4DV6F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv6F00
1IBKF 2KJVA 4B3RF 2BVZA 4DR6F 4B3SF 1HNWF 1IBLF 2YY3A 4DV4F 1F60B 1FJGF 4DR5F 1QJHA 4X66F 2UUAF 2HHHF 1XMQF 4NXMF 2UUBF 1G1XA 1CQNA 1HR0F 4AQYF 4DR7F 3R3TA 4DV2F 4LFBF 4X62F 4DR3F 4DUYF 4DUZF 2E5LF 1VMBA 4X65F 2ZM6F 1XMOF 4LF6F 4JI3F 4B3MF 4JYAF 5IWAF 5LMUF 1N32F 4OX9F 3T1YF 4DV5F 1HNXF 4DV7F 4LF9F 4LF8F 4DV6F 2UUCF 4X64F 4DV3F 2RJZA 1N34F 5AJ3F 4DR1F 2B7BB 4JI2F 1J5EF 1LOUA 3ZZPA 2BXJA 2VQFF 4JI4F 4K0KF 3OTOF 4LF7F 4JI7F 4JI8F 1XNQF 4LFAF 1XNRF 4JI6F 4DV1F 1FKAF 2J5AA 4DR2F 1G7CB 3T1HF 5BR8F 4DR4F 2UXBF 4LF5F 4GKKF 4B3TF 4JI5F 1HNZF 4DV0F 2UU9F 4JI1F 2UXDF 1N36F 1I94F 1N33F 2B7CB 1B64A 1RISA 4LFCF 4GKJF 4JI0F 2VQEF 1IJEB 5LMNF 2UXCF 4YHHF 4KHPF 1IBMF 4JV5F 4YY3F 1CQMA 4LF4F 2KJWA 2F4VF 1GH8A 1IJFB 4NXNF
chains in the Genus database with same CATH superfamily
4ENOA 1F9HA 2Z57B 4P10A 1BQNA 3D0HE 3NGUA 4C11B 2DNGA 1VQOS 2WB1D 3SSSA 1GT8A 4WFAQ 4Y2IA 2WBMA 3D66A 4J9MA 2ATLA 2OPPB 4J9UE 4UUXA 3ZZYA 3FSYA 4ZHRA 5F8MA 1Y7PA 4HDHA 5CA5A 2MMYA 4HI2A 5ADZA 4DV0J 3VQSA 5U47A 3GWCA 3LP2A 4LR9A 4TYBA 4ZLNA 2GIRA 4DF8A 4RU9A 3K5OA 1SL1A 3CCES 1RWOB 2HVEA 3KLGA 2W8KA 2BYCA 2YKMA 4RBTA 5HMYA 3NGDA 2V9WA 4WZQA 1NH8A 2HHSA 4USUA 1RHMB 1O51A 1NMEB 4WTYA 2AJFE 2LP4A 2DH9A 2OAUA 3M2VB 3V5RA 4K4UA 5DQGA 1HWLA 2HG4A 1BWVA 1VRUA 4OV6A 2KH9A 1CQNA 2DR6A 3DRXA 1QD1A 4F3OA 3FEYB 4DUZJ 1R6VA 3FGVA 3ITHA 3M2VA 3Q89A 5E2QA 4A48A 4ILLA 4OI3A 4DV2J 3D6FB 3SXLA 2D3O1 4DUZF 1DQ8A 2DEIA 2F8HA 2CJBA 4KFBA 2V2ZA 3CE8A 8ATCB 3ITHB 4C8YA 1IUJA 2QGFB 1XNQJ 1T8EA 4ZVRB 3BSAA 1MMNA 3GG1A 1QY7A 1NSPA 2VBWA 4LUBA 4XDDA 2XMJA 4ZPWR 1FRKA 4DR6J 5GADU 1Y3JA 4QIGA 5CZXA 4F4YA 1HQUA 1L3VA 3EPGA 4TY8B 3MF5A 2PDAA 3QGIA 4O4GA 3ENVA 4O3NA 2FUG9 2V69A 1V9OA 5E41A 3BQ1A 4WYLA 5KFFA 3QLHA 4DR1F 4DL5A 1TUVA 2FHOB 4QWCA 2WSCC 3BO2A 3H8YA 2HHQA 3FSXA 3M32B 4FVMA 4RX6A 1S0OA 1UVIA 3HHNB 4JI2F 1OIAA 4MMOA 3TQEA 2CPIA 2OH2A 2HS4A 2FPHX 5L38A 2F4VJ 4JI3J 2BXJA 3ETMA 1NCLA 1NSKL 1WDTA 4C11A 5IXUA 1H6KX 3RB0A 1YLXA 3HHEA 2W8LA 2IPOB 3DNCA 4I69A 3HHLA 4AL7A 1CC8A 1ZAXA 2K8GA 1K9MT 2FYXA 1I51B 1PYOB 2FC9A 2DGXA 1FKPB 4KGXB 3TEHB 3T3FA 1HI8A 3MM5B 1SIZA 4K5SA 4QYRA 2ROPA 3A8JA 1MMDA 4X84A 4DV1F 1SJ3P 1ZH5A 5KFBA 3I9ZA 1DAXA 3H20A 1XMBA 4I64A 3C6UA 4WP9A 1N54B 3PZPA 3GTYX 4WFZA 3CDBA 2MKHA 4O0NA 5BR8F 3MEEA 1KTQA 4G1QB 2PE8A 2VZ9A 1SVDA 4ZP7A 2LA4A 5A2QU 4IUFA 3EDRB 4AE5A 4DV0F 1S1WA 4OZ2A 5A0YB 4ANEA 2QL9B 1C0TA 3A8IA 3CJ4A 7FDRA 2IJFA 3RBDA 3M8PB 3E51A 3VALA 1B0VA 1H38A 4OHYA 2JFKA 2VL1A 4LFCF 5DGAA 4ZVOB 2KKHA 4C9DA 4LQ9A 1RLDA 3IN5A 3FUYA 3N5FA 3K89A 2BM1A 3SDEB 2JRSA 3ZZ0A 4I1TA 2HVDA 1SC4B 2B8PA 3DU6A 2QLWA 3M9OB 4WBFA 1RADB 1VQNS 1GX5A 4NRUA 3TEGA 4DX8H 2HFSA 1RT2A 2DNHA 1ZPWX 5CHCB 4QBUA 4RU2A 4I67A 3L9ZA 1RHKB 3G2XA 3MMBB 5K14A 2MKYA 4C7QA 2ILZA 2VH7A 2KJWA 2YH0A 4MKVA 5DM6Q 3N6MA 4EZ6A 2QL7B 2AEJA 4L3KA 4DPOA 2E29A 4DBQA 5D4NA 3D67A 3PW7A 2C2DA 2GHVC 1YBUA 2G13A 2IM0A 3D4JA 4DZ6A 2B8QA 2KYXA 4QIEA 3P49B 4KO0A 4YB6A 1F60B 4K5RA 3R7NB 5AJ3J 2C2OB 4NRTA 3ET6A 3PRDA 5KFPA 1W2BR 4N76A 1PG5B 4EO6A 2OPPA 4ZHRB 4K4TA 3W7BA 4DR4J 5HMZA 4YB7A 4PQAA 5I42B 1TUWA 2HNZA 2OEKA 2ZH5A 3CJ8A 1IKYB 5H9EK 4JI1J 4MAKA 3FK4A 3JXOA 3LPYA 4RO0A 3FJ2A 2XCPA 1KC8T 1LKZA 3C15A 4PWUA 3DDKA 4X62J 3MD1A 3MM6B 4M5LA 2ZJPQ 1SBRA 1NB2A 4BDPA 1TL3A 2Q1LA 1S99A 1CULB 4RNFA 3ZZUA 2I6WA 3M6XA 4CO4A 2DGUA 1T9WA 4CI0B 2AQ4A 3R3TA 1U0HA 1B0TA 1X8DA 2FHMA 2QMWA 4RW4A 5ETMA 5ETTA 3S1TA 2UUAJ 3NY0A 1RT4B 3V4MA 3PXGa 3U7JA 5CAAA 2KM8B 3W64A 1J27A 2VASA 3PX0A 1RAIB 4DSJA 1WOSA 1M5SA 2W2PP 3GIIA 3FFIA 1YWXA 4ECXA 2EFGA 2NLWA 2WW4A 4A47A 5DG7A 2OFHX 3WC2A 1LK7A 2JJ4D 2M9KA 3OTDA 2RU9A 3N79A 3NEKA 3Q2TC 4DFMA 3ELHA 3H25A 3MXHP 4ED2A 2N7CA 3A3PB 5T7LB 1S9FA 1TMMA 2LQJA 3ONQA 5L9XA 1NHVA 4KB7A 2XM3A 2J6SA 3B78A 2UUCF 4OLOA 1QSSA 3DLKB 4P7VA 3SV3A 2DPIA 1VS3A 5E3AA 2HHPA 3CCTA 4DV4J 2ZD1B 4EBCA 6FDRA 3KHGA 3VAFA 4J9QA 5J2PA 2AGQA 1LXJA 3HO1A 4CO1A 3A12A 5A8RB 4DL7A 2P2CB 3MUMP 2E5LJ 1DTQA 1UZHA 3BKTA 2ZD1A 3U1LA 3LO3A 4NLTA 5DRKA 3SCKE 3TNVA 3ZNJ1 3DHWC 3LOUA 4PCQA 2VQFF 3KLHB 3ENAA 1VK3A 3US5A 2N3LA 4NLDA 4U8YA 3HT3A 4A46A 5AT1B 4U96A 2FY1A 3K0JA 3I31A 1UVLA 3PYGA 3P4UB 5ETKA 2F63A 4DUYJ 1S97A 4NLOA 2V8VA 1RWNB 1GAOA 5BJRA 1FVSA 3VGSA 3MM5A 3N28A 3DRYA 1ZBTA 4FKXA 4ZIVA 3QYYA 1QAYA 4ECUA 2SXLA 2YPYA 4ILRA 4A8YA 1XK8A 1H2UX 1TKDA 3C6TB 4ED4A 2K2PA 3OT9A 5C42A 3L3CA 2ZUAA 4FZVA 2Y0SD 2VDIA 1JLCA 1FNMA 4ZVGA 4FN5A 1FFWB 2ATCB 4Q5VA 4GKKJ 2Q43A 1VQSA 4WIQA 1M1KT 3KHHA 2CPEA 2MQLA 2AJ1A 3FMBA 3PO5A 1JLCB 4DCJB 1VBZA 1X5TA 3UPFA 3RBXA 2R8IA 2HHXA 1VOMA 2ZNYA 2CZ4A 2Z30B 3N6NA 1KRPA 2CNOB 4NCAA 1S48A 4O4GB 2BJEA 4C8KA 1MN9A 4ID8A 3WDOA 4C48A 4MIAA 3OLAA 3BSOA 4FBUA 2XMTA 4ICLA 1WNEA 2D1CA 1RAFB 2ZNZA 4PXDA 3CJQA 2IA6A 2ZZNA 1SXLA 1PGZA 1VQ8S 4OZ3A 4JV5F 4CNYA 3WC0A 1IBCB 3KFWX 3TAMA 2AX1A 4CH0S 3MFHA 4EI2A 5ETVA 3ILLA 3JTNA 5D77A 4O3RA 4TY8A 3HHLC 2W7PA 2Y1JA 4O4RA 3QQCD 2JC0A 4H4OA 4ES3A 5HP1A 2UVUA 3I6PA 2CNNB 1RA7A 5J2QB 5DM7Q 