3T9ZA

A. fulgidus glnk3, ligand-free
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 21
structure length 95
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9zA00
2NUHA 2JJ4D 3L7PA 1P1LA 3AH6A 4CO4A 4CO2A 3NCQA 2PIIA 4CO3A 4USIA 4C3KA 1NH8A 2DCLA 1V6HA 5D4PA 2J9DE 4R25A 4NYPA 4CO1A 4NYOA 2XULA 2RD5C 3TA2A 3O8WA 1XK8A 3M05A 5L9NA 2NS1B 5DS7A 4E98A 2V5HG 1KR4A 1O51A 4YB7A 1HWUA 3OPKA 1VHFA 2ZFHA 1PILA 3AA9A 1QY7A 4RWWA 4OZLA 1V3SA 2O67A 4RWXA 3BZQA 2CZ4A 3O5TB 2GX8A 2Z0GA 2J9CA 1GNKA 3TA0A 1NH7A 4IYQA 3N5BA 4Y65A 2NUUG 3NCRA 4WK3A 4CNYA 3GSDA 3AHPA 4AFFA 4RX6A 1UMJA 2EG1A 3TA1A 1NZAA 4OZNA 3X3UA 1V3RA 5DRKA 2J9DA 3T9ZA 4Y6IA 4YB6A 1V9OA 1UKUA 1Q1KA 2E66A 4USHA 4C3MA 2VD3A 4CO0A 4YB5A 3AA8A 3LF0A 2XZWA 5D4OA 2J9EA 2GNKA 4CNZA 1VFJA 2XG8A 4D3HA 3CE8A 2O66A 3DFEA 4C3LA 3NCPA 4OZJA 4WK1A 5D4LA 1H3DA 2ZOMA 1UFLA 4RLEA 4D3GA 4ZK7M 2GW8A 1O5JA 2EG2A 2XBPA 4USJC 1OSCA 3MHYA 4CO5A 1J2VA 3HLUA 1UL3A 5D4NA 1NAQA
chains in the Genus database with same CATH superfamily
3OSPA 1GMWD 3IMQJ 1UEVA 1RAOA 1M1GA 4Q8EA 1WACA 4M5DB 1F2HA 2HG4A 1NU4A 3GYNA 3HD1A 2DGUA 5EN1A 2ZHAA 2IBKA 2AD9A 3FMBA 2AYEA 4O3RA 2K2PA 1BWEA 2HBRB 2F7VA 2L08A 3N6MA 1XNQJ 3FJ2A 5DDPC 1IN0A 1YDLA 2A6MA 3T5JA 2F8MA 4ZHRB 3FCHA 2P9CA 1TZ0A 1QSLA 5CYQA 4HHJA 1RWNB 1QAYA 2QA4G 3RB6A 5HP1A 3HSZA 2BQRA 3PJWA 1LOUA 3BR8A 4Y2AA 4DQSA 3OUYB 4H4KA 4IFYB 1VRUB 2PA3A 2MLXA 3OR2A 4Q5VA 1JLFB 3R5JB 4DR1J 3PR4A 4CYUA 2ZH3A 4B9VA 2MQQA 3IR5B 3RBDA 2KI2A 4CLYA 3KWMA 4KO0A 5J2MB 3AFGA 4AQYJ 1GTEA 1JLQA 1S10A 3MM9B 3SQOP 1YLXA 2E5IA 4K2JA 3W8GA 1UVLA 1SB6A 1MROB 3PJXA 2EPIA 2C42A 4I69A 3MAHA 3CJSA 3JYTB 2XZTB 1RT7B 4NZ6A 3UO0A 4OZNA 2E29A 3KLEB 2YKMA 1Z2ZA 2GHVC 4K4XA 1TK5A 1H73A 4F7VA 1RWOB 5GADI 1EQMA 5L1IA 3IP0A 1VJQA 5ETVA 2FJDB 3KLFA 5U47A 1DHMA 3US5A 3CPWR 2R9LA 2BANA 1EKRA 2P9GA 4NLDA 3Q8VA 4HI1A 3CF5Q 1VIOA 3MGJA 2QMUB 2GQQA 4K0KF 1G4CA 2OSQA 2LYVA 1BGXT 3W61A 4AT1B 2I0XA 5F8NA 1HBMB 2CDRB 1B7YB 5KG6A 1JLEB 4ZOSA 1N36F 4OHVA 1L3TA 3FQLA 3IR6B 3DLEB 3GJSB 2CQ3A 1RT2A 3M8YA 2KO1A 1CQNA 2CAJA 1XMQF 3FC9A 4CI0B 2V67A 1MG7A 3JS9A 1WF1A 2UUAF 4EBEA 1AUDA 3M1VA 3R9LA 3O1LA 5G0RA 2JHEA 1CULA 2RDIA 5C25B 4JI1J 4USUA 2W7PA 3ZZOA 1RAEB 1C1BA 2MZTA 2Z2LA 2W9AA 2CJ9A 3EVOA 3I0SB 2GHWA 3ICLA 5DO2A 5D0EA 2W8KA 4TNOA 2VDHA 3OXLA 1N6QB 1U2CA 4UF4A 4JI6F 4WBFA 1SC6A 2QX0A 2XSJA 1HMVA 4NXMJ 1WC5A 5KFHA 1T0TV 1G1XA 3BN4A 1TL1A 3GLJA 5KFIA 4OI6A 3OFHA 3FEYB 4YS2A 3ILIA 1URRA 2K1RA 4FKXA 2J6UA 3EJMA 2V2KA 3ELHA 4ETZA 1K1SA 2Y0SD 1DZ5A 1CJKB 4DV4F 2DT9A 5ETNA 4WE1A 1RT1A 2UUCJ 1H7WA 4WJBA 3N28A 3OSNA 5KAKA 3PW7A 4GKKF 5B0CA 3H8YA 1U1PA 2YNHA 3IFEA 1C1CB 4F4XA 2M88A 4FYVB 4K4TA 2AEJA 3W2VA 1SL1A 2OPSB 4I7FA 2MKIA 2HZVA 3W1YC 1EARA 2W2OP 2NPIA 4LSNA 1Y5LB 3TX8A 4FXWA 4PEOA 4A8OA 4RZRA 4DR4J 5CZXA 4KHMA 3KHHA 5IT9Y 2JC1A 3LW5C 4YOEA 2F9DA 1SKSA 3HSJA 1Y7PA 2D3OR 4UUXA 3ETOA 4ZK7M 5FDLA 2Z4PA 5FLXU 3QGHA 5CABA 2AEFA 5GAGU 4WYWA 4X62F 2J76E 1TV6A 4ATNA 3OXFA 3ZFVA 2KT2A 3G2XA 3TJ8A 3EXCX 3QSYB 4FVMA 2ILYA 2HLUA 1NB7A 2Y1LB 2HS0A 4IH7A 5GMEA 4RNFA 1QAJA 5T41A 4MIAA 3K59A 2HNYB 1R6VA 1MWZA 3ET6B 1AZSB 1JJ2R 1FEEA 2HWTA 4CRJA 1PGZA 3MAQA 4IKAA 4ZCMA 2LECA 3NGRA 4QR2A 2W01A 2VG6B 4B3SJ 2J8AA 3MR2A 3MR6A 1HD0A 3R27A 1IVZA 1FDAA 2ZZMA 3EZOA 4UOGA 3KK1A 3L7UA 5I4MA 4I0WA 2W7OA 2RU3A 2VQEJ 1Y5NB 2X51A 4IUFA 1LW0B 2OH2A 4MK8A 3TJ9A 2B56A 3MEEA 3H0PA 1BXNA 4P74A 1NJZA 3QJLA 1AB8A 1Q4RA 1LWCA 2HAIA 4KPYA 1Q5VA 1X9WA 4OYOA 3FK4A 5EGYA 2PIIA 1NSKL 3FBBA 5HJXA 3TZZA 3M8PB 5E33A 3G8SA 2DHGA 3IM8A 4CO1A 1DTTB 4C48A 2ZBPA 5BYQA 4F2SA 4WFZA 5HI7A 2W25A 4KE5A 2M5YA 2VOOA 4ZVHA 1PILA 4HL9A 3D67A 2EVZA 1I51B 3KG4A 3TX0A 2QA1A 3K0JA 1FRIA 4ECYA 5L38A 2ZJRQ 3MOZA 3QT7A 4AQYF 4Z7CA 1WG1A 1N8RT 2CDQA 1RQ0A 2MLYA 5J2NA 4F4AA 1RWUA 2YWEA 1S6OA 1V9OA 3TNVA 1RZMA 3GFYA 1FJ7A 2AJ0A 1E6YA 4N41A 4NYZA 5IM0B 1F5BA 3R5BA 1SJ4P 2VJUA 2J8SA 2R7XA 4USJC 1KS2A 1U02A 2J0SD 5GAGI 3PW2A 3MPVA 1NKCA 2BRLA 1ZM3A 4GMKA 5F3TA 4DCPB 4HHHA 3G82B 2CPYA 4KB7A 3TEGA 1H74A 3J7ZT 4MIWA 2KFNA 1NH8A 3TANA 4CZCA 4OHZA 5FIIA 6FD1A 2FPHX 4KH0B 2DPIA 4K7QA 2ZFHA 1KHWA 4TYBA 4QU7A 3UCUP 4B9SA 2I2YA 4DUZJ 2VODA 1EQ0A 2CPDA 2LA6A 3QSIA 1LFWA 4F4YA 4ECZA 3RGIA 1HYSB 2WSFC 3VHQA 3D0HE 2I6WA 1VLYA 5LXYA 3DGVA 3RTVA 2QFIA 2BKNA 2JX2A 1YHQS 1M5KC 2JFDA 2XCAA 3C46A 3HHDA 4B9TA 2AEMA 4WYLA 1LW2B 4QWDA 3LP2A 4S0MA 3K5OA 3N01A 2NR0A 1X9MA 4ZIVA 5IV4A 1S9EA 2G0CA 2BR0A 1VBKA 4NCBA 5IT0A 2NLWA 1N5SA 4N8OA 3HLUA 2QGFB 3D68A 2DGVA 3QIPB 2GIRA 3FDSA 4NXMF 3FNNA 3AXMA 2XS2A 2ZVSA 1JLAB 4USVA 1J5EJ 1SH3A 3EICA 4RW8B 2DNRA 4QWCA 3V4MA 1FT8A 2JLGA 2A2DA 2HQDA 2F65A 1IXKA 1OQ3A 1KVIA 1KOHA 4JV0A 2ZE2A 2XYPB 2O67A 4ZVQB 3MTKA 4N56A 1UJ5A 3KFWX 1KKHA 2ZZTA 4P71A 4AL7A 2VG5B 3EE3A 1Z2LA 1QE1A 4HYKA 4F26A 1OSDA 3JTOA 2ASLA 3MTJA 1LWXA 1R0BG 4ANEA 1BHNA 5J1NA 3CDEA 3IWLA 3W5ZA 1CEZA 1OWXA 1REVB 1C2PA 4P75A 2WK4A 4L74A 3PRVA 3BDEA 2HHUA 5HQLA 1FK9B 3CJKB 3RAQA 3D0IE 5DDQC 4ZHRA 2B6AA 3IRXA 2AMCB 1HNVB 1S72S 2N7CA 5C5JA 3AQPA 4NCGB 3M8QB 1ZM4A 2BOPA 