2PEBA

Crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
KEDTIEIAGFHAHVYFDAASRDVAARVREGLGARFEVQLGRWFDKPIGPHPKGMYQVAFLPNQFDKVVPWLMLNREGLDILVHPETGDAVSDHAVYSLWLGAALALNIEFLRQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative dioxygenase
publication title Crystal structure of putative dioxygenase (ZP_00109509.1) from Nostoc punctiforme PCC 73102 at 1.46 A resolution
rcsb
source organism Nostoc punctiforme
total genus 28
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2pebA00
2P8IA 2NYHA 2PEBA
chains in the Genus database with same CATH superfamily
2HBQB 3NS7B 3M2UB 3WQPA 2EPIA 3GE9A 1F6TA 4L3KA 2AGQA 1S9GA 2VBYA 3DYAA 4O23A 2E7WA 1RDRA 2UV8G 4B17A 5DQHA 4I2QA 5D0HA 2QC3A 2C22A 1N6QA 1JLQB 3UWTA 2HNZA 1HMVB 4O3SA 3SMZA 2RQKA 3VAHA 3DI6B 1C1BB 4WK3A 2JFDA 2FTRA 1P8GA 2CQGA 4KO0A 2ZM6F 1B64A 2AGPA 2F65A 2WTFA 1RT4A 3DLGA 1RBOB 2WSCC 4OZ5A 5CYQA 4LREA 4Y2KA 1X8DA 3CT9A 4OYAA 1CJKB 5GADU 4YR3A 1X31C 4NYPA 1CVJA 4ZP6A 3M9MB 4FPIA 2H4YB 4FZVA 4NLPA 3W9HA 4PG5A 2MXYA 5GMEA 4M95A 4ECQA 3J81Y 1VJWA 1HBUB 3IS9B 2YWGA 4WJBA 2F63A 2YH0A 2QLFB 2MDAA 2ZBPA 3KHHA 5KT3A 5DG9A 3D67A 1KN6A 1HHTP 3GYNA 2Y3YA 4DR5J 1WEYA 4IR9A 3MEDA 4CT8A 3UN2A 1FRHA 3CE8A 2H48B 5LXRA 1C0TB 4IFYB 1QLNA 3D3CJ 1TV6B 5DLFA 2J9DA 3GB0A 1OMSA 1ELOA 2F5GA 4DSJA 2AIRB 2RS2A 5E2QA 4RL1A 3QZ7A 4B9LA 3Q8PB 2DB1A 2HRUA 1RGVA 3H5XA 1P1LA 2HNYA 3P45B 1V3SA 2BJEA 4U6PA 2J76E 2WW4A 3Q86A 4USTA 1VRUB 2W7AA 2VFUA 4NLXA 3PO5A 2VQFF 3LF0A 2XMVA 1S1TA 4KAIA 1TL1B 2XHWA 3CULA 4OYBA 2BJDA 5EWGA 4K2XA 3V81B 2ZVIA 1JMTA 4U7CA 2QIFA 4F0HA 3BO4A 1Y10A 5A0YB 2HG4A 3H8YA 1ZZFA 2YKQA 3D3BJ 2C3PA 2IAJB 4IOBA 2L08A 4OX6A 1U09A 2UVRA 2MZSA 1NPRA 1SQFA 3K89A 1TKZA 1VISA 3GV7B 2YNFA 1GH8A 3W60A 2L48A 1WC6A 4QWEA 1IVZA 3I5CA 3GU0A 2W4CA 2NLWA 1E6YA 5C24B 5J2NB 2H9ZA 4YB6A 2WVFA 3TNVA 2W2MP 5E3QA 2NYIA 3JSRA 2MQMA 3AODA 4WKRA 4ZP8A 4DHVA 4F7VA 5C7PA 2MY8A 2VFVA 4O0NA 3FBFA 1U45A 2VA3A 3MCNA 4OLPA 2HQGA 4FPRA 2I38A 1ZAXA 3Q2SC 4N7TA 2JLGA 1AROP 1RTDB 4K2JA 3KOAA 1JJ4A 1NJXA 4C0OC 5M2RA 2BKPA 1T0TV 2DGWA 5HROB 4KYZA 4ZCKA 5I4MA 2HHSA 1UCNA 5C42A 3CB4A 5F8HA 2JOQA 2VU5A 2J7WA 2RAQA 1Y5NB 4WFYA 5B0EA 1ZPVA 3MEGB 4CLUA 4ZVHA 1D8YA 1GMWD 1D9AA 4WFAQ 4V19J 3R6GB 1V6HA 2VC1A 2HZAA 1VC0A 3AJDA 3W5XA 3ILOA 1GXUA 1NK9A 2B6AA 3DLKB 3LGHA 4KTQA 4C11A 2M52A 5BYSA 1HPZA 2AZ1A 2KXHA 1BLUA 4Y65A 3M05A 5HMXA 1XWLA 5F0UA 4USWA 3KJFB 2NXNA 4DFPA 5LSOA 1N32J 3ENVA 1LXJA 1LOUA 1WDDA 1NJZA 3SQGA 3ILLA 3R9LA 4RNOA 1XMOF 2VL1A 3UE2A 4B9MA 1M1KT 5DS7A 3W61A 2GC8A 2DR9A 1WJ9A 2NREA 1NHVA 3D5MA 1T94A 1KRPA 5HO4A 1HBMA 4HLBA 2IVMA 2HMIB 3BN4A 2BXJA 3HHLA 5SUHA 2F4FA 2BJ3A 3ENQA 2WRMA 4CI0B 3IN5A 3TA1A 3T5JA 2VH7A 1VQ6S 4IFVB 1HWUA 3DOLB 1GT8A 4IR1A 4WP8A 4CH1A 2XM3A 3IP0A 3PW7A 4ICLA 1UMJA 4L74A 1NEEA 1MWQA 4J9QA 4K4UA 4AL5A 4BC9A 2E1CA 4K4XA 3CD5A 4EBEA 1IBMJ 3EPGA 2AJ2A 2KT2A 2R2SA 3RAQA 3MGJA 1IXKA 3BEGB 3BZQA 2AJ4A 4LSZB 2B7CB 4CLPA 4ZCIA 5GMKa 1HQ2A 4OLOA 3H0PA 3TA0A 2NR0A 5DGAA 1NU4A 3MOJB 3MR5A 4A8WA 5T7LB 1IUJA 1NZ8A 5IM0A 4F4KA 1SC1B 4OYXA 2YWEA 3TYTA 5J1EA 1PILA 3TI0A 4X2BA 1FWLA 1F5AA 2PC6A 4LF8J 1RLCL 3DRRB 4K4VA 3KJVB 3TAPA 2B5JA 4W92B 1WEZA 1YRXA 4ZIVA 2E7VA 3UQSA 1JB0C 3F41A 4NXMF 2DNQA 1T05A 3D7SB 4ZVSB 3NGTA 3W8GA 3EWGA 1JX4A 2AU0A 3L3CA 4JI3J 4NLSA 5GMDA 2WK4A 1EIYB 2RH3A 1UJ4A 3RW7A 1HNIB 4C4WA 5BR8J 1H7XA 4TY9A 2CQCA 1M5PC 1UKUA 3EXYA 4CLWA 3KG1A 3PTWA 2XYGB 4TVAB 5BYQA 4KKOA 1E6VB 3JQMA 3BO3A 3RTVA 1UJ5A 3I6PA 1FEEA 1C0UB 2V8HA 2WVDA 5G0RB 3R97A 1B4SA 2XZWA 1NKCA 1TK8A 2F7VA 1B0VA 1ZM4A 2EC2A 4RBUA 5IWAF 1OIAA 4QCLA 2ABYA 3NP5A 4Y0FA 1D1UA 1GK8A 2GVZB 3C16B 2WB1D 5SZTA 2D7SA 3PIOQ 4OV1A 5KFFA 4QIEA 1Q7YT 1WKJA 2LU2A 1QE1B 3NGUA 3S8SA 4L3NA 4NLUA 1KTVA 1WACA 1DHMA 3HPOA 3D0IE 4ID5B 2C2EA 3ILJA 4IO9Q 4MIWA 2OSQA 2ZD1A 2AJ1A 4P2SA 1TUWA 4U8YA 3R5AA 4ZJLA 4ZP9A 1XNRF 4AQYJ 1UJ6A 5A6PA 3H90A 5FLXU 2BQUA 2BW7A 2CYYA 3H98A 1HW9A 3DOMA 4MAKA 2DHXA 3GSDA 2MLYA 4OI2A 1S1WA 3KLEA 5F8LA 3RAMA 4IG3A 1F2GA 1UEVA 2R7OA 3AA8A 4RKUC 2GW8A 4IG0A 1EETA 2V4QA 2Q66A 4NRUA 3O44A 1FJGF 1U2CA 2FC9A 5IT0A 4RUCA 1UFWA 4LFAJ 4H4MA 4OHVA 1KLNA 1BY9A 1TKDA 1NK7A 1RT3B 1PJ5A 4RPFA 2UV8A 2XMKA 1PG5B 1CS4A 1RT1B 2K3KA 3A8KA 2ZOGA 4QW9A 3TWZA 3QAUA 2DH7A 3C2PA 2OPSB 2B4OA 2Z57B 3MECA 1J27A 1M5VC 4U8VA 5IOLA 2LXFA 3OFFA 3T1YJ 4DF4A 4JBCA 3LW5C 2PGCA 1UZHA 3BR8A 5KT7A 5B0AA 4K0KJ 1HHQA 4MTPA 1DAXA 2ADCA 1U1PA 1U1LA 1FXDA 1SL1A 2IRYA 8ATCB 1S0OA 4NCGA 3NAIA 3UD5A 1U48A 4DX6A 2P9EA 1Q0NA 4WZMA 4ECYA 1RLDA 4F25A 3J7AN 2EG2A 3MM5A 3EGZA 4W90B 2J6SA 3Q24A 2CJYB 4JI5F 1GX6A 1S0VA 2Y1IA 3WIUA 3FJ2A 4LRCA 2K3IA 3E51A 3IR5B 2FY8A 1HI1A 3A8IA 1WC5A 1TAUA 2RE1A 4ZLLA 2VA2A 1HWIA 3CDAA 1PSDA 1JLAB 2MKKA 4OYIA 1FKPB 1PBAA 1C1CA 2V5HG 4DV3J 2MLXA 2KH9A 2JLFA 2MGZB 2HLUA 4C97A 3W5ZA 1BQMA 1UW4A 2DNHA 3C46A 3IM8A 4CM0A 4MKBA 2DHGA 4PAAA 2AYGA 4I7FA 2YWWA 2Y8WA 4PQUA 1X4AA 2ATCB 1R0AB 5HATA 2DGUA 2NZCA 4P7VA 2B9XA 2VODA 2FJAB 3MDFA 4DR4J 3K5OA 2V8DA 3BKFA 5LMNF 4HH1A 5GAGU 3PJ9A 2UUBF 2UUTA 1VQ5S 1GAOA 2MSSA 3OL8A 3EUNA 3BGUA 3M2UA 2LDYA 1FRJA 4NLRA 4CO1A 1IQTA 3BH7B 2E5JA 2G4BA 3D6FB 2ZBCA 2V50A 2GVDA 3TVZA 2D3UA 3ZZPA 2BKNA 1YJRA 1HI8A 1HMVA 4O44B 1Z2ZA 1OJ4A 1W2BR 3SV3A 2B9EA 1RAGB 2BDPA 1RT5A 3CCSS 5KT5A 3IC1A 4F4WA 4HTJA 2ZH2A 4LVNP 2VDIA 1CJKA 1XN9A 3IR7B 3B78A 2XLIA 3EE3A 3QPIA 4FVCA 1K73T 2ZC4A 3VAIA 1H3DA 2C2NA 1V3ZA 4I6WA 1DTQB 3IAM9 2DPIA 1ZH5A 5ETKA 1X9WA 1KBRA 3P5BP 2ROEA 1Y00A 3IS9A 1RAIB 2UVWA 4WWSA 4YP3A 3UN3A 1JLEB 2MEWA 2QL7B 4G1QB 5H9EJ 5DQGA 2HIYA 2VJUA 1AXQA 1LK5A 3TEHB 3KHRA 3QT8A 3D1HA 3L09A 1Y9OA 4JYAJ 3IWNC 4N77A 1C0TA 1TV6A 3MI7X 4Y2AA 1HNVA 1SIWB 3O8WA 4M5DB 4J9MA 1GTEA 4LJMA 1VJQA 5ADZA 1DRZA 1XEZA 1LEOA 2Q43A 4TYBA 3AA9A 3MMJA 2V63A 2LU1A 1M5KC 4BCAA 4ZDNA 3AOBA 4DQRA 1MN7A 2HRYA 3A8EA 2NSBA 3NAHA 1U47A 2W7PA 2P2CB 4JI8J 2W2NP 5KFRA 3D6TB 3SZ2A 3GYXB 2HYIB 4V1Ak 5THWA 1TL1A 3CVKA 3V6DA 2DRDA 1X60A 3QO9B 4CRJA 3M8RA 2VZ9A 4DX5A 4A8MP 3LPEA 2OMLA 4KHRA 4JV5F 1B7YB 4NXNF 3MFHA 1S1XB 1RHMB 4ED2A 2JH3A 4EO8A 1WOSA 4M5IA 2IM0A 2K7JA 1AFIA 2BJ9A 1IKYB 3MCMA 2JL9A 3ICLA 4C8MA 2KKHA 2IAJA 1RWWB 3L7UA 2E44A 3U1LA 3EMTA 1ZOTA 2OUGA 3DNCA 4RJVA 1N5YB 1X5PA 3NOGA 3I0RA 3VAKA 1M1GA 3WBZA 2MQQA 5K8OA 4NPOA 1PGZA 4MFBB 1LKZA 2WONA 5C24A 5B0GA 3GJSB 5J2NA 1KTQA 1SC4B 4LRAA 3R7SB 1JLFB 2DR7A 5E5NA 4B3RJ 3HVTA 3K8WA 2LQ9A 2HS4A 4F3QA 3FRYA 2CPZA 2ILZA 2A3JA 1WSRA 4NZ0A 1FNMA 2CQ1A 1PYOB 4O3OA 3QT6A 4UQTA 4DU7A 2VOOA 4OZ2A 1NSAA 1RTDA 2P9GA 1XMOJ 3UFCX 1DTTB 4EEYA 4JB8B 4J9NA 2RQ4A 5EX0A 4OFZA 4RW8A 2HVHA 2PA3A 8RUCA 2ZOMA 3CJKB 2BEFA 5LL6d 5D78A 3V6HA 4KGKA 3KLIB 1JKHB 4GVBA 2XY5A 4B3SJ 2V8PA 3G6ES 2OSRA 1BC6A 2R8IA 1TUVA 5KFIA 4Q7AA 1N4LA 3H7HB 3TRGA 3E01A 2YNIB 1W7WA 3Q22A 1U1MA 3KK2B 1WC3A 1FRIA 2RRAA 3IWXA 2YX4A 5FDLB 2DXDA 1U49A 2XSJA 1H2VZ 4U95A 2PEBA 4Y00A 3FC9A 3AH6A 3VZHA 2GNKA 2BR0A 3KMQA 1FNOA 4FF2A 4LF4F 2ZUAA 2FQQB 2PIIA 1JJHA 3D54A 4DV6F 4DU8A 1X0PA 2MSTA 4EYHB 5LT5A 4HHHA 5E0OA 2M3DA 2LEPA 1R0CB 3TZWA 3FKBA 4UZBA 3KYLA 4OX8A 2QN6B 1F9EB 4HL9A 1K0TA 2OHDA 1NUEA 4WYLA 4U9RA 3CCQS 3PO4A 1XNQF 4IFVA 2CJKA 4JI2F 4ZPDA 4ECRA 1U8SA 3MEKA 4XAKA 2HK3A 3HVWA 1S48A 2JEGA 5LJ5Y 3KUEA 1IBKF 3EGWB 2IBKA 1KQKA 2DRBA 1RU2A 3V5RA 1KVJA 2VIHA 2FPHX 3OTEA 2ZZTA 3H5YA 5FJ4A 3OTOF 2HFVA 2FLNA 5I3UB 4A8OA 3EVWA 4USVA 2BQ3A 3PW4A 1FKOB 3EVOA 2BKOA 2FVPA 2ASJA 2J0QD 4BWJA 1NBEB 3QLHB 1ULRA 4AXJA 5E3AA 4LF7F 1Q16B 3FMWA 2IYGA 3DMJB 4Y2IA 4OV6A 3CDWA 4YY3F 3LGMA 2M8DB 3FSYA 3IO1A 2KVIA 4NCBA 1IKWB 4AUKA 4CH0S 4CLTA 1P6TA 3CCVS 3SCIE 2VPYB 2W8LA 2VFSA 2SXLA 4FYXB 2K8GA 2MTLA 3KJVA 3GG1A 1VQYA 5HJYA 5KFEA 5DETA 5IWAJ 2VBXA 3H40A 4ZPWR 3ULHA 5B08A 2RVJA 3BDEA 3SIPB 2G0JA 3QQCD 1KONA 3CCTA 1G2EA 1EAYC 2ZJPQ 1YQHA 1UFKA 3IM9A 2FLOA 5D0RA 5E3RA 4E98A 2GV1A 5K14A 5E41A 4J9RA 4WTOB 1WC4A 1N33F 1KHVA 2ZDPA 1RHKB 1VK8A 3RRHA 2RKIB 4J9SA 3FZBA 4Q0BB 3SFUA 2UXCJ 4X4TA 1ITPA 1AT1B 4K5RA 4F2RA 1FESA 3ISZA 3TUPA 5G0RA 3LH2S 2QYCA 4YEAA 5EDWA 1TP7A 3QMQA 4S0MA 2R3VA 1AUSL 2EI5A 3GILA 2ROPA 4RW6A 3NGDA 2FY1A 2M9KA 3HSZA 1Z4UA 3TZZA 2CJBA 4C3KA 2HGLA 2IIHA 4DSIA 4QW8A 4C6AA 1TKTA 2WBRA 3MMAA 3M8WA 1LFPA 2K2PA 4NLWA 2MKIA 1LW0A 1JXVA 3UDLA 4P75A 1KWMA 3PR5B 4MIBA 3LUYA 4WXWA 2HNDB 4W4MA 1KD1T 4B9TA 1FK9A 3JTOA 3EYZA 4OJGA 3C6TB 5HBMA 3BPDA 2QO3A 2OPQB 4JOUA 3CCLS 2RNEA 3NY0A 4ELTA 4CIOA 4C8OA 3SYZA 3OLAA 2YPYA 4TYAA 4N76A 4TLQA 1XC9A 2AMCB 2CIMA 3CDEA 4KC5A 4K8RA 3BYRA 2LA4A 1HD0A 3K0JA 3DDNA 4CNYA 2HQIA 1NJIT 1JJ2R 4AFFA 3C19A 4YB1P 2MHNA 3ILIA 1QAJA 2DK2A 1WWHA 1G6BA 4DV5F 3MUTP 3ONQA 3N4WA 3SCJE 3C6UB 1DLOB 3FSXA 1RT1A 1V5IB 1RT6B 4JI5J 1RT7A 3LOUA 3HHEA 3CWJA 4OJHA 5GAGI 4KQZA 4X4UA 4DV1F 3E2EA 2OPSA 2VKZG 4YB7A 5KFDA 2FHJA 2W9CA 3NBPB 4IRCA 4AL6A 2I5JB 2LCWA 1X4EA 3AD9C 1HA1A 1AZSA 3LP1A 3MAHA 4EZ6A 3ZTPA 3IG1A 4F3MA 1OQ3A 4ZCLA 3H4BA 3KLVA 1GEHA 1FTCA 4RW4B 4LSLB 3H42A 3TAMB 1NZAA 2HWTA 1WOOA 1VQKS 3NKYA 3NCQA 5LMNJ 1YJWS 2UUBJ 1X5SA 4ZVQB 2W7OA 4LBHA 1TVRA 4GC6A 1U1KA 3W1YC 1KS2A 1VR6A 1GMVA 2XLJA 4WU3A 3M32B 4PQAA 2M5YA 4NEYA 3OR2A 2ZJQQ 3NGKA 2CADA 2PDAA 4YUDA 1RP5A 4NA1A 5F0WA 2HAIA 3FQKA 1FKPA 1UL3A 2ZNYA 3OR1B 1NK4A 3ISND 2R8JA 5M2PA 2GMLA 3DRXA 4QU7A 2YKPA 5ETLA 3VALA 4JI6J 2EW9A 4TY8B 2E5HA 2ZWPA 5F8GA 5C25A 4QYZK 2L9NA 5J1PA 3AB4B 4FN5A 2A0FB 2CA9A 2FD2A 4A47A 1TZ0A 1RXOB 3PKYA 1AB8A 5A8RA 4Q8FA 4ES3A 1VQPS 4CLSA 4FF1A 2K7KA 4DF8A 1P1TA 4I6YA 2HHHJ 4ZVPB 1LV5A 3PKMA 1SXLA 2C2KB 4YR0A 4X62J 3M2RB 2Z2LA 2Q3PA 4K50A 2DVIA 1SBRA 3AHPA 3MAQA 1S4EA 4LF9F 2UUWA 3HLUA 4X66F 1U8WA 4OJ3A 1SL2A 2C2RA 2WOMA 1Q5YA 4KHPJ 1S9GB 4DR2F 1XMQF 2CQIA 1JIHA 4O44A 1X4DA 2QL5B 2HNZB 2LFVA 4DXLA 2R8HA 3QGPA 1UZDA 2Z2ZA 4IDKA 2EFOA 1DQ8A 3J80Y 2CQ4A 5L1LA 3GIIA 3HO1A 3BR9A 4HI1A 4KO0B 4OYZA 2IHR1 3RUBL 3LWMA 1RT4B 1Q82T 1H2UX 2ALZA 4OZ3A 3PRVA 5HK4A 4ECWA 2FZGB 3WIVA 1SQGA 3GFZA 4ETXA 1F3FA 3C15B 4EGLA 3MMBB 4URGA 2QTWA 1HNZJ 4NEZA 3R8YA 2OJ3A 1JLEA 3D1OA 1FJEB 