4DV6F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv6F00
2YY3A 2VQFF 4DR3F 5LMUF 4JI6F 2KJWA 3R3TA 2UXBF 4B3SF 1IBKF 4LF9F 4DV0F 4NXNF 2F4VF 5IWAF 4DV3F 1IJFB 2BVZA 1RISA 1LOUA 1HNXF 3ZZPA 1XNQF 2UUBF 3OTOF 4B3MF 2UXCF 4JI3F 1XMQF 1CQNA 4LFAF 4JI1F 1N36F 4OX9F 2BXJA 3T1YF 2ZM6F 4X65F 4DR5F 4NXMF 4JI7F 4DV7F 4LF5F 4JV5F 1XMOF 4JI4F 5LMNF 4LFCF 1IBLF 4DUZF 2UUAF 2E5LF 1GH8A 1IJEB 4AQYF 4YHHF 4LF8F 5AJ3F 1QJHA 4DV2F 4LF4F 4DV4F 1XNRF 3T1HF 2UXDF 4DR2F 4DUYF 4DV6F 2B7BB 4X64F 1HR0F 1G1XA 4DV5F 4DV1F 4GKKF 4LF7F 1B64A 1N32F 4YY3F 2UUCF 4JI8F 4B3TF 1VMBA 1I94F 2HHHF 1N33F 1HNZF 4JI2F 1FJGF 4GKJF 4LFBF 5BR8F 4DR6F 4K0KF 2J5AA 4JYAF 1G7CB 1HNWF 4JI0F 4LF6F 2RJZA 2B7CB 1IBMF 4JI5F 2VQEF 4DR7F 1J5EF 1N34F 2UU9F 2KJVA 4KHPF 4DR1F 1F60B 4X66F 1CQMA 1FKAF 4X62F 4B3RF 4DR4F
chains in the Genus database with same CATH superfamily
2B9WA 2L3MA 3CCLS 5B7WA 4YDXA 3BZQA 1HWLA 3TA1A 4LJMA 4X65J 2UUWA 2QMXA 1MLAA 1WHYA 4J9UE 2PEBA 1KEKA 3RAXA 4LFCJ 3BN4A 1S6OA 5J2NB 1YLXA 4H4KC 3MURP 1U2FA 1V5IB 3CD0A 2Q6BA 1VOMA 1BQMA 1Y11A 4R8UB 2VG7A 2OH2A 2IRXA 4NYOA 3BN7A 3QGHA 2VDHA 4K5SA 2V4JA 4M5JA 4DFKA 4OJHA 5HJXA 2NXUA 4F4XA 1FWPA 5I3UB 2H5IB 4JV0A 4LFBF 2P8IA 2VZ9A 1DLOB 2B7CB 1QY7A 1NB7A 5HK4A 2KB2A 1JJCB 4RPFA 3BKTA 1H2UX 3ELHA 3HX9A 4K4XA 3EUNA 1X4CA 3CVKA 2VQFF 1NUEA 1NLKL 1BGXT 3CCJS 2UXBF 2CQIA 2K7JA 2HHUA 4FVCA 5E2QA 3CD6S 5KT6A 3VCDA 3BO4A 1UFLA 2PGCA 4OZNA 4YMEA 1ZZNA 4A8XA 4KV8B 4OZ3A 4ERDA 3D0IE 3FEZA 3WC0A 2ZFHA 2MKSA 5DO2A 4RX6A 2GAGC 4OHVA 3MEDA 2UXDF 3OFEA 3R2DJ 4NLYA 4EK2A 1FX2A 3CD7A 1YJUA 2C3MA 2PD1A 1VRTA 2KRRA 4I2PA 1U6BA 1U25A 4NRTA 3HHNB 4ED2A 2UP1A 2HVIA 1RTDA 1FNMA 1IR1A 3DGVA 2E1AA 4OIXA 4ED5A 2J0WA 2ZBQA 2CQ4A 4Z7CA 3DLHA 1U8SA 2H51B 2R2RA 1RT3A 1U1RA 4LF2A 2W7OA 2R2SA 2F1FA 4OYXA 1PYTA 2GO8A 3TZXA 4NXMJ 1XBWA 1T3OA 1Y0HA 1UVNA 3D2WA 2ZUGA 1U45A 2CJ9A 1RWPB 1VK3A 3C16A 4P9SA 4URSA 4ZK7M 2XO7A 3FZ2A 1FDAA 2KXHA 2LP4A 1SPBP 4MH8A 4OZLA 2R8KA 4Q2LA 1FRIA 2CPXA 5K14B 1SUQA 3UD3P 4UY8T 1C2PA 3PDNA 2W7AA 1MG7A 2I6WA 2ZOFA 1N32F 2HFUA 1OYDA 4TXSA 5EUHA 5F8LA 3IGVA 1I3OB 2YX4A 1WC1A 2VG6B 2JDJA 3VZHA 4UY85 2BQUA 2JEFA 4ZLPA 1RCOB 2XWXA 2IMOA 4PWUA 1DHMA 2DHGA 2MQQA 2RDDA 3QZ8A 3U7JA 4ZA1A 1YRUA 1F5CA 2CPFA 3K5OA 1LNQA 1C1BA 2CYYA 3A3PB 5HVHA 4DR3F 2MHNA 5EX0A 2WOMB 1KFSA 4DUTA 3P6YC 5GADI 3GIIA 3N79A 3B6BA 5G4DA 4KO0A 2WVBA 4Z37A 1WACA 1A6LA 3I82A 3C14A 3QSYB 4AXJA 3MZIA 2OSQA 2WVCA 3ILJA 1HBNA 2FHMA 4KKOB 1MN7A 3BPDA 5CQGA 2GFFA 2W8KA 4IG3A 2RSQA 3NBPA 5J1EA 1WC6A 5ETRA 3CDWA 4C8MA 1REGX 3T1HF 2YKQA 3BDPA 2I9SA 3MM9B 4UZBA 3DFEA 4BC7A 1BQNA 3DLGA 3BBFA 3T6JA 2RB7A 4N8OA 4K5RA 3N28A 3FGVA 5J2PB 4OX6A 4CQ1A 2WBMA 4M5GA 5HVGA 3F73A 3TOQA 2RQMA 3SI8A 2XZWA 3EDRB 3KK3B 2JJ4D 4JUZA 2MQNA 4AL5A 2DNMA 2F8HA 4KFBA 1RZMA 1HLWA 5F3ZA 2KM8C 4IQMA 4DPYA 5GAEU 3IG1B 3E8OA 4JI6F 3FRZA 3HVAA 2R42A 4K4UA 4DX6A 5KFRA 1B7FA 4USKA 2IA0A 3I4PA 2YNFB 1CS4A 1KHWA 4HLBA 3A3NB 1TFYA 2CQCA 3PYDA 3HHLA 1NJIT 4HYKA 2FTRA 4KE5A 4ZPTR 1YSJA 2N7YA 1YZ6A 2BJ7A 3OVBA 3HVTA 4CO1A 1DRZA 1ZM9A 2ZITA 5I3QA 2DGUA 2MGZA 4P75A 2MKKA 1UJ4A 4DU7A 4DV1F 2LXUA 1FXRA 3RBEA 3JAMY 3MCMA 2CPYA 5BR8F 1T95A 2J5AA 3N0VA 1Q7LB 7AT1B 1PBAA 4J9SA 4M5NA 3UR0A 2HGNA 3KDNA 2W9AA 2C3PA 2YQ3A 2GVZB 2XZDB 5I4MA 1HMVA 4OZJA 1CJTA 1RP5A 2BW2A 1HBUB 3TJ9A 4TVAB 3NNCA 5AE2A 3ZZOA 2R2TA 1YK9A 3J7ZT 3M2RA 5CYMB 3CJ2A 4CLPA 4DSIA 3CD5A 3WQPA 4ID5A 2BYCA 1VQNS 4F3OA 4HKQA 1HA1A 2DNNA 1O6XA 3FCVA 1UFKA 3ZTOA 2OMOA 1WNEA 3TA2A 3R6LB 4IFVA 5GMDA 4J9KA 1P1TA 4WIIA 2D1CA 4RWXA 2CPJA 2KYZA 4OQJA 2WSFC 1IVZA 4QCLA 4FKYA 1IBMJ 4ZPBA 1R8CA 4R0JA 1LFWA 1UAWA 2MXYA 2AD9A 4KSEB 1NK5A 5IOLA 1M0SA 3K8WA 1DY3A 3IC1A 1JLGB 2OFHX 1FERA 5KG0A 4P72A 6FDRA 3RGIA 3FCHA 2VFVA 1IBKF 1VQLS 1NH8A 4PKDB 4WK1A 4PXEA 4J9LA 2E1MC 2HK3A 1JXEA 2AJ1A 2LA4A 1S97A 4G6VB 1KONA 5B08A 1RTIB 4AT1B 1R0AA 4JI4F 1WTBA 1ZAWA 1Q8BA 1IBLF 3KJQB 4U7UD 4ZHRB 4WJBA 1C4AA 1YTYA 1Y5IB 4CRJA 2CQ1A 2I5JB 1F2GA 1DTTB 1RT2A 3KJVB 5E33A 4URGA 3O8WA 3C15B 1AUSL 1TFWA 3CCUS 2BOPA 2F8EX 8RUCA 4DX8H 1PJ7A 2D9OA 2AJ0A 4ZJOA 1SIZA 2MZQA 1RQ0A 3CWJA 3ITHA 4CM0A 3KTQA 4HI2A 2OTLS 5KG5A 1PGZA 3LANA 4WU2A 2Y0SD 2KXFA 3SCKE 4LSNB 4Z7YA 2GVDA 5G0RA 1WHXA 1KFDA 1AFIA 4A47A 2AZ3A 4IG0B 3SBMA 5HLFB 4OJ3A 4GO7X 5HQMA 1WTFA 1KSPA 3B8HA 5HMXA 2MQLA 3PJ9A 5IC4B 3MM7B 5DLFA 3C6TA 4NLPA 2WSCC 1TUGB 4PZVA 1TAUA 4N5SA 4LSZB 3QO9B 3JYTB 2E29A 3C3LA 1B99A 2Y1JA 1UWAA 4IO1A 3QJPA 4EWTA 2DHHA 3PY8A 3DRRB 3VAHA 2OI2A 1TV6A 2ZH9A 1QJHA 5IZHA 4DL5A 2J7UA 3HMJG 2YH1A 1R43A 1N54B 1PYOB 3JTPA 1E6YA 3HK2A 2QA4S 3TQEA 2QSWA 4CLUA 3K58A 1SC3B 3OW2R 4WE1A 1X5SA 1VRUA 5DDQC 4LT6A 4ICLB 3QT7A 4CO5A 1DQ8A 2EC2A 2Q1LA 2QN6B 3IR5B 2BJ3A 2WCXA 2JVRA 4MYTA 1WF1A 4QWBA 5SZTA 1TUVA 1JLBA 3S1TA 1VLOA 1CQMA 2ZD1B 3HSGA 4Y2CA 1CG2A 4FKXA 3CGIA 3C6UB 3W5YA 3KLFB 5HBMA 3Q8VA 5EN1A 2BACA 2YWGA 4EFAC 1SH0A 5E3CA 2FY1A 4O3SA 2NYHA 1S1XB 4QYRA 2MZJA 2E9ZA 4G1QB 4DSKA 2WONA 1YDLA 1UW9A 2GJIA 4JV1A 3MD1A 2X51A 3EMTA 2MKYA 3KKFA 1UVLA 3V81B 2VUGA 3M32B 1UVJA 