2MZ1A

Solution structure of hnrnp c rrm in complex with 5'-uuuuc-3' rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoproteins C1/C2
publication title Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mz1A00
2MKIA 2DGQA 2DNOA 2MJNA 1FJ7A 2HVZA 3SDEB 3MOJB 4TLQA 4WF9Q 4CH0S 1WG4A 2MQPA 3THPA 1VQ5S 5IFMA 2DNHA 3S01A 1X5PA 2LCWA 2BZ2A 3THTA 4EGLA 1YJNS 1Q86T 5H1SV 4J5OA 2CQ3A 2V94A 4Y0FA 2MKKA 3S6EA 3CUNA 1X4FA 2LXIA 1VBZA 2LA6A 1X5TA 1U1OA 1F9FA 1U6BA 1X0FA 2DGSA 2DNGA 5GVQA 2HGNA 2KU7A 1WF1A 2CPDA 2CPEA 2CQIA 4YOEA 3G8TA 2JRSA 2MMYA 3JB9k 1PGZA 5LJ5Y 2HGMA 1VQOS 4UQTA 4V19X 2RQCA 3J7YU 1X4GA 1FXLA 1VQKS 3EGNA 2DGWA 1SJRA 2XB2D 4ZKAA 1X4BA 3P49B 1X4CA 3G4SS 2E5JA 1U2FA 4W90B 5LSOA 4OZ1A 2N3OA 1X5SA 4YUDA 2MQQA 5MLCV 1HD0A 2XSFA 3VAJA 2KHCA 2RNEA 2CPFA 2DH7A 5DDPC 2E44A 1H2TZ 1P1TA 2CPIA 2Q79A 1DHMA 1YHQS 2OIHA 2OSQA 1OWXA 4F02A 5BJRA 2DO0A 1JJ4A 2DNPA 2HZCA 2MZSA 1O0PA 2DGTA 2VOPA 3UCZP 1WI6A 2EVZA 3H2UB 3NMRA 4U67Q 1CVJA 2ZJRQ 4CIOA 2DISA 2KFYA 5IM0B 1S79A 1N8RT 2M88A 1IQTA 4Z2XA 5LSLA 2AYGA 2CQHA 4WFAQ 2X1AA 4QPTA 1YJWS 2XNRA 4IOCQ 1A7GE 2J8AA 2MZQA 4QU7A 2CQ4A 2RQ4A 2G0CA 2DNZA 1OIAA 4M5DB 3G6ES 1D9AA 2RS8A 5D78A 1VQ8S 2JVOA 1G2EA 3DLLQ 2RS2A 1DZ5A 3I55S 2D3OR 3MURP 2MZRA 2AD9A 2KVIA 1M1KT 3BO3A 1BY9A 3ZZYA 2GHPA 2DNMA 2U2FA 2LECA 3S7RA 3G71S 5CXTA 2A3JA 1QVGR 2DGUA 2MJUA 1N88A 2G4BA 3H2VE 2QFJA 2DH8A 2N82B 2MKSA 3UCGA 1ZH5A 1KC8T 4CQ1A 1WHVA 2CQ0A 1D8ZA 3UD4P 3RW6A 2RVJA 2YH0A 2MKCA 2PEHA 2KH9A 1FHTA 3CCLS 2N7CA 2SXLA 1U1RA 1H2UX 1WHWA 2CPYA 3U1LA 5D77A 4TU7A 2MY7A 4FXWA 2E5IA 3CMAS 4RU2A 2DH9A 2JWNA 3CD6S 2DGVA 2MB0B 1SXLA 2KT5A 1UFWA 1VQ7S 2O3DA 1WELA 2DIUA 1WHYA 3TP2A 2DNNA 2DK2A 2DNRA 4ED5A 2HGLA 5DDQC 1W2BR 2N3LA 1M5KC 2MXYA 2DNKA 4BS2A 3CPWR 1YWXA 2DITA 2MQNA 2WBRA 4IOAQ 1FJCA 1X4EA 1WF2A 4W92B 4FXVA 2EK1A 1FO1A 5GAEU 1VC5A 1K73T 2CPZA 1HD1A 1WEYA 3MXHP 2DHAA 1M5OC 3MDFA 1FT8A 2MPUA 5CYJA 5GAHU 5HL7Q 2KN4A 5DM6Q 1KOOA 1Q81T 1SJQA 2RUGA 2CPJA 1OPIA 2OSRA 3CXCR 1WHXA 2XS7A 2DHSA 2KYXA 3UWTA 1U1NA 2M9KA 3CCQS 3R1LA 3IWNC 2CQCA 5CA5A 1NO8A 2RRAA 3CCMS 2MGZA 2MYFA 3LPYA 2KM8B 1URNA 1YTYA 2I2YA 1U1MA 5DETA 3EGZA 4QU6A 2CQ1A 4C4WA 1SJ4P 1VBYA 3P5TL 3NNCA 1R8HA 3MD3A 2MHNA 2M52A 5LXYA 5LXRA 2DIVA 2M2BA 2CPHA 4TU8A 2QEXS 2OTLS 3B4DA 1QVFR 1KD1T 2LEBA 2KXFA 2X1BA 2RU3A 2KRBA 3MUMP 1A9NB 3N9UC 4CH1A 1M90T 1WTBA 2DGOA 3VAFA 4UY8T 1KQSR 3CCES 2YKAA 2AYEA 3FEYB 3Q2TC 2DHXA 1QM9A 2M0GB 2VOOA 3NNHA 1Q7YT 3MUTP 2DNYA 3MUVP 3FEXB 1VQ4S 3Q2SC 4WKRA 1VQMS 1VQ9S 2XNQA 2YH1A 3OW2R 2M8DB 5JVGQ 5DDOC 4OZ0A 3HI9A 1VQPS 2J0QD 1WEXA 4PKDB 2D9PA 2KG1A 1RKJA 1U6FA 2HYIB 1HL6A 2U1AA 5GADU 1DRZA 2DB1A 2F9DA 2CQBA 2MKHA 2J76E 1UW4A 2KI2A 3ZZZA 3IRWP 2LMIA 1Q82T 2PE8A 1FJEB 2CQGA 4Y00A 3CCJS 1H2VZ 2AYMA 3V4MA 1N54B 2CPXA 1X4AA 3BO4A 3CCRS 2FHOB 2BOPA 3I56S 1N52B 4PRFA 1XN9A 4WFNQ 3VALA 2CQDA 5GMKa 1R8PA 2KRRA 3BS9A 2ERRA 1K9MT 2M70A 3BEGB 3CC4S 2I38A 1VQNS 3L3CA 4ERDA 1ZZFA 2KXNB 4IO9Q 3TO8A 1M5PC 2JX2A 3UCUP 2L9WA 2LEAA 5DDRC 3P3DA 3NS5A 2G1DA 2M7SA 1VC0A 2J0SD 4C7QA 4WCEQ 2VONA 2FC8A 1JJHA 2FY1A 3HHNB 1SJ3P 4WFBQ 2D9OA 3CC7S 3CCSS 2K3KA 3LQVA 3SDEA 3VAHA 2DO4A 2DNQA 4F26A 2DNLA 1VQ6S 2M4MA 3UE2A 5JVHQ 2MKJA 3VAKA 2MQMA 3S8SA 3P6YC 2DHGA 1X4HA 2LA4A 4QQBA 1H6KX 2LQ5A 2ZJQQ 2NZ4A 3MI7X 3MD1A 4PR6A 1YJ9S 3CULA 1U1QA 2LYVA 2MGZB 2YWKA 4A8XA 2KM8C 3G8SA 3R1HA 1YIJS 5GAGU 1M5VC 2GO9A 4P6QA 3VAIA 2E5GA 3ULHA 2RRBA 2L08A 3SMZA 2CQ2A 3US5A 2LKZA 3U1MA 2CJKA 2L41A 5HO4A 3G96A 3UD3P 1WG5A 4LJMA 1VQLS 3EX7B 3TYTA 2MQOA 3BO2A 2CQPA 1S72S 1X5OA 1AUDA 2F3JA 1U1PA 3R27A 3DXBA 2LXUA 2OTJS 2MSTA 2X1GA 4TU9A 2UP1A 5EN1A 2VODA 2NLWA 1WF0A 2MZ1A 2ADBA 1PO6A 1X4DA 3D2WA 5ITHA 4IUFA 2XS2A 3NNAA 1NJIT 2KG0A 1NU4A 3CC2S 2X1FA 2ADCA 1P27B 3K0JA 3VAMA 2QA4S 1OO0B 2MQLA 2JVRA 1ZZNA 1KOHA 5IM0A 3CCUS 2MZTA 3CTRA 1RK8A 1WEZA 2XS5A 5LJ3Y 2OJ3A 1SJFA 3CMES 4LIRA 1VBXA 3SXLA 2M8HA 2RT3A 1JJ2R 1YI2S 2MY8A 2B0GA 3NS6A 4LMZA 3RW7A 3CF5Q 1FNXH 2E5HA 1WI8A 3J7ZT 1L3KA 1U1KA 2FC9A 1UAWA 1VC6A 4F25A 1HA1A 1UP1A 1U1LA 1K8AT 2KXHA 3CCVS 2ZJPQ 2F9JA 2EK6A 2MSSA 3VAGA 2YTCA 2AYBA 2DGXA 1DBDA 3G9CA 1JMTA 3PIOQ 1YITS 3B4MA 2K8GA 4YB1P 4C0OC 2FPHX 2MZJA 5IQQA 3PIPQ 5DM7Q 5FJ4A 3VF0B 1B7FA 1WG1A 1WWHA 4WIIA
chains in the Genus database with same CATH superfamily