4G1QA 2UVVA 3GLJA 1U0HA 3BBBA 3CIZA 4JV5J 1UFLA 4USKA 3H20A 1WNEA 4RUBA 3KLHA 3U1MA 2RSQA 3CD7A 2CQ3A 2H5JB 1S6OA 1EKSA 2OMOA 3T41A 4LT6A 2NXJA 4M5DA 4A48A 1RB0A 3W9IA 3VGSA 4ZS6A 3VTIA 2YTCA 1RWPB 1N0VC 2CPYA 3NMAA 2EKNA 2H5EA 2XMUA 3DC2A 1FDNA 2HNYB 3H2UB 2XQCA 3DKDA 1CLFA 2M4MA 2R42A 1U25A 1HWJA 3P96A 3QO9A 4LBIA 4F8RA 4PWWA 2LVWA 1RABB 1S1TB 4R5PA 2MYFA 4C48A 4QOTA 3BB5A 3JQJA 1LWCA 3BO2A 4ZN3A 4K4WA 1S4FA 1FDDA 2RU9A 4FKYA 2GAHC 5GAEU 4X4QA 2R2UA 2MKJA 5E33A 2DO4A 1YX2A 2QG9B 4WCEQ 5IZHA 3H5UA 2E5IA 5A8KB 4M1KA 2GMHA 2PA8D 4OI6A 3CDBA 4UOCA 1TKZB 2G13A 4DL4A 2XHCA 3UCGA 4PR6A 1OY6A 5LXYA 5CQGA 1AUDA 2LQJA 1S6PB 4EI2A 5AE2A 1GXLA 2X3DA 4MFBA 4DFMA 3MOZA 1Y4ZB 2Y1JA 1E6YB 1NK8A 2ACMA 3UNGC 4AT1B 1NDCA 1CQNA 4YDDB 1ZM2A 1S12A 1WHXA 5KG6A 3Q8QB 3ENAA 3C66A 2KYZA 3P49B 1VHIA 1X4FA 1OSDA 2O01C 5DRKA 4YOEA 2AJQA 3NRBA 3BM7A 5KG1A 1KVIA 3PEJA 1LNQA 4CO0A 3I5BA 4MKVA 5L1IA 1C4CA 1PJ6A 4LF4J 4A8XA 4DX8H 1RTJA 1Q78A 4M5GA 3R5GA 1YWXA 3B6BA 4DV6J 3BPSP 1D0EA 5KG7A 4O0IA 3OFGA 4BHQA 2OD4A 2R8GA 2VG5A 1Z2LA 3KDNA 2KFZA 3OL6A 1FHTA 4MK9A 2XZDB 3IBWA 4P2MA 2V34A 1NB7A 4DUZF 4A8KA 1SCJB 4TQRA 3HI9A 2BYCA 4DBQA 1XNQJ 3SFGA 4CTAA 4JI2J 2YNIA 2B6AB 4J9KA 1H72C 2B8QA 4C11B 5GVQA 3FCVA 1HPZB 1F5BA 1DARA 3V4IB 2EVZA 3MR6A 3SV4A 5ETPA 4PG6A 2E9TA 3TZXA 2OEJA 4KPYA 3PV8A 1TQLA 2VF3A 1GFWB 4DPWA 3R6LB 2X51A 2J0WA 5KFAA 2O1PA 4X4VA 4DV7F 1YJ7A 1RKJA 3HJFA 1RA7A 1NDPA 3G4SS 4OI1A 4LQ3A 3ITHB 1YKWA 4DDFA 3NS6A 4LF7J 5D4NA 4CH7A 3EZ5A 1HBMB 1EQ0A 4IYQA 5CYJA 2V2ZA 3HHLB 1REVA 3N6NA 3S7RA 3UDVA 4YY3J 3BV8A 1APSA 5B09A 3KFWX 5AT1B 1D09B 1W25A 1F60B 3S1TA 2VC0A 2HBZB 4QIWD 2CJAA 4ICLB 4DLGA 3IRXA 2BZ2A 3GSIA 2BE9B 1QVGR 1N32F 5I3UA 4USUA 1UPPA 3OFEA 5JJBA 1K47A 4CP5A 1NK0A 1MMDA 2HS3A 4ZVRB 1U6FA 4J37A 4WP9A 4C8ZA 1KOHA 2I8EA 4PUOA 4ZLJA 1A6LA 4HH0A 4NLGA 3HCXA 1S99A 4RW9A 3DMJA 5LM7E 4BS2A 4ECXA 4AL7A 3US5A 3A1YG 3BQ0A 1IKWA 3BSOA 4C8YA 5IM0B 5J1EB 3FDSA 1TK5A 4JV2A 3M8QA 3T5HA 5RUBA 3R27A 1S6UA 1AA1B 5HL7Q 1TELA 2YNGA 3QT5A 1RWMB 4DR3F 2GQQA 3TJ9A 4IQXA 2J0XA 2A18A 3HHNB 4P71A 1T05B 3WDOA 2PMHA 1CULA 1ZTWA 1H2TZ 1FT8A 2KHCA 1U4BA 1TL4A 2F8MA 3QGIA 1T9YA 3K5MA 2BM0A 4FS1A 1JXEA 2DPJA 2DYAA 4CLKA 3CNQP 3W9JA 2GJIA 1Y3KA 4KKOB 4HDHA 4USMA 3OSNA 2MZQA 2MB0B 3SDEA 3R5BA 2DGQA 4OI4A 4OYOA 4CLFA 3MPDA 5D3GA 3MEEB 3SXLA 1YBTA 2GAGC 3G71S 2ZKUA 2OEKA 3FZ2A 3L95X 2OH2A 1WSVA 3T3FA 2LQBA 3U02A 1SKRA 1FF2A 1LWEB 4Q2MA 2I1RA 4OZNA 4GO5X 1VC5A 4JI0F 1R27B 3PXGa 3ZZZA 4PRFA 2HHUA 3GCWP 2DH9A 5F8NA 4JI3F 2RHQB 4RWWA 4C8KA 1QUVA 2W25A 3EPIA 4M5MA 2WSFC 2IM2A 4DV5J 4OHWA 5BR8F 3OL7A 3CCZA 1RTHA 2ZD1B 1B0PA 4HACA 2XY7A 2J5AA 4KT0C 2Q6BA 2J7KA 4CO5A 5HSPA 3S01A 4B9NA 1CBKA 4TU8A 3LQVA 5DM7Q 1WUUA 3C8YA 3MR2A 2JFKA 1N5SA 4KV8A 2FJWA 3GIKA 1VBXA 3UD4P 1DQ9A 2F9DA 2IJFA 3DOMB 2GGPB 2DNMA 4PCQA 3MPUB 2GJFA 3R5JB 5GAHI 5CD4H 2ZE2A 2ZVSA 3OVBA 3QWPA 4IG3B 4NRTA 3MM6A 5KFUA 3UDCA 4ED6A 1YZ7A 4IG0B 4CNZA 4B3TJ 1EETB 4J9OA 5DZ7A 1XERA 1VI7A 4ED1A 4QWAA 4WTYA 3AAWB 3PG9A 1TFYA 4B9UA 1OS5A 5B7WA 2WZ1A 2I6WA 2AGOA 3MPVA 4H4MB 3QIPA 2EFVA 2DGVA 3C6UA 4USJC 3DLLQ 2AKWB 4Y2CA 2KI2A 1CS4B 1VQ4S 2OEMA 1UA0A 1NO8A 3PJXA 2HVZA 1WC0A 1R8CA 3T19A 2C2MB 2IY5B 2M88A 3W2WB 4ZP7A 2V8GA 5A8WA 3MECB 2ZJRQ 1L3UA 2CWKA 5KFTA 8AT1B 5L46A 4M5NA 4D3GA 1U26A 5K5MA 2O3DA 5J2PA 2KZMA 4DG1A 2M8HA 5IC4B 2ZUGA 3PX4A 3ENWA 4LFAF 3RZAA 3IFEA 4NCGB 1VS3A 1KHWA 3TAMA 4DR6J 3D66A 5KG3A 5HQLA 2DEIA 4PXCA 3N5BA 3TX0A 5CCMA 4Q2LA 2HSEB 3MM5B 2XY6A 2HW3A 2G1HA 3CC7S 3PFEA 4PEOA 1SL0A 5HVHA 2FVRA 1NSPA 3M32A 4HYKA 4J91A 1JXLA 1S1VB 3IRWP 5AE1A 4X66J 5HMZA 2KB2A 1XR6A 1GXTA 1GMUA 1RSCA 3T1YF 4DR2J 4LFBF 1XMQJ 3MM9A 1MU2A 2XMMA 1BQMB 2CPIA 3QATA 2F3JA 4I7FB 1AYEA 3NXZA 4PQUB 3P8BB 2DHHA 4IQMA 2HZVA 4DL2A 1NKBA 2HURA 4QPXA 3UD3P 2U1AA 3AFGA 2E66A 2H65B 3AJ2A 2IFXA 2XGQA 3T5KA 1PKUA 4NE9C 6AT1B 1PC4A 3OTDA 1NM2A 4EWTA 1VRQC 3PX0A 1FWKA 3FEXB 4DOZA 3M1VA 4F26A 3C3LA 1UPMB 1YSJA 2GVDB 3K5LA 4DUTA 3CMQA 1L5UA 4DV3F 2Y0BB 1VCTA 2BQRA 3V2UC 4PWUA 1FRKA 1HR0F 1X0FA 2E9ZA 2RD5C 1NK5A 4TLRA 1VLOA 1R43A 3CSKA 3GCXP 1AW0A 3CCWA 1JJCB 4ES2A 1VBZA 4KBIA 4OL8A 1RBAA 1EZZB 5GAEI 1RT5B 4NYZA 2DGSA 3VWSA 1V5VA 2BJ1A 3M6UA 1NSKL 2MZ1A 3FFIA 1I5OB 4DR4F 3DCAA 3W2VA 2M70A 2IM3A 4C0BA 3C15A 3MMBA 1URNA 3OHAA 3UI3A 2CFXA 2VFRA 1BUXA 1RWXB 3D28A 5L38A 2W9BB 1HNXF 2OO4A 2CNNB 2VONA 2QEXS 5B0FA 2UUCF 2JEIA 1MN9A 5ETVA 1BQNA 3AQOA 2DD8S 2DNGA 1LWXA 4XPCA 3NNAA 4ZHRA 4PKDB 2X3GA 3BH6B 2ZHBA 3ZTSA 2DNOA 2UUAF 2CKWA 1HNVB 1T9XA 2QMUB 3VVUA 5HAOA 2IA0A 3FCHA 3X1LB 2BOAA 3IA0A 1YBUA 4DV2J 3GIRA 1S9EB 4Z37A 5AE3A 4O4GA 2OD6A 3LALA 4YDXA 2WHOA 4DR7F 3RG6A 3OPKA 4RBTA 4Y34A 3O6QA 3K58A 2L3MA 2X1GA 1IR1A 4I0WA 2MKHA 3NNCA 3V6DB 4LR7A 3W3SA 1Y7PA 5L9XA 3BSNA 4Q5VA 1A0OB 2ZHAA 1KR4A 1FERA 2B43A 3ZZOA 2OAUA 4JYAF 3I31A 4ILLA 2F8EX 4IRDA 2Y9HA 1J5EF 4FYYB 2VFTA 3MURP 3EJMA 3G82B 5A8KA 5HVFA 2PI4A 3DLHA 4C98A 3JXOA 5KOWA 1RAFB 2DCLA 4ANDA 3K5NA 2Z0GA 3HSDA 1IKVA 3D6MB 3MD1A 3NWRA 4I1TA 1WD6A 2CQ0A 3P4UB 1QJHA 4MJKA 4JI8F 3FNNA 3NMRA 3I0RB 4G1IA 1S6PA 1RA6A 4H4OA 3OT9A 4CDIA 4WXOA 5FIIA 1UWAA 3T1HF 2WONB 5EWEA 2DY1A 3M6XA 2KL8A 2ZZMA 4DUZJ 3WC0A 3HVTB 5KT4A 2WAQD 1ROFA 3P6YC 1RADB 2QJ3A 3HDSA 3Q23A 1QTMA 5EN1A 2B4UA 2FLLA 5B0CA 2OLWA 4CM2A 3POTA 1NMEB 4OX7A 4X4NA 4MK7A 2I9SA 4PPDA 1CQMA 3M30A 4DV7J 3KLGA 1UVKA 1TL3A 2HEKA 1SQEA 4ECUA 2KM8C 3UNYA 1TMMA 4RW8B 4HR2A 3G9CA 3OSPA 3GR1A 4RU2A 4I2PA 3T6JA 1UETA 3MUMP 2BUNA 1RTIB 4B3RF 4GVBB 3DRYA 2H3EB 3MM8B 2JLEA 4FXDA 1K1SA 1NK6A 4UOGA 4N8NA 2JEJA 2LECA 1YVFA 3E01B 3AXMA 2MKCA 2E9RX 2FDNA 3V4IA 5HANA 4ANEA 3LAMA 2VOPA 4C2MA 1YRUA 5ETSA 4HVZA 3JQKA 1VQSA 3MCSA 3GV8B 2XSJB 2CAJA 2XGPA 4WFBQ 3TUIC 2Z8QA 4ED0A 4DL5A 1LWFA 2FHOB 2JZ5A 2D9PA 5D0EA 3J81j 4R8UB 1FRLA 2CPFA 2CNLB 3ITHA 2XMAA 5F3ZA 4HHJA 1N88A 2DNYA 2KU7A 3H2LA 5J1NA 1FRMA 4LFCF 4GKKJ 1X5OA 2P5VA 4B3SF 1LW2A 1WKKA 2V0NA 2ALYB 2KXFA 2RU3A 2GIRA 4MYTA 5U47A 4CO4A 3PY8A 4DR3J 4KGVB 5KFKA 1O6XA 1YJ9S 3HKWA 3AQPA 2K1RA 5JVGQ 4WIQA 2MKYA 2HIQA 2VJVA 3AY0A 4ZKAA 3RBDA 4AD6A 4WU2A 3DFEA 3VCDA 3IGNA 1JLGA 4MK8A 1MROB 5L1JA 1VQMS 1LXNA 4R25A 3KG4A 4O3PA 4C3LA 3UPFA 4ZJQA 2ROGA 4R0EA 1T9WA 1KFDA 3EVMA 2E1AA 3QJPA 5K20B 1S10A 3Q0AA 1B70B 5HLFA 4ZLNA 1H0HB 1M0SA 2IJNA 4ZPTR 1L3TA 1C4AA 3QNWB 4A8FA 1GQEA 1YK9A 4LRBA 4JI0J 4QIFA 2LYVA 3CUNA 4Q44A 5F41A 5DLGA 4PWDA 5I42B 2GS8A 2HRTA 3CMES 1EARA 5IT4A 5K14B 2OPPA 3OTCA 1K0VA 3T5LA 2F8HA 1TUGB 2MJUA 1YJNS 2WVBA 3MM7B 5T41A 2AEMA 1V9OA 1BGXT 2J9CA 2Q1LA 3GQCA 1SJ1A 1HIYA 3O2IA 3ISNC 3BN7A 4I69A 2ZFHA 4YQWA 1X7VA 3N6MA 3MEEA 1LQ9A 2G2ZA 5HP1A 1FNXH 4HEA9 3N5FA 5DDPC 1D9DA 1LFWA 2JX2A 2J6TA 4ZA1A 4C7QA 2GZOA 4RW6B 5D0GA 4LF6J 1Q8KA 3MF5A 4N56A 1LWEA 3ET6A 3R7BB 1TKTB 3I4HX 3MMAB 2QL9B 4DCJB 3MTKA 2ACYA 5F9LA 1LW0B 3OL9A 4QR2A 2FJEB 4FS2A 5D15A 2O5DA 3BSCA 4IRKA 2R9LA 2QLBB 2YWKA 4DCPB 5A2QU 1UVLA 4UW2A 3CJSA 4F4ZA 2LKZA 3NS5A 4GKJJ 1CJTB 1BXNA 3KHGA 1FK9B 2UXCF 2AD9A 2UU9J 3HFZB 4WF9Q 5HBMB 2YKMA 1R3NA 3QRQA 4PG8A 2M0GB 5L9NA 4FYWB 2B56A 4DS4A 2RIJA 4QWDA 2GGPA 1YIJS 4H4KC 1T7PA 1Q95G 2P8IA 1T3NA 2C1EB 2XNQA 4OMFG 1U1RA 2KT5A 2OKQA 2BOPA 1N34F 4U7UK 1OPIA 1FX2A 1L3SA 1N8RT 5FD1A 2V68A 1Q8IA 2EFQA 2JRSA 2A6OA 3VGUA 2YY3A 5CAAA 3RYLA 2FGCA 1YJUA 3TQEA 1VHFA 4B08A 2V2KA 2DIUA 3T9ZA 4P74A 4NZ7A 4I68A 4CO2A 2QSFA 1UEUA 4DUYJ 3PZPA 3DOKA 4ZVGA 2J8SA 1RT7B 2R7RA 1KFSA 4ELUA 1JNRB 2YBVA 4YMEA 3MFIA 2VUGA 4K5SA 4V19X 3W2WA 3Q8RB 1S7IA 3FEZA 4PXBA 3KDOA 3ZZTA 1J5OA 1NLKL 2W9CB 4UT4A 2RUSA 4LFBJ 1AZSB 3LTOA 3LP1B 3CJ4A 2A2DA 4AXIA 2V6AA 2GIQA 2XULA 3D1QA 3IG1B 2GO8A 5BXIA 3DGPB 2VPZB 2XO6A 1B3TA 3IBFB 4OI3A 2KJVA 1OQ6A 3UO0A 2XWXA 3MCOA 4P52A 4RZRA 5I3QA 2B3TB 2DO0A 3D68A 5IV3A 4DV4F 5DJBA 2W2PP 2AJ0A 1TVRB 3IBCB 3UN5A 4K4TA 1S1VA 3OR2B 1T11A 1VFJA 3PDNA 4CLYA 2XTJP 2OGUA 1FTRA 2ASLA 2QX0A 4J7CA 3X3UA 1HR0J 4XO0A 3MPWA 2IC3A 4LR9A 3AOCA 4Q43A 4C0HA 3VF0B 5C25B 2J7UA 3UDEA 4JV1A 5F8JA 1FWPA 3FBEA 2HVDA 3GJQB 4B02A 1RT2A 2RMLA 1Q8BA 1RWUA 1IR2A 4WP3A 5A8RB 4ZK7M 4EFAC 5KG0A 2RQCA 2DNZA 3E8OA 5FLXY 2CZ9A 3CJRA 4HT5A 1HQEA 3A3NB 3ZZRA 1SV5A 3QGHA 1NJWA 2MQNA 4WE1A 3TJ8A 2HVIA 3A8JA 4USHA 1HNXJ 2GIFA 1TMJA 1CEZA 2WOMB 2EFPA 4DL7A 2UUCJ 4ITSA 3ZTOA 3J81U 5ITHA 2AHOB 1FA0A 4JI6F 5AXKA 2AZ3A 2VQEF 2EBGA 2BANB 4XK8C 1SH3A 4IDKB 5D6GA 2UUAJ 3K2YA 2ZKTA 4QYZJ 2D41A 3IXQA 1OO0B 3JSMB 3N6LA 2KRRA 1X4BA 3RB0A 3VR1A 3AB2B 1S79A 3G8QA 2OFGX 3LA0A 1YI2S 2HHHF 3TOQA 5CABA 2YKNB 4BLGA 4X62F 7FDRA 4A8YA 4DR7J 4WBFA 2ILYA 3QSIA 3MR3A 1JK9B 5KT2A 2W9BA 2VG7B 3TZYA 3LP2A 2HHTA 4L73A 4KHPF 1U0HB 2AT1B 3BDPA 1RWVB 3WC2A 2BRLA 5CH7B 1RTZA 4MMOA 4KFBB 2CQBA 3KLHB 2DHAA 4DSFA 3DLJA 1J5EJ 1WG4A 3W7BA 1FRXA 1FJ7A 3DLEA 4A8QA 1WF0A 5D8HB 4LSNB 1HI0P 1T8EA 1YRTA 4FVMA 1DZ5A 4JI7F 3W65A 5KTQA 2NXEA 3CD6S 5IT9Y 1YDLA 1S9EA 2RUGA 1FE0A 1JQGA 4ZPCA 2DR5A 4ZOSA 4LVOP 1XK8A 4ZVTB 1HNZF 2CJQA 3J7ZT 4X65J 2HQDA 4C8NA 2FHJD 2QRRA 1ZS6A 2D3OR 3CGIA 5ETNA 2WB4A 2CQPA 5J2MA 3T1HJ 2JWNA 4R5PB 3OXLA 4ECSA 2FIUA 2CPXA 1LWCB 4UOHA 1D9FA 3GG0A 4ZPVR 4ZMMA 2N3LA 3TEGA 5G4DA 2BE2A 2DEJA 2XMJA 2AYBA 3G82A 2F1FA 5DG8A 5H9FJ 4DZDA 4RW7B 5AXNA 1UWBA 4XDDA 4FXWA 3AOAA 2MQLA 3KNGA 5IQQA 4DEZA 4C8LA 5KFOA 1UVIA 1HYSB 3H4DA 4ZVEA 3DDKA 5E3CA 1S5ZA 1QM9A 5EX3A 1WG1A 1ZAVA 5BYRA 4F0MA 4DV0F 2KRBA 4XTTA 1RCXB 1GX5A 4UUXA 4EO6A 3ZXWA 2ERRA 3R2DJ 2KZZA 5KFVA 3HHKA 1P9QC 1SB6A 1JLCB 1IR0A 3ZNJ1 1QSLA 5LOQA 3OW2R 3QJJA 1M5OC 1IBLJ 3DM2A 1K1QA 1O0PA 1SVDA 1DBDA 2QLJB 2LDIA 2UXBJ 3KG0A 3LWLA 3FMBA 4FNHA 4F3OA 4UY85 3FUYA 2UXDJ 1SKWA 3MAAA 3RBXA 1BQXA 1URRA 4OZ1A 1Q1KA 2CNOB 3CJ0A 4A8SA 2QV6A 6FDRA 3VV2B 1RHJB 2XS7A 1RTJB 1TAQA 2DITA 3P3DA 1N56A 1ZZNA 1WI8A 4P73A 1RYRA 2HFZA 2N7YA 4LIWA 1B0TA 4OX9F 2VG5B 1R6YA 3UW1A 4DX7A 4LFCJ 2LEAA 3EGVA 3A4TA 5HJXA 1RACB 1RTIA 2ZHOA 4CO3A 1MWYA 1WEXA 3MM8A 1Y5IB 4F2SA 1T02A 3SCKE 3SSSA 1HKAA 2CVEA 4LF5F 3WX4A 4CTAB 2DJWA 3PRBA 2FJVA 3EM1A 2BE7D 2R7UA 2M2BA 1TR0A 