1LK5A 1WKJA 1Q86T 2HNYB 2Q3PA 4LFBJ 4ED7A 4LSLB 4EZ6A 4UTGA 1U1OA 1JNZB 1WC5A 2DTJA 1ZS6A 2QO3A 3A8JA 4F4KA 1RABB 4PG6A 4KH0B 1J5EF 2HNZB 4RUBA 2KI2A 2MQPA 1YX2A 4NRUA 2VQFJ 4P2MA 2UXBJ 1J2VA 3GIRA 1NDKA 3VGUA 2OPRB 4ELTA 4GVLA 3BQ2A 1RT6B 4X4NA 4MK8A 1WOPA 4OYOA 1FWKA 3RU0A 4C8ZA 1Q78A 4B08A 2APOA 1YQHA 1WKLA 1RYRA 3KHLA 1RTJB 5C42B 2YKPA 4B3OB 3K89A 1N5QA 2UXDJ 3SEOA 2C28A 4OI2A 5U47A 1W26A 3MMAB 4ZP8A 5A8KB 2GGPA 4DV4F 4NL5A 2RNEA 3MPWA 3AT1B 1CSJA 4DSJA 4LF7F 4CTAB 2O1PA 5BXIA 2WW4A 3M9OB 3IGNA 3SQGB 4AUKA 3GPAA 4I56A 5GAHI 3LW5C 2J9DA 1PO6A 4ZVUB 4QR0A 4O4GB 4M5KA 2XGQA 3FRYA 2D3UA 3DLLQ 2ROPA 4EYHB 2RF2A 2AEFA 4LIWA 4FVMA 1CBKA 4EO6A 4B9NA 3ZZYA 1N0VC 2Y1IA 5LM7E 2QLFB 4JI1F 1VYAA 2QTWA 1NMEB 3Q24A 3KYLA 4RBTA 3CUNA 1K44A 2V8HA 2KO1A 2QL9B 2FUG9 3GIKA 4YEAA 3Q8UA 1NBEB 2ILYA 2OKQA 2WVDA 2XZTB 1N32J 3G86A 4M5DA 3FBFA 3JTNA 3UE2A 4CWBA 2G1DA 2IM1A 4DQQA 4MYUA 2HHQA 1FRXA 4GKKF 2IPOB 2ROEA 4U67Q 2IBKA 4PQUA 1PIEA 4B3TF 3QT6A 2EFPA 4K4ZA 2MY7A 3KG0A 1FT8A 1UA0A 3AD8C 4O3PA 2DR8A 4B17A 4LF6F 5KG1A 4F4AA 1WC3A 5AT1B 4DL4A 2G0IA 3CW2C 4DR3J 3CC7S 5D0RA 2JLFA 1KQSR 3BGUA 4ECRA 2GCFA 1I5OB 4Q43A 2Y1LB 1PAUB 4B3RF 2KYXA 4ECSA 5IV3A 5ETSA 4P74A 3CCZA 5LMUF 1UJ6A 4DV0F 1RLCL 3FQLA 3B78A 3FFIA 3FBCA 2M7SA 1NEEA 3UNYA 3KHGA 2EFGA 1N5YA 3M6UA 3TR5A 4IDKA 1UEUA 4NA3A 2D41A 4A8FA 4DSFA 3UR3C 2H48B 3T1AA 4DJBA 4I2PB 3EPIA 3T1HJ 4P10A 1Q5VA 3K5NA 1S79A 3TAQA 3BSAA 3KK1A 3JSBA 4DXLA 1RTDB 4K50A 4AL7A 2KKHA 1XNRF 3IM8A 2B4VA 3HD1A 3MWBA 1VMBA 4XTTA 3LTOA 4J5OA 4WZMA 5T7LA 4N41A 3CE8A 4B9LA 1HBMB 2P9EA 4NMXA 2R7QA 1RJJA 3I5AA 2G4BA 3ZTSA 2O66A 3OVAA 1KTVA 2HHPA 1VBXA 4JI6J 3I5BA 4QPTA 3EGWB 3IBCB 1RWUA 4WFZA 3O1LA 3FK4A 2XSFA 2EW9A 3WIUA 1HARA 1O51A 2CJYB 1ZZFA 4C97A 4K4VA 3GR1A 2O3DA 3BQ1A 4K4YA 1YJNS 2E1RA 2ZNZA 3G8TA 3K57A 2DIVA 3AB2B 2B4PA 3RB0A 2BZ2A 1VHIA 2PEHA 1HI8A 1FK9A 3DOKA 1SKWA 3IRWP 2W4PA 1BD6A 4DFMA 3PRBA 1RHMB 4BBYA 3VVUA 3GB0A 2CJKA 3JSRA 2P2CB 5BR8J 1TKDA 1VQSA 2JSXA 2PIIA 1FFWB 2G13A 1P27B 2V2ZA 1C1BB 4RNHA 3OL6A 3KHRA 4USJC 4I68A 1TTHB 1RAGB 4RNFA 3PW2A 1CULA 3DYAB 3R5BA 4ZVSB 2MKHA 1VC5A 2IJNA 2M9KA 1HW8A 2KZZA 2C3YA 2ERRA 2YY3A 2CDRB 4ZLJA 2GZOA 4ECTA 2CPHA 1YZ7A 4RW6A 2ZC4A 1HBNB 3N6MA 3G8SA 4LF9F 2C2OB 2V63A 3R5CA 2RHSB 4O3OA 3MMBA 4QU6A 3D3BJ 5L9XA 4DL6A 2V8VA 4RW8A 4QPXA 1JLCA 4OYZA 5J1EB 4G3IA 1GAOA 2FVCA 3I87A 4LFAF 2V9WA 1EP4A 2VF3A 3BH6B 1JLEA 3J80Y 2OEKA 4PYAA 2GQQA 2JWNA 2QLWA 1B0VA 2JNJA 1NB2A 1RWXB 1D0EA 1UFWA 5HROB 2MYFA 2BABA 4DL3A 1RBAA 1N56A 3TUZC 1KDNA 2CG8A 3QWPA 1TKXA 1VQKS 1VC0A 3B82A 4KIAA 1EAYC 2QIFA 3HP6A 1I51B 1T7PA 3MECB 3N01A 1JJHA 2U1AA 2CJAA 2LVWA 2I38A 3CCVS 4TNOA 1CJKA 2M70A 5KOXA 1WHWA 3KNAA 2VFUA 5KFVA 4GC7A 1IBKJ 2EG2A 2Z4PA 3HSZA 4Q45A 2DGWA 3Q2SC 2VBYA 2UUTA 4IUFA 4YUDA 1UWBB 4DPOA 3HVTB 2KN4A 5IC6B 4A46A 3D66A 3JQJA 3LPYA 1URNA 4ID8A 3KJNB 1WG4A 1HI1A 5LSRA 4JI4J 1IBLJ 4WTYA 3M7VA 1MU2A 2DGQA 3G82A 1VJQA 2CRLA 5CZXA 3LQVA 4DR2F 3GG0A 1V6HA 1QUPA 4O0NA 4AD6A 1NDLA 4USIA 1WF2A 3IAM9 1HMVB 1HQEA 1SKUB 3H98A 1YBAA 4RW7A 3MMCA 1DBDA 2J9DE 2X3DA 1F3VA 3DLEA 1AUDA 1LXJA 3NCQA 2XNRA 8ATCB 4J91A 1ZM3A 3KK2A 2W4DA 3O44A 3J7YU 4H54A 5T41A 2ALYB 3M2RB 4P2XA 4O23A 2GV1A 3QBCA 1VBYA 2A10A 3W2WA 3MFIA 4X4VA 4W90B 3HD2A 4F04B 2IDLA 1BXNA 1TKZB 4X4SA 3IO1A 2R2UA 1OS5A 2CNNB 2MKJA 4IFVB 3OXFA 4ZOSA 3RAMA 3BF4A 1R6VA 4ZLLA 2DNKA 3DHWC 4LRDA 2ZKUA 3P45B 4ZVGA 4I0WA 3GQCA 4ZVHA 4K4WA 2C2EA 5M2UA 1KOOA 1JKHB 5D78A 3RTVA 4RW9A 4K4TA 3Q83A 1RA7A 4RBUA 4V19J 1P8GA 3UO0A 1VK8A 1VQ4S 4OYBA 4LUBA 3PYEA 3QNWB 1TL1A 2ZH2A 1PKUA 3BYPA 4O3QA 2DNOA 2ZBPA 4WPAA 3BREA 4FF1A 2YNHA 4O44B 1FVQA 2XULA 5DZ6A 5D4OA 2IVYA 5CYQA 1JLFB 3BGRB 2M52A 2A2CA 1FTCA 2BANB 1FJCA 5HATA 2HEKA 4LR8A 3OUYA 3DOMA 3J81Y 3SCIE 2C2ZB 4IQXA 2GMJA 2Y0BB 4B9SA 3CC4S 4CLWA 2FZKB 3TO8A 1TKTA 4ED0A 1IKWA 1S99A 4I1TA 1BE4A 4DCOB 2HBQB 2N82B 1NKEA 1N8RT 5J1NA 4ALZA 4F4ZA 2GVDB 3BJYA 3KLIA 3NGKA 5G0RB 5ETMA 1DFDA 3M8QA 2FGCA 3PIOQ 4MJKA 1J5EJ 1TL5A 1UTAA 4KH1B 3I0SA 3D1HA 1SIWB 2JRSA 1NAQA 1S1UA 4TLRA 5IV4A 2Z56B 3W1YC 3M6WA 1R6YA 4KGKA 2MZTA 3V2UC 3FQKA 2A18A 4ZJQA 1Y00A 3BR9A 4C7QA 1YJ7A 3VALA 1X4AA 4DR4F 1LK7A 3QMQA 3D6HB 2EFQA 4ECUA 3Q0AA 3DMJB 1RBOB 2HQCA 4ZIWA 3CPWR 4USTA 3CEDA 3HDSA 3EVOA 4LMZA 1RSCA 1V5VA 1KVKA 2QLJB 2CG4A 3NMRA 2IVFB 1ZA1B 1YIJS 2HQDA 1Q5YA 3EDQB 5GAEI 3TWZA 1Q8LA 2Z0GA 5J2NA 4DR5F 2FHJA 4ZPAA 1G6BA 3OD2A 4DV4J 1PJ6A 2BR0A 1VRUB 1HI0P 1JWWA 2OMLA 4LF7J 2HS3A 3H5UA 2AYMA 1FTRA 1ZETA 2BJ9A 4NLGA 3HSDA 3W2VB 1NSPA 4OV1A 2Q66A 1FNOA 4JB8B 4URQU 2NSCA 5H9FJ 2DEIA 3ICLA 3FC9A 4EBCA 1VQMS 2VA3A 2R8HA 2OUGA 4DF8A 2Z57B 5KFOA 4E98A 4MFBB 5HBMB 3R27A 3CO0P 1WI6A 1RU1A 3RB4A 4X4UA 1FRKA 1HKAA 4ZCIA 4KPCA 3POTB 2W9CB 2MTLA 2XYHB 2W9BA 4W92B 4JI1J 4CNYA 4FN5A 3L95X 2OO4A 1VCTA 3DXBA 1M5HA 1M5KC 2HVDA 2ZJQQ 3BM7A 2U2FA 3NWGA 1S6PB 4B9VA 1GMVA 4QOTA 3A1YG 1RK8A 1VS3A 4OV6A 4OI4A 2KZMA 1NO8A 1C0TB 3W63A 1RWMB 2JEIA 2V68A 4GKKJ 3Q22A 3UCUP 4B3TJ 4U7UK 1NK7A 3DDIA 5CD4H 3EXYA 4KR0B 1NXIA 3CJ0A 2Y8WA 