3HHNB 5B7WA 4WXOA 3BREA 4R25A 3GIRA 2AJQA 1FEHA 2DXEA 4DPYA 3AT1B 2NS1B 2DNKA 5B0DA 2V5HG 1VRUA 2COLA 5ADZA 1JLFA 2A1BA 2HWIA 3BSOA 2CYYA 1NJXA 2E5JA 1NCLA 3M32B 1FDBA 1Q53A 2J9CA 2ZH1A 3PO5A 4U9RA 2ZH2A 1IBMJ 5KG1A 4J9LA 4JI8J 1SC3B 2YX1A 1UVKA 1FD2A 1RB0A 4ZLLA 3D54A 1T9TA 3OR1A 5E3RA 1U0HA 2BJ7A 1X9SA 3LUYA 5IXUA 4A8WA 4WP9A 4WIIA 3RRGA 2IBOA 4NLSA 1IR1A 1YJ9S 3DRRB 1JKHA 1MROA 3EGWB 3TW0A 2CNOB 2V94A 3NG8A 3ZTPA 3M2RA 2P8IA 1VC0A 2MKCA 3M9MB 4CDIA 2H5IB 5H9FK 3KMSA 2ZOMA 4ID5B 3EM1A 2E5LJ 3NNHA 1HNZF 1KFSA 1HWJA 3MCSA 2BQUA 3CCZA 4RBTA 2VPXB 2F4VF 1TK8A 1QDUB 1Q81T 3IG1B 1X0PA 1D9DA 4C8OA 4LF5J 3R3TA 4LSZB 3DLHA 1P9QC 5IC6B 2OELA 2HRYA 4USWA 5SUHA 4LREA 1FFSB 2RUGA 2KH9A 4WFXA 2OHDA 3RZAA 2CUYA 1LV5A 4OJHA 2ZBCA 1HBMA 4DLGA 1IBKJ 3H2VE 3I5AA 2VFTA 5LSRA 3HFVA 1EB0A 4IOCQ 2RRBA 2ZH5A 1F9EB 4PXDA 2BE9B 4F25A 4YUDA 2ZDOA 2EFQA 2X1BA 3HJVA 3S8SA 4WFNQ 3AOBA 2ZBRA 3G86A 1VFJA 3SV4A 4ZPVR 2VPWB 3BYRA 5KG5A 4Q0BA 3BV8A 2MB0B 3AOCA 2BM1A 1TKZA 1X5PA 1RWXB 1O8BA 1PSDA 3UCZP 3V6HA 4LJMA 3DGPB 3QFHA 4LIWA 2HHPA 2Z2ZA 3HFKA 1S1XB 3M9NB 3KUEA 1N6QA 2RRNA 1EAYC 2KZMA 1WKKA 1WF0A 1RTHA 4C11B 4DV5F 1FDDA 1UWBB 2BABA 3ULHA 4WFBQ 2PMWA 4Y2MA 3LP1B 2UV8A 3TQEA 1MMNA 2R42A 1TL7B 3N79A 1B7FA 1IJFB 2NUUG 1RLDA 2FQQB 4C8MA 4NLWA 5F9NA 1SJQA 4BCAA 1R0AB 4DUZF 1FRXA 2WVDA 2BRKA 7FD1A 3NRBA 3KK3A 3ITHA 3H20A 2DGWA 3C15B 2EK1A 5A0YA 2UV8G 1IWGA 4FNIA 4M94A 3SMZA 2W9CB 2BBEA 2VB6A 2DHHA 3CWJA 4OZ5A 2D9OA 2D7SA 2HURA 1CJUA 4LQ3A 4OZ0A 1FD8A 2NUHA 2V4JA 2CWXA 4F3MA 3PFEA 3OTOJ 3VQSA 1TFYA 4PWUA 4ZVRB 1KFDA 2Y0BB 1B70B 1U09A 3GPAA 4NYOA 3P6YC 4ZVTB 1CJVA 1YJVA 4F50A 2DXFA 2YNFB 4CH0S 1VQKS 1FVSA 4J90A 3FSXA 4NEZA 4AE5A 5L1JA 2LEBA 2DIUA 2NSBA 1S12A 2R2UA 3LPYA 1YQHA 2CRLA 3PW5A 3M8WA 3P5BP 2L9DA 5J2PB 4XIUA 4LBPA 2YNGB 4QIWD 3SQGB 1C0UB 3FCVA 3QJPA 1KQKA 2B7CB 2HNYA 3NS5A 2XS7A 1TUVA 2MQNA 3DMJB 2LQBA 4ZVFA 2DY1A 3DOLA 1NMEB 4HH0A 1S49A 2RILA 4DFKA 4UOFA 5HBMB 1IBLJ 2YWFA 1Q79A 2WZ1A 4ECXA 4FBTA 1M5PC 4P10A 2EC0A 1FX2A 2G0IA 3KOAA 1S1TB 1YK9A 2FZKB 2FJAB 4HVZA 1L3SA 2BE2B 1SUQA 1FX4A 1R8PA 2DNMA 4HTIA 1RADB 1RISA 3PZPA 1HLWA 3D5MA 2LQJA 1JQGA 2XSFA 1KBRA 2POKA 1IKWB 1B4SA 2HAFA 3QRPA 3PYEA 4NZ0A 3GMGA 1IKVA 4G65A 1WOSA 4DF8A 1U6FA 3FCWA 5A8RA 1F9FA 5C24A 3CJ8A 4JI0J 4DQQA 3T19A 4LF9J 4ZPTR 1FRJA 2DR7A 3M4XA 3I31A 1XR7A 1YITS 1RT4B 3CCRS 5G4DA 3U7JA 5LMNJ 4J91A 2HFVA 1SQGA 1Q8KA 4FF3A 3OL6A 2DNNA 3OV7A 4IH6A 1VMBA 3R7SB 2MGZA 2FD2A 4USHA 1N52B 2VKZG 3CCSS 2VQFJ 3U1MA 1S6QB 1N88A 2ZM6J 2QYGA 3IWNC 3QLHA 4C8LA 2IMWP 2AT1B 4OZJA 2HVIA 2C3MA 4KR0B 1TK0A 1R89A 2NXJA 2RDJA 5HAOA 1F6TA 2YKQA 1TU0B 1TL4A 5IM0A 2ZH7A 4DR2J 1WTFA 5IQ6A 4KKOB 5KTQA 4M5HA 3CDBA 1WJ9A 1ZM2A 3C66A 4X4UA 3K8WA 1R31A 3D9BA 4QZVB 3PX0A 3J7A1 1JLGA 4JYAJ 1JK9B 3TAMB 4ED6A 5AXMA 1TUGB 3G82A 1V5VA 4ICLB 2E5GA 2D74B 1RAIB 4BWMA 3VAGA 4PPZA 3HM9A 1TKTB 3DOKA 2LLZA 4JI7J 4XTTA 4HH1A 1FFWB 1IBKF 3JTNA 2EFGA 3NP5A 4YB6A 3QZ8A 3F0NA 3T1YJ 4CH1A 4R8UA 2YQ1A 2C2RA 3QAUA 3ISND 3HT3A 2H4YB 1JLCB 4JUZA 2MZQA 1LFPA 3VVTA 2J7UA 4Z2XA 4KH1B 2DY9A 1XNRF 2VBXA 5C42A 3S7RA 3K5PA 4NLPA 2CQ4A 2ZH6A 1FJGJ 1ULRA 5LSLA 3MAAB 2F40A 5J1EB 3M05A 5AE2A 1Y4ZB 2PGCA 1OS5A 5HVFA 3QIPA 4GVLA 4UTGA 2VOPA 4EZ6A 2KB2A 4NCAA 2XZDB 1RLCL 5KFEA 2HQ3A 2CZ4A 2PFDA 1KRPA 1YKWA 4C8KA 2V69A 3HVTB 3HD2A 2KDOA 4QYZK 1X7VA 4CH7A 4RW8A 1WDTA 3H40A 1RYSA 4MTPA 4NMXA 4O44B 3VGTA 4OYMA 4F67A 2ZH8A 2ZUGA 2HHHJ 4FZVA 1ZZNA 2F8EX 2FTRA 1WC4A 1Q78A 3BGRB 4NLTA 3UDLA 4WZMA 4K4VA 4M5IA 3CC7S 2A0FB 1WKJA 1UA0A 3PEJA 4M1KA 4U7UK 1DQ8A 1QVFR 1VQ8S 5E3PA 4Y2IA 2KM8C 2DRDA 3WIUA 5B0FA 4OL8A 4E2FB 3T5LA 4ILMA 1GXLA 4O3PA 3SBMA 4YHHJ 4PG5A 1ZAVA 3QWPA 3PYGA 4OHWA 3DC2A 2XYGB 3Q8UA 4DJBA 3OTOF 2QSFA 3J7AN 2CJKA 1AT1B 2ADCA 2PA8D 4C7QA 2OLWA 5KG4A 4RWXA 3KUGA 4B9UA 4ED3A 1R8BA 2QEXS 1R8AA 4UZCA 2FGOA 1IKXB 4DMZA 2DRBA 1BQNB 1UP1A 2LCWA 1Q1KA 5BR8F 3WC0A 3UE2A 5B09A 4X64J 2GNKA 1S9GB 1G6BA 1N34F 1YZ6A 2MQ8A 2WVEA 3NCPA 4I2PB 3PHTA 1P6TA 3QYYA 5DQIA 2Z30B 4KGXB 1PAUB 4ER8A 4ILRA 2EEYA 3PRDA 4C3KA 2NZ4A 4JI5J 4ID5A 2DHXA 2LQ8A 3BH7B 4PXEA 4GRSA 3OTBA 1HHSA 1J5OB 2PEHA 4LF4J 4WZQA 2QA2A 2GJFA 1ZA2B 2VL1A 3IG1A 5A2QU 1M1KT 1U49A 1FRLA 2HHQA 3MPUB 3U1NA 3M6WA 1M5VC 2MQOA 3GSDA 4LRDA 3BKTA 4JI0F 2XS5A 1T8EA 1RKIA 4K5SA 1T03B 2YQ0A 4ANCA 3UDEA 3GE9A 2DNQA 2E66A 2VPYB 3VCDA 4PCQA 3AA8A 4LFAF 3CCES 4RNNA 3P4UB 3MM7B 4FF4A 2Q6BA 1IJEB 1RHUB 1KWMA 1S77D 4M5LA 4DS4A 3RJMB 2KKHA 3MMBA 4CO5A 2QSWA 2QV6A 4DR6J 2H4WB 4ED2A 2YY3A 4M5KA 2A18A 1RBLA 3BB5A 3POTA 3R6LB 1NHUA 4Q44A 4EGLA 1IM4A 4BC9A 3VAIA 4MYTA 3TVYA 5L39A 4DR2F 4I2QA 4OHXA 1T9XA 3PW4A 3CJ5A 4WTOB 3G6YA 4ZLNA 4WP8A 3I0RA 1FRHA 1S1XA 3G87A 5JVGQ 2CPHA 1U48A 2Y8YA 1RT6A 4IO1A 4JYAF 4A47A 1C0TA 2FJVA 1VIXA 1UWBA 1ZETA 3FSYA 3P96A 4OYXA 1UWAA 3TOQA 2L3MA 2XCPA 2IC3B 3LWLA 4MFBA 4X65J 4MIBA 3LP1A 1HBUB 4XAKA 3X1LB 2D41A 3PRBA 1TL7A 3ZZTA 5SZTA 2U1AA 1R0AA 4DX5A 2MSTA 4HT5A 1NK8A 3D2WA 5I3UB 1HW8A 1RU1A 4B3RF 3LTOA 2UU9F 3T1HF 3MCOA 2JSXA 2GW8A 3AXKA 3PW0A 2D69A 3C15A 5ETSA 