2MZ1A

Solution structure of hnrnp c rrm in complex with 5'-uuuuc-3' rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Heterogeneous nuclear ribonucleoproteins C1/C2
publication title Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mz1A00
2AYMA 1VQNS 2DIUA 2DNNA 2X1BA 3CF5Q 2E44A 5LSOA 3R27A 2MQPA 5GAHU 1X5SA 2I2YA 3CCQS 2CQIA 3BO2A 2KN4A 1AUDA 1HD1A 1VQOS 1U6FA 2M2BA 2DGVA 3CMES 2X1GA 1B7FA 3Q2SC 5BJRA 2ZJPQ 3CCMS 4F26A 2DNGA 1U1LA 2BZ2A 3DLLQ 3MUVP 2CPFA 3S7RA 1X5OA 5LJ5Y 1VQLS 2LYVA 2MJNA 1VQ5S 4WIIA 1PO6A 3G96A 1WG1A 1O0PA 2QFJA 2OIHA 4W90B 1WF1A 2N3LA 2XS7A 1Q7YT 2CQ0A 2VONA 4WKRA 1YI2S 2RVJA 2CQ4A 1N8RT 2HYIB 2CQBA 2RQ4A 4FXVA 3TYTA 3CCUS 2F9JA 2DGOA 3EGNA 1WF0A 3VAGA 5HL7Q 2G4BA 3UE2A 2DH9A 2K8GA 4PKDB 1DZ5A 3VAKA 1KC8T 5GMKa 2JVRA 1JJ4A 2RRAA 2RU3A 3R1HA 3B4MA 2MQLA 1VC5A 1YTYA 2DGUA 2XSFA 3P49B 2L9WA 2L41A 4CIOA 3HHNB 1VQMS 4U67Q 4J5OA 1X5TA 2MZQA 2DNKA 1X4DA 3HI9A 2XB2D 1Q81T 2B0GA 3VAMA 1H2TZ 2KVIA 4QU6A 2O3DA 2FHOB 2MHNA 2NZ4A 2M9KA 1YIJS 2BOPA 1FT8A 1WF2A 2KFYA 3L3CA 1YJWS 3CC4S 2MY8A 1U6BA 2EK6A 5D77A 1Q82T 2HZCA 1WTBA 2WBRA 1X4GA 2D3OR 2LEAA 1S72S 1QVFR 1OWXA 2MQNA 1YJNS 2U2FA 2G1DA 2OTJS 2RQCA 2J0QD 3H2UB 2EVZA 1URNA 2EK1A 2MY7A 3G8SA 2N82B 2RRBA 1U1KA 2LXUA 3G4SS 2KYXA 2QA4S 3CMAS 1Q86T 3ZZZA 2MKJA 2L08A 3H2VE 2MKHA 3DXBA 4IOAQ 2DNPA 2OTLS 2KT5A 3BO4A 4LJMA 2LQ5A 2VOPA 2KXNB 5DDPC 2DO0A 2DHGA 2MGZB 2V94A 1NO8A 2MSTA 1WEYA 2HVZA 2YH0A 2YTCA 4M5DB 2Q79A 4YOEA 1KOOA 2XS2A 4ED5A 3J7YU 1NU4A 1WELA 4LMZA 1R8PA 3MUTP 1VC0A 2KHCA 3SMZA 3BS9A 3I55S 5H1SV 2DISA 2I38A 3IWNC 3CCLS 2AYGA 1UAWA 3V4MA 1IQTA 1D9AA 1M5KC 3G9CA 3EGZA 1JJ2R 2HGMA 5DM6Q 1FO1A 4WFAQ 1SJRA 2KXHA 2LMIA 5EN1A 2CQDA 1JMTA 2MGZA 1VBZA 3BEGB 1VQ9S 3UCUP 2MYFA 1WWHA 5LXYA 2E5GA 2HGLA 2E5HA 2FC8A 2JWNA 2CPEA 1VQ7S 3CCVS 2DNRA 2F3JA 3MOJB 3G8TA 5GVQA 2DGSA 1WHVA 2PEHA 2MKSA 1KOHA 3CCJS 4EGLA 3B4DA 2DNZA 1VQKS 2M8HA 1A7GE 2CQ3A 3NS6A 3CD6S 1FJ7A 5CYJA 3CUNA 4Y00A 2LCWA 4YB1P 3UWTA 1FXLA 4F25A 2XNRA 5LXRA 3P3DA 1M5VC 3VAIA 2M52A 1FHTA 2ADBA 3D2WA 2MJUA 3PIOQ 1YWXA 1WHWA 1X5PA 1P27B 4ZKAA 1OO0B 1H2VZ 2DH8A 2KM8B 5MLCV 4UY8T 2ERRA 4RU2A 2JX2A 5CA5A 1F9FA 2LKZA 5LJ3Y 3NNCA 3S6EA 1N88A 3THPA 1X4BA 3CCSS 1K8AT 3IRWP 1JJHA 5DM7Q 2DGTA 1R8HA 3NNHA 3PIPQ 3CULA 2RT3A 1M5PC 2OSRA 1VBXA 3LPYA 2DGWA 3MD3A 5GADU 2KG0A 3RW7A 1VBYA 2CPIA 2M8DB 2ADCA 1DBDA 2N3OA 2MB0B 3CTRA 1X0FA 1CVJA 1OPIA 2D9OA 2XS5A 2FPHX 2DNMA 1RKJA 2MZRA 2MQMA 3VAJA 3U1LA 3SDEA 2KI2A 2LECA 3P5TL 1U1QA 3UD4P 2XNQA 1N54B 2PE8A 2RUGA 2ZJQQ 3SXLA 3RW6A 3MXHP 5FJ4A 3UD3P 1A9NB 1UFWA 2KRRA 2AYEA 3LQVA 1U1PA 3OW2R 2MQQA 5CXTA 3S8SA 2MPUA 4F02A 5IQQA 3TO8A 2CPXA 2RS8A 4P6QA 2CPZA 2RS2A 2JRSA 1K9MT 5DDRC 3U1MA 1ZZNA 2JVOA 3ZZYA 2NLWA 2J76E 2N7CA 2VODA 4IUFA 2FY1A 2MKCA 2DIVA 2MKKA 5JVHQ 2DGXA 5JVGQ 2DNYA 3Q2TC 1N52B 1NJIT 3VAFA 4IO9Q 2DB1A 2GO9A 3MURP 2KXFA 1M90T 1BY9A 1U1OA 2MZTA 1KQSR 2DNQA 2LA4A 3VF0B 2QEXS 2MMYA 3K0JA 2M4MA 1D8ZA 3R1LA 3I56S 1H6KX 3MDFA 5IM0B 5HO4A 1PGZA 4WCEQ 4A8XA 5DDOC 3NS5A 1WG5A 2F9DA 4YUDA 3BO3A 5D78A 2J8AA 1X4EA 3FEYB 4W92B 1X4AA 3CXCR 3VAHA 2DNHA 1SJQA 1DRZA 2G0CA 4QPTA 3CCRS 1KD1T 5DETA 3N9UC 2DNOA 2YWKA 1W2BR 1FJEB 4OZ1A 4PR6A 3TP2A 2M0GB 1WEXA 1U2FA 5IM0A 2X1AA 2GHPA 3CC2S 2MQOA 1OIAA 2AD9A 2CQPA 1WHYA 2OSQA 2KH9A 1YITS 1HD0A 2M88A 1WG4A 2DHAA 2MSSA 5LSLA 4C7QA 2KRBA 4C0OC 4TLQA 3CCES 4BS2A 2DHXA 3MI7X 5ITHA 4TU7A 2CPDA 2K3KA 4V19X 2D9PA 2J0SD 2CQ1A 2DGQA 2E5JA 4Z2XA 3MUMP 2M70A 1G2EA 4C4WA 3SDEB 1XN9A 1HL6A 4OZ0A 4WFNQ 3JB9k 1VQ4S 4CH0S 1M5OC 1VQPS 1X4HA 2U1AA 2A3JA 2VOOA 2CQ2A 4CQ1A 2CQCA 2DITA 2CPHA 3MD1A 4QU7A 2MZ1A 3NMRA 3FEXB 2AYBA 2MZJA 4WFBQ 2KU7A 2CJKA 1DHMA 1YJ9S 1ZZFA 1P1TA 3EX7B 4QQBA 4FXWA 1X4FA 2CQHA 4TU9A 1HA1A 2DK2A 2KG1A 2OJ3A 4LIRA 5GAEU 1S79A 3J7ZT 2DO4A 2YKAA 4TU8A 4WF9Q 1L3KA 2MZSA 2KM8C 4ERDA 2X1FA 1SJFA 2CPYA 3UCZP 4Y0FA 3NNAA 1WI8A 4UQTA 4IOCQ 1YHQS 2YH1A 1K73T 1SXLA 2CQGA 2DH7A 3THTA 1WEZA 3G71S 1FJCA 1VQ8S 4PRFA 1M1KT 3VALA 2SXLA 2LXIA 1SJ4P 2UP1A 2MXYA 1RK8A 2ZJRQ 1WI6A 1X4CA 1U1MA 2CPJA 1VQ6S 1QM9A 2HGNA 1SJ3P 2DHSA 3US5A 1FNXH 5DDQC 1U1RA 3P6YC 2RNEA 1U1NA 3G6ES 3UCGA 3S01A 2FC9A 4CH1A 1UW4A 1ZH5A 5IFMA 3ULHA 2M7SA 2DNLA 1VC6A 2LEBA 1QVGR 3CC7S 1UP1A 3CPWR 1WHXA 2MKIA 2E5IA 1H2UX 2LA6A 5GAGU
chains in the Genus database with same CATH superfamily