2R8JA 2R9LA 4LF6J 3H40A 3CJ5A 3R7SB 1U1PA 5JXSA 2RJZA 2BM0A 5K9FA 4B3RJ 1RADB 2BMBA 1H6KX 2C2DA 5LMUJ 2VL1A 3I0RA 4DV0J 2Y9HA 1T3NA 4H4OB 4RU2A 4KTQA 1TMJA 3GONA 3ZNUA 1GFWB 2GMLA 3EZ5A 5J2QA 7FDRA 1CQNA 1F9HA 2NLWA 1X4EA 5HANA 2DNZA 1VQ9S 4MTPA 4UUXA 2JZ5A 1XNRJ 2GX8A 4G1IA 3IRXB 1GH8A 2L9DA 3T6BA 2AX1A 4W98A 2G9OA 2EKYA 1GXUA 5J1PA 1CEZA 2A6OA 4TYAA 5K14A 1SH2A 1ICEB 2V8PA 3QRRA 1KVIA 3OXGA 2MDAA 4UQGA 2YBVA 4CYUA 2RF2B 4PUOA 5JVHQ 1MROB 2IM3A 4DR6F 2VG6A 3T9ZA 1S1WB 4Y65A 1S49A 3HHLC 3Q8SB 3QT5A 5CD4A 2CAJA 4A8KA 2YKOA 4ES1A 1WC0A 4TLQA 3CJKB 1NK4A 2J8SA 1RHKB 2MEWA 4QWCA 2CUYA 4QW8A 2C2KB 1CJVB 3MAAA 3HM9A 1H7WA 1Y9OA 1NHUA 2AJ2A 2WOMA 2W2QP 1RISA 2L41A 1RI7A 5KFGA 4M5DB 2PI5A 1Q7YT 4N7TA 1UMJA 2E5GA 2VG5B 1W2BR 1KTQA 3A8EA 2ZC3A 2JC1A 4HI1A 4CP5A 2ASLA 2AGPA 3KLEA 4WFXA 1HPZB 4KKOA 2HNDB 3JXOA 2DVIA 1AYEA 3QIPB 3MGJA 5BYSA 4NPOA 5CXTA 1G2EA 3CCSS 1VC6A 1PC4A 4A8MP 3I9V9 2BJEA 3CJ4A 1Y5LB 2XY7A 5C7PA 3MEGB 4C3MA 2HG4A 4IYQA 4DL7A 3CULA 2YNIB 3VHQA 2XEXA 2YPZA 4IOCQ 1TU0B 2KTQA 3KK3A 1R31A 1B0PA 2HRTA 4LF9J 1N5YB 5LT5A 2C3UA 2RHQB 3JSYA 3IG1A 4I6YA 2BJ8A 2OPSA 3G6YA 4LFAJ 4F67A 5IWAF 1T05B 1UP1A 2CNKB 1LWCB 1O5JA 2YNFA 4NLUA 1UL3A 2EWHA 3DLKA 2WW8A 3DCAA 3D6FB 2WSEC 5JUMA 4C8LA 3I5CA 2DRAA 1QUVA 4JYAJ 3OL8A 3H42A 1S9EB 3FSYA 1Q8KA 1D8ZA 3GFXA 2I2YA 1X9MA 5D4LA 4DFJA 3R2CJ 2FZGB 2B4OA 1H73A 5D8HB 2X1AA 2ATLA 2DCLA 5KOWA 2XWYA 3Q8QB 3VQTA 4PRFA 5M2PA 2ZVIA 5RUBA 3PZPA 2DR5A 2HBZB 2PT0A 4F0HA 3PO4A 1Q95G 1H2TZ 2KRBA 4NCGB 2OTJS 2CPEA 4FBTA 4EZ9A 1SV5A 4PXCA 1N0UA 3NEKA 1HYSA 2CQPA 3GV7B 3V6DB 4WWSA 1UEKA 1M90T 1U7LA 3DRPB 1HBUA 2LQ5A 1KWMA 2J9EA 2QGFB 4DMZA 1FK9B 3DOKB 5F9NA 4R0EA 2E7WA 2W4CA 1OQ3A 5IXUA 3PEJA 5A2QY 1Z1ZA 3QWUA 1K9MT 3FKBA 4KY3A 4LF5F 2VFTA 3RRHA 3PHTA 2WB1D 4DR2J 1XQIA 2ZDOA 2FJAB 5KFMA 2NCKL 4O3RA 4Q7AA 2HFZA 8AT1B 1CULB 4A48A 3NCPA 1TELA 5FLXY 1PSDA 1FKOB 2QMUB 3HVWA 2J8AA 2GO9A 1N33F 2NUUG 1FJGF 2MKIA 2VA2A 4CIOA 4OMFG 1FCAA 4OHXA 1OSDA 1ROFA 1IKXA 2HHWA 4A8WA 2QSFA 4DN9A 1B70B 1JLCB 2LYVA 2DIUA 1JLGA 1Z2LA 3NG8A 1TL3B 5EGYA 2V69A 3M6XA 1JLEB 2BRLA 3M05A 2MJUA 4Y3CA 1LW2B 2NSBA 3EXCX 4QWEA 1SVDA 1WHVA 3P5TL 3RAQA 2DXFA 3VAMA 1AROP 3FMWA 4WP3A 5KFNA 3LAKA 1PILA 2QYGA 4M5MA 5AXMA 1PYSB 2LECA 2XGPA 2LFVA 1R8PA 2HFOA 1TKXB 4PG5A 2HSEB 4UQTA 2LLZA 3O2IA 1SQGA 1QE1B 4FS2A 1RTIA 1FRHA 3BSCA 2VB6A 4NCBA 4ZP6A 4ZHRA 5B0CA 2ZZTA 2CJQA 2LDIA 5SUHA 2NR0A 1RHJB 2VBWA 1DTTA 3WIVA 1CJKB 3CF5Q 3KJVA 3HF5A 1XR5A 3C15A 1Q82T 4FF3A 3D5MA 3RUBL 1UKUA 1V9OA 2DH9A 2W2OP 5ADZA 5DRKA 1X4GA 2F63A 4BLGA 4N77A 3A12A 1FEEA 2D74B 2YKNB 2JX2A 4BWMA 2Q79A 4LSNA 5DDOC 3TYTA 2CQ0A 1FKAF 4AXIA 3TUJC 3DDKA 2HYIB 1MU2B 2RKIB 1VISA 1FFGB 5J2MB 2QL7B 4AL6A 1EX8A 2Z2ZA 1M5SA 3UDLA 5HLFA 5D0GA 3EZOA 4NASA 4C8NA 2N4CA 3VV2B 3HO1A 3PV8A 3VGTA 2UVRA 5LXYA 2UXCF 2ZKTA 1JIHA 4PABA 3MM7A 3CJRA 3OBIA 4EUVA 3JS9A 1YITS 2BJ1A 3M8WA 5HL7Q 3QAEA 1R89A 5HO4A 3AA8A 3QO9A 3JYTA 3TNVA 5ETVA 3MMCB 4PWWA 3NY0A 1RAJA 3VTIA 4YS2A 1NK9A 2XI2A 3BS9A 2XMKA 1X0PA 3KK2B 4Y6IA 3DRRA 2AF6A 1EZZB 2E1CA 3ZTRA 1QAJA 2D69A 3DRSB 2PA8D 2VKRA 3G6ES 2F3JA 3SV4A 5CCLA 2YX1A 3ILIA 1S6UA 5DQHA 2GNKA 4ICLA 3I32A 4FF4A 4HHUA 4TY9A 2YNGB 1HNVA 4M5HA 4DR4J 2NZ4A 2MLYA 2WZ1A 2X1FA 3BGFA 5HJYA 3P5BP 3MM5B 3C6UA 2HLUA 4DPUA 1HNIB 3ZXWA 3GFHA 3F44A 4J9RA 3HHKA 3V4IB 4DR5J 2W8LA 5H9EJ 3W5ZA 4CO3A 1XMQF 4J9VA 2BV3A 1G3OA 1C4CA 4XO0A 1C1CB 2OHDA 1X4FA 3QZ7A 1XK8A 1S5ZA 2FJVA 1GMWA 4EBDA 1T0TV 1TL1B 4USMA 2QFJA 3FUYA 1EKRA 3V81A 4NI2A 3M32A 3SSSA 4W4MA 3EGVA 4DFPA 2YNHB 3RR7A 3C19A 4FPIA 1IR2A 1DARA 4WCEQ 1H72C 3PX0A 4KYZA 1VIXA 3R7BB 2QC3A 1UJ5A 1IKYA 2DNQA 2I0XA 1SJ1A 2FB0A 3BQ0A 3IWLA 1R27B 1KLNA 3EVMA 3AB4B 1RT1B 2ADCA 1SJ4P 3M1VB 2IYGA 3B4MA 2J7WA 1DQ9A 3BGOP 3M2UB 1XJWB 2FJEB 1HWJA 3DN9A 2GJ2A 3PKYA 1Q16B 2FGOA 4M1KA 4QU7A 2RU3A 1CLFA 2FC8A 3AD7C 3T41A 4OJ1A 4YB5A 4U95A 5IT4A 4Y2IA 2B5JB 4NMLA 1RTJA 2DGVA 2PN6A 3WX8A 3JSMB 2GW8A 1QSYA 2FVPA 1FE0A 2AGQA 3MMAA 1S1UB 5A8KA 2FD2A 2OPPB 1R0CB 3OTEA 3W62A 4ELVA 4ELUA 4C2MA 3ZZ0A 1Y7PA 2KFYA 1F3FA 2UVUA 4CTAA 2CKWA 2DBBA 2FVRA 5GMEA 1Y5NB 2YQ0A 3W65A 1BWEA 2M3DA 5F8HA 1JXLA 3OHBA 1GXLA 3TEHB 1N34F 2XMMA 4O4GA 3Q8RB 2DR7A 1SJQA 1PCAA 4L6V3 3R5JB 2NQPA 2C1EB 5E41A 3D1OA 5DS7A 1S0MA 2ZZMA 1J5OA 3CJTA 3SMZA 2RAQA 3SXLA 3PW4A 5M2RA 3MR7A 3GYXB 1WC4A 4ECZA 2HHTA 4P7TA 2K3IA 4JI3F 3PEHA 3H59A 2ZJRQ 4IH5A 3IFEA 1T8EA 9ATCB 1SH3A 3NOCA 2QA4G 4F0KA 2DEJA 3QLHB 4C0OC 2XYGB 1M1GA 2R7VA 3H4BA 2PMZD 1F2HA 3O3LA 3ENVA 1ZBTA 3GSDA 4GRSA 3OPKA 3TVYA 2RRBA 2EI5A 3HJFA 4DR6J 2DNGA 4E8UA 4OYAA 2J9CA 5F8IA 3OV7A 2W9BB 1FJEB 2AZ1A 3CDBA 3GLJA 1I1GA 4Y0FA 1S12A 3OSNA 4PXBA 5KG7A 2EK6A 3CDEA 1K1QA 2EFVA 1X4HA 1S1VB 4I64A 4CCHA 4WXWA 4AYBD 5I42B 1QTMA 2HZCA 1S9GB 2KXNB 4QIGA 1ZH5A 1VQ7S 3J7YI 3HZGA 5CYJA 3MM6A 3M8SA 5C2CA 1YWXA 4FBUA 3P4UB 1R0BG 5E3AA 4NA2A 2EEYA 4QJVA 4ENOA 2N7CA 2LXIA 2BA9A 3THPA 2JVOA 5BYRA 4CLYA 1NSQA 4I2QA 3AQPA 4LF4F 2ROGA 1EKSA 1NPPA 2GIRA 1KC8T 1FESA 3I0RB 1X7VA 4KJIA 2AWZA 4HHHA 3SSQA 4OL8A 2BBEA 