3T9ZA

A. fulgidus glnk3, ligand-free
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 21
structure length 95
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9zA00
1UL3A 3AA8A 4NYPA 5D4LA 3CE8A 1O5JA 4RLEA 2V5HG 4C3MA 2O67A 2PIIA 4USIA 5DRKA 1OSCA 4USJC 1XK8A 2NS1B 4Y6IA 4C3LA 4D3GA 1J2VA 2XG8A 4RWWA 2J9EA 2J9CA 3O5TB 1GNKA 3NCRA 4AFFA 4OZLA 3L7PA 5D4NA 4YB5A 3LF0A 2XZWA 2JJ4D 1NAQA 3NCPA 1PILA 1Q1KA 2O66A 4NYOA 2CZ4A 1UKUA 4OZJA 3T9ZA 2VD3A 2J9DA 1KR4A 3DFEA 5D4PA 2EG1A 3TA0A 2XBPA 2J9DE 2XULA 4C3KA 4WK3A 4CO5A 3AH6A 3X3UA 1VHFA 4YB6A 1V9OA 1QY7A 1NZAA 4RWXA 4YB7A 3BZQA 3N5BA 4ZK7M 3M05A 4CO4A 1H3DA 1NH7A 1V3RA 1NH8A 3OPKA 2DCLA 2EG2A 2ZFHA 1O51A 1V6HA 4CNYA 4D3HA 1HWUA 4RX6A 1UMJA 3MHYA 2NUHA 4Y65A 3AHPA 1P1LA 1V3SA 5D4OA 2GX8A 2ZOMA 3AA9A 3TA1A 3TA2A 3NCQA 4CO3A 4OZNA 4USHA 3HLUA 1VFJA 1UFLA 4WK1A 2GNKA 3O8WA 2GW8A 4CNZA 4CO2A 3GSDA 4R25A 4CO0A 4CO1A 2RD5C 2Z0GA 2NUUG 4E98A 4IYQA 2E66A 5DS7A 5L9NA
chains in the Genus database with same CATH superfamily
2UU9F 3OTCA 2XY7A 3MUMP 2DHGA 2XMJA 3H2UB 4RLEA 2HWIA 4O3SA 4RW6B 2HGMA 2FC9A 1ZTTA 3MTJA 3G87A 4I64A 4OYBA 1UETA 4ECYA 3MDFA 2C2ZB 4ILLA 1ZPVA 1U6FA 1T94A 1B0PA 3US5A 2B9EA 2DGUA 2KRBA 2M4MA 3B4MA 4H4KA 5GADI 4NCAA 3NAHA 3IM9A 2E5LJ 4XAKA 1WF1A 3T6BA 2BOAA 3VR1A 2YPZA 3NRBA 4AXIA 3JSBA 2FJVA 3T5HA 2DR9A 1DTQB 4ZS6A 4DPWA 1AZSA 1V9OA 5GAEI 3TUPA 1X9SA 3S6EA 2DNGA 3O44A 1V5VA 3PM9A 1IKVB 4KHPJ 5HLFA 1YJWS 2MQMA 1VQ4S 1TL7B 4UY85 4ETXA 1JKHB 2I0XA 1RABB 5HVFA 2OUGA 3QNWB 2G2ZA 2KXHA 3Q8QB 2O1PA 2BBEA 1RT4B 4K4SA 4ZVRB 4Q7AA 1NKEA 4IFVB 1VR6A 1UA1A 2JDJA 1X5PA 4QIVA 1NSQA 3W64A 5ETNA 3FCVA 1OY9A 3UWTA 3BJYA 2QIFA 3UDEA 1SL1A 3G4SS 3JTPA 3G71S 4K59A 4KHRA 2KJVA 3RRGA 1JNRB 2V50A 2OHDA 3TX8A 4LBHA 2JFKA 3CD5A 1RWXB 3H5XA 1C1BB 3VAJA 2OAUA 4YP3A 3DM2B 1BQNB 5D4PA 2XYPB 1TVRA 3P5BP 2HHUA 4RUHA 4DR2F 2DJWA 4K4XA 2ASYA 4HYKA 5KT3A 1M1KT 4YR2A 1CJTA 2N7YA 2EVZA 3GE9A 4ANDA 1M5OC 2DISA 1K47A 5IOLA 4W92B 3EUNA 2OFGX 2XGPA 1TL1B 1FTCA 2PT0A 2HFVA 3HZGA 5H9FJ 2BANA 1RT7A 4EYHB 1X4DA 3KLIA 5ETKA 3HT0A 3D66A 2RUSA 1HPZB 1U1NA 1FFWB 2B7BB 3S01A 4KGZB 3VWSA 4U8VA 3ZNUA 4DXLA 3GJQB 2RHSB 5C24A 4HLBA 3MGJA 3CJ5A 1U47A 4FYXB 5BYSA 3A4TA 2PEHA 4DV1J 4X62F 3QT7A 1MROA 3I32A 1SIZA 3CCLS 3DRYA 4FXWA 5I42A 2B8PA 3FSXA 2FVCA 3HKWA 1JLAB 5C2CA 2QV6A 1NU4A 4ZK7M 2EFOA 5B09A 3MEGA 3G86A 4ECRA 3SEOA 1YTYA 4F2RA 1N36J 3J7YU 2GMLA 1MU2B 4WP8A 1X4BA 3QO9B 2N4CA 1WC5A 1VLYA 4ZPWR 1DHMA 3D6HB 3G8QA 2CVEA 3B54A 3PW5A 2QT7A 1F9EB 5THWA 3D68A 4X65F 5BYQA 1YZ7A 3R3TA 2O67A 3WIUA 3A3PB 5DRKA 3H7HB 1RTHB 3EGNA 2CJBA 3DYAA 3CTRA 1S6QB 2P2CB 4TY8B 4IH5A 2MKSA 1LKZA 1QSLA 5DGAA 3VAIA 4NEZA 3G8TA 1HQ2A 3J81j 1RTIB 5KT5A 1FNOA 2JJ4D 2ZKUA 2W4CA 4OYXA 2GAGC 3U1LA 7AT1B 2LVWA 3R6GB 3VTIA 1FJEB 1LWCA 5MLCV 1S76D 2NYIA 2ROEA 4IRDA 2OGUA 2RIJA 1I6JA 3EGZA 4CT9A 1NH8A 1KLMB 2PE8A 2NXUA 3EX7B 3VZHA 4LRFA 5JXSA 4DS5A 3G6YA 1FKPB 2DO0A 2V4RA 5DGBA 4OZNA 5HVGA 2MTLA 3D7SB 4NXNJ 1FDBA 1UFLA 2NXEA 5C2GA 2M7SA 4LF5F 4R8UA 3PJ9A 2ZD1A 1NDCA 4PXBA 2B6AB 5KFIA 1NEEA 1VOMA 2P6TA 3EDRB 1S99A 2HSEB 9RUBA 2EEYA 1ZOTA 5ITHA 3ILLA 4DDFA 3IN5A 5E33A 4HDGA 2W4PA 1RWOB 3R5JB 1KDNA 3ELHA 2QGFB 5HO4A 2BZ2A 3F44A 2PD1A 3QLHA 4MFBB 4NLTA 1GTHA 2VKRA 4F25A 5D3GB 3PHEA 1ZAXA 1GXLA 3LW5C 4EU0A 4UOFA 3HD1A 1GMUA 1FRHA 5B0FA 4NA1A 1T03A 1APSA 3J80Y 4RW8B 3Q8SB 1RYSA 3DRSB 4AUKA 1W26A 1XMBA 1ZA1B 2CQCA 2H48B 2CQ3A 4C0OC 4ILMA 1PAUB 4PABA 5HP1A 4DUTA 3OL8A 3W2VA 2L08A 2XWXA 3PXGa 4JI4F 1FK9A 2PFFB 2YWEA 2HHQA 1DQ9A 3KG1A 2QA4S 5KFNA 2EWHA 2FD2A 1D1UA 3W3SA 4DV5F 1S0VA 1XJWB 3LO3A 5E3RA 2AHOB 3KHGA 3N01A 4ZVPB 1KRPA 3RG6A 2IM1A 4ED8A 4P6QA 2ZH7A 5ETRA 5A76A 1KD1T 1Q1KA 1FKAF 2EBGA 2IC3B 3Q23A 4P71A 4NCGB 4U7CA 3PX4A 3OTEA 1YWXA 1E6VB 3DHXA 3L4BC 2VJVA 1HNVA 4K5SA 3Q8PB 1H6KX 1RQ0A 5LMNJ 5AXLA 5A8RB 4W98A 2YWWA 3MHYA 4ZLJA 3F73A 1G1XA 3AA9A 1Y11A 1WTBA 3A8IA 4J9LA 3HLUA 4P72A 3FNNA 3TQEA 2KVIA 2QN6B 2UUCJ 4QIEA 3VVTA 5DG7A 4F0HA 1XTZA 4EEYA 4JB8B 2XGQA 3MAQA 5DLGA 4MIBA 4F4YA 2C2KB 2BJDA 4F3OA 5KFLA 1PYTA 2QC3A 3GFYA 4UTGA 2K2PA 1YJTA 5KFBA 3K5LA 4DFMA 3C66A 4EFAC 4UW2A 1QDUB 1KLNA 4DSJA 2VG5B 3C2PA 1AUDA 2I6WA 1HNIA 3CGIA 1R0CB 4V19J 4J9PA 2HAIA 3NBPB 4J37A 2KHCA 1HNWF 4P10A 1U49A 1R3NA 1RTJB 2KH9A 3IO1A 2FHJA 3AOCA 3ZZOA 1M5SA 1R27B 4NLQA 2YWGA 4K4WA 3HULA 5U47A 2Y1RI 5A8KA 4C8OA 1WHXA 2JLEA 1VK3A 2IAJA 5CHCB 2LQ8A 1KVIA 2LEAA 3K5MA 3PW0A 2YH1A 3ISZA 1ROFA 3MXHP 1U1QA 3BN7A 4X4QA 2JRSA 3FDSA 4A8SA 2K3IA 1S1WA 2HK2A 5LJ3Y 5C5JA 1TFWA 2ZH5A 5MAOA 3C16A 1FWLA 5H1SV 5CYMB 3H90A 5ETTA 4WKRA 3MMAA 3DI6A 4EO6A 1ITPA 2MYFA 1D9AA 4DSIA 2R4FA 3BQ0A 2QA1A 2WW4A 5HROA 5E3PA 2BR0A 4JV1A 5KFVA 5KG3A 5KFFA 2CWKA 2EC0A 1XEZA 1TKXB 3KTQA 4OHVA 1EETB 1S9FA 5AE3A 2CPXA 3I4HX 2B4VA 1I94F 5DQHA 2W9BB 1IR2A 3VAMA 1P1LA 2J7WA 1DTTA 3OLBA 2EK6A 3NGRA 2OPSB 4FN5A 3UI3A 5A2QU 1IBCB 2MSSA 2JC0A 2RH3A 3ZNJ1 1RT3A 3F56A 2QLWA 2PFDA 3QRPA 3W63A 3I9V9 1XERA 4IG3A 2CYYA 2GVZA 2QLJB 1I51B 3I5BA 2DRDA 4PWWA 3K5OA 4P73A 5KG0A 1NJXA 3QRRA 2VFRA 