2W4PA 2C3UA 4CO3A 1Y5LB 3MECA 3QFHA 3Q22A 1FE4A 1MU2A 3M9NB 4WF9Q 3THTA 2LCWA 4JI6F 1RBAA 1AROP 2MKKA 2A18A 2LXIA 5F8IA 2QLJB 3WC2A 3KMSA 4MMOA 4DX6A 2BABA 2E9ZA 2PIIA 4UQTA 3THVA 3OVSA 4NI2A 1TELA 3GV7B 3MR7A 1OY8A 5ETSA 2RQKA 3SV4A 3ZC4A 1R8CA 2CNNB 4RW4A 4ZVSB 1YKWA 1ZAVA 3NGKA 1LXJA 1DHMA 4L6V3 3MTJA 3A12A 2QL5B 1YJVA 1IR2A 4Y6IA 2DISA 1IQTA 4NLTA 4DV5J 2XGQA 4CRJA 3HHLD 3KG0A 1RUSA 1B0VA 2ZOFA 2Z0GA 1VQ8S 3EVOA 1JLGB 3I55S 2W9CB 3M2UB 2F63A 3BSOA 1TQLA 3R3TA 1KR4A 2HVDA 2HS0A 2N82B 1UA1A 4KKOB 4JI2J 3KJFB 4Q45A 3KFWX 5AT1B 3MMCA 5J2PA 3KHLA 4OI2A 5EDWA 4HYKA 1S0OA 1VGYA 2CZ9A 2J8SA 3RAQA 3MEGA 3KNAA 3PX6A 2AGPA 3DHXA 1UFWA 2FVCA 1TK5A 5D15A 1W2BR 5D6GA 3W2WB 1JK9B 4JV0A 3GV8B 4U7UD 1K73T 4RO0A 1XMOJ 2ZH8A 3KLFA 2BKNA 4DSEA 5IQ6A 4LFCF 5J2MB 2HRUA 2FVRA 2KN4A 4MKVA 4NYZA 3V6HA 1NNDA 2BE2A 4RL1A 3OFEA 2V69A 1IKYA 1NMEB 3OFGA 2KYXA 3DU5A 1I94J 4N56A 1CULB 4XTTA 3OTOJ 4O3NA 3K58A 3BGFA 5E3PA 2CQ1A 1FFGB 1FRLA 1YSJA 4FXDA 5LXRA 2FVPA 3PHEA 4X65J 2WHOA 3B4DA 3SBMA 2FJAB 1U2CA 3PR5B 2BRKA 3JSBA 4QBUA 3KJQB 2XMAA 3ISZA 4RNFA 1IBKJ 3D66A 4X2BA 5KFZA 3FZBA 4G1QB 3WHIA 1R3NA 4ZIVA 1UEKA 2VG7B 5HAOA 2IBKA 1RHKB 3IWLA 4LF8F 2IBOA 4ZPBA 5GADU 2CQBA 2MKHA 1K0TA 4FF2A 2KI2A 5T7LA 3KXDA 2W9BB 3F41A 1FERA 5GMKa 2AJ1A 4B9TA 5F9NA 3CC4S 3FJ2A 3TO8A 2YQ3A 2JX2A 2YKOA 4GO7X 2G1DA 1TAQA 4MH8A 3OL9A 4QR1A 2CVEA 3PKYA 1B7YB 1F3FA 3CJ3A 3HHLA 5B0GA 1IUJA 1H72C 3KKFA 4ECUA 2B43A 1RYSA 1FKAF 2R7OA 2ZJQQ 4OYAA 1T03B 2O1PA 4A8XA 2ACYA 1WKKA 2I0XA 1TP7A 4OIXA 1C1BA 1RAIB 2L08A 3ZZUA 2ZNYA 1KLNA 2CJ9A 2VFSA 4MKAA 2VU5A 4OX7A 1H98A 4TU9A 1X0PA 2W8LA 4K0KJ 2JFKA 4R8UA 3NEKA 3W1YC 3HSGA 4DPTA 4ED8A 4KGKA 4LF4J 1NJIT 4DLGA 3BGLA 2QA4S 3OTBA 2RQMA 1N5YA 1U8WA 3CMES 1UKUA 4YB5A 4K4WA 3PG9A 4LMZA 1FNXH 1L3KA 5HN0A 2UVVA 2XYGB 1SKSA 4F25A 1NK6A 2KXHA 3BYPA 3ILJA 4WZMA 1IR0A 1HNXF 3MR5A 2BE9B 4PWUA 3KDNA 4AUKA 4W4MA 4A8SA 5D4PA 1I51B 2R42A 1WWHA 4YEAA 2DNOA 2MJNA 4RNMA 4CO2A 1BGXT 3KLFB 3OXFA 1IBLJ 3PYFA 5E0OA 2HFVA 4F50A 3AA8A 1DJ0A 3I87A 2GIRA 1WSVA 2RB7A 3TA0A 4FVMA 1RSCA 2DR5A 4O3SA 5LMNJ 4WP9A 2DGWA 3B6BA 1SJRA 1RHRB 1KNZA 3G6VA 5A8WA 1Q8KA 1XTZA 1RAAB 4X4OA 5LSOA 3C16B 3VAJA 2RNEA 1HBMA 1RU2A 1VOMA 4MFBA 3UPFA 3R5CA 4O3RA 2ZBRA 1YRUA 1BXNA 2MQ8A 2JZ5A 3TX8A 3NCQA 3M8YA 4R5PA 4IFVA 2HS3A 1CPZA 2VB6A 3JAMU 4QU7A 5T7LB 3MPUB 3T5LA 1RWMB 2RS8A 2J5AA 4DL0C 4QIWD 2ABYA 2V50A 5K20B 4DL3A 2F7VA 3G71S 5E3RA 1MMLA 4YDDB 2KJVA 3NXZA 2HHPA 3HVTA 2VDIA 5RUBA 1HKAA 4LVOP 3U27A 1SIZA 4C8YA 4I64A 1EKRA 1NEEA 2RVJA 3CJQA 4ZVRB 2EW9A 2XMKA 1K44A 2PO4A 4ID5B 3JSMA 1FHTA 3F73A 3U1LA 3H2LA 5DQGA 2MY7A 5KT7A 3CMAS 4ELTA 2BJ3A 3B82A 2E7WA 2MB0B 4QR2A 2B4UA 4UUWA 3QIPB 1IKVB 2I1RA 4WFYA 1OPZA 2WAQD 1S12A 3W9JA 4C48A 4U7CA 3I4PA 1KWMA 1JNRB 1WEYA 1G6BA 4ECQA 2W4DA 4CLPA 3MTKA 2JOQA 1UW9A 1XR7A 4AXIA 4I56A 1YZ6A 4F0KA 2IFXA 1FJGF 2V8VA 2V6AA 4ZP9A 3W5ZA 5IT4A 2C2NA 3LP1B 4EYHB 1QTMA 1B70B 4LFBJ 3B54A 5HMYA 2CADA 1XJWB 1JLCA 4ZLLA 4X4UA 2Y0SD 2DIVA 2M2BA 1VR6A 2OTLS 3T1HJ 2K3IA 3Q89A 2BV3A 1L3VA 1WTBA 2R7VA 5KFCA 4ED7A 4Y3CA 1I5OB 4U95A 2DHXA 1QM9A 4NEYA 3OPKA 1TL1B 3L9ZA 3AJDA 1VQMS 2H51B 3H5UA 2BJ9A 3T3FA 2CJYB 1I94F 4PQAA 2J0QD 4HT7A 1XK8A 3OTOF 2QTWA 3UVJA 4WKYA 1NDPA 3ZZZA 5BYSA 2HURA 1RTHB 3WX8A 4JUZA 4LR7A 4ANDA 2VA2A 2ZDOA 3SIPB 4X65F 2G2YA 2ZBIA 4FF4A 4ETZA 1OS5A 4CO1A 3AD7C 2BXJA 5DDRC 2C28A 3RB4A 1IBKF 4M5MA 5SUHA 1GXTA 2FUG9 2YNGA 3HCXA 2VONA 4B02A 5D0GA 5GMEA 5HROA 3Q8YA 3CC7S 3SQOP 2MHEA 2DNQA 2HK3A 4I67A 1YJUA 2MKJA 3CW2C 4A47A 1TKZA 5THWA 2NREA 4KB7A 3D4JA 3A3NB 4MFBB 1YJ9S 2PC6A 3QT6A 4ZLPA 3W5YA 1OQ3A 5D0RA 2R7UA 1V5VA 1RWVB 4P2FA 2F4FA 3QQCD 4DV0F 3TA1A 4LSLA 3CB4A 3O6QA 3QNWB 2CKWA 1RT4A 3NAHA 4NXNF 1PC5A 2AP6A 2OPQB 4TY8B 3QATA 2VASA 2ZFHA 3MM6A 4A8QA 1WEZA 2ZZTA 4UTGA 1VBXA 4MYUA 3C14A 2PA3A 1RLCL 3TI0A 3UN3A 4M5DA 3JSMB 2ZUAA 4ZCKA 4RW9A 2PFFB 2Y9HA 4OI0A 2ZD1A 1SL1A 2EK6A 4LBPA 2KB2A 1Q7LB 3A8KA 4M5LA 1ICEB 4EBCA 1U4BA 3K89A 4ECWA 4LRFA 2DEIA 2YVSA 3LH2S 3OTDA 3LP2A 2R2UA 4A8OA 3QT7A 2CIMA 1X5TA 4X62F 4NX9A 2HGNA 2O01C 4WFXA 5IT9U 2XLIA 5AE3A 4QIGA 1RBOB 3JB9k 3MEEA 3CNQP 4NZ7A 2VDHA 3J7YU 4NE9C 2XB2D 2K06A 4ZPTR 3PEJA 4URGA 5J2NA 4W90B 3CJ0A 3QFWA 3G6XA 2LQ8A 3KLEA 2DY9A 1NHVA 2YQ0A 3IS9A 1IBLF 5L1JA 1H2TZ 4F04B 2CPIA 2OIHA 1OWXA 3M8QA 4F02A 4I2QA 5KT3A 1Q4RA 2ZE2B 1FXDA 2MZSA 2VOPA 3CDAA 4AT1B 4LR9A 2Z2YB 5KFUA 3UVJB 5LMNF 1FRJA 2JC1A 3BGRA 4K50A 3GYNA 4HH0A 1LNQA 1RLDA 3BR9A 1S1VA 2ALYB 2IDLA 4A4JA 4MKBA 2LECA 3MF5A 2A3JA 1QVGR 3I0SA 3GCXP 3H2VE 5E33A 2MKSA 1HHTP 1HR0J 4PUOB 1YK9A 5D0HA 3I5CA 2GW8A 4OX8A 2MKCA 2UUAJ 3CCLS 4TU7A 2VPZB 3I96A 4FXWA 1FDAA 2E5IA 2I5JA 1NKBA 2NZCA 1SQGA 2CWKA 2PGCA 1AFJA 1HNVA 3T1YJ 3V6JA 1R31A 2DHAA 3IAS9 5FLXY 4L76A 3OLAA 5CQGA 2J7UA 2DXEA 1HI8A 4LSLB 1NHKL 3H59A 3W62A 4PYDA 1J5EJ 2PMWA 4P73A 2WVDA 3ISNC 2WCXA 1URNA 3H5XA 2CJAA 1VBYA 3JS9A 3RAMA 1VK8A 2V68A 2IC3A 1FE0A 2X1BA 3C14B 3DOLB 3M8PA 4UY8T 4RW9B 4KFBA 1S6QA 4KGZB 1VQ9S 1HW9A 2G2OA 5HANA 2XY7A 2GVDA 4A48A 2PEBA 3CD0A 1DTQB 2DR7A 2Y8YA 3M1VA 4LFBF 4DQIA 1T05B 3V4MA 1GH8A 3W65A 1BQNB 1UVIA 2BOAA 4GKJF 1PBUA 3CCRS 2CJBA 3VALA 1K9MT 5B0EA 1Y00A 3D5MA 2I38A 3WX4A 1QSSA 4NLVA 3NGUA 3P3DA 2DR9A 3ILLA 3X1LB 4ZPVR 2ZUGA 3ZNJ1 4WFBQ 2K3KA 1JLBB 1TKXB 1KS2A 5KG3A 2DNLA 3C6UA 5CH7B 3M9MB 4QYZJ 3IS9B 1OY6A 4PR6A 4RUHA 1NK5A 1KVKA 3K8WA 4I2QB 1S9EA 4DPUA 2V5HG 3BJYA 4JV5F 3VAIA 4NCGA 2GQCA 4H4OA 2AJFE 1MW7A 1IXKA 3MMJA 4OYWA 1VQLS 2UUWA 4P2XA 3TYTA 2JDJA 2G1HA 2WRMA 4OLOA 2UV8A 1PILA 2B3TB 4M5HA 2X1GA 2P9EA 3VZIA 2IPOB 3PYDA 2CZVC 1PO6A 3RGIA 1F0XA 1G4CA 1NU4A 2AIRB 2X1FA 2A2CA 3H7HB 2AHOB 1SPBP 2YXLA 3C3LA 3FMWA 3W61A 2NUUG 2M8HA 3FSXA 3BN7A 3MGJA 1PCAA 3J7ZT 2WOMB 1VC6A 4A46A 2MEWA 5G4DA 3BQ2A 3ICLA 4PCQA 3TUJC 3PDNA 4DJBA 4WYLA 1YITS 3UN2A 3LA0A 