1G4CA

Crystal structure of a complex of hppk(r92a) from e.coli with mg2+ at 1.65 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1g4cA00
1TMJA 2QX0A 1EQMA 3HSJA 3ILIA 4M5JA 3MCOA 3HD1A 2F65A 1F9HA 5ETRA 4CRJA 3ILOA 3HCXA 4F7VA 2BMBA 1IM6A 2CG8A 3HD2A 4M5LA 4M5KA 4M5IA 3UD5A 1RU2A 4M5HA 3MCMA 4M5MA 5ETVA 3KUGA 1RTZA 1HQ2A 5ETKA 3UDVA 4AD6A 4CYUB 3HSZA 1RU1A 4M5GA 5ETQA 5ETMA 5ETNA 5ETTA 5ETLA 4PZVA 5ETSA 3HSGA 2F63A 1TMMA 1HKAA 3MCNA 1DY3A 5ETPA 1KBRA 3HSDA 3IP0A 3KUEA 1EQ0A 1EX8A 3ILLA 5ETOA 1RB0A 3ILJA 3KUHA 1G4CA 1RAOA 3UDEA 3QBCA 4CYUA 3HT0A 1CBKA 4M5NA 4CWBA 1Q0NA
chains in the Genus database with same CATH superfamily
3LP1A 2MKYA 4NXMF 1B70B 1RWNB 2YNHB 1Q81T 5F8MA 2BEFA 3MMCB 4CYUB 5E7OB 1AA1B 2J8SA 3CB4A 1EJ7L 3TVZA 1WF1A 1X0PA 1GMVA 2LP4A 2HLTA 2HHHJ 1RSCA 1M1GA 4K4TA 3JSMB 1MG7A 1K0TA 2HNYB 2DCUB 3CCTA 2ZNZA 5LMUF 4HT5A 1YTYA 4B08A 3AJ1A 3I5BA 1BQXA 1APSA 5KFLA 3VHQA 1WORA 1OSCA 2V94A 4PWUA 4NCBA 2GVDB 1OSDA 3IWXA 1JLCB 1EETA 4Y2MA 2OP5A 1HBNB 3ZO7A 1YI2S 3M8WA 4CH7A 1KSPA 3BQ2A 5E3AA 1J5OB 4OYMA 4WK3A 2M5YA 1Z1ZA 3ZZZA 3DXBA 4ZP6A 3M2VA 2BX6A 1SB6A 2BKPA 3R5DA 4XDCA 1I1GA 1N6QB 3HFKA 1S6PB 3IAM9 3M6UA 1RWWB 2AMCB 4X4PA 2KG1A 3MMAA 4LMZA 2ABYA 3SQGB 2EFQA 1NPPA 3GMGA 4LSLA 2FVSA 3OL7A 3MUTP 2ASDA 3I4PA 1IUJA 3PW7A 1FEHA 4KFBA 5KFQA 2HVEA 2VJUA 2JZ5A 1CJTA 4DUYJ 4JI4J 1FJGJ 2LQBA 3LOUA 4DV1J 1ULRA 3BGLA 5FDLB 1H7WA 1S10A 3RAMA 4J9NA 1AZSA 1N52B 3BN4A 4LIRA 5HJXA 5ETKA 2AYEA 4QIGA 3M4XA 3PY8A 1NZAA 4OL8A 2OELA 3T5JA 3V6HA 3ZTQA 3H90A 5U47A 2HFUA 5CD4A 2KKHA 2JEFA 3T5HA 4EI2A 3HM9A 5CCMA 2DNMA 3KLHB 1JKHA 4ZCLA 2C28A 1RQ0A 3QLHB 1YK9A 1TKDA 4UTGA 3RTVA 2CUYA 4WKYA 1WOSA 2HHSA 1HPZB 2FC8A 5HQ8A 4B3OB 3HT0A 3GTYX 3KJNB 3OHBA 4LIWA 1N33J 3GZ7A 4L3KA 2RH3A 5F8GA 3EPIA 2KFYA 2C2RA 2I38A 3P6YC 3NGKA 1LW0A 2CQBA 1EETB 3AXKA 3UW1A 2IAJB 3MWBA 4P2SA 4HACB 3GIMA 2O1PA 5HO4A 2CPHA 2XMAA 3R6GB 5DQHA 2CIMA 4ZP9A 1JLEB 2RDJA 1Q78A 1U2RA 1Q7LB 3FBBA 5ETOA 5DDPC 2HQGA 3RGIA 4LFBF 1VI7A 3EGNA 4Q0BA 3M8RA 2R7QA 2CZ9A 1HL6A 1RTZA 5D0RA 1EHWA 3NS7B 1RCOB 1NZ8A 3J7YI 3PHTA 2IMOA 1XR7A 2DKOB 3CJ8A 3L95X 1QTNB 3JB9k 4RW4B 5IS2A 4LSZB 2QLXA 3Q2SC 1EKRA 3TZXA 4Y6IA 2LEPA 3OBIA 3KHGA 1HA1A 4P9SA 2E1RA 4IOBA 4ZHRA 4DFPA 1IKVA 5KFZA 1S9GA 2M0GB 1P27B 3K17A 4DF4A 5IT9U 3TQEA 3P96A 2XLIA 2M88A 1YJNS 4PG4A 3DDNA 3CT9A 4C0HA 4DSEA 2V63A 4PYDA 2G1DA 3G8TA 3HVWA 3A8KA 5J1NA 2HK2A 4DZ6A 1VYAA 2VBZA 1FO1A 2BE9B 4IG3A 4OX9J 3DLGB 3U7JA 4DXLA 4IO9Q 5ETMA 1F60B 3DRRA 5IT9Y 1WF2A 1S77D 2RUGA 3C3LA 4WBFA 2E7VA 3DI6A 1HLWA 2B9XA 2V9WA 2R7SA 5CHCB 3GFZA 3PKYA 2E5LF 2C2DA 2W8LA 1YGYA 3PJWA 1LWXA 3SMZA 1HNWJ 1U25A 1RT7B 3ADAC 1U09A 3T1HF 1KFSA 1N8RT 1MMDA 1YRTA 3KLVA 3FZ2A 4JOUA 1U47A 4I6YA 2OPSA 3TZWA 4PYAA 1PAEX 2D3OR 2MKSA 3G4SS 1Y00A 3N79A 4OIXA 4ZOSA 1UZHA 4DV6F 3GCXP 3P4UB 5A0YA 2XG8A 2Q6BA 1Q7YT 4KHRA 4M5DA 1CBKA 3UN5A 4F50A 5J2PB 2IRYA 1VQ5S 1M5HA 1RAFB 4X64F 3A3NB 1HBMA 3AB4B 1KEKA 1A7GE 4KHPJ 9RUBA 1U6ZA 1PYOB 3W2WB 3J81j 1U1KA 3T6JA 1NSAA 4JI7J 3R2CJ 3PX4A 4B02A 2XO6A 2BXJA 4RW8B 5IWAJ 2B6AA 2BDPA 4JV5J 4USWA 1LQ9A 3HVRA 2F4VJ 3UWTA 1B7YB 1FKAF 1WC5A 1CPZA 4ZKAA 2LLZA 4U9RA 4KR0B 3TAPA 4USKA 4K4UA 1WTBA 1TK5A 4Q7AA 2QLWA 3AQOA 1N48A 3EYZA 3NMAA 1MLAA 1ICEB 1M90T 4U7UK 3LALA 4LF5F 1YJ9S 2VOPA 2YWFA 2BQUA 1UAWA 2V2KA 3UNYA 1HKAA 3IRXB 2HWTA 2CVIA 3MPYA 3C6UB 1LWCB 4CNZA 3LH2S 1JLAB 2BJ8A 3D3CJ 1UEUA 3W8PA 4YB7A 2UUAF 2VG7B 3CD5A 1R8PA 3CIZA 4G1IA 3Q8QB 2BOPA 2D41A 4EWTA 4WPAA 3KLFA 2F8HA 2HKEA 1PC5A 5KFMA 3K5MA 2H4YB 4PQUB 3M2UA 4LUBA 1D3WA 3AODA 1WDDA 2YWEA 1RACB 4OX7A 4WFXA 1WJ9A 1F5CA 3RBDA 2XMKA 4RPFA 1EQMA 2HFNA 1RT5B 1DQ8A 2AYBA 4HEA9 3IM8A 3GB0A 2GS8A 2KYXA 2HW3A 1R8AA 1UJ5A 3CDAA 5BYSA 2BJ3A 4LQ3A 3EMTA 3HLUA 2YNFA 2L9DA 5DZ6A 1K9MT 2ZC4A 1UEKA 1SIWB 3EX7B 2A0FB 4WYLA 2AJ1A 1ZA1B 4TXSA 2ZH2A 3F0NA 1FVSA 4ICLB 4KV8A 2VPYB 3LQVA 1IKYB 1NMEB 2HQ3A 1TVRA 1S9EA 3RW6A 2Y0SD 2V69A 1NSPA 5AXLA 3WX4A 2L48A 3TA0A 3R2DJ 2BJDA 4JUZA 2JVRA 1UJ4A 1H38A 1S0VA 2JEIA 4IQXA 2HZCA 1F2HA 2CNLB 1PSDA 2CDQA 2VIHA 4URGA 4IG0B 3C6TA 1RGVA 4NWBA 2OUGA 1HYSA 2EVZA 1JJHA 5GVQA 2B7CB 2PIIA 4FKYA 5M2UA 5A2QU 3NOGA 2GHPA 2HZAA 3NL0A 3H4BA 3B8HA 4EFAC 1P1TA 2H3EB 4M5LA 5KT6A 1GMWD 4A8KA 4DL2A 4OHZA 3AD9C 3NCPA 4OZ5A 3MCNA 2MKKA 4X65F 1FX2A 2D9OA 1HHTP 3LPEA 4OZ2A 2W24A 4NRUA 5H9EK 3I5AA 3PEHA 5A2QY 4NX9A 4HYKA 2H5IB 4O4RA 4F0HA 1S1VA 1FJCA 1DQ9A 4K0KF 4HKQA 4LVOP 3VGSA 2VPZB 3KG0A 2L41A 4EK2A 2IMWP 2ZE2A 4Q8EA 2FJWA 5A8KA 2ZH1A 3ETOA 4OI6A 1WOOA 4RUBA 2IHR1 3TOQA 4O3NA 5G4DA 1NUEA 2QG9B 3MR7A 4A8YA 3IFEA 3MM5B 2HG4A 1JLQA 4Y00A 3E01B 4MFBB 1C2PA 2MJNA 4I2PA 1IBKF 1HNZJ 3BDEA 3A12A 3OTDA 3IBWA 1NKCA 3ITHB 4TY8B 2ASLA 4K5RA 2PD1A 1X4EA 1O5JA 1IR1A 1LV5A 2K1RB 2GZOA 3VAHA 1KP6A 4PG7A 4A8XA 4F8RA 3DLLQ 2ZH3A 3TYTA 3QZ8A 3F44A 3IWNC 2XS2A 4ZDNA 4DG1A 1LW2A 3MR5A 2MQQA 3PR5B 3SV3A 4C8MA 2OD6A 3O3LA 2V8PA 5M2RA 5CYMA 4FF2A 1UWBB 2Y1IA 3QO9B 2DEJA 3MI7X 2I5JA 1HQEA 2ZUAA 1QTMA 4P2XA 3TARA 2KB2A 4NLRA 5D4PA 4J9RA 4KE5A 1UEVA 1ZZFA 2QT7A 5B0AA 1AYEA 1N32J 4C6AA 3NGDA 4USIA 2MQOA 1EKSA 1RHKB 1U1LA 5CD4H 3GYNA 4FVMA 4NLVA 2OPQB 1VRUA 1G1XA 3E51A 3I0SB 4DV7J 1TFYA 2MHEA 2CQPA 2NXEA 4WP9A 4CH1A 4O44A 5IV3A 1HBOB 4FS2A 4WYWA 2BKOA 2DPIA 1RYRA 3OW2R 1VQ8S 1XNRJ 4IFVA 4O4GA 1C0UB 4DL7A 3KLEB 3SCKE 5IV4A 1QAXA 2WZ1A 3HHLD 2OMOA 3F73A 1S1UA 2AT1B 2QA1A 1HBUB 1C0TA 5C42B 2C2OB 3NWRA 1S12A 3S1TA 4CTAA 2CPJA 3BV8A 1CJKB 1NJXA 2R7OA 2ZUGA 3VQTA 2AJ0A 3AT1B 4QYZK 2MY7A 1WHYA 1KQKA 3G2XA 4CZCA 4DDFA 3TWZA 2DBBA 2BJEA 3I31A 1N0UA 3EZ5A 2BM0A 5I42A 1RK8A 4NPOA 3MM8A 4TU7A 5FIIA 4JP8A 5IT0A 1RBOB 