2MZ1A

Solution structure of hnrnp c rrm in complex with 5'-uuuuc-3' rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords Heterogeneous nuclear ribonucleoproteins C1/C2
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mz1A00
1D9AA 2M0GB 2JWNA 4WFNQ 2DGSA 2XNQA 2CPHA 2MHNA 2DIVA 4W90B 1X5OA 1M90T 5DM6Q 2M70A 2CQPA 3DLLQ 2KM8C 3TO8A 1SJ3P 2PEHA 4IOAQ 4W92B 2XS2A 2MKCA 5EN1A 2N7CA 2ZJRQ 1WI8A 2LECA 2KI2A 1K8AT 3CXCR 1VQPS 2KRBA 1WG4A 3RW6A 3CC2S 5DDOC 1AUDA 1HL6A 2CPJA 3G8TA 5LSLA 1JJHA 2KVIA 2MSTA 2OSQA 3U1MA 2M8HA 2MYFA 1M5VC 1SJRA 3BS9A 1WG5A 4PR6A 2K8GA 2E5IA 3CCLS 1PGZA 3VAMA 1RK8A 3G71S 1VBYA 2UP1A 2J0QD 5CYJA 2N3LA 3J7ZT 5JVHQ 3G4SS 5IFMA 3CCRS 2HVZA 3NNHA 2XSFA 2KN4A 1VQOS 1JJ2R 3UCGA 1X4GA 1XN9A 1U1KA 3MI7X 3CPWR 2CQCA 2DHGA 3US5A 2RUGA 1U1PA 2DHAA 2DHXA 3VAIA 1FXLA 3ULHA 1DZ5A 2X1FA 3CD6S 2BOPA 4FXVA 1O0PA 2MXYA 1RKJA 1YWXA 3CCVS 1FT8A 4QU7A 1FHTA 4IOCQ 1L3KA 1QVFR 3MURP 1U6BA 1WHYA 2M9KA 1X4AA 2B0GA 1FJ7A 4BS2A 1YJWS 1UFWA 1U1LA 1Q82T 3B4DA 2VOOA 2NLWA 1K9MT 2LYVA 2CQ1A 2L9WA 1JJ4A 4Y0FA 1Q7YT 2KHCA 1M5PC 3PIPQ 2CPZA 4C4WA 3SDEB 1WWHA 3CTRA 1DRZA 4ED5A 1DHMA 2NZ4A 2AD9A 2J0SD 2EK1A 2KRRA 2CPDA 2CQHA 2DISA 4QQBA 2DGTA 5LSOA 3VAFA 1VQLS 3BO4A 2MGZB 4PRFA 3H2VE 2E5GA 1SJFA 5H1SV 2DNQA 2CPXA 2JX2A 3LPYA 3G9CA 4U67Q 2CQ4A 2JRSA 5FJ4A 3NNAA 1IQTA 2V94A 4CIOA 2HYIB 5DETA 1WHVA 1B7FA 1JMTA 5CXTA 2AYEA 2DNPA 1F9FA 2M88A 4LIRA 5DDQC 2M4MA 2MZ1A 2M8DB 4IUFA 2AYBA 2F3JA 2RQCA 3U1LA 1VBZA 2CPFA 5JVGQ 1OIAA 3S8SA 3DXBA 2MZJA 3I55S 3NS5A 3LQVA 2A3JA 5HO4A 2KG0A 4F25A 1U1RA 2FPHX 2Q79A 4UQTA 3VAJA 3THTA 5GADU 1VBXA 3H2UB 3MUTP 2ZJQQ 2JVOA 2MMYA 1A7GE 3UE2A 2FY1A 3SDEA 4ZKAA 2CPIA 3THPA 1OPIA 2MKIA 1U6FA 2DH8A 1M1KT 2DH9A 4FXWA 2X1AA 1S72S 3CF5Q 2MQLA 1N54B 2CQIA 3NMRA 2KG1A 2LEAA 5IQQA 2MB0B 2MY7A 2QEXS 2SXLA 2DNRA 5GAGU 1VQ5S 1FO1A 2KT5A 1WELA 1X5SA 4TLQA 4ERDA 2OTLS 3B4MA 2D9OA 2MQQA 1VQ6S 2DO0A 1H2VZ 4YB1P 1X0FA 5CA5A 2RVJA 1WI6A 1WEYA 3P6YC 4QU6A 3P49B 4QPTA 3VALA 1WG1A 3Q2TC 2LEBA 2XS7A 4WFAQ 2D9PA 1FJCA 2QA4S 2DNZA 2RQ4A 1W2BR 3CMES 3EGNA 1YITS 3CCMS 2DGQA 5IM0B 3IWNC 1VC6A 2CQGA 1QM9A 2I2YA 4EGLA 3CMAS 2AYMA 1VQ9S 2KFYA 2CQDA 2LXIA 2DO4A 1X4BA 2VONA 1A9NB 5GAEU 3G8SA 2J8AA 3R27A 1S79A 2E44A 1Q86T 4CH0S 1M5OC 1NU4A 2DGOA 2MY8A 4F26A 1X4HA 3MXHP 4WF9Q 2DNKA 1DBDA 2MZRA 2LQ5A 4RU2A 4A8XA 1R8PA 3G96A 1YJNS 2F9DA 1VC5A 3K0JA 3CCSS 3CCQS 1N88A 1SXLA 4C0OC 3JB9k 1OO0B 1UW4A 3P5TL 5LJ5Y 3P3DA 1U1QA 2MQOA 2RS2A 2MQNA 3UCZP 2HZCA 2CQBA 4CQ1A 1VQ4S 1YI2S 2KH9A 2KYXA 3MDFA 2MKSA 2MGZA 3R1HA 1N8RT 5BJRA 1SJ4P 2E5JA 1X5PA 2YH1A 5D78A 1VQNS 3UCUP 2RU3A 2KXNB 2D3OR 2ADCA 1VQ8S 2DNMA 1WF1A 1U2FA 1X4EA 3TP2A 2MQPA 5DDPC 1NJIT 1ZZFA 1G2EA 1YIJS 4V19X 2QFJA 3EGZA 2EK6A 3CCES 1UAWA 1P27B 2G4BA 2CQ3A 2MKJA 1HD0A 2M52A 4C7QA 3R1LA 4TU7A 3BEGB 3MD3A 2O3DA 3VF0B 4PKDB 5GAHU 2YTCA 2YH0A 2MZTA 5D77A 2N82B 2MQMA 1P1TA 2JVRA 3S7RA 3MUMP 3UD3P 1ZZNA 2DNNA 1QVGR 3Q2SC 2DGVA 1YTYA 1KD1T 3NS6A 3ZZZA 1BY9A 2RRAA 1KOHA 2DITA 2LA4A 4J5OA 1WF0A 1N52B 2HGLA 5ITHA 1OWXA 4IO9Q 4LJMA 1NO8A 2DNHA 2EVZA 2N3OA 1R8HA 1H2UX 2DHSA 3J7YU 1URNA 3SXLA 3PIOQ 1YJ9S 2CQ0A 5LJ3Y 1KOOA 2J76E 4P6QA 2M2BA 2OJ3A 2MKHA 1HD1A 2X1GA 2DH7A 3FEXB 5MLCV 5IM0A 2LXUA 1K73T 1H6KX 2MZSA 1VQ7S 2LA6A 5LXYA 4YOEA 5DDRC 3N9UC 3HI9A 2VOPA 3NNCA 4LMZA 2X1BA 2PE8A 1H2TZ 5GMKa 1VQKS 1Q81T 4YUDA 1WTBA 4Y00A 2MZQA 1WEXA 2LKZA 3CULA 2AYGA 3VAHA 4WCEQ 2G1DA 3BO2A 2E5HA 2WBRA 3MUVP 3IRWP 1U1OA 1KQSR 2MPUA 2M7SA 2DB1A 2XS5A 2HGMA 3I56S 2DK2A 1VQMS 2KXFA 2OIHA 1WHWA 2I38A 4F02A 1ZH5A 1X4DA 2VODA 4WIIA 2L08A 3S6EA 2DNGA 1UP1A 2L41A 2CPEA 1HA1A 2KM8B 1CVJA 1SJQA 4OZ0A 3TYTA 1FNXH 2KU7A 2FC8A 2MKKA 1FJEB 3ZZYA 2CQ2A 3FEYB 2F9JA 5LXRA 2G0CA 2MJUA 4Z2XA 2YKAA 2YWKA 2DNYA 3CCUS 2CJKA 1U1MA 3CC4S 2FC9A 5GVQA 2U1AA 2MSSA 3UWTA 5HL7Q 2XNRA 3VAKA 1X4FA 2HGNA 2KXHA 2XB2D 3BO3A 4TU8A 1KC8T 2CPYA 2LCWA 2K3KA 3CCJS 4WFBQ 1D8ZA 1WHXA 3HHNB 2ZJPQ 3VAGA 4M5DB 1VC0A 2LMIA 4WKRA 3CUNA 2GO9A 2RRBA 2ERRA 3UD4P 2GHPA 3CC7S 1YHQS 1WF2A 3EX7B 1PO6A 3D2WA 2DIUA 4CH1A 2DGWA 2BZ2A 3OW2R 2RS8A 2RNEA 1X4CA 2DGXA 2OSRA 2MJNA 4UY8T 2DGUA 2OTJS 3MOJB 2U2FA 3V4MA 3SMZA 1X5TA 4TU9A 3S01A 1U1NA 5DM7Q 2FHOB 3RW7A 3G6ES 2RT3A 2ADBA 4OZ1A 3L3CA 3MD1A 2DNOA 2DNLA 1M5KC 1WEZA
chains in the Genus database with same CATH superfamily