1VHFA 3BQ0A 2MZJA 5KG7A 2Z56B 4RKUC 5CD4A 1YBTA 2JFDA 5H9FJ 1R0AA 2R9LA 2HVZA 1KHVA 3JSRA 3SDEB 2H1YA 1HIYA 1R0CB 3IMQJ 4TLQA 1OMSA 4E2FB 3SCKE 3BZQA 3BBBA 3KLGB 3OBIA 3OR2A 4B9NA 3DRRA 2CQ3A 1ZM2A 4WE1A 1VBZA 2HHVA 3OXGA 4KV8A 1VRUA 3NRBA 4QIFA 3N0VA 4LSZB 4YOEA 1VQOS 4IKAA 1MMNA 4WU2A 4F4AA 1X4BA 4WBFA 2JC0A 2RKIA 5CYMB 2RF2A 2HVIA 3M8PB 3TVYA 4IRCA 1XR5A 1TVRB 2QGFB 2GZOA 2FIUA 5A8KA 4KT0C 1N34F 4DPWA 1IWAA 3DYAA 5LL6d 2KFYA 2ZKTA 1Q8IA 3W8GA 1SL2A 2IY5B 3TEGA 2BMBA 1A7GE 1KTQA 3G6ES 1D9AA 4ALZA 4ITSA 4NMXA 3KG1A 2GQ2A 2OPSB 4XIUA 5MAOA 4EFAC 4ZIWA 1EZZB 3ILOA 1RWXB 1WC0A 3DI6A 5HBMB 1EAYC 3PW0A 1O51A 2ILYA 2QMUB 2GVZB 2EG2A 2RAQA 4LUBA 1HWLA 3AT1B 2ZH7A 1FESA 3GR1A 1N48A 3GR0A 3C8YA 1ZTTA 3MM7B 1TV6B 2DNNA 2IRXA 1MWYA 2IYIA 5DG8A 4ECSA 1LK5A 2JEFA 3PR4A 1Y5IB 2WBMA 4PAAA 2UV8G 4H4OB 5B08A 2GIFA 2ROEA 3VTIA 2AZ1A 2WSEC 5KFMA 2YKMA 3FVYA 3HDSA 2ZVSA 4USVA 1MSWD 4DQRA 5L8RC 1RT5A 4FYXB 5E7OB 1FTCA 1S1XA 3LPEA 2C2MB 4HDGA 4I68A 3PO5A 4CNYA 1NO8A 4Q2MA 3CCMS 2MGZA 1UPPA 5DETA 3J81U 2EPIA 3NNCA 3H4DA 4OJHA 3M32B 2HLUA 2ZZMA 4X84A 1E6YA 1S1WB 3CSKA 2LEBA 2B51A 4NLXA 2CA9A 2YKAA 5CYQB 4KH0B 2Y1LB 2M0GB 4P2SA 3LGNA 3NNHA 2OAUA 3V5RA 3P5BP 2B4PA 3FGVA 1KONA 1KFSA 1WTFA 2VV5A 1NSKL 3OFHA 4OYXA 4PXDA 2P5VA 2AJ2A 2D9PA 4WYWA 1R0AB 2A6MA 1CS4A 3IRWP 3HF5A 3QRRA 4YB6A 1C0TA 2IM1A 2XLJA 2UZAA 3BO4A 5HI7A 3NGSA 3SI8A 3DRRB 2NXJA 2ZNZA 1FWPA 1UCNA 5KT5A 4KV8B 3OVBA 3MCOA 3BREA 2P9GA 4OV6A 1JJHA 2KKHA 3ETOA 4ANCA 3NBPB 3WQPA 3AOAA 2QSFA 4ZVTB 3JQKA 3UE2A 2MQMA 2RKIB 4Z37A 4DUZF 1T9XA 1GXLA 2ZH5A 4LBIA 4B3RJ 1IR1A 4P6QA 2B4VA 1DARA 2LQ9A 4ZVOB 3DYAB 4HHJA 4M5NA 1RAOA 4OJ3A 4K4ZA 2VFTA 8AT1B 1DQ9A 3OVAA 1IKWA 1AUDA 3KOAA 2BW7A 3CEDA 2MDAA 4I7FA 5EN1A 2HNDA 2OEMA 3GJQB 4I6WA 1YBUA 5ITHA 4DL2A 3KK2A 1CG2A 3CC2S 3BDEA 4HI1A 3DI6B 3E01B 4IH6A 3HMJG 3P96A 1H7WA 1NRKA 4HHUA 4EUVA 2MTLA 3FBFA 1N5VA 2RIJA 1RADB 1YI2S 3DKDA 3E8OA 1EKSA 1RTZA 2AJ4A 3KK1A 1U1LA 3RZAA 5ETRA 2MSSA 2CXEA 2YTCA 4DL5A 5AJ3J 3PIOQ 3GE9A 5F3TA 4F4YA 3RAXA 5C2GA 4NLRA 1NKEA 5FJ4A 1B7FA 3HVAA 3GYXB 3CD5A 4LFAF 2MLXA 2QL7B 1OJ4A 2YKMB 1MWQA 4LR8A 3H42A 4XDCA 1RWPB 4ZJQA 5ETTA 3DGVA 1RT5B 3CJ2A 4RBTA 1F1BB 4QPXA 2DGSA 5C25B 1O6XA 3EGWB 5DGBA 2CQIA 3DRSA 2V9WA 4ZPCA 3E51A 3TUZC 5IWAF 2ZHOA 2R2TA 4YHHF 3P49B 3ZTQA 3L7OA 3GFXA 4K4YA 2X7IA 3BQ1A 2XSFA 4F8RA 6AT1B 9RUBA 3HSDA 2AW0A 3DNCA 2EEYA 3QO9B 2QL9B 2HNYA 3W9IA 2HZCA 4KTQA 5AXKA 3U02A 2VJUA 2Y1JA 3PEHA 3LW5C 3FQLA 5GAGI 2ZDPA 1FKPA 1WDDA 1FRHA 4HR2A 2MZRA 2FD2A 2DNMA 2C3MA 1L3UA 4O23A 5K14A 3DLGB 2O5DA 2NSCA 1EP4B 2QFJA 3D1HA 2GX8A 3D1OA 1NJXA 3MAQA 1FFWB 3LGHA 1FDNA 2CUYA 2D3ZA 1DTTB 3LP0B 5F8JA 4Q43A 1H7XA 2C3YA 1TUGB 4C8MA 3LWLA 2M3DA 1VQ7S 1WELA 2DIUA 1CJTA 1FDBA 4O4GB 2V2VA 3CPWR 2HZAA 2HQ3A 2XZTB 5D3GA 1N6QB 3AQPA 3VV2B 5EUHA 1HD1A 1HI0P 2WK4A 2RDDA 1JXEA 2YKQA 2HHXA 1TFYA 1FK9B 1TZ0A 4FPIA 3SCJE 3AODA 3EDRB 3A13A 1IKWB 4RBUA 4JI5J 4G3IA 3B8HA 2Q6BA 3IXQA 2F4VJ 3R6GB 2YNFB 1FCAA 4QIEA 2XMWA 4I7FB 2HNDB 3EGZA 3VR1A 3IM8A 4TN2A 3I31A 1UPMB 4Q0BB 2D1CA 2B5JA 5AXNA 4ECTA 4LF1A 4CO4A 4F3QA 4DR7J 4ED6A 4RW7A 2V63A 1ZA2B 4I2PA 1SC4B 9ATCB 1RB0A 3IC1A 3FEYB 1RTDB 1S7IA 3DRXA 2BE7D 1RTJA 4JOUA 3KHHA 3KK1B 4FS1A 3P4UB 2XCAA 1NBEB 5K9FA 2X3DA 1WEXA 5A8RA 4PKDB 4URQU 1NJYA 1SQFA 2J0WA 2AYMA 3TZYA 1FX4A 1UWAA 4B3MF 5J1EA 5DLFA 3D28A 3IFEA 3D9BA 4KHPJ 3AB4B 3K2YA 4C0HA 2CQDA 2EC2A 1PAEX 3L3CA 4ERDA 1ZS6A 2L9WA 4ED1A 4NRTA 4OX9F 1SKUB 3DRSB 3QLHB 1HW8A 2M7SA 4RUBA 2GNKA 2FLNA 2F1FA 3H4BA 1HARA 2Z4PA 3CD7A 5HQLA 2WONA 1IKXA 3SCIE 3GG1A 5J1NA 5KAKA 4KY3A 1CJVA 3S8SA 3P6YC 3AY0A 4LREA 4NA2A 4K4XA 4N76A 2XTJP 4D3GA 1NSQA 1PIEA 2IM3A 5F0UA 3Q8UA 4EZ6A 4RNNA 2EBGA 3F0NA 3OUYA 4DR2F 2OPPB 4CP5A 1RT2A 3K5LA 5J1PA 3ITHA 2W2NP 1B0TA 5KOXA 3M6XA 3BKUA 2DEJA 1SUQA 2EKNA 5D4NA 3I0RA 3UO0A 4NEZA 3NL0A 1U1PA 1T7PA 3A8JA 2VODA 4ZPAA 2ADBA 3EM1A 3QJPA 2VA3A 2HHUA 1T9WA 2PI4A 3MM5A 1NZ8A 4KGMA 1YRXA 1A6LA 2MZTA 3CTRA 4R0JA 2OELA 2FC9A 2WVFA 1IN0A 1M1GA 4ZP8A 2H4YB 4XAKA 2ZJPQ 1RT1A 3MM8A 2UXBJ 2EFGA 4F2RA 4YB1P 3AD8C 2Y3YA 4CLWA 4KQZA 2CDRB 2WTFA 3T41A 2DGQA 2W8KA 3M30A 2G9OA 1V3RA 3KJNB 2BQRA 3IR5B 3Q0AA 4C8NA 4LSNA 3G86A 3LALA 2GJFA 3SFUA 1RT7B 3RBEA 2E1RA 1ULRA 2AU0A 3C6TA 2HLTA 3HM9A 2BJ8A 2MMYA 2FLPA 3ET6A 1VQKS 4IG0B 4F4WA 4JI4F 1U02A 2B5JB 5B0FA 4QIVA 1RT3A 2N3OA 5MLCV 4QWEA 3EYZA 2H4WB 1P1TA 5IT9Y 2ZOGA 4DR5J 2RILA 1LWFB 3VGTA 4NLGA 4P7TA 3PHTA 1PSDA 3FBEA 1IWGA 2C2OB 1DZ5A 4B9MA 2LP4A 3AOBA 1LW0A 2DXFA 5C7PA 1D8ZA 3HD2A 3KUGA 2YH0A 1QLNA 1BWVA 3DRPB 3Q86A 5D77A 4A8YA 4IR9A 3W60A 5L1LA 4M95A 4JYAJ 4ECZA 2G0JA 4B3TF 2HNZB 3SYZA 4FNIA 4KE5A 5D8HB 3KK3B 1TKDA 4B3OA 2VFUA 4RW6B 3GWCA 1FO1A 1HYSA 4EZ9A 1M5OC 1V9OA 1S1UA 2YWGA 1UFKA 3ITHB 2YKNB 1FWKA 2V0NA 3I0RB 3CXCR 2NYHA 1WHXA 4PZVA 4JI8J 1BC6A 1T9VA 2F8HA 3FBCA 1S9GA 3L09A 1TUVA 4L3KA 1S6PA 4YP3A 2UUBJ 1KLMB 3IWNC 4B9SA 1PJ7A 3H5YA 2YWEA 2I2YA 3J7Z5 4IDKB 2NXEA 3PRBA 2XMVA 4DV4J 3FSYA 1R8HA 2EBEA 1TL3A 2BYCA 2A6OA 5T41A 3OT9A 2FHKA 1TR0A 2GGPA 3AH6A 1XNQJ 4RLEA 2AYEA 