2IDLA 3TI0A 4GRSA 3W7BA 4H4MB 4LF6F 1O0PA 1DHMA 2AGOA 4LF4J 4ATNA 3I0RA 2XS7A 1NJWA 4B9LA 3W65A 5AT1B 2MKHA 1CJVB 2I2YA 2BRLA 1J27A 3OFGA 1JIHA 1I6JA 1EIYB 2CJ9A 2VG6A 5IQQA 4QWAA 1R8BA 3BPDA 2ZH9A 1RAHB 4CT9A 4E0DA 1PIEA 1S6UA 5DLFA 5J2MB 4AXIA 1U6FA 5E41A 1JLBB 1CLFA 4KKOB 2FC9A 4F26A 1VGYA 4DR5F 2HHVA 3NEKA 2VA2A 1PJ7A 4ANDA 4TKTA 5I3PA 2OI2A 1I94J 5B08A 2E1MC 3HKWA 4JV0A 2N3OA 3P49B 4DUTA 4M5KA 5HI7A 1B0TA 1GAOA 1IWAA 3S01A 2X51A 2MPUA 1NBEB 4GMKA 4QOTA 2AZ3A 3NGSA 4ZPTR 2R9LA 4YQWA 3VGVA 2QEXS 2YWHA 2A2CA 3LW5C 2Y9HA 2LYVA 4JI1F 1UW4A 1JK9B 1KN6A 2KXFA 4NYPA 1PGZA 2MKJA 2A2DA 5HANA 3G8SA 4ILMA 4WCEQ 3KOAA 2ZM6J 2RB7A 2J7KA 4USMA 1FRJA 3F41A 4ZVOB 1FK9A 3DM2B 3LP0B 2KN4A 3LP2A 4X4QA 4B3TJ 2FIUA 2RE1A 1BY9A 4DCJB 2XULA 3PO5A 2EC0A 3HVTA 5AXNA 1VHIA 2XSJB 4ED4A 5I4MA 4X62J 3MEGA 1JLFB 2W01A 4G6VB 4A8WA 1RADB 4P71A 2E44A 4QJVA 1QAIA 2ASYA 3JQMA 4X4VA 3KWMA 3HHDA 3DGPA 4R8UA 2PE8A 4CO2A 2IA6A 3MAQA 1LWEB 1IBLF 2OH2A 1SBRA 2ADCA 1NPKA 3BR9A 4HL9A 5C25B 4FF4A 1BQNA 1KTQA 3EWGA 2VKZG 2ZH7A 5E5NA 4YMEA 3CCUS 2DGXA 3DLKB 5GAEU 1T11A 1H72C 4PG6A 3QT7A 4I6AA 1WKKA 3RAQA 1MU2B 4X66J 4CLFA 5KT7A 4RR5A 2LEBA 4F3OA 3H20A 2UVUA 7FD1A 1L5UA 3UE2A 3U1NA 2KI2A 1GXLA 1VC5A 4GVBA 1CULA 3BSCA 1N5YB 2HVIA 2IBOA 3ILJA 3NG8A 3RR7A 4DV3J 2RU9A 5LT5A 3Q8UA 1S0MA 1TKTA 4ECYA 5D4NA 1S4FA 2W2MP 2CG4A 1TL1A 1TMMA 2E29A 1VBYA 4MK8A 5K8NA 2ILYA 3T5LA 3ISND 1HQUB 1QLNA 2WVCA 2BJ7A 1AB8A 4WP8A 3N4WA 3VVTA 2HGLA 1RHJB 4DPOA 2YWGA 3QBCA 3OTOF 3MECB 5CQGA 2ZD1B 1PILA 4ZPVR 1S57A 3TX8A 2VQEJ 4U6PA 1KQFB 5HP1B 4HI1A 2F1FA 3R6LB 1NU4A 2VOOA 1S7IA 1RBAA 4UOHA 3DLJA 3HVTB 1MROB 4CM2A 1ZPVA 2B43A 4DPUA 5DRKA 4JI6F 1X60A 3DRYA 5LMNJ 4B3SF 4ZPWR 2ATCB 5KFHA 2HHWA 2MB0B 2AX0A 1W26A 3W9JA 2RF2A 4NLGA 2CJYB 3UD5A 2R7WA 2ROPA 2MEWA 4E2FB 4JI2J 1Y9OA 1VFJA 5RUBA 1KR4A 2B3TB 3A3OB 4ECVA 1FESA 3D9BA 1ZBTA 2ATLA 2IVYA 2HHUA 4B9NA 2VG5A 3HJVA 4IH6A 4PXEA 2W8KA 5DETA 2KYZA 4KGKA 2XS5A 4PG5A 3D0GE 2DO4A 1YVFA 4ZN1A 4QWCA 3FUYA 3HSGA 1YRXA 1GXTA 1TV6B 3MR2A 2YKMA 4IOCQ 1DARA 4K5SA 1SJ1A 4UZBA 3KTQA 2VASA 2JX2A 2DNQA 2HQFA 2D7SA 1CJUB 4TYAA 1KVJA 3VAIA 4NYZA 4YS2A 3BSOA 1VRTB 2CJAA 3RJMB 1U2FA 2FLOA 2XMTA 5HBMB 4ZVEA 3OJSA 5BR8F 4EZ9A 5E3PA 2AJ4A 1D0EA 4ZITA 2KU7A 5DO2A 1DTTA 5D8HB 1VQ6S 2R8IA 2ZC3A 2ZBPA 1SC4B 2HNDB 3UDVA 1VQOS 4N76A 1HWLA 3TQ1A 2AQ4A 2P6SA 1V3SA 2GFFA 3Q86A 3CJ5A 3HZGA 4LBPA 3KG1A 1R6VA 1JWWA 5T14A 3ZTRA 4O3PA 2DR7A 1YRUA 1F9EB 3SI8A 3OJUA 1FX4A 3KMSA 3R5AA 2R7TA 1YJRA 4M95A 5IZHA 5HLFA 5HROB 2DNRA 2MXYA 4S0MA 2EFGA 3N6LA 3BO3A 3ZXWA 3MPVA 2ZDOA 3BH7B 2JHEA 4ELTA 4FNHA 5GAGU 4W92B 1RT4B 3DRSA 3DGVA 2AGPA 4ECSA 2FVRA 1CS4A 2AJQA 5DZ7A 2R2RA 1UMJA 1GMUA 4KY3A 2BW2A 4I7FA 2MLYA 3MAAB 3DRPA 4L75A 4Q2LA 4DV4F 2E1PA 3M1VA 3CJTA 3JTPA 2WOMA 4CRJA 2ZKTA 3H7HB 1FVQA 4ES3A 3FK4A 2VBWA 2H1YA 1LFPA 1U8SA 4P75A 3QPIA 4Y2AA 4NXMJ 3J80U 3MEEB 1F9HA 3R7NB 1HNXJ 1GNKA 2DNYA 4NLQA 2PC6A 1YKWA 2VU5A 3CD0A 4U8VA 5D4LA 2RS8A 3N5BA 4H4OB 4A8OA 1RA7A 2MQPA 3DOMA 1WI8A 5D6GA 3J80Y 1TAQA 1UPPA 3UR3C 4YY3J 3DYAA 3TX0A 4B17A 2AX1A 1SQGA 1XN9A 4K4ZA 4NLSA 3OL6A 2HHXA 3DDIA 4YOEA 1U24A 2EKYA 4JI8J 1FNOA 2I9SA 3RAXA 3MPUB 2RVJA 5F8NA 2Y8WA 1RB0A 2MYFA 3UCUP 8AT1B 3N6NA 4PUOB 4YR2A 4WE1B 3ZTPA 4L6V3 2GCFA 4B3MF 4ALZA 4KPYA 3KLIB 1UVNA 4DR4F 2IC3B 1NHUA 1SCJB 1SH3A 3HD1A 1QUVA 1NK5A 1S1XB 2ILZA 5B0BA 4GVLA 3POTB 1VS3A 1YIJS 1MNEA 2F63A 2QL5B 4AXJA 3C46A 3AD8C 2L9WA 2ZHOA 3FCHA 1ZM4A 2N7CA 3J7AN 1BD6A 2FY1A 1SPBP 4HDHA 2OSRA 1FKOB 1U4BA 4F4ZA 2V34A 4OJHA 1RHMB 1W7WA 2IJNA 2FGOA 3OR2A 1VMBA 5CYQA 2OKQA 5B0FA 1Q4RA 2YBVA 1TUGB 2CQ3A 3TRGA 3JYTB 3IR5B 2DXFA 1Q8LA 1IQTA 3O6QA 2JL9A 2EC2A 1PJ5A 1M1HA 2J9EA 2DVIA 1FKPB 1LXJA 3W5YA 2BKNA 1P8GA 3IR7B 4BLGA 4ECWA 1LWFA 5LXYA 2HS4A 2X1BA 3LF0A 1D09B 3HP6A 2OMLA 5JUMA 2RS2A 1IJFB 3SFGA 3PYEA 5HVFA 4C8YA 1T9VA 4ZIVA 2CADA 2M70A 4N41A 4A46A 1RAGB 3EGWB 2O01C 5FD1A 1B99A 4KGVB 4WU2A 2BE2A 2B4OA 3N9UC 4OZLA 1UTAA 2Q6CA 1ACMB 2XCPA 4X4RA 4F25A 1X4FA 2HQIA 3G9CA 1GK8A 1S6QB 2O67A 3GSDA 1WNEA 3BREA 3FVYA 1RLDA 3D7SB 2EBGA 2C2EA 5THWA 1AUSL 2RKIA 4LFBJ 3CCES 4DX6A 4N8NA 3M8PB 4C0BA 1F6TA 4UY8T 4DN0A 1L3TA 3FRYA 2HBQB 4OYIA 3SIPB 3SBMA 4I6WA 3KK2B 2IM3A 2DR8A 2BMBA 4P52A 2XNQA 5K5MA 3ENQA 1MWZA 2B8QA 1VQKS 3KHRA 4W90B 2KHCA 1FFWB 4JYAF 1TR0A 4PPDA 1RWKB 3D0IE 1MN9A 4F2SA 4Q8FA 2CWXA 5EDWA 2GGPB 2JOQA 4K4XA 4P10A 5H1SV 3LGHA 5C24B 2PT0A 2EEYA 2Y0BB 3KJVA 1U1MA 1FTCA 1KFDA 2QO3A 1F0XA 4HHHA 2AHOB 2FJBB 3OLAA 3W66A 2HRUA 5D77A 4A8QA 1TKXB 1GMWA 2F8MA 5KFVA 4QCLA 2EFNA 4KT0C 3CMQA 1DRZA 2XYHB 2FQQB 1S0OA 2QZ8A 3M8YA 2ACMA 4YR0A 3LUYA 2BVZA 2EFPA 4F0MA 5EN1A 2V4QA 3E8OA 1UZDA 1FXDA 4RO0A 1SQEA 2FZGB 3W9HA 3CD6S 4B9SA 3WZ0A 4DR3J 4JV1A 5LM7E 3CJ4A 1HW9A 1PJ6A 4DX5A 2GNKA 3KK1B 2PMWA 2PMHA 4MIWA 4NI2A 4PR6A 1RWMB 1JJCB 3C14B 1XEZA 5IQ6A 2UXDF 5AXMA 3TUIC 3J7A1 4AUKA 2DH8A 4ZLJA 5IXUA 4QWDA 5T41A 2POKA 2XMMA 4PEOA 4KPCA 4ETZA 5HJYA 3OUYA 3MTJA 2AIRB 2ZBIA 1U49A 1RUSA 5F3ZA 2CNNB 4DV6J 4EO8A 2PFFB 1OY8A 2N7YA 1S97A 3SSRA 3RBXA 1NK8A 3EM1A 1URNA 2MQ8A 3GG0A 1V3RA 2VC1A 3RB0A 1HD0A 4Y3CA 3PW4A 4F67A 2HNZA 2NUHA 3J7Z5 3OXFA 2M8HA 2K8GA 1C1CB 2ZBCA 2ERRA 4ED3A 2PA3A 5GAEI 2MY8A 4LRCA 2C2ZB 1TQLA 2BJ1A 4NMLA 1SV5B 3PG9A 4USJC 3NBPB 5DLGA 2CYYA 2VZ9A 1X31C 3RZAA 4LFCJ 1OQ6A 1HHQA 3FGVA 2QJ3A 1R27B 1NB2A 3UVJB 1X7VA 1HFEL 2NZCA 2G2YA 4RBVA 4H4KA 3LAMA 4N56A 1WDTA 4M5JA 3CJKA 2NSCA 1WSVA 1UFWA 2Z57B 1P9QC 4NLTA 4DJBA 1RT1A 4AL5A 1FDDA 2QMWA 2MGZB 4J37A 2VDHA 1SJQA 1TKZB 3D3BJ 3CMAS 2ZHBA 4XTTA 5FJ4A 1Y5NB 4FPRA 2P9EA 5HN0A 4F02A 4F0KA 2XY6A 4ED6A 3MR6A 5AJ3F 3HHLA 2CQHA 4DQPA 3M9NB 