1SH0A 2KFZA 2V8HA 5GAHU 2DHHA 1KP6A 5B7WA 1AUDA 2V4QA 1U6FA 2M2BA 3IBFB 1KN6A 4HKQA 2NUHA 1XIQA 4O44A 5F8LA 4OI3A 1TELA 1VQLS 4F8RA 4DR2F 3ZZUA 1LWEA 1U49A 4P9SA 3NY0A 4I0WA 1O0PA 1UWBB 2QFJA 2W2NP 4LF9J 3NWGA 1S0OA 2DPJA 2W2MP 3BKTA 1Q7LB 1B4SA 3KK1A 2RJZA 4ZVGA 3NBPB 1B0TA 4ER8A 4UTGA 1ZM2A 2GMJA 4IRCA 1WTFA 3IR6B 1TK5A 2JVRA 4HHHA 3D3CJ 4KHRA 3GPAA 2IFXA 1FK9B 5K14A 3FGVA 2HWIA 4X4VA 3PHTA 4L3KA 3FFIB 3AQOA 3UNYA 1QUPA 3CJ0A 3QWUA 3TZYA 2KYZA 2ZZTA 4RJVA 1ZM4A 2GA7A 4FNHA 2XG8A 2OUGA 2H3EB 3T1YJ 1W2IA 2COLA 2DXDA 3TUIC 2WAQD 1IJEB 1JKHB 2B7BB 7FD1A 2Y0SD 4YS2A 3PHEA 4FDFA 2BE2A 4LT6A 3BDEA 3K5LA 1YJ7A 2XS2A 1S77D 3UO0A 4RBVA 3UW1A 1VC0A 3W5YA 2QMXA 3OXLA 1UFKA 3PW4A 1FTRA 1OQ6A 4RNHA 3CCLS 3AODA 1WDTA 4PABA 3G9CA 4EBDA 2Z2YB 4NLWA 2AGPA 5KFJA 4X4UA 4USUA 4R25A 2E5HA 1Q53A 2EFQA 2DNRA 4P7VA 3G8TA 1WHVA 1ZYQA 1TL3A 3W62A 2XGQA 4ID5B 4F7VA 1APSA 3B4DA 2B5JA 2JEJA 5CD4H 1X8DA 4DSFA 1TUWA 4IRDA 5F0UA 3J7Z5 4DL4A 4EZ6A 4K4WA 3J80U 1LKZA 1T03B 4C3LA 5FD1A 3KDOA 2ZC4A 1XK8A 4B9LA 4LFAJ 1GXTA 5E3RA 1H2VZ 2DH8A 4F0MA 2Y8WA 3DLEB 5HVFA 4C8OA 4JI3J 4HACA 4B9NA 2P2CB 3N5BA 3PIPQ 2VL1A 2H5IB 1U02A 4OYXA 4C0BA 1NRKA 2YNIA 3R2DJ 1GNKA 5CCMA 2HURA 1CVJA 4U96A 2R2RA 3C6TB 1I94F 1CBKA 2UVRA 1RKJA 2J9DA 5D6GA 1U1QA 3UD4P 3MM9B 2XNQA 1YX2A 1N54B 1H72C 4OL8A 2FJEB 2FVSA 2MQQA 4CZCA 4DPOA 2CPXA 2RS8A 5F0WA 3T6BA 5LT5A 2RKIA 5KG7A 5DGBA 3PW2A 3LWMA 3B78A 3CT9A 3L95X 1MG7A 1S6QB 5E2QA 1N52B 3BB5A 3GZ7A 4USMA 4OX9F 1FNMA 2I9SA 2M4MA 1J2VA 3QGGA 3SBMA 1WG5A 1TKZB 3KJVA 1FNOA 1HNVA 5F8NA 4X64J 4KRWA 3B8HA 3P96A 2G0CA 3AB4B 1EHWA 4WWSA 1SJ1A 3HF5A 3HVTA 4DV6F 1LW0B 1R6YA 2J6UA 5IM0A 2RHQB 1OIAA 5KFRA 4MK9A 5F8JA 4LFBF 5FDLB 4DPXA 2J9EA 1G2EA 3C66A 1S1WB 1XN9A 4FNIA 1VQ4S 1TQLA 3MECA 2UU9J 3Q8PB 3FQLA 2A3JA 2IM2A 1HBUB 3D0GE 4EZ9A 4DV3F 2IA0A 2HIQA 4DX5A 1HQEA 4LQ9A 4BC7A 3EX7B 4XPCA 1HA1A 3F73A 2KG1A 2I0XA 4TU8A 3Q8UA 4Y0FA 2LQJA 2DH7A 3DU6A 4DEZA 5J2MB 1SB6A 4F0HA 3DNCA 5IWAF 3IC1A 1U1MA 4PG5A 4GVBB 4Q2LA 5GAGI 2YPYA 1R0AB 4ZMMA 3PR5B 2IHR1 3G6ES 3ZZ0A 3VQTA 2XWYA 4NOHA 3IBWA 3QFWA 3M8WA 1X7VA 3QPIA 3HJVA 2VC0A 1L3TA 4JI7J 5LSOA 4TY9A 3KUHA 1LXNA 4JV0A 1X5SA 3DRRA 2VBXA 2ALZA 5F9LA 4KH1B 3HD2A 1M1GA 1Q0NA 1NSKL 4YQWA 2RAQA 4Q0BA 1PC4A 1RT3B 4HI2A 1NK9A 2ZOMA 5B0FA 3G96A 2R2UA 3EZUA 2XEXA 3OFEA 1QAYA 2CJ9A 2D41A 1JLCB 1V6HA 3BGLA 4FYWB 5HL7Q 2P9CA 3H5YA 1TV6A 3UPFA 4PXDA 3RR8A 5GMKa 1JJ4A 2RU3A 2N4DA 4U8YA 2XSFA 3CD7A 2D74B 4J5OA 1X5TA 1DLOB 3MCOA 5B0CA 4M5IA 2QFIA 1XEZA 3OFGA 3C16B 4JV1A 2HQFA 2MHNA 2NZ4A 4QWAA 1IR2A 2HVHA 5KG3A 1W7WA 1EZZB 4WXWA 1NDCA 4ZVHA 1XMOJ 2DT9A 4HHUA 2WOMA 2MQNA 3VV2B 1UJ6A 1RB0A 2RQCA 2F4VF 4FYVB 4PQUA 2LXUA 3R5DA 4DZ6A 3ZZZA 1N5YA 2F8MA 4XDCA 2KT5A 4LSNB 4DL6A 5KFNA 1CLFA 3LAMA 2VOPA 1T3NA 4ELTA 1YJRA 4J9NA 1WELA 3MMAB 3D9BA 5E5NA 3IWNC 2XHWA 3ZNJ1 4OX7A 4RW6A 1FO1A 2IVMA 4A8KA 2YXLA 3TAQA 4WYWA 5BXIA 2QL7B 2D3O1 4Q2MA 4DU7A 4X66J 1B0VA 4KHPJ 4RWWA 5EGYA 4OYIA 2KB2A 1U0HA 2MQ8A 5D4PA 4ECWA 4NCGA 3Q8YA 3KLGB 1WJ9A 2XNRA 1T9WA 4OJ3A 4PZVA 5DQHA 3PV8A 2GHWA 3PTWA 2I6WA 3HSZA 5AE2A 3SZ2A 1FRMA 2XC9A 2OPRA 3EE3A 1RWNB 4A8OA 4TQSA 1F9FA 4DSIA 1RAGB 1X4BA 2IRUA 3W5ZA 3BM7A 1C1CA 3C8YA 3HFZB 5G0RB 3NNHA 3KG1A 3TZZA 4OX8A 1HARA 1CQMA 3OLBA 1HYSA 2CPIA 3HFKA 3ONQA 4QYRA 1OPIA 2BOAA 2D9OA 5KFCA 1RTDB 4N8OA 4P71A 1F2GA 2FUG9 1IWGA 2ZBPA 2WVEA 3FZBA 3H59A 4OZ3A 3BF4A 1X60A 5I4MA 3DLJA 1MMNA 2DR7A 4WZQA 2AYEA 2BR0A 1O6XA 1NK5A 2HHVA 3ISND 2IAJB 2RQKA 3PFEA 5HI7A 4LF5J 5G4DA 4E0DA 2MKCA 3D1HA 4ZP9A 2DB1A 4FP9A 2OFGX 2OPSB 1M90T 2P9GA 4MFBB 3MDFA 1EAYC 4YR2A 1NK7A 1A0OB 3NS5A 4YUDA 4CTAA 4GO7X 1RAJA 2LFVA 1RZMA 2FB0A 4MIWA 4LF4J 2R8IA 1RBAA 4V19J 3KLEB 4DPUA 1UA1A 1SKWA 1DQ8A 4I7FB 3DM2B 2EG2A 4TLQA 3D7SB 2LU2A 1NSPA 3K5OA 3AY0A 5J2QB 3SDEB 4DR5J 1NH7A 3MMCA 2M3DA 4XO0A 2FZKB 1X4HA 2AEJA 4NXNF 2VOOA 3JQMA 2VFUA 4ATNA 4MYUA 4DS5A 1R0CB 2AYBA 1YK9A 2ZE2A 1K1SA 1WACA 3PXGa 1RLCL 1XR6A 1F2HA 1IBMF 4B3TF 3UCZP 1HI8A 5E3AA 5DG7A 1IBKF 2C2MB 2LQ8A 3MMBB 1PYSB 1F3VA 3UDCA 4NYOA 4UZCA 3HT0A 1S6PB 3KYLA 1WOOA 2B51A 3KUGA 3NOGA 3AJ2A 5KFSA 3GYXB 4KKOB 3VGUA 4RBUA 3ULHA 1TKTB 2VB6A 4J9LA 1QVGR 4HVZA 4MKBA 3ET6B 2PMWA 4HYKA 4F4XA 4F3MA 4KIAA 4F4WA 4QW9A 2HG4A 3Q8SB 3RUBL 3NGKA 3FRYA 1XNRJ 2RHSB 4HH0A 4CYUB 2IM3A 4XK8C 1Q1KA 1TFWA 1HR0J 4WK1A 1JLQB 2QG9B 2VBWA 4IFYB 6FDRA 2XQCA 2MJNA 2FJVA 4QPXA 4WK3A 4DV2J 4B9TA 4WKRA 3PEJA 2DBBA 1YI2S 4F04B 1RHMB 2IVYA 2W4CA 4FXVA 3CCUS 4JI6J 3GB0A 2DGOA 4DSLA 3BQ0A 5L39A 3V4IB 3IFEA 1ZAWA 1AA1B 2KHDA 2K8GA 3G86A 2OKQA 4ANEA 1T95A 1KC8T 1UWBA 3B4MA 3GIJA 1GX6A 4ES3A 3C6UB 2AWZA 4X65F 4I68A 1YTYA 2DGUA 2YY3A 3OUYB 3I0RB 2DNKA 2C22A 4ZJLA 4DUYF 2B0GA 3HM9A 2EBGA 4DR6F 2BOPA 2RRNA 3WX4A 4CP5A 3IS9B 1FK9A 1LWFB 1RHRB 3ZO7A 2E1PA 3G4SS 4WU2A 7FDRA 2DNPA 3LGHA 2IYIA 2Y1IA 1HI1A 1HBOB 4G3IA 2MGZB 2DRDA 2AZ1A 5T7LA 2YH0A 3PYEA 5J1EB 2HFUA 4ZPCA 1AB8A 4ICLB 4ED5A 2VH7A 3TJ9A 3BN4A 1UPPA 2WB1D 1M5KC 4EI2A 5L46A 5KFHA 5ADZA 3PDNA 1VBZA 2ZFHA 5DLGA 1RA7A 1TL7B 2JWNA 4ANDA 5KFQA 1FX2A 1KOHA 4EBEA 3TOQA 3V6HA 2VQEF 3BSAA 1RYSA 1U25A 4F25A 4OYAA 1H0HB 3EZ5A 1RTZA 3OJSA 2QYCA 1FJGJ 4DMZA 4L76A 4ID5A 2IM0A 3SYZA 3DDIA 3GFZA 1JLBB 2HQIA 3POTB 4DSJA 5IV3A 1GQEA 5FLXU 1T03A 2VDIA 3PG9A 3J81Y 2A6MA 2CRLA 1Q8KA 2EG1A 4OZNA 4U6PA 2Y1LB 4UW2A 4USHA 1NB7A 2KDOA 3DLEA 3ELHA 4NPOA 1YJTA 2ZDPA 3RBXA 4C8MA 3HLUA 3O5TB 2NUUG 2CWKA 1P9YA 1WKKA 3DOKB 5E3CA 1XMQF 1R8CA 2AT1B 3S8SA 3K8VA 1G7CB 4A46A 1N33F 3TO8A 2HK3A 3MM9A 1ZZNA 3CCZA 3G82A 3WBZA 3OTDA 2XYHB 4O23A 1SIZA 1VBKA 3E01B 2K2PA 2VDHA 2VG6B 2RSQA 4EO8A 4X4OA 4CLWA 4WCEQ 5HBMA 2UUBJ 1RABB 2XMAA 1P1LA 4DL7A 3JSBA 4DI6A 3KLVA 3CCRS 5AXMA 2FLLA 1B70B 4ZCIA 4ECZA 2YWKA 4DV0J 1IKXB 3UQSA 3TW0A 1TKZA 4ZCKA 2YWWA 3GJRB 2R7XA 4AL6A 4C0OC 3FNNA 