5E0OA 4P73A 2QE5A 2ACYA 5KFPA 3RRKA 2ABYA 2XI3A 4P7TA 3D6FB 4KHRA 2E9TA 2HK2A 4OLOA 4PWDB 3LOUA 2HWHA 5E3QA 2BV3A 2MDAA 2RKIB 4ZPAA 4FS1A 2ZNYA 4PABA 1SV5B 1VQPS 2R2SA 1YJ7A 2WB4A 2VPZB 5RUBA 3BGLA 2JWNA 1A9NB 1HBOB 4HLBA 2J0WA 1FESA 2B4PA 2ZWOA 5BYRA 3C16B 1D8ZA 3L3CA 5J2PA 1HNWJ 2GFFA 2YNGA 3G6XA 2JDJA 3Q2TC 2IAJB 4K50A 2Q79A 2MJNA 2V6AA 2VFUA 2J5AA 3M8RA 4PG7A 1KVKA 1U24A 2K06A 1T9YA 1JJHA 1X4HA 5KG7A 4KFBB 5CAAA 5IWAJ 1W25A 5KFLA 3MEDA 1V5IB 4PRFA 1MN9A 1KC8T 3HT0A 3L7PA 2N3OA 4DSLA 1PBAA 1TUWA 1C4CA 1FWPA 2JLFA 1S1TA 5ETLA 2OMOA 2BX6A 4N47A 2BE2A 4ECWA 4IFVB 1FFGB 3GIJA 4ES2A 5F8MA 4M63A 2HS4A 4DR3F 3RB3A 5D3GA 1DLOA 2HHWA 3UNYA 2LQ5A 2OTLS 3NBPB 2ZC4A 5K8PA 4MMOA 4LRCA 3TP2A 4G1QB 5DETA 4DV2F 1GX5A 1HNXF 4DSFA 2DCUB 4NA1A 5DG7A 2IIHA 2KG1A 4LF6F 2FJBB 4LR7A 3HPOA 2IVYA 3TWZA 1JXVA 2OTJS 4CTAA 4TLQA 3M6UA 3P49B 1T7PA 5HL7Q 3HMJG 3R1LA 2MQMA 2C2OB 5EX0A 4EO8A 2RB7A 5ETMA 4JV2A 1NSPA 4KRWA 2R8HA 3QFWA 2NREA 2W7AA 1A0OB 4F04B 1GEHA 4DL6A 3RU0A 1CQMA 4CIOA 4Q2LA 5D77A 2JVOA 5DS7A 2EFNA 2NXUA 2V50A 4K4ZA 2K8GA 4KKOA 4PXBA 5D15A 5IT9U 4KGVB 3DXBA 2KYXA 4JB8B 5HP1B 2F4FA 4LF7J 1RKJA 5CXTA 4C4WA 3TAMA 5F8HA 5KFBA 3CD6S 1SQFA 4QYRA 3PY8A 4Y2KA 4CT8A 3TRGA 1VJWA 3I82A 3J80Y 3IXQA 1IWAA 2YKNB 4KYZA 3Q22A 4OI0A 4C8NA 1U2RA 1VQOS 1WORA 2HEKA 1QUVA 1D8YA 4TQRA 2CPEA 4F2RA 5K9FA 3QBCA 4JI2F 1CS4A 4EO6A 3NGTA 4G3IA 2VFSA 4JP8A 1JLQB 1S6UA 1RABB 5EHHA 2RSQA 8ATCB 2R2TA 5F8LA 3BH6B 4DV3F 1OYEA 4B3OA 4OX6A 1IKYA 1P9YA 4ZA1A 2YKMB 2HZCA 4NYPA 5HVGA 4DV1J 3KDNA 2DR9A 4LBIA 3PEHA 3BBBA 3KLFB 4IG0A 2MZRA 3OL7A 2BANB 4L76A 1QTMA 1QVGR 1WI8A 2Q3PA 3N5BA 3C14A 4XDDA 2XEXA 4OJ1A 4USMA 3D1OA 1FE4A 2IA0A 6AT1B 1U25A 3DKDA 4DL0C 1HQ2A 5THWA 4EYHB 3CCTA 5A8WA 3HVTA 2AP6A 1KHVA 5F8GA 3CEDA 5K20B 4ZVGA 4D3HA 3GCWP 3F56A 3LANA 4X4RA 4CLSA 4ZJOA 1ZBTA 2ALYB 5LL6d 1LK5A 4ELVA 1RT2B 3HVWA 2CPFA 5D8HB 1GXTA 2B43A 3ENWA 4BBYA 2UXDJ 1A7GE 3M1VB 4UZBA 5G0RB 1CULB 2CFXA 4ZLJA 2EKYA 3W7BA 3M7VA 4G1IA 4WFYA 1ROFA 2DPJA 4B17A 2Z2MA 4ZLPA 4FYYB 2XULA 3I9V9 5L9NA 4DCOB 4E0DA 1T95A 4ECQA 2R7TA 1HWUA 1LEOA 4OYAA 3QO9A 4EBDA 2Y3YA 2KU7A 3SSRA 1MWYA 1QY7A 3H59A 3TVKA 2W9BA 2JRSA 4NXNF 3O5TB 3TJAA 2XSJB 1HMVB 5A8KB 1TL1B 5L9XA 1FKPA 2K1RB 1Q86T 1VCTA 3GILA 2BE7D 3PG9A 4WE1B 3KKFA 5D4OA 3G8TA 3WHIA 1RT1B 4LFBF 4PQUB 3VGSA 1IKXA 4UOHA 3U02A 1FWLA 3PIOQ 2YNHB 3R6GB 3NNAA 3NMAA 2HHXA 3IGVA 3D1HA 5HSPA 2GA7A 2OPRA 3W2VB 3KHLA 1CJTA 1TP7A 1VK3A 2E1PA 1DRZA 4I7FB 2XMJA 4DR5J 1S9GA 4O23A 2OFGX 4BS2A 4QPTA 3VAHA 4B9MA 3TI0A 1MSWD 3CMES 3MMAA 1TKDA 2DR5A 2WW4A 4YP3A 3DHWC 1HWLA 1UAWA 3BKFA 3UFCX 4DLEA 2ZH4A 5JVHQ 1ELOA 3SZ2A 2G13A 4X84A 1APSA 1XTZA 1U8WA 3Q0AA 4DPOA 2C28A 5HMYA 4ETXA 4KTQA 4IR1A 4OFZA 1XC9A 3LGHA 1K44A 2RE1A 5FDLB 4YN3B 3N6LA 4UW2A 2G2YA 1ZA1B 4DX6A 1FI4A 2UZAA 2CPIA 4X4VA 3DOMB 2QL9B 5GMKa 4HT7A 3BKUA 3BGOP 3IC1A 4J9PA 2DO0A 2E1RA 4IRCA 2KRRA 1H72C 1O0PA 4TYAA 2RF2A 4AD6A 5LOQA 5K14A 1T03A 1TL5A 1U6BA 1RWKB 4ZS6A 1RAJA 1ZAXA 2YXLA 3KNGA 4DL2A 4NLVA 1XQIA 3HFZB 3W65A 5F8IA 4L3KA 3QT8A 1SPBP 1UPPA 3VZHA 4DR7J 3DM2A 4RNOA 3ZO7A 3KK1B 2K3KA 3OL8A 2FIUA 3CCWA 1VDHA 3PIPQ 1XMOF 5KFNA 3MEEB 4JI3J 3M9OB 4UY85 4C2MA 4ZITA 2NQPA 2WCXA 4ANDA 1NH7A 2W1BA 3KDOA 3N9UC 2KT5A 1OY8A 3NGKA 4RW9A 1O6XA 1LWCB 4IQMA 5M2PA 2RS2A 4RU2A 1S9FA 1HPZA 2KVIA 1VQSA 3A12A 2XLIA 1H7XA 1UVNA 3EGVA 3BS9A 3I55S 4WCEQ 1PJ5A 3CE8A 2V9WA 2KL8A 4J9VA 1X5SA 1DQAA 3R5GA 2DR6A 3SSSA 4OMFG 2Q43A 4ZPWR 5KFJA 4HDHA 3VVUA 3K57A 1NK5A 4RW4B 4RL1A 2IYIA 1FXLA 1RA7A 4RKUC 4ENOA 3T5HA 5AXLA 3ZZ0A 4B02A 1G7CB 4DV0J 2UXCJ 2APOA 3R8YA 5I3QA 3JAMY 2W4DA 1RHKB 4H54A 3TEHB 2Y8WA 3DDKA 2XMUA 2DK2A 2RD5C 1DTQA 3ADAC 3VGVA 2O3DA 1H6KX 1UTAA 3BSAA 2M7SA 4U95A 1VQ9S 2HQFA 4PXCA 2FVCA 3HULA 1VR6A 3QQCD 4PWDA 2UUTA 3NEKA 5KFGA 1PJ7A 3MEGA 4X4NA 3TUIC 3NMRA 1X4GA 3CO0P 3I9ZA 3ZZRA 5EWEA 4NPOA 2ACMA 3IAM9 2AGPA 1UJ4A 2GO9A 3PNIA 5AXNA 1N33J 4EZ9A 3MWBA 2CJBA 4JOUA 1K8AT 3DNCA 2DISA 4P2MA 2UVRA 4X4PA 3K5LA 3C16A 1X0FA 4F8RA 4Q43A 4DXLA 2C2NA 3G8QA 4JV5J 4DU8A 2EI5A 2WVBA 2YX7A 1S1UB 1EJ7L 1X8DA 2ASDA 4F3OA 4RNMA 1JXLA 1GK8A 2JFKA 4KFBA 3AY0A 4AXIA 2X3GA 3ISNC 3TZXA 2HW3A 4IDKA 1RTIA 2GCFA 4LRBA 1FF2A 4IOBA 2UUBF 2BACA 2C2EA 1XIQA 3PDNA 3GV8B 3LP2B 2CWKA 4UQGA 3C8YA 4QWEA 3FUYA 2MXYA 1S9EB 3VV2B 3HI9A 3TA0A 2RQKA 1T9VA 3OLBA 2R2RA 2CPJA 1UMJA 3TAPA 2MYFA 2RT3A 5A6PA 1HHQA 1S6PA 3NBPA 2J7WA 1YJTA 1T05B 4G1QA 1BWVA 3DFEA 1RWPB 2W2PP 2IYGA 5KFOA 4PKDB 4TY9A 2ZE2B 1LQ9A 4XDCA 2YH0A 1HKAA 4ES3A 2DH9A 2RIJA 2EKNA 3CW2C 5HATA 1OQ6A 4WWSA 4NASA 4ECUA 1NAQA 4B3TJ 2GMLA 1NSQA 2GGPA 3I32A 4CO3A 3W9IA 1FJEB 1QE1B 2FJEB 1Y11A 1D0EA 3H42A 2IVFB 2AKWB 1U7LA 2EFPA 3WC2A 3R97A 4DV7J 4OX9F 4YB7A 3BPSP 1LWFB 4USTA 2N4CA 3EXYA 2WAQD 2G1HA 1UVIA 3A3PB 8AT1B 1MU2A 3ZTOA 2B6AB 3IRXB 3GG1A 5BXIA 4PZVA 4LF8J 3SYZA 1N4LA 4DFJA 3KXDA 5HMZA 1HNIA 4O4GA 3B82A 2FLNA 2HS3A 2DRAA 1FO1A 4LFCJ 2DTJA 2LU2A 2ZZNA 2WOMB 4DU7A 2K3IA 1ZS6A 2YKNA 2LDYA 1UEUA 5LMUF 2E9RX 3IN5A 3G6VA 1PCAA 2DNLA 4ED0A 2G9OA 3MR7A 1H98A 1UCNA 2DH8A 3UPFA 