4M5LA 2KT5A 1VRQC 1R8BA 4FNHA 1JXVA 1HBMA 3LP0B 2VJUA 3OLAA 5J2QB 1ZYQA 1FXDA 2AP6A 4A8QA 4HHJA 2CZVC 3SDEB 5KFDA 1NZ8A 1RWVB 4QYZJ 3W61A 4BWJA 3D9BA 5IWAJ 1D3WA 1U1NA 2P6TA 1UPMB 1Q53A 5L46A 3AODA 3CMQA 4DWIA 4FNIA 3JQMA 1LV5A 4Q2MA 3W7BA 1ZTWA 2R7TA 2CADA 1EHWA 1A0OB 1I6JA 3R6GB 5A8WB 3AD9C 4ZDNA 3NMAA 3RG6A 2DNYA 4F02A 1XN9A 4CYUB 3K7RA 4ANDA 3S01A 4PUOB 4EEYA 3OHAA 3PRVA 4HDHA 2IDEA 2YXLA 1VQ8S 2O67A 2OJ3A 4DUYF 2KG1A 4F8RA 4B9UA 4AFFA 5H9EK 1WOOA 4ZVOB 5BYQA 4ZLNA 2WK4A 4K4SA 5HN0A 1I94F 3R5DA 1FO1A 1TZ0A 3FVYA 2RUSA 2NUHA 3OTCA 2C2RA 3MAAB 1RGVA 4U96A 3Q2TC 2FHKA 4DR7F 2LQJA 3DYAA 1WWHA 5K8MA 2D7SA 4HT5A 5BJRA 4WFYA 4L76A 3W9HA 4F3QA 2ZOMA 4TN2A 3KLEB 3QAUA 3ZO7A 2HQ3A 5KG2A 2ZE2A 2XC9A 4LF5J 3D28A 1SCJB 2V2QA 3M8RA 1U24A 4E2FB 1OIAA 4OX9F 3EGNA 2A1BA 1YVFA 3AXKA 1MN9A 3HT3A 1JB0C 2MZ1A 3H0PA 1U0HA 1RKJA 5HROA 3KG1A 2BKOA 1NKBA 1V3RA 2GA7A 1N33J 1FJGJ 4RKUC 5HMWA 3OR1B 4F7VA 5K8NA 3PX6A 5B0AA 4FPRA 3CCMS 1RDRA 2MHEA 2OPSB 3MECA 3NS5A 4I67A 3KMQA 4JI5F 1UW4A 4PYDA 2YWWA 2G0JA 4MIBA 3DLKB 3M9MB 2DGXA 2RD5C 3TAMA 2RIJA 2LDYA 5EHHA 3GYGA 1SBRA 5CH7B 2JLGA 5ETOA 4NEYA 3X3UA 4CO4A 2N3LA 4PXDA 2VBZA 3CMAS 1UWBA 1KN6A 1X0FA 2LKZA 4C0HA 4MKVA 3VAFA 3OTOF 3ZNJ1 4ANEA 3PACA 2BW7A 1RBLA 2ZBCA 2VC1A 4DV7F 3IAS9 3SSRA 1IQTA 4F2RA 5LOQA 2V0NA 1WG1A 4P52A 3QRPA 2CNLB 3BSNA 1SXLA 5KFFA 3VAKA 2HBYB 2B8PA 3J7A1 2BQRA 1SV5B 2CVEA 1LEOA 2XQCA 2GS8A 2VDIA 1U47A 1HYSB 4NZ0A 3QRQA 1AFJA 1PC5A 1LW0B 3D1QA 1MWYA 2VPZB 1SKSA 2RRAA 1QAIA 2VQEF 2FC9A 3CB4A 2ZH6A 2IY5B 1OPZA 2A0FB 4ZVPB 2ILZA 3OVSA 5IT9Y 1H3DA 1RA6A 3OT9A 4OLPA 2UXCJ 2I8EA 4ZCMA 1TKZA 1T9VA 1UPPA 2BVZA 4YDDB 3ZZPA 3N4WA 1QTNB 3MR3A 5FJ4A 4ETXA 2EXUA 2MQ8A 1N36F 2VKZG 5D3GB 1X5TA 3UDCA 3CJ3A 2HFNA 5L1JA 5IS2A 3LAMA 3TX0A 4WFBQ 4OJGA 3I4HX 2QT7A 4MK7A 5DETA 3FEYB 1IKXB 1S10A 1HR0F 1JKHA 3QQCD 3TQ1A 1P1LA 2W24A 4YB1P 3M4XA 3JAMU 2HHHF 2XYPB 2C42A 2QL5B 2VICA 4NZ7A 3QGGA 4MKYA 2KJVA 4KHPF 3UCZP 4GC6A 4Y28C 2FJDB 2FY8A 2K1RA 4O44A 4QW9A 1F5AA 3LP1B 3R9LA 1XMQJ 1JLFA 3BGRA 4J9PA 1Q81T 2CQ3A 1S0OA 5AXLA 1LKZA 4P73A 4PG8A 1X9WA 2BANA 4OI1A 1ZTTA 4V1Ak 3K5LA 2H4YB 4LBPA 2XMAA 4I69A 3M2VA 4ITSA 1S9FA 2LXFA 4Z2XA 5L38A 4DSLA 2FPHX 4C11B 2F4FA 4NZ6A 2AV5A 4QYZK 1FE4A 2V2KA 4IFYB 3I6PA 2CPDA 2IRYA 1EQMA 2R8IA 1U1KA 4K8RA 3MM8B 4YY3F 2B6AA 2AYBA 1TVRA 5B09A 3ET6B 3DU6A 1FRLA 4ZS6A 2CQBA 5GAGU 4DI6A 5LJ5Y 2M8HA 1JLQA 4I6AA 2OD6A 4FYDA 2L9NA 2FZCB 3VZIA 4BCAA 2VPXB 1T9WA 2DGSA 3M6VA 3C2PA 4PCQA 3DMJA 3GJTB 4A8SA 4DHVA 2QZ8A 4F36A 4C9DA 3AJ1A 3DGPB 2R7UA 3GCXP 1P6TA 2IMWP 1SJFA 2PE8A 1G4CA 1SQEA 1M5OC 3CIZA 5CAAA 4NE9C 3H25A 4J9NA 3KWMA 4RL1A 1NHKL 1QLNA 1YHQS 1NK8A 1Q8IA 1HNVB 1FNXH 4UOHA 4DV5F 1IN0A 1FF2A 1TK8A 4FXVA 2G2ZA 5LL6d 3K5MA 4N76A 4GVBB 3W2VA 2MB0B 4XIUA 1AXQA 3HKWA 3QT8A 4IH7A 2BRKA 1BUXA 2GAHC 4PWDB 4HTIA 1N34J 3PIPQ 1OMSA 5B0GA 2HZVA 3GCWP 5D4NA 2H65B 3HFVA 3L7UA 5KFJA 1WSRA 4MFBA 2Y1RI 1RT5B 2NS1B 3ISNC 3LWMA 2Y3YA 5ETPA 1WD6A 5C25B 1X31C 1VHFA 2HWHA 6AT1B 2VONA 3POTA 3PCOB 2W9CA 2EPIA 1WDDA 1CPZA 1OY8A 1YJVA 2M88A 4JI3J 5ETQA 3E51A 4F25A 4U6PA 3CMES 5F8JA 1S7IA 2DRBA 5K8OA 3NS6A 4NI2B 4YQWA 4LVOP 2BXJA 4PPZA 1S6PA 2BKNA 2KM8B 3LH2S 5K8PA 3VAGA 2EBGA 3LP2A 2BE7D 3L7OA 2RQ4A 2V8GA 1C0TA 1N88A 2P5VA 2WTFA 2EKNA 1IKYB 2DHXA 4OHZA 5IFMA 4L3NA 4LIRA 4DCPB 3WBZA 5T14A 4OYMA 3DLBA 4HT7A 3IP0A 4ZCLA 2XMUA 1SL1A 2LEBA 5B0FA 4ED8A 5F0WA 2KHCA 2VASA 4JI0F 4IOAQ 4I6WA 5HP1B 2IBOA 2DGTA 2XHWA 1NK0A 2HHVA 4X62F 2DRDA 2Z2YB 2JH3A 3TW0A 4H4OA 3T5LA 3MD3A 4U7CA 3GIJA 4ANCA 3U1LA 3PKMA 3F41A 3SCJE 4ECYA 3KUEA 3NNAA 2OPQB 3TJ8A 1RWOB 4ZIVA 3DI6A 4RW4A 1VQ5S 5D0EA 4OFZA 3D6TB 5ITHA 3BPSP 1IWAA 3LA0A 4LF4J 2BE9B 2X1BA 3HHDA 2VPWB 3IRXA 2FJBB 2M0GB 4DLEA 3NKYA 3AQOA 4P71A 2MMYA 3U02A 3QJLA 2PA3A 1B4SA 4YR2A 1QVFR 2HRUA 3ENWA 4U8YA 1RT4B 1N6QB 2IHR1 5KFPA 1J5OB 3GG1A 5DLGA 4K0KF 1MROA 2NZCA 1S1WA 1U6ZA 4ZJLA 3J7AN 4DSEA 1U8WA 4RLEA 2ZWPA 1F60B 1FDNA 4ZVRB 3CJKA 5C5JA 3BBCA 1CJVA 4FDFA 3HVRA 4LVNP 4M94A 5MAOA 2COLA 2JHEA 2YQ1A 3RJMB 1AW0A 2J6SA 2CQHA 2DR6A 2NREA 3LO3A 3CJSA 1D9FA 2VG5A 2B51A 3D68A 4ZITA 4LBIA 4RNMA 2HGMA 1TAQA 3QGIA 3P8BB 5AE1A 1B7YB 4DUZF 4DUYJ 1HPZA 2GHPA 2HNDA 2MKCA 4I7FB 2RMLA 1QD1A 1B0TA 2CJXB 3UN2A 2R7XA 3QIPA 1I94J 1NK6A 4X4QA 2F7VA 5FD1A 2HLTA 3TZYA 6FD1A 1WKKA 2IAJB 3GFYA 1NKCA 3M8YA 4QIFA 3EZUA 3OSPA 5KT4A 4DR7J 3DKDA 2LMIA 2YWFA 5EWFA 3MEGA 4U9RA 5A8RB 1WF0A 3UN5A 2JFKA 2QG9B 2HIYA 4ECVA 2YNIA 3MM6B 4CI0B 4HH1A 1W2IA 3HHLD 2HBRB 4NLRA 3UW1A 4NCAA 4HTJA 4F50A 1D09B 3PJXA 1YJ9S 2NXEA 3PW5A 4ED4A 4WF9Q 2NXJA 3ONQA 5DM6Q 2R3VA 4LBHA 1RB0A 4OX9J 3NGRA 2DGOA 1T05A 5KT3A 4I2QB 3PR5B 2V50A 2ALZA 4LR9A 2VODA 1LWCA 2ZWOA 1GT8A 1DURA 1SL0A 3T1YF 2QJ3A 4DPTA 3UCGA 3KLVA 3G8QA 1UZHA 4PR6A 2D9PA 5B0BA 4NLWA 1S9EA 2ZEJA 2H54B 4DPWA 4YHHF 1LWFB 3B54A 4ECXA 1AZSB 3FJ2A 2B7BB 3H4DA 2XS5A 3CCWA 1BMQB 2XMJA 2P9GA 4MK9A 1U48A 4JI5J 4EYIB 1JK9B 4NLVA 4ZVFA 1VIOA 4RJVA 1TL7B 3MPUB 3Q23A 2XY5A 3R1HA 4NCGA 1ZAVA 3IN5A 3K17A 1K0TA 3M30B 5L39A 3W60A 2L08A 3V6DA 