3GG0A 2CADA 2V9KA 1HBMB 3TQ1A 3K8WA 2C2DA 1WNEA 3M7VA 1S4EA 1LW0A 2CNKB 3GJSB 3PM9A 5T14A 8ATCB 2B4VA 1LWXA 3MPWA 2Z2MA 4JI0F 1ZA2B 3RB6A 1T3OA 5FDLA 3DGPB 2R7SA 1P1TA 1T9XA 2F8HA 3I5BA 4QQBA 2KKHA 4HT7A 1S1WA 1AW0A 1GEHA 3J7ZT 3B6BA 1HBUA 2FD2A 1TMMA 2GQQA 2POKA 1HFEL 2AW0A 5DRKA 5ETPA 5M2UA 1WI6A 1V3RA 2XMJA 4X64F 1HHSA 4ZPAA 2KZMA 1Y5LB 2HRUA 4CH1A 1ZAXA 3OR2B 2M5YA 3ZXWA 5IFMA 2PA3A 1U2RA 3CC7S 1F60B 5J2MA 4ELUA 5JJBA 3A3OB 3IBCB 2VKZG 4I2PB 1IM6A 2B7CB 1R0AA 1RXOB 1KKHA 4HDHA 2Y3YA 1UETA 3WC2A 3BBCA 3QNWB 2XBPA 2E1CA 5KG2A 2CPFA 2LYVA 5E3QA 4F4AA 1RWVB 4PPZA 3KWMA 1RHUB 2FJXA 2WW4A 2OMOA 4DCOB 3J81U 5I42B 3R7SB 2RVJA 1N8RT 5KAKA 3EGNA 4USIA 4LR8A 4NZ7A 1RT3A 3JTOA 4QR1A 2O5DA 4NA2A 5D15A 2XTJP 3F41A 2HVEA 3EGVA 3KLFB 3HULA 2ZM6J 1JLCA 1IUJA 4J9SA 4QOTA 1MROB 3NLCA 1VFJA 1SC3B 3OBIA 3VCDA 4F2RA 4WP8A 3GV7B 2DRBA 1Q8IA 2FHOB 4JI5F 3HSGA 2IVFB 1X9WA 1N34J 1C1BB 1S97A 1X4GA 2D3OR 3IR5B 2NYIA 3PO5A 1DLOA 2WCXA 4DQQA 1UKUA 3C16A 3DXBA 1BE4A 4J9UE 1HQ2A 5AE3A 3GILA 4JOUA 2L48A 4EMDA 1HBNB 4Q5VA 5K8OA 1KQFB 3IM9A 1LFPA 3SMZA 3I55S 4CO2A 5H9EK 2KJWA 1KQKA 1QSSA 2HGMA 2LMIA 1BQMA 1VQ9S 2GJIA 1Q79A 1HLWA 3DRSB 2RIJA 5HK4A 1OS5A 1VQ7S 2J9DE 1RLDA 3QATA 1UVNA 3BSOA 5CCLA 3I9ZA 3CW2C 3OV7A 4NLDA 3M8YA 3P3DA 4Y2CA 3GIMA 1SBRA 2MJUA 3BGUA 4EBCA 2D7SA 1FKOB 4OJGA 1HNIA 2V2ZA 3GJTB 1KDNA 4W4MA 2C3YA 2EFPA 3KLGA 4A8WA 5T41A 1KVJA 3N4WA 3IAM9 4LF7J 5FIIA 1QD1A 3EYZA 4DFPA 1DY3A 3F44A 3UFCX 1IKVB 4C6AA 1KNZA 3D0HE 3HP6A 1FX4A 1S49A 2XMVA 4H4KC 3EM1A 3H42A 2XS5A 3BDPA 1Z1ZA 2OEMA 3P5TL 4LF6F 1EJ7L 5G0RA 4Y2AA 4DL3A 5A2QU 2BANB 4CDIA 1VDHA 1KVIA 2AJQA 2ZOFA 2X3DA 1PILA 5E0OA 1XJWB 2CPZA 3ZZYA 4LRAA 3K5NA 3NOCA 2MKKA 5JVHQ 3VAFA 1BQNB 3N79A 3HZGA 3GCXP 4KAIA 2HNZB 5HO4A 1S1XB 2RILA 1R0BG 3LAKA 3BO3A 4YR0A 3KLIB 3FEYB 2CG4A 3HKZD 4B3MF 2RB7A 3UDLA 1FCAA 3GG1A 3TVYA 2XMKA 1U45A 2F40A 1XBWA 2UUAF 2XMTA 4MFBA 4QR0A 2AD9A 2OI2A 3OLAA 4RO0A 1F5BA 1NXIA 2K3KA 4V19X 4DSKA 5D8HB 2A18A 3KLEA 4YP3A 3H40A 4ZIWA 1HL6A 2D3UA 4I7FA 3M9MB 3DM2A 4UUWA 5L38A 1UW9A 2ZH2A 4ZVRB 5ETMA 1WC6A 3MCMA 2Q66A 1DHMA 3JQKA 2UV8G 3HX9A 1EARA 2G13A 3UD5A 2HNDA 1SJFA 1BQXA 1RU2A 4H4MB 2RD5C 4BWMA 1FJCA 2BRKA 1YG0A 4BWJA 4RW4B 1N4LA 1RK8A 1RQ0A 5KFYA 3LWLA 2JC0A 4YMEA 4B9MA 1WORA 3DLGB 2WONA 5DDQC 1VHFA 4RWXA 2F65A 2H65B 1K0TA 3MMBA 4TNOA 3AA9A 4YB7A 3GFXA 5D4OA 3QZ7A 3MCSA 2DIUA 1S6PA 1VRTB 3M30B 2HFOA 3HZEA 2GJ2A 1RAAB 2QT7A 1V9OA 1TKTA 2X1GA 1AFIA 3W2VB 2QRRA 3ET6A 2LP4A 3T41A 2V50A 4FN5A 3S7RA 4OYZA 4CNZA 3CCWA 2RF2B 4USTA 1DQ9A 3PJXA 2N3LA 4RW9B 3NGTA 3PCOB 2B9WA 1KTVA 2W4PA 1JLQA 3HSDA 3BQ1A 3OL8A 4HR2A 1TU0B 1QY7A 3GCWP 3AD8C 2YKMB 3HHNB 4M94A 1IR0A 2B8QA 2MZQA 5DG9A 2BVZA 4DFMA 1VRQC 4ZJQA 1S9GB 1Q82T 3C6UA 1FRXA 3DFEA 3OUYA 3I0RA 2G1DA 1CEZA 1B99A 1NEEA 3PR4A 5LMNF 1S9EA 2OTLS 3W8GA 1MWYA 2ZH5A 3IS9A 1LWFA 3PX0A 3K58A 4J9RA 1WEYA 2HVZA 1BXNA 1HMVB 2IJFA 2HQGA 4PYAA 3U7JA 3RRHA 1FA0A 3AXKA 2AQ4A 5EN1A 2FJWA 1HBOA 2MGZA 3OXGA 3LW5C 1FKPB 4FVCA 3FQKA 5J1EA 3BR9A 3CVKA 4M5NA 5LMUF 4JP8A 3U02A 5GVQA 1REVB 5HMYA 4EK2A 4FPRA 3K2YA 4GC7A 4OHWA 4NLUA 4LVNP 1FJ7A 3Q8QB 2Q6CA 4G6VB 1TL7A 3EDQB 3MM6B 3KMQA 2ADBA 1SC4B 1WHWA 5B09A 1REGX 2KTQA 2KM8B 4R0JA 5AXKA 1N6QB 3MM5B 3LA0A 4DR3J 4CO3A 1FVQA 4A8MP 3ILLA 2ZH7A 4H54A 2GNKA 2B9XA 2ZD1B 5B0AA 5CYQB 3EMTA 1JLEB 5GADU 2ALYB 2M8DB 3QSIA 3H25A 1OY6A 4OQJA 1JLBA 1T7PA 1F9EB 2DNMA 2YNGB 2MZRA 4DR1J 2CKWA 3EVWA 2RUGA 3NEKA 2W9BA 5A8RA 2K1RB 1MSWD 1UCNA 1FDNA 2QN6B 3BN7A 3PRVA 4X2BA 3G8QA 1GTEA 3LP2B 5KT4A 2VA3A 2RS2A 2JRSA 5DDRC 1GFWB 1RT4B 3ENWA 2NZCA 2DVIA 3QWPA 4U8VA 3DOKA 2XWXA 2UVUA 4Y2MA 2WB4A 4OV1A 1N5SA 3CB4A 2QEXS 3K59A 3MPDA 3NS7B 4DN0A 1PG5B 5D78A 2ZHAA 3E01A 3C14B 3GTYX 1CS4B 1OY8A 1M0SA 2VG6A 4AXIA 4CLUA 4DCPB 1FRIA 4PR6A 4M1KA 5KFVA 1U2FA 4K4TA 3FSXA 2OSQA 2V2VA 5JMNA 3DDKA 2UZAA 3T19A 3M32A 3IA0A 3BYRA 5KG6A 5J1PA 2CPDA 2E5LJ 3DHWC 3R5GA 3M2RB 3BYPA 4WFNQ 2K7JA 2CQ2A 1HBMA 4QR2A 4USWA 1RAHB 1ZZFA 2V4JB 1TZ0A 1ELOA 4PXEA 4YN3B 2V67A 2CQHA 2W9CA 2DK2A 4BBYA 2ACYA 5GAEU 2NCKL 4HLBA 4GKJJ 2AX0A 3CMQA 4C3KA 2ZEJA 2VFTA 2YH1A 2A1BA 4B08A 1K73T 5SUHA 2IMWP 4DX7A 4M5MA 4BCAA 5HLFB 2CJYB 1IBLF 3NGUA 2DHSA 3US5A 5K5MA 2C3PA 4LF8J 1YRUA 4PG4A 4UOFA 2LEPA 5C24A 3WHIA 4E2FB 2MKIA 1H2UX 2V69A 2UXCF 3TUPA 2MQPA 4GKKJ 2HBRB 3IAS9 3OR2A 2BMBA 1XTZA 2BA9A 2DGVA 2YQ1A 3SSQA 1JLAB 3OVBA 5CQGA 3MUVP 1NK6A 4PWUA 4I4BA 4O3QA 1BWVA 4ZVFA 3AD7C 2BXJA 5DZ7A 1WF1A 1J5EF 1FFWB 2EI5A 1FE0A 1Q78A 2PIIA 1RT7B 2F9JA 2PEBA 1WF0A 1ZOTA 4OZ5A 4RUHA 4YHHF 3TZWA 3N5FA 2OD4A 2WHOA 1YJVA 3MR5A 1U4BA 4CIOA 4CLPA 2VA2A 3MM8B 2J9CA 2QC3A 4CWBA 3VGVA 4RPFA 4ZOSA 2FY8A 2IC3B 1CJUB 5KFFA 1FESA 3FVYA 4CO1A 3R7BB 4HTJA 3KLFA 4KPCA 2Z8QA 2I5JB 2UUWA 1MROA 3V6DB 2OTJS 4GVLA 4B3SJ 3R6LB 2MY7A 3MEDB 3H5SA 1QE1A 3CJ8A 4URQU 2V2QA 4MIBA 3CJ4A 1C1BA 3I5CA 1RHJB 3QLHB 4N7TA 3MCNA 3BV8A 5A8WB 4RUCA 2DHGA 1S99A 4FF3A 5B08A 3NKYA 1KOOA 1NU4A 1JJCB 5BR8J 3UNGC 3R3TA 2GAHC 5A6PA 1D9AA 4IH7A 1JJ2R 4MT1A 3PY8A 3GIIA 1HBNA 3W3SA 2CDRB 1OYDA 4U95A 5HROB 4H4OA 