5HI7A 2F4VJ 3PHTA 2B9YA 3QYYA 1RU1A 2B51A 4F36A 1UVNA 3MMCA 4URQU 2IYIA 3PCOB 4NI2A 2AYMA 3HM9A 2R7WA 3RAXA 1KOOA 2ASYA 2VICA 1ACMB 1CJUA 4TQSA 2RB7A 3QBCA 4G65A 4R8UA 3GTYX 2YQ0A 1M5HA 3M4XA 3HSGA 5DG7A 6FD1A 2HHXA 3PX6A 4Z7YA 3JS9A 4P2FA 1REVB 2MPUA 2Z2MA 1R89A 2CPJA 3B4MA 2XLKA 2GHVC 3I55S 1PBUA 4IOCQ 2EWHA 4KB7A 1CSJA 3JAMY 4YN3B 1WOPA 3V6JA 1S7HA 2RDDA 3HFVA 2E5LF 2DR6A 5LSRA 3IRXB 1S0NA 4URSA 3RBEA 2F9JA 5L1KA 3PYGA 3H25A 3OFHA 2KT3A 3BJYA 3ZTQA 3MR7A 3G8SA 3HHLC 1KVKA 1MROA 4YB5A 3MTJA 2F40A 1QAXA 2YQ1A 2EK6A 2W24A 2HQCA 4PUOB 2XWYA 4PZVA 3R7NB 2IJRA 3AD7C 1P9YA 5AXLA 4RW9B 5KFSA 1FDBA 3FVYA 2VPWB 3VQSA 5IFMA 4X64F 4NL5A 3M8QB 4KH1B 4QIGA 2W2OP 3KMSA 4X4OA 2FLPA 1S77D 4DSLA 2QMXA 2MMYA 2YNGB 2KHDA 2RF2A 2V4JA 2CVIA 2X1BA 1OY8A 2ZOFA 5K8PA 4DFKA 2DT9A 3GPAA 4QWCA 2LQ5A 2V9WA 3M8YA 3I9ZA 1CULB 4FXVA 5I42A 2HBRB 1IKXA 2Z30B 5CYMA 4CYUB 5E7OB 4HKQA 1TKXA 3KXDA 2WW8A 3GJRB 2DY9A 4B9SA 4L76A 1H7WA 1NKEA 1FCAA 2DH8A 4P2XA 1FDAA 1QD1A 1F9HA 3MM7A 3BF4A 4KJIA 1NJYA 4L75A 9RUBA 3I96A 2YXLA 4NLQA 1RISA 5IXUA 1HNWJ 1PYTA 3L4BC 3SDEB 5D3GB 4DQPA 3LGNA 2AJFE 2VASA 4DI6A 2Y8YA 2GCFA 5HN0A 1PO6A 1ZPWX 1RAHB 4B3OA 1T03A 1N34J 4NLOA 3N79A 2YH1A 2QYGA 3VGTA 3SI8A 4EBDA 3GFXA 2LEBA 1G7CB 1XIQA 1SJ4P 4J9UE 3VGVA 4LF1A 3AXKA 2FJBB 2MY7A 3CC2S 3AT1B 4ID8A 3TO8A 1R7IA 4BDPA 1CJTA 1RTHB 3PW2A 4HACB 2C3OA 1VBKA 2FJDB 1BMQB 3I9V9 2AP6A 2A6MA 2FYXA 4CWBA 2C3YA 1B99A 3JTNA 1U7LA 4D3HA 1WTBA 2FZCB 3R1LA 1CJVA 4KV8B 2L9WA 4OIXA 5HQMA 1F2HA 2KXNB 4WZQA 3O3LA 2FC8A 4BC7A 5AJ3J 2ZE2B 4E0DA 2PFDA 3MM6B 3K57A 2HWIA 4UOFA 2XB2D 1KKHA 1FD2A 4RR5A 4FYVB 3Q8UA 4RLEA 2HVEA 1BE4A 2ZZNA 2CJXB 1VRTA 4OI0A 4FBUA 4WFXA 5EHHA 2OIHA 2OELA 3QIPB 1N48A 5E3PA 2X1FA 3ZO7A 5ETQA 1U1OA 5F3TA 4JI4F 1NDLA 3CO0P 4DV4J 4DPOA 2V94A 2B4VA 1S6QB 1KQGB 5IC6B 2OI2A 2VBWA 3EZUA 3HKZD 1VDHA 2CUYA 2D1CA 2KDOA 3BGOP 4FP9A 4E2FB 4DPUA 3CJ5A 4IH5A 5A8WB 3QT7A 4EK2A 1IM6A 5EWFA 2NYHA 2UVUA 2XBPA 4B3TF 3WX8A 4K4SA 3PYEA 5J2PB 4DG1B 5CA5A 1NH8A 4LQ9A 3DGPA 2R7XA 3PIPQ 3EZOA 4QIVA 3TA2A 1SI9A 4CCHA 1KNZA 1HW8A 3DU5A 1S1UA 1R8BA 3I4PA 1EB0A 1FO1A 3PNIA 3EGNA 4EUVA 3D2WA 1WHVA 4B3MJ 2CDQA 4NA3A 5K8MA 3O1LA 5L8RC 2FHKA 5GAHU 1OYDA 4RO0A 3I0SB 1EP4B 1HBNB 2YX7A 5KFHA 2CRLA 2E1PA 4Z2XA 1SPBP 4QR1A 3MM9B 4DPTA 5KAKA 1MU2B 1RQ0A 2IRUA 5DDRC 2R7VA 3DHXA 1MWZA 3ZTRA 2VQEJ 5C5JA 2YWHA 3BGRA 2ZH5A 3DRPA 1VQ7S 3EDRB 4P6QA 2C28A 3BGFA 2DHSA 4MYUA 4DN9A 4DR6F 1TU0B 2CG8A 3SCLE 3Q8SB 5IV4A 4F4XA 4ERDA 1QAYA 1SUQA 4MIAA 4WFZA 2DKOB 4RNMA 2XO7A 4QBUA 1SJFA 4ECVA 5H1SV 1YHQS 1OWXA 1YBAA 2J0SD 1PCAA 4ETZA 5EUHA 3M1VB 4LF2A 4ECZA 4R0JA 1B7FA 3L7OA 3M8ZA 1I1GA 1N5TA 4G3IA 3M8SA 2MKSA 4IKAA 1JLBA 4ZPBA 4ILRA 4DL0C 4YS2A 1MSWD 3IGVA 4OYMA 2CNKB 2EKYA 2BANA 3NG8A 4PG4A 1ICEB 1FVSA 2O66A 3LP0A 4DJBA 1XBWA 2JSXA 1FFGB 4MH8A 4MKYA 3JSMA 1BWEA 4X84A 4JI7J 2HFOA 3FFIB 2DR8A 2VV5A 1BD6A 1N36F 2YKNA 3KK3A 4O3NA 3OXGA 3W2VB 4N41A 2BACA 4DL6A 3TUZC 2IMWP 2HFNA 1HBOA 4ENOA 4X4SA 2L41A 4KRWA 5KFPA 4GVLA 1PJ7A 2R7QA 5GADI 2VG7A 5IT9U 3UR0A 3ADAC 2H54B 4NASA 1RBLA 2ZH1A 1O5JA 1BQNB 2QSWA 4KFBA 3OBIA 2QFJA 1MG7A 4ZHRB 2RILA 3HVRA 3PHEA 1VLYA 4LSNA 2R2RA 1HQUA 1Q7LB 1U0SA 2FVCA 7FD1A 2OPRA 2N4DA 2ZM6J 3I32A 4NZ6A 2XCPA 1TK0A 2H1YA 2B7BB 5IQ6A 3HULA 2E7XA 1DURA 4CLLA 3JYTA 3BYPA 1N0UA 4F4AA 3M2VB 2E29A 1YITS 2DNPA 4XDCA 4O4GB 3DRSB 2MZTA 3WHIA 4CT9A 1WKLA 2KFNA 3R2CJ 4DV0J 2FUG9 2VPXB 3UVJB 2DBBA 4IO1A 2CPDA 3RRGA 4PG7A 2NS1B 1R8HA 1BHNA 2J9EA 1JLQA 3R5DA 2ZC3A 1HD1A 2KG0A 3T6BA 4DR1F 3DI6A 1EX8A 1GMWA 2EFGA 1C1BA 5KFLA 3I56S 4RW7A 3THPA 1U1NA 2ZBQA 2QA2A 4WYWA 4C9DA 3MXHP 3OJUA 2BVZA 4QQBA 2RT3A 3AD8C 3CEDA 4DV2F 1HYSA 1IKVB 1VMBA 3U1NA 2VKRA 5DZ6A 4DFJA 4EMDA 1I51B 5DDQC 3PR4A 2G0IA 3K59A 4M94A 1NCLA 4XPEA 2HGNA 2HQFA 1S49A 1HBUA 1FD8A 1RZMA 4OX9J 2VQFJ 4H4OB 1T9VA 2HQ3A 2ZH7A 2DGTA 4KSEB 2NQPA 1JLCA 2HS0A 2ASDA 1KSPA 3FRZA 3SSRA 4OQJA 4I67A 1RAOA 4DQQA 5KFJA 1KLMB 2GQCA 5CD4A 4LF5J 3NGRA 4K4ZA 1F0XA 2N82B 1HWKA 4W98A 1EJ7L 4IFYA 3BREA 4M5LA 1W2IA 2NXUA 4FDFA 1KC8T 3FCWA 3ETMA 3TANA 3DLBA 2DNLA 1KDNA 1C2PA 3POTB 2RDIA 1ZA2B 4DMZA 4QR0A 2Z2YB 3CPWR 3F56A 2V69A 2JDJA 1R6VA 2CQHA 3M30B 3KLGB 1VRUA 3UR3C 3M8PB 4KGMA 1TL3B 3HX9A 3IWLA 5ETRA 2QLXA 4I2PB 3V81A 2EC0A 1QVFR 2YKAA 4QWBA 1H98A 1I94F 3F0NA 1UAWA 1HARA 4ED8A 1T95A 5A0YA 4QPTA 2HHVA 2NUHA 3BGLA 2AEJA 2E5LJ 3IAS9 5JVHQ 1SH0A 1O8BA 1T9TA 1F9FA 3CMAS 3JAMU 2O67A 2NZ4A 2B0GA 1Y5LB 3G2XA 3UCUP 2OFHX 2JHEA 3C14B 1QSYA 2VD3A 4M63A 1LWFB 3R5CA 3GYGA 4FYDA 2AYEA 3RB3A 4NMXA 3BKUA 1Q86T 1FI4A 2UP1A 3OV7A 2VG6B 1VQOS 3NCRA 4H54A 3VHQA 3SEOA 3RW6A 4NCAA 2YVSA 1MLAA 5MLCV 3MZIA 1Q53A 2GHPA 4PXEA 2AX0A 4X64J 1LW2B 2G2YA 1ZYQA 3KWMA 2ZNZA 2PI5A 2KM8B 1RCOB 2V9KA 3SBMA 5KFGA 5DM6Q 2ZWOA 3CO9A 4DSKA 4J9PA 4WPAA 3VAGA 3NCPA 1QAIA 2K1RB 1U24A 3CCMS 4MKAA 3CF5Q 3KK1B 2AX1A 5DO2A 2DXEA 3P5TL 1MMNA 3MHYA 1FVQA 1JLGB 2ZBIA 3LO3A 2KVQE 2IDEA 2Y0SD 3PM9A 1KQFB 2ZBRA 4GO7X 5HROA 2CPEA 4I6AA 3CDUA 4JI1F 4NWBA 4KHMA 2K06A 3V4MA 1Y3JA 1H6KX 3MEGA 3KLFB 4GKKF 2LA6A 3J7YU 2GHWA 2KYXA 2AEFA 1Y0HA 3KTQA 1VK3A 3RBZA 4TU9A 3A3OB 5HLFB 4P72A 2JVOA 1G4CA 2OP5A 3DLKA 2YX1A 2ZH8A 2CPHA 4NLDA 4DPXA 1FFSB 3AJ1A 4PYAA 1M90T 1VQ9S 2IM1A 3PYDA 5KFBA 4U96A 2JC0A 2PT0A 1U2FA 4ER8A 4CYUA 3CCJS 4PWDB 4N47A 2YQ3A 2BX6A 4DWIA 3CJ3A 2HWHA 2OPPB 4KIAA 1VQLS 5HVGA 4OHYA 5D77A 1N52B 2I2YA 2RRNA 3B54A 2R8KA 1VBYA 2ZITA 2HMIA 1QTNB 2HK2A 5HP1B 3DOLA 3PJWA 1X4HA 1IBCB 1F5CA 5D4PA 1RAJA 4F0KA 1QSSA 3ET6B 4BWMA 2D69A 4NXMJ 3J7Z5 2PFFB 1OPZA 4I64A 3L7PA 4GC7A 2E1RA 3CJ2A 1TFWA 2XI3A 2DRAA 2PN6A 4NYOA 2Y1RI 3HSJA 1GNKA 1NB2A 2FB0A 2DTJA 3W5YA 4JI4J 3HT0A 5LSLA 3KNAA 2V2VA 3G6XA 5T7LA 1F1BB 4HHUA 2YKMB 4M5HA 3G8TA 1SH2A 4Q8EA 1NNDA 1K8AT 1YZ6A 4KGZB 4PPZA 3K7RA 3CD0A 1IJEB 3NOCA 2Z58B 3OVSA 3DRRA 3Q8VA 2EK1A 3B8HA 4F04B 3QFHA 2UZAA 1XMBA 4E8UA 4LF6F 4RNNA 2JEFA 3Q89A 2KJWA 2EFNA 4G1PA 1DJ0A 2IMOA 2W01A 2MQ8A 5J2QB 3H5SA 2MZRA 1U2RA 3HMJG 5I3PA 1T3OA 3TAQA 4DPYA 1PYSB 3FEYB 1HNIA 4EYIB 2FZKB 3HT3A 2OTJS 3HHLD 1S76D 2BJ8A 4GKJF 4EZ9A 4ZCMA 1L3KA 3NNHA 2UU9F 1E6VA 1S6QA 3KUGA 2GX8A 1XNRJ 3DOKB 1JNZB 1Q5VA 1N5QA 1C0UA 1CPZA 1NPPA 2FJXA 4CLZA 3VAJA 3W63A 1A9NB 5KFNA 1VYAA 4A46A 1J5OB 3EDQB 2AWZA 2NPIA 2YNHB 3QGGA 2CG4A 2J8AA 1CC8A 3N01A 2BBEA 2N4CA 4X4RA 1NSQA 2LP4A 1X4CA 3H59A 2GVZA 3ZC4A 5CXTA 3C16A 2ZH3A 4ILMA 2NSCA 1FJGJ 1D3WA 4U7UD 3LPYA 1QE1A 1Q8LA 4TNOA 4J5OA 3PVXA 4ID5A 3ZFVA 1X4GA 4JUZA 1SJRA 1AFJA 3W62A 4DUYF 3RJMB 4TN2A 1UTAA 4OHZA 4WKYA 2W4DA 4BBYA 5LMUF 1NDKA 1WC1A 4OZJA 3FBBA 1NRKA 3I0SA 1EP4A 1HBNA 1NAQA 3G87A 4GRSA 4IUFA 2CZVC 1I3OB 1UEKA 4P7TA 1IWAA 4YHHF 4K4YA 2IC3B 4HT7A 4IH7A 3U27A 3KJNB 1RAAB 3OUYB 3QSYB 5B0DA 1S0MA 2MHEA 2NCKL 3D6HB 4UZCA 3TJAA 2QA1A 5KFXA 3VAMA 4Y6IA 1FXLA 3K17A 1S59A 3GV5B 3K5PA 2I0XA 1S9FA 2W1BA 1RT2B 3THVA 2B8PA 3J80U 1N36J 2J9DE 1RT3A 4XIUA 3QAEA 3A3PB 3N0VA 2GA7A 5KFMA 4JV0A 2W4PA 2QE5A 1HQEB 1SV5B 4ZLPA 3GIMA 3RR7A 3G6YA 4WE1B 1UVJA 1EHWA 1S72S 3GONA 5AXMA 3WZ0A 3OLBA 3Q2TC 3KKFA 2DNNA 5KOXA 4ZJOA 3TVYA 4USIA 2PD1A 4LIRA 3THTA 2LQ8A 2GJ2A 3PYFA 4KPCA 2IRXA 2XS2A 3CTRA 2DGOA 2Q6CA 2BM1A 3N9UC 2V67A 4RX6A 2DGXA 3DXBA 2ADBA 4O3RA 5C2GA 2C2DA 3A12A 4N8OA 2IA6A 2AW0A 4GMKA 3ZNUA 1IJFB 3Q83A 1ZA1B 3DXSX 4WK1A 4ZVOB 1CG2A 1XTZA 2FHMA 2PSZA 2FVSA 1WELA 4LUBA 5K8NA 1JLAA 3LP2B 1R8AA 4M8LA 4WIIA 2C42A 2BRKA 2XC9A 2MGZA 2DISA 3QRPA 2Z4PA 5HMWA 3V6KA 1R8PA 3EX7B 9ATCB 3FBCA 3MPYA 4DR1J 4ZVFA 1F3VA 5BJRA 3LANA 2Y1LB 3VZIA 4QU6A 3VQTA 2ATLA 3HP6A 2ZH4A 3DLEB 2RS8A 3DN9A 1R0AA 5CZXA 1TL7B 3PFOA 1NXIA 2AF6A 2XMWA 4J9VA 3M2VA 2BABA 3J7A1 1FX4A 2C2ZB 4NOHA 1SJ3P 3DRSA 3SQOP 3GIJA 4KY3A 4DLEA 4CZCA 1U1QA 2NPFA 4LRDA 2HHPA 3M6WA 3UVJA 5H9EK 4Y28C 1ZM3A 1VGYA 2FVQA 1YGYA 5J2MB 1X9MA 3LAKA 4YFUA 3TQ1A 1W26A 2EEYA 3DYAB 2L9DA 1UW9A 4I2QB 2A1BA 1XQIA 4ZPAA 1NPKA 1N6QB 1I6JA 1YJVA 5T14A 4DQIA 3D0HE 2A2CA 3PRDA 3CCES 3BBFA 2BE2B 2YPZA 1SKUB 3ELHA 1T9UA 1RAEB 1UWBB 3DLGB 5CYQB 2WBMA 4YR2A 2QZ8A 1EKRA 4K59A 4FBTA 2M7SA 2DCUB 1DTQA 1RKIA 4AE5A 4C3MA 4X65F 5JMNA 1XR7A 2HFSA 5CZVA 1DQAA 1ZTTA 1RI7A 4LMZA 1ZETA 2RQMA 3SSQA 2RRBA 4KE5A 1J2VA 2HHWA 1JWWA 2HLTA 2AV5A 4NXNJ 5KFWA 5K9FA 2HGMA 1ZM9A 1K44A 4KH0B 2IVFB 1I94J 1KLMA 2HFUA 2YKOA 4NX9A 4J9LA 4N5SA 2CWXA 3MEDB 1D8ZA 3T9NA 3R1HA 2KFYA 3DM2B 5KFQA 5KG2A 5H9FK 2GMJA 1QDUB 3FGVA 2DNRA 4HTIA 5F8IA 4LRFA 2CDRB 4MT1A 2XS5A 4UTGA 4F67A 1DFDA 5DGBA 1Q79A 4ZVUB 3MAAB 3JSYA 3JSBA 1VIXA 5KT6A 1RJJA 4J90A 5CHCB 2MQOA 2GO9A 3QIDA 2MLZA 3RRKA 4ZITA 4HI2A 3M8PA 3U7JA 1YTYA 3F44A 2CZ4A 2PMWA 3NL0A 1GTHA 3BKTA 2HAFA 1ZAWA 3FK4A 3I87A 1FKAF 1RK8A 1S1XA 1FJCA 4DR5F 2HHQA 2XSFA 4DN0A 2P9CA 3J7YI 1IBLF 1IKYA 4KR0B 2XG8A 2UXBF 2W9AA 2H51B 3W66A 1V3RA 3IR6B 3E3XA 4TKTA 4ZN1A 4DCOB 4UQGA 2UXDF 1VOMA 3M6VA 1U6BA 2RDJA 1QY7A 3MMCB 4QZVB 4I56A 4NI2B 2QGFB 4NMLA 3C14A 4FKXA 2JVRA 2ZH9A 1N5YA 2GFFA 1ZBTA 4NLVA 2B4PA 1CJUB 3VAFA 1WDTA 2YNFB 4FF3A 1KEKA 3QWUA 3W64A 1RYSA 2P6SA 3MWBA 2VG6A 4I4BA 4JI1J 2MJNA 2EXUA 2APOA 1JLFA 3H2VE 4CQ1A 1G3OA 3OJSA 1KP6A 1WG5A 2W8KA 2PEHA 4AYBD 2E5GA 2IPOB 3JTPA 4X4PA 2NUUG 2VBZA 1PAUB 4UUWA 4RU9A 2PO4A 4Z7CA 3HZGA 2F4VF 4EBCA 4ATNA 4EU0A 2G0CA 4Y2MA 1YJTA 1VC6A 1N5VA 1L3VA 2PMZD 4L72B 4OJ1A 3KK1A 1SJQA 2D9OA 3BQ1A 2WCXA 4ED4A 2MZJA 3JB9k 1H74A 2YWFA 1DTTA 2COLA 5L39A 3TARA 3QFWA 2XEXA 3CJKA 4ED3A 3KLFA 5C42B 3KLIA 1JKHA 2BW2A 2IVYA 3GFHA 2WVCA 3NWGA 3HF5A 4DSEA 1MMLA 2X7IA 2C3UA 2GQ2A 1RWNB 3RB6A 1TTHB 3TVKA 1VIOA 3KK2A 2B9WA 2NXCA 1IBKJ 2RF2B 2V4JB 1YG0A 2JJ4D 5FDLA 4QJVA 2G2OA 5B0BA 1NHKL 4OYPA 3HZEA 2G1DA 4M5KA 5MAOA 3OTOJ 2RHSB 1IKXB 1RHUB 2D3O1 3KHLA 5CYMB 1U6ZA 3SQGB 2POKA 4UF4A 1TKXB 3PEHA 3D4JA 2R2TA 3I5AA 2OTLS 1XR5A 5C2CA 2W2QP 3RR8A 2KN4A 3PW5A 5ETTA 4FNIA 2RJZA 1NH7A 1RUSA 3D0GE 2HPUA 2HZCA 4WFNQ 2BJ7A 2WVEA 2LMIA 3GMGA 2P6TA 2MQPA 5M2UA 2V8VA 2DNKA 5KG4A 5DQIA 3R3TA 3G96A 3N28A 3GP9A 5HQ8A 4FF4A 4TXSA 4ELVA 3CJ8A 3KJQB 4NLTA 4ED7A 3CXCR 3CCRS 