1N8RT 1Q7YT 3SDEB 1FA0A 1VIOA 2LDYA 4RWWA 3DRRB 1UVMA 2CQ0A 4EBDA 4Y2IA 3G8SA 4OZLA 3I0RA 4ECQA 2HNYB 3JTNA 4ZPVR 3GFXA 1PILA 3ENQA 3H0PA 3TO8A 5BJRA 1F5BA 4ZP8A 2ZC3A 2BJ1A 3KLGB 4R5PA 5F8HA 3IBCB 1XR5A 3TR5A 4N47A 5IQ6A 1F6TA 2CWXA 1NZAA 2W01A 4PG8A 1U1LA 1V6HA 2HQIA 2ZOFA 5GVQA 3WX8A 1RSCA 4TU9A 2ZOMA 3JQKA 3JSRA 7FD1A 1LFWA 2VQEF 3OFFA 3A3NB 1AT1B 1KQFB 3IBFB 1S1VB 4TU7A 4NLWA 1KS2A 2DXFA 4LRAA 4ECXA 4CO2A 1VBXA 1BQMA 2E66A 4N8NA 1UL3A 2KG0A 5F8NA 3TZXA 1W2IA 3OXLA 4AXJA 1Y3JA 2ZM6J 5F0UA 1HNXF 1NXIA 2PC6A 2R8KA 1RWVB 5LXRA 2HYIB 3KJQB 1VLOA 3EPIA 4OX7A 1FVQA 1UZHA 2VFTA 2OMOA 2MQLA 1UWAA 3V81A 4B3RJ 3MMCA 2J7UA 1U45A 3QWPA 5LJ5Y 5J2QA 2LKZA 4K4TA 1HQEB 1OIAA 1MWQA 3JB9k 2ZZTA 2CPIA 2GHWA 2Q66A 3OL6A 4J91A 2DY1A 5LSLA 4ZVUB 5HJYA 1I3OB 3W65A 2ZBPA 1CQNA 4WYLA 5HMYA 4URQU 1CBKA 3M9OB 3THVA 1OO0B 2H4WB 3WBZA 4OI2A 2C22A 3HZEA 2E1AA 3ILJA 2JX2A 3H98A 3FCWA 4J9SA 1QE1B 2CDRB 3A8JA 4FNIA 1S10A 3AD7C 3NAIA 4M5KA 3LAMA 1FRLA 1NPRA 1TUVA 4QR1A 1N4LA 2A0FB 3MCOA 4QU6A 2ZH3A 1CJUB 4QZVB 1N32J 1UVIA 1URRA 2XZWA 2HFUA 5DQIA 5KFHA 2XMAA 4B3OA 3FEZA 2AJFE 1L5UA 5ETSA 2ALZA 1K1QA 4Q43A 5CYQB 3OL9A 2A3JA 1S77D 2AD9A 4ECSA 2B5JB 3M8PA 2B51A 2RILA 1V3RA 3MD3A 4CI0B 2ZFHA 2CVIA 4I6AA 3FJ2A 3OXFA 2YTCA 5KT6A 1FFSB 2PSZA 3RAMA 2W24A 3PO5A 4LFCF 1JLGA 3D67A 4YR3A 2A2CA 4BWJA 1WI8A 3GB0A 1RK8A 2YNFA 3KJVA 2RMLA 3V4IB 2XC9A 3V6DB 1M1HA 1TL3B 3DOMB 1R0AA 4IOAQ 2GO9A 2LDIA 2DXDA 3M2VA 1HNZF 2AYEA 2AGPA 1G6BA 4NLSA 4FBUA 4DX6A 4I7FB 4RW9B 3BDEA 4USVA 1R8BA 2V4JA 3G2XA 1RLDA 1VHIA 4CM0A 5HL7Q 2QRRA 2J6TA 3MM9A 2XSJB 1CVJA 3MECA 4TYBA 2Q6CA 1BQXA 1RHRB 3HHDA 2HRYA 1RU1A 2KFYA 1SC3B 3EZ5A 5I3UA 5D6GA 5KFQA 1HQUB 4WE1A 5DQGA 1ZZFA 3DRXA 1RCOB 3TVKA 1FE4A 3KDOA 2XS2A 2W7PA 2YPYA 5CZVA 1QY7A 4NLGA 1SKUB 2AMCB 4EUVA 4ZPTR 4ZN3A 2MB0B 3MR5A 2XS5A 4M5JA 1BC6A 5B0CA 4ES3A 3OFEA 2BE2B 4TU8A 2DNPA 1Y10A 5D4OA 1FX2A 1SQGA 2R8IA 3I82A 1VQ8S 4MTPA 3LGMA 4DL2A 2RRAA 1N54B 3ZTRA 1R89A 2I38A 4CDIA 4P7VA 1Z1ZA 4DR3J 3IRXB 2IHR1 3RZAA 1RT2B 1N5VA 3GIMA 2BUNA 2DNLA 1FFGB 1HYSB 4JI2J 4LSLB 4B3SF 4LT6A 3DC2A 4PWDA 3QJLA 3W7BA 4F50A 3OVBA 2YKNA 2V6AA 1RKJA 2WBMA 3EZOA 4YUDA 1WSRA 3R5GA 3ISND 5I3PA 2PDAA 1T8EA 2F4FA 5DO2A 3EVWA 2PI5A 4ITSA 2M8DB 2VPZB 3MEDB 3IWLA 1FJCA 1T05A 3M1VB 2R8GA 2AJ0A 3CCRS 3CIMA 3UO0A 4QJVA 4DR1J 3CCSS 1UW9A 3QFWA 2CQ4A 1S1XA 3OTOF 2OI2A 4ZJOA 4DX8H 3DLHA 2CNNB 2PMHA 2CNKB 4MIWA 1A9NB 4K4YA 2ZH9A 3DDNA 2J0QD 2YBVA 3BO2A 3WC0A 2FYXA 1RGVA 2QZ8A 4DL7A 2Z0GA 4JI6J 8RUCA 1T9YA 5LOQA 3BN4A 4A48A 3AD9C 1U1MA 3KJFB 1I5OB 1HI8A 5DZ6A 1QAXA 5K8NA 3TJ8A 3BBCA 4L72B 3FMBA 1NDKA 2V8GA 3W8PA 4YOEA 3M8QA 4EZ9A 2C1EB 5EWGA 3VGUA 3CCTA 4ZVHA 4X84A 2W2NP 4LF6J 1YBAA 2RF2B 3P6YC 2M3DA 4QIWD 3M8YA 3K5NA 1E6YA 2B7CB 1YLXA 2DH8A 1NSKL 5HQLA 4YHHJ 3DOLB 4X64J 2Q1LA 4DV6J 4CO4A 3I0SA 5CXTA 2XEXA 2GGPB 4USKA 2HZCA 4JI1F 3DLEB 2CPDA 2GX8A 3HHNB 3TUIC 3RBDA 4LF8J 3CC4S 3QZ7A 2V8PA 2C3YA 2GNKA 1YITS 1KQSR 4RW6A 4OZ0A 1KFDA 4CO0A 4P2SA 3JYTB 5F8IA 2RDJA 5KG1A 4DX7A 2VF3A 3KMSA 4KGXB 4GKJF 3NGTA 2X3DA 3NG8A 4ES1A 4USIA 4DSKA 3HDSA 2V4QA 2IFXA 4Q8EA 1RT6B 5L9XA 2W1BA 2HPUA 2X51A 1J2VA 4CLFA 3LANA 2G4BA 1WF0A 3PCOB 1AROP 2HWTA 2KXFA 3QAUA 2QMUB 1DTQA 3HXMA 1PC4A 3PVXA 4F4AA 2YNGA 4J9VA 3VAHA 3FFIB 6AT1B 2MY7A 2CJQA 1RAIB 1SJ3P 3DFEA 5SUHA 2IRYA 5I4MA 1IKVA 3AXKA 3FVYA 3M8RA 3EXCX 2R9LA 1TL7A 1JKHA 3ETOA 2Y1LB 2F7VA 1FHTA 3OPKA 2CJYB 1HWUA 4IOBA 1SC4B 3ILOA 3R5BA 4RUCA 1RT4A 4O3PA 2HVHA 1S1TB 4OX6A 4DJBA 4IFVA 3RB0A 5C42B 2OLWA 2E9TA 2DB1A 4YS2A 1H2TZ 1RWPB 2YX4A 4CTAB 1F2HA 3TJAA 4ECTA 5K8MA 4TNOA 3M9NB 2FHOB 2W2MP 3RBZA 1NPPA 3AJ2A 4JI7J 4IR9A 4C4WA 1HWJA 1GX5A 3N79A 2VOOA 4AD6A 4U96A 2UXDF 1BQNA 1YVFA 3MI7X 3PR5B 2K7JA 4WF9Q 1RTZA 4ILRA 3ITHB 3VGTA 2Z2ZA 3MEEB 3PRBA 4J9RA 2J9DA 1X8DA 2R7OA 1UVKA 3BH7B 2MZJA 3BKUA 2V2KA 4ALZA 2HAFA 5HAOA 2W7OA 4HTJA 2UUAF 2HWHA 4ZPCA 1REVB 1LW0B 2HHVA 3BH6B 3CJ4A 2AJ1A 1K9MT 1TL1A 3RB3A 1IQZA 4DG1B 3MFIA 2H51B 2W2OP 2ZJPQ 4DL5A 2OD6A 3DXBA 2HVIA 2GJFA 2NQPA 2XO6A 2VG6A 1HPZA 2ZBRA 4DV4F 4JV5F 2RD5C 4C9DA 1U7LA 4KPCA 1FD2A 4O3OA 5F0WA 2IA6A 3CD7A 3D2WA 2AIRB 2BW2A 1F5CA 1JQGA 1X4GA 2GA7A 2WAQD 1G3OA 5KFPA 3PYEA 4F2SA 4FF3A 2WK4A 1LWXA 3R97A 4XPEA 4UQTA 1YX2A 2YNHB 1NHKL 3OTBA 2V8HA 2MGZA 1FDDA 2R7RA 3MFHA 5J1PA 1HBUA 3QRQA 4PXEA 1AA1B 2CQDA 3FZBA 4QU7A 4DR7J 4GVLA 2CKWA 3RBXA 3W2WB 1MU2A 3EVMA 1PJ7A 3IAM9 2LMIA 1N5TA 3V2UC 4C7QA 3B4DA 3PDNA 3T6JA 1YRUA 3HSDA 2V9KA 5KT7A 1MMNA 2KO1A 1RAFB 5F9LA 1FD8A 3SFUA 3M6XA 3HJFA 1S6QA 4TY8A 2GJIA 1KOOA 3GYGA 4DZDA 5HSPA 3NNHA 4O3NA 1RTIA 4WTYA 2G2YA 3P5TL 3BQ1A 4B02A 1GTEA 3DRPB 2JH3A 3T1AA 4JI0F 3G96A 2ZJRQ 2XHWA 1VI7A 3QGGA 2ZH2A 3KLEB 5BYRA 1P9YA 3CDUA 5AXNA 1LXNA 2NREA 2V34A 4DU8A 2Z58B 1KLMA 5KG2A 1XWLA 5KFEA 1FKPA 3X3UA 3M30B 3OHAA 5L8RC 5KG5A 4YB7A 2SXLA 1KFSA 3Q89A 4ELUA 3D5MA 3EE3A 1LK5A 3L9ZA 2B6AA 1FX4A 4YY3F 1A7GE 1VCTA 3NNAA 4YEAA 3T1HJ 3CCUS 2XLIA 3GQCA 1C1CA 4IRKA 3H25A 4L6V3 2OMLA 1RT5B 4N7TA 4A47A 2DR7A 3D6MB 2KZMA 1P8GA 2MKJA 5F3ZA 3MMJA 4M5LA 2COLA 