2V0NA 1V3ZA 4ZIVA 3I82A 4P10A 4PXBA 1S48A 5IT0A 5I3UB 4K4XA 4P2XA 3MFHA 1MNEA 3DRSA 1B3TA 1DAXA 1OO0B 3AFGA 3T1AA 1KVKA 2ZH8A 2O01C 5HQMA 2NXEA 2YWGA 2VICA 2QSWA 3NNCA 2YVSA 3D66A 3R6GB 2DGTA 3CGIA 3M1VB 1TK0A 2QLWA 1CSJA 2Y0BB 1TUVA 3MAHA 3ETMA 1FKOA 3AD9C 4KGVB 2H5EA 4DUZF 2NS1B 2V4RA 4NE9C 3K5MA 1KSPA 3SXLA 1VK8A 3RW6A 1IKVA 3I96A 1OSDA 1Y9OA 3LQVA 2VF3A 2CFXA 1R89A 3HD1A 5CHCB 1RAOA 3MHYA 4RUBA 2MPUA 1ITPA 4OHVA 1PBAA 4LF1A 3MF5A 2UXDF 2JVOA 2BANA 2J76E 4FS1A 5U47A 4YY3J 3NAIA 1NMEB 3Q2TC 3N6MA 4RNOA 2RU9A 1EKSA 2QLBB 3CJQA 3VF0B 3K0JA 2RQMA 3LP1B 1PGZA 2EWHA 5CH7B 5DDOC 1RT5B 1J5OB 1DRZA 4WFXA 1W2BR 3D1QA 2HNZA 1QAJA 3KLIA 1WG4A 5HJYA 4PAAA 1EIYB 3SV4A 3MI7X 3NCQA 3T5JA 2W25A 2D9PA 2J0SD 2VQFF 1PAEX 2WSEC 5AJ3F 2M70A 4OYBA 2PT0A 3MGJA 5C42B 5KOWA 1TL1B 4B3RF 2J5AA 1NLKL 3DMJB 2CPHA 2MZ1A 4NLOA 3LH2S 2LDIA 3OTOF 1YJ9S 4QIEA 2WRMA 4ECVA 3KKFA 1N32F 1HNWF 1X4FA 2K06A 2HS0A 3NGDA 2W1BA 1W25A 1BD6A 2OEKA 3AOCA 3SQOP 4DCJB 2FVRA 1H7WA 4NA1A 4X4PA 1WEZA 3BGOP 2WVBA 2UUCJ 2L3MA 4OI6A 1VRUB 4ILRA 4ENOA 2C1EB 2CPJA 2H9ZA 3ZTPA 1FNXH 3T1HJ 2G0JA 2RNEA 2G0IA 3SFGA 1UW4A 1ZH5A 4WXOA 4H4MA 3FK4A 4JB8B 4UY85 2IYGA 2DR9A 4K4YA 1FWKA 4RW4A 3CDBA 1NPKA 3CF5Q 1S6OA 3DLGA 3OPKA 4KB7A 4DPYA 1NHKL 3BBBA 2LXFA 2HHWA 3DC2A 1U1LA 5LJ5Y 3MEEB 1VRTA 2CJXB 1HQUB 2QZ8A 3ILJA 1SH2A 2ASDA 4HH1A 3EPIA 1CJKA 5KFTA 2CZ9A 2Z2LA 3W2VA 4ES2A 3QAEA 4IG3B 3UE2A 3M9OB 3PYGA 3A4TA 5HVHA 3OJUA 2JFDA 2HZVA 2L41A 2XY7A 3GIRA 2HAFA 3W61A 1Q81T 5KG0A 1CQNA 8AT1B 2EK6A 1RWMB 4DF8A 4O4RA 3CIZA 2OLWA 2YKMA 3M2UB 4ED3A 2XCAA 2B6AB 3AA8A 2J0QD 4OYMA 3OTCA 2N82B 4O3NA 3CMAS 4K7QA 2FLNA 1N56A 1ZM9A 4UOCA 3QT6A 2FQQB 4DV5F 4DL2A 1RTJA 3VWSA 4RNFA 1SVDA 1KLMB 3U1NA 2VJVA 2QTWA 4MJKA 1TP7A 2YTCA 1MMLA 5E3PA 4M5DB 3DI6B 2PDAA 3QFHA 1HNZJ 1UJ5A 4U7UD 3MUTP 1VK3A 1SV5B 1XR5A 3H4BA 2W01A 3S1TA 3QGHA 4Y2IA 3CJKB 2NQPA 4QZVB 2J7UA 3BGRB 3LP0B 3ZNUA 2R7RA 4K4UA 3WC0A 2HGLA 1HMVA 2FC8A 3MOJB 3DOLB 2HS3A 3EPGA 5ETSA 4JYAF 3T5KA 4ZVOB 3ICLA 1U47A 5KFZA 2AJFE 3R5AA 4ILMA 3T5HA 1RDRA 4YB1P 1FKPA 1HWLA 3M8QB 1REVA 4DR4F 3PIOQ 1P27B 4ZVPB 2HHHJ 1PC5A 1Q5YA 5J2NB 4CLFA 2QYGA 4RU9A 3MM6A 4X62J 5LSRA 3UVJB 2XCPA 3I0SA 4B02A 1Q5VA 1N6QA 1S1VA 1NUEA 2OPQB 2AEMA 3C19A 3NGRA 3U1LA 1TL5A 2ZD1A 2IRYA 5CYQA 3OQ2A 1JLEA 1BHNA 3OD2A 2KRRA 2W24A 2HEKA 4DR7F 3ZTSA 4F3OA 4C0HA 2YNGA 4DQPA 2WZ1A 3LOUA 3MM7B 5KFBA 4NX9A 4NLSA 2D1CA 2K1RA 4AQYJ 3LGNA 1NJXA 2QLFB 1Y5NB 3LP2A 3ISNC 2D69A 2KXFA 1BY9A 3VVUA 1FERA 2DNQA 3CEDA 3ZC4A 2MMYA 2GMHA 2HFZA 2EFVA 2ROEA 3RZAA 1UZHA 4FBUA 2D3ZA 1JNZB 1LFWA 3UN5A 4RNMA 3GONA 3N9UC 1CJVB 4FKXA 1NZ8A 4I67A 3IGNA 4DPTA 2GHPA 2RDDA 2R7VA 2VBYA 4OJ1A 3DLKB 2FYXA 5EWEA 1ZTWA 3H5XA 4KH0B 2CNOB 2VASA 5KFEA 1U09A 4FBTA 4P2FA 3RR7A 4KT0C 1K47A 3D68A 4P2SA 4KTQA 4K4VA 1N0UA 2XHCA 2VJUA 1VYAA 1YBTA 3TEGA 3FEXB 3EDRB 2XMWA 2MZJA 2GQCA 2E29A 2JC1A 3GYNA 1UVKA 1VMBA 3M2RA 4ZPWR 4P73A 1N36F 1NKEA 2OJ3A 4WF9Q 1HI0P 1SCJB 3CD0A 2Y1RI 2NXUA 3M05A 5J2PB 3ENQA 2VFSA 1SXLA 2H5JB 2V4JA 1EKRA 3EZOA 2H1YA 2VPYB 3QIDA 4ZS6A 2LXIA 2OAUA 1SJ4P 4D3GA 3SI8A 1MN9A 1RWUA 1X4CA 2J7WA 2UXBJ 4WJBA 2ZWPA 4Q44A 1GMUA 3PZPA 1WC4A 2FC9A 4JI2J 2DNLA 5IT9Y 2IMOA 3ETOA 1AYEA 1V3SA 3TR5A 5GAGU 5HLFA 4DHVA 2DNNA 4USKA 2JEFA 2V8VA 2XZTB 4MK7A 3NWRA 3CMES 1FI4A 3Q2SC 4DFKA 3A8IA 3KFWX 1C4AA 2EFNA 2HBYB 3HO1A 4C11A 3BSNA 3DLLQ 2OMLA 3AHPA 5DO2A 1YDLA 1Q16B 3OHBA 5KFMA 3HHLD 2HYIB 2OO4A 2J6SA 2Q43A 2V2KA 4B9SA 3MFIA 2DR6A 3J7AN 4X4QA 5KFKA 1DZ5A 1OPZA 2YNFB 3W2WB 4NMLA 2VU5A 3EGWB 4DR2J 2OPPA 4G1QB 5IC6B 2JLFA 2CVIA 4WP9A 4JI8F 3T5LA 1JIHA 1RT7A 1X4DA 3R8YA 3SCLE 1LWCB 2O3DA 1S76D 4F50A 2A2CA 2I1RA 2EPIA 3L3CA 2ZUGA 1R8BA 3T3FA 3GSIA 4N77A 2CNLB 3IG1B 3EXYA 3ZTOA 4Y2KA 3Q22A 5DGAA 3RGIA 3TAPA 2P8IA 3MM8A 3G8SA 4CLLA 2BJ9A 1WSRA 4KHMA 1F5AA 4R8UB 3RB4A 1PAUB 3BO4A 1U8SA 2PSZA 2I5JA 1MU2A 3V6DA 1U48A 3VTIA 4OI4A 2H4WB 1S1TA 2B9EA 1PYTA 3BS9A 3V2UC 3ZZOA 4FF2A 4WFAQ 5A8WA 2MLZA 2E9RX 5HMZA 4ZLJA 2HIYA 3BKUA 3KK1B 3W8PA 3T9NA 4GC6A 5DZ6A 4G1PA 4LQ3A 5F41A 1YQHA 1FRKA 4QWEA 3MR2A 4K2XA 2ZDOA 4YR3A 3CUNA 3UWTA 3HMJG 4CLTA 3PO4A 4ZN1A 2LQ9A 1SI9A 1M5VC 4KE5A 1QAXA 5HROA 3UR3C 4J9OA 3SFUA 4IDKA 5LJ3Y 5I3UA 2XLKA 5KFXA 2QA4G 4A4JA 4I2QA 5KT7A 2R7WA 4CT8A 3RW7A 1KFSA 1FXRA 2GIRA 1T05B 4N41A 1SIWB 5D0EA 3UDEA 1X0PA 2YBVA 3VAJA 2LECA 1Y3JA 4ED0A 1H3DA 5IT9U 3LUYA 3M6VA 1MWQA 2K3IA 1UJ4A 2YKPA 3FZ2A 3JSMB 2AZ3A 1I94J 4K4ZA 2WTFA 1K9MT 1VLOA 4MKAA 3THVA 5KFPA 3KK2A 4OYWA 3LF0A 4XPEA 2GO9A 4IG0B 1KEKA 2W8LA 2IJNA 4NEYA 5GMEA 3JTNA 2XY5A 2YWHA 3O44A 1NK0A 3IO1A 1CC7A 2XLIA 2DCLA 2J8AA 4EO6A 3VAHA 2DNHA 4J9VA 3PVXA 4OX9J 2FVQA 4USVA 4HACB 3LP1A 4DV4F 3DOMB 3CC2S 1FD2A 4C8LA 1I3OB 3CJRA 3OTBA 2KRBA 2OEJA 1RT5A 3CCES 1J5OA 1VJWA 1KRPA 3I6PA 3DRXA 4WZMA 1B7YB 4RBTA 2H4YB 5I3PA 1ZBTA 2ZKTA 4DV6J 2HNYB 2AF6A 4C8ZA 3AH6A 3JB9k 1FEEA 4ITSA 4CH0S 4TN2A 4CQ1A 2DITA 1NB2A 1Z2ZA 4LFBJ 3D6FB 3KJFB 2JZ5A 1RWKB 4JI1F 2LQBA 4ZVQB 2BE7D 3PW7A 3MWBA 4FXWA 4TU9A 4MMOA 5C42A 2RKIB 1KFDA 2W8KA 1TL1A 2KM8C 1KHVA 3DMJA 1SUQB 1TTHB 