3OTOJ 3DRPA 2GC8A 3A3OB 5KTQA 1RAEB 4DV1J 4DV7J 1BY9A 1RAFB 2V8DA 1SB6A 3RR8A 2RDJA 3DOLB 2XS2A 1VDHA 5KFBA 4L75A 5L1IA 4C3LA 4YFUA 3DHXA 2V34A 3W9JA 3JQKA 3D67A 3DDNA 3TJAA 1ZPVA 3E3XA 2CPIA 4PQAA 3PNIA 4Y34A 3T5JA 1NRKA 1FKOA 2VQEJ 1DZ5A 3VQSA 1T03B 4X4PA 3UNGC 4MKBA 2ZUAA 3R5GA 2VV5A 1SI9A 2CIMA 4R5PB 2DH7A 3QSIA 5KAKA 2XCPA 2ZE2B 1CC8A 3O6QA 2XHCA 4X66F 4A8YA 1TL3A 2JOQA 1T9YA 4XDCA 2P9CA 4LRBA 4PEOA 2HW3A 2JLEA 1LW2A 1U0HB 1N36J 2BM1A 3RB6A 4B3MF 2QEXS 3GV8B 2J0XA 4TU7A 2BOAA 3QATA 3LWLA 1YRXA 2FLNA 4BS2A 4UZCA 5DG8A 1ZPWX 1VQPS 1X4DA 4IRCA 1QE1A 3GWCA 4ED6A 1HR0J 2DK2A 4ILLA 5C24A 3LGHA 1KQKA 2HHHJ 2HVHA 2LQ9A 1WOSA 3EYZA 2IC3B 5EWEA 1VLYA 4KQZA 3TAMB 4C98A 1QSLA 3WZ0A 1FDBA 2GQCA 2F40A 4KHPJ 5C2GA 3DM2B 3I55S 3S8SA 4DL2A 1HD0A 4HH0A 3NWRA 3TX8A 1KHVA 4USUA 3K0JA 1CVJA 2YKNA 3HFKA 1OSCA 3LUYA 2MY8A 4DQSA 1QSSA 2KH9A 3N5BA 1CJUB 3I9ZA 4F4WA 3D6MB 4C8YA 1GTEA 2RKIA 2B43A 5J2MA 1N5SA 5KFCA 3N6NA 2KDOA 3BKUA 1S0VA 3CDUA 2QRRA 3ISZA 5KG3A 5A0YB 1T9XA 2PC6A 1K1SA 2GIQA 2UZAA 1RAIB 1Y3JA 2VBXA 1S6QB 1DQAA 3J80U 3BR8A 4CNZA 4NLDA 1NJWA 1Y3KA 2AMCB 4CDIA 1A7GE 1ZM4A 4OYIA 3EX7B 2KU7A 2RILA 1F9FA 4YY3J 1FRJA 1HFEL 3L9ZA 2ZH5A 4FYVB 3NLCA 3EE3A 3DRSA 2ZNYA 4WFNQ 2HS4A 4PG7A 2C2MB 4EBEA 3AFGA 3ENAA 3LOUA 4DBQA 5HAOA 2L48A 2XMTA 4M8LA 2YNGA 1HWKA 5FDLB 3W9IA 2KVQE 2YWHA 1DJ0A 2HKEA 3MM5A 3MXHP 1RAOA 1T94A 1HNIA 4DV3F 3LGNA 1FKPB 2EBEA 1PBUA 4OI3A 1MWQA 3V4IA 3ZTQA 1TMMA 2IVMA 4CH0S 1C1CA 3FBEA 4N8NA 3G9CA 2O01C 4QZVB 4DV5J 2YX7A 1U0SA 3KLHB 2HRYA 1RKIA 1GX6A 2KFZA 4JV2A 4DL0C 4HEA9 3J7Z5 3R8YA 1GNKA 4QWDA 4JI8F 3PYGA 1KD1T 2I1RA 4EU0A 3OJUA 5GMKa 4UUWA 1SQFA 2BE2B 2DPIA 2K1RB 2GHWA 3SCLE 4KB7A 4DLGA 3B4DA 3EVWA 1RT7B 3UDEA 4DOZA 2UU9F 3H8YA 5IM0B 3H5XA 1GX5A 2VFSA 2A6MA 3UDVA 3CDAA 2QLXA 1RE1B 2AHOB 3GFZA 2XMVA 4C48A 3M2VB 4NLXA 4P2SA 5KFKA 3GMGA 4KGXB 1RT1A 1HD1A 2H3EB 3M1VA 1MMDA 3RW6A 3LALA 3TAPA 4WKRA 2YVSA 1BC6A 3M2UA 3GJSB 4NXNF 5L1KA 1OY9A 2AU0A 1M5PC 4TY8B 4QR1A 1YBTA 3J81j 5HQLA 1L5UA 5D4PA 4HL9A 1RUSA 2B6AB 4JV5F 2DO0A 1TVRB 2B5JA 4CT8A 3KMSA 1NZAA 1WG5A 1HW9A 1KS2A 4C6AA 3JSMA 4ZPDA 1JLQB 2ZHBA 2QV6A 1O8BA 1UETA 4HACA 2OPPA 1EB0A 3E01A 2CZ4A 4WIQA 3L4BC 2NPIA 4JI0J 3S7RA 4C0BA 1H74A 5DG9A 5AXNA 3NAIA 2G2YA 2VU5A 1BQXA 1ZM2A 4IH6A 1HNWF 1X9SA 2CWKA 2AYGA 4X62J 3M8ZA 1N48A 1D9AA 4DZ6A 3CCQS 1RYSA 3CXCR 1BWVA 4IRDA 1X5OA 1RXOB 2B56A 4DN0A 4FS1A 3A13A 2VHGA 2VC0A 4DS4A 1SKRA 4RUAA 3GV5B 2YWEA 2ABYA 2Z58B 5B0DA 3GP9A 5HVFA 1S7HA 2Z30B 4IKAA 2C2NA 5B0EA 3J81U 4CLZA 1NSAA 3ADAC 3PFOA 3QLHA 3KLGA 2UV8G 2UUAF 1FHTA 1LXNA 3AAWB 1EETB 4DV6F 3R97A 4MT1A 1ZAXA 2PO4A 5DDRC 2DNPA 5E0OA 2OFGX 3U27A 4K0KJ 3AOCA 3V4MA 2WB4A 4G1PA 4KPYA 5F3TA 2AGOA 5THWA 5E5NA 4ZN3A 3MAHA 2QYCA 2R7OA 4JOUA 4K59A 2WRMA 1SC6A 2NYIA 3EWGA 3GIMA 3A8KA 1S1VA 3TRGA 4KGZB 4UOGA 1UEVA 2XO6A 1S59A 1YKWA 5I42A 4QIEA 1S9GA 4DF4A 1HHSA 3LP2B 3KXDA 2PDAA 4K2XA 1IKVB 4KHMA 3NL0A 2VD3A 1HNXF 4M5IA 2YTCA 4USWA 2UV8A 3MI7X 4QR2A 1XWLA 2CA9A 3HLUA 4X2BA 1KQGB 4DUZJ 1KBRA 4CLLA 3PX4A 1ZOTA 2RS2A 5KFEA 3QPIA 1LQ9A 3LF0A 2IYIA 3SFGA 3M8PB 2D3ZA 2KG0A 1MNEA 4CH1A 3IA0A 4RO0A 1ZA2B 3ETMA 3M9NB 2RDIA 2B3TB 3KG4A 3N6LA 3OQ2A 3G6VA 3ZZZA 2DXDA 2M8DB 2ZH4A 3P96A 3W5XA 1VBKA 5AXKA 4RUHA 2JEJA 1SJ3P 1HQUA 1HBOB 4OI0A 3RYLA 3PM9A 2QE5A 3LP0A 1NNDA 4F0MA 2DY9A 2CJBA 3N9UC 3DI6B 4RW4B 2MJNA 3SDEA 5LXRA 3VAIA 1HWUA 1VR6A 3CTRA 4L74A 2WVFA 1IXKA 1LFPA 4Y2AA 5DQIA 3T1YJ 1IJFB 4WKYA 2XSJB 1XNQF 1X5PA 3K2YA 3MEKA 2XCAA 2HFVA 1GXTA 2MQOA 2DH8A 3BDEA 3MR6A 3H5SA 1N5TA 2K06A 5A8WA 4KGMA 1KP6A 3D54A 4YHHJ 2ZH3A 2FLOA 3KFWX 2ZZNA 3PO5A 2KVIA 3HJVA 3DC2A 3BBBA 2JFDA 2ASDA 4LF8F 1RHUB 4ZPCA 1KLMA 1FRMA 4X64F 2MQMA 2XBPA 3MR2A 2XI3A 4FP9A 4LQ3A 2CWXA 3KNGA 1K0VA 1RTHA 1Z2ZA 1KOHA 4V19X 1LWEB 3WHIA 4WTOB 1NPRA 2CPZA 1M1KT 3QFHA 4H4MB 5KT2A 2JEGA 2LQ8A 2LA6A 3MTJA 2ASJA 1NHVA 4KRWA 5GAGI 4WFAQ 5ETLA 1XC9A 3C46A 3F56A 3EICA 3VVTA 2A3JA 5HMZA 5E3QA 1NDPA 1EJ7L 1FD8A 1U02A 4ER8A 4KHRA 1REVA 5KFYA 4LRAA 2BEFA 3OL7A 1BQMB 2GQ2A 3RZAA 2VG7B 2ZVSA 5IQ6A 4NEZA 3NGUA 3MF5A 4Y2KA 4DS5A 2YH0A 4C4WA 2CQDA 4ZP9A 3GJRB 4PPDA 4Y00A 3KUHA 1F6TA 2D3OR 3A4TA 2V4JB 1S1TA 3NP5A 4XPEA 3OR1A 1DAXA 4FXDA 2HFSA 3HFZB 2DO4A 2F8MA 4DG1A 2ZHAA 1DTQA 1F5BA 2HAFA 5HSPA 4DQIA 2KFNA 4LF1A 1NCLA 1RAHB 4X66J 4DZDA 1GTHA 3GR0A 2K8GA 3FMBA 2Y8YA 2PMWA 2Z2MA 4D3HA 1WORA 3BGLA 5ETKA 1D8YA 2E5IA 4TQRA 3DNCA 2KJWA 4B3MJ 1P9QC 4QIVA 1VQOS 3TUPA 3ILOA 2HQFA 1C0UA 4C3KA 2XTJP 5JJBA 3OLBA 1JMTA 2IJRA 1Q0NA 3CCRS 3FDSA 4HVZA 4ED3A 2HK2A 3HPOA 3ZZRA 3L09A 3PG9A 1IWGA 1S4FA 1U26A 1YG0A 4AQYF 2XM3A 2EVZA 3PFEA 3MEDB 2ACYA 3UWTA 1V3ZA 5E3PA 1TQLA 3Q86A 3MR5A 2WHOA 4RZRA 1U1QA 3CC2S 4LR7A 2DNHA 4LREA 1U4BA 1VRTB 3V6JA 5DM7Q 4YB7A 1UVKA 4WBFA 3RBXA 5D0HA 1X4BA 3HHEA 4H4KA 5DDPC 2POKA 1F9EB 1LW0A 2B9YA 1RU2A 2DISA 4YR0A 4L72B 2WVEA 5H9FK 2DYAA 3OFFA 1WJ9A 3IWNC 1UVMA 4KBIA 3Q8YA 3VGVA 2ZOGA 1YBUA 1RT3B 2E7VA 3TA0A 4CLFA 3I56S 2DPJA 1HHQA 2CDQA 1D9DA 3R1LA 1U1MA 3ZZTA 2QMWA 2AJFE 1OPIA 1OYEA 1L3SA 1A9NB 3X1LB 