4F50A 5DDOC 1IQZA 2DIVA 4B3OB 1T03B 3FQLA 4OYWA 1WHYA 3GJTB 4DQSA 1YLXA 3HJVA 1K9MT 3OD2A 1FKOA 3B4DA 3Q8YA 2ZEJA 4JP8A 3QLHA 2V4RA 4DL3A 1N54B 1N33J 3HXMA 2KTQA 2R7TA 1PAEX 2WSEC 2KG1A 4P10A 1R31A 1OYEA 4RWXA 2CXEA 4RNFA 3M9NB 1EQMA 4PXDA 1HWLA 4G6VB 1HNWF 1U02A 2QMWA 2R4FA 4ES1A 1CJVB 4DZ6A 2JNJA 1Q4RA 2CQ2A 2Z56B 1HLWA 3CCUS 1DY3A 3A13A 2A10A 1RWKB 3RGIA 5A76A 2B5JB 2LXIA 1SC3B 3HFKA 3MD3A 4M5JA 3CJQA 2ZH6A 4Q45A 5JUMA 4ALZA 1A7GE 1IWGA 1PIEA 3EICA 1SC6A 1IBMF 1Q81T 4U67Q 4PABA 3CC4S 5J2QA 2VDHA 5KFYA 3BQ2A 1VRTB 2BMBA 3M7VA 1FFWB 1BWVA 1Y11A 3NEKA 3TX8A 3ETOA 2XNRA 3DGVA 2RKIA 4ECTA 4Q0BA 3QZ8A 2E1MC 4HDGA 1LK7A 5EGYA 5LMUJ 3DDIA 1G1XA 2XYPB 2CJ9A 2Q79A 4NA2A 4A4JA 3D9BA 3VVTA 3FSIA 4NLYA 4LF8F 2YNHA 2C2OB 1UVMA 2R7SA 1IN0A 1WF2A 4RUAA 5AJ3F 1IM4A 7AT1B 3IMQJ 3B82A 4YHHJ 1QUPA 3TUJC 3QRRA 2XCAA 3T1AA 3OTBA 2CQDA 1CC7A 1UA1A 1X9SA 5JXSA 3RU0A 2JC1A 3CW2C 4RNHA 3OHBA 3I82A 4H4KA 3TP2A 3OXFA 3NGSA 3O5TB 1RWOB 1S1UB 2HNDA 1OSCA 2D3ZA 1FEHA 1WTFA 3C6TA 2LLZA 5KFCA 3RB4A 2XYHB 3OVAA 1WHWA 5F8MA 3EXCX 5ETOA 2OPQA 3K8VA 4KGXB 4IOAQ 4DV1J 2PE8A 3HK2A 3TW0A 1FXRA 1RHRB 3MUVP 1P27B 3HD2A 1VQ8S 1S1WB 3KLEB 5A6WA 3BBCA 2X1AA 4O4RA 4ZIWA 3ZZUA 1RHQB 3OUYA 4L6V3 1UP1A 5LJ3Y 1HL6A 1REGX 3ZZYA 3HD1A 2IBOA 5D4LA 4B9VA 5A2QY 3BGRB 4O3QA 3DRPB 3HVAA 1PC5A 4DS5A 1WORA 4RBVA 1WF1A 1O51A 2HBYB 3W8PA 4K7QA 2VHGA 1SUQB 5F9NA 1MNEA 1DLOA 2XI2A 4TU7A 2J6UA 4UY8T 2LXUA 4B3MF 1RT6A 4LBPA 4AQYF 5KFZA 1KQSR 3DU6A 2H5IB 3GZ7A 1H38A 3GFYA 1MW7A 4P9SA 2D74B 3CIMA 3L9ZA 3PW0A 3NBPA 3BSAA 2DXFA 1WI6A 2C3MA 2I5JA 3GR0A 2U2FA 2VB6A 4Y3CA 3NLCA 1JLBB 2QT7A 3PACA 2IDLA 2QA4S 1M1HA 1M5SA 2KO1A 2XZTB 3DHWC 3TR5A 2G9OA 3LP0B 2EBEA 4ANCA 2QLWA 2V2QA 4RW4A 1S57A 4LSLA 5IS2A 5CCLA 2EG1A 5HMYA 4LR8A 5D4OA 4PYDA 1HFEL 2HKEA 1Z1ZA 3GWCA 5ETMA 1H73A 3KK3B 2N7CA 4QYRA 1SKSA 1HBOB 4OZLA 4ED5A 1SIZA 1FE4A 2BA9A 3CJTA 1VQNS 3F73A 4LF9J 2QA4G 1TL5A 1S97A 3QJLA 3G6VA 3KUHA 1RE1B 1R0BG 1NHUA 1X5TA 3OR1A 1C1CB 5KG5A 4OHXA 2FGOA 1OY9A 4TY8A 4K0KF 4RUHA 2QFIA 3ZZ0A 2ZDOA 2H4WB 2AQ4A 2N3OA 3OQ2A 1HQUB 1TL7A 3HHDA 2OPRB 3BS9A 3UCZP 2XMTA 2BV3A 4F4YA 3JYTB 1XJWB 1HHSA 3S6EA 3M2RA 3M9OB 3G86A 4OZ0A 4IH6A 4F02A
chains in the Genus database with same CATH topology
2P8IA 2NYHA 2PEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8I A;  2NYH A;  2PEB A; 
#chains in the Genus database with same CATH topology
 2HBQ B;  3NS7 B;  3M2U B;  3WQP A;  2EPI A;  3GE9 A;  1F6T A;  4L3K A;  2AGQ A;  1S9G A;  2VBY A;  3DYA A;  4O23 A;  2E7W A;  1RDR A;  2UV8 G;  4B17 A;  5DQH A;  4I2Q A;  5D0H A;  2QC3 A;  2C22 A;  1N6Q A;  1JLQ B;  3UWT A;  2HNZ A;  1HMV B;  4O3S A;  3SMZ A;  2RQK A;  3VAH A;  3DI6 B;  1C1B B;  4WK3 A;  2JFD A;  2FTR A;  1P8G A;  2CQG A;  4KO0 A;  2ZM6 F;  1B64 A;  2AGP A;  2F65 A;  2WTF A;  1RT4 A;  3DLG A;  1RBO B;  2WSC C;  4OZ5 A;  5CYQ A;  4LRE A;  4Y2K A;  1X8D A;  3CT9 A;  4OYA A;  1CJK B;  5GAD U;  4YR3 A;  1X31 C;  4NYP A;  1CVJ A;  4ZP6 A;  3M9M B;  4FPI A;  2H4Y B;  4FZV A;  4NLP A;  3W9H A;  4PG5 A;  2MXY A;  5GME A;  4M95 A;  4ECQ A;  3J81 Y;  1VJW A;  1HBU B;  3IS9 B;  2YWG A;  4WJB A;  2F63 A;  2YH0 A;  2QLF B;  2MDA A;  2ZBP A;  3KHH A;  5KT3 A;  5DG9 A;  3D67 A;  1KN6 A;  1HHT P;  3GYN A;  2Y3Y A;  4DR5 J;  1WEY A;  4IR9 A;  3MED A;  4CT8 A;  3UN2 A;  1FRH A;  3CE8 A;  2H48 B;  5LXR A;  1C0T B;  4IFY B;  1QLN A;  3D3C J;  1TV6 B;  5DLF A;  2J9D A;  3GB0 A;  1OMS A;  1ELO A;  2F5G A;  4DSJ A;  2AIR B;  2RS2 A;  5E2Q A;  4RL1 A;  3QZ7 A;  4B9L A;  3Q8P B;  2DB1 A;  2HRU A;  1RGV A;  3H5X A;  1P1L A;  2HNY A;  3P45 B;  1V3S A;  2BJE A;  4U6P A;  2J76 E;  2WW4 A;  3Q86 A;  4UST A;  1VRU B;  2W7A A;  2VFU A;  4NLX A;  3PO5 A;  2VQF F;  3LF0 A;  2XMV A;  1S1T A;  4KAI A;  1TL1 B;  2XHW A;  3CUL A;  4OYB A;  2BJD A;  5EWG A;  4K2X A;  3V81 B;  2ZVI A;  1JMT A;  4U7C A;  2QIF A;  4F0H A;  3BO4 A;  1Y10 A;  5A0Y B;  2HG4 A;  3H8Y A;  1ZZF A;  2YKQ A;  3D3B J;  2C3P A;  2IAJ B;  4IOB A;  2L08 A;  4OX6 A;  1U09 A;  2UVR A;  2MZS A;  1NPR A;  1SQF A;  3K89 A;  1TKZ A;  1VIS A;  3GV7 B;  2YNF A;  1GH8 A;  3W60 A;  2L48 A;  1WC6 A;  4QWE A;  1IVZ A;  3I5C A;  3GU0 A;  2W4C A;  2NLW A;  1E6Y A;  5C24 B;  5J2N B;  2H9Z A;  4YB6 A;  2WVF A;  3TNV A;  2W2M P;  5E3Q A;  2NYI A;  3JSR A;  2MQM A;  3AOD A;  4WKR A;  4ZP8 A;  4DHV A;  4F7V A;  5C7P A;  2MY8 A;  2VFV A;  4O0N A;  3FBF A;  1U45 A;  2VA3 A;  3MCN A;  4OLP A;  2HQG A;  4FPR A;  2I38 A;  1ZAX A;  3Q2S C;  4N7T A;  2JLG A;  1ARO P;  1RTD B;  4K2J A;  3KOA A;  1JJ4 A;  1NJX A;  4C0O C;  5M2R A;  2BKP A;  1T0T V;  2DGW A;  5HRO B;  4KYZ A;  4ZCK A;  5I4M A;  2HHS A;  1UCN A;  5C42 A;  3CB4 A;  5F8H A;  2JOQ A;  2VU5 A;  2J7W A;  2RAQ A;  1Y5N B;  4WFY A;  5B0E A;  1ZPV A;  3MEG B;  4CLU A;  4ZVH A;  1D8Y A;  1GMW D;  1D9A A;  4WFA Q;  4V19 J;  3R6G B;  1V6H A;  2VC1 A;  2HZA A;  1VC0 A;  3AJD A;  3W5X A;  3ILO A;  1GXU A;  1NK9 A;  2B6A A;  3DLK B;  3LGH A;  4KTQ A;  4C11 A;  2M52 A;  5BYS A;  1HPZ A;  2AZ1 A;  2KXH A;  1BLU A;  4Y65 A;  3M05 A;  5HMX A;  1XWL A;  5F0U A;  4USW A;  3KJF B;  2NXN A;  4DFP A;  5LSO A;  1N32 J;  3ENV A;  1LXJ A;  1LOU A;  1WDD A;  1NJZ A;  3SQG A;  3ILL A;  3R9L A;  4RNO A;  1XMO F;  2VL1 A;  3UE2 A;  4B9M A;  1M1K T;  5DS7 A;  3W61 A;  2GC8 A;  2DR9 A;  1WJ9 A;  2NRE A;  1NHV A;  3D5M A;  1T94 A;  1KRP A;  5HO4 A;  1HBM A;  4HLB A;  2IVM A;  2HMI B;  3BN4 A;  2BXJ A;  3HHL A;  5SUH A;  2F4F A;  2BJ3 A;  3ENQ A;  2WRM A;  4CI0 B;  3IN5 A;  3TA1 A;  3T5J A;  2VH7 A;  1VQ6 S;  4IFV B;  1HWU A;  3DOL B;  1GT8 A;  4IR1 A;  4WP8 A;  4CH1 A;  2XM3 A;  3IP0 A;  3PW7 A;  4ICL A;  1UMJ A;  4L74 A;  1NEE A;  1MWQ A;  4J9Q A;  4K4U A;  4AL5 A;  4BC9 A;  2E1C A;  4K4X A;  3CD5 A;  4EBE A;  1IBM J;  3EPG A;  2AJ2 A;  2KT2 A;  2R2S A;  3RAQ A;  3MGJ A;  1IXK A;  3BEG B;  3BZQ A;  2AJ4 A;  4LSZ B;  2B7C B;  4CLP A;  4ZCI A;  5GMK a;  1HQ2 A;  4OLO A;  3H0P A;  3TA0 A;  2NR0 A;  5DGA A;  1NU4 A;  3MOJ B;  3MR5 A;  4A8W A;  5T7L B;  1IUJ A;  1NZ8 A;  5IM0 A;  4F4K A;  1SC1 B;  4OYX A;  2YWE A;  3TYT A;  5J1E A;  1PIL A;  3TI0 A;  4X2B A;  1FWL A;  1F5A A;  2PC6 A;  4LF8 J;  1RLC L;  3DRR B;  4K4V A;  3KJV B;  3TAP A;  2B5J A;  4W92 B;  1WEZ A;  1YRX A;  4ZIV A;  2E7V A;  3UQS A;  1JB0 C;  3F41 A;  4NXM F;  2DNQ A;  1T05 A;  3D7S B;  4ZVS B;  3NGT A;  3W8G A;  3EWG A;  1JX4 A;  2AU0 A;  3L3C A;  4JI3 J;  4NLS A;  5GMD A;  2WK4 A;  1EIY B;  2RH3 A;  1UJ4 A;  3RW7 A;  1HNI B;  4C4W A;  5BR8 J;  1H7X A;  4TY9 A;  2CQC A;  1M5P C;  1UKU A;  3EXY A;  4CLW A;  3KG1 A;  3PTW A;  2XYG B;  4TVA B;  5BYQ A;  4KKO A;  1E6V B;  3JQM A;  3BO3 A;  3RTV A;  1UJ5 A;  3I6P A;  1FEE A;  1C0U B;  2V8H A;  2WVD A;  5G0R B;  3R97 A;  1B4S A;  2XZW A;  1NKC A;  1TK8 A;  2F7V A;  1B0V A;  1ZM4 A;  2EC2 A;  4RBU A;  5IWA F;  1OIA A;  4QCL A;  2ABY A;  3NP5 A;  4Y0F A;  1D1U A;  1GK8 A;  2GVZ B;  3C16 B;  2WB1 D;  5SZT A;  2D7S A;  3PIO Q;  4OV1 A;  5KFF A;  4QIE A;  1Q7Y T;  1WKJ A;  2LU2 A;  1QE1 B;  3NGU A;  3S8S A;  4L3N A;  4NLU A;  1KTV A;  1WAC A;  1DHM A;  3HPO A;  3D0I E;  4ID5 B;  2C2E A;  3ILJ A;  4IO9 Q;  4MIW A;  2OSQ A;  2ZD1 A;  2AJ1 A;  4P2S A;  1TUW A;  4U8Y A;  3R5A A;  4ZJL A;  4ZP9 A;  1XNR F;  4AQY J;  1UJ6 A;  5A6P A;  3H90 A;  5FLX U;  2BQU A;  2BW7 A;  2CYY A;  3H98 A;  1HW9 A;  3DOM A;  4MAK A;  2DHX A;  3GSD A;  2MLY A;  4OI2 A;  1S1W A;  3KLE A;  5F8L A;  3RAM A;  4IG3 A;  1F2G A;  1UEV A;  2R7O A;  3AA8 A;  4RKU C;  2GW8 A;  4IG0 A;  1EET A;  2V4Q A;  2Q66 A;  4NRU A;  3O44 A;  1FJG F;  1U2C A;  2FC9 A;  5IT0 A;  4RUC A;  1UFW A;  4LFA J;  4H4M A;  4OHV A;  1KLN A;  1BY9 A;  1TKD A;  1NK7 A;  1RT3 B;  1PJ5 A;  4RPF A;  2UV8 A;  2XMK A;  1PG5 B;  1CS4 A;  1RT1 B;  2K3K A;  3A8K A;  2ZOG A;  4QW9 A;  3TWZ A;  3QAU A;  2DH7 A;  3C2P A;  2OPS B;  2B4O A;  2Z57 B;  3MEC A;  1J27 A;  1M5V C;  4U8V A;  5IOL A;  2LXF A;  3OFF A;  3T1Y J;  4DF4 A;  4JBC A;  3LW5 C;  2PGC A;  1UZH A;  3BR8 A;  5KT7 A;  5B0A A;  4K0K J;  1HHQ A;  4MTP A;  1DAX A;  2ADC A;  1U1P A;  1U1L A;  1FXD A;  1SL1 A;  2IRY A;  8ATC B;  1S0O A;  4NCG A;  3NAI A;  3UD5 A;  1U48 A;  4DX6 A;  2P9E A;  1Q0N A;  4WZM A;  4ECY A;  1RLD A;  4F25 A;  3J7A N;  2EG2 A;  3MM5 A;  3EGZ A;  4W90 B;  2J6S A;  3Q24 A;  2CJY B;  4JI5 F;  1GX6 A;  1S0V A;  2Y1I A;  3WIU A;  3FJ2 A;  4LRC A;  2K3I A;  3E51 A;  3IR5 B;  2FY8 A;  1HI1 A;  3A8I A;  1WC5 A;  1TAU A;  2RE1 A;  4ZLL A;  2VA2 A;  1HWI A;  3CDA A;  1PSD A;  1JLA B;  2MKK A;  4OYI A;  1FKP B;  1PBA A;  1C1C A;  2V5H G;  4DV3 J;  2MLX A;  2KH9 A;  2JLF A;  2MGZ B;  2HLU A;  4C97 A;  3W5Z A;  1BQM A;  1UW4 A;  2DNH A;  3C46 A;  3IM8 A;  4CM0 A;  4MKB A;  2DHG A;  4PAA A;  2AYG A;  4I7F A;  2YWW A;  2Y8W A;  4PQU A;  1X4A A;  2ATC B;  1R0A B;  5HAT A;  2DGU A;  2NZC A;  4P7V A;  2B9X A;  2VOD A;  2FJA B;  3MDF A;  4DR4 J;  3K5O A;  2V8D A;  3BKF A;  5LMN F;  4HH1 A;  5GAG U;  3PJ9 A;  2UUB F;  2UUT A;  1VQ5 S;  1GAO A;  2MSS A;  3OL8 A;  3EUN A;  3BGU A;  3M2U A;  2LDY A;  1FRJ A;  4NLR A;  4CO1 A;  1IQT A;  3BH7 B;  2E5J A;  2G4B A;  3D6F B;  2ZBC A;  2V50 A;  2GVD A;  3TVZ A;  2D3U A;  3ZZP A;  2BKN A;  1YJR A;  1HI8 A;  1HMV A;  4O44 B;  1Z2Z A;  1OJ4 A;  1W2B R;  3SV3 A;  2B9E A;  1RAG B;  2BDP A;  1RT5 A;  3CCS S;  5KT5 A;  3IC1 A;  4F4W A;  4HTJ A;  2ZH2 A;  4LVN P;  2VDI A;  1CJK A;  1XN9 A;  3IR7 B;  3B78 A;  2XLI A;  3EE3 A;  3QPI A;  4FVC A;  1K73 T;  2ZC4 A;  3VAI A;  1H3D A;  2C2N A;  1V3Z A;  4I6W A;  1DTQ B;  3IAM 9;  2DPI A;  1ZH5 A;  5ETK A;  1X9W A;  1KBR A;  3P5B P;  2ROE A;  1Y00 A;  3IS9 A;  1RAI B;  2UVW A;  4WWS A;  4YP3 A;  3UN3 A;  1JLE B;  2MEW A;  2QL7 B;  4G1Q B;  5H9E J;  5DQG A;  2HIY A;  2VJU A;  1AXQ A;  1LK5 A;  3TEH B;  3KHR A;  3QT8 A;  3D1H A;  3L09 A;  1Y9O A;  4JYA