2VIHA 4DV3J 1NJZA 3K17A 1NSQA 2E66A 1RYRA 1ZPWX 1FD8A 4TQRA 2B8PA 4AUKA 1HWKA 2QL9B 3KJVB 1QM9A 1HNVB 4Y34A 4BC9A 2X3GA 4F67A 1S0MA 2VC1A 4JV5F 1VC6A 2BJEA 1WKJA 2AEFA 3HVTB 2XULA 1R8AA 4KSEB 1L3UA 4A8SA 2ASYA 1VRUA 2UUTA 1SC6A 1DJ0A 2VG7B 5IWAJ 3I31A 5BYQA 4TVAB 5L8RC 4NLPA 4QYZK 4UF4A 1OMSA 4ILLA 2DNGA 4DV7F 4DWIA 3W64A 2CDQA 2Z4PA 2V8PA 4NWBA 4F36A 1AT1B 1D8YA 1Y0HA 3W9HA 5D0RA 5EX0A 3E3XA 4CLKA 3KK3B 4YEAA 3MEEA 4PKDB 3VAKA 1HQUA 1WSVA 2X7IA 4WBFA 2JDJA 1EETB 4M5LA 4UOHA 2UUCF 1U8WA 1H2TZ 2GX8A 5KFWA 3QIPA 3W9JA 4JI4F 3KG4A 5ETVA 4LRDA 4HDGA 4DV1F 2HZCA 2GV1A 2Z30B 4B9VA 5CD4A 3EWGA 1RT2B 1IQZA 3H2UB 5IV4A 4OYPA 1Q86T 4B3OB 3QBCA 4IR9A 4RW7A 3ADAC 2GS8A 3I4HX 5DDPC 4C8YA 3I5AA 2DO0A 3M2UA 4IH5A 3OL6A 5K8NA 1D9DA 4DZDA 1U24A 2B6AA 3VHQA 2F4VJ 4Q0BB 4NLRA 4G65A 1D09B 4LFCF 3PKMA 1KLMA 1SJRA 4CT9A 4OI0A 2HVDA 2C2NA 4M5DA 3DI6A 2QGFB 1YRTA 1SV5A 1QSLA 4R0EA 3BJYA 3CCJS 2JEIA 3CJKA 3Q0AA 2M8HA 3CD6S 4WYLA 2JFKA 3TQEA 2YWFA 3LP0A 2VPZB 4ECQA 1RTIB 2WK4A 1YKWA 2YQ3A 3DOLA 4M8LA 2PGCA 2GAGC 1YWXA 4K0KF 4ZKAA 2W7OA 4A8FA 2QLXA 2CXEA 1RWOB 4UY8T 4RU2A 5CA5A 2KFNA 1RISA 1Y10A 3M8QA 2HKEA 4PQUB 2H54B 3EXCX 3WX8A 2NSCA 1HNXF 4K59A 2ZBCA 3M8PB 5J2NA 4QIVA 1NDKA 1WD6A 3PACA 1LOUA 1YJUA 3UVJA 4TYAA 1NKBA 2NSBA 3HDSA 3BQ2A 3WIUA 3D28A 2BKNA 5KOXA 2FY1A 3TI0A 2W7PA 2DYAA 3LANA 1IWAA 2G2YA 2MZTA 1XMBA 3MM7A 1C0TA 2RMLA 4L73A 2J8SA 1X4AA 2ASLA 3TAMA 4EU0A 1ZM3A 3HHLB 3OFFA 3M2VB 4QPTA 1RGVA 4M5JA 3LGMA 4FVMA 1GH8A 3QRQA 2MQOA 4UZBA 4K5SA 4XAKA 1ICEB 1IXKA 1PYOB 3JSRA 2MSSA 3T9ZA 4BS2A 2R2SA 1CJVA 1RHKB 2C2OB 4JUZA 3VR1A 2ZWOA 3TX8A 2A2DA 3FKBA 5HVGA 3DLBA 2GHVC 2MTLA 3CSKA 4H4KA 4QU7A 4ANCA 1TFYA 2BABA 3HVWA 2BQ3A 3NBPA 2XMMA 3HHKA 4KYZA 3KUEA 2CUYA 3RRKA 3W66A 5DG8A 3A3NB 4NXNJ 2FHJA 1BGXT 3NNAA 4DXLA 4HEA9 2CQGA 3IP0A 4K8RA 3FFIA 2DXFA 1RKIA 1WOPA 4RX6A 1YSJA 1FDDA 3R5BA 1VQ6S 3FC9A 1JNRB 3ISZA 1PJ5A 3HHDA 5L9NA 2QX0A 3P6YC 4B3TJ 2MKYA 3AQPA 2FHMA 1IBKJ 4KGXB 2LA6A 3DKDA 3CDWA 3WQPA 1JKHA 3CWJA 4LF9F 4MKVA 2I2YA 1OQ3A 3FMWA 4ZP7A 4J9KA 2VG5B 1BC6A 2CG8A 5K20B 2EC2A 5IZHA 5CYMB 1K44A 3D5MA 4NA3A 5DJBA 3D0IE 3EVMA 1DQAA 1UFLA 4ECUA 5ETKA 3SCJE 1PO6A 1JX4A 2EW9A 4MAKA 4W90B 2XY6A 5KG1A 3HHEA 4WP3A 1LV5A 2XI3A 2ZE2B 2HHTA 2IDLA 3O3LA 4LF2A 4NEZA 5D0HA 3T1YF 2HVIA 2HMIB 2KVIA 1WF2A 1S57A 3CC4S 1U7LA 3GIKA 1BWEA 4IR1A 1ROFA 4HT5A 2PA8D 4X65J 1UVLA 4EWTA 3TNVA 3LPEA 4ED1A 3LO3A 1Y7PA 1LWCA 2RRBA 3JS9A 4DR6J 3J7YI 9ATCB 4IH6A 4AYBD 3WIVA 3P45B 3C6TA 1UVJA 1VOMA 3V6KA 4OV6A 2DD8S 5ETRA 1WKLA 1NSAA 4R8UA 3MR3A 2CJQA 4OFZA 3FSYA 2DXEA 4DS4A 2QJ3A 3CNQP 2CPEA 3CCVS 3HT3A 4I1TA 4LFAF 1NPRA 1S6QA 1HW9A 4CCHA 2DNZA 4LSLB 5CYJA 2R8GA 4Y00A 2GMLA 3OTEA 4JI3F 1FEHA 1R43A 4QYZJ 1AROP 3BPDA 2DTJA 2BW2A 1Y4ZB 2KZZA 2VQEJ 3TZXA 1DURA 4QBUA 2O1PA 2B9YA 1NZAA 3MD3A 3FBBA 3PRDA 3W5XA 3OSNA 4PUOB 4IQMA 2C28A 1LQ9A 2MQMA 1AXQA 5T7LB 4J9QA 1LW2B 2Q1LA 4F0KA 4A8QA 1EX8A 3X1LB 4FZVA 5CXTA 4TY8B 1T05A 3RAXA 3M8RA 4F02A 3O8WA 4RW8B 3FCHA 1JXVA 3HVRA 2GGPB 1RAEB 1DTQB 1VISA 2PMHA 4I6YA 3JSMA 1RU1A 1XMQJ 4OJHA 1WC5A 1SQFA 1C2PA 1N33J 2W2PP 3CDEA 4GVBA 1HKAA 5B0EA 2EXUA 3CXCR 1S4FA 3VGTA 1SJQA 3GV8B 2GFFA 4IG0A 5DETA 4RNNA 2F5GA 4FXDA 2EBEA 2ZITA 4K2JA 3TP2A 3MTKA 4DJBA 2UU9F 1IKYB 2DHAA 1L3VA 5LSLA 3QO9B 1O8BA 1N48A 2DHXA 3OXFA 2AIRB 3MPYA 1G1XA 2APOA 2C3OA 4LR7A 2DGQA 5D4NA 1XC9A 1RTHB 1VR6A 4YB5A 3DOMA 5HANA 3TA1A 5I3QA 1FF2A 3D4JA 2FZGB 3V81B 3PFOA 1X31C 5KG4A 1XERA 2BKOA 3O1LA 3AJDA 2HNYA 2BQRA 2CNNB 5A8KB 2DY1A 3G82B 5KFOA 1FFGB 1TKDA 1F3FA 2IRXA 3SCIE 1VQSA 2MZSA 3DU5A 1NDPA 1LK5A 4JI0J 2G9OA 2CPYA 4NYPA 2LDYA 4IOCQ 4UQTA 4OMFG 3OVSA 1QUVA 4ZLPA 2SXLA 4JI7F 2MXYA 5HBMB 4B17A 3GLJA 3RYLA 3K89A 4P2MA 1SUQA 3IMQJ 5GAHI 4NI2B 2HHPA 4L3NA 3Q83A 3L4BC 4AXJA 2VFVA 2OD6A 1N5QA 2JLGA 4D3HA 4LSNA 4YFUA 3FJ2A 2OELA 2F63A 2XYGB 3CCQS 3BO2A 5KT3A 2ZH1A 2PI4A 2ZJPQ 1TVRB 3CCMS 1UEVA 3MMAA 5C5JA 2XZWA 2OHDA 4ED6A 1IR1A 2VG7A 3FBEA 4Y6IA 3LTOA 4KGMA 4DX8H 2KJVA 4DSEA 4I6AA 2HZAA 3V5RA 1N5TA 3NG8A 2DH9A 2YNHB 1D3WA 1W26A 4R5PB 2J6TA 4C3MA 1SH3A 4J9MA 2PD1A 5JXSA 1XMOF 1FDBA 3ZFVA 2L9WA 4U67Q 4F4KA 3HSJA 4QU6A 3UI3A 3KK3A 4URGA 2PO4A 1AZSB 5HMXA 3NXZA 1S7IA 5D77A 1WTBA 2Y1JA 1NJWA 1EETA 1RWPB 4DLGA 4C9DA 4ZP8A 2BE9B 3DGVA 1U1KA 5A6WA 4JI5J 1S0VA 1EQ0A 3OT9A 2MKHA 3DRYA 4HL9A 1KTQA 2HHQA 1F5CA 2KXNB 5IT4A 1RTDA 1RT2A 4KV8B 3H8YA 4GMKA 1EP4B 2DJWA 5AT1B 2BW7A 3F0NA 4X66F 4KHPF 2ZVIA 4L74A 4HHJA 1C4CA 1WC0A 2E7VA 4B3OA 1UAWA 4DDFA 5E33A 2ILZA 3DHXA 4J37A 2KXHA 3VVTA 3OFHA 5LXYA 2IAJA 2ZZMA 2P9EA 3HK2A 4K5RA 4OHYA 2F1FA 2OPSA 2XI2A 1BMQB 3PJWA 3LALA 3VAIA 4FPIA 5IC4B 3D2WA 1MWZA 2ZUAA 2IIHA 2BM1A 4CM0A 3I32A 1RTIA 2PMZD 2B43A 2AKWB 5KFLA 2OSRA 2XSJB 3LPYA 2KG0A 4DN9A 1TAQA 1VBYA 4ZLLA 1P8GA 4IYQA 3E2EA 1WUUA 3KXDA 5J2QA 3SDEA 2KI2A 3CJ3A 3KTQA 1A6LA 2ZBQA 4LF5F 4O4GB 4O3RA 4FS2A 4TYBA 3GJQB 2QV6A 3OVAA 4NLGA 3B82A 2J0XA 1BQMB 1F6TA 3HVAA 1U0SA 3M8PA 4P6QA 4LF6J 1SQGA 3U1MA 5D3GB 3A8JA 3ILIA 4CRJA 1NAQA 4LRFA 2B56A 3K57A 2KL8A 3W65A 4LF4F 5KT2A 2J7KA 3QAUA 1NJIT 