4USMA 5CH7B 5HMZA 4KR0B 4F4KA 1W25A 2PO4A 2RKIB 1J5OA 4E0DA 4NXMF 5IC6B 2B4VA 4Y2AA 5KFFA 1FTRA 4PQUA 3J81Y 3THVA 2XNQA 4F36A 2MHNA 2R3VA 4ED8A 2HFSA 2R2RA 1GH8A 1J5EF 2DIVA 1X5OA 2J7UA 4YB7A 1QAIA 3DLLQ 2KM8C 1UFKA 2WAQD 3RB0A 1UZHA 1SJ3P 1HBUB 3C14A 5KG1A 2FZCB 2NXJA 4TKTA 1TP7A 4JOUA 2CZ4A 4MKAA 2HNDB 5A6WA 5L8RC 2ZJRQ 4RWWA 3R5AA 1WI8A 1OYEA 1TVRA 2LECA 1K8AT 4OHZA 3CXCR 5C2GA 1VQPS 2KFZA 3M30A 1WG4A 1N32F 1MN9A 5F8JA 1HI1A 2B8PA 4DPWA 2BDPA 1C0UB 1IR2A 4EO6A 3DYAB 3RJMB 3BYRA 4Q0BB 2LXFA 2IM3A 1X7VA 3SQOP 1RKIA 4FNIA 2GGPB 3GILA 2CA9A 5LSLA 4FP9A 2KVIA 2BM1A 2XY7A 1VLOA 2HS3A 3K57A 5K8OA 3MM5B 2MYFA 1SC4B 1UKUA 2F65A 1CPZA 1SJRA 2XEXA 3R6LB 1U49A 1F3FA 4PR6A 3CCLS 4RZRA 1FE4A 4ZPTR 3DCAA 4QWEA 4J9SA 2MLZA 1PGZA 2XMAA 2ZEJA 4DV0F 4LF9F 3DHWC 2VA3A 3NAIA 2P2CB 3HM9A 2J0QD 1ITPA 2N3LA 3R6GB 3J7ZT 3RZAA 4DDFA 3ITHA 3LANA 4IO1A 4CLPA 1YJ9S 3BN7A 3GR0A 5IFMA 4LRAA 4DN9A 3J7Z5 3D1HA 4MK7A 4DR6J 2E5LF 1ROFA 2HVZA 4P7TA 5J1NA 9ATCB 4PXEA 2KN4A 1SUQB 2KL8A 4DWIA 4PUOA 1TU0B 5B08A 4S0MA 1C2PA 5KT4A 2P9GA 5LMNJ 3DOLB 5KFQA 3MEDB 4A8YA 3GFZA 2IY5B 3BGLA 1F5CA 2V69A 5KTQA 2HHXA 2VKZG 3NGRA 2ABYA 3ENAA 2DHAA 4KHMA 1R27B 3W62A 3VAIA 4DV7J 1FXLA 2JEIA 1GTEA 1UVKA 3PJ9A 4JV1A 2G1HA 4ED2A 3ZTPA 5I3UB 1DZ5A 3G4SS 2DXDA 4J9LA 4RNFA 1N36F 5GAGI 4RBVA 1X60A 4XIUA 1BUXA 4D3GA 3CCVS 2DR6A 5J2NB 1DQ8A 4IOCQ 4Q2LA 3VTIA 1TL7B 2HIQA 5AXNA 1L3KA 4OJ3A 4LR7A 5KFNA 3KLEB 1QVFR 1B64A 5LMUJ 1RQ0A 1KTQA 1FXDA 2VG5A 3MR3A 1S10A 1T02A 1TL4A 1I5OB 1KBRA 2KJWA 4H4MA 3GJTB 1CJTA 1WTFA 4F4YA 1YJWS 1Q82T 3B4DA 1TKZB 2VOOA 5EGYA 3CD7A 3QRRA 4U6PA 1BQXA 4FKXA 4ED6A 2CNOB 2YKOA 1AYEA 2YNFA 4B3RJ 2V4RA 5I42A 1Y0HA 5T7LB 2POKA 2HQCA 3C66A 3ZZ0A 1NH7A 4KHPJ 2ZH3A 1RAOA 1M5HA 5K8NA 1WWHA 1Y5LB 2VU5A 2C3YA 1DRZA 4ED7A 3N28A 3CJTA 4BLGA 1SL0A 3RBZA 3CD0A 3PRBA 1LW2A 1U8SA 4YB5A 2I6WA 4L3NA 4OI0A 4HL9A 2DGTA 4RW7B 2E1PA 4PRFA 1HIYA 4DV0J 4LF9J 5ETMA 2E5GA 1WSRA 1REVB 2P8IA 3AOCA 4ANDA 3LWLA 1IBKF 2EXUA 1SPBP 5HN0A 3ZZTA 4DL2A 1SJFA 4ELVA 4DF4A 4LF5F 5HVGA 5LT5A 1FNOA 3DRRB 1MWYA 3GLJA 3NBPB 2AHOB 4MKYA 2CPXA 4RU9A 3HJFA 2P9EA 1T9YA 2YXLA 2AJ1A 3CIMA 1RWUA 3EZOA 3M4XA 4P73A 4WJBA 3SV4A 3H2LA 3FZBA 2QT7A 3G9CA 3KK1B 3EZ5A 2ATLA 4LFCJ 5E5NA 3R8YA 5AJ3F 2HYIB 3D6MB 4U95A 4LSZB 1WHVA 1CULA 4L76A 4ID5B 2RIJA 3SEOA 5CXTA 3DRPA 3TUIC 4EZ6A 2IDEA 2ILYA 3GU0A 2AYEA 1E6YA 2CZVC 4LSNA 1F9FA 2RILA 4C8LA 1CJUB 4WYWA 1NXIA 2CFXA 2LDYA 4LIRA 2M4MA 4K7QA 3VQSA 5DDQC 2MZ1A 3TANA 4NLRA 3GJSB 4IUFA 4OYWA 3CJKB 2AYBA 1UVJA 3Q8QB 2PN6A 2RHSB 2RQCA 4OJGA 1NSQA 1T9VA 2IJRA 1PYOB 3U1LA 7FDRA 1VBZA 4IQXA 3M8QA 2DEIA 1VRTB 2VJVA 5D0EA 1LXJA 5KT2A 5C7PA 4JI6J 4IH5A 1LK5A 3DN9A 1S1UA 1ZPVA 4QIWD 4ZS6A 2ZH5A 2KG0A 4F25A 1N34J 2ALYB 4X4RA 3I31A 5KFYA 4UQTA 5DGBA 3W66A 2VD3A 4NE9C 3Q8RB 3QRQA 4IKAA 4WK1A 5GADU 4K4YA 2GGPA 2XO6A 1VBXA 2OPSB 3PYGA 1B0VA 2ZJQQ 2JVOA 3KJVB 1D0EA 3OFFA 4HACB 1RHUB 3OXFA 5KFVA 3IG1B 3UFCX 3M6UA 4KPCA 2W4DA 2ZDPA 1OPIA 4OYAA 1EQMA 4RW9A 2OD6A 4EFAC 4URGA 3G6YA 1YK9A 2IYGA 4G1PA 2HHHF 3HZGA 1U02A 1U6FA 1BC6A 2DH9A 1GXUA 1XQIA 1EIYB 1XNQJ 1H3DA 1D09B 3CF5Q 4F50A 4EU0A 2KG1A 3QPIA 4Y28C 1D8YA 3C46A 1RCOB 4ZVUB 3PR5B 3SSSA 2IYIA 2MB0B 3R5BA 2SXLA 3IWXA 3BF4A 4A8OA 3GSIA 5GAGU 2ZWPA 1R8BA 2KT5A 3GIMA 2E1CA 1IKVB 4KGZB 3PY8A 1VGYA 1TKXB 3M1VB 4YDXA 1QAYA 2HBYB 1CC8A 1GXLA 2E1AA 2OEMA 3E01B 4JYAJ 2ZH8A 2FY8A 5CA5A 1RBLA 1U6ZA 1WEYA 5G0RB 4LF5J 3ZZPA 1MNEA 4ICLB 3P6YC 1WC0A 3PYDA 4CWBA 3IGVA 3Q2TC 2LEBA 1JLQA 2HLUA 2DR5A 4C8OA 3ETOA 4WFAQ 3MMJA 2EC2A 3K7RA 3TX0A 2QN6B 5CD4A 2QA4S 2OP5A 1JLAB 3PO5A 4PXCA 4GVLA 1W2BR 4Q8FA 1Z4UA 2C1EB 1LWCA 1PAUB 3CE8A 3RG6A 1MW7A 3P96A 4WKYA 2WVDA 5DO2A 4NPOA 4I0WA 2XWXA 5F8MA 2CQGA 2UXCJ 2ZITA 2XI3A 3NCQA 1F9HA 4MIWA 2UUAF 4HH0A 4ENOA 1WC4A 1WSVA 3PJWA 4ILRA 3TRGA 2KFYA 1VQ9S 2YWGA 2VB6A 4JI8F 3M6XA 4Z7YA 2LXIA 1FE0A 1AZSB 3SFGA 2XI2A 5GAEU 1UEVA 4DV2F 1N0UA 2XMWA 3P45B 2GA7A 1QAJA 4NYPA 4URSA 5JMNA 1RT3B 4O44B 1LW0A 2AZ1A 4H4KA 2BKPA 3LGMA 1XNRJ 3VVUA 3C16B 2DGOA 1F0XA 4ZVEA 1X4HA 2Z4PA 3MAHA 1SI9A 1VCTA 2DNKA 4NI2B 4F26A 2BE2B 3CMQA 3UN3A 3UPFA 2VJUA 4K4WA 4RU2A 4ITSA 5CCMA 1LW2B 3WQPA 1J2VA 1S48A 1FRHA 3K5PA 4NLWA 1BQNA 5KFUA 5AE1A 4FPRA 3J81U 4I1TA 1R6YA 1VC5A 2EC0A 4GO5X 3AJ1A 3K0JA 4IH7A 1RTDB 1REVA 4I6WA 4P74A 1OO0B 1UW4A 3KLGA 3W2VA 2ZH6A 1PYSB 3KUHA 3P3DA 2WK4A 4HKQA 4BCAA 3BSNA 1IKWA 2MQNA 4NOHA 1RT2A 2OI2A 5CABA 3Q8SB 3MPYA 3UCZP 4F4WA 1UJ6A 1VLYA 2HZCA 2QA2A 2XG8A 3PEHA 4EK2A 1VQ4S 4DR6F 1RI7A 3N0VA 1N8RT 2R2SA 4N41A 4OZ3A 2KFNA 1Y7PA 2F4FA 2CDRB 1F3VA 4FNHA 4KKOA 3V6DB 2Y0SD 3MCOA 4J9PA 1RB0A 1RT5B 3ET6A 4N8NA 4JI0J 4DR7J 3KWMA 4KFBB 5DRKA 4K4XA 2YNIA 2FB0A 2HFUA 3F0NA 1TV6B 3FKBA 4PQAA 5FIIA 4YR0A 5KG5A 2GS8A 2YX4A 4XPEA 3RB4A 4KGXB 1WF1A 2ADCA 3CJ3A 2WVFA 4WFZA 1P8GA 1N33J 3TP2A 4OZJA 4HR2A 4FS1A 5HANA 4NXMJ 4H54A 2W9AA 1UVNA 2Y8YA 1ZZFA 1IKYB 3ELHA 4LSLB 1SV5A 4P9SA 3OJSA 4NLVA 1TUVA 2NXNA 2QFJA 2R2TA 3LAKA 4IG0B 4KO0B 4Y2IA 1R31A 4USJC 5IT9Y 2C3PA 4ID5A 3CSKA 4DV1J 1URRA 1UAWA 4DR2F 4IRDA 4NLUA 4K5RA 4C97A 1E6YB 2DXEA 4IFYB 4LSNB 2HNYA 3R5JB 1Q78A 4RLEA 4ED4A 4ZCMA 4DUYJ 3PW7A 1FRKA 2QMXA 4C8MA 4C7QA 2R8GA 1JLFA 2NCKL 1Q53A 2GQCA 3MCMA 3WBZA 2Z58B 4TU7A 4A8SA 1I94J 3O1LA 1NJZA 5CQGA 5CD4H 1OSCA 3TR5A 2O3DA 4N5SA 4C6AA 4X66F 4PKDB 3T5JA 4DFKA 3KJFB 2P6SA 3RBXA 1BWVA 3QQCD 3BDPA 3M2RB 2MZTA 3CO9A 2EG2A 3QZ8A 2XSJB 4J91A 3EXYA 4OIXA 2N82B 3X3UA 3OLBA 4IR9A 4ZPCA 1R8AA 4YQWA 3C8YA 3LPEA 1ZZNA 4FF1A 3SCLE 2DNNA 5CZXA 3UDLA 2HBZB 4RUBA 1T8EA 1XR5A 3DGPB 3H98A 1O5JA 4GMKA 3UW1A 3OT9A 3SBMA 3VGVA 2C2EA 2XMJA 2E9TA 2HVHA 3T1YJ 4TY8A 1HQEA 2R8KA 5E2QA 3CJRA 1N52B 5CYMA 2FVQA 1OWXA 1NBEB 2AV5A 3SQGB 5DQIA 3U27A 2N3OA 5C24B 1R8HA 2B51A 4LQ9A 3HSDA 2CWKA 3M7VA 1NK8A 3TVYA 3PJXA 3I5CA 3MM6B 4RNHA 