2MZ1A

Solution structure of hnrnp c rrm in complex with 5'-uuuuc-3' rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoproteins C1/C2
publication title Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mz1A00
1VQ9S 3D2WA 3IWNC 2CPYA 3CMAS 2MY8A 2KRRA 2XS5A 5BJRA 1VQMS 1W2BR 4YUDA 2OIHA 2XS7A 1U1MA 2DGXA 2CQHA 2X1GA 1U1OA 2MPUA 2QEXS 4IOCQ 4UY8T 1HA1A 3CMES 2D3OR 1RK8A 2N3LA 2MGZB 2DGVA 4TU9A 5D77A 3VAKA 1OWXA 2J8AA 1N52B 5IM0B 3UCGA 1VQLS 2CJKA 2FC8A 3NNAA 1DBDA 1VQ7S 2J76E 4J5OA 3CCES 2DH7A 5D78A 2XNQA 2CPXA 2F9DA 2MKJA 1FJEB 2X1FA 1WI8A 1KC8T 4W90B 3PIPQ 4QU6A 1WHVA 2AYEA 2MQQA 2HYIB 3NMRA 2I2YA 2DIUA 4IOAQ 3BO2A 1WTBA 3G4SS 4IUFA 4PKDB 3G8SA 3VAMA 5LJ5Y 3SDEB 1X4GA 2M70A 3ZZYA 5H1SV 1HD1A 2UP1A 1ZZNA 2LXUA 4WKRA 1X5OA 3K0JA 2RNEA 4CQ1A 1VC6A 5DDRC 2MJNA 3CCUS 1KOHA 2DO0A 1NO8A 3MD3A 4A8XA 1U1RA 1FNXH 2MQPA 1RKJA 2G1DA 1U1LA 5DDOC 2LKZA 1X5SA 3ZZZA 3S8SA 3VAGA 2XNRA 4C4WA 1S72S 2MHNA 2O3DA 1JJHA 2DNRA 2M2BA 2MZRA 2VODA 3N9UC 3CCMS 1M5PC 5LSOA 2MZJA 2RT3A 2LYVA 2DITA 4TLQA 3TP2A 3UCZP 2CQ2A 2MZ1A 3MUVP 1AUDA 1WF1A 3TO8A 1K8AT 2QA4S 3MI7X 2VONA 3FEYB 1FXLA 4F26A 4BS2A 4Y0FA 2M4MA 1VQNS 2ZJQQ 3U1MA 3CD6S 4Z2XA 3CCLS 2XS2A 5DM6Q 4W92B 2LCWA 1HL6A 3ULHA 5LJ3Y 2MKSA 2PE8A 4EGLA 2DNLA 1YITS 2G4BA 1VBZA 2MXYA 1JJ4A 5DDQC 1VQ6S 3CPWR 2U2FA 1FHTA 1KD1T 4QPTA 4CH0S 2WBRA 3BS9A 2CQIA 1X4DA 3BEGB 1WEZA 2DO4A 4OZ1A 2YH1A 2FHOB 2DNMA 2MZTA 3CCQS 2KI2A 4LIRA 2KRBA 1G2EA 4WFBQ 4LJMA 5IFMA 2LMIA 4RU2A 2KXHA 2MKHA 1QM9A 2BZ2A 4PRFA 2B0GA 5LXRA 2MQLA 1UP1A 4YB1P 1WF2A 5EN1A 3UD3P 3DXBA 4WIIA 2MMYA 2OTLS 2LQ5A 2DGSA 2KM8C 3CCRS 3VAJA 2K8GA 5HL7Q 4OZ0A 1F9FA 3CCJS 1NJIT 3CC4S 4QU7A 3NS5A 3MUMP 2RQCA 1U2FA 4FXVA 2LECA 3V4MA 5DDPC 1FJCA 3S6EA 1VBYA 2CQGA 2KG0A 1WG4A 3NNCA 1DZ5A 1R8PA 3R27A 3IRWP 2JX2A 5LXYA 3S7RA 2AYMA 2RRAA 4F02A 4LMZA 3UWTA 1WF0A 2CQ3A 2DIVA 4M5DB 2GO9A 1D8ZA 3I55S 2X1BA 4PR6A 3FEXB 1SJ4P 2CQDA 2DNPA 2CQ4A 2M88A 1XN9A 2I38A 2L9WA 2MQNA 3G9CA 3U1LA 3G96A 1H2TZ 2DB1A 2CPZA 1X4CA 3P3DA 1VC0A 2JRSA 1X4BA 2KFYA 3MUTP 1VQ5S 5DETA 1CVJA 1YIJS 2SXLA 2JVRA 4C0OC 1M1KT 2M8DB 2CPIA 3CULA 2E5IA 1SJRA 1X4FA 2OTJS 1ZH5A 1VQ8S 1D9AA 2D9OA 2DHAA 2DGUA 1H6KX 1U1QA 5MLCV 3HI9A 2JVOA 4V19X 2L08A 4U67Q 2N7CA 2CPJA 5ITHA 3H2UB 2M7SA 5IM0A 3CCSS 2YKAA 2AYBA 4ED5A 1WWHA 5CXTA 2DHXA 1O0PA 2DNHA 2OSQA 2HGNA 2KXFA 2DNQA 5CA5A 2MSTA 2X1AA 4ZKAA 2LEBA 1UW4A 3CUNA 2RU3A 2HVZA 2OJ3A 1WHYA 3OW2R 2LEAA 1UFWA 1U6BA 2OSRA 4TU8A 2VOPA 3VAFA 1M90T 5IQQA 4CIOA 1WI6A 2MZQA 3RW7A 2ERRA 2RUGA 4TU7A 3R1LA 3NNHA 2DGTA 2DH8A 2KHCA 2KN4A 1X0FA 3NS6A 5GVQA 3PIOQ 3THPA 2YWKA 1URNA 5GAGU 2AD9A 2YTCA 1A9NB 2MZSA 1PO6A 1M5OC 2DGWA 2M0GB 3G6ES 3VF0B 5JVGQ 2E44A 2DGOA 3H2VE 2RRBA 3EGNA 4FXWA 1X5PA 2ZJRQ 3HHNB 2MYFA 4WFAQ 2EK1A 2MJUA 2RVJA 1KQSR 1VQ4S 4P6QA 2M8HA 1WEYA 1L3KA 3Q2TC 1U1PA 5GAHU 1M5KC 3CC7S 2KH9A 1N54B 1VC5A 1OPIA 2MKIA 3VALA 2DISA 3G8TA 1Q86T 3BO3A 2DNNA 1YTYA 2KXNB 2DH9A 2G0CA 1FO1A 1BY9A 2MY7A 1WHWA 4WF9Q 2MQOA 3Q2SC 3J7ZT 2D9PA 2M52A 1NU4A 1A7GE 3CTRA 5LSLA 1OIAA 5GMKa 3B4MA 2CQBA 1P27B 1N88A 3US5A 2CPDA 3CF5Q 4YOEA 5GAEU 1JMTA 3J7YU 2BOPA 3I56S 1QVFR 3LQVA 2RQ4A 2DHSA 2M9KA 2DNKA 2N3OA 1YJ9S 1B7FA 1H2VZ 2PEHA 5CYJA 3UE2A 3P6YC 1PGZA 3B4DA 1S79A 3P49B 3MD1A 1Q82T 5HO4A 2XSFA 3MXHP 1U1NA 4QQBA 3UD4P 3VAIA 1SJQA 1UAWA 2KU7A 1Q7YT 1P1TA 2FC9A 2Q79A 1WEXA 2CQ0A 3G71S 2E5JA 2CPFA 1QVGR 4IO9Q 1YJNS 2MGZA 1DHMA 2HZCA 3MDFA 3CC2S 1N8RT 2FPHX 2ZJPQ 1X4AA 2RS8A 1U1KA 2GHPA 2XB2D 2CQPA 1VQOS 1X4HA 2LXIA 1YI2S 2HGLA 2V94A 3MURP 5FJ4A 2N82B 2VOOA 1ZZFA 1X4EA 3TYTA 2A3JA 3RW6A 4UQTA 2FY1A 2ADCA 3LPYA 2J0SD 4ERDA 3CCVS 1YHQS 2CQCA 1U6FA 2EK6A 3CXCR 2NZ4A 2YH0A 3P5TL 1WG5A 3UCUP 4WFNQ 3L3CA 1IQTA 2DHGA 2E5GA 5GADU 1VQKS 3SDEA 2MQMA 2JWNA 5DM7Q 5JVHQ 1R8HA 2LA6A 1Q81T 2AYGA 2RS2A 1SXLA 2F9JA 2MB0B 1HD0A 3BO4A 1K9MT 2CQ1A 3MOJB 4CH1A 2U1AA 2DNGA 2NLWA 2F3JA 3R1HA 3VAHA 2E5HA 1X5TA 2DNZA 2KT5A 1VQPS 3S01A 2KG1A 3JB9k 1OO0B 2LA4A 1WHXA 1DRZA 2MSSA 2HGMA 1JJ2R 1YJWS 2MKCA 3EGZA 2K3KA 1WELA 4WCEQ 3EX7B 1KOOA 1VBXA 2MKKA 2KYXA 2DK2A 2ADBA 2KM8B 1M5VC 1FJ7A 2CPHA 2EVZA 1YWXA 3DLLQ 1SJFA 4Y00A 2DNOA 1SJ3P 2KVIA 2L41A 3SMZA 1H2UX 1FT8A 2DNYA 4C7QA 2CPEA 3SXLA 2QFJA 1WG1A 4F25A 2DGQA 2J0QD 1K73T 3THTA
chains in the Genus database with same CATH superfamily