2EBEA 1RA6A 4N5SA 4MFBA 3RAQA 1T9XA 2BV3A 4QYZK 4KE5A 4BHQA 2H3EB 5HVHA 2DNOA 3LOUA 1NZ8A 5D3GA 3IC1A 3MR7A 4LF4F 2VBYA 5H9EK 5JUMA 3GPAA 2IYIA 3GMGA 3LF0A 3SV3A 3CJQA 2KL8A 3I9ZA 1KC8T 4OJGA 2DIVA 4RW8A 3GIIA 3T9ZA 3SXLA 2I1RA 4U67Q 4P2XA 3DRSA 4QYRA 3MPUB 3D1HA 4C8YA 4IDKB 4DN0A 1UPPA 2GVDB 2C2DA 3J80U 4KHPF 1RAOA 3FBEA 3HKZD 2DEJA 4QWEA 3OW2R 5A0YA 5AT1B 4MIAA 1SKRA 2Z8QA 4DSLA 2MLYA 1JLQA 3TRGA 2EC2A 1BXNA 2OSRA 1N5YA 3CMQA 1U0HA 4WZMA 1B64A 4TXSA 3IR7B 1GH8A 2BA9A 1Q95G 2F9JA 1WWHA 2OPQB 3ETMA 1C0TA 5LM7E 3TARA 2D3OR 2CJXB 3MF5A 3CDWA 1B70B 3GYXB 3VAGA 1KQGB 1MW7A 1MLAA 5CABA 2V67A 1NHUA 4HI2A 1EB0A 2QLFB 1EZZB 2IC3A 2LQ5A 1Y4ZB 5K8PA 1WOOA 4NCGA 2QMXA 2RU9A 1RHQB 3C3LA 3FQLA 3OR1B 4LBIA 1TKTB 1B3TA 1RT1A 2XMVA 4GKKF 1E6VA 4WKYA 4X4PA 2A18A 4F3QA 1KP6A 2GHVC 3GYNA 3ILIA 5A8RA 2CA9A 3DOKB 1U24A 3A8EA 4XPCA 2C42A 4KHMA 2C2EA 5LT5A 1DRZA 1ELOA 4DOZA 4NRUA 3N6MA 4Z2XA 2HBYB 3M7VA 1JLCA 5AJ3F 5KOXA 3MZIA 3NS6A 1WEXA 3GONA 4C0HA 4XDCA 4KV8B 2IMWP 2WSFC 1RAEB 4PXCA 2QO3A 3FUYA 2C3MA 2ZZMA 5LSRA 3H40A 1N33F 2BVZA 3PYFA 4IH6A 1KVJA 2R7QA 2AEMA 1NK8A 2VG5A 3AOAA 1RBAA 1HI1A 3ULHA 4I2QB 1SJFA 4N77A 1QUVA 3TOQA 2BJ7A 4DV1F 3NBPA 4ZCIA 4Y3CA 3S8SA 2E29A 3I96A 2KHDA 1ZPWX 5HQMA 4OI0A 1S6UA 5AE2A 2HS0A 2FLPA 4C11B 2MEWA 5CQGA 2LU1A 2DGVA 4X4UA 4DL4A 4ICLB 4DUYF 2ZWPA 5CCMA 3H8YA 1NPKA 3AB4B 3NOCA 1BLUA 3H2LA 2W25A 5GMEA 1PYSB 2E7WA 4CLZA 3LP1B 2FLOA 2XLKA 4ELTA 4HH0A 5KG6A 4JBCA 2RDDA 4FVMA 2DCUB 5CCLA 4DR6F 3PX0A 3TA2A 3ENAA 3FZ2A 7FDRA 2LQJA 1D9DA 3TJ9A 4OIXA 1QLNA 4LMZA 2XY6A 3DDIA 4WXWA 5DS7A 4B9TA 2PO4A 3GFZA 3WX4A 3FBCA 5E5NA 1OY8A 1WD6A 3KK2B 1IR0A 2BX6A 1VC0A 4N76A 2B4PA 1VQOS 3BGOP 4Q0BA 3EM1A 2ZH4A 1NK4A 1IKWB 1KKHA 4USMA 1LWFB 3R5DA 5FIIA 3IS9B 4IFYB 3N9UC 3SSSA 1TKXA 1S0OA 1HKAA 1RAAB 4DMZA 2G2OA 2CFXA 2HFZA 2W9BA 5T14A 2IBOA 5IV3A 1YSJA 2QA2A 2OPSA 1C4CA 1H7XA 2J76E 3TAQA 4P75A 2WONB 4JYAF 4NXMJ 1VRTB 3DMJA 3X1LB 2Q3PA 2GW8A 3EVOA 3J81Y 2W7AA 1SV5B 1IJFB 3SDEA 2BOPA 3SBMA 3PEHA 3DRRA 1VQ7S 3E51A 4PAAA 4I6YA 5HANA 4LFBF 4L3NA 3TNVA 3QT5A 2HNYA 2HS3A 4KSEB 4DUZF 2R7TA 4HHHA 5J1EB 2VPYB 2XI2A 2ZHOA 3KLFB 5JMNA 1NHVA 4OI4A 3WQPA 2NXJA 4OI1A 3FMWA 2NXCA 4O0NA 2R7XA 4XK8C 2PMWA 5KOWA 1IWGA 4IH7A 3R7BB 1X0PA 1ZAWA 2EG1A 2J9DE 2YXLA 4CO5A 4NLDA 1VQKS 3DXSX 4FNHA 2CPEA 5GMKa 2E9RX 4O4GA 3OSPA 2NYHA 2IY5B 3MPDA 3VGSA 1KSPA 2GZOA 2LQBA 2KN4A 5DDQC 5A8WB 1U26A 2QTWA 2DHSA 3UD5A 3LTOA 5AXMA 4DL0C 3D0GE 4EK2A 2ASJA 1WG4A 5K20B 1EKSA 1TUGB 4DN9A 3H5SA 3I87A 5HBMB 2QFIA 4JI3J 4UY8T 4K8RA 2V0NA 1RWUA 1T7PA 3JXOA 4UOGA 3HVTA 3ZZPA 1LXJA 3K17A 4Q2LA 3HHLD 1XBWA 4Q8FA 2MLXA 4LF5J 5K14A 1HQEA 2BE7D 1PJ5A 3ISNC 2R7WA 4NYOA 1QM9A 4OZ5A 2BXJA 1U8SA 4LSNB 3W9HA 3OTDA 1S49A 2L9WA 6FDRA 3OL7A 1GMWA 3OHBA 1YHQS 4USWA 4CLLA 1NDPA 4DSEA 1UTAA 4F0KA 3D3CJ 3TVZA 2FVPA 3R6LB 4NYZA 3CCES 1FXDA 2G9OA 1NJWA 4FPRA 4HL9A 3CO9A 4ENOA 3HVRA 4Y2KA 4ZVOB 4ZMMA 3KG4A 3FC9A 3BYPA 3TQ1A 2J7KA 1WEZA 2PI4A 1SJ1A 3EGVA 2RAQA 4J9MA 4G1QB 2J9EA 4UF4A 3MCNA 1FRJA 3HVWA 5L1KA 4CP5A 2VZ9A 2LQ9A 2HZAA 2F1FA 3KYLA 5CYQA 1X7VA 3AD8C 1RXOB 1TFYA 4CLUA 1BWVA 2AW0A 2B5JA 2R7SA 3P8BB 5E0OA 4WPAA 3KHRA 2XNQA 4QWAA 3OUYA 1V3ZA 3BYRA 3GJTB 2MQPA 4U7UD 1RHMB 3R2DJ 1TAQA 4FS2A 3THPA 3V6DA 1RHJB 1AXQA 3IGVA 1TL3A 3DOMA 2BQUA 1QSSA 1RKIA 1IBLF 5FD1A 4I7FA 4RW9A 2DNKA 2KTQA 1SH3A 3EYZA 2CPYA 2XSJA 4OJ3A 3UNGC 4BBYA 4ZP7A 3BKFA 2GIRA 3NWGA 4YFUA 4PEOA 4LR9A 1CJTB 3KMQA 4E2FB 2DKOB 3E01B 4LUBA 4EBCA 4MKVA 2C2MB 3CEDA 5CAAA 4USTA 3EJMA 2FY1A 1VS3A 4X66J 3QJJA 2JSXA 3HI9A 3ENVA 2BE2A 3GR1A 4A8QA 4ZHRB 2WSEC 1U1KA 3LGNA 1NBEB 4M95A 1NH7A 1N34J 4E8UA 3M2UA 4CNYA 2FHMA 4C8ZA 5IT9Y 5C24B 3ET6B 1HR0J 3PKMA 3OVSA 4RO0A 3OJUA 1RT2A 1R8HA 2ZNZA 2OIHA 2EXUA 4BC9A 1HYSA 3PYGA 4LSLA 3QAEA 1MROB 1YRXA 3OQ2A 2ERRA 3DGPA 4HVZA 1P1TA 4DR5F 2O3DA 1CULB 3IXQA 1FF2A 4YB1P 1S4EA 4ZCLA 4F36A 4UOHA 3MEGB 5HI7A 1W25A 1M5VC 4FBTA 4RNMA 1VMBA 4YN3B 3SZ2A 1FNXH 4DPXA 4JI8J 2R8JA 3NLCA 5EX3A 3M1VA 1WC6A 1MWYA 2GS8A 4ZCMA 3AODA 2FHJD 2D74B 3BBFA 2MDAA 2YKMB 1IWAA 2XULA 2MKCA 4J9OA 1D8ZA 4C48A 2HQCA 2FJXA 3C19A 1CJVA 2A6MA 5HJXA 4C8LA 1G4CA 2RE1A 1S9EA 1R8CA 2IIHA 1TK5A 3GJSB 1JLEA 3TAMA 3MR3A 1XMOJ 3EZUA 1SUQB 4RNHA 1LW2B 5LMUF 5KFSA 3P3DA 4CZCA 1HFEL 2WVCA 3HHLB 3U27A 4F4WA 5B0DA 3OBIA 1LWCB 3MM5B 4FZVA 2JLGA 1PG5B 1T95A 4GVBB 2RS2A 5D8HB 2C28A 4O3QA 2UUTA 3QJPA 4MK7A 2EK1A 1Z2ZA 2QFJA 4DBQA 4DPTA 2RF2A 5KG4A 4EGLA 3LA0A 2ZC4A 3W61A 1RAJA 2MZ1A 3WC2A 3CJRA 1FJGJ 2A6OA 5E2QA 2XZDB 2OTJS 2KFZA 3CJ2A 5CA5A 1LOUA 4C2MA 3DLEA 2ZVSA 3AH6A 2GO8A 2HG4A 2HNZA 5E3AA 4C8MA 1VQYA 3QPIA 3UR0A 4EO8A 4DQRA 2Y8WA 1W7WA 2V69A 2WVBA 4M5GA 3JYTA 1VJWA 5DETA 3TA1A 3QLHB 2E9ZA 3OFHA 1FRKA 1OYDA 1SI9A 1U1RA 2VC1A 2OJ3A 4NRTA 2YWKA 2IRUA 2XTJP 1OQ6A 1SKSA 3IFEA 4DSFA 4GRSA 4ED5A 2FLLA 3VAFA 5K8OA 1T0TV 2J6UA 4KTQA 1UVNA 4NX9A 1T03B 4ZITA 8AT1B 1ZM3A 4F3MA 2MZRA 3NGUA 2XG8A 3J7ZT 3PG9A 3FFIA 1TL5A 2HMIB 4A4JA 2BRKA 1VRQC 5T7LB 1QAYA 4TY9A 3VHQA 4DX5A 1F2GA 1SJQA 4X4OA 2YQ3A 4MK8A 5HP1B 2M0GB 5KFWA 2FY8A 4WXOA 