1G4CA

Crystal structure of a complex of hppk(r92a) from e.coli with mg2+ at 1.65 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1g4cA00
3HD1A 3ILLA 3HT0A 3ILIA 5ETMA 1RAOA 1RU1A 4M5JA 1TMMA 5ETOA 3MCOA 3QBCA 4M5MA 3IP0A 4M5HA 4CRJA 1CBKA 3ILOA 1TMJA 1RU2A 1EQMA 3HSDA 2CG8A 3KUGA 3MCNA 5ETLA 5ETKA 4AD6A 1RTZA 1KBRA 3KUHA 2F65A 4F7VA 1IM6A 1RB0A 4M5NA 5ETPA 1HKAA 1DY3A 5ETTA 2F63A 3HD2A 3HSJA 3KUEA 3UDEA 4CYUB 1F9HA 4M5KA 1HQ2A 4M5IA 4CYUA 1Q0NA 1G4CA 4CWBA 2QX0A 3HSGA 4M5LA 5ETSA 3UD5A 1EQ0A 5ETRA 3ILJA 1EX8A 3HCXA 4M5GA 5ETNA 2BMBA 5ETQA 5ETVA 3MCMA 3HSZA 3UDVA 4PZVA
chains in the Genus database with same CATH superfamily
4P2FA 3G2XA 2RU9A 4I68A 2C22A 1S79A 2ZH8A 5CZVA 4YMEA 3GSIA 4AL6A 3SBMA 3B82A 2JX2A 2QT7A 1VBXA 3QMQA 5C5JA 4O4GB 1NK8A 2DY9A 5AJ3F 4CP5A 2GA7A 1VLOA 2VQEF 3IBCB 2C2MB 4QW8A 2AKWB 3JSMB 1Y4ZB 2RAQA 4EO6A 4HI2A 3P4UB 3W64A 2VDHA 3IWLA 2B9YA 3PEJA 1VQPS 4UF4A 3HZEA 4K59A 1FDBA 3SYZA 1RK8A 2U1AA 1YTYA 1OY6A 4DSLA 4LF8F 2F5GA 4F04B 1NU4A 3FKBA 2CADA 1NK5A 3FBBA 3K57A 1U8WA 5ETSA 2WSCC 1CS4A 3SIPB 1YJ9S 2F8EX 4LF7F 2OPPA 4X62F 2BQ3A 4I2QA 3FMBA 4LRCA 3ULHA 4LVNP 4ANDA 2VFTA 2XULA 4KB7A 2UU9F 4WWSA 4G1QA 4OI2A 2B5JA 1X0FA 3AD9C 2GVDB 3PKMA 2UXBF 4FS2A 4OYXA 1VHIA 5DDOC 1WKJA 3N9UC 1QAXA 3ITHA 1LWCB 1K1QA 1JX4A 4QPTA 4RZRA 3AOCA 2AGOA 4XO0A 4ZVPB 4QIWD 4O4RA 1WG4A 4WU3A 4LSZB 3CC7S 4ZLPA 2XI3A 1JKHB 1J2VA 4P2XA 3TX0A 4WP8A 3GIJA 2WONA 1FDAA 5D4LA 3ILLA 1FKPA 1JLEB 2KZZA 3OTBA 4RBUA 4JI4F 2I1RA 2PC6A 2YKMA 5DETA 3M6VA 3MMBA 4NXMJ 2EKNA 3DLHA 1WD6A 3IMQJ 4NA2A 4PWDB 3G8TA 4KGKA 4GO5X 2YXLA 3BQ0A 4HH0A 4CLZA 1F9EB 2R7UA 3J7YU 3IBFB 4E8UA 2MKKA 2MLXA 4KHPF 2QZ8A 2NSBA 5D4PA 2ZBQA 1PAUB 2HBRB 2O1PA 2ATLA 2HZVA 1VYAA 3MM8A 4Y34A 3G82B 4CTAA 1X4AA 3PR5B 4QWCA 5B0EA 4CZCA 3PEHA 1U6ZA 5HN0A 1TAUA 3ISND 4XDDA 3MPUB 2XWXA 1FRHA 2CQ3A 3PX0A 3OQ2A 5KFPA 1BXNA 1N32J 1VRUB 3DXBA 1TVRA 1UEKA 2PD1A 4NLRA 1XERA 2ZH5A 2KKHA 2X1FA 2D7SA 1B7YB 4NZ0A 3Q2SC 5A8KB 5ETLA 5D4NA 3ZC4A 1DFDA 1L3UA 2ZE2A 1C1CB 3MFHA 3PXGa 2J76E 4CT9A 1U2RA 2Z58B 1YIJS 2CPIA 2V69A 2I5JA 1BWVA 3UE2A 3CCLS 1EHWA 3CO0P 1B99A 4RW8A 4N47A 2N7YA 4LFCF 3SCKE 3M30B 3W66A 5KFTA 2HLTA 3MCMA 3BZQA 4DU7A 2EFGA 2F1FA 1IR2A 3EGNA 3PIPQ 5KG7A 5KG2A 3QIDA 4JV2A 2Z2LA 3DRRB 4NRTA 2K2PA 4G1QB 3BSOA 1VIOA 4HVZA 2EC2A 3TYTA 1WTBA 4WFZA 4YP3A 5L9XA 5F8HA 5AJ3J 2AZ3A 4LVOP 3KLVA 2IHR1 2VQEJ 2MQ8A 1FX4A 5LMUJ 5HMXA 4PXDA 3OV7A 1UEVA 4E0DA 3Q23A 1YRTA 1Q78A 3C16A 8RUCA 1VQ4S 2WTFA 2HQ3A 5DQIA 4B9TA 4B3TF 5D15A 1TKTB 1ZZNA 2OSQA 2HWTA 4GKKF 4MFBB 4R8UB 3C6TA 4LF8J 2RIJA 4PG4A 1A7GE 3JYTA 2DD8S 2P2CB 3EGZA 1UJ5A 9RUBA 3WX8A 2BEFA 1N33F 2YKMB 1Q82T 4LF7J 4X62J 1Q5YA 4HYKA 1KWMA 2ZWPA 1NB7A 2W2PP 4NL5A 2PSZA 1DQAA 1MMNA 4MMOA 4LRDA 3NGKA 2V8PA 2UU9J 4C8OA 2WW8A 3UDLA 3PHEA 3QPIA 4F3OA 2MQPA 3L9ZA 3CMAS 4QYRA 2BKNA 4ZP7A 2UXBJ 2VPZB 1TUVA 3Q8VA 1S48A 1WI6A 1QSLA 1U0HB 2PMZD 1F1BB 2B9WA 2H3EB 1YJVA 3ISNC 2EBGA 1HMVB 3DLEA 4JI6F 2YKQA 1YJTA 3GJSB 4LFBF 1RI7A 5I3UA 1NJXA 4P75A 4JI4J 2FVCA 3OL8A 4RW6A 1OSCA 3DU5A 1SVDA 3M8PA 3TANA 1QVGR 3PJ9A 4KSEB 4V1Ak 4DFMA 3RW7A 1FESA 2ZKUA 3IC1A 4KHPJ 2HSEB 1N5SA 1T03B 5F3TA 1MWZA 5HSPA 3D9BA 3CCWA 4OYMA 3PDNA 3L4BC 3CJRA 2VOPA 3O44A 1WC1A 3AD7C 2R8GA 5MLCV 1HBUA 4DZ6A 2I0XA 2N7CA 4L73A 3Q0AA 4FS1A 1S9EA 3UDVA 1WI8A 4DX6A 3UO0A 3VV2B 2W9CA 5IM0A 3RB3A 3R1HA 3HVAA 4DCPB 3GE9A 2R7TA 2AJ2A 3D6TB 3DLGA 5M2RA 3H42A 1TKZA 1KVJA 1W25A 4J9KA 5AE1A 4LJMA 5H9FK 2FHJD 4DFKA 3FEYB 4YB1P 4B9MA 2A0FB 5FLXU 2AEFA 4C2MA 3EGVA 1RAJA 3UW1A 3BBBA 4CH1A 3D0HE 1F5CA 2MZSA 5DM6Q 1HWJA 2M8DB 3AT1B 2HRYA 3NP5A 4FYVB 4ID8A 3GILA 1BMQB 2FJEB 1WF0A 2NXEA 1G4CA 1S9GB 2V2ZA 3OSPA 2M52A 4E2FB 4LBPA 3FBCA 1VJQA 3MEDB 1YLXA 3Q2TC 2VJUA 2DJWA 2HZAA 4YFUA 4O44A 3N79A 4NOHA 1Q8IA 2L9NA 4EO8A 3C6UB 2QSWA 2E5JA 4B3TJ 3NMAA 3GPAA 1TL3A 5LJ5Y 2HNZA 4GKKJ 3SSQA 1DHMA 2WSEC 2XC9A 2W4CA 4WKYA 4KKOA 1SC3B 4JI7J 4RW9B 2Y1JA 3FCHA 3VGSA 2G2YA 1FA0A 4NMLA 1N33J 3NRBA 2C1EB 5EWGA 1FFWB 1VQ8S 2CJXB 1Q4RA 1WHVA 4Y2CA 1JLGA 4MTPA 1NRKA 4HH1A 2HAIA 1R0BG 1QD1A 4OI3A 1LWXA 5KFKA 2Q1LA 2KRRA 3B6BA 5HVHA 1FFSB 2K7KA 3LF0A 1EIYB 4DV4F 1CJKA 4ZMMA 4IG3B 3DC2A 3LWLA 3NOGA 1FRLA 3CMES 2YNFB 3ICLA 1ZTTA 2GC8A 1YX2A 3E01B 3H2LA 2VQFF 1AROP 3TJAA 2W7AA 4C6AA 3HMJG 3MR5A 2AEMA 2IRYA 4ZIWA 4JI6J 2CQ0A 2QFIA 2HQDA 3UDCA 4ILLA 2G0CA 2ALZA 4EZ6A 4YOEA 4LFBJ 2LCWA 2WZ1A 3C19A 2KB2A 4EMDA 4DL2A 5HVFA 3NGTA 4G1PA 1KC8T 5DRKA 1ZH5A 3DLGB 1CC8A 3MM5B 1FKAF 1NSAA 2CPYA 2VH7A 3FVYA 2F9JA 3I87A 1SQEA 2O01C 2B43A 4JBCA 1TU0B 4PWUA 1RP5A 3HZGA 4DPUA 3Q8UA 2VG7B 4TU9A 2GVZB 4RNMA 3W8PA 1TKXB 3HJFA 4NI2B 2Q3PA 1FNOA 4R0EA 2J0XA 5FLXY 3N6NA 3G6YA 3C15B 4CLTA 2BJ3A 4I6AA 2AJ0A 2OH2A 5E3CA 5KG6A 4ER8A 1OSDA 4C0BA 4ID5A 1LFPA 1WOOA 2CG8A 1XTZA 1FXDA 2V8HA 2ZUAA 5E7OB 1GFWB 1JLQA 1SUQB 3ILJA 4QU6A 1KSPA 4GC7A 2JHEA 2ILYA 3SV3A 4DUZF 4OQJA 3CIMA 5DZ7A 5HL7Q 2K1RA 2EEYA 1CQNA 3K5PA 3CCSS 1M5SA 4QQBA 3I31A 3KFWX 2F63A 4C3KA 1LEOA 1U45A 1RQ0A 5CQGA 2VPWB 1N52B 4ANEA 2PT0A 1V5VA 2QYCA 1KQKA 2FLOA 1SV5A 1J27A 2VOOA 2JNJA 2DPIA 1B64A 5B08A 4CLYA 3BPSP 1C0TA 4FN5A 4C8NA 3W9IA 3K17A 2WVFA 4LRFA 1VR6A 2DB1A 4KC5A 3DOKB 2XLKA 2ZFHA 4RX6A 1GXLA 3NY0A 1WWHA 3BN7A 4LSLA 1S6PA 2CZ9A 3TUIC 4W92B 1UP1A 5KFRA 4F50A 1Q16B 4DQRA 4USTA 2C28A 1UFLA 3CJKB 1VIXA 3CJSA 1X5PA 3N0VA 3MD1A 4OIXA 3AOBA 4CIOA 1SL0A 5DDPC 3TNVA 3K59A 2MJNA 5CYJA 3R5DA 4A8XA 2FY8A 4J5OA 5A76A 3SDEB 4ECVA 2QV6A 1FI4A 4ALZA 3OXFA 2V8GA 2R7WA 1XEZA 1LV5A 4L72B 4DV4J 2E5IA 4ZN3A 4IO1A 3UPFA 1SJ4P 5CYQA 2ZZMA 5KFUA 2C2EA 3T9ZA 1NZ8A 2ZH9A 2P9CA 2XHCA 2VQFJ 4I67A 1V5IB 2CJAA 3SZ2A 4J9PA 4IFVB 4NLVA 1LW2A 2JRSA 1HWLA 3JQMA 4ECWA 2APOA 2R7SA 3X3UA 3NNHA 5KFFA 2OELA 1VRTB 3MGJA 3M8QA 2FJAB 1P9QC 2QLBB 1NJIT 5LSOA 3ZZUA 3CDUA 1N36F 2EFQA 4DR5F 1REGX 2MGZB 1YBAA 3EVWA 3FK4A 1KQFB 2BJ7A 1NNDA 3KK2A 1QDUB 4PG8A 1I51B 2XZTB 3QGIA 1N34F 5HJXA 3MTKA 1ZYQA 2XQCA 5EGYA 4H4MB 5HROB 3M8SA 1F9FA 3KLIA 1RHRB 2J5AA 4BBYA 1BD6A 3JTPA 1K47A 3HHLA 1RAHB 4Q8FA 3QWUA 2RQMA 3K5MA 2RS2A 4IR1A 3OD2A 1RT1A 4ES1A 5JVGQ 2YNIA 3MM6B 3W61A 3TUPA 1GT8A 3PG9A 2DGQA 1QE1A 4DSEA 4OZ1A 1OO0B 4MK8A 2QEXS 3T6BA 2G0IA 1DRZA 3DGPB 4TNOA 4LBHA 1OJ4A 2BUNA 2ROPA 2XM3A 4DUZJ 4EBCA 1SH3A 2MQOA 3BBFA 3VVUA 2M7SA 2ZWOA 4CH0S 4R0JA 1ITPA 4ED4A 3CJ3A 2JFKA 3HJVA 4FDFA 1SJFA 5LOQA 3D68A 4NLWA 3R6GB 2MKHA 1WC4A 1EX8A 4N41A 1IKXB 1FNXH 4DUYF 4XPCA 1GK8A 3BSAA 1X4EA 3CJ8A 5D4OA 1HWUA 2AZ1A 4CLUA 2BJDA 5T7LA 1PSDA 3QIPB 4I7FA 2X3GA 1RTHB 1TV6B 2ZJQQ 2ERRA 4ZVUB 2OKQA 3KK1B 4F7VA 1E6VA 2HQIA 2BM1A 2C2OB 4LSNA 3BO3A 4PXEA 5CHCB 3UD3P 4AE5A 5K9FA 1JXLA 2ZVSA 3TEGA 1REVA 1Y7PA 4RBTA 1UMJA 4YR0A 3AA8A 3GYGA 1S1VB 4H4OA 3BEGB 4ECRA 3W2WB 2DITA 2LU2A 3QAUA 5IS2A 4HT7A 1D1UA 3DRSB 1RT7A 4V19J 1PCAA 3OL9A 3LPYA 4ZN1A 1RE1B 4O3NA 1CPZA 4DN0A 1RAGB 2PA8D 2CQ2A 3ELHA 2PEHA 4DJBA 2AYMA 1RTIA 2BANB 2RSQA 2AIRB 5K5MA 1IKWA 1RWNB 2V34A 3Q86A 2E1CA 2V2QA 2CQGA 5A2QU 1SPBP 3M8YA 2DTJA 4O3SA 4RNOA 5JMNA 2C3YA 5HP1B 3NGUA 4EGLA 2KYZA 1SJ1A 2VBYA 4LT6A 7FD1A 4KFBA 4ECYA 2DR7A 4RR5A 3KUGA 4BDPA 3NBPB 3UR0A 3KKFA 4YN3B 4HTJA 2UUAF 1SJRA 2DHXA 1FVSA 1N4LA 5KG0A 2ILZA 1HNVB 1WSVA 2HNDA 1RAOA 3OHBA 3BGRA 1RT2B 3RAQA 2OMOA 2YKAA 2UP1A 5AE3A 1I3OB 1YQHA 3TUJC 1N36J 1MWYA 4DR5J 1SI9A 1NK4A 2XWYA 3CD6S 1X9MA 4K0KJ 2QA4S 3HLUA 3VGVA 3CCTA 5EUHA 2R8IA 1WHXA 2CPHA 5J2PB 1KLMA 2V4QA 2IPOB 3C8YA 3H8YA 4OI1A 1N34J 3R9LA 2HBQB 4OX8A 3LUYA 4LBIA 1N0VC 2VD3A 3D28A 1OS5A 4QPXA 2RU3A 2D69A 3J7YI 3A1YG 4I7FB 1RBOB 1H3DA 4X4RA 2G2OA 3SFGA 1U47A 5KFVA 5J2NA 2EFVA 2WOMA 2HK2A 3KYLA 4K4SA 1I1GA 3JTNA 3D67A 2MHEA 1DLOB 3UDEA 2KHCA 2FGCA 3RJMB 2AEJA 1U0SA 3TARA 2QO3A 3U02A 3IWXA 3ONQA 4C8ZA 5AXNA 2WCXA 1EJ7L 3NAHA 3B4MA 3ZO7A 3A4TA 4FP9A 3RRKA 1UZDA 1T9WA 1FNMA 2ADBA 4ZPDA 1U8SA 4P7VA 5JUMA 4DUYJ 2CNOB 4O0NA 1JLCB 4PXBA 4KGMA 4C0HA 2KVQE 3IGVA 1F3VA 2BV3A 1T0TV 1IKWB 4JYAF 1BQMA 3T1HF 4IRKA 2JEIA 1BLUA 1HLWA 1RU1A 3ISZA 4X4SA 3F73A 1EKRA 3GIMA 3UD5A 3KK3B 2R7RA 1J5EF 2CUYA 2ZM6F 5A2QY 2GFFA 5E3QA 3MCNA 2V5HG 3CXCR 4KV8B 3VZHA 5KFIA 4C97A 4UZCA 1RT4B 2YX1A 4MT1A 1S1TA 4ECQA 1UJ4A 1CC7A 4HEA9 4DSKA 4DV3F 4HR2A 2ZD1A 3BREA 4LR8A 3R2CJ 4I1TA 1JJCB 5DG7A 4JI2F 1TAQA 1HA1A 1F6TA 2MZTA 4ZVFA 3BPDA 4D3HA 5D0EA 1HL6A 2W9AA 2Z0GA 4HACB 2IAJA 1KLMB 1T02A 5HLFA 2KXHA 4KGVB 3UVJB 4OI4A 1KFDA 1EETA 3QRPA 2DHAA 2M9KA 3MI7X 5ETMA 1AYEA 2CQIA 1G7CB 3U1MA 5KG4A 2CPJA 3HVRA 3GV8B 2UUAJ 1RXOB 2KN4A 2HGLA 1IBLF 1S4EA 2IMOA 2F7VA 2WOMB 4ZVEA 4M95A 4QJVA 5KT5A 1GTEA 4F0MA 2XZDB 2CQBA 3H2UB 2E7VA 1QAYA 4LF5F 3T1AA 2E5HA 4ZCKA 3JAMU 5GVQA 3FFIB 3K8VA 1VMBA 4I69A 1KTQA 4DDFA 1F2GA 1F0XA 3BGUA 1LW0B 4RW7A 2A1BA 2Y3YA 5HBMA 3ENVA 1LWFA 3ILIA 3LPEA 3RAXA 1FXLA 3OFEA 3PYDA 3CSKA 4ZJOA 3V4IB 4DV2F 1FEEA 1HQUA 5L39A 4J9OA 4ZP8A 2C3UA 4F4KA 4JI1F 4FBTA 4FNIA 2OGUA 4ECTA 5HQMA 2F40A 2UV8A 5E3AA 2X3DA 1RISA 1CSJA 1H6KX 4PABA 1TL1B 3N5FA 2Y1LB 3PTWA 1IJEB 5E33A 4KAIA 4Q44A 3PW7A 5THWA 2J0WA 4YB6A 5EHHA 4NE9C 1IN0A 3QQCD 3ZTQA 3DI6A 3KLEA 2BM0A 1OQ3A 3GYXB 4TY8B 2V68A 1S1TB 1U7LA 2DO0A 2G1HA 4IH6A 3R6LB 3MPVA 4WXWA 2RMLA 3AQOA 2AYEA 1O0PA 1S7HA 4UOGA 3FBEA 4DR2F 2NUHA 3LW5C 3KLFB 3HHLD 1B70B 3GR0A 4Z7YA 1QAJA 5SZTA 2CQCA 1Q8LA 3T1HJ 2IAJB 1DURA 4ZP9A 1Y9OA 1UVIA 3HHDA 4IOAQ 2HGNA 2J7UA 2XG8A 3NL0A 2HHPA 4PPDA 5C2CA 1J5EJ 5KFJA 2GZOA 2ZM6J 2G13A 3V2UC 1NK9A 4ATNA 5KFMA 3K5OA 1KVKA 4B9UA 5KFNA 2OIHA 1YHQS 4WIIA 1S76D 1XMQF 5J2MA 5KFAA 4FPRA 2YQ1A 2P6TA 2BE2A 3BKFA 3JTOA 4ANCA 2DH7A 1NEEA 2H1YA 1SB6A 4DV3J 4ELVA 4DPOA 3RBEA 3DLBA 2VA2A 2V9WA 3LTOA 1WC5A 2XCAA 1BGXT 1S57A 3HCXA 3FQKA 4KQZA 4DSJA 2IM1A 4QCLA 1R8CA 4PG5A 3CTRA 2B4UA 1ZZFA 3P96A 1XJWB 1N56A 3Q22A 4L6V3 1YWXA 4CM2A 3LQVA 3HM9A 3W63A 2LA6A 2YWEA 3PRVA 4ZCLA 3C66A 4K4ZA 3I9ZA 3OR2B 2YWFA 1UW9A 4I0WA 3J7A1 4KR0B 4NCBA 1IBLJ 2FLNA 2CPDA 4KT0C 5C24A 2I9SA 3UN2A 3WC0A 1U6BA 2N4DA 4J9LA 3IAM9 4LF5J 2PMHA 4KIAA 1KONA 3ENWA 3PZPA 4NYZA 3TW0A 1VQ9S 4OZLA 2CVIA 2JEJA 4OMFG 2B6AB 3I4HX 3EVMA 1RUSA 2XSJA 3CUNA 1RWXB 1DTTA 2O67A 2ZHAA 1KKHA 1RBLA 1VISA 2I38A 5C2GA 5F3ZA 2YWKA 2XY7A 2OPQA 4DV2J 2OUGA 1IR1A 2QLXA 2AJ4A 3D3CJ 3QGGA 5J1PA 4K5RA 2W9BA 3V6HA 3HHLC 4JI1J 2GGPA 4IOBA 