3T9ZA

A. fulgidus glnk3, ligand-free
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 21
structure length 95
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9zA00
3TA2A 4RWWA 2J9DE 4RWXA 2GNKA 4C3KA 2CZ4A 2Z0GA 3CE8A 3TA1A 1VHFA 4CO2A 4USJC 1UMJA 4AFFA 2EG1A 1KR4A 4WK1A 4OZNA 4Y6IA 5DS7A 4Y65A 2XZWA 4CO3A 1OSCA 2O67A 4CO4A 2EG2A 2NUHA 1UFLA 5DRKA 4IYQA 1Q1KA 4E98A 4NYPA 4D3HA 2DCLA 5L9NA 4D3GA 3MHYA 4YB5A 5D4LA 1VFJA 1GNKA 1O51A 1V3RA 4R25A 1NAQA 3X3UA 5D4PA 3DFEA 2XULA 1NH7A 4YB7A 2GX8A 1NZAA 4CO1A 2O66A 4C3MA 3GSDA 1XK8A 1PILA 5D4NA 3NCPA 4ZK7M 3HLUA 4OZLA 1O5JA 3O8WA 3NCRA 2ZOMA 2NUUG 4CNZA 3AHPA 4OZJA 1QY7A 4CO0A 1V6HA 2VD3A 2RD5C 4USIA 3NCQA 2V5HG 2PIIA 1HWUA 3AH6A 4NYOA 5D4OA 4CO5A 1NH8A 3M05A 2XBPA 4USHA 3AA8A 4C3LA 1J2VA 3L7PA 1UKUA 3N5BA 4RX6A 1V3SA 3AA9A 1V9OA 3O5TB 3TA0A 4YB6A 1H3DA 2JJ4D 1P1LA 2NS1B 4RLEA 4CNYA 2ZFHA 2XG8A 3T9ZA 2J9CA 2J9DA 3LF0A 2E66A 2J9EA 3BZQA 2GW8A 3OPKA 1UL3A 4WK3A
chains in the Genus database with same CATH superfamily
3PACA 3M2UB 1RCOB 1YLXA 4DFJA 5KG1A 5IT4A 3CCSS 1XR7A 1DBDA 2GMLA 1T3NA 2OJ3A 2M70A 4URSA 2PEBA 2X1BA 1SL1A 1UP1A 3N79A 3TUPA 2KG1A 2MLYA 5F8HA 2HVZA 2BVZA 5IM0A 3QAEA 2MQMA 3CXCR 2V4RA 2ATCB 1WEYA 2NXJA 4CLLA 5IQQA 3MM7B 3O3LA 5SZTA 1XQIA 4ZK7M 2WZ1A 3J7YI 4P72A 4TN2A 1NKEA 2EBEA 2EFNA 3M8QA 4CO0A 4ED1A 1UEKA 5F8MA 3KK1B 3HHEA 5D6GA 3LP0A 3TZXA 1EETB 1PYOB 2C2OB 3PW5A 3Q8YA 5LOQA 2QZ8A 1RQ0A 3R7NB 1KC8T 3H5XA 1X5TA 2RQ4A 2HRYA 2RS2A 1I94J 3UFCX 1DARA 2BANA 1S97A 5KT5A 2ZD1A 4MKBA 1X31C 5HQLA 4A8SA 3E3XA 5L38A 1EB0A 2DISA 1SVDA 4X4UA 1SBRA 3MCSA 2RUGA 3LQVA 3QIPA 3TJ9A 1N33F 2IM1A 2RSQA 4DR5J 3HJVA 2KXFA 3TRGA 2J6UA 4N41A 2FZCB 1TMJA 2GHPA 3PY8A 3K89A 2VBZA 1RT3B 3H5UA 3O2IA 3IS9B 5KTQA 3FGVA 2JVOA 5AT1B 4WE1B 1G3OA 5RUBA 3BSOA 4ZPCA 3W9IA 3JYTA 2VOPA 2P9GA 1X9MA 2P6TA 3DRXA 5FDLB 4RW4B 2JC0A 1V6HA 4F0HA 4OYWA 2VJVA 3MMCA 2L3MA 4LSNA 2B56A 3BH7B 3Q2TC 4Q8EA 2DO0A 4IDKA 4LBIA 1AFIA 2DNYA 2HHVA 1NPRA 3DOLA 3KK2B 4USKA 4ECXA 3MTKA 3KXDA 1GQEA 3CJ3A 3HKWA 4DHVA 3UNGC 3MUTP 4RWWA 4QWEA 4P6QA 5BR8F 2F9DA 4ZIVA 5LJ3Y 5B0AA 1L3TA 1TKZA 4OI6A 2NPIA 4KR0B 1TKDA 3D28A 4C4WA 3AT1B 2H54B 4BCAA 1CULA 4CQ1A 4DL3A 4MK9A 1B4SA 3G87A 3E01B 1J27A 4URQU 2B5JA 2NSBA 4RW7A 1UWBB 3GLJA 5HVGA 2NLWA 1YIJS 4LF7J 4FVMA 4C0OC 5HK4A 1AT1B 3MFHA 1JMTA 3UE2A 1UJ4A 2CJKA 2OI2A 3KLIA 4NLPA 1R43A 4P2MA 2NYIA 3GV7B 1GMWA 2L48A 3NCQA 2K3KA 2P9CA 3Q83A 1L5UA 2GAHC 4X65F 4Y2CA 2VIHA 1DHMA 2KDOA 1CC8A 2QX0A 3QPIA 2WW4A 2BJ8A 4CLTA 2NS1B 1VQ5S 4NRTA 2NQPA 2LQ5A 2X1AA 1Q0NA 2HQCA 4AE5A 2PO4A 4Z7YA 4GKKJ 2ZHAA 1U49A 2F65A 2QA2A 2GA7A 3NAHA 4DR3J 3BV8A 1OS5A 5E3CA 1TL1A 3MFIA 2VB6A 1UTAA 2LQ8A 4K4XA 1WUUA 3ZC4A 5KG6A 2HKEA 1OY6A 1PCAA 1U1PA 1Y00A 4HHHA 1U6BA 2XULA 3LGMA 3K17A 2LMIA 4QU7A 4DX8H 3LTOA 3UO0A 3LP2A 2FIUA 2AV5A 3PHEA 2RQMA 3Q23A 3MCMA 1TUGB 2JHEA 3MM5A 2DXDA 1SKUB 3HVWA 5D8HB 1R0AB 2PD1A 3CJTA 3D54A 3IN5A 2ZH8A 4YDDB 2C1EB 4A8WA 4HTIA 1NHVA 2DO4A 1EARA 3NKYA 2HBQB 1TL3B 5H9EJ 4B9SA 3RZAA 2F4VJ 3W7BA 2A6OA 1Z1ZA 3GU0A 4LF5F 3G6XA 1ZAWA 2MGZB 4CH7A 1VR6A 3JTNA 1VQ4S 4EBCA 2ROEA 2DHSA 3NRBA 4DX5A 4KGKA 4YEAA 4J5OA 3DOMB 3UNYA 3PYGA 2D7SA 4Y34A 3PW4A 1RWXB 1UPPA 4U8VA 3POTA 3W64A 1KWMA 3M32B 2KXNB 3IG1B 4UW2A 2HQIA 3A3NB 1RWUA 3DLGA 4IOBA 1UAWA 3C15A 3MPYA 4NZ7A 5J1NA 1FA0A 1N33J 4B3RF 4RBVA 1HR0F 2HVIA 1WORA 3DI6B 1CJUA 2BW7A 3X1LB 2ZUAA 2HHQA 1VIOA 3V4MA 4ES2A 4OYZA 2DIUA 2XSJB 2SXLA 2E9TA 4FN5A 4M1KA 4M5DA 3WC2A 5C24A 2FYXA 3P49B 2FB0A 3U1NA 3QO9B 1FXRA 3PNIA 1VDHA 1V9OA 4NXMF 4EZ6A 1DY3A 2LYVA 1QVGR 3KK3A 1EAYC 1HA1A 1XMQJ 4CLSA 1S0NA 4OHYA 3BBCA 2JFDA 1IBMJ 3VV2B 1H72C 3GJQB 3TAMB 2I38A 2DKOB 2E1PA 2HQDA 3FZBA 1ZM3A 2P5VA 3IBCB 1S6OA 4ZJOA 1U24A 2WW8A 5BR8J 5DDPC 4Y28C 1Q86T 4I0WA 2WSFC 1B3TA 3LP1A 3ZZRA 4QWCA 3UN3A 3SI8A 1WSVA 4HYKA 3MEGB 3GSDA 4PWDA 2WB4A 1RP5A 5LSOA 2HMIB 5G0RA 4N77A 1S9EB 2HRTA 4KV8B 2RJZA 2DBBA 2QLBB 1DTTB 1TL4A 1RT5A 1HKAA 4LF2A 4ER8A 4OLPA 3FC9A 4X65J 3MEEA 3F73A 4USMA 5CYQA 4LFCF 3SFUA 1PYSB 3PYEA 2EKYA 4UUXA 2M5YA 2J9EA 3CF5Q 2CQ3A 2ZBQA 5HROB 2R42A 3EJMA 4L72B 1IUJA 1VIXA 3G8SA 1BXNA 4ZVUB 3IMQJ 4L3NA 4IKAA 4YUDA 1LWFA 4CLFA 3HMJG 2C22A 1VBZA 2MQPA 2MKHA 2HZCA 5CCMA 4Z7CA 1NDPA 1ZZFA 4A47A 2AHOB 2ZBIA 2XSFA 3FSIA 3OJSA 3BQ2A 3KUEA 1HNVA 2VDHA 2DNRA 1TV6B 3S01A 3IO1A 3BO4A 5J2MA 3THVA 1HBUA 4OZ3A 2YQ0A 4HTJA 2AJ4A 4M5KA 2DGVA 4NX9A 4C3LA 5LXRA 3P6YC 3KLGA 3ZTPA 1RTIA 4FYXB 3TWZA 2B6AB 4B3TJ 3KHHA 1WEZA 1RSCA 2GIRA 4U67Q 3QSYB 3VF0B 3CJ5A 4DV4F 3GCXP 2Z30B 3MEDB 2YNFA 4JI6F 3GV8B 2GNKA 1HQUA 1G2EA 1RT6B 4DPUA 3US5A 2BJ3A 1K47A 4C8OA 1F2HA 2DK2A 5ETRA 1JLBA 1HHTP 3KJVA 1GFWB 2E9ZA 2VJUA 1AUSL 3LWMA 2Q43A 5CCLA 1Q8LA 1GMUA 1LK5A 3IFEA 2Y8YA 4NA1A 1TAUA 4J9QA 2MEWA 2F8MA 3GYGA 3ZXWA 2E1RA 1D3WA 1M5KC 3FSYA 5DQHA 1RAIB 1EZZB 5I4MA 3JAMU 4DPXA 4K7QA 3I4PA 3TNVA 5KFZA 4N56A 1KQSR 3N6LA 5IT0A 2XI3A 5EWGA 3FKBA 4RNMA 2IYIA 2XNQA 5KT3A 3HX9A 1Q7LB 1XEZA 4UZBA 3J81U 1HNXJ 5JMNA 3GIIA 1U48A 5HL7Q 2YKMA 1MWQA 2E9RX 2QA4G 3MR5A 2GVDA 4DV2J 2HQ3A 