3KTQA 1YRXA 2O5DA 1FKAF 1KOOA 1HNZJ 1HNZF 1HQ2A 2OJ3A 1NB7A 3E01A 1HBUA 1FFGB 2NSCA 2X1GA 3C14B 1LOUA 3OL6A 3FEXB 3QJLA 4KTQA 3R5DA 4ZVTB 2LXUA 4C4WA 3M2VA 3I96A 4DUZJ 3QGGA 2MZSA 3RRKA 2LA6A 5LXYA 3IMQJ 4YOEA 1JLQB 5DDRC 3JSBA 3LP1A 2AU0A 1FXRA 3N9UC 5A2QY 3M30B 5E3AA 3TQEA 2Z8QA 2R9LA 2HAFA 2KYZA 2R7SA 3HSJA 3D28A 4LMZA 3W9JA 3BZQA 3E3XA 4PABA 5JJBA 1Z2LA 2HHQA 2AMCB 3PM9A 3V5RA 1WTBA 4ECYA 2QMUB 3JTOA 2MZQA 1AFIA 4WF9Q 1V9OA 3QAEA 3AB4B 2BW2A 2IFXA 4MIAA 3BKUA 3P4UB 3VGTA 4N8OA 3NLCA 3LWMA 2GVDB 3WX8A 5IOLA 3OSNA 2GW8A 2E5HA 2Y3YA 3HP6A 2YPYA 3MUVP 1L3SA 3GV7B 1B99A 2V34A 4ECSA 1QUVA 2BE7D 1WKJA 2R4FA 4YB6A 5D4OA 4IRCA 2R8JA 2B4OA 3C3LA 2P5VA 3M8SA 2QG9B 2X3GA 3I56S 1VFJA 2DK2A 2PA8D 1SIWB 1CC7A 3AH6A 2BABA 3KG1A 5IV4A 2JEGA 3LF0A 4K4ZA 4E98A 3KLVA 4LVNP 1FVQA 2OPPA 2KXFA 1M5SA 2OEKA 2KKHA 4KAIA 3W5XA 2OIHA 4F02A 3EGWB 4O3SA 4KHPF 4WU2A 4WPAA 1JKHB 4UUXA 2Z2ZA 3MEDA 3FCHA 1KR4A 3EVMA 1UP1A 2Q66A 1FF2A 2CPEA 3UD5A 3MURP 2J5AA 2KM8B 4K2JA 3GV5B 3EVWA 4EEYA 2F5GA 5A8KB 2JOQA 2YY3A 3M32A 4PYAA 3W8GA 3CJ5A 2UUTA 3NXZA 3QGIA 3R5GA 4K2XA 2KU7A 4DG1A 2CJKA 3M6VA 4O3RA 3K89A 1FJEB 2HRYA 3M8ZA 4U9RA 3TJ9A 1UETA 1S99A 2D3UA 1RT2B 2YKAA 2DNYA 4TN2A 5DZ7A 1T9WA 1FRXA 2FC9A 4U7CA 3CCUS 1NK6A 1D1UA 4DR4J 3KOAA 1NJYA 3QNWB 5HL7Q 1UWAA 1XK8A 4Y3CA 4ZPBA 4OX6A 3VAKA 1X4FA 4I2PA 4NLPA 4JV0A 1U4BA 2VUGA 4YN3B 2Z0GA 4LBPA 2FHJD 2L9NA 3JS9A 3MAAB 3PEJA 4LSLA 1CJVB 3DMJB 2HLTA 2J0XA 7FD1A 4RNMA 2WONB 1D8ZA 4KFBA 1WC3A 3FFIA 2ZJPQ 3DLGA 2YNFB 2N4DA 1IQZA 4MIBA 1YQHA 1KDNA 1YJRA 3FCVA 3OL7A 2ERRA 1T11A 3RBEA 1TFWA 3OLAA 1UA0A 4ECQA 3EX7B 1HWIA 2CZ9A 4IRKA 2W4PA 3DLEB 3D2WA 2NXCA 5B09A 2V8GA 3V4IA 2DGWA 2V2QA 2YNHA 4ZVFA 3OTOJ 2LQ8A 2J9DA 4U8VA 2VA2A 2OSRA 4DQRA 2DGUA 2UZAA 4IFYA 3EDQB 3MOJB 4U7UD 2BRKA 1N0VC 2VFRA 1RACB 3SMZA 4LIWA 3V4MA 1SQEA 1VYAA 1X5TA 4TU9A 2CRLA 1U1NA 1NHVA 2FHOB 4CO4A 4AQYJ 5F41A 1A0OB 4NEZA 5KFDA 3MM9A 1DTQB 4PXBA 3L3CA 1N5QA 2D7SA 2VPYB 4RJVA 5E3QA 1N4LA 2DNLA 1ZM2A 1M5KC 3OL8A 2RH3A 2E7XA 2XSJA 2AJ0A 4HI2A 5GMDA 2ZH7A 3ZZOA 1ULRA 4ZA1A 4WFNQ 4OYIA 2G13A 2QMWA 4YY3F 4V19J 3B8HA 2KTQA 4DR1J 2WVBA 2CPHA 3HO1A 2VFVA 4O3QA 4DS5A 3AXKA 2V67A 4GVBB 4PWUA 4F3QA 4X65J 5EDWA 4FVCA 3AJ2A 1K1SA 5KFJA 5KT3A 3BGFA 4GC7A 5HROA 3IBCB 4YR3A 2V8VA 4TY8B 3HULA 4IOAQ 4TLRA 4CO5A 2ACMA 4DXLA 1ZBTA 3SI8A 2QJ3A 1Y11A 4W92B 4PEOA 5F3TA 1RSCA 4RW8B 1RUSA 3M8PA 5C24A 1G6BA 4CLSA 2N7CA 1TL7A 3HVTB 1UTAA 5IT0A 3LP1B 2KI2A 2V2KA 4X64F 2W9CB 1T0TV 5KFGA 2W8KA 3NEKA 2A2DA 3OPKA 2HZAA 1FDNA 3DLKB 1XR7A 4CM2A 1CJTB 3U02A 5L39A 4EUVA 1UJ5A 3NGDA 1PSDA 2FLPA 1AUDA 3BQ0A 5HVFA 2ZOFA 2CPJA 2FZGB 3D1QA 5D4PA 3PYFA 1JJHA 1H38A 2MSTA 3KDNA 5THWA 5HMXA 4WE1A 4UF4A 3UNYA 1DY3A 4FYWB 3FGVA 3OVBA 4EWTA 3N01A 4TYAA 2BRLA 2HAIA 5AXMA 3W2WA 3UN2A 1M5VC 4NZ0A 1QSLA 4JI1F 5ETPA 1CJKB 2RDJA 2E5IA 4C3MA 2IRUA 4O3PA 3GWCA 3QYYA 1I3OB 1RXOB 1SQFA 5LMUF 1RK8A 3FSYA 3GE9A 4PWDB 1NCLA 4NLQA 1N5SA 4ED1A 2RQMA 3FUYA 4K5SA 3Q8PB 2DVIA 2CG8A 1S6PB 3GYXB 5JVHQ 3HFVA 3MR2A 2AX0A 1ZTTA 2QTWA 4ZVOB 1PAEX 1FFSB 1AUSL 1S0OA 2K7KA 2UXDF 2KVQE 4DX5A 1ZAXA 3IXQA 2XSFA 4ZK7M 4DV6J 4U7UK 3ZTOA 2VBYA 4DPTA 5LSRA 1JJ2R 3ISND 4H4OB 3UCGA 1TMJA 1G7CB 2OPRA 3MI7X 3GG0A 1BLUA 4KC5A 3HVWA 3TUZC 2IM1A 3Q86A 3HT0A 2ASDA 5DG8A 4ZPAA 2NSBA 2J6UA 1HQUA 3LGHA 1U1PA 2WVEA 1KRPA 1RBAA 1VQSA 4LRBA 3CDUA 3I87A 4DF8A 1HNWF 1U2CA 4MH8A 4USVA 2KO1A 5B0FA 5A8KA 2QGFB 5C2CA 1OY9A 5G4DA 2X1FA 1FEHA 2V50A 3G82B 3MPVA 2BOPA 1FDBA 4L72B 4FXVA 1O0PA 1XMBA 3K5OA 5I3QA 5BR8J 2E66A 1YWXA 2R7XA 5BR8F 3CB4A 1BMQB 4QU7A 1T3OA 3NG8A 1X0PA 4WXOA 3KLHB 1IBMF 3BGUA 3PR4A 1IJEB 1FKOB 2JC1A 2LU2A 1OMSA 3PACA 1G4CA 4RW4B 1KEKA 2W2OP 3X1LB 1NH8A 2OELA 2GAHC 1S9GB 3N4WA 1KQKA 1X4AA 2B0GA 2XMTA 1FJ7A 1VRUB 3GMGA 3K2YA 3BR9A 2CXEA 1UFWA 1HNXJ 2HW3A 2ZKTA 3U1NA 2ZZMA 4NLSA 4U8YA 1PILA 1Q5VA 1S1TB 4NYOA 5KG7A 2DCLA 2LYVA 4F3MA 1K9MT 1APSA 4ZJOA 2CQ1A 2PSZA 1RT3A 1E6VB 1Q7YT 1K0VA 2KHCA 3MGJA 2JZ5A 2F4VF 4FYVB 1YJVA 2Y1JA 4DR7F 1G1XA 1RTHA 5A2QU 4B9LA 1YRTA 4DJBA 3IG1A 4HI1A 5L1JA 4JI3J 4JI4F 4MAKA 3H5YA 3MR7A 1B70B 2HSEB 4PZVA 4O0NA 4ZN3A 3OUYB 3HT3A 2AD9A 1C4CA 2DTJA 2FJWA 1VQLS 2L3MA 5M2UA 2DISA 3T5LA 3A3PB 1F60B 1PBUA 3DU6A 2MGZB 2XGQA 2IA0A 1KFSA 4CRJA 1FVSA 5ETLA 3MR5A 3M9MB 1HR0J 3R5CA 5L1IA 3BM7A 3CGIA 4FVMA 1TKTB 4IH6A 1BQMB 1OY8A 5H1SV 4DL4A 1DFDA 3D6HB 2E9ZA 1ACMB 2HQGA 2FGOA 3CIZA 3WIUA 4X62F 2VFTA 3N5BA 2YBVA 1HBNA 3ILLA 3W61A 5E33A 4X4OA 1FI4A 1FJGJ 4RBUA 2CQ4A 5EX0A 5IWAJ 1JLCB 2ZBIA 4YHHF 1WUUA 2W2MP 5E3RA 5FJ4A 3NKYA 5SZTA 2QV6A 1TAQA 5F8IA 1U24A 2BBEA 2Z2YB 4PG8A 2XGPA 4Q5VA 2HG4A 2V6AA 3FEZA 1PG5B 1FK9B 5KFPA 1NM2A 3A8KA 4M5LA 2YWEA 1NK7A 2W4CA 2VDIA 2MQ8A 5K14A 1JXEA 4NLOA 5E3CA 3L7OA 1U2RA 2DY9A 5ETOA 5H9EK 1HNWJ 4OZ5A 1PC5A 1JX4A 2M88A 4PPZA 4QOTA 4ZLJA 4BBYA 1HHSA 2KHDA 2M8DB 5IV3A 4JYAF 1MWZA 2YPZA 3D0IE 3OTEA 5D0GA 4WIQA 1CS4B 2M3DA 2E1MC 2F3JA 4HLBA 3TVZA 3SCIE 3KK3B 4N76A 2AX1A 2VPZB 3D9BA 5JVGQ 2I8EA 1OIAA 4B3TF 2R2UA 4QIGA 1EX8A 3IR7B 4WP3A 4F67A 1C0TB 2CUYA 4HDHA 2A3JA 5HO4A 1UPMB 