5L9NA 3PTWA 2EFNA 1H7XA 2ZM6F 1XTZA 3C16B 5D3GA 5K5MA 3UVJA 2UVWA 3BYRA 2E5LF 3VGSA 1NSKL 2RU9A 1JNRB 3P49B 2KL8A 2OEMA 3H90A 4DV2F 1SUQB 1TK0A 2HWIA 1G1XA 3FNNA 2L9WA 2FJXA 5GVQA 1RLDA 4RU9A 3KOAA 2FVQA 1F0XA 2C22A 2AYEA 3MEEA 2J6UA 3W8GA 4CLTA 4HR2A 1T9UA 4D3GA 2O5DA 4DV3J 5CABA 1XERA 2Z8QA 5KT7A 2V9KA 4MIWA 2DNRA 3LP1A 3R5AA 4CH7A 3D0HE 4KO0B 1U2CA 5KFWA 4O4RA 5C24B 2RE1A 1X60A 3A8IA 3C14B 3MFHA 4G65A 5A2QU 2FLPA 2XB2D 4DX5A 3C66A 4ILRA 2PMHA 4DQRA 1R3NA 4C11A 5LMNF 2BJDA 4IG3B 4IFYA 4Q0BA 3NBPB 1OWXA 5DJBA 5AJ3F 4JI8J 3WC2A 4OZ0A 5F0UA 4WP9A 2Q43A 4B02A 1BQNB 1IM4A 3CCES 3DLGB 2DKOB 1KQFB 5FLXU 4OLOA 3MM8A 1H38A 3FSIA 4NLSA 1XR6A 2UU9J 3ET6A 3HCXA 4OI6A 4JYAF 2YKMA 5CHCB 1N5VA 2ZBRA 3AOAA 1W25A 1PAEX 3AOBA 1ELOA 4NLOA 1MWZA 4KFBB 1VGYA 3BO3A 1JQGA 3IMQJ 4NXNJ 2FHJD 1V3SA 1JLAA 3T19A 2XG8A 4RR5A 3K8VA 5A6PA 3EM1A 1L3TA 1CS4B 4O0IA 3NGTA 4P7VA 2UUBF 3QJJA 4OX8A 5KG6A 4RBVA 1XR7A 3HHLB 1BHNA 1WELA 3TVKA 4RNOA 4JV5J 3LPEA 3VF0B 3DGPA 3WX4A 4Y2MA 4EO8A 4DQPA 3BSOA 9RUBA 2CQ2A 4ZP7A 1KVJA 3PVXA 2ATCB 4YOEA 2HVZA 1AB8A 4J9QA 1T11A 2ZDPA 5ETNA 1HIYA 2MGZB 4FYWB 3BO2A 3CCTA 4KC5A 1FWLA 1WEYA 5JMNA 3GZ7A 3MPDA 3IS9A 1HNWJ 1WSVA 3IWXA 4QBUA 1MSWD 4GVBA 5E7OB 3AA9A 4MIAA 2E44A 4PWDA 1KNZA 3CNQP 4EI2A 3H7HB 1S77D 3JB9k 4U8VA 3OR2A 1VQYA 3MDFA 5IQQA 2AJ4A 1RT5A 5D15A 1CJTB 4MKAA 2CZ9A 4F26A 3FSXA 5C25A 1PJ5A 2IM2A 2VOPA 2HMIA 2E5HA 1L3KA 3RBDA 5CA5A 2HHXA 5H1SV 1YJTA 4WP8A 1FDDA 1X8DA 2F4VF 3HSJA 3BH7B 5KFXA 1T9TA 4ID5B 1VI7A 3BV8A 2NXCA 4TU9A 1MMLA 4KT0C 3TP2A 2N3OA 2UUAJ 1RWNB 2IIHA 1F1BB 4C8OA 5JVGQ 4DV6J 2JC0A 1IJEB 5EX3A 3FEXB 2KT2A 2R4FA 3H2VE 5KFIA 2P6SA 2V5HG 3FZBA 4ILMA 3U1NA 2YWKA 5F41A 3ETOA 4UT4A 1HNZF 4JI2F 2F9DA 3OXLA 2ZH7A 2FLLA 4C8KA 2W1BA 4K2JA 1K8AT 2MLZA 5HP1A 4NA1A 4Q8EA 3ISND 4OYPA 5F8MA 4AE5A 4OX7A 1HNXJ 2GJFA 2ASYA 1Y10A 3SFUA 2RQCA 4X4OA 3W64A 1YJRA 1E6VA 3ZFVA 1JX4A 1S57A 5HMYA 2OPQA 2E7XA 2OEJA 4FYYB 4HACB 2W25A 3MPVA 3THVA 3E01B 3IR6B 2B8QA 1R0AB 2V4RA 1XMOF 2F9JA 2FIUA 2W7PA 4QWAA 1RT2B 4R25A 3PW7A 1Q1KA 2WBRA 2N4DA 1WEZA 1IR0A 1RT4A 1N6QA 4YP3A 1M5VC 3AY0A 3ITHB 4ZVQB 1GEHA 3MMJA 2DNLA 3ZC4A 1AT1B 2CXEA 1N4LA 2PI4A 3CSKA 2DB1A 2RVJA 5KFSA 5KG4A 5GADU 2ZH1A 4USVA 3PHEA 4UW2A 2J0QD 1UZDA 1FA0A 2XLIA 1XNQJ 3G71S 5IT0A 3KLGB 1KRPA 3ILLA 3IR7B 4FZVA 1VQ6S 4IR1A 3C6TB 1SC4B 4A8OA 3AJ2A 1IM6A 1O0PA 5MLCV 2AJQA 3MCOA 4L3KA 3OTDA 3BKFA 2DITA 2LU1A 4F3MA 4LF8J 3W66A 3AHPA 1NU4A 2RH3A 1TV6B 4X64J 1M1HA 2OELA 4I7FA 3SQOP 1JJ2R 4N56A 1FJ7A 4XDDA 1E6YB 4ZVEA 4CLSA 2CFXA 4J7CA 2UUCF 2IAJA 4WE1B 4Q5VA 2R7RA 3MUMP 2RRNA 3OFHA 3KDOA 4R8UA 2XLKA 3MUTP 5A8RA 4TYBA 4QQBA 3K5PA 1RTZA 3UQSA 5D77A 1JLBB 3UPFA 3KUGA 3ZTPA 1U1LA 4XAKA 4ZN1A 5I3UA 5LSLA 4BHQA 1ULRA 1DLOA 3PJWA 5KFAA 2M2BA 1BLUA 1NJZA 1FX4A 2V6AA 2YKAA 3ENQA 1UCNA 2E9TA 2E66A 4JI7F 2WONB 1B3TA 1SJRA 2YPYA 4NLQA 3HXMA 3P3DA 2XMWA 2E5JA 1HQUB 3DRYA 2LQBA 3CJQA 2MSTA 1IQZA 4NLTA 1LWFA 3MUVP 2QFIA 1L3UA 3IBFB 3ZZUA 1AZSA 4KV8A 1WEXA 5KFTA 4J9MA 3KJFB 2RUGA 3G6XA 3N5FA 4GKJF 2XS7A 1TK5A 2J0SD 5CCMA 3K59A 4LRCA 1TL7A 2HAIA 4DR1F 1ACMB 3BB5A 1U2RA 2AEJA 3M30A 1IUJA 2X7IA 3D0GE 1QAYA 4WZQA 3DLJA 1GK8A 5DGBA 4B3SF 4OZ5A 3RBZA 2HHSA 1NH7A 2FVSA 1KLMB 2XLJA 3HT0A 2XNQA 4OHYA 3EGZA 4PAAA 2HQGA 1S76D 2VIHA 4X65F 4AQYJ 2CNOB 2PFFB 3DOLA 4LFCF 4NYZA 2HWTA 3OTBA 1RTHB 2GGPB 3Q89A 4DPXA 1HWIA 3CIMA 3CT9A 4CLKA 5LSOA 1YRTA 3TEGA 1HHTP 4S0MA 5HI7A 4DX7A 5EWGA 3RRGA 3TARA 1T03A 2MPUA 2W2PP 4P2FA 4UOFA 2AEMA 1XIQA 1NPKA 1RHRB 3GTYX 5DQGA 1S0NA 4R5PA 1RWKB 2ZHOA 5KFQA 1K73T 4OYWA 1CC7A 3AXMA 4K7QA 1REVB 4TKTA 3W8PA 3D4JA 3WDOA 2IFXA 3V5RA 4WYLA 5CZVA 2H9ZA 2FQQB 2OSRA 4NWBA 2GMHA 1VBZA 2OLWA 2FDNA 4F4YA 2ZM6J 1QDUB 3GJQB 1QVGR 2HQIA 2W01A 2DR9A 1JJ4A 3AJDA 3T3FA 1Q4RA 3DU5A 3HKZD 2E5LJ 2QA1A 1TL4A 4ZMMA 3V6HA 1S1TB 2AT1B 1MMNA 2EC0A 2G1HA 2QA2A 3O5TB 2AQ4A 4BC9A 3UD4P 4KAIA 4DV2J 3U1MA 4DG1B 1DTQB 4EMDA 2R8GA 4NYPA 3NGSA 4NX9A 3I31A 2WAQD 4ECWA 1EIYB 2DXEA 4CZCA 4PQUB 4ZCKA 2IC3A 7FD1A 4NOHA 2XY6A 4TU8A 4DDFA 1MW7A 4KGVB 1FD2A 1EQ0A 3DM2A 4X84A 1C0UB 1TR0A 3D7SB 3MM9A 2HPUA 3VR1A 4ED1A 4J90A 3NNHA 1HQ2A 5KFUA 5AE3A 1OJ4A 4JBCA 3E2EA 3NCRA 3US5A 5J2PA 3NAHA 1T02A 3KHHA 5LJ3Y 3OFGA 5F8GA 2UVVA 1APSA 2Q6CA 1CJUA 3OJSA 4GO5X 1SC1B 3FFIB 3GILA 2R7WA 2DY1A 3RW7A 1VJWA 2BX6A 5A0YA 1LWXA 4P6QA 4IDKB 3HULA 4J9OA 5LMNJ 3EJMA 3I96A 3F0NA 4NXMF 2J6TA 1RAAB 5AJ3J 1S6QA 4F2SA 2HVEA 2MZRA 5DGAA 3KK1B 3HI9A 5E3RA 3CO9A 3GYNA 1SL2A 2NPFA 2ADBA 2MSSA 1L3VA 4RNNA 4IRKA 3GU0A 3SYZA 1YJWS 2ZBIA 2V4QA 2D3O1 2M5YA 1H0HB 4O3NA 3PYFA 4RWWA 5T7LB 2KT3A 3MAQA 2RQKA 2H5EA 1G7CB 4E0DA 1WDTA 2ZH8A 2R7SA 4JP8A 4ETZA 2JL9A 5KT5A 2E1PA 2QLBB 1WI8A 1U6FA 5FDLA 2UUBJ 1W7WA 1GMWD 3UVJB 2V2VA 2GIFA 2IJFA 3MPYA 2X3GA 2DT9A 4YB6A 4LRFA 3QFWA 1FKPA 3FBBA 2E9RX 2GVZA 3UD5A 2CVIA 3PXGa 3THTA 1J27A 3BEGB 2IM0A 3G4SS 1VFJA 4IO9Q 2B0GA 1OQ6A 5KFHA 5CYMA 3KLHA 2W2MP 3MEEB 3G2XA 2BUNA 2V67A 3JTOA 1H2VZ 2LU2A 4ES3A 3VWSA 2BE2A 3TZZA 1N52B 4CO0A 3D3CJ 2DHAA 3QIDA 1RT7A 5IM0A 1OY6A 3MCSA 2VFRA 