1IN0A 2FZKB 4HTJA 4FNIA 1NDKA 4EEYA 5KG1A 2V8VA 5KG5A 1KBRA 4RLEA 1MN7A 1QD1A 4DF8A 1X4GA 3BJYA 5K14A 4FKXA 2W4CA 2QYCA 1VR6A 5IFMA 2UVVA 2UP1A 3Q22A 1V3ZA 4OZNA 1BQMA 2J6UA 1XERA 3DMJB 3PZPA 3DC2A 1XMQF 2V6AA 3RU0A 2VPWB 3IO1A 5A6PA 3G82A 3UN2A 2YX7A 1R8HA 3MM9A 1WHVA 1RTHA 3OLBA 3IS9A 5ETSA 5T7LB 1ZH5A 1NNDA 4DR7F 3K58A 4ELVA 1S76D 3GCWP 1KRPA 3QYYA 3RUBL 2LXFA 2C3MA 1FDNA 1R0BG 3ET6A 1FJGF 4DV1F 1FD2A 2QLBB 2Y3YA 3HSDA 2MSTA 3QSIA 1VLOA 1V9OA 2JEGA 1R0AA 2C3YA 2X1AA 3CCVS 1N34F 3PEJA 2WK4A 3UR0A 4IFYA 4CLPA 2FJVA 1RBLA 4LSNA 3FQLA 4GO7X 4OJ1A 3W3SA 4FYWB 2CPYA 4ZVHA 3BZQA 1L3UA 2HK3A 1V5IB 1IJEB 2DY1A 1OQ3A 2FHJD 4C3LA 1Y3KA 2GC8A 4D3HA 3W62A 3TR5A 2VFUA 2XHWA 2BE7D 1XTZA 4G1PA 3UCZP 3FSYA 3C15A 2DRAA 4C97A 4C48A 5D0HA 5DGBA 1TL5A 3GJRB 3M9MB 4X4TA 4JI3F 3OD2A 2MZSA 4FYXB 4DQIA 3BPSP 4X65J 2G0CA 4EO6A 3D5MA 3NMRA 2EKNA 1OYEA 5F0UA 2FHMA 4X84A 2VICA 4BBYA 1TMJA 2J9DE 4A4JA 2HMIB 4OI0A 3MD3A 3V4IB 1ZTTA 4E8UA 4USHA 4KTQA 4ETXA 4K0KJ 4YB5A 3ZTOA 4ZVPB 2MMYA 3M6XA 2EK1A 3GYXB 2DGWA 2M7SA 3D68A 4EGLA 5GAGI 3P45B 4OJ3A 2XQCA 2XI3A 2W9BA 2W4DA 2WSEC 3A8EA 2KRRA 5CA5A 5A8WA 4CLWA 5GADU 2PI5A 2BR0A 3DOLB 4QPTA 4R5PA 2E5JA 4OYZA 3HDSA 2A6OA 1VK3A 4DS5A 4IDKB 1UL3A 4ANCA 1FRMA 2CPIA 5CAAA 3CXCR 3M2RB 3L3CA 2N4CA 1OMSA 4NA3A 1XMBA 1FDAA 4A48A 1PBAA 2OPRB 4ZN3A 5F8LA 3T1YJ 3CJQA 2BABA 5KFGA 1RTDB 1IKXB 3PYDA 1UVLA 3P5TL 2XZDB 1NDPA 2AEFA 4YP3A 1FD8A 3EPGA 2CZVC 4DUZF 3CCZA 1VIXA 5F8IA 1FWKA 1HI0P 2KDOA 4C3MA 4OYOA 3B78A 3WDOA 3VAJA 2HVHA 3DFEA 4ECUA 3C16A 2M9KA 5A76A 3KYLA 1RT6A 2CXEA 1DQAA 1GTHA 1WHWA 1HMVA 3DN9A 2M4MA 2H54B 2ZFHA 3GWCA 2GHWA 3DLEB 4Z7YA 3T5KA 1HNIB 3FNNA 3ENWA 1VDHA 3JAMU 1GEHA 5L1KA 3G6ES 3P8BB 4KO0A 3MMBB 2X1GA 2GO9A 4CO3A 3M8QA 1YX2A 1QAJA 1C1BB 2DIUA 4O0NA 1DJ0A 4ZVGA 4K8RA 4F4XA 3AOBA 5LXRA 3SYZA 2YH1A 5J1EB 2VHGA 1T05B 1JXVA 3EZOA 4MT1A 3UDEA 3EDRB 3M30B 2XGPA 4NXNF 2HRYA 1HNWF 5JXSA 2IJRA 2FLPA 3J7ZT 1WC4A 1OIAA 2RHQB 2P5VA 3BKTA 2PEBA 2R42A 1NHVA 3MOZA 1X4CA 1M0SA 4LT6A 4QYRA 4NCGB 2FJAB 2HAFA 3M8SA 1TL3B 1SC1B 1X5OA 2GAHC 1RAAB 4ID5A 2PGCA 3I55S 2JC0A 2J9CA 4M1KA 1Q53A 1N5SA 4AQYJ 3GG1A 3CEDA 1JLGA 4FDFA 5DDRC 5MLCV 1KHVA 4I67A 1LK7A 1YG0A 4IRDA 4RJVA 4FPIA 3BGRA 4LF6J 4U96A 3W5XA 5IWAF 3EVOA 3GJSB 5J2QB 5DM7Q 3IA0A 2N3LA 1FE0A 2F4VF 5A8RB 2DR6A 1PKUA 1U0HB 2V8GA 2E5GA 3MR3A 4ID8A 4DSIA 3PRBA 3X3UA 3BKUA 1DLOA 2ZKUA 3ZNJ1 3RB4A 2MZRA 1W2IA 2LKZA 2X1FA 4OHVA 2B0GA 4DV2J 2OSQA 3ILIA 3KFWX 2YNIA 3US5A 3PYGA 4J5OA 2B9YA 1KLMA 1WG1A 4QZVB 3QIPB 2CPXA 3UI3A 5IM0B 5K9FA 1E6YB 1Y10A 4J90A 3CPWR 2YPYA 1X4AA 1VISA 4DR5J 2RQMA 1NH7A 3SCJE 3KK3A 2GVZB 4O3OA 2CAJA 1SC6A 5LOQA 2RQKA 2MTLA 3KDOA 2CNOB 1TL7B 1WKLA 1D1UA 2KG0A 2OFHX 4UZCA 3QRQA 2AKWB 2WAQD 1NJYA 3TUZC 2OAUA 3HKZD 1GQEA 3FZBA 3UPFA 4RW7B 4OFZA 4HHJA 1URRA 1H2UX 2UU9J 2YNGB 2V2QA 5ETPA 2IRXA 1SJFA 1VOMA 2A1BA 3PKMA 3CCQS 3QT6A 4HDGA 4ILRA 3BYRA 4QR2A 3Q8RB 1KQGB 1F5BA 2HVZA 1K1QA 3E2EA 2Y1RI 1OY6A 2IDEA 4C9DA 1RCXB 1JMTA 1OPZA 4MIBA 1KDNA 3V6DB 2WB1D 3HFZB 5CH7B 3RYLA 2AV5A 1N5VA 3E3XA 1UCNA 4KHMA 2ZJRQ 1Q8KA 5HATA 2GO8A 4L73A 1U0SA 4OYPA 1TP7A 4M5MA 3QMQA 4DFKA 5KAKA 3QFHA 4A8FA 4RW6A 5E2QA 2J0SD 3QJLA 1IBMF 1FNXH 1FE4A 5EHHA 1FWLA 1Q5YA 3T1AA 5KG2A 1R0CB 1S0NA 3IGNA 4J9KA 1DURA 2WONB 3KUHA 1T95A 1HR0J 1IBLJ 3ETMA 2KHDA 4LF9J 1RTIB 4OYAA 4DL4A 3N28A 3NGTA 2DNGA 2JLEA 5J2NA 3NP5A 3AOAA 4RKUC 4YDDB 2LQ8A 3LP1B 2NUUG 1ROFA 4NA1A 2LDYA 2MQNA 2KFNA 3PDNA 2FD2A 1NKBA 5L1LA 3WHIA 5D4OA 1NLKL 3LA0A 5D3GA 2UZAA 3TNVA 3M32A 4M63A 3AQPA 4NLXA 1AROP 3CJRA 1S1WA 2DGOA 4IR1A 4DPTA 2BYCA 4UF4A 3FBFA 1YJWS 3CCJS 1T8EA 5DQGA 3PYFA 3H2LA 5I3UA 1Y7PA 2B5JA 2BQ3A 2C2NA 1T9WA 3IBFB 4ES1A 1NXIA 1YZ6A 4LRFA 3OL9A 2F4FA 3TO8A 3Q23A 5ETLA 2E5IA 4KAIA 1WEZA 3PXGa 1SJ4P 2NYIA 2DPJA 3PHEA 3R7BB 1RT2A 3RRKA 3H5UA 1HNZF 2I0XA 1LFWA 4LR7A 5KFJA 3D67A 2W9CA 4ZP7A 2DNKA 3PO4A 3M2VB 3DOKA 5K8MA 2IFXA 2VV5A 3D1QA 3MM6A 3MMAB 3GSIA 2KFZA 4LSLB 2QL9B 2Z4PA 3IG1A 1QSSA 4LF7J 1CVJA 4CO5A 1QVGR 3GQCA 4KFBB 3CCSS 4B3SJ 2YKPA 2NXNA 3NXZA 4TY9A 1F3FA 4K7QA 1FXLA 1CJTB 1YWXA 3PFOA 2W4PA 3OTBA 2YWWA 1KVIA 2GQCA 2C2MB 4DWIA 4RW9A 4I2QA 3HULA 4E98A 2IM0A 4J9VA 1AZSB 1IR0A 1JNZB 2VL1A 1RJJA 4ZVTB 1ELOA 2QA4S 2CPFA 1VQ4S 3EVMA 3CC7S 3H8YA 1GX5A 2QA2A 3RRHA 3R1HA 3UD4P 3SDEA 2BANA 1YBTA 1N32F 4TNOA 3GFXA 3Q8PB 5KFNA 1Q1KA 1XIQA 1JKHB 4B3RJ 4U7CA 1SXLA 5DGAA 1SUQA 4P6QA 2W9AA 1FRXA 3BDPA 2HS3A 5BR8J 4DV7F 2AEJA 3C2PA 3Q8YA 4KBIA 3BH6B 2A18A 2V5HG 1ZAXA 4D3GA 2WVDA 2UUBF 3GONA 1MWYA 3OSPA 2YKQA 4KQZA 1NJZA 4HR2A 4DS4A 4UOGA 1LW0B 2YKNA 3B4MA 1ZOTA 4N47A 5KT2A 1X9SA 2YY3A 2V2ZA 4CP5A 1IKWA 1DTQA 1TK0A 1ITPA 2E9TA 1S9FA 4ELUA 2BW7A 2AZ1A 4Q0BB 3HF5A 1SJRA 4WFAQ 2C3UA 4HLBA 5HVGA 3CWJA 1M5KC 5KFBA 5DDOC 3Q8SB 1HNVA 1PCAA 4DCPB 4WTOB 1H98A 1N4LA 3K89A 4RBUA 4RWWA 1CC8A 5F9NA 3NKYA 1M5VC 1Q8BA 2CQ2A 1P1LA 4ZHRB 1HWUA 4CO4A 1IKVB 3FBCA 2DHGA 1S9GB 2NXCA 5F41A 5KFFA 3M8ZA 2IPOB 3HK2A 3AHPA 1YBAA 3GIKA 4G3IA 1VQNS 1RT3A 3J7YU 1OJ4A 4G1QA 5SZTA 3PR4A 4IG3B 2QL7B 2ASJA 1G3OA 4DFMA 1WACA 1XR6A 3AJDA 4C11A 2IRUA 2OPPA 5E3CA 4F7VA 3DRRB 3W8GA 4PKDB 1HQ2A 4V19J 3AB2B 2W7AA 2OTJS 4QWBA 1CEZA 1MMNA 5D15A 4F3QA 3ZFVA 5GADI 3DI6B 5F0WA 4C8NA 6FDRA 2H5JB 2VF3A 1FEEA 1T9XA 1RTJA 3CJSA 2NYHA 3NCQA 1WC3A 1S5ZA 4NOHA 2BUNA 1TZ0A 2OPSB 4DSLA 4QIVA 1FJ7A 2DNNA 5KFWA 1T3OA 3H0PA 4RNHA 1X9MA 5KFTA 3M05A 3KJFB 2H65B 3ICLA 3T19A 1JJ4A 1SC3B 4W4MA 4RUCA 4AL7A 2NXJA 1U1OA 5A0YB 4JV2A 3LGMA 3RG6A 2RHSB 2GIQA 3UN3A 4B3MJ 4NYOA 2YXLA 4M5DB 4CLUA 3K5PA 2V2VA 4DV5J 4IQMA 1QE1A 2OIHA 4DR4J 2VBYA 3GLJA 3KG4A 2DGUA 3MGJA 2KZMA 4PWDA 1HBMB 1XQIA 3KXDA 