4B9LA 3UN5A 1E6YB 4ZLJA 3BGUA 3QAUA 1WDDA 4DF4A 3H25A 4FXWA 3E8OA 4LF8F 1C0UA 4IRDA 2J5AA 3A3OB 1NSPA 3DKDA 2ZBPA 2VONA 4WKRA 2A3JA 3PCOB 2YH0A 3BDEA 4N76A 1R89A 5D3GB 2J8SA 2CWXA 4O0IA 1SI9A 3D2WA 5B0CA 8AT1B 3SMZA 5J2QA 2QSFA 2BJ9A 4C8YA 1KBRA 2WVDA 1SXLA 1GAOA 3IWNC 3OR1A 3CJKB 8ATCB 3ET6B 3SYZA 3CMQA 5E3RA 4DV5J 1T9WA 3ELHA 7FDRA 4R8UB 1AZSA 2WOMB 4DPYA 1UPMB 5DZ6A 3DRPB 2KZMA 3CE8A 1S72S 3GILA 2VQFF 4JI3J 3J7YU 3H59A 5E5NA 2GIQA 1S99A 2CG8A 1UA1A 3G86A 1TK5A 1Q82T 1CJVA 2BKOA 3G71S 2GGPA 4C8KA 5IV3A 1GX6A 3HVAA 4ZS6A 2AYBA 3H0PA 4PXCA 5EWEA 3P3DA 2YWWA 2YNHB 3MM7A 3NMRA 2KZZA 3H90A 3IC1A 5D0GA 1TUVA 4BC9A 3BS9A 1TTHB 4LF9F 1SJ1A 1KQFB 1P8GA 3U7JA 4ZVQB 4X4RA 3EGZA 5HQ8A 5E41A 3M8YA 3R8YA 3T1HF 1TAQA 2C2DA 1WF0A 1EETA 2X7IA 2IVYA 5LL6d 5HSPA 1I3OB 3EZUA 4PG6A 1FJEB 2FY8A 1VISA 1Y9OA 1REVB 3MPVA 3W66A 3BF4A 4DWIA 2XG8A 3M6UA 2C2NA 3TVKA 3W5YA 2E66A 1WOSA 1Q5VA 3CCZA 3K57A 1XNQF 1JNZB 2A2CA 3TJAA 3QYYA 1KKHA 3TVZA 1BQXA 1F5CA 2VC1A 5CABA 4DV4J 5T7LA 4JI6J 1RT3A 2IDEA 1SV5A 3S8SA 3IS9A 2MSSA 9ATCB 2XLJA 1RWOB 3FFIB 3LPEA 4WE1A 1U25A 3MUMP 1S48A 3PW2A 2MDAA 1GXTA 4LIWA 2C3PA 4ED7A 5FDLA 3OUYB 1L3SA 2ADBA 4C6AA 3TVYA 2EK6A 4RW9B 5IV4A 1FTRA 5ADZA 3P8BB 5AE3A 4A46A 2G0IA 4FBTA 2KO1A 3AQOA 2IBKA 4HKQA 5D0EA 1H98A 2NXUA 4LBPA 4PPZA 4DFMA 2XS7A 3NL0A 1SC4B 4UOHA 3IR5B 1S79A 5IC6B 2KVIA 1GXUA 4DV7F 3RGIA 4EWTA 5KT6A 4QU6A 4ETXA 1QSYA 1X5PA 2MY8A 3SSRA 1UMJA 5ETPA 1T0TV 5DLGA 4ZPWR 2POKA 3GPAA 1N34F 4ILMA 2DB1A 3JSRA 3W61A 2IM3A 3OTEA 2ROGA 3E01A 4YOEA 2ZM6F 3QRRA 2W4DA 1HL6A 2QMUB 1O51A 2BE2B 3QT8A 3Q2SC 2AX1A 2BW2A 2XTJP 3CDAA 2DHHA 4X4TA 4YR3A 3I4HX 3I5BA 3Q24A 4JYAJ 1DLOA 4WPAA 1X0PA 4YN3B 3Q8QB 4JI4J 4MH8A 4PZVA 4DL5A 4PABA 4ZPAA 1NPKA 1R8AA 2UXCF 1RLDA 2AZ1A 2DEJA 1HNWF 4RR5A 1FFSB 3OV7A 3KLHA 1FJ7A 4B3SF 1M5SA 5GMKa 3RRKA 3AA9A 2HHHF 4URGA 2M88A 1VQ9S 1DTQB 1NLKL 1TP7A 3B4DA 5F9LA 4FPRA 1T9UA 3NS7B 1KONA 1VI7A 3CIZA 3QGGA 3WBZA 2ZH7A 1VQ7S 3N9UC 3K7RA 2ABYA 3R5DA 4HH0A 5CQGA 3NS5A 2HS0A 1OQ6A 4KKOB 3EX7B 4RUBA 1P1TA 1RWNB 2IRYA 4J9NA 1YK9A 3W65A 4I2PB 4DV0J 4PPDA 4NASA 2XGQA 2MQQA 5CD4H 1YBAA 1XK8A 4IFVA 1ULRA 4CH0S 1N6QB 2QMXA 4O3NA 1VS3A 1WKJA 1R0AA 2CG4A 3I5AA 2ZZTA 3KLEB 3K5LA 4YY3J 2C3OA 5CYMB 4W90B 2APOA 2J7WA 2KM8B 1PBUA 2VFVA 2EWHA 2E1CA 2MGZA 1RKJA 2CDRB 3LAMA 2JEJA 4ED0A 4X66F 3BDPA 1OWXA 3G6YA 4HVZA 1ZM9A 1WF2A 3OVBA 1VQOS 1TKTB 5ETKA 3D0IE 3DOMA 3GFYA 2YBVA 1FJGF 2XMJA 4X62F 2R7UA 2XCAA 4KT0C 1XNQJ 1U2FA 4JV5F 1RT4B 3IG1A 4QIEA 3DMJA 4QIFA 3I9ZA 3EDRB 4DPOA 3EM1A 4U96A 5C25A 5J1EB 4OV6A 2J0QD 4O3RA 1GNKA 3D1OA 2JEIA 2NXCA 1NB7A 2HBRB 5EN1A 3DI6A 4LT6A 2KB2A 4K50A 2WHOA 4ZCIA 4GKJJ 1F3FA 2OTJS 4ZVHA 2ILYA 2R9LA 2KFZA 1XMOJ 3ETMA 2CUYA 3IA0A 4NLQA 3IBFB 1URNA 3QO9A 1K8AT 3J7A1 3CPWR 2OLWA 1ZA1B 3NOCA 1RABB 1W2IA 2IAJB 1C0TA 3I82A 3C16B 4J9RA 2MQOA 5F9NA 2QG9B 1B70B 3WIUA 1HYSB 2ZWOA 3MXHP 2M7SA 3HFZB 3TAMA 3OLBA 4TLRA 2M9KA 3K5OA 3QQCD 3OHBA 3BGLA 3QWPA 3D0GE 1RI7A 3MMAB 2CZ4A 2QGFB 1UA0A 3SQGA 1NZ8A 2BYCA 1N56A 3CCES 3M2RA 1ZZNA 2KRRA 2N4DA 3JSMB 1U1NA 3BBFA 2XHCA 2PE8A 4KQZA 4LREA 4NCBA 2WBRA 2BEFA 3MEGA 2D9PA 4L3KA 1Q16B 4OYOA 2PA3A 2R7QA 2F9JA 3VVTA 1F9EB 1S9EA 4KV8A 3CJRA 3D1HA 2ASYA 2A18A 2MJNA 3UVJA 1U0HB 5A6WA 2P6SA 1NK9A 1X0FA 5KG3A 4DEZA 3M8RA 2B0GA 3NGDA 2QJ3A 1IXKA 3N5BA 2Z2LA 1U8WA 2Z2ZA 4ZITA 2Y0SD 2LXFA 1N54B 4NLDA 4F50A 3OSPA 1HNWJ 2GV1A 4ATNA 4PG7A 2U2FA 1PYTA 2FHMA 4IQXA 1LW0B 4TU8A 5HROA 3VQSA 2KG0A 1T11A 3Q22A 4TYAA 4U9RA 4QCLA 3TA2A 2W2NP 3H20A 3AXMA 3UDCA 1CJKB 1IWAA 2XMTA 1DJ0A 3QFWA 1FTCA 4LJMA 3PX4A 2XZWA 2V8GA 4N47A 3HHLC 3N28A 3T6JA 1OQ3A 1YTYA 5KFKA 1TR0A 2Z58B 3ISND 4A8OA 1YGYA 2V9KA 2Y1JA 1S10A 1Y11A 1FKAF 2ZKUA 3DLEB 4DUYJ 2QMWA 3RAQA 3OTCA 2B4OA 4WZQA 4NXNF 4LFBF 5L1LA 2VV5A 3BR9A 1B7FA 4UUWA 3SQOP 2GS8A 4B3MJ 4F4YA 3QMQA 3DRYA 2ERRA 4ECTA 2OPSA 1R6VA 4OYXA 5B0BA 2Y1LB 5CYJA 2W8LA 2N7CA 3G82B 4EFAC 2ZH3A 4NZ0A 3OTOF 4DS5A 1OY8A 2CJYB 1N52B 1V3SA 3BPSP 1NK6A 5L8RC 4YS2A 4Q44A 3MM8B 4DR4F 3GWCA 3QJLA 1JLAA 1MROB 2RNEA 1RT6A 1Y0HA 2RKIA 3JS9A 1ZM4A 2X3GA 3CJ2A 2B4PA 3JSBA 3ZZTA 3HVRA 2PMZD 1KN6A 1W7WA 3H4DA 4G1QB 3PRDA 4X62J 4Q45A 4DQRA 2G1HA 2H5EA 3K58A 4JV5J 4JI2F 4WXWA 2D69A 4OYAA 4DV3F 4IRKA 1EP4B 2GCFA 3IBWA 4DU7A 5KT4A 1M5OC 4DL4A 3K0JA 5FIIA 3R7SB 1UW4A 4BBYA 1SPBP 2OO4A 1JX4A 3UWTA 2JH3A 4OHWA 2RAQA 3RBEA 1RBAA 3ZZOA 1X4HA 1F5BA 3ULHA 2CQ4A 5EHHA 3PW7A 2FDNA 4LR9A 3UW1A 4HI1A 1I6JA 2FY1A 2OIHA 2I2YA 2UP1A 4H4KC 1HI0P 3FQKA 1IKXB 3J80U 5IQ6A 3F41A 1SH2A 1TMMA 1KQGB 3VTIA 5E0OA 3TUJC 4WFZA 5DM7Q 2R2TA 3C14B 2GO8A 4TY8B 5GMDA 3R3TA 2YWKA 4TQSA 2VFSA 1R7IA 5HN0A 3SBMA 2VG7A 4PYAA 2L41A 3GIKA 1YRUA 1ZTTA 3FSXA 5AXKA 3A1YG 2IM2A 5KFHA 5B0DA 4ILLA 1DAXA 3R6GB 3P5TL 1O6XA 3DOKB 1KDNA 2QC3A 2ZVIA 4NLOA 3RG6A 2NZCA 1GXLA 4O4RA 3BQ0A 4V1Ak 1TU0B 4ELTA 2FLOA 2QLFB 4UOGA 5DG8A 3MOZA 2F8EX 3LALA 4ED8A 4RKUC 3FK4A 4LF6F 2K06A 4U8YA 3T1YF 1X7VA 3I5CA 1CJTB 3H8YA 4AYBD 3CJKA 3ET6A 1SKSA 3UD4P 3W5ZA 4DUZF 2A10A 5BJRA 2EFPA 3T1AA 3DRPA 4DG1B 1KVKA 2HHWA 1PJ5A 