2HYIB 2R8HA 2V50A 4KV8A 2FJDB 1JLQB 1QM9A 1GMWD 1WC3A 3PVXA 1JQGA 2EPIA 4WE1A 1WC5A 4A8WA 1VCTA 1WKLA 3A1YG 3FEXB 4IOAQ 1XR5A 2HRUA 5GAGU 3KLEB 1Q53A 4L76A 4IO9Q 1KQKA 4EEYA 3TX8A 2RDIA 1HNZJ 1IR1A 4C8NA 4B9SA 1H3DA 3BBCA 5B0EA 5KFMA 2R7WA 1W26A 1S12A 1XMQF 2C42A 5LJ5Y 1XERA 2KL8A 2BZ2A 4BCAA 4EO8A 2E5HA 2W4PA 4I4BA 3HVAA 2GIFA 3IRWP 1TKTA 2KI2A 4JI4J 5F8IA 2KB2A 3GFXA 3D0IE 2EKYA 2MZRA 2VBXA 4NZ6A 4UW2A 2PI4A 1S1XB 2M3DA 4AQYJ 1NK7A 3HPOA 2CYYA 4DG1A 2DHSA 5GVQA 2L08A 3RB4A 1NJZA 4ELUA 1C0UA 3AXMA 3U27A 1FRMA 1S6OA 3VAHA 2R7VA 5B0GA 2ZDPA 3EZUA 2EFVA 2CPXA 4NLWA 3G8TA 4DZDA 2YKOA 2LDYA 2V4QA 2FHJA 1WDDA 2M5YA 1MU2B 2PMWA 1DJ0A 2IVMA 4CLYA 2RB7A 2XMUA 4Z7CA 3JYTA 1FTRA 1RAJA 4MKAA 1KKHA 2ZWPA 2LCWA 4QR1A 2FD2A 2NPIA 4B9TA 3UN5A 2AX0A 2V0NA 1HQUB 1PCAA 2CJYB 3HDSA 3HVTA 1F9FA 3M2UA 2BJ9A 4ZVUB 3FNNA 1LNQA 2MJUA 2C3UA 1DQAA 2AT1B 2CQCA 2W7AA 5HMWA 3J81U 2G0IA 3H2VE 1DFDA 4M5KA 4NI2A 5KFXA 1NZAA 4JI4F 1LK5A 1IKYA 4JV5J 2DXEA 2B5JA 2HMIB 1DLOB 2RIJA 4YN3B 3UDCA 2Y3YA 4F2SA 1S4EA 1XMQJ 4UQTA 4F4XA 2VG7B 3ET6B 5ITHA 1V5VA 1FKAF 2HHVA 3MD3A 2AJ2A 3IR6B 2MQPA 1NO8A 3RAQA 3NNCA 1L5UA 2OO4A 2HBZB 3AJ1A 4TXSA 2AYGA 2GO8A 2YBVA 5IT9U 1YDLA 3IO1A 1S6PB 2CQ0A 1Y5LB 3J7ZT 1S1WB 3PM9A 1PC5A 2GX8A 5H9FJ 3T19A 2DHAA 2GFFA 2R7OA 3NP5A 3AXKA 3RU0A 2KDOA 4EU0A 2ASLA 2MDAA 5A76A 1E6VA 2HLUA 3PCOB 5K9FA 2ZH2A 4MTPA 3FBEA 5CH7B 3R7SB 1CJUA 2X3DA 1F5BA 2BW7A 2WVFA 2VD3A 2XSJA 2ZH6A 1C1BA 3EPIA 1YVFA 2CQBA 5IC6B 4DX5A 2FVPA 5GMKa 3W62A 2HIYA 5F41A 2D3OR 1UPMB 5KFOA 3NBPB 5GAGI 4NXNJ 5GMDA 4KHPJ 3AAWB 4MKYA 5HSPA 2R8GA 2ZE2A 5DDQC 1YX2A 4Y65A 1VHFA 5CYMB 4WFXA 4BC7A 5A8WA 2KXNB 4LF7J 1KVIA 4LJMA 1RE1B 2D3UA 4FXVA 3WIVA 2VA3A 3JSRA 2ZHAA 3CVKA 3R5CA 2MKJA 3NKYA 4LBHA 1CC7A 1YJRA 2YXLA 3KUGA 2GJFA 4DPTA 2OLWA 2HAFA 4X4RA 2CPHA 3HHLB 3VGUA 3QZ8A 3BM7A 2Z2ZA 2I2YA 1SKUB 1SIWB 1OS5A 3KUHA 3SMZA 3VAIA 4DV4F 1DTTA 4OJ3A 5KFGA 3TWZA 2UUCJ 4DSKA 2YTCA 3BB5A 2HW3A 2OPQA 1NK4A 2ALZA 1HYSA 5CYQB 2WCXA 1LWCA 3I9V9 5A6PA 1KLMB 3RB6A 2J0QD 5DETA 2FJWA 1M1HA 4FF1A 2HSEB 4FF3A 2HVIA 2KFYA 4CP5A 2JWNA 5F8LA 2UUTA 1TAQA 2EFNA 2HAIA 4Y6IA 3CJKA 3KLFA 3CC2S 4K2XA 5B09A 4EUVA 3K5LA 3LW5C 3RR7A 1AB8A 2AWZA 4NE9C 2NXUA 2R42A 3AD9C 2ZHBA 1D1UA 3DLHA 3MPWA 1F3VA 1VRUB 4K59A 2HQFA 2MKSA 3BBBA 2E5LF 1ZZNA 4KKOA 3HSJA 4ZCIA 1DY3A 2EFQA 3KJNB 1SV5A 5D4PA 4NXMF 1RAGB 3MUVP 3DOKA 1Y5NB 2V68A 3KWMA 5KFTA 1CJUB 3QWPA 4HR2A 4QWEA 1RT2B 5BYQA 1PSDA 3GP9A 4G1PA 1WACA 4J9SA 3VZHA 1YBAA 3I82A 1BC6A 4IG3A 5K8PA 2ZH9A 3ZZZA 2DRDA 3FRYA 3G86A 1BQXA 3JTPA 1KQGB 2LVWA 4MK7A 1ZTWA 2DVIA 1H7XA 4X64F 5HP1B 2VFVA 1UEKA 1T7PA 1XMOJ 1FDNA 2B9WA 5THWA 5KOXA 1EKRA 3JAMY 3FMWA 4DHVA 3T1YJ 4CM2A 2HRTA 4P7TA 5BYRA 5KFZA 1LXNA 5G0RB 3LP2B 3WX8A 2EXUA 3VAJA 4PWDA 1LWCB 1ULRA 1ZM2A 3M2RB 4MIWA 3GIMA 1S6UA 3OVBA 1X4BA 4LVNP 2DXDA 2JSXA 4CLKA 1T9TA 4Q0BB 1UKUA 1BQMA 1TK0A 1M0SA 4ER8A 3MAAB 1D3WA 4Z37A 2B6AA 2MHNA 4TU7A 3PKYA 4DR2F 1NNDA 2XQCA 4FPRA 2LA6A 2FDNA 2HNYA 1MMLA 1Y5IB 3ICLA 3NGKA 4J9KA 2C22A 1CEZA 1RDRA 2RS8A 3H4DA 5KFSA 4DCPB 5IM0B 3MOJB 4DR4F 1X0PA 2GVZB 3PIPQ 1XWLA 4ZVEA 5MLCV 1Q7LB 1RT1B 4A8QA 2C3PA 2ASYA 1CBKA 4URQU 5J2NB 2Y8WA 1F3FA 5E33A 2WVDA 3D9BA 1OPIA 2JX2A 4IFVA 2B3TB 3OTCA 4DQRA 4TKTA 1YRTA 1GQEA 2GVDB 2HFZA 3B82A 1X31C 4DLEA 3RW7A 4WZMA 3T41A 2CVEA 4DDFA 3IWXA 5DDOC 1S49A 2DGSA 1NKBA 1VISA 1VIXA 3J81Y 2E7XA 3I87A 1N52B 1O0PA 3JSBA 5KFJA 3R1HA 4OQJA 3LGHA 3IM8A 4LSNA 3DLKA 2HHTA 1RBAA 2FIUA 2F8EX 3MAHA 3MMCB 3NNAA 1XBWA 1S4FA 2BJ1A 2JFDA 2QV6A 2V6AA 3A13A 2XSFA 4HI1A 2GGPB 1R43A 2MHEA 4NL5A 5D4OA 2F4VF 2BEFA 1YZ7A 3CCMS 1GMWA 2MJNA 1X4CA 1AW0A 3FC9A 1N5TA 4MKBA 2UXCJ 2J9EA 1OO0B 2APOA 2CPFA 3HULA 2B9EA 1T94A 2IM3A 1N6QB 5C5JA 5AXMA 3DRSA 4KT0C 2ZH3A 3CF5Q 1GTHA 3UVJB 4I56A 4RUAA 1JXLA 4A8FA 2YNIA 1NK0A 1P1LA 3R8YA 1AUSL 3AOCA 1M5HA 2LFVA 1JLGB 1RGVA 1UJ6A 2HZAA 2W2NP 3N5BA 4NZ7A 2DKOB 2EK6A 5HL7Q 4ED8A 1HYSB 3EUNA 3M30A 3SBMA 4LBIA 3R1LA 1RLCL 3R9LA 2ZC3A 3CB4A 3IC1A 2KT2A 2UV8A 2XLKA 1RTIA 3PW0A 4H4KC 1FD2A 2KHCA 5ETRA 3PEHA 2KU7A 2BOAA 4X62F 4DV2F 3RR8A 1QVFR 1TL3B 3BPDA 4KYZA 1TV6A 3UI3A 1K1SA 3VAKA 3QGGA 1S72S 2DEJA 1FVQA 2P6SA 4IRKA 2DNRA 2KN4A 2LQ8A 3GR1A 3W5YA 5H9FK 3MR5A 3HKWA 2H5IB 1G4CA 1LW2B 4CLLA 3Q86A 4DR1J 4JBCA 3E2EA 1H0HB 1IVZA 1B70B 2JDJA 2XYGB 4XAKA 4K4XA 5LMUF 5CYMA 5A8WB 1VBKA 2G0JA 4ZKAA 3PJWA 1YI2S 2CQIA 5HJYA 2W4DA 2J9DE 1N0VC 4NA3A 3DRRB 3JQKA 4HHJA 2ACMA 3H0PA 1F0XA 1X4DA 2GV1A 4PWWA 3TP2A 3IG1A 2FGCA 1IN0A 1ZAWA 1R6YA 4TU9A 4YOEA 4OJGA 4Q43A 1UA0A 4LF4J 4YUDA 5KFIA 3BYPA 3NGRA 3CCQS 4DV6J 2JEIA 5B0AA 4FF4A 1R31A 2KXHA 4IG0B 5IS2A 1VIOA 4OYPA 3W63A 1D9AA 1ITPA 2DCUB 2QC3A 1OYEA 3CT9A 4F26A 4I6WA 4CLZA 1G2EA 1H7WA 2VA2A 1TFYA 1JXVA 2WONA 3BBFA 1B7FA 2FLNA 5J1EB 2XO7A 4GVBA 4M5GA 1Y0HA 2A2CA 3EGVA 1VQ6S 2H4WB 5KG0A 4DXLA 3KNGA 2CWXA 4GVBB 3KTQA 3LAKA 1FNXH 3CULA 2FVCA 3MEEB 2HWTA 2MZTA 3DRPB 2VIHA 4X4NA 2D3ZA 3AQOA 1T11A 5CCLA 3DKDA 1RB0A 3FBCA 3MOZA 3P8BB 3QIDA 5FDLB 3NGTA 3JSMB 5CYJA 2ZJRQ 2QA2A 3KOAA 4P75A 3TAQA 3PDNA 