2X3GA 4LFAF 2W7PA 2H4WB 1HARA 3TAMA 3VR1A 3UFCX 2V4JA 4EU0A 1RE1B 3Q83A 1ZAWA 1CC7A 3VQSA 2B6AB 3OPKA 2MLXA 1NAQA 1T03A 1T94A 4XPEA 3TW0A 3OQ2A 5F8JA 4XIUA 3SSSA 4GKKJ 2DNOA 3GIJA 3CC2S 4TU9A 1FRIA 3W5ZA 4OZ3A 5ETNA 4YB1P 2JDJA 4ECRA 4NLUA 4N7TA 4FBUA 4TQSA 3QWPA 1VCTA 2MZ1A 4J9OA 2PI4A 4C8LA 3V81A 2QC3A 4X66F 3G86A 1H7XA 4JB8B 4ZVRB 5GAHU 3IGVA 4AT1B 2XLJA 4P2MA 4DV3F 3KLGA 1HHSA 2R7UA 4ZA1A 3KLFB 2IY5B 1TAUA 4DN9A 4DOZA 2M52A 2QRRA 3M2UB 1G6BA 3EXYA 3GFYA 4QW9A 2KTQA 2EFOA 5I3QA 3BQ0A 2VQFJ 2AYMA 1EP4A 2DNHA 3ONQA 3WBZA 3NY0A 1ZYQA 2Q3PA 4DPYA 4ZPAA 2D74B 1N5QA 2HS0A 4OHXA 1IR2A 4NLOA 1U26A 2ZBQA 3CE8A 2J5AA 4OYXA 4LREA 2CPDA 4ZJOA 2XYGB 3W2VA 2YNFB 2XLKA 4OZ0A 3LTOA 3VGUA 2FYXA 2Z2LA 2VQEF 3U02A 4ENOA 4MKBA 1UFKA 3DRXA 1TK8A 2IVMA 4KV8B 3MM7A 2V4RA 2LQ9A 5ITHA 1TVRB 4J9SA 5LMNF 5G0RA 3FC9A 1YITS 1S9EB 4F3MA 1N5TA 3MEDA 4DQRA 2RMLA 3D6MB 3B82A 2C1EB 1S1TA 2K3IA 4NZ7A 2L9NA 5CZXA 2KT5A 3HO1A 4JI2F 2FHJA 3BB5A 4L72B 2WHOA 3H4DA 2ZVIA 4FXVA 2MZJA 3OR1A 1TELA 2MZTA 2QFJA 2B4PA 5IOLA 2AD9A 1X5TA 5CABA 1NPRA 3C6TB 4DL5A 3V81B 1HYSB 4I0WA 2M2BA 5HQLA 5LSLA 3PJ9A 2ZVSA 4DI6A 2Z2YB 9ATCB 2YQ1A 1UVIA 2YNHA 3QFWA 3MMCA 3IMQJ 1NEEA 4USTA 4CYUA 4I56A 3UNGC 2R2SA 1VQMS 1LXNA 2NZ4A 1YJVA 4ZJQA 3D4JA 1LNQA 2P2CB 3GJQB 4LRAA 5LJ3Y 1X9WA 3Q8VA 1HD1A 3JSMA 1S1VB 4K4VA 1WOPA 4JI5J 3V2UC 4UQGA 2ZE2B 1V6HA 3FJ2A 4GKJJ 5A8KB 2XEXA 4K4SA 4NMXA 3ZZPA 2JFDA 3K7RA 2AJ2A 1F5AA 2V0NA 2VONA 3MCOA 5L38A 2GVDA 2KZZA 4RNFA 5B0EA 1JLCA 1JLQB 1HBNA 4Q43A 1X4DA 2DGSA 4Z37A 4I2PB 1KS2A 2GW8A 3OVBA 1J5OA 4WZMA 1K73T 3THTA 1UJ6A 2NPIA 4BHQA 3WQPA 4J9MA 3JQJA 1N6QA 1S6PA 3CD7A 1FRLA 2CPZA 2EPIA 2DT9A 1J5EF 4DR1F 1EX8A 5D78A 4PWWA 4YDXA 3SQGA 1Y3JA 4URQU 5DQIA 2IIHA 4NZ0A 2XMUA 4EBEA 3PNIA 2HBZB 4ZPDA 5B0DA 2WW4A 2GIFA 3CNQP 3SXLA 3H59A 4DQSA 3CDEA 4DR2J 2A10A 4DG1B 4FS1A 4XK8C 3I4HX 1LW2B 2YWKA 2J0QD 5HK4A 1Y5IB 1VC0A 2BBEA 2LXUA 4Z7CA 4ZIWA 4LF2A 3BBFA 3O2IA 4N77A 5FDLA 1SIZA 5HVHA 2FLNA 2J7WA 5CYMB 3EE3A 1KQSR 4EMDA 4QIWD 2DGTA 1QY7A 1A0OB 5DJBA 2HGNA 2P6TA 1KWMA 4DU8A 5KFYA 2G2OA 1WELA 4Y34A 3VTIA 2I5JB 3MDFA 3OSNA 1HQEB 4FXWA 1VQLS 3GV5B 1VIOA 5CCLA 3OTEA 5K20B 1OWXA 1MSWD 1HNXF 3D1HA 1SKSA 1BWEA 1KHWA 4OI4A 1W25A 3MEKA 4QYZJ 2R2TA 2J9DA 2ZJPQ 1NH8A 2XMVA 3KLHA 4X4UA 1SL0A 4M5IA 5AXKA 5KG3A 5HMXA 1VRUB 2GIRA 4LVNP 2V50A 1XMOF 2DIVA 3QLHA 4F04B 3QAUA 4YY3F 3G87A 2KM8C 3SCLE 5AJ3J 1U1RA 4O44B 1HPZA 5F9LA 3OFFA 4B3OA 1JXEA 3R5CA 4FBTA 4IUFA 1PAUB 4IFVB 4O4GB 4JI8F 3PW2A 2KO1A 2XC9A 1F1BB 2ALYB 4R0JA 3I5CA 2NSBA 3KMQA 1S1UB 3CJ0A 2J0XA 4N8OA 2IAJA 1C0TB 4HACA 2KVIA 4CTAB 3VZIA 2HFSA 2Q66A 3MUVP 1JLEA 2QIFA 1XMQJ 2P8IA 2N4DA 5EX3A 3FEYB 1MWQA 4MMOA 4CQ1A 4XAKA 3KNGA 3BGFA 4WJBA 3QRRA 4WTYA 5I42B 2DR9A 3MM8B 4DR7J 1K0VA 3EUNA 3CCLS 4A47A 3CW2C 4DL6A 2ZITA 1Y11A 4OYWA 2DB1A 3I0RB 1DAXA 4M5GA 3VVUA 5HMYA 3DKDA 4TQRA 4RW4A 2ZH8A 3DU5A 2MDAA 1UVJA 5EWEA 3JTNA 2UUCJ 5CXTA 1N34J 2VG6B 2NPFA 1S6OA 1SJ3P 2WW8A 3CIMA 3QGGA 1C4CA 4O3RA 3FDSA 4OX6A 2CWKA 4C8KA 1Q16B 4LBIA 4DV0J 3GPAA 2WTFA 4X4OA 3CSKA 2R3VA 3AA9A 1JQGA 5JVGQ 3NS5A 3AOCA 3DLGA 2F7VA 3U1MA 5BYQA 1PYSB 3I9V9 1NDLA 2L08A 4JI3J 3MURP 1H2VZ 1IXKA 2MQLA 4ZLLA 2J0WA 4UOFA 1VJWA 3D66A 2IVFB 2XNRA 2ZZTA 4LQ9A 2DCLA 1WF0A 2FVPA 3K8VA 1U8WA 1IVZA 1RLCL 1SI9A 2HBRB 2HFOA 1RT7A 1FNMA 2D3UA 1IQZA 2W2OP 3IR6B 4USVA 1ZM9A 4B9MA 2XHCA 1BLUA 4JI0F 1WWHA 5FLXU 3S6EA 2X7IA 3GP9A 3IM9A 2QLJB 3K57A 1UKUA 1UFLA 2HHQA 4FYVB 1UPMB 5KT3A 4IYQA 2CQ0A 4NRTA 2ZOMA 2CQ4A 4QW8A 2XBPA 4IOAQ 5FLXY 4C2MA 3DHWC 5J2PA 1FK9B 4CLSA 2HQDA 2VKRA 5EUHA 2CRLA 1WG5A 2GJFA 3LP2B 3HI9A 5HAOA 5KFUA 2GMLA 4B9VA 1YJUA 1NK9A 3W2WA 2QE5A 4DUZJ 3MEGB 4ZPBA 1T9YA 3WC2A 4RW8A 3O8WA 4DFJA 3EICA 4C8ZA 4OYBA 1NDCA 3RB6A 4TN2A 2VFSA 2GA7A 4DZDA 2DGVA 4EYIB 2C2KB 3L7UA 3BN7A 1CQNA 2KT3A 3DGPB 4R8UB 4ED8A 3AJ2A 1XJWB 4R0EA 5L46A 3HVAA 4Q5VA 1N36F 4X2BA 3SFUA 5IT4A 4K4WA 3PIOQ 1BQNB 2FVCA 3TEGA 5KG6A 2DY9A 1M5OC 4HTIA 3OFHA 3UD3P 2RQ4A 4UY85 3IRXA 4Q45A 2KL8A 4F36A 4MYTA 3MCSA 3ILOA 3C6UA 3OTCA 4P74A 1LWCA 4GVBB 2X3DA 3N5FA 3JXOA 1CULB 1JLAA 3CO0P 3J81U 3L09A 1GH8A 4DR3F 2VG7A 2ALZA 4NXNJ 5L9XA 1TKTB 1YLXA 2MZQA 4ITSA 4DL0C 3AAWB 1GTEA 4RL1A 1TL1B 2YTCA 4CLZA 2UXBJ 3BBBA 2XY7A 4PQUA 2ZH4A 1D8ZA 3V5RA 3BR8A 2NS1B 1M5SA 3TJAA 1U7LA 4DEZA 2IM1A 4IR9A 3J81Y 3OHAA 2MKCA 1F2GA 1DFDA 1RT5A 2YH0A 2O5DA 4Q44A 4H4KC 4YHHJ 3V6JA 3ZZTA 2DHSA 4DU7A 4CH0S 2UV8G 3LWMA 3V4MA 4CLYA 4ZCKA 4ZLPA 4NCAA 2Q79A 1FCAA 4ED1A 2WVEA 5C5JA 2IYGA 3BSAA 3TVYA 4BWJA 3C19A 3CCMS 4ICLA 1FWPA 4X4NA 5KFOA 2AEMA 1XK8A 1RHQB 1IKYA 3S8SA 3W9IA 2MLZA 3HHLC 1FXRA 2RF2B 3ULHA 2NREA 5GAHI 3JSRA 4NEZA 3EDQB 2AGQA 2B9EA 2N82B 4LFCF 2Z2MA 4EZ6A 2CQCA 3DLBA 2D1CA 2VG5B 1PYTA 1OYDA 2RD5C 3OXLA 2F9JA 1UP1A 2UUWA 2CG8A 2G2ZA 4IG0A 1RKJA 2YKMB 1WEYA 4BCAA 3LWLA 4IH7A 2YKAA 3RW7A 2B7BB 2VBXA 1U1PA 3QJJA 4H54A 2UXCF 3HD2A 2HIQA 3QSYB 3SCIE 3W61A 4TLRA 2L3MA 2EW9A 2XCAA 4EUVA 3DXSX 1S79A 3TANA 1DTTB 2LA4A 3MZIA 2LECA 5L1IA 3NGUA 5LMUJ 1R7IA 2JNJA 3CMES 4M5NA 3ZZYA 1EB0A 4TLQA 3MCMA 3ENVA 2WBMA 1FJEB 2E5HA 2Z8QA 4DLEA 3D6HB 1N54B 3MM5A 1RAIB 3PM9A 4F4YA 1O6XA 4GC6A 3E01A 4MFBA 2H5EA 3H5XA 5HLFB 2QSWA 4KGMA 4CIOA 2JEJA 4ZS6A 2LXIA 4F4AA 3ITHA 4IKAA 2E9ZA 4TY8A 2ROEA 3MUMP 2FVQA 2O66A 3DRSB 1CS4B 4HH0A 2K1RA 1H2TZ 3IWLA 1IBMJ 3GIRA 4MKVA 4RNMA 1CG2A 8RUCA 1R43A 2HQCA 5C7PA 4I7FB 1WEXA 1KD1T 3DRPB 3BBCA 3FEXB 3N0VA 1YJ7A 1TU0B 4A8MP 2B4VA 3M1VB 1RYSA 3U1LA 3D0HE 2WOMB 1HIYA 3P3DA 5KG0A 1BE4A 2AF6A 2EI5A 3GV8B 1VBZA 2E9RX 5DS7A 1YQHA 4RWXA 1UWBA 2Z30B 3QO9A 2C3OA 2Q1LA 5KFAA 3I96A 3TA2A 1JJ2R 5LSRA 2FJEB 2IBKA 3KHHA 2LDIA 