2DGQA 1PSDA 4ZN3A 4BC7A 3IGVA 5AE1A 2ZHBA 2EFGA 3MD3A 1W25A 3KWMA 4X4OA 5K20B 3UCUP 5E2QA 2XNRA 3BJYA 3VWSA 1LKZA 4OX7A 4LVNP 2YNHA 4PG4A 3G6VA 2VHGA 4Q0BB 1NM2A 4PWWA 3M8QB 4F67A 3U27A 3GFZA 4LMZA 3TARA 4J91A 1IWGA 3GFXA 4NRUA 1RTJB 3LP0B 2NUUG 3OTBA 2MB0B 1QAYA 2XWXA 3TOQA 1OPIA 2Q79A 2CJXB 2LEBA 5KG5A 4RZRA 4NXNJ 4LFBJ 1UZHA 4CDIA 4P10A 2BANB 2OPRB 4G6VB 4LSLA 3FBEA 4PCQA 4YB6A 3CCUS 4LIRA 2AX0A 2ACMA 3QIPB 2FZGB 1HWLA 4Z37A 3HHDA 1S1WB 2LDIA 3GFHA 1FKOB 2QL5B 1LNQA 1Z2LA 4ZPBA 1HBOA 1U47A 2BE9B 2ATLA 2GAGC 2C28A 5ETMA 1JB0C 4DPWA 1NJXA 4ZOSA 1B99A 1S7HA 4ZVSB 1RLCL 2ZHOA 3KJQB 2X1GA 4P52A 3FMWA 4S0MA 3V4IA 3I0SA 5KFJA 2GVZB 2AGOA 1FI4A 4YHHJ 4JI2J 1BGXT 1IKYA 2MZQA 4W98A 1U6ZA 4OYBA 3C19A 4DR1J 4RW9A 2HURA 1RAJA 5DG7A 4M5GA 1SQFA 4WYWA 5F3TA 3ZTRA 1L3VA 4JI5F 2XI2A 5IWAF 1T05B 2FLPA 2C2RA 5ITHA 5DO2A 1WG4A 4P2SA 4KH1B 2XCPA 3TAQA 2V4JB 5A6PA 2H4YB 1Y3KA 1R3NA 4OYIA 1F9FA 4C3KA 1H74A 3VAJA 4RW7B 4WJBA 5KT7A 4NL5A 4ED5A 4QWBA 3NGKA 1DURA 2AF6A 2ZH6A 3KLIB 2QN6B 4CZCA 3GIMA 1RWKB 4OFZA 2BE2A 2FPHX 4HHUA 4MIAA 3DYAA 4AXJA 3EWGA 5CXTA 2NREA 1NUEA 1FHTA 3OR2A 1W26A 3O8WA 5K9FA 4YR2A 2KFNA 2K7JA 1VQMS 1OJ4A 2NR0A 1D8ZA 5K5MA 5I3PA 3TYTA 3FZ2A 3KDOA 2LCWA 3BKTA 3FCVA 3W2WB 3EGVA 2RQKA 1T9VA 2IDLA 2IRUA 3PW0A 3RU0A 2WONB 1FERA 1LEOA 2WSCC 1DTQA 4EI2A 3T1YJ 2BUNA 3PJ9A 1TL1B 3ITHA 2FJBB 3T5KA 7FD1A 5A8KB 2D1CA 2FD2A 2GQCA 3CD7A 1HHSA 2OFHX 3EVWA 2CADA 1RAOA 3GG0A 3V2UC 3OL9A 5LM7E 4I2PA 4M5MA 2AJ1A 4QR0A 4IO1A 1NJZA 2DR7A 3IM9A 4Y3CA 1RAHB 2AQ4A 3DCAA 3MM5B 2LA6A 2JFKA 3D6TB 5KFGA 3PG9A 2V2KA 4QJVA 5F8NA 2R8JA 4AL7A 2CFXA 1K9MT 1JLCA 1FRIA 1Y3JA 1R27B 3KLEA 2MLXA 4USIA 1U1MA 5CYMA 4F4KA 3GMGA 2QYCA 3N6MA 4IOAQ 2L9DA 2HAFA 4DLEA 1R8CA 2MZSA 2OMLA 1WC5A 4P9SA 4CT8A 2ASLA 2VODA 2DITA 1P9YA 2BABA 3Q8UA 4O23A 3S7RA 1TKTA 4OMFG 3POTB 2J0WA 3JTOA 4HDHA 4LSZB 4H4MA 3DLGB 3TQ1A 3G9CA 2P9EA 1MWZA 2B8PA 1ZPVA 1RT4A 3MAQA 2FVRA 4KGMA 1QE1B 3QGIA 2KU7A 4IO9Q 4Y2AA 1SJ3P 2DNQA 2NPFA 5A0YB 3CCMS 5ETSA 4E98A 2QLWA 1FJCA 4X4SA 3GR1A 1U0SA 5GADI 3ETOA 2I6WA 3IRWP 5AJ3F 3GP9A 2W9AA 1YJWS 4M5DB 5C24B 3R5AA 2XMWA 3UDEA 2MZ1A 2UXDF 3ZTQA 3SCLE 4OZ1A 3CMAS 4FKYA 3D6MB 2YX4A 4F7VA 2AT1B 3MAAB 3KK3B 1HI1A 4ELUA 2DNOA 3A13A 1SJRA 1U02A 2ZH9A 3CCLS 4MIWA 3CIMA 4YMEA 2ZOFA 4CNYA 2V6AA 5IWAJ 3BKFA 4CTAA 1HWIA 4G1IA 4KRWA 3MMAA 5MAOA 1SIWB 3FUYA 2BZ2A 2FHJD 3PEHA 3JSMA 4QIVA 2G0JA 4PQUA 2KM8C 5KFAA 2QLJB 1KD1T 3IP0A 4JI7F 5G0RB 1OSDA 5B0FA 4NEYA 1RWMB 4MYTA 2COLA 2VBYA 2IVMA 5A8WA 1RT5B 3MD1A 4F3OA 5IZHA 3HI9A 4RUCA 1YBTA 2Z8QA 4CM2A 5C2CA 3R5GA 1HBMB 4P2FA 4PYDA 5DDQC 4O4GA 1QUPA 2R8KA 1U1RA 3A8KA 2L9NA 4I69A 3O5TB 2JJ4D 3OFGA 4O44A 3CUNA 9RUBA 3RUBL 2AYMA 3CCQS 1ZYQA 4QPTA 4IR1A 1LWFB 2OKQA 2HHXA 2QSWA 3VAFA 3P5BP 1U26A 2KT2A 3SCKE 1RISA 1S0OA 2PN6A 2VF3A 4DQQA 2UXBF 5KFBA 1N0VC 3HXMA 4B3OA 3CWJA 4CLKA 5LMUF 1T8EA 2KYZA 2AWZA 4GRSA 3TEHB 1HNVB 3QATA 2WBMA 4QR1A 1N4LA 1JNRB 1WC4A 5EUHA 1NAQA 4GO5X 5F0WA 3DLEA 1AYEA 4FYWB 1IKVA 1NSAA 1HBUB 5D15A 3MEKA 4DR2J 2FUG9 4K0KF 4DL2A 4WFYA 4DI6A 4IH6A 1QDUB 3NBPA 1RTIB 5HP1B 3KHLA 3G82A 1IKWB 3VVUA 1P6TA 4JUZA 4TKTA 4IG3B 2ASJA 3MM8A 3KDNA 4FS2A 1D0EA 2CNOB 3NWGA 4ALZA 2DRAA 4NMXA 3D5MA 3RR7A 2JL9A 2MJUA 3KUGA 1MROA 2IY5B 1FF2A 1YJNS 3W3SA 3U1MA 1KLMB 1JLBB 1JXLA 2C2KB 3RB4A 1NSQA 1WELA 4ZP7A 6FD1A 2N4CA 4ICLB 1FFGB 3NAIA 3HO1A 2OEMA 4N7TA 1P27B 4OZ0A 4G1QA 1IR0A 2V2ZA 1TVRB 2F1FA 2YX7A 3RYLA 1QVFR 2DR8A 3DLKB 4LF4F 2JDJA 3PYFA 1VC5A 2MZRA 1L3UA 1EP4A 4B9UA 1RZMA 3KNAA 3TZYA 5CD4A 1YZ6A 5J1PA 4NA3A 4DXLA 1NPPA 4LR7A 5HJXA 3HJFA 3EVMA 1UJ6A 5EWFA 1XWLA 1RHUB 2RD5C 2PIIA 3DDIA 2BJ7A 3K2YA 3PKYA 2RDDA 4KBIA 2V67A 1FEHA 1FDBA 1FESA 1UEVA 4OJHA 1ZOTA 5D77A 1Q79A 1K1SA 2YKMB 4P71A 3MI7X 4F02A 3E2EA 3GTYX 5D78A 2H4WB 3GIRA 3OL7A 1B0VA 3D7SB 4I6WA 3C14A 1JLFB 2KHCA 3QNWB 2HIYA 1C0UB 4TY8A 4K2XA 3BN7A 5I42A 4ANDA 2ZBCA 3OFHA 1FNXH 3ISZA 1ACMB 5THWA 1R8PA 4Y2MA 1CVJA 1TKXB 2CYYA 1SJ4P 2E5LJ 2C2EA 3OL8A 3W8PA 5KFFA 2CZ9A 3HLUA 1D1UA 1O5JA 4RW8A 4OL8A 3OR1B 1RU1A 1YSJA 2L9WA 4ZVPB 1IBKF 2AZ3A 4B08A 3G8TA 3L9ZA 2BKPA 3RW7A 3MTJA 1ZPWX 4HR2A 4DG1A 1S9GB 4DV1F 3T9NA 1CJVB 2OAUA 4BS2A 1IVZA 2GGPB 4LVOP 3FRZA 4CLWA 2VICA 1ZTWA 4DX6A 1S1VA 4YB1P 4Y65A 3WDOA 4LRAA 3SDEB 2B9XA 4AQYF 1HBNA 1BE4A 2QFIA 1XJWB 3E51A 4WWSA 4FZVA 4ELVA 2UUBJ 4E0DA 3ENAA 3MDFA 4Q0BA 1Y7PA 1LV5A 2OEKA 2IA0A 1LK7A 4X64F 4PEOA 4OIXA 4JI8F 5AXNA 2RDJA 2RF2B 1WG1A 5LT5A 2ZE2B 1RTJA 2PA8D 2EW9A 4OI0A 3OVSA 1VQ6S 3IAM9 2DTJA 5T14A 3HHLD 1CG2A 4CP5A 2OD6A 4K0KJ 1NDLA 4I4BA 4F4WA 3ADAC 4JI0F 2OPRA 4OYPA 2HNYA 5D0HA 2IJFA 1S4FA 4RPFA 4A8FA 2Y0BB 5I3UB 2HZVA 4KE5A 4OX8A 4WFNQ 4IRCA 4RLEA 2XYPB 3MR7A 3NP5A 2KFYA 5EGYA 2E1MC 5C2GA 1HWJA 1S1WA 5FLXU 2V8HA 5HVFA 5M2UA 5T7LB 1FKOA 2XMUA 1JK9B 3RAXA 1SV5B 5H9FK 4ZHRB 5A8RA 2BX6A 3J81j 2HRUA 2RUSA 3FCWA 4HT5A 2JEFA 3TR5A 2HWHA 4K4VA 2Y1RI 3FBFA 2ZZNA 1FDNA 3UD5A 4D3HA 1FXDA 3PV8A 3KLVA 1LW2A 1IBLF 3DDNA 1S1TA 3EPGA 4IH7A 1WC6A 1A7GE 2GVZA 1NEEA 5F3ZA 2UVVA 3HD1A 4ILRA 2VBWA 4FNHA 4LF4J 3B8HA 1VBKA 