3O1LA 3I55S 3FEZA 4KH1B 3Q8QB 3W8PA 3QPIA 2YX1A 2HVHA 2DGOA 1S1UB 2VF3A 2UU9J 3TO8A 2Y0BB 2UXDF 1GMUA 3TVZA 3DGPB 4FPIA 3BV8A 4XDCA 1RHQB 2LKZA 1HNVB 3LP1B 4RUCA 1YK9A 3TQ1A 2M70A 1NK9A 5KFYA 1NDLA 3W2VA 3M9NB 5BYSA 4C3MA 2JC1A 3BREA 1IWAA 4ZP6A 4CQ1A 1NJXA 1HBNB 4YY3J 3TOQA 3PHTA 3T6BA 4X4UA 3BH6B 2ZBPA 2DHGA 1O6XA 2J6UA 5I3UA 4OFZA 5F9LA 1S57A 1FEEA 1WI8A 2RUGA 1U25A 4CLFA 4DSLA 3A8KA 4FKYA 3GSDA 3OR1B 1S9EB 4ECTA 1XC9A 2IFXA 4TQSA 1Q7YT 1AZSA 1RHUB 3D6TB 4LF4F 2D41A 2KT3A 2JNJA 2IYIA 4NLXA 4YS2A 2ZE2B 3OJUA 3KYLA 3UNGC 5HN0A 2HQ3A 3MMBA 1Y9OA 5K14B 1VC5A 2FLOA 4WP8A 2KZZA 1X9WA 4TVAB 2C2KB 1IR0A 4H4MA 2VPXB 4KAIA 2HFNA 4U95A 3V4IB 2WSEC 3HP6A 1QAIA 2HFVA 4CLUA 2VG5A 2W9CA 4CTAB 3CO0P 2XTJP 1RYRA 3M6VA 5HQLA 3WX4A 4ZP9A 1W25A 4HH0A 1DARA 1FE4A 1IQZA 2W25A 3GE9A 3EGWB 4IFYA 3LAMA 4HVZA 3DDNA 1YJNS 5DQHA 1JK9B 1X4EA 2QA4S 2RNEA 5HVFA 5HQ8A 2UV8G 2AKWB 4QQBA 3W9HA 3W9IA 3H2UB 2EFPA 4RNNA 1YKWA 4PG7A 3KXDA 3CCSS 1RKJA 1G1XA 1JJ4A 3MCSA 2VG6B 3N6LA 4KGZB 3M8PA 3MI7X 4OI6A 3U02A 4A4JA 1R8AA 1J5OA 1H2TZ 3X3UA 1FTCA 1KOHA 2DT9A 3FFIB 2R9LA 4YP3A 4E0DA 4W98A 1VMBA 4LQ3A 5G4DA 4X4TA 1K0TA 5CD4H 1TFWA 3HFKA 2ZM6F 3TANA 1NKEA 2HHHJ 2AJQA 4NLPA 4PG4A 1O8BA 4F4KA 2HS0A 1R8CA 1ZPVA 4KGVB 2VJUA 1N32F 3S7RA 1HBNA 3AD8C 1NDPA 2RAQA 3O8WA 4DV5F 2H51B 3W65A 4DV7F 4LF8F 4O23A 3NWRA 3FZBA 4QW8A 4B08A 3PFEA 1SH3A 1HHQA 3FDSA 2XO6A 4CLPA 2VV5A 3C19A 2ZWOA 2HNDA 1S0MA 2ABYA 5D8HB 2RQKA 1RACB 3NCPA 5IWAJ 4CO5A 1HD0A 3H5SA 5GAHI 2HGMA 2PA8D 1FO1A 1TKXA 2CJXB 2EEYA 1YJTA 5KT5A 2FLLA 3MAAA 5G0RA 4UOFA 3UDVA 5CQGA 2MY7A 2RU3A 2BW2A 3MHYA 3GYNA 1BUXA 1LW0A 2IDLA 2I0XA 1KD1T 1YSJA 3E8OA 4J90A 1SJ1A 4EBEA 3I96A 1WSVA 5B0BA 2Z2LA 1SL0A 2NYHA 5DJBA 3K57A 2G4BA 3KG4A 2BM0A 2DXFA 1SC1B 2OUGA 2YNIB 3I5BA 4M5NA 1Q5YA 3KLEA 1FXLA 1SQGA 1ZTTA 1R8BA 1NU4A 2ZBRA 4LBPA 2Y9HA 2LEPA 2P9EA 1WKJA 1IKVA 4ZITA 1APSA 5DG8A 3CC4S 4F7VA 3PRBA 1IM6A 4CO3A 2OD4A 4RWWA 3GMGA 1SB6A 1WF0A 2KO1A 3TZYA 1TQLA 1U2RA 1LWFA 2YWHA 3HSGA 3IS9B 3KDOA 1NPPA 4M1KA 1NPRA 4C8MA 3UCGA 1ZYQA 3R2DJ 4CT8A 1J5OB 4PQUB 4B9UA 3M8RA 2FJBB 2ROGA 4QWDA 3H98A 2YWEA 1NBEB 2GQ2A 1RWVB 3MM7A 5LL6d 3ZZRA 3IRXB 3QSIA 3T5LA 1X5OA 2AYMA 1IJEB 1YZ6A 2EWHA 2W01A 3ILJA 2H4YB 4QJVA 3VAMA 1IBMF 3OSPA 1RI7A 3Q2SC 1FEHA 2JEGA 4ED5A 4F3QA 2IY5B 1HLWA 4PG6A 4TN2A 2MLYA 2XYPB 4X64J 3JYTB 1R89A 1WORA 1IR2A 3GIJA 1Q5VA 5LSRA 3V81A 3KMQA 1TAUA 1S9EA 2O3DA 5E3RA 3LGMA 4DFPA 3M1VB 1FRXA 1HA1A 4RW7A 4IO1A 3R97A 1NEEA 2GAHC 3DDIA 2R4FA 1BQMB 3V6JA 3CC7S 4NWBA 3J80U 5GADI 2OMLA 4RW7B 3F0NA 3EICA 3VVUA 1FHTA 2HNYB 4U7UK 1N33J 4OZ5A 3QJJA 3NOGA 4ZPBA 1TVRA 5IQ6A 3MR6A 1R8PA 1PJ7A 3GFYA 3UVJA 4PUOA 3OPKA 3CJTA 2AW0A 2MYFA 1S1VA 4DF4A 3TJ8A 5KT7A 4HDGA 4YEAA 2OPRB 2ZUGA 4U9RA 3CNQP 4Y2KA 1S1XA 3UN3A 1M5VC 1ZOTA 2A10A 1MW7A 1RCXB 3E01A 5KT2A 2IYGA 4HHHA 3LQVA 7AT1B 2VPZB 3Q8SB 5HVGA 1KN6A 2EBGA 1UAWA 4N7TA 4MYUA 5IT0A 1ZETA 3MM7B 1FFGB 1PO6A 3FVYA 2M8HA 1S1UA 2NXJA 3R5GA 2KHDA 1FWPA 3K2YA 1VLOA 2E9TA 2X1FA 3AB2B 1LWFB 1RKIA 3IS9A 4DJBA 1KDNA 1P9QC 1BLUA 5D3GB 1JLBA 2HGNA 1G3OA 1SV5B 5DO2A 5M2PA 5IWAF 1HWJA 1U24A 3HXMA 1OPZA 1SQFA 2VPWB 4PPDA 4OYMA 1VDHA 2O67A 1HWKA 2WOMB 2M8DB 2PD1A 2G2OA 4LF2A 3IR5B 5DZ6A 3EWGA 2CZ9A 2MKKA 4LF9F 2E5GA 2XB2D 2VKZG 1HNWJ 3G82A 4HEA9 1FT8A 4D3GA 4FF2A 1N32J 1JNRB 1CS4A 1S6QB 3MCNA 4OYBA 4USMA 1M5PC 3N0VA 1FRIA 1SKWA 1JWWA 3DU5A 1WJ9A 2LLZA 1R0AA 3CJ5A 4KHPF 2P9GA 3DI6A 3RRKA 3ZTPA 3T5KA 5KG7A 3M8ZA 5K8OA 1GK8A 3FZ2A 4LFAF 1FDAA 4IH7A 3PW4A 3QT6A 2V4JA 4ZS6A 4UF4A 3CJKB 1XQIA 2NPFA 2AV5A 2CQDA 3MM6A 2JVOA 2P8IA 1S1VB 2NUHA 3QAUA 4I2QB 1TL1A 4TQRA 1RTDA 1Y10A 2J5AA 3I32A 2FJVA 4UY8T 1V3ZA 2QE5A 4F02A 1T02A 1UW4A 2NXEA 4OMFG 2VOPA 4X66J 1OQ6A 3E01B 1N4LA 1KNZA 2DD8S 2IIHA 3HF5A 1CLFA 4LF5F 1P6TA 1R8HA 2DH7A 4OX7A 3C16A 1U1OA 4X2BA 1D0EA 1RAAB 2H5EA 3UN2A 1IKWB 4EFAC 3T1HJ 3L7UA 4WWSA 1S1TB 2H54B 2LU1A 3MR7A 1S7IA 3C16B 2BQ3A 5D0RA 4B9LA 1VQ5S 1CSJA 3GJTB 5KFWA 2IM1A 2VC1A 1Q4RA 2QEXS 3PKMA 2R7TA 5C7PA 4GKJF 4FNIA 1U6ZA 2ZVSA 4WFBQ 2R2TA 3LP1A 1U8SA 2NSBA 4Q7AA 2MGZB 3RBEA 2KTQA 3AD7C 3PJ9A 1C0UB 2QT7A 1Y11A 1WEXA 2H1YA 4RW9B 3ZTRA 1NJWA 2MXYA 4OYWA 2C2MB 3LPEA 1Y00A 2Q6BA 3H59A 1U26A 2HWIA 2W24A 2HZCA 3IGVA 4M5IA 4EYHB 3D7SB 4NMXA 4NX9A 3UD3P 2BOPA 1B7YB 4K8RA 3JQJA 1P27B 1D9FA 4NOHA 2F9JA 5KAKA 4NLQA 1Z2ZA 5E3PA 3BGLA 2KJVA 1VFJA 3MEGA 6FD1A 3OQ2A 2XBPA 4B3RF 2XYHB 2QLBB 2LU2A 5LSOA 3BO3A 3CXCR 3HFZB 3OTBA 3G82B 1I94J 1MWQA 3QBCA 2V94A 1VQ4S 2CADA 5LJ3Y 1SKSA 1MSWD 4AD6A 4IRCA 1T9VA 3D1HA 4WK1A 2K7KA 2LDIA 3SEOA 4IFYB 1LWXA 2J0WA 2MEWA 4ZLLA 2Q66A 3GJSB 3JSYA 2VODA 1T05A 5D78A 2UXDJ 2FGOA 5B7WA 5IM0A 4QW9A 2U2FA 3TARA 3N01A 4ELVA 2DIVA 3ILOA 2DHHA 3G87A 2OI2A 1HI0P 4J5OA 2P5VA 3K8VA 4XO0A 1XNRJ 1F9EB 2BRLA 2QN6B 2ZZMA 1HR0F 4RNOA 1QTNB 3UO0A 5A6WA 2G0CA 4LFBF 4ETXA 1BMQB 1F2HA 1KR4A 2C28A 3MTKA 4QWBA 3UD5A 5LOQA 3KK2B 4C4WA 2ZITA 1F5AA 2L9WA 1HKAA 1FDBA 4YDXA 3PACA 5IZHA 2FZGB 1VK8A 1TR0A 3SYZA 2BE7D 1S1TA 3W5XA 2J7WA 1M1GA 1OSDA 3H5UA 5D6GA 4NLRA 2R7UA 4B3MF 