4YR3A 2R4FA 3DFEA 4J9PA 3MUTP 3M6UA 5KG6A 3Q2SC 4ED3A 3U7JA 1RT1B 2M8DB 4JI5F 2CWXA 1PG5B 4ES1A 4OZ0A 2GJ2A 2F4VF 2B9WA 4MT1A 2HYIB 2YNIB 4Q2LA 1JLAA 3VCDA 3OR1A 3C15A 5KFFA 3DLHA 5B0AA 2CPXA 4P52A 1KFDA 3R5GA 1FRIA 4K4TA 4DR7F 2KRRA 2ERRA 4OHVA 4C11A 2QSWA 2XQCA 1KQGB 3D6HB 1HI1A 1VRTA 4HHHA 3C6TB 4HLBA 2OKQA 3HLUA 2FY1A 2H9ZA 1PC4A 1S77D 4NXMJ 5ETPA 2YWFA 2LXFA 4PG5A 1B0PA 1YJRA 2IRYA 1HQ2A 3FZ2A 2Q6CA 3MI7X 3CULA 3IP0A 2COLA 3CJSA 2E5GA 5KFVA 3MAHA 2RRBA 1HBOA 4KR0B 1N36F 4K7QA 1WG5A 4DF8A 1E6VB 4NLWA 2YX7A 3EX7B 5ETVA 4LF6J 1GTEA 2XI3A 2XZDB 1LWCB 3DXBA 1WDTA 2WSFC 2F8EX 2UP1A 1G7CB 2L48A 1RP5A 4BCAA 2XGPA 4USWA 2LU1A 4JI1J 5HMXA 2QZ8A 4GMKA 4ZVQB 3R5JB 4ZVHA 3KMQA 4N41A 1TL7B 1ZZNA 4Z7CA 3BSCA 4UUXA 2AEFA 5KOWA 1JJ2R 4J9SA 2OUGA 2C3OA 4DOZA 1ZM3A 2H65B 1DLOA 2IMOA 4AL7A 4ICLA 1XWLA 4DUYJ 2FPHX 5IQQA 1GTHA 1V3ZA 5HJXA 3UCUP 3QGPA 2MKIA 4DV1J 3I9V9 3BKTA 4ZCIA 1FJ7A 3IR6B 4DR1J 2G2ZA 1R43A 2XLKA 1KBRA 5KT2A 1S1UB 2XI2A 2DNHA 4EGLA 1YJNS 3L7PA 1P8GA 1Y5NB 2VFRA 3RRHA 4X64J 3QT8A 3HZEA 2HBRB 2JLEA 1QSYA 1BQMB 1IM4A 5A76A 3BV8A 2UXBF 2BKPA 3OL8A 2E5LJ 4GKKJ 2HHHJ 1RWUA 1NPPA 2EFOA 4ZVGA 2WW8A 3DM2A 3ENQA 1CEZA 3PW4A 1DY3A 1X5SA 3BB5A 4RUCA 3I32A 3OTEA 5EX0A 3GIMA 3D3BJ 2Q79A 4ENOA 4XPCA 1S0MA 3DMJA 1IVZA 2DNPA 1NHUA 1UVJA 1YZ7A 4CIOA 3MMBB 1RAFB 2Q43A 3CIMA 3GFHA 4OZ5A 4IOCQ 3KLHB 5LOQA 4TNOA 5KFOA 4Q7AA 4PXBA 2EI5A 4QW9A 5M2RA 1NJWA 4JI3J 3BKFA 1XEZA 2UUCJ 4L72B 2D69A 2CYYA 3HFZB 1R0BG 2G4BA 2DH8A 4OQJA 1GMUA 5D4LA 3DLJA 3D68A 5L9NA 2PEHA 4I69A 3HHLC 4ZVUB 4ECYA 2N7CA 4DCOB 1KP6A 1VQSA 2OH2A 3AXKA 5F41A 2ZH2A 3N01A 3CCWA 5BYRA 1WHYA 3TP2A 2B7CB 4YFUA 2KFNA 3NP5A 4AYBD 1WOSA 2P2CB 2VPXB 2Q66A 4DDFA 3H0PA 2MPUA 4MK7A 2VQFJ 3VZHA 4DPXA 1Q81T 3FBBA 2GAHC 2OSRA 2ZWOA 2LEPA 1FKOB 3PCOB 3IWXA 4RZRA 4O3OA 3R1LA 3FFIB 3RBDA 3LTOA 1NK7A 1AUSL 1YTYA 1U1MA 5C2CA 2A1BA 3QJJA 1SCJB 3O8WA 1SIWB 4B08A 2EKYA 4ZLJA 1H0HB 1S0VA 3C2PA 5EWEA 3SQGB 2FJVA 3MUMP 3N9UC 3VAFA 2NSBA 1KQFB 1RE1B 3IRXB 1C2PA 2J9DE 3MM9A 3RB6A 3O5TB 4EK2A 1AA1B 2YH1A 5F8NA 3OW2R 4JI8F 4ICLB 3A1YG 4DL6A 4ER8A 5BR8F 3J81Y 3KJVA 3P8BB 5AXLA 1RKJA 4PEOA 2KT3A 1UW4A 2OMLA 2CQGA 4Y00A 3CCJS 1H2VZ 4FZVA 3RRGA 2YY3A 1N52B 1BMQB 3PX0A 2J0XA 1HNZJ 1XNQF 1ZZFA 2HFZA 3CVKA 2CZ4A 5A0YA 3MMAB 1I3OB 2KO1A 4LF7J 1VC0A 4M5GA 1S7HA 3HHNB 1SJ3P 4JI7F 2YKPA 2KT2A 4CTAB 3ZZRA 2JLGA 2DO4A 3FK4A 1J2VA 3OD2A 1AT1B 1UZDA 2KL8A 1QE1A 1VQ6S 2M4MA 3HJFA 2DHGA 1NH7A 5B0CA 1XIQA 1TL5A 4DR4J 4IRDA 3BGUA 1WC6A 4IFYA 2YNHA 2KM8C 3NOGA 4PXEA 1GX6A 1MWZA 1SC6A 3DOKA 3M6WA 3TJ8A 3MCNA 1P9YA 2XBPA 4MTPA 2W7AA 1AB8A 1CJUA 4DZDA 5F3ZA 4NXMF 3UDVA 3MEDB 5EWFA 2Q3PA 3T5KA 1NM2A 1EIYB 3J7YI 4DPOA 1N32J 3CJ5A 1SL0A 3FMBA 8RUCA 4ED2A 4K4VA 3K0JA 2VJVA 3NOCA 1F3VA 5IM0A 4WP3A 3CCUS 4CLKA 3HT3A 2E1PA 1SKRA 2V2QA 2Z30B 2B9EA 2GJIA 4X4NA 3ZNUA 4YB7A 2VG5A 1MROA 2E5HA 1I6JA 1XNRJ 1RCXB 3CCVS 3F56A 4LF6F 1FDDA 2BEFA 3M2RA 1DBDA 3RG6A 3ZZPA 4MIWA 2VH7A 1G1XA 3DGPA 4ZOSA 1TUWA 2H5EA 1U0HB 5DGAA 1XC9A 1WOOA 3QWPA 4U7UK 1KTVA 1WJ9A 3DLKB 4IG3A 3C46A 4BWJA 3IM9A 2BANB 3EZUA 5I42A 1SH2A 2HHTA 3PRDA 3S6EA 4DV7J 4CT8A 1Y10A 2LDYA 1F9FA 1NZAA 2XWXA 4UQGA 2HMIB 2NCKL 3GPAA 1RA7A 2HIQA 4ATNA 2UU9J 4PWDB 1JLEB 1J5OB 1HPZA 1S48A 1U26A 4OZ1A 1O8BA 1D0EA 1HD0A 2QMXA 4DR1F 3BBCA 1D9DA 4KYZA 3N28A 3NCPA 3OSNA 1FXRA 1CC7A 1UWBB 4OYBA 4RW8A 1FD8A 1FEEA 4X64F 3CE8A 3NMRA 4U67Q 2ZJRQ 2OLWA 1N8RT 2PI5A 3FCVA 4DR6J 4DR3J 1ZTWA 1ZA1B 1OIAA 4ZDNA 2FB0A 1GNKA 2BX6A 2ZBCA 1W2IA 1MNEA 2W9AA 5GMDA 4DCJB 1RABB 3MURP 5L46A 5J2QB 5CXTA 3UR0A 8ATCB 3MECB 2IMWP 1LW2A 1MU2B 2V4RA 3L7UA 2G13A 1U1RA 2CPYA 5AXMA 4DV3F 4DG1A 1QE1B 2DH9A 4NL5A 4NYOA 2IJNA 2GV1A 5I3UA 3MEKA 2DK2A 3KUHA 3R97A 3GIRA 4JI3F 4DWIA 1D9FA 4IOAQ 2IJFA 4FXVA 2UUCF 3MR3A 4NI2B 2ZEJA 4LVNP 2FJDB 2WB1D 1X8DA 4ILRA 5CYJA 3G6YA 3QSIA 3GJTB 4EYIB 3HKZD 4P9SA 1C0UA 4RW4B 2KYZA 1Y9OA 2AEJA 1S4FA 2VKZG 1GFWB 4PABA 1VJQA 2V34A 4AQYF 1NDKA 1T11A 4K59A 4EEYA 3LPYA 1YQHA 2VQEJ 1AW0A 4OYIA 4HL9A 3KNGA 2WZ1A 1WC5A 2QX0A 2KZZA 1TKTA 1HNWJ 1SH3A 5L38A 2Y0BB 1S9FA 4O4RA 3Q83A 2GCFA 3V2UC 2VQFF 3JYTA 2VG6A 1D09B 5CD4H 3K57A 3AAWB 4S0MA 4C8ZA 3VVUA 1QUPA 2HFOA 3EICA 2WW4A 3NWGA 5HQMA 3N6NA 1B4SA 3IA0A 3MMCB 1XBWA 2VC1A 5J2PB 3HJVA 3MAAA 2J76E 1RAJA 1N56A 3JQMA 3J80U 3MEGB 2R7QA 4PRFA 4RBVA 5F8LA 2RD5C 1MG7A 5I42B 4ED0A 2V2ZA 4QR0A 4GVBA 2KXNB 3GJSB 2FHMA 4U6PA 1G3OA 1V3SA 4RJVA 2AGOA 2NR0A 4PG7A 2BE2B 2XEXA 1K1QA 1IKYB 2J7KA 3D3CJ 3TANA 2AZ3A 2LA4A 4YY3J 3EXCX 5IS2A 4HTIA 3RRKA 3CJKA 3IG1A 2OD6A 4LF9F 4KGVB 2GO9A 3PFOA 4NLDA 3DN9A 1LEOA 3I82A 5HLFA 4HACA 4R0EA 5HP1A 1S49A 4J9UE 2PMZD 4LF7F 2B8QA 3G82A 2BA9A 2MQOA 1VRQC 3DLBA 2EFVA 1KHWA 3ENAA 2DRDA 3OHBA 4E8UA 2XG8A 1WSRA 4O0NA 1JLQA 4KO0A 2JEJA 2DRAA 2QV6A 3M8SA 3SXLA 1LW2B 2ZH3A 3OJUA 1T9TA 4NZ6A 2ZH1A 2DXDA 3CF5Q 2H5IB 4E0DA 4CLTA 1K8AT 4C8LA 3F44A 1UL3A 4N7TA 2DGXA 5I3UB 2QA4G 3B4MA 1U49A 1MMDA 4ZCLA 2E9RX 2XY6A 1WG1A 4FBTA 2D3O1 3PO4A 4ZK7M 2Z57B 3N5FA 4DV5F 4CH0S 2RHSB 3HHLB 5IFMA 1X5PA 2BZ2A 1WC4A 1QDUB 1Q1KA 1T94A 1U8SA 