J;  3IWN C;  4N77 A;  1C0T A;  1TV6 A;  3MI7 X;  4Y2A A;  1HNV A;  1SIW B;  3O8W A;  4M5D B;  4J9M A;  1GTE A;  4LJM A;  1VJQ A;  5ADZ A;  1DRZ A;  1XEZ A;  1LEO A;  2Q43 A;  4TYB A;  3AA9 A;  3MMJ A;  2V63 A;  2LU1 A;  1M5K C;  4BCA A;  4ZDN A;  3AOB A;  4DQR A;  1MN7 A;  2HRY A;  3A8E A;  2NSB A;  3NAH A;  1U47 A;  2W7P A;  2P2C B;  4JI8 J;  2W2N P;  5KFR A;  3D6T B;  3SZ2 A;  3GYX B;  2HYI B;  4V1A k;  5THW A;  1TL1 A;  3CVK A;  3V6D A;  2DRD A;  1X60 A;  3QO9 B;  4CRJ A;  3M8R A;  2VZ9 A;  4DX5 A;  4A8M P;  3LPE A;  2OML A;  4KHR A;  4JV5 F;  1B7Y B;  4NXN F;  3MFH A;  1S1X B;  1RHM B;  4ED2 A;  2JH3 A;  4EO8 A;  1WOS A;  4M5I A;  2IM0 A;  2K7J A;  1AFI A;  2BJ9 A;  1IKY B;  3MCM A;  2JL9 A;  3ICL A;  4C8M A;  2KKH A;  2IAJ A;  1RWW B;  3L7U A;  2E44 A;  3U1L A;  3EMT A;  1ZOT A;  2OUG A;  3DNC A;  4RJV A;  1N5Y B;  1X5P A;  3NOG A;  3I0R A;  3VAK A;  1M1G A;  3WBZ A;  2MQQ A;  5K8O A;  4NPO A;  1PGZ A;  4MFB B;  1LKZ A;  2WON A;  5C24 A;  5B0G A;  3GJS B;  5J2N A;  1KTQ A;  1SC4 B;  4LRA A;  3R7S B;  1JLF B;  2DR7 A;  5E5N A;  4B3R J;  3HVT A;  3K8W A;  2LQ9 A;  2HS4 A;  4F3Q A;  3FRY A;  2CPZ A;  2ILZ A;  2A3J A;  1WSR A;  4NZ0 A;  1FNM A;  2CQ1 A;  1PYO B;  4O3O A;  3QT6 A;  4UQT A;  4DU7 A;  2VOO A;  4OZ2 A;  1NSA A;  1RTD A;  2P9G A;  1XMO J;  3UFC X;  1DTT B;  4EEY A;  4JB8 B;  4J9N A;  2RQ4 A;  5EX0 A;  4OFZ A;  4RW8 A;  2HVH A;  2PA3 A;  8RUC A;  2ZOM A;  3CJK B;  2BEF A;  5LL6 d;  5D78 A;  3V6H A;  4KGK A;  3KLI B;  1JKH B;  4GVB A;  2XY5 A;  4B3S J;  2V8P A;  3G6E S;  2OSR A;  1BC6 A;  2R8I A;  1TUV A;  5KFI A;  4Q7A A;  1N4L A;  3H7H B;  3TRG A;  3E01 A;  2YNI B;  1W7W A;  3Q22 A;  1U1M A;  3KK2 B;  1WC3 A;  1FRI A;  2RRA A;  3IWX A;  2YX4 A;  5FDL B;  2DXD A;  1U49 A;  2XSJ A;  1H2V Z;  4U95 A;  2PEB A;  4Y00 A;  3FC9 A;  3AH6 A;  3VZH A;  2GNK A;  2BR0 A;  3KMQ A;  1FNO A;  4FF2 A;  4LF4 F;  2ZUA A;  2FQQ B;  2PII A;  1JJH A;  3D54 A;  4DV6 F;  4DU8 A;  1X0P A;  2MST A;  4EYH B;  5LT5 A;  4HHH A;  5E0O A;  2M3D A;  2LEP A;  1R0C B;  3TZW A;  3FKB A;  4UZB A;  3KYL A;  4OX8 A;  2QN6 B;  1F9E B;  4HL9 A;  1K0T A;  2OHD A;  1NUE A;  4WYL A;  4U9R A;  3CCQ S;  3PO4 A;  1XNQ F;  4IFV A;  2CJK A;  4JI2 F;  4ZPD A;  4ECR A;  1U8S A;  3MEK A;  4XAK A;  2HK3 A;  3HVW A;  1S48 A;  2JEG A;  5LJ5 Y;  3KUE A;  1IBK F;  3EGW B;  2IBK A;  1KQK A;  2DRB A;  1RU2 A;  3V5R A;  1KVJ A;  2VIH A;  2FPH X;  3OTE A;  2ZZT A;  3H5Y A;  5FJ4 A;  3OTO F;  2HFV A;  2FLN A;  5I3U B;  4A8O A;  3EVW A;  4USV A;  2BQ3 A;  3PW4 A;  1FKO B;  3EVO A;  2BKO A;  2FVP A;  2ASJ A;  2J0Q D;  4BWJ A;  1NBE B;  3QLH B;  1ULR A;  4AXJ A;  5E3A A;  4LF7 F;  1Q16 B;  3FMW A;  2IYG A;  3DMJ B;  4Y2I A;  4OV6 A;  3CDW A;  4YY3 F;  3LGM A;  2M8D B;  3FSY A;  3IO1 A;  2KVI A;  4NCB A;  1IKW B;  4AUK A;  4CH0 S;  4CLT A;  1P6T A;  3CCV S;  3SCI E;  2VPY B;  2W8L A;  2VFS A;  2SXL A;  4FYX B;  2K8G A;  2MTL A;  3KJV A;  3GG1 A;  1VQY A;  5HJY A;  5KFE A;  5DET A;  5IWA J;  2VBX A;  3H40 A;  4ZPW R;  3ULH A;  5B08 A;  2RVJ A;  3BDE A;  3SIP B;  2G0J A;  3QQC D;  1KON A;  3CCT A;  1G2E A;  1EAY C;  2ZJP Q;  1YQH A;  1UFK A;  3IM9 A;  2FLO A;  5D0R A;  5E3R A;  4E98 A;  2GV1 A;  5K14 A;  5E41 A;  4J9R A;  4WTO B;  1WC4 A;  1N33 F;  1KHV A;  2ZDP A;  1RHK B;  1VK8 A;  3RRH A;  2RKI B;  4J9S A;  3FZB A;  4Q0B B;  3SFU A;  2UXC J;  4X4T A;  1ITP A;  1AT1 B;  4K5R A;  4F2R A;  1FES A;  3ISZ A;  3TUP A;  5G0R A;  3LH2 S;  2QYC A;  4YEA A;  5EDW A;  1TP7 A;  3QMQ A;  4S0M A;  2R3V A;  1AUS L;  2EI5 A;  3GIL A;  2ROP A;  4RW6 A;  3NGD A;  2FY1 A;  2M9K A;  3HSZ A;  1Z4U A;  3TZZ A;  2CJB A;  4C3K A;  2HGL A;  2IIH A;  4DSI A;  4QW8 A;  4C6A A;  1TKT A;  2WBR A;  3MMA A;  3M8W A;  1LFP A;  2K2P A;  4NLW A;  2MKI A;  1LW0 A;  1JXV A;  3UDL A;  4P75 A;  1KWM A;  3PR5 B;  4MIB A;  3LUY A;  4WXW A;  2HND B;  4W4M A;  1KD1 T;  4B9T A;  1FK9 A;  3JTO A;  3EYZ A;  4OJG A;  3C6T B;  5HBM A;  3BPD A;  2QO3 A;  2OPQ B;  4JOU A;  3CCL S;  2RNE A;  3NY0 A;  4ELT A;  4CIO A;  4C8O A;  3SYZ A;  3OLA A;  2YPY A;  4TYA A;  4N76 A;  4TLQ A;  1XC9 A;  2AMC B;  2CIM A;  3CDE A;  4KC5 A;  4K8R A;  3BYR A;  2LA4 A;  1HD0 A;  3K0J A;  3DDN A;  4CNY A;  2HQI A;  1NJI T;  1JJ2 R;  4AFF A;  3C19 A;  4YB1 P;  2MHN A;  3ILI A;  1QAJ A;  2DK2 A;  1WWH A;  1G6B A;  4DV5 F;  3MUT P;  3ONQ A;  3N4W A;  3SCJ E;  3C6U B;  1DLO B;  3FSX A;  1RT1 A;  1V5I B;  1RT6 B;  4JI5 J;  1RT7 A;  3LOU A;  3HHE A;  3CWJ A;  4OJH A;  5GAG I;  4KQZ A;  4X4U A;  4DV1 F;  3E2E A;  2OPS A;  2VKZ G;  4YB7 A;  5KFD A;  2FHJ A;  2W9C A;  3NBP B;  4IRC A;  4AL6 A;  2I5J B;  2LCW A;  1X4E A;  3AD9 C;  1HA1 A;  1AZS A;  3LP1 A;  3MAH A;  4EZ6 A;  3ZTP A;  3IG1 A;  4F3M A;  1OQ3 A;  4ZCL A;  3H4B A;  3KLV A;  1GEH A;  1FTC A;  4RW4 B;  4LSL B;  3H42 A;  3TAM B;  1NZA A;  2HWT A;  1WOO A;  1VQK S;  3NKY A;  3NCQ A;  5LMN J;  1YJW S;  2UUB J;  1X5S A;  4ZVQ B;  2W7O A;  4LBH A;  1TVR A;  4GC6 A;  1U1K A;  3W1Y C;  1KS2 A;  1VR6 A;  1GMV A;  2XLJ A;  4WU3 A;  3M32 B;  4PQA A;  2M5Y A;  4NEY A;  3OR2 A;  2ZJQ Q;  3NGK A;  2CAD A;  2PDA A;  4YUD A;  1RP5 A;  4NA1 A;  5F0W A;  2HAI A;  3FQK A;  1FKP A;  1UL3 A;  2ZNY A;  3OR1 B;  1NK4 A;  3ISN D;  2R8J A;  5M2P A;  2GML A;  3DRX A;  4QU7 A;  2YKP A;  5ETL A;  3VAL A;  4JI6 J;  2EW9 A;  4TY8 B;  2E5H A;  2ZWP A;  5F8G A;  5C25 A;  4QYZ K;  2L9N A;  5J1P A;  3AB4 B;  4FN5 A;  2A0F B;  2CA9 A;  2FD2 A;  4A47 A;  1TZ0 A;  1RXO B;  3PKY A;  1AB8 A;  5A8R A;  4Q8F A;  4ES3 A;  1VQP S;  4CLS A;  4FF1 A;  2K7K A;  4DF8 A;  1P1T A;  4I6Y A;  2HHH J;  4ZVP B;  1LV5 A;  3PKM A;  1SXL A;  2C2K B;  4YR0 A;  4X62 J;  3M2R B;  2Z2L A;  2Q3P A;  4K50 A;  2DVI A;  1SBR A;  3AHP A;  3MAQ A;  1S4E A;  4LF9 F;  2UUW A;  3HLU A;  4X66 F;  1U8W A;  4OJ3 A;  1SL2 A;  2C2R A;  2WOM A;  1Q5Y A;  4KHP J;  1S9G B;  4DR2 F;  1XMQ F;  2CQI A;  1JIH A;  4O44 A;  1X4D A;  2QL5 B;  2HNZ B;  2LFV A;  4DXL A;  2R8H A;  3QGP A;  1UZD A;  2Z2Z A;  4IDK A;  2EFO A;  1DQ8 A;  3J80 Y;  2CQ4 A;  5L1L A;  3GII A;  3HO1 A;  3BR9 A;  4HI1 A;  4KO0 B;  4OYZ A;  2IHR 1;  3RUB L;  3LWM A;  1RT4 B;  1Q82 T;  1H2U X;  2ALZ A;  4OZ3 A;  3PRV A;  5HK4 A;  4ECW A;  2FZG B;  3WIV A;  1SQG A;  3GFZ A;  4ETX A;  1F3F A;  3C15 B;  4EGL A;  3MMB B;  4URG A;  2QTW A;  1HNZ J;  4NEZ A;  3R8Y A;  2OJ3 A;  1JLE A;  3D1O A;  1FJE B;  4G1Q A;  2UVV A;  3GLJ A;  1U0H A;  3BBB A;  3CIZ A;  4JV5 J;  1UFL A;  4USK A;  3H20 A;  1WNE A;  4RUB A;  3KLH A;  3U1M A;  2RSQ A;  3CD7 A;  2CQ3 A;  2H5J B;  1S6O A;  1EKS A;  2OMO A;  3T41 A;  4LT6 A;  2NXJ A;  4M5D A;  4A48 A;  1RB0 A;  3W9I A;  3VGS A;  4ZS6 A;  3VTI A;  2YTC A;  1RWP B;  1N0V C;  2CPY A;  3NMA A;  2EKN A;  2H5E A;  2XMU A;  3DC2 A;  1FDN A;  2HNY B;  3H2U B;  2XQC A;  3DKD A;  1CLF A;  2M4M A;  2R42 A;  1U25 A;  1HWJ A;  3P96 A;  3QO9 A;  4LBI A;  4F8R A;  4PWW A;  2LVW A;  1RAB B;  1S1T B;  4R5P A;  2MYF A;  4C48 A;  4QOT A;  3BB5 A;  3JQJ A;  1LWC A;  3BO2 A;  4ZN3 A;  4K4W A;  1S4F A;  1FDD A;  2RU9 A;  4FKY A;  2GAH C;  5GAE U;  4X4Q A;  2R2U A;  2MKJ A;  5E33 A;  2DO4 A;  1YX2 A;  2QG9 B;  4WCE Q;  5IZH A;  3H5U A;  2E5I A;  5A8K B;  4M1K A;  2GMH A;  2PA8 D;  4OI6 A;  3CDB A;  4UOC A;  1TKZ B;  2G13 A;  4DL4 A;  2XHC A;  3UCG A;  4PR6 A;  1OY6 A;  5LXY A;  5CQG A;  1AUD A;  2LQJ A;  1S6P B;  4EI2 A;  5AE2 A;  1GXL A;  2X3D A;  4MFB A;  4DFM A;  3MOZ A;  1Y4Z B;  2Y1J A;  1E6Y B;  1NK8 A;  2ACM A;  3UNG C;  4AT1 B;  1NDC A;  1CQN A;  4YDD B;  1ZM2 A;  1S12 A;  1WHX A;  5KG6 A;  3Q8Q B;  3ENA A;  3C66 A;  2KYZ A;  3P49 B;  1VHI A;  1X4F A;  1OSD A;  2O01 C;  5DRK A;  4YOE A;  2AJQ A;  3NRB A;  3BM7 A;  5KG1 A;  1KVI A;  3PEJ A;  1LNQ A;  4CO0 A;  3I5B A;  4MKV A;  5L1I A;  1C4C A;  1PJ6 A;  4LF4 J;  4A8X A;  4DX8 H;  1RTJ A;  1Q78 A;  4M5G A;  3R5G A;  1YWX A;  3B6B A;  4DV6 J;  3BPS P;  1D0E A;  5KG7 A;  4O0I A;  3OFG A;  4BHQ A;  2OD4 A;  2R8G A;  2VG5 A;  1Z2L A;  3KDN A;  2KFZ A;  3OL6 A;  1FHT A;  4MK9 A;  2XZD B;  3IBW A;  4P2M A;  2V34 A;  1NB7 A;  4DUZ F;  4A8K A;  1SCJ B;  4TQR A;  3HI9 A;  2BYC A;  4DBQ A;  1XNQ J;  3SFG A;  4CTA A;  4JI2 J;  2YNI A;  2B6A B;  4J9K A;  1H72 C;  2B8Q A;  4C11 B;  5GVQ A;  3FCV A;  1HPZ B;  1F5B A;  1DAR A;  3V4I B;  2EVZ A;  3MR6 A;  3SV4 A;  5ETP A;  4PG6 A;  2E9T A;  3TZX A;  2OEJ A;  4KPY A;  3PV8 A;  1TQL A;  2VF3 A;  1GFW B;  4DPW A;  3R6L B;  2X51 A;  2J0W A;  5KFA A;  2O1P A;  4X4V A;  4DV7 F;  1YJ7 A;  1RKJ A;  3HJF A;  1RA7 A;  1NDP A;  3G4S S;  4OI1 A;  4LQ3 A;  3ITH B;  1YKW A;  4DDF A;  3NS6 A;  4LF7 J;  5D4N A;  4CH7 A;  3EZ5 A;  1HBM B;  1EQ0 A;  4IYQ A;  5CYJ A;  2V2Z A;  3HHL B;  1REV A;  3N6N A;  3S7R A;  3UDV A;  4YY3 J;  3BV8 A;  1APS A;  5B09 A;  3KFW X;  5AT1 B;  1D09 B;  1W25 A;  1F60 B;  3S1T A;  2VC0 A;  2HBZ B;  4QIW D;  2CJA A;  4ICL B;  4DLG A;  3IRX A;  2BZ2 A;  3GSI A;  2BE9 B;  1QVG R;  1N32 F;  5I3U A;  4USU A;  1UPP A;  3OFE A;  5JJB A;  1K47 A;  4CP5 A;  1NK0 A;  1MMD A;  2HS3 A;  4ZVR B;  1U6F A;  4J37 A;  4WP9 A;  4C8Z A;  1KOH A;  2I8E A;  4PUO A;  4ZLJ A;  1A6L A;  4HH0 A;  4NLG A;  3HCX A;  1S99 A;  4RW9 A;  3DMJ A;  5LM7 E;  4BS2 A;  4ECX A;  4AL7 A;  3US5 A;  3A1Y G;  3BQ0 A;  1IKW A;  3BSO A;  4C8Y A;  5IM0 B;  5J1E B;  3FDS A;  1TK5 A;  4JV2 A;  3M8Q A;  3T5H A;  5RUB A;  3R27 A;  1S6U A;  1AA1 B;  5HL7 Q;  1TEL A;  2YNG A;  3QT5 A;  1RWM B;  4DR3 F;  2GQQ A;  3TJ9 A;  4IQX A;  2J0X A;  2A18 A;  3HHN B;  4P71 A;  1T05 B;  3WDO A;  2PMH A;  1CUL A;  1ZTW A;  1H2T Z;  1FT8 A;  2KHC A;  1U4B A;  1TL4 A;  2F8M A;  3QGI A;  1T9Y A;  3K5M A;  2BM0 A;  4FS1 A;  1JXE A;  2DPJ A;  2DYA A;  4CLK A;  3CNQ P;  3W9J A;  2GJI A;  1Y3K A;  4KKO B;  4HDH A;  4USM A;  3OSN A;  2MZQ A;  2MB0 B;  3SDE A;  3R5B