5I3PA 1GQEA 3H20A 5KFZA 2OIHA 4RUCA 4XK8C 2F4VJ 2ACMA 4RW6B 5IT9U 1RWWB 4DU8A 3H2UB 3MMBB 2HURA 4RW8B 4Q0BB 4ATNA 2OD4A 4N47A 2G2OA 4B9MA 3TZWA 1EP4B 4TY8A 5A6WA 2GHVC 3MCNA 3TANA 1H98A 1FFSB 1QM9A 4FXWA 4IOBA 2BDPA 1QAXA 3MOJB 1U49A 4FYXB 2ZJPQ 5HQ8A 3VAJA 2PFDA 2BQ3A 4Q44A 5GAHU 2YKMB 3SZ2A 2DD8S 4DEZA 1HNZJ 4JI2J 2FYXA 3UN3A 2K2PA 5DZ7A 4TQSA 2AW0A 2MZSA 2HGLA 5A76A 4YR3A 1OO0B 1AA1B 1D1UA 5ETTA 1JLAB 2B9XA 1RHQB 3PW0A 1U09A 3ULHA 2I5JA 1EARA 1GMUA 4M63A 3W3SA 2KHDA 2LEPA 1Q79A 1FI4A 4CT9A 3LGMA 4USHA 3QYYA 1R8HA 2AKWB 3IBWA 1S4EA 1YGYA 4FF2A 2J76E 2CQGA 4M95A 3L3CA 1FEHA 5L1LA 4WXOA 4Q8FA 2B4UA 1TUWA 1XMOJ 1NDCA 1R8AA 4EGLA 3G82B 1RACB 4I4BA 1UVIA 4IG0A 3IS9B 2W2NP 3R7NB 2IRUA 3NRBA 3PRDA 5FIIA 3NOGA 2VPYB 4B9TA 1R7IA 1WUUA 4UF4A 2EG1A 4DCJB 3CJ8A 1EETA 3OR2B 3HZEA 4LQ9A 2V94A 1S72S 1HQEB 4ECQA 3DXSX 4OZ2A 4OZ1A 4RW7B 2OP5A 3DLEB 1NM2A 2HMIB 2B9EA 4MMOA 5EDWA 2HS0A 2M4MA 1IBMF 4OHWA 3W2WB 3L7PA 3UFCX 2EK1A 4CM2A 3TUIC 2K7KA 1S48A 3G87A 1URRA 2LCWA 4J37A 4PG4A 5DG7A 3R3TA 2QX0A 4WK3A 3NS7B 2AIRB 4UOCA 3G96A 5L8RC 1LOUA 1IKVA 3MOZA 4IR9A 1HL6A 3T9NA 2OAUA 2ZD1A 3T5KA 4GMKA 3V6KA 1Y4ZB 4WYWA 3KLFA 3TVZA 4WU3A 2H5JB 1IBCB 3M8PA 4QIWD 2UUCJ 4RW9B 1XEZA 2H1YA 1S1XA 3GSIA 2PSZA 4A4JA 4G1QA 3MHYA 2VOOA 3FCWA 4ZVTB 4MAKA 2OGUA 3UI3A 2HIQA 4CO2A 1HBOA 2J7KA 2HNYA 2RS8A 1E6VB 1Z4UA 2LEAA 5F8NA 2A2DA 5F9LA 4LSLA 3OL9A 1UA1A 3IM9A 3SIPB 3TI0A 2K3KA 5CYQB 3NGDA 5D6GA 1FXLA 4L73A 3RB3A 3H2LA 3IXQA 3DRXA 2NXNA 5K20B 3GE9A 2HNZA 5KFLA 2FJWA 1XMBA 3OUYB 4JI7J 2XSJA 4HDGA 3DOMB 3AH6A 3H5YA 1NJYA 3MTKA 3S6EA 2OPRA 2RT3A 4ZPWR 2SXLA 2IA6A 1TKTB 1RT6A 2EFOA 2DHSA 1IKWB 4YN3B 1TP7A 1RCXB 4X4TA 1KKHA 2AX0A 1PG5B 4XPCA 3PR4A 3RRKA 1P9YA 2X1GA 3KLIB 4GKJJ 3NXZA 2F65A 3M8QB 1B64A 2DCUB 2VJVA 2BKPA 5C42A 4B3OA 4ZKAA 2HZAA 3I0SB 3QGPA 1NJXA 4BDPA 3EPGA 1K47A 1KR4A 2DJWA 2F5GA 1ITPA 4DR1J 4ES2A 2Z2LA 1LWEA 3SV3A 2G0CA 4X4RA 3C8YA 2MLXA 2H4WB 1FVSA 2FHOB 2C3OA 4B3SJ 3Q8PB 3T5HA 2VH7A 4H4MA 4ZPVR 3SQGA 1YI2S
chains in the Genus database with same CATH topology
3DNCA 2ILZA 5D4OA 2B9WA 3OVSA 2L3MA 5IT9Y 3CCLS 1H3DA 1RA6A 2IVYA 4OLPA 5B7WA 4YDXA 2KJWA 5CYQA 3BZQA 1JLFB 3BGRB 2I8EA 1P9QC 4QIVA 1VQOS 4ZCMA 1TKZA 2M52A 1HWLA 2A2CA 3TA1A 1C0UA 1FTCA 4LJMA 4C3KA 2BVZA 4YDDB 2BANB 3ZZPA 2UUWA 2QMXA 3N4WA 5JJBA 3OLBA 1FJCA 1WHYA 1JMTA 1KEKA 3MR3A 3OUYA 5FJ4A 3RAXA 4ETXA 3CCRS 3BN4A 3FDSA 1S6OA 4HVZA 3DOMA 5J2NB 1N36F 4ED3A 2VKZG 3J81Y 4H4KC 3MURP 5D3GB 1X5TA 3SCIE 3UDCA 3HPOA 3CJ3A 4IQXA 3ZZRA 1U2FA 3CD0A 2GMJA 3L09A 4B9SA 3CC4S 2HFNA 2Q6BA 1VOMA 1BQMA 3TO8A 5L1JA 5IS2A 1S4FA 1TKTA 1U26A 4ED0A 4R8UB 2VG7A 1YG0A 3LAMA 4AQYF 4WFBQ 2EVZA 3PFEA 1IKWA 1S99A 2IRXA 3MEDB 4I1TA 2ACYA 3UWTA 2OH2A 4OJGA 3I4HX 4NYOA 2N82B 1V3ZA 5E3PA 1NKEA 2QT7A 1N8RT 4MK7A 5J1NA 5DETA 4ALZA 3BN7A 1TQLA 3FEYB 1IKXB 3MR5A 1S10A 4F4ZA 2WHOA 4RZRA 1U1QA 3QGHA 3CC2S 1HR0F 1JKHA 3BJYA 2DNHA 3TQ1A 3KLIA 3NGKA 4K5SA 5G0RB 1U4BA 1DFDA 1P1LA 1VRTB 2W24A 3M8QA 2V4JA 4YB1P 3M4XA 3V6JA 4DFKA 5DM7Q 4YB7A 1UVKA 4OJHA 2FGCA 2HHHF 2NXUA 4F4XA 1X4BA 3HHEA 3PIOQ 4MJKA 5I3UB 1TL5A 4H4KA 4JV0A 5DDPC 2POKA 4LFBF 1LW0A 2C42A 3D1HA 3I0SA 2B9YA 1SIWB 2DISA 4YR0A 4L72B 2JRSA 1NAQA 1S1UA 2VZ9A 1DLOB 4TLRA 3OFFA 3M6WA 2B7CB 3IWNC 1R6YA 4KGKA 2MZTA 1QY7A 3V2UC 4NZ7A 3FQKA 1NB7A 1UVMA 2A18A 3QGGA 1Y00A 4MKYA 4KBIA 2KB2A 2KJVA 3BR9A 4KHPF 3UCZP 4GC6A 4Y28C 2ZOGA 2FJDB 4C7QA 1H2UX 3HX9A 4K4XA 3VALA 3EUNA 1X4AA 1RT3B 4DR4F 1X4CA 1LK7A 3QMQA 3TA0A 3CVKA 2K1RA 2EFQA 4O44A 3I56S 2VQFF 4QW9A 2DPJA 4ECUA 1F5AA 1BGXT 2CDQA 1D9DA 3CCJS 3Q0AA 2UXBF 3LP1B 3DMJB 2CQIA 3R1LA 1JLFA 3BGRA 3CPWR 3CEDA 3HDSA 4J9PA 2CQ3A 3ZZTA 1U1MA 1Q81T 4LMZA 2QMWA 1S0OA 2AJFE 2K7JA 2HHUA 5AXLA 4FVCA 1LKZA 5E2QA 3CD6S 1OPIA 5KT6A 4PG8A 1X9WA 2CG4A 1L3SA 2BANA 4OI1A 1ZTTA 3NMRA 3VCDA 2IVFB 1A9NB 3BO4A 3X1LB 1YIJS 3K5LA 1UFLA 5GAEI 2PGCA 4OZNA 4YMEA 5L9NA 4I69A 1ZZNA 4A8XA 3M2VA 4ITSA 4KV8B 2EFNA 1S9FA 1Q8LA 1H7XA 4ERDA 2Z0GA 2ZM6F 2LXFA 4Z2XA 1XTZA 5L38A 4DR5F 5J2NA 4DSLA 2FPHX 5D3GA 4C11B 3D0IE 2FHJA 4ZPAA 4NZ6A 5K5MA 1G6BA 2AV5A 3FEZA 1FE4A 2UVWA 2V2KA 4IFYB 2E5LF 3I6PA 3WC0A 2ZFHA 2CPDA 2BR0A 1VRUB 2MKSA 1HI0P 1JWWA 2OMLA 5DO2A 2IRYA 2HS3A 4RX6A 3H5UA 2RU9A 1JNRB 4OHVA 3P49B 3MEDA 2AYMA 1FTRA 2R8IA 4DV2F 1SUQB 1TK0A 2UXDF 2HWIA 1U1KA 1ZETA 3OFEA 4NLGA 4NLYA 1G1XA 3CD7A 3W2VB 4OV1A 1YJUA 2C3MA 2Q66A 3MM8B 4YY3F 2PD1A 2B6AA 1FNOA 4URQU 2NSCA 5H9FJ 3FNNA 2AYBA 3ICLA 2L9WA 1TVRA 4EBCA 1VRTA 1VQMS 2VA3A 2KRRA 5B09A 2R8HA 4I2PA 2FJXA 4DF8A 1U6BA 1U25A 3DU6A 5GVQA 1FRLA 4NRTA 3HHNB 4ED2A 4RU9A 4ZS6A 2CQBA 5KFOA 2UP1A 5GAGU 3KOAA 2FVQA 4E98A 5LJ5Y 2M8HA 4MFBB 1JLQA 1F0XA 1RTDA 2HVIA 5HBMB 2C22A 1FNMA 3R27A 2AYEA 4I6AA 2OD6A 1WI6A 3MEEA 2J6UA 4FYDA 2E1AA 2L9NA 4OIXA 3RB4A 3VZIA 4BCAA 2VPXB 2J0WA 4ED5A 4X4UA 1FRKA 4D3GA 2O5DA 4ZCIA 2DGSA 3M6VA 3POTB 2CQ4A 2W9CB 3DLHA 2W9BA 4W92B 1U8SA 2R2RA 1RT3A 1XERA 1U1RA 2Z8QA 3C2PA 4PCQA 2V9KA 5KT7A 2W7OA 2R2SA 2F1FA 4MIWA 4CNYA 4FN5A 2DNRA 3LP1A 3L95X 3DMJA 3R5AA 4CH7A 2GO8A 4A8SA 