1DQ9A 5ETKA 3WHIA 3ZFVA 1NJZA 2BDPA 4YHHF 4DPTA 4DU8A 1Z2ZA 4G3IA 2J8SA 1S0VA 4B02A 1ZM9A 1TK0A 3OFHA 4Y2AA 4USUA 1S99A 2ZH1A 3QT8A 1S59A 2Z56B 3OL6A 3M9NB 2J6TA 2COLA 3WQPA 3CD0A 3NCQA 2VONA 2VASA 3KHLA 3VQSA 4QWBA 3I55S 3ENQA 3AJ1A 3OUYB 2AJQA 3IRWP 3Q8PB 4KTQA 5LSRA 3VAHA 3QLHB 4Y6IA 2FJVA 5EX3A 2FVPA 1JXVA 1URNA 3JSYA 3HVTB 4D3GA 4YB7A 4PQUA 3DOMB 4JI8J 2FJDB 3NEKA 1N5VA 2RS8A 3A3OB 2WBRA 4QWAA 5A0YB 5KFQA 2UZAA 1P1LA 4DL0C 4WK1A 4J9RA 4WE1A 3QYYA 4DV7F 1EB0A 4M5DB 2VBXA 1XMOF 2OEKA 1RHKB 3L7OA 3PHTA 2R2SA 1FKOB 4CYUB 2EWHA 2QFJA 3ZNJ1 2F4VJ 2A2CA 1HPZB 4X65F 3TZYA 1N6QB 2Y0SD 1FERA 3MOZA 4R5PB 4Y2IA 1XMQJ 3TVZA 1CEZA 3CDEA 4A8OA 1DY3A 1UKUA 4F8RA 3ZTOA 4LIWA 1VS3A 3CJ5A 4A48A 3IFEA 2W25A 2BRKA 2O66A 2JVOA 3FGVA 3GWCA 2AP6A 4A8QA 3HKWA 4Q0BB 3T5LA 5IV3A 3VAKA 3MUTP 4GO7X 5DLFA 3FQLA 2FVQA 3H2VE 4ZHRA 5B09A 3S7RA 3MEGB 5KT7A 1RYRA 4B9VA 3POTA 4HTIA 1VQNS 3PO4A 4YDXA 2NYIA 1UETA 4ZS6A 4EI2A 2B4PA 3PR4A 4QIFA 2YNGA 2AYGA 2UXDF 4M5MA 1R8HA 1Q86T 1T8EA 3PV8A 2PFDA 5JXSA 4DL6A 1Y10A 1AFIA 3QATA 2CDQA 2W7OA 3T41A 2QX0A 1FO1A 5F8LA 4XPEA 4DQIA 2R9LA 1C4AA 4B3MF 1IKVA 3UN3A 3DMJA 3IXQA 1SJQA 5IZHA 1T05A 2MEWA 1URRA 2WB1D 2YVSA 2FJXA 4RWWA 2L48A 2EK6A 1T7PA 1R0AA 2HFZA 4ZPAA 2P8IA 3F41A 2LDYA 5B0GA 1CJTA 5HQ8A 2AX1A 3MOJB 1CULA 3Q8YA 4A8FA 3BV8A 5L8RC 1TL7B 4QBUA 3MECA 1R8AA 3AJDA 1C0UA 2FZGB 4PKDB 1GMWA 1G1XA 1PC5A 1OWXA 2K7JA 4YHHJ 4RW4B 3SQGA 1W7WA 2RJZA 1F2HA 3CVKA 2JJ4D 1F9HA 2KM8B 2B8PA 1JB0C 1C4CA 2UUWA 5DQHA 1D9FA 3LP0A 2ZH7A 4AL5A 1X4HA 4KE5A 2I6WA 4ES3A 2RHSB 1DZ5A 2CQ1A 2G9OA 4U7CA 3VR1A 3D4JA 5FDLA 2NS1B 3MR3A 3DLKA 5ITHA 4WP3A 3DRPA 1HR0F 3VGTA 4FF3A 5GAGU 1N5YA 1H0HB 4J7CA 1RLDA 4K4VA 2E1RA 2RRNA 3QAEA 5G0RB 3IR7B 5A8RB 5KT2A 1FX2A 3KJQB 3QO9A 5J1EA 4L76A 4DV7J 2ABYA 4PRFA 2WVCA 2J9EA 1XMOJ 1Y3KA 4NA1A 3POTB 2YKNA 1RADB 2W1BA 4DV6J 1VQ7S 5EWFA 5D3GA 3UQSA 4DG1A 2DHGA 3D5MA 3G8QA 3RTVA 3RR8A 3J7Z5 1IKYA 4X65J 2B4OA 1NSQA 1ROFA 3DYAA 2PN6A 1HBNB 2IFXA 1WDDA 2DYAA 3LH2S 2IC3A 2XMWA 4O3RA 4RL1A 2EC0A 4DFPA 3IWNC 3DMJB 1CJVA 1VGYA 4LIRA 4ED1A 2DY1A 2NR0A 1AUSL 4Q2LA 2P6SA 1MU2A 3GLJA 3ILOA 3QNWB 3MM7B 3KLGB 1WKLA 4LQ3A 1S1WA 1VQOS 4K2XA 2KYXA 4TKTA 2R2RA 1U2FA 2O3DA 3X1LB 3DRXA 2QLFB 4UQGA 3GSDA 1NJWA 3JXOA 2R8KA 4F3MA 3BO2A 3LP1A 1CBKA 1HYSA 2UXDJ 4HDGA 3R7BB 1UPMB 3P49B 1FK9A 4YR2A 2FGOA 2W4PA 3EMTA 3KHRA 4X4QA 1O6XA 3PYEA 3SQGB 4CNZA 5A8WB 1RTDA 1JLAB 1IWAA 4PEOA 3CE8A 2C2KB 3W2VA 1NZAA 4B3MJ 1LWEA 1RB0A 4C8LA 3KNAA 1NH7A 1C1BA 3PW0A 2J6SA 1I5OB 3FZBA 3HO1A 2HVHA 5ETOA 2ZITA 1T9TA 1WC6A 3D3BJ 1VQKS 2LVWA 3IN5A 5F8NA 4ICLB 3DLKB 5K14A 1RYSA 2W2QP 4GVBA 2C2ZB 5BYRA 3H4DA 3MZIA 3G6VA 2HRTA 4ZLLA 1MWQA 1WC0A 2ZOFA 2J7WA 4TYAA 2HAFA 2VB6A 4C98A 5CYMB 1UAWA 4NLDA 3M8ZA 4MIAA 4N7TA 3HSZA 2GJ2A 3IR5B 4RJVA 1X4DA 1WF1A 3D66A 3IA0A 3EDRB 4DPWA 4OZ3A 3A8EA 2VUGA 3NGDA 1HBOA 4NLYA 1L3TA 4A8MP 2KDOA 3TO8A 4AFFA 1S49A 5CH7B 3CCUS 1S6QB 2RDJA 2DNYA 4F25A 2HEKA 2HHVA 3ZXWA 1NDCA 1L5UA 4ES2A 4RNHA 2R7VA 2NPIA 4B9NA 3VGUA 4FXVA 5E3RA 4ZLJA 2A3JA 3KJFB 3I0SB 1HR0J 4ELUA 2FLLA 3M6WA 3M4XA 3W7BA 3RZAA 2I8EA 2QYGA 1RWMB 3HP6A 2DRBA 4F26A 3K8WA 3FSYA 1MU2B 3MHYA 1UA1A 3G4SS 4TQSA 2NZCA 3IS9B 3O5TB 2DXFA 4JV1A 2XMJA 1FRKA 2LXIA 3K7RA 3I82A 2BOAA 3QT7A 3M2UA 4K4UA 2GAHC 2F4FA 3DRYA 1RT5B 3PCOB 4PYDA 4PQAA 2WBMA 3TA1A 3MMCA 1UWBB 4FVCA 1KVIA 2C42A 1F5AA 4FYYB 1FK9B 3IG1A 2UXCJ 3BGOP 3T5KA 5KFHA 3O6QA 2X1AA 3HF5A 2IYIA 3P6YC 1D8ZA 4IQXA 4PZVA 3KJVA 1UWAA 3WIUA 3J81U 2CG4A 1MROA 2J9DE 2MKCA 1FE4A 1GXTA 3I0RA 2M3DA 1C1BB 2CQPA 2DKOB 1ZA1B 1JLBA 4P7TA 2DR8A 1HWKA 3L95X 3MAQA 5M2PA 2GV1A 4MK7A 5B0FA 4FBUA 4IDKA 3M1VA 1PBUA 3ET6B 3ZTPA 4DLEA 2DCUB 2A6MA 4AQYF 2V4RA 2NREA 1NPKA 2IRXA 5ADZA 1JIHA 5K14B 2JEFA 2NXJA 2WRMA 2L9DA 2LMIA 1UCNA 2H54B 2FZKB 2LQJA 4UZBA 4OX7A 3TWZA 2HBYB 1G2EA 1TK5A 1CJUA 1XR5A 4Y00A 2V4JA 1X9SA 3MWBA 3NCRA 3GR1A 1A6LA 2HMIB 1AXQA 5KT3A 2ZH4A 4I2PB 3GG0A 4KGXB 4U7UD 4F4ZA 5I42B 2C3MA 1RA7A 4PXCA 4A47A 4ED6A 3V6DA 2P9EA 4TLRA 1E6YA 2V2VA 1TR0A 5GMKa 4F4XA 3KOAA 1XC9A 1LK7A 2KFYA 3DXSX 5DG8A 4BHQA 2ZDPA 4DS4A 2D1CA 4PG6A 3FEXB 3M2RA 1X7VA 1AFJA 1EZZB 4IRCA 1XNRF 2VBWA 3GJTB 3GU0A 1SKRA 2J7KA 2H5EA 4GKJF 3QJJA 1WG5A 3D6FB 4HHHA 1NM2A 3DLLQ 3FMWA 2KL8A 1RWOB 2V2KA 3OJUA 3GONA 2MPUA 4A8YA 3QGHA 3SFUA 2ZDOA 5DGAA 4USHA 2AW0A 4ZK7M 1U6FA 2CPZA 4QOTA 1K44A 1YJNS 2EFOA 3THTA 2QL5B 2YX4A 3IM8A 2J8AA 3DOLA 4J91A 1RBAA 3MMCB 1HBMB 4RPFA 4OX9F 2MZ1A 4CLLA 1FDNA 2RKIA 2OPRB 1MSWD 1X9WA 1Y0HA 2NXUA 4IKAA 3TAPA 2DNPA 1HNIB 3MEEB 3CMQA 3GZ7A 4F02A 2GCFA 3M32A 2RDDA 5B0AA 2KVIA 4UUWA 4XTTA 3K5LA 1GH8A 2Q6CA 2H9ZA 1CG2A 4B3RF 2RILA 5L46A 3J81Y 3HFVA 1GMWD 3CDBA 1WC3A 3O1LA 3MPDA 1HNXF 1SJ3P 1NH8A 4WTYA 2GW8A 1VBYA 4E98A 5KFLA 4J9QA 1U49A 1M5VC 4B08A 1IBMF 2K3KA 3CEDA 1R8BA 4OHXA 1T3NA 4B3OA 4KO0B 2KM8C 2DT9A 3R5AA 4KYZA 2D3O1 1VQ5S 1KS2A 1RAEB 4DV0F 3PX6A 4J37A 2FD2A 2LEBA 2Y0BB 1R43A 2B3TB 2IA6A 2L9WA 1YZ6A 3LOUA 2VG6A 5A6PA 1UFKA 1VFJA 4DBQA 4P72A 3P5BP 2R3VA 2VIHA 1ZAVA 4O0IA 2OPSA 3Q83A 2DH8A 1NKCA 4JI5F 2OHDA 1R3NA 3PW4A 2HIQA 1FRIA 2AF6A 4HL9A 2WK4A 3EICA 2YPYA 3BSCA 4DF8A 3EZ5A 1PJ5A 5BXIA 1WDTA 2KFZA 2DNNA 2CDRB 1ZPWX 3TJ9A 3BKUA 1Z4UA 2E5LF 4AQYJ 4NLUA 3KDOA 5LMNF 1NDLA 4FVMA 3I9V9 2KT3A 3RUBL 2DNMA 1S1UA 1AT1B 1M5PC 1Q81T 2MLZA 3OTDA 4NLSA 1B0VA 1CS4B 1X5OA 1B0TA 2F9DA 3R3TA 3KMSA 2OPPB 2A18A 2XBPA 1WOPA 3UN5A 2MTLA 3H5XA 4I2QB 5AXKA 1MN9A 4JP8A 1XR6A 1BQNA 1YDLA 5L9NA 1QJHA 3N5BA 1M0SA 1QSSA 1MG7A 2HK3A 4V19X 3DKDA 2B5JB 3DOLB 3ENAA 5JVHQ 2Y9HA 1UW4A 4DX7A 2DEIA 2OP5A 3GFYA 4M8LA 3ITHB 2OD4A 2VV5A 5KOXA 2KTQA 2CZ4A 2Y8YA 4ZVRB 3M9OB 3M32B 5K8PA 3C46A 1XNRJ 4U95A 2B8QA 1AW0A 4GKJJ 3HHEA 4WU2A 4AUKA 3TRGA 2WONB 4O3QA 4AXJA 1FKPB 1PJ6A 5HANA 4IFYA 4KPCA 4P52A 1KR4A 1RCXB 5H1SV 3MMBB 4DCJB 1YJRA 5EWEA 1PYSB 3AFGA 5BR8F 2GO8A 2J9DA 5B7WA 5KG1A 5B0CA 2Z4PA 4B17A 1ZAWA 3PKYA 3Q8QB 4RNNA 1Y5IB 2XMVA 2NXCA 2MKIA 1KHVA 1KOHA 5DS7A 4IYQA 3HX9A 5FD1A 3MM8B 4KHRA 4OX9J 2KJWA 2IVYA 5D77A 4CTAB 1RWWB 1OY9A 5IFMA 3W62A 1J5OA 3HT0A 3CIZA 1PYOB 4X84A 1RT6A 1U02A 3MM9A 2XYGB 3EE3A 1C2PA 5K8OA 2KHDA 2XO7A 3AOAA 4ED3A 1TVRB 3UCZP 2CJ9A 1ZM4A 4ED2A 3SEOA 2GJIA 1RHMB 4WK3A 2HIYA 4X64F 3DHXA 1FHTA 2CPFA 1K0VA 3H0PA 2ZHBA 1ZM3A 2ZE2B 3IRXA 3MFIA 1YSJA 2XYPB 2OJ3A 3D1QA 2I5JB 1SIZA 4URGA 4M94A 1S0NA 1P27B 1JLFA 4J9VA 1IR0A 1IBMJ 5D0HA 1TKDA 4RW8B 3DDIA 3B54A 5C7PA 1EP4A 2GQCA 5IT9U 2ASDA 1D09B 4DV0J 4NLXA 4CH7A 2GO9A 2QA2A 2LKZA 5HO4A 2X7IA 1BC6A 3CT9A 3MAAA 4OL8A 2XGPA 1H7WA 2MZJA 2DIUA 4OZNA 3T5HA 1OPIA 3ZZZA 2IYGA 4C3MA 3DDKA 4DQQA 3EGWB 4EZ9A 3VAGA 3EWGA 1VQYA 3GJRB 1BQXA 4KRWA 1NJYA 4DN9A 3QJLA 5HMZA 5F8JA 5KFOA 1WOSA 3C16B 4UOCA 4WFXA 1TL5A 2AJ1A 2GJFA 5AT1B 2E5LJ 3TEHB 4FYXB 5LMNJ 3C6TB 1JWWA 3PIOQ 3JYTB 2BQRA 2LQ9A 4LFCJ 4M5GA 3UD4P 4C0OC 4XK8C 3HVWA 2PFFB 1DJ0A 2BBEA 2WSFC 5HQLA 1V9OA 4U8YA 3NGRA 4OHZA 4JI3F 2JH3A 2FB0A 3CJ2A 1EKSA 2HNYA 3OL7A 2ALYB 3Q24A 5E41A 4QR0A 3FJ2A 1MNEA 4DWIA 3H25A 3KLHA 4YB5A 1VI7A 5M2UA 5C42A 1YZ7A 2DNHA 3CDWA 1GMVA 1WHYA 2GMLA 3E3XA 3RBDA 3RR7A 4ZVSB 1KEKA 3FRYA 2YWWA 1FF2A 1XN9A 2DGUA 4FXDA 2LQ5A 3DLEB 2Z2ZA 3R5CA 3GV5B 4NCGA 5D78A 2R7OA 3EXYA 2DXEA 2YQ3A 5I3UB 3BKTA 3G87A 4DOZA 3KMQA 1UFWA 4WFNQ 1BWEA 4RW6B 1NKBA 1VDHA 3ADAC 5BR8J 3E2EA 1RWPB 3LWMA 3M8PB 1F3FA 2DK2A 1H2TZ 3T9NA 3GP9A 4EBEA 2EK1A 1ZOTA 1EP4B 3ZZRA 3QSYB 3G96A 2FJWA 3GFZA 2L41A 2XI2A 2ROEA 3SMZA 2R2UA 3C14A 4ZOSA 5IT9Y 1JXEA 1HBUB 5T14A 4ZLNA 3GTYX 1S9EB 2KT5A 1WJ9A 4KBIA 2W9CB 5HMWA 5IM0B 1SIWB 5E5NA 3L09A 4LFAF 3L3CA 4X64J 1T9VA 1WTFA 1QAIA 2VICA 2D3ZA 1TKZB 2OD6A 2PI4A 1RTJA 4F36A 3DLJA 4MKVA 2DNKA 1GEHA 3PFOA 1WF2A 4CO1A 2JLFA 5GAGI 1XWLA 2DR6A 2DGVA 1VQSA 1LXJA 4BWJA 3SCIE 2VFVA 1NSPA 3BQ1A 2R42A 1Q0NA 1VJWA 3M2VA 2QIFA 3IGNA 3V6JA 1H98A 4FF4A 1RKJA 4TY9A 2CAJA 4YEAA 2VG5A 3FEZA 1SQGA 3NNAA 2QG9B 1X4CA 5K20B 3MDFA 3MR2A 3AAWB 4FPIA 4O44B 3M7VA 4DR6F 4EU0A 3TAMA 4F4WA 1SKSA 4K2JA 2R8HA 1WACA 1Q7LB 2W8LA 1B3TA 1TL3B 2HS0A 2NXNA 2IMWP 2HNZB 5LSLA 1FTRA 2MY8A 2PMWA 1ICEB 4KKOB 4NEZA 2BMBA 1D0EA 2MB0B 4EK2A 1IXKA 1O8BA 4Z2XA 4X4VA 4TXSA 4LR7A 5FIIA 4OX6A 1JLGB 2ZZNA 2DNZA 3T5JA 4P9SA 3Q8RB 5CCMA 3BM7A 4JI3J 3J81j 1DQ8A 2RQCA 2NSCA 2L08A 4BLGA 2AGQA 2V0NA 2MZQA 4HKQA 2E7XA 1CJKB 4ZCIA 3J7AN 3RB0A 1KTVA 4J9MA 1S4FA 4O4GA 2BJ8A 3S6EA 1R89A 3UR3C 2X1BA 5IC6B 3JSMA 1U25A 3CWJA 3RRHA 4WZMA 3MR6A 4TU8A 5D0RA 1D8YA 4NRUA 1K73T 4USMA 1FRJA 4G1IA 3CULA 1WEYA 2AYBA 2FVRA 5CD4H 2QA1A 4K50A 3CF5Q 2HFNA 2LECA 4OJ1A 3CD5A 1PYTA 4PG7A 2FHKA 4LRBA 5MAOA 4YS2A 3GB0A 3VVTA 2DIVA 4Q8EA 3BGFA 1PKUA 2D3OR 4ZPCA 2WVBA 1TUGB 2OEMA 1JJ2R 4U8VA 4DSFA 2ACMA 2E1AA 2E9ZA 1RKIA 2B51A 2W2OP 2DISA 4L75A 2GVDA 1N8RT 1LWCA 1IQTA 3CD7A 4ID5B 4IOCQ 1M90T 6FDRA 2QL9B 2VZ9A 2FC9A 1JLQB 4LFAJ 2JOQA 4F4AA 4QYZJ 1JKHA 3OBIA 2UVRA 3VWSA 3OXGA 1JLEA 5EX0A 2QTWA 3VAFA 3O2IA 4CM0A 4JV0A 5DLGA 2W24A 3NWRA 3M6UA 3M8WA 3AQPA 4PWDA 4NXNF 2BJEA 2K1RB 4FZVA 4O3OA 4CLSA 1X4FA 3O3LA 4OYAA 3NGSA 4W98A 4DR7F 3DNCA 2VU5A 3TVYA 1HKAA 4QIEA 3RGIA 5H9FJ 1TFWA 2LA4A 3G82A 4ZKAA 1T9XA 4DCOB 3N01A 4WP9A 1L3SA 4NX9A 3VAJA 5LJ3Y 2H65B 3W5YA 2XCPA 1SV5B 5DGBA 4UY8T 1FWLA 1C0TB 1RAIB 2UVWA 1U1MA 2M70A 3NS7B 4USJC 1VRUA 4CO2A 1A9NB 2G4BA 4TLQA 1IJFB 1TQLA 4DR6J 2ZJPQ 4OV1A 5LMUF 5A8KA 3CCQS 1SXLA 3LGHA 3OT9A 2CRLA 1WKKA 4LSLB 3K58A 3A13A 5JJBA 1S6PB 1C1CA 3AY0A 5GAEI 3CCMS 3V4MA 3P8BB 4EYHB 3EJMA 1EARA 3RG6A 1UJ6A 4P73A 4I56A 2VF3A 4F67A 5CZXA 1D9DA 2QL7B 2JC1A 4O23A 1RZMA 2CNKB 3PYGA 3M30A 2C3PA 3GG1A 1LNQA 5DDRC 5EDWA 2ZVIA 4DR3F 2RE1A 3SQOP 4CLKA 4NWBA 1H7XA 3KG1A 3MF5A 3BDPA 1VCTA 3DRRA 5DO2A 4DHVA 3DDNA 4BC9A 5CYQB 1S10A 1UVJA 2EG2A 1VC6A 2JDJA 3AXKA 2CNLB 4CQ1A 2QMXA 1RWUA 2IM0A 2NPFA 2HHQA 2AGPA 5L38A 1K8AT 3RB6A 1M1KT 3U1LA 2EPIA 1M1GA 1LW2B 2CYYA 3ZZOA 4RUHA 3OLAA 3C3LA 4C8YA 1TKTA 2KG0A 3HHNB 3G6XA 2HQCA 4OYOA 3QZ8A 4Q5VA 4MFBA 4R8UA 2CVEA 2X51A 3TX8A 3M8QB 5LM7E 1VRQC 4K4XA 1HNZF 1WEXA 4WKRA 4Y3CA 3FBFA 4ED5A 5KFCA 5LL6d 4Q43A 2JWNA 2RD5C 1SC6A 1M1HA 1WUUA 3KK2B 3TOQA 1SC1B 1YI2S 4WYWA 1NXIA 1XR7A 2RF2A 2E44A 2AD9A 3W3SA 2HURA 2G0JA 2PIIA 1FJ7A 4CLWA 3Q89A 3SSRA 3KLIB 1HQEA 2DBBA 2CPXA 5E2QA 1SL2A 1RAFB 2WW4A 1OY8A 