4TQRA 5GVQA 3M4XA 3CJ4A 3JQJA 3M2VA 1UJ4A 1C1BB 1Q8LA 3AJ1A 5ETOA 4X66J 4JI2F 2WB4A 1S6UA 5M2PA 2IVYA 3PKMA 4Y2MA 1YJTA 2G0IA 3SEOA 2UXCJ 2YPZA 5EWGA 4AXJA 5DDPC 3D6MB 4ZVFA 5IZHA 4R8UB 3JYTB 2VG6B 4C8KA 2IRUA 2R7SA 3QBCA 5A6PA 2WVEA 2BM0A 1VFJA 4Y28C 4DV7F 1WI6A 1CVJA 5KFJA 1S79A 1N5YB 4UW2A 3MCMA 3EE3A 1XMOF 2BVZA 2J8AA 2DNZA 4CM2A 2PD1A 1U0SA 1X60A 3IR7B 3PZPA 3HHDA 4KC5A 3AA9A 2BDPA 5A2QY 2HQFA 1N88A 5C24A 1NSPA 3POTA 3ZO7A 2CNKB 2HFUA 3DOMA 4Q8FA 2AX1A 3TAMA 2XSJA 5E2QA 3SSSA 1GMVA 1WKJA 1Q5YA 2HRYA 1H2UX 3A8EA 4NPOA 2VFVA 3N6MA 1M1HA 4RU2A 3VVTA 1WC3A 5CABA 5DS7A 2Y1RI 2R8JA 1SV5A 4C8OA 1LFPA 1WF2A 5GAEU 1N4LA 1S10A 2GHVC 3MXHP 4CLYA 2J6UA 5C42A 4FDFA 2BJ7A 2OEJA 5A8WB 5HP1B 4NLQA 5HATA 5JMNA 2RUGA 1HBMB 5BYQA 1V5IB 1OYDA 1KKHA 1GK8A 3NCRA 3DHWC 2KM8B 4R5PB 2OD4A 5ADZA 2YX1A 4IFVB 1JLQB 2HQGA 3PW7A 4O44A 2HHQA 4TU8A 2ZWPA 2XMTA 1KQKA 3RR8A 4NMLA 2IA0A 1AZSA 4CDIA 7FDRA 1S5ZA 2AX0A 5EX3A 5U47A 3OTCA 4NCAA 1SC1B 3FEXB 4WKRA 1T9UA 1RTIA 2MKYA 1EETA 3TJAA 3LANA 3HVTB 4H4KA 1H38A 2IIHA 1WD6A 4LFCJ 4HKQA 3I5BA 2I8EA 2ATCB 1S0NA 3CDWA 2ASDA 1WORA 2PE8A 4JI0J 1UA0A 3SCLE 4H4MA 3I56S 3H90A 3V6DA 1XN9A 1PYTA 2CJXB 3PW5A 3PYGA 5FDLA 2HQIA 4YQWA 3LWMA 4K0KF 1ZYQA 1O5JA 4LF4F 4RWXA 2BKOA 4NYPA 1SI9A 4M8LA 2FGOA 4YMEA 3HFKA 3DDNA 1IBMJ 4OYPA 3MD1A 4C6AA 2E7VA 4ILLA 2YWKA 1CC8A 1RGVA 5GAGU 4LF8J 3QMQA 2CFXA 1JLCB 3BR8A 4U96A 2FJWA 3QYYA 2HIYA 2DCLA 5L1IA 1PYOB 1LQ9A 1YBAA 3N6LA 4JV1A 2L41A 3ZTRA 2V8GA 3W8PA 4G1PA 1HHSA 1Q0NA 1X5OA 2MSTA 4EBEA 2DRBA 1ZAWA 3O1LA 1HWUA 4YY3F 3BF4A 2BJ1A 3SSRA 1U47A 4RNOA 1KOHA 3DOMB 1RK8A 2P6SA 1MLAA 1F6TA 4ES3A 3L4BC 2NPIA 2HK2A 1EARA 1RAEB 4TLRA 1JLGA 3VAGA 3SFGA 4X4SA 2W9CA 3M2UA 3G9CA 2KHDA 3L95X 3PRVA 2GFFA 1NK4A 3PIPQ 4MKYA 2HS4A 3HZGA 3DRYA 3R8YA 2YNGB 4KKOA 3FC9A 5HROB 5I4MA 4V19J 5C42B 2NPFA 4MAKA 1VQ5S 3VHQA 1Q86T 1TKZB 2BW2A 4PWWA 4DI6A 4J9OA 3T9ZA 2V94A 5F9LA 3IGNA 1M5SA 4OMFG 3X3UA 2DNGA 2HAIA 2B8PA 1UETA 4KAIA 3W2WA 1PGZA 4WXOA 3V4IA 1VCTA 2EXUA 5J2MA 1QY7A 4FKYA 2E44A 2RHQB 1RT4B 4N77A 1CULA 3W7BA 4AL5A 5BJRA 1JJ4A 4OI1A 4L75A 3UCZP 3H2UB 5F8HA 3IBFB 3VWSA 3MM6B 2QFIA 4Z2XA 5H9EJ 1D3WA 3V6KA 3CWJA 1YJWS 2QYCA 1FVSA 2NS1B 7AT1B 4M5DB 3A4TA 4H4MB 5E3QA 2MLYA 2ZD1B 3ILIA 2QE5A 2W2PP 1M1KT 2JEIA 1LFWA 1RACB 4RPFA 1NB7A 1FRMA 2ACMA 1ZAXA 4G1QA 1NK9A 2CG8A 2VHGA 4DQPA 3TZXA 1GQEA 3AD9C 4CQ1A 3CCTA 3QGIA 4HI2A 3HD1A 3LP2B 4I0WA 1EQ0A 3T1HF 2W9BA 2GS8A 1JXVA 1H73A 1UJ5A 2DT9A 1R89A 3HX9A 2O3DA 2DY1A 3T5HA 3ENWA 4A8FA 3MEEB 2E1CA 1SB6A 1VC5A 1JNZB 4TKTA 4Y2IA 5J2NB 4XDDA 3ZTOA 4V1Ak 5LM7E 3KLEB 1RI7A 1YRTA 1OPIA 2D3UA 4LBHA 3M8QB 3TAPA 4ZCMA 4ANEA 4RNHA 5K8OA 2CQCA 1T03A 2RRAA 4FKXA 4UZBA 4QU6A 1SJ4P 3P5TL 1XERA 2M52A 3W64A 4MK9A 5KFIA 2HQDA 4J9NA 2GC8A 2QEXS 3NKYA 2XHCA 1PBAA 5KFLA 3BGRB 1A9NB 2V2KA 4DUTA 1S1VB 4J9QA 1APSA 2YBVA 4TQSA 2L3MA 5DDOC 3I0SB 3D67A 3EJMA 1VQPS 3EVWA 5CZXA 3TUPA 4CCHA 1M0SA 3M8ZA 1HL6A 2U1AA 2DB1A 1FJEB 5FD1A 1S1TA 1GXUA 3K5MA 2X51A 1U45A 1FJGJ 4DSKA 2I5JB 4UOGA 1P6TA 2LFVA 2M70A 5KFDA 3A8IA 1DFDA 4RU9A 2J6SA 1HNVB 4ZVPB 4USKA 1Q16B 2E7XA 3NS5A 1NSAA 2DR6A 4JB8B 4WXWA 3M9OB 1HFEL 3CCSS 3NS7B 1T9YA 3V4IB 3R2DJ 1SH0A 1HMVA 4LRAA 3DU6A 4D3HA 3CGIA 4QQBA 4JI0F 2GAGC 2JJ4D 2NZ4A 2QA2A 1TFWA 2ZH9A 3R1HA 3G8SA 2HWTA 2A10A 4K4SA 3PW2A 2Y1IA 5CCMA 2R7XA 2IC3B 2KDOA 5AE1A 2CJKA 2CAJA 5F8MA 2P8IA 1VDHA 2HAFA 2W01A 1S76D 1AFIA 4DX5A 1XR6A 3C16A 3BO2A 1PKUA 1NXIA 2F3JA 4KFBB 1S6QB 5HQ8A 2J9DA 3M8RA 2HPUA 4YN3B 1V6HA 4Y34A 2L9DA 3E3XA 2NLWA 3UNYA 4GC6A 4WFZA 1UTAA 1RHUB 2GVDB 2NUHA 3FEZA 3M8WA 1UVLA 5KFAA 1IBMF 1T3OA 2R2SA 2LLZA 1Q53A 2ADCA 1P27B 1JLFA 4XK8C 5F0WA 3PV8A 2FJEB 3M1VB 3T6JA 2RH3A 5LJ3Y 3VGUA 4USHA 2R3VA 3RU0A 2B6AA 4KPCA 3R6LB 4PG8A 3UW1A 4F0HA 4EWTA 3EZOA 1JQGA 1JMTA 4OJ1A 4DV0J 2VZ9A 2VBYA 3VGVA 5HSPA 2J9CA 4N8NA 3Q8RB 4X4RA 3TZWA 4OHWA 2QIFA 1WG4A 2MQPA 4ID5A 3KLVA 3GIIA 5DLGA 5L9XA 3C6UB 3R5BA 1FX2A 1TK8A 1RWOB 1S99A 3CUNA 4NXNJ 3QIPA 1IKVA 2KU7A 5LMUJ 1S9EB 4FNHA 1FFSB 3JTNA 4NCGB 2BJEA 1H3DA 4Y2AA 1P9QC 4DS5A 2W7PA 1Q5VA 1YLXA 1HR0F 4DFJA 1R6VA 1U2FA 3LUYA 2UUAF 2CVIA 2GMHA 1P1LA 2CPFA 1JWWA 4K2XA 4P75A 2X3GA 1NK0A 2EC0A 3LP1A 2EVZA 3KG4A 3TARA 4DV2J 3T1YF 1UEUA 3K8VA 1UZHA 2AYGA 4F4XA 4ZITA 5E41A 1YVFA 2AKWB 2MZQA 3GB0A 1S1TB 1FRKA 2JVOA 2RS2A 4X62J 2D3OR 4DF4A 2AD9A 4LF5J 3D7SB 2A0FB 1TL1A 1J5EF 5B0DA 3S7RA 4DL7A 3LOUA 1BHNA 3TAQA 3MCSA 1ZH5A 2R8GA 5I3QA 4DZ6A 5D0EA 4DSJA 2KH9A 2M5YA 1RTHA 3OR2B 2A2DA 1Q79A 1HMVB 3CDEA 3I4HX 1RCOB 3PJXA 4WE1B 2KT5A 1VRUB 1RT6A 3E2EA 3GFYA 4EI2A 2XMMA 4ED5A 1BWEA 3SSQA 2F40A 2MXYA 2XZWA 2AQ4A 4K4UA 1OSCA 1HWKA 1TU0B 2EK1A 2HVEA 1REVA 2K7JA 5DQHA 2EFQA 3MR6A 3M05A 5GAHU 3QZ7A 1A0OB 5KFNA 7FD1A 1SJQA 3UDEA 2RF2B 3D6FB 5CZVA 2M9KA 3PJWA 4IYQA 4I1TA 3PVXA 3GIKA 1S57A 2QT7A 4DLEA 2VIHA 4N8OA 5A8KB 3EXYA 3K5OA 5M2UA 1RWKB 1XMBA 4F4KA 1GX5A 1JLFB 3OL6A 4DXLA 1TTHB 4ELVA 4CH1A 2ZITA 1ITPA 1KQSR 2B6AB 2PA8D 3MUVP 2H5JB 2H48B 1T95A 5SZTA 3FCHA 2VBWA 2OPQA 4TY8A 1EQMA 4FP9A 2FVQA 2UVUA 4B9VA 2LMIA 3NGTA 5JJBA 