3D0HE 2OO4A 3DXBA 4DHVA 4KO0B 1M5HA 1M5KC 5KFWA 4O4RA 5C24B 2RE1A 2QZ8A 4C9DA 1XBWA 2ZJQQ 3BM7A 1T3OA 3AJ1A 3MFHA 2U2FA 1Y0HA 1UVNA 2R7UA 1P6TA 1S6PB 3NWGA 3D2WA 1SJFA 2FLPA 2IMWP 2ZUGA 2PE8A 4B9VA 2XB2D 4QOTA 3C66A 1U45A 3A1YG 1RK8A 4ILRA 1VS3A 2PMHA 4DQRA 1R3NA 2CJ9A 1VK3A 4OI4A 2KZMA 1SQEA 1M5OC 4C11A 1NO8A 3CIZA 5LMNF 2BJDA 1C0TB 4IG3B 4URSA 4ZK7M 2XO7A 4IFYA 3FZ2A 2JEIA 4Q0BA 3NBPB 3H25A 1FDAA 2KXHA 3Q22A 4J9NA 1OWXA 3KWMA 5DJBA 5AJ3F 3UCUP 4MH8A 1QLNA 4OZLA 3WC2A 4OZ0A 4U7UK 1NK7A 1YHQS 5F0UA 5CD4H 2Q43A 2R8KA 1NK8A 1Q8IA 1FRIA 1HNVB 4Q2LA 4B02A 2CPXA 5K14B 1SUQA 3UD3P 1FNXH 1C2PA 1BQNB 1IM4A 3PDNA 3DLGB 3CCES 4UY8T 1KQFB 3EXYA 2W7AA 4DV5F 4KR0B 1IN0A 1FF2A 2ZOFA 1TK8A 4FXVA 1N32F 5LL6d 3K5MA 4TXSA 4N76A 3W2VA 4OLOA 2MB0B 4XIUA 1AXQA 3CJ0A 2R8JA 3MM8A 2R9LA 3HKWA 5EUHA 4IH7A 5F8LA 2BRKA 3H40A 1H38A 3FSIA 3IGVA 4PWDB 3CJ5A 4HTIA 1XR6A 4NLSA 2YX4A 3PIPQ 2VG6B 5B0GA 4OI6A 5D4NA 1U1PA 5JXSA 4JYAF 2JDJA 3VZHA 4UY85 2BQUA 2JEFA 2YKMA 5CHCB 1N5VA 4ZLPA 5KFJA 1W25A 2RJZA 2IMOA 1ELOA 2XWXA 4PWUA 2BM0A 1DHMA 2DHGA 4MFBA 2Y1RI 5K9FA 1RT5B 4NLOA 2NS1B 3ISNC 1MWZA 3LWMA 4KFBB 1H6KX 2C2DA 2MQQA 3QZ8A 2VL1A 3I0RA 3U7JA 1WD6A 5C25B 4ZA1A 1VGYA 1YRUA 1F5CA 1VHFA 2CPFA 4H4OB 3BO3A 1T3NA 4RU2A 3K5OA 2HWHA 2VONA 4KTQA 3POTA 1C1BA 2FHJD 1V3SA 2W9CA 1JLAA 2CYYA 4DR3F 2EPIA 1CPZA 3T19A 2MHNA 2XG8A 1YJVA 5EX0A 2WOMB 1KFSA 2M88A 3E51A 4F25A 3P6YC 4U6PA 3K8VA 5GADI 3CMES 5A6PA 5F8JA 2GMLA 3GIIA 1L3TA 4O0IA 4P7VA 3N79A 2DRBA 3EZ5A 5J2QA 2UUBF 5G4DA 4KO0A 3QJJA 4OX8A 5KG6A 4RBVA 1XR7A 3HHLB 3TVKA 1WELA 7FDRA 4Z37A 4RNOA 1CQNA 5K8OA 3NS6A 1WACA 1A6LA 3I82A 3VF0B 4AXJA 3DGPA 4YQWA 3MZIA 2OSQA 3WX4A 4Y2MA 4LVOP 2BXJA 4PPZA 4EO8A 4DQPA 1S6PA 3BSOA 2NLWA 1X4EA 2KM8B 2DNZA 3LH2S 1VQ9S 5K8PA 3VAGA 2EBGA 4MTPA 1HBNA 2FHMA 2CQ2A 4KKOB 2JZ5A 4UUXA 4ZP7A 3LP2A 1KVJA 3PVXA 3L7OA 2RQ4A 2GX8A 2HVZA 4YOEA 4J9QA 4G1IA 3IRXB 2V8GA 2GFFA 2ZDPA 5CQGA 1GH8A 1C0TA 2W8KA 1N88A 2L9DA 4IG3A 2MGZB 2P5VA 3T6BA 2RSQA 3NBPA 2AX1A 5J1EA 3BO2A 2WTFA 2G9OA 3CCTA 3CDWA 2EKYA 4C8MA 1IKYB 1GXUA 5J1PA 2DHXA 4KC5A 3T1HF 4OHZA 5IFMA 1CEZA 4L3NA 2YKQA 4LIRA 2I9SA 3MM9B 3BDPA 3DFEA 4TYAA 4BC7A 5K14A 1WEYA 1SH2A 1BQNA 3WBZA 3DLGA 5T14A 3DLBA 4HT7A 3GZ7A 3IS9A 1KVIA 3OXGA 3T6JA 2MDAA 2RB7A 4N8OA 3IWXA 4K5RA 3N28A 3FGVA 4UQGA 4QBUA 5J2PB 1MSWD 4OX6A 4CQ1A 4ZCLA 2RF2B 4PUOA 2WBMA 5JVHQ 3F73A 5E7OB 3AA9A 2XMUA 1SL1A 4MIAA 1MROB 2E44A 2IM3A 4PWDA 4DR6F 2LEBA 5B0FA 3TOQA 2RQMA 5F0WA 2VG6A 2KHCA 4ED8A 1KNZA 3T9ZA 3SI8A 1S1WB 2XZWA 2VASA 4JI0F 3KK3B 2JJ4D 4Y65A 1S77D 1S49A 3HHLC 3JB9k 3Q8SB 4I6WA 4JUZA 4IOAQ 5HP1B 2MQNA 3OR2A 1VQYA 3MDFA 5IQQA 2IBOA 2DGTA 2AJ4A 1RT5A 2DNMA 4AL5A 4A8KA 2F8HA 2XHWA 2YKOA 4ES1A 4KFBA 4TLQA 5F3ZA 3CJKB 2KM8C 1NK0A 1NK4A 4IQMA 2HHVA 4MKAA 4X62F 4F26A 4QWCA 3FSXA 5C25A 2JH3A 5GAEU 4QW8A 2IM2A 3TW0A 4H4OA 2VOPA 3T5LA 3IG1B 3MD3A 3E8OA 4U7CA 2HMIA 3HM9A 2E5HA 1L3KA 1H7WA 1Y9OA 4JI6F 3GIJA 3RBDA 5CA5A 3FRZA 3HVAA 3U1LA 2HHXA 1NHUA 5H1SV 1YJTA 3PKMA 2WOMA 4K4UA 3F41A 5KFRA 3SCJE 1B7FA 1FDDA 4ECYA 1X8DA 2F4VF 2IA0A 5KFXA 3I4PA 1RISA 2YNFB 2L41A 3NNAA 1RI7A 5KFGA 1KHWA 2OPQB 4HLBA 4M5DB 2PI5A 1Q7YT 1UMJA 4ID5B 1TFYA 2CQCA 2E5GA 1VI7A 2VG5B 3HHLA 3DI6A 4RW4A 1KTQA 4TU9A 1MMLA 4KT0C 1W2BR 1NJIT 1VQ5S 3TP2A 2N3OA 4HYKA 4OFZA 3A8EA 2FTRA 4KE5A 5ITHA 4ZPTR 1YSJA 2N7YA 2ZC3A 2JC1A 4HI1A 4C8OA 5JVGQ 3OVBA 2ASLA 2AGPA 3KLEA 4WFXA 1HPZB 4KKOA 2HNDB 3HVTA 2X1BA 2JC0A 2DVIA 1IJEB 3HHDA 2VPWB 3IRXA 4CO1A 1DRZA 1ZM9A 2ZITA 5I3QA 2DGUA 5EX3A 2FJBB 3QIPB 2M0GB 2MGZA 3FEXB 4DLEA 2KT2A 3NKYA 3AQOA 3MGJA 5BYSA 2MMYA 4NPOA 3U02A 5CXTA 2R4FA 3H2VE 1G2EA 3QJLA 2PA3A 3CCSS 2MKKA 1UJ4A 4YR2A 1VC6A 1QVFR 1PC4A 2HRUA 5KFIA 2P6SA 3ENWA 4DV1F 2LXUA 2V5HG 4A8MP 1RT4B 1FXRA 3FZBA 1N6QB 4ILMA 3I9V9 2IHR1 3U1NA 3RBEA 3JAMY 2YWKA 2BJEA 3CJ4A 5F41A 1Y5LB 5KFPA 2XY7A 3ETOA 3MEGB 1HNZF 4JI2F 1J5OB 4C3MA 2F9DA 3GG1A 2CPYA 2HG4A 4IYQA 1T95A 5DLGA 5BR8F 4K0KF 4DL7A 3CULA 2J5AA 1MROA 2YNIB 3OXLA 2XEXA 4IOCQ 2ZH7A 3N0VA 1Q7LB 1S1WA 2FLLA 4C8KA 2KTQA 3KK3A 1R31A 4J9SA 1U6ZA 1B0PA 1K8AT 3UR0A 2HGNA 2W9AA 5HP1A 4DSEA 4NA1A 4RLEA 4Q8EA 2C3PA 2YQ3A 3ISND 1F60B 5I4MA 1FDNA 1HMVA 1N5YB 4OZJA 5F8MA 3CJKA 5C5JA 5LT5A 2C3UA 1RP5A 2BW2A 4AE5A 1HBUB 3JSYA 4OX7A 3NNCA 5AE2A 3IG1A 4I6YA 3HVRA 2OPSA 2ASYA 4LVNP 4M94A 3G6YA 3ZZOA 5MAOA 2R2TA 3SFUA 2COLA 2JHEA 2RQCA 4X4OA 4F67A 3J7ZT 5IWAF 1T05B 1UP1A 1YJRA 1AW0A 1E6VA 3M2RA 3ZFVA 2J6SA 5CYMB 1LWCB 1O5JA 2CQHA 2YNFA 3CJ2A 4NLUA 1JX4A 1UL3A 5HMYA 2OPQA 4DSIA 2EWHA 2NREA 2E7XA 3CD5A 4ID5A 3LO3A 2BYCA 3DLKA 1D9FA 1VQNS 4F3OA 2VG5A 2B51A 2WW8A 2W25A 4HKQA 3DCAA 4RNMA 2HGMA 3MPVA 3THVA 1HA1A 2WSEC 3E01B 5JUMA 1TAQA 2DNNA 3IR6B 3QGIA 1R0AB 4C8LA 3I5CA 2V4RA 2DRAA 1XMOF 1QUVA 5AE1A 3OL8A 2F9JA 1S9EB 3FSYA 2OMOA 1WNEA 4DUZF 1D8ZA 3TA2A 3GFXA 2I2YA 2FIUA 2W7PA 1X9MA 1HPZA 2GHPA 2HNDA 4IFVA 2MKCA 4I7FB 2RMLA 4J9KA 1P1TA 1B0TA 5D4LA 4QWAA 1RT2B 4R25A 4DFJA 4WIIA 2R7XA 3QIPA 2D1CA 4RWXA 1NK6A 2CPJA 2KYZA 3PW7A 4OQJA 2F7VA 4X4QA 5FD1A 2B4OA 5D8HB