4YDDB 2FPHX 3QIDA 2Q79A 3BQ1A 1WDTA 5DS7A 4NLXA 1V3SA 2GFFA 3QWUA 5HI7A 3VAJA 2ROGA 4J9KA 1JLFB 2G2ZA 2HWTA 3HSZA 3PX6A 1LWFA 3QATA 3M8PB 3UNGC 2J6SA 1GMUA 3SDEA 2B43A 3THPA 3W2WB 2QL5B 4F4XA 3VHQA 4CLWA 4JI5F 3C15A 2VHGA 2UUAJ 4IR1A 2DH8A 2UU9J 4JI1J 2YKQA 1S59A 2X1AA 4ZN1A 4XAKA 1S72S 2BACA 3RRHA 3HHLB 4CYUB 1FCAA 3DFEA 3KHRA 2H65B 4LRFA 4A8QA 1GMWA 2CQIA 3ZTSA 1D3WA 3BGRB 1SKWA 2P6TA 2DRAA 1TR0A 2MY7A 2ILZA 4DV5F 4NZ7A 4B08A 3Q24A 4TLQA 1JLEB 1J27A 3BSCA 4M1KA 2APOA 2XCAA 2NQPA 1IKXA 2OTLS 4P10A 1BWEA 2YKPA 2RJZA 2DO0A 4PG7A 2LEPA 3KDOA 1KSPA 4HHJA 1RAHB 2Y1IA 1X0FA 5CYMB 1ELOA 1SJ1A 1EQ0A 3P49B 4CCHA 3VALA 3MOZA 2BVZA 1WG1A 1MMDA 3ENQA 3H0PA 3OTCA 2GJ2A 2G0IA 2AW0A 2C2ZB 4G1QB 1JK9B 3IN5A 1F9EB 1AFJA 1ZM3A 2HWIA 2ZD1B 3T9ZA 4Q43A 2UXBF 4ECTA 3QBCA 4IG3B 4ZVRB 1YITS 1X8DA 3N79A 5KFRA 4JP8A 3I9V9 3OR2B 1RE1B 4YY3J 3IWNC 1UW9A 2PT0A 3FSXA 5IXUA 3T1AA 1KLNA 2J7KA 2GZOA 2HQFA 5HMWA 2GMLA 2LQJA 1VHFA 2GVZA 3L09A 2NR0A 2I2YA 3AD8C 4DL7A 3QRPA 3CMAS 2EW9A 2YWHA 4FZVA 3GYNA 3DRSA 2EG1A 3K5LA 1IBMJ 1SV5B 3H25A 4ZP6A 1VRUA 2DO4A 4A8MP 1X4BA 1Y3KA 4R8UB 1NK9A 5J2MA 2PFFB 1A9NB 3W63A 1EETB 2BJ9A 5F8HA 3OSPA 3D66A 4C9DA 2AT1B 2YKMB 3TQ1A 2E44A 3IR6B 4I2QB 3HFZB 4WTOB 4OI3A 1Q86T 4J90A 3TJAA 2HMIA 3HHDA 4ZP7A 2V0NA 5FDLA 1LQ9A 3K5NA 2ZOGA 4M5MA 3CD5A 3VGUA 3HDSA 1KLMA 4DCOB 4HYKA 1X31C 2FTRA 1RAFB 3NL0A 4F3OA 2W7OA 1Y3JA 1V3ZA 1DBDA 4F4ZA 3OL9A 2MZRA 1R8PA 3DXSX 2R7QA 3GTYX 4OLPA 3PW4A 3QIPB 3IBFB 4ZHRB 4ZIWA 1HW8A 2F9DA 2Z56B 4CDIA 3IFEA 3BDEA 4OFZA 4LFCF 4X2BA 1SXLA 4C0OC 3JB9k 1Q8BA 5KFOA 3P5TL 2V4JB 3PTWA 2H51B 1CLFA 1NK4A 2FVSA 4PAAA 2J6TA 1FKPA 3TW0A 1YZ6A 3PYEA 2NYIA 4CQ1A 3HJVA 1YI2S 2KH9A 3ISZA 4B3OB 1R43A 3KLFA 1EKRA 4OJHA 2PA3A 1X5PA 3K59A 3PFEA 3PG9A 2CJXB 4ZVSB 1QD1A 4DG1B 4J9QA 2YH1A 1Q4RA 4YEAA 4Q0BA 4WP9A 3H59A 2I9SA 5CYQB 2ZM6J 2QLWA 2VBWA 5BYQA 3NRBA 3OXGA 3GIKA 2DJWA 5AE3A 2ZM6F 3EYZA 2XY5A 1X9SA 3FZ2A 4DZDA 3LH2S 4RKUC 3UO0A 3CCWA 4ILMA 3M2VB 1L5UA 3HF5A 5LM7E 1VBYA 1G2EA 1IBKJ 3MM8B 4YS2A 2R7UA 4ZCLA 1T05B 5J1EB 1FA0A 3TX8A 3GR1A 3EGZA 4X4SA 3SSQA 1FDAA 3UVJB 3BSAA 2A18A 5I3UA 1UCNA 2JLEA 4QW8A 4KGVB 2NXEA 4CT8A 2MKJA 2PEBA 4O3OA 5HBMB 1WNEA 2XYPB 4AE5A 4CLKA 5B0BA 2VQEF 3D3BJ 4DR1F 3R1LA 1SH2A 4ZIVA 1UWBB 3BKTA 1AXQA 4EYHB 2W7PA 1YJUA 3GPAA 3FJ2A 5J2NA 3MMAA 3MD3A 2E1RA 3NGKA 5D15A 2GVDA 3K58A 1LWEB 1S49A 5HJXA 1VRTA 4E2FB 2A0FB 1IBCB 1C0TA 5GAHU 2YTCA 2YH0A 4USKA 1T9UA 5D77A 2RUSA 3NAHA 2EFPA 1XMOF 3TEHB 4DCPB 2KT3A 3MUMP 3S7RA 4DR5F 4G65A 2BJEA 4KYZA 4WTYA 4X4UA 1SH0A 1XERA 2WOMB 1QTNB 2J9EA 2WW4A 5J2QB 1YDLA 5KFZA 2DGVA 3KJVA 1QVGR 2FQQB 2CJYB 2OMOA 4FPIA 1RHMB 4QBUA 1KD1T 1K0TA 3WHIA 3NS6A 3DDKA 4B02A 5M2RA 5HSPA 5C42A 1EP4A 3BPSP 3FBCA 1BY9A 1Q8KA 3C15B 1T95A 4MK8A 2W9BB 2RRAA 3TA1A 1KOHA 1L3VA 3BREA 2EBGA 1FRLA 1YGYA 3HVAA 3D3CJ 2BMBA 3I0SA 4LJMA 1N36J 2UVUA 2ZBQA 2ZBPA 2OGUA 4O4GB 5T41A 3W9IA 2I5JA 1CSJA 1V5VA 4G1QA 4KT0C 3SXLA 1ZAVA 2DKOB 4RW7A 3TAMA 3AB2B 2CQ0A 1DQAA 3A12A 4JI6F 1MG7A 3OFGA 1DARA 2J0WA 4WZQA 3M32B 2M2BA 3ILOA 2MKHA 1RAJA 4PG4A 1Y9OA 5HLFB 1YRUA 2IMWP 2PC6A 5IWAF 4OYZA 7AT1B 2DH7A 3D0GE 1IR0A 1KFDA 4ZCIA 3FBEA 5FLXU 1TKDA 2KB2A 1K73T 2HVIA 1H6KX 2IIHA 1RP5A 2OPQB 2D3ZA 1DAXA 5GAEI 1XBWA 4Q7AA 1S9EA 1N56A 1B4SA 2VOPA 2PI5A 4LQ3A 5E0OA 4FS2A 2CADA 3GV8B 4ELTA 5DG7A 2B56A 1Q81T 3I4HX 5ETRA 2R7RA 1NK5A 4Y00A 3PHTA 3MEEA 2AEMA 3GJRB 2PMHA 3W7BA 2E9RX 1HI8A 1WEXA 1HWKA 2J7WA 3JTNA 3LOUA 4ZLLA 2IC3B 4I2QA 4KJIA 3ZC4A 3V6HA 2AYGA 3PRVA 3N6NA 3CULA 4FF2A 4OL8A 1GMWD 3JQJA 4M5NA 3VGSA 2GV1A 3G6VA 2EI5A 5DG9A 1MU2B 3BKFA 4X4VA 1REGX 1S76D 1KQSR 2MPUA 3LAMA 3NCRA 1SIZA 4OZNA 2ZH9A 3GFYA 1BXNA 3I6PA 1SCJB 2RDIA 2V68A 4TY9A 1ZA1B 2QFIA 1S6QB 4IYQA 4GKJF 1NDPA 2YKNA 2Q43A 5JXSA 2HHWA 2HMIB 5IZHA 1JNRB 2QX0A 3K8VA 1U26A 5LMNF 2QIFA 5A8WB 1WHWA 4DL6A 2B6AB 4L6V3 1HPZA 3PW5A 1X4DA 3SFUA 3Q83A 3MM9B 3RBDA 1LXNA 4L3KA 4ZPDA 3MMBA 3S6EA 3DM2A 2L41A 1N5TA 1RHJB 4IQMA 3HCXA 1HA1A 1NHKL 3UN5A 4AL6A 3A8IA 5DGAA 1CVJA 3KHHA 2DPJA 2C22A 2CWXA 4LR8A 3AA9A 3TYTA 4XK8C 4DL5A 1S0NA 2FVRA 4JI2J 2V5HG 1FNXH 2V9KA 5KFLA 2W24A 3EZUA 2FC8A 3FBBA 4QYZK 3W5YA 1U25A 4DSEA 4B9SA 5KFKA 4QW9A 4QR0A 2XY6A 2F9JA 1KVIA 4DV2J 1N6QA 3QSYB 1RAIB 5HROB 1N5VA 1YLXA 2EEYA 2F63A 2OFGX 1YKWA 3M2UA 3UWTA 3KK3A 1KQGB 2QL9B 2XNRA 2R7OA 4C8NA 2V2ZA 3GYGA 4YHHJ 3BQ2A 4C8YA 2CPYA 3IC1A 2LCWA 1XNRF 2C3OA 2GIQA 3KMQA 2K3KA 4YR2A 1VK8A 1PJ6A 3AODA 3DLHA 3NGUA 4ZPVR 2FVPA 4MT1A 3QJPA 4I6YA 3AD7C 5ETTA 4K59A 1S1TA 2ZOMA 2LMIA 3DLKA 4C48A 4J9NA 1VC0A 5D4NA 2DY1A 3CUNA 2RRBA 1I6JA 4A8FA 3UD4P 1E6VA 4WFYA 2GHPA 1AW0A 2OO4A 3CC7S 4ETXA 3E51A 1WF2A 4UOFA 4ECXA 3MPDA 1PO6A 2HFVA 3DKDA 4R25A 3GCXP 2GMHA 3J80U 4X4QA 2GHVC 3MMAB 5EWGA 2A6MA 4ICLA 2D41A 1HNXF 4CLZA 3UVJA 2AF6A 1IM6A 1KONA 2YX1A 3FC9A 3CCZA 4BC9A 2J9DE 4QYRA 1N5YB 4P75A 2AGOA 2IA6A 4K0KJ 2U2FA 2VASA 1VIXA 3R3TA 4UW2A 3RAMA 4M5KA 3UDCA 2Z57B 3FBFA 3EVOA 3SCJE 3J80Y 4EZ9A 3ZO7A 3RR7A 4KIAA 5ADZA 3EGVA 1GFWB 2AQ4A 5I4MA 1NDCA 3NOCA 2XO7A 1GAOA 2RT3A 2ADBA 3TZZA 2VC0A 2NPIA 