3RUBL 4ZDNA 4GC7A 3OR1B 3UDVA 1U0HB 1SXLA 2IFXA 2DCLA 3WQPA 2KG0A 1DBDA 4DX8H 3KHGA 1PYSB 1VQ6S 1JKHB 1WC3A 1VRQC 1FTRA 1B64A 3M2RB 4KGKA 2C22A 4URQU 3K8VA 2PN6A 4L6V3 1OJ4A 3HK2A 3SV3A 4ZPCA 3QATA 2VG7B 2K7JA 3UR0A 4W92B 3CNQP 4M5MA 2E5HA 4WKYA 4DS5A 5CQGA 2FHKA 3DI6B 4JI3F 3MCMA 2EWHA 3U1LA 4I6AA 3JSMA 1V3RA 4QIVA 4EUVA 4NX9A 4DOZA 2W4PA 2CQ0A 2B0GA 1QSSA 3ENAA 1N0VC 5D0GA 4OI3A 2DO4A 5H9EK 2H9ZA 4F4WA 2OPPB 1WEYA 1VC6A 2LFVA 4MH8A 5HLFB 4OQJA 2YBVA 1OY6A 3EYZA 1RBOB 2IDEA 3C6TA 2VBZA 7FDRA 2V8VA 2XMAA 2GAHC 5JJBA 4OYPA 3AD7C 4LRFA 3V6DB 1RK8A 4I56A 5B0GA 4LSLB 1RGVA 3EGZA 1QUPA 1NSAA 2WTFA 2ZJQQ 4JV1A 2XO6A 1DY3A 1RT5A 4Q0BB 1FVQA 1T3NA 3UWTA 1HBNA 1S7HA 1TKZB 2CPZA 1H0HB 4M8LA 2W8LA 2R7WA 4DQRA 3LALA 2LXUA 3FBFA 4L73A 2KXHA 1YIJS 4CM2A 5M2UA 2V9KA 3O2IA 1RTJA 2I38A 4H4OA 1FA0A 2HVZA 5A8KA 1RTHB 3SCJE 2V4RA 5F41A 2AV5A 3EZUA 3UDCA 2HPUA 3PX6A 1XMBA 3PXGa 3G71S 4B3MF 1UA1A 4JBCA 5GVQA 2FY1A 3LAMA 4J37A 2EC2A 5BYSA 4NLRA 1D3WA 4F4ZA 2XBPA 1WC1A 1ITPA 2HYIB 3M2VB 3K7RA 1RHQB 2PDAA 4PQUA 1NEEA 2L48A 4NZ7A 5JMNA 1YJUA 3MMCA 3K5MA 3CSKA 3QGIA 2J9DE 3KK3B 3ITHB 3QMQA 3BM7A 3RBXA 5A0YB 4ZKAA 5CHCB 2QG9B 3T5KA 1UPMB 1KLNA 3Q8YA 2V0NA 4IYQA 1CJUB 2C3UA 4ZIWA 1YVFA 2HQIA 2V4JB 3I5CA 4P6QA 4WPAA 1KQFB 1FRMA 2FLOA 3HVRA 2B51A 5AJ3F 3NGSA 3CMQA 3ZTSA 1JJ4A 2UVUA 4IG3B 3LF0A 3PO4A 2MEWA 1CJVB 2MQLA 1B0VA 4OZ3A 1UZDA 5KFZA 3DOMA 3MM6B 3J81j 2CNKB 3CJTA 4FP9A 4RLEA 4D3GA 4WXWA 3H5YA 4TU8A 1V3ZA 3GV7B 1SCJB 3QJJA 2JL9A 5GAHU 3EPIA 3DOLB 4OYZA 4YY3J 1KLMB 3QAEA 1GMUA 2KFYA 2J6SA 4WTYA 1KEKA 4L72B 1G2EA 2YTCA 4KHPJ 1HR0J 1TVRA 1Q8IA 2B7BB 2V34A 3LGMA 4NRTA 1QTNB 1K47A 4J9NA 4P7VA 1ZAWA 1XNQF 3KMQA 2D3ZA 1SUQB 2DGOA 4P52A 5H9FJ 3CJQA 1I94J 5E3AA 2BKOA 2R7QA 4R5PA 4J9RA 2XC9A 1NRKA 1K0VA 2HFUA 5E5NA 1NKBA 1FNMA 1IKVB 5F9LA 4JI4J 4NLUA 1VOMA 4FNHA 1HD1A 3CIZA 5A8RB 2KZZA 2GIFA 5C24B 5C7PA 1Y3JA 3GJQB 3UN5A 2X1FA 2UXBJ 1UW9A 4DR1F 1RXOB 4PAAA 3MM8B 3M30A 1T3OA 2CG4A 2CQ2A 2OMLA 2IM3A 2JEJA 2DGTA 5CYMA 3K58A 1PAEX 1Y0HA 2MGZB 2YPZA 4RW4A 4OIXA 5EWFA 2PE8A 4I67A 1U1OA 2HGNA 2RQ4A 3ZTRA 3QLHB 1S0NA 4LT6A 3HP6A 2P6TA 2QL5B 1AFJA 1K73T 1Y9OA 5DQHA 1ZH5A 4X4TA 1RTDA 2ZH9A 2MJUA 3D66A 2M4MA 1ZTWA 5KT2A 2OEJA 1S4EA 3OT9A 5CCMA 1OO0B 4DQPA 1JLGB 1N48A 2XZWA 5AT1B 4G1PA 2FZCB 2XWXA 3B6BA 4PG4A 4OI4A 1N32J 4TLRA 1O5JA 3FEXB 2O01C 1SL0A 3DOKB 1M1HA 2D3UA 2BA9A 1FWKA 2MZ1A 3NY0A 4NLGA 1ACMB 5GAHI 3EUNA 3H2UB 3NLCA 4A8YA 2ATCB 3V4IB 2Z56B 1S1UA 3I6PA 4R8UB 4MYUA 1KTQA 3H98A 3BQ2A 1EHWA 3NGDA 3GIIA 4NA2A 2YH1A 3HZGA 2FLPA 2V8PA 4DFMA 1YBTA 3IS9A 1UZHA 3V5RA 2N3LA 4YB1P 4JI1F 3V6JA 5C42B 2E1CA 1R43A 3QRRA 2XNQA 2Z2YB 1Q8BA 2HNZB 3GU0A 3VALA 2I1RA 2J9DA 3R2DJ 5EX3A 2VDIA 2XB2D 4DDFA 3R7BB 3GFHA 2O66A 5KFWA 3B8HA 4QW9A 3FSIA 4KV8B 3G9CA 3S1TA 3HF5A 3S6EA 3QGGA 5F0UA 1S7IA 4LIRA 4OYIA 1T05A 2FVQA 1XR6A 2AJ4A 1VQYA 1NHVA 2ASYA 1HL6A 4K4UA 1E6VB 4RUAA 2DVIA 1RWVB 1W7WA 1X4DA 5ETQA 3EGNA 4J7CA 2UUCF 3LH2S 4GVBB 1W26A 3VZIA 3DRSA 1U1KA 2WBMA 3ILJA 3FBEA 5HROB 5KT3A 2F9JA 2VC0A 1X4FA 2VU5A 2O1PA 4TVAB 4KT0C 4ELTA 5MLCV 4PPDA 4DR4F 1LWFA 1F1BB 4KQZA 5ETTA 1SJRA 1T02A 3T6BA 1CG2A 2M2BA 3KTQA 4X4SA 3WDOA 2FHOB 1VQ5S 2KN4A 3CUNA 3RBZA 1QLNA 5IS2A 2CG8A 2UP1A 3D6MB 5LXRA 2JVRA 1JMTA 3AD9C 1RU2A 3PCOB 5A76A 2B9XA 2WOMA 2YVSA 2CQGA 1FXDA 4K0KJ 3P45B 2V8DA 4PG6A 2WB1D 2WSCC 4ZPBA 4PQAA 1WEXA 3QPIA 4RWWA 3RW7A 4U7CA 1N56A 2FC8A 1RAGB 1GTHA 1YBUA 2QLFB 3BQ1A 5KG2A 4CNYA 4B3SF 2R7OA 1XMQJ 2H1YA 3KJVA 2R8IA 2EG1A 2MKJA 2XM3A 2UUAJ 1W2IA 1JIHA 2VQEF 5HO4A 2VG7A 1T9UA 3PV8A 1ZPWX 3E3XA 4DV6J 2DH7A 1UW4A 1RCXB 2FJWA 4RW6B 1RI7A 1VISA 3DI6A 3UCGA 2DEJA 4I64A 1N5YA 4J9MA 4JI4F 1UEKA 5KFKA 3BO4A 2QL7B 3CCUS 4JI6J 2CA9A 1NK6A 5HANA 2FLLA 2OPPA 3NS6A 1U8SA 2F5GA 5HLFA 3HJFA 3IWXA 2WW8A 2H48B 3BGUA 2MLZA 2E9ZA 4J9UE 4AL6A 5JUMA 4DV4J 4YR2A 3CDAA 2ZHBA 4NRUA 2SXLA 2PEBA 4DI6A 2OFHX 2QC3A 2M0GB 3ETMA 2YKOA 3IM9A 4GKKJ 4TN2A 3V6DA 3MMBB 2GMHA 4LSLA 2U2FA 1YX2A 2QZ8A 2WVFA 2DNHA 2MZJA 4N77A 3FRYA 3POTB 3TA1A 4LF2A 4HTJA 3PTWA 2OPQA 2BJEA 2GVDA 3H5UA 2CQHA 4ERDA 4NE9C 4YEAA 3LP0A 4I2QB 1S79A 3I0RB 3RR8A 1AYEA 2B9WA 2BJ3A 2CNNB 4URSA 5EDWA 2CQCA 1RT6B 3DN9A 3GP9A 1C0TB 4ELUA 4V19J 4QIFA 3M6VA 2DB1A 2ROPA 4BC7A 3RBEA 5AXKA 3VF0B 2ZKTA 2XO7A 3ZC4A 3P3DA 5GADU 4MFBB 1FHTA 1RWWB 3N4WA 4QYZJ 2IRYA 3M2VA 3MCNA 4FVCA 2DNOA 3L7OA 1YJWS 4KSEB 3LPEA 3J80U 1PJ6A 2VZ9A 2X3DA 3UN3A 1NNDA 1NJYA 1VK8A 2N7YA 2X1GA 4G6VB 3VAFA 5K5MA 3IBWA 3NOCA 5LSOA 2HBYB 4O3OA 2GX8A 2DYAA 3D4JA 1BC6A 2KM8B 3L09A 3RR7A 5DJBA 2IJFA 3KYLA 4NOHA 3IRWP 1RUSA 1MMDA 2RUSA 3CJ0A 2G2OA 4C98A 3D0GE 1P27B 3ZNUA 3V81A 2NCKL 3R5AA 5I42A 4IG3A 2FGCA 2R7RA 2BVZA 3PVXA 5KFUA 2O5DA 2OD6A 3MM6A 2W2QP 4FBUA 4AYBD 2CNLB 1J5EF 1SH0A 1I3OB 3EPGA 3H25A 5L1KA 4F36A 2JEFA 2BXJA 1YRXA 3OJSA 1HI1A 2B4UA 2B3TB 1FERA 2R8JA 1KLMA 1WI6A 2WONA 2MTLA 3MEDB 5KOWA 1AA1B 4OJ3A 5LM7E 1WKLA 3BJYA 1TL3B 3SFGA 4OV1A 2YKAA 4K2XA 5LJ5Y 4KGMA 2N4DA 2XY7A 1NK0A 2EBEA 1FNOA 3Q86A 1XEZA 3ENQA 5D3GB 1DLOB 4FPRA 2HGMA 2VFVA 2LQ9A 1VRTA 