4ECSA 1KFDA 1VYAA 2X3GA 3ZTSA 4ECYA 2J6TA 1R0BG 1K0VA 4Y00A 1FE0A 3UQSA 2AYBA 2DNNA 4OX9J 4U7UD 1RU2A 3EVMA 3KLIB 2C3MA 3OD2A 3MCOA 1HNXF 1GMVA 2F40A 4FYDA 1UZDA 4O3SA 2FB0A 3EMTA 3QFHA 4LT6A 4WU3A 5J1NA 4C3KA 7FD1A 1UCNA 2BANA 3V6HA 1EKSA 1HIYA 1XTZA 2Z2MA 4O3QA 2BE2A 2PN6A 4WIIA 4DQSA 3CWJA 3QJPA 1KOOA 3W9JA 2YPZA 1RT6B 2FVRA 4CM0A 1AUDA 2WAQD 2NSCA 1K73T 3X1LB 3OSNA 4RUHA 1CJTA 2YKPA 3OR2A 2X1AA 5D4LA 2ERRA 1JLAB 1NXIA 1WD6A 2DGQA 1TK5A 3HD2A 1IWGA 4TYAA 3GV7B 2QFJA 1GX6A 1X4AA 4WXWA 2BJ3A 3T1AA 4CLTA 1AFIA 3HM9A 2X51A 2GNKA 5DLGA 4EGLA 2BQUA 3AJDA 3UFCX 3KNAA 4ETZA 2B51A 3EXYA 2K1RB 2HKEA 3UCUP 3NMRA 2XG8A 3O6QA 2UXBF 2CJKA 1TP7A 4IDKA 2V8HA 2BRKA 5GAEI 4NA1A 1PBAA 4YR3A 4JI5F 2C2ZB 2PA3A 1FWLA 3OVSA 2N82B 2ASDA 2L9NA 2OSRA 4B9NA 4B3SJ 3EVWA 4G1QA 1C4AA 3HZGA 2J7KA 5M2UA 4WPAA 4E8UA 4HL9A 3DXBA 4USIA 1PKUA 2K06A 1B64A 3FRZA 4RW9A 2CDRB 4RW4B 4ECWA 1TL5A 3GG0A 4ED1A 2GVDA 1HHSA 3IMQJ 4I2PA 1UJ4A 4HYKA 2VQFJ 2HFOA 4CDIA 2XMAA 3W8GA 2D7SA 2XWXA 2UXCF 4PZVA 4YHHF 1LW2A 4L75A 4PKDB 1FRJA 2CA9A 3GFZA 2BANB 2D74B 1NUEA 5DDRC 1NHUA 2RDDA 2VFUA 3HVRA 1L3SA 1PBUA 2YNGA 3ENQA 3D2WA 1R3NA 1VBYA 3CJ2A 4ED3A 3S01A 1HNIA 4OZLA 3M1VA 3KLIA 3OTEA 4TY9A 4DPUA 3Q23A 1J5EJ 4JV2A 2OEJA 1K44A 2N4CA 4ZLPA 3CDEA 3DN9A 2CJ9A 2GMLA 3GPAA 3CDUA 2EG2A 4YHHJ 2GJIA 1U6FA 3QLHB 2LXIA 5KFVA 1QAJA 3QJLA 3QATA 4RL1A 5EGYA 4R8UB 2MQ8A 2YY3A 4ES2A 2GA7A 5HQMA 3KDNA 3VGVA 4Q0BA 2DITA 1FJGF 4IQMA 2Q3PA 4NLVA 3UR0A 2B43A 1S76D 2CQ1A 1DURA 3M2RA 4OYOA 2AZ3A 3C8YA 5DS7A 4E98A 5C25B 3TRGA 3HSZA 2WVCA 5B0CA 2R8JA 2UUAF 4OI1A 3GCWP 5L39A 2ROEA 4Z7YA 1Z2LA 3OHAA 2VG6A 2I8EA 2OTJS 4URGA 4DFJA 5B0DA 2BBEA 1VQLS 2COLA 2K3KA 4ZA1A 2EG1A 4XPEA 3OTOJ 1Q8KA 5LM7E 3RW6A 4DR2J 2CQGA 4OYIA 3JTOA 4BHQA 4DL4A 3TA2A 1HD1A 4FS2A 1Z4UA 5DQIA 4M8LA 3M6WA 4RWXA 1HBMB 4PYAA 2ZKTA 1H74A 4DQIA 4LSNB 4ICLB 4WFYA 3HD1A 1OJ4A 3MWBA 4I0WA 3JS9A 3HZEA 3U1NA 3W2WA 1U1PA 2YWFA 2DRBA 1SJ4P 4Q8FA 2IHR1 2POKA 2QO3A 4DN9A 4UZBA 3M7VA 3TAMB 1KWMA 5KFQA 2RRNA 3WBZA 2MGZA 2ZJQQ 3KJVB 3T1YF 1U48A 1M90T 4WCEQ 3Q0AA 1REVB 3IM9A 4CCHA 3OLBA 1RBLA 1MNEA 3C14B 1RT6A 2F1FA 2CQ4A 1WELA 5I3PA 5AE1A 4DV3F 5J2QA 1VBXA 2Y1LB 3SQOP 5ETOA 3V2UC 2DHXA 4DCOB 4ZLJA 1EHWA 3CDWA 4F4ZA 1CVJA 3HJFA 2DH8A 2VPYB 5JVGQ 1JX4A 3GILA 3QRQA 4OI2A 2LECA 2FVQA 2VHGA 4YB1P 2ZH1A 3TAPA 2IBOA 4F25A 2PT0A 2MQQA 5I42A 1RAOA 5KFHA 1T0TV 2IRXA 2PMZD 1MROA 5EWFA 4OYZA 5KG1A 1WTBA 1UVMA 1OYDA 3C15B 2ZDOA 2I9SA 3IA0A 3DLGB 4KBIA 1UWBB 4Y0FA 4CRJA 4YB5A 2K7JA 3OXGA 4K50A 2DTJA 3UWTA 5LXYA 4MFBB 2B56A 1RK8A 1X5SA 3Q83A 5C24A 1RWUA 3ZTOA 1HR0J 1QSYA 1JLGA 2KXFA 4HHUA 4ZVHA 2DO0A 3FKBA 3L95X 2R3VA 1U4BA 4IQXA 1E6YB 5HBMA 2OJ3A 1Q78A 3PTWA 4O3OA 1PJ6A 1TZ0A 3D54A 3R5AA 3CSKA 3SZ2A 2G2ZA 1FJGJ 3AY0A 1SC6A 4YFUA 3DOKB 4GRSA 5E0OA 2L48A 2DPJA 3FCHA 4DL0C 1JLBB 3K8WA 4YR2A 1NSAA 2ZVIA 2VICA 1MLAA 2DBBA 3CD5A 3KHRA 3MM8A 3BO4A 1UJ5A 4BC9A 2ZH8A 3QRRA 1S0NA 1T9UA 4N8NA 4HT7A 3QIPA 3H7HB 4ZK7M 4K0KJ 1UP1A 1PILA 1OY8A 1MG7A 3BYRA 4WJBA 5JMNA 2W7OA 3GYXB 1WG1A 3J81j 3PW2A 2O66A 3DLJA 2LXFA 3D3CJ 3MAQA 5HVHA 5D3GA 3SDEA 3VHQA 4P72A 1XN9A 4J9PA 1SC3B 3TVYA 1KTVA 1X60A 3MCMA 4M5HA 5KFRA 4H4OB 1M5KC 1SH0A 2YVSA 1RTJA 5F0WA 4J91A 2YWWA 3CCUS 4R8UA 4NI2B 1RT3A 3GV8B 3D6MB 4BWJA 3D1OA 2JHEA 4ELTA 2W2MP 2XHCA 4CTAA 4DR6F 2ZKUA 4B3SF 4IG0A 1FKOB 3CJ0A 1LFPA 4TLQA 1DLOA 2OHDA 1T03A 5AXNA 1U8WA 5KG3A 3R5BA 2HNDB 4CIOA 4GKJJ 4LF6J 3G4SS 2G1HA 4ID5A 3HX9A 4JV0A 4O0IA 4QWAA 2UXBJ 2IBKA 3OFHA 3PY8A 3DYAA 1A7GE 4DR5F 1TL7A 1WF1A 4X4PA 2PO4A 5E3QA 2DR5A 4F3MA 1MROB 3CEDA 3ISNC 3BQ2A 1TUGB 4WK3A 1RU1A 1CULA 1HW8A 1HARA 1Q16B 4XK8C 3ILIA 5IQQA 3SFGA 2QRRA 4NLGA 2CJQA 4U8VA 2QFIA 3RBZA 1X5PA 4KIAA 5EWGA 3K5MA 3CCVS 2MB0B 2LQBA 4P74A 4EZ9A 1XR7A 4DPXA 2Y1IA 2E5JA 2J8AA 4IH6A 4MK9A 4IOCQ 4F4WA 1HMVB 1RQ0A 3F56A 3MZIA 4QZVB 1A9NB 3VQTA 3HFVA 3PYEA 4A8SA 2A6OA 4QIVA 1TTHB 3BKFA 2OPSB 2NREA 3M9MB 2EC2A 5EUHA 3MMAA 1XR6A 2XEXA 3DGPA 2XCAA 2QTWA 4FVCA 3BN4A 1NK8A 4I7FA 5HLFB 4QR0A 3H40A 1UVJA 4DWIA 3ADAC 3VVTA 3VCDA 1IBLJ 2FC8A 3G6XA 4QPXA 4RNMA 2G9OA 1C1BB 1SQEA 1EP4A 3D68A 4M5MA 3M4XA 3EJMA 4OX9F 3G6VA 1SKRA 2I5JB 4M5DB 5LSLA 5KFAA 1X9MA 4JYAJ 5F8NA 4OYAA 1FESA 2E7VA 1VC6A 2RHQB 4WF9Q 6AT1B 3R27A 1TKZA 1U1KA 2UZAA 2PI5A 5ETPA 2QMXA 1EQMA 2XLJA 3FBFA 1RWMB 2AJ4A 4NLYA 4ZVPB 2VOOA 4ANDA 1TKZB 2WSFC 4UT4A 1LOUA 1WEYA 2BE2B 2VBYA 4J9OA 2BACA 1LW0B 1URRA 4WYWA 5A8RA 2LYVA 2RF2A 1KQSR 1L3TA 3CCWA 3NAHA 2MKIA 4JI8F 2MLZA 2DNOA 2PEHA 4ZPAA 3NGSA 2AYEA 5L8RC 2GHWA 1LQ9A 1BXNA 1TKXB 4ATNA 1RHRB 4LRCA 4JI6F 4ITSA 4NXMJ 3GYGA 1YTYA 2IJNA 2MZSA 2B5JB 2FTRA 2ZFHA 2ZHOA 3MURP 1N36J 3ENWA 4V1Ak 4C8OA 4QU6A 2FHJD 1D09B 3KLGB 5T14A 3W3SA 3DMJB 4KQZA 2BDPA 2J0XA 4CYUB 4AT1B 2IDEA 1I3OB 2OKQA 3FQKA 2MQOA 3EZOA 4M94A 3RGIA 4F0HA 4C97A 1OY9A 2BX6A 2IM2A 1HNZF 3FBBA 1WOOA 1D8ZA 3J80Y 3BQ0A 1RTIB 3LGNA 5EDWA 1N33F 3VTIA 2RMLA 3C6TA 3O44A 4ZMMA 4LF5J 1IKWA 3I0SB 2E66A 5K20B 4B3RJ 2Q79A 4EYIB 1NH7A 2HBRB 1HWIA 3NCQA 2M2BA 4N8OA 3PIOQ 1RCOB 2IC3A 1UMJA 4J9VA 