4ZPTR 4WU2A 4HHJA 2XLKA 2AYGA 1ROFA 2W7PA 1FWPA 4X4QA 5D4OA 1T05A 1VQYA 2HHSA 3QGHA 1X9SA 2HQFA 3RR8A 2JLGA 2FC8A 2OEJA 1UVIA 3D0HE 2JX2A 1H3DA 1P1LA 3ZZUA 2V4JA 5KAKA 4QW8A 2XMKA 2ALYB 3A8EA 2HBZB 3J7AN 5GAEI 4ZVTB 2UU9F 2B7BB 1CSJA 1CC7A 1G4CA 2HQGA 4K8RA 4J7CA 1EQMA 4ZMMA 2DNZA 1U1QA 2MQNA 2K8GA 3BEGB 2EFOA 3QRQA 3B54A 3MPUB 2D41A 5B08A 1V3RA 4KHPJ 1DLOB 2H5IB 2V63A 3LW5C 4C3MA 2FZKB 2D3OR 2R7WA 5HVHA 5L1IA 2L08A 1C1CB 3KLHB 4LRFA 5HAOA 2R7TA 5KFEA 5F0UA 2CQCA 3UQSA 2VOOA 4PWUA 3W63A 1OY9A 3LGHA 3J7Z5 3FMBA 2EBGA 3FQLA 3W2WA 3L09A 5LMNF 2X3DA 2HS3A 3OXGA 1FD8A 3M05A 2WONA 3L7PA 3KHGA 1J5OA 5BYQA 4MK7A 1YHQS 2KN4A 3CJ8A 5KFIA 1FWKA 3T6BA 5A8KA 1BQNB 4EGLA 2UVRA 2DHAA 1KHVA 1ELOA 1MNEA 3PHTA 3EYZA 4DV1J 1N5VA 3I87A 2AU0A 4UY8T 1HFEL 5HMXA 3DRSB 3B78A 3GIJA 4RU2A 4IFVB 3M6VA 3LPYA 4DF8A 2HS4A 3FNNA 3KG1A 2JLEA 1SH0A 4R25A 4OI1A 4AXIA 2AJ0A 3ZNJ1 4JV1A 1RAGB 3RBZA 2UV8G 2VDIA 4I1TA 4PQAA 4JI8J 3G8QA 5F8JA 2W2QP 1TFYA 3NWRA 4QW9A 2BM1A 2G9OA 4HACA 3G96A 4BDPA 3ILIA 1HD0A 4DDFA 3UPFA 3AA8A 6FDRA 5ETVA 1HMVB 2JLFA 2AJQA 2DD8S 5GADU 4O0NA 4DSFA 1BWVA 4NI2A 3DMJB 3T5HA 2HK3A 1S6PB 5C25B 4NLVA 4DSIA 3QWUA 3M8PA 1TK0A 3PM9A 1QE1A 4OZ2A 1YITS 3VGTA 5A2QY 2HHPA 4EBEA 5A0YA 1RU2A 2NUHA 3ENVA 4Y00A 2HGMA 3BN4A 4PXEA 2FC9A 3PJXA 1UWAA 2ZZMA 3CCVS 2FJEB 1XR5A 4QWDA 5L1KA 4NWBA 3SV4A 3EZOA 1KOOA 1RKIA 4CLPA 1V5IB 3K59A 3RRHA 2GQQA 3F56A 1TZ0A 3I31A 1VK8A 3QLHB 3MAAA 2V5HG 1YRTA 1C0TB 3AFGA 2I5JB 1GK8A 3I55S 4XPEA 2G2YA 2JRSA 3AODA 1RE1B 2D3ZA 1VRQC 2M52A 2QA4S 1C2PA 2XWYA 3SQGB 1KEKA 2J9CA 1WSRA 2K2PA 2DH8A 2C3MA 2KHDA 4CI0B 3IR7B 3M2RB 3ICLA 2QEXS 1UVLA 4A4JA 1IM6A 2FQQB 5DGAA 3MCNA 4TU7A 3AOBA 1ZETA 3G4SS 4IQMA 1PKUA 2B43A 5E3PA 3UDVA 1S1UB 3PXGa 1Y5LB 1BHNA 2CPEA 2O67A 3CCJS 1MSWD 2K1RB 1E6VA 1Q95G 1VFJA 2YNIB 4DSJA 3WHIA 1CQMA 3UVJB 1HPZB 2XZDB 5KFRA 4PXBA 2PFDA 2UUAF 4OZJA 1X5SA 3QIDA 2UZAA 2MYFA 4KFBB 1WI6A 1HBMA 1YVFA 4QOTA 2OHDA 4ZPVR 4YR0A 2MZJA 2PC6A 4ES3A 3BSNA 1FD2A 3R1LA 2NYHA 4QQBA 3N6NA 3SZ2A 1GT8A 2OGUA 1SKWA 3H7HB 5HI7A 4ECYA 2XO6A 4DQPA 1RA7A 3EXYA 4AL5A 4NE9C 4I6YA 4PRFA 1LQ9A 5KFTA 4CLZA 4RUAA 3AD9C 1KNZA 4AFFA 2F40A 2QT7A 5F8IA 2ZBRA 2LQBA 1OYEA 5FLXY 5KFNA 1RTDB 2JVRA 1Q8IA 1VCTA 5CZXA 5KFSA 3C2PA 1UVJA 1YX2A 3FVYA 5E7OB 4BHQA 5LJ5Y 2MMYA 2JNJA 3D68A 3NGUA 1ZBTA 4F0KA 2OPSB 4C0BA 4FXDA 2RIJA 1G6BA 4MKYA 3MURP 1QAIA 1Q7YT 2KJWA 2HFSA 2J7UA 4DR6F 2GQ2A 1FNMA 2GJIA 4N8OA 1VQPS 2CQIA 1BQMB 1V3ZA 5HP1A 4F2RA 2WVCA 3QT7A 4ZLNA 1IKWA 3KYLA 1X4BA 4ID8A 2Z2MA 4LF5J 1FFWB 4IG3A 1UEUA 2HLTA 2HG4A 1J2VA 1PAUB 2KYXA 1LFPA 1JLAB 2AJFE 4UT4A 1JLEA 2RKIB 1JKHA 2E5JA 1RWWB 3R6LB 2YKAA 2R7VA 4UQTA 2WK4A 2AJ2A 1KLMA 4IG0A 2RHSB 2EPIA 1LWEB 3VGSA 4MMOA 4M63A 4TVAB 1YDLA 4KPYA 4ICLA 1QJHA 3TAPA 2CQPA 1TVRA 4B3RJ 1D9FA 4LRDA 1HR0J 3DLKA 4DSKA 2H65B 1FRLA 1UW9A 1LWCA 1Q8KA 1ITPA 3P4UB 1RT7B 1RXOB 1VLYA 2VFRA 3MAHA 1DQAA 3OTDA 3EXCX 2KVQE 4CNZA 2HBYB 2J6TA 3A8JA 2RU3A 1S7IA 1WHXA 1A6LA 5DDRC 4NXMJ 5KFLA 2XBPA 2A6MA 3CCRS 1SIZA 1HLWA 1DQ8A 1S1XB 4KJIA 1TFWA 3Q8VA 1CLFA 4ECVA 5AE2A 4RNOA 1FRKA 4RBUA 1D09B 2VG7B 1FEEA 1JLFA 3BSCA 1I94F 3THPA 3SFGA 2VU5A 4P73A 4WZMA 4NMLA 1CQNA 3ZZPA 5K14B 3OJUA 3LOUA 3DU5A 2UVUA 4NLTA 4ZJLA 1UFLA 4O3OA 4C8LA 2W2MP 4DR5F 1TKXA 2XY6A 3DM2A 4DLGA 3V6KA 3X3UA 5D4PA 4KAIA 2CVEA 4UTGA 3AB4B 4Y2KA 2EI5A 4OYMA 3I96A 3HSGA 1KRPA 2ZH5A 1N88A 2XMAA 1U45A 2Q6BA 2HZAA 2FJDB 1S49A 1LXJA 2PMWA 3LH2S 4LFCJ 3DGVA 4K5RA 4Q2LA 3B6BA 5F8LA 1H2UX 3AQPA 2VUGA 1S9GA 4K59A 3VQTA 1QSSA 2BA9A 4EO6A 5KFDA 2ASDA 1JJCB 2YX1A 1HARA 4ED3A 5HJYA 1OMSA 3NLCA 3PDNA 3SDEA 5KFCA 2O3DA 3MM6B 4XTTA 5G4DA 2VA3A 1NKBA 2XGPA 4ENOA 1QLNA 1WWHA 3D9BA 1RTZA 2RF2A 2W9BA 3RAMA 2ZE2A 4L73A 1NBEB 1PILA 3T5LA 2LXIA 2ZJQQ 3HSJA 1R6YA 1FT8A 4LF7F 4ZP9A 2FJWA 1RTHA 2LECA 5KFYA 2B4VA 4LSLB 2DRDA 3M7VA 7AT1B 3D3CJ 3M8WA 4DR6J 3I6PA 5BYSA 2RDIA 3CDBA 5I3UA 1WC3A 4MKAA 2DHGA 1QAJA 2WCXA 3WQPA 1HBOB 2YNGB 4ZPDA 1CEZA 5L39A 2ZVSA 4LUBA 4ZHRA 3SCJE 2XHWA 2DGUA 4BLGA 2YKOA 4GKKF 2VH7A 4CCHA 1VHFA 3IGNA 3V4IB 1DRZA 3HCXA 3B82A 1Z2ZA 3AOAA 1IJEB 2C42A 3I0SB 2G0CA 4TXSA 4XDCA 3LAKA 5J2PB 5H1SV 1UVNA 4NCGB 4KH0B 3VALA 4EU0A 3C8YA 3SCIE 1RA6A 5HATA 4U95A 3BKUA 2MXYA 5C42B 3IRXA 2OFGX 1VC6A 1IKYB 3PZPA 1M1HA 5IT9Y 2NZ4A 1WOOA 2EC2A 1MG7A 3HDSA 1F5AA 3DLHA 5D4NA 1PGZA 2ZDOA 3AD7C 2YWGA 2XZTB 1UJ5A 4A8YA 3HULA 5GMEA 5E3AA 2OPQB 1F9HA 5GAEU 4WTYA 2B3TB 4J9PA 1JXVA 5H9FJ 2OELA 4MIBA 2Z4PA 2ZC3A 5C7PA 2MQ8A 2J76E 5B0EA 1S6QB 4OQJA 4F0MA 2F4VF 1DZ5A 3CULA 4USUA 3PO4A 3G6ES 1MLAA 4OZ5A 1SUQA 4F3QA 2EFQA 2Z57B 2V0NA 1HI8A 1OIAA 3DYAB 4WK1A 2AMCB 4OZNA 4QZVB 3N5FA 1U1KA 4LF8J 5F41A 2VL1A 3O44A 3OR2B 4CO4A 3DU6A 2F3JA 1ZAXA 1KVJA 4LRBA 3CNQP 4DU8A 2IC3A 4YQWA 3GB0A 2RS8A 1NHKL 1IJFB 2JEGA 1D8YA 2W24A 4KY3A 2V69A 1C1CA 3CT9A 2H9ZA 1KLNA 2YQ3A 3MECB 2Y3YA 2VPYB 1NJWA 3MUVP 1F1BB 3RB0A 1J5EF 3ITHB 1T3OA 1VQNS 1JJ2R 4J9OA 2DGWA 1WHVA 2G13A 4GC6A 3PX6A 3JXOA 3HT0A 4QIGA 4G65A 2DY1A 1BQNA 4TLQA 1XBWA 4GVBA 2VQFJ 2MKJA 5CA5A 2CVIA 1YJ7A 1XMQF 3M8ZA 2HWTA 