3QGGA 3DC2A 1DURA 4OX6A 1SC3B 3BSAA 3LO3A 4QYRA 1MN7A 5IC4B 2N4CA 5E5NA 1F2GA 3DDKA 2FLLA 2NQPA 3EPGA 4WCEQ 2CNOB 2XMUA 3EDQB 3LQVA 3D0HE 1FF2A 5JUMA 4F26A 1NDCA 3J80Y 3NLCA 5JVHQ 4BHQA 2C2ZB 3CDUA 3PJ9A 4WTOB 2OPRA 2JSXA 2QC3A 2LQ5A 1S1XB 3GONA 4HH1A 3UD5A 1VLYA 2E66A 1RQ0A 2MGZB 2W2MP 2ZM6J 5KFXA 1RHQB 3U1MA 1E6YB 4YDXA 1F60B 4GKJJ 1Q78A 2ZC4A 4K5SA 4N5SA 1W25A 3D54A 1QSLA 1D1UA 1IM6A 1K1SA 5F8GA 4ZA1A 1JIHA 1JB0C 2XYPB 2NXUA 4P74A 4IH5A 3CJ8A 2AT1B 2ZE2A 1UJ6A 4IUFA 2XS2A 4CZCA 3NNAA 1L3SA 3GG0A 3ENVA 3VQTA 5KG0A 4TYAA 2HWIA 1CS4B 1PYSB 1GEHA 4LIRA 1C0TB 3PYEA 3UDCA 1YGYA 4J9VA 2V4QA 5HMWA 2ZKUA 2Z2LA 4OHYA 4G65A 2F9JA 1IJEB 4U8YA 1RT6B 2CJQA 1Q95G 4JV5J 5DM7Q 3QAEA 4BC7A 1FNOA 4K8RA 4WIIA 1EJ7L 3TQ1A 4PUOA 2L9NA 2C2RA 4DV6J 1REVB 1ACMB 5ETMA 2UVRA 2GHWA 3S01A 4USUA 5KFYA 1UVNA 4CLUA 2FLOA 2DTJA 1X4FA 4PPDA 3RBXA 5HMZA 1UVKA 1YX2A 3LAMA 2GQQA 1FXLA 2FZCB 4IQMA 4MK8A 2ZOMA 1TMMA 4NLYA 4ZJOA 4WU3A 2HBQB 4M5KA 3GSDA 2DYAA 2KHCA 1QAIA 3T1AA 1QAYA 4DPYA 2FQQB 1NPRA 1JX4A 1T3NA 3IO1A 1LOUA 1YHQS 4NA1A 4I4BA 3KK2B 3MR2A 3BDPA 4DQQA 5LMUF 1VLOA 3TX0A 4QPTA 3Q24A 5H9EK 4UT4A 5C5JA 3NG8A 4YR0A 4Y65A 1G2EA 3DOLA 3DLLQ 3AB2B 4NZ0A 3GYGA 4BLGA 2VD3A 3BO3A 1BY9A 1NK8A 4R25A 1U25A 3ZZOA 4RWWA 2HHSA 4FPRA 4BBYA 1DTQA 4KBIA 3WC0A 1QJHA 1T05A 4KHRA 1R7IA 4DV2F 2SXLA 2R8HA 4USJC 1BQNA 3EMTA 5KG4A 4WZQA 2IAJA 4ZHRA 5JXSA 4ZN1A 2N7YA 1WNEA 2OPRB 4NLUA 1C1CA 4B3SJ 4PXCA 1N34J 3QRPA 2MQNA 3PTWA 1QUVA 4LF5F 1X4EA 2C2KB 5HVGA 2PT0A 1NUEA 2ALZA 3MDFA 5DM6Q 1JLBA 3PFEA 1TKXA 3GCWP 3K17A 3BPDA 2OMOA 3OLBA 2ZH6A 4DHVA 4A8WA 1YJ7A 4FN5A 5ETQA 4LRCA 3CCQS 3BSNA 2HNYB 5IV4A 1PJ5A 4C4WA 1RU1A 1XMQJ 2V4JA 1F5CA 2ROGA 2XMJA 3H25A 2CPHA 2ROPA 1KD1T 2KXFA 4Y2KA 4B9UA 3KDOA 3ADAC 6FDRA 1FKPB 1RBLA 2DJWA 1SVDA 5KFBA 3KTQA 4QWBA 5K14B 1X9MA 3CMQA 1D8YA 2K7KA 5JVGQ 1URRA 2JH3A 4UF4A 4B3RF 1QAJA 2DPIA 1WKLA 1DRZA 2ZBQA 2JEGA 1Q82T 1TL4A 1X4AA 1UEVA 3BM7A 2WOMA 2HRTA 3I6PA 2YQ1A 1R8PA 1CJTB 3A3OB 1S97A 2AEMA 1N0UA 4QWCA 1M5PC 2F8MA 5B7WA 2LEAA 5D3GB 5KG2A 2CRLA 3HULA 4I6YA 5KFWA 2QO3A 2J0SD 3TR5A 4DMZA 1RHJB 5IV3A 1RAHB 3AJ2A 4OHXA 3SDEA 1ZM4A 1N5TA 1QTNB 3MFHA 1FD2A 4W98A 3KLGA 4FF3A 5LT5A 2V9KA 4UY85 3AQOA 3HP6A 1M5VC 4HVZA 4NA3A 5AJ3F 4IOBA 1HQEA 2NXNA 3RBZA 2I9SA 5DRKA 3UQSA 1U48A 2QLXA 2AV5A 5KFGA 2NYIA 4RW7B 2FHJD 2V67A 4ZS6A 3EVMA 4I2PB 5CYMA 4OHZA 4A8MP 1RTJB 4Q8EA 4DN9A 3LAKA 4NASA 1TVRA 5A2QU 4DEZA 3GZ7A 4F3MA 5A8RB 1OO0B 4QW8A 2MLZA 4OZJA 4QCLA 2ZM6F 1VHIA 1CQMA 2W4CA 1SJFA 1TK0A 2NXCA 4KSEB 5J1EB 4K2JA 4DUZJ 4CLZA 5KFRA 3H40A 2ZHBA 1WI8A 3Q8PB 5KFKA 2Z8QA 3PNIA 2IAJB 4ZHRB 2OPSA 4CM0A 2YWHA 1C1CB 1RAGB 2QLFB 2QMWA 3UDLA 3FQKA 5HBMA 3VF0B 3CJRA 1R8BA 2GA7A 1FTRA 3QIDA 1HWJA 2WONB 1IKXB 5I3PA 1BLUA 2GVZA 1CJVB 3NGDA 5H1SV 4LQ3A 1Z2ZA 1SKWA 5K5MA 1U6BA 5GADI 1X0FA 3MM7A 1TV6A 2CPDA 2R7RA 4BC9A 3OUYB 2JRSA 1NPKA 2HGMA 4F2SA 3BPSP 1KVJA 1RT2B 4C97A 2V4JB 3HVRA 4OZ2A 3WZ0A 4U9RA 3P45B 3G4SS 2E5JA 1OSDA 4C3MA 1SUQB 2MQQA 4DV6F 4M5JA 2DH7A 3JSYA 5DG9A 2F65A 2FJBB 4E98A 3K5NA 4X4VA 5KT6A 2DGTA 3QRQA 3MM5B 3VQSA 3FKBA 2M88A 4LFAJ 3UR3C 1ROFA 3M32A 1X9SA 2CQHA 2OI2A 4WFAQ 2X1AA 4LRDA 2O66A 1S1WA 4L73A 3HSJA 2R2RA 4JP8A 5CYQA 3MM8B 1U2RA 2WVCA 3TW0A 5IWAJ 1NCLA 3G87A 2IM2A 2C2EA 3EPIA 1HQUA 3R7BB 4M94A 5CHCB 4YHHJ 4GC7A 1GT8A 4P71A 3UD4P 3RW6A 3M30B 4XO0A 2W25A 3WIUA 4FYYB 1ZBTA 4LSNB 3MOZA 4ZJLA 2FHJA 3AFGA 2BQUA 1U7LA 3KWMA 5KFHA 1LV5A 3LF0A 3ISND 2DNRA 1NLKL 2N3LA 4FS2A 4BS2A 2WBRA 1L3TA 1FJCA 4W92B 2DR8A 2VBZA 2YWWA 3ET6B 1HQEB 4KHMA 3NBPA 1RT3B 4NRUA 5DZ6A 2XS7A 4KHPF 2DHSA 2QJ3A 1VYAA 1U1NA 2DBBA 5KFEA 1NB2A 4M63A 5CA5A 1XQIA 2FJXA 3HHKA 4B3SF 4A8KA 5LXYA 4ZPWR 1LWEA 4USMA 1QVFR 2K1RA 1N5QA 3ZTPA 4ECXA 2IYGA 5HK4A 4CNZA 2R7TA 3KYLA 2DGOA 3CCES 2HBZB 3D0IE 1LW0B 4QWDA 4UOCA 3HI9A 3E01A 5D4OA 2DKOB 2B4OA 1WC1A 2FDNA 1XMQF 3GSIA 3ETMA 2OHDA 2FHOB 2BOPA 2IJRA 1S59A 3QT5A 4EBDA 2AMCB 4IO9Q 1I1GA 2RU9A 4EU0A 3GJRB 4B3OB 2LVWA 1HBUA 3O2IA 2IA6A 2J9EA 2QG9B 4C2MA 1HYSB 3DLEA 4WWSA 4OZNA 3R2CJ 1HWIA 4ECRA 4OJGA 3R7SB 4Z7YA 1X4HA 3M7VA 1S9GB 2EG1A 1S6PB 3CO0P 3N5BA 1U1QA 5ETLA 5C25A 2B9XA 1DAXA 1Y3KA 3BN4A 2EFPA 2H3EB 3SMZA 1TL3B 4IO1A 1U6ZA 4B3MJ 2DHHA 3G96A 2B56A 4KGXB 4LJMA 2GGPB 1HNIA 5L39A 3NAIA 4MIAA 4F0MA 2CDQA 3ZZ0A 3WIVA 1VI7A 3W5XA 2O67A 4F3OA 3TA2A 2MZ1A 4OX9J 3QO9A 2K2PA 2MQLA 1JLAB 4CI0B 2XS5A 1HQUB 1VBKA 2OJ3A 2YX4A 1N33J 3OR1B 3C15B 4P72A 1HBNA 3IN5A 3RW7A 1HA1A 2IM0A 4C11B 1NDLA 2OEKA 2AYBA 4OI6A 1VRTB 3DLGA 4DR2J 4X4PA 3MHYA 4DR5F 4FYWB 1EP4A 5L1KA 4J9KA 1QD1A 3N4WA 3QSYB 3MOJB 3W3SA 4UZCA 1LK7A 3UNGC 2CG4A 5A6WA 1DTTA 3LP0A 1UVMA 4ED4A 4Y2CA 4P7VA 1JXLA 4IRKA 2GMLA 3T9NA 1PAUB 3QWUA 1R8AA 3TWZA 1U1OA 2HW3A 2RSQA 4NLSA 3WBZA 1BE4A 3MFIA 4DQSA 5CCLA 4O4GA 3RYLA 5LJ5Y 3RB0A 1N6QA 1HBOB 3TRGA 2ZHAA 4ID8A 4ZKAA 4KIAA 3OJSA 1LWEB 2ZH4A 2K1RB 1FK9A 3RR7A 4DCPB 4EMDA 1HHQA 3OXLA 2BR0A 5GAEI 2YNFA 2DO0A 4H54A 4JYAF 3DXSX 4OL8A 1RJJA 2ASLA 4Q0BA 1YDLA 2RMLA 1N0VC 2XNRA 1W26A 2DVIA 1QAXA 1KN6A 5D78A 3N79A 3CIZA 2P6TA 1DLOB 5HJYA 1RTDA 