1UFLA 2EG2A 3VQTA 2VIHA 1XJWB 5D0RA 5D4NA 2JJ4D 1LXNA 2V63A 3VWSA 2YWHA 3E51A 5DGBA 1NBEB 4TY8B 4HACA 3MECA 3MM8A 1RE1B 3AODA 3UD3P 1REGX 2HMIA 3OD2A 4CTAB 1CPZA 4PYDA 1IBMF 4QOTA 2VJVA 4JI8F 2AYGA 3CXCR 3CTRA 4PR6A 1U1LA 5ETRA 3NWRA 5C2GA 2IM1A 1WOOA 4X4QA 4FYDA 1NPPA 1VC5A 4USKA 1NPRA 3GTYX 2ROEA 3J7Z5 3OW2R 2ZKUA 1S99A 4X66J 4RPFA 2WBRA 2XYHB 2IRXA 4R0JA 1RHRB 5KT6A 3RB4A 3J81Y 3W3SA 3W66A 3AB4B 2E5LF 3O3LA 1YWXA 3HDSA 2ZHOA 3PR5B 4DV6F 3JXOA 2DGSA 5KFVA 4RO0A 3KJQB 3KLIA 2KXFA 2ZDPA 1F3VA 4LF5F 1S1VA 3GB0A 2F3JA 1FCAA 2Q1LA 1ZZFA 1VS3A 2GQCA 2J7KA 5T14A 3C6UA 3MPDA 3FZBA 5IV3A 1CS4B 3KJFB 3CIMA 4QIGA 1GQEA 1R3NA 4TQSA 3KNAA 1RSCA 3V4IA 3Q24A 2FZGB 4WKRA 4B3OB 1IKYB 5KFCA 2P6SA 5H1SV 2VD3A 4U96A 1KTVA 1RBAA 2JNJA 4O0NA 1L3UA 2HBZB 4CNZA 1K9MT 3GIKA 1BD6A 1HHTP 2H3EB 3R5CA 1T11A 1RP5A 2I5JA 4IG0B 2HNZA 1X5TA 1UVMA 5M2RA 5KFTA 4RUCA 2IHR1 2GMJA 1RA6A 2C1EB 1J2VA 3C14B 3K2YA 1B99A 4IRDA 5IC4B 4KV8A 1PYTA 1UVJA 1RAFB 4NLYA 1SIWB 5A8WB 3WX8A 3DLBA 2LP4A 1VBYA 1O51A 3IR7B 2P2CB 1E6VA 1VHFA 4J9SA 4MJKA 4IH5A 1R8HA 2XGPA 4NI2A 4F02A 3GQCA 4GVBA 4C9DA 4YDDB 1BMQB 1YG0A 4A48A 2MZSA 3HCXA 1MW7A 1Y10A 5HROA 3CC4S 3MXHP 3NCRA 3TYTA 3PX4A 1OIAA 2IDLA 2H54B 4EYIB 4M95A 1EZZB 3SCLE 3CC2S 4CQ1A 5T7LB 4H4MA 2LEPA 2XY6A 5E7OB 3JAMU 1X4BA 1GFWB 2W2MP 4F0KA 4LUBA 2IVMA 3QO9B 1S0MA 3BF4A 3W60A 1SKUB 2W9BB 2HNDA 2YNIB 2P9EA 1G3OA 4A8FA 3WZ0A 5HN0A 2BJ8A 1FKAF 1FKPB 1S0OA 1RT3B 1BY9A 3VAMA 1HNZJ 2HRUA 2XLKA 1DQ9A 1WSRA 4ZCLA 4P2SA 2DKOB 4NWBA 2F4VJ 4FYXB 3NWGA 3O8WA 4ZJLA 1RWMB 4OJGA 4HEA9 1WF2A 3K5NA 4OZLA 2KFZA 4BLGA 5CD4A 2OPRB 1CJTB 2OEMA 2RU9A 3NKYA 2NXNA 2G1DA 3JQMA 2HHTA 2HHSA 4ZP9A 3MMAB 4KY3A 2RRAA 4Y6IA 5KG0A 5J2QA 2CJAA 2FVSA 2JLEA 3NAIA 3OVBA 3VR1A 2ADBA 1IBLF 4KJIA 1TAQA 3OQ2A 3UVJA 2AZ1A 3JQJA 2OGUA 2CADA 4QR1A 4M5NA 1CC8A 3A4TA 2CZVC 3M2UB 2EXUA 4FF2A 1NK7A 1FKOA 3Q8RB 1L5UA 4LVNP 1KN6A 3OVAA 4RW6A 4NLQA 3LWMA 4RU9A 3WX4A 4KPCA 2A3JA 5A6WA 4EK2A 3D7SB 2JOQA 2GIQA 3DLLQ 4DSKA 3ISZA 2RF2B 2QJ3A 5HJYA 5K14B 4DV5J 3FKBA 4LF9F 4WP3A 2DEIA 3ZZUA 3WIVA 3MM5B 1F9HA 1GX6A 3SCIE 4Y3CA 2MHNA 3HHLD 3CT9A 5LMNF 2Z0GA 4ECSA 4QWBA 2ZOFA 3RW6A 1IR0A 1J27A 3Q23A 3BEGB 4ED4A 5CD4H 1B3TA 2AGOA 4QWAA 1SL2A 3CCMS 3DM2B 2E7VA 2VQFF 2IMOA 4Q7AA 2ZM6F 1VQNS 2LVWA 4GC6A 2ZITA 3MUMP 1VI7A 3A8IA 3OBIA 4X66F 3FVYA 4A8XA 4LRAA 3OLAA 2N82B 1Q16B 1H2UX 4K4WA 5F0WA 4NL5A 4Y0FA 3KG0A 1OSCA 2V2ZA 3ENVA 1WEZA 2H5EA 4DPTA 3H90A 4RW9B 1UJ6A 4X4OA 4DSJA 2VC1A 2VUGA 2XWYA 4C0BA 3MI7X 1HPZB 1KSPA 2Z57B 2JEIA 5IZHA 3BBFA 3HVAA 3KLHA 4QCLA 2L41A 4CP5A 4MKBA 3T6JA 2HLTA 1MWQA 2HFSA 4JI7F 3W5YA 4QIEA 2D9PA 3OXGA 5IOLA 3DLKB 3THPA 4XK8C 1D09B 1NZAA 3T1YF 3CMAS 1Q0NA 2OEKA 4A8MP 1GT8A 4M5DA 4B9LA 1NLKL 1DTQB 2UVVA 3MD1A 1GH8A 1Y00A 3JSYA 4ZP7A 5KT5A 1VQMS 5D4LA 1KP6A 2AWZA 3B54A 3TZWA 3A3OB 2BMBA 2AYMA 2XTJP 2YPYA 4FXVA 3MEGB 3CJ3A 1FJGF 1Q7YT 1LWEB 1M5SA 4EWTA 1FNXH 2ZOGA 1FJCA 2A2CA 2B9YA 3I5BA 4ZCKA 8RUCA 3OJUA 2QMWA 4LR8A 4DUYJ 5DM7Q 3D3BJ 1NJIT 4ZMMA 3THTA 2B5JB 6FDRA 4GKJJ 1GNKA 3MUVP 2CZ9A 1HQUB 4QU6A 3OUYA 4IFYA 4O3QA 4CT9A 2OAUA 2CIMA 3MD3A 1ZYQA 2HHHF 2RS8A 1H38A 1VBZA 3X3UA 2XY5A 3TR5A 4IDKB 1JNRB 1RTIB 4OYWA 1Q82T 4HKQA 1VQ7S 5J2MA 4OX8A 3ILOA 4DHVA 1S1WB 1TL3A 2HKEA 2Q66A 4WK1A 3TARA 4ZJQA 2R8KA 3MM9A 3Q8QB 1PO6A 1X5OA 4Z37A 2JEGA 5J1PA 4YHHF 4ZP6A 2WRMA 4C97A 2AF6A 1GMVA 1UL3A 1WOPA 4GO5X 2FC9A 3QT6A 3JYTA 5L1LA 1RT7A 3LA0A 4LF1A 2FDNA 3KLEA 1S6PB 1X4AA 4FN5A 4ZVPB 2ZJPQ 1KR4A 1AXQA 9RUBA 1AW0A 1TELA 2DR8A 2F63A 3C19A 4ES1A 2OIHA 2MMYA 2Y9HA 1U45A 3I96A 4B9NA 4TY8A 1T94A 4FS2A 4TU7A 2ZWPA 4P2FA 3T41A 2VF3A 4U7UD 4J9QA 2GGPB 3QZ7A 1BUXA 4RNHA 4CLUA 4X64F 2JC0A 4OLPA 2DHAA 4EBCA 3O6QA 4R0EA 1S0VA 1H2TZ 4EMDA 1JLEA 3SI8A 3MOJB 1CC7A 3SXLA 4M5JA 1WD6A 4XPCA 3DLEA 1VYAA 2LA4A 2C2KB 1AUSL 3PM9A 1MU2B 4C0HA 3MDFA 3NGUA 2IPOB 2IY5B 3R1HA 4FF1A 4JI5F 5FD1A 3AD8C 1HWIA 1XNRJ 4WF9Q 2VONA 5C25A 2KJWA 3TVZA 1HNIB 4O4GB 2EK6A 3SEOA 1F2GA 1URNA 3UR3C 5DGAA 1NXIA 4LF4F 3I0SA 3TA2A 1YRUA 5KFXA 4RBVA 1NK9A 2CVIA 4DL3A 1NPKA 1WWHA 3OPKA 2PI4A 1X31C 2ILZA 3QIDA 2DBBA 2FHJA 5L46A 4OHYA 3A3NB 4N76A 2DJWA 3OTEA 3HO1A 4K5RA 3R2CJ 2MY7A 1FXRA 1HWKA 2M70A 2E7WA 2MY8A 2NXEA 4LVOP 4NMLA 2R7VA 5K8MA 3SDEB 1DAXA 3GZ7A 5KFAA 1M5OC 1NKEA 4ED7A 5KFQA 2EBGA 4IO9Q 1CJKA 3MEKA 1YRTA 1U26A 4Z7YA 2VBYA 3NOGA 1QM9A 3UQSA 1C1CA 2MKHA 1H3DA 4MKVA 4DR6F 2VASA 2OPSA 1S4FA 3MHYA 3DYAB 5EWGA 3P8BB 4EU0A 5KT4A 1QJHA 3BO2A 2AJFE 2IJRA 1C4AA 3JSMB 4UQTA 2VKRA 3DU5A 5HMXA 2CQBA 3PHEA 1V6HA 3RG6A 4OZ1A 5IQQA 2E1MC 1WUUA 2AYBA 1HFEL 2BJ1A 1JJCB 5B0AA 3HSDA 3EX7B 1Q8LA 1TKXB 3B4DA 1F0XA 3W64A 3MPWA 2Y1JA 1RAAB 1RHJB 3FMWA 4NEYA 4X65F 3T3FA 3C6TB 4WU3A 2RH3A 4C6AA 4ED1A 3VGUA 2FY8A 1FE0A 1X4EA 2F1FA 4MKAA 3EWGA 1DJ0A 5K8NA 5LT5A 4DG1B 3V6KA 2I8EA 2NXCA 1XBWA 2XG8A 5BR8J 1BLUA 1RT5B 1R6YA 1NDLA 4IR9A 1HBNB 1N34J 3HHKA 3ET6A 1Y3KA 5T7LA 1AZSA 3JQKA 4K4YA 3TZYA 1U1NA 3MPYA 1NJWA 1QAIA 2A10A 2GVZB 4RBUA 2CJQA 2OP5A 4URGA 2JH3A 2VG6A 1P8GA 1RTJB 2YNIA 4H4OB 3LAKA 1ZPVA 4WIQA 4W98A 4DL4A 