1IBMF 1HQ2A 3DRSA 2IPOB 2AGPA 3NNCA 2OMOA 1RGVA 1EJ7L 3W8GA 4CWBA 3I0RA 4M5NA 1VJWA 1NNDA 1JLCB 1VRTB 3I9V9 2LFVA 4PKDB 4I7FB 3DRRB 2OTLS 2LQJA 2O66A 4LF9J 2YVSA 4NLSA 3I32A 2FJVA 3Q89A 4NLUA 1HNIB 4UQGA 3W62A 4ZP8A 4LF1A 3T1HJ 3GONA 1H38A 4I6AA 1YJRA 3HSDA 3PFOA 4I2QA 3EGWB 4WFXA 3TW0A 4ID5A 3V6JA 1RB0A 3A8IA 3HSZA 1SC6A 1F6TA 5D0RA 1HMVA 2DYAA 2MLZA 4H4MB 3D4JA 2XB2D 3EUNA 3HT3A 2BACA 2J6SA 2W2OP 4U6PA 2DIVA 4P7TA 2B51A 1S6PA 1PJ7A 4ZJQA 1FRJA 4RWXA 4DN9A 4J9UE 1VBXA 1QTNB 3IWLA 4I68A 4Y6IA 5HO4A 3ISNC 3UR0A 2ZJRQ 4A8XA 4YP3A 3NS6A 1Q53A 1UFWA 3KNGA 2VA2A 3ZTOA 1N5YA 2W4PA 4ZCLA 1MMNA 2XYGB 5JXSA 1SQEA 2A0FB 1I1GA 3CDUA 4QYZK 3BGRA 4F4AA 4PUOA 3QLHA 2I5JA 2V2QA 3MPWA 1RACB 3NGSA 2FTRA 2CQ0A 2CRLA 2MKKA 1H0HB 4CTAB 4C7QA 1RT1A 2PFFB 1CS4A 4DV7J 3MWBA 3KOAA 2R7XA 2XMVA 1S5ZA 3UCZP 4GVLA 2LXUA 1JJHA 1NDCA 3DLBA 2RHQB 1B0TA 1S12A 2GMHA 4LFAF 2X51A 4B3TF 1EQ0A 5LSLA 4PQUB 2DNPA 1NK7A 1N34J 1NJYA 1S1UA 5IOLA 2HW3A 3ZZ0A 2ZM6J 1SC1B 4NZ6A 2MSTA 3W60A 2E7XA 2LDYA 2KH9A 2K1RA 2EG2A 3AJDA 3EDQB 5DM6Q 3P96A 1WHWA 2YNIA 2DHXA 3MHYA 5A8WB 2M8DB 2E5HA 2V8VA 5KFQA 2DH9A 3R2DJ 3BPDA 2N82B 1HPZA 5HLFB 2CQDA 1RT2A 2VZ9A 3K5NA 4FF1A 4FBUA 3MM9A 4O4GB 2DNNA 2UXCJ 4KFBA 3CJ0A 2XM3A 2R3VA 3M9NB 4O44B 3QSIA 3CJ4A 1FNOA 1FVSA 2KKHA 4B3SJ 4I67A 4DMZA 1H2VZ 3OW2R 2HHHJ 4N8NA 2UVWA 4FVCA 4XK8C 2OSRA 2BDPA 2E7VA 4KIAA 2DGXA 4Q5VA 1J5EJ 1Y5NB 2IFXA 1IN0A 2HIQA 1ZM2A 1T9XA 3HHLB 4M5LA 1XERA 4C0HA 4B9VA 3WX4A 4MTPA 1Q8BA 4B3OB 1RHRB 4C11B 1OYDA 5K8OA 4JI1F 2B9WA 3QFHA 1HNXF 3CMES 3C66A 3HZGA 1RTDA 1S0VA 1IKVB 4CO3A 4CIOA 1B0PA 2ACYA 4DV2F 1CBKA 1Q1KA 1MMDA 2CPJA 1GTEA 2DR6A 1T03B 2BJ1A 3M9MB 1HW9A 2KI2A 3NBPB 3R1HA 2DJWA 2AW0A 4OHXA 3PIOQ 3PRBA 3TUZC 3RRGA 4OZLA 4DJBA 3NCRA 1BQMA 1Q4RA 4HT7A 4ECRA 3V81B 3KLFB 1F0XA 5KG7A 4HL9A 4P2XA 3N01A 3CJQA 4KO0A 4Y0FA 4IFYA 1AB8A 3ZZZA 1FX2A 3M4XA 5L9XA 1WEXA 4M5HA 2N3OA 4X66J 3N0VA 2DNLA 3QT5A 1C4CA 5MLCV 2ZFHA 3B4MA 3OD2A 2R8IA 1LWEA 1FJGJ 1WC1A 4DV5F 2ZEJA 2E7WA 4EO8A 2AIRB 2ROPA 3V5RA 2YKPA 4KGVB 3MPDA 4JI3F 2HVEA 2WTFA 1GMWD 2ZUGA 1ZA2B 4KTQA 4QYRA 1WG5A 5M2RA 1RT7A 3WIVA 1VRUA 4K4ZA 3VGVA 4Q7AA 2V68A 2GX8A 2WAQD 4CO1A 2ZNZA 3H2UB 5DLFA 3LUYA 3Q0AA 2R7OA 1VHIA 3M30B 2F7VA 4C8ZA 2P2CB 1MWYA 1O8BA 2CWKA 3HHNB 3QBCA 4X4VA 4HLBA 5HANA 3D3BJ 3MMBA 3JQKA 3M2VB 2HGLA 2H1YA 1RAAB 4NPOA 2V2VA 1EKRA 1S1XA 1XIQA 2UUWA 2XY5A 1X4GA 1JLGB 3M1VB 3TJ8A 1RAEB 1TUWA 5I42B 1FRHA 3FBCA 4ZP6A 4NYZA 2G1DA 2IHR1 1APSA 4MYUA 4F8RA 2BJDA 5K14A 3MZIA 1YJ9S 2XS5A 3PTWA 1N5TA 1RADB 4LFAJ 3FJ2A 3VAMA 3SXLA 4U7UK 1KP6A 3ZZYA 4WP8A 2FGOA 2AEMA 2ZNYA 4R5PA 1PC4A 2CKWA 2QYGA 4RW8B 2VG5A 3CEDA 3TI0A 3KJFB 2GMJA 4O3QA 2KT5A 2BR0A 5KG4A 4CYUA 3V6DA 2RRAA 4E2FB 2AKWB 1JLQB 4ZKAA 1Y4ZB 2GJFA 3D6FB 4Y2IA 3DNCA 4LQ3A 4XIUA 3LO3A 3MR6A 2VFTA 3OLAA 1T9YA 3EE3A 2CA9A 2H3EB 3BB5A 3HHKA 2RILA 3H98A 1BC6A 5T41A 2XEXA 3HPOA 1A0OB 1RHKB 4B9MA 4ZVGA 1FKPA 1S1VB 3MOJB 1M5VC 4DL6A 3H5YA 1HBNB 1NK0A 3RBDA 1G7CB 2E5IA 4NEZA 3ENQA 1KSPA 4NLXA 3QJPA 3MM6A 4WU3A 4HH1A 4FYVB 4JI1J 2PSZA 2E44A 4ECQA 5DRKA 5DETA 3ZTSA 4OLOA 3W2VB 3BO3A 3HVTA 2IYGA 4Q43A 1AW0A 1YJUA 1NH7A 1IBCB 4IH5A 5ETOA 4OJ3A 3IAS9 1AFJA 4LRCA 3LANA 3C6UA 2HNYB 1S9FA 5L46A 1PJ6A 2GHVC 4ES1A 1RHJB 4WBFA 2U1AA 1KHWA 4UOCA 2WVEA 1JXEA 3OTOJ 2W2PP 1M0SA 4JYAF 4OX6A 1AUDA 4LR8A 4RW6B 2RT3A 1HHQA 4JI4F 1D9DA 4DR4J 1QTMA 2YNGA 4KYZA 1TL7A 5A8RB 4USVA 2XYHB 2DNHA 4K4UA 2CPIA 2RB7A 3H40A 1X60A 3LF0A 4K2JA 4CLUA 3AOCA 4WTOB 2BKNA 2V34A 2YQ1A 2ZDPA 3ZO7A 4DCOB 2W25A 1RUSA 5CH7B 1VQLS 1WOPA 2E5GA 1LW2B 4CO2A 1S1TB 5J2PA 1YI2S 3BO2A 3PVXA 2CPFA 4ZVEA 3L4BC 4NCGA 1RHQB 3M2UA 5C42A 3QRPA 4DV3J 1IQTA 4M5IA 4L6V3 1I5OB 1X4DA 5K8MA 1QAXA 4DCPB 2FHJA 2NXNA 5U47A 4DV0F 3HF5A 1NCLA 4R0JA 2VC0A 4QR2A 2VKRA 2ZOMA 2EKNA 1F2GA 1HW8A 2OPQA 1QD1A 3T41A 1SC3B 1KTQA 3AAWB 4U7UD 1S76D 1K0VA 1NDKA 3DHWC 3HKZD 2ADCA 1X4CA 2WRMA 3LA0A 3LGNA 5J2NB 4FS1A 4YY3F 1SL2A 4TY9A 1S6QA 1BY9A 4ZVOB 3R7BB 2DGSA 3JSYA 3KK1A 3A3PB 1H73A 1VQ8S 1CPZA 4DR7F 2CAJA 4JP8A 2KT3A 2AGQA 4ANEA 5EDWA 5SUHA 2QL9B 1REGX 3K5PA 3ZNUA 1KR4A 2CNLB 3T19A 2HAIA 4USWA 2ILZA 1N5SA 1OSCA 2BE7D 5JUMA 2AEFA 2HLUA 1NXIA 1O0PA 5JVHQ 2YH1A 1DQ9A 2OPPB 4P74A 2BQRA 2UUCF 4H4OB 4P7VA 1BD6A 3CC7S 4K4WA 3NGRA 1SQGA 3MECA 4DZ6A 5M2PA 3AHPA 4X4NA 4GKJF 1J5OB 4LF6J 3FEYB 3BREA 4G3IA 1WD6A 3TZZA 3PIPQ 3KJNB 1XMOF 4DSEA 4DPTA 5KG0A 4V19X 4DUZJ 1S59A 4RW4A 1C1BB 2YKNB 4OHZA 2W9CB 2R7SA 2R2UA 2KRBA 2M0GB 3RTVA 2JOQA 2HSEB 5CZVA 2C2MB 3GQCA 3KK2A 4JB8B 3RBXA 4UOFA 2MHEA 1NJIT 4K4TA 4J9SA 1MU2B 2IMWP 3R5BA 3UI3A 1Q78A 5IFMA 2VFUA 4ANCA 5JJBA 4KB7A 4BWMA 3VAGA 3IWXA 1VRTA 4DV6F 4I7FA 2FVQA 3OXLA 3DRRA 1MMLA 1OO0B 1H7WA 4HACB 1HNIA 4X84A 4RU9A 2CPYA 4DQIA 1TQLA 4J9MA 1UWBA 3G2XA 3BR8A 3TX8A 2OP5A 1VBYA 1BLUA 1KOHA 5DJBA 4M8LA 4WFAQ 3EMTA 1JWWA 5HBMB 3VAKA 3KUHA 4NI2B 1FK9B 3BBBA 2V8DA 5KG2A 5KT2A 3M8PB 4CLYA 2RH3A 2V8PA 3A12A 3OFEA 5A76A 3Q8RB 4EYHB 5KOWA 1M5PC 1RBOB 2X1FA 4L76A 5FJ4A 1N36F 1SH3A 3CSKA 2DNGA 2HNDB 1YJVA 5EX0A 4F04B 2N3LA 5GAGI 4DL7A 4ZVRB 