A 1VC0A 5E33A 1S9GA 1IKWB 1HD0A 4NXNF 1U7LA 4GO7X 5A8KB 4MFBB 3THVA 3DMJA 1U4BA 4HT7A 1B7FA 1ELOA 4I2QA 2K1RA 1JLBB 2OPRB 2C28A 2FVPA 1B0PA 5DLGA 1WG1A 2WONA 1X9WA 2R7VA 2CPJA 1VJWA 4JI3F 1SQEA 2NLWA 3SQGB 1X4CA 2N3OA 3KLGB 3WX4A 4ZVGA 3NRBA 2EFQA 3FQKA 1QAIA 4LUBA 4QPXA 5KOWA 2H9ZA 2J6TA 4X4QA 3NWGA 4K0KF 2WSEC 2CVIA 2LDYA 4R0JA 1K8AT 4PUOA 1LWFA 1WF0A 2YX7A 3GR1A 1NZAA 3KK1A 2YVSA 2F8MA 2K3KA 2LQBA 4RW7B 4DV5F 2FLPA 5L1KA 3PW4A 2J6SA 2HWTA 1ZZFA 2XMMA 1NJWA 3HFKA 4ED1A 2AJ4A 3BN4A 4ZVHA 2C2EA 2XZWA 2CZ4A 3B82A 3V4MA 3MEEB 5C25B 3IR6B 1X5PA 3KK3A 3O2IA 4DS5A 3D0IE 2ZJPQ 2N3LA 2MJUA 3CC7S 1P6TA 2FLOA 4PXDA 4J9SA 2I1RA 4P2SA 2IRXA 3M32B 2MYFA 4FS2A 1F5AA 3OVAA 1LFWA 4ECQA 4IG3A 2V4JA 1JLAA 1T02A 2ZOMA 1WTBA 1VBZA 2DNNA 1RT5A 1SJRA 2JLFA 4ZLPA 1NB7A 2SXLA 4FVCA 3DXBA 1LV5A 2BRLA 4BWJA 4KGMA 3FFIB 3NCQA 2MKHA 3D1OA 2DPIA 4HI1A 2WRMA 1DBDA 1VC5A 1Y5LB 1TFYA 2IA0A 3DXSX 3KHRA 5J2QA 4X4SA 4NWBA 2J0WA 3J81Y 3MR5A 3D0GE 3EYZA 3FMBA 1NK0A 2BE2B 5KT2A 3K59A 2EKYA 4QW9A 3U02A 3ZZ0A 4CNYA 3SDEA 5M2RA 3UD4P 4ERDA 1HBNA 4FN5A 1U09A 5B0CA 4Y00A 4ZPAA 3MMAB 1N5YA 3AB2B 2I9SA 4PCQA 5KG2A 4WK3A 1ZAWA 2J9CA 2DR9A 3VAFA 1D9FA 1N52B 2YKQA 3W2VA 4PPZA 4X62F 2FJAB 4J9KA 4ZCMA 2FJDB 3GFZA 5B0BA 2AGQA 5KFRA 4BBYA 1VLYA 5LSLA 4HH1A 1U1MA 1RYSA 1QVFR 4CIOA 2ILYA 4O0IA 1IKVA 2K2PA 1X4BA 1HNWF 1IJFB 3OTDA 1QE1A 5CA5A 3M4XA 3V4IB 4F2RA 4JYAF 4ZP7A 4F3QA 1KHWA 1ULRA 2WW8A 3N6LA 3R5DA 5A6PA 4B3SF 4RBUA 3RR7A 2Z2LA 1KONA 4J9PA 3T3FA 5KT6A 4RWXA 2D9PA 4DG1A 2UUCF 4E98A 3K7RA 5E3CA 2C3MA 5LXYA 1DLOB 4DUZF 4LF6F 1P8GA 4NLPA 2N7CA 2JRSA 3HHLC 5KFVA 1GTHA 4A8OA 2IYIA 