1U0HA 2VPXB 3HHLB 4ZPBA 4WTOB 2F65A 2HS3A 3QWPA 2BX6A 1RT1B 4NLGA 1VK3A 1UVNA 2YNIB 1HMVA 1FT8A 1QE1B 2QMUB 2C2DA 1FVQA 4ZPTR 2Q43A 5AE2A 3QRQA 1HHQA 1PAEX 1H38A 2IM3A 1SL1A 4UOFA 2QN6B 4NXNJ 2F8MA 4NYOA 3HFKA 1X4BA 4DR7J 2BE7D 1NB2A 4BWMA 2R7QA 2ZBIA 1T03A 1QSYA 3TZZA 1HIYA 1KQGB 3LP2A 3OVAA 3I5CA 1P1TA 5GMEA 4DR4F 5CCLA 3LA0A 5AXLA 5T7LB 2XMKA 4L3NA 1RA6A 3CO9A 1CLFA 2DHHA 2K8GA 4DEZA 5ETVA 4ECSA 2HG4A 2HKEA 1NMEB 2W01A 4M5HA 1RGVA 1E6VB 3F56A 1X5SA 4LSNB 1Q7YT 2HFSA 2RNEA 3GV7B 1Q95G 1NSKL 2NLWA 1ZBTA 3E51A 1REVB 4G65A 1HHTP 1IBCB 1G3OA 1LK5A 4H4OB 4O3PA 5CA5A 5I3QA 3R5GA 4DL3A 3W8GA 1R6YA 4C7QA 3TZXA 2MKSA 3HDSA 1RT7B 4IH5A 4JI7F 2BXJA 3FSXA 2VC1A 3G9CA 3WIVA 2FC8A 2GHWA 4WZQA 2ZNZA 3BF4A 3OXLA 3NOCA 3RBXA 4DR3J 1RTIB 4MK9A 4NASA 2EXUA 1RSCA 4DL4A 5D8HB 2J6UA 5KFGA 1GX6A 2FHMA 1S9GA 4DPYA 4ZIVA 1H73A 4JUZA 4K4YA 2XHWA 1OQ6A 4AD6A 2RF2B 1Y00A 3MEDA 2PI5A 1IVZA 2C3OA 5GAHU 1NLKL 3VTIA 4CCHA 3VZIA 2YY3A 3H7HB 1HQEB 4KFBB 2GMHA 3C6UA 2HVIA 2HQFA 1X60A 4HDHA 2UVUA 1O51A 1TELA 3D54A 2MXYA 1R6VA 7FDRA 3H5SA 2HNDB 4WPAA 4RW9A 3BGRB 2IVMA 2BABA 3FCVA 2DXDA 1HNZJ 3I96A 1TL4A 2HHSA 5CABA 3AB4B 2IDEA 1HW9A 5F9NA 1Q79A 2QLWA 1RAAB 3KXDA 3U1NA 2YNHA 1NBEB 2KXFA 3A3NB 5DZ6A 4ZVOB 4ZVHA 2ZOMA 1AUDA 3VF0B 4R25A 3OTOF 4IG3A 3IR6B 4J90A 5KOWA 3LP2B 1NUEA 1N88A 1FFGB 4OYZA 3RRGA 2HW3A 2OTJS 2YNFA 5EN1A 2PEBA 2HHTA 3E01A 4AT1B 5H9EJ 4QYZK 1UPPA 3GFHA 2CIMA 1H2VZ 4U9RA 1UEUA 2AQ4A 5J2NB 2JFDA 1RWVB 2Z2YB 1HARA 2DRAA 4ECXA 2CPEA 3H4BA 2BR0A 3UI3A 2FTRA 4LF9F 1YBTA 2ADCA 4UOHA 3I5BA 2DVIA 1JNZB 3MM5A 5CD4A 1D9AA 4CLPA 2IJFA 2HWIA 5DDQC 3LO3A 1SQFA 3M8RA 2FZCB 4LF2A 4FKXA 3D1HA 3EYZA 2VG7A 2VBZA 3W65A 2GVZA 4RKUC 1TKXA 3CGIA 4NI2A 3RU0A 3LANA 4FKYA 3WDOA 1FWPA 2ZOGA 4DR4J 3OW2R 4X2BA 3A8IA 2DH9A 4OLOA 3C15A 1KD1T 3A12A 4I4BA 1BQMB 1X4GA 1IUJA 2WAQD 2EW9A 3BSNA 3G6ES 1U26A 3PJXA 1G6BA 2MYFA 4FXWA 2AMCB 4C3LA 1SUQA 3TQEA 2P5VA 3GIKA 4X4NA 1RHUB 2RVJA 2UUCF 3OPKA 1WNEA 2B4VA 3DM2A 4UW2A 2MKYA 1QUPA 3T6JA 3CJ0A 4ZITA 3QRRA 2AJFE 3HKZD 4KPYA 2CJQA 4TN2A 2AHOB 1ZTWA 2A2DA 4N8OA 1YJUA 5I4MA 3US5A 3W5ZA 2CA9A 4UTGA 3CCES 2ZD1B 4Q7AA 3AHPA 1K1SA 1RHQB 5KFZA 4FF2A 3KHHA 3KTQA 2YNHB 4FYWB 3HD1A 4OZ5A 2GIQA 4JYAJ 5AXMA 5HLFB 4G6VB 1K9MT 2HFOA 3B8HA 3GJQB 3RYLA 4CO3A 1EETB 2LLZA 3FDSA 3IAS9 2QSFA 1Y3JA 2HZCA 4LF4F 5GMDA 2LP4A 2NUUG 2XMUA 3P3DA 3DOKA 2MDAA 2D41A 3OFGA 4CWBA 4X4TA 1CVJA 1YRXA 1BHNA 1FCAA 1HD0A 2KJVA 5KFDA 2E29A 4K8RA 5B0BA 2B7CB 1KP6A 3GQCA 2VODA 3HSJA 1HQ2A 3CJKA 2FDNA 3W60A 1IWGA 2IBOA 3LAMA 4JI2J 4DL7A 2M88A 4F2SA 2EFNA 1TP7A 2H5JB 2ZBPA 1RCOB 1T3OA 2N3LA 3SDEA 1RACB 5LXRA 3JAMY 1APSA 4RW7B 1KN6A 4AYBD 3RBZA 1FEHA 1LWFB 2D74B 5HBMB 3OTOJ 3UFCX 1TTHB 3TZWA 5HVGA 5L1IA 1NDKA 3HSDA 3TA2A 3KNGA 3BR9A 3UNYA 1HQUB 1JQGA 2MMYA 2FVSA 3AB2B 3K2YA 1NKEA 1BY9A 1QUVA 1HHSA 2FHOB 4IFVA 3AXMA 2XS2A 1QY7A 3BH7B 2ZZTA 3BN4A 3BYRA 3O8WA 5KFSA 1QVFR 2K3IA 5L1KA 2O5DA 3TA0A 4ED8A 4LF9J 4QWEA 3R7NB 2DRDA 1VRTA 3PO5A 1JMTA 3U27A 4PWWA 4WJBA 4A4JA 1UVKA 5T41A 3DM2B 2VKRA 3QJPA 3DI6B 1PC4A 4BCAA 3KLEB 4Y2MA 2GHPA 1V3RA 2MGZA 4QR2A 4EBDA 3DGVA 3PJWA 2BACA 2BZ2A 2LEAA 2MQLA 4PAAA 3I56S 3B78A 2KZMA 2GIRA 3I32A 3D1OA 1WORA 1S0MA 2DR9A 3NAIA 1YITS 1GTHA 1R8PA 1M5KC 1L3KA 4MKYA 1UTAA 3F0NA 4J9SA 4UUXA 2GMJA 2XMMA 4F4YA 4H4MA 2KH9A 5HROA 1NPRA 1RU2A 2FQQB 3NS5A 1UA0A 4LUBA 2PA3A 2DR5A 2RUGA 4QW9A 4FF1A 4ZPVR 3MM6A 1RDRA 1FD2A 5BJRA 2B0GA 4ILRA 2GAGC 1IQZA 3EDQB 2UUCJ 1U1KA 3MUMP 3DGPA 1DTQA 1PGZA 1V3SA 3BYPA 4B9SA 3NMRA 5J2MB 3V5RA 1XNQF 2XMTA 2GQQA 2BE2B 1U4BA 5F0WA 3UCGA 2HLUA 4NLPA 3S8SA 1ZS6A 3I6PA 2OFGX 3AODA 2PE8A 4DR2J 2KG1A 1FD8A 4WYLA 1IKXA 3CPWR 1LOUA 3K89A 5FJ4A 9ATCB 2ZH3A 2EI5A 4MH8A 2XNRA 4Z7CA 4A46A 3LALA 3QIPA 4ETZA 2BYCA 5IT4A 2ZH6A 4LF4J 1RTHA 1TV6A 1YK9A 3PW5A 1P9YA 1KBRA 3W1YC 5ETPA 4NEYA 2FJBB 3KK1A 1T11A 3R2DJ 1NAQA 1S77D 5D0GA 4DXLA 1U48A 3JQKA 1XMBA 4USKA 4JI0F 3TP2A 2K06A 3PNIA 1O5JA 2HHXA 1S1VA 5C24B 1X5TA 4J9UE 6FD1A 4ELTA 3W2WA 2AT1B 3D6MB 3IBWA 5HAOA 3T1YF 2FPHX 1Y5NB 1H74A 3DRSA 2ZC4A 3WZ0A 3MURP 1YVFA 4TVAB 2HGMA 2MHNA 5J1NA 4ETXA 1KOOA 2JLEA 3LAKA 2XSJB 4RU9A 4K0KF 4FYDA 1EQ0A 4L3KA 1DTTB 4OZ2A 1GAOA 6AT1B 2BANA 2EKYA 2QRRA 2HVZA 2XB2D 3QSIA 5H9EK 3ZNUA 2RH3A 3UWTA 3AJ2A 2XYHB 4YDDB 1SKUB 4ZA1A 2AWZA 4IUFA 4AL7A 3CCVS 4QIGA 2MJUA 2OPQB 4M5KA 2W2MP 3ZZPA 5HP1A 3W5XA 2W9BB 2CJYB 2ZBRA 2GGPB 3G8SA 4DLGA 3QZ7A 2EVZA 4NLOA 1U1RA 4EEYA 3NBPA 2BE9B 2C2NA 4NLQA 1U1QA 4I64A 4LRAA 2FUG9 1F60B 1K0TA 1HNVA 5IQ6A 1UL3A 4I6WA 3FSIA 4YY3F 1RT2A 2D9PA 4OFZA 3T19A 1DTQB 5L1JA 2VJVA 2MQMA 1IM4A 5B0DA 3DHWC 3EVOA 4EUVA 2NCKL 2OMLA 2QMWA 3I4PA 1PILA 3IO1A 5KG5A 1T95A 5J2PA 1HD1A 4Q2MA 1NCLA 4PQUB 2IA0A 1FJCA 4WBFA 5D6GA 1YGYA 2A6OA 3EPIA 5KT4A 4WE1B 1JNRB 3EZUA 4U7UK 2DGXA 3QGPA 4C11A 1PG5B 2I2YA 1OYEA 4OJHA 2GQ2A 4LQ9A 3R1LA 1DLOA 2CZVC 1P8GA 3L7UA 4KHMA 4WF9Q 4URQU 3H90A 3Q8SB 4OI6A 3H5YA 4KY3A 1DARA 2DCLA 5ETQA 2MSTA 2J9CA 1B4SA 3MCOA 8AT1B 3ZTSA 4Y0FA 1Z2LA 1XNQJ 4DV1F 5KAKA 2V6AA 2UUBF 4NPOA 5RUBA 4X4PA 2R8JA 3JS9A 4DUTA 3VAIA 3OVBA 2EBEA 1PIEA 4IO9Q 3M9MB 2RQKA 1Q8BA 2OI2A 2LEPA 2IRUA 4DMZA 4PYAA 1JLCA 4QU7A 4CT8A 2QE5A 2KT2A 4RLEA 2Z8QA 4ZHRB 4Y28C 4KGZB 2IIHA 5J2QA 4DV5F 2F8HA 2VKZG 4MAKA 3D0GE 3V6KA 2DGTA 2YNGB 3KK3A 1F5BA 2MLYA 1YJ7A 2CNNB 1N48A 3BDEA 1RABB 4PCQA 4JI0J 3R7SB 4KV8A 2Q79A 3NWGA 2CFXA 1HWIA 2DNLA 3T1YJ 1RT4A 4PR6A 4HI1A 1IKVB 1YRUA 3BBCA 4CLFA 3RB4A 4RNFA 1OYDA 2DNQA 1T05B 4OLPA 2OSRA 3GIRA 3CW2C 1R0AB 1NHVA 1PJ7A 5F0UA 2VDIA 1ULRA 2V67A 1CJTB 2ASJA 2E5GA 4HACA 4RUCA 2B7BB 1EAYC 3SV4A 1CULB 1HI0P 3UCUP 4USIA 3UVJA 1LQ9A 4DZDA 5DJBA 5CAAA 4BC7A 5GADU 3MECB 3BS9A 1C0UB 4F0HA 1FWKA 2NZ4A 2DGOA 3W9HA 2KFNA 4LMZA 4C11B 4EFAC 4CRJA 1U24A 1U1LA 4B3SF 4NYPA 1TMJA 3FNNA 4N8NA 3SCJE 2HYIB 2W7PA 5F41A 1PBAA 2DPJA 4YY3J 2W8KA 4HHUA 3LP0B 4HLBA 1I94F 2XY6A 2YKOA 1RT3A 2QGFB 3HI9A 1SKWA 5DG9A 3FFIA 1FJGF 3HT3A 2MSSA 4OYPA 4ZVTB 2W2NP 4USVA 2LDIA 5KFWA 1WEZA 5FDLB 2KXNB 2RQ4A 5IWAF 1LW0A 4DX5A 2FLPA 1AZSA 2XTJP 3DRPB 2RDIA 4ECZA 3PX4A 1N5YB 3V4IA 4PUOA 2IJNA 3PYFA 1GXUA 3MPWA 3QO9B 3NG8A 5J1EB 4DFJA 1VOMA 2RRBA 5J2QB 2NYHA 3CC2S 2M8HA 2HVEA 2BA9A 2YKNB 5BYSA 5D3GB 3HSGA 2HHHF 3L7PA 3VALA 1TL1A 2AX0A 4DG1B 2JLGA 4DR1F 1H2UX 2M4MA 3PACA 2UUTA 1IKYB 2N82B 2CJBA 1UVLA 2IVFB 5CXTA 4PPZA 5KT6A 3DFEA 4ENOA 3DYAB 4DV1J 4GC6A 3B4DA 2UUBJ 2XLJA 2IC3B 4URSA 4OHYA 4TY8A 2KU7A 1U09A 5E3PA 1TMMA 2NQPA 1CJVB 1QTNB 1TK8A 3P45B 1JJ4A 2ZNYA 2RHQB 3KUEA 2CQDA 5KFYA 3KLFA 2EFPA 4F0KA 4UT4A 1TFYA 2GX8A 2QC3A 1S1WB 4DV5J 4F2RA 1MLAA 3KG4A 4RO0A 1FRXA 3HK2A 1X31C 3WBZA 2D3UA 2H5IB 4ZVGA 3LP1B 3OSNA 1HYSB 1XIQA 3BH6B 2ASYA 2PO4A 2Q6BA 1NDPA 2E7WA 1WHWA 2CQ4A 1U1PA 2OLWA 2YWGA 1W26A 5GAHI 1RTDB 3QFHA 2OAUA 3OJSA 4TYBA 3MMAA 2XNQA 3W2VB 3KHGA 1S5ZA 1LWEB 3VAMA 5GAEU 3OHAA 1RT3B 1CQMA 1ZPVA 1W2BR 1S9FA 3OR1A 2Y1IA 5LT5A 1DAXA 4CO0A 1YJWS 1U1OA 3PM9A 2OEJA 3UNGC 2BJ1A 1OIAA 4BS2A 5HJYA 4ECUA 1AZSB 2HFUA 2MQQA 4GVBB 2AV5A 2HFVA 4ILMA 1X0PA 3FZ2A 3N28A 3V81A 2Z30B 1OMSA 4PUOB 3A3PB 4M63A 4FNHA 4EWTA 2DNOA 1Q5VA 1VLYA 1S97A 3QFWA 2XY5A 2CKWA 1UZHA 3OR2A 3QT6A 1Y5LB 4B3SJ 1HBOB 4M5NA 4U96A 1QM9A 4WFYA 4W90B 4HHJA 1R31A 5KFEA 3DU6A 2HHWA 4OZ0A 2UVVA 1NPPA 3CB4A 1I94J 2V8DA 4IQMA 4LF1A 2MKJA 1FJGJ 1Y11A 3H59A 2B6AA 3EUNA 2HVDA 4M5LA 3MXHP 2YH1A 4ITSA 3GCWP 5IWAJ 1FE0A 1VQLS 1ZM2A 2W4DA 4GRSA 4K4TA 5U47A 2YWHA 1B7FA 4JI8F 2G1DA 4DS5A 2RT3A 3S1TA 1P6TA 3BJYA 3KJNB 5F9LA 3R27A 3ETMA 1NK0A 1Z1ZA 3MAHA 4WFBQ 1KQSR 3M2UB 1R7IA 2BKPA 4P6QA 5KG3A 4GMKA 3GMGA 4WFAQ 1SBRA 1GMUA 4CDIA 2HHHJ 4DR1J 3IP0A 1FRMA 3WC2A 1T9YA 3IG1B 1NHKL 4LR9A 2P9GA 2OFHX 1AA1B 2BQUA 2F4VF 3THPA 3H40A 3R5BA 4ZJQA 4USWA 2A10A 4H4KA 3HPOA 3MMAB 3KJVB 3OVSA 3PRBA 3OUYA 1MROB 2M5YA 1HNWF 3I0RB 3CCJS 3OFFA 1ELOA 4OYBA 3QLHA 1W2IA 1JLBB 2HS4A 4J9NA 3G86A 4MYTA 3HVTA 3OR1B 3HXMA 2F3JA 4H54A 2VC0A 3DOMA 1S0OA 4MKAA 2H4WB 4IDKB 3M1VB 1NK6A 3TR5A 4JV5F 5A0YA 3J80U 3LGNA 2DEJA 2POKA 1QTMA 1T94A 4M5DA 4DL5A 1XBWA 3KDNA 3SSSA 3R8YA 3V81B 1CJUB 3I5AA 1FKOA 2V4JB 4CYUA 1KDNA 1U2CA 2ZKTA 3QT5A 2LYVA 1HPZA 4P2MA 5E0OA 1N6QA 3NXZA 4U6PA 4R5PA 3VQTA 2VPYB 3CCZA 3HD2A 3V6DB 3FUYA 1E6YB 2MQNA 5C25A 2J0QD 2E66A 3R5JB 1SCJB 1NO8A 5F8GA 4Q0BA 3M2RB 4Z37A 4UQTA 2ROGA 2IDLA 5KFBA 1HFEL 2JSXA 1KLNA 4N76A 3PY8A 4IG0A 1JK9B 3MR7A 3MEGA 3WX4A 1SC4B 1YG0A 1HI1A 1R0CB 2V94A 2RUSA 1X8DA 2DNRA 3ZZ0A 2J0SD 2ZHOA 5G4DA 2ASLA 3RW6A 2XLIA 4JOUA 2GHVC 1M5OC 1S72S 1S7IA 3DN9A 4CO5A 5A6WA 1VC0A 2XSFA 3U7JA 3F44A 3M05A 3CJQA 2RKIB 3HFZB 3N4WA 2M0GB 2XS7A 3BR8A 4NLTA 3ETOA 3MCSA 1KNZA 4KH0B 1QLNA 2N4CA 1UVMA 4DF4A 1TUWA 4Y65A 2DGSA 3JSRA 4IRDA 2CXEA 2XS5A 4DPXA 4ZJLA 3EXCX 2VL1A 1TL7A 1FDDA 3CJTA 1HI8A 1N54B 4RBVA 2ZEJA 2V8VA 3S01A 2VA3A 3ZZTA 4W4MA 1MW7A 4N77A 4RW4A 3OTEA 3J80Y 1V3ZA 4B3OB 2B9XA 2PDAA 4MKBA 4DV6F 1KHWA 2CWKA 1M5HA 2DHSA 2ZH2A 1BUXA 5IC4B 3FC9A 1T9UA 5ETNA 2HQGA 1FTCA 4P74A 4ZDNA 4TQRA 2V50A 2CQHA 2VG6B 2OPSB 1HNWJ 5ETTA 4I6YA 1BE4A 5BYQA 2YBVA 2KRBA 5C25B 1A0OB 2ACYA 4B3RJ 1MMDA 2BRLA 5HK4A 2V9KA 2LXUA 4P2SA 3GIIA 1LKZA 4A8WA 3PW2A 4C4WA 4NZ7A 3BQ2A 3THVA 4A8KA 2BKOA 1HNXJ 4JV5J 4OHVA 1VQMS 7AT1B 1WSRA 3D7SB 2GNKA 5ETRA 5G0RA 1N0UA 5A8RA 4XIUA 4IG0B 3FCWA 2AU0A 2HRUA 4N5SA 4MYUA 1RWKB 1S1UB 2WB4A 4ERDA 2H4YB 2LQ8A 4DI6A 2XEXA 1VBZA 3IM9A 4WIQA 4HT5A 3OLBA 2D9OA 3MTJA 5LXYA 1KRPA 4DQSA 2HPUA 3OTCA 2OTLS 2ZUGA 5K8NA 4LREA 3PVXA 3BGLA 1BQNB 4DX8H 2CJKA 3N6MA 2ZJRQ 1HBNA 1N5TA 5HATA 4OJ3A 5DM7Q 4JI5J 3MMJA 1VBKA 4TU7A 3FRZA 4ZCMA 2XMAA 2FYXA 2JZ5A 2KO1A 1FJEB 4X4OA 3QBCA 3NNCA 2HHUA 3AD8C 2FY1A 3MM7A 1YKWA 1IM6A 3D0IE 3KLGA 4KH1B 3CCRS 5F8MA 1VQ6S 5IT0A 4AXIA 2VFSA 4IFYB 1S12A 4U67Q 2Q66A 2HWHA 2KI2A 2LFVA 1RJJA 1SH2A 2Y1RI 1S6UA 1RLCL 1MMLA 3A8KA 2V63A 5A8WA 2GS8A 2QLJB 2YPZA 1JLAA 2YKPA 4Y2KA 1GX5A 3W9JA 2B9EA 4P71A 2ZC3A 4ZPWR 1R27B 2R4FA 4C8MA 3GCXP 3MPYA 1J5OB 2ZBCA 3GYNA 4QZVB 4MIBA 1RT6B 3SI8A 4LF6F 3MM9B 4Q45A 3KWMA 4X66F 3P5TL 3ZZYA 2JC0A 4L74A 2DNGA 4ZP6A 4ICLA 2XO6A 5IQQA 2MY7A 4M5JA 4IH7A 1S6OA 2RRAA 2JEGA 2LXFA 3IRXB 3R97A 3K5NA 1LFWA 2HBZB 3PRDA 2YTCA 5CYMA 2BW7A 1VC5A 1JLFB 4C48A 4OI0A 1IBKF 1B0PA 4P10A 1H72C 1MN7A 3VCDA 3TVKA 3T3FA 