2GV1A 2NZCA 4K5SA 1IKXB 1GTHA 4P72A 2WONB 2EFOA 5DGAA 3U7JA 4FVMA 4DQSA 1HA1A 2UVVA 2BE2A 3UQSA 3RAMA 4H4MB 4DBQA 4H4OB 1Q4RA 2N4CA 3HXMA 2YQ0A 1RT7B 4WFXA 3NMAA 3PJ9A 2FDNA 4DCJB 2ZEJA 1LWXA 3N01A 4DR4F 4U8YA 3AQPA 2AYEA 1U0SA 1UKUA 2MQQA 3OTEA 2DIUA 4IOAQ 4DL7A 3GE9A 2G1HA 2VG7A 4K4SA 1LFWA 1W2IA 2CA9A 3TUPA 1R8BA 1RADB 3ZZZA 1PYSB 2HW3A 1S72S 2FJXA 4KT0C 1UEUA 3CCMS 1RWKB 1IVZA 2RQKA 3HZEA 3TAQA 5L1LA 4B9TA 1GNKA 5HVGA 2ZH7A 1CSJA 2XCAA 3M8RA 2LCWA 2P2CB 2MHEA 2MKSA 2PE8A 3FJ2A 2M5YA 1YDLA 2QLJB 1RHUB 2RH3A 5F8HA 5KT5A 1LFPA 2VFSA 5EHHA 4WU2A 2ROEA 5E33A 5K14B 2WVDA 2YKMB 5J2QB 1AFIA 4MKAA 1AUSL 3CEDA 2PEBA 1SCJB 2AEFA 2J7WA 2OTLS 1T11A 1VOMA 3QSIA 2CNKB 3P45B 1NK0A 3PY8A 3NS5A 1SC3B 3UDLA 3H2LA 2CJAA 2CG8A 3MR2A 2WVEA 3DI6B 1TKTA 3M8SA 2V2KA 1AZSA 4LMZA 4NZ0A 1HBUB 5IZHA 4KGVB 5I4MA 2GO9A 2EFQA 2C2RA 5KG5A 4CDIA 1SJ4P 4DV1F 2HHTA 5IWAF 1K0TA 4WP9A 2BJ9A 2L9WA 3AJ1A 3L09A 4K2JA 5EWFA 1U4BA 3ZTSA 4B3OA 1YVFA 1REVA 1WC5A 4QWCA 2A10A 1DURA 4C0BA 3KFWX 1IBMJ 3FRZA 3KLEB 1D9AA 2QYGA 2DGUA 4XPEA 4JUZA 4PG6A 5B0DA 3GYXB 3GONA 4A8KA 4IRDA 4PG8A 1U45A 4YR2A 1YGYA 1Q8BA 1UWAA 2HQ3A 1OQ3A 3FC9A 4ILLA 3CUNA 1IBCB 1U6BA 1Y0HA 2DY9A 2FHKA 2MZQA 3A8EA 4ICLA 4DR7J 3EZUA 3QGIA 3NGSA 1Q53A 5GAGU 3IRXB 2W01A 5EWGA 2YTCA 1CJTB 2FVSA 4GKKF 2DPJA 1FFWB 4M5NA 1X5PA 3HHNB 4QWBA 2MYFA 4WFAQ 4OV1A 3DCAA 2EC0A 3ZTQA 1L3KA 1ITPA 2OUGA 1UA1A 1HBMA 2FHJA 4EZ6A 1S4EA 1ZA1B 4MJKA 2EPIA 3OJSA 1NU4A 3CTRA 3CJRA 5L9NA 4MFBA 4WK1A 3KUHA 5HP1B 3DOMB 4IO1A 1N88A 4JV5F 4YOEA 2ALYB 1TKXB 4ZVGA 3LW5C 3LQVA 1R31A 3M8WA 4ED1A 2UU9J 3P6YC 2VFTA 4K7QA 3ELHA 4KGXB 2HG4A 3P49B 2OPRB 1NH8A 3Q8SB 4AFFA 4DQPA 1ULRA 4FNIA 4PWDA 3A1YG 4LFBJ 4RLEA 3OFHA 3X1LB 2Y1IA 3LUYA 1PYOB 3DM2A 3FDSA 4PXBA 5KFMA 1T03B 4HHHA 3RW6A 2J0SD 1HI1A 4RW4A 2B4UA 4K8RA 3AD9C 2JWNA 1B64A 2LA6A 3MHYA 4LF5F 2UUTA 1FDNA 1TR0A 4CH1A 2U1AA 1KS2A 3NGRA 1S1TB 5CYQB 2YVSA 5D4OA 2CNOB 2MKCA 2O66A 3J81Y 2VQEJ 1EZZB 4USHA 2VPXB 2L41A 3DRRA 5E3CA 1M1GA 1EETB 2IIHA 1WG1A 2QC3A 2JDJA 4DV2F 4DPOA 2A6MA 2PMHA 4USVA 1VQMS 4KV8B 1H73A 3DRSB 1FFSB 2CJ9A 2R7RA 3B54A 2H4WB 4EYIB 2N3LA 1SC4B 4X66F 3BSCA 3DOKA 3A4TA 2F9DA 2MKJA 2Z8QA 3WIUA 4DL0C 4LR9A 1R6VA 4QU6A 1S1WA 4C3LA 3TVZA 4DSKA 2V4JA 2M3DA 4EK2A 4DUYJ 1SIWB 1C1BA 2ZH5A 2ZM6J 1RE1B 2XWXA 2MKYA 1FJGF 2MJNA 3OUYA 1KOHA 4ECSA 3NGTA 4OYZA 4B3SF 2EXUA 1TV6A 2BJDA 4M5DA 4LF4F 4P73A 4ECUA 1FKOA 2HVIA 1CJUA 2FQQB 1HHQA 3P8BB 4DV3J 4JI1J 3AODA 4B9NA 3M9MB 4F2RA 4WXWA 2XS2A 2OLWA 4C8NA 1UPMB 2XC9A 2GA7A 1FE0A 1F60B 3PYEA 4F0MA 4DS5A 5B09A 2FVRA 2OI2A 3HVRA 2WB1D 5T14A 5LMNF 1KD1T 2B6AA 4KHPF 1VISA 2IRXA 1VRTB 3HFZB 4RNMA 4Q8FA 5DLFA 1MROB 2GFFA 4CLSA 4C8YA 4YB6A 3IC1A 1HR0F 3LP2B 2XY7A 1E6YB 1SKUB 1QAJA 1Y11A 3S6EA 1C0UB 1WC0A 2VBYA 2AYMA 3D3BJ 3M6XA 4O3SA 1PSDA 2J9CA 4RNHA 1D8ZA 2J6TA 2EKNA 2X1BA 3ZO7A 5L1KA 1RLDA 1XWLA 1MWQA 3KXDA 1X60A 4OYMA 3U1LA 1K44A 4OI1A 3RG6A 3CJ0A 4RBVA 3G87A 1RGVA 4DSFA 3SCJE 1RKIA 2OTJS 3FCVA 1UJ5A 3LF0A 4A46A 2HRUA 2WOMA 2RDJA 5ITHA 4JV1A 2ACYA 2BRLA 1UPPA 1Q78A 4RL1A 1U8SA 2LEBA 2IY5B 3CB4A 1Q5VA 2RU3A 2J9DA 3GLJA 4C97A 3QZ7A 1U49A 4Q0BB 1LQ9A 2IJNA 2DEIA 3RW7A 1CJKA 3R1LA 2AGPA 4WU3A 4M5GA 3KK1A 1HBNB 2K2PA 3C46A 4DJBA 3JAMY 2XO6A 4KJIA 3TUJC 2DGOA 4FXWA 1O6XA 1KQSR 2ZWPA 4QWEA 2CWKA 3MR5A 4FDFA 1XMQF 2ASYA 1LOUA 4XDCA 2M52A 2YWFA 1QE1A 3FFIB 5J2NB 5EX0A 5I3QA 3HULA 3PO5A 3CF5Q 4O44B 2JLEA 2KDOA 1LXNA 4EZ9A 4LRFA 3QAEA 5E2QA 4CT8A 4S0MA 3CJ2A 4N5SA 2C22A 2QL7B 1HFEL 3HM9A 4G1IA 4ZLNA 3HX9A 2YX1A 1RT2B 1CQNA 4IO9Q 2ZJPQ 3F41A 2C2KB 1YI2S 1LWFB 1VMBA 1MWYA 2IYGA 4IG3A 2FVPA 3I0RB 4G6VB 3TA0A 1JLEA 2DPIA 1WOSA 2Z30B 1N34F 1Q79A 3MZIA 3KG1A 1Q95G 2RKIA 2CQ1A 3M32A 1ZM2A 4NOHA 4PEOA 3VAHA 3AXKA 1VQPS 2IVMA 4ER8A 3C14B 2G2YA 4KYZA 4OYAA 3PEHA 1HYSA 2ATLA 2CXEA 4KGKA 2DGQA 4JI7J 5E0OA 5CABA 2ZKUA 5DGBA 1YJVA 2RIJA 3KTQA 4JI6F 4DLGA 2GJFA 1N0UA 2HHUA 3TJAA 4Q7AA 1CC7A 3OHAA 4I7FA 4ZCIA 3Q24A 1NK9A 2UVRA 1T9WA 3WZ0A 3VHQA 3CJ4A 3M9OB 2OEJA 3L7PA 2FLLA 3AJDA 4KKOB 1X4GA 2FGOA 3I5AA 4IH7A 4TYBA 1ZZNA 3FQKA 4DHVA 3GR0A 2W9BA 2OHDA 3C15A 2XYHB 5IS2A 3DLHA 2H5IB 2XO7A 1N32J 2VV5A 2OD6A 2V34A 1NMEB 1JLFB 1EARA 1F5BA 1V5IB 3MMJA 4LREA 3FEYB 1TVRB 1FRIA 4Y2MA 4DR3J 4NYOA 1AB8A 5A8RA 1NPPA 3EJMA 3UR3C 5KFOA 3ONQA 1IR1A 3DRYA 4NLWA 1NK6A 4DV7J 2YNFA 4RWXA 1S0OA 2Z2LA 3B82A 5AXNA 2KRBA 1F5AA 4UTGA 2KXHA 3ETMA 2B0GA 3L7OA 4DR1F 4OFZA 1FXRA 5FLXU 2VG7B 4OI2A 3PTWA 1GK8A 5BR8J 4DS4A 3KJFB 1HNVA 2A2CA 2KJWA 2HWTA 4FKXA 3I6PA 1R8PA 3R7NB 3S7RA 2AX0A 1R27B 1PILA 2Z56B 2CPZA 1VGYA 3HVTB 4X62F 1SJ1A 4O3QA 4PCQA 4ECTA 3K89A 1URRA 4I6WA 1XNRF 3M6WA 2D9OA 1Q7LB 1J27A 3DLKA 4R8UA 4HYKA 2OP5A 4AL7A 2VIHA 4U67Q 5GMEA 1ZTTA 1HBOA 4UW2A 5A6WA 3PR5B 4USMA 3AB2B 2DNQA 2JSXA 5J2PA 1XK8A 4U6PA 2GQQA 5HATA 2BQ3A 1FWKA 1UFWA 2LEAA 2CIMA 4B3RJ 2F8EX 1S77D 3V6HA 2MLXA 3X3UA 3SFUA 4NXMF 2HZVA 4TU7A 2I6WA 1F2HA 1SH3A 1S6UA 3NAHA 4AT1B 1TKTB 2VU5A 2YKQA 2AD9A 3ENQA 5DLGA 3GSIA 5IV3A 1TL5A 1QAYA 5K5MA 1MWZA 4FVCA 2DRBA 1S57A 2Y9HA 3QJJA 4X64J 4L75A 2HHHJ 2BA9A 3FCHA 4B3OB 1REVB 5AJ3J 2G9OA 2DNNA 1YTYA 1IR2A 3JQJA 1HWIA 1LW2A 4WF9Q 3GJTB 4C6AA 2JEGA 1U6ZA 2CVEA 1Q8IA 3TX0A 3QGGA 1U09A 3D68A 3QATA 4G1PA 3OTOJ 1GH8A 3MD1A 1XNQJ 2OAUA 1BWEA 3QLHB 3TNVA 1CG2A 1OY8A 4Y6IA 4ICLB 4ZPWR 4CP5A 1DARA 2BRKA 2HZCA 1N8RT 2HQIA 4NLPA 4ZJOA 4LSLA 2HNDA 1RU2A 4LVNP 1VFJA 1MNEA 4RBTA 1NDKA 4M63A 1RHKB 4ID5A 3G82B 3UCUP 1KBRA 3L3CA 5C2GA 3C2PA 1HBMB 3DGPB 2BYCA 1Y5LB 2RS2A 2IJRA 3N4WA 3IG1A 3MM7A 3HPOA 4AXJA 4EBCA 5KG2A 4L76A 4MFBB 4ZP8A 2ILYA 1YJWS 1WELA 1VRUA 3KMQA 3MAAA 5KT6A 5RUBA 5ETLA 2RD5C 3RYLA 1ZM9A 4PUOA 3W61A 4YEAA 1XR6A 3A8KA 4LF9F 1VIXA 3OTDA 3T3FA 5C25A 1N56A 2MPUA 3CMES 3KG4A 3LGNA 2H3EB 5E5NA 3MOZA 1HNZF 1YKWA 1RTDB 1N5SA 2ZC3A 4GVBB 4DSEA 1L3SA 4J5OA 3FMBA 