4NA2A 1U1LA 5HMXA 2DISA 2IMOA 3MM9A 2I1RA 5D0GA 5ETLA 4OZ0A 4PR6A 2YNHA 4LRDA 4ZJOA 1WC4A 3HSDA 1VGYA 5IOLA 3PX6A 4ED6A 3FCWA 1SUQB 1ELOA 3H90A 2BA9A 1W2IA 2IVYA 3F41A 2ZOGA 3BS9A 1ZM3A 3LA0A 4I6YA 4PABA 4USTA 3QO9A 4NCGA 1R27B 4B02A 5LXRA 1REVA 2ILYA 3MPVA 2Z56B 5F8JA 2BV3A 2XMVA 4NZ0A 1YJVA 5CABA 1HNWF 2QSFA 4UOGA 4NCBA 4ECQA 2F7VA 4ECVA 1ZA2B 2VBZA 3QZ7A 2IRYA 3J7Z5 2RQCA 3IWNC 2A1BA 1YJ7A 2W9AA 4YQWA 3BR9A 1CJVB 3AFGA 2CQ3A 4N77A 1S59A 2VKRA 2F65A 3BSCA 3L7OA 4KE5A 4L3NA 1L3KA 5I3QA 4CZCA 3UE2A 3LWMA 1UVNA 3DOMB 2IMWP 3PNIA 3BEGB 3D0GE 4DR3J 2IAJA 1EJ7L 1KONA 4DX6A 2CQHA 4OYXA 3DFEA 2KFNA 1CPZA 2AEFA 3LANA 4X65J 4ZVSB 3SV4A 1UFLA 1I1GA 1XIQA 3G6YA 2C2EA 5F3TA 4DR7F 4PG8A 4KH0B 1LWEB 5L1JA 1FJ7A 3UDLA 1RHJB 3R6LB 4UQGA 2MZ1A 3T9NA 2NZ4A 1E6YA 5HBMB 2QYCA 3TJ9A 1KHVA 2J9DA 1WHYA 4RKUC 1N0UA 1WWHA 3SSQA 4X65F 3Q8YA 4UUWA 1VHIA 2V2KA 2QMUB 2RSQA 1Y4ZB 2VDHA 4C0BA 1U02A 1RXOB 3O2IA 3PYDA 1LEOA 5E7OB 2UP1A 1S77D 4DN0A 3J7YI 4DUTA 2G2YA 3MM9B 5KFDA 1IBKJ 1HQEA 1ZM4A 2A0FB 3M2UB 3GJQB 1HBOB 3OFFA 2JL9A 2LEAA 4RPFA 4AXIA 1JKHB 5I4MA 3UDEA 2JEJA 2RJZA 2V8GA 1TMJA 5EHHA 3RTVA 1GNKA 3IR7B 4DV7J 1N34F 3KJVA 4RW8B 2NUUG 1N5YB 1FX2A 4KO0B 1KP6A 1RYSA 4AXJA 2RF2B 1KEKA 2DGWA 3H2LA 2BMBA 3RUBL 3DLEB 4LSLB 5LMNJ 3HK2A 1YGYA 1RT5B 4FYXB 1MN7A 2VQEJ 1H73A 3M32A 1N48A 2ZM6J 1UL3A 4U67Q 1R0CB 1UEVA 1T9YA 2OSQA 3UW1A 4CH7A 4WFNQ 4DPWA 5F3ZA 2IAJB 1P8GA 3MPUB 4DS5A 2KT5A 3QGHA 2K1RA 2B9YA 2W1BA 4FYVB 4P2MA 5JXSA 4N41A 5H1SV 1FK9A 1HHTP 1CJVA 1GXTA 4WU2A 4A8OA 3TUJC 1X7VA 3TZWA 1IXKA 2B0GA 2XY7A 1I6JA 5EWEA 3O3LA 1HPZA 1ACMB 1Q1KA 2B4UA 2VB6A 2Z2YB 1WSRA 1HWUA 3OFGA 5H9EJ 1Q82T 1RBOB 4HT5A 4DU8A 4PQUA 1EAYC 4DQQA 1YHQS 2VFSA 3GLJA 3IP0A 1UA1A 5JJBA 3I4PA 4DL2A 3CMQA 3SI8A 2EC0A 1NKCA 1HMVA 5DDPC 1SPBP 1WHXA 4NLSA 2GS8A 2WB4A 5CXTA 1RT4A 4G1IA 1LV5A 1K8AT 3L4BC 1MWYA 2I5JA 2VQEF 2OP5A 3MTJA 3POTA 1B4SA 2VC0A 3MM8B 4J9LA 3T5HA 3VV2B 3PO4A 2MPUA 1IBMJ 3QO9B 4NCGB 5C2CA 2X1BA 1VQMS 2XGPA 2DR8A 5LT5A 4KPCA 2AP6A 1F2GA 3GFHA 2AMCB 4RJVA 1IKXA 5MAOA 5L1KA 4ECRA 2FLPA 1RWXB 2EW9A 3DRRA 5IT9Y 4DL3A 1IJFB 3WZ0A 5IV4A 3P45B 2IA0A 3TUIC 5RUBA 3MPDA 1S5ZA 1UFKA 1JKHA 5FLXU 3BH7B 1KBRA 2OPQB 3PW5A 1NK6A 1SH2A 5HJXA 5JVHQ 4P2XA 4LRBA 1BQNB 1TL7B 2HS3A 1UWBA 4KGKA 1FXRA 4O44B 4OZ1A 4K4SA 4N47A 2JLFA 2GQCA 1WOPA 2OMOA 1S9GA 4DV5J 1RTDB 2G1DA 1DHMA 4C3LA 3M30B 2CPJA 3BPSP 3W66A 4ALZA 1N6QA 1QJHA 3QT8A 2D9PA 5KFCA 1N5VA 1UFWA 3MFIA 3OL9A 3K59A 3AT1B 1H2VZ 2HIQA 2FZKB 2HQGA 4I6AA 3JAMU 4YMEA 3H42A 5C42B 3KLVA 1T05B 2HQIA 1TL1B 4X4QA 1REGX 2RD5C 3DOMA 3PEJA 3DRPA 2QLXA 2CFXA 4F04B 2GW8A 4Z2XA 3HMJG 1JLEB 3M8QB 3MUTP 3CUNA 3B54A 5HI7A 2AEMA 3NAIA 4G6VB 2V34A 4OHVA 4NYOA 4DR3F 1EB0A 1EZZB 5CZVA 3AA9A 4GVLA 4P6QA 4DV1J 4ILMA 4IDKB 2JLEA 2MSSA 3LP0A 2ALYB 3K58A 4WKYA 2ASJA 3IBWA 1FXDA 3G9CA 1Q8LA 1QLNA 5K8MA 4K4VA 1C0TB 3LP0B 2BQRA 1BHNA 3MPYA 3THTA 4K2JA 4ED7A 1N56A 4OHWA 4GMKA 4LF8J 2NCKL 4OI0A 1RP5A 3LALA 4DEZA 4KTQA 4JYAF 2F4FA 2CXEA 5AXLA 4I7FB 3BGUA 4C8LA 2AF6A 1NK5A 2AIRB 3ZNUA 5C2GA 2W4CA 4DOZA 4DV6F 4DS4A 1AFJA 2KRBA 3GR0A 2MLXA 4KR0B 4C6AA 1WKKA 2C2NA 4AUKA 2XHWA 5HO4A 1VQ9S 4G3IA 3KG0A 4RR5A 3GIKA 1RT5A 1HBOA 3LF0A 2DO4A 1QSLA 1WG4A 1HNIB 2ZZTA 2O01C 2PEBA 4USWA 3SCIE 5LMUJ 2XS5A 1H98A 1S9GB 2NYIA 3ZZPA 1IM4A 1OWXA 2RDJA 2W2QP 4AL6A 1OMSA 1JXEA 2U1AA 2E1MC 3OFEA 1HL6A 3CCLS 3ZC4A 5C25A 5DLFA 4GC7A 3FCVA 3PHEA 4NASA 1XNQF 2DK2A 4R5PA 1TELA 2AHOB 3NNHA 5KG5A 4KJIA 1BD6A 1ZZFA 2Z8QA 2QYGA 2DIUA 2CNKB 2VU5A 4CYUA 4FYWB 4C0OC 3J7A1 1G7CB 2YQ0A 3DYAB 2V2QA 1FERA 3BGRA 4N5SA 1LWEA 2GQQA 1TVRB 3NS6A 4FS1A 3PX4A 3IBFB 5EX3A 2PFDA 5KG2A 2DGTA 4RW6A 2EKNA 2QZ8A 4ED0A 4CLWA 1YITS 3AB4B 3KK2A 2XC9A 4B3OA 4ZPVR 4B9VA 2CPDA 5AXKA 5FDLA 2UU9F 1KVKA 1FI4A 1RABB 1SJRA 4LSZB 1CJKA 2CG8A 2GJ2A 3PR5B 4L6V3 3KJQB 1VLYA 4P9SA 1UVKA 4DMZA 2FHKA 4DPYA 1KFSA 4HLBA 4JI6J 3MDFA 3W2WB 1RISA 3P3DA 1E6VB 4LRAA 1S0VA 2E9ZA 2GHPA 1NDCA 3MMJA 1F6TA 4Y2CA 3EYZA 3AOBA 1A0OB 3F73A 2YNFA 1VR6A 2DNZA 3TUZC 4KGMA 5GAHU 1U2CA 2NR0A 1HBMA 3QGPA 1VC0A 2XULA 3OW2R 2DCLA 1BGXT 1FD8A 1RTHA 2W2OP 1WI6A 4KHRA 2XLIA 2BJDA 1V6HA 1C2PA 3OUYA 5F8GA 5J2PB 3KMSA 1U1MA 2Y8YA 9RUBA 2GCFA 2VFRA 2DGVA 3MMCA 2BE9B 5KG6A 4URSA 4FNHA 4EMDA 1RSCA 3VAGA 1NJYA 4OI4A 4OHZA 1WTFA 5J1EA 2HZVA 3P5TL 1PYTA 2GIQA 3JQMA 1UPPA 2Z58B 3J7AN 1FRLA 4MH8A 3S6EA 1IBLF 5M2RA 1JLFB 2ZBIA 2ZOFA 3A3OB 2JEFA 2OEMA 2HHUA 5E3CA 1FFSB 3HLUA 8RUCA 2EBEA 2GO9A 2LEBA 2KFZA 2X7IA 3V4IA 1AYEA 3T9ZA 3RJMB 1DQ9A 1NDKA 2VUGA 4RBUA 3BGRB 4Q44A 4C98A 4GC6A 4ZP8A 2VONA 2XI3A 2UUWA 2GVZA 2B4VA 1KLMA 1AT1B 5IFMA 3KK3A 2HNZB 2HWHA 4DX7A 3QT5A 4WTOB 1EIYB 2QA4G 2QL5B 3RYLA 5AE3A 1U2FA 1U1RA 4WP3A 3KK3B 2FZCB 3HHLD 2DB1A 1HNVA 1FWKA 3OHBA 2BABA 5KFUA 1HFEL 4Y34A 3KHLA 5T41A 3M8YA 3CJSA 2XS7A 3VWSA 2H65B 2YKNB 3RB3A 1VQKS 3HHDA 4DR5J 2PMHA 3LTOA 3QFWA 2HFUA 4DR7J 3PJXA 4YDDB 1ZS6A 4ZVQB 2E1CA 5FLXY 3TW0A 4UOCA 5I3UB 4LF6F 4DV3J 1WG5A 5GMEA 3BF4A 2DNQA 4JOUA 4ZPDA 2CZVC 3O5TB 5E5NA 2UVRA 3KJFB 3TYTA 4NMLA 5IV3A 4KRWA 