4IO9Q 1UEKA 4GO5X 1X9SA 3Q8VA 3MAQA 5LM7E 1TAUA 3PNIA 3GR0A 2V68A 3I56S 3FEZA 4BHQA 3C3LA 5ETTA 1XR7A 1FFSB 1HNIB 1G3OA 4KKOA 3H5UA 3FUYA 3TA2A 4DFJA 2BDPA 4DR5F 4CO4A 1TMJA 2ZHOA 1RHQB 2IJRA 3HHLA 3M2VA 4B3MJ 2YKQA 1MN7A 4CYUA 4ECYA 3M6UA 4EEYA 2CQ1A 2E5JA 2Z56B 2UUAJ 4IFYA 3G87A 3RBEA 3UR0A 3E51A 2Z57B 4DF4A 2NR0A 4IQXA 2WVFA 4NLXA 4ZA1A 1S1UB 4EYIB 3VZIA 2Q3PA 3V4IA 4YDDB 3L7OA 1S79A 5DQIA 2C3MA 3N6LA 2X1FA 2FHKA 1WI8A 3G71S 2AMCB 1VHIA 3MAAB 3P8BB 3DRPB 4FYDA 1S12A 3BH6B 4JBCA 2ACMA 4FF4A 1XNRF 1U1NA 2XLJA 3S01A 4V1Ak 3ZTQA 3F56A 1HR0F 2E5IA 1JK9B 2O66A 1VQNS 4DV2F 1F9HA 3D6MB 4NL5A 4BDPA 1N0VC 2CQIA 3D6HB 4JI6F 2R7OA 2GZOA 2K7KA 4P52A 2Y8YA 4YB6A 4ICLA 2V5HG 5H9FK 1I1GA 2BZ2A 2R8JA 3NCRA 1VQ5S 4AD6A 1YVFA 4J90A 1AFJA 5A0YB 2VG5A 2RQ4A 4Q7AA 5CYMA 5K8MA 2E7XA 1FVSA 3H2LA 2QL5B 1C0UB 3GWCA 1Y3KA 3ENVA 2HNDB 5DS7A 4LRBA 3ZTRA 1JXEA 3PRBA 5KFUA 3VAMA 3UN2A 2E9ZA 3PEHA 2BUNA 1Q4RA 2QO3A 4AFFA 5J1NA 1L5UA 2KFYA 4ES1A 2MY8A 4OHXA 4PWWA 2WONB 1KLNA 1YZ6A 1T9TA 1EB0A 2IBKA 3I4PA 2MEWA 3POTA 2HAIA 5FLXY 1YJNS 3M9NB 5THWA 3VQSA 1RWWB 3D67A 2EVZA 2HMIA 1NHUA 2NREA 3GV5B 3KDNA 4ZVUB 2L08A 1BUXA 2LQ5A 3TVZA 1R31A 4MH8A 1CPZA 3KJQB 1NO8A 2V34A 3B54A 2Q79A 5LL6d 3KHLA 1R8PA 4XDDA 4X4SA 4NYZA 5H1SV 5LMNJ 1K1QA 3R97A 2JJ4D 3IRXB 2AYGA 5IXUA 5EHHA 3VGSA 5DM6Q 2CAJA 2MYFA 1DFDA 3D1OA 3QYYA 2LLZA 2E5GA 1NKCA 3WZ0A 1GAOA 3FBCA 3BREA 1FJGF 1M5SA 3MPUB 3KHGA 3D54A 2C2EA 1OSCA 1QLNA 4KGKA 4AL7A 2A6OA 2IA6A 3MZIA 5A76A 1TKXB 1JLGB 2NYHA 3SV3A 2ASJA 1UL3A 3A1YG 5LMUJ 4IRKA 3KJNB 1RAIB 1Y00A 1SL2A 4J91A 4LSLA 5EUHA 1IKXA 3MTJA 2B4PA 2NPFA 1K8AT 1IKWB 4U7UK 1T9YA 1M5PC 1AUSL 1S9EB 3GYGA 2GQ2A 3QQCD 2MB0B 3PKYA 4AL5A 2FPHX 5C2CA 1S9FA 3GFHA 4DL5A 2PE8A 1SL0A 2BM0A 3MXHP 3CJ2A 2BJ8A 4A47A 4PUOA 1H73A 2JHEA 4FYXB 3DGPA 2W4DA 1Z2LA 4OZ2A 2JEGA 1CJTB 2KO1A 2ZNZA 1GMVA 2HHSA 5K8PA 1LW2A 3RAQA 1YLXA 3NRBA 2UUBF 3NGSA 1UVMA 2DEJA 3MMJA 3N6NA 4Y65A 1NCLA 1R6VA 1D0EA 4XIUA 5JVGQ 3IGVA 4QIGA 2OH2A 4TY8A 1TL4A 4DV0F 3MR6A 2RH3A 3IWXA 3SQGB 4RW8A 2F7VA 1YBAA 3R7NB 1D8ZA 1RSCA 3PX6A 3TWZA 3L09A 2YQ0A 3DCAA 3QZ8A 2GGPA 2W7AA 4KFBB 4W92B 4U9RA 1DTQA 4WKYA 1F1BB 3SIPB 1QTNB 1PJ7A 6FD1A 1RT1B 1SKRA 1JWWA 2IDEA 1XWLA 2FLPA 4B9UA 2N7YA 4I2PA 5JUMA 3JYTB 4TLRA 4NASA 4AE5A 4YDXA 4WE1B 3Q23A 3ITHB 1ACMB 2AU0A 2W9BB 5A8RB 2E1MC 2BEFA 1IKYA 3ZZRA 1ZTTA 2HBQB 2JLEA 2DRAA 3QO9A 3HCXA 5I42A 4OIXA 1D1UA 3NMRA 2CWXA 1FRJA 3CJTA 2CJKA 1RTHA 2HK2A 5EX3A 2QMWA 2AGQA 1WOSA 2BACA 2RE1A 2RDJA 3NAHA 3V81A 5CZXA 4QW8A 1GT8A 1DTTB 2C2ZB 2GVZB 2QA1A 4O3PA 1VQ8S 1M1KT 5A8KA 4P72A 3OL9A 2EEYA 3UCGA 4J7CA 2BJ3A 3QT8A 1PSDA 1TK8A 1FRLA 2WSFC 1KHWA 5HQLA 2AYMA 4L75A 2E44A 1IBLJ 3TA0A 3H0PA 3M32B 1L3SA 3O6QA 1KS2A 4M5GA 5F9NA 4NI2A 4CNYA 1B7FA 5BJRA 2PC6A 5C7PA 2UXCJ 1GMWD 1HHQA 1VJQA 2BJ7A 4LRCA 1SC1B 3H7HB 2ZM6F 1Q7YT 2CQ4A 5KFAA 1TVRA 1JLFB 2G4BA 1YZ7A 1NNDA 1N34F 2W9CB 5M2PA 3QMQA 1JB0C 3C2PA 1Y11A 4L6V3 5KT5A 3HHLC 1T8EA 4PG7A 1J5EJ 3R2CJ 4ID8A 4ED8A 2YX4A 3M8SA 1CULB 2N4CA 2YNHA 3QRPA 3AJ1A 3KHRA 4R5PA 4YHHJ 1U6BA 2FZCB 3ENAA 2WBRA 1PJ6A 1DARA 2DKOB 5EWGA 3P4UB 5C24B 1URNA 2KYXA 2YKNB 1AZSA 2ZKUA 2CJBA 4ZCLA 2GC8A 3IM8A 2YWEA 2MSTA 2X51A 3HPOA 2MLXA 5A2QY 4FKYA 1OYEA 3BGFA 4ECTA 2B3TB 4LMZA 2G2OA 3FMBA 1SL1A 2DISA 4E98A 1QSYA 3KMSA 1FRHA 1URRA 5IOLA 5M2RA 2WW8A 2L9DA 2A10A 2HQCA 3N01A 3AB2B 4KV8A 2PFFB 1WWHA 3JAMY 1EP4A 2ZH6A 1FWLA 2DGSA 4ECXA 2PEHA 3CD5A 5BYSA 4PG8A 5AXLA 2EKYA 5F3TA 3GU0A 3PW5A 2ROGA 4RR5A 1VQKS 1BQNA 1NH8A 2BYCA 1S0NA 3EVOA 4LF7F 1S1XA 4CLSA 2BBEA 2B4OA 2H48B 1X5PA 5L1LA 5H9FJ 4WU3A 4ZPVR 4N47A 4WTOB 2ERRA 2GO8A 4GRSA 2LKZA 4A48A 1UWAA 1PIEA 3CCSS 4DQIA 1Q95G 3IRWP 5DM7Q 2ZH3A 2O67A 4MKYA 4TKTA 1QE1B 3V6JA 2HRTA 4DU8A 2RUSA 5F8HA 2Z58B 2HWHA 4ZLNA 1S5ZA 3CTRA 7AT1B 2A0FB 2ZNYA 1HWIA 3GE9A 5L1KA 1B64A 2ZJQQ 4ZDNA 1QTMA 2R8HA 3RBDA 2QLJB 2XSJA 3IWLA 2AGOA 3A12A 1ULRA 4I69A 3TJ8A 1SPBP 4DUZJ 3L9ZA 2DCUB 4O4GA 4H4OB 2VODA 5ETQA 2DIVA 2QSFA 5L1JA 1RAFB 3H20A 9RUBA 2LA4A 3JQJA 8RUCA 1FXDA 3WDOA 3DDNA 5D3GA 2UXDJ 4A8XA 4HI1A 2P6TA 5C2GA 4LR9A 1HWUA 2G2ZA 4PWDB 2R2TA 2VZ9A 1RE1B 3KLHB 2DNOA 3JTPA 1IVZA 2M0GB 4X4TA 2IBOA 2PFDA 4DBQA 3A13A 2CQPA 4CO5A 2KH9A 3M30A 4C7QA 2ZH9A 3A3PB 3DYAB 1MMDA 2V8DA 4TU7A 3RB3A 2GVDB 3MUMP 1O51A 3IXQA 2FTRA 4EUVA 2FVPA 4O3SA 3FDSA 2RF2A 1VQPS 5K9FA 2QE5A 4RW9A 2CQCA 4OHZA 1I6JA 3OR1B 1WC3A 4K4SA 3L7PA 4O3OA 1ZAVA 2VQFJ 1CG2A 5AJ3J 4LREA 3R5JB 2DO4A 4ERDA 4DQSA 4B3RJ 2BV3A 3PYDA 4O0IA 3HKWA 1YHQS 1S1UA 4KO0B 2JSXA 3MR7A 3OTOJ 4PPDA 3VALA 3EUNA 2UP1A 1N32J 1HNWJ 3JAMU 3TUJC 2VFRA 2HGNA 1S9GA 4L72B 1U26A 2ROPA 1U1RA 2FIUA 2M7SA 4QJVA 3RJMB 1UA0A 1VS3A 3MAAA 3DRPA 1U2CA 5KFDA 1S7HA 1T9VA 5BYRA 3QJJA 3G2XA 4F26A 2Y9HA 3QSYB 5F8MA 3PW0A 1WG1A 3A8EA 3BKFA 2XS7A 3PJ9A 1UVIA 3CJ5A 4AT1B 3BR8A 4UUXA 4ECRA 1GXUA 4DOZA 2JL9A 3M6WA 1V5IB 2RRAA 4WIQA 1OJ4A 4NXMJ 2W2QP 5A0YA 3P49B 2GW8A 1VQMS 2XB2D 3TARA 4ZVEA 4F4ZA 2CZVC 2ZVSA 1VIXA 5L9XA 1YJWS 1C0UA 2V63A 1S10A 1J27A 5F3ZA 3MM5A 2LEAA 3G6YA 3MEGB 1QVFR 1S72S 3CO9A 3GSDA 2U2FA 1GTHA 