1XTZA 1UCNA 2JZ5A 3PEJA 1RYSA 2HWIA 4EUVA 3K8WA 2MY7A 5IC4B 2MZTA 4JBCA 2LVWA 2UUTA 4DBQA 3CD6S 4F3MA 4MT1A 4DUYF 3T5JA 4DX7A 2M4MA 4JI5J 2N7YA 1Y10A 4B3MF 1T02A 2VASA 1R31A 4DFKA 1EX8A 3NNHA 5HMZA 1X4FA 4UZCA 1S6UA 3QZ7A 4NLWA 3PFEA 2DEIA 3AXKA 3ILLA 3KTQA 3CJSA 5B7WA 4WP9A 2CPZA 1WC0A 1TL3A 4HEA9 1VMBA 1E6VB 4W92B 4L74A 1T94A 2A1BA 2YPYA 5GAHI 1HWKA 3JAMY 4EBDA 2PEHA 4DR7J 2IA6A 1RYRA 3OHAA 4A8QA 2ZKTA 4QYZJ 4IYQA 2NXEA 1S77D 2GFFA 1L3KA 1SJFA 5HLFA 4EZ9A 3BGFA 1GEHA 1KFDA 2IRXA 3MF5A 2JC1A 2DCUB 2KJVA 1XMBA 3M32A 2FVCA 3JQMA 3J81Y 3VZHA 3GV5B 2HFZA 2Z2YB 2UUCJ 3F44A 4NLYA 1Q5YA 4PR6A 4KC5A 3CW2C 3UN2A 4UF4A 1WF1A 2DT9A 2RRNA 1HWUA 2V4QA 3EICA 4RNFA 2R8GA 4ZA1A 3D66A 2XSJA 2IJNA 4ZDNA 3JQJA 4ZLPA 2FLLA 3HHLA 3PR4A 2BV3A 3HM9A 2H5JB 1X9WA 1MW7A 5KFMA 1H6KX 4C11A 2EEYA 3RJMB 2Z0GA 1IR2A 2ZWPA 4U7CA 1M1KT 3GR0A 4C98A 1RAFB 4FF3A 4TYBA 2AYEA 2QTWA 1U7LA 3R5JB 1T03A 1K73T 2D3UA 2EXUA 2CZVC 1B64A 3GZ7A 1VGYA 2HHTA 2GO9A 2EVZA 2ZITA 2CPHA 4CRJA 4DV6J 4WCEQ 3V81A 2DPJA 3KLFA 2CQ2A 2RMLA 2D3O1 3DGPB 1S57A 2HHUA 1JLEB 1JKHB 1AXQA 3C6TB 3QGPA 1ZAVA 3T3FA 3VHQA 2D9OA 4M95A 2CPXA 4IG0B 2HMIA 1IM4A 1UKUA 1YG0A 4ZVFA 2QA1A 4R0EA 3PR5B 1RCXB 4K5SA 2HK2A 5K8NA 4FP9A 1DFDA 3GCWP 4FYDA 1YBUA 2CQHA 5KFPA 2K7KA 1DTTA 4HDGA 4MFBB 2MHNA 1FXLA 2MKSA 3TUIC 8RUCA 3OFFA 1F3VA 4MK8A 2BRKA 1LWCB 1K44A 3VGUA 4C2MA 4A8KA 2PMHA 1N36J 1KS2A 3OBIA 5AJ3J 4XPCA 1U6FA 1NB2A 1GX5A 1M90T 2B9YA 1WNEA 3DXBA 2UXDJ 2I8EA 2RE1A 3FCHA 1S4EA 2HFOA 3M30A 1WDTA 4IOCQ 3KFWX 4H4KA 3Q8PB 1Q81T 4ECSA 2BBEA 1G1XA 2KL8A 3IM8A 1FX4A 4YDXA 2M3DA 4FF4A 3DDKA 3KG0A 3D67A 1KTVA 1VYAA 5I3QA 5A2QU 3M2VA 4NYOA 2HNZB 3QZ8A 5K8PA 5DGBA 2R2SA 1TV6A 1JLGA 3M1VA 4J9KA 5JVGQ 1EHWA 3CDEA 2V9WA 3F0NA 2GJ2A 4TQRA 4ZN1A 2EFVA 1NKCA 1WJ9A 2MKIA 1VC0A 3TA1A 3ENWA 2HGNA 3DM2B 2B6AA 4TU9A 4A8MP 2I1RA 2FVPA 4JI7J 3FDSA 3H2VE 4USTA 2FVSA 3MEDA 5L9NA 5KOXA 1NO8A 5D4LA 4ECZA 4PAAA 4WIIA 3K5MA 3ONQA 2FJAB 1JLQA 3FRYA 3CO9A 1HQEB 2OSQA 1D9AA 2R4FA 2YKQA 1H2TZ 2AEJA 4QBUA 1TK8A 3TEGA 3CVKA 3WZ0A 4YHHF 2QIFA 3GG1A 2BMBA 3TP2A 2QRRA 2CNKB 2W1BA 1M5HA 4F25A 2XS2A 4DR1F 1VQSA 3R5CA 3NG8A 4F4ZA 1R8BA 4KHMA 3S6EA 3RW6A 3M8SA 3TZWA 2PDAA 3M6XA 2HVDA 2UXBJ 3TQEA 2YY3A 2XC9A 4AUKA 4FKXA 2F5GA 1UVMA 3IR6B 2CJAA 5LMUJ 3HFVA 2AP6A 1N48A 2W9BB 4C97A 3VAHA 4XO0A 5ETNA 5B0GA 3W2VA 5CAAA 3EGNA 3ILOA 1RTHB 4Q2MA 1FVQA 1E6YA 4H54A 2IMOA 1PC5A 4WF9Q 3SSQA 4QIWD 2NCKL 3W9JA 2QL7B 4YFUA 4WKYA 2HVHA 4OJ1A 1RHMB 4OX9F 2LEAA 1IR1A 1BUXA 5CHCB 4RW6A 1Y5IB 3MMJA 5D3GA 3SV3A 4RUHA 2VG6B 4F4XA 1SL0A 4USHA 1YKWA 4PXDA 4RX6A 2J7KA 1HNZF 1FCAA 2J9DA 1VLOA 4OI3A 2LEPA 3RB3A 2B4UA 1F60B 2VQEF 2OD4A 2W7AA 3AD8C 3O6QA 4NLRA 4ZCKA 3BSAA 4F36A 3BM7A 4P75A 3IRXB 2EG1A 2CQBA 1UVKA 4WYLA 4R8UA 2WOMA 4DOZA 4MAKA 4F2SA 3H42A 4L75A 1FDAA 5HMYA 1VJQA 2ALZA 2ZH2A 2F63A 2OUGA 4RL1A 3L3CA 4B02A 3EPIA 2XO7A 2Y1IA 4IR9A 5IM0B 1H7XA 2O5DA 4DCJB 3NEKA 1PIEA 1NK5A 2VKZG 4J9LA 4PG8A 3CC4S 2XY7A 2HYIB 1FE4A 3PJWA 2DR5A 2J0SD 4KGZB 2FHKA 3OQ2A 4C48A 2CJQA 4ZIWA 1LWXA 3D1QA 4PG5A 5J2NA 4AL6A 1NH8A 2W8KA 2DXFA 3THTA 5L1JA 4XAKA 1SUQB 2CPDA 2RU9A 3CC2S 5DQGA 1N5QA 1UFKA 1U09A 1UETA 1NMEB 1W2BR 5KFXA 1EKSA 3BGOP 1NU4A 1PBAA 4OJGA 3EZ5A 3OXFA 3HP6A 1REVA 2ZD1B 6AT1B 4B9NA 2IC3B 2VBXA 1FE0A 5E3QA 2CXEA 1VOMA 2XQCA 3BYPA 1N8RT 4I64A 3DHXA 4DL0C 2YXLA 2RRBA 5HMWA 2OPPA 2VPXB 1KVIA 1PAEX 3NMAA 4EEYA 4C8NA 1MN7A 4H4OA 3C3LA 2IVFB 1WKLA 4E8UA 3H5SA 5IS2A 2LP4A 3JYTB 2PI4A 3FFIA 2CQGA 2YWEA 5DQIA 1WKKA 3KHRA 1IBKJ 1PG5B 1SKRA 2QO3A 3GYNA 2LLZA 3MMCB 4XDDA 4LSNB 1NK4A 2HPUA 3OUYA 1AA1B 3W9HA 2BM0A 1C1BA 1WACA 4GVBB 2YKNA 3QJJA 4IDKB 2W9CA 2CNNB 3DOLB 2ZC4A 1NK8A 1VQKS 4RBTA 2BJEA 3NY0A 3CB4A 1RWVB 4MKVA 2H51B 2CDQA 2RQCA 2GIFA 2C3YA 3L7UA 3Q8SB 3GJSB 3I0RB 3SIPB 1MU2A 2IM0A 4AQYJ 3UD3P 1LFWA 3I56S 4AT1B 4USJC 3OVAA 1TKZB 1HIYA 4HI2A 2EK1A 4CT9A 4ITSA 1Z4UA 2MKYA 1CULB 3U1LA 3AJ2A 4X64J 3R27A 3KMSA 3HD2A 2DH7A 2B5JB 4FXVA 1X4EA 2WVFA 3FEXB 5HQMA 4I2QB 4ID5B 4JV2A 3NCPA 2A2DA 3SSSA 1QY7A 4JI0J 4DSLA 4Z2XA 5HBMA 1X4AA 1WHYA 4I56A 1FK9A 1R8HA 4CO5A 2B9EA 3RB6A 5KFVA 2E29A 4OX9J 1V5VA 5GAGU 2KTQA 4EYIB 3OL6A 2VPWB 3UCGA 4A48A 1GTHA 1UL3A 1HNZJ 3HZEA 2J9DE 4GMKA 2PGCA 2GHWA 2YPZA 5H9EK 1XNRF 4J9VA 4C8MA 3D6HB 2HNDA 4DN0A 2HFUA 2VQEJ 1N5YB 2JWNA 2ZH4A 1IBLJ 2I0XA 1WTBA 5LXYA 5AXMA 3W1YC 4YB5A 2DRBA 3BGRB 4PUOB 2C2ZB 2FJXA 2YWFA 3GSIA 3DFEA 1U8SA 4F26A 1FWLA 3L7OA 4RNHA 4KKOA 2FGCA 2M2BA 5BXIA 3DLJA 1N32F 3LP2B 3U02A 3GE9A 1YQHA 2QFJA 1RT1B 5FD1A 1XC9A 2Y9HA 1CS4B 2C3UA 2I9SA 4DR2F 3NOGA 1JIHA 2XMMA 2PT0A 2R2RA 2ZH1A 1LOUA 1N6QA 5GAHU 3JTPA 5ETLA 5KFOA 4OHVA 3DC2A 2O1PA 2BQ3A 2DNKA 1QUVA 4WFBQ 3FEZA 1NSKL 3V6HA 3MGJA 4ZCMA 3DLLQ 5IT9U 5DDOC 1ZH5A 1RJJA 3R9LA 2UU9J 2ZOGA 2W7OA 2FLNA 4M5JA 4WK3A 1U1OA 1K1QA 3GYXB 1U4BA 2J8AA 3M9OB 2LQ9A 4FPIA 4KPCA 2CJ9A 2R8HA 1NHUA 1RT2B 3NGTA 3CCWA 3ZFVA 2WB1D 3MM9B 4DS4A 2O01C 3C15B 3Q86A 4MJKA 3J80Y 3ILJA 4GC7A 2Q1LA 3N4WA 4RNNA 2E1AA 1R0BG 1CJUB 5J1EA 3PYDA 3R2CJ 1YJTA 5LMNJ 3PKMA 4OI4A 4CH1A 1RWPB 3CD0A 