4I64A 4OZ1A 1NKCA 3DRXA 1JXVA 1SUQA 1LW0B 2HQ3A 1H0HB 1FRIA 5H9EJ 1DLOA 1HBNB 4DR3J 1QAXA 4LFBJ 4P52A 3UI3A 2IBOA 1RHKB 3G6XA 1HNIA 1JLCA 4OLOA 4B17A 3EPIA 2JWNA 2W8LA 5EWFA 4QR2A 1AZSA 4UZBA 2XCPA 3PVXA 1MMLA 4UTGA 4C8ZA 1RYSA 2VL1A 4KE5A 2QSFA 4W90B 4C11B 4DEZA 3OHBA 1IBLJ 2GAGC 2GC8A 2CQPA 3W65A 2W9BA 1T9XA 2VFUA 3R7NB 4X62J 4DL3A 1EHWA 3HLUA 2FHMA 2AJQA 3POTB 4X4PA 2HS4A 2PEHA 5BYSA 3WDOA 5K20B 1FFWB 2YQ1A 5BYRA 3TUJC 8AT1B 3F41A 2MKCA 5EN1A 4A8WA 3OTOF 2AP6A 4CNYA 4RW4A 4JV5J 2HHSA 3NGSA 5KFIA 3CC2S 4NLYA 4CLTA 3D0HE 4Y6IA 2FYXA 1ZTWA 1RT1B 1RT6A 1Y5IB 3DOMB 5D0RA 3DI6A 3G8TA 2CJ9A 2ZZTA 5C25B 2YNGB 3OR1A 1HNVA 2OPQA 3KLGB 4B3MF 3MM7A 5ETSA 4B3MJ 4NCAA 2CVEA 4OV1A 3BS9A 4DQQA 1WG5A 3G86A 1YZ7A 2K8GA 3HHEA 4LRDA 1S1XB 2ASLA 1XEZA 3QZ7A 4CYUA 2DRDA 3G71S 4C3LA 4NRTA 2UP1A 1ZYQA 4MJKA 5A0YA 5JUMA 5K9FA 2K1RB 1HHTP 3KMSA 5HMYA 1OPZA 3AOBA 4N47A 2C28A 2UUBJ 2MHEA 3BR8A 3CCTA 3RR8A 2IVYA 3T1HF 3CCRS 2RAQA 2FLLA 1X9MA 4MYUA 1LKZA 1TL5A 4NYZA 3JSYA 5KFAA 1VQOS 1MU2A 1R0CB 1TL1B 1X4GA 1XN9A 2IDLA 5A76A 4LF8F 3OVAA 1S12A 3CPWR 1FWLA 1U7LA 2DHGA 1KVJA 1H73A 4PPDA 3US5A 2NUHA 4FN5A 3KXDA 2AEJA 2DHXA 3BBCA 4WK3A 2YKNB 4DLEA 3MECB 1V6HA 3OD2A 2YWFA 3ULHA 2ZC3A 5DJBA 4XDDA 3EPGA 4C3KA 4DUTA 1WDDA 2WSFC 3I5BA 5A8RB 2MXYA 4OYOA 1S1VA 1PYTA 1SC6A 2E7VA 1RKJA 1UVMA 2BA9A 5K14B 3DRPB 1N6QB 1FHTA 4DV1F 3DM2B 1Z1ZA 4DX7A 1LFWA 3TAQA 2HFNA 2ZFHA 3M2UB 3CDBA 1XMQJ 3MAQA 3EJMA 4NCBA 1U6BA 3DRSB 4K50A 4DPYA 1O51A 3I82A 1LK7A 4JB8B 3HVRA 4HT7A 4BS2A 1C0UA 1I94F 1SKRA 3J81j 1J5EJ 4K4UA 1U1LA 1T7PA 4LF1A 1YBTA 3IS9B 3FCWA 1GXTA 1P1LA 4LBIA 2NLWA 1H7WA 3GIJA 4M5DA 4L74A 4ZVGA 4CI0B 3E2EA 1JJ4A 4ED0A 2DD8S 3QT5A 1DTTA 1SC1B 3QLHB 4Y0FA 3TNVA 3DLJA 2UVWA 2GJFA 3PXGa 4KPYA 1M5PC 4PG6A 3PIPQ 2JLGA 4Q8EA 2B7BB 1SVDA 3IBWA 4G1IA 5L9XA 3SDEB 4CT9A 2FJVA 5KFCA 3CTRA 5AXLA 2BJ8A 1JNZB 1FD8A 3G2XA 4I7FB 4EBDA 2J0SD 4K8RA 2KRRA 2CPDA 2ZE2A 2N7YA 3IA0A 4USTA 2NYHA 5F0UA 3TOQA 5MAOA 4CLYA 4Q44A 3BO4A 4K4VA 3H2VE 4DR4F 4OI6A 2RF2B 3HK2A 3MPWA 2DPIA 3D68A 3I5AA 4LFAF 1NKEA 3CJ0A 1ZA2B 4J9UE 3OHAA 1IKXB 2KT2A 3DOLA 5KFTA 5CAAA 2DNQA 2G2OA 3W3SA 3LPYA 4JI5J 4EBCA 1MROB 3H4BA 3C19A 4DSLA 2AEFA 1JB0C 3HKWA 4DR5J 4LFBF 5D8HB 2JRSA 1W2IA 3NNAA 2E29A 2UUCF 5F9NA 2VPWB 4OX9J 1IQTA 1NK0A 2EFQA 2V94A 1WKLA 4HTJA 4USIA 4CLLA 4CIOA 1XIQA 4ZVQB 4DLGA 1DTQA 3RRGA 2M5YA 1B7FA 4PG5A 4AYBD 2HQIA 4QCLA 2OPPB 1T03B 1R0AA 4M8LA 4DPUA 1DLOB 2F4VJ 2GQ2A 5IT9U 4DCJB 1HWLA 4JI8J 2IVFB 4LR9A 3ADAC 2MLXA 3TZXA 1VS3A 1U0HB 4MK9A 2VQFJ 1T05A 2CPFA 2LP4A 2C2DA 3Q22A 1NDLA 2G2YA 5H9FJ 2MZJA 4RUHA 4DR2J 1B0PA 2EWHA 4GVBA 3NS5A 5F3ZA 3I55S 2C2RA 2AJ4A 5HATA 1U1RA 2F8HA 4A46A 1RYRA 3POTA 1HR0F 5HBMA 4CH7A 1RTIA 3THTA 4QWAA 1OJ4A 2YKMA 5EHHA 3MUTP 1FNMA 2YNGA 4RW8A 1HFEL 2MMYA 1UEKA 3UE2A 2BR0A 2FY1A 4K4SA 4ZKAA 2VIHA 2XWYA 4NLDA 1MSWD 3JSRA 2HWHA 4USHA 1F2HA 2BM0A 2R42A 2PMZD 2Q3PA 1BHNA 3PNIA 3HMJG 1M1KT 2CAJA 3ILJA 1Y00A 1FTCA 1RT6B 2MQLA 1N54B 2WONA 4KH1B 4KHRA 4MYTA 2LEAA 2CJBA 3DI6B 2VZ9A 5IQQA 4XPCA 1UA1A 4JV2A 3J7AN 1FEEA 2DNRA 1HNVB 1RGVA 1FO1A 3MPUB 1X5SA 4ERDA 3KK2A 1ZS6A 5FLXY 3MCNA 2XM3A 1CG2A 3DRRA 3B4MA 3O44A 2D9OA 1RT4B 4F0HA 1VQ6S 1T94A 3RAQA 1S1XA 3DLEA 2JEJA 1O8BA 3D6TB 4URQU 3GFHA 4OYMA 1R89A 1B0TA 1HYSB 4QYZJ 4KGKA 1OQ6A 4QPTA 1HBOA 5B0EA 1XC9A 4QWBA 2VF3A 2EKYA 2I5JB 2XS7A 3KLIA 1CQMA 2D9PA 3ISNC 1FJCA 4ZJQA 4I6AA 3FFIB 4HVZA 1IR1A 1RT7B 1CULB 2MEWA 6FDRA 3OVSA 4P71A 4C0HA 3CMES 4UY85 3EGNA 2K3IA 2HFZA 1TL3B 2IAJA 5L38A 1CJUA 3CCMS 4B9NA 4FBUA 1RHQB 2DGQA 5KAKA 2UVRA 5CYQA 5D4LA 4ALZA 4ELUA 2F40A 1VC6A 4QPXA 4FYDA 4N7TA 3GB0A 4DQSA 2VG6A 2AYMA 1UZDA 3WIVA 1T3NA 3QGHA 3QGPA 3UDEA 4F0MA 3JYTB 4HTIA 3G82A 1TUGB 5J1EA 3I4PA 4DN0A 1RAGB 4DV5J 1U45A 3WC2A 3F44A 3G8SA 3U7JA 2IJFA 2C3UA 2J8AA 3AQOA 3AT1B 4DZ6A 1GX5A 2OPSA 3DU5A 1KQFB 1RWWB 2BJ1A 4ATNA 1SB6A 4KSEB 4CH0S 3TA2A 4DFMA 3DOKA 2FZKB 3P5BP 4RW9B 1M5OC 1NU4A 5IT4A 2OEJA 2ROEA 1UWBA 3NWGA 2R7TA 1TELA 2EFOA 2EKNA 3D67A 1HKAA 4UOGA 2QLFB 2NUUG 1GQEA 4FYXB 4HHUA 3J7YI 4DSIA 3WZ0A 3G96A 3GONA 2W1BA 3T6JA 4MKBA 4ZP9A 3RGIA 1EAYC 4MTPA 1OY6A 1JLBA 1JLGA 3VVTA 4N77A 1RWMB 4NWBA 1PCAA 5L1KA 1U47A 3QAUA 3CCQS 2RF2A 3MZIA 2WOMA 5J1PA 2WZ1A 3RAXA 3DHXA 1RTHB 3BJYA 2I0XA 4M5IA 5LJ5Y 3IM9A 5KFHA 4JI7F 4AXIA 1U1QA 2MQOA 2RS2A 3CT9A 3I0RA 2B9EA 3R97A 1B7YB 4DX6A 2QE5A 1KHWA 2NZ4A 1Q79A 1S0VA 2W9CA 5KOXA 1MROA 2RHQB 3HD2A 2MKSA 3GFXA 1NEEA 2OD4A 3SQGA 2MGZA 3F73A 2XLIA 4O4GA 4OZLA 2D74B 4CTAA 3K5MA 2GMJA 4HH1A 3M9NB 3W5ZA 4ECRA 4DU7A 1ZM9A 5D78A 2XQCA 3MM6A 2D69A 4AT1B 2RU3A 2WVCA 3FMWA 4CO0A 2D3OR 1T03A 3BH7B 3IAS9 2RU9A 3WC0A 2KZMA 1U2FA 1HMVA 4TQRA 5KFXA 4FXDA 5HVHA 1PBAA 1TK0A 5DZ6A 2MQPA 1JQGA 3RYLA 5DDPC 1N33F 1NJIT 2NREA 2LDIA 2B9YA 4RUAA 2RE1A 3SIPB 3PZPA 4R0JA 2V4QA 1Q0NA 2UV8G 1S6PA 2Z2LA 2JNJA 3IP0A 3CWJA 2EK6A 3VZHA 3CCES 2O67A 3AOAA 4DR3F 1R8CA 3VV2B 4EBEA 4F2SA 2ACYA 1P27B 4MKVA 1QSYA 1KWMA 4HDGA 4OQJA 3ZTRA 3TEGA 4GC6A 1LV5A 2DBBA 2G4BA 3A8EA 1WJ9A 4OJ1A 5KG3A 3PFOA 2M52A 3TWZA 3TVKA 4ZOSA 5KT6A 4FBTA 