3CDUA 4X4RA 2HFSA 4QCLA 2ILYA 4ELVA 4CH7A 3H2VE 1H74A 2ATCB 3AOAA 3QRRA 1XNQJ 2H51B 1E6VB 4YOEA 2HWTA 1U6ZA 2F4FA 4M5KA 4DPWA 1N5VA 5HN0A 2OP5A 3AAWB 5B0DA 3V4MA 3TRGA 4J9PA 3EGZA 4DV5J 5GMDA 2CQDA 3DLHA 1GK8A 1CJKB 2KT3A 3KG0A 1RT4A 3UN3A 1IJFB 3FSIA 2P6SA 3IRXA 4K50A 4QIWD 3N0VA 4DR3F 2LCWA 1RWXB 1I5OB 4NZ6A 1IN0A 4ZCMA 2M52A 4ZPTR 3RTVA 1P9QC 2BRLA 4JYAJ 2KVQE 3C14A 1B0PA 5HP1B 3W60A 1CS4A 1N88A 2VBZA 3THPA 4ED4A 2DR8A 1RADB 2DPIA 1HPZB 4WTYA 2EC0A 1TKXA 4DR1F 1JLGA 4ETZA 2RDIA 2DY9A 1OY9A 1E6YB 3CIMA 3X3UA 4ECSA 4DR4J 5DQGA 2DGWA 2UVWA 3CCTA 4N56A 5F8IA 3VZHA 3R5CA 1V5VA 3QT5A 1RTJB 4C97A 4ZHRB 2XZDB 1IKWA 3FCVA 3GR1A 4P75A 4X84A 3GQCA 2YX1A 5FJ4A 3UD3P 1A9NB 3RAMA 4OYOA 2C3UA 1U1PA 4QWDA 6AT1B 1T9UA 5KT6A 4OLPA 3SCKE 5LOQA 5L1IA 2XO6A 2ZOGA 5C25B 2DGXA 2V9WA 1RT6B 1YGYA 4DR7J 3U27A 2YPZA 4I56A 5MAOA 1CJTA 4IOBA 3R1LA 5E7OB 2OFHX 3IR7B 1P6TA 2DEIA 1KD1T 2E5LF 1FJEB 4OZ1A 3SQGA 1WEXA 3C15B 1SKSA 2FJDB 2Z2ZA 4KFBA 3Q24A 4LIWA 3ILOA 3I0SB 5HQ8A 1YBUA 1S1VB 5ITHA 4EYHB 1RT1A 4HTIA 1BLUA 1JLAA 4C4WA 1SKUB 3JYTA 4GKJF 1M5OC 2ZHBA 2XGPA 4C8NA 4Z37A 4WFBQ 2KU7A 4WPAA 3NL0A 4WE1A 5ETNA 1UPMB 2FGOA 3ITHA 1O5JA 2VUGA 4MIAA 4IFVB 4DG1B 2YKAA 1XQIA 2EKNA 1M5HA 4LF8F 4ZN3A 4OZJA 1MW7A 3KNAA 2W2OP 1FDAA 1K0VA 4Z7CA 2ZJRQ 1N36J 5HATA 3A8KA 4KPYA 1SJ3P 2IC3A 1CJUA 4GKKF 3QT7A 1DTTA 1S6UA 3AT1B 2GVZA 3K5PA 3GMGA 2AJ0A 4O44B 3MEDA 2FLOA 2R7UA 3QGPA 2HFVA 4OI1A 1LWEB 1QJHA 2ZBRA 3QLHA 4CM2A 3R9LA 4WFZA 1VQOS 5H9EJ 3OSPA 2Q6BA 1Y5IB 2CA9A 4LBIA 3CDAA 1X5OA 1GXLA 3DN9A 4MK8A 4FF1A 2HLTA 2ZC3A 3TX0A 2OIHA 2HQ3A 3MOZA 2CQ0A 2VONA 5K14B 3TYTA 4DLEA 2DR5A 3OHAA 2C2KB 2P5VA 3MEKA 4M95A 3RU0A 3T6JA 5F8GA 4WFYA 4RL1A 4LSZB 4DX6A 3TEHB 3IN5A 2L9NA 2AHOB 1R3NA 4KBIA 5EWFA 1VC5A 4MYTA 3QGIA 4JV2A 4IKAA 4B3SF 3HI9A 1JLFA 4ZVSB 2WVCA 1HIYA 1FTCA 2VPXB 4LUBA 2XM3A 2C42A 1FT8A 1S59A 2QA2A 2B4UA 1UZDA 5KFGA 3G6VA 4JI8J 1OWXA 2BE2B 2HFNA 5E41A 1RA6A 2FDNA 3Q86A 1UEUA 3M1VA 2JNJA 4X4NA 1CULA 5BR8F 2IPOB 2R42A 4IO1A 3M6XA 4IOAQ 4PEOA 3P5BP 3RRGA 3CE8A 1IM4A 3TUZC 1Z4UA 2V94A 4P7TA 4C11B 2YKNA 4PQAA 1TL3B 4N5SA 2FGCA 3PX4A 1IQTA 2B5JB 3DXSX 4C2MA 1NJYA 2AV5A 1JMTA 3BH7B 5EDWA 1VGYA 3JSYA 2F3JA 2R7TA 2LVWA 2MKSA 5IS2A 4EGLA 2OPPB 4C8KA 2C2RA 2CQ3A 3NS6A 2AJ1A 1RBLA 1FXLA 2IY5B 3ZZTA 5LXRA 4O0NA 2ZH4A 1FHTA 4NLVA 2FVCA 1RCXB 3EJMA 1RP5A 1NPPA 4ED7A 4NLQA 2YNIB 1FWPA 2GCFA 5MLCV 5GADI 1EQMA 3H4DA 2YKOA 3C46A 2RT3A 1RUSA 2FJBB 3EICA 1T94A 2HSEB 4ETXA 4PYDA 4XTTA 3ZZPA 2Z0GA 2ADCA 4NRTA 4RZRA 1X0FA 1CC8A 1LK7A 1MU2B 4RUAA 2FHJD 5CABA 4USJC 3CO0P 4PCQA 4NCAA 1S1TB 2HHUA 1HWJA 2ABYA 4YY3F 1QDUB 1NHVA 3OW2R 2AP6A 3RB0A 2VKRA 3L7UA 3G6XA 5HJXA 3H98A 1SQEA 5B0GA 3AXMA 3JXOA 4LBHA 2XO7A 2BJ1A 5DLFA 3E8OA 2NLWA 2N7CA 3KNGA 1KBRA 2DNYA 1H7XA 2EFOA 3MURP 4QWBA 4NRUA 1KQSR 1JQGA 2ATLA 5IM0B 5ETOA 4BLGA 4QIFA 4Q8EA 3GFYA 1LNQA 1X4EA 2E9TA 4IDKB 2ZZNA 2I8EA 1MLAA 3SSRA 2MHEA 2HQDA 2CZ4A 4I2QB 3TJAA 1HD0A 3MECB 4PWDA 4F2SA 4ED2A 1UMJA 2CYYA 1NDLA 3KLHA 1HQEB 4Y3CA 2MDAA 3I9V9 4DV4J 4NCBA 2OGUA 1WC1A 5GAEI 1HW8A 3DYAA 3O2IA 3MD1A 2QIFA 2GVDA 4IG3A 1VQYA 1WDDA 1T02A 4G1IA 3I87A 5D4LA 2CVEA 4LIRA 3T1HF 4Y28C 3KK2B 4ZK7M 3OR1A 1H38A 3W7BA 1RI7A 4S0MA 4JI1J 2J0WA 1RCOB 1I51B 4ZP6A 4PG6A 2AJ2A 1VI7A 2PN6A 3DRRB 4P74A 1RBOB 4KO0A 4CLYA 2LEBA 1KR4A 2R4FA 1UP1A 3CPWR 2JH3A 3GP9A 4KR0B 4ZJOA 2X1BA 3W1YC 3R27A 2E7WA 2VV5A 1PCAA 2KN4A 1HD1A 4FYYB 2V6AA 4JV5J 1G6BA 4UT4A 2LU1A 4KQZA 3BSCA 4NMXA 1KWMA 1T11A 1TV6B 4WIIA 3N28A 4ZPBA 1PBUA 1R27B 4Z7YA 3BGRA 2YX7A 2CQBA 4Q43A 3VAGA 1NBEB 4ALZA 4DV7J 1T0TV 1NK4A 4NLYA 5KFIA 4MTPA 4C98A 4M5HA 3R1HA 2MQLA 2WOMB 4F3QA 2NXNA 3HXMA 2VHGA 2IM1A 2M9KA 1YIJS 2XMUA 1N5YB 3HFVA 4QWCA 2XYPB 5AXNA 1HNZF 4KJIA 2EK1A 2WBMA 2QA4S 2E1AA 1IBCB 3Q89A 4OX6A 4JI4J 2MKJA 4LJMA 4DV1J 4RW6B 4DQRA 2OPQA 3MEGA 2NXJA 3NCPA 1LXJA 4EFAC 1NK8A 4CLZA 3W63A 3BZQA 3J7YU 4OI2A 2WSCC 2KHCA 5HSPA 4N76A 1RJJA 2CJAA 2I38A 3J7A1 4UQGA 4W98A 1U0HB 1KONA 2HLUA 1ZS6A 2VPWB 4NCGB 3BEGB 5HMWA 3UCUP 4KC5A 1RACB 1E6VA 2E1RA 2QMUB 2UVVA 1KQGB 1D9FA 2HHHF 4RLEA 2OPRB 2F8EX 1A7GE 4NXMF 4LFCJ 2HBZB 3QJLA 2R9LA 1LEOA 2R3VA 3J81j 1Q8LA 2ZBIA 2KT2A 4X62F 1C1CB 3K7RA 2GIQA 4F4YA 4A8YA 3QIPB 5ETLA 1H98A 3SSSA 5CAAA 1HYSB 2GIFA 3KHHA 2BQUA 1HHTP 2JX2A 3S6EA 4U7CA 1JJHA 3HJFA 1JXLA 1R8HA 4Q8FA 1VCTA 3DLKA 1X9MA 2BKPA 3CULA 4ZPDA 3SEOA 1VBXA 3FRZA 4DL0C 4K0KJ 4RW7B 1DBDA 2N3OA 5HP1A 3M4XA 2FJAB 3NP5A 1XNQF 5RUBA 2W9AA 1TUGB 2BJDA 2EFGA 5CZVA 1HPZA 3RG6A 3AOBA 3UDVA 1E6YA 5SZTA 3FBFA 4AQYF 4KY3A 4CO0A 3NMAA 1UFWA 3PYFA 2HS4A 3QJPA 1HNXJ 4LVOP 4ZHRA 2R8KA 5IQQA 4UOGA 4DUTA 5IQ6A 1IBMJ 4IUFA 2WVDA 1Q8BA 4RKUC 2R7QA 4CTAB 2NXCA 5KTQA 4OLOA 5J2PA 1UTAA 2AX1A 1U1OA 1M1HA 5B0BA 3CJSA 2CIMA 2V8GA 1H6KX 4NLTA 5HAOA 1GX5A 2F9DA 1R7IA 4PXCA 5C25A 5D0GA 1RT6A 2HPUA 4NZ0A 1GMWA 2JOQA 3H90A 2X1AA 4TXSA 3MMCB 4ZVTB 1WHYA 1ZPVA 3TVKA 4E8UA 2M88A 1YITS 3D6TB 5AE1A 1PKUA 2AJ4A 4URSA 2UV8A 2GJFA 1YRXA 4Z2XA 3C15A 3KOAA 3FCWA 1G4CA 4OZ0A 4I64A 1TR0A 2U1AA 2NPIA 4N8NA 3J80Y 3BBFA 3D3BJ 1NM2A 3TANA 1F0XA 2MLYA 4Q45A 2HW3A 4C48A 2YNFA 3W2WA 3OL7A 2UXBF 1VIOA 4G1QA 3RBZA 1L3KA 4CI0B 4JI2F 4M63A 2HRYA 3THTA 3MPVA 4DUYJ 4ZITA 4PRFA 1FKAF 1C0TB 2VD3A 1VLYA 4DG1A 4IFVA 3BPSP 4OZLA 3M8ZA 3W9IA 1QAIA 2PI5A 3IG1A 3TAMB 4KGZB 2G1HA 2BX6A 1FE4A 4LBPA 1ZETA 1WHXA 5KG5A 4I6WA 2HHXA 3Q8RB 1ZA1B