4YUDA 1L3VA 5I3PA 2YH0A 2MZRA 4YQWA 2L3MA 5F8IA 1S1XA 5IXUA 2UXCF 1S6QA 1N5QA 3MAAB 4OZJA 3PFEA 4NCAA 5SUHA 3HHKA 3ZTRA 1VK8A 1WELA 2Y8WA 4OJGA 2DO4A 3I0SA 3NS6A 4WXOA 4MIWA 1RHJB 3DCAA 4OV6A 2IJRA 3CJ4A 2BJ9A 2R7XA 1SH0A 3MUVP 3CDAA 2E9RX 2U2FA 5IOLA 2IY5B 4K5SA 3BB5A 3IS9A 2G2ZA 8ATCB 2LU1A 4YR3A 1Q53A 3TJ8A 2DGWA 4NA3A 4N56A 4GVLA 1RT5A 3NKYA 2E1PA 3M6XA 4RU2A 1UWBA 1XQIA 3NCPA 1FXRA 2HNYB 4M1KA 3SCLE 4K4WA 4RUBA 3C2PA 1ZA2B 2OO4A 3KLHB 3N6LA 5C42B 4OYIA 2JL9A 1PO6A 1JJHA 3EPGA 4F3QA 5HMYA 2VHGA 3JQJA 3ET6A 3H5UA 2SXLA 3EM1A 4DQPA 2M2BA 2E9TA 1XK8A 2PGCA 4NCGB 4IR9A 4C9DA 3EZOA 3KUHA 4NZ6A 1NHUA 2WVDA 4CNYA 4CO4A 1YBUA 1EQMA 5GADI 2HMIA 4K7QA 1Q8KA 4UY85 2IBKA 4I2PA 2RB7A 2EG1A 2Z57B 5I42A 1Q1KA 3LGMA 3KG0A 3C14B 1LXNA 4QIVA 2N3OA 4OHWA 3J7ZT 1S1XB 5IV4A 2LQBA 4LF6J 2C2RA 3MD3A 4X66J 1NK7A 3E8OA 2VFRA 4C8KA 3TI0A 3VHQA 4KJIA 3NLCA 2VFUA 5KFXA 4ZVQB 4RWXA 3CNQP 2Z2MA 5DQGA 3JSBA 4CI0B 3D2WA 3BO4A 1I6JA 1DBDA 4WCEQ 1KFSA 1RTJB 3SXLA 3D6HB 5L1LA 1U1NA 4NXMF 1ACMB 4B9LA 3CC4S 2BW2A 1IBKJ 1VHFA 5K8MA 2FHJA 2ATCB 4DSIA 4QWDA 3TQ1A 5HI7A 1TZ0A 1GQEA 4EYIB 3AA9A 2GIFA 1HBMA 2JVRA 3K0JA 1AB8A 2YQ0A 4RUAA 3TUZC 3RAMA 4OYWA 2H48B 3M2VB 4H4KC 2OPRA 1OPZA 2IM2A 4ED0A 3TAQA 3EX7B 1GNKA 1HNIA 3MEEA 2VG5B 4XDCA 4XAKA 3GFXA 4NMXA 3JB9k 1N32F 3AH6A 3MEKA 3HULA 4S0MA 5KTQA 3TAMB 4ED7A 2UV8G 2R2TA 2WVEA 2QA4G 2BOPA 1WG1A 1RTZA 3H20A 2CWXA 2YX7A 1D3WA 3H98A 4M5IA 3A8JA 1HW8A 1ZETA 2BVZA 2WHOA 2E1MC 2QJ3A 1ZAXA 4A8SA 4QR1A 4JB8B 4KO0A 3G71S 4MJKA 2XGQA 2XZWA 2B56A 4X4UA 2H51B 2FIUA 2X1GA 1V6HA
chains in the Genus database with same CATH topology
3HD1A 3ILLA 3HT0A 3ILIA 5ETMA 1RAOA 1RU1A 4M5JA 1TMMA 5ETOA 3MCOA 3QBCA 4M5MA 3IP0A 4M5HA 4CRJA 1CBKA 3ILOA 1TMJA 1RU2A 1EQMA 3HSDA 2CG8A 3KUGA 3MCNA 5ETLA 5ETKA 4AD6A 1RTZA 1KBRA 3KUHA 2F65A 4F7VA 1IM6A 1RB0A 4M5NA 5ETPA 1HKAA 1DY3A 5ETTA 2F63A 3HD2A 3HSJA 3KUEA 3UDEA 4CYUB 1F9HA 4M5KA 1HQ2A 4M5IA 4CYUA 1Q0NA 1G4CA 4CWBA 2QX0A 3HSGA 4M5LA 5ETSA 3UD5A 1EQ0A 5ETRA 3ILJA 1EX8A 3HCXA 4M5GA 5ETNA 2BMBA 5ETQA 5ETVA 3MCMA 3HSZA 3UDVA 4PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD1 A;  3ILL A;  3HT0 A;  3ILI A;  5ETM A;  1RAO A;  1RU1 A;  4M5J A;  1TMM A;  5ETO A;  3MCO A;  3QBC A;  4M5M A;  3IP0 A;  4M5H A;  4CRJ A;  1CBK A;  3ILO A;  1TMJ A;  1RU2 A;  1EQM A;  3HSD A;  2CG8 A;  3KUG A;  3MCN A;  5ETL A;  5ETK A;  4AD6 A;  1RTZ A;  1KBR A;  3KUH A;  2F65 A;  4F7V A;  1IM6 A;  1RB0 A;  4M5N A;  5ETP A;  1HKA A;  1DY3 A;  5ETT A;  2F63 A;  3HD2 A;  3HSJ A;  3KUE A;  3UDE A;  4CYU B;  1F9H A;  4M5K A;  1HQ2 A;  4M5I A;  4CYU A;  1Q0N A;  1G4C A;  4CWB A;  2QX0 A;  3HSG A;  4M5L A;  5ETS A;  3UD5 A;  1EQ0 A;  5ETR A;  3ILJ A;  1EX8 A;  3HCX A;  4M5G A;  5ETN A;  2BMB A;  5ETQ A;  5ETV A;  3MCM A;  3HSZ A;  3UDV A;  4PZV A; 
#chains in the Genus database with same CATH topology
 4P2F A;  3G2X A;  2RU9 A;  4I68 A;  2C22 A;  1S79 A;  2ZH8 A;  5CZV A;  4YME A;  3GSI A;  4AL6 A;  3SBM A;  3B82 A;  2JX2 A;  2QT7 A;  1VBX A;  3QMQ A;  5C5J A;  4O4G B;  1NK8 A;  2DY9 A;  5AJ3 F;  4CP5 A;  2GA7 A;  1VLO A;  2VQE F;  3IBC B;  2C2M B;  4QW8 A;  2AKW B;  3JSM B;  1Y4Z B;  2RAQ A;  4EO6 A;  4HI2 A;  3P4U B;  3W64 A;  2VDH A;  3IWL A;  2B9Y A;  3PEJ A;  1VQP S;  4UF4 A;  3HZE A;  4K59 A;  1FDB A;  3SYZ A;  1RK8 A;  2U1A A;  1YTY A;  1OY6 A;  4DSL A;  4LF8 F;  2F5G A;  4F04 B;  1NU4 A;  3FKB A;  2CAD A;  1NK5 A;  3FBB A;  3K57 A;  1U8W A;  5ETS A;  2WSC C;  1CS4 A;  3SIP B;  1YJ9 S;  2F8E X;  4LF7 F;  2OPP A;  4X62 F;  2BQ3 A;  4I2Q A;  3FMB A;  4LRC A;  3ULH A;  4LVN P;  4AND A;  2VFT A;  2XUL A;  4KB7 A;  2UU9 F;  4WWS A;  4G1Q A;  4OI2 A;  2B5J A;  1X0F A;  3AD9 C;  2GVD B;  3PKM A;  2UXB F;  4FS2 A;  4OYX A;  1VHI A;  5DDO C;  1WKJ A;  3N9U C;  1QAX A;  3ITH A;  1LWC B;  1K1Q A;  1JX4 A;  4QPT A;  4RZR A;  3AOC A;  2AGO A;  4XO0 A;  4ZVP B;  4QIW D;  4O4R A;  1WG4 A;  4WU3 A;  4LSZ B;  3CC7 S;  4ZLP A;  2XI3 A;  1JKH B;  1J2V A;  4P2X A;  3TX0 A;  4WP8 A;  3GIJ A;  2WON A;  1FDA A;  5D4L A;  3ILL A;  1FKP A;  1JLE B;  2KZZ A;  3OTB A;  4RBU A;  4JI4 F;  2I1R A;  2PC6 A;  2YKM A;  5DET A;  3M6V A;  3MMB A;  4NXM J;  2EKN A;  3DLH A;  1WD6 A;  3IMQ J;  4NA2 A;  4PWD B;  3G8T A;  4KGK A;  4GO5 X;  2YXL A;  3BQ0 A;  4HH0 A;  4CLZ A;  1F9E B;  2R7U A;  3J7Y U;  3IBF B;  4E8U A;  2MKK A;  2MLX A;  4KHP F;  2QZ8 A;  2NSB A;  5D4P A;  2ZBQ A;  1PAU B;  2HBR B;  2O1P A;  2ATL A;  2HZV A;  1VYA A;  3MM8 A;  4Y34 A;  3G82 B;  4CTA A;  1X4A A;  3PR5 B;  4QWC A;  5B0E A;  4CZC A;  3PEH A;  1U6Z A;  5HN0 A;  1TAU A;  3ISN D;  4XDD A;  3MPU B;  2XWX A;  1FRH A;  2CQ3 A;  3PX0 A;  3OQ2 A;  5KFP A;  1BXN A;  1N32 J;  1VRU B;  3DXB A;  1TVR A;  1UEK A;  2PD1 A;  4NLR A;  1XER A;  2ZH5 A;  2KKH A;  2X1F A;  2D7S A;  1B7Y B;  4NZ0 A;  3Q2S C;  5A8K B;  5ETL A;  5D4N A;  3ZC4 A;  1DFD A;  1L3U A;  2ZE2 A;  1C1C B;  3MFH A;  3PXG a;  2J76 E;  4CT9 A;  1U2R A;  2Z58 B;  1YIJ S;  2CPI A;  2V69 A;  2I5J A;  1BWV A;  3UE2 A;  3CCL S;  1EHW A;  3CO0 P;  1B99 A;  4RW8 A;  4N47 A;  2N7Y A;  4LFC F;  3SCK E;  3M30 B;  3W66 A;  5KFT A;  2HLT A;  3MCM A;  3BZQ A;  4DU7 A;  2EFG A;  2F1F A;  1IR2 A;  3EGN A;  3PIP Q;  5KG7 A;  5KG2 A;  3QID A;  4JV2 A;  2Z2L A;  3DRR B;  4NRT A;  2K2P A;  4G1Q B;  3BSO A;  1VIO A;  4HVZ A;  2EC2 A;  3TYT A;  1WTB A;  4WFZ A;  4YP3 A;  5L9X A;  5F8H A;  5AJ3 J;  2AZ3 A;  4LVO P;  3KLV A;  2IHR 1;  2VQE J;  2MQ8 A;  1FX4 A;  5LMU J;  5HMX A;  4PXD A;  3OV7 A;  1UEV A;  4E0D A;  3Q23 A;  1YRT A;  1Q78 A;  3C16 A;  8RUC A;  1VQ4 S;  2WTF A;  2HQ3 A;  5DQI A;  4B9T A;  4B3T F;  5D15 A;  1TKT B;  1ZZN A;  2OSQ A;  2HWT A;  4GKK F;  4MFB B;  4R8U B;  3C6T A;  4LF8 J;  2RIJ A;  4PG4 A;  1A7G E;  3JYT A;  2DD8 S;  2P2C B;  3EGZ A;  1UJ5 A;  9RUB A;  3WX8 A;  2BEF A;  1N33 F;  2YKM B;  1Q82 T;  4LF7 J;  4X62 J;  1Q5Y A;  4HYK A;  1KWM A;  2ZWP A;  1NB7 A;  2W2P P;  4NL5 A;  2PSZ A;  1DQA A;  1MMN A;  4MMO A;  4LRD A;  3NGK A;  2V8P A;  2UU9 J;  4C8O A;  2WW8 A;  3UDL A;  3PHE A;  3QPI A;  4F3O A;  2MQP A;  3L9Z A;  3CMA S;  4QYR A;  2BKN A;  4ZP7 A;  2UXB J;  2VPZ B;  1TUV A;  3Q8V A;  1S48 A;  1WI6 A;  1QSL A;  1U0H B;  2PMZ D;  1F1B B;  2B9W A;  2H3E B;  1YJV A;  3ISN C;  2EBG A;  1HMV B;  3DLE A;  4JI6 F;  2YKQ A;  1YJT A;  3GJS B;  4LFB F;  1RI7 A;  5I3U A;  1NJX A;  4P75 A;  4JI4 J;  2FVC A;  3OL8 A;  4RW6 A;  1OSC A;  3DU5 A;  1SVD A;  3M8P A;  3TAN A;  1QVG R;  3PJ9 A;  4KSE B;  4V1A k;  4DFM A;  3RW7 A;  1FES A;  2ZKU A;  3IC1 A;  4KHP J;  2HSE B;  1N5S A;  1T03 B;  5F3T A;  1MWZ A;  5HSP A;  3D9B A;  3CCW A;  4OYM A;  3PDN A;  3L4B C;  3CJR A;  2VOP A;  3O44 A;  1WC1 A;  3AD7 C;  2R8G A;  5MLC V;  1HBU A;  4DZ6 A;  2I0X A;  2N7C A;  4L73 A;  3Q0A A;  4FS1 A;  1S9E A;  3UDV A;  1WI8 A;  4DX6 A;  3UO0 A;  3VV2 B;  2W9C A;  5IM0 A;  3RB3 A;  3R1H A;  3HVA A;  4DCP B;  3GE9 A;  2R7T A;  2AJ2 A;  3D6T B;  3DLG A;  5M2R A;  3H42 A;  1TKZ A;  1KVJ A;  1W25 A;  4J9K A;  5AE1 A;  4LJM A;  5H9F K;  2FHJ D;  4DFK A;  3FEY B;  4YB1 P;  4B9M A;  2A0F B;  5FLX U;  2AEF A;  4C2M A;  3EGV A;  1RAJ A;  3UW1 A;  3BBB A;  4CH1 A;  3D0H E;  1F5C A;  2MZS A;  5DM6 Q;  1HWJ A;  2M8D B;  3AT1 B;  2HRY A;  3NP5 A;  4FYV B;  4ID8 A;  3GIL A;  1BMQ B;  2FJE B;  1WF0 A;  2NXE A;  1G4C A;  1S9G B;  2V2Z A;  3OSP A;  2M52 A;  4E2F B;  4LBP A;  3FBC A;  1VJQ A;  3MED B;  1YLX A;  3Q2T C;  2VJU A;  2DJW A;  2HZA A;  4YFU A;  4O44 A;  3N79 A;  4NOH A;  1Q8I A;  2L9N A;  4EO8 A;  3C6U B;  2QSW A;  2E5J A;  4B3T J;  3NMA A;  3GPA A;  1TL3 A;  5LJ5 Y;  2HNZ A;  4GKK J;  3SSQ A;  1DHM A;  2WSE C;  2XC9 A;  2W4C A;  4WKY A;  4KKO A;  1SC3 B;  4JI7 J;  4RW9 B;  2Y1J A;  3FCH A;  3VGS A;  2G2Y A;  1FA0 A;  4NML A;  1N33 J;  3NRB A;  2C1E B;  5EWG A;  1FFW B;  1VQ8 S;  2CJX B;  1Q4R A;  1WHV A;  4Y2C A;  1JLG A;  4MTP A;  1NRK A;  4HH1 A;  2HAI A;  1R0B G;  1QD1 A;  4OI3 A;  1LWX A;  5KFK A;  2Q1L A;  2KRR A;  3B6B A;  5HVH A;  1FFS B;  2K7K A;  3LF0 A;  1EIY B;  4DV4 F;  1CJK A;  4ZMM A;  4IG3 B;  3DC2 A;  3LWL A;  3NOG A;  1FRL A;  3CME S;  2YNF B;  3ICL A;  1ZTT A;  2GC8 A;  1YX2 A;  3E01 B;  3H2L A;  2VQF F;  1ARO P;  3TJA A;  2W7A A;  4C6A A;  3HMJ G;  3MR5 A;  2AEM A;  2IRY A;  4ZIW A;  4JI6 J;  2CQ0 A;  2QFI A;  2HQD A;  3UDC A;  4ILL A;  2G0C A;  2ALZ A;  4EZ6 A;  4YOE A;  4LFB J;  2LCW A;  2WZ1 A;  3C19 A;  2KB2 A;  4EMD A;  4DL2 A;  5HVF A;  3NGT A;  4G1P A;  1KC8 T;  5DRK A;  1ZH5 A;  3DLG B;  1CC8 A;  3MM5 B;  1FKA F;  1NSA A;  2CPY A;  2VH7 A;  3FVY A;  2F9J A;  3I87 A;  1SQE A;  2O01 C;  2B43 A;  4JBC A;  1TU0 B;  4PWU A;  1RP5 A;  3HZG A;  4DPU A;  3Q8U A;  2VG7 B;  4TU9 A;  2GVZ B;  4RNM A;  3W8P A;  1TKX B;  3HJF A;  4NI2 B;  2Q3P A;  1FNO A;  4R0E A;  2J0X A;  5FLX Y;  3N6N A;  3G6Y A;  3C15 B;  4CLT A;  2BJ3 A;  4I6A A;  2AJ0 A;  2OH2 A;  5E3C A;  5KG6 A;  4ER8 A;  1OSD A;  4C0B A;  4ID5 A;  1LFP A;  1WOO A;  2CG8 A;  1XTZ A;  1FXD A;  2V8H A;  2ZUA A;  5E7O B;  1GFW B;  1JLQ A;  1SUQ B;  3ILJ A;  4QU6 A;  1KSP A;  4GC7 A;  2JHE A;  2ILY A;  3SV3 A;  4DUZ F;  4OQJ A;  3CIM A;  5DZ7 A;  5HL7 Q;  2K1R A;  2EEY A;  1CQN A;  3K5P A;  3CCS S;  1M5S A;  4QQB A;  3I31 A;  3KFW X;  2F63 A;  4C3K A;  1LEO A;  1U45 A;  1RQ0 A;  5CQG A;  2VPW B;  1N52 B;  4ANE A;  2PT0 A;  1V5V A;  2QYC A;  1KQK A;  2FLO A;  1SV5 A;  1J27 A;  2VOO A;  2JNJ A;  2DPI A;  1B64 A;  5B08 A;  4CLY A;  3BPS P;  1C0T A;  4FN5 A;  4C8N A;  3W9I A;  3K17 A;  2WVF A;  4LRF A;  1VR6 A;  2DB1 A;  4KC5 A;  3DOK B;  2XLK A;  2ZFH A;  4RX6 A;  1GXL A;  3NY0 A;  1WWH A;  3BN7 A;  4LSL A;  1S6P A;  2CZ9 A;  3TUI C;  4W92 B;  1UP1 A;  5KFR A;  4F50 A;  1Q16 B;  4DQR A;  4UST A;  2C28 A;  1UFL A;  3CJK B;  1VIX A;  3CJS A;  1X5P A;  3N0V A;  3MD1 A;  4OIX A;  3AOB A;  4CIO A;  1SL0 A;  5DDP C;  3TNV A;  3K59 A;  2MJN A;  5CYJ A;  3R5D A;  4A8X A;  2FY8 A;  4J5O A;  5A76 A;  3SDE B;  4ECV A;  2QV6 A;  1FI4 A;  4ALZ A;  3OXF A;  2V8G A;  2R7W A;  1XEZ A;  1LV5 A;  4L72 B;  4DV4 J;  2E5I