2ZNYA 3HPOA 1U0HA 1ZAWA 2IM2A 2OPRB 1CBKA 4QWDA 1FDDA 2B4UA 4W4MA 1R0BG 3VF0B 4AQYF 1BD6A 4B3RF 1S6UA 3GQCA 2MKYA 2OLWA 2UUWA 2Y8WA 4FKYA 1PIEA 4C8KA 2MQMA 1P1TA 2JVRA 3UD3P 3P8BB 3UR0A 1IXKA 5KOWA 3TI0A 2W01A 4RNOA 1OSDA 2K7JA 3MF5A 4L75A 4M94A 1Y10A 2FHJA 1LNQA 1SC3B 2CVIA 3Q23A 4WXWA 4TVAB 1VJQA 3GP9A 4ZCKA 5LL6d 3ZZZA 1R0AB 2BXJA 2ZBRA 3B6BA 4RO0A 5A8WA 1UVLA 3J7A1 2LA4A 2B9WA 4J5OA 4DV4J 1WF0A 4LF6J 3D6FB 1KHVA 4M5HA 5ITHA 3H4DA 3G87A 1QSSA 2DNHA 3BGRA 4JI7J 2FLNA 1HBOB 1AA1B 2ASYA 2DHSA 4KKOB 4O4RA 3KHLA 1URNA 3Q8YA 3B54A 4E8UA 1U0SA 3ET6B 4DL0C 1GEHA 1TKZA 2QO3A 3LTOA 1JLEA 1Y5NB 3SCKE 3ZZRA 4C11A 3HHKA 5CCLA 3KK2B 1SKSA 2C2KB 5LJ3Y 2E5LJ 1RU2A 4M5GA 4P6QA 1TV6A 2R7WA 5I42B 1RAAB 1HD1A 3FQKA 3DYAA 3VR1A 4O3NA 2UU9F 2HVDA 1BE4A 2H4WB 2O66A 4M95A 5MLCV 3MHYA 5A6PA 3BBBA 4LBHA 4DUZF 1XTZA 3FK4A 3HZEA 4F04B 5BXIA 3PX0A 3MM5A 2W7AA 3IR5B 4WFXA 4IG0A 4KO0A 2BKOA 2XMVA 4I2PB 1HBMB 3Q0AA 3N5FA 1K47A 2X1BA 3MAAA 4N56A 3MEKA 1RT1A 5GMKa 3JYTA 4YUDA 2MLYA 4DSKA 4P7VA 4JI2F 1H98A 3CVKA 4DV3J 3DLGB 3KHGA 3D4JA 3OR1B 2VQFF 4C98A 2LKZA 3HHLC 1YG0A 3QFWA 3DC2A 2NPFA 3VAHA 2HEKA 3BB5A 2FDNA 3MR6A 2BQ3A 1KNZA 1N48A 2LU1A 3R7SB 2AIRB 3H90A 3KUEA 3CJKA 3IRWP 1VQYA 2CNNB 4ECZA 3PRDA 3LP2B 4KV8A 5KFBA 1U1OA 4DSJA 1WOSA 5A0YB 4Y2CA 1GTHA 2HIYA 1JWWA 2DB1A 2XS5A 2D1CA 3UQSA 5EWEA 4P72A 2QC3A 4WU3A 3IGNA 1ICEB 4BDPA 4WKRA 1YSJA 3KJNB 3PHEA 1FK9A 4ER8A 2HNZB 5RUBA 3L7UA 2ATCB 4LUBA 1NNDA 2I38A 1XNQF 4A47A 5F8LA 1KLMB 4KBIA 4ANCA 3H40A 1F1BB 4Y65A 4AXJA 1SL1A 5HJYA 1F5BA 3IRXB 4PXDA 2KJVA 1P9YA 3ICLA 1YJ7A 2NS1B 2FD2A 2VG5B 1S1UB 3T6BA 3JAMY 1NKBA 1RDRA 3OFEA 3LP0A 1Q8IA 2LQBA 2MKKA 3FEYB 2BJ7A 3OFHA 4IFVB 1FRMA 3OJUA 5KT5A 1GNKA 2G0CA 1Q5YA 1FKPB 2MJUA 2YWKA 2ZBCA 4Z2XA 3CC4S 3AJDA 3HKZD 2U1AA 5GVQA 3EICA 2MSSA 2EFGA 5D0HA 2XMMA 3MTKA 1IM4A 2OH2A 4B3OA 2YWWA 2BOAA 1NZ8A 3CJ8A 1S97A 4DHVA 3BO3A 2AJ2A 1TQLA 2DCUB 2H5EA 2LFVA 2XB2D 2B4PA 2RQKA 3HVTA 1S7HA 2R7VA 1C1BA 4QIFA 5FD1A 3CCJS 4WFBQ 1WHXA 4ANEA 3V4IB 2ROPA 3HHNB 1JLAA 3CDWA 1IWGA 2HHVA 3NCPA 3VAGA 2BANA 2HK3A 5K5MA 1R3NA 4M5DB 1QUPA 3OTBA 4IG3A 5E7OB 3RU0A 1DTTB 2H4YB 8RUCA 1HHQA 1XMQF 3H5SA 2BYCA 1YHQS 1KVKA 2OFHX 4DPXA 4ZPWR 3PKYA 4KQZA 2FJEB 1YVFA 3MM8A 4CH1A 2WRMA 2BV3A 2DR9A 2BZ2A 1FWPA 2RS8A 3O8WA 1RZMA 2XC9A 2Y9HA 3OTDA 1N34F 2DGXA 3HXMA 4JV5F 1V5IB 2W25A 2GQQA 1NSPA 2AKWB 4ZVHA 4X4NA 3BN4A 3TZWA 5B0AA 2IMOA 1U09A 2PIIA 4R8UA 5M2PA 2H1YA 4DQIA 4LF7J 1EETA 3S01A 2G9OA 2CNLB 4CLUA 3AY0A 2BUNA 3RW7A 1QJHA 1IN0A 3FQLA 1Q95G 2RSQA 3I32A 4QIEA 1F2GA 3OR2A 2BX6A 3OBIA 2AWZA 2JL9A 4AFFA 2ALZA 2DNOA 1F6TA 4J9VA 8ATCB 1QE1B 1EJ7L 3RB6A 2GVZB 1FX4A 4OX8A 3VZIA 5F8NA 2FJDB 1D9AA 4GRSA 3C16A 2Y1LB 1M1HA 2M0GB 4NI2A 1TFYA 4FF4A 2DGSA 2Q6BA 2QYCA 4LFAJ 4X65F 1M90T 2GO8A 4NCGA 2P9CA 5DM6Q 2A6OA 1IJFB 2B3TB 2DXFA 1NDKA 2M70A 2VDHA 1L3TA 2FIUA 3TO8A 4AL7A 1S1VB 1RLDA 2VH7A 3ZZUA 3CJSA 4ZJLA 5DQHA 2XS2A 2ZZNA 4B3TJ 2JLFA 5ETKA 1CJVA 3DMJA 1FKOA 2KRBA 2WB4A 4NA2A 2H48B 1RWXB 3RW6A 3ENVA 1XJWB 3KLFB 2JEFA 4JBCA 2BQRA 1UVIA 2V8HA 4CZCA 1BGXT 4JUZA 3VCDA 5DDOC 3V6DA 4GO7X 2HPUA 4DPOA 2V8PA 1DURA 1RT5A 2VBXA 1HL6A 4NMXA 3W1YC 2F7VA 1P6TA 5F0WA 2YNIB 3CJQA 4NEYA 2WB1D 4RR5A 1M1GA 3ZXWA 2PI4A 3H5XA 1FX2A 3W2VB 2OSQA 3OXLA 1IKVA 3Q89A 2M8HA 3U1MA 5GAHI 1XR6A 4FYYB 3C6TB 2OUGA 4PWWA 2ZH1A 1XWLA 5J2PA 4J7CA 2IRXA 2JJ4D 4EI2A 4O0IA 1PC4A 3VAMA 2CJAA 1UEUA 3LP2A 1SBRA 2C2OB 2YVSA 1RWKB 2Z30B 3BGOP 1P9QC 4KV8B 5G0RA 3MEEB 5CYJA 1D9FA 1S77D 2UXCF 3BPDA 4G3IA 3CJ2A 4NLTA 1MWQA 2CG4A 3AXMA 5ETQA 1JIHA 4DOZA 2ZE2B 1EKSA 2BE9B 1YJNS 4F2RA 2HBRB 1HW9A 2HNYB 2JFDA 3L95X 4OYBA 4WZMA 4WBFA 4DV6F 1RT4A 2ZVSA 4LF7F 1GT8A 1C1CA 2V8DA 4ZLPA 1LWCB 3NNHA 4OHYA 4OHXA 4UUWA 1TKTA 3A1YG 3T3FA 1U1KA 1RWPB 1WKKA 2CJQA 1HYSA 3V2UC 5E41A 2CQCA 5DLFA 1IKYA 2O01C 4P2FA 3D5MA 4PQUB 1QDUB 1KKHA 1I51B 3KUGA 2W2PP 2ASJA 2B7CB 1AROP 2RUGA 4LT6A 3TUPA 2J8SA 2Y0BB 1HARA 1TTHB 3R7BB 4ZP8A 1YBUA 4ZDNA 2VKRA 2GIFA 4DFJA 1K1QA 3CD6S 2HFOA 2MDAA 4OV6A 5HAOA 4IFVA 4USWA 2ZC4A 1FT8A 4ES2A 3MMBB 3IRXA 4I69A 1OYDA 2NZCA 4WYLA 2VG6B 1WHYA 2YQ0A 3KFWX 2QLBB 2M9KA 4QJVA 4B9UA 2XLKA 3M2RA 5IQ6A 1NRKA 3E8OA 1TZ0A 4I68A 3JXOA 2K2PA 3NMAA 3RUBL 1C1BB 2UUBF 2I1RA 2GIRA 2MTLA 3ENWA 2BE2A 2UUCJ 4OHWA 1KP6A 2QYGA 3PCOB 5J2QA 2XMUA 5HLFA 1PJ5A 3GSDA 4TXSA 1BQNB 2L9WA 3DOKB 2FHKA 1RTIB 3AA8A 5AXKA 1QY7A 2DEJA 4OMFG 2CPZA 1YJTA 4KY3A 2QA4G 4PCQA 2HQDA 4PWDA 4JI3F 4JI4J 1NPKA 3F56A 1EARA 4ED5A 1H7XA 1DHMA 5EX3A 1IKWB 2ZDOA 3CW2C 2C2MB 2L9DA 3A3OB 3JQKA 3ITHB 4HHHA 2BANB 2C2NA 2ZHAA 2A1BA 2EK1A 5D3GB 2CQHA 4QQBA 1S5ZA 5LSOA 1JLBB 1JLGB 3VAFA 4LF4J 1RU1A 3AD9C 2HBQB 4UOHA 5B0CA 4FF3A 4NA3A 4NXNJ 4RW6A 1LFPA 1WACA 2LQ9A 2X3DA 3C6UB 3VWSA 4PUOB 1QTMA 2QLJB 2VG7B 1W7WA 5AT1B 2V63A 3H20A 2IC3A 3W60A 2QSWA 4RPFA 4XO0A 3HD1A 4ID8A 2CKWA 3D54A 2X7IA 1RTZA 1QLNA 2JX2A 2ZUAA 5LOQA 1WC1A 5B0GA 5DQGA 1N5YA 1FJGF 2HHHJ 4U67Q 2C42A 3B82A 2UVVA 3FDSA 5D6GA 1FWKA 4EO8A 2HHTA 4BWJA 3MMCA 2JH3A 3IWLA 3KLIB 5KG2A 4AUKA 5KT7A 3Q8VA 4X66J 2H5JB 3WX4A 4GKKF 5DETA 