4TVAB 2KVIA 3TNVA 2Z2ZA 4C9DA 4F67A 4GO5X 2UUBF 2VICA 2MJUA 1LWXA 1HBUB 3UCGA 4K5RA 4JI4J 3VGSA 4C98A 4DV4F 3DLEB 3GP9A 2W2QP 5HVHA 4KJIA 4U8VA 1MN9A 1JKHA 3OV7A 3CD6S 2DGVA 1SXLA 2IVMA 5DG7A 3AOCA 5DDQC 1IQZA 2OP5A 4GRSA 2CPZA 3V81A 1ZPWX 3QLHA 4J90A 4CO0A 1T0TV 1RXOB 3W2VA 3DM2B 3RUBL 1KOOA 1HNIB 4CLFA 3UWTA 2LQBA 1Q8BA 3FNNA 3B78A 5B0BA 5KT4A 3DMJB 2LQJA 3MPWA 2MYFA 4TY9A 2HVHA 3HT0A 3MZIA 2QRRA 2KZMA 2I6WA 2OPPA 3UI3A 3FDSA 4F7VA 2HSEB 4KPYA 2D7SA 2ASYA 4CLLA 3NWRA 3AHPA 2XWYA 1HBNB 2HZVA 3IGVA 1CLFA 4B3TJ 1Y3JA 5EHHA 2HBYB 1FA0A 2XNQA 1NJZA 4NWBA 2QLWA 4USIA 3WDOA 4ZN3A 2FZKB 5KG1A 3IAM9 2F9DA 2R8IA 1BD6A 2C22A 1VIOA 3R5AA 3JAMY 1PJ6A 2D41A 1OQ6A 4C0BA 4WFNQ 3H5SA 1KEKA 3J7AN 1TMJA 4LQ9A 4NOHA 3GFZA 2RRNA 5KTQA 3GV5B 5T14A 3HXMA 4LF2A 4JI1F 2FC8A 2VC0A 3VAKA 2VKRA 2Z2MA 2BBEA 1H6KX 3OHAA 1RT7A 4MYTA 4G6VB 2E1MC 1YIJS 3AXMA 3ULHA 3GLJA 4OYZA 4DU8A 3J7A1 3W63A 3PXGa 4DUYF 1H74A 5E3CA 1NKCA 1X9WA 2RUSA 5HO4A 4IG0A 4DV1F 2IVFB 3UD3P 3ELHA 3CCZA 1S72S 1VQYA 2FY8A 4ETXA 3MM9B 2C2DA 2OTJS 1GAOA 4C3KA 3CJTA 1W7WA 1ZM9A 1X4DA 2AJ0A 1RWWB 3ZZTA 2KG0A 3KJVB 1LWFA 1LKZA 4PPZA 3JTOA 4DSFA 1GMWD 3J81j 1T02A 3KHGA 1BQXA 2E5LF 4GKKF 4HDHA 2HHHF 2RT3A 2MY8A 2B0GA 4WK1A 4DU7A 4DBQA 1UAWA 2WSCC 1JKHB 3CT9A 3BGOP 5A0YB 2AF6A 4O0IA 1N36J 3FRYA 2BRLA 4OLPA 2HKEA 3V81B 2QN6B 1RZMA 3D1QA 3EZ5A 2JL9A 3DRPA 3NY0A 3W2VB 5EGYA 5DJBA 4J5OA 4N47A 1N33F 1RA6A 3GU0A 4Y0FA 2XY5A 3K59A 2LA6A 4IFYB 3EUNA 2E9TA 2YNHB 3ZTSA 1WF1A 2CPEA 2HNZA 4X4TA 1F2HA 4QYZK 5IT0A 3KK3A 3DOKB 2RQCA 4RW6A 3SZ2A 5ETKA 3GILA 2QYGA 3EGNA 1KVIA 4JV2A 1EHWA 2GIQA 1X4CA 1CJUB 3MPYA 2YKNA 3T6BA 4TXSA 1K0VA 2BUNA 5KFTA 1VS3A 4TYBA 4IQXA 2VBXA 2EFNA 1KLMA 2J6TA 2V8PA 2RDIA 3DDIA 3Q23A 2RE1A 1OYEA 4H4KC 4IDKA 1CQNA 5IM0B 3FCWA 3UN5A 4HTJA 3Q8VA 2KFZA 2W7OA 4CLSA 2G0CA 2VG5B 4DSLA 1MROB 2RDJA 4EO6A 3TEHB 2APOA 4AE5A 2J7WA 3M2RB 1X7VA 2U2FA 3GIJA 1KDNA 4BDPA 2ZZNA 2UXDJ 1ZPVA 3DGPB 1R27B 3QPIA 1B3TA 1KC8T 4QWAA 1WHVA 2VL1A 5DO2A 4CO5A 2YNIA 4M1KA 1T8EA 3PY8A 2KVQE 5H9FK 2DCUB 4IG3B 4UOHA 2HG4A 1KSPA 4BWMA 2JWNA 5KG5A 4IH7A 2LDIA 4ZPDA 1CSJA 1UFLA 1M5KC 4CYUA 2DNKA 2C3PA 5G0RA 2DITA 2POKA 4P10A 2R7WA 4WP8A 4C3LA 1S6OA 1GMWA 1HPZB 5HL7Q 3TVKA 4FVCA 4OZLA 5AE2A 3TVZA 4J9LA 3W9HA 3RB3A 1RKIA 3LGMA 3MPDA 4OI4A 3O44A 2XHWA 4RW8B 2AJQA 4AL6A 1HNZF 4QJVA 4DFKA 2OFGX 3A3PB 2ZBPA 3KLIA 5B09A 4ECVA 4Q44A 4AD6A 2YPYA 1J27A 3CDBA 1E6VA 2HFSA 3PX4A 2PMHA 3R9LA 5K8NA 1LWCA 2PFDA 3G8QA 2VOOA 1Q7YT 4NLOA 2DNYA 4MIBA 2ASJA 3PM9A 3KUEA 4OYOA 4DR4F 2BM1A 3MPVA 3FSIA 2B9YA 3HPOA 3T19A 1TL7A 2VPYB 4J91A 2C42A 2HEKA 2ZC3A 1N54B 4DG1B 3HHEA 4PQUA 4OV1A 2BACA 4DFPA 4EO8A 3BS9A 4L3NA 1ELOA 2FYXA 1VQNS 2F5GA 3HKWA 4ELUA 4QZVB 2QLBB 1N32F 1OY9A 1U09A 1CJKA 4C7QA 4NCBA 3BYRA 1Z1ZA 2D9OA 2XCPA 3VAHA 5HVFA 3CO9A 4DX8H 3NMAA 2HHWA 1C0UB 2FTRA 3IBCB 3D0GE 3GQCA 4LIWA 2Y8WA 1F5AA 1XNRF 2LYVA 5BR8J 3H20A 1BQMA 2PDAA 1FNMA 2ILZA 1B99A 2CQ2A 3ZFVA 2FZGB 2KTQA 3QAUA 4CWBA 1VJWA 4O3PA 2UUTA 1TKTB 2BJDA 4ILMA 3UFCX 3Q8QB 2E29A 3R27A 2LXUA 4WK3A 1F9EB 1M5HA 3RTVA 3D2WA 4WTYA 1WOPA 4FF1A 4L74A 5ETNA 4OYMA 4XPEA 1SBRA 4JI7J 2JVRA 1DQ8A 2W2OP 4JI6J 3IBWA 3TUIC 3MMBA 3MAAB 4RR5A 2OFHX 2AGQA 2UU9F 3BH6B 3KLHA 2W24A 4KRWA 4ZMMA 4DN0A 2UVWA 1U1KA 4QOTA 1UP1A 1UMJA 3K7RA 4UOFA 2XO7A 4GVBB 1F9HA 1B64A 5LSRA 4F4ZA 3GMGA 4AFFA 1SQEA 4NLPA 4C0OC 3K5PA 1Y11A 3BBFA 4CYUB 1NH8A 5G0RB 3TJ9A 2OGUA 3EGVA 4ZP6A 1K47A 3OFFA 1BUXA 4OI3A 3D6TB 1N5SA 4HEA9 4DSIA 3KHRA 4DR6F 3THPA 4WIQA 3HK2A 4DR3F 1NAQA 4P2MA 4I6AA 1RWNB 3I5AA 3FRZA 1Z4UA 2AWZA 5CAAA 3CJKB 3R5DA 1KRPA 3IG1B 1ZETA 4ES2A 2C1EB 3G8TA 4Q5VA 4V19X 3OL7A 1WACA 5HLFB 4HACB 1X4GA 4USTA 2JHEA 3KLIB 4CT9A 2BQ3A 2PN6A 3G82B 4B17A 4FYVB 3DCAA 4YUDA 4MJKA 1Z2LA 4GVLA 4RUAA 2XO6A 1FKOA 2OSQA 4LT6A 3T5JA 1AXQA 3FFIA 3Q8SB 1O0PA 4DS4A 2XC9A 1ZOTA 4KO0B 5GAHI 5LSLA 3G2XA 2Q1LA 4PYAA 4IR1A 1FI4A 5IOLA 1RDRA 5IXUA 2CQ4A 2RQ4A 3SQGA 3RJMB 1JJCB 5BXIA 1FWLA 5DQIA 3MWBA 4PQUB 3SV3A 1RISA 3IRXA 2LU2A 2DPJA 3FUYA 3ZZYA 2GHPA 3W66A 3H8YA 3HSZA 5DZ7A 1VMBA 4F36A 2DGUA 4OFZA 3O3LA 4PG4A 3BH7B 2VQEF 2E1AA 5IC6B 1CJKB 2CQ0A 2CNLB 5FLXU 1R6YA 4O3QA 1WHWA 1FRXA 1HNWF 1L5UA 4G1IA 3HVWA 3NGRA 4WJBA 1WUUA 6FD1A 2EWHA 2HGLA 1IBCB 3M2VB 4ZLNA 2Z58B 1YWXA 2XULA 3MMAA 4ZVEA 4DX7A 2UXDF 1FT8A 4FBUA 4J9MA 4CTAA 2PSZA 2FGCA 1C4AA 2GO8A 1VIXA 1F5BA 2XM3A 2CPJA 4FYDA 3OSPA 3QGHA 3ONQA 2ATLA 2WVBA 1U24A 2MHNA 3MD3A 2VF3A 4DV3J 3QJLA 2RU3A 2ZVIA 2KRBA 2GMJA 3TOQA 4J9RA 1M90T 1RYRA 1Y0HA 2V8DA 2VPWB 3JTPA 3Q2TC 5K8MA 3H98A 3MEDA 1VQ4S 4B9LA 3JXOA 3C66A 1AYEA 2QA1A 3HO1A 3C19A 5C24B 1VISA 3POTB 1Y4ZB 2W1BA 2VUGA 3S1TA 2KG1A 1U6FA 3TAMB 2V8HA 2XSJB 4X4QA 2HWHA 2IHR1 4OZ3A 4DFMA 4J7CA 2XYHB 4CH7A 4AQYJ 4PG6A 2RJZA 3BEGB 4LRBA 1SV5B 3GTYX 4M5IA 4YS2A 1EX8A 4KH1B 2HFNA 2DD8S 1U0HA 2R8KA 1TAUA 2D74B 2FVSA 3I9ZA 3DLKA 1C4CA 3OQ2A 2BANA 4URSA 1X31C 2JNJA 3TQEA 2HMIA 3QZ8A 1RHMB 2N4DA 4O44B 3U1NA 3US5A 2LKZA 4ZP7A 1EB0A 3M6VA 1LXNA 2IDEA 4YR2A 1HLWA 1S4EA 4PWDA 4DL4A 4WPAA 1AZSB 1JLEA 1J5OA 3PACA 5KFPA 1HNXJ 3EWGA 5KFQA 2CQPA 1IJFB 1VK3A 5E3AA 2P9CA 1RTIB 1UWBA 1YG0A 1EETB 1WF0A 2JLFA 3HFVA 3R7NB 1SJ1A 4RX6A 3VAMA 4HT5A 1DQAA 3TZZA 5KFSA 4X66F 2KJWA 3NS6A 4JBCA 1REGX 2OO4A 1CBKA 1Y7PA 3V6DB 1FEHA 1FVQA 2UXCF 5FIIA 2HQCA 5FDLB 4LF9J 2VG7A 2B7BB 5J2QA 3ZXWA 2K8GA 2H54B 4J37A 5K8PA