5E3RA 1QSYA 3T3FA 4M5HA 3H98A 4C7QA 2JLGA 3QIDA 5CZVA 4TU8A 3AFGA 5EWFA 2HLUA 2FLLA 3MF5A 2HGMA 5KFIA 3DOMB 2VJVA 2C42A 4WFNQ 2OPQA 2R7RA 4ZLNA 1NHKL 3OL8A 1AXQA 1ZM3A 3I0SA 2R8HA 3HCXA 5F3TA 3DYAB 3ZZUA 4J9UE 2CA9A 1VBXA 1NK0A 1QUPA 1ZETA 2DH7A 2C3PA 1HBOA 4F4KA 4LR9A 1QSLA 1VLYA 4MTPA 2I8EA 2NCKL 4YB6A 2Z56B 1Q5VA 3QQCD 1BMQB 1C0UA 5KOWA 1NK7A 2BACA 3KLEA 5KFXA 4ZVSB 2B8PA 1SL2A 4IH5A 2AW0A 3C8YA 4V19X 1G7CB 1Y5LB 1KTVA 5AE3A 1HBUA 2QX0A 3C66A 4CDIA 5C42A 3S7RA 2XO7A 5DG7A 1S49A 2Q43A 1CJKA 2KXNB 5JVHQ 2QGFB 1RU1A 4LJMA 2DK2A 5H9FJ 4O3SA 1VHFA 3D2WA 4OLOA 1R8CA 1G4CA 3T1YF 2Z58B 5D0GA 1S59A 2M8DB 4QU7A 1S72S 3ISNC 4OQJA 2ZOFA 3HX9A 1XNQF 3R3TA 2KM8B 3MD1A 3RR8A 4H4MA 3QJPA 3D1OA 1MMLA 3B54A 4Y2CA 3CCRS 4FF1A 1CJVA 1B64A 4ED0A 3G6VA 3R7SB 2KXHA 4UUWA 5L8RC 2J76E 3OR2B 3VWSA 3AA8A 5CYQB 1FT8A 4WFZA 3OVAA 4NL5A 1U1QA 4CLLA 3JS9A 3ZC4A 5J2MA 1FFSB 3H2UB 3NCRA 3HXMA 3SZ2A 4DHVA 3ZZRA 2JH3A 3BKFA 4AFFA 1JLBA 1LWFB 4KKOA 4FVCA 2RNEA 4MK7A 4QR1A 4AYBD 3H2VE 3T9ZA 3M9OB 1BC6A 4WXOA 3PIPQ 3I82A 2B4UA 1OO0B 5B09A 2MKIA 4I4BA 4YFUA 2JSXA 4WFBQ 4QR0A 1SKWA 2E5LJ 1LK5A 1CQMA 2BA9A 4YN3B 2BE2B 3NNCA 3TJ8A 3IBCB 2UUBJ 3T1HJ 2FHKA 1JX4A 2DHXA 3UDCA 3CCWA 3DU6A 3PX6A 3BO2A 3EZUA 2AYGA 1LKZA 2RILA 4Y0FA 2A6MA 3R27A 2VD3A 3AXMA 3QNWB 2RKIB 3AD7C 4NZ6A 3TZZA 3HHKA 5ETVA 4DQQA 4LF8F 4AQYF 3RRGA 1RZMA 1XC9A 1T0TV 3RBZA 1SH0A 1L3KA 3Q2TC 3UQSA 2PFDA 5MAOA 3G6YA 1VRQC 4X64J 1Z2ZA 3DM2A 3LP0A 2F9DA 4P73A 3VF0B 2RUSA 2K7KA 2HIYA 1A6LA 2GJ2A 2MHNA 1I3OB 4DR6F 1AFJA 2XSJA 4WIIA 4P72A 1ZM2A 4CLTA 1JLFA 4L3NA 1H74A 8ATCB 3PV8A 3O44A 5C2GA 4LRBA 2MSSA 5E3QA 1XWLA 3NWGA 3SQOP 1H3DA 2HURA 4DV2F 3KJVB 2OJ3A 1B7FA 2ZZMA 5LSOA 2DHHA 4RUAA 3HHEA 1LWEA 3QGHA 4NE9C 2DNLA 5C25A 2BRKA 4LF5J 1VC6A 1YSJA 3VGTA 1AFIA 1IWGA 4DMZA 2UV8A 3DLKA 1RWVB 2VODA 1NB7A 2ADBA 3SV4A 1GXUA 1MU2A 4XO0A 2R8JA 3AH6A 3K5LA 2UVRA 4NEYA 1I5OB 3HJFA 4RNOA 3NRBA 1Q8IA 3CDUA 3I56S 3CJ2A 1N5YA 3QGPA 3TJ9A 2UUAJ 2QA4G 1J2VA 3H5YA 2HHHF 3QRPA 1RAJA 1H6KX 3CTRA 3GR1A 4NI2B 2FJXA 4KH0B 4KGZB 2DRBA 1QVFR 3W1YC 3W60A 2UU9F 2SXLA 3SSQA 4BDPA 2XWYA 1YJTA 5DM6Q 4W98A 3NNAA 1HQUA 3NAHA 3K5OA 2H51B 1TTHB 1YHQS 4UQTA 1WG4A 5HQMA 1F3VA 3OUYB 1M1KT 4P7TA 2FTRA 4V1Ak 3B4DA 3I32A 2JWNA 3ELHA 4BWMA 2F8EX 3MECA 2Y1LB 4C8OA 2F40A 2ZD1A 5KFCA 1FERA 1LOUA 7FDRA 3HFVA 2D3ZA 2OEKA 2QMUB 5HP1A 3THVA 4LFAJ 3JSYA 4CO1A 2HNZB 3FEZA 2KT2A 1PO6A 1BWVA 1MROA 3MAHA 1NSKL 2OFGX 5KOXA 2G0JA 2UUTA 2XTJP 3GYGA 1P9YA 3QGIA 2FPHX 2HSEB 4DUYF 4JI4F 3PVXA 2ZBRA 4QIEA 3BQ1A 3DDKA 2VPXB 2KJVA 3MHYA 4OHYA 1HR0F 2PA8D 4DSKA 3GILA 1Q95G 2OHDA 4LF9F 3IC1A 2CJQA 1B0VA 2XMWA 2YKOA 3KUGA 2GX8A 2E7WA 4CLKA 2G4BA 3R5JB 1L3VA 3CJKB 3R9LA 4ECZA 3R97A 4KC5A 2VDIA 2CPEA 2VFTA 1TV6A 3D6FB 2P9GA 1RT1B 2WSCC 1WC1A 4ZP8A 3PFEA 3TZYA 2NR0A 2VB6A 3KUEA 3M6VA 1AUDA 1CJUA 5B7WA 2LVWA 5KTQA 2B9WA 1VRTA 4NLYA 2COLA 5HBMA 5B0CA 1KNZA 3HHLB 3M6WA 4I64A 4WK1A 1A9NB 5D0EA 4HHUA 1N33F 2OEJA 2NXUA 2XY5A 4YR3A 4AD6A 3L9ZA 1WSRA 1EZZB 2RRBA 2YQ3A 1D9DA 2HNDA 2JC1A 5K14B 5DDQC 1VQ9S 1IBCB 5KFDA 4ED5A 5BYRA 5M2PA 3B6BA 1BQMB 4ES2A 4WFYA 2V8DA 1WC0A 2W2NP 4XDDA 2GMJA 2CJKA 3G82B 4MYUA 2QMXA 4L76A 1IBKJ 3MM9B 4LBHA 2DD8S 2CQGA 1RTHB 5AE2A 5ETRA 4PXCA 3IS9B 3MTKA 5HROA 4EBDA 4UOCA 4FF3A 1NO8A 4LF7F 1RT4A 2APOA 2FGCA 4B9TA 4WWSA 3BS9A 3ET6B 2PN6A 3Q24A 4WF9Q 4NLWA 1YZ7A 3FBEA 1K47A 1R0AB 2QFIA 3G71S 4ZPCA 2DGQA 1BHNA 3MAAA 4ZK7M 4Q2MA 4IFYB 3R8YA 2XZTB 3KHLA 4LSNB 3TUPA 3MPDA 4MKAA 3T9NA 1RDRA 2FB0A 3LPYA 1E6VA 1RAOA 2W2PP 5J1PA 4ERDA 2DTJA 4RBTA 3C15B 2XI2A 4OX9F 2KJWA 4EYHB 3MEEA 5L9NA 3BGOP 2I1RA 2C22A 1YDLA 4B3RF 2Z2ZA 2VA3A 2FJDB 3CUNA 3PRDA 2XB2D 5GMDA 4H4OA 4DLGA 3JAMY 1X8DA 2DRDA 3BF4A 4CI0B 3R5BA 2XMJA 2IJFA 5DG8A 1R89A 1Z4UA 5KFSA 4ZVQB 4JBCA 3VV2B 5A6WA 2PO4A 3VAFA 1DZ5A 5EWGA 3DLHA 2W25A 2W9BB 2DNZA 2G9OA 1BXNA 5A8WB 4CO0A 2XYPB 5K8OA 1AT1B 4K59A 4RZRA 2V9KA 1Y4ZB 4PUOA 2WSFC 4R5PB 4J91A 3A8IA 3R1LA 4WE1A 1Q79A 1SQFA 3HZEA 4URSA 3WX8A 1RHRB 1NSQA 3KLIA 2QSFA 3QT8A 3QT5A 2IC3A 4PCQA 3L7OA 1SKUB 2WCXA 4OMFG 2I6WA 1S1XA 1J5EJ 2HFVA 4DR1J 5L1JA 4ED7A 1OS5A 3POTA 3G6XA 4KHPF 1RWUA 4RX6A 3IN5A 3ZZOA 1Z2LA 3HSJA 3HMJG 4TVAB 2J8AA 4DX7A 3K5NA 4JI7F 3BEGB 4DL3A 5DG9A 4YUDA 3FKBA 4JV5F 1FHTA 2HAIA 1Y0HA 2BJ9A 2G13A 1EQ0A 3KDNA 3K59A 3C16B 3CGIA 3JSBA 4PABA 4UT4A 2K06A 4BS2A 2ZWOA 1RT6B 2G1HA 2H9ZA 2LQ5A 1HMVB 4ECTA 1FKOA 2CNKB 7AT1B 1E6VB 5KFRA 4Y28C 1U02A 1GT8A 2XGQA 4KIAA 3JYTA 2XWXA 1F9FA 4FN5A 4KO0B 4KGXB 1FTRA 3M8QB 2ZZNA 4QU6A 3ENAA 2YQ0A 1RAEB 1X0FA 3K8WA 2HFZA 2QV6A 3ZZ0A 1FKPA 3IP0A 3GU0A 2DO0A 3PW0A 6AT1B 1NM2A 4PAAA 5KT4A 2Y8YA 2DJWA 4ZCIA 1XMOJ 1B0PA 1UETA 3FMBA 3PRVA 4MAKA 1R6YA 4C98A 3A3PB 1JB0C 2LU1A 1TL4A 2U2FA 1KVKA 3JTOA 2HHTA 2RDDA 4PQAA 2F3JA 3TUJC 3EXCX 1WD6A 1S6QA 4F4WA 4LF1A 4ZVFA 2LFVA 4TYBA 3CDBA 4JI1J 4MJKA 1R3NA 4ID5B 4DV5F 4LR8A 3LAKA 4C4WA 1UVKA 4C3KA 1X5SA 4IO1A 2R8KA 1HI1A 3M8PA 1JLGB 2IM2A 3QZ7A 3EVWA 4A8SA 5HL7Q 2YPZA 3U27A 4QBUA 2ZWPA 2CJBA 5ADZA 3BGRB 1SVDA 3DCAA 4K2XA 4KB7A 2Y1JA 3KK2A 1B3TA 2ACYA 4Y2KA 2PMZD 6FD1A 2ZHAA 3W63A 4CWBA 5GMEA 4F2RA 3CO9A 1S4EA 1U48A 1VK8A 1DLOB 1RHUB 4GKKF 4QWEA 3W64A 2GGPA 4MIAA 3H25A 5CYJA 4GC7A 3EJMA 5C24A 2BZ2A 2YNIB 4AL6A 1QDUB 1G2EA 1KLMB 2GAGC 1FRHA 5H9FK 1N88A 5LJ5Y 2OEMA 1TKXA 4K2JA 4U8YA 4O3QA 1PG5B 2DYAA 3KK3B 3KJQB 3EGVA 4U95A 2M3DA 5F8HA 3F56A 4FYDA 1RWPB 2LMIA 4KJIA 1X5PA 5AE1A 3MFIA 2V8HA 3VAMA 3GJTB 2QYGA 1VQYA 1BGXT 2R4FA 4G65A 2FZCB 4X4SA 4Y2IA 3T6BA 3WIVA 1FRKA 1HI8A 3KK1A 2VQFF 2JJ4D 3K2YA 3C14A 3Q89A 4XPCA 3WIUA 3A4TA 3G8QA 3D54A 4JI0J 4OJGA 3H40A 1PC4A 3X1LB 2K7JA 2DISA 2F5GA 4U67Q 