1FDNA 5FDLB 5KAKA 2AKWB 1TP7A 3C15B 3GSIA 4C3KA 4WK3A 1XNRF 3HJVA 3U1MA 2HNDB 2PN6A 2XYHB 2WB4A 3HVAA 1S1TA 2KZZA 4X4TA 4K2JA 4NEYA 5C42A 3KOAA 4IKAA 4NLUA 3RR8A 2CQGA 4DEZA 3N6LA 1HNXJ 4CTAA 2VQFJ 3A12A 2HS4A 2CQIA 3BKTA 2R7UA 3HFKA 1HW8A 1N6QB 1MN7A 4KB7A 1TKDA 1FNMA 3CCWA 2D69A 1WACA 1FCAA 4M63A 2P9CA 2NPIA 4PKDB 5B7WA 2LA6A 4Q45A 2MZQA 3ITHA 4I1TA 3BO4A 2AT1B 3MEEA 2MZTA 2MHEA 3CXCR 1KHVA 1DLOB 2Z30B 1B0TA 3EWGA 4IG0A 1WORA 4ZDNA 3JSMB 3LP0B 4ETZA 1LW0A 3MAAA 3FRYA 5G4DA 4DV2J 2UXBF 4PUOB 4RBUA 1QUPA 3I55S 2CPHA 4DG1A 2E1PA 1HIYA 3CNQP 4HR2A 2C3UA 3HFVA 1R8PA 2ROPA 4QOTA 3W8GA 3U1NA 1Y3KA 2K7KA 1AW0A 2EG2A 4CIOA 4N8OA 4DV3J 3BO3A 3O2IA 1S59A 4DR3F 5DLFA 1VRUB 1RI7A 2HVZA 2MXYA 1HNIB 3R1HA 3CSKA 2WW8A 4OZ3A 3EPGA 1IQTA 1DZ5A 3I6PA 4JI2F 3DNCA 1OQ3A 3W9JA 2E5IA 4IOCQ 1D0EA 5D4LA 2YNHA 3LPEA 3M2RB 1S48A 2MSTA 1PIEA 1XC9A 2QEXS 3B78A 5EX0A 3UNYA 4LFCJ 4OI6A 5AE1A 3C6UB 3UE2A 4DV7F 3ICLA 2UVRA 2E44A 3L7PA 3ZFVA 1RACB 3W2WA 3FK4A 4KJIA 2IVYA 4GO5X 2CZ4A 4RU9A 1GFWB 1HNZJ 4ECVA 2N7CA 3J7YI 3HK2A 1HHTP 4C8KA 4LQ3A 3RBEA 4P52A 2EI5A 2DRBA 3AJDA 4DFPA 5ETOA 3GR0A 3ZTPA 1S9GA 3D6FB 4ZIWA 3QT8A 3MMAB 1WKJA 3DI6B 4JI6F 1S57A 2IM2A 2W8LA 3CC7S 2QYCA 4OHZA 5IM0A 3IG1A 3KLVA 2WSCC 4BDPA 5HROB 1YGYA 4QYZJ 1WDDA 1EJ7L 2XMUA 3G82B 4LQ9A 3W5ZA 2GJ2A 5H9EJ 3GG1A 3NP5A 1DARA 4I0WA 2CG4A 3IP0A 3KLEA 1RE1B 4WP3A 3HMJG 2WTFA 4J9KA 1TKZB 2E1MC 4LFAJ 4MKYA 3GLJA 1DTTB 4H4KC 5HMXA 1RZMA 5CYJA 3M30A 1MN9A 2BRLA 1NAQA 4LBPA 4K0KF 1UKUA 1RAGB 1LV5A 4X64F 1L3VA 4DV6F 4YDDB 5KT4A 2GVZB 2ALYB 4OYPA 3MMBB 1XMQJ 4OHWA 3A8KA 4B3SJ 1TZ0A 3LP2A 1S7IA 1RU2A 4CM2A 1UP1A 4WFZA 2VASA 5EN1A 4F0MA 2W2QP 1RT5A 2MPUA 4Z7CA 1Q86T 2AGOA 2G0CA 5IV4A 2NUHA 2JNJA 3I0RB 1SL0A 4PWUA 4HKQA 2LXUA 3SFGA 5KFJA 5ADZA 4PYDA 2EKNA 4OI3A 3F0NA 2NXNA 5IS2A 1F5AA 1ICEB 2UXCF 2R2SA 3DCAA 2QJ3A 4KAIA 1R43A 4ES2A 3ZXWA 2ZJQQ 2CJ9A 1O5JA 3GTYX 4RKUC 5KFOA 3RW6A 5ETLA 1JK9B 1XK8A 2E1CA 3K8WA 1LFPA 2AU0A 4D3GA 2AJ4A 2I5JB 4NPOA 5GAGU 1GAOA 1U2RA 5KFXA 4J9NA 1GXTA 2APOA 2JFDA 4IDKA 2BJ3A 3M9MB 3QFHA 1H0HB 2ZKTA 4H4MB 1YK9A 2HHHF 3HP6A 3ADAC 2RJZA 5FLXY 4LRCA 6FD1A 3RB6A 5T41A 2HQ3A 1RISA 3DHWC 3J7Z5 4RZRA 3GV5B 1VYAA 3R7NB 2Y8YA 2YKOA 2FVQA 3DN9A 1VC5A 3BGUA 3AHPA 1V3SA 4ELVA 4UQGA 3D3BJ 3CJ8A 4KH0B 1NK0A 1B99A 3FCHA 2ZHAA 2J8SA 3OVAA 3SSQA 4CNZA 5HQ8A 4JI7F 1IJEB 2OEJA 3V81B 1RYRA 3MMCB 4KKOA 2ZBIA 3UD3P 2BJEA 1JWWA 2XM3A 3UQSA 1HD1A 2KT5A 3OR1A 1CJKB 4UOCA 4JI1J 3TZWA 1TKTA 2RQ4A 4RBVA 2Y0SD 3GWCA 1VQ9S 3KLHA 5HK4A 3QATA 1V5IB 4ZVTB 5GAGI 2CJKA 3KUHA 3HM9A 2RS8A 3DKDA 1ZETA 4ZKAA 3H2VE 3PJXA 4QIGA 2NLWA 1AFJA 4OYZA 3SCIE 2W9CB 4CLKA 2RRNA 1N5QA 2A2DA 1RADB 4OZJA 2LYVA 1CS4B 3W62A 4GKJJ 4HDHA 1I1GA 2HK3A 3HHKA 3OXGA 1H7WA 2DGWA 4CH0S 4HHJA 4O3RA 4FKYA 4URGA 3NOGA 3P45B 2XI3A 3GCWP 3G6ES 4EMDA 2DTJA 3T5JA 4P9SA 1RB0A 3N28A 5CD4A 3UDCA 3PW2A 5DG9A 2OTLS 3UN2A 3AT1B 2IM3A 4HTIA 1DAXA 4OHXA 2HIYA 4IO9Q 1B7FA 4Y00A 3H4BA 4CWBA 1X60A 1BWEA 1RWKB 1XR6A 4AQYF 2AGQA 1X4AA 4X4NA 4C11A 4NCBA 4P2MA 2X1AA 1JX4A 3ZZUA 3NGSA 1JLGB 4NLOA 4TN2A 1C4AA 2FJDB 2JWNA 1EP4B 3HHLC 3UW1A 2F4VJ 1J5EJ 2CDQA 2DNQA 4ZJQA 3SCKE 4DR7F 1S4FA 1X4FA 1IM4A 4V1Ak 1R0AB 3LP1A 4OYAA 3MPVA 1WTFA 4J90A 4HT5A 3OSNA 2KKHA 2I8EA 3NY0A 4G1IA 2VG7B 3IGNA 4LF9F 3RGIA 2BJ8A 5IXUA 2UXDJ 1X4HA 2GV1A 2QMWA 5C7PA 1IBKJ 1T11A 2KYZA 4W4MA 3ZTSA 4X2BA 1TQLA 1CG2A 3BPDA 1WHWA 5M2UA 5I3UB 2MZSA 3KK2A 2L3MA 2HGNA 2Z2MA 1N52B 3T5KA 1NJYA 4U7UK 3MOZA 2V2VA 2L9NA 1K44A 3OFGA 1IKWA 1LWFA 4KO0B 1X4EA 4I2PB 3IS9A 1FESA 2OEMA 4HH1A 4IFYA 3G6XA 3SQOP 3CCJS 3TZYA 3SMZA 3NL0A 3FSYA 1Q8BA 3FBBA 4PCQA 3JSYA 1NJIT 4X4SA 3AY0A 4FYVB 4PQUB 4DV4J 4JV5J 3D6TB 4DF8A 3B6BA 1FDAA 2C3PA 4RW4B 4TLQA 2XSFA 1HBNB 2XBPA 3M6WA 1D09B 2VPWB 5EDWA 1WC0A 4ZVQB 2K06A 4F7VA 2JL9A 2NZCA 4KR0B 3PX6A 4PWDB 1YKWA 1GEHA 3BV8A 3T1HF 1FRMA 1U09A 1ZZNA 2HURA 3Q8RB 2Y0BB 2YQ0A 2D7SA 4I4BA 1SV5A 2YKNB 2GFFA 3MURP 1MWZA 2ZUAA 3HO1A 4JI5F 3AXMA 1BE4A 2QL5B 3J81U 2AJ2A 3I4PA 3NMAA 4CLPA 2XQCA 3BGFA 1UFWA 2JLFA 3NGDA 5J1EA 4B9UA 5L9NA 1T05B 4J5OA 2DGQA 1JNZB 2JHEA 3N6NA 2DIUA 3BGRB 2B8QA 2R2RA 1RJJA 1S1XB 2QLBB 2R8HA 2M9KA 1N5SA 4FDFA 3G9CA 2GAHC 5IZHA 3C6TA 4C6AA 2E7XA 3I5AA 4DZ6A 3UD4P 2ZOGA 1NNDA 3T1YF 1NK9A 1R31A 2MQQA 2ADCA 4UUXA 1U1OA 4OJ1A 4NLPA 4ZA1A 2XLJA 3LWLA 3RAXA 4MJKA 1WSVA 5A8WA 3BZQA 3R1LA 3BR8A 1P27B 3R5AA 1S97A 2BEFA 2ILZA 4NWBA 3M8QB 2HFSA 1Q79A 1SJRA 2XY5A 3D54A 3GV8B 1T02A 1HBMA 5HBMA 1UEVA 4DQPA 1M0SA 2WVDA 2UVVA 4OZ2A 1YI2S 1YDLA 2FLNA 3Q2TC 1HBOA 4XTTA 3HCXA 1SXLA 3MTKA 4NL5A 4LRBA 5F8JA 3I0SB 3CWJA 4IQMA 2FPHX 3FSIA 2DITA 4YY3J 1VIXA 3A1YG 4P2FA 4LSNA 1EIYB 1NM2A 3W5XA 2AEJA 3DLJA 3MWBA 3QSYB 2R7VA 1CC7A 2FZGB 2OPPB 4G65A 4LIWA 3C8YA 1QSYA 3K5PA 2DGOA 4RL1A 2NSBA 5F8LA 2ZE2B 3QBCA 4QWCA 2FGCA 2UUWA 2UUBJ 2QSWA 1RP5A 5C25B 4LF4J 1IXKA 3TYTA 1YJ9S 3K58A 1PSDA 4JV0A 1VQLS 1N48A 2W8KA 2YNGB 2BYCA 5GMDA 1OWXA 4WU3A 4G1QA 3ZZRA 3H4DA 1R6YA 3AA8A 4DCOB 3UVJB 2AZ1A 3BSCA 1XN9A 3QGPA 3Q24A 1HHQA 5DM6Q 1OPIA 1UAWA 1HW9A 1PBUA 5E3QA 5DG8A 