1LEOA 1KC8T 1UVJA 3D0GE 5L46A 4J9QA 3QO9A 3MECA 3T41A 4HH1A 3M1VB 2JNJA 3LGHA 3LO3A 4ZHRA 1S6QA 2NXNA 4ES1A 3LWLA 2QA1A 1U25A 1X5OA 4C11B 3R3TA 4DPUA 3CCUS 2OMLA 3MD3A 5ETKA 3VVTA 2F40A 3OLAA 5DDOC 3VAGA 4N8NA 1TK0A 2Q6CA 4I67A 3SV3A 3N9UC 5KFEA 2LXFA 2LYVA 4LF7F 4TLQA 3J7AN 4J91A 1OY9A 2IDLA 2CQ2A 1FKPA 5H9FJ 3DRRB 3OQ2A 2FLNA 2WAQD 2GVZA 3HMJG 2AWZA 1REGX 4OMFG 1ACMB 2K7JA 4W92B 3I5BA 2AJ2A 4CYUA 2DNLA 2W24A 4ID8A 2IPOB 1FRLA 1LXJA 1QDUB 2V63A 2VBXA 3JQMA 3BEGB 4AQYJ 2HVEA 3DOKB 2FHOB 1RCXB 3ILLA 4Y2KA 3I9ZA 4DL2A 2LMIA 2MKHA 3C8YA 1QM9A 4PRFA 2JL9A 2UVUA 1C1BB 1T94A 5H9FK 5HI7A 4A8SA 3CCRS 2DRAA 4WYWA 4LBHA 2LECA 3KUEA 3OUYB 2AF6A 1PC4A 1FJCA 2BX6A 2HHQA 2R3VA 3IBWA 3VV2B 3DDNA 2CQ3A 2COLA 4M5DB 3TRGA 3FEXB 1NSQA 1FKOB 2B5JB 3R2DJ 1CJUB 2HFVA 3O6QA 1FRKA 3G9CA 3SI8A 5IT4A 1XTZA 1IR0A 2LQJA 2QA2A 3W1YC 4P7TA 4RO0A 2IM2A 2ZVIA 4NZ6A 3BR9A 2C3MA 1NDPA 2V4QA 1IM6A 2O5DA 1WC3A 2YNGA 4IQMA 5GAEI 2YPYA 4J37A 2R7TA 5MLCV 3PX0A 1HQEA 2B6AB 2HQGA 2KZMA 4HEA9 4N41A 1O0PA 2H5JB 4UY85 1T95A 1DLOA 1WORA 2QLWA 1NK5A 4Q5VA 2E9ZA 5KFQA 3CW2C 5A8WA 2OSRA 3A8IA 3M30A 4LSNB 2ZKTA 1CS4B 3MM6A 4LF6J 3QQCD 2K1RB 1UMJA 2DGTA 1NZAA 4DUZJ 3GG0A 2A0FB 1IBLJ 4DV6J 1HNXF 2FLPA 1PO6A 1LWCB 2ZOFA 1T8EA 2VKRA 2RRBA 5KFZA 2EK1A 1PJ6A 1B0TA 2VB6A 2DEJA 2QA4G 5GAHU 3TANA 3EVMA 1X31C 2IAJA 3THVA 4B17A 3BYRA 4M5HA 4U8VA 2HHVA 4ZP6A 3FEZA 5KFYA 1GMWA 1RSCA 2VFVA 2AZ3A 5ETMA 1N4LA 2BOPA 2J9DE 2RQ4A 1YJ9S 4QJVA 3UE2A 1NXIA 2VUGA 4M5LA 1S79A 4QYRA 1Q82T 2QMXA 3W9HA 2KU7A 3ZXWA 1KLNA 1Z2ZA 2O67A 2IBOA 2WCXA 2R7VA 1DHMA 2FVQA 4F4ZA 3GZ7A 2OFHX 2MEWA 2Z57B 2V94A 4I68A 4YHHF 1T3NA 2NQPA 3LAKA 4LRCA 2OELA 4K4YA 3IS9A 2E5GA 5GADU 4KR0B 3NS7B 1WDDA 5JVHQ 2EFPA 5K8NA 1HD0A 1K9MT 5KFIA 2Y0BB 3HSGA 4DU8A 1HW9A 1HKAA 3MOJB 1TUWA 2XG8A 1QE1B 2YWGA 3S01A 4RW8A 2GQ2A 4LF8F 2KG1A 2FJBB 1OO0B 5A0YA 2ZH9A 2HGMA 1HNIB 1VBXA 2UUWA 4OJ3A 2NPIA 4X4RA 3K5LA 2MTLA 3IP0A 3VCDA 3T5KA 4ED6A 1EQMA 4CLUA 1VQ9S 5C42A 1RHQB 2ZDOA 1L3VA 1RABB 3FSYA 1LK7A 3QBCA 5AXKA 4IOCQ 3QJPA 1Q8LA 2UUAJ 3HHDA 5KG7A 5D3GA 3LANA 1XQIA 2J8AA 3UCGA 4RZRA 4EMDA 1DBDA 4Q2MA 3O8WA 1IXKA 5KG1A 4DDFA 2J6UA 4PKDB 3PRVA 3VAMA 2M70A 1KNZA 4J9KA 4WKRA 2IM1A 2RKIB 2DO0A 2MQ8A 2XY5A 5FIIA 4WKYA 1U1RA 3Q86A 1RWNB 2LKZA 1X5SA 4RNOA 3ZZPA 1EAYC 4J9PA 3M2RA 1HARA 5HQ8A 2ZH2A 7FD1A 5J1EA 3TP2A 3GIMA 1HYSB 1AUDA 1TL3A 1WF1A 4EYHB 1F0XA 2EBGA 3V2UC 4BS2A 3DN9A 2VPYB 2J5AA 1KRPA 5LJ3Y 2KJVA 2XGQA 1IQZA 2APOA 3OPKA 3BZQA 2YH1A 1T7PA 1G2EA 1UZDA 3T1HF 2YKNA 3H40A 1C4AA 1NAQA 3EM1A 3K8WA 1BE4A 4OYOA 2VF3A 1HWUA 4WIIA 3D3CJ 2JEJA 4ELUA 2LQ5A 1HPZB 3UI3A 3VAJA 2V4RA 3K5MA 1HMVA 2W9BB 4LIWA 2FHJD 3C15B 3KYLA 3CDEA 1QD1A 2DBBA 5J1PA 3M2UB 4K4XA 2Y3YA 5A76A 3KJVB 1RXOB 2CQDA 3OD2A 4OI6A 3W64A 5AXMA 1EKRA 1XN9A 2MQNA 1U7LA 3CD0A 3CJSA 4ZVSB 3MMAA 2HHPA 2ASJA 4NLGA 3MMCA 2E5IA 2OFGX 1GXTA 5A8RB 2G0IA 1HI0P 4J9UE 3G6VA 1QJHA 1RCOB 2DHAA 2R8KA 1H6KX 1OQ6A 1U1QA 2RDDA 4BHQA 5CAAA 5BXIA 4CO2A 1M0SA 1LK5A 1RT7A 1EJ7L 1S6PA 2FJWA 1TP7A 1WJ9A 4NCGB 1F1BB 1HNVB 4TNOA 3ZC4A 2F4FA 1KLMB 4PAAA 2KN4A 4OZJA 4N7TA 2ZNZA 4MH8A 3PIOQ 5B0FA 1NHUA 5HMYA 3HT0A 1QLNA 2LDYA 3BGOP 4NLOA 1GX6A 2L9NA 1VHIA 2F8HA 4USUA 5JVGQ 1X9WA 3ENWA 4JI3F 4Q8EA 1X0PA 2ZJRQ 4XTTA 5FDLA 1RAJA 2HMIA 5F41A 4ED4A 2RVJA 4KRWA 1Y00A 4AD6A 4B9UA 2Z2YB 1OPIA 3FSIA 4DF4A 3C19A 2Q6BA 2YNHA 2YWEA 3J7ZT 1C0TB 2BUNA 3DDKA 4X4VA 2C2NA 3DLKB 1VRQC 4FYWB 3L7UA 1H7XA 3US5A 1ZM4A 3I56S 4DR4J 2NUHA 3F73A 2V67A 2N3OA 4F4KA 5J2PB 1TQLA 2YKMA 4N77A 5J2QA 4GVLA 4URQU 4NXNF 2XEXA 2B43A 4J9NA 2VKZG 3MPDA 4EU0A 4FNHA 1UA0A 3VZHA 3VZIA 3KDNA 2V8PA 2HGLA 2OPSB 4JI2F 4ZA1A 3VGTA 5CH7B 1ZZFA 1JWWA 1X4EA 3TYTA 4U95A 2CZVC 2FY1A 3UD5A 1JNZB 4CI0B 4C8OA 2IRYA 2R4FA 3I31A 3L4BC 2MQMA 1SXLA 2XY6A 1YBTA 4IRCA 3GWCA 2V0NA 2UXBF 2JJ4D 3T19A 2KT5A 2UXDF 2BKPA 1ZOTA 2MSSA 3PRBA 5KFCA 2KM8B 1SQFA 3SQOP 4OZ5A 1JLBB 3GFZA 3J81U 3CIZA 1FESA 4F4XA 3RAQA 5HAOA 2R2TA 1K73T 4UUWA 1S48A 3IWNC 3ISND 4ZVRB 2F5GA 4FKYA 1RK8A 1SPBP 4P74A 2HNDB 1VQLS 2DCLA 3NNAA 4DQQA 3SSQA 1Q1KA 3IRXA 1CJTA 4MTPA 4ETXA 5IWAJ 4OLPA 4B9VA 4C3KA 4HDHA 3Q8UA 4A8OA 3MFHA 4O3PA 1RQ0A 2WW8A 2FGCA 5JUMA 2QG9B 3MM7B 1BD6A 3VTIA 2JC0A 4DR2F 5KOXA 4CLZA 4OJGA 3TI0A 2G1DA 1X9MA 3S8SA 2XNRA 3KLHB 1IWGA 4C4WA 4WZQA 4LF1A 2V50A 1M5PC 3DOMA 1VRUB 4YY3F 3MAAB 1TKZB 2W25A 4PUOB 3V81A 2ALZA 1FXLA 2OPRA 3CCLS 2XZTB 5DQGA 4K50A 4DR7F 5C25B 4ETZA 2P6SA 2IC3B 5B0GA 5GMDA 3DDIA 2ATCB 3GJQB 3VGSA 1T9VA 4QPTA 1WEZA 3GILA 2QTWA 2EEYA 3T6BA 4QBUA 1N5YA 1TKDA 2J9EA 3QO9B 4DUTA 4CT9A 3FVYA 4Y2IA 3TA2A 2BE7D 1S6QB 3MR6A 1S76D 2EWHA 4QU7A 3SCIE 3MUMP 1S1UB 2R7UA 2ACMA 5LXYA 4RUCA 4JV5J 5DQIA 4ANEA 4ILRA 3MMBB 4DOZA 4NLYA 4CLFA 4Q43A 4FF1A 2GVZB 1MN7A 1XIQA 3J80U 1CLFA 4LFBF 4HT7A 2FJEB 1M1KT 3E01A 2ZITA 4PPZA 4TQRA 4CYUB 5KFBA 1YBUA 3PW5A 1VQ8S 3J7YI 3DRSA 1JLGA 3T5LA 4IFYB 3J7Z5 3VVUA 3B8HA 3H7HB 2YKAA 1T05B 4DQRA 2KXFA 2W2NP 2X1AA 4DPTA 3QRRA 2XMJA 4A8WA 2ZH4A 2ERRA 2H54B 4J9RA 3PYFA 4PQAA 2DH8A 3C6UA 4DCOB 2X7IA 3MCNA 4UOCA 4JI5J 1N5QA 2PFFB 