A;  4ZN3 A;  4IO1 A;  3UPF A;  1SJ4 P;  5CYQ A;  2ZZM A;  5KFU A;  2C2E A;  3T9Z A;  1NZ8 A;  2ZH9 A;  2P9C A;  2XHC A;  2VQF J;  4I67 A;  1V5I B;  2CJA A;  3SZ2 A;  4J9P A;  4IFV B;  4NLV A;  1LW2 A;  2JRS A;  1HWL A;  3JQM A;  4ECW A;  2APO A;  2R7S A;  3X3U A;  3NNH A;  5KFF A;  2OEL A;  1VRT B;  3MGJ A;  3M8Q A;  2FJA B;  1P9Q C;  2QLB B;  1NJI T;  5LSO A;  3ZZU A;  3CDU A;  1N36 F;  2EFQ A;  4DR5 F;  1REG X;  2MGZ B;  1YBA A;  3EVW A;  3FK4 A;  1KQF B;  2BJ7 A;  1NND A;  3KK2 A;  1QDU B;  4PG8 A;  1I51 B;  2XZT B;  3QGI A;  1N34 F;  5HJX A;  3MTK A;  1ZYQ A;  2XQC A;  5EGY A;  4H4M B;  5HRO B;  3M8S A;  1F9F A;  3KLI A;  1RHR B;  2J5A A;  4BBY A;  1BD6 A;  3JTP A;  1K47 A;  3HHL A;  1RAH B;  4Q8F A;  3QWU A;  2RQM A;  3K5M A;  2RS2 A;  4IR1 A;  3OD2 A;  1RT1 A;  4ES1 A;  5JVG Q;  2YNI A;  3MM6 B;  3W61 A;  3TUP A;  1GT8 A;  3PG9 A;  2DGQ A;  1QE1 A;  4DSE A;  4OZ1 A;  1OO0 B;  4MK8 A;  2QEX S;  3T6B A;  2G0I A;  1DRZ A;  3DGP B;  4TNO A;  4LBH A;  1OJ4 A;  2BUN A;  2ROP A;  2XM3 A;  4DUZ J;  4EBC A;  1SH3 A;  2MQO A;  3BBF A;  3VVU A;  2M7S A;  2ZWO A;  4CH0 S;  4R0J A;  1ITP A;  4ED4 A;  3CJ3 A;  2JFK A;  3HJV A;  4FDF A;  1SJF A;  5LOQ A;  3D68 A;  4NLW A;  3R6G B;  2MKH A;  1WC4 A;  1EX8 A;  4N41 A;  1IKX B;  1FNX H;  4DUY F;  4XPC A;  1GK8 A;  3BSA A;  1X4E A;  3CJ8 A;  5D4O A;  1HWU A;  2AZ1 A;  4CLU A;  2BJD A;  5T7L A;  1PSD A;  3QIP B;  4I7F A;  2X3G A;  1RTH B;  1TV6 B;  2ZJQ Q;  2ERR A;  4ZVU B;  2OKQ A;  3KK1 B;  4F7V A;  1E6V A;  2HQI A;  2BM1 A;  2C2O B;  4LSN A;  3BO3 A;  4PXE A;  5CHC B;  3UD3 P;  4AE5 A;  5K9F A;  1JXL A;  2ZVS A;  3TEG A;  1REV A;  1Y7P A;  4RBT A;  1UMJ A;  4YR0 A;  3AA8 A;  3GYG A;  1S1V B;  4H4O A;  3BEG B;  4ECR A;  3W2W B;  2DIT A;  2LU2 A;  3QAU A;  5IS2 A;  4HT7 A;  1D1U A;  3DRS B;  1RT7 A;  4V19 J;  1PCA A;  3OL9 A;  3LPY A;  4ZN1 A;  1RE1 B;  4O3N A;  1CPZ A;  4DN0 A;  1RAG B;  2PA8 D;  2CQ2 A;  3ELH A;  2PEH A;  4DJB A;  2AYM A;  1RTI A;  2BAN B;  2RSQ A;  2AIR B;  5K5M A;  1IKW A;  1RWN B;  2V34 A;  3Q86 A;  2E1C A;  2V2Q A;  2CQG A;  5A2Q U;  1SPB P;  3M8Y A;  2DTJ A;  4O3S A;  4RNO A;  5JMN A;  2C3Y A;  5HP1 B;  3NGU A;  4EGL A;  2KYZ A;  1SJ1 A;  2VBY A;  4LT6 A;  7FD1 A;  4KFB A;  4ECY A;  2DR7 A;  4RR5 A;  3KUG A;  4BDP A;  3NBP B;  3UR0 A;  3KKF A;  4YN3 B;  4HTJ A;  2UUA F;  1SJR A;  2DHX A;  1FVS A;  1N4L A;  5KG0 A;  2ILZ A;  1HNV B;  1WSV A;  2HND A;  1RAO A;  3OHB A;  3BGR A;  1RT2 B;  3RAQ A;  2OMO A;  2YKA A;  2UP1 A;  5AE3 A;  1I3O B;  1YQH A;  3TUJ C;  1N36 J;  1MWY A;  4DR5 J;  1SI9 A;  1NK4 A;  2XWY A;  3CD6 S;  1X9M A;  4K0K J;  2QA4 S;  3HLU A;  3VGV A;  3CCT A;  5EUH A;  2R8I A;  1WHX A;  2CPH A;  5J2P B;  1KLM A;  2V4Q A;  2IPO B;  3C8Y A;  3H8Y A;  4OI1 A;  1N34 J;  3R9L A;  2HBQ B;  4OX8 A;  3LUY A;  4LBI A;  1N0V C;  2VD3 A;  3D28 A;  1OS5 A;  4QPX A;  2RU3 A;  2D69 A;  3J7Y I;  3A1Y G;  4I7F B;  1RBO B;  1H3D A;  4X4R A;  2G2O A;  3SFG A;  1U47 A;  5KFV A;  5J2N A;  2EFV A;  2WOM A;  2HK2 A;  3KYL A;  4K4S A;  1I1G A;  3JTN A;  3D67 A;  2MHE A;  1DLO B;  3UDE A;  2KHC A;  2FGC A;  3RJM B;  2AEJ A;  1U0S A;  3TAR A;  2QO3 A;  3U02 A;  3IWX A;  3ONQ A;  4C8Z A;  5AXN A;  2WCX A;  1EJ7 L;  3NAH A;  3B4M A;  3ZO7 A;  3A4T A;  4FP9 A;  3RRK A;  1UZD A;  1T9W A;  1FNM A;  2ADB A;  4ZPD A;  1U8S A;  4P7V A;  5JUM A;  4DUY J;  2CNO B;  4O0N A;  1JLC B;  4PXB A;  4KGM A;  4C0H A;  2KVQ E;  3IGV A;  1F3V A;  2BV3 A;  1T0T V;  1IKW B;  4JYA F;  1BQM A;  3T1H F;  4IRK A;  2JEI A;  1BLU A;  1HLW A;  1RU1 A;  3ISZ A;  4X4S A;  3F73 A;  1EKR A;  3GIM A;  3UD5 A;  3KK3 B;  2R7R A;  1J5E F;  2CUY A;  2ZM6 F;  5A2Q Y;  2GFF A;  5E3Q A;  3MCN A;  2V5H G;  3CXC R;  4KV8 B;  3VZH A;  5KFI A;  4C97 A;  4UZC A;  1RT4 B;  2YX1 A;  4MT1 A;  1S1T A;  4ECQ A;  1UJ4 A;  1CC7 A;  4HEA 9;  4DSK A;  4DV3 F;  4HR2 A;  2ZD1 A;  3BRE A;  4LR8 A;  3R2C J;  4I1T A;  1JJC B;  5DG7 A;  4JI2 F;  1TAQ A;  1HA1 A;  1F6T A;  2MZT A;  4ZVF A;  3BPD A;  4D3H A;  5D0E A;  1HL6 A;  2W9A A;  2Z0G A;  4HAC B;  2IAJ A;  1KLM B;  1T02 A;  5HLF A;  2KXH A;  4KGV B;  3UVJ B;  4OI4 A;  1KFD A;  1EET A;  3QRP A;  2DHA A;  2M9K A;  3MI7 X;  5ETM A;  1AYE A;  2CQI A;  1G7C B;  3U1M A;  5KG4 A;  2CPJ A;  3HVR A;  3GV8 B;  2UUA J;  1RXO B;  2KN4 A;  2HGL A;  1IBL F;  1S4E A;  2IMO A;  2F7V A;  2WOM B;  4ZVE A;  4M95 A;  4QJV A;  5KT5 A;  1GTE A;  4F0M A;  2XZD B;  2CQB A;  3H2U B;  2E7V A;  1QAY A;  4LF5 F;  3T1A A;  2E5H A;  4ZCK A;  3JAM U;  5GVQ A;  3FFI B;  3K8V A;  1VMB A;  4I69 A;  1KTQ A;  4DDF A;  1F2G A;  1F0X A;  3BGU A;  1LW0 B;  4RW7 A;  2A1B A;  2Y3Y A;  5HBM A;  3ENV A;  1LWF A;  3ILI A;  3LPE A;  3RAX A;  1FXL A;  3OFE A;  3PYD A;  3CSK A;  4ZJO A;  3V4I B;  4DV2 F;  1FEE A;  1HQU A;  5L39 A;  4J9O A;  4ZP8 A;  2C3U A;  4F4K A;  4JI1 F;  4FBT A;  4FNI A;  2OGU A;  4ECT A;  5HQM A;  2F40 A;  2UV8 A;  5E3A A;  2X3D A;  1RIS A;  1CSJ A;  1H6K X;  4PAB A;  1TL1 B;  3N5F A;  2Y1L B;  3PTW A;  1IJE B;  5E33 A;  4KAI A;  4Q44 A;  3PW7 A;  5THW A;  2J0W A;  4YB6 A;  5EHH A;  4NE9 C;  1IN0 A;  3QQC D;  3ZTQ A;  3DI6 A;  3KLE A;  2BM0 A;  1OQ3 A;  3GYX B;  4TY8 B;  2V68 A;  1S1T B;  1U7L A;  2DO0 A;  2G1H A;  4IH6 A;  3R6L B;  3MPV A;  4WXW A;  2RML A;  3AQO A;  2AYE A;  1O0P A;  1S7H A;  4UOG A;  3FBE A;  4DR2 F;  2NUH A;  3LW5 C;  3KLF B;  3HHL D;  1B70 B;  3GR0 A;  4Z7Y A;  1QAJ A;  5SZT A;  2CQC A;  1Q8L A;  3T1H J;  2IAJ B;  1DUR A;  4ZP9 A;  1Y9O A;  1UVI A;  3HHD A;  4IOA Q;  2HGN A;  2J7U A;  2XG8 A;  3NL0 A;  2HHP A;  4PPD A;  5C2C A;  1J5E J;  5KFJ A;  2GZO A;  2ZM6 J;  2G13 A;  3V2U C;  1NK9 A;  4ATN A;  5KFM A;  3K5O A;  1KVK A;  4B9U A;  5KFN A;  2OIH A;  1YHQ S;  4WII A;  1S76 D;  1XMQ F;  5J2M A;  5KFA A;  4FPR A;  2YQ1 A;  2P6T A;  2BE2 A;  3BKF A;  3JTO A;  4ANC A;  2DH7 A;  1NEE A;  2H1Y A;  1SB6 A;  4DV3 J;  4ELV A;  4DPO A;  3RBE A;  3DLB A;  2VA2 A;  2V9W A;  3LTO A;  1WC5 A;  2XCA A;  1BGX T;  1S57 A;  3HCX A;  3FQK A;  4KQZ A;  4DSJ A;  2IM1 A;  4QCL A;  1R8C A;  4PG5 A;  3CTR A;  2B4U A;  1ZZF A;  3P96 A;  1XJW B;  1N56 A;  3Q22 A;  4L6V 3;  1YWX A;  4CM2 A;  3LQV A;  3HM9 A;  3W63 A;  2LA6 A;  2YWE A;  3PRV A;  4ZCL A;  3C66 A;  4K4Z A;  3I9Z A;  3OR2 B;  2YWF A;  1UW9 A;  4I0W A;  3J7A 1;  4KR0 B;  4NCB A;  1IBL J;  2FLN A;  2CPD A;  4KT0 C;  5C24 A;  2I9S A;  3UN2 A;  3WC0 A;  1U6B A;  2N4D A;  4J9L A;  3IAM 9;  4LF5 J;  2PMH A;  4KIA A;  1KON A;  3ENW A;  3PZP A;  4NYZ A;  3TW0 A;  1VQ9 S;  4OZL A;  2CVI A;  2JEJ A;  4OMF G;  2B6A B;  3I4H X;  3EVM A;  1RUS A;  2XSJ A;  3CUN A;  1RWX B;  1DTT A;  2O67 A;  2ZHA A;  1KKH A;  1RBL A;  1VIS A;  2I38 A;  5C2G A;  5F3Z A;  2YWK A;  2XY7 A;  2OPQ A;  4DV2 J;  2OUG A;  1IR1 A;  2QLX A;  2AJ4 A;  3D3C J;  3QGG A;  5J1P A;  4K5R A;  2W9B A;  3V6H A;  3HHL C;  4JI1 J;  2GGP A;  4IOB A;  1DQ9 A;  5ETK A;  3WHI A;  3ZFV A;  1NJZ A;  2BDP A;  4YHH F;  4DPT A;  4DU8 A;  1Z2Z A;  4G3I A;  2J8S A;  1S0V A;  4B02 A;  1ZM9 A;  1TK0 A;  3OFH A;  4Y2A A;  4USU A;  1S99 A;  2ZH1 A;  3QT8 A;  1S59 A;  2Z56 B;  3OL6 A;  3M9N B;  2J6T A;  2COL A;  3WQP A;  3CD0 A;  3NCQ A;  2VON A;  2VAS A;  3KHL A;  3VQS A;  4QWB A;  3I55 S;  3ENQ A;  3AJ1 A;  3OUY B;  2AJQ A;  3IRW P;  3Q8P B;  4KTQ A;  5LSR A;  3VAH A;  3QLH B;  4Y6I A;  2FJV A;  5EX3 A;  2FVP A;  1JXV A;  1URN A;  3JSY A;  3HVT B;  4D3G A;  4YB7 A;  4PQU A;  3DOM B;  4JI8 J;  2FJD B;  3NEK A;  1N5V A;  2RS8 A;  3A3O B;  2WBR A;  4QWA A;  5A0Y B;  5KFQ A;  2UZA A;  1P1L A;  4DL0 C;  4WK1 A;  4J9R A;  4WE1 A;  3QYY A;  4DV7 F;  1EB0 A;  4M5D B;  2VBX A;  1XMO F;  2OEK A;  1RHK B;  3L7O A;  3PHT A;  2R2S A;  1FKO B;  4CYU B;  2EWH A;  2QFJ A;  3ZNJ 1;  2F4V J;  2A2C A;  1HPZ B;  4X65 F;  3TZY A;  1N6Q B;  2Y0S D;  1FER A;  3MOZ A;  4R5P B;  4Y2I A;  1XMQ J;  3TVZ A;  1CEZ A;  3CDE A;  4A8O A;  1DY3 A;  1UKU A;  4F8R A;  3ZTO A;  4LIW A;  1VS3 A;  3CJ5 A;  4A48 A;  3IFE A;  2W25 A;  2BRK A;  2O66 A;  2JVO A;  3FGV A;  3GWC A;  2AP6 A;  4A8Q A;  3HKW A;  4Q0B B;  3T5L A;  5IV3 A;  3VAK A;  3MUT P;  4GO7 X;  5DLF A;  3FQL A;  2FVQ A;  3H2V E;  4ZHR A;  5B09 A;  3S7R A;  3MEG B;  5KT7 A;  1RYR A;  4B9V A;  3POT A;  4HTI A;  1VQN S;  3PO4 A;  4YDX A;  2NYI A;  1UET A;  4ZS6 A;  4EI2 A;  2B4P A;  3PR4 A;  4QIF A;  2YNG A;  2AYG A;  2UXD F;  4M5M A;  1R8H A;  1Q86 T;  1T8E A;  3PV8 A;  2PFD A;  5JXS A;  4DL6 A;  1Y10 A;  1AFI A;  3QAT A;  2CDQ A;  2W7O A;  3T41 A;  2QX0 A;  1FO1 A;  5F8L A;  4XPE A;  4DQI A;  2R9L A;  1C4A A;  4B3M F;  1IKV A;  3UN3 A;  3DMJ A;  3IXQ A;  1SJQ A;  5IZH A;  1T05 A;  2MEW A;  1URR A;  2WB1 D;  2YVS A;  2FJX A;  4RWW A;  2L48 A;  2EK6 A;  1T7P A;  1R0A A;  2HFZ A;  4ZPA A;  2P8I A;  3F41 A;  2LDY A;  5B0G A;  1CJT A;  5HQ8 A;  2AX1 A;  3MOJ B;  1CUL A;  3Q8Y A;  4A8F A;  3BV8 A;  5L8R C;  1TL7 B;  4QBU A;  3MEC A;  1R8A A;  3AJD A;  1C0U A;  2FZG B;  4PKD B;  1GMW A;  1G1X A;  1PC5 A;  1OWX A;  2K7J A;  4YHH J;  4RW4 B;  3SQG A;  1W7W A;  2RJZ A;  1F2H A;  3CVK A;  2JJ4 D;  1F9H A;  2KM8 B;  2B8P A;  1JB0 C;  1C4C A;  2UUW A;  5DQH A;  1D9F A;  3LP0 A;  2ZH7 A;  4AL5 A;  1X4H A;  4KE5 A;  2I6W A;  4ES3 A;  2RHS B;  1DZ5 A;  2CQ1 A;  2G9O A;  4U7C A;  3VR1 A;  3D4J A;  5FDL A;  2NS1 B;  3MR3 A;  3DLK A;  5ITH A;  4WP3 A;  3DRP A;  1HR0 F;  3VGT A;  4FF3 A;  5GAG U;  1N5Y A;  1H0H B;  4J7C A;  1RLD A;  4K4V A;  2E1R A;  2RRN A;  3QAE A;  5G0R B;  3IR7 B;  5A8R B;  5KT2 A;  1FX2 A;  3KJQ B;  3QO9 A;  5J1E A;  4L76 A;  4DV7 J;  2ABY A;  4PRF A;  2WVC A;  2J9E A;  1XMO J;  1Y3K A;  4NA1 A;  3POT B;  2YKN A;  1RAD B;  2W1B A;  4DV6 J;  1VQ7 S;  5EWF A;  5D3G A;  3UQS A;  4DG1 A;  2DHG A;  3D5M A;  3G8Q A;  3RTV A;  3RR8 A;  3J7Z 5;  1IKY A;  4X65 J;  2B4O A;  1NSQ A;  1ROF A;  3DYA A;  2PN6 A;  1HBN B;  2IFX A;  1WDD A;  2DYA A;  3LH2 S;  2IC3 A;  2XMW A;  4O3R A;  4RL1 A;  2EC0 A;  4DFP A;  3IWN C;  3DMJ B;  1CJV A;  1VGY A;  4LIR A;  4ED1 A;  2DY1 A;  2NR0 A;  1AUS L;  4Q2L A;  2P6S