1NPKA 1X4FA 1RZMA 2Q6CA 2C1EB 2JLGA 1PYSB 4L74A 3GCXP 2W9BA 2RH3A 4IOBA 5L1LA 1VI7A 3GU0A 2MSTA 3EM1A 1FJEB 2J7UA 4IG3B 2Z0GA 1EETB 4NEZA 4USKA 3UR3C 3OVAA 3D28A 3L7PA 2IJRA 3R5JB 2WONB 1NJIT 3OJSA 3M8WA 3H5YA 1JLQA 3UNYA 3PG9A 4IYQA 1NSQA 4IRDA 1EARA 1J5EF 2CQPA 4QYZJ 5L1IA 4K0KF 3OTOF 4JI7F 1RJJA 3CD0A 1DTQB 4OIXA 4B17A 2E1AA 3AJ2A 1KQFB 3B6BA 2M0GB 3P6YC 1IQTA 3EGNA 2UVVA 1CJTB 2K3IA 3OR2B 3B4MA 9ATCB 4RZRA 2L9DA 2R8KA 1D9DA 3R2CJ 4YR0A 2ZEJA 2R7XA 3N4WA 4UTGA 3GONA 2CPYA 4QCLA 1FKPA 2DNLA 1QVGR 4U7CA 1G6BA 1NLKL 3RZAA 2UUBJ 3P5BP 4BWMA 4CNZA 1R7IA 3H5XA 4CH1A 1B3TA 2HBYB 3IXQA 4QR2A 2RILA 3GJRB 2Z4PA 4B3OB 1PIEA 1C1CB 5IC4B 3CJRA 3MEDB 5A8KB 5HLFA 4IR9A 3TUPA 2YQ1A 3HI9A 1PAEX 2GMHA 1CJKB 3NG8A 3DLLQ 3GIRA 4FYYB 2YNHB 2WTFA 4WKRA 4H54A 4JI0F 4M63A 4DG1B 2C3YA 4C8ZA 1M5OC 3OR1A 2J76E 3ZTQA 3DM2B 3C14A 2IC3B 1XJWB 4I2PB 2XZTB 1YJUA 1BY9A 3BDPA 4XPCA 3POTB 3A8EA 1VRQC 4IH5A 5KOWA 3GB0A 1D8YA 3I0RA 5HROB 4Q45A 3EVOA 1EQ0A 4KPYA 1CS4B 1S6QA 1U09A 2MZJA 5D15A 5SUHA 1OQ3A 1P9YA 4AYBD 3CPWR 4NXNF 5ETSA 2LQ9A 3TX0A 2RQ4A 1U6BA 2J0SD 2PSZA 2H48B 3QRPA 3QAEA 4KSEB 4S0MA 3BDEA 3CO9A 1HBUA 4CO2A 1RT3B 3PFOA 5K5MA 4I2QA 1JNZB 2ZC4A 2MKCA 1Z1ZA 3AOAA 1RWWB 3OXFA 4CLSA 4EWTA 2FJXA 1W7WA 3OXLA 2BJ7A 3SFUA 5BXIA 1U47A 3KLHA 1KVJA 4PG5A 4IKAA 4L73A 3BGOP 1VJQA 3WIUA 4RUBA 4UOHA 2A2DA 2CJAA 3AHPA 3GZ7A 5D0HA 3M8QA 4B3TJ 1IKVB 2R7SA 4OLPA 2YX7A 4D3HA 3NL0A 1QE1B 3F44A 3G8SA 5A0YA 2LXUA 4KFBB 1HQ2A 3BN7A 1S6PA 4KHMA 1GFWB 3CIMA 3K7RA 2RS2A 1JLEA 1GEHA 1UW9A 2XZWA 2E1RA 3PYFA 1UTAA 2HK2A 4J37A 3BGFA 4OX6A 4DFKA 2F3JA 3CMES 1KHWA 2FY8A 2L41A 3G8QA 8AT1B 3BR8A 2M7SA 2A6MA 1EP4B 4G65A 2V2VA 1XMOF 3EGZA 3KK1B 4V19J 2MQMA 4MK8A 4ZIWA 1K1QA 2RVJA 2W9BB 3ZXWA 1X4HA 2YWGA 3THPA 2E44A 3JB9k 2DR9A 3DOLB 3MECB 2BUNA 4ERDA 1S7HA 3CIZA 1KLNA 1FRHA 2KVIA 1SJFA 1N5YA 3DHXA 2DNKA 4F67A 1NRKA 1RT7A 1MU2A 4XTTA 1DBDA 3RAXA 3DLEA 1HQEB 3HT0A 4LSLA 2ZH7A 1VJWA 2NZCA 4FBTA 1DTTB 1RAEB 1RT7B 3DI6B 4R25A 4Y28C 1PC4A 1TL4A 2KVQE 3PRVA 5FD1A 1AXQA 4CO0A 2V67A 4RW8A 5KFNA 1Q0NA 3OV7A 5FJ4A 3E3XA 2RE1A 3WHIA 4FXDA 4LFBJ 2DNYA 2YKQA 4LF7F 3V6KA 2CDQA 3CJ3A 3QSYB 1WF2A 1FKOA 1T03B 4OL8A 3SQGB 5HATA 1FDDA 3B4DA 3D1QA 4PPZA 2GMJA 3IAS9 4FDFA 2AGPA 1XNRF 3JSMA 2NS1B 1J2VA 5IT4A 2HEKA 3D6HB 3DMJA 1QE1A 2O1PA 3DC2A 5DG9A 5DGBA 4K4WA 4P2SA 4JI5J 2M4MA 1U7LA 2PFFB 2BKOA 5EX0A 2GAGC 5KTQA 2AZ1A 3VZIA 2QSWA 4A8KA 4B3TF 3Q22A 2VFTA 1Q95G 1WC0A 2D69A 3BSNA 1F1BB 1QAXA 2LMIA 2V9KA 2YX4A 3NS5A 1PAUB 1Q8IA 2DY9A 2HQDA 4GO5X 4QIWD 3LWLA 4LF1A 4NPOA 4P73A 3PR4A 1UEUA 1YBTA 1I5OB 1TK8A 3HJVA 3K5NA 1AROP 2FQQB 1I94F 4NLUA 2CPZA 2V5HG 1QDUB 3FQLA 3QIPB 2N3OA 1L3UA 2N4DA 2RRBA 3KG1A 1T95A 1JMTA 3K5PA 2YH1A 4OZNA 2XMMA 4PYDA 2XGQA 3ISND 1S79A 4OZJA 4JUZA 4KKOB 1RWPB 3I5CA 3M05A 3RG6A 5KT4A 2XMKA 1SUQA 2A3JA 1QUVA 1T9XA 2IVFB 3SCJE 2CKWA 2GGPA 4J9NA 4HACA 2WBRA 2HBQB 1EETA 4JB8B 2CAJA 4P71A 1T3OA 2PC6A 1CG2A 2JH3A 3GQCA 3RRHA 3BKUA 3UCZP 2JVRA 2P9CA 1A6LA 2XZDB 1OY6A 1UWAA 3IGNA 4USHA 4LIWA 2UVWA 2HK3A 3K17A 3QT7A 4H4MB 1GH8A 3IG1B 2XI2A 1HNXJ 2YNGB 3HKZD 4E2FB 1JJCB 3I0RB 5HROA 4O44A 2CIMA 1V3RA 2HURA 2WRMA 4R0JA 3V6DA 4BS2A 1FA0A 4QU7A 2I38A 3SQGA 3NOCA 2DYAA 2WW8A 4B3MJ 3LH2S 3ZO7A 1U45A 5SZTA 4PWDB 5J2MA 4OX8A 3V6DB 1PJ5A 4CWBA 4OHXA 4F4AA 2HQCA 1U1QA 5KFKA 4ECZA 3IFEA 4X66F 4ID5B 1Y3KA 5J2MB 1Q86T 4PXEA 4XIUA 1H72C 2V4JB 4TLRA 1QUPA 3NCRA 5L46A 4LR8A 1RUSA 1NZ8A 3SCLE 5L9NA 2AU0A 5J1PA 4W90B 2B6AB 2CRLA 2EI5A 2WZ1A 3G71S 4DSIA 5F9NA 3R5DA 2A18A 2DRAA 4AQYF 4GO7X 2EVZA 3GSIA 3NS7B 3P96A 5ETNA 1NHKL 1YJ9S 4ZCMA 4JV1A 4RLEA 2DNPA 3IWLA 3R6GB 4DUYF 2XMWA 2J9CA 4LIRA 2FJEB 3TA1A 1QTMA 4K4ZA 4ZPCA 3KK1A 2KZMA 1GXLA 2GC8A 2ZBQA 2VJVA 2FJAB 3SIPB 2QX0A 2B4PA 3W5ZA 4HACB 1FJCA 2HVZA 1RTHB 3OUYB 2WOMA 3EDQB 3TVKA 2R2SA 4C2MA 1C4CA 2M88A 2AGOA 2MQNA 4F0MA 4NYPA 3ISZA 3C66A 4UZCA 2KG0A 2MTLA 1NAQA 3UD4P 1N5QA 1X0FA 2YNFB 4V19X 4LMZA 2B9XA 3KKFA 4HTJA 2H3EB 3ZZOA 5KG4A 2QLJB 2KRRA 1SCJB 1LFWA 3MEGB 3TZZA 4Y2AA 4M95A 2B7BB 3NWGA 4LVOP 4IR1A 3B8HA 4M5DA 3CCRS 1FNOA 1HBUB 2DNMA 4NYZA 2DY1A 4KV8B 5D0EA 2YWKA 3CTRA 4OJHA 4DI6A 4U6PA 2YQ3A 3MR2A 1AZSB 3AQPA 3CDAA 2W9CB 5CYQA 4H4KA 3ZFVA 2F5GA 3HVTB 4ZN1A 3EXCX 1WEZA 2E5IA 1F5CA 3OL6A 3CGIA 2OFGX 3I4HX 4KC5A 2YKMB 3CD7A 2DJWA 3IBCB 5GAEU 1P1TA 1V3SA 1VRTB 4ZCLA 5KT6A 2KYZA 3G6ES 3VR1A 3R7BB 3C6UB 3EZ5A 1X9SA 1GXUA 1SI9A 4DU7A 1YRXA 3NLCA 2VG5B 3NRBA 2CUYA 3HCXA 4W92B 3DXSX 4F0KA 2O5DA 4LRFA 4F50A 2QG9B 4RW6B 4R5PB 4ZJQA 2HMIA 3DLBA 3T1HF 1VQYA 2H9ZA 4DLGA 1V5IB 5J2NA 1VQ7S 2NQPA 3U1MA 5B08A 4RBVA 2KM8C 5AE2A 1NM2A 4QPTA 2RUSA 3FSIA 4PUOB 1DRZA 2F9DA 1B99A 3MR3A 4GKKF 2OPSA 5B0FA 3TA0A 3MEDA 4AFFA 5A8KA 2HRYA 2V63A 3I56S 1KS2A 3LUYA 4K7QA 4J9RA 1BE4A 4JI1F 2MZQA 3M6UA 1JB0C 3W2VB 4A8XA 5JUMA 2M52A 2C2RA 3NXZA 4KY3A 2N7YA 1TKTB 3M8SA 3CMAS 4M5JA 4ZVTB 4X4OA 3H4BA 5HK4A 4LFAJ 4ZOSA 3NBPA 3OL7A 1ICEB 2D9OA 2EFOA 3DOLA 2CVIA 3MECA 3W60A 4X4SA 4C0HA 4FP9A 1RAHB 3W1YC 3QWUA 2Y1RI 2RKIA 3VF0B 5F8HA 5LMNF 3TI0A 1WC6A 2XSJB 