3X1LB 3CVKA 4QIVA 3UR0A 4B9SA 1W2IA 4I7FA 3CCWA 3MAQA 1RT7A 4PG8A 2R7SA 1HBMB 2Z0GA 4LF8F 2D3UA 3TI0A 2JSXA 2JJ4D 4DQIA 1UEUA 1KVJA 1EETB 3ISND 4UY85 3Q24A 3MEKA 2BANA 3QJLA 3GYXB 1I6JA 2UXCF 4EU0A 1RTDB 4FXWA 1UVNA 1QUVA 3EZ5A 4TY9A 1TVRA 1HHTP 4ILRA 2LQJA 2RDJA 1RT2A 4J9MA 4HI2A 3R5BA 2F9JA 4ZVFA 1JLEA 1Y00A 4QPTA 3FSIA 3GR0A 5CHCB 2DPJA 5C42A 2BVZA 2HHPA 1YJVA 2PN6A 1UETA 4CO3A 3PACA 5A0YA 1TL1B 4I69A 5KFEA 4R8UB 3BO2A 2F4VF 2ZJQQ 2A1BA 2I8EA 3C2PA 4KE5A 2XS2A 4BHQA 2DIUA 4DF4A 2RF2B 1UW4A 5L8RC 2FLNA 3V81A 2XG8A 3ZZPA 4IO9Q 4NLYA 4NCGA 2X1BA 1FE4A 5KG0A 5L1JA 5CXTA 2OKQA 1HHSA 2R7QA 4OI4A 3VZHA 4DR5F 2B5JA 1UA0A 4O3QA 2XNRA 2G9OA 2HNDB 5IM0B 1VRTA 4RBVA 1UVMA 3TRGA 1PSDA 1C0UB 2J9EA 2PT0A 1IKXA 3QIPA 2HMIA 4M95A 1QAYA 2YWHA 4O4GA 5GMKa 2RILA 2IAJA 3Q0AA 5CZXA 1RTIB 2DIVA 1UVLA 1G7CB 3G8SA 2ZNZA 2PIIA 2DB1A 3IWXA 1FTRA 2OAUA 3L95X 5B08A 5EUHA 2DHAA 2NPIA 4JI1F 4RUHA 2HVHA 3OR1A 3DI6A 4MMOA 4KTQA 1MU2B 1AROP 3FJ2A 2HNYB 2DGUA 3TX8A 2YWFA 2ZKTA 2MQOA 1T03B 1PC4A 3JSRA 3OL6A 1VQ5S 3J7ZT 7FDRA 5HN0A 2QMWA 1C1BB 2QO3A 2KI2A 4AFFA 4IQMA 1WHXA 2LVWA 2KG1A 1K9MT 5D3GA 3IG1B 4FPRA 3WDOA 1FRIA 2ASYA 2E7XA 2RU3A 3L7OA 1DURA 5IQ6A 3NGDA 1R27B 3H5YA 4ECVA 3CJKA 1S9EA 3DLGA 1HQUA 2HW3A 1X0PA 2JDJA 2B0GA 5DRKA 4R0EA 2KZMA 1HNVA 2ZHBA 2QV6A 3BDEA 1HWKA 5DGBA 3KG4A 2VG7A 1MNEA 2JFDA 2GMJA 4LSLB 4Y2IA 1SJ3P 4OHZA 2CQ2A 3I87A 2A3JA 2WB4A 1T05B 3SSRA 2AWZA 1T7PA 2GFFA 2FDNA 4TQSA 2Z2MA 4A8FA 4O3RA 5A8RA 2E7WA 4OJHA 4DN0A 2W9CA 1RYRA 1N56A 2ZC3A 1OPIA 2JEFA 1IBKF 1YWXA 3OXGA 2HVIA 2IM3A 2EFOA 4U7UK 4EO6A 1UVJA 3PXGa 2YKAA 2C22A 2EVZA 4DV6F 2GGPB 