3O5TB 4OZ1A 3QIDA 1XR7A 3J7A1 1HHSA 1PYOB 1VDHA 1D3WA 4TVAB 3CCVS 2CZ9A 1X5OA 2F65A 2GC8A 4Y2MA 1M5KC 2GQCA 4RBTA 4W90B 3GILA 2P6SA 2H1YA 4WYWA 2F63A 2VPXB 4N41A 3CD0A 3M32B 1KNZA 4UZCA 3CJSA 3R5CA 1X5SA 1PCAA 3KK3A 2IVFB 1YBUA 4NA2A 4KFBB 4J9UE 3IAS9 1VQNS 3M05A 5IWAF 2GMJA 2BJ9A 4CH1A 2ACYA 2LCWA 1LQ9A 3T5LA 4NI2B 3C14B 4GKKJ 1KTQA 2ZBQA 2ZNYA 2B4OA 2DGSA 3NWRA 2B9YA 4LF7J 5HMZA 4EWTA 5KFZA 3E01A 2MQNA 3KNAA 3DLKB 3RUBL 2HIQA 4Y2CA 2YNIA 3MM7B 1OY6A 1RA7A 4QQBA 5AJ3J 3M8SA 5KFAA 2NSCA 4CLTA 3JAMY 4I69A 1IBMF 4F04B 5F8GA 4PPDA 2CADA 3TEGA 5D4NA 1JLFB 2VG6B 2X1GA 3R2CJ 4A46A 4CYUA 3AQPA 4ZHRA 1N33J 4ZOSA 2B9WA 3SIPB 5FJ4A 2P8IA 3MM6A 2PA8D 3ET6A 3WDOA 4NXMF 4LRDA 4EI2A 2VA2A 4V19X 1U6ZA 4N56A 5IT9U 4O44A 1Q5VA 4PQAA 2LA4A 5K9FA 2MGZB 1GK8A 1SL2A 4B9NA 4QIFA 1CULA 1KVKA 3IA0A 2ZITA 3FGVA 4RNFA 4DUYJ 1N0UA 1HBUB 2MJUA 4YR0A 3BPSP 3KUGA 2QA4G 5KFYA 2I9SA 4ZP9A 1F3FA 2VL1A 3M6UA 4FP9A 3CC2S 1Y5LB 5DDPC 5A6WA 4ZVGA 4DR6J 3NS5A 4WWSA 2J9CA 3Q83A 2UZAA 2IJFA 3ZO7A 2WOMB 5DJBA 2YKMA 2KJWA 1YJ7A 4MKBA 4JOUA 3CDAA 3HX9A 1Y7PA 5BR8F 2FDNA 3SI8A 2X1BA 5KFMA 4ATNA 2F8HA 4KC5A 1SUQA 1TK8A 1LW2A 4L75A 2LXIA 2VICA 2DNHA 4Q2MA 1RUSA 2K1RB 4K4VA 3HHLA 2H4YB 1FKOB 4Q5VA 3MM5A 2BACA 4CO3A 2V68A 1BHNA 2DH9A 4GVBA 4LF1A 3OJSA 2FZKB 4KGMA 1DFDA 3B82A 2AQ4A 4IYQA 2N3OA 4JI3F 3MAHA 4U6PA 3PTWA 1WF2A 4NZ7A 1U2CA 3OR2B 2AWZA 1OSCA 4JYAJ 3TX0A 2M5YA 4C8NA 2PEBA 1GNKA 2LFVA 1HMVB 1WHYA 1C1CB 5F3TA 5J2PB 4F02A 5RUBA 3AB2B 1RLCL 2IJNA 2IVMA 2BDPA 4B3TF 1L3SA 3V6JA 3I56S 2QYGA 2RB7A 4LFBJ 2XMMA 2Z4PA 4WFYA 2EFPA 1WUUA 4DUZJ 1P6TA 2QX0A 2HHWA 4ZPAA 3IR6B 3HT3A 1X0FA 5B0AA 4ED0A 2DPJA 3KKFA 3PIOQ 3NCQA 3POTB 2P5VA 2RKIB 3P96A 1T3NA 1C1BA 3GSDA 3R9LA 4DFKA 3DM2A 1DURA 5HATA 1NDLA 2HMIA 1R7IA 1S5ZA 3Q8VA 4FF1A 5E41A 4F67A 3D1OA 1PGZA 5T7LA 5SZTA 3SCJE 1N88A 2HRTA 2VONA 3PR4A 1F9HA 5A0YB 1BMQB 1N0VC 5FDLA 2OPRB 3DDKA 1JLQB 3KHLA 4OX8A 1N5YB 3NCRA 3C15A 1WDTA 1U0HB 3KG0A 4AL5A 3MD1A 4C97A 2HNDA 4B9SA 2ZHBA 2MKKA 4ANEA 3MUVP 1C0TB 1FRIA 1BGXT 3CVKA 2CQPA 1JXEA 5D0GA 4CRJA 1N6QA 1H3DA 1OPZA 1Q5YA 3RRKA 4M5DB 2Z2LA 2JVOA 4IO1A 2ZH6A 2ZUGA 1R0BG 4PRFA 2DNMA 2XNRA 1MSWD 5ETMA 2MJNA 2YY3A 2QE5A 4QPXA 4FXDA 1BUXA 2PMZD 1U4BA 4B3MF 4ZLLA 1VFJA 1RT1B 3UCGA 2WZ1A 1S1UB 2D41A 4YQWA 2XO7A 3SQGB 2IDLA 1EQMA 2G0IA 3FEYB 1F60B 1JLBB 1DLOA 3BBBA 5GAHU 1JLAA 2V5HG 3LH2S 4DV0J 1TAUA 5HMWA 3JSMA 1REGX 3LP0A 2AYMA 1JLCB 1GXUA 4DS4A 3CB4A 3LQVA 2J8AA 4X66F 1O6XA 4PUOA 4KGVB 3HSGA 3P4UB 5L1IA 2XCPA 1GMWD 3QO9A 2HHXA 1UA0A 3GJRB 2RU3A 2VBZA 3A3OB 3HSJA 1N34F 2BMBA 1TTHB 2MY8A 2FB0A 1HR0F 2IM0A 2LP4A 1WOPA 4OX9J 1VRUA 2AYGA 2DXEA 1QTMA 1F0XA 1RDRA 1RTHA 4FF2A 4WFAQ 2XMKA 4LR7A 5EGYA 1KONA 4ID5B 1XNQF 1SVDA 4G1PA 1H2VZ 4DR4F 5KG7A 2F8EX 5EUHA 2C2OB 3M2RA 3PW4A 3PJWA 4F26A 3VAKA 2LEPA 2DR5A 2N82B 2BM1A 4DL6A 3ZZTA 2ACMA 3C6UA 4DI6A 2JEIA 4E0DA 1S0MA 1UWBB 3Q0AA 2I2YA 1SC6A 5GAHI 4JI8F 1UVJA 3W9IA 2PA3A 1IBLJ 3BSOA 1T9VA 2V2ZA 1T3OA 4UZBA 4RR5A 3T3FA 3V5RA 1X4CA 4M1KA 3VQSA 2BKOA 3BREA 3QIPB 3QQCD 1SH2A 4PG7A 5J1NA 4AYBD 2K3KA 3GU0A 2R2UA 1XMOF 3AFGA 1C0UB 2OH2A 4Q0BB 3Q22A 4J7CA 1K73T 2KDOA 4USHA 3G82A 2F5GA 2JEFA 3NKYA 2CXEA 2HRUA 5F9NA 3O8WA 2C3OA 5IFMA 3H5YA 2E5LF 4NLYA 1TKZA 5DM7Q 1NSAA 3U02A 2YWFA 4HACB 5HN0A 4URSA 2HQDA 1U0SA 3M4XA 3THTA 4ZCKA 2BM0A 2E5GA 2JEJA 2NPFA 2RRBA 3GP9A 3MCMA 2MQOA 1FJGF 1DQAA 1RHUB 1HL6A 3MMBA 3DMJB 2D3O1 3KWMA 2CJAA 5M2PA 3NCPA 2VBWA 2GCFA 1VQ5S 3CO0P 5JJBA 1K1SA 4DR5J 3WIVA 4XDDA 1IKYB 3P49B 3KUEA 1WG5A 1NSPA 3BF4A 4O23A 4P7TA 1UFKA 1YJNS 1G7CB 1KEKA 1U8WA 2DGXA 2NR0A 4TQRA 2ATLA 2CUYA 2YKPA 2XWYA 2PGCA 3Q86A 4RX6A 1Q8LA 1X9WA 2VB6A 3PZPA 1T9TA 3IM8A 1YJVA 5KFKA 1TK0A 2CQHA 4A8KA 3D28A 1F1BB 3DLGB 1U48A 3NEKA 4EZ6A 2Y1JA 2WB1D 3UFCX 2YWHA 1RTDB 3N0VA 2I5JA 5E3CA 2V63A 1GX6A 4O4RA 3E3XA 3FEXB 3N4WA 2CG8A 3IWXA 4O4GB 4H4OB 4LJMA 2HHPA 4S0MA 5L46A 1CEZA 5D15A 2UU9J 5J2NB 3TWZA 2X1FA 4H54A 2DHXA 4X4RA 2AEFA 4MKAA 4OYWA 5LMUJ 4H4MA 2HVDA 1TV6B 3Q8UA 2CPFA 1S6PB 3VVUA 2OFHX 4DHVA 2O01C 1F3VA 1YBTA 3QT6A 1Y9OA 4ZPBA 2VD3A 1J5OB 1QD1A 5FLXU 2V2QA 2VFUA 1JMTA 2VQFF 5J2MB 4M5NA 2J6SA 3UCZP 4Q44A 1FE0A 3QGHA 2YH0A 2GHPA 2MKIA 4AL6A 1RWWB 4MH8A 3R8YA 4FF4A 3HVTB 1X31C 2Y9HA 4ZLPA 3AJ1A 5K14B 1CJKA 2FJEB 1UZDA 3W5YA 2ZZNA 5LSOA 3OT9A 3CJ3A 5BXIA 1GMVA 4IR1A 1RTJA 3L7UA 4RW7B 2IPOB 2VKZG 3CD6S 4OMFG 3H20A 3K0JA 2W9CA 2CNOB 1CS4A 1HARA 1TR0A 1WC1A 2Y1IA 4WCEQ 3NGKA 4DV2F 1N36F 1D9FA 3MM8B 1WHVA 1IUJA 3K7RA 2DVIA 1KWMA 2M88A 4DV3F 1G2EA 1SPBP 3LUYA 1IKXB 1ZBTA 4DR2J 1UMJA 5CYMA 2JOQA 2OSQA 2D9PA 1NO8A 1ZS6A 1K8AT 4CH7A 5B0EA 4A8YA 2XYGB 1C2PA 1RBOB 2WRMA 1XNRJ 2NUUG 1KQKA 4GC7A 5ETVA 2JZ5A 3MR2A 4MYUA 2X7IA 3OUYB 5G0RB 4OHYA 2QL9B 2BKPA 1EP4A 1VC6A 1PKUA 4ZLNA 1EETA 2H5JB 4WBFA 4LSZB 2VH7A 3TP2A 1YJUA 2WVEA 2E1RA 4LF2A 1EHWA 1NB2A 1BD6A 2DYAA 2B9XA 1CPZA 4QBUA 1U2FA 1VGYA 4RU2A 4NXNF 4M94A 2VG7A 3R7SB 5JVGQ 3N5FA 3M8ZA 1QJHA 1Y00A 2FHKA 4C0BA 4WU2A 4X62J 1OJ4A 4FKXA 4UUWA 2E5HA 2H5EA 3D9BA 3EGWB 4D3HA 1H2UX 2RQKA 1S6OA 3HF5A 2Z56B 9ATCB 