2F4FA 2F8HA 1U2RA 1A9NB 1SCJB 1JQGA 5LSRA 1JJ4A 3EVOA 1YRXA 2DR9A 3JB9k 2FHOB 3GJTB 1FO1A 4G1PA 2LU1A 4JV0A 4DUTA 3L95X 3VCDA 3LWLA 2GW8A 2BQUA 3K8VA 1XN9A 3OPKA 4BWJA 1B7YB 4B17A 2BRLA 1FRXA 3BYRA 2IAJA 3KKFA 2IBOA 3C16A 2DY9A 1URRA 1YZ7A 5DS7A 1HYSA 4QPXA 1R0CB 1T9TA 2WSEC 1BMQB 2GC8A 2DCLA 2HEKA 4D3GA 3W5XA 3VAIA 4ED6A 3AJ1A 1RBLA 3WC0A 1RDRA 3LP1B 4LBHA 2Q66A 4KO0B 4IFYB 4K4SA 3KG4A 4RO0A 2E5LF 1WI8A 4PWDB 2DNMA 1I51B 4WIQA 2Z56B 3DGPA 1GH8A 2CJBA 4WP3A 3J7ZT 4WXOA 3C6TA 3PRVA 1T95A 3AH6A 3O1LA 3TX0A 2EC0A 2DPIA 1T7PA 2G4BA 2B7CB 5DZ7A 2J0XA 2QE5A 1U0HA 4J90A 2PI5A 3MEEB 4Q8FA 1X8DA 1TELA 4C9DA 2RVJA 4MFBA 5CYQB 4EK2A 2D74B 3HK2A 2WVBA 2HFVA 4O3SA 3NNAA 2W4CA 1QSLA 2LA4A 3GJRB 1QM9A 4TNOA 4FF2A 1VRUB 3M6WA 2QLXA 1LW0A 2R7RA 2MTLA 1HD1A 1IQZA 1ZS6A 4IUFA 3DXSX 1XNRJ 1FRMA 4KSEB 1CJKA 1OPZA 2LU2A 5DG9A 4O3PA 2JSXA 2XLIA 4ECWA 1MN9A 5ETTA 1NZAA 2UUBF 4AD6A 3VZIA 3BH6B 3VR1A 4FYYB 3MMBB 3IXQA 3FBBA 1FDDA 1PO6A 1EIYB 2AD9A 1C4AA 5J2MB 1N32J 2KXHA 3DN9A 2HNZA 4X2BA 4CM0A 2Y8WA 4NOHA 5ETQA 1RK8A 2H48B 1TL5A 2G2ZA 3KLGB 2CQ1A 2V94A 1M1GA 3T9ZA 2W01A 2YTCA 3BZQA 2YWHA 3NXZA 4V19J 4ECUA 5AXLA 2BXJA 1X5OA 4FDFA 5C5JA 4R5PB 4OI2A 2YNFB 4B9TA 1HQUB 2M8HA 2VG5B 2GZOA 3TANA 1AROP 2UV8A 1VK3A 2DGTA 3A4TA 5KFUA 4CYUB 2G2OA 3H2LA 3V6DB 1YWXA 3QT6A 4DZDA 2IJRA 2QV6A 4ERDA 3OT9A 2K3IA 3AB2B 3KJVB 5E33A 1P9QC 4YB7A 2UUAJ 1HQEA 4ETZA 2Q6CA 3MR2A 5F8GA 2MPUA 4X4PA 3CD5A 3AY0A 3PO5A 5GVQA 2VD3A 4RJVA 4ED4A 1FKPB 2VPZB 4NCAA 2MKCA 1GMVA 1K0TA 3H4BA 5KFWA 1KQKA 2NSCA 3TA0A 1ICEB 3MR3A 4M94A 2BOPA 3P45B 4GO7X 1SJQA 2P8IA 2MQLA 1U2CA 3HFKA 4KGXB 3MCOA 3UDLA 1LXNA 4KHRA 4DFPA 3S1TA 1IKXA 3HVTB 2ZJPQ 1WTFA 3CGIA 4FNIA 2GVDB 3WX8A 2HFNA 1N0UA 4N5SA 2DXEA 4K4YA 3BQ1A 4UY85 3R97A 4ZLLA 4J37A 5B09A 4NYPA 3C6UB 4OV1A 1BWEA 5EX3A 3PX0A 4EMDA 2DVIA 2IIHA 4DQSA 3UR3C 1SB6A 1UZDA 3SEOA 4KHPF 3CDWA 4ED2A 3CO0P 4W4MA 2BOAA 5IXUA 3DOKA 2LKZA 2B8QA 1TL7B 4NA2A 1KFSA 2V50A 1NRKA 5J2QB 4NLGA 2VG6A 2CIMA 3TO8A 3OSNA 5BYRA 2DGOA 1XR6A 4DR3F 1S0MA 1U1LA 2OH2A 3KMQA 1CJTA 2Q3PA 3CCTA 3CTRA 3C46A 4LQ9A 4JOUA 1AZSB 4QWAA
chains in the Genus database with same CATH topology
3PACA 3M2UB 2RNEA 1RT6A 2QEXS 4DFJA 1Y0HA 1UVLA 4A4JA 5KG1A 5IT4A 2MHEA 5DGAA 4K4TA 1NJIT 2RKIA 4TU7A 1ZM4A 4J9SA 1MU2B 2IMWP 2X3GA 3CJ2A 1ZETA 3G4SS 4IQMA 1XR7A 2B4PA 1DBDA 3CCSS 3JSBA 2B43A 3R5BA 5E3PA 1S1UB 3ZZTA 2GMLA 3PXGa 1Y5LB 1T3NA 3UI3A 3HVRA 2CPEA 2OJ3A 2O67A 2PMZD 3CCJS 2M70A 1Q78A 5IFMA 2VFUA 4URSA 1MSWD 1KN6A 2X1BA 2K1RB 1E6VA 1SL1A 5JJBA 4G1QB 1UP1A 3PRDA 4KB7A 4Q45A 4BWMA 3N79A 3H4DA 4DQRA 3VAGA 3IWXA 2H5EA 1VRTA 2KG1A 3K58A 1VFJA 2YNIB 4DSJA 5F8HA 2HVZA 4DV6F 4I7FA 4JI2F 2FVQA 3OXLA 3DRRA 1CQMA 2BVZA 4WXWA 5IM0A 1MMLA 3QAEA 2MQMA 3CXCR 2V4RA 1OO0B 1EP4B 1H7WA 1WEYA 4DV3F 4IRKA 5IQQA 1HNIA 2GCFA 4X84A 1HPZB 3MM7B 4RU9A 2CPYA 3IBWA 4DQIA 3O3LA 5SZTA 5KFRA 5KT4A 1M5OC 4PXBA 1TQLA 4DL4A 4ZK7M 2UUAF 3K0JA 3J7YI 4J9MA 5FIIA 1UWBA 4TN2A 1NKEA 4OZJA 1UW4A 4BBYA 3BR8A 2EBEA 2EFNA 3TX8A 2OP5A 1X5SA 2OO4A 3M8QA 1VBYA 4CO0A 1JX4A 1BLUA 3UWTA 3QIDA 2JH3A 1KOHA 2UZAA 2MYFA 4OHWA 5DJBA 3RBEA 4M8LA 4KFBB 1WI6A 1HBMA 1YVFA 4QOTA 3ZZOA 4ED1A 1X4HA 4WFAQ 1F5BA 5F8MA 3KK1B 4ZPVR 3HHEA 3ULHA 5D6GA 4YR0A 1JWWA 5HBMB 2CQ4A 3VAKA 5EHHA 3LP0A 3PW7A 2FDNA 2MZJA 1EETB 3UW1A 2PC6A 4ES3A 1FK9B 4HI1A 1I6JA 2FY1A 3BSNA 2OIHA 1FD2A 2V8DA 5KG2A 5KT2A 3PW5A 3R1LA 2I2YA 4QQBA 2UP1A 3N6NA 4H4KC 1GT8A 2QZ8A 3SZ2A 1RQ0A 3FQKA 1HI0P 1IKXB 1SKWA 1KC8T 3H5XA 1X5TA 5HI7A 4ECYA 5IQ6A 3M8PB 2RQ4A 2HRYA 2RS2A 3F41A 4DQPA 2RH3A 3UFCX 3OFEA 1SH2A 1DARA 2BANA 1RA7A 3EXYA 4AL5A 3Q8RB 1KQGB 1S97A 4I6YA 5KT5A 3VTIA 4EYHB 5E0OA 4PRFA 5KOWA 1M5PC 2ZD1A 4MKBA 1LQ9A 3TUJC 5KFTA 4WFZA 4A8SA 3E3XA 5L38A 5DM7Q 2DISA 2R2TA 4RUAA 2X1FA 5FJ4A 1N36F 1SH3A 2GO8A 4X4UA 1SBRA 1KNZA 4AFFA 2F40A 2QT7A 3MCSA 4TY8B 5F8IA 3R3TA 2RUGA 2LQBA 3CSKA 2DNGA 2YWKA 3LQVA 2HNDB 3QIPA 1YJVA 5FLXY 1N33F 2IM1A 2RSQA 4TQSA 2VFSA 2KXFA 1R7IA 5HN0A 2VG7A 5KFNA 1RTDB 5EX0A 3TRGA 2L41A 2J6UA 2N3LA 4N41A 5GAGI 2GHPA 2JVRA 3GIKA 4DL7A 1Q8IA 3PY8A 5CZXA 2VBZA 1XTZA 1YRUA 3FSXA 5AXKA 1ZTTA 1RT3B 3H5UA 3O2IA 3A1YG 2JZ5A 3PEJA 3IS9B 2IM2A 1RYSA 5KFHA 5KTQA 5KFSA 5B0DA 3C2PA 3FGVA 1UVJA 3FVYA 4ILLA 1DAXA 2JVOA 3P5TL 4WE1B 5E7OB 2HWIA 4EUVA 3DOKB 3K8WA 2MY7A 4BHQA 1G3OA 5LJ5Y 2MMYA 3BSOA 4ZPCA 2MZTA 4JBCA 3JYTA 1ZBTA 2OPSB 4C0BA 4FXDA 2VOPA 2RIJA 1G6BA 4NLOA 2LVWA 2P9GA 4MKYA 1X9MA 1GXLA 2UUTA 4DBQA 4O4RA 3MURP 3BQ0A 3CD6S 1QAIA 2P6TA 4F3MA 2KJWA 3DRXA 1Q7YT 4DUYF 5FDLB 4ELTA 2FLOA 2J7UA 4DR6F 2GQ2A 1FNMA 2GJIA 3T5JA 4N8OA 1VQPS 5DG8A 4RW4B 2CQIA 2JC0A 1BQMB 3MOZA 1V6HA 1V3ZA 5HP1A 4F2RA 2F8EX 2M4MA 3MMCA 2N7YA 3LALA 2L3MA 1IKWA 4LSNA 4ED8A 3KYLA 4RKUC 2B56A 4B3MF 4LF6F 1T02A 3Q2TC 1X4BA 4ID8A 2VASA 2Z2MA 1X7VA 3T1YF 3I5CA 4Q8EA 2DO0A 4IDKA 1R31A 4IG3A 1UEUA 2HLTA 1AFIA 2HG4A 4DFKA 2DNYA 3H8YA 1J2VA 2HHVA 2KYXA 1LFPA 1JLAB 3DOLA 3NNHA 4AYBD 3CJKA 3KK2B 5HMZA 1X4FA 1SKSA 1S6UA 2AJFE 3QZ7A 4NLWA 4ECXA 3PFEA 1JLEA 3UD4P 4DUZF 2RKIB 3KTQA 3MTKA 