5IXUA 1S6OA 3QIDA 3Q8QB 2ZH7A 2AX0A 2FVCA 1FHTA 3DYAA 3LAKA 3C3LA 3CGIA 5KFNA 1ZYQA 4USJC 2MQNA 5KG7A 1Y5NB 3L7PA 2XMWA 3LGMA 2HHUA 3D5MA 3UR3C 2VQFF 2C3PA 4PPDA 1GXLA 2J9DE 1FF2A 2XCPA 3FGVA 5BR8F 1KS2A 4ALZA 4IKAA 3OJUA 3GIKA 3DLLQ 2NUHA 2N4CA 4URGA 3AQOA 1UAWA 4EWTA 4I64A 3MM5B 4QWBA 2JLGA 1VFJA 1Q7LB 5EX0A 2CFXA 4A8XA 3N01A 5CCMA 3CCLS 4C3LA 4QW8A 2MQQA 3TYTA 4JUZA 4ZHRB 5CD4H 3PEJA 4RW4B 3VAIA 5FD1A 3MGJA 4F02A 5IT9Y 1LXNA 4DR3F 2Y1RI 2AGOA 2FVQA 4ED8A 5G4DA 3HKWA 5HMWA 3QGGA 3CCSS 2R7XA 2W8KA 1NK9A 3HDSA 1K1QA 1EP4A 5E3AA 2CZVC 4JI4F 3R5AA 4OZ1A 2IRUA 2KXFA 2M8HA 3M6XA 4CT8A 1S9GB 2DNGA 4NYPA 4WFYA 4RNNA 5L39A 4JI6F 2OMLA 4H4OA 3BQ2A 2ZZMA 4DJBA 4IG0A 3M2RA 2GNKA 4XIUA 1DZ5A 4DSIA 2FPHX 2EFGA 2VFSA 2K1RB 4I2QB 4IRKA 4DUYF 1N34F 2NPFA 4JI2F 4R5PA 3MF5A 1YJWS 1F2GA 1UJ5A 4NA2A 5HMXA 2MPUA 2LMIA 5D4NA 2ZOGA 2X3GA 2JWNA 2XHWA 4PKDB 2U1AA 3AA8A 5DG9A 4ECUA 3FVYA 2AJ1A 1VQ6S 1CQNA 3PX6A 1U6ZA 4FF1A 3G6YA 1VQPS 3I9V9 2R9LA 1KEKA 1APSA 4YEAA 4PUOB 1LWFB 3KK1B 1S97A 2D3ZA 1UVKA 3F73A 1P1LA 2EFVA 3BO3A 5KFAA 4K4YA 1FXRA 4HKQA 2F3JA 1KSPA 4X4TA 2Z8QA 2ZE2A 3N9UC 3G6VA 2CQCA 4HTJA 3EZUA 3FQLA 1VQSA 3VAJA 1GQEA 1NJYA 4IRCA 3I4PA 3KK3B 3PW0A 1NHUA 2CJBA 3MM8A 4ES3A 3PJWA 4I56A 4LFBF 3F44A 2KJVA 4U9RA 1HR0F 2IJNA 1CVJA 2HRUA 3LOUA 3IGNA 3CJ5A 4Y6IA 2AP6A 4YDDB 2C2RA 2R7OA 4IG3B 2V4JB 1JLAB 4IR1A 4OJ1A 5HBMA 3BN7A 3IO1A 2MKCA 1XR5A 1U1KA 3Q8RB 4DBQA 1RT5B 2X1GA 4GC7A 1S99A 2JHEA 2AYGA 1FJGF 2CPXA 3SV3A 2GIRA 3Q22A 3DC2A 5KT5A 4LFAF 2F8EX 3I0RB 4IO1A 4RW6B 5J2PA 2ROPA 1CEZA 4Y2CA 3BZQA 4ZKAA 3VAMA 4LVOP 5J2QB 4YB5A 1J2VA 1RTJB 3MURP 4C3KA 