4BCAA 3KHLA 2W8LA 4HTJA 1I1GA 4TY8A 2C2OB 1LWEA 3Q2TC 3KK2A 4P2SA 2AHOB 2EKYA 4OX6A 4DV2J 4LUBA 2MKIA 1Q86T 1BY9A 1S7HA 1WHWA 2YNGB 4H54A 2RAQA 1OIAA 4X66J 3DU5A 1B4SA 5D4LA 1H7WA 4KIAA 2QMWA 3GYNA 3HJVA 4ANDA 2DNKA 1R0AA 1NKEA 1H2VZ 4DL6A 1DLOB 1VRTA 4EBEA 4MK7A 3HFKA 3KDOA 4X4QA 4F3QA 2BKNA 1RHMB 2DD8S 3EDQB 3M30B 1FJGJ 4DZ6A 2YQ1A 4DSJA 1R0CB 3EE3A 4KPCA 3G2XA 4FXDA 1S1XA 4YDDB 3VGUA 1X4AA 3TA1A 2CAJA 4B3SJ 3NL0A 3POTA 4C3MA 2VDHA 3H5XA 3BBCA 3SCLE 4LF4J 1TUVA 2VOOA 3DYAB 1KFDA 5IV4A 3O1LA 1WG5A 1XR7A 1IUJA 5C5JA 1YJRA 1R8HA 2MB0B 2HHWA 1RBOB 1S9GB 2VD3A 3QGHA 2DNGA 4PXEA 1KVKA 4E98A 2GMHA 2V8HA 1DQ9A 2QFIA 4NCBA 1YWXA 1R8CA 3DGVA 2DNOA 1RT3A 4NLDA 5HJYA 5ADZA 4Z7CA 1RUSA 2R7WA 2CVIA 1TL1A 2HS0A 1RT6A 4ED7A 3WC2A 1Y3JA 4FPIA 3PEJA 1HR0J 2XS5A 3IN5A 2GGPA 2DRDA 4L73A 1RJJA 4DX8H 4I2PA 1JJCB 3NP5A 2AX1A 2EG1A 2FC8A 3IR7B 1WD6A 3OBIA 5HBMB 2UUBF 5ETPA 2DR7A 4MYUA 1YX2A 3G8SA 1NJZA 1RT5A 1KTQA 2GQCA 4ZPAA 3I96A 2ZHOA 3BPDA 4LQ3A 2BACA 2PMZD 3QMQA 2MQPA 2QZ8A 2BVZA 4MAKA 4RW8B 1FK9B 5A0YB 2HKEA 2NXUA 3RR7A 2E1CA 3FFIA 5HMZA 2NXJA 4P7VA 4F50A 5A8KA 4O44A 3MI7X 2HBZB 5HROA 4F26A 5C42B 3TX8A 3VQTA 2PMWA 1TK5A 1RT4A 4YQWA 2QSWA 3IWLA 5KG0A 1IJEB 2XYGB 4M5JA 1TUGB 3HHLC 3DRPA 2CQIA 2CZ4A 2RMLA 1LWFA 2JEIA 2AP6A 1FKAF 1Z1ZA 4WFBQ 3I0RA 3VWSA 1HQ2A 4HLBA 1NSAA 1YJUA 1TU0B 1SIZA 1U26A 2V8DA 2AGQA 3H5SA 3DLEA 1N0VC 2VL1A 1ZBTA 1XMQJ 2H65B 1RB0A 4A8QA 2W7OA 4ZVPB 5HQLA 1VBYA 4JV0A 1NHKL 1YQHA 3K7RA 3FBBA 3CVKA 3UW1A 2RRNA 3K8VA 3BH7B 3H4BA 2HS4A 2BE9B 4MIAA 5E3QA 1S99A 3GJSB 2PGCA 1TL3B 2XULA 4DG1B 2HFNA 4XAKA 2JRSA 4WP8A 4K4VA 3BDPA 3PO4A 2SXLA 4F3OA 1R0BG 3EYZA 3O3LA 1X9SA 1H0HB 2DXFA 1GXUA 3HKWA 3BH6B 1AA1B 3TEGA 3D9BA 5IC6B 3KLGA 1JQGA 1RZMA 3CJ3A 1KKHA 4ZS6A 5G0RB 1N34J 2H48B 2HVZA 3EXYA 3T5HA 2AKWB 4KKOA 2EFNA 4E8UA 4JP8A 3IA0A 2RUGA 1HMVB 2V9KA 2VBZA 1D1UA 2PC6A 1URNA 2I1RA 3GV8B 2LU2A 5F0WA 4L72B 4WJBA 1M5OC 2M0GB 3TZYA 2V69A 2DR5A 4FYXB 3PDNA 2ZBQA 1FA0A 2YX4A 4K4UA 3PJWA 1CPZA 1UW9A 3CC7S 4QW8A 2HFSA 1TVRA 4KGZB 3MMCB 4YDXA 4C48A 2DH9A 1VQSA 1RTZA 3K59A 3C3LA 3Q2SC 3TUZC 4I2QA 4K0KF 2QT7A 4ZPBA 1XJWB 2H4YB 3GIJA 1SH0A 1Q5YA 2CPDA 2J0WA 4USIA 1P9YA 5C7PA 3EGWB 1S6PB 2AJ0A 2WRMA 4FYDA 4QZVB 1R7IA 2XSFA 3WBZA 4HR2A 3ENAA 1Q7YT 3AJ2A 2Q66A 1OPZA 3EXCX 4ZCKA 1YJNS 1S9EA 3TR5A 1HW8A 1FRHA 4F0HA 3PXGa 3CJ8A 3ZZRA 2A3JA 3WX4A 4J7CA 4GKJJ 2R8IA 5FDLB 2HMIB 2RUSA 1SKSA 1UZHA 1T02A 4OX9J 1QTNB 3ENVA 4N56A 4DR3F 4JI0F 1V6HA 3HVTA 4Y65A 2AJFE 4C98A 1FD8A 3SEOA 2YNHB 4G1QB 2F3JA 1X5TA 2DNZA 1HHSA 4ILMA 1TAUA 3EGZA 2XZWA 2MKKA 3A12A 3DLLQ 2WB4A 4RUHA 4DR1J 2F1FA 1O51A 4QCLA 3V5RA 3KLIA 2XMKA 1WC6A 2HQFA 4ECXA 2V2ZA 2C2DA 1FRJA 3T9ZA 2QJ3A 1QAIA 5KT7A 2XMVA 3CSKA 4QR0A 2B9EA 3OR2A 2KT2A 2GMLA 3HHLD 4LBPA 5HN0A 3LOUA 3GFYA 4KTQA 2X1FA 4Z7YA 3WHIA 4NE9C 3NMRA 1RAEB 4X62J 2HRYA 3Q8PB 3MPWA 1HHTP 2BABA 2HLTA 1VC6A 1T3OA 1XNRJ 1F6TA 5ETVA 5KG4A 3H20A 4J9OA 3BV8A 4U7UK 3R5AA 4R25A 1FVQA 2XCPA 3MUVP 4B3RF 4P2XA 3MFIA 5LMUF 4V1Ak 4NXMJ 7AT1B 4KFBA 4DWIA 4USKA 1LKZA 3QLHA 4FBUA 1YITS 3MCSA 1YRXA 3QIDA 3BGLA 4CH0S 1MU2A 2WBRA 2Z58B 2DNMA 4KO0A 2VH7A 1KDNA 2XLIA 2JEFA 3ZFVA 4M5IA 2BZ2A 5KFVA 3PJXA 3CCZA 1WF2A 4GRSA 2HZAA 3OSNA 2GIFA 3NCPA 3G82A 5AJ3F 2RHQB 2ZDPA 5K9FA 2BJEA 1U47A 2NXEA 3IGVA 3CC4S 1F9FA 3DGPA 4BC9A 3QT5A 5KFUA 3DLBA 3AOAA 3OTCA 5DZ6A 4WK3A 2GIRA 4F02A 2V6AA 3NGKA 4G3IA 4CH7A 2WVFA 1QSSA 2VA2A 4JB8B 2QSFA 1F9HA 2AQ4A 1XNQF 1GMWD 2I38A 3HFVA 3G96A 3V81B 1B7YB 3UNGC 4KHMA 4NL5A 2FJAB 2WSCC 5ETNA 2AGOA 9RUBA 3NAIA 4ZLLA 3GFXA 2NR0A 1GEHA 4CTAB 4I64A 4MKVA 2R7QA 3G6XA 4OYWA 3IMQJ 2L08A 1CC8A 4P9SA 4JYAF 1WKJA 4U7CA 3OL7A 2YNIA 4IG0A 1RTDA 2OPQB 4X2BA 3CDUA 3GPAA 4IH6A 4GVBA 4Z37A 3HF5A 3DOLB 3PR4A 1N5YB 2QN6B 2CDRB 4RPFA 4JI8F 3C16B 1VK3A 4QPXA 2BJ3A 4P52A 5KFTA 3M1VA 4DPWA 2ROGA 1OSDA 1MLAA 2HNZA 4K4ZA 4I56A 4C11A 1PBAA 2C2ZB 4EI2A 4MKYA 1RAHB 3AD7C 1KEKA 2GCFA 1U8WA 3H2VE 3R97A 2VPZB 4JOUA 4CO0A 1M5KC 1H98A 3H4DA 4F4YA 4LF9J 4K4TA 4OZNA 4DPYA 1PAUB 3E01B 2XMUA 2KXNB 1OY6A 2MY7A 3CCWA 5CYMA 2VA3A 3OXFA 1HNZJ 1JLGB 1LW0A 5GMKa 1FDBA 1QSYA 4P2MA 4WFYA 3Q8VA 2DCUB 2M9KA 2N4DA 3Q8RB 4U9RA 5HLFA 2C2EA 3JQKA 2A18A 3I4PA 3IR6B 3UD4P 3HO1A 1JXVA 4LF2A 4HT5A 3HD2A 1FRMA 3GG1A 3EZ5A 4ZP9A 3OXLA 4IYQA 3MPVA 3C6UB 1U1KA 5B08A 2P9GA 1ZS6A 4K59A 3VGVA 5AE2A 3RB6A 3UNYA 4ERDA 2ADCA 3OR1A 2IMOA 1YHQS 2EK6A 4TY8B 2YH0A 1BGXT 2MDAA 2B5JA 1LWEB 1V3ZA 4C0HA 3KK2B 4WXOA 1JLCA 3RB3A 3AA8A 1Q81T 1PYTA 2X51A 1QSLA 3IBCB 3QFWA 1SH2A 5HMXA 2UUCF 1MSWD 4J9LA 2P9EA 2XZDB 2FB0A 1WHXA 2K3KA 3RRHA 2DK2A 3KJQB 1FJ7A 2XGPA 3TVKA 3ZTPA 3IM8A 1R0AB 1SJ3P 1IKWB 2DNYA 2CPEA 2UXCF 3E8OA 3NWRA 2J0QD 4JI4J 2CRLA 1FWLA 5KFSA 3D7SB 2JC1A 3MEDA 4QIVA 2OIHA 3TZZA 4ELVA 4UZBA 3DC2A 6FDRA 4LSNA 1NB2A 1CS4A 1U02A 2QEXS 2C3UA 2VG5B 4WE1B 1S0VA 1S1XB 1IN0A 4HHUA 2K1RA 3POTB 1OWXA 1TFWA 4RJVA 4X4UA 2CPXA 1SBRA 4QWAA 1LWCA 2OMOA 3PIPQ 1RYRA 2E1AA 3FNNA 4C2MA 5E7OB 3ISZA 2XMAA 3K2YA 3QRPA 1IJFB 3J80Y 2VJVA 4C8MA 1IKYA 4Y2AA 2JFDA 1NK8A 2ZC4A 1RWVB 5M2UA 1YG0A 5KFAA 