A;  1MU2 A;  3GLJ A;  3ILO A;  3QNW B;  3MM7 B;  3KLG B;  1WKL A;  4LQ3 A;  1S1W A;  1VQO S;  4K2X A;  2KYX A;  4TKT A;  2R2R A;  1U2F A;  2O3D A;  3X1L B;  3DRX A;  2QLF B;  4UQG A;  3GSD A;  1NJW A;  3JXO A;  2R8K A;  4F3M A;  3BO2 A;  3LP1 A;  1CBK A;  1HYS A;  2UXD J;  4HDG A;  3R7B B;  1UPM B;  3P49 B;  1FK9 A;  4YR2 A;  2FGO A;  2W4P A;  3EMT A;  3KHR A;  4X4Q A;  1O6X A;  3PYE A;  3SQG B;  4CNZ A;  5A8W B;  1RTD A;  1JLA B;  1IWA A;  4PEO A;  3CE8 A;  2C2K B;  3W2V A;  1NZA A;  4B3M J;  1LWE A;  1RB0 A;  4C8L A;  3KNA A;  1NH7 A;  1C1B A;  3PW0 A;  2J6S A;  1I5O B;  3FZB A;  3HO1 A;  2HVH A;  5ETO A;  2ZIT A;  1T9T A;  1WC6 A;  3D3B J;  1VQK S;  2LVW A;  3IN5 A;  5F8N A;  4ICL B;  3DLK B;  5K14 A;  1RYS A;  2W2Q P;  4GVB A;  2C2Z B;  5BYR A;  3H4D A;  3MZI A;  3G6V A;  2HRT A;  4ZLL A;  1MWQ A;  1WC0 A;  2ZOF A;  2J7W A;  4TYA A;  2HAF A;  2VB6 A;  4C98 A;  5CYM B;  1UAW A;  4NLD A;  3M8Z A;  4MIA A;  4N7T A;  3HSZ A;  2GJ2 A;  3IR5 B;  4RJV A;  1X4D A;  1WF1 A;  3D66 A;  3IA0 A;  3EDR B;  4DPW A;  4OZ3 A;  3A8E A;  2VUG A;  3NGD A;  1HBO A;  4NLY A;  1L3T A;  4A8M P;  2KDO A;  3TO8 A;  4AFF A;  1S49 A;  5CH7 B;  3CCU S;  1S6Q B;  2RDJ A;  2DNY A;  4F25 A;  2HEK A;  2HHV A;  3ZXW A;  1NDC A;  1L5U A;  4ES2 A;  4RNH A;  2R7V A;  2NPI A;  4B9N A;  3VGU A;  4FXV A;  5E3R A;  4ZLJ A;  2A3J A;  3KJF B;  3I0S B;  1HR0 J;  4ELU A;  2FLL A;  3M6W A;  3M4X A;  3W7B A;  3RZA A;  2I8E A;  2QYG A;  1RWM B;  3HP6 A;  2DRB A;  4F26 A;  3K8W A;  3FSY A;  1MU2 B;  3MHY A;  1UA1 A;  3G4S S;  4TQS A;  2NZC A;  3IS9 B;  3O5T B;  2DXF A;  4JV1 A;  2XMJ A;  1FRK A;  2LXI A;  3K7R A;  3I82 A;  2BOA A;  3QT7 A;  3M2U A;  4K4U A;  2GAH C;  2F4F A;  3DRY A;  1RT5 B;  3PCO B;  4PYD A;  4PQA A;  2WBM A;  3TA1 A;  3MMC A;  1UWB B;  4FVC A;  1KVI A;  2C42 A;  1F5A A;  4FYY B;  1FK9 B;  3IG1 A;  2UXC J;  3BGO P;  3T5K A;  5KFH A;  3O6Q A;  2X1A A;  3HF5 A;  2IYI A;  3P6Y C;  1D8Z A;  4IQX A;  4PZV A;  3KJV A;  1UWA A;  3WIU A;  3J81 U;  2CG4 A;  1MRO A;  2J9D E;  2MKC A;  1FE4 A;  1GXT A;  3I0R A;  2M3D A;  1C1B B;  2CQP A;  2DKO B;  1ZA1 B;  1JLB A;  4P7T A;  2DR8 A;  1HWK A;  3L95 X;  3MAQ A;  5M2P A;  2GV1 A;  4MK7 A;  5B0F A;  4FBU A;  4IDK A;  3M1V A;  1PBU A;  3ET6 B;  3ZTP A;  4DLE A;  2DCU B;  2A6M A;  4AQY F;  2V4R A;  2NRE A;  1NPK A;  2IRX A;  5ADZ A;  1JIH A;  5K14 B;  2JEF A;  2NXJ A;  2WRM A;  2L9D A;  2LMI A;  1UCN A;  2H54 B;  2FZK B;  2LQJ A;  4UZB A;  4OX7 A;  3TWZ A;  2HBY B;  1G2E A;  1TK5 A;  1CJU A;  1XR5 A;  4Y00 A;  2V4J A;  1X9S A;  3MWB A;  3NCR A;  3GR1 A;  1A6L A;  2HMI B;  1AXQ A;  5KT3 A;  2ZH4 A;  4I2P B;  3GG0 A;  4KGX B;  4U7U D;  4F4Z A;  5I42 B;  2C3M A;  1RA7 A;  4PXC A;  4A47 A;  4ED6 A;  3V6D A;  2P9E A;  4TLR A;  1E6Y A;  2V2V A;  1TR0 A;  5GMK a;  4F4X A;  3KOA A;  1XC9 A;  1LK7 A;  2KFY A;  3DXS X;  5DG8 A;  4BHQ A;  2ZDP A;  4DS4 A;  2D1C A;  4PG6 A;  3FEX B;  3M2R A;  1X7V A;  1AFJ A;  1EZZ B;  4IRC A;  1XNR F;  2VBW A;  3GJT B;  3GU0 A;  1SKR A;  2J7K A;  2H5E A;  4GKJ F;  3QJJ A;  1WG5 A;  3D6F B;  4HHH A;  1NM2 A;  3DLL Q;  3FMW A;  2KL8 A;  1RWO B;  2V2K A;  3OJU A;  3GON A;  2MPU A;  4A8Y A;  3QGH A;  3SFU A;  2ZDO A;  5DGA A;  4USH A;  2AW0 A;  4ZK7 M;  1U6F A;  2CPZ A;  4QOT A;  1K44 A;  1YJN S;  2EFO A;  3THT A;  2QL5 B;  2YX4 A;  3IM8 A;  2J8A A;  3DOL A;  4J91 A;  1RBA A;  3MMC B;  1HBM B;  4RPF A;  4OX9 F;  2MZ1 A;  4CLL A;  1FDN A;  2RKI A;  2OPR B;  1MSW D;  1X9W A;  1Y0H A;  2NXU A;  4IKA A;  3TAP A;  2DNP A;  1HNI B;  3MEE B;  3CMQ A;  3GZ7 A;  4F02 A;  2GCF A;  3M32 A;  2RDD A;  5B0A A;  2KVI A;  4UUW A;  4XTT A;  3K5L A;  1GH8 A;  2Q6C A;  2H9Z A;  1CG2 A;  4B3R F;  2RIL A;  5L46 A;  3J81 Y;  3HFV A;  1GMW D;  3CDB A;  1WC3 A;  3O1L A;  3MPD A;  1HNX F;  1SJ3 P;  1NH8 A;  4WTY A;  2GW8 A;  1VBY A;  4E98 A;  5KFL A;  4J9Q A;  1U49 A;  1M5V C;  4B08 A;  1IBM F;  2K3K A;  3CED A;  1R8B A;  4OHX A;  1T3N A;  4B3O A;  4KO0 B;  2KM8 C;  2DT9 A;  3R5A A;  4KYZ A;  2D3O 1;  1VQ5 S;  1KS2 A;  1RAE B;  4DV0 F;  3PX6 A;  4J37 A;  2FD2 A;  2LEB A;  2Y0B B;  1R43 A;  2B3T B;  2IA6 A;  2L9W A;  1YZ6 A;  3LOU A;  2VG6 A;  5A6P A;  1UFK A;  1VFJ A;  4DBQ A;  4P72 A;  3P5B P;  2R3V A;  2VIH A;  1ZAV A;  4O0I A;  2OPS A;  3Q83 A;  2DH8 A;  1NKC A;  4JI5 F;  2OHD A;  1R3N A;  3PW4 A;  2HIQ A;  1FRI A;  2AF6 A;  4HL9 A;  2WK4 A;  3EIC A;  2YPY A;  3BSC A;  4DF8 A;  3EZ5 A;  1PJ5 A;  5BXI A;  1WDT A;  2KFZ A;  2DNN A;  2CDR B;  1ZPW X;  3TJ9 A;  3BKU A;  1Z4U A;  2E5L F;  4AQY J;  4NLU A;  3KDO A;  5LMN F;  1NDL A;  4FVM A;  3I9V 9;  2KT3 A;  3RUB L;  2DNM A;  1S1U A;  1AT1 B;  1M5P C;  1Q81 T;  2MLZ A;  3OTD A;  4NLS A;  1B0V A;  1CS4 B;  1X5O A;  1B0T A;  2F9D A;  3R3T A;  3KMS A;  2OPP B;  2A18 A;  2XBP A;  1WOP A;  3UN5 A;  2MTL A;  3H5X A;  4I2Q B;  5AXK A;  1MN9 A;  4JP8 A;  1XR6 A;  1BQN A;  1YDL A;  5L9N A;  1QJH A;  3N5B A;  1M0S A;  1QSS A;  1MG7 A;  2HK3 A;  4V19 X;  3DKD A;  2B5J B;  3DOL B;  3ENA A;  5JVH Q;  2Y9H A;  1UW4 A;  4DX7 A;  2DEI A;  2OP5 A;  3GFY A;  4M8L A;  3ITH B;  2OD4 A;  2VV5 A;  5KOX A;  2KTQ A;  2CZ4 A;  2Y8Y A;  4ZVR B;  3M9O B;  3M32 B;  5K8P A;  3C46 A;  1XNR J;  4U95 A;  2B8Q A;  1AW0 A;  4GKJ J;  3HHE A;  4WU2 A;  4AUK A;  3TRG A;  2WON B;  4O3Q A;  4AXJ A;  1FKP B;  1PJ6 A;  5HAN A;  4IFY A;  4KPC A;  4P52 A;  1KR4 A;  1RCX B;  5H1S V;  3MMB B;  4DCJ B;  1YJR A;  5EWE A;  1PYS B;  3AFG A;  5BR8 F;  2GO8 A;  2J9D A;  5B7W A;  5KG1 A;  5B0C A;  2Z4P A;  4B17 A;  1ZAW A;  3PKY A;  3Q8Q B;  4RNN A;  1Y5I B;  2XMV A;  2NXC A;  2MKI A;  1KHV A;  1KOH A;  5DS7 A;  4IYQ A;  3HX9 A;  5FD1 A;  3MM8 B;  4KHR A;  4OX9 J;  2KJW A;  2IVY A;  5D77 A;  4CTA B;  1RWW B;  1OY9 A;  5IFM A;  3W62 A;  1J5O A;  3HT0 A;  3CIZ A;  1PYO B;  4X84 A;  1RT6 A;  1U02 A;  3MM9 A;  2XYG B;  3EE3 A;  1C2P A;  5K8O A;  2KHD A;  2XO7 A;  3AOA A;  4ED3 A;  1TVR B;  3UCZ P;  2CJ9 A;  1ZM4 A;  4ED2 A;  3SEO A;  2GJI A;  1RHM B;  4WK3 A;  2HIY A;  4X64 F;  3DHX A;  1FHT A;  2CPF A;  1K0V A;  3H0P A;  2ZHB A;  1ZM3 A;  2ZE2 B;  3IRX A;  3MFI A;  1YSJ A;  2XYP B;  2OJ3 A;  3D1Q A;  2I5J B;  1SIZ A;  4URG A;  4M94 A;  1S0N A;  1P27 B;  1JLF A;  4J9V A;  1IR0 A;  1IBM J;  5D0H A;  1TKD A;  4RW8 B;  3DDI A;  3B54 A;  5C7P A;  1EP4 A;  2GQC A;  5IT9 U;  2ASD A;  1D09 B;  4DV0 J;  4NLX A;  4CH7 A;  2GO9 A;  2QA2 A;  2LKZ A;  5HO4 A;  2X7I A;  1BC6 A;  3CT9 A;  3MAA A;  4OL8 A;  2XGP A;  1H7W A;  2MZJ A;  2DIU A;  4OZN A;  3T5H A;  1OPI A;  3ZZZ A;  2IYG A;  4C3M A;  3DDK A;  4DQQ A;  3EGW B;  4EZ9 A;  3VAG A;  3EWG A;  1VQY A;  3GJR B;  1BQX A;  4KRW A;  1NJY A;  4DN9 A;  3QJL A;  5HMZ A;  5F8J A;  5KFO A;  1WOS A;  3C16 B;  4UOC A;  4WFX A;  1TL5 A;  2AJ1 A;  2GJF A;  5AT1 B;  2E5L J;  3TEH B;  4FYX B;  5LMN J;  3C6T B;  1JWW A;  3PIO Q;  3JYT B;  2BQR A;  2LQ9 A;  4LFC J;  4M5G A;  3UD4 P;  4C0O C;  4XK8 C;  3HVW A;  2PFF B;  1DJ0 A;  2BBE A;  2WSF C;  5HQL A;  1V9O A;  4U8Y A;  3NGR A;  4OHZ A;  4JI3 F;  2JH3 A;  2FB0 A;  3CJ2 A;  1EKS A;  2HNY A;  3OL7 A;  2ALY B;  3Q24 A;  5E41 A;  4QR0 A;  3FJ2 A;  1MNE A;  4DWI A;  3H25 A;  3KLH A;  4YB5 A;  1VI7 A;  5M2U A;  5C42 A;  1YZ7 A;  2DNH A;  3CDW A;  1GMV A;  1WHY A;  2GML A;  3E3X A;  3RBD A;  3RR7 A;  4ZVS B;  1KEK A;  3FRY A;  2YWW A;  1FF2 A;  1XN9 A;  2DGU A;  4FXD A;  2LQ5 A;  3DLE B;  2Z2Z A;  3R5C A;  3GV5 B;  4NCG A;  5D78 A;  2R7O A;  3EXY A;  2DXE A;  2YQ3 A;  5I3U B;  3BKT A;  3G87 A;  4DOZ A;  3KMQ A;  1UFW A;  4WFN Q;  1BWE A;  4RW6 B;  1NKB A;  1VDH A;  3ADA C;  5BR8 J;  3E2E A;  1RWP B;  3LWM A;  3M8P B;  1F3F A;  2DK2 A;  1H2T Z;  3T9N A;  3GP9 A;  4EBE A;  2EK1 A;  1ZOT A;  1EP4 B;  3ZZR A;  3QSY B;  3G96 A;  2FJW A;  3GFZ A;  2L41 A;  2XI2 A;  2ROE A;  3SMZ A;  2R2U A;  3C14 A;  4ZOS A;  5IT9 Y;  1JXE A;  1HBU B;  5T14 A;  4ZLN A;  3GTY X;  1S9E B;  2KT5 A;  1WJ9 A;  4KBI A;  2W9C B;  5HMW A;  5IM0 B;  1SIW B;  5E5N A;  3L09 A;  4LFA F;  3L3C A;  4X64 J;  1T9V A;  1WTF A;  1QAI A;  2VIC A;  2D3Z A;  1TKZ B;  2OD6 A;  2PI4 A;  1RTJ A;  4F36 A;  3DLJ A;  4MKV A;  2DNK A;  1GEH A;  3PFO A;  1WF2 A;  4CO1 A;  2JLF A;  5GAG I;  1XWL A;  2DR6 A;  2DGV A;  1VQS A;  1LXJ A;  4BWJ A;  3SCI E;  2VFV A;  1NSP A;  3BQ1 A;  2R42 A;  1Q0N A;  1VJW A;  3M2V A;  2QIF A;  3IGN A;  3V6J A;  1H98 A;  4FF4 A;  1RKJ A;  4TY9 A;  2CAJ A;  4YEA A;  2VG5 A;  3FEZ A;  1SQG A;  3NNA A;  2QG9 B;  1X4C A;  5K20 B;  3MDF A;  3MR2 A;  3AAW B;  4FPI A;  4O44 B;  3M7V A;  4DR6 F;  4EU0 A;  3TAM A;  4F4W A;  1SKS A;  4K2J A;  2R8H A;  1WAC A;  1Q7L B;  2W8L A;  1B3T A;  1TL3 B;  2HS0 A;  2NXN A;  2IMW P;  2HNZ B;  5LSL A;  1FTR A;  2MY8 A;  2PMW A;  1ICE B;  4KKO B;  4NEZ A;  2BMB A;  1D0E A;  2MB0 B;  4EK2 A;  1IXK A;  1O8B A;  4Z2X A;  4X4V A;  4TXS A;  4LR7 A;  5FII A;  4OX6 A;  1JLG B;  2ZZN A;  2DNZ A;  3T5J A;  4P9S A;  3Q8R B;  5CCM A;  3BM7 A;  4JI3 J;  3J81 j;  1DQ8 A;  2RQC A;  2NSC A;  2L08 A;  4BLG A;  2AGQ A;  2V0N A;  2MZQ A;  4HKQ A;  2E7X A;  1CJK B;  4ZCI A;  3J7A N;  3RB0 A;  1KTV A;  4J9M A;  1S4F A;  4O4G A;  2BJ8 A;  3S6E A;  1R89 A;  3UR3 C;  2X1B A;  5IC6 B;  3JSM A;  1U25 A;  3CWJ A;  3RRH A;  4WZM A;  3MR6 A;  4TU8 A;  5D0R A;  1D8Y A;  4NRU A;  1K73 T;  4USM A;  1FRJ A;  4G1I A;  3CUL A;  1WEY A;  2AYB A;  2FVR A;  5CD4 H;  2QA1 A;  4K50 A;  3CF5 Q;  2HFN A;  2LEC A;  4OJ1 A;  3CD5 A;  1PYT A;  4PG7 A;  2FHK A;  4LRB A;  5MAO A;  4YS2 A;  3GB0 A;  3VVT A;  2DIV A;  4Q8E A;  3BGF A;  1PKU A;  2D3O R;  4ZPC A;  2WVB A;  1TUG B;  2OEM A;  1JJ2 R;  4U8V A;  4DSF A;  2ACM A;  2E1A A;  2E9Z A;  1RKI A;  2B51 A;  2W2O P;  2DIS A;  4L75 A;  2GVD A;  1N8R T;  1LWC A;  1IQT A;  3CD7 A;  4ID5 B;  4IOC Q;  1M90 T;  6FDR A;  2QL9 B;  2VZ9 A;  2FC9 A;  1JLQ B;  4LFA J;  2JOQ A;  4F4A A;  4QYZ J;  1JKH A;  3OBI A;  2UVR A;  3VWS A;  3OXG A;  1JLE A;  5EX0 A;  2QTW A;  3VAF A;  3O2I A;  4CM0 A;  4JV0 A;  5DLG A;  2W24 A;  3NWR A;  3M6U A;  3M8W A;  3AQP A;  4PWD A;  4NXN