1N8RT 3BZQA 3OBIA 3C3LA 3D3BJ 1EX8A 3IRXA 4ZCKA 1T3NA 4Y2MA 1OSCA 2PGCA 3HHKA 3TR5A 3PV8A 3W61A 5DZ7A 2ZBCA 2R2UA 3IAM9 2ADCA 1N34J 2EK1A 5KFLA 1HW9A 2R7RA 3AODA 4LF9J 1IBKF 3ULHA 3CCZA 2BKNA 1FX4A 2C3OA 2E9RX 2BVZA 2BKPA 2CWKA 1RTZA 3GV5B 3THVA 2E1PA 3A4TA 4JI0J 2J8SA 3VGTA 4BLGA 2RT3A 4ANCA 2HPUA 4ZJLA 2NXNA 4QYZK 4RNHA 1AA1B 1TU0B 4JP8A 3A3NB 4MYTA 1DZ5A 4B9MA 1K47A 2BJ8A 2XNRA 4FXWA 1KSPA 3KUEA 1Q81T 3S8SA 2OPRA 4WE1B 2XNQA 2ZH4A 1ROFA 2MY8A 1RT1A 2IRUA 4X4VA 2HLTA 3DLGA 3Q8UA 2HHHF 2E7WA 2UUBF 4DL6A 4CT9A 5BR8J 1U0SA 2H5JB 2JOQA 3Q8VA 3SSRA 3CCJS 2CG4A 2WVBA 1Q79A 3QMQA 3L09A 2ZOMA 3EE3A 1ZA1B 1SJQA 2RRAA 4UY85 4NEYA 2OGUA 3ZZTA 2QJ3A 2RQMA 4DQPA 1U0HB 3N9UC 1RWKB 2V8DA 4QIFA 3Q24A 4Y3CA 3RRGA 4Q8EA 1TV6B 5CCMA 3MEKA 4ZVFA 4JI7J 1WC1A 1C1CA 2PIIA 3DM2A 5FIIA 3RAMA 1JJHA 4JI3F 3QNWB 1MWZA 1N5SA 2ADBA 4JI2J 4HTIA 4J7CA 2ACYA 2BR0A 5CD4A 1URNA 4ZPTR 2X1GA 4HKQA 2FVSA 1WHVA 5HAOA 5KT3A 5A2QY 4Q2MA 4QOTA 3C46A 4USJC 2XY5A 2AJ0A 1YJWS 4Q2LA 1GTEA 3OL8A 2XWYA 5AJ3F 1HI1A 1FF2A 3MGJA 2HGLA 2NXCA 4WXOA 4L72B 1JLFA 3T5JA 1R0AB 2F8MA 1IKXB 2V8PA 3DRSB 1VRTA 4O3PA 1RTJB 1SL2A 2QIFA 1B0PA 3AH6A 4N56A 5KFEA 2DR7A 1Q8BA 1ZAVA 2QLFB 4K4YA 5K8NA 1S10A 4R0EA 1JJ2R 3ETOA 3T6JA 4TU8A 1FK9B 4LR7A 3NMAA 2WHOA 4DSEA 5ETQA 2AD9A 1XEZA 2XS2A 3DCAA 1JLAA 3D5MA 4MJKA 2YKAA 1UETA 4OV1A 4TNOA 4BBYA 4EK2A 4ES1A 2KG1A 2VG7A 4F36A 2R2RA 4F2RA 3C2PA 3BJYA 1U1NA 4EBDA 3J7YU 4MIBA 4HH1A 3CD6S 5EN1A 2RHSB 1YQHA 4MFBA 4MT1A 3TJAA 4PAAA 5C24B 3TZXA 3KLFB 1YG0A 4P52A 4P2FA 4I68A 3EX7B 1WHWA 2CNLB 4USVA 2OTLS 1ZM9A 2OIHA 1N88A 3MMAB 1HPZB 2WK4A 3Q8RB 1N36F 2B4OA 4PRFA 1JIHA 3AA8A 2HHWA 4F8RA 2CQ2A 2B7CB 2LQ5A 4ZDNA 2V4RA 3DGVA 5F0UA 4PXCA 2RKIB 1FCAA 4IFVB 4PXBA 2R7QA 1RA6A 3CW2C 4JI8J 1O5JA 2L3MA 2JZ5A 2YKNA 5T7LA 4ZN3A 2WVEA 3I0SA 1NB7A 2OD6A 3HVWA 3I5AA 1VQPS 1WUUA 4DSFA 4LREA 4OJ1A 2XY6A 2OELA 5HANA 1BWEA 4PEOA 3WQPA 3G96A 4A8MP 3Q8PB 3V81B 4YY3F 1CQMA 1YRUA 2GZOA 1U49A 4AL5A 1X4GA 2QA1A 1YIJS 4W4MA 4LFCJ 2P6TA
chains in the Genus database with same CATH topology
4C11B 1VQOS 1BQNA 3D0HE 2DNGA 2WB1D 3SSSA 1GT8A 4WFAQ 4Y2IA 2WBMA 2ATLA 4J9MA 2OPPB 4UUXA 3ZZYA 4ZHRA 3FSYA 5F8MA 4B9NA 1Y7PA 4HDHA 5CA5A 2MMYA 4HI2A 5ADZA 3VQSA 5U47A 3GWCA 3LP2A 4TYBA 4DF8A 2GIRA 4RU9A 3K5OA 1SL1A 3CCES 3KLGA 2W8KA 2BYCA 2YKMA 4RBTA 5HMYA 3NGDA 2V9WA 4WZQA 1NH8A 2HHSA 1O51A 4WTYA 2AJFE 2DH9A 2OAUA 3M2VB 3V5RA 4K4UA 5DQGA 1HWLA 2HG4A 1VRUA 2KH9A 1CQNA 4F3OA 3DRXA 3FEYB 3FGVA 3ITHA 3M2VA 5E2QA 4A48A 4ILLA 4OI3A 3SXLA 4DUZF 1DQ8A 2F8HA 4KFBA 2CJBA 3CE8A 3ITHB 4C8YA 1IUJA 1T8EA 3BSAA 1MMNA 3GG1A 1QY7A 2VBWA 4LUBA 4XDDA 2XMJA 4ZPWR 1FRKA 5GADU 1Y3JA 4QIGA 5CZXA 4F4YA 1HQUA 1L3VA 3EPGA 4TY8B 3MF5A 2PDAA 3QGIA 4O4GA 3ENVA 4O3NA 2FUG9 5E41A 1V9OA 3BQ1A 4WYLA 5KFFA 3QLHA 4DR1F 4DL5A 1TUVA 2FHOB 4QWCA 2WSCC 3BO2A 3H8YA 2HHQA 3FSXA 3M32B 4FVMA 4RX6A 1S0OA 1UVIA 3HHNB 4JI2F 1OIAA 4MMOA 2OH2A 2CPIA 2HS4A 2FPHX 5L38A 2BXJA 4DQPA 5IXUA 4C11A 3RB0A 1H6KX 3HHEA 2W8LA 4I69A 3DNCA 4AL7A 3HHLA 1CC8A 1ZAXA 2K8GA 1K9MT 2FC9A 2DGXA 1FKPB 3T3FA 1HI8A 3MM5B 1SIZA 4K5SA 4QYRA 2ROPA 4DV1F 1MMDA 4X84A 4DF4A 1SJ3P 5KFBA 3I9ZA 1DAXA 3H20A 1XMBA 4I64A 3C6UA 1N54B 3PZPA 4WFZA 3CDBA 2MKHA 5BR8F 3MEEA 1KTQA 4G1QB 2PE8A 2VZ9A 4ZP7A 2LA4A 4IUFA 4AE5A 4DV0F 1S1WA 5A0YB 1C0TA 3CJ4A 7FDRA 2IJFA 3RBDA 3M8PB 3E51A 3VALA 1B0VA 1H38A 4OHYA 2JFKA 2VL1A 4LFCF 5DGAA 2KKHA 4C9DA 4LQ9A 3IN5A 3N5FA 2BM1A 3SDEB 2JRSA 3ZZ0A 4I1TA 3DU6A 2QLWA 3M9OB 1VQNS 1GX5A 4NRUA 4QBUA 4DX8H 4RU2A 1RT2A 2DNHA 1ZPWX 5CHCB 4I67A 3MMBB 5K14A 4C7QA 2ILZA 2VH7A 2KJWA 2YH0A 5DM6Q 3N6MA 4EZ6A 4DPOA 2E29A 4DBQA 5D4NA 3PW7A 2C2DA 2GHVC 2G13A 2IM0A 2KYXA 4QIEA 3P49B 4KO0A 4YB6A 1F60B 4K5RA 4NRTA 3PRDA 5KFPA 1W2BR 4N76A 4EO6A 2OPPA 4ZHRB 4K4TA 3W7BA 5HMZA 4YB7A 4PQAA 5I42B 2HNZA 2ZH5A 1IKYB 4MAKA 3LPYA 2XCPA 3FJ2A 1KC8T 1LKZA 4PWUA 3DDKA 3MD1A 3MM6B 2ZJPQ 4BDPA 1SBRA 1TL3A 2Q1LA 1S99A 4RNFA 3ZZUA 4CO4A 3M6XA 2AQ4A 2DGUA 4CI0B 3R3TA 1B0TA 1X8DA 2FHMA 2QMWA 4RW4A 3S1TA 1RT4B 3V4MA 3PXGa 3U7JA 2KM8B 2VASA 3PX0A 4DSJA 1M5SA 3GIIA 3FFIA 1YWXA 4ECXA 2EFGA 2NLWA 4A47A 5DG7A 4WKRA 2OFHX 3WC2A 1LK7A 2JJ4D 2M9KA 3OTDA 2RU9A 3N79A 3Q2TC 4DFMA 3H25A 3MXHP 4ED2A 2N7CA 5T7LB 1S9FA 2LQJA 3ONQA 5L9XA 1NHVA 4KB7A 2J6SA 3B78A 2UUCF 4OLOA 1QSSA 3DLKB 4P7VA 3SV3A 2DPIA 1VS3A 5E3AA 2HHPA 3CCTA 4EBCA 2ZD1B 2AGQA 6FDRA 3KHGA 3VAFA 4J9QA 5J2PA 3HO1A 1LXJA 4CO1A 5A8RB 4DL7A 3MUMP 1DTQA 2ZD1A 3U1LA 3LO3A 4NLTA 5DRKA 3SCKE 3TNVA 3DHWC 3LOUA 4PCQA 2VQFF 3KLHB 1VK3A 3US5A 2N3LA 4NLDA 3HT3A 4A46A 2FY1A 3K0JA 3I31A 1UVLA 1S97A 4NLOA 2V8VA 1GAOA 5BJRA 1FVSA 3MM5A 3N28A 3DRYA 1ZBTA 3QYYA 1QAYA 4ECUA 2SXLA 4ILRA 4A8YA 1XK8A 1H2UX 1TKDA 3C6TB 5C42A 2K2PA 3L3CA 4FZVA 2Y0SD 1JLCA 1FNMA 4ZVGA 4FN5A 4Q5VA 2Q43A 1VQSA 1M1KT 3KHHA 2CPEA 2MQLA 2AJ1A 3FMBA 3PO5A 1JLCB 1VBZA 1X5TA 3UPFA 2R8IA 2HHXA 1VOMA 2ZNYA 2CZ4A 3N6NA 1KRPA 4NCAA 1S48A 4O4GB 2BJEA 4C8KA 4ID8A 3OLAA 3WDOA 4FBUA 4MIAA 3BSOA 1WNEA 4KHPF 2XMTA 4ICLA 2D1CA 2ZNZA 4PXDA 2IA6A 2ZZNA 1SXLA 1PGZA 