3UCGA 3GFHA 1N0VC 2HYIB 2D9PA 4I69A 4OHWA 2LQJA 2VUGA 2HWIA 3OTOJ 3HHNB 3ILLA 1T02A 2FDNA 1XBWA 1T7PA 2OO4A 3PCOB 1PBUA 4RUHA 2V68A 2VFRA 2E1AA 3GV7B 2HZVA 5KFKA 4PRFA 4OV1A 2J7UA 4WIQA 2J6TA 1C4AA 3RBEA 2F65A 3O5TB 4RW6B 3FRZA 1C1CA 3P5BP 4JI6J 2ZDPA 3R5GA 4WZQA 2IA0A 1KOHA 4RNNA 1XR5A 3PW5A 1R31A 3D28A 4ZVUB 1DBDA 1SV5A 3NBPA 2W1BA 4ED2A 1I51B 3MFHA 1U1NA 1WTFA 3Q0AA 2JRSA 3DHXA 1N36J 3UVJA 1MW7A 5JJBA 3AY0A 5J2NB 1HWJA 2WBRA 3VAKA 3ZTSA 4HVZA 1K44A 4DX8H 2HVDA 4OZJA 4ILLA 4QQBA 2DEIA 5D3GB 1WC6A 2GJIA 2WRMA 1W2BR 2MGZA 1S7HA 4NLPA 2HWHA 2BM1A 1TKZA 2DHAA 3M32B 1GX6A 2ZEJA 1S1WB 1Q86T 3H5SA 5HMWA 1T3NA 1OY9A 4IRKA 4WP3A 2EWHA 2KRBA 4CM0A 2DXDA 5B0GA 1RXOB 5I3UB 3PX0A 2B5JB 4JI5F 3ISZA 1NK4A 1LEOA 3VCDA 3CULA 2DITA 3OT9A 2B56A 1UA0A 4GKJF 2XSFA 1XNRF 4USUA 1QJHA 1WKJA 5EX0A 2PEHA 2RIJA 2K3KA 1ZS6A 3NNHA 1EARA 1RU2A 3I6PA 1UA1A 1K1SA 1NRKA 1RT2B 1T9TA 1O51A 1AW0A 2W9CB 3V6KA 3RB3A 4DPXA 3DMJA 1IM6A 1ZA2B 2WB4A 3MOJB 3OFEA 1RABB 3OXGA 3DOKB 2WVFA 2HBYB 2RT3A 4N5SA 2HRTA 3MM6B 5KG4A 3TAQA 2OD4A 2EG1A 3QATA 5T7LA 1UW9A 3IG1B 2LCWA 3BYPA 5HMZA 3FSIA 1KKHA 3ZNUA 1U2CA 4BC7A 4K50A 4Z2XA 3NGRA 4CT8A 4I1TA 2ZJQQ 4ZMMA 3TP2A 4LF4F 4KH1B 2CFXA 4DR2F 1NJIT 2CKWA 2P9CA 2RQCA 3FSXA 4RW9B 4I2QB 4QPXA 3FFIA 5KT5A 4KYZA 3G96A 2GQQA 1SL1A 1Q82T 4OLPA 4DV4J 1H73A 3FQKA 1VQSA 2CJXB 2O3DA 4KSEB 1T9UA 3SDEB 4DBQA 2BANB 2J6SA 4HH1A 2E7XA 1EAYC 2D69A 5GMKa 2RJZA 4NA2A 2UXCJ 1QAYA 2RSQA 5L39A 1SUQB 4EBCA 1VQ7S 2H48B 4ECXA 3PJXA 2EK6A 4J9PA 1I94F 2R7VA 1WI6A 2UVWA 3A1YG 3DNCA 1M5PC 2NQPA 2PSZA 3CDWA 2XZWA 5JMNA 4RU9A 2HMIA 3V4IA 4P2FA 4M94A 3HT3A 3KNAA 4PXDA 4MK9A 5SUHA 4DSJA 2ZH6A 5IC4B 4J9QA 2CDRB 2EG2A 2YKNB 2AWZA 5KG7A 3K0JA 1ZZNA 1FA0A 1HWKA 1IKWB 1DTQB 2WVBA 4CCHA 3N6MA 3PTWA 4CNYA 4ER8A 1U45A 3O1LA 3DOLA 2CZ4A 2QTWA 4HT7A 2E1CA 2D3O1 4IDKA 2ZM6F 2OGUA 3M2RA 4FYYB 5C2CA 2B51A 2OPRA 2K2PA 4WU3A 1RTDA 1IKXA 2IYIA 1HNVB 4B3TF 1B4SA 4Y65A 4FP9A 3BGUA 3KKFA 4BC9A 3FCWA 3BM7A 2RDIA 4NLDA 1RWOB 3IAS9 4X62F 3FFIB 2DNPA 4OZ1A 1D9AA 2CQIA 2UUCF 3SEOA 3NAIA 2DR5A 1JNRB 1RA6A 3A13A 1HWIA 4DCOB 1X4HA 2VC0A 4MH8A 2E66A 3IXQA 3NOCA 1KONA 1RT3B 3MXHP 2CQ1A 3DLEA 3UO0A 3HPOA 2CVEA 2W7OA 4DV0F 1K8AT 1RP5A 4G1QB 1HNIA 1REVA 4PPZA 3A8JA 1RWXB 1ZPWX 2MJUA 2GMHA 2R8GA 3MMBA 4C11B 2OPPB 2AJFE 2QLFB 1JXLA 2DXEA 2AU0A 2Z0GA 1P6TA 2EXUA 1RISA 1C1BA 3TA1A 4UUXA 1KOOA 3CC4S 4WXWA 3I87A 4HI2A 1L3SA 2OLWA 2R2UA 4K4YA 2U1AA 5J1EA 5BXIA 1Q0NA 1T05A 3WC0A 1RTJB 3D6TB 5KFEA 4IRCA 5BJRA 3M30A 4OX8A 1NCLA 4UW2A 1X4BA 1SH2A 3LGNA 3TVKA 4OI2A 3CVKA 5E0OA 4O23A 1RI7A 4MKYA 2JVOA 3CJ3A 4NCGA 1CSJA 3QWUA 4YEAA 2GQ2A 4C0OC 1TL3A 1QM9A 4GO5X 4ZCMA 3QAEA 3BO4A 1QE1B 1V5VA 1WHXA 1NK6A 3OVSA 3UDLA 3VAGA 4FZVA 4PWDB 3VALA 1WUUA 2RRAA 3FCVA 3VZHA 1D9FA 1HW8A 4NASA 3TAMB 2JLFA 2G0IA 2AP6A 2V4JB 2JFKA 1XNQJ 3THPA 5ETQA 2MQMA 2RU3A 2ZNYA 4WKRA 4L74A 5J2QA 3NS6A 1T03B 2PDAA 4J7CA 4R25A 5A8RA 1D8YA 2OTLS 3CF5Q 5H9EJ 1U0HA 2A3JA 5LL6d 4PZVA 4JYAJ 2GV1A 2W2QP 1TFWA 2FUG9 1H0HB 1REVB 5E33A 1RKIA 1UWAA 2DH9A 3I9ZA 3MMJA 2RRNA 1FDBA 3H42A 5ETTA 1DY3A 3QIPA 2LU2A 4OI3A 1UVMA 3M7VA 2XM3A 5IM0A 1E6YA 4FXDA 1FI4A 2ZOGA 4OV6A 4DPWA 2HPUA 3FMWA 2GVZA 3MPWA 2YVSA 4PG8A 4DSFA 3LANA 3KLGB 3BSNA 3N01A 4PXBA 2KVQE 2YX4A 1O8BA 3PACA 1TL7A 4O0IA 2UXBF 4ANEA 1FFGB 1EP4B 1TUVA 3L7PA 4ZJLA 4RU2A 4RW7A 2YNGA 5HSPA 2HNYA 1FF2A 2UXDJ 1S48A 2ZH5A 1ZAVA 1NKEA 1IM4A 3L4BC 2HEKA 1N56A 1KC8T 1REGX 2EBEA 1KLNA 2NLWA 4KRWA 4YHHF 5EGYA 2LEAA 3W2VB 2VH7A 2EFVA 2BOAA 1SKRA 1GFWB 5KFPA 3IRWP 1VBKA 2V67A 3LO3A 4LF8J 4QIFA 3T41A 3V6DA 3EGZA 5IC6B 2R7XA 3MM7B 2KH9A 2LA6A 4ECQA 3NLCA 2CQDA 5G0RB 3MEDB 3GE9A 4LRDA 1U6BA 2QN6B 4AE5A 1TUWA 1S1TB 4DR6J 3GIIA 1VQPS 3OV7A 4M8LA 4I68A 2HHPA 2BQRA 4U7UD 1BUXA 1VJQA 1OPIA 2FY8A 5K8PA 3JQKA 2VFVA 4J9LA 2RAQA 3OR1B 4OI1A 2GHVC 2YX1A 2WONA 2BV3A 4P7VA 3TEHB 2FHOB 1RTIA 3HSZA 3GR0A 2ROGA 1S99A 1YBUA 1ZTWA 4B9UA
chains in the Genus database with same CATH topology
1TMJA 2QX0A 1EQMA 3HSJA 3ILIA 4M5JA 3MCOA 3HD1A 2F65A 1F9HA 5ETRA 4CRJA 3ILOA 3HCXA 4F7VA 2BMBA 1IM6A 2CG8A 3HD2A 4M5LA 4M5KA 4M5IA 3UD5A 1RU2A 4M5HA 3MCMA 4M5MA 5ETVA 3KUGA 1RTZA 1HQ2A 5ETKA 3UDVA 4AD6A 4CYUB 3HSZA 1RU1A 4M5GA 5ETQA 5ETMA 5ETNA 5ETTA 5ETLA 4PZVA 5ETSA 3HSGA 2F63A 1TMMA 1HKAA 3MCNA 1DY3A 5ETPA 1KBRA 3HSDA 3IP0A 3KUEA 1EQ0A 1EX8A 3ILLA 5ETOA 1RB0A 3ILJA 3KUHA 1G4CA 1RAOA 3UDEA 3QBCA 4CYUA 3HT0A 1CBKA 4M5NA 4CWBA 1Q0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TMJ A;  2QX0 A;  1EQM A;  3HSJ A;  3ILI A;  4M5J A;  3MCO A;  3HD1 A;  2F65 A;  1F9H A;  5ETR A;  4CRJ A;  3ILO A;  3HCX A;  4F7V A;  2BMB A;  1IM6 A;  2CG8 A;  3HD2 A;  4M5L A;  4M5K A;  4M5I A;  3UD5 A;  1RU2 A;  4M5H A;  3MCM A;  4M5M A;  5ETV A;  3KUG A;  1RTZ A;  1HQ2 A;  5ETK A;  3UDV A;  4AD6 A;  4CYU B;  3HSZ A;  1RU1 A;  4M5G A;  5ETQ A;  5ETM A;  5ETN A;  5ETT A;  5ETL A;  4PZV A;  5ETS A;  3HSG A;  2F63 A;  1TMM A;  1HKA A;  3MCN A;  1DY3 A;  5ETP A;  1KBR A;  3HSD A;  3IP0 A;  3KUE A;  1EQ0 A;  1EX8 A;  3ILL A;  5ETO A;  1RB0 A;  3ILJ A;  3KUH A;  1G4C A;  1RAO A;  3UDE A;  3QBC A;  4CYU A;  3HT0 A;  1CBK A;  4M5N A;  4CWB A;  1Q0N A; 
#chains in the Genus database with same CATH topology