4FVCA 2LXFA 1H98A 2GIFA 4KO0A 4B9VA 1Q0NA 4TYAA 4I2PA 3W66A 2UXBJ 1QTNB 3D0IE 2AX0A 4ED1A 3FKBA 2ROGA 3KLGA 3UN3A 4ZN1A 3SCLE 1ULRA 4NYPA 1VQPS 1JJ4A 4R0EA 4LFAF 3BB5A 4ZVFA 2OD4A 2AP6A 4PQUA 4JP8A 3PY8A 3M2UB 2MLZA 1L3TA 3I5CA 4X65J 4X4VA 4RW4A 4AE5A 1AFIA 3F41A 4AFFA 1HBNA 2CQBA 5F8MA 1XMQF 1EAYC 4PG6A 1S1VA 2J5AA 2RSQA 1LWEB 3DGPB 3CW2C 4QWBA 3KK1B 2AYBA 3PW7A 5B0BA 5KTQA 4CLSA 4K50A 2DO4A 2HBQB 3GIKA 4DCJB 2UVUA 2ZEJA 4IRCA 5LXYA 4DV7J 2KXNB 1O51A 3NMRA 2VC0A 4Y65A 2MKYA 1QVFR 1WI6A 5EWFA 1NJZA 1IVZA 1L3KA 1NKBA 4CLYA 1NKCA 5DZ7A 3Q2SC 3BGRA 4ERDA 3OD2A 1N56A 4WZQA 1YQHA 1NRKA 1K0TA 4KPYA 4DWIA 2AF6A 5B0GA 1CJVB 3VF0B 4EBEA 3PFOA 1GT8A 2R42A 2HEKA 2F9DA 3TUZC 1VK8A 1S9EB 1QAIA 2E7VA 3JTOA 2VDHA 2F8MA 3CJKB 2YX1A 4B9MA 2OEKA 2KT2A 4OQJA 1JLEB 3TAMB 5LMNF 2LLZA 3W1YC 1M90T 4K7QA 3R27A 3IR5B 4FPIA 4XO0A 2Z57B 2ZWOA 5D0RA 4WTOB 2A10A 4Y0FA 2D3UA 2UUCF 2KB2A 1CQMA 3Q8YA 4A8WA 1F9FA 4ED7A 2XCAA 5KFTA 1Q78A 1WKKA 3O6QA 2ASLA 4QR0A 1YZ6A 1KBRA 4L73A 1QE1A 3KFWX 2WVFA 2KM8B 1WC4A 3K89A 4ED3A 1AZSB 4F4XA 2H65B 2CNLB 1CJUA 4K0KJ 1S72S 3K8VA 2ZVIA 4DPUA 3KHHA 3H59A 4BWMA 2GMHA 2EFNA 5HLFB 4NMXA 1JXLA 2HZVA 4L74A 2D3ZA 2HNZB 1SCJB 3JQMA 3CE8A 4RUAA 2HFOA 5L38A 2NS1B 2OPPA 4JI4J 3V4MA 2H54B 2G13A 3L09A 2JEGA 3TEHB 3V6KA 4DV5J 4ZJLA 3VV2B 1PAEX 2FC8A 5K5MA 2ZE2A 4CQ1A 1Q81T 1JIHA 1OYEA 3BSNA 2DNRA 4Y2AA 3LWMA 2J0XA 2UXCJ 1PC5A 1FRXA 1WJ9A 1WG1A 3V4IA 1U02A 2M52A 3FRZA 5C25A 2ATCB 1FVSA 4DL3A 4NZ0A 2CRLA 1WKLA 2KRRA 1VBZA 1DBDA 1CLFA 2V8DA 2C2NA 1R6VA 1UEUA 3PNIA 4MAKA 1HLWA 1TVRB 4KY3A 4A8FA 4OL8A 2RT3A 4OYMA 3DU5A 1SQFA 1JJ2R 2HGLA 4KGKA 3UVJA 2VODA 2KT3A 2HHHJ 1HQUA 4AT1B 1VJQA 3B8HA 1P9QC 2HQGA 2Z2YB 2VDIA 4HI1A 1FI4A 2CQ2A 1SH0A 2BANB 2F4VF 1RT7B 1J5EF 4NLRA 5JVHQ 1MMLA 1S0NA 2HLUA 4FXVA 3KLIB 1TU0B 4LR8A 3M32A 4RPFA 4DLGA 1M5PC 1X9MA 1EARA 2HVEA 2L48A 3FQKA 2POKA 3MOJB 4KFBA 1U1PA 2P9GA 3NNCA 4IQXA 4F4KA 1SQEA 1S7HA 3RRHA 4CCHA 1RWMB 3IRXA 1IBKF 5L1LA 1TMJA 4NI2A 3C14A 1BY9A 4OFZA 4M8LA 1VQSA 1HNWJ 3VALA 1QAJA 1HWKA 5I42B 3CJTA 2FJBB 2YKAA 3DLKA 4RNNA 4IG0B 1HI0P 4KYZA 4ECUA 3MM7A 4MT1A 2D9OA 2E5JA 3MAAB 4LVNP 1AUSL 2Y3YA 2AZ3A 3ZTOA 3ZTQA 3V6HA 3VQTA 2VFSA 3MEDA 1YIJS 4G6VB 1JLFA 2ZDOA 4QW8A 5DDRC 5H9FK 3JAMU 4HEA9 3CULA 1DY3A 2MMYA 4OJHA 1WEYA 5F41A 3CCQS 3BM7A 1A0OB 4A8OA 3BQ2A 2HW3A 2M2BA 2O66A 3DYAB 1URNA 3L95X 2HHTA 3JS9A 5EWEA 2XS7A 2B0GA 3IMQJ 2N4DA 2RQCA 1FXLA 4GO7X 1Q53A 4YB6A 1FEHA 4AQYJ 3I31A 4NASA 4QR2A 3HHEA 2RDIA 2F3JA 2LU2A 2HBRB 3ZZ0A 4B08A 2ZM6F 3CUNA 1I94J 1RAHB 2MQ8A 1SBRA 2HKEA 2R3VA 3BDPA 3RU0A 4NLXA 3IRWP 4K4UA 4NE9C 4ZVSB 1H72C 1S79A 2WOMA 1UEKA 2AJQA 4C98A 1NUEA 3GG0A 4LF9J 4C3MA 4B3RF 3DU6A 4R8UB 2ZD1B 3DOLA 3UDVA 2JC1A 3MR6A 1VQ6S 2GGPA 1S9GB 3MCSA 4MMOA 3RB4A 2H5IB 4LIRA 5EHHA 3E8OA 2QL7B 1TMMA 5IM0B 3IG1B 2DGTA 3WZ0A 2XMTA 1X5TA 2K1RA 4A8XA 3MEKA 1LNQA 1FKOA 2FZCB 3RR7A 1Z2LA 1NCLA 3HD2A 3QZ8A 1IM6A 3TVYA 1LEOA 2DHAA 1SJ4P 1RT6A 2CAJA 2GQQA 1OSDA 4NOHA 1ZH5A 3GIRA 3A13A 2KI2A 4DQIA 1K0VA 2XMWA 2DPIA 2AX1A 3TAPA 1N32F 3OR2A 3LAKA 5L1JA 4WIQA 4CO1A 1WNEA 2VQEJ 2V8VA 4DLEA 4K2XA 4DCPB 3LP2B 2Q43A 5IT4A 2LEBA 1KHWA 2DEIA 4QW9A 4I56A 1HMVA 4DPYA 3W2VB 3MPWA 4TQSA 2VIHA 5J2PA 3KDNA 3DLLQ 3IWNC 1A6LA 4DPOA 1FK9B 2ZDPA 4JI5J 1PO6A 2IA0A 1FWPA 3D4JA 3T41A 5M2RA 1T9WA 4ED4A 4ED6A 4K5RA 2UUBF 4YDXA 2ZH1A 1KTVA 1ZYQA 3TW0A 1ZM9A 3AAWB 1L3UA 3M6VA 2CIMA 4RWXA 3N5BA 3POTA 2DR6A 2IYGA 2RKIA 1QVGR 3C46A 3HSZA 2B3TB 4EYIB 3CJ0A 2CPZA 3T1YJ 1HNVB 4U95A 3QWUA 2Q79A 2G1HA 2OPRA 4PPZA 4ID8A 2PIIA 1REVA 4USJC 1B7YB 2U1AA 3TUJC 2R2TA 2MKHA 2IRXA 2HLTA 2RHQB 3CDBA 3CCZA 2DNZA 2FGOA 2WBRA 1RBLA 4YB5A 1NLKL 4I6WA 3J7AN 2DHHA 4TKTA 2OELA 1SIWB 4M5DA 4KKOB 1FXRA 3ONQA 3BR9A 5KFDA 1Q7LB 1U6BA 2J0SD 2DT9A 4I67A 3KLHB 2DR8A 1OS5A 4BC7A 3SYZA 1S1UA 1M5HA 2RQMA 3SSRA 2VA3A 2YKQA 4LF7F 3SQGA 2FJAB 3BSAA 4CLWA 1JLBA 1S12A 4G3IA 3VGVA 4B9LA 2IJRA 1JJHA 5A8KB 2NCKL 2IAJB 2DNYA 4L76A 2VUGA 5IT0A 4ER8A 4DR1F 3BEGB 4Y28C 4KT0C 2EFGA 1XQIA 3IBWA 4OV1A 2EPIA 2DNNA 1S1WB 1Y5NB 2DRAA 2A1BA 1UJ6A 3C16B 5A6PA 1W2BR 3O3LA 1VBYA 1KR4A 4FYYB 4QWDA 1T9UA 1M1GA 5KFRA 3RYLA 3M8WA 2YVSA 1Z4UA 1Q8IA 4ID5A 4PG5A 4U8YA 4ZVEA 5D77A 2EFQA 2FQQB 5ETQA 3CCMS 3DRPA 2QG9B 4OLOA 1ZAVA 1RHKB 2V9WA 5A2QY 1UWBA 3EMTA 4WFNQ 4OLPA 1FTRA 1HD0A 5IC4B 4LF6F 2UV8G 2KU7A 5ETPA 4ZIVA 4CT8A 2G1DA 1TELA 5IWAJ 2GIQA 4L3KA 4Z37A 4KQZA 1NMEB 4Y6IA 1FT8A 1RT3B 4YHHF 3TANA 2C2RA 2KM8C 5B08A 4FS1A 3DLBA 4U9RA 5IQQA 3PIPQ 4IG3B 2BKNA 2OO4A 2ILYA 3QIPA 2WHOA 3H5UA 2RNEA 4RUBA 3W60A 3UCUP 2VBXA 4LF8F 1KN6A 2UV8A 3T19A 2IMOA 1UW4A 4ECZA 2L9DA 2FUG9 1C0UA 2DBBA 1Q82T 1FO1A 4FYWB 4LREA 3MUTP 3L7OA 3EDQB 3RTVA 1IBMJ 5CD4H 3PFEA 2RVJA 4R5PB 4AL7A 1NK7A 1AYEA 1Y0HA 4LVOP 2YX7A 1HWLA 1JJCB 4HACA 1XIQA 4MK9A 2BQRA 2HBZB 2KFNA 4R0JA 3OTOJ 2YQ1A 3RJMB 4QPTA 2CQ1A 4R25A 4USUA 2B4UA 5KFGA 4F4ZA 2WCXA 3EXYA 1FWKA 3HPOA 1HWIA 1RWNB 4KIAA 2L41A 4NMLA 2GVDA 4K4ZA 4YMEA 4KH1B 3CT9A 1MG7A 2XHCA 2HHSA 3GFHA 1BQMB 3PHTA 3K59A 4GC6A 3PEJA 2KG1A 4WP9A 3UN5A 1IKYA 1Q8KA 