A;  2DGQ A;  4OI4 A;  4OYO A;  4CLF A;  3MPD A;  5D3G A;  3MEE B;  3SXL A;  1YBT A;  2GAG C;  3G71 S;  2ZKU A;  2OEK A;  3FZ2 A;  3L95 X;  2OH2 A;  1WSV A;  3T3F A;  2LQB A;  3U02 A;  1SKR A;  1FF2 A;  1LWE B;  4Q2M A;  2I1R A;  4OZN A;  4GO5 X;  1VC5 A;  4JI0 F;  1R27 B;  3PXG a;  3ZZZ A;  4PRF A;  2HHU A;  3GCW P;  2DH9 A;  5F8N A;  4JI3 F;  2RHQ B;  4RWW A;  4C8K A;  1QUV A;  2W25 A;  3EPI A;  4M5M A;  2WSF C;  2IM2 A;  4DV5 J;  4OHW A;  5BR8 F;  3OL7 A;  3CCZ A;  1RTH A;  2ZD1 B;  1B0P A;  4HAC A;  2XY7 A;  2J5A A;  4KT0 C;  2Q6B A;  2J7K A;  4CO5 A;  5HSP A;  3S01 A;  4B9N A;  1CBK A;  4TU8 A;  3LQV A;  5DM7 Q;  1WUU A;  3C8Y A;  3MR2 A;  2JFK A;  1N5S A;  4KV8 A;  2FJW A;  3GIK A;  1VBX A;  3UD4 P;  1DQ9 A;  2F9D A;  2IJF A;  3DOM B;  2GGP B;  2DNM A;  4PCQ A;  3MPU B;  2GJF A;  3R5J B;  5GAH I;  5CD4 H;  2ZE2 A;  2ZVS A;  3OVB A;  3QWP A;  4IG3 B;  4NRT A;  3MM6 A;  5KFU A;  3UDC A;  4ED6 A;  1YZ7 A;  4IG0 B;  4CNZ A;  4B3T J;  1EET B;  4J9O A;  5DZ7 A;  1XER A;  1VI7 A;  4ED1 A;  4QWA A;  4WTY A;  3AAW B;  3PG9 A;  1TFY A;  4B9U A;  1OS5 A;  5B7W A;  2WZ1 A;  2I6W A;  2AGO A;  3MPV A;  4H4M B;  3QIP A;  2EFV A;  2DGV A;  3C6U A;  4USJ C;  3DLL Q;  2AKW B;  4Y2C A;  2KI2 A;  1CS4 B;  1VQ4 S;  2OEM A;  1UA0 A;  1NO8 A;  3PJX A;  2HVZ A;  1WC0 A;  1R8C A;  3T19 A;  2C2M B;  2IY5 B;  2M88 A;  3W2W B;  4ZP7 A;  2V8G A;  5A8W A;  3MEC B;  2ZJR Q;  1L3U A;  2CWK A;  5KFT A;  8AT1 B;  5L46 A;  4M5N A;  4D3G A;  1U26 A;  5K5M A;  2O3D A;  5J2P A;  2KZM A;  4DG1 A;  2M8H A;  5IC4 B;  2ZUG A;  3PX4 A;  3ENW A;  4LFA F;  3RZA A;  3IFE A;  4NCG B;  1VS3 A;  1KHW A;  3TAM A;  4DR6 J;  3D66 A;  5KG3 A;  5HQL A;  2DEI A;  4PXC A;  3N5B A;  3TX0 A;  5CCM A;  4Q2L A;  2HSE B;  3MM5 B;  2XY6 A;  2HW3 A;  2G1H A;  3CC7 S;  3PFE A;  4PEO A;  1SL0 A;  5HVH A;  2FVR A;  1NSP A;  3M32 A;  4HYK A;  4J91 A;  1JXL A;  1S1V B;  3IRW P;  5AE1 A;  4X66 J;  5HMZ A;  2KB2 A;  1XR6 A;  1GXT A;  1GMU A;  1RSC A;  3T1Y F;  4DR2 J;  4LFB F;  1XMQ J;  3MM9 A;  1MU2 A;  2XMM A;  1BQM B;  2CPI A;  3QAT A;  2F3J A;  4I7F B;  1AYE A;  3NXZ A;  4PQU B;  3P8B B;  2DHH A;  4IQM A;  2HZV A;  4DL2 A;  1NKB A;  2HUR A;  4QPX A;  3UD3 P;  2U1A A;  3AFG A;  2E66 A;  2H65 B;  3AJ2 A;  2IFX A;  2XGQ A;  3T5K A;  1PKU A;  4NE9 C;  6AT1 B;  1PC4 A;  3OTD A;  1NM2 A;  4EWT A;  1VRQ C;  3PX0 A;  1FWK A;  3FEX B;  4DOZ A;  3M1V A;  4F26 A;  3C3L A;  1UPM B;  1YSJ A;  2GVD B;  3K5L A;  4DUT A;  3CMQ A;  1L5U A;  4DV3 F;  2Y0B B;  1VCT A;  2BQR A;  3V2U C;  4PWU A;  1FRK A;  1HR0 F;  1X0F A;  2E9Z A;  2RD5 C;  1NK5 A;  4TLR A;  1VLO A;  1R43 A;  3CSK A;  3GCX P;  1AW0 A;  3CCW A;  1JJC B;  4ES2 A;  1VBZ A;  4KBI A;  4OL8 A;  1RBA A;  1EZZ B;  5GAE I;  1RT5 B;  4NYZ A;  2DGS A;  3VWS A;  1V5V A;  2BJ1 A;  3M6U A;  1NSK L;  2MZ1 A;  3FFI A;  1I5O B;  4DR4 F;  3DCA A;  3W2V A;  2M70 A;  2IM3 A;  4C0B A;  3C15 A;  3MMB A;  1URN A;  3OHA A;  3UI3 A;  2CFX A;  2VFR A;  1BUX A;  1RWX B;  3D28 A;  5L38 A;  2W9B B;  1HNX F;  2OO4 A;  2CNN B;  2VON A;  2QEX S;  5B0F A;  2UUC F;  2JEI A;  1MN9 A;  5ETV A;  1BQN A;  3AQO A;  2DD8 S;  2DNG A;  1LWX A;  4XPC A;  3NNA A;  4ZHR A;  4PKD B;  2X3G A;  3BH6 B;  2ZHB A;  3ZTS A;  2DNO A;  2UUA F;  2CKW A;  1HNV B;  1T9X A;  2QMU B;  3VVU A;  5HAO A;  2IA0 A;  3FCH A;  3X1L B;  2BOA A;  3IA0 A;  1YBU A;  4DV2 J;  3GIR A;  1S9E B;  4Z37 A;  5AE3 A;  4O4G A;  2OD6 A;  3LAL A;  4YDX A;  2WHO A;  4DR7 F;  3RG6 A;  3OPK A;  4RBT A;  4Y34 A;  3O6Q A;  3K58 A;  2L3M A;  2X1G A;  1IR1 A;  4I0W A;  2MKH A;  3NNC A;  3V6D B;  4LR7 A;  3W3S A;  1Y7P A;  5L9X A;  3BSN A;  4Q5V A;  1A0O B;  2ZHA A;  1KR4 A;  1FER A;  2B43 A;  3ZZO A;  2OAU A;  4JYA F;  3I31 A;  4ILL A;  2F8E X;  4IRD A;  2Y9H A;  1J5E F;  4FYY B;  2VFT A;  3MUR P;  3EJM A;  3G82 B;  5A8K A;  5HVF A;  2PI4 A;  3DLH A;  4C98 A;  3JXO A;  5KOW A;  1RAF B;  2DCL A;  4AND A;  3K5N A;  2Z0G A;  3HSD A;  1IKV A;  3D6M B;  3MD1 A;  3NWR A;  4I1T A;  1WD6 A;  2CQ0 A;  3P4U B;  1QJH A;  4MJK A;  4JI8 F;  3FNN A;  3NMR A;  3I0R B;  4G1I A;  1S6P A;  1RA6 A;  4H4O A;  3OT9 A;  4CDI A;  4WXO A;  5FII A;  1UWA A;  3T1H F;  2WON B;  5EWE A;  2DY1 A;  3M6X A;  2KL8 A;  2ZZM A;  4DUZ J;  3WC0 A;  3HVT B;  5KT4 A;  2WAQ D;  1ROF A;  3P6Y C;  1RAD B;  2QJ3 A;  3HDS A;  3Q23 A;  1QTM A;  5EN1 A;  2B4U A;  2FLL A;  5B0C A;  2OLW A;  4CM2 A;  3POT A;  1NME B;  4OX7 A;  4X4N A;  4MK7 A;  2I9S A;  4PPD A;  1CQM A;  3M30 A;  4DV7 J;  3KLG A;  1UVK A;  1TL3 A;  2HEK A;  1SQE A;  4ECU A;  2KM8 C;  3UNY A;  1TMM A;  4RW8 B;  4HR2 A;  3G9C A;  3OSP A;  3GR1 A;  4RU2 A;  4I2P A;  3T6J A;  1UET A;  3MUM P;  2BUN A;  1RTI B;  4B3R F;  4GVB B;  3DRY A;  2H3E B;  3MM8 B;  2JLE A;  4FXD A;  1K1S A;  1NK6 A;  4UOG A;  4N8N A;  2JEJ A;  2LEC A;  1YVF A;  3E01 B;  3AXM A;  2MKC A;  2E9R X;  2FDN A;  3V4I A;  5HAN A;  4ANE A;  3LAM A;  2VOP A;  4C2M A;  1YRU A;  5ETS A;  4HVZ A;  3JQK A;  1VQS A;  3MCS A;  3GV8 B;  2XSJ B;  2CAJ A;  2XGP A;  4WFB Q;  3TUI C;  2Z8Q A;  4ED0 A;  4DL5 A;  1LWF A;  2FHO B;  2JZ5 A;  2D9P A;  5D0E A;  3J81 j;  4R8U B;  1FRL A;  2CPF A;  2CNL B;  3ITH A;  2XMA A;  5F3Z A;  4HHJ A;  1N88 A;  2DNY A;  2KU7 A;  3H2L A;  5J1N A;  1FRM A;  4LFC F;  4GKK J;  1X5O A;  2P5V A;  4B3S F;  1LW2 A;  1WKK A;  2V0N A;  2ALY B;  2KXF A;  2RU3 A;  2GIR A;  4MYT A;  5U47 A;  4CO4 A;  3PY8 A;  4DR3 J;  4KGV B;  5KFK A;  1O6X A;  1YJ9 S;  3HKW A;  3AQP A;  2K1R A;  5JVG Q;  4WIQ A;  2MKY A;  2HIQ A;  2VJV A;  3AY0 A;  4ZKA A;  3RBD A;  4AD6 A;  4WU2 A;  3DFE A;  3VCD A;  3IGN A;  1JLG A;  4MK8 A;  1MRO B;  5L1J A;  1VQM S;  1LXN A;  4R25 A;  3KG4 A;  4O3P A;  4C3L A;  3UPF A;  4ZJQ A;  2ROG A;  4R0E A;  1T9W A;  1KFD A;  3EVM A;  2E1A A;  3QJP A;  5K20 B;  1S10 A;  3Q0A A;  1B70 B;  5HLF A;  4ZLN A;  1H0H B;  1M0S A;  2IJN A;  4ZPT R;  1L3T A;  1C4A A;  3QNW B;  4A8F A;  1GQE A;  1YK9 A;  4LRB A;  4JI0 J;  4QIF A;  2LYV A;  3CUN A;  4Q44 A;  5F41 A;  5DLG A;  4PWD A;  5I42 B;  2GS8 A;  2HRT A;  3CME S;  1EAR A;  5IT4 A;  5K14 B;  2OPP A;  3OTC A;  1K0V A;  3T5L A;  2F8H A;  1TUG B;  2MJU A;  1YJN S;  2WVB A;  3MM7 B;  5T41 A;  2AEM A;  1V9O A;  1BGX T;  2J9C A;  2Q1L A;  3GQC A;  1SJ1 A;  1HIY A;  3O2I A;  3ISN C;  3BN7 A;  4I69 A;  2ZFH A;  4YQW A;  1X7V A;  3N6M A;  3MEE A;  1LQ9 A;  2G2Z A;  5HP1 A;  1FNX H;  4HEA 9;  3N5F A;  5DDP C;  1D9D A;  1LFW A;  2JX2 A;  2J6T A;  4ZA1 A;  4C7Q A;  2GZO A;  4RW6 B;  5D0G A;  4LF6 J;  1Q8K A;  3MF5 A;  4N56 A;  1LWE A;  3ET6 A;  3R7B B;  1TKT B;  3I4H X;  3MMA B;  2QL9 B;  4DCJ B;  3MTK A;  2ACY A;  5F9L A;  1LW0 B;  3OL9 A;  4QR2 A;  2FJE B;  4FS2 A;  5D15 A;  2O5D A;  3BSC A;  4IRK A;  2R9L A;  2QLB B;  2YWK A;  4DCP B;  5A2Q U;  1UVL A;  4UW2 A;  3CJS A;  4F4Z A;  2LKZ A;  3NS5 A;  4GKJ J;  1CJT B;  1BXN A;  3KHG A;  1FK9 B;  2UXC F;  2AD9 A;  2UU9 J;  3HFZ B;  4WF9 Q;  5HBM B;  2YKM A;  1R3N A;  3QRQ A;  4PG8 A;  2M0G B;  5L9N A;  4FYW B;  2B56 A;  4DS4 A;  2RIJ A;  4QWD A;  2GGP A;  1YIJ S;  4H4K C;  1T7P A;  1Q95 G;  2P8I A;  1T3N A;  2C1E B;  2XNQ A;  4OMF G;  1U1R A;  2KT5 A;  2OKQ A;  2BOP A;  1N34 F;  4U7U K;  1OPI A;  1FX2 A;  1L3S A;  1N8R T;  5FD1 A;  2V68 A;  1Q8I A;  2EFQ A;  2JRS A;  2A6O A;  3VGU A;  2YY3 A;  5CAA A;  3RYL A;  2FGC A;  1YJU A;  3TQE A;  1VHF A;  4B08 A;  2V2K A;  2DIU A;  3T9Z A;  4P74 A;  4NZ7 A;  4I68 A;  4CO2 A;  2QSF A;  1UEU A;  4DUY J;  3PZP A;  3DOK A;  4ZVG A;  2J8S A;  1RT7 B;  2R7R A;  1KFS A;  4ELU A;  1JNR B;  2YBV A;  4YME A;  3MFI A;  2VUG A;  4K5S A;  4V19 X;  3W2W A;  3Q8R B;  1S7I A;  3FEZ A;  4PXB A;  3KDO A;  3ZZT A;  1J5O A;  1NLK L;  2W9C B;  4UT4 A;  2RUS A;  4LFB J;  1AZS B;  3LTO A;  3LP1 B;  3CJ4 A;  2A2D A;  4AXI A;  2V6A A;  2GIQ A;  2XUL A;  3D1Q A;  3IG1 B;  2GO8 A;  5BXI A;  3DGP B;  2VPZ B;  2XO6 A;  1B3T A;  3IBF B;  4OI3 A;  2KJV A;  1OQ6 A;  3UO0 A;  2XWX A;  3MCO A;  4P52 A;  4RZR A;  5I3Q A;  2B3T B;  2DO0 A;  3D68 A;  5IV3 A;  4DV4 F;  5DJB A;  2W2P P;  2AJ0 A;  1TVR B;  3IBC B;  3UN5 A;  4K4T A;  1S1V A;  3OR2 B;  1T11 A;  1VFJ A;  3PDN A;  4CLY A;  2XTJ P;  2OGU A;  1FTR A;  2ASL A;  2QX0 A;  4J7C A;  3X3U A;  1HR0 J;  4XO0 A;  3MPW A;  2IC3 A;  4LR9 A;  3AOC A;  4Q43 A;  4C0H A;  3VF0 B;  5C25 B;  2J7U A;  3UDE A;  4JV1 A;  5F8J A;  1FWP A;  3FBE A;  2HVD A;  3GJQ B;  4B02 A;  1RT2 A;  2RML A;  1Q8B A;  1RWU A;  1IR2 A;  4WP3 A;  5A8R B;  4ZK7 M;  4EFA C;  5KG0 A;  2RQC A;  2DNZ A;  3E8O A;  5FLX Y;  2CZ9 A;  3CJR A;  4HT5 A;  1HQE A;  3A3N B;  3ZZR A;  1SV5 A;  3QGH A;  1NJW A;  2MQN A;  4WE1 A;  3TJ8 A;  2HVI A;  3A8J A;  4USH A;  1HNX J;  2GIF A;  1TMJ A;  1CEZ A;  2WOM B;  2EFP A;  4DL7 A;  2UUC J;  4ITS A;  3ZTO A;  3J81 U;  5ITH A;  2AHO B;  1FA0 A;  4JI6 F;  5AXK A;  2AZ3 A;  2VQE F;  2EBG A;  2BAN B;  4XK8 C;  1SH3 A;  4IDK B;  5D6G A;  2UUA J;  3K2Y A;  2ZKT A;  4QYZ J;  2D41 A;  3IXQ A;  1OO0 B;  3JSM B;  3N6L A;  2KRR A;  1X4B A;  3RB0 A;  3VR1 A;  3AB2 B;  1S79 A;  3G8Q A;  2OFG X;  3LA0 A;  1YI2 S;  2HHH F;  3TOQ A;  5CAB A;  2YKN B;  4BLG A;  4X62 F;  7FDR A;  4A8Y A;  4DR7 J;  4WBF A;  2ILY A;  3QSI A;  3MR3 A;  1JK9 B;  5KT2 A;  2W9B A;  2VG7 B;  3TZY A;  3LP2 A;  2HHT A;  4L73 A;  4KHP F;  1U0H B;  2AT1 B;  3BDP A;  1RWV B;  3WC2 A;  2BRL A;  5CH7 B;  1RTZ A;  4MMO A;  4KFB B;  2CQB A;  3KLH B;  2DHA A;  4DSF A;  3DLJ A;  1J5E J;  1WG4 A;  3W7B A;  1FRX A;  1FJ7 A;  3DLE A;  4A8Q A;  1WF0 A;  5D8H B;  4LSN B;  1HI0 P;  1T8E A;  1YRT A;  4FVM A;  1DZ5 A;  4JI7 F;  3W65 A;  5KTQ A;  2NXE A;  3CD6 S;  5IT9 Y;  1YDL A;  1S9E A;  2RUG A;  1FE0 A;  1JQG A;  4ZPC A;  2DR5 A;  4ZOS A;  4LVO P;  1XK8 A;  4ZVT B;  1HNZ F;  2CJQ A;  3J7Z T;  4X65 J;  2HQD A;  4C8N A;  2FHJ D;  2QRR A;  