2DHSA 3F44A 1P1TA 1RT3A 2BDPA 2H51B 1LW0A 3ZNJ1 3OL9A 3BGFA 2KT3A 4QBUA 2BQ3A 1SJ1A 3BZQA 4OV6A 4ED8A 2V2QA 2XHWA 1MLAA 2ZD1B 4DUYF 3GSIA 2XMMA 4L3NA 4CLPA 4EEYA 2I9SA 5DLGA 3M8ZA 3MMCB 4GKJF 3DLGB 1HNWF 1NUEA 1WDDA 3UI3A 4CLTA 4HI2A 2KVQE 3M8PA 2KXNB 4CO0A 1VGYA 1DTTA 2CQPA 2XNRA 3HSGA 3R7NB 4LFAJ 4ITSA 3HHEA 5KFSA 4RR5A 5IWAF 3OTDA 4K59A 4MK7A 2Z8QA 5DLFA 3CJRA 1WG4A 4DF4A 3W5XA 3W2WB 5E3CA 3HKWA 2VHGA 3BQ0A 4CO4A 1EETB 4KC5A 3OFEA 2PSZA 4ZVSB 2B9EA 3M2UA 2MSSA 1FDNA 2DNPA 3RB0A 3CCJS 2L9WA 4NLOA 2V68A 3GV5B 2NYHA 1W2BR 5ETOA 5AE3A 1S59A 1EX8A 4KBIA 1R27B 4CM0A 2PFFB 5MAOA 2PMZD 3E8OA 5DG8A 3GWCA 4ZPDA 3MM5A 2VA2A 2V2VA 1PC5A 4FXDA 3MUTP 1ZM9A 1TVRB 3PJ9A 2BKPA 2V8GA 4DPXA 2HFOA 1QD1A 3DXSX 2QA4S 2CJYB 3NNCA 4Y2CA 3L95X 3BSCA 4B3RJ 1TTHB 2UU9J 3T1HJ 4U67Q 2M8HA 1X4CA 1VHIA 1HYSA 2BJ9A 3TO8A 3AH6A 2UVWA 4CO2A 1PBUA 2V8HA 1RJJA 4R5PB 4OI1A 5DG9A 2CXEA 2GHPA 3CD0A 5FLXY 4C0OC 4LF7F 3CGIA 5IFMA 1LW2A 3AOAA 3H2LA 1SJFA 3KLGB 4DX7A 4UOCA 4EFAC 1WC6A 3M30B 3AHPA 5H9EJ 2HFNA 4CLKA 4IRKA 3HHLB 4ZVOB 5CYMB 5DRKA 4L75A 4YDXA 1JLAA 3IGNA 1SH2A 4O0IA 1SBRA 2QRRA 3DLKA 4A8KA 3GFZA 1WHVA 2AQ4A 2E7XA 4FYWB 3MFHA 3A1YG 3QRQA 3Q8SB 3A8JA 1RTDB 2EFVA 1B0TA 3FBCA 1P1LA 2GJ2A 4UUWA 3VTIA 2VG5A 3KUHA 4O3NA 2YX4A 3E01B 4DV1F 3A13A 1CLFA 1QSYA 3ZZZA 4TKTA 3QT5A 1XK8A 1EP4B 1HI0P 1LWEA 3MR3A 3EZ5A 4P72A 5K8OA 2AGQA 2G0JA 2B4VA 5FJ4A 1REVA 1S57A 3CDUA 4OYBA 4AL5A 2AHOB 1FK9A 2ZVIA 2B8PA 1YI2S 3CJKA 4DR3J 3HXMA 2BEFA 1JB0C 3GFXA 1NK4A 2LKZA 1IUJA 5DZ6A 2PI5A 1HNVA 4OI2A 4DN9A 2J0XA 3TQ1A 4NCGA 3KK2B 3M8QA 3UNGC 4EI2A 3EDQB 4DV2J 5L8RC 2B5JA 2R8GA 1HNXJ 2C3YA 4C3MA 3Q8PB 1GMWA 1HQUA 2VICA 1BQMB 4LF6J 1Q7LB 4DWIA 2UXDF 3M32A 3P5TL 2R7UA 3W62A 3IS9B 2LXIA 4DCJB 3Q89A 1VQLS 2G2ZA 4QQBA 2BUNA 2HIYA 1S1WA 4HDGA 4QJVA 2C2MB 4CLLA 2LDIA 1EIYB 2KYZA 2ATLA 1TMJA 2OSRA 4I68A 2XLJA 1SVDA 3RAMA 3DRRA 2KJVA 1D9FA 2XMWA 2HVDA 2GJIA 2AX1A 1N54B 3GJTB 4FDFA 1SQEA 1MMLA 1Z1ZA 5JXSA 5DQGA 5LJ3Y 1IBCB 1H2VZ 3N5FA 4RW7B 4U6PA 2DGQA 1IM6A 4DSIA 2AX0A 4DUTA 2RHQB 4WK3A 1WNEA 3JB9k 2KRBA 3ZTQA 4V1Ak 1S76D 2FJXA 3DRXA 2CPXA 4N8NA 5BJRA 3DRSB 2QLJB 2YWWA 2GO8A 3IO1A 3DRPB 4JI2J 4E8UA 3GR0A 4DR5F 2YWGA 1LKZA 1OYDA 4DPUA 1HA1A 3LGNA 3FEZA 1JWWA 1JLBB 1D9AA 2PO4A 1N5TA 1Q95G 1QAXA 1YJNS 2VV5A 3FGVA 1NZ8A 2MQPA 2M8DB 3BYPA 1U6ZA 4DV3J 1CBKA 5B0BA 3JTPA 3CCVS 3CB4A 4Q45A 2C2DA 1V3SA 5E2QA 1IR2A 1N5QA 3DGPA 3PKMA 5F8JA 2XHCA 1N0UA 4WU2A 2RJZA 1RACB 3T9ZA 1L3KA 4LQ9A 4C11A 3NS7B 1AFIA 1KONA 3UD4P 4BHQA 4V19X 3S01A 5AE1A 1YZ7A 2B8QA 3SDEA 2KHCA 3OVSA 2HVEA 3FRZA 1UFWA 4J9OA 2VH7A 2EW9A 4UY8T 4UT4A 3BO3A 2BZ2A 1KVJA 1ICEB 1VLOA 3KJVB 5HQ8A 4DR7F 3I4HX 4IOAQ 4DL5A 3NCQA 4A4JA 2LEAA 3OHAA 1YBAA 2OD4A 3DYAA 4E98A 3D6TB 4RUHA 5B08A 3DRYA 1HQEB 5CA5A 3V2UC 2E44A 1N5YB 1Z4UA 2JZ5A 3G4SS 2W9CA 2RAQA 3O44A 3HX9A 4AUKA 2XMTA 1SC1B 3RAXA 4NXNJ 4PYAA 3PYFA 2B4OA 2D3O1 3K17A 1KNZA 2CKWA 4OZ2A 1M0SA 1TKXA 2QMXA 2EFOA 3C2PA 2HBQB 4ZP8A 4KGZB 1XWLA 1UFKA 4I6YA 3HHLC 2HK3A 1U0SA 2R7SA 2XMVA 2YNFA 7AT1B 5HMWA 4LFBJ 2GZOA 4F0MA 2HRTA 1S5ZA 4DV0F 4DG1A 2UXCF 2Y1IA 1U1QA 2UUWA 3SQGA 1C0UA 1HI8A 3W9HA 3VAKA 2LXFA 4I1TA 5GAEU 5HQMA 2CVEA 1U47A 3DMJA 2OPQB 3MF5A 2GVDB 1XN9A 4O4RA 2W24A 3LP0B 2OKQA 1WG5A 2AJ1A 3AJ2A 5DM6Q 3GIMA 1KQGB 2QYCA 3BDPA 2LU1A 2GVZA 5HBMA 5GMDA 2X1AA 4ZN3A 4PUOB 3FFIB 2FB0A 2IM0A 1R7IA 2DIVA 1NM2A 3J81U 3TUPA 4ZCIA 2MKYA 5HVHA 1MNEA 3BBCA 1CVJA 1N33F 2QIFA 4F0HA 1F3FA 1IKWA 3B4MA 3OFFA 3ZXWA 1HARA 2ZD1A 3VAJA 4FKYA 2BM0A 2WVCA 1WTBA 2HSEB 1A6LA 2YKPA 1OPZA 4JV5F 3DLGA 3HZEA 3AJDA 3R5DA 2C2ZB 4ECRA 3GONA 2RQCA 4A46A 1WHXA 2OI2A 2NPFA 3Q2SC 4A8SA 4CWBA 1RT4A 5D78A 1UETA 3I4PA 1WHWA 4C8ZA 4QPXA 2XQCA 4TU9A 3CD7A 2HGLA 2ROGA 2IA6A 2RDDA 3JSRA 3GYXB 3LO3A 3CULA 3L4BC 4KIAA 1RTZA 1JXEA 2XI2A 1B0PA 3W2WA 4AXJA 2RVJA 3K89A 5CCLA 1S6QA 1RDRA 2GS8A 1N5VA 4WFAQ 1R8CA 1EETA 1BE4A 3T1AA 2VBWA 3V81B 4Y28C 1XMOJ 4P2XA 5I42B 1SJ3P 3HKZD 4P9SA 1ZTTA 1KQSR 4RX6A 1OY9A 5CYQB 4RJVA 1RAHB 1X60A 1YSJA 4MK9A 4XPEA 1WC0A 3H4DA 3W9JA 2NYIA 2H65B 3D6HB 4B08A 3MFIA 1VBXA 3SSQA 4LR9A 3AQOA 2RQMA 2J9EA 2RNEA 2KTQA 4YMEA 3UD5A 3OR2B 3W63A 3AJ1A 3IAS9 4I4BA 5EUHA 2HZAA 2BW2A 3KG1A 4ICLA 4CYUB 3F41A 4K4SA 1HW9A 4B3TF 2WONB 2IRUA 1TKTA 4A8QA 3PFOA 4QW8A 4KO0B 5GAEI 1PC4A 3A8EA 2GV1A 2HFZA 1S48A 4DV7F 3ZZYA 1OPIA 1RCOB 4YFUA 1GXUA 4RUBA 1TFWA 3KJNB 1RYRA 3BN7A 3MMJA 5E41A 2AW0A 1Y5IB 1KDNA 3AA9A 1VRTB 1JLCA 3CO9A 4LF8F 2CQDA 3BR9A 2PD1A 2IJNA 5DDOC 2HHVA 3UN2A 3IBCB 1TR0A 2YQ3A 3J7YU 3ILLA 2GQ2A 2IM2A 3FZ2A 3KLGA 4LFCF 4YR0A 3MAAA 3QNWB 1RHMB 2ZNZA 2FHJD 5J1EA 1Q5YA 3FQKA 4YB5A 1DURA 4CCHA 2PMHA 4HACB 3CD5A 2LMIA 3NXZA 3MECB 2CQ1A 1U2FA 3DLJA 3RYLA 1NB2A 3HHLA 2F8HA 2HMIB 3DHXA 3MR5A 4YQWA 2KHDA 5KG3A 4ZVEA 1TMMA 4DQIA 1BQXA 2QTWA 4O44A 1ZOTA 2R4FA 4M5GA 5D4PA 2FHMA 3BGRA 2ZBIA 2RHSB 2DXDA 3TAQA 1SC4B 1TAUA 3EMTA 2DGXA 1SIZA 2GC8A 2UUBJ 3E01A 3A8KA 3E2EA 5D6GA 4W90B 2AZ3A 2MHEA 1C1BB 4NLXA 3L9ZA 1EP4A 3AAWB 1SKWA 2DNZA 2FUG9 3KLIB 4AFFA 2C3OA 4BDPA 1S1VB 1DARA 3T9NA 3DDNA 3DU6A 