4ZLNA 2ZD1A 3KG0A 1YBAA 4BHQA 1JMTA 4NCGB 3L7PA 3TAPA 3DNCA 5GMEA 2DNPA 4TNOA 1QE1A 1W26A 4I56A 2GNKA 4J9RA 1G3OA 2PGCA 3HSGA 3NGTA 4X84A 5U47A 5KG0A 4K0KF 3LO3A 4CO3A 3UR3C 1WOOA 2OKQA 4OI4A 3JSMA 2XULA 4TYBA 2WBMA 1NZAA 1TVRB 3S8SA 5KFWA 4DUYF 1WC5A 3DXBA 4JI0F 3MEGB 2EFNA 1CQNA 3LQVA 1RA6A 4Y2MA 4P2XA 2WTFA 2XBPA 4L73A 2VQEJ 2YQ3A 3HX9A 4USUA 1FESA 2JDJA 1RTJA 4U96A 3H2UB 1FD2A 2B6AA 2JFKA 1HPZB 3KKFA 3DGPA 3AFGA 4IOBA 1A7GE 4GKJJ 2FJBB 5ETNA 5IC4B 4OYPA 2CPIA 1S1WA 5KG6A 4OI1A 5DLGA 3QT8A 2MKIA 5FDLB 3BH6B 2DR8A 1IUJA 3IO1A 3A13A 1A6LA 2KDOA 4NLGA 1HQEB 4FXWA 2HURA 1C4AA 1DQ9A 3BYPA 1OS5A 3DOMA 2PD1A 3H5UA 3NMRA 1L3UA 2E7WA 3IM8A 1SQGA 4X4TA 3SV3A 4Q45A 2QEXS 1R7IA 2XZDB 4DBQA 2J9CA 3Q8UA 3QIPA 1VQ5S 1VOMA 1EZZB 1WELA 5KFEA 3I9ZA 3T5KA 3NY0A 1NSKL 2R8HA 4LF4F 3ZTQA 1IBLF 1AT1B 5HK4A 4OX7A 2MQQA 3NBPA 2BJDA 4FDFA 3NWRA 1C1CB 1H2VZ 4P2MA 4YB1P 2DRBA 4B9MA 1N32J 1S57A 1UJ4A 4CO1A 5L1LA 2RVJA 1WI6A 2L48A 4DQPA 4QU6A 2VV5A 3BV8A 2QZ8A 2B9XA 1TK8A 2IRYA 3TARA 1VRQC 1FERA 3S1TA 1TUWA 1D9DA 3H8YA 2CDQA 1VHIA 4CLFA 2PMWA 6AT1B 2Z2MA 9RUBA 2DNZA 4H4KC 1MN7A 2RQ4A 2ZUGA 1R6VA 2F8MA 4NZ6A 3V81A 2GX8A 1TL1A 1UFLA 1UPPA 1YX2A 3AAWB 3CJ4A 1GMVA 3FRZA 3T1YF 3EWGA 4MFBB 3HHLD 5IM0B 1SKUB 4OI2A 3JTPA 2EBEA 5HP1B 2XTJP 4NASA 1TMMA 1WORA 1QM9A 5E3PA 1S6OA 2GHWA 1NLKL 3MCSA 3O5TB 4F4AA 3KLEA 2B8QA 2ZHOA 3L9ZA 4EGLA 5KFMA 3M8YA 4DS4A 1NJWA 1RISA 1U8WA 3H7HB 3B78A 2CQDA 4NL5A 1H72C 4KRWA 4BC7A 3OQ2A 2FVCA 2B5JA 1RCXB 1S4EA 3ZNUA 4UZCA 1GX6A 2JC0A 2VONA 3QT6A 5A8RA 5F9LA 3R27A 1PKUA 2GCFA 1S79A 2OAUA 1ZETA 4RUCA 3PDNA 1U48A 3QJJA 3MFHA 4YP3A 3ETMA 4ES3A 2CYYA 3KYLA 5T7LA 4ZITA 4DV7F 2KZZA 1NPRA 1S7IA 3K17A 3CNQP 2HK2A 3M05A 1HNIB 2MY8A 3MXHP 1F5AA 1RLCL 2DT9A 3EMTA 2F1FA 4I67A 1DJ0A 2H3EB 1SH3A 2VFSA 3BBFA 2LQ5A 4A8XA 1VK3A 4G6VB 2IPOB 2NXUA 2HNZA 2LVWA 4F0KA 2RB7A 3CCSS 5AE2A 1N88A 2C3MA 1HLWA 3QT7A 2F8EX 2VG7A 3L4BC 1RADB 2XMKA 2FLOA 3FMBA 4OX9F 3SSRA 4ES1A 2G0JA 4LF2A 1RWNB 3N6MA 3KNGA 5C42B 5C5JA 3T41A 3MFIA 3SYZA 1UMJA 4KB7A 2CQBA 4ETZA 1VMBA 1Q7LB 2VC1A 3NP5A 4YFUA 2KYXA 2OHDA 3MDFA 2FUG9 3I0SB 3R1HA 3CDAA 5BJRA 4RW6B 1ZOTA 2E5JA 2QA1A 3QO9A 2K1RA 1RJJA 2IVMA 2ZH4A 1SJ4P 5H9FK 1PJ7A 3LP0B 3EXCX 3MMCB 4ECWA 4ED3A 2XYHB 2XYGB 1JXLA 3PO4A 4ZMMA 3CDEA 3PKMA 4CM0A 1IVZA 1VQNS 3UCUP 2ZNZA 3EE3A 2KXNB 3M6WA 5CZVA 3ONQA 1VQ8S 4NA1A 2DNMA 2W2QP 1RHRB 2ZHBA 2QRRA 2LLZA 4R5PB 2FJXA 1X4EA 4BWMA 1ZM4A 1CEZA 4ECUA 3PV8A 4DSFA 3LGNA 2H9ZA 1YIJS 4V19X 4AL5A 3GJQB 3M8QB 2YNHB 4M5JA 4NRUA 3MECA 3QFHA 3PX4A 1HBMA 3AHPA 5B0DA 2AJFE 4J9MA 2A10A 2VICA 3V6JA 1MMNA 2CQ3A 3SZ2A 1S9FA 4PYDA 1HD0A 1Z2ZA 3GIRA 4O44A 1RTJB 3FSIA 1VR6A 4ZVPB 2N4CA 5T14A 4H4OA 2AGPA 3JSMB 5KFSA 3MWBA 2HKEA 4DU8A 3BEGB 1AB8A 3QSIA 4HACA 4KH0B 3KLHA 3C2PA 1S1WB 4ECVA 3RTVA 5IS2A 5AJ3J 3MEGA 2CIMA 4IDKB 5CHCB 1HQUB 4C2MA 5HQMA 5KG4A 2RD5C 3M8WA 4ZHRA 2DYAA 2XZTB 3R2DJ 3K8WA 1MLAA 4LF8J 3JAMU 2V2VA 4OHVA 1S6QA 4TQSA 3Q2SC 2JHEA 3DDIA 1YTYA 3T19A 1LWXA 4RL1A 2V4JA 2XLJA 3O3LA 2HRUA 2WHOA 3GZ7A 1X9WA 1TKXA 2H54B 2WSEC 3M1VA 3DLBA 4O23A 1KN6A 4A4JA 4D3HA 3M8RA 4A8KA 2DITA 2IBKA 2HZVA 2XZWA 4IO9Q 2HGLA 2RKIA 1J5OB 3FVYA 4B9TA 1S9GA 1NO8A 4RX6A 2EVZA 2HNDA 4NMLA 2ZVIA 1H2UX 2EPIA 3QWPA 3J7YU 1H74A 1NHUA 2ZWOA 4M63A 3IS9A 3G8QA 2UXDJ 1VDHA 4UT4A 4V1Ak 5B7WA 2J76E 4UQGA 1NB2A 2YX7A 1TAUA 3KG4A 4DFPA 5K8PA 3QLHA 2HS0A 2OMLA 1WC6A 4MFBA 5IM0A 4QIVA 1VJWA 2HVEA 4LVOP 4WE1B 3PW0A 1Q1KA 5ETVA 5HP1A 1VQ7S 2D3O1 3MTJA 2HHUA 2QLXA 4RWXA 2W2NP 4I7FA 3N6LA 2XHCA 1CJKA 3HI9A 3CEDA 3PW2A 3NNCA 3KJQB 3JQMA 1LEOA 3A8JA 3H42A 1ZPWX 2PE8A 1H2TZ 2B5JB 3EM1A 2PDAA 3V81B 4WWSA 1VQKS 3VQTA 4ILLA 4DI6A 4HT5A 2A2CA 2Y1RI 3R2CJ 1Y4ZB 3LALA 4W98A 2IJNA 2ZKUA 3FRYA 2G1DA 4KGMA 1LWEA 1NPPA 3UDVA 3W8PA 5J2PB 4WCEQ 3BO2A 2WBRA 4DV4F 1O6XA 1S0MA 4LF6F 3W64A 4EMDA 3LUYA 4Z7CA 1SL2A 4F8RA 3O2IA 2AGQA 2HHPA 1VIOA 1I1GA 1RABB 3DDNA 4OYXA 1IWAA 4EYIB 2M7SA 2IM0A 1V3RA 3A3NB 4Y34A 1NSAA 6FD1A 1WD6A 1NJXA 2HGMA 1RBOB 2UV8A 1RWVB 2V9WA 2H5IB 2X51A 1RAEB 3D7SB 3M9OB 3V6KA 1S4FA 5L46A 4B3SF 4B3SJ 2BW7A 1XMOJ 5HQLA 2GJIA 4QR1A 1EP4B 5EUHA 4MMOA 1VQMS 3CO0P 1KC8T 2K06A 5HQ8A 1RTDA 1M0SA 1LWFB 1T9TA 4DX8H 1ZH5A 4NX9A 4Z37A 2VODA 4WIIA 4Y2KA 5L9NA 2L08A 1HWJA 1CS4A 2DNGA 4CO2A 3PIOQ 3W9HA 3EUNA 3IAM9 3TAMB 3NOGA 2CNKB 3HHLA 4I4BA 3LA0A 2VPXB 4J37A 4F7VA 4RBTA 1SJQA 4NXNF 4OZ0A 4XDCA 4CNZA 4H4MB 5SUHA 3QO9B 1TK5A 3KNAA 3FNNA 1VBKA 2ZH2A 4DV3F 1EB0A 2JSXA 4LREA 1K44A 3ZZYA 2CQ2A 2PFDA 4DMZA 3BSOA 4K4TA 2DR7A 3TA0A 4RNNA 5LXRA 5GADI 3I0RB 4LRCA 2WCXA 1KTVA 4AD6A 3LW5C 4HEA9 1U1MA 3NS7B 4QZVB 1S9EB 5F8GA 4R5PA 2HGNA 2UXBJ 2KXHA 1Q8LA 2BEFA 4P2SA 4TU8A 2BJ3A 3DGVA 2Q6CA 4CP5A 3RB3A 4CTAB 2WW8A 3QMQA 1Q16B 3D1OA 3ILIA 5K8MA 1HWUA 3OUYA 1UL3A 3OV7A 1RT7A 4UOCA 1GK8A 4J9OA 3EDRB 3R9LA 4A48A 3T9NA 3O6QA 3DRYA 2R8IA 2GO9A 2RDDA 2O1PA 4C0BA 4B9VA 2IAJB 4WP8A 2EFVA 1HMVB 3ZFVA 3HFKA 4Q2MA 2AZ3A 2FGCA 4OZ2A 5C25A 1VISA 1NMEB 2BQUA 4GKKJ 1JJCB 1OQ3A 2DIUA 1BQMA 2VBZA 3MM7B 1B3TA 1RWOB 3TZYA 3C6TA 2XHWA 4XTTA 2RRNA 1RA7A 1HI0P 2FJAB 3OW2R 1VI7A 1KS2A 3GG1A 3AQPA 5I3PA 2RNEA 3A4TA 4X64J 3TJ8A 3T1HJ 5D3GA 1X4CA 1WOPA 4UY8T 2MJNA 2OTJS 1NAQA 3ZNJ1 3GIIA 5J2MB 3GCWP 1NUEA 3KK1A 3C6UA 2QL7B 2DHHA 5DM7Q 1TL3A 3G6ES 2COLA 1FRJA 4QWCA 1JKHA 4YMEA 2IHR1 2WSCC 2RMLA 3MD1A 4R0EA 4IDKA 2HRTA 2Q1LA 3T5HA 2BKNA 1WEZA