4GMKA 4IUFA 1OMSA 1EX8A 1EQ0A 5D0EA 3DGVA 4DQSA 3VCDA 5KFUA 2EW9A 2F40A 3JQJA 3S1TA 3LPYA 2OPQA 1B0VA 3TA0A 3QSIA 2P9EA 4ZP6A 3BGLA 2M70A 3LGHA 5E7OB 2OP5A 3OV7A 3DLGA 3LALA 3OLAA 1H74A 1KOHA 3C6TB 1RTDA 3CMAS 5J2QB 4M5MA 1FJ7A 1JXVA 1H38A 2BE9B 2W9AA 2FIUA 1ZA2B 5BR8J 2UVWA 4XIUA 2HFNA 3D1QA 2UP1A 4H4OA 5D78A 2ASDA 5J2NA 1WOSA 1UVLA 1NK5A 3DOKA 2X3GA 1JB0C 1RCXB 1IR1A 1TV6A 3PYDA 5DDOC 1S6PA 3NS7B 4I68A 2VHGA 2LECA 4FYDA 1J5OA 2M8HA 1VBKA 2G0JA 2VFVA 2FTRA 2EFVA 1HBMB 1FEEA 2NZ4A 4KV8A 5J2MA 2KVQE 4M5IA 1VISA 2VU5A 1HBOB 3ZZYA 5KFCA 4OYOA 1DQ8A 4KRWA 1SC1B 2GQ2A 3H42A 1VHFA 2FJWA 4WJBA 4B3OB 4I2QA 3KXDA 2IBKA 3PRDA 5I3QA 1MNEA 3UPFA 3L3CA 5D0HA 1VQMS 1YG0A 2W2PP 4A8MP 3PKYA 4PXDA 1D8YA 1Y5IB 3M8PB 2CPJA 4RW7A 4B3TJ 4J9QA 5CH7B 1FERA 4DV0F 1B4SA 1ACMB 4ICLA 1NB7A 2O5DA 5KT2A 4HHUA 2DH7A 2VV5A 4RJVA 3ZC4A 1TL4A 3PACA 4ANCA 2YNFB 3KJVB 3G6VA 5AXKA 4C3LA 3PRVA 3MM8A 2OKQA 2W4DA 2ZBCA 2QSFA 3M2VB 4BCAA 1DJ0A 2FVRA 3MPYA 2V4JB 1UJ4A 4ZPDA 3CMES 2D1CA 2VOPA 4OX9F 1ZTWA 3MM9B 1IKXA 3NXZA 3MECB 2BW7A 3UR3C 4BS2A 3CIZA 4DQQA 3TI0A 4F8RA 1O0PA 4WE1B 4RNOA 3CPWR 2V94A 3KNGA 3PV8A 2J0WA 3K2YA 3S7RA 3SV4A 2UUAJ 2H9ZA 2KYXA 3GCXP 5G0RA 4WK1A 4NLVA 1UCNA 4JUZA 3D0HE 3O1LA 5LL6d 1Q16B 3KK3B 1YRTA 3HFZB 2MHNA 4O0IA 1HA1A 3PO4A 2Q6BA 4WFBQ 4WIIA 2WONA 4B3MJ 2DY9A 1WELA 1VRTA 2JVRA 2K8GA 3AQOA 4DU7A 4NA3A 1UJ5A 3QGIA 4TLRA 2DD8S 4JV2A 1MMDA 2ADBA 3AOBA 2YNIB 4QCLA 4MYTA 1WC3A 1PJ6A 4ECWA 5L39A 2CZVC 3ENWA 2N3LA 2VJUA 2DCLA 1ZM4A 3TZZA 1ZM2A 3WHIA 4PZVA 1GQEA 3KLFA 1CC8A 2ABYA 4CYUB 2ZH8A 2IDEA 4M5HA 5CZXA 4PYAA 2XZTB 4Y34A 1Q4RA 4HT7A 3CDEA 2EKYA 1SB6A 1U25A 4P74A 4E98A 2AV5A 4PR6A 1SKWA 4KBIA 3MM6B 1IN0A 4BLGA 3K57A 2B43A 2FVSA 4PG4A 4NZ6A 2DK2A 4OYIA 3E2EA 4O44B 1XNQJ 3GZ7A 2BABA 1H73A 1O8BA 3CF5Q 1LWEA 4DR4J 4OV6A 2QLXA 1AB8A 3ZZZA 3FBFA 3KK1A 2BQ3A 2U2FA 1UPMB 5GADU 1J27A 4DFJA 4UT4A 4JI0J 1LK7A 3T9NA 3EICA 4B17A 3U7JA 1PBAA 3RW7A 1YJRA 5GAEU 2XB2D 4ED2A 3QMQA 4DF4A 3BS9A 2B56A 3GIJA 3UDLA 1E6YB 3GV7B 1NK6A 5IC6B 2RUGA 1TUWA 1EKRA 3QYYA 1R8AA 4Z7YA 3VZIA 1CSJA 4WFXA 3KJNB 3CJKA 2HQFA 8ATCB
chains in the Genus database with same CATH topology
2UU9F 3OTCA 2XY7A 3MUMP 2DHGA 2JZ5A 2ZJQQ 3MR2A 4MYUA 3OUYB 2IA6A 3CD7A 2CJ9A 1O5JA 2XMJA 3H2UB 5G0RB 3D2WA 4OHYA 4RKUC 2BW2A 1F5CA 4RLEA 2HWIA 1EP4A 5KFOA 1VC6A 4O3SA 1X4GA 3RW6A 4RW6B 2HGMA 1JK9B 1XK8A 2E1CA 3K8WA 1LFPA 2GA7A 2WAQD 1EETA 1G3OA 2FC9A 2AU0A 4D3GA 1ZTTA 3MTJA 4I64A 1UETA 2AJ4A 5KFPA 2I5JB 4FF3A 4ECYA 3MDFA 4F2SA 4ILLA 2VH7A 3TP2A 4NPOA 5GAGU 1ZPVA 2WK4A 1U6FA 1GAOA 1YJUA 1T94A 4XPEA 1B0PA 4UQTA 3US5A 2E1RA 1U2RA 2YNHB 5KFXA 4J9NA 1GXTA 3OTBA 2DGUA 2APOA 1BD6A 2JFDA 2V8HA 4IDKA 2KRBA 2B9XA 3M9MB 2MGZA 1H0HB 1CPZA 2M4MA 4QBUA 3B4MA 1FDDA 4H4KA 5GADI 4NCAA 2ZKTA 1U2FA 1VGYA 3NAHA 2R7RA 4RU2A 4NXNF 4M94A 4XAKA 3MFHA 2VG7A 5J1PA 1HBUA 1WF1A 3T6BA 4H4MB 4PXEA 2HHHF 2CQDA 3HP6A 5JVGQ 3FZBA 3N5FA 4QU7A 3VR1A 3NRBA 4AXIA 1QJHA 2RJZA 1Y00A 3JSBA 2FJVA 3T5HA 2FHKA 5FLXY 2CKWA 6FD1A 1DTQB 4C0BA 2DR9A 4ZS6A 1V9OA 4WU2A 3W2WB 1MU2A 5GAEI 1X9SA 3RB6A 5T41A 2DNGA 2HQ3A 3S6EA 1RISA 3DHWC 3J7Z5 4UUWA 3IAM9 4RZRA 3GV5B 2E5HA 2H5EA 2LMIA 2YKOA 3O44A 2FVQA 1N5TA 3EGWB 4D3HA 3V2UC 1H2UX 2RQKA 1S6OA 3DN9A 3PM9A 1IKVB 1VC5A 3HF5A 3BGUA 3AHPA 1V3SA 5HLFA 4ELVA 4UQGA 1YJWS 4C7QA 3B4DA 3PDNA 4FVCA 2MQMA 1VQ4S 3T6JA 2LXFA 4UY85 1YRUA 4ETXA 3FCHA 1JKHB 2I0XA 1NK0A 1H98A 2ZHAA 2V9KA 4KO0A 5KT7A 4B9VA 3OVAA 1MMNA 2KO1A 4TYAA 3SSQA 4CNZA 4I2PA 5F9LA 5HQ8A 2KXHA 3Q8QB 2O1PA 3D0IE 4JI7F 2BBEA 1FD8A 2AX0A 1RT4B 4ED1A 1IJEB 4K4SA 3SFUA 3M6XA 3V81B 2ROGA 4Q7AA 1S6QA 1RYRA 3KLGA 1NKEA 3HJFA 3MMCB 4IFVB 2ZBIA 4KKOA 2GJIA 1KOOA 4TY8A 3SCLE 3UD3P 1UA1A 2JDJA 1ULRA 1X5PA 2BJEA 4QIVA 4NYPA 1VQPS 1JWWA 1JJ4A 4R0EA 4LFAF 2DR8A 3UQSA 1HD1A 3BB5A 4ZVFA 3UWTA 3NNHA 3BJYA 2KT5A 3OR1A 4O3NA 4UOCA 2OD4A 2AP6A 1RTIA 2QIFA 4WTYA 4PQUA 1SL1A 3P5TL 1TKTA 2RQ4A 4RBVA 3BQ1A 3PY8A 3G4SS 2Y0SD 3JTPA 3M2UB 3G71S 3GWCA 4B02A 1VQ9S 3KLHA 1L3TA 3I5CA 4X4VA 1GTEA 3DRPB 2JH3A 4K59A 4KHRA 4RW4A 2KJVA 4AE5A 3T1AA 4JI0F 1AFIA 3G96A 2ZJRQ 3F41A 5GAGI 2CJKA 3RRGA 2XHWA 4AFFA 1JNRB 1HBNA 1VI7A 3TX8A 3HM9A 2JFKA 2RS8A 3CD5A 1ZETA 2CQBA 3QGGA 4ZKAA 2ZH2A 3H2VE 3PJXA 4QIGA 5F8MA 3KLEB 2NLWA 1AFJA 3H5XA 5BYRA 1XMQF 4PG6A 1S1VA 1C1BB 3SCIE 2W9CB 3CDUA 3VAJA 2RRNA 2OAUA 1N5QA 5AXNA 1LXNA 2NREA 2A2DA 2J5AA 4OZJA 2RSQA 4YP3A 1LWEB 3DM2B 1BQNB 1KLMA 2LYVA 5D4PA 4QWBA 5KG2A 1TVRA 4HDHA 1I1GA 2HHUA 4RUHA 1XWLA 5KFEA 1FKPA 3KK1B 2AYBA 4DR2F 3HHKA 2DJWA 3X3UA 3M30B 3OXGA 1H7WA 2DGWA 3OHAA 5B0BA 5L8RC 4K4XA 3PW7A 5KTQA 2ASYA 4CH0S 4HYKA 4HHJA 5KT3A 5KG5A 4K50A 4YB7A 1M1KT 2DO4A 3GIKA 2SXLA 4YR2A 1KFSA 2UVUA 2N7YA 4ELUA 4O3RA 3D5MA 2EVZA 3GE9A 4URGA 4IRCA 5LXYA 2KXNB 1LK5A 1O51A 1M5OC 2XI3A 2DISA 3G6ES 3NMRA 2B6AA 2VC0A 2DTJA 3T5JA 4Y65A 4YY3F 1A7GE 1QVFR 1WI6A 5EWFA 1NJZA 4W92B 1L3KA 3N28A 1NKBA 3NNAA 3EUNA 4YEAA 3CCUS 2OFGX 2XGPA 2XLIA 3GQCA 1C1CA 3UDCA 1NKCA 3PW2A 4IRKA 3Q2SC 5DG9A 3BGRA 2OTLS 3H25A 4ERDA 4L6V3 1TL1B 2OMLA 1RT5B 