5CH7B 3C6UB 3PACA 3C3LA 1IQZA 5KOXA 1JNZB 2BOAA 3KK2A 4TXSA 4ECTA 2L9NA 4XO0A 2CJXB 5KFMA 3ONQA 2MPUA 2YWKA 3LQVA 1BQMA 3BSNA 1HIYA 9ATCB 2W2NP 1BQNA 4Q2MA 4MT1A 3GR1A 2AU0A 4U8YA 3NL0A 3QWUA 3I56S 3IA0A 4CLWA 2VA3A 4LSNB 3OTCA 3EDRB 4C8YA 3TUJC 5KFYA 3NAHA 4I2PA 2I5JB 4OX9J 4MAKA 1F60B 3CVKA 1SI9A 1U4BA 2XGQA 2PC6A 2HIQA 4MKYA 3J7YI 4Y65A 2QLXA 3G96A 5KFFA 4DSEA 1LNQA 1PYOB 5F3ZA 2D1CA 4RW7A 3GG0A 5CZVA 1PKUA 3EVMA 3UW1A 3SCKE 1YGYA 3F73A 3G6ES 1J5OA 4ZN1A 3M6XA 2M3DA 1WHYA 3OHBA 3AB2B 1M90T 4F4KA 4NI2B 3TUZC 1TV6B 1K1QA 4LBHA 1SKRA 3M8SA 2OJ3A 2MKKA 4HR2A 2W4CA 3GYGA 1D1UA 3IBFB 5LMUJ 1S97A 4PWWA 3DRPA 4W4MA 2P5VA 3D28A 1WSVA 3H5SA 4U8VA 2M9KA 4LMZA 4H4MB 4BWJA 3D3CJ 3MZIA 1YJRA 1R0CB 1JLBA 3MM7A 4DPWA 2J6TA 4YR3A 1K0TA 1PIEA 1YTYA 3MURP 5B0EA 2HNDB 1I1GA 4I6WA 2V4QA 4PG8A 3JSBA 2Q6CA 5KFRA 1VQ4S 5D0HA 2BYCA 3CJ4A 4ID8A 4F3QA 1IQTA 1UKUA 2GAGC 5IT4A 2ZC3A 2HVHA 3CJ2A 3EVWA 2AJ2A 2CQIA 2QT7A 4C3LA 2PT0A 4DEZA 5DZ7A 4O3SA 4Y34A 4DZ6A 4J9KA 1KOOA 1U1RA 3H7HB 2E1AA 1F5CA 2OUGA 4H4KC 4DN0A 2ZEJA 1MN7A 4CLFA 2G4BA 4IQXA 2IC3A 1N36J 4YY3F 2DITA 4Y00A 3N6NA 1CSJA 4N7TA 2Y1RI 1NHKL 1HBUA 5J2QB 4CLZA 4ED5A 2K7KA 1GAOA 4OX7A 1HR0F 4KHPF 4X2BA 2QO3A 3UVJB 1JX4A 4ILLA 1AROP 3QGPA 5KT7A 2OO4A 2XMKA 4QR0A 2QLWA 5J2NB 5I3UA 3I87A 1LXJA 3KHRA 2RMLA 4K8RA 2VFRA 1NDPA 1PG5B 3ZZPA 1NO8A 1FKOB 2HQGA 1E6YB 2DNGA 2DNYA 3W8PA 2QLBB 1I94F 3B78A 1HQEA 3CCQS 3CCLS 1XR5A 5KFDA 1I5OB 2AIRB 3Q83A 5HK4A 4DBQA 3KLVA 5DDRC 4ECVA 4HHUA 2QN6B 2ZUAA 2UXBF 4DZDA 2RKIA 5C2CA 4B3MJ 4J5OA 4FPIA 2BJDA 1SV5A 2J0QD 4KAIA 5CYJA 4N5SA 1HBOA 1NDKA 2HQCA 5ETKA 2MKSA 3U27A 2NZCA 4NA3A 1KD1T 2ALZA 3THVA 4USIA 1FRKA 1OMSA 3RRHA 2ERRA 2Z58B 2FVPA 2NSCA 3CDWA 3DCAA 3OFGA 3DDIA 4DFPA 1F5AA 2IAJA 1I6JA 1M5HA 3GJRB 1EKSA 3N0VA 2DD8S 1WELA 2WHOA 2M52A 3H4BA 1FTCA 2R3VA 3GCXP 2BW7A 1T9WA 2C3PA 2WSEC 3PKYA 2FYXA 3BPDA 2A6OA 5ITHA 2ZBQA 4PUOA 3FFIA 4ZVUB 2X7IA 4DL7A 1TQLA 2QFJA 5A2QY 5AJ3J 5ETPA 2FVRA 3KLHB 2H5JB 4IFVA 1N32F 3PYDA 1XERA 1NDCA 1DFDA 1LK7A 3SFUA 1L3VA 4GO7X 1U1MA 4X62J 3WBZA 2ASJA 3D1QA 3SIPB 5I3PA 4ALZA 3H5XA 4Q8FA
chains in the Genus database with same CATH topology
3OSPA 5KT4A 1QJHA 3PRDA 3BO2A 2CG4A 2CQ2A 2AJFE 2OMLA 2IM3A 2JEJA 2DGTA 5CYMA 1C4AA 1UEVA 3K58A 3JSMB 1Y0HA 4UQTA 4C3KA 2MGZB 4RW4A 2NZ4A 2VKRA 3DU5A 4ID5A 5HMXA 2CQBA 2DHXA 3PHEA 1V6HA 4OIXA 4OZ1A 5EWFA 4Q8EA 4PXEA 1WACA 2PE8A 5IQQA 4I67A 4M5DB 2E1MC 2HG4A 1U1OA 2HGNA 2RQ4A 2AYBA 3OTBA 1HHSA 1J5OB 2PEHA 1HFEL 3QLHB 4WZQA 1NU4A 3GYNA 1S0NA 4LT6A 3HP6A 2P6TA 5B0AA 2DGUA 5EN1A 2QA2A 3EX7B 2ZHAA 2IBKA 2AD9A 1AFJA 2VL1A 3IG1A 1K73T 1Y9OA 1Q8LA 5DQHA 3FMBA 1ZH5A 1TKXB 3B4DA 1F0XA 1M1KT 2AYEA 4X4TA 2K2PA 1U49A 3MPWA 1FRLA 2Y1JA 4O3RA 1BWEA 2HHQA 1RTDA 3U1NA 3M6WA 3FMWA 2ZH9A 2MQOA 1M5VC 2MJUA 3GSDA 2F7VA 2L08A 4X65F 3N6MA 4JI0F 3T3FA 2M4MA 3C6TB 3FJ2A 1ZTWA 5KT2A 4WU3A 2XS5A 5DDPC 1T8EA 1RKIA 2RH3A 4K5SA 1T03B 4ED1A 1FE0A 1X4EA 2F1FA 4MKAA 1IN0A 1DJ0A 5K8NA 3GE9A 5LT5A 2DNQA 2E66A 2VPYB 5CCMA 3VCDA 1OO0B 4DQPA 4DG1B 1JLGB 3V6KA 4PCQA 2I8EA 3AA8A 4LFAF 3T5JA 2F8MA 2XZWA 1N48A 4ZHRB 1XBWA 3CCES 3FCHA 2P9CA 2XG8A 4G1PA 1TZ0A 4RNNA 1QSLA 5CYQA 3MM7B 1BLUA 2XWXA 4FF4A 4HHJA 1RT5B 2Q6BA 1QAYA 1R6YA 1IJEB 2VONA 2QA4G 4IR9A 4PG4A 3RB6A 1HBNB 4OI4A 1S77D 3HHKA 4DS4A 5HP1A 4TLRA 1Y3KA 5T7LA 2BQRA 1O5JA 3FEXB 3PJWA 1LOUA 2KKHA 2O01C 3MMBA 1SL0A 4CO5A 2QSWA 3DOKB 3BR8A 4K4YA 1U1NA 4Y2AA 4DQSA 2QV6A 3MPYA 3OUYB 2D3UA 1NJWA 2BA9A 4H4KA 4ED2A 4IFYB 1VRUB 2PA3A 2YY3A 2MZ1A 2A10A 1QAIA 3OR2A 2A18A 3BB5A 4Q5VA 1JLFB 3POTA 4NLGA 4RBUA 2CJQA 5GAHI 1NHUA 4Q44A 2OP5A 4URGA 4EGLA 3PR4A 1IM4A 2JH3A 2VG6A 3EUNA 4BC9A 3VAIA 1P8GA 4MYTA 1RTJB 2ZH3A 3H2UB 3NLCA 4A8YA 2YNIA 4B9VA 3TVYA 2MQQA 3V4IB 3IR5B 3LAKA 4H4OB 3RBDA 1ZPVA 5L39A 2KI2A 1S1UA 4DR2F 4I2QA 4OHXA 3I6PA 3KWMA 3PW4A 3CJ5A 4KO0A 4R8UB 5J2MB 3G6YA 4DL4A 4MYUA 1KTQA 3H98A 3I0RA 1FRHA 2DHSA 3F44A 1P1TA 1RT3A 1S1XA 3BQ2A 2BDPA 1LW0A 3NGDA 5JVGQ 2CPHA 1U48A 3GIIA 4NA2A 1RT6A 2YH1A 3BGFA 3OL9A 1GTEA 1JLQA 2KT3A 4QBUA 1S10A 4IO1A 3MM9B 4JYAF 3HZGA 4A47A 2BQ3A 2FLPA 1SJ1A 2E5IA 4DFMA 1C0TA 3BZQA 4ED8A 3IS9A 1UVLA 2XHWA 2FJVA 1VIXA 1SB6A 3V5RA 1UWBA 2N3LA 1MROB 3PJXA 2ZD1B 4YB1P 4DUYF 3V6JA 1ZETA 4JI1F 2EPIA 2C42A 2XMMA 5C42B 3FSYA 4I69A 3P96A 4L3NA 3MAHA 3JYTB 4EEYA 3TOQA 2I9SA 2L3MA 2E1CA 1R43A 5DLGA 3MMCB 2XCPA 2IC3B 4GKJF 1RT7B 2XNQA 3DLGB 4NZ6A 3LWLA 4OZNA 4MFBA 1Q8BA 1HNWF 2HNZB 4MIBA 3VALA 2I1RA 2E29A 2J9DA 3UI3A 3LP1A 4HI2A 3KLEB 3M8PA 1HBUB 2YKMA 1Z2ZA 5EX3A 2GHVC 4XAKA 2KXNB 3X1LB 2D41A 3PRBA 4CO0A 1VGYA 2XB2D 4DDFA 4K4XA 1TK5A 1DTTA 3ZZTA 2CQPA 2XNRA 5SZTA 3GFHA 2U1AA 2O66A 5GADI 5KFWA 1R0AA 3B8HA 4QW9A 5L1IA 2MSTA 3FSIA 4ITSA 4KV8B 3HHEA 4HT5A 2FJDB 1NK8A 3D2WA 5KFSA 3G9CA 3KLFA 3S1TA 5I3UB 5U47A 1DHMA 1HW8A 3HF5A 5IWAF 4B3RF 3US5A 3OTDA 2UU9F 3T1HF 3CPWR 2R9LA 2BANA 4K59A 3S6EA 4MK7A 2JSXA 2GW8A 3QGGA 5F0UA 4LIRA 2Z8QA 5DLFA 2P9GA 4NLDA 1WG4A 1T05A 2FVQA 3PW0A 4DF4A 1XR6A 2AJ4A 1VQYA 3W2WB 5E0OA 5E3CA 4HI1A 1NHVA 2ASYA 3HKWA 2QE5A 