 3LP1 A;  2MKY A;  4NXM F;  1B70 B;  1RWN B;  2YNH B;  1Q81 T;  5F8M A;  2BEF A;  3MMC B;  4CYU B;  5E7O B;  1AA1 B;  2J8S A;  3CB4 A;  1EJ7 L;  3TVZ A;  1WF1 A;  1X0P A;  1GMV A;  2LP4 A;  2HLT A;  2HHH J;  1RSC A;  1M1G A;  4K4T A;  3JSM B;  1MG7 A;  1K0T A;  2HNY B;  2DCU B;  3CCT A;  2ZNZ A;  5LMU F;  4HT5 A;  1YTY A;  4B08 A;  3AJ1 A;  3I5B A;  1BQX A;  1APS A;  5KFL A;  3VHQ A;  1WOR A;  1OSC A;  2V94 A;  4PWU A;  4NCB A;  2GVD B;  1OSD A;  3IWX A;  1JLC B;  1EET A;  4Y2M A;  2OP5 A;  1HBN B;  3ZO7 A;  1YI2 S;  3M8W A;  4CH7 A;  1KSP A;  3BQ2 A;  5E3A A;  1J5O B;  4OYM A;  4WK3 A;  2M5Y A;  1Z1Z A;  3ZZZ A;  3DXB A;  4ZP6 A;  3M2V A;  2BX6 A;  1SB6 A;  2BKP A;  3R5D A;  4XDC A;  1I1G A;  1N6Q B;  3HFK A;  1S6P B;  3IAM 9;  3M6U A;  1RWW B;  2AMC B;  4X4P A;  2KG1 A;  3MMA A;  4LMZ A;  2ABY A;  3SQG B;  2EFQ A;  1NPP A;  3GMG A;  4LSL A;  2FVS A;  3OL7 A;  3MUT P;  2ASD A;  3I4P A;  1IUJ A;  3PW7 A;  1FEH A;  4KFB A;  5KFQ A;  2HVE A;  2VJU A;  2JZ5 A;  1CJT A;  4DUY J;  4JI4 J;  1FJG J;  2LQB A;  3LOU A;  4DV1 J;  1ULR A;  3BGL A;  5FDL B;  1H7W A;  1S10 A;  3RAM A;  4J9N A;  1AZS A;  1N52 B;  3BN4 A;  4LIR A;  5HJX A;  5ETK A;  2AYE A;  4QIG A;  3M4X A;  3PY8 A;  1NZA A;  4OL8 A;  2OEL A;  3T5J A;  3V6H A;  3ZTQ A;  3H90 A;  5U47 A;  2HFU A;  5CD4 A;  2KKH A;  2JEF A;  3T5H A;  4EI2 A;  3HM9 A;  5CCM A;  2DNM A;  3KLH B;  1JKH A;  4ZCL A;  2C28 A;  1RQ0 A;  3QLH B;  1YK9 A;  1TKD A;  4UTG A;  3RTV A;  2CUY A;  4WKY A;  1WOS A;  2HHS A;  1HPZ B;  2FC8 A;  5HQ8 A;  4B3O B;  3HT0 A;  3GTY X;  3KJN B;  3OHB A;  4LIW A;  1N33 J;  3GZ7 A;  4L3K A;  2RH3 A;  5F8G A;  3EPI A;  2KFY A;  2C2R A;  2I38 A;  3P6Y C;  3NGK A;  1LW0 A;  2CQB A;  1EET B;  3AXK A;  3UW1 A;  2IAJ B;  3MWB A;  4P2S A;  4HAC B;  3GIM A;  2O1P A;  5HO4 A;  2CPH A;  2XMA A;  3R6G B;  5DQH A;  2CIM A;  4ZP9 A;  1JLE B;  2RDJ A;  1Q78 A;  1U2R A;  1Q7L B;  3FBB A;  5ETO A;  5DDP C;  2HQG A;  3RGI A;  4LFB F;  1VI7 A;  3EGN A;  4Q0B A;  3M8R A;  2R7Q A;  2CZ9 A;  1HL6 A;  1RTZ A;  5D0R A;  1EHW A;  3NS7 B;  1RCO B;  1NZ8 A;  3J7Y I;  3PHT A;  2IMO A;  1XR7 A;  2DKO B;  3CJ8 A;  3L95 X;  1QTN B;  3JB9 k;  4RW4 B;  5IS2 A;  4LSZ B;  2QLX A;  3Q2S C;  1EKR A;  3TZX A;  4Y6I A;  2LEP A;  3OBI A;  3KHG A;  1HA1 A;  4P9S A;  2E1R A;  4IOB A;  4ZHR A;  4DFP A;  1IKV A;  5KFZ A;  1S9G A;  2M0G B;  1P27 B;  3K17 A;  4DF4 A;  5IT9 U;  3TQE A;  3P96 A;  2XLI A;  2M88 A;  1YJN S;  4PG4 A;  3DDN A;  3CT9 A;  4C0H A;  4DSE A;  2V63 A;  4PYD A;  2G1D A;  3G8T A;  3HVW A;  3A8K A;  5J1N A;  2HK2 A;  4DZ6 A;  1VYA A;  2VBZ A;  1FO1 A;  2BE9 B;  4IG3 A;  4OX9 J;  3DLG B;  3U7J A;  4DXL A;  4IO9 Q;  5ETM A;  1F60 B;  3DRR A;  5IT9 Y;  1WF2 A;  1S77 D;  2RUG A;  3C3L A;  4WBF A;  2E7V A;  3DI6 A;  1HLW A;  2B9X A;  2V9W A;  2R7S A;  5CHC B;  3GFZ A;  3PKY A;  2E5L F;  2C2D A;  2W8L A;  1YGY A;  3PJW A;  1LWX A;  3SMZ A;  1HNW J;  1U25 A;  1RT7 B;  3ADA C;  1U09 A;  3T1H F;  1KFS A;  1N8R T;  1MMD A;  1YRT A;  3KLV A;  3FZ2 A;  4JOU A;  1U47 A;  4I6Y A;  2OPS A;  3TZW A;  4PYA A;  1PAE X;  2D3O R;  2MKS A;  3G4S S;  1Y00 A;  3N79 A;  4OIX A;  4ZOS A;  1UZH A;  4DV6 F;  3GCX P;  3P4U B;  5A0Y A;  2XG8 A;  2Q6B A;  1Q7Y T;  4KHR A;  4M5D A;  1CBK A;  3UN5 A;  4F50 A;  5J2P B;  2IRY A;  1VQ5 S;  1M5H A;  1RAF B;  4X64 F;  3A3N B;  1HBM A;  3AB4 B;  1KEK A;  1A7G E;  4KHP J;  9RUB A;  1U6Z A;  1PYO B;  3W2W B;  3J81 j;  1U1K A;  3T6J A;  1NSA A;  4JI7 J;  3R2C J;  3PX4 A;  4B02 A;  2XO6 A;  2BXJ A;  4RW8 B;  5IWA J;  2B6A A;  2BDP A;  4JV5 J;  4USW A;  1LQ9 A;  3HVR A;  2F4V J;  3UWT A;  1B7Y B;  1FKA F;  1WC5 A;  1CPZ A;  4ZKA A;  2LLZ A;  4U9R A;  4KR0 B;  3TAP A;  4USK A;  4K4U A;  1WTB A;  1TK5 A;  4Q7A A;  2QLW A;  3AQO A;  1N48 A;  3EYZ A;  3NMA A;  1MLA A;  1ICE B;  1M90 T;  4U7U K;  3LAL A;  4LF5 F;  1YJ9 S;  2VOP A;  2YWF A;  2BQU A;  1UAW A;  2V2K A;  3UNY A;  1HKA A;  3IRX B;  2HWT A;  2CVI A;  3MPY A;  3C6U B;  1LWC B;  4CNZ A;  3LH2 S;  1JLA B;  2BJ8 A;  3D3C J;  1UEU A;  3W8P A;  4YB7 A;  2UUA F;  2VG7 B;  3CD5 A;  1R8P A;  3CIZ A;  4G1I A;  3Q8Q B;  2BOP A;  2D41 A;  4EWT A;  4WPA A;  3KLF A;  2F8H A;  2HKE A;  1PC5 A;  5KFM A;  3K5M A;  2H4Y B;  4PQU B;  3M2U A;  4LUB A;  1D3W A;  3AOD A;  1WDD A;  2YWE A;  1RAC B;  4OX7 A;  4WFX A;  1WJ9 A;  1F5C A;  3RBD A;  2XMK A;  4RPF A;  1EQM A;  2HFN A;  1RT5 B;  1DQ8 A;  2AYB A;  4HEA 9;  3IM8 A;  3GB0 A;  2GS8 A;  2KYX A;  2HW3 A;  1R8A A;  1UJ5 A;  3CDA A;  5BYS A;  2BJ3 A;  4LQ3 A;  3EMT A;  3HLU A;  2YNF A;  2L9D A;  5DZ6 A;  1K9M T;  2ZC4 A;  1UEK A;  1SIW B;  3EX7 B;  2A0F B;  4WYL A;  2AJ1 A;  1ZA1 B;  4TXS A;  2ZH2 A;  3F0N A;  1FVS A;  4ICL B;  4KV8 A;  2VPY B;  3LQV A;  1IKY B;  1NME B;  2HQ3 A;  1TVR A;  1S9E A;  3RW6 A;  2Y0S D;  2V69 A;  1NSP A;  5AXL A;  3WX4 A;  2L48 A;  3TA0 A;  3R2D J;  2BJD A;  4JUZ A;  2JVR A;  1UJ4 A;  1H38 A;  1S0V A;  2JEI A;  4IQX A;  2HZC A;  1F2H A;  2CNL B;  1PSD A;  2CDQ A;  2VIH A;  4URG A;  4IG0 B;  3C6T A;  1RGV A;  4NWB A;  2OUG A;  1HYS A;  2EVZ A;  1JJH A;  5GVQ A;  2B7C B;  2PII A;  4FKY A;  5M2U A;  5A2Q U;  3NOG A;  2GHP A;  2HZA A;  3NL0 A;  3H4B A;  3B8H A;  4EFA C;  1P1T A;  2H3E B;  4M5L A;  5KT6 A;  1GMW D;  4A8K A;  4DL2 A;  4OHZ A;  3AD9 C;  3NCP A;  4OZ5 A;  3MCN A;  2MKK A;  4X65 F;  1FX2 A;  2D9O A;  1HHT P;  3LPE A;  4OZ2 A;  2W24 A;  4NRU A;  5H9E K;  3I5A A;  3PEH A;  5A2Q Y;  4NX9 A;  4HYK A;  2H5I B;  4O4R A;  4F0H A;  1S1V A;  1FJC A;  1DQ9 A;  4K0K F;  4HKQ A;  4LVO P;  3VGS A;  2VPZ B;  3KG0 A;  2L41 A;  4EK2 A;  2IMW P;  2ZE2 A;  4Q8E A;  2FJW A;  5A8K A;  2ZH1 A;  3ETO A;  4OI6 A;  1WOO A;  4RUB A;  2IHR 1;  3TOQ A;  4O3N A;  5G4D A;  1NUE A;  2QG9 B;  3MR7 A;  4A8Y A;  3IFE A;  3MM5 B;  2HG4 A;  1JLQ A;  4Y00 A;  3E01 B;  4MFB B;  1C2P A;  2MJN A;  4I2P A;  1IBK F;  1HNZ J;  3BDE A;  3A12 A;  3OTD A;  3IBW A;  1NKC