F;  2BJE A;  2K1R B;  4FZV A;  4O3O A;  4CLS A;  1X4F A;  3O3L A;  4OYA A;  3NGS A;  4W98 A;  4DR7 F;  3DNC A;  2VU5 A;  3TVY A;  1HKA A;  4QIE A;  3RGI A;  5H9F J;  1TFW A;  2LA4 A;  3G82 A;  4ZKA A;  1T9X A;  4DCO B;  3N01 A;  4WP9 A;  1L3S A;  4NX9 A;  3VAJ A;  5LJ3 Y;  2H65 B;  3W5Y A;  2XCP A;  1SV5 B;  5DGB A;  4UY8 T;  1FWL A;  1C0T B;  1RAI B;  2UVW A;  1U1M A;  2M70 A;  3NS7 B;  4USJ C;  1VRU A;  4CO2 A;  1A9N B;  2G4B A;  4TLQ A;  1IJF B;  1TQL A;  4DR6 J;  2ZJP Q;  4OV1 A;  5LMU F;  5A8K A;  3CCQ S;  1SXL A;  3LGH A;  3OT9 A;  2CRL A;  1WKK A;  4LSL B;  3K58 A;  3A13 A;  5JJB A;  1S6P B;  1C1C A;  3AY0 A;  5GAE I;  3CCM S;  3V4M A;  3P8B B;  4EYH B;  3EJM A;  1EAR A;  3RG6 A;  1UJ6 A;  4P73 A;  4I56 A;  2VF3 A;  4F67 A;  5CZX A;  1D9D A;  2QL7 B;  2JC1 A;  4O23 A;  1RZM A;  2CNK B;  3PYG A;  3M30 A;  2C3P A;  3GG1 A;  1LNQ A;  5DDR C;  5EDW A;  2ZVI A;  4DR3 F;  2RE1 A;  3SQO P;  4CLK A;  4NWB A;  1H7X A;  3KG1 A;  3MF5 A;  3BDP A;  1VCT A;  3DRR A;  5DO2 A;  4DHV A;  3DDN A;  4BC9 A;  5CYQ B;  1S10 A;  1UVJ A;  2EG2 A;  1VC6 A;  2JDJ A;  3AXK A;  2CNL B;  4CQ1 A;  2QMX A;  1RWU A;  2IM0 A;  2NPF A;  2HHQ A;  2AGP A;  5L38 A;  1K8A T;  3RB6 A;  1M1K T;  3U1L A;  2EPI A;  1M1G A;  1LW2 B;  2CYY A;  3ZZO A;  4RUH A;  3OLA A;  3C3L A;  4C8Y A;  1TKT A;  2KG0 A;  3HHN B;  3G6X A;  2HQC A;  4OYO A;  3QZ8 A;  4Q5V A;  4MFB A;  4R8U A;  2CVE A;  2X51 A;  3TX8 A;  3M8Q B;  5LM7 E;  1VRQ C;  4K4X A;  1HNZ F;  1WEX A;  4WKR A;  4Y3C A;  3FBF A;  4ED5 A;  5KFC A;  5LL6 d;  4Q43 A;  2JWN A;  2RD5 C;  1SC6 A;  1M1H A;  1WUU A;  3KK2 B;  3TOQ A;  1SC1 B;  1YI2 S;  4WYW A;  1NXI A;  1XR7 A;  2RF2 A;  2E44 A;  2AD9 A;  3W3S A;  2HUR A;  2G0J A;  2PII A;  1FJ7 A;  4CLW A;  3Q89 A;  3SSR A;  3KLI B;  1HQE A;  2DBB A;  2CPX A;  5E2Q A;  1SL2 A;  1RAF B;  2WW4 A;  1OY8 A;  1U0H A;  2VPX B;  3HHL B;  4ZPB A;  4WTO B;  2F65 A;  2HS3 A;  3QWP A;  2BX6 A;  1RT1 B;  4NLG A;  1VK3 A;  1UVN A;  2YNI B;  1HMV A;  1FT8 A;  1QE1 B;  2QMU B;  2C2D A;  1FVQ A;  4ZPT R;  2Q43 A;  5AE2 A;  3QRQ A;  1HHQ A;  1PAE X;  1H38 A;  2IM3 A;  1SL1 A;  4UOF A;  2QN6 B;  4NXN J;  2F8M A;  4NYO A;  3HFK A;  1X4B A;  4DR7 J;  2BE7 D;  1NB2 A;  4BWM A;  2R7Q A;  2ZBI A;  1T03 A;  1QSY A;  3TZZ A;  1HIY A;  1KQG B;  3LP2 A;  3OVA A;  3I5C A;  1P1T A;  5GME A;  4DR4 F;  5CCL A;  3LA0 A;  5AXL A;  5T7L B;  2XMK A;  4L3N A;  1RA6 A;  3CO9 A;  1CLF A;  2DHH A;  2K8G A;  4DEZ A;  5ETV A;  4ECS A;  2HG4 A;  2HKE A;  1NME B;  2W01 A;  4M5H A;  1RGV A;  1E6V B;  3F56 A;  1X5S A;  4LSN B;  1Q7Y T;  2HFS A;  2RNE A;  3GV7 B;  1Q95 G;  1NSK L;  2NLW A;  1ZBT A;  3E51 A;  1REV B;  4G65 A;  1HHT P;  1IBC B;  1G3O A;  1LK5 A;  4H4O B;  4O3P A;  5CA5 A;  5I3Q A;  3R5G A;  4DL3 A;  3W8G A;  1R6Y A;  4C7Q A;  3TZX A;  2MKS A;  3HDS A;  1RT7 B;  4IH5 A;  4JI7 F;  2BXJ A;  3FSX A;  2VC1 A;  3G9C A;  3WIV A;  2FC8 A;  2GHW A;  4WZQ A;  2ZNZ A;  3BF4 A;  3OXL A;  3NOC A;  3RBX A;  4DR3 J;  1RTI B;  4MK9 A;  4NAS A;  2EXU A;  1RSC A;  4DL4 A;  5D8H B;  2J6U A;  5KFG A;  1GX6 A;  2FHM A;  1S9G A;  4DPY A;  4ZIV A;  1H73 A;  4JUZ A;  4K4Y A;  2XHW A;  1OQ6 A;  4AD6 A;  2RF2 B;  1Y00 A;  3MED A;  2PI5 A;  1IVZ A;  2C3O A;  5GAH U;  1NLK L;  3VTI A;  4CCH A;  3VZI A;  2YY3 A;  3H7H B;  1HQE B;  4KFB B;  2GMH A;  3C6U A;  2HVI A;  2HQF A;  1X60 A;  4HDH A;  2UVU A;  1O51 A;  1TEL A;  3D54 A;  2MXY A;  1R6V A;  7FDR A;  3H5S A;  2HND B;  4WPA A;  4RW9 A;  3BGR B;  2IVM A;  2BAB A;  3FCV A;  2DXD A;  1HNZ J;  3I96 A;  1TL4 A;  2HHS A;  5CAB A;  3AB4 B;  2IDE A;  1HW9 A;  5F9N A;  1Q79 A;  2QLW A;  1RAA B;  3KXD A;  3U1N A;  2YNH A;  1NBE B;  2KXF A;  3A3N B;  5DZ6 A;  4ZVO B;  4ZVH A;  2ZOM A;  1AUD A;  3VF0 B;  4R25 A;  3OTO F;  4IG3 A;  3IR6 B;  4J90 A;  5KOW A;  3LP2 B;  1NUE A;  1N88 A;  1FFG B;  4OYZ A;  3RRG A;  2HW3 A;  2OTJ S;  2YNF A;  5EN1 A;  2PEB A;  2HHT A;  3E01 A;  4AT1 B;  5H9E J;  4QYZ K;  1UPP A;  3GFH A;  2CIM A;  1H2V Z;  4U9R A;  1UEU A;  2AQ4 A;  5J2N B;  2JFD A;  1RWV B;  2Z2Y B;  1HAR A;  2DRA A;  4ECX A;  2CPE A;  3H4B A;  2BR0 A;  3UI3 A;  2FTR A;  4LF9 F;  1YBT A;  2ADC A;  4UOH A;  3I5B A;  2DVI A;  1JNZ B;  3MM5 A;  5CD4 A;  1D9A A;  4CLP A;  2IJF A;  2HWI A;  5DDQ C;  3LO3 A;  1SQF A;  3M8R A;  2FZC B;  4LF2 A;  4FKX A;  3D1H A;  3EYZ A;  2VG7 A;  2VBZ A;  3W65 A;  2GVZ A;  4RKU C;  1TKX A;  3CGI A;  4NI2 A;  3RU0 A;  3LAN A;  4FKY A;  3WDO A;  1FWP A;  2ZOG A;  4DR4 J;  3OW2 R;  4X2B A;  3A8I A;  2DH9 A;  4OLO A;  3C15 A;  1KD1 T;  3A12 A;  4I4B A;  1BQM B;  1X4G A;  1IUJ A;  2WAQ D;  2EW9 A;  3BSN A;  3G6E S;  1U26 A;  3PJX A;  1G6B A;  2MYF A;  4FXW A;  2AMC B;  4C3L A;  1SUQ A;  3TQE A;  2P5V A;  3GIK A;  4X4N A;  1RHU B;  2RVJ A;  2UUC F;  3OPK A;  1WNE A;  2B4V A;  3DM2 A;  4UW2 A;  2MKY A;  1QUP A;  3T6J A;  3CJ0 A;  4ZIT A;  3QRR A;  2AJF E;  3HKZ D;  4KPY A;  2CJQ A;  4TN2 A;  2AHO B;  1ZTW A;  2A2D A;  4N8O A;  1YJU A;  5I4M A;  3US5 A;  3W5Z A;  2CA9 A;  4UTG A;  3CCE S;  2ZD1 B;  4Q7A A;  3AHP A;  1K1S A;  1RHQ B;  5KFZ A;  4FF2 A;  3KHH A;  3KTQ A;  2YNH B;  4FYW B;  3HD1 A;  4OZ5 A;  2GIQ A;  4JYA J;  5AXM A;  5HLF B;  4G6V B;  1K9M T;  2HFO A;  3B8H A;  3GJQ B;  3RYL A;  4CO3 A;  1EET B;  2LLZ A;  3FDS A;  3IAS 9;  2QSF A;  1Y3J A;  2HZC A;  4LF4 F;  5GMD A;  2LP4 A;  2NUU G;  2XMU A;  3P3D A;  3DOK A;  2MDA A;  2D41 A;  3OFG A;  4CWB A;  4X4T A;  1CVJ A;  1YRX A;  1BHN A;  1FCA A;  1HD0 A;  2KJV A;  5KFD A;  2E29 A;  4K8R A;  5B0B A;  2B7C B;  1KP6 A;  3GQC A;  2VOD A;  3HSJ A;  1HQ2 A;  3CJK A;  2FDN A;  3W60 A;  1IWG A;  2IBO A;  3LAM A;  4JI2 J;  4DL7 A;  2M88 A;  4F2S A;  2EFN A;  1TP7 A;  2H5J B;  2ZBP A;  1RCO B;  1T3O A;  2N3L A;  3SDE A;  1RAC B;  5LXR A;  3JAM Y;  1APS A;  4RW7 B;  1KN6 A;  4AYB D;  3RBZ A;  1FEH A;  1LWF B;  2D74 B;  5HBM B;  3OTO J;  3UFC X;  1TTH B;  3TZW A;  5HVG A;  5L1I A;  1NDK A;  3HSD A;  3TA2 A;  3KNG A;  3BR9 A;  3UNY A;  1HQU B;  1JQG A;  2MMY A;  2FVS A;  3AB2 B;  3K2Y A;  1NKE A;  1BY9 A;  1QUV A;  1HHS A;  2FHO B;  4IFV A;  3AXM A;  2XS2 A;  1QY7 A;  3BH7 B;  2ZZT A;  3BN4 A;  3BYR A;  3O8W A;  5KFS A;  1QVF R;  2K3I A;  5L1K A;  2O5D A;  3TA0 A;  4ED8 A;  4LF9 J;  4QWE A;  3R7N B;  2DRD A;  1VRT A;  3PO5 A;  1JMT A;  3U27 A;  4PWW A;  4WJB A;  4A4J A;  1UVK A;  5T41 A;  3DM2 B;  2VKR A;  3QJP A;  3DI6 B;  1PC4 A;  4BCA A;  3KLE B;  4Y2M A;  2GHP A;  1V3R A;  2MGZ A;  4QR2 A;  4EBD A;  3DGV A;  3PJW A;  2BAC A;  2BZ2 A;  2LEA A;  2MQL A;  4PAA A;  3I56 S;  3B78 A;  2KZM A;  2GIR A;  3I32 A;  3D1O A;  1WOR A;  1S0M A;  2DR9 A;  3NAI A;  1YIT S;  1GTH A;  1R8P A;  1M5K C;  1L3K A;  4MKY A;  1UTA A;  3F0N A;  4J9S A;  4UUX A;  2GMJ A;  2XMM A;  4F4Y A;  4H4M A;  2KH9 A;  5HRO A;  1NPR A;  1RU2 A;  2FQQ B;  3NS5 A;  1UA0 A;  4LUB A;  2PA3 A;  2DR5 A;  2RUG A;  4QW9 A;  4FF1 A;  4ZPV R;  3MM6 A;  1RDR A;  1FD2 A;  5BJR A;  2B0G A;  4ILR A;  2GAG C;  1IQZ A;  3EDQ B;  2UUC J;  1U1K A;  3MUM P;  3DGP A;  1DTQ A;  1PGZ A;  1V3S A;  3BYP A;  4B9S A;  3NMR A;  5J2M B;  3V5R A;  1XNQ F;  2XMT A;  2GQQ A;  2BE2 B;  1U4B A;  5F0W A;  3UCG A;  2HLU A;  4NLP A;  3S8S A;  1ZS6 A;  3I6P A;  2OFG X;  3AOD A;  2PE8 A;  4DR2 J;  2KG1 A;  1FD8 A;  4WYL A;  1IKX A;  3CPW R;  1LOU A;  3K89 A;  5FJ4 A;  9ATC B;  2ZH3 A;  2EI5 A;  4MH8 A;  2XNR A;  4Z7C A;  4A46 A;  3LAL A;  3QIP A;  4ETZ A;  2BYC A;  5IT4 A;  2ZH6 A;  4LF4 J;  1RTH A;  1TV6 A;  1YK9 A;  3PW5 A;  1P9Y A;  1KBR A;  3W1Y C;  5ETP A;  4NEY A;  2FJB B;  3KK1 A;  1T11 A;  3R2D J;  1NAQ A;  1S77 D;  5D0G A;  4DXL A;  1U48 A;  3JQK A;  1XMB A;  4USK A;  4JI0 F;  3TP2 A;  2K06 A;  3PNI A;  1O5J A;  2HHX A;  1S1V A;  5C24 B;  1X5T A;  4J9U E;  6FD1 A;  4ELT A;  3W2W A;  2AT1 B;  3D6M B;  3IBW A;  5HAO A;  3T1Y F;  2FPH X;  1Y5N B;  1H74 A;  3DRS A;  2ZC4 A;  3WZ0 A;  3MUR P;  1YVF A;  4TVA B;  2HGM A;  2MHN A;  5J1N A;  4ETX A;  1KOO A;  2JLE A;  3LAK A;  2XSJ B;  4RU9 A;  4K0K F;  4FYD A;  1EQ0 A;  4L3K A;  1DTT B;  4OZ2 A;  1GAO A;  6AT1 B;  2BAN A;  2EKY A;  2QRR A;  2HVZ A;  2XB2 D;  3QSI A;  5H9E K;  3ZNU A;  2RH3 A;  3UWT A;  3AJ2 A;  2XYH B;  4YDD B;  1SKU B;  4ZA1 A;  2AWZ A;  4IUF A;  4AL7 A;  3CCV S;  4QIG A;  2MJU A;  2OPQ B;  4M5K A;  2W2M P;  3ZZP A;  5HP1 A;  3W5X A;  2W9B B;  2CJY B;  2ZBR A;  2GGP B;  3G8S A;  4DLG A;  3QZ7 A;  2EVZ A;  4NLO A;  1U1R A;  4EEY A;  3NBP A;  2BE9 B;  2C2N A;  4NLQ A;  1U1Q A;  4I64 A;  4LRA A;  2FUG 9;  1F60 B;  1K0T A;  1HNV A;  5IQ6 A;  1UL3 A;  4I6W A;  3FSI A;  4YY3 F;  1RT2 A;  2D9P A;  4OFZ A;  3T19 A;  1DTQ B;  5L1J A;  2VJV A;  2MQM A;  1IM4 A;  5B0D A;  3DHW C;  3EVO A;  4EUV A;  2NCK L;  2OML A;  2QMW A;  3I4P A;  1PIL A;  3IO1 A;  5KG5 A;  1T95 A;  5J2P A;  1HD1 A;  4Q2M A;  1NCL A;  4PQU B;  2IA0 A;  1FJC A;  4WBF A;  5D6G A;  1YGY A;  2A6O A;  3EPI A;  5KT4 A;  4WE1 B;  1JNR B;  3EZU A;  4U7U K;  2DGX A;  3QGP A;  4C11 A;  1PG5 B;  2I2Y A;  1OYE A;  4OJH A;  2GQ2 A;  4LQ9 A;  3R1L A;  1DLO A;  2CZV C;  1P8G A;  3L7U A;  4KHM A;  4WF9 Q;  4URQ U;  3H90 A;  3Q8S B;  4OI6 A;  3H5Y A;  4KY3 A;  1DAR A;  2DCL A;  5ETQ A;  2MST A;  2J9C A;  1B4S A;  3MCO A;  8AT1 B;  3ZTS A;  4Y0F A;  1Z2L A;  1XNQ J;  4DV1 F;  5KAK A;  2V6A A;  2UUB F;  4NPO A;  5RUB A;  4X4P A;  2R8J A;  3JS9 A;  4DUT A;  3VAI A;  3OVB A;  2EBE A;  1PIE A;  4IO9 Q;  3M9M B;  2RQK A;  1Q8B A;  2OI2 A;  2LEP A;  2IRU A;  4DMZ A;  4PYA A;  1JLC A;  4QU7 A;  4CT8 A;  2QE5 A;  2KT2 A;  4RLE A;  2Z8Q A;  4ZHR B;  4Y28 C;  4KGZ B;  2IIH A;  5J2Q A;  4DV5 F;  2F8H A;  2VKZ G;  4MAK A;  3D0G E;  3V6K A;  2DGT A;  2YNG B;  3KK3 A;  1F5B A;  2MLY A;  1YJ7 A;  2CNN B;  1N48 A;  3BDE A;  1RAB B;  4PCQ A;  4JI0 J;  3R7S B;  4KV8 A;  2Q79 A;  3NWG A;  2CFX A;  1HWI A;  2DNL A;  3T1Y J;  1RT4 A;  4PR6 A;  4HI1 A;  1IKV B;  1YRU A;  3BBC A;  4CLF A;  3RB4 A;  4RNF A;  1OYD A;  2DNQ A;  1T05 B;  4OLP A;  2OSR A;  3GIR A;  3CW2 C;  1R0A B;  1NHV A;  1PJ7 A;  5F0U A;  2VDI