1ZS6 A;  2D3O R;  3CGI A;  5ETN A;  2WB4 A;  2CQP A;  5J2M A;  3T1H J;  2JWN A;  4R5P B;  3OXL A;  4ECS A;  2FIU A;  2CPX A;  1LWC B;  4UOH A;  1D9F A;  3GG0 A;  4ZPV R;  4ZMM A;  2N3L A;  3TEG A;  5G4D A;  2BE2 A;  2DEJ A;  2XMJ A;  2AYB A;  3G82 A;  2F1F A;  5DG8 A;  5H9F J;  4DZD A;  4RW7 B;  5AXN A;  1UWB A;  4XDD A;  4FXW A;  3AOA A;  2MQL A;  3KNG A;  5IQQ A;  4DEZ A;  4C8L A;  5KFO A;  1UVI A;  1HYS B;  3H4D A;  4ZVE A;  3DDK A;  5E3C A;  1S5Z A;  1QM9 A;  5EX3 A;  1WG1 A;  1ZAV A;  5BYR A;  4F0M A;  4DV0 F;  2KRB A;  4XTT A;  1RCX B;  1GX5 A;  4UUX A;  4EO6 A;  3ZXW A;  2ERR A;  3R2D J;  2KZZ A;  5KFV A;  3HHK A;  1P9Q C;  1SB6 A;  1JLC B;  1IR0 A;  3ZNJ 1;  1QSL A;  5LOQ A;  3OW2 R;  3QJJ A;  1M5O C;  1IBL J;  3DM2 A;  1K1Q A;  1O0P A;  1SVD A;  1DBD A;  2QLJ B;  2LDI A;  2UXB J;  3KG0 A;  3LWL A;  3FMB A;  4FNH A;  4F3O A;  4UY8 5;  3FUY A;  2UXD J;  1SKW A;  3MAA A;  3RBX A;  1BQX A;  1URR A;  4OZ1 A;  1Q1K A;  2CNO B;  3CJ0 A;  4A8S A;  2QV6 A;  6FDR A;  3VV2 B;  1RHJ B;  2XS7 A;  1RTJ B;  1TAQ A;  2DIT A;  3P3D A;  1N56 A;  1ZZN A;  1WI8 A;  4P73 A;  1RYR A;  2HFZ A;  2N7Y A;  4LIW A;  1B0T A;  4OX9 F;  2VG5 B;  1R6Y A;  3UW1 A;  4DX7 A;  4LFC J;  2LEA A;  3EGV A;  3A4T A;  5HJX A;  1RAC B;  1RTI A;  2ZHO A;  4CO3 A;  1MWY A;  1WEX A;  3MM8 A;  1Y5I B;  4F2S A;  1T02 A;  3SCK E;  3SSS A;  1HKA A;  2CVE A;  4LF5 F;  3WX4 A;  4CTA B;  2DJW A;  3PRB A;  2FJV A;  3EM1 A;  2BE7 D;  2R7U A;  2M2B A;  1TR0 A;  5HI7 A;  2F4V J;  3PHT A;  2B9Y A;  3QYY A;  1RU1 A;  2B51 A;  4F36 A;  1UVN A;  3MMC A;  4URQ U;  2IYI A;  3PCO B;  4NI2 A;  2AYM A;  3HM9 A;  2R7W A;  3RAX A;  1KOO A;  2ASY A;  2VIC A;  1ACM B;  1CJU A;  4TQS A;  2RB7 A;  3QBC A;  4G65 A;  4R8U A;  3GTY X;  2YQ0 A;  1M5H A;  3M4X A;  3HSG A;  5DG7 A;  6FD1 A;  2HHX A;  3PX6 A;  4Z7Y A;  3JS9 A;  4P2F A;  1REV B;  2MPU A;  2Z2M A;  1R89 A;  2CPJ A;  3B4M A;  2XLK A;  2GHV C;  3I55 S;  1PBU A;  4IOC Q;  2EWH A;  4KB7 A;  1CSJ A;  3JAM Y;  4YN3 B;  1WOP A;  3V6J A;  1S7H A;  2RDD A;  3HFV A;  2E5L F;  2DR6 A;  5LSR A;  3IRX B;  1S0N A;  4URS A;  3RBE A;  2F9J A;  5L1K A;  3PYG A;  3H25 A;  3OFH A;  2KT3 A;  3BJY A;  3ZTQ A;  3MR7 A;  3G8S A;  3HHL C;  1KVK A;  1MRO A;  4YB5 A;  3MTJ A;  2F40 A;  1QAX A;  2YQ1 A;  2EK6 A;  2W24 A;  2HQC A;  4PUO B;  2XWY A;  4PZV A;  3R7N B;  2IJR A;  3AD7 C;  1P9Y A;  5AXL A;  4RW9 B;  5KFS A;  1FDB A;  3FVY A;  2VPW B;  3VQS A;  5IFM A;  4X64 F;  4NL5 A;  3M8Q B;  4KH1 B;  4QIG A;  2W2O P;  3KMS A;  4X4O A;  2FLP A;  1S77 D;  4DSL A;  2QMX A;  2MMY A;  2YNG B;  2KHD A;  2RF2 A;  2V4J A;  2CVI A;  2X1B A;  1OY8 A;  2ZOF A;  5K8P A;  4DFK A;  2DT9 A;  3GPA A;  4QWC A;  2LQ5 A;  2V9W A;  3M8Y A;  3I9Z A;  1CUL B;  4FXV A;  5I42 A;  2HBR B;  1IKX A;  2Z30 B;  5CYM A;  4CYU B;  5E7O B;  4HKQ A;  1TKX A;  3KXD A;  2WW8 A;  3GJR B;  2DY9 A;  4B9S A;  4L76 A;  1H7W A;  1NKE A;  1FCA A;  2DH8 A;  4P2X A;  1FDA A;  1QD1 A;  1F9H A;  3MM7 A;  3BF4 A;  4KJI A;  1NJY A;  4L75 A;  9RUB A;  3I96 A;  2YXL A;  4NLQ A;  1RIS A;  5IXU A;  1HNW J;  1PYT A;  3L4B C;  3SDE B;  5D3G B;  4DQP A;  3LGN A;  2AJF E;  2VAS A;  4DI6 A;  2Y8Y A;  2GCF A;  5HN0 A;  1PO6 A;  1ZPW X;  1RAH B;  4B3O A;  1T03 A;  1N34 J;  4NLO A;  3N79 A;  2YH1 A;  2QYG A;  3VGT A;  3SI8 A;  4EBD A;  3GFX A;  2LEB A;  1G7C B;  1XIQ A;  1SJ4 P;  4J9U E;  3VGV A;  4LF1 A;  3AXK A;  2FJB B;  2MY7 A;  3CC2 S;  3AT1 B;  4ID8 A;  3TO8 A;  1R7I A;  4BDP A;  1CJT A;  1RTH B;  3PW2 A;  4HAC B;  2C3O A;  1VBK A;  2FJD B;  1BMQ B;  3I9V 9;  2AP6 A;  2A6M A;  2FYX A;  4CWB A;  2C3Y A;  1B99 A;  3JTN A;  1U7L A;  4D3H A;  1WTB A;  2FZC B;  3R1L A;  1CJV A;  4KV8 B;  2L9W A;  4OIX A;  5HQM A;  1F2H A;  2KXN B;  4WZQ A;  3O3L A;  2FC8 A;  4BC7 A;  5AJ3 J;  2ZE2 B;  4E0D A;  2PFD A;  3MM6 B;  3K57 A;  2HWI A;  4UOF A;  2XB2 D;  1KKH A;  1FD2 A;  4RR5 A;  4FYV B;  3Q8U A;  4RLE A;  2HVE A;  1BE4 A;  2ZZN A;  2CJX B;  1VRT A;  4OI0 A;  4FBU A;  4WFX A;  5EHH A;  2OIH A;  2OEL A;  3QIP B;  1N48 A;  5E3P A;  2X1F A;  3ZO7 A;  5ETQ A;  1U1O A;  5F3T A;  4JI4 F;  1NDL A;  3CO0 P;  4DV4 J;  4DPO A;  2V94 A;  2B4V A;  1S6Q B;  1KQG B;  5IC6 B;  2OI2 A;  2VBW A;  3EZU A;  3HKZ D;  1VDH A;  2CUY A;  2D1C A;  2KDO A;  3BGO P;  4FP9 A;  4E2F B;  4DPU A;  3CJ5 A;  4IH5 A;  5A8W B;  3QT7 A;  4EK2 A;  1IM6 A;  5EWF A;  2NYH A;  2UVU A;  2XBP A;  4B3T F;  3WX8 A;  4K4S A;  3PYE A;  5J2P B;  4DG1 B;  5CA5 A;  1NH8 A;  4LQ9 A;  3DGP A;  2R7X A;  3PIP Q;  3EZO A;  4QIV A;  3TA2 A;  1SI9 A;  4CCH A;  1KNZ A;  1HW8 A;  3DU5 A;  1S1U A;  1R8B A;  3I4P A;  1EB0 A;  1FO1 A;  3PNI A;  3EGN A;  4EUV A;  3D2W A;  1WHV A;  4B3M J;  2CDQ A;  4NA3 A;  5K8M A;  3O1L A;  5L8R C;  2FHK A;  5GAH U;  1OYD A;  4RO0 A;  3I0S B;  1EP4 B;  1HBN B;  2YX7 A;  5KFH A;  2CRL A;  2E1P A;  4Z2X A;  1SPB P;  4QR1 A;  3MM9 B;  4DPT A;  5KAK A;  1MU2 B;  1RQ0 A;  2IRU A;  5DDR C;  2R7V A;  3DHX A;  1MWZ A;  3ZTR A;  2VQE J;  5C5J A;  2YWH A;  3BGR A;  2ZH5 A;  3DRP A;  1VQ7 S;  3EDR B;  4P6Q A;  2C28 A;  3BGF A;  2DHS A;  4MYU A;  4DN9 A;  4DR6 F;  1TU0 B;  2CG8 A;  3SCL E;  3Q8S B;  5IV4 A;  4F4X A;  4ERD A;  1QAY A;  1SUQ A;  4MIA A;  4WFZ A;  2DKO B;  4RNM A;  2XO7 A;  4QBU A;  1SJF A;  4ECV A;  5H1S V;  1YHQ S;  1OWX A;  1YBA A;  2J0S D;  1PCA A;  4ETZ A;  5EUH A;  3M1V B;  4LF2 A;  4ECZ A;  4R0J A;  1B7F A;  3L7O A;  3M8Z A;  1I1G A;  1N5T A;  4G3I A;  3M8S A;  2MKS A;  4IKA A;  1JLB A;  4ZPB A;  4ILR A;  4DL0 C;  4YS2 A;  1MSW D;  3IGV A;  4OYM A;  2CNK B;  2EKY A;  2BAN A;  3NG8 A;  4PG4 A;  1ICE B;  1FVS A;  2O66 A;  3LP0 A;  4DJB A;  1XBW A;  2JSX A;  1FFG B;  4MH8 A;  4MKY A;  3JSM A;  1BWE A;  4X84 A;  4JI7 J;  2HFO A;  3FFI B;  2DR8 A;  2VV5 A;  1BD6 A;  1N36 F;  2YKN A;  3KK3 A;  4O3N A;  3OXG A;  3W2V B;  4N41 A;  2BAC A;  4DL6 A;  3TUZ C;  2IMW P;  2HFN A;  1HBO A;  4ENO A;  4X4S A;  2L41 A;  4KRW A;  5KFP A;  4GVL A;  1PJ7 A;  2R7Q A;  5GAD I;  2VG7 A;  5IT9 U;  3UR0 A;  3ADA C;  2H54 B;  4NAS A;  1RBL A;  2ZH1 A;  1O5J A;  1BQN B;  2QSW A;  4KFB A;  3OBI A;  2QFJ A;  1MG7 A;  4ZHR B;  2RIL A;  3HVR A;  3PHE A;  1VLY A;  4LSN A;  2R2R A;  1HQU A;  1Q7L B;  1U0S A;  2FVC A;  7FD1 A;  2OPR A;  2N4D A;  2ZM6 J;  3I32 A;  4NZ6 A;  2XCP A;  1TK0 A;  2H1Y A;  2B7B B;  5IQ6 A;  3HUL A;  2E7X A;  1DUR A;  4CLL A;  3JYT A;  3BYP A;  1N0U A;  4F4A A;  3M2V B;  2E29 A;  1YIT S;  2DNP A;  4XDC A;  4O4G B;  3DRS B;  2MZT A;  3WHI A;  4CT9 A;  1WKL A;  2KFN A;  3R2C J;  4DV0 J;  2FUG 9;  2VPX B;  3UVJ B;  2DBB A;  4IO1 A;  2CPD A;  3RRG A;  4PG7 A;  2NS1 B;  1R8H A;  1BHN A;  2J9E A;  1JLQ A;  3R5D A;  2ZC3 A;  1HD1 A;  2KG0 A;  3T6B A;  4DR1 F;  3DI6 A;  1EX8 A;  1GMW A;  2EFG A;  1C1B A;  5KFL A;  3I56 S;  4RW7 A;  3THP A;  1U1N A;  2ZBQ A;  2QA2 A;  4WYW A;  4C9D A;  3MXH P;  3OJU A;  2BVZ A;  4QQB A;  2RT3 A;  3AD8 C;  3CED A;  4DV2 F;  1HYS A;  1IKV B;  1VMB A;  3U1N A;  2VKR A;  5DZ6 A;  4DFJ A;  4EMD A;  1I51 B;  5DDQ C;  3PR4 A;  2G0I A;  3K59 A;  4M94 A;  1NCL A;  4XPE A;  2HGN A;  2HQF A;  1S49 A;  1HBU A;  1FD8 A;  1RZM A;  4OX9 J;  2VQF J;  4H4O B;  1T9V A;  2HQ3 A;  2ZH7 A;  2DGT A;  4KSE B;  2NQP A;  1JLC A;  2HS0 A;  2ASD A;  1KSP A;  3FRZ A;  3SSR A;  4OQJ A;  4I67 A;  1RAO A;  4DQQ A;  5KFJ A;  1KLM B;  2GQC A;  5CD4 A;  4LF5 J;  3NGR A;  4K4Z A;  1F0X A;  2N82 B;  1HWK A;  4W98 A;  1EJ7 L;  4IFY A;  3BRE A;  4M5L A;  1W2I A;  2NXU A;  4FDF A;  1KC8 T;  3FCW A;  3ETM A;  3TAN A;  3DLB A;  2DNL A;  1KDN A;  1C2P A;  3POT B;  2RDI A;  1ZA2 B;  4DMZ A;  4QR0 A;  2Z2Y B;  3CPW R;  3F56 A;  2V69 A;  2JDJ A;  1R6V A;  2CQH A;  3M30 B;  3KLG B;  1VRU A;  3UR3 C;  3M8P B;  4KGM A;  1TL3 B;  3HX9 A;  3IWL A;  5ETR A;  2QLX A;  4I2P B;  3V81 A;  2EC0 A;  1QVF R;  2YKA A;  4QWB A;  1H98 A;  1I94 F;  3F0N A;  1UAW A;  1HAR A;  4ED8 A;  1T95 A;  5A0Y A;  4QPT A;  2HHV A;  2NUH A;  3BGL A;  2AEJ A;  2E5L J;  3IAS 9;  5JVH Q;  1SH0 A;  1O8B A;  1T9T A;  1F9F A;  3CMA S;  3JAM U;  2O67 A;  2NZ4 A;  2B0G A;  1Y5L B;  3G2X A;  3UCU P;  2OFH X;  2JHE A;  3C14 B;  1QSY A;  2VD3 A;  4M63 A;  1LWF B;  3R5C A;  3GYG A;  4FYD A;  2AYE A;  3RB3 A;  4NMX A;  3BKU A;  1Q86 T;  1FI4 A;  2UP1 A;  3OV7 A;  2VG6 B;  1VQO S;  3NCR A;  4H54 A;  3VHQ A;  3SEO A;  3RW6 A;  4NCA A;  2YVS A;  1MLA A;  5MLC V;  3MZI A;  1Q53 A;  2GHP A;  4PXE A;  2AX0 A;  4X64 J;  1LW2 B;  2G2Y A;  1ZYQ A;  3KWM A;  2ZNZ A;  2PI5 A;  2KM8 B;  1RCO B;  2V9K A;  3SBM A;  5KFG A;  5DM6 Q;  2ZWO A;  3CO9 A;  4DSK A;  4J9P A;  4WPA A;  3VAG A;  3NCP A;  1QAI A;  2K1R B;  1U24 A;  3CCM S;  4MKA A;  3CF5 Q;  3KK1 B;  2AX1 A;  5DO2 A;  2DXE A;  3P5T L;  1MMN A;  3MHY A;  1FVQ A;  1JLG B;  2ZBI A;  3LO3 A;  2KVQ E;  2IDE A;  2Y0S D;  3PM9 A;  1KQF B;  2ZBR A;  4GO7 X;  5HRO A;  2CPE A;  4I6A A;  3CDU A;  4JI1 F;  4NWB A;  4KHM A;  2K06 A;  3V4M A;  1Y3J A;  1H6K X;  3MEG A;  3KLF B;  4GKK F;  2LA6 A;  3J7Y U;  2GHW A;  2KYX A;  2AEF A;  1Y0H A;  3KTQ A;  1VK3 A;  3RBZ A;  4TU9 A;  3A3O B;  5HLF B;  4P72 A;  2JVO A;  1G4C A;  2OP5 A;  3DLK A;  2YX1 A;  2ZH8 A;  2CPH A;  4NLD A;  4DPX A;  1FFS B;  3AJ1 A;  4PYA A;  1M90 T;  1VQ9 S;  2IM1 A;  3PYD A;  5KFB A;  4U96 A;  2JC0 A;  2PT0 A;  1U2F A;  4ER8 A;  4CYU A;  3CCJ S;  4PWD B;  4N47 A;  2YQ3 A;  2BX6 A;  4DWI A;  3CJ3 A;  2HWH A;  2OPP B;  4KIA A;  1VQL S;  5HVG A;  4OHY A;  5D77 A;  1N52 B;  2I2Y A;  2RRN A;  3B54 A;  2R8K A;  1VBY A;  2ZIT A;  2HMI A;  1QTN B;  2HK2 A;  5HP1 B;  3DOL A;  3PJW A;  1X4H A;  1IBC B;  1F5C A;  5D4P A;  1RAJ A;  4F0K A;  1QSS A;  3ET6 B;  4BWM A;  2D69 A;  4NXM J;  3J7Z 5;  2PFF B;  1OPZ A;  4I64 A;  3L7P A;  4GC7 A;  2E1R A;  3CJ2 A;  1TFW A;  2XI3 A;  2DRA A;  2PN6 A;  4NYO A;  2Y1R I;  3HSJ A;  