A;  3ITH B;  4TY8 B;  2ASL A;  4K5R A;  2PD1 A;  1X4E A;  1O5J A;  1IR1 A;  1LV5 A;  2K1R B;  2GZO A;  3VAH A;  1KP6 A;  4PG7 A;  4A8X A;  4F8R A;  3DLL Q;  2ZH3 A;  3TYT A;  3QZ8 A;  3F44 A;  3IWN C;  2XS2 A;  4ZDN A;  4DG1 A;  1LW2 A;  3MR5 A;  2MQQ A;  3PR5 B;  3SV3 A;  4C8M A;  2OD6 A;  3O3L A;  2V8P A;  5M2R A;  5CYM A;  4FF2 A;  1UWB B;  2Y1I A;  3QO9 B;  2DEJ A;  3MI7 X;  2I5J A;  1HQE A;  2ZUA A;  1QTM A;  4P2X A;  3TAR A;  2KB2 A;  4NLR A;  5D4P A;  4J9R A;  4KE5 A;  1UEV A;  1ZZF A;  2QT7 A;  5B0A A;  1AYE A;  1N32 J;  4C6A A;  3NGD A;  4USI A;  2MQO A;  1EKS A;  1RHK B;  1U1L A;  5CD4 H;  3GYN A;  4FVM A;  4NLV A;  2OPQ B;  1VRU A;  1G1X A;  3E51 A;  3I0S B;  4DV7 J;  1TFY A;  2MHE A;  2CQP A;  2NXE A;  4WP9 A;  4CH1 A;  4O44 A;  5IV3 A;  1HBO B;  4FS2 A;  4WYW A;  2BKO A;  2DPI A;  1RYR A;  3OW2 R;  1VQ8 S;  1XNR J;  4IFV A;  4O4G A;  1C0U B;  4DL7 A;  3KLE B;  3SCK E;  5IV4 A;  1QAX A;  2WZ1 A;  3HHL D;  2OMO A;  3F73 A;  1S1U A;  2AT1 B;  2QA1 A;  1HBU B;  1C0T A;  5C42 B;  2C2O B;  3NWR A;  1S12 A;  3S1T A;  4CTA A;  2CPJ A;  3BV8 A;  1CJK B;  1NJX A;  2R7O A;  2ZUG A;  3VQT A;  2AJ0 A;  3AT1 B;  4QYZ K;  2MY7 A;  1WHY A;  1KQK A;  3G2X A;  4CZC A;  4DDF A;  3TWZ A;  2DBB A;  2BJE A;  3I31 A;  1N0U A;  3EZ5 A;  2BM0 A;  5I42 A;  1RK8 A;  4NPO A;  3MM8 A;  4TU7 A;  5FII A;  4JP8 A;  5IT0 A;  1RBO B;  2IDL A;  3TI0 A;  4GRS A;  3W7B A;  4H4M B;  4LF6 F;  1O0P A;  1DHM A;  2AGO A;  4LF4 J;  4ATN A;  3I0R A;  2XS7 A;  1NJW A;  4B9L A;  3W65 A;  5AT1 B;  2MKH A;  1CJV B;  2I2Y A;  2BRL A;  1J27 A;  3OFG A;  1JIH A;  1I6J A;  1EIY B;  2CJ9 A;  2VG6 A;  5IQQ A;  4QWA A;  1R8B A;  3BPD A;  2ZH9 A;  1RAH B;  4CT9 A;  4E0D A;  1PIE A;  1S6U A;  5DLF A;  5J2M B;  4AXI A;  1U6F A;  5E41 A;  1JLB B;  1CLF A;  4KKO B;  2FC9 A;  4F26 A;  1VGY A;  4DR5 F;  2HHV A;  3NEK A;  2VA2 A;  1PJ7 A;  4AND A;  4TKT A;  5I3P A;  2OI2 A;  1I94 J;  5B08 A;  2E1M C;  3HKW A;  4JV0 A;  2N3O A;  3P49 B;  4DUT A;  4M5K A;  5HI7 A;  1B0T A;  1GAO A;  1IWA A;  3S01 A;  2X51 A;  2MPU A;  1NBE B;  4GMK A;  4QOT A;  2AZ3 A;  3NGS A;  4ZPT R;  2R9L A;  4YQW A;  3VGV A;  2QEX S;  2YWH A;  2A2C A;  3LW5 C;  2Y9H A;  2LYV A;  4JI1 F;  1UW4 A;  1JK9 B;  1KN6 A;  2KXF A;  4NYP A;  1PGZ A;  2MKJ A;  2A2D A;  5HAN A;  3G8S A;  4ILM A;  4WCE Q;  3KOA A;  2ZM6 J;  2RB7 A;  2J7K A;  4USM A;  1FRJ A;  3F41 A;  4ZVO B;  1FK9 A;  3DM2 B;  3LP0 B;  2KN4 A;  3LP2 A;  4X4Q A;  4B3T J;  2FIU A;  2RE1 A;  1BY9 A;  4DCJ B;  2XUL A;  3PO5 A;  2EC0 A;  3HVT A;  5AXN A;  1VHI A;  2XSJ B;  4ED4 A;  5I4M A;  4X62 J;  3MEG A;  1JLF B;  2W01 A;  4G6V B;  4A8W A;  1RAD B;  4P71 A;  2E44 A;  4QJV A;  1QAI A;  2ASY A;  3JQM A;  4X4V A;  3KWM A;  3HHD A;  3DGP A;  4R8U A;  2PE8 A;  4CO2 A;  2IA6 A;  3MAQ A;  1LWE B;  1IBL F;  2OH2 A;  1SBR A;  2ADC A;  1NPK A;  3BR9 A;  4HL9 A;  5C25 B;  4FF4 A;  1BQN A;  1KTQ A;  3EWG A;  2VKZ G;  2ZH7 A;  5E5N A;  4YME A;  3CCU S;  2DGX A;  3DLK B;  5GAE U;  1T11 A;  1H72 C;  4PG6 A;  3QT7 A;  4I6A A;  1WKK A;  3RAQ A;  1MU2 B;  4X66 J;  4CLF A;  5KT7 A;  4RR5 A;  2LEB A;  4F3O A;  3H20 A;  2UVU A;  7FD1 A;  1L5U A;  3UE2 A;  3U1N A;  2KI2 A;  1GXL A;  1VC5 A;  4GVB A;  1CUL A;  3BSC A;  1N5Y B;  2HVI A;  2IBO A;  3ILJ A;  3NG8 A;  3RR7 A;  4DV3 J;  2RU9 A;  5LT5 A;  3Q8U A;  1S0M A;  1TKT A;  4ECY A;  5D4N A;  1S4F A;  2W2M P;  2CG4 A;  1TL1 A;  1TMM A;  2E29 A;  1VBY A;  4MK8 A;  5K8N A;  2ILY A;  3T5L A;  3ISN D;  1HQU B;  1QLN A;  2WVC A;  2BJ7 A;  1AB8 A;  4WP8 A;  3N4W A;  3VVT A;  2HGL A;  1RHJ B;  4DPO A;  2YWG A;  3QBC A;  3OTO F;  3MEC B;  5CQG A;  2ZD1 B;  1PIL A;  4ZPV R;  1S57 A;  3TX8 A;  2VQE J;  4U6P A;  1KQF B;  5HP1 B;  4HI1 A;  2F1F A;  3R6L B;  1NU4 A;  2VOO A;  1S7I A;  1RBA A;  4UOH A;  3DLJ A;  3HVT B;  1MRO B;  4CM2 A;  1ZPV A;  2B43 A;  4DPU A;  5DRK A;  4JI6 F;  1X60 A;  3DRY A;  5LMN J;  4B3S F;  4ZPW R;  2ATC B;  5KFH A;  2HHW A;  2MB0 B;  2AX0 A;  1W26 A;  3W9J A;  2RF2 A;  4NLG A;  2CJY B;  3UD5 A;  2R7W A;  2ROP A;  2MEW A;  4E2F B;  4JI2 J;  1Y9O A;  1VFJ A;  5RUB A;  1KR4 A;  2B3T B;  3A3O B;  4ECV A;  1FES A;  3D9B A;  1ZBT A;  2ATL A;  2IVY A;  2HHU A;  4B9N A;  2VG5 A;  3HJV A;  4IH6 A;  4PXE A;  2W8K A;  5DET A;  2KYZ A;  4KGK A;  2XS5 A;  4PG5 A;  3D0G E;  2DO4 A;  1YVF A;  4ZN1 A;  4QWC A;  3FUY A;  3HSG A;  1YRX A;  1GXT A;  1TV6 B;  3MR2 A;  2YKM A;  4IOC Q;  1DAR A;  4K5S A;  1SJ1 A;  4UZB A;  3KTQ A;  2VAS A;  2JX2 A;  2DNQ A;  2HQF A;  2D7S A;  1CJU B;  4TYA A;  1KVJ A;  3VAI A;  4NYZ A;  4YS2 A;  3BSO A;  1VRT B;  2CJA A;  3RJM B;  1U2F A;  2FLO A;  2XMT A;  5HBM B;  4ZVE A;  3OJS A;  5BR8 F;  4EZ9 A;  5E3P A;  2AJ4 A;  1D0E A;  4ZIT A;  2KU7 A;  5DO2 A;  1DTT A;  5D8H B;  1VQ6 S;  2R8I A;  2ZC3 A;  2ZBP A;  1SC4 B;  2HND B;  3UDV A;  1VQO S;  4N76 A;  1HWL A;  3TQ1 A;  2AQ4 A;  2P6S A;  1V3S A;  2GFF A;  3Q86 A;  3CJ5 A;  3HZG A;  4LBP A;  3KG1 A;  1R6V A;  1JWW A;  5T14 A;  3ZTR A;  4O3P A;  2DR7 A;  1YRU A;  1F9E B;  3SI8 A;  3OJU A;  1FX4 A;  3KMS A;  3R5A A;  2R7T A;  1YJR A;  4M95 A;  5IZH A;  5HLF A;  5HRO B;  2DNR A;  2MXY A;  4S0M A;  2EFG A;  3N6L A;  3BO3 A;  3ZXW A;  3MPV A;  2ZDO A;  3BH7 B;  2JHE A;  4ELT A;  4FNH A;  5GAG U;  4W92 B;  1RT4 B;  3DRS A;  3DGV A;  2AGP A;  4ECS A;  2FVR A;  1CS4 A;  2AJQ A;  5DZ7 A;  2R2R A;  1UMJ A;  1GMU A;  4KY3 A;  2BW2 A;  4I7F A;  2MLY A;  3MAA B;  3DRP A;  4L75 A;  4Q2L A;  4DV4 F;  2E1P A;  3M1V A;  3CJT A;  3JTP A;  2WOM A;  4CRJ A;  2ZKT A;  3