chains in the Genus database with same CATH topology
2GA7A 2W4PA 3PO4A 1FTRA 2C3UA 3QIDA 4ZK7M 4CO3A 3HVAA 1Y5LB 3MECA 3GYXB 3CD5A 3Q22A 1FE4A 1HWJA 1MU2A 1IKXB 2WONB 3N5FA 5I3PA 4LFAF 1BLUA 3M9NB 4WF9Q 4DV5F 4CH0S 3HHLB 5IFMA 1X5PA 2LCWA 2BZ2A 4JI6F 3THTA 3NGDA 2YKMB 5H1SV 4LQ3A 1AROP 1Q1KA 4XDCA 1T94A 1Z2ZA 2MKKA 2A18A 1SKWA 2LXIA 1U8SA 1RT5B 3CJ2A 4RBTA 4TQRA 5K5MA 1U6BA 5GADI 1X0FA 4QPXA 3MM7A 5F8IA 2DGSA 1TV6A 5GVQA 5C25B 3M4XA 2CPDA 3CJ4A 3EGWB 5DGBA 3KMSA 3WC2A 4MMOA 3M2VA 2CQIA 2R7RA 4BC9A 1UJ4A 3DRSA 2BABA 3OUYB 2JRSA 1C1BB 2V9WA 4ZPCA 3E51A 2HGMA 2PIIA 3TUZC 4F2SA 2E9ZA 4UQTA 3THVA 1KVJA 5IWAF 3OVSA 1Q8LA 1RT2B 4C97A 2V4JB 2ZHOA 3GV7B 3HVRA 3AJ1A 3WZ0A 4U9RA 4JI2F 2RQKA 2R2TA 2WB4A 1S6UA 4YHHF 5M2PA 3P49B 3SV4A 3G4SS 2IVYA 2E5JA 1OSDA 3L7OA 3ZC4A 4C3MA 1SUQB 3GFXA 1YJTA 4Y2MA 4K4YA 3PKMA 1R8CA 3BQ1A 3SEOA 2MQQA 2XSFA 1S0OA 4DV6F 4RW4A 5EWGA 4AXJA 2DH7A 3JSYA 5DDPC 1ZAVA 4F8RA 3NGKA 4ZVFA 5DG9A 2AW0A 1LXJA 5IZHA 2FJBB 4E98A 4R8UB 1DHMA 4L6V3 3K5NA 3MTJA 3DNCA 3JYTB 2VG6B 4C8KA 2IRUA 2R7SA 4X4VA 3QO9B 5A6PA 2HNYA 5KT6A 2HZCA 1YJVA 4KTQA 2BM0A 2DGTA 5AXKA 1VFJA 4Y28C 4DV7F 1WI6A 3U02A 3MM5B 1CVJA 3VQSA 4Y6IA 2DISA 5KFJA 1S79A 2M88A 1IQTA 4NLTA 1N5YB 4UW2A 1ROFA 3M32A 3UR3C 1X9SA 2CQHA 4WFAQ 2X1AA 2Y1JA 2XGQA 2O66A 3PEHA 1XMOF 2BVZA 3LW5C 3HHLD 1S1WA 3KG0A 2J8AA 2DNZA 1B0VA 3FQLA 2ZOFA 2PD1A 5GAGI 2ZDPA 2Z0GA 2R2RA 1VQ8S 3IR7B 3PZPA 1JLGB 1FKPA 5CYQA 3HHDA 3I55S 1FRHA 4KC5A 2MZRA 3MM8B 3AA9A 1U2RA 2BDPA 2FD2A 2W9CB 3M2UB 2DNMA 3TW0A 2C3MA 1L3UA 4O23A 5K14A 3DLGB 3BSOA 1TQLA 2O5DA 3R3TA 5A2QY 2IM2A 2NSCA 1EP4B 1N88A 5C24A 1KR4A 2HS0A 2QFJA 2N82B 3POTA 2C2EA 1UA1A 4KKOB 3DOMA 3D1HA 1HQUA 2GX8A 3EPIA 3D1OA 4Q8FA 4Q45A 3KFWX 5CHCB 4GC7A 1GT8A 3MAQA 1NJXA 4M94A 2AX1A 3TAMA 3UD4P 3MMCA 2XSJA 3M30B 5E2QA 3RW6A 3SSSA 4XO0A 5J2PA 3KHLA 1FDNA 2W25A 4OI2A 2D3ZA 5EDWA 4HYKA 1DTTB 1ZBTA 2HRYA 1VGYA 3LP0B 1H2UX 4Q43A 3A8EA 1H7XA 4LSNB 5F8JA 4NPOA 2C3YA 3RAQA 3MOZA 2VFVA 3N6MA 2FHJA 3MEGA 4C8MA 3KNAA 3PX6A 4RU2A 2BQUA 3LWLA 2M3DA 1U7LA 2AGPA 3DHXA 1UFWA 1VQ7S 1WELA 3KWMA 5KFHA 2DIUA 1LV5A 2FVCA 3LF0A 1TK5A 5DS7A 3ISND 1FDBA 2DNRA 2Y1RI 1W2BR 5D6GA 2N3LA 2R8JA 4FS2A 1SV5A 4O4GB 3W2WB 1JK9B 4JV0A 3GV8B 3CPWR 4BS2A 4C8OA 2HQ3A 2WBRA 1L3TA 1FJCA 5D3GA 1LFPA 1WF2A 4W92B 2DR8A 1N6QB 2VBZA 5GAEU 3AQPA 1K73T 1N4LA 1S10A 1HD1A 5EUHA 2GHVC 2ZH8A 3MXHP 1HQEB 3KLFA 1HI0P 2J6UA 2WK4A 5C42A 4DSEA 5IQ6A 4KHMA 1JXEA 4LFCF 5J2MB 5A8WB 2YKQA 3NBPA 2HRUA 5HP1B 2FVRA 2HHXA 2KN4A 1TFYA 1RT3B 1FK9B 4NLQA 1TZ0A 4NYZA 3V6HA 1NNDA 2BE2A 3SCJE 2RUGA 3OFEA 1IKYA 1HBMB 5BYQA 3OFGA 4NRUA 1IKWB 4RBUA 4G3IA 3B8HA 2XS7A 4KHPF 2DHSA 2KYXA 3DU5A 1U1NA 4N56A 2Q6BA 3IXQA 2DBBA 2YNFB 5KFEA 1FCAA 4QIEA 4M63A 3NCRA 2XMWA 5CA5A 4I7FB 2HNDB 3DHWC 4O3NA 2KM8B 3K58A 3BGFA 2FJXA 5E3PA 3EGZA 3VR1A 4R5PB 2CQ1A 2OD4A 5ADZA 1FRLA 2YX1A 3HHKA 1YSJA 4TN2A 4B3SF 3I31A 4IFVB 4A8KA 4Q0BB 2D1CA 1JLQB 5LXYA 4ZPWR 3PW7A 4FXDA 5LXRA 4O44A 2FVPA 2B5JA 2HHQA 1LWEA 3PHEA 4TU8A 2WHOA 2XMTA 3B4DA 1QVFR 2FJAB 2K1RA 1N5QA 5AXNA 4ECTA 1KQKA 4CO4A 3RR8A 4F3QA 4ECXA 2IYGA 4NMLA 4CNZA 4ED6A 2IA0A 4RW7A 3KYLA 2R7TA 3PR5B 2BRKA 2DGOA 3JSBA 4I2PA 4QBUA 3CCES 7FDRA 3IC1A 2AX0A 3FEYB 1RTDB 5EX3A 3DRXA 5U47A 3ISZA 1RTJA 4RNFA 3OTCA 4NCAA 3FEXB 4JOUA 3KHHA 3D0IE 3KK1B 4WKRA 4X2BA 4FS1A 5KFZA 1LW0B 3FZBA 2XCAA 1RTIA 4G1QB 1EETA 1R3NA 3LANA 2VG7B 4QWDA 5K9FA 2IBKA 4UOCA 3HI9A 1WEXA 3HVTB 3IWLA 5A8RA 4PKDB 4H4KA 4LF8F 1H38A 4URQU 1WD6A 2IBOA 4HKQA 3E01A 4ZPBA 3I5BA 2I8EA 5D4OA 5GADU 1S0NA 2CQBA 1NJYA 3CDWA 2MKHA 1K0TA 4FF2A 2KI2A 5T7LA 2ASDA 2J0WA 2PE8A 2B4OA 1UA0A 2AYMA 2FDNA 1XMQF 2W9BB 4B3MF 3SCLE 5J1EA 4H4MA 5DLFA 3D28A 3IFEA 3F41A 2FHOB 3AB4B 2BOPA 3I56S 3V6DA 3K2YA 1XN9A 4C0HA 1FERA 2CQDA 5GMKa 2AJ1A 3PW5A 5FDLA 4B9TA 5F9NA 3CC4S 4EBDA 2HQIA 3L3CA 4ERDA 4IO9Q 1I1GA 3FJ2A 2YQ3A 3TO8A 4YQWA 2JX2A 2RU9A 2YKOA 3LWMA 2L9WA 4K0KF 4ED1A 4NRTA 4EU0A 1ZYQA 4B3OB 4GO7X 2LVWA 1HBUA 4OX9F 3O2IA 2IA6A 2J9EA 1O5JA 2G1DA 1TAQA 4C2MA 4MH8A 3DRSB 3QLHB 1HW8A 2M7SA 4LF4F 1HYSB 3OL9A 3DLEA 4RWXA 4QR1A 2GNKA 4OZNA 2FLNA 2F1FA 3H4BA 4NYPA 1SI9A 1HARA 2Z4PA 3CD7A 2CVEA 1HWIA 1IKXA 2WONA 3PKYA 4ECRA 3SCIE 4OJGA 3HHLA 3CJ3A 5B0GA 3GG1A 5J1NA 5KAKA 1IUJA 3S8SA 3P6YC 3AY0A 1X4HA 4M8LA 3KKFA 2FGOA 4ECUA 2B43A 1RYSA 4YMEA 1S9GB 2EG1A 3HFKA 2R7OA 3DDNA 1FKAF 4NA2A 1S6PB 4K4XA 2ZJQQ 4N76A 4D3GA 3MD1A 3N5BA 1U1QA 1T03B 4ILLA 2IM3A 2O1PA 5F0UA 5C25A 2B9XA 2YWKA 4A8XA 1CC8A 2ACYA 4EZ6A 1DAXA 1RGVA 1Y3KA 5GAGU 2EBGA 3BN4A 4RNNA 2I0XA 1TP7A 3QMQA 2CFXA 2EFPA 1JLCB 3BR8A 4OIXA 3OUYA 1C1BA 2FJWA 3QYYA 2DCLA 5L1IA 4DR2F 2OPPB 2L08A 3SMZA 1TL3B 3ZZUA 4IO1A 1LQ9A 2ZNYA 1RT2A 3K5LA 1YBAA 1KLNA 1U6ZA 3N6LA 5J1PA 4JV1A 2L41A 3ITHA 3G96A 2CJ9A