1VQ8S 4JV5F 4CNYA 3WC0A 3KFWX 3TAMA 2AX1A 4CH0S 3MFHA 3JTNA 5D77A 4O3RA 4TY8A 3HHLC 2W7PA 2Y1JA 4O4RA 4ES3A 2JC0A 4H4OA 5HP1A 2UVUA 3I6PA 5J2QB 1RA7A 5DM7Q 2HYIB 2R8HA 4KV8A 2FJDB 1JLQB 1QM9A 3PVXA 2EPIA 4WE1A 4A8WA 4IOAQ 3A1YG 3FEXB 1XR5A 2HRUA 5GAGU 3KLEB 1Q53A 4IO9Q 1KQKA 4EEYA 3TX8A 2RDIA 4C8NA 4B9SA 1H3DA 5B0EA 5KFMA 2R7WA 1XMQF 2C42A 5LJ5Y 1XERA 4BCAA 2BZ2A 4EO8A 2E5HA 2W4PA 4I4BA 3HVAA 3IRWP 1TKTA 2KI2A 5F8IA 2KB2A 3GFXA 3D0IE 2EKYA 2MZRA 2VBXA 4NZ6A 4UW2A 2PI4A 1S1XB 2M3DA 1NK7A 3HPOA 2CYYA 4DG1A 2DHSA 5GVQA 2L08A 3RB4A 1NJZA 4ELUA 1C0UA 3U27A 1FRMA 1S6OA 3VAHA 2R7VA 5B0GA 2ZDPA 3EZUA 2EFVA 2CPXA 4NLWA 3G8TA 2YKOA 2LDYA 2V4QA 2FHJA 2M5YA 1MU2B 1DJ0A 2IVMA 2RB7A 2XMUA 3JYTA 1FTRA 1RAJA 4MKAA 2LCWA 4QR1A 2FD2A 2NPIA 4B9TA 2AX0A 2V0NA 1HQUB 3HDSA 3HVTA 1F9FA 3M2UA 3FNNA 2MJUA 5HMWA 2C3UA 1DQAA 2CQCA 2W7AA 3H2VE 1DFDA 5KFXA 1NZAA 4JI4F 1LK5A 1IKYA 2B5JA 2HMIB 1DLOB 2RIJA 3UDCA 4F2SA 4UQTA 4F4XA 2VG7B 5ITHA 1FKAF 2HHVA 3MD3A 3IR6B 2MQPA 1NO8A 3RAQA 1L5UA 2OO4A 3AJ1A 4TXSA 2AYGA 2GO8A 3IO1A 1S6PB 2CQ0A 1Y5LB 3J7ZT 1S1WB 3PM9A 1PC5A 2GX8A 5H9FJ 3T19A 2DHAA 2GFFA 2R7OA 3NP5A 3RU0A 2ASLA 2KDOA 4EU0A 2MDAA 1E6VA 2HLUA 5K9FA 2ZH2A 4MTPA 5CH7B 1F5BA 2VD3A 2XSJA 2ZH6A 1C1BA 1YVFA 2CQBA 2FVPA 5GMKa 5F41A 2D3OR 5KFOA 3NBPB 5GAGI 3AAWB 4MKYA 2R8GA 2ZE2A 5DDQC 4Y65A 1VHFA 5CYMB 4WFXA 4BC7A 5A8WA 2KXNB 1KVIA 4LJMA 2D3UA 4FXVA 2VA3A 3JSRA 2ZHAA 3CVKA 3R5CA 2MKJA 3NKYA 1CC7A 1YJRA 2OLWA 4X4RA 2CPHA 3HHLB 3QZ8A 3BM7A 2I2YA 1SIWB 1OS5A 3SMZA 3VAIA 4DV4F 1DTTA 4OJ3A 5KFGA 4DSKA 2YTCA 3BB5A 2HW3A 2OPQA 1NK4A 2ALZA 1HYSA 5CYQB 2WCXA 1LWCA 3I9V9 5A6PA 1KLMB 3RB6A 2J0QD 5DETA 2FJWA 4FF1A 4FF3A 2HVIA 2KFYA 2JWNA 5F8LA 2UUTA 1TAQA 2EFNA 2HAIA 4Y6IA 3CJKA 3KLFA 3CC2S 4K2XA 5B09A 4EUVA 3K5LA 3LW5C 3RR7A 2AWZA 1D1UA 2NXUA 2ZHBA 3DLHA 3MPWA 1VRUB 4K59A 2MKSA 2E5LF 1ZZNA 4KKOA 4ZCIA 2EFQA 5D4PA 1SV5A 3MUVP 3DOKA 1Y5NB 3KWMA 5KFTA 3QWPA 4QWEA 1RT2B 5BYQA 1PSDA 4G1PA 1WACA 4J9SA 3VZHA 1YBAA 3I82A 1BC6A 4IG3A 5K8PA 2ZH9A 3ZZZA 3FRYA 3G86A 1BQXA 3JTPA 1KQGB 2LVWA 4MK7A 1ZTWA 2DVIA 1H7XA 4X64F 5HP1B 2VFVA 1T7PA 1FDNA 2B9WA 5THWA 5KOXA 3JAMY 3FMWA 4DHVA 4P7TA 5BYRA 5KFZA 1LXNA 5G0RB 3LP2B 3VAJA 4PWDA 1LWCB 1ULRA 1ZM2A 3M2RB 4MIWA 3GIMA 1S6UA 3OVBA 1X4BA 4LVNP 2JSXA 4Q0BB 1UKUA 1BQMA 1TK0A 1M0SA 1D3WA 4Z37A 2B6AA 2MHNA 4TU7A 3PKYA 4DR2F 1NNDA 4FPRA 2LA6A 2FDNA 2HNYA 1MMLA 1Y5IB 3ICLA 3NGKA 4J9KA 2C22A 1CEZA 1RDRA 2RS8A 3H4DA 5KFSA 5IM0B 3MOJB 4DR4F 1X0PA 3PIPQ 1XWLA 4ZVEA 5MLCV 1Q7LB 1RT1B 4A8QA 2C3PA 2ASYA 4URQU 5J2NB 5E33A 1OPIA 2JX2A 4IFVA 2B3TB 3OTCA 4DQRA 4TKTA 1YRTA 1GQEA 2HFZA 3B82A 4DLEA 3RW7A 4WZMA 2CVEA 4DDFA 3IWXA 5DDOC 1S49A 2DGSA 1NKBA 1VIXA 3J81Y 2E7XA 3I87A 1N52B 1O0PA 3JSBA 5KFJA 3R1HA 4OQJA 2HHTA 4LSNA 3DLKA 2FIUA 3MMCB 2F8EX 3MAHA 3NNAA 1XBWA 1S4FA 2JFDA 2QV6A 2XSFA 4HI1A 2GGPB 1R43A 2MHEA 4NL5A 5D4OA 2F4VF 3CCMS 2MJNA 1X4CA 1AW0A 1N5TA 4MKBA 2J9EA 1OO0B 2APOA 2CPFA 1T94A 2IM3A 1N6QB 5C5JA 5AXMA 3DRSA 4KT0C 2ZH3A 3CF5Q 1GTHA 4RUAA 4I56A 1JXLA 4A8FA 2YNIA 1NK0A 1P1LA 1M5HA 1JLGB 1RGVA 1UJ6A 3N5BA 4NZ7A 5HL7Q 4ED8A 2EK6A 1HYSB 3EUNA 3M30A 3R1LA 2ZC3A 3CB4A 3IC1A 2KT2A 2UV8A 2XLKA 1RTIA 3PW0A 4H4KC 1FD2A 2KHCA 3PEHA 2KU7A 4DV2F 4X62F 3RR8A 1QVFR 1TL3B 1TV6A 3UI3A 1K1SA 3VAKA 3QGGA 1S72S 1FVQA 2P6SA 4IRKA 2DNRA 2KN4A 3GR1A 3MR5A 3HKWA 1LW2B 4JBCA 3E2EA 1H0HB 2JDJA 4XAKA 4K4XA 5LMUF 5CYMA 5A8WB 1YI2S 4ZKAA 3PJWA 2CQIA 2W4DA 2J9DE 1N0VC 4NA3A 3DRRB 4HHJA 1F0XA 1X4DA 2GV1A 3TP2A 5EDWA 3IG1A 2FGCA 1IN0A 1ZAWA 1R6YA 4TU9A 4YOEA 4OJGA 4Q43A 1UA0A 4YUDA 5KFIA 2JEIA 3CCQS 5B0AA 4FF4A 1R31A 2KXHA 4IG0B 5IS2A 1VIOA 1D9AA 2DCUB 3CT9A 4F26A 4I6WA 1G2EA 1H7WA 2VA2A 1TFYA 1B7FA 2WONA 2FLNA 5J1EB 2XO7A 1Y0HA 2A2CA 1VQ6S 5KG0A 3KNGA 3KTQA 3LAKA 1FNXH 3CULA 2FVCA 3MEEB 2HWTA 2MZTA 3DRPB 4X4NA 2D3ZA 3AQOA 5CCLA 3JSMB 2ZJRQ 3MOZA 3QIDA 2Q66A 5FDLB 5CYJA 3KOAA 2QA2A 3TAQA 3PDNA 3O1LA 3I55S 3FEZA 3Q8QB 2HVHA 3QPIA 2YX1A 2DGOA 1S1UB 3TO8A 2UXDF 3TVZA 4XDCA 2LKZA 1HNVB 3LP1B 4RUCA 3TQ1A 2M70A 1NK9A 5KFYA 3M9NB 3W2VA 5BYSA 4C3MA 2JC1A 3BREA 4ZP6A 4CQ1A 1NJXA 1HBNB 3TOQA 3T6BA 4X4UA 2J6UA 2DHGA 5I3UA 4OFZA 5F9LA 1FEEA 1WI8A 2RUGA 1U25A 4DSLA 3GSDA 3OR1B 1S9EB 4ECTA 1XC9A 2IFXA 4TQSA 1Q7YT 4LF4F 2D41A 2KT3A 4NLXA 2IYIA 3OJUA 2ZE2B 3KYLA 3UNGC 5HN0A 2HQ3A 3MMBA 1Y9OA 5K14B 1VC5A 2FLOA 2KZZA 1X9WA 4KAIA 1IR0A 4H4MA 2VPXB 2HFNA 3V4IB 2WSEC 3HP6A 1QAIA 2VG5A 2W9CA 4CTAB 1RYRA 3M6VA 3WX4A 4ZP9A 1W25A 4HH0A 1DARA 1FE4A 1IQZA 2W25A 3GE9A 3EGWB 4IFYA 3LAMA 4HVZA 3DDNA 1YJNS 5DQHA 1JK9B 1X4EA 2QA4S 2RNEA 5HQ8A 2UV8G 4QQBA 1QVGR 4RNNA 3H2UB 2EFPA 1RKJA 3CCSS 4PG7A 1G1XA 1JJ4A 3MCSA 2VG6B 3N6LA 3M8PA 3MI7X 4OI6A 3U02A 4A4JA 1R8AA 1J5OA 1H2TZ 3X3UA 1FTCA 1KOHA 2DT9A 3FFIB 2R9LA 4YP3A 4E0DA 1VMBA 4LQ3A 5G4DA 4X4TA 1K0TA 5CD4H 1TFWA 3HFKA 2ZM6F 3TANA 1NKEA 2AJQA 4NLPA 4PG4A 1O8BA 4F4KA 2HS0A 1R8CA 1ZPVA 1N32F 3S7RA 1HBNA 3O8WA 4DV5F 4DV7F 4LF8F 4O23A 3FZBA 4QW8A 4B08A 3PFEA 1SH3A 3FDSA 2VV5A 5D8HB 2HNDA 1S0MA 2ABYA 2RQKA 3NCPA 4CO5A 1HD0A