1GNK A;  1NB2 A;  2FB0 A;  2DTJ A;  3W5Y A;  4JI4 J;  3HT0 A;  5LSL A;  3KNA A;  2V2V A;  3G6X A;  5T7L A;  1F1B B;  4HHU A;  2YKM B;  4M5H A;  3G8T A;  1SH2 A;  4Q8E A;  1NND A;  1K8A T;  1YZ6 A;  4KGZ B;  4PPZ A;  3K7R A;  3CD0 A;  1IJE B;  3NOC A;  2Z58 B;  3OVS A;  3DRR A;  3Q8V A;  2EK1 A;  3B8H A;  4F04 B;  3QFH A;  2UZA A;  1XMB A;  4E8U A;  4LF6 F;  4RNN A;  2JEF A;  3Q89 A;  2KJW A;  2EFN A;  4G1P A;  1DJ0 A;  2IMO A;  2W01 A;  2MQ8 A;  5J2Q B;  3H5S A;  2MZR A;  1U2R A;  3HMJ G;  5I3P A;  1T3O A;  3TAQ A;  4DPY A;  1PYS B;  3FEY B;  1HNI A;  4EYI B;  2FZK B;  3HT3 A;  2OTJ S;  3HHL D;  1S76 D;  2BJ8 A;  4GKJ F;  4EZ9 A;  4ZCM A;  1L3K A;  3NNH A;  2UU9 F;  1E6V A;  1S6Q A;  3KUG A;  2GX8 A;  1XNR J;  3DOK B;  1JNZ B;  1Q5V A;  1N5Q A;  1C0U A;  1CPZ A;  1NPP A;  2FJX A;  4CLZ A;  3VAJ A;  3W63 A;  1A9N B;  5KFN A;  1VYA A;  4A46 A;  1J5O B;  3EDQ B;  2AWZ A;  2NPI A;  2YNH B;  3QGG A;  2CG4 A;  2J8A A;  1CC8 A;  3N01 A;  2BBE A;  2N4C A;  4X4R A;  1NSQ A;  2LP4 A;  1X4C A;  3H59 A;  2GVZ A;  3ZC4 A;  5CXT A;  3C16 A;  2ZH3 A;  4ILM A;  2NSC A;  1FJG J;  1D3W A;  4U7U D;  3LPY A;  1QE1 A;  1Q8L A;  4TNO A;  4J5O A;  3PVX A;  4ID5 A;  3ZFV A;  1X4G A;  4JUZ A;  1SJR A;  1AFJ A;  3W62 A;  4DUY F;  3RJM B;  4TN2 A;  1UTA A;  4OHZ A;  4WKY A;  2W4D A;  4BBY A;  5LMU F;  1NDK A;  1WC1 A;  4OZJ A;  3FBB A;  1NRK A;  3I0S A;  1EP4 A;  1HBN A;  1NAQ A;  3G87 A;  4GRS A;  4IUF A;  2CZV C;  1I3O B;  1UEK A;  4P7T A;  1IWA A;  4YHH F;  4K4Y A;  2IC3 B;  4HT7 A;  4IH7 A;  3U27 A;  3KJN B;  1RAA B;  3OUY B;  3QSY B;  5B0D A;  1S0M A;  2MHE A;  2NCK L;  3D6H B;  4UZC A;  3TJA A;  2QA1 A;  5KFX A;  3VAM A;  4Y6I A;  1FXL A;  3K17 A;  1S59 A;  3GV5 B;  3K5P A;  2I0X A;  1S9F A;  2W1B A;  1RT2 B;  3THV A;  2B8P A;  3J80 U;  1N36 J;  2J9D E;  1RT3 A;  4XIU A;  3QAE A;  3A3P B;  3N0V A;  2GA7 A;  5KFM A;  4JV0 A;  2W4P A;  2QE5 A;  1HQE B;  1SV5 B;  4ZLP A;  3GIM A;  3RR7 A;  3G6Y A;  4WE1 B;  1UVJ A;  1EHW A;  1S72 S;  3GON A;  5AXM A;  3WZ0 A;  3OLB A;  3Q2T C;  3KKF A;  2DNN A;  5KOX A;  4ZJO A;  3TVY A;  4USI A;  2PD1 A;  4LIR A;  3THT A;  2LQ8 A;  2GJ2 A;  3PYF A;  4KPC A;  2IRX A;  2XS2 A;  3CTR A;  2DGO A;  2Q6C A;  2BM1 A;  3N9U C;  2V67 A;  4RX6 A;  2DGX A;  3DXB A;  2ADB A;  4O3R A;  5C2G A;  2C2D A;  3A12 A;  4N8O A;  2IA6 A;  2AW0 A;  4GMK A;  3ZNU A;  1IJF B;  3Q83 A;  1ZA1 B;  3DXS X;  4WK1 A;  4ZVO B;  1CG2 A;  1XTZ A;  2FHM A;  2PSZ A;  2FVS A;  1WEL A;  4LUB A;  5K8N A;  1JLA A;  3LP2 B;  1R8A A;  4M8L A;  4WII A;  2C42 A;  2BRK A;  2XC9 A;  2MGZ A;  2DIS A;  3QRP A;  2Z4P A;  5HMW A;  3V6K A;  1R8P A;  3EX7 B;  9ATC B;  3FBC A;  3MPY A;  4DR1 J;  4ZVF A;  1F3V A;  5BJR A;  3LAN A;  2Y1L B;  3VZI A;  4QU6 A;  3VQT A;  2ATL A;  3HP6 A;  2ZH4 A;  3DLE B;  2RS8 A;  3DN9 A;  1R0A A;  5CZX A;  1TL7 B;  3PFO A;  1NXI A;  2AF6 A;  2XMW A;  4J9V A;  3M2V A;  2BAB A;  3J7A 1;  1FX4 A;  2C2Z B;  4NOH A;  1SJ3 P;  3DRS A;  3SQO P;  3GIJ A;  4KY3 A;  4DLE A;  4CZC A;  1U1Q A;  2NPF A;  4LRD A;  2HHP A;  3M6W A;  3UVJ A;  5H9E K;  4Y28 C;  1ZM3 A;  1VGY A;  2FVQ A;  1YGY A;  5J2M B;  1X9M A;  3LAK A;  4YFU A;  3TQ1 A;  1W26 A;  2EEY A;  3DYA B;  2L9D A;  1UW9 A;  4I2Q B;  2A1B A;  1XQI A;  4ZPA A;  1NPK A;  1N6Q B;  1I6J A;  1YJV A;  5T14 A;  4DQI A;  3D0H E;  2A2C A;  3PRD A;  3CCE S;  3BBF A;  2BE2 B;  2YPZ A;  1SKU B;  3ELH A;  1T9U A;  1RAE B;  1UWB B;  3DLG B;  5CYQ B;  2WBM A;  4YR2 A;  2QZ8 A;  1EKR A;  4K59 A;  4FBT A;  2M7S A;  2DCU B;  1DTQ A;  1RKI A;  4AE5 A;  4C3M A;  4X65 F;  5JMN A;  1XR7 A;  2HFS A;  5CZV A;  1DQA A;  1ZTT A;  1RI7 A;  4LMZ A;  1ZET A;  2RQM A;  3SSQ A;  2RRB A;  4KE5 A;  1J2V A;  2HHW A;  1JWW A;  2HLT A;  2AV5 A;  4NXN J;  5KFW A;  5K9F A;  2HGM A;  1ZM9 A;  1K44 A;  4KH0 B;  2IVF B;  1I94 J;  1KLM A;  2HFU A;  2YKO A;  4NX9 A;  4J9L A;  4N5S A;  2CWX A;  3MED B;  1D8Z A;  3T9N A;  3R1H A;  2KFY A;  3DM2 B;  5KFQ A;  5KG2 A;  5H9F K;  2GMJ A;  1QDU B;  3FGV A;  2DNR A;  4HTI A;  5F8I A;  4LRF A;  2CDR B;  4MT1 A;  2XS5 A;  4UTG A;  4F67 A;  1DFD A;  5DGB A;  1Q79 A;  4ZVU B;  3MAA B;  3JSY A;  3JSB A;  1VIX A;  5KT6 A;  1RJJ A;  4J90 A;  5CHC B;  2MQO A;  2GO9 A;  3QID A;  2MLZ A;  3RRK A;  4ZIT A;  4HI2 A;  3M8P A;  3U7J A;  1YTY A;  3F44 A;  2CZ4 A;  2PMW A;  3NL0 A;  1GTH A;  3BKT A;  2HAF A;  1ZAW A;  3FK4 A;  3I87 A;  1FKA F;  1RK8 A;  1S1X A;  1FJC A;  4DR5 F;  2HHQ A;  2XSF A;  4DN0 A;  2P9C A;  3J7Y I;  1IBL F;  1IKY A;  4KR0 B;  2XG8 A;  2UXB F;  2W9A A;  2H51 B;  3W66 A;  1V3R A;  3IR6 B;  3E3X A;  4TKT A;  4ZN1 A;  4DCO B;  4UQG A;  2UXD F;  1VOM A;  3M6V A;  1U6B A;  2RDJ A;  1QY7 A;  3MMC B;  4QZV B;  4I56 A;  4NI2 B;  2QGF B;  4NML A;  3C14 A;  4FKX A;  2JVR A;  2ZH9 A;  1N5Y A;  2GFF A;  1ZBT A;  4NLV A;  2B4P A;  1CJU B;  3VAF A;  1WDT A;  2YNF B;  4FF3 A;  1KEK A;  3QWU A;  3W64 A;  1RYS A;  2P6S A;  3MWB A;  2VG6 A;  4I4B A;  4JI1 J;  2MJN A;  2EXU A;  2APO A;  1JLF A;  3H2V E;  4CQ1 A;  1G3O A;  3OJS A;  1KP6 A;  1WG5 A;  2W8K A;  2PEH A;  4AYB D;  2E5G A;  2IPO B;  3JTP A;  4X4P A;  2NUU G;  2VBZ A;  1PAU B;  4UUW A;  4RU9 A;  2PO4 A;  4Z7C A;  3HZG A;  2F4V F;  4EBC A;  4ATN A;  4EU0 A;  2G0C A;  4Y2M A;  1YJT A;  1VC6 A;  1N5V A;  1L3V A;  2PMZ D;  4L72 B;  4OJ1 A;  3KK1 A;  1SJQ A;  2D9O A;  3BQ1 A;  2WCX A;  4ED4 A;  2MZJ A;  3JB9 k;  1H74 A;  2YWF A;  1DTT A;  2COL A;  5L39 A;  3TAR A;  3QFW A;  2XEX A;  3CJK A;  4ED3 A;  3KLF A;  5C42 B;  3KLI A;  1JKH A;  2BW2 A;  2IVY A;  3GFH A;  2WVC A;  3NWG A;  3HF5 A;  4DSE A;  1MML A;  2X7I A;  2C3U A;  2GQ2 A;  1RWN B;  3RB6 A;  1TTH B;  3TVK A;  1VIO A;  3KK2 A;  2B9W A;  2NXC A;  1IBK J;  2RF2 B;  2V4J B;  1YG0 A;  2JJ4 D;  5FDL A;  4QJV A;  2G2O A;  5B0B A;  1NHK L;  4OYP A;  3HZE A;  2G1D A;  4M5K A;  5MAO A;  3OTO J;  2RHS B;  1IKX B;  1RHU B;  2D3O 1;  3KHL A;  5CYM B;  1U6Z A;  3SQG B;  2POK A;  4UF4 A;  1TKX B;  3PEH A;  3D4J A;  2R2T A;  3I5A A;  2OTL S;  1XR5 A;  5C2C A;  2W2Q P;  3RR8 A;  2KN4 A;  3PW5 A;  5ETT A;  4FNI A;  2RJZ A;  1NH7 A;  1RUS A;  3D0G E;  2HPU A;  2HZC A;  4WFN Q;  2BJ7 A;  2WVE A;  2LMI A;  3GMG A;  2P6T A;  2MQP A;  5M2U A;  2V8V A;  2DNK A;  5KG4 A;  5DQI A;  3R3T A;  3G96 A;  3N28 A;  3GP9 A;  5HQ8 A;  4FF4 A;  4TXS A;  4ELV A;  3CJ8 A;  3KJQ B;  4NLT A;  4ED7 A;  3CXC R;  3CCR S;  4F50 A;  5DDO C;  1IQZ A;  2DIV A;  4B3O B;  1T03 B;  3FQL A;  4OYW A;  1WHY A;  3GJT B;  4DQS A;  1YLX A;  3HJV A;  1K9M T;  3OD2 A;  1FKO A;  3B4D A;  3Q8Y A;  2ZEJ A;  4JP8 A;  3QLH A;  2V4R A;  4DL3 A;  1N54 B;  1N33 J;  3HXM A;  2KTQ A;  2R7T A;  1PAE X;  2WSE C;  2KG1 A;  4P10 A;  1R31 A;  1OYE A;  4RWX A;  2CXE A;  4RNF A;  3M9N B;  1EQM A;  4PXD A;  1HWL A;  4G6V B;  1HNW F;  1U02 A;  2QMW A;  2R4F A;  4ES1 A;  1CJV B;  4DZ6 A;  2JNJ A;  1Q4R A;  2CQ2 A;  2Z56 B;  1HLW A;  3CCU S;  1DY3 A;  3A13 A;  2A10 A;  1RWK B;  3RGI A;  5A76 A;  2B5J B;  2LXI A;  1SC3 B;  3HFK A;  3MD3 A;  4M5J A;  3CJQ A;  2ZH6 A;  4Q45 A;  5JUM A;  4ALZ A;  1A7G E;  1IWG A;  1PIE A;  3EIC A;  1SC6 A;  1IBM F;  1Q81 T;  4U67 Q;  4PAB A;  3CC4 S;  5J2Q A;  2VDH A;  5KFY A;  3BQ2 A;  1VRT B;  2BMB A;  3M7V A;  1FFW B;  1BWV A;  1Y11 A;  3NEK A;  3TX8 A;  3ETO A;  2XNR A;  3DGV A;  2RKI A;  4ECT A;  4Q0B A;  3QZ8 A;  2E1M C;  4HDG A;  1LK7 A;  5EGY A;  5LMU J;  3DDI A;  1G1X A;  2XYP B;  2CJ9 A;  2Q79 A;  4NA2 A;  4A4J A;  3D9B A;  3VVT A;  3FSI A;  4NLY A;  4LF8 F;  2YNH A;  2C2O B;  1UVM A;  2R7S A;  1IN0 A;  1WF2 A;  4RUA A;  5AJ3 F;  1IM4 A;  7AT1 B;  3IMQ J;  3B82 A;  4YHH J;  1QUP A;  3TUJ C;  3QRR A;  2XCA A;  3T1A A;  3OTB A;  2CQD A;  1CC7 A;  1UA1 A;  1X9S A;  5JXS A;  3RU0 A;  2JC1 A;  3CW2 C;  4RNH A;  3OHB A;  3I82 A;  4H4K A;  3TP2 A;  3OXF A;  3NGS A;  3O5T B;  1RWO B;  1S1U B;  2HND A;  1OSC A;  2D3Z A;  1FEH A;  1WTF A;  3C6T A;  2LLZ A;  5KFC A;  3RB4 A;  2XYH B;  3OVA A;  1WHW A;  5F8M A;  3EXC X;  5ETO A;  2OPQ A;  3K8V A;  4KGX B;  4IOA Q;  4DV1 J;  2PE8 A;  3HK2 A;  3TW0 A;  1FXR A;  1RHR B;  3MUV P;  1P27 B;  3HD2 A;  1VQ8 S;  1S1W B;  3KLE B;  5A6W A;  3BBC A;  2X1A A;  4O4R A;  4ZIW A;  3ZZU A;  1RHQ B;  3OUY A;  4L6V 3;  1UP1 A;  5LJ3 Y;  1HL6 A;  1REG X;  3ZZY A;  3HD1 A;  2IBO A;  5D4L A;  4B9V A;  5A2Q Y;  3BGR B;  4O3Q A;  3DRP B;  3HVA A;  1PC5 A;  4DS5 A;  1WOR A;  4RBV A;  1WF1 A;  1O51 A;  2HBY B;  3W8P A;  4K7Q A;  2VHG A;  1SUQ B;  5F9N A;  1MNE A;  1DLO A;  2XI2 A;  4TU7 A;  2J6U A;  4UY8 T;  2LXU A;  4B3M F;  1RT6 A;  4LBP A;  4AQY F;  5KFZ A;  1KQS R;  3DU6 A;  2H5I B;  3GZ7 A;  1H38 A;  3GFY A;  1MW7 A;  4P9S A;  2D74 B;  3CIM A;  3L9Z A;  3PW0 A;  3NBP A;  3BSA A;  2DXF A;  1WI6 A;  2C3M A;  2I5J A;  3GR0 A;  2U2F A;  2VB6 A;  4Y3C A;  3NLC A;  1JLB B;  2QT7 A;  3PAC A;  2IDL A;  2QA4 S;  1M1H A;  1M5S A;  2KO1 A;  2XZT B;  3DHW C;  3TR5 A;  2G9O A;  3LP0 B;  2EBE A;  4ANC A;  2QLW A;  2V2Q A;  4RW4 A;  1S57 A;  4LSL A;  5IS2 A;  5CCL A;  2EG1 A;  5HMY A;  4LR8 A;  5D4O A;  4PYD A;  1HFE L;  2HKE A;  1Z1Z A;  3GWC A;  5ETM A;  1H73 A;  3KK3 B;  2N7C A;  4QYR A;  1SKS A;  1HBO B;  4OZL A;  4ED5 A;  1SIZ A;  1FE4 A;  2BA9 A;  3CJT A;  1VQN S;  3F73 A;  4LF9 J;  2QA4 G;  1TL5 A;  1S97 A;  3QJL A;  3G6V A;  3KUH A;  1RE1 B;  1R0B G;  1NHU A;  1X5T A;  3OR1 A;  1C1C B;  5KG5 A;  4OHX A;  2FGO A;  1OY9 A;  4TY8 A;  4K0K F;  4RUH A;  2QFI A;  3ZZ0 A;  2ZDO A;  2H4W B;  2AQ4 A;  2N3O A;  3OQ2 A;  1HQU B;  1TL7 A;  3HHD A;  2OPR B;  3BS9 A;  3UCZ P;  2XMT A;  2BV3 A;  4F4Y A;  3JYT B;  1XJW B;  1HHS A;  3S6E A;  3M2R A;  3M9O B;  3G86 A;  4OZ0 A;  4IH6 A;  4F02 A; 
#chains in the Genus database with same CATH homology
 2P8I A;  2NYH A;  2PEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...