1JKHA 2A10A 2E5JA 5B7WA 5BJRA 2CPZA 1GQEA 2YKAA 3CJ3A 2EFPA 3HKWA 2R7VA 4UQTA 2WK4A 3T1AA 3DRPA 4DG1B 4DHVA 3UNGC 1KLMA 4IG0A 1TL3A 3MUTP 2HHWA 2EPIA 1LWEB 4RWWA 4QWEA 4HEA9 4P6QA 1VMBA 5BR8F 1E6VB 2F9DA 4MMOA 4M63A 2DGQA 5LJ3Y 4W92B 1PSDA 4KPYA 5B0AA 4ICLA 1T94A 1L3TA 4BC7A 3IGVA 5AE1A 1TKZA 2ZHBA 1QJHA 2EFGA 4OI6A 2NPIA 2A1BA 3MD3A 4KR0B 1TKDA 3D28A 5GAHI 1HWKA 3TAPA 1W25A 3JAMY 3KWMA 4EBDA 2PEHA 4X4OA 2IA6A 1RYRA 2CQPA 3OHAA 4A8QA 2ZKTA 1TVRA 4QYZJ 4C4WA 4BCAA 4CQ1A 4DL3A 3UCUP 4MK9A 1D9FA 4IYQA 5E2QA 2XNRA 1S77D 2GFFA 3DLKA 4DSKA 3BJYA 3VWSA 3E01B 4URQU 1LKZA 1L3KA 2B5JA 4OX7A 2NSBA 2YNHA 1FRLA 4LVNP 4PG4A 4RW7A 1UWBB 1LWCA 3G6VA 1SJFA 2NLWA 1YIJS 4Q0BB 5HLFA 4FVMA 4EZ9A 1RT7B 3BGFA 3M8QB 4C0OC 1KFDA 3MFHA 2IRXA 3MF5A 1JMTA 2DCUB 2JC1A 2KJVA 1VLYA 1XMBA 2VFRA 3MAHA 1DQAA 4F67A 3M32A 3UE2A 1UJ4A 2FVCA 3J81Y 2CJKA 3KLIA 3OTDA 4NLPA 1R43A 3VZHA 3U27A 3GFZA 4LMZA 3EXCX 3TARA 3GV5B 3GFXA 2HFZA 4NRUA 2NYIA 1RTJB 3GV7B 3LP0B 2NUUG 3OTBA 3F44A 4CNZA 4NLYA 2MB0B 1QAYA 2XWXA 3TOQA 2L48A 2J6TA 1OPIA 2Q79A 4PR6A 2RU3A 4KC5A 3NCQA 2LEBA 5KG5A 4RZRA 2K3KA 2P9CA 1L5UA 1WF1A 2DT9A 4X65F 2RRNA 1HWUA 2V4QA 1WHXA 4Y2CA 1A6LA 5DDRC 1DHMA 2KDOA 2BANB 1CC8A 5KFLA 4RNFA 3QPIA 2XBPA 2OPRB 3CCRS 4G6VB 1SIZA 2R8GA 4ZA1A 1DQ8A 2XSJA 4LSLA 2IJNA 4ZDNA 4PCQA 4ZLPA 4YB6A 3CCUS 2FLLA 1S1XB 4LIRA 4KJIA 2NS1B 1VQ5S 4NRTA 3HHLA 2AX0A 1TFWA 1CLFA 2NQPA 3PR4A 4ECVA 2LQ5A 2X1AA 2BV3A 5AE2A 4RNOA 3HM9A 4AE5A 1FRKA 2PO4A 3QIPB 4RBUA 1X9WA 1HWLA 1MW7A 4Z37A 5KFMA 3HHDA 1H6KX 2VG7B 1FEEA 1JLFA 1S1WB 3BSCA 4C11A 2ZHAA 1U49A 2QA2A 1I94F 2GA7A 3NAHA 2LDIA 3GFHA 1FKOB 3THPA 1Z2LA 4ZPBA 3SFGA 1HBOA 4WZMA 4NMLA 1U47A 1OS5A 2Z0GA 5E3CA 4U7CA 1M1KT 1CQNA 3GR0A 3ZZPA 5K14B 3OJUA 3LOUA 2ATLA 2C28A 3DU5A 2UVUA 1TL1A 4C98A 2VB6A 3MFIA 4NLTA 1JB0C 4FF3A 4TYBA 2AYEA 4K4XA 1U7LA 1UFLA 1NJXA 4O3OA 4C8LA 3ZC4A 4ZOSA 1S7HA 1T03A 1K73T 5KG6A 2ZHOA 4DR5F 2X1GA 1TKXA 3FMWA 2XY6A 2D3UA 3DM2A 1U1PA 3V4IA 1Y00A 1U6BA 4DLGA 3V6KA 2CZVC 3X3UA 3I0SA 5D4PA 2XULA 1B64A 3GZ7A 1VGYA 3LGMA 4KAIA 2CVEA 2LMIA 4QU7A 4DX8H 2GO9A 5KFJA 2HHTA 3AB4B 2EVZA 2AGOA 4Y2KA 2EI5A 2ZITA 3LP2A 2CPHA 2FIUA 2AV5A 4WCEQ 3I96A 3PHEA 2RQMA 1KRPA 2ZH5A 3Q23A 1N88A 1BGXT 3V81A 2DPJA 3KLFA 2CQ2A 1IKYA 2MZQA 2RMLA 1U6ZA 2JHEA 3MM5A 4RW9A 1U45A 2Q6BA 3HVWA 5D8HB 1R0AB 2HHUA 1JLEB 2PD1A 3D54A 3IN5A 1RAJA 2FJDB 2ZH8A 4YDDB 5DG7A 1JKHB 4A8WA 1AXQA 3C6TB 1S49A 4WYWA 3QGPA 5F3TA 1LXJA 4HTIA 1ZAVA 1L3VA 3T3FA 1NHVA 4JI5F 2DO4A 2XI2A 3LH2S 2D9OA 2CPXA 4IG0B 5IWAF 1T05B 2HMIA 3NKYA 4M95A 4K5RA 1TL3B 2FLPA 1IM4A 5H9EJ 2C2RA 4B9SA 4Q2LA 1UKUA 5F8LA 3RZAA 1YG0A 5ITHA 4ZVFA 5DO2A 1WG4A 4P2SA 3W7BA 2QA1A 1Z1ZA 4R0EA 1H2UX 4LF5F 3PR5B 3G6XA 1ZAWA 4K5SA 2XCPA 3AQPA 2MGZB 2VUGA 5K8NA 4FP9A 4CH7A 3TAQA 3JTNA 1DFDA 2V4JB 1S9GA 5A6PA 4EBCA 1VQ4S 2ROEA 4FYDA 4K59A 2CQHA 3VQTA 5KFPA 2K7KA 1DTTA 2DHSA 4HDGA 4MFBB 1QSSA 2BA9A 2MHNA 3NRBA 4EO6A 1FXLA 2MKSA 3TUIC 5KFDA 3OFFA 4MK8A 2BRKA 4KGKA 4YEAA 1Y3KA 1R3NA 2ASDA 1F9FA 2YX1A 4C3KA 1HARA 4ED3A 4J5OA 3VAJA 3NLCA 3PDNA 2D7SA 4RW7B 4WJBA 5KT7A 1LWCB 4Y34A 4NL5A 3SDEA 5KFCA 4ED5A 3PW4A 4QWBA 2O3DA 3MM6B 3NGKA 1DURA 2AF6A 4C2MA 4A8KA 3POTA 5G4DA 3M32B 2PMHA 2KXNB 3IG1B 2VA3A 4UW2A 2HQIA 1KS2A 2ZH6A 1RWUA 3KLIB 3DLGA 3OBIA 4IOBA 1UAWA 4CZCA 3GIMA 3MPYA 4OFZA 4XPCA 1U6FA 4NZ7A 2BE2A 5J1NA 2XGPA 1NKBA 2FPHX 1FA0A 1GX5A 1M90T 2B9YA 4RBVA 4B3RF 4MIAA 3DYAA 1QLNA 1WWHA 1WNEA 3DXBA 2RF2A 1HR0F 2HVIA 4AXJA 5CXTA 2NREA 2I8EA 2W9BA 2RE1A 1FHTA 3OR2A 3RAMA 3FCHA 2ZE2A 3DI6B 2HFOA 3M30A 1PILA 4IOCQ 3T5LA 2LXIA 2ZJQQ 3X1LB 2HHQA 1VIOA 3V4MA 1R6YA 1FT8A 4LF7F 4ZP9A 2FJWA 1RTHA 3KFWX 4H4KA 2LECA 5KFYA 3O8WA 3Q8PB 1Q81T 4ECSA 2BBEA 1G1XA 4ES2A 5K9FA 4YR2A 4YDXA 2M3DA 2DIUA 2B4VA 2XSJB 4LSLB 4FF4A 2KFNA 2SXLA 2K7JA 3DDKA 1VQMS 3KG0A 4FN5A 2E9TA 2NR0A 4M1KA 1KTVA 4M5DA 3WC2A 1D8ZA 5K5MA 5I3PA 5C24A 5I3QA 3TYTA 3FZ2A 3P49B 3M2VA 4NYOA 2LCWA 2FB0A 3U1NA 3QO9B 2HNZB 3I6PA 5BYSA 1FXRA 2RDIA 3PNIA 3QZ8A 3W2WB 5K8PA 3CDBA 5I3UA 5DGBA 2R2SA 4MKAA 2DHGA 2RQKA 1TV6A 1QAJA 2IRUA 1JLGA 3PW0A 3M1VA 1V9OA 3RU0A 2WONB 2WCXA 4NXMF 1HBOB 1FERA 2YNGB 4EZ6A 2WSCC 4J9KA 4ZPDA 1DTQA 2LYVA 1QVGR 5JVGQ 2BUNA 1CEZA 3CDEA 2V9WA 5L39A 3KK3A 2ZVSA 1HA1A 4LUBA 1TL1B 2GJ2A 3ITHA 2FJBB 4TQRA 3T5KA 7FD1A 1S0NA 2EFVA 4OHYA 4ZHRA 5A8KB 1NKCA 2JFDA 3SCJE 2XHWA 2DGUA 2D1CA 3TAMB 2I38A 2YKOA 2MKIA 2FD2A 1VC0A 2GQCA 4GKKF 3TA1A 2VH7A 3CD7A 3ENWA 4CCHA 2HGNA 1VHFA 3DM2B 2B6AA 3IGNA 3V4IB 3FZBA 1HHSA 4TU9A 1ZM3A 4A8MP 1DRZA 2P5VA 2OFHX 3B82A 1Z2ZA 1IJEB 2I1RA 2C42A 3I0SB 1S6OA 2G0CA 4TXSA 4XDCA 3LAKA 1U24A 2WW8A 5J2PB 3GG0A 5H1SV 2FVPA 3FDSA 5DDPC 4Y28C 1UVNA 4NCGB 3V2UC 3OL9A 3VALA 3H2VE 1Q86T 4I0WA 2WSFC 4EU0A 2FVSA 3MEDA 3C8YA 3SCIE 1RA6A 5L9NA 4I2PA 5KOXA 2MXYA 1NO8A 5C42B 2AJ1A 5D4LA 3LP1A 4IO1A 4QR0A 3ZZRA 3IRXA 1NJZA 2DR7A 2OFGX 1VC6A 4ECZA 1IKYB 3PZPA 4Y3CA 4QWCA 4WIIA 2AQ4A 5IT9Y 3DCAA 3K5MA 3MM5B 2LA6A 3SI8A 2JFKA 2NZ4A 3ONQA 2FJAB 4HYKA 5KFGA 1JLQA 3GSDA 3MEGB 2V2KA 3CO9A 1F5AA 1HQEB 3FRYA 2OSQA 3HDSA 1D9A<