A;  1ULR A;  2V67 A;  1CJT B;  2ASJ A;  2E5G A;  4HAC A;  4RUC A;  2B7B B;  1EAY C;  3SV4 A;  1CUL B;  1HI0 P;  3UCU P;  4USI A;  3UVJ A;  1LQ9 A;  4DZD A;  5DJB A;  5CAA A;  4BC7 A;  5GAD U;  3MEC B;  3BS9 A;  1C0U B;  4F0H A;  1FWK A;  2NZ4 A;  2DGO A;  3W9H A;  2KFN A;  4LMZ A;  4C11 B;  4EFA C;  4CRJ A;  1U24 A;  1U1L A;  4B3S F;  4NYP A;  1TMJ A;  3FNN A;  4N8N A;  3SCJ E;  2HYI B;  2W7P A;  5F41 A;  1PBA A;  2DPJ A;  4YY3 J;  2W8K A;  4HHU A;  3LP0 B;  4HLB A;  1I94 F;  2XY6 A;  2YKO A;  1RT3 A;  2QGF B;  3HI9 A;  1SKW A;  5DG9 A;  3FFI A;  1FJG F;  3HT3 A;  2MSS A;  4OYP A;  4ZVT B;  2W2N P;  4USV A;  2LDI A;  5KFW A;  1WEZ A;  5FDL B;  2KXN B;  2RQ4 A;  5IWA F;  1LW0 A;  4DX5 A;  2FLP A;  1AZS A;  2XTJ P;  3DRP B;  2RDI A;  4ECZ A;  3PX4 A;  1N5Y B;  3V4I A;  4PUO A;  2IJN A;  3PYF A;  1GXU A;  3MPW A;  3QO9 B;  3NG8 A;  5J1E B;  4DFJ A;  1VOM A;  2RRB A;  5J2Q B;  2NYH A;  3CC2 S;  2M8H A;  2HVE A;  2BA9 A;  2YKN B;  5BYS A;  5D3G B;  3HSG A;  2HHH F;  3L7P A;  3VAL A;  1TL1 A;  2AX0 A;  4DG1 B;  2JLG A;  4DR1 F;  1H2U X;  2M4M A;  3PAC A;  2UUT A;  1IKY B;  2N82 B;  2CJB A;  1UVL A;  2IVF B;  5CXT A;  4PPZ A;  5KT6 A;  3DFE A;  4ENO A;  3DYA B;  4DV1 J;  4GC6 A;  3B4D A;  2UUB J;  2XLJ A;  2IC3 B;  4URS A;  4OHY A;  4TY8 A;  2KU7 A;  1U09 A;  5E3P A;  1TMM A;  2NQP A;  1CJV B;  1QTN B;  1TK8 A;  3P45 B;  1JJ4 A;  2ZNY A;  2RHQ B;  3KUE A;  2CQD A;  5KFY A;  3KLF A;  2EFP A;  4F0K A;  4UT4 A;  1TFY A;  2GX8 A;  2QC3 A;  1S1W B;  4DV5 J;  4F2R A;  1MLA A;  3KG4 A;  4RO0 A;  1FRX A;  3HK2 A;  1X31 C;  3WBZ A;  2D3U A;  2H5I B;  4ZVG A;  3LP1 B;  3OSN A;  1HYS B;  1XIQ A;  3BH6 B;  2ASY A;  2PO4 A;  2Q6B A;  1NDP A;  2E7W A;  1WHW A;  2CQ4 A;  1U1P A;  2OLW A;  2YWG A;  1W26 A;  5GAH I;  1RTD B;  3QFH A;  2OAU A;  3OJS A;  4TYB A;  3MMA A;  2XNQ A;  3W2V B;  3KHG A;  1S5Z A;  1LWE B;  3VAM A;  5GAE U;  3OHA A;  1RT3 B;  1CQM A;  1ZPV A;  1W2B R;  1S9F A;  3OR1 A;  2Y1I A;  5LT5 A;  1DAX A;  4CO0 A;  1YJW S;  1U1O A;  3PM9 A;  2OEJ A;  3UNG C;  2BJ1 A;  1OIA A;  4BS2 A;  5HJY A;  4ECU A;  1AZS B;  2HFU A;  2MQQ A;  4GVB B;  2AV5 A;  2HFV A;  4ILM A;  1X0P A;  3FZ2 A;  3N28 A;  3V81 A;  2Z30 B;  1OMS A;  4PUO B;  3A3P B;  4M63 A;  4FNH A;  4EWT A;  2DNO A;  1Q5V A;  1VLY A;  1S97 A;  3QFW A;  2XY5 A;  2CKW A;  1UZH A;  3OR2 A;  3QT6 A;  1Y5L B;  4B3S J;  1HBO B;  4M5N A;  4U96 A;  1QM9 A;  4WFY A;  4W90 B;  4HHJ A;  1R31 A;  5KFE A;  3DU6 A;  2HHW A;  4OZ0 A;  2UVV A;  1NPP A;  3CB4 A;  1I94 J;  2V8D A;  4IQM A;  4LF1 A;  2MKJ A;  1FJG J;  1Y11 A;  3H59 A;  2B6A A;  3EUN A;  2HVD A;  4M5L A;  3MXH P;  2YH1 A;  4ITS A;  3GCW P;  5IWA J;  1FE0 A;  1VQL S;  1ZM2 A;  2W4D A;  4GRS A;  4K4T A;  5U47 A;  2YWH A;  1B7F A;  4JI8 F;  2G1D A;  4DS5 A;  2RT3 A;  3S1T A;  1P6T A;  3BJY A;  3KJN B;  5F9L A;  3R27 A;  3ETM A;  1NK0 A;  1Z1Z A;  3MAH A;  4WFB Q;  1KQS R;  3M2U B;  1R7I A;  2BKP A;  4P6Q A;  5KG3 A;  4GMK A;  3GMG A;  4WFA Q;  1SBR A;  1GMU A;  4CDI A;  2HHH J;  4DR1 J;  3IP0 A;  1FRM A;  3WC2 A;  1T9Y A;  3IG1 B;  1NHK L;  4LR9 A;  2P9G A;  2OFH X;  1AA1 B;  2BQU A;  2F4V F;  3THP A;  3H40 A;  3R5B A;  4ZJQ A;  4USW A;  2A10 A;  4H4K A;  3HPO A;  3MMA B;  3KJV B;  3OVS A;  3PRB A;  3OUY A;  1MRO B;  2M5Y A;  1HNW F;  3I0R B;  3CCJ S;  3OFF A;  1ELO A;  4OYB A;  3QLH A;  1W2I A;  1JLB B;  2HS4 A;  4J9N A;  3G86 A;  4MYT A;  3HVT A;  3OR1 B;  3HXM A;  2F3J A;  4H54 A;  2VC0 A;  3DOM A;  1S0O A;  4MKA A;  2H4W B;  4IDK B;  3M1V B;  1NK6 A;  3TR5 A;  4JV5 F;  5A0Y A;  3J80 U;  3LGN A;  2DEJ A;  2POK A;  1QTM A;  1T94 A;  4M5D A;  4DL5 A;  1XBW A;  3KDN A;  3SSS A;  3R8Y A;  3V81 B;  1CJU B;  3I5A A;  1FKO A;  2V4J B;  4CYU A;  1KDN A;  1U2C A;  2ZKT A;  3QT5 A;  2LYV A;  1HPZ A;  4P2M A;  5E0O A;  1N6Q A;  3NXZ A;  4U6P A;  4R5P A;  3VQT A;  2VPY B;  3CCZ A;  3HD2 A;  3V6D B;  3FUY A;  1E6Y B;  2MQN A;  5C25 A;  2J0Q D;  2E66 A;  3R5J B;  1SCJ B;  1NO8 A;  5F8G A;  4Q0B A;  3M2R B;  4Z37 A;  4UQT A;  2ROG A;  2IDL A;  5KFB A;  1HFE L;  2JSX A;  1KLN A;  4N76 A;  3PY8 A;  4IG0 A;  1JK9 B;  3MR7 A;  3MEG A;  3WX4 A;  1SC4 B;  1YG0 A;  1HI1 A;  1R0C B;  2V94 A;  2RUS A;  1X8D A;  2DNR A;  3ZZ0 A;  2J0S D;  2ZHO A;  5G4D A;  2ASL A;  3RW6 A;  2XLI A;  4JOU A;  2GHV C;  1M5O C;  1S72 S;  1S7I A;  3DN9 A;  4CO5 A;  5A6W A;  1VC0 A;  2XSF A;  3U7J A;  3F44 A;  3M05 A;  3CJQ A;  2RKI B;  3HFZ B;  3N4W A;  2M0G B;  2XS7 A;  3BR8 A;  4NLT A;  3ETO A;  3MCS A;  1KNZ A;  4KH0 B;  1QLN A;  2N4C A;  1UVM A;  4DF4 A;  1TUW A;  4Y65 A;  2DGS A;  3JSR A;  4IRD A;  2CXE A;  2XS5 A;  4DPX A;  4ZJL A;  3EXC X;  2VL1 A;  1TL7 A;  1FDD A;  3CJT A;  1HI8 A;  1N54 B;  4RBV A;  2ZEJ A;  2V8V A;  3S01 A;  2VA3 A;  3ZZT A;  4W4M A;  1MW7 A;  4N77 A;  4RW4 A;  3OTE A;  3J80 Y;  1V3Z A;  4B3O B;  2B9X A;  2PDA A;  4MKB A;  4DV6 F;  1KHW A;  2CWK A;  1M5H A;  2DHS A;  2ZH2 A;  1BUX A;  5IC4 B;  3FC9 A;  1T9U A;  5ETN A;  2HQG A;  1FTC A;  4P74 A;  4ZDN A;  4TQR A;  2V50 A;  2CQH A;  2VG6 B;  2OPS B;  1HNW J;  5ETT A;  4I6Y A;  1BE4 A;  5BYQ A;  2YBV A;  2KRB A;  5C25 B;  1A0O B;  2ACY A;  4B3R J;  1MMD A;  2BRL A;  5HK4 A;  2V9K A;  2LXU A;  4P2S A;  3GII A;  1LKZ A;  4A8W A;  3PW2 A;  4C4W A;  4NZ7 A;  3BQ2 A;  3THV A;  4A8K A;  2BKO A;  1HNX J;  4JV5 J;  4OHV A;  1VQM S;  7AT1 B;  1WSR A;  3D7S B;  2GNK A;  5ETR A;  5G0R A;  1N0U A;  5A8R A;  4XIU A;  4IG0 B;  3FCW A;  2AU0 A;  2HRU A;  4N5S A;  4MYU A;  1RWK B;  1S1U B;  2WB4 A;  4ERD A;  2H4Y B;  2LQ8 A;  4DI6 A;  2XEX A;  1VBZ A;  3IM9 A;  4WIQ A;  4HT5 A;  3OLB A;  2D9O A;  3MTJ A;  5LXY A;  1KRP A;  4DQS A;  2HPU A;  3OTC A;  2OTL S;  2ZUG A;  5K8N A;  4LRE A;  3PVX A;  3BGL A;  1BQN B;  4DX8 H;  2CJK A;  3N6M A;  2ZJR Q;  1HBN A;  1N5T A;  5HAT A;  4OJ3 A;  5DM7 Q;  4JI5 J;  3MMJ A;  1VBK A;  4TU7 A;  3FRZ A;  4ZCM A;  2XMA A;  2FYX A;  2JZ5 A;  2KO1 A;  1FJE B;  4X4O A;  3QBC A;  3NNC A;  2HHU A;  3AD8 C;  2FY1 A;  3MM7 A;  1YKW A;  1IM6 A;  3D0I E;  3KLG A;  4KH1 B;  3CCR S;  5F8M A;  1VQ6 S;  5IT0 A;  4AXI A;  2VFS A;  4IFY B;  1S12 A;  4U67 Q;  2Q66 A;  2HWH A;  2KI2 A;  2LFV A;  1RJJ A;  1SH2 A;  2Y1R I;  1S6U A;  1RLC L;  1MML A;  3A8K A;  2V63 A;  5A8W A;  2GS8 A;  2QLJ B;  2YPZ A;  1JLA A;  2YKP A;  4Y2K A;  1GX5 A;  3W9J A;  2B9E A;  4P71 A;  2ZC3 A;  4ZPW R;  1R27 B;  2R4F A;  4C8M A;  3GCX P;  3MPY A;  1J5O B;  2ZBC A;  3GYN A;  4QZV B;  4MIB A;  1RT6 B;  3SI8 A;  4LF6 F;  3MM9 B;  4Q45 A;  3KWM A;  4X66 F;  3P5T L;  3ZZY A;  2JC0 A;  4L74 A;  2DNG A;  4ZP6 A;  4ICL A;  2XO6 A;  5IQQ A;  2MY7 A;  4M5J A;  4IH7 A;  1S6O A;  2RRA A;  2JEG A;  2LXF A;  3IRX B;  3R97 A;  3K5N A;  1LFW A;  2HBZ B;  3PRD A;  2YTC A;  5CYM A;  2BW7 A;  1VC5 A;  1JLF B;  4C48 A;  4OI0 A;  1IBK F;  1B0P A;  4P10 A;  1H72 C;  1MN7 A;  3VCD A;  3TVK A;  3T3F A;  4YUD A;  1L3V A;  5I3P A;  2YH0 A;  2MZR A;  4YQW A;  2L3M A;  5F8I A;  1S1X A;  5IXU A;  2UXC F;  1S6Q A;  1N5Q A;  3MAA B;  4OZJ A;  3PFE A;  4NCA A;  5SUH A;  3HHK A;  3ZTR A;  1VK8 A;  1WEL A;  2Y8W A;  4OJG A;  2DO4 A;  3I0S A;  3NS6 A;  4WXO A;  4MIW A;  1RHJ B;  3DCA A;  4OV6 A;  2IJR A;  3CJ4 A;  2BJ9 A;  2R7X A;  1SH0 A;  3MUV P;  3CDA A;  2E9R X;  2U2F A;  5IOL A;  2IY5 B;  4K5S A;  3BB5 A;  3IS9 A;  2G2Z A;  8ATC B;  2LU1 A;  4YR3 A;  1Q53 A;  3TJ8 A;  2DGW A;  4NA3 A;  4N56 A;  4GVL A;  1RT5 A;  3NKY A;  2E1P A;  3M6X A;  4RU2 A;  1UWB A;  1XQI A;  3NCP A;  1FXR A;  2HNY B;  4M1K A;  3SCL E;  4K4W A;  4RUB A;  3C2P A;  1ZA2 B;  2OO4 A;  3KLH B;  3N6L A;  5C42 B;  4OYI A;  2JL9 A;  1PO6 A;  1JJH A;  3EPG A;  4F3Q A;  5HMY A;  2VHG A;  3JQJ A;  3ET6 A;  3H5U A;  2SXL A;  3EM1 A;  4DQP A;  2M2B A;  2E9T A;  1XK8 A;  2PGC A;  4NCG B;  4IR9 A;  4C9D A;  3EZO A;  3KUH A;  4NZ6 A;  1NHU A;  2WVD A;  4CNY A;  4CO4 A;  1YBU A;  1EQM A;  5GAD I;  2HMI A;  4K7Q A;  1Q8K A;  4UY8 5;  2IBK A;  4I2P A;  2RB7 A;  2EG1 A;  2Z57 B;  5I42 A;  1Q1K A;  3LGM A;  3KG0 A;  3C14 B;  1LXN A;  4QIV A;  2N3O A;  4OHW A;  3J7Z T;  1S1X B;  5IV4 A;  2LQB A;  4LF6 J;  2C2R A;  3MD3 A;  4X66 J;  1NK7 A;  3E8O A;  2VFR A;  4C8K A;  3TI0 A;  3VHQ A;  4KJI A;  3NLC A;  2VFU A;  5KFX A;  4ZVQ B;  4RWX A;  3CNQ P;  2Z2M A;  5DQG A;  3JSB A;  4CI0 B;  3D2W A;  3BO4 A;  1I6J A;  1DBD A;  4WCE Q;  1KFS A;  1RTJ B;  3SXL A;  3D6H B;  5L1L A;  1U1N A;  4NXM F;  1ACM B;  4B9L A;  3CC4 S;  2BW2 A;  1IBK J;  1VHF A;  5K8M A;  2FHJ A;  2ATC B;  4DSI A;  4QWD A;  3TQ1 A;  5HI7 A;  1TZ0 A;  1GQE A;  4EYI B;  3AA9 A;  2GIF A;  1HBM A;  2JVR A;  3K0J A;  1AB8 A;  2YQ0 A;  4RUA A;  3TUZ C;  3RAM A;  4OYW A;  2H48 B;  3M2V B;  4H4K C;  2OPR A;  1OPZ A;  2IM2 A;  4ED0 A;  3TAQ A;  3EX7 B;  1GNK A;  1HNI A;  3MEE A;  2VG5 B;  4XDC A;  4XAK A;  3GFX A;  4NMX A;  3JB9 k;  1N32 F;  3AH6 A;  3MEK A;  3HUL A;  4S0M A;  5KTQ A;  3TAM B;  4ED7 A;  2UV8 G;  2R2T A;  2WVE A;  2QA4 G;  2BOP A;  1WG1 A;  1RTZ A;  3H20 A;  2CWX A;  2YX7 A;  1D3W A;  3H98 A;  4M5I A;  3A8J A;  1HW8 A;  1ZET A;  2BVZ A;  2WHO A;  2E1M C;  2QJ3 A;  1ZAX A;  4A8S A;  4QR1 A;  4JB8 B;  4KO0 A;  3G71 S;  4MJK A;  2XGQ A;  2XZW A;  2B56 A;  4X4U A;  2H51 B;  2FIU A;  2X1G A;  1V6H A; 
#chains in the Genus database with same CATH homology
 3HD1 A;  3ILL A;  3HT0 A;  3ILI A;  5ETM A;  1RAO A;  1RU1 A;  4M5J A;  1TMM A;  5ETO A;  3MCO A;  3QBC A;  4M5M A;  3IP0 A;  4M5H A;  4CRJ A;  1CBK A;  3ILO A;  1TMJ A;  1RU2 A;  1EQM A;  3HSD A;  2CG8 A;  3KUG A;  3MCN A;  5ETL A;  5ETK A;  4AD6 A;  1RTZ A;  1KBR A;  3KUH A;  2F65 A;  4F7V A;  1IM6 A;  1RB0 A;  4M5N A;  5ETP A;  1HKA A;  1DY3 A;  5ETT A;  2F63 A;  3HD2 A;  3HSJ A;  3KUE A;  3UDE A;  4CYU B;  1F9H A;  4M5K A;  1HQ2 A;  4M5I A;  4CYU A;  1Q0N A;  1G4C A;  4CWB A;  2QX0 A;  3HSG A;  4M5L A;  5ETS A;  3UD5 A;  1EQ0 A;  5ETR A;  3ILJ A;  1EX8 A;  3HCX A;  4M5G A;  5ETN A;  2BMB A;  5ETQ A;  5ETV A;  3MCM A;  3HSZ A;  3UDV A;  4PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...