2ACYA 1HL6A 4K4UA 3CF5Q 1E6VB 4RUAA 3BQ0A 1VIOA 3MGJA 3RRKA 5KFPA 2DVIA 2ABYA 2XI3A 4CO4A 1EETB 2GQQA 4KC5A 4K0KF 2OSQA 3OFEA 2LYVA 1BGXT 2PSZA 4P7TA 3M2UA 1X4DA 3EGNA 4KHRA 2I0XA 2UUCF 2MSSA 3LH2S 2E9TA 5F8NA 1FDNA 4OLOA 4PWDB 1HBMB 2DNPA 3VZIA 3LOUA 3DRSA 1U1KA 2HWHA 3RB0A 2WBMA 5KG6A 1JLEB 5E3QA 5HROB 5KT3A 4ZOSA 1N36F 3CCJS 4OHVA 2F9JA 2VC0A 2BV3A 1X4FA 1L3TA 2L9WA 2O1PA 4NLOA 3FQLA 3IR6B 2MDAA 3DLEB 2RKIB 4ZPAA 2CQ3A 4KT0C 4FS1A 3GV5B 1RT2A 2ZNYA 4ELTA 5MLCV 1SV5B 2KO1A 1CQNA 1VQPS 2R2SA 1W2BR 2WB4A 1XMQF 4CI0B 5AE3A 2VPZB 4PPDA 3BGLA 2JWNA 1A9NB 1HBOB 4HLBA 2J0WA 1WF1A 1FESA 2UUAF 4EBEA 4DR4F 4KBIA 1AUDA 3M1VA 1R27B 2B4PA 3O1LA 5G0RA 1LWFA 2JHEA 2RDIA 2PFFB 5MAOA 4KQZA 5C25B 2PMZD 3E8OA 5DG8A 3GWCA 4ZPDA 3MM5A 5BYRA 2W7PA 2VA2A 3ZZOA 1PC5A 1D8ZA 1C1BA 2MZTA 2Z2LA 2W9AA 1SJRA 2CJ9A 3L3CA 5J2PA 1T02A 3T6BA 4FXDA 1CG2A 3I0SB 2M2BA 2GFFA 3KTQA 2GHWA 2YNGA 3G6XA 2JDJA 3Q2TC 3ICLA 2IAJB 5DO2A 3MUTP 4K50A 2Q79A 2W8KA 4TNOA 2MJNA 1ZM9A 4X4SA 3WDOA 2FHOB 3OXLA 1VQ5S 2VFUA 2J5AA 1N6QB 1TVRB 3M8RA 2KN4A 4PG7A 4JI6F 3CUNA 2V8GA 1U24A 2HFOA 1JJHA 1X4HA 3DXSX 5KG7A 2QA4S 4KFBB 1QLNA 1SC6A 3NNCA 2XSJA 5IS2A 4Y2CA 1HMVA 3L95X 2UP1A 3BSCA 1W25A 5KFLA 5KFHA 3MEDA 5LXRA 1G1XA 2JVRA 3BN4A 1TL1A 4U67Q 1JMTA 2M8HA 1X4CA 5KFIA 4PRFA 1HYSA 1KC8T 4OI6A 3L7PA 3TO8A 2B9XA 2WOMA 3OFHA 3FEYB 3AH6A 1URRA 2UVWA 4CO2A 2K1RA 2J6UA 2V2KA 2V8HA 4ETZA 1K1SA 2N3OA 1RJJA 4R5PB 4DSLA 2YVSA 2CQGA 1FXDA 2Y0SD 1DZ5A 1C4CA 4DV4F 2JLFA 2DT9A 1S1TA 2V8DA 2OMOA 4PG6A 4WE1A 2WB1D 4OI1A 5DG9A 1RT1A 4N47A 2BE2A 1H7WA 2WSCC 4ECWA 2GHPA 3CD0A 4IFVB 4WJBA 4PQAA 3N28A 4ZPBA 4ES2A 3GIJA 5FLXY 4C0OC 5F8MA 4M63A 3OSNA 2HS4A 4LF7F 5KAKA 3CGIA 4DR3F 3RB3A 3PW7A 5IFMA 1LW2A 5D3GA 1DLOA 1WEXA 4GKKF 3QPIA 2HHWA 5B0CA 3H8YA 3H2LA 2YNHA 3IFEA 4RWWA 1C1CB 1U1PA 1SJFA 4F4XA 2M88A 4K4TA 3KLGB 2LQ5A 3RW7A 4U7CA 3W2VA 1N56A 2OTLS 2FC8A 1SL1A 3NBPB 2ZC4A 2OPSB 5K8PA 4UOCA 4EFAC 1GTHA 4MMOA 4I7FA 3TP2A 2MKIA 3BQ1A 5KG2A 4G1QB 3M30B 2R7OA 3AHPA 4CNYA 2NPIA 4B3SF 4LSNA 5DETA 3KJVA 1Y5LB 5H9EJ 4DV2F 2R8IA 2HFNA 1GX5A 3TX8A 2EG1A 4IRKA 4FXWA 1HNXF 3HHLB 4DSFA 2MKJA 5CYMB 2DCUB 4A8OA 4NA1A 4RZRA 5DRKA 5CZXA 5DG7A 1W2IA 4KHMA 4YDXA 2KG1A 3KHHA 5IT9Y 1JIHA 2VQEF 1JLAA 4LF6F 3IGNA 5HO4A 1SH2A 2FJBB 2JC1A 2VG7A 4O0IA 1SBRA 3PV8A 3HPOA 3LW5C 1ZPWX 2IVYA 3E3XA 2QRRA 3DLKA 2DH7A 1UW4A 2F9DA 4YOEA 4A8KA 1SKSA 2OTJS 2FJWA 4RW6B 1RI7A 3GFZA 1WHVA 3DI6A 2AQ4A 2E7XA 3UCGA 1Y7PA 4CTAA 4I64A 4TLQA 2D3OR 4UUXA 1N5YA 3M6UA 3P49B 4J9MA 3MFHA 4JI4F 3A1YG 3ETOA 4ZK7M 1T7PA 3Q8SB 5KFKA 3BO4A 5HL7Q 3HMJG 5FDLA 3R1LA 2Z4PA 3CCUS 1RTDB 3QGHA 2MQMA 2EFVA 1B0TA 1NK6A 5EX0A 4EO8A 2RB7A 4JV2A 4KRWA 5GAGU 2FLLA 4WYWA 1P1LA 2OPPA 2R8HA 2GJ2A 4X62F 4UUWA 3VTIA 2J76E 3NS6A 2NREA 2VG5A 4O3NA 1TV6A 2YX4A 3E01B 4DV1F 2W7AA 4ATNA 1U8SA 3OXFA 5HLFA 3HJFA 3IWXA 1CLFA 2WW8A 3ZFVA 1QSYA 2KT2A 4DL6A 3ZZZA 3BGUA 3RU0A 1CQMA 4TKTA 4CIOA 4Q2LA 1XK8A 1EP4B 3EXCX 5D77A 2JVOA 4FVMA 5DS7A 1HI0P 1LWEA 2ILYA 2HLUA 2E9ZA 2EFNA 4AL6A 3MR3A 2NXUA 1NB7A 4K4ZA 5JUMA 3EZ5A 5K8OA 2AGQA 2HS0A 2K8GA 2B4VA 4IH7A 4YR2A 5FJ4A 4RNFA 4KKOA 1QAJA 1REVA 4PXBA 5T41A 4MIAA 3K59A 3CDAA 2HNYB 2ZHBA 3CDUA 2SXLA 4NRUA 4AL5A 1MWZA 3DXBA 2KYXA 1FK9A 2OFHX 5HP1B 1YI2S 2M0GB 3CJKA 1RKJA 3HXMA 1JB0C 2YKOA 5CXTA 4C4WA 3GFXA 4TN2A 3V6DA 2LKZA 1NK4A 3MMBB 1IUJA 2GMHA 1JJ2R 4LSLA 3TAMA 2U2FA 5F8HA 5KFBA 3CD6S 1FEEA 2HWTA 1PGZA 2PI5A 1HNVA 4OI2A 4QYRA 4DN9A 3MAQA 2QZ8A 3PY8A 2DNHA 2MZJA 4IKAA 4N77A 4Y2KA 3FRYA 4ZCMA 2LECA 4QR2A 2J0XA 3POTB 3TA1A 3TQ1A 4CT8A 3TRGA 1VJWA 4NCGA 3I82A 3KK2B 4HTJA 3M8QA 3UNGC 2VG6B 2J8AA 3J80Y 3MR2A 3MR6A 3IXQA 2YKNB 2OPQA 1HD0A 3Q22A 3R27A 2BJEA 4OI0A 5L8RC 2B5JA 2R8GA 4C8NA 1U2RA 1VQOS 2C3YA 3H5UA 2CQHA 4C3MA 1FDAA 3Q8PB 2ZZMA 4ERDA 4YEAA 3LP0A 4I2QB 1HQUA 3KK1A 1QUVA 1D8YA 4TQRA 5I4MA 2CPEA 4I0WA 2W7OA 4F2RA 5K9FA 1BQMB 1S79A 3I0RB 3RR8A 4JI2F 2RU3A 1Y5NB 4EO6A 2B9WA 2X51A 4G3IA 4IUFA 2VFSA 1LW0B 2OH2A 4URSA 5EDWA 4MK8A 2CQCA 1Q7LB 4DWIA 1RT6B 3DN9A 1JLQB 1S6UA 2B56A 3MEEA 2UXDF 5EHHA 3M32A 1C0TB 4ELUA 3P5TL 2R7UA 3IS9B 2LXIA 4V19J 1NJZA 1VQLS 4QIFA 2RSQA 3M6VA 3QJLA 2DB1A 2ROPA 1Q4RA 4QQBA 4BC7A 2R2TA 3RBEA 2BUNA 5F8LA 1LWCA 5AXKA 3VF0B 2HAIA 4KPYA 2ZKTA 1S1WA 4HDGA 2XO7A 4DV3F 3ZC4A 1X9WA 4QJVA 3P3DA 5GADU 4MFBB 5EGYA 2LDIA 2PIIA 4OX6A 4B3OA 1FHTA 1IKYA 4ZA1A 3M8PB 3N4WA 2KYZA 2ATLA 2YKMB 2HZCA 5E33A 3G8SA 2OSRA 2DHGA 4I68A 2XLJA 4QYZJ 2IRYA 4NYPA 4CO1A 3M2VA 3RAMA 1DTTB 4FVCA 2DNOA 3DRRA 2KJVA 3L7OA 2DR9A 1YJWS 1D9FA 4KSEB 2XMWA 5BYQA 4F2SA 4WFZA 5HI7A 2W25A 4KE5A 2VZ9A 2GJIA 2M5YA 4ZVHA 2VOOA 2AX1A 1N54B 1PILA 1NNDA 1SQEA 4HL9A 1MMLA 1Z1ZA 5JXSA 1NJYA 1VK8A 3PEHA 5DQGA 3KLFB 2EVZA 3KG4A 4IG0A 5LJ3Y 2N7YA 1H2VZ 2X1GA 3N5FA 2MZRA 3OL7A 4G6VB 4RW7B 3VAFA 2BANB 5K5MA 2QA1A 3IBWA 4U6PA 2DGQA 3K0JA 1FRIA 5LSOA 1QVGR 1QTMA 4O3OA 1WI8A 2GX8A 4DSIA 4ECYA 2Q3PA 2AX0A 5L38A 3N5BA 2ZJRQ 1BC6A 4XDDA 2KM8B 4WK3A 1WNEA 3MOZA 3L09A 3JB9k 3RR7A 2KRBA 2XEXA 5DJBA 4AQYF 1S76D 4OJ1A 2IJFA 3D1OA 2FJXA 1FE4A 1WG1A 1N8RT 2CDQA