3BSOA 2KVQE 3D6HB 1U1LA 2E7XA 5CD4H 3JYTA 3M8ZA 2N7YA 2BM0A 4OZLA 1TL4A 1RT3B 2R8HA 4J9MA 4A4JA 1I3OB 1K8AT 1TL1B 4DV0F 1RT6B 2B9WA 2QV6A 3U1MA 5KG6A 4ZITA 2GGPB 3W8PA 3ULHA 4LRDA 1KQFB 4B3TF 4I2PB 3GSDA 5SZTA 5DDQC 2XYPB 3ZZTA 5L9XA 1ZPWX 3TUIC 4KH1B 3K5OA 5EUHA 3BS9A 4G65A 4ZLJA 3PV8A 4RW6A 4PQUB 3I82A 4RKUC 1DTTA 4YB1P 3L9ZA 2HLUA 1VLYA 3AA9A 1RT5B 2BXJA 4FF2A 4IOBA 2RQCA 4HI1A 1U2FA 4FXVA 5KT2A 2HSEB 2ZBCA 1WDTA 2JX2A 2Z2MA 1G1XA 2XQCA 2MLZA 4A8FA 1Y7PA 1HWKA 1HNIA 2HK2A 3Q23A 2VQFF 2FZCB 1TAQA 5A8KB 1V9OA 1H2TZ 3GCXP 5HROB 1Q0NA 5ETQA 3V6KA 4N47A 3V6JA 1C2PA 2JVRA 4C0OC 3HJFA 1RT4B 4ANCA 1HIYA 3A8JA 1EX8A 2JVOA 1WOPA 3DRPB 4MIBA 1SL0A 2RDIA 2Z2ZA 4YHHJ 2LLZA 2WSEC 1WSRA 4LVOP 5CA5A 2CUYA 4ZKAA 1AFJA 1UW4A 2OJ3A 1WHYA 3AQOA 4J9SA 4QR2A 3DLEB 2E1RA 4K5RA 3KHRA 3SFGA 3L95X 2QIFA 4X4NA 3F56A 4LF8J 3NS6A 4ZVUB 5GVQA 1YZ7A 3BGFA 4QW9A 1VQYA 2IHR1 1L3TA 4WTOB 4X4SA 4CRJA 4OZ2A 3D1HA 2KH9A 3OL6A 1VI7A 2IA6A 3BO3A 3GV5B 2DVIA 5D15A 2BBEA 5HVFA 1UVIA 3GP9A 2ZE2A 5B0AA 4UQGA 3B4MA 3KLGB 1OYDA 3ET6A 3HHKA 2ZH3A 5CYJA 4ZVFA 3WIVA 3B4DA 2IVYA 1DQAA 1BQXA 4X4OA 1JIHA 3VAIA 4I6AA 2ZOGA 1UAWA 2NXCA 2FC9A 1WEXA 2YY3A 1HPZA 2CPFA 1FX4A 1NBEB 4RW7A 3RB4A 1KP6A 3KLFB 4OI4A 2GAHC 1Y4ZB 5FJ4A 3LAMA 2C28A 1LNQA 1VDHA 3M2UA 2BMBA 4FF4A 2NZ4A 2HFZA 3KJVA 3FBEA 3PYGA 4NLQA 2UV8G 2DTJA 3CO0P 4O3NA 5F8JA 4I2QB 4LFCF 3CE8A 2VFUA 4NEZA 4LFAF 4OX8A 1Z4UA 1I5OB 2ADBA 1J2VA 3D28A 2R7SA 1S59A 2H1YA 3T1HJ 1J5OB 3QJLA 5T7LA 1GFWB 1DJ0A 3A3NB 5CQGA 2MY8A 3BYPA 3D66A 1VBKA 2FUG9 3SIPB 3W62A 2VHGA 2NSBA 1XBWA 4QIEA 4NCGA 2EFVA 4H4KC 3H5UA 4ZJQA 1S9EB 1NPKA 5IM0B 1KLMA 3HSZA 1D3WA 3HKZD 4USWA 2BW2A 1JXLA 5KFFA 3RB0A 1NPRA 5KG3A 4RNNA 2RB7A 4IUFA 4DR6F 5DJBA 3HZGA 3K5PA 3RJMB 4NWBA 2D41A 1JK9B 4NPOA 2J6SA 5AE1A 4NA3A 1RU1A 3MM5A 3HVWA 3MPYA 3AH6A 1FNXH 4IH5A 5DG7A 2KB2A 1C0TA 2WW4A 2R7XA 2O3DA 3K17A 1RDRA 4ELTA 4X4TA 3OTBA 4NMLA 5ETOA 2VONA 5DQHA 4ZLPA 5KAKA 2M4MA 3KLIB 1HL6A 4ZCMA 2ZHBA 2F8MA 5C24B 3LP0B 3HVAA 3ZZ0A 4CLYA 1FTRA 4WBFA 6AT1B 1A0OB 1VQ6S 2ABYA 3OVBA 3OR2B 2XI2A 5ETRA 5F0UA 4YS2A 1HNWF 3HSDA 2OPSA 1BQNA 3CCQS 3B6BA 3CJKA 5LXRA 4B02A 3KLVA 3DFEA 2MMYA 4USTA 4UF4A 4M95A 2DGSA 2E66A 1Z2LA 3CGIA 2JOQA 1KHWA 3LWMA 3H59A 2GHVC 2WHOA 3QIPB 4OV6A 3MWBA 1UJ4A 4M5KA 1DZ5A 3U1NA 3F44A 5CZXA 5H9EJ 5HSPA 2DNPA 3CO9A 4AL6A 5K8PA 2VC0A 2BOAA 3GIIA 1JLBA 4B3MJ 2ZBRA 3D6TB 4CM2A 4P75A 2KO1A 4NXNJ 1Y10A 3BREA 2NUUG 3M6UA 1KVJA 4IKAA 2CPIA 3MTKA 3CULA 4RUBA 1SJRA 4KFBB 2NREA 3DU6A 1VLOA 3BN7A 2Z4PA 5A2QY 5JJBA 3FMWA 3DHWC 1AW0A 1UTAA 1N36F 2CPJA 4JI2J 1MU2B 4ED5A 1WWHA 3PG9A 4KO0B 3TAPA 5CXTA 5A6PA 2IVFB 5H9EK 3CT9A 2XLKA 3OW2R 3MAQA 1JLQB 2WVBA 5IQQA 1WI6A 2FLOA 1ROFA 2YPZA 2UXBJ 3TJ9A 3NKYA 2ZD1B 2UXDJ 5K20B 1RAGB 4LRBA 4RUAA 4QOTA 5D0RA 3G6ES 3VF0B 5AE3A 3KG0A 3KLHA 3FZBA 2HVDA 5M2PA 5F3ZA 5KFPA 4ZCLA 2LQ8A 2MJUA 1MW7A 1TKZA 2DR8A 1DTQB 1SKWA 1NLKL 5D4NA 3T9NA 4I6YA 4F7VA 2OD4A 2PSZA 3N6NA 2AW0A 3QT8A 4ED3A 2XBPA 2GJ2A 2IC3A 3UFCX 1T9XA 1EQ0A 2DXDA 4DX5A 2LQBA 5GAEU 4DV4F 2YNIB 4IG0B 1RHRB 2BV3A 2BM1A 3FUYA 2KT3A 2V8VA 4NZ7A 1TZ0A 4QQBA 2DHHA 4RBUA 2Q79A 2NS1B 2CQ0A 2ROPA 4DR2J 1SL1A 2HNZB 3DLGA 3CC2S 3R6GB 3CD7A 2FPHX 3PW0A 2AEJA 1S1UA 1FFGB 3GB0A 4DFKA 2EG2A 4KAIA 2GVDA 4URGA 3R5BA 4UQTA 4YY3J 3MMBA 5HANA 4L6V3 1K1SA 3D1OA 4ZIWA 2W2MP 4O4GA 1RWPB 4EUVA 1S6OA 2X3DA 5E3RA 5CYMB 2X3GA 4NMXA 2IDEA 3FQLA 3JB9k 1LW0B 4Y34A 1YZ6A 2CFXA 3D1QA 5D0HA 4ENOA 4IFYA 4IRKA 4Y00A 5HLFB 4E2FB 1PAEX 1T05A 4CLPA 2ZH8A 2AV5A 2LDIA 2D3O1 4DQIA 4YUDA 2DGXA 3BBFA 4A8YA 3N0VA 1U1OA 2BEFA 4QR1A 1XMOF 4YN3B 4TU9A 3QGPA 4N76A 3BR8A 2J76E 5D78A 2GS8A 2PA8D 2O01C 3OR1B 3M05A 1D0EA 3IWXA 2CJXB 1BLUA 5J2MA 4IQXA 3ZZYA 3NOCA 1JLCB 1FWPA 4Y28C 4RW9A 3KHHA 2XHCA 2UP1A 2VC1A 3W5XA 2GNKA 5DDRC 2B3TB 4DFJA 4BC7A 1I94F 4KH0B 2EC2A 2C3OA 2DT9A 1ZAXA 4NASA 4OHVA 2MHNA 1CJVB 1JJHA 4OZ3A 4DCPB 1ZAWA 2G2ZA 3CD5A 2QA4S 2W2PP 1VHFA 1B0VA 1I6JA 2QX0A 3MM9A 1UVMA 2J7UA 3NY0A 3MEDB 1KFSA 2E5LF 2GX8A 3HCXA 3ITHA 1BHNA 3OT9A 4JI5F 1G3OA 3C66A 4EWTA 3E51A 2CKWA 1FDDA 4MT1A 2XHWA 4LJMA 3DYAA 1RTHB 4RU2A 3EGVA 4DL4A 3PW2A 3ZNUA 2C1EB 2IA0A 3PCOB 2PT0A 2OGUA 1IKYB 2R2RA 5HL7Q 4KC5A 5GAGI 2W9CA 2KG0A 3PW7A 5I42B 1S9GA 2BQRA 3JYTB 3R27A 1ZM3A 2W7PA 4PABA 2RRAA 1SC1B 3D5MA 1IBKF 1WF0A 2D1CA 4U96A 4A47A 4QIWD 1NM2A 1S10A 1J5EJ 1YK9A 5I3PA 2Y1JA 1I51B 2B4VA 2GHWA 1QY7A 1BMQB 3TAMA 3MUTP 1CVJA 1YIJS 3JS9A 4UOGA 1O8BA 1NJXA 2JLFA 1WUUA 4MMOA 3K58A 1X8DA 5E3AA 1DY3A 3G6YA 2GO8A 4ECVA 3GTYX 3CJ5A 3H2UB 3RGIA 4F8RA 2B4OA 3I9V9 5JXSA 4ZMMA 1SQEA 4RW6B 1WTFA 5HBMA 5F8MA 4V19J 2XLJA 4USJC 1DTTB 3CJTA 3W9IA 1N6QA 1SV5A 1XEZA 3TEHB 2JH3A 2YQ3A 3M4XA 3TARA 3MCOA 2FJVA 4W98A 2D3UA 3BDEA 2AJQA 1IKVA 1NNDA 3T1YJ 3TZWA 3NNHA 3HP6A 3UN2A 2I8EA 2EI5A 1H3DA 4EO6A 4CO5A 2YWKA 1PBUA 1U0HA 1ICEB 3ILOA 2V5HG 1FK9A 5I3UB 1S97A 1T9TA 3PW4A 3W8GA 4FPRA 1EP4A 1KHVA 4KHRA 4XPCA 3QZ8A 4M94A 3VALA 2IRUA 3DMJB 5HK4A 3CMQA 1JLAA 3JTOA 4OHXA 2HEKA 5LSLA 1AXQA 2B8QA 4X84A 3I87A 3OFGA 2UUBJ 3F0NA 3I0SB 4MK8A 1QVFR 2QLXA 