1FTCA 1N56A 2IM3A 2PT0A 3HZGA 4HTIA 5H9FJ 4A47A 2DR7A 1DAXA 4OHXA 2KZMA 2BANA 4WZQA 1RT7A 4EYHB 1X4DA 4IO9Q 1P8GA 1B7FA 1YQHA 2MKJA 4Y00A 1NRKA 3H4BA 1K0TA 5F3ZA 3MMJA 3KLIA 4KPYA 4DWIA 2COLA 2AF6A 5B0GA 3VF0B 4EBEA 2EBEA 3PFOA 1RA6A 1BWEA 4N5SA 4MFBA 3RAQA 1HPZB 1U1NA 2BV3A 1GT8A 1XR6A 2F9DA 3TUZC 1VK8A 2B7BB 4KE5A 1S9EB 1X4AA 3S01A 3VWSA 4BHQA 4AQYF 2AGQA 3JTOA 2DNOA 1QAIA 4X4NA 3LOUA 2F8MA 3CJKB 4C11A 2YX1A 4NCBA 2X1AA 4B9MA 5D3GA 3IC1A 2KT2A 1JX4A 4OQJA 1JLEB 3TAMB 5LMNF 4LF4F 3ZZUA 5C24A 1JLGB 2LLZA 2VBYA 4HLBA 4NLOA 4TN2A 1C4AA 2FJDB 2JWNA 3MGJA 5JUMA 3CJ5A 1EP4B 3HHLC 3UW1A 2IYIA 3GMGA 3LF0A 1U47A 1M90T 3SV3A 2CDQA 5BYSA 2DNQA 4DR7F 3SCKE 1S4FA 3R27A 3I9ZA 2PEHA 1X4FA 3IR5B 1KC8T 4OJGA 2DIVA 4RW8A 1IM4A 4XO0A 4X62F 3GIIA 1R0AB 1MROA 3I32A 3LP1A 3T9ZA 3SXLA 2A10A 4Y0FA 2I1RA 4U67Q 2D3UA 2UUCF 2KB2A 1SIZA 4QYRA 3DRSA 3CCLS 3DRYA 4FXWA 5I42A 1CQMA 3MPVA 3FSXA 3D1HA 2FVCA 4C8YA 4IDKB 4DN0A 4A8WA 1WTFA 1F9FA 1JLAB 3HKWA 4ED7A 4HT5A 2XCAA 3OSNA 2C2DA 2QV6A 2KKHA 2I8EA 1NU4A 5KFTA 4KHPF 4ZK7M 2EFOA 1Q78A 4G1IA 3O6QA 2VG7B 5B09A 3IGNA 2ASLA 3MEGA 4LF9F 3G86A 4QR0A 5IXUA 4ECRA 1X4HA 2GV1A 2QMWA 3SEOA 1YTYA 3HKZD 4QWEA 2KYZA 3OW2R 5A0YA 1QE1A 4X2BA 3KFWX 4MIAA 1SKRA 2Z8QA 4DSLA 1TQLA 1JLQA 4F2RA 2KM8B 3TRGA 3J7YU 1CG2A 2OSRA 2GMLA 4ED3A 1N5YA 1MU2B 4F4XA 1WHWA 4WZMA 1B64A 1S72S 3K8VA 5M2UA 1X4BA 4TXSA 5I3UB 3QO9B 3IR7B 1GH8A 2N4CA 3KHHA 2MZSA 3KK2A 2BA9A 2L3MA 2HGNA 1VLYA 2Z2MA 1N52B 4ZPWR 1DHMA 3T5KA 3H59A 2F9JA 1WWHA 4BWMA 2OPQB 1NJYA 2GMHA 1C0TA 3G8QA 3TARA 2D3OR 2CVEA 2EFNA 5HLFB 4U7UK 3MOZA 3PW5A 1JXLA 3MF5A 2QT7A 2L9NA 5THWA 3CDWA 2D3ZA 4X65F 2HNZB 3OFGA 1IKWA 3CE8A 5BYQA 3GYXB 3VAGA 1LWFA 1KQGB 1MW7A 2O67A 3R3TA 4KO0B 4RUAA 2HFOA 5DRKA 5L38A 1X4EA 1NHUA 4I2PB 3IS9A 1FESA 4HI2A 2NS1B 2OPPA 3V4MA 4HH1A 4IFYA 3G6XA 1RTHB 3CCJS 2G13A 3EGNA 3SMZA 2CJBA 3DYAA 3CTRA 3NL0A 3FSYA 2IC3A 1S6QB 2LQ5A 1Q8BA 3L09A 2JEGA 1Y4ZB 4TY8B 3V6KA 4PCQA 4IH5A 2MKSA 5K8PA 2FC8A 4NCGA 2QMXA 2RU9A 1LKZA 3JSYA 5K5MA 5DGAA 1QSLA 2ZE2A 3C3LA 4CQ1A 1Q81T 3FQLA 1JIHA 3VAIA 3BSNA 3G8TA 1NJIT 2DNRA 4X4SA 3OR1B 3AY0A 1RTIB 4PQUB 4Y2AA 5KT5A 3LWMA 1FNOA 2JJ4D 1TKTB 2J0XA 2W4CA 2ZKUA 1RT1A 2XMVA 4GKKF 1E6VA 4DF8A 1PC5A 4WKYA 3U1LA 1FDAA 1FRXA 4X4PA 2C3PA 1WG1A 2A18A 4F3QA 2M52A 2LVWA 3V4IA 4RW4B 3FRZA 4TLQA 5C25A 2GHVC 3VTIA 3GYNA 1FJEB 1LWCA 5MLCV 1FVSA 5A8RA 2XSFA 4DL3A 1S76D 1HBNB 2XBPA 2NYIA 3M6WA 3DOKB 4NZ0A 2ROEA 2VPWB 5EDWA 1U24A 3A8EA 2CRLA 2KRRA 4XPCA 1VBZA 1DBDA 2C42A 2JL9A 4IRDA 4KHMA 2C2EA 2RIJA 1I6JA 1CLFA 5LT5A 2V8DA 1DRZA 1ELOA 4KR0B 4DOZA 1UEUA 3PX6A 4PWDB 4NRUA 3EGZA 4CT9A 3N6MA 3T1HF 1NH8A 3PNIA 1FRMA 1KLMB 4MAKA 1U09A 4Z2XA 2PE8A 2NXUA 1JLCA 3EX7B 1ZZNA 3Q8RB 1TVRB 3VZHA 5AJ3F 5JXSA 5KOXA 4DS5A 3MZIA 2D7SA 4A8FA 4I4BA 3NS6A 3G6YA 4OL8A 1FKPB 2RT3A 1SV5A 3DU5A 2YKNB 2GFFA 2DO0A 3MURP 2V4RA 1MWZA 5DGBA 1WEXA 4JI5F 4OZNA 1JJ2R 3HO1A 4C0HA 2HGLA 4XDCA 4KV8B 2IMWP 2WSFC 1FDBA 1UFLA 4KGKA 2VODA 2M7SA 4PXCA 3I4PA 2QO3A 2KT3A 4R8UA 4LF5F 3NMAA 2ZD1A 4PXBA 1HQUA 2C3MA 1UFWA 2B6AB 3BGFA 5KFIA 2JLFA 1NEEA 1VOMA 3NGDA 2P6TA 5LSRA 3B8HA 3H40A 2ZZMA 1N33F 5J1EA 2BVZA 4IH6A 1S99A 4B9UA 1KVJA 1P9QC 5L9NA 1T05B 2R7QA 4J5OA 1ZOTA 1NK8A 5ITHA 4DDFA 3IN5A 2VG5A 2DGQA 1JNZB 5E33A 4HI1A 2JHEA 3N6NA 2DIUA 1HI1A 3BGRB 3ULHA 2R2RA 4I2QB 1SJFA 2CQ2A 2W4PA 1RJJA 1SH0A 4HDGA 1S1XB 2R8HA 4N77A 2BANB 2F4VF 1QUVA 3TOQA 1RT7B 1J5EF 4NLRA 5JVHQ 1MMLA 1N5SA 2HLUA 2M9KA 1S0NA 5HO4A 2BZ2A 3F44A 3G9CA 4FXVA 4DV1F 3NBPA 3KLIB 5IZHA 3M32A 2PD1A 3C6TA 4Y3CA 4ZCIA 3S8SA 2E7XA 2E29A 4DLGA 3I96A 1M5PC 1X9MA 3QLHA 3I5AA 4MFBB 2KHDA 3UD4P 2L48A 2R8JA 3FQKA 2POKA 1ZPWX 2ZOGA 1NNDA 3T1YF 3MOJB 1NK9A 4OI0A 1R31A 4KFBA 4NLTA 1S6UA 5AE2A 1GTHA 2VKRA 2HS0A 1U1PA 4C11B 5CQGA 2MQQA 4F25A 2LU1A 2FLPA 2DGVA 2ADCA 2P9GA 5D3GB 3NNCA 4X4UA 4DL4A 4IQXA 4F4KA 4UUXA 3PHEA 1ZAXA 1U1OA 4ICLB 1GXLA 4OJ1A 1SQEA 4DUYF 4NLPA 4ZA1A 2XLJA 3LW5C 1S7HA 4EU0A 3LWLA 3RRHA 3RAXA 4CCHA 1FRHA 1IBKF 3IRXA 5B0FA 5CCMA 5L1LA 3H8YA 4MJKA 3AB4B 5A8WA 1BY9A 4OFZA 1BLUA 4NA1A 3H2LA 3BZQA 4M8LA 1T03A 2W25A 3R1LA 1APSA 3BR8A 4RW8B 1P27B 1VQSA 3J80Y 2E7WA 3Q8SB 3R5AA 1S97A 3LP1B 1RYSA 2FLOA 3VALA 2ILZA 1QAJA 3DRSB 4AUKA 1HWKA 4NWBA 5I42B 4HH0A 4ELTA 2XLKA 2FJBB 1XMBA 2CQCA 5KG6A 4JBCA 4FVMA 3M8QB 2DCUB 5CCLA 2YKAA 3DLKA 1Q79A 4DR6F 2CQ3A 4RNNA 3PX0A 4IG0B 3TA2A 4C0OC 1SJRA 4ILMA 2XY5A 3D54A 3GV8B 1HI0P 4ECUA 1T02A 3MM7A 2D9OA 1HBMA 5HBMA 1UEVA 2E5JA 3FZ2A 4LVNP 7FDRA 5HP1A 4DQPA 1M0SA 2LQJA 2UVVA 3OL8A 3W2VA 1YI2S 1D9DA 4OIXA 1QLNA 2L08A 2XWXA 2FLNA 3Q2TC 4LMZA 1HBOA 3PXGa 4JI4F 1FK9A 2PFFB 2YWEA 4WXWA 2XY6A 3V6HA 2HHQA 5DS7A 1DQ9A 3VQTA 4B9TA 3KG1A 2PO4A 1SXLA 3MTKA 2QA4S 2VFSA 3MEDA 5KFNA 3GFZA 2EWHA 2FD2A 4NL5A 3WX4A 1D1UA 5E5NA 3W3SA 1WD6A 4DV5F 1YIJS 5F8JA 1S0VA 4G6VB 1IR0A 3KK2B 1JLFA 2ZDOA 3I0SB 1VC0A 3LO3A 3CWJA 5E3RA 4N76A 4IQMA 2B4PA 1VQOS 3KHGA 2FPHX 3FSIA 4QW8A 5DDRC 2DITA 3N01A 1VIXA 3A1YG 4HEA9 1KRPA 3CULA 4LSNA 2IM1A 2MMYA 4Q0BA 4OJHA 2ZH4A 1WEYA 1NK4A 1IKWB 5F41A 3CCQS 1LWFB