4OZLA 2U2FA 4HDHA 2I2YA 3DN9A 5ITHA 3SDEB 5BYRA 1HBNB 4PR6A 1N5YB 4Y28C 3ZZZA 3R1HA 3QLHA 3VWSA 5I3QA 4G1QA 3N79A 2I5JA 3LQVA 4N8NA 2D1CA 3BEGB 2CVEA 1C4CA 4U6PA 2XB2D 3W2VB 4AXIA 2MKSA 3MCSA 1CPZA 2W4DA 3RB3A 6FDRA 2OH2A 1Y3JA 5KG5A 2MQLA 1Z4UA 2RIJA 4K4SA 4N8OA 1TP7A 4QZVB 3IRXA 3ZC4A 4DV3F 1IKVB 1KFDA 4ECZA 1QY7A 2ILZA 4NRTA 1SV5A 4TXSA 2BXJA 1QE1B 2CG4A 2R8IA 1VIXA 3SCKE 4Q8FA 4LJMA 1YRXA 3T6JA 2DO0A 3MZIA 4JV0A 5GAHI 4NLDA 4P6QA 5KG4A 4P7VA 2UUBF 2OJ3A 4ZP8A 2B4UA 2L9DA 2HVZA 3RZAA 1JNZB 3OTBA 4DG1B 3E01A 4KV8A 5GAHU 1VBYA 1A9NB 4ITSA 2ZBIA 3TP2A 2VODA 2VD3A 5G0RA 4K2XA 1Q78A 5BYQA 5DQIA 3PO5A 4I7FB 1RT7B 4C8YA 3CPWR 3N0VA 4HDGA 4MYUA 2Q3PA 2AV5A 3MM7A 4C8OA 5HL7Q 4DR2F 3OSNA 3GFHA 4FF3A 3PR4A 2KM8C 2BANB 4DFJA 1NO8A 4PQAA 2EK1A 4QYZJ 2L3MA 1DTTA 2KXNB 2RDIA 1LW0A 3T19A 3M8QA 1WG4A 3LUYA 1IBMF 2B6AA 4B17A 4MYTA 2Y1JA 1IQZA 1WF1A 3DLJA 1A6LA 4HTIA 3NBPB 3JTNA 5C42B 1HYSA 2EPIA 4LQ9A 1FCAA 2M8DB 5KFIA 5A0YB 4AUKA 4DV2F 3E8OA 2UVUA 1X7VA 4ICLA 1VS3A 1MWZA 1NH8A 1T94A 2DNRA 3V81B 1QTMA 2KFNA 4KSEB 4NCGB 3DLKA 1B64A 2HNZA 1FE0A 3TUIC 5DDRC 3U1LA 1CC8A 4F50A 5J2MA 5B0AA 3M30A 1VRTB 3NAHA 1IKXB 1RKJA 5KG6A 4O4GB 5E7OB 1SI9A 4G1IA 3DRYA 2VKZG 2IAJB 2R7RA 5KFJA 1S49A 4B08A 1U45A 3VF0B 1TQLA 3UCUP 2OTJS 2C3YA 1QAJA 4M94A 4TNOA 4GC6A 3OR1B 3DI6B 3ENWA 2RVJA 3K2YA 4NRUA 5E3QA 2HYIB 2O5DA 1DQ8A 2VL1A 4OIXA 4ZMMA 2CQHA 2QLWA 3M8RA 3N6MA 1Q79A 3UQSA 2AQ4A 4ZVEA 2QZ8A 5KFLA 2FJEB 5KFFA 3FZBA 1GXTA 4ZPTR 2XMJA 3A8EA 2ROGA 5I3UB 5HROA 2GA7A 4CO0A 3V6DA 2MHEA 1HL6A 2DK2A 3SCLE 4CQ1A 4OJGA 2BYCA 1S76D 3HHEA 4CH7A 4FYDA 1KLMA 3EPGA 2BM0A 1Y3KA