5HVHA 1RWMB 5B0EA 2Y0SD 2WBMA 4L3NA 1SJQA 2F4VF 2WK4A 3CNQP 1P1TA 4M1KA 3IAM9 4M5MA 5HQMA 4PPDA 2V8GA 4CO4A 2MGZA 4DFPA 2EW9A 4AUKA 1N33F 1JX4A 4DFMA 2LXIA 3UVJB 4F36A 3ZNJ1 2AEMA 4X4PA 2CWXA 3KJNB 3UPFA 3CCVS 4CM0A 3G86A 3OJUA 2I5JA 4X65F 3EWGA 4NLVA 4NLUA 4DX7A 4DG1A 2AYGA 1TL7A 2G13A 4EO8A 4GMKA 3TQ1A 3ISNC 4OYXA 2NLWA 1O5JA 2ZE2B 4IFVB 4UT4A 3HSJA 1CEZA 2DR9A 4ES2A 1M5VC 3ET6B 5G0RA 2P6TA 4RR5A 2Y1LB 1UVLA 3H25A 3CMAS 2ZUAA 1EB0A 3I32A 2KRRA 1W2BR 4DR5F 2X1GA 2L9DA 1KQGB 3CCTA 2B7CB 2LFVA 3UDEA 2WTFA 5D77A 4RW7B 4DV5F 1UVNA 3CCES 3RZAA 4F0KA 1SI9A 1WI8A 4W90B 2VICA 4O0IA 1VYAA 2R2UA 1RTJA 2HYIB 2ZHAA 3WDOA 1F2GA 4NI2A 1XMBA 4GO7X 5IXUA 2HVHA 4CQ1A 4ZN1A 1D09B 1NO8A 3W2WA 1JKHB 3SYZA 4HTIA 4AE5A 4LBIA 1VJWA 2BANA 1UL3A 2RT3A 4OX7A 5M2RA 1KQKA 4TXSA 3U27A 1VIOA 1S0NA 5T7LB 2EBEA 1C1CA 1GT8A 4Y0FA 2ZJQQ 3CIMA 1NH7A 2R42A 5D8HB 4OI0A 4ECRA 1GTEA 5KFLA 4KPYA 2MXYA 3V6DA 1SC6A 4U7UD 5DZ7A 3W65A 4NLTA 3M2VA 1CULA 2HFUA 2ASDA 5IFMA 4B9MA 2ZH6A 4ECYA 3ICLA 3W3SA 1P9QC 4FYVB 4JBCA 2B4PA 4DX6A 1ZETA 3MM5B 1MN9A 1BWVA 4K0KJ 1BQMB 3MM8A 3GR1A 4G1QA 4HL9A 2B7BB 4FZVA 4CLTA 2C42A 2QLBB 2CQ4A 4LR8A 2M88A 2VPWB 5F9NA 2G2OA 2H51B 2UVWA 3P3DA 1PC5A 1C4CA 1FI4A 3PRDA 4NCAA 4TLRA 4AYBD 3AT1B 1WC1A 3PM9A 4HACA 4LSZB 2C3YA 2OH2A 3AY0A 1FD2A 1UVKA 4GKJF 1T9YA 1SB6A 2Q1LA 3TW0A 1M5SA 1SUQA 1BQNB 1UFKA 2DNHA 3BN4A 4YB5A 3NWGA 2W4PA 4OX9F 3CJKB 2UZAA 2AMCB 1TFYA 3GFHA 4JI0J 5KFGA 2VOPA 3QWPA 4CIOA 3NLCA 4TQSA 1BC6A 3KNGA 2BE2B 5IT0A 5DS7A 2LQ9A 3OSPA 3KNAA 3S1TA 1A9NB 1HQUA 3N28A 3MCMA 2R9LA 3Q8YA 1WKLA 4BWMA 4R0EA 3N6MA 3R5GA 1Y5NB 4MK9A 1VQ4S 2XSJA 4F4WA 3T5JA 1EKSA 2CZ9A 1U1PA 1W7WA 5L38A 2HWIA 3G8TA 2H5EA 2HBRB 3NOGA 2Y8YA 4QIGA 5L1IA 5DG9A 3J7YU 1UWBA 3SZ2A 3W63A 3NEKA 5KFRA 2AZ1A 2VG6A 3AHPA 4DV1J 4L74A 1PGZA 2W7AA 3W2VA 3D0IE 4UOHA 1RACB 4ZVOB 4OYIA 5KT3A 1XC9A 2DXEA 1IBMF 1VCTA 3R7BB 1MMDA 1KN6A 2D74B 2GHPA 2CQPA 3D4JA 1F9EB 3EVWA 2ZH1A 2O1PA 3MURP 8RUCA 2N82B 5F8GA 4RWWA 2HIYA 1NRKA 3LPYA 3P5TL 1UJ6A 5CCMA 1S7IA 2LEPA 1K1QA 5LMUJ 2PA3A 1BXNA 3JSMA 3Q8QB 3QNWB 5SUHA 1Q8KA 3FZ2A 1AZSB 3R1HA 2E5HA 1JJ2R 4CTAA 4YB7A 4ZVEA 3BKTA 2CPHA 4ED8A 1XERA 2OPQA 4GKKJ 3DOLA 3LP1A 3NXZA 1RTIA 4LQ9A 3C16A 2XMTA 1GQEA 1FEHA 3RU0A 5BJRA 2XS7A 4BBYA 1U1MA 2E9TA 1MMNA 2CQHA 5LSRA 2AU0A 2NYIA 1U48A 5K8OA 3DLGB 1FDAA 4UY8T 1H74A 2D3OR 1FE4A 2HK3A 5T41A 3BGUA 3EZOA 2KL8A 3FK4A 2XM3A 1YLXA 3NG8A 2DH7A 1PJ7A 2GVDB 5CD4A 3UR0A 2RILA 4DU7A 2W4DA 3GYGA 2UU9F 3I4HX 3BO2A 2XWYA 3G4SS 4IR9A 2Y8WA 2XMWA 2IJFA 2HBYB 1L5UA 4O4GB 4E0DA 5H1SV 3KKFA 3FGVA 3P4UB 1HD1A 3TZXA 2V2QA 3H42A 1GMVA 1F3FA 1RKJA 2HHSA 3N79A 3BQ2A 1L3UA 3GJRB 4B9LA 4JYAJ 2DNRA 2VODA 5IQ6A 2OKQA 1S1VA 3C6TA 3KUGA 3UCZP 3D54A 4JI8J 1EHWA 3TO8A 4ZN3A 4NYPA 4EBDA 1RA7A 1H38A 1NKBA 3BBBA 4IDKA 2NCKL 4WWSA 4DZDA 5DRKA 4LF5J 5AXLA 1NK7A 2G4BA 1JJ4A 5FD1A 1AT1B 3GU0A 3CPWR 2V2VA 4CCHA 4KSEB 2ZOMA 1X4DA 3W9JA 2VQEF 2MZTA 4LIRA 1NJYA 4RU9A 4UOFA 3HHEA 2MQLA 3G8QA 4OIXA 3RBXA 3HD1A 5J2MB 3UD3P 4ZPTR 4BLGA 4PWDB 3ZZOA 2WZ1A 2IYIA 4PG7A 2KM8C 4RW9B 4PYAA 2ASLA 1BUXA 3BPSP 3V4MA 3KK3A 3FBFA 1FXDA 3B78A 3DM2B 2QLFB 1S5ZA 3J81j 1T0TV 3UWTA 1R8AA 4HDGA 2ZNYA 1YBAA 4RW4B 3IO1A 3MEKA 2YBVA 3NRBA 1ZPVA 3K57A 2OPPA 3SQGA 4DL5A 2F65A 1IKWA 4DUYF 2HQDA 3EMTA 3E2EA 3MM9B 2B9YA 1NCLA 5DETA 2ZM6F 2M8DB 5F8LA 3AAWB 5F8NA 2HQCA 3H98A 3ITHB 2W8KA 1NB7A 2VG5A 4WE1A 4V19X 2FZGB 5IT9U 2N7CA 3PYDA 2M7SA 4MIWA 4F2SA 9ATCB 3M8QA 2MSTA 3W60A 4DV3F 4JI1F 5HJXA 2IMWP 4ZVHA 1Y3KA 1JXEA 3DKDA 4WZMA 2IM0A 2QL9B 3RTVA 2UUCJ 2YKPA 3AB4B 2W9CB 1KWMA 3Q89A 1PIEA 4FP9A 2MZSA 3GIRA 5LMNJ 3A3OB 1S1WB 2CJYB 1U2RA 3NBPA 4KHPJ 2V4JB 1FX2A 3EGNA 4JI4F 2UXCJ 3AXMA 3CDWA 3W66A 4F67A 1F5CA 4NEYA 3ADAC 3TAMB 4I1TA 2HS3A 3HHLA 4I69A 3PKMA 1TV6B 1TMJA 2W2OP 3RBEA 3JSRA 4TKTA 2DHSA 1FERA 3Q22A 4Y2CA 4PQUA 2Q3PA 1N6QB 1SV5B 2HIQA 3FSXA 2GMJA 4RNFA 3MXHP 1U1NA 4HH0A 3FCWA 1E6VA 2YWHA 4GC6A 4KB7A 2JFKA 4HHJA 1IKVB 2XI3A 3JTNA 1QVGR 5THWA 4MYTA 2FZKB 3AOCA 2BQUA 1U0HB 4O3RA 4DN0A 3R9LA 3BGRA 4EEYA 3QFHA 1V3RA 4BWJA 5BYSA 1RWWB 4DV0J 4ZVQB 1EP4B 1W26A 4WFNQ 4HKQA 4W4MA 1K47A 4FF3A 2DHGA 3SDEA 1YJ7A 2C2MB 2B9XA 1DQ8A 1RAIB 2I9SA 2RU9A 1YSJA 2ZWOA 2C3PA 4B3TJ 1JLAB 3D67A 1R3NA 4FS1A 2DYAA 4DF8A 4BDPA 2FJDB 3IBFB 1YJTA 1SL2A 2OEKA 1UCNA 4WCEQ 3MPUB 5LL6d 1UEVA 4Q2LA 2KVIA 1FEEA 1FT8A 1PG5B 2GW8A 1FF2A 3QPIA 1KVIA 1WACA 2PO4A 2POKA 5EX3A 2CPYA 3CDAA 2HNYA 4NRUA 5IOLA 2WOMB 4PYDA 2LP4A 2RF2A 3M8YA 4OJHA 3D0HE 4P10A 1R43A 2MGZB 1TTHB 2KFZA 4ALZA 4YR0A 1VQ7S 3Q0AA 2XNQA 2CNNB 3OLBA 1FJEB 4L3KA 1ZAVA 5F8IA 2VQFJ 1WHVA 4M8LA 1PCAA 3EPIA 2I5JB 3NGDA 4FS2A 2RHSB 3OL8A 2ZVSA 4K4WA 1CJKB 5E41A 2NSCA 3E3XA 3TOQA 1IM4A 1TL7B 3K0JA 4ZPCA 2HFOA 3KK1B 3TQEA 3CJQA 4A8XA 1GX5A 2BJ1A 1G4CA 1M5HA 3PHEA 4UZCA 2ZBPA 2MZJA 2KKHA 1Y9OA 3SV4A 2F7VA 4RX6A 4CLLA 2MZ1A 4WTYA 2CDQA 3H8YA 2R8JA 3CD6S 5DM6Q 4NRTA 1WSVA 2E1MC 4DPXA 4OI3A 1F3VA 3R7SB 3H5YA 1IWAA 4KQZA 3RRKA 1RT1A 3KLFA 4ZVTB 2KI2A 1NHVA 1RTJB 4FYYB 5EN1A 3DXBA 1RBLA 4JI7F 4NI2B 2GZOA 5G4DA 2QMUB 4GO5X 3MTJA 