chains in the Genus database with same CATH topology
5CH7B 5HMZA 4KR0B 4F4KA 1W25A 2PO4A 2RKIB 1J5OA 4E0DA 4NXMF 2B4VA 4Y2AA 5KFFA 1FTRA 4PQUA 3J81Y 3THVA 2XNQA 2MHNA 4ED8A 1GH8A 2R2RA 2DIVA 1X5OA 2J7UA 4YB7A 1QAIA 3DLLQ 2KM8C 2WAQD 3RB0A 1SJ3P 1HBUB 5KG1A 4TKTA 1TP7A 4JOUA 2CZ4A 4MKAA 2HNDB 5A6WA 5L8RC 2ZJRQ 4RWWA 3R5AA 1WI8A 1TVRA 2LECA 1K8AT 4OHZA 3CXCR 1VQPS 2KFZA 3M30A 1WG4A 1N32F 5F8JA 1HI1A 2BDPA 1C0UB 4EO6A 3DYAB 4Q0BB 2LXFA 2IM3A 1X7VA 1RKIA 4FNIA 2GGPB 3GILA 5LSLA 4FP9A 2KVIA 2BM1A 2XY7A 2HS3A 3K57A 5K8OA 3MM5B 2MYFA 1UKUA 1CPZA 1SJRA 2XEXA 1U49A 4PR6A 4J9SA 3CCLS 4RZRA 1FE4A 4ZPTR 3DCAA 4QWEA 1PGZA 4DV0F 4LF9F 3DHWC 2VA3A 3NAIA 3HM9A 2J0QD 2N3LA 3J7ZT 3RZAA 4DDFA 3ITHA 3LANA 4IO1A 3BN7A 3GR0A 5IFMA 4DN9A 3J7Z5 3D1HA 4MK7A 2E5LF 1ROFA 2HVZA 4P7TA 5J1NA 4FF4A 4PXEA 2KN4A 1SUQB 4DWIA 4PUOA 5B08A 1C2PA 5KT4A 2P9GA 3DOLB 5KFQA 3MEDB 4A8YA 3GFZA 3BGLA 1F5CA 5KTQA 2VKZG 2ABYA 4KHMA 2DHAA 1R27B 3VAIA 1FXLA 2JEIA 1GTEA 1UVKA 4JV1A 4ED2A 5I3UB 1DZ5A 4J9LA 4RNFA 1N36F 5GAGI 4RBVA 4XIUA 4D3GA 3CCVS 5J2NB 1DQ8A 4IOCQ 4Q2LA 3VTIA 2HIQA 5AXNA 1L3KA 4OJ3A 5KFNA 3KLEB 1QVFR 1B64A 1RQ0A 1KTQA 1FXDA 2VG5A 3MR3A 1S10A 1T02A 1TL4A 2KJWA 4H4MA 1WTFA 4F4YA 1YJWS 1Q82T 3B4DA 1TKZB 2VOOA 5EGYA 3CD7A 4U6PA 1BQXA 4ED6A 2YKOA 2YNFA 2V4RA 5I42A 1Y0HA 5T7LB 2POKA 3C66A 3ZZ0A 1NH7A 2ZH3A 1M5HA 5K8NA 1WWHA 1Y5LB 2C3YA 1DRZA 4ED7A 3N28A 1SL0A 3CD0A 3PRBA 1LW2A 1U8SA 4YB5A 4OI0A 4L3NA 4HL9A 2DGTA 4RW7B 4PRFA 2E5GA 1REVB 1IBKF 3LWLA 4DL2A 5HN0A 3ZZTA 1SJFA 4ELVA 4DF4A 4LF5F 5LT5A 1FNOA 3DRRB 1MWYA 3NBPB 4MKYA 2CPXA 4RU9A 2P9EA 3M4XA 2AJ1A 3CIMA 1RWUA 3SV4A 4WJBA 3G9CA 3H2LA 3FZBA 2QT7A 3KK1B 3EZ5A 2ATLA 5E5NA 5AJ3F 2HYIB 1WHVA 4ID5B 2RIJA 3SEOA 5CXTA 3DRPA 3TUIC 4EZ6A 2ILYA 2AYEA 1E6YA 2CZVC 4LSNA 1F9FA 2RILA 4C8LA 4WYWA 2LDYA 2CFXA 4LIRA 3VQSA 2M4MA 5DDQC 2MZ1A 3TANA 4NLRA 4IUFA 1UVJA 2AYBA 3CJKB 1AW0A 3Q8QB 2PN6A 2RQCA 4OJGA 3U1LA 7FDRA 1VBZA 4IQXA 3M8QA 1VRTB 1LXJA 5KT2A 4IH5A 1LK5A 3DN9A 1S1UA 1ZPVA 4QIWD 4ZS6A 2ZH5A 2KG0A 4F25A 4X4RA 3I31A 5KFYA 4UQTA 5DGBA 3Q8RB 2VD3A 4IKAA 4WK1A 5GADU 4K4YA 2GGPA 1VBXA 2OPSB 1B0VA 2ZJQQ 2JVOA 3KJVB 1D0EA 3OFFA 2ZHAA 3OXFA 5KFVA 3IG1B 3UFCX 3M6UA 2W4DA 2ZDPA 1OPIA 4URGA 4EFAC 4RW9A 2OD6A 3G6YA 2IYGA 4G1PA 2HHHF 3HZGA 1U6FA 1BC6A 2DH9A 1GXUA 1H3DA 3CF5Q 4F50A 4EU0A 2KG1A 3QPIA 4Y28C 1D8YA 3C46A 3PR5B 3SSSA 2IYIA 2MB0B 3R5BA 2SXLA 3IWXA 3BF4A 4A8OA 5GAGU 1R8BA 2KT5A 3GIMA 2E1CA 1IKVB 3PY8A 1VGYA 1TKXB 3M1VB 4YDXA 1QAYA 1CC8A 1GXLA 2E1AA 3E01B 2ZH8A 5CA5A 1U6ZA 1WEYA 5G0RB 3P6YC 3ZZPA 1MNEA 4ICLB 3IGVA 3Q2TC 2LEBA 1JLQA 2HLUA 2DR5A 4C8OA 3ETOA 4WFAQ 3MMJA 3K7RA 2QA4S 2OP5A 1JLAB 4PXCA 1W2BR 4Q8FA 1Z4UA 1LWCA 3CE8A 1MW7A 3P96A 4WKYA 5DO2A 4NPOA 4I0WA 2XWXA 5F8MA 2CQGA 2ZITA 2XI3A 3NCQA 4MIWA 2UUAF 4HH0A 4ILRA 3PJWA 3TRGA 2KFYA 1VQ9S 2YWGA 2VB6A 4JI8F 3M6XA 2LXIA 1FE0A 3SFGA 2XI2A 5GAEU 1UEVA 4DV2F 1N0UA 2XMWA 2GA7A 1QAJA 4NYPA 4URSA 1RT3B 4O44B 1LW0A 4H4KA 3LGMA 2DGOA 1F0XA 4ZVEA 1X4HA 2Z4PA 3MAHA 1SI9A 2DNKA 4F26A 4K4WA 2BE2B 3UPFA 4RU2A 4ITSA 5CCMA 1LW2B 1J2VA 1S48A 1FRHA 3K5PA 4NLWA 1BQNA 5KFUA 5AE1A 4FPRA 1YJNS 4I1TA 1R6YA 1VC5A 2EC0A 4GO5X 3AJ1A 3K0JA 4IH7A 1RTDB 1REVA 4I6WA 1OO0B 1UW4A 3KLGA 3W2VA 2ZH6A 3P3DA 2WK4A 4HKQA 4BCAA 3BSNA 1IKWA 2MQNA 4NOHA 1RT2A 3UCZP 3Q8SB 3MPYA 4F4WA 2XG8A 1UJ6A 1VLYA 2HZCA 2QA2A 3PEHA 1VQ4S 4DR6F 1RI7A 3N0VA 1N8RT 2R2SA 4N41A 2KFNA 1Y7PA 4FNHA 4KKOA 3V6DB 2Y0SD 4J9PA 1RT5B 4N8NA 3KWMA 4KFBB 5DRKA 4K4XA 2YNIA 2FB0A 1TV6B 5FIIA 4PQAA 2ADCA 4YR0A 5KG5A 2YX4A 4XPEA 1WF1A 3CJ3A 4WFZA 1P8GA 3TP2A 4OZJA 1UVNA 4FS1A 4H54A 2W9AA 1ZZFA 1IKYB 4LSLB 3OJSA 1SV5A 4NLVA 1TUVA 2QFJA 2R2TA 3LAKA 4IG0B 4KO0B 4Y2IA 1R31A 4USJC 5IT9Y 2C3PA 4ID5A 3CSKA 4DR2F 1URRA 1UAWA 4IRDA 4NLUA 4K5RA 4C97A 1E6YB 4IFYB 4LSNB 4RLEA 2HNYA 3PW7A 1Q78A 4ZCMA 1FRKA 2QMXA 4C8MA 4C7QA 2R8GA 1JLFA 3WBZA 1Q53A 2GQCA 4TU7A 4A8SA 3O1LA 1NJZA 5CQGA 5CD4H 1OSCA 3TR5A 2O3DA 4N5SA 4X66F 3T5JA 4PKDB 4DFKA 3RB4A 3BDPA 2P6SA 3M2RB 2MZTA 3CO9A 2EG2A 3QZ8A 2XSJB 4OIXA 3EXYA 2N82B 3X3UA 3OLBA 4IR9A 4ZPCA 1R8AA 4YQWA 3C8YA 1ZZNA 4FF1A 3SCLE 2DNNA 5CZXA 3UDLA 1T8EA 1XR5A 3H98A 1O5JA 4GMKA 3UW1A 2C2EA 2XMJA 2E9TA 2HVHA 4TY8A 1HQEA 2R8KA 5E2QA 1N52B 5CYMA 2FVQA 1OWXA 2AV5A 3SQGB 5DQIA 3U27A 2N3OA 5C24B 1R8HA 2B51A 4LQ9A 1NK8A 3TVYA 3PJXA 3I5CA 3MM6B 4RNHA 3KTQA 1YRXA 2O5DA 1FKAF 1KOOA 1HNZF 2OJ3A 1NB7A 3E01A 1HBUA 2X1GA 2NSCA 3OL6A 1LOUA 2HHXA 3FEXB 3QJLA 4KTQA 3R5DA 2LXUA 3M2VA 3I96A 3QGGA 2MZSA 3RRKA 2LA6A 5LXYA 4YOEA 1JLQB 5DDRC 3JSBA 3LP1A 2AU0A 1FXRA 3N9UC 5A2QY 3M30B 5E3AA 2Z8QA 2R9LA 2KYZA 2R7SA 4LMZA 3D28A 3BZQA 3E3XA 5JJBA 1Z2LA 2HHQA 3PM9A 3V5RA 1WTBA 4ECYA 1AFIA 3JTOA 2MZQA 4WF9Q 1V9OA 3QAEA 3AB4B 2BW2A 2IFXA 4MIAA 4N8OA <