chains in the Genus database with same CATH topology
2AYMA 1SC6A 1SH0A 1DJ0A 2DIUA 2VG7B 3MCSA 2E44A 1S6PA 3I31A 5BYQA 2KFZA 3TA0A 1VRTB 2V8HA 3M30B 5L8RC 5GAHU 3M32B 2HFOA 1L3SA 3O6QA 1KS2A 3HZEA 2GJ2A 4NLPA 5B7WA 2QT7A 5F9NA 1AUDA 2V4QA 1U6FA 2M2BA 1KN6A 1V9OA 4HKQA 1TKTA 4CNYA 2NUHA 2X1GA 4ILLA 1B7FA 5BJRA 1AFIA 3W2VB 2DNGA 2PC6A 2QRRA 4DV7F 4O44A 4DWIA 4FN5A 5F8LA 4OI3A 3S7RA 1VQLS 4F8RA 4CNZA 4DR2F 3ZZUA 1LWEA 3CCWA 1U49A 2CDQA 2RF2B 4I0WA 1O0PA 1UWBB 1DQ9A 2Z4PA 2QFJA 3PJXA 3NWGA 4NWBA 2N3LA 4RW9B 2ZM6F 1S0OA 2DPJA 1Q7YT 1D8YA 1Q7LB 1Y0HA 2B9WA 2CQ4A 5EX0A 3KK1A 5KFAA 2RJZA 1KTVA 4ZVGA 1TVRA 1JLFB 3E3XA 2W4PA 2G4BA 1NNDA 1JLQA 3NBPB 3KK3B 4YEAA 1B0TA 1N34F 2W9CB 3BQ1A 3MEEA 4PKDB 5M2PA 3QMQA 3OL8A 1ZM2A 1JB0C 2GMJA 3VAKA 1WTFA 4IRCA 3C2PA 3IR6B 1QY7A 2JVRA 1TK5A 1HQUA 4L6V3 5KT5A 3HHLC 1T8EA 4PG7A 4KHRA 2IFXA 2YKMB 3HHNB 1FK9B 2JDJA 4M94A 1IR0A 4ID8A 5K14A 1EETB 2MZQA 3FGVA 4ED8A 2YX4A 3M8SA 2HWIA 4X4VA 5DG9A 3FFIB 3AQOA 2UUCF 2BVZA 1H2TZ 2GX8A 2N4CA 2YNHA 4DFMA 1QUPA 3AJ1A 5KFWA 3CJ0A 3QIPA 3QWUA 3KHRA 2KYZA 4JI4F 3KG4A 4R5PA 1ZM4A 2GA7A 1U6BA 4HDGA 4DV1F 1S9GB 2HZCA 1Q82T 2WBRA 4FNHA 2GV1A 4B9VA 3C6UA 1FRXA 2XG8A 3DFEA 1DARA 3OUYA 5EWGA 3I0RA 1RT2B 2G1DA 1W2IA 1IQZA 5C24B 3H2UB 1CEZA 1URNA 2COLA 2KYXA 3TUIC 1NEEA 2YKNB 1Q86T 5J2PA 3PR4A 2WAQD 5LMNF 1IJEB 1S9EA 4B3OB 2ZKUA 4IR9A 2OTLS 2CJBA 4RW7A 1JKHB 2B7BB 7FD1A 4ZCLA 2Y0SD 1MWYA 2ZH5A 2GC8A 3I4HX 5DDPC 4C8YA 3I5AA 2DO0A 3IS9A 3M2UA 3PHEA 2BE2A 4IH5A 1LWFA 4LT6A 3BDEA 3OL6A 5K8NA 3K5LA 2YWEA 3PX0A 2MSTA 3K58A 4J9RA 1D9DA 1WEYA 2HVZA 1U24A 2X51A 2B6AA 3HPOA 5A2QY 2XS2A 1HMVB 2IJFA 1S77D 4Q0BB 3BGFA 4ECTA 2B3TB 4LMZA 4RBVA 3UW1A 1VC0A 2QMXA 3OXLA 3FMBA 1SL1A 2DISA 4NLRA 3U7JA 4E98A 3RRHA 1QSYA 3PW4A 3KMSA 1FTRA 1OQ6A 1FRHA 1FA0A 4RNHA 3CCLS 1URRA 5M2RA 3G9CA 2WW8A 4LFCF 4EBDA 2AQ4A 2L9DA 2A10A 3PKMA 5EN1A 1KLMA 1SJRA 4CT9A 2FJWA 1HBOA 3N01A 4OI0A 4NLWA 2MGZA 2AGPA 3OXGA 5KFJA 3LW5C 3AB2B 4X4UA 1FKPB 4KV8A 2PFFB 1WWHA 4FVCA 3JAMY 3FQKA 1EP4A 4R25A 5J1EA 3BR9A 3DI6A 3CVKA 4M5DA 2E5HA 1Q53A 2EFQA 2ZH6A 2DNRA 4P7VA 5LMUF 3U02A 3G8TA 5GVQA 1REVB 2DGSA 1WHVA 4ECXA 1TL3A 1SV5A 1YRTA 1ZYQA 2PEHA 5HMYA 3CD5A 5BYSA 2XGQA 1QSLA 4FPRA 4R0EA 4PG8A 4ID5B 3BJYA 3CCJS 3K2YA 5AXLA 2EKYA 2JEIA 5F3TA 1APSA 4GC7A 3B4DA 4OHWA 3PW5A 2B5JA 2ROGA 4LVNP 4NLUA 2M8HA 3CJKA 1BQNA 5CD4H 3Q0AA 1VQKS 1X8DA 4DSFA 2JEJA 3CD6S 1FJ7A 4IRDA 5F0UA 4WYLA 1NH8A 3J7Z5 2JFKA 2Q6CA 3Q8QB 4DL4A 2YWFA 4EZ6A 3LP0A 4K4WA 2VPZB 4G6VB 2BYCA 4ECQA 1S0NA 1RTIB 4LF7F 1LKZA 2WK4A 1S1XA 3MM6B 1T03B 4C3LA 2YQ3A 3DOLA 2BBEA 4M8LA 2ZC4A 1XK8A 2B4OA 5FD1A 2PGCA 2ADBA 3KMQA 1YWXA 1WHWA 4K0KF 1X5PA 4B9LA 4ZKAA 5B09A 2W7OA 5L1LA 1GXTA 5E3RA 1H2VZ 2DH8A 2KTQA 2KM8B 5H9FJ 4A8FA 4WU3A 4ZPVR 4N47A 2QLXA 4R0JA 5AXKA 1N6QB 4UY8T 2ERRA 4RU2A 3MM5B 5CA5A 2GO8A 4A48A 1RISA 2LKZA 2KFNA 3CCSS 4DQIA 4CO3A 3DLEB 4C8OA 1FVQA 3IRWP 4A8MP 5DM7Q 3M8QA 2ZH3A 2O67A 2ZH7A 4MKYA 4H54A 2GNKA 4PQUB 4B9NA 2B9XA 3N5BA 3PIPQ 2ZD1B 5B0AA 2VL1A 5CYQB 4TKTA 1QE1B 1JLEB 3EXCX 3V6JA 5GADU 5F8HA 2HWHA 4C0BA 2M8DB 1NRKA 2YNIA 1GNKA 5CCMA 3H25A 3CTRA 2NSCA 1HNXF 1CVJA 4K59A 4OQJA 2R2RA 1JLBA 2ZNYA 1T7PA 3C6TB 1I94F 2UVRA 2DNMA 1HWIA 2ZBCA 3M8PB 5J2NA 1RKJA 2YNGB 2MZRA 4QIVA 3GE9A 2J9DA 5D6GA 1U1QA 3UD4P 1WD6A 3MM9B 2XNQA 3PACA 5L1KA 2CKWA 1B64A 1N54B 2RUGA 2ZJQQ 2W9BA 5A8RA 4ZDNA 1LOUA 2K1RB 1QTMA 1MSWD 2R8HA 1YJUA 3RBDA 2XSJA 1FDNA 3IWLA 2AGOA 3BN7A 4X2BA 4I69A 1ULRA 3G8QA 4TYAA 4OL8A 1NKBA 1GTEA 3LP2B 2FJEB 2NSBA 2FVSA 2MQQA 4CZCA 3HDSA 5KT4A 3BQ2A 4DPOA 2CPXA 2RS8A 2VA3A 5F0WA 3T6BA 2RS2A 2JRSA 5DDRC 5LT5A 2DCUB 4O4GA 1RT4B 2RKIA 3D28A 5KG7A 3ENWA 5DGBA 4H4OB 2VODA 5KOXA 2FY1A 3PW2A 3LWMA 3B78A 3CT9A 2DVIA 3L95X 2DIVA 3TI0A 2QSFA 3QWPA 5L1JA 2W7PA 3DOKA 1S6QB 5E2QA 1N52B 2XWXA 3BB5A 3GZ7A 3LANA 2UVUA 4Y2MA 2WB4A 4OV1A 2MZTA 3H20A 1N5SA 4OX9F 2LA4A 1FNMA 2I9SA 3CB4A 2QEXS 2M4MA 1XMBA 3MM7A 3K59A 1C0TA 1FXDA 3WDOA 3DDNA 1J2VA 3QGGA 5D3GA 2RMLA 4A8XA 4DN0A 1WG5A 2P6TA 4HI1A 1TKZB 1HWUA 3KJVA 5D78A 1FNOA 1HNVA 5F8NA 1X4AA 2ASLA 4PWDB 2ZHAA 3TAMA 4EU0A 4KRWA 2R2TA 1ZM3A 3HHLB 2VZ9A 3E01A 3B8HA 3OFFA 3M2VB 3P96A 2G0CA 4QPTA 3AB4B 1RGVA 2VG6A 1M0SA 4AXIA 3KLHB 2DNOA 3LGMA 4FVMA 1SJ1A 3HF5A 3HVTA 1FRIA 4PR6A 1GH8A 4M1KA 4DV6F 3JTPA 2M0GB 4X4TA 1LW0B 1R6YA 5KFVA 2J6UA 1U2FA 5IM0A 2MQOA 1OIAA 4K4TA 3FSXA 2IBOA 4K5SA 4XAKA 5KFRA 4DBQA 1IXKA 2CQPA 3JSRA 4CO5A 2OSQA 2KH9A 3M30A 3DDKA 2UZAA 2MSSA 3M32A 3T19A 3IA0A 4C7QA 2ZH9A 4MK9A 5F8JA 3T9ZA 4BS2A 5KG6A 3DYAB 2R2SA 1MMDA 2V8DA 5J1PA 4LFBF 4TU7A 2CPDA 5FDLB 4JUZA 3RB3A 3VR1A 3DHWC 3MUMP 3TX8A 2J9EA 1O51A 1G2EA 3IXQA 2A2DA 3M2RB 3C66A 2FTRA 4EUVA 1S1WB 1XN9A 4FNIA 2FVPA 4WFNQ 4O3SA 1VQ4S 3DLBA 3FDSA 2RF2A 1TQLA 3MECA