4OHYA 1MMLA 2F63A 1D9FA 5DDPC 4JI6J 2VDIA 1VR6A 2CQGA 5ETTA 4A48A 1GAOA 3W2WB 2XMMA 5EDWA 1K0VA 4IG3B 3IRWP 3QWUA 1TK8A 1JLEB 1G7CB 2AJ1A 2BANB 2K06A 2FVCA 5E3PA 5L39A 2FD2A 2J8SA 3V4IA 5GAHI 2GC8A 5AT1B 3N6LA 1J5OA 1C1CB 5BYQA 1NK4A 1VC0A 4DMZA 1X4BA 2GIQA 3SCKE 3M32B 4CO1A 4ATNA 1X4FA 1G6BA 2KFNA 3V6DB 3P96A 3CDBA 2PN6A 5A2QU 3GQCA 2ZBIA 3QT6A 3O2IA 5IM0A 2AYBA 1N32F 2QRRA 2WVCA 3M2VB 1CULB 4Q45A 1ELOA 1OMSA 3NCQA 3GIKA 3T6JA 3NGUA 2HBQB 3M8PA 4R5PA 1VK8A 4Y3CA 4I7FB 3MEEA 4LFCJ 2KHCA 3MM8B 4O3OA 4LFAJ 3THPA 1UEKA 3BM7A 4YFUA 4DV7F 1AROP 3CWJA 4UUXA 3WC0A 4HVZA 4OJ1A 4O0NA 3R2CJ 1RHJB 3QT7A 5GADI 4C8LA 4CWBA 2M8HA 1JNRB 3MEGA 2BR0A 5BR8F 1FO1A 2ZFHA 4CLWA 2MQOA 4DN9A 4PWWA 3IAS9 5C24A 1S9FA 1A7GE 3LP0A 2BW7A 4HACB 2BJ8A 3LPEA 7FDRA 2CQBA 1P27B 3LALA 4ECZA 1JMTA 2J7KA 4DL3A 4NX9A 4CLKA 1SUQB 3O44A 2PEHA 2W2QP 3DHXA 1NDLA 4DR6J 5HO4A 4K2XA 3WQPA 2XTJP 1FRXA 3T1AA 3MR3A 1IKXA 3R5CA 2HHXA 2WONA 1H72C 2ZZNA 5B0BA 2E5JA 2RE1A 1RA6A 8AT1B 2YNFB 5DO2A 4ECWA 2FIUA 2XB2D 4H4MA 1VQOS 1R6YA 1X4HA 4H4OA 1S12A 3QIPA 1HQUB 4C9DA 3KHGA 5U47A 2AJ4A 3WX8A 2P8IA 1SKRA 5DG8A 2VASA 2XSJB 1IQTA 1VQKS 2OEMA 2F9JA 2HAIA 3EVOA 1S0MA 4OHWA 1KTVA 2A2DA 4WP3A 2LA4A 2HRTA 1OS5A 2R2SA 1KOOA 3R5DA 3FRYA 1WC4A 3BQ0A 2KYXA 1UWBB 1HNWJ 1NSPA 2AT1B 2EVZA 2OO4A 1SJFA 1HI8A 2VG6B 1Q16B 3SXLA 2QFJA 1YRTA 4X64F 3QYYA 3THTA 2HHHF 3W2VB 3D2WA 2H9ZA 4ES3A 2HAFA 3RUBL 1JLQA 2FHMA 4R8UB 3GCWP 4LR7A 3QRQA 3LGMA 1RAAB 1N52B 2CJKA 1HBOB 2ZD1A 1N5VA 3UN5A 4B3MF 2KHDA 1KR4A 2NPFA 3ZTOA 5K14A 1W25A 3OTOF 4MKBA 1V3SA 1WTBA 2DY1A 4ZPDA 1HLWA 3I5CA 1DTQA 2PFDA 3JSMB 2LXUA 2RNEA 3UN3A 3ZZUA 5MAOA 2RSQA 2QE5A 3DI6A 4YP3A 1N36J 1HBUA 2CNLB 4TVAB 3IFEA 2MZRA 2DITA 3DRXA 2JHEA 3JTPA 3LP1B 2YKOA 1RTIB 2DR6A 4QIFA 4Z2XA 5KT4A 1LW2B 3IM9A 5KTQA 4R0JA 4LRAA 5J1NA 2ZZTA 3KLEA 2QYCA 2A6OA 4NLRA 1DFDA 1RAFB 1VBZA 1OSCA 4JV2A 2U2FA 2E9RX 1ZYQA 2QL5B 3PX4A 4OL8A 4B08A 2E1PA 3M6VA 4XDDA 5ETSA 1NJWA 1UFLA 1PJ5A 5D6GA 5FLXY 1FNOA 3KWMA 4PG4A 4OQJA 3BB5A 2HWHA 1DAXA 2K8GA 1M1HA 2BJ7A 4OZ0A 4TN2A 3CCJS 3OVAA 2CADA 4LSLB 1JB0C 1WG4A 3D6MB 3BQ1A 4DV4J 2DIVA 2J0XA 3I55S 1S1VB 3C6TB 4ID5B 1NUEA 3QSYB 1P6TA 1VJQA 4ZJLA 3ETOA 1APSA 5D0GA 3IR5B 3DLJA 1X4CA 1D8YA 2KFYA 1VQ5S 3IG1B 4IDKB 5KFHA 4OYBA 1X7VA 1P1LA 2Z0GA 2DKOB 3J7A1 4OHZA 1B0PA 3OL9A 5HP1A 2P9CA 4NLSA 5KFNA 1TKXA 2R8GA 1RLCL 2HPUA 2WSFC 4AXIA 2DHXA 4URSA 5KFWA 2HGNA 2BDPA 2K3IA 4DEZA 3OVSA 2KZZA 4LF7J 2FTRA 2JZ5A 3M7VA 3BJYA 2I0XA 2EFGA 3VAFA 1M90T 1TELA 1NDCA 2L3MA 3KK3B 3AD8C 5L1JA 1X0FA 4C8KA 2W9AA 1TMMA 2E7WA 4HI2A 2RQMA 1KONA 1T03A 4AQYF 3TJ8A 5KFXA 3SSRA 3GMGA 1CJVA 3MECB 1PKUA 3TVYA 2OPPB 3SQGB 5JMNA 4J90A 2VJUA 4ZHRB 4P6QA 1WEYA 3JSBA 2CJQA 3LTOA 2YX7A 5C2CA 4I4BA 2CJBA 2FYXA 3TWZA 3PNIA 1SVDA 3HLUA 4FN5A 2UV8A 1XMOJ 3EICA 2PI4A 2V9WA 1S1TA 2AIRB 5CYQA 3AOBA 3UDVA 5CCLA 1FKPB 1FCAA 3R5JB 3M8QB 1EETA 1HWJA 4OYPA 1RTHA 1U2CA 2G0JA 4ZK7M 1B99A 4NYZA 4CNZA 4KV8A 3BSAA 4FBTA 1I94J 1QAXA 3G71S 4QWDA 3GV7B 3MDFA 2RS8A 1OYEA 5I42A 4PZVA 2KYZA 5CZVA 4NA2A 5IC4B 1NKCA 3NBPB 1RAOA 3R8YA 3UDCA 1RI7A 3PVXA 3RBZA 5DM7Q 2D3ZA 2P5VA 3HHLB 2B51A 2E5LJ 3ILIA 3PACA 4LF6F 3AFGA 4KY3A 1N5TA 5LT5A 4DUZF 3MGJA 3BSNA 2QGFB 1IBLF 1ZTWA 4DV6F 1DRZA 3JAMU 3EX7B 3BF4A 1HNXJ 3D6FB 4KE5A 1RWUA 4DSIA 3SMZA 1FTCA 1KSPA 3OFEA 4PWUA 4ED0A 1SQGA 4ITSA 1E6VB 3PZPA 5B7WA 3IXQA 2E29A 3SSSA 3ZTRA 3Q83A 2KTQA 3M9NB 1RWXB 3PKYA 2DGVA 1HQEB 3VAKA 4CZCA 4ZOSA 1A6LA 1IBKJ 4KGMA 3BGRB 1J5EF 1VS3A 3SBMA 2DJWA 4P71A 5I3UA 5A8WB 1MROA 2I2YA 1RISA 3MF5A 4ZPVR 4F04B 3KMSA 1WKKA 4GC7A 2HURA 5LJ5Y 3SDEB 3MM6B 3RAXA 1OJ4A 4ZP7A 3LP2A 1E6YA 4XIUA 2VFRA 2FY8A 4NLXA 3N5BA 6FD1A 1NEEA 3FKBA 3DMJA 1C0UA 3LA0A 2PDAA 4J9VA 4LT6A 3RR8A 3EDRB 2PI5A 5IT9Y 2M2BA 5LSOA 5KFKA 1U24A 3I0SA 1MG7A 5F9LA 4D3GA 4WPAA 4EFAC 2IAJB 1VQNS 3VQSA 4DXLA 3T1YF 2HNYB 2GJIA 4EGLA 2RF2B 2Y1RI 5LM7E 1WOOA 1RBAA 5K8MA 2Q43A 3HT3A 1FHTA 4OZ1A 2DO4A 1B3TA 4O4RA 3UVJA 2CG4A 4ED2A 2VZ9A 4TYAA 3HDSA 3R6LB 3H0PA 1UP1A 2K7KA 5F3TA 5BYRA 2W1BA 3W7BA 4Q0BA 1NJIT 1N48A 5D4PA 3VR1A 1FNMA 2UUAF 1HBNA 2IBKA 3O5TB 4F3MA 3NNCA 3PHTA 4ECQA 1CQMA 1RYSA 1EIYB 2PD1A 2MLYA 4C8ZA 4IFVA 4PR6A 2NYHA 3IS9B 1QUPA 1YRUA 4D3HA 4PXCA 4H4KA 1QTMA 2DB1A 2JLGA 3IGNA 3MR7A 4CNYA 2F4VJ 1GXLA 4N8OA 3H90A 1ZH5A 5D0EA 4DI6A 1N33J 5J2NA 2R7OA 3OFFA 3HI9A 3EUNA 3LH2S 3CCSS 3FBCA 1RT1B 5KOWA 4WFZA 2OSQA 4O23A 2GAGC 2ZUGA 3UO0A 4X65J 1CBKA 2D7SA 1RP5A 5EWEA 1S49A 4TU8A 4WYLA 5B0CA 1T9UA 5CHCB 1RT2A 4KBIA 2LU1A 5D3GB 2B8PA 3U02A 5HMWA 4QYZJ 3W5YA 3RBDA 1D9DA 3RRGA 1JKHA 4DLEA 2DGWA 5L8RC 2YXLA 3JXOA 2LVWA 2E44A 3V4IB 4PG5A 4I0WA 1NSKL 1B70B 4CO3A 3A13A 3OV7A 2RJZA 2VBWA 3W5ZA 4A8MP 2PIIA 1XR5A 1N54B 1VC5A 2ZZMA 3DNCA 2DISA 4DR5J 4XK8C 2G0CA 2A1BA 3PFEA 1QUVA 2D9PA 4F4AA 4PXDA 3M2RB 5KFDA 2YWWA 4DV5J 3QAUA 3C14A 2IM3A 4QYZK 1HWLA 3NCRA 3ILJA 5J1EB 5LOQA 4YR3A 3EPGA 1S4FA 2W4CA 2V68A 3BKFA 1B7FA 3MAHA 1RWOB 1P8GA 1AYEA 1R89A 2D69A 1V5VA 1Y5IB 4YMEA 2E7VA 4AL5A 4ZDNA 4OLOA 1UETA 3M8PB 2B56A 4R5PB 2QO3A 3OHBA 4TY9A 1NZ8A 3JSYA 3MEEB 3PFOA 1BQMA 5EGYA 2YKNB 2L48A 3PX6A 2IFXA 4B9SA 2CQCA 1U6FA 3CXCR 1WNEA 3KOAA 1FVSA 1GMUA 3MEGB 3BKUA 4DSLA 4P2FA 3BO4A 1ZA2B 1LV5A 3N5FA 2ILZA 5KFJA 4ZIVA 3K5NA 2BKOA 4NA1A 3HK2A 4Q44A 8ATCB 2CYYA 3P5BP 4WIQA 4XO0A 3A3PB 1H2UX 1JLFA 4JI3J 3DXSX 4C7QA 3OXGA 4IR1A 4F25A 3MMAB
chains in the Genus database with same CATH topology
5KFSA 5C42A 1VQ9S 2XMTA 2GV1A 2ZDOA 1GQEA 1L3VA 4K5SA 1FEHA 2JC1A 3MEDA 1IKXB 4QIVA 3RU0A 5BJRA 1GTHA 4BBYA 2OIHA 1U1MA 4ELVA 2E9TA 2WONB 1MMNA 3FSYA 1LK7A 2CQHA 2EFOA 3DC2A 6FDRA 5LSRA 2AU0A 2NYIA 5AXKA 4LSNA 3U7JA 5DGAA 1U48A 2QEXS 4FVMA 2C3UA 2VG5B 3DLGB 1FDAA 4WE1B 1HA1A 1Q8LA 1S1XB 5K8OA 2D3OR 2UVVA 1IN0A 4UY8T 1FE4A 3HHDA 5KG7A 5D3GA 2K1RA 2BE2A 5T41A 3UQSA 3LANA 3RAMA 3BGUA 3POTB 4H4MB 1OWXA 2J8AA 4DBQA 3UCGA 4RZRA 4H4OB 1Q4RA 2N4CA 3HXMA 1TFWA 1DBDA 4Q2MA 3NG8A 4X4UA 1RT7B 4WFXA 2DH7A 3NMAA 2CPXA 3O8WA 1SBRA 1IXKA 2FDNA 4QWAA 3N01A 4DR4F 1LWCA 3UR0A 2OMOA 2RILA 3AQPA 3PIPQ 2W4DA 1RYRA 2AYEA 2UU9F 2E1AA 1UKUA 3FNNA 4C2MA 2MQQA 3I4HX 5KG1A 3OTEA 2DIUA 5E7OB 4DDFA 3BO2A 2J6UA 4IOAQ 3ISZA 3K2YA 2XWYA 3G4SS 4DL7A 4IR9A 4PKDB 2XMWA 3GE9A 2IJFA 3VAMA 1IJFB 1L5UA 2VG7A 4O4GB 3J80Y 4E0DA 2M70A 4C8MA 1IKYA 3KKFA 5H1SV 1KNZA 3FGVA 4J9KA 4K4SA 4Y2AA 1LFWA 1HD1A 2JFDA 1W2IA 1NK8A 4WKRA 2IM1A 2RKIB 2ZC4A 5M2UA 2DO0A 1R8BA 1YG0A 5KFAA 2XY5A 5FIIA 4WKYA 3BSOA 1U1RA 1RKJA 1U1LA 2E7XA 2HHSA 5CD4H 3N79A 2LKZA 1X5SA 3ZZZA 3ZZPA 4RNOA 3JYTA 3BQ2A 4J9PA 3M2RA 1HARA 2N7YA 2HW3A 1L3UA 1S72S 2FJXA 4B9LA 4KT0C 2BM0A 2DNRA 2VODA 5HQ8A 1UEUA 2OKQA 5IQ6A 2ZH2A 3CCMS 1S1VA 3C6TA 7FD1A 4OZLA 1TL4A 5J1EA 2RQKA 1RT3B 3TP2A 3GIMA 3UCZP 3D54A 3HZEA 2R8HA 4J9MA 3TAQA 5L1LA 1AUDA 1TL3A 1HYSB 4B9TA 4A4JA 1WF1A 4EYHB 3TO8A 1K8AT 4NYPA 1GNKA 4EBDA 1TL1B 1F0XA 2ZH7A 4DV0F 1CSJA 2EBGA 1RA7A 1RT6B 3V2UC 4BS2A 2B9WA 2QV6A 3DN9A 1H38A 2VPYB 3U1MA 2J5AA 2XCAA 3M8RA 5KG6A 1NKBA 4IDKA 2LCWA 1KRPA 2GGPB 5DRKA 3ULHA 5LJ3Y 2MHEA 2MKSA 2PE8A 2KJVA 5AXLA 1KQFB 1NK7A 4B3TF 2XGQA 4I2PB 3FJ2A 2M5YA 2G4BA 3GSDA 2RH3A 5SZTA 1JJ4A 1IQZA 5DDQC 3ZZTA 5L9XA 2APOA 5FD1A 3OPKA 1ZPWX 5F8HA 3CPWR 3TUIC 5KT5A 3BZQA 1LFPA 2VFSA 4CCHA 3K5OA 5EUHA 4KSEB 3BS9A 2ZOMA 5EHHA 1X4DA 2VQEF 2YH1A 4WU2A 2MZTA 1T7PA 2ROEA 5E33A 4LIRA 1NJYA 3PV8A 1G2EA 4RU9A 4RW6A 3HHEA 4PQUB 3I82A 4RKUC 5K14B 3T1HF 2YKMB 5J2QB 1AFIA 2YKNA 3H40A 1C4AA 2MQLA 1DTTA 4MKAA 1NAQA 3K8WA 4YB1P 3CEDA 3G8QA 4OIXA 5J2MB 3UD3P 1HWUA 2HLUA 4ZPTR 4WIIA 2J7WA 2JEJA 2OTLS 4ELUA 1VLYA 3AA9A 3ZZOA 2LQ5A 4PWDB 2KM8C 2IYIA 4PG7A 4RW9B 1RT5B 1HPZB 1VOMA 3UI3A 2BXJA 3VAJA 4FF2A 4IOBA 1NK0A 2ASLA 2V4RA 3PY8A 3NS5A 2RQCA 4HI1A 1U2FA 4FXVA 3K5MA 3V4MA 5KT2A 1HMVA 3KK3A 2W9BB 4LIWA 1FXDA 3UDLA 3H2LA 2FHJD 3B78A 3DM2B 2CJAA 3MR2A 3DI6B 1TKTA 2ZBCA 3KYLA 3CDEA 3M8SA 2V2KA 2JX2A 4LMZA 4NZ0A 2DBBA 3UWTA 5J1PA 1HBUB 1R8AA 2Z2MA 3M2UB 4HDGA 4K4XA 5IZHA 2ZNYA 5I4MA 1G1XA 1YBAA 2GO9A 4A8FA 2EFQA 4RW4B 1Y7PA 2C2RA 3IO1A 5KG5A 1HWKA 1HNIA 3Q23A 3KJVB 3MEKA 1SJ4P 4DV1F 2CQDA 3NRBA 2HHTA 4OI6A 2VQFF 5IWAF 1ZPVA 1TAQA 1K0TA 5AXMA 5A8KB 3K57A 2OPPA 1XN9A 3SQGA 2L9WA 4DL5A 1V9OA 2MQNA 3AJ1A 1U7LA 3CD0A 3L09A 1H2TZ 1IKWA 5EWFA 4DUYF 1U4BA 5HROB 3E2EA 3V6KA 3MM9B 2B9YA 4N47A 3V6JA 4B3OA 5DETA 1YVFA 3MMAA 1C2PA 1REVA 2HHPA 2ZM6F 2JVRA 4C0OC 2ASJA 2M8DB 4NLGA 4QWCA 3MMCA 2E5IA 3AAWB 5F8LA 2OFGX 1GXTA 3HJFA 2A10A 5F8NA 5A8RB 1DURA 1RT4B 4C0BA 3KFWX 3FRZA 3H98A 3ITHB 1HI0P 3KLEB 3G6VA 1D9AA 1QJHA 2W8KA 2DHAA 2DGUA 4XPEA 1H6KX 4JUZA 1OQ6A 1U1QA 1NB7A 2R8KA 2VG5A 4WE1A 2JVOA 4PG6A 4V19X 4BHQA 2N7CA 5B0DA 4CO2A 1M0SA 3DRPB 2M7SA 3GYXB 4MIWA 4A8KA 4IRDA 4PG8A 4MIBA 1SL0A 1U45A 2RDIA 2LLZA 2WSEC 4F2SA 1LK5A 4YR2A 1YGYA 1Q8BA 4LVOP 1RT7A 1S6PA 3M8QA 2HQ3A 5CA5A 2MSTA 2FJWA 1OQ3A 4ZKAA 4DV3F 1AFJA 4JI1F 1UW4A 4ILLA 3CUNA 1TP7A 2OJ3A 1WHYA 3AQOA 4J9SA 2IMWP 4ZVHA 1U6BA 4QR2A 3DLEB 1Y0HA 1Y3KA 1JXEA 2E1RA 4K5RA 4NCGB 3KHRA 2FHKA 2MZQA 4WZMA 2IM0A 3SFGA 3A8EA 4ICLA 3RTVA 3L95X 2YKPA 3AB4B 2W9CB 2QIFA 3EZUA 1HNVB 4TNOA 3QGIA 3ZC4A 1KLMB 4X4NA 3F56A 2KN4A 4OZJA 3NS6A 2ZNZA 4MH8A 5GVQA 3PIOQ 5B0FA 1Q53A 5GAGU 1NHUA 3IRXB 5HMYA 5EWGA 2YTCA 4FP9A 1QLNA 2LDYA 2FVSA 2MZSA 4NLOA 1GX6A 2L9NA 3BGFA 4QW9A 1VQYA 2IHR1 2F8HA 1S1WB 5JVGQ 4GKKF 1L3TA 1U2RA 3ENWA 1X9WA 3NBPA 2V4JB 4X4SA 2DPJA 1X0PA 4JI3F 4Q8EA 3EGNA 1X5PA 2ZJRQ 5FDLA 3HHNB 4QWBA 2MYFA 1RAJA 4WFAQ 2HMIA 4JI4F 4OV1A 5F41A 3DCAA 2EC0A 3CDWA 2RVJA 1L3KA 3D1HA 4KRWA 4F67A 1F5CA 1Y00A 1UA1A 4DQSA 4B9UA 3TAMB 1HBMA 2KH9A 2FHJA 4I1TA 2HS3A 1OPIA 3HHLA 4EZ6A 3FSIA 3OL6A 4DF4A 1VI7A 4I69A 2IA6A 3BO3A 3PKMA 4MJKA 2Q6BA 3GV5B 2DVIA 2BBEA 2EPIA 2YNHA 2YWEA 3OJSA 1UVIA 1TV6B 3J7ZT 1C0TB 2BUNA 3DDKA 4X4VA 1NU4A 3CTRA 5L9NA 4MFBA 2ZE2A 3DLKB 4WK1A 5B0AA 3RBEA 5HP1B 4UQGA 3B4MA 3KLGB 4IO1A 1H7XA 1N88A 3JSRA 3US5A 4JV5F 4YOEA 1TKXB 4ZVGA 1ZM4A 3LW5C 4TKTA 3I56S 3LQVA 2DHSA 3HHKA 1R31A 2NUHA 3F73A 2ZH3A 2N3OA 1FERA 3Q22A 4ED1A 4F4KA 5CYJA 4ZVFA 2VFTA 5J2PB 3P6YC 4Y2CA 4PQUA 2Q3PA 1TQLA 1N6QB 3B4DA 1SV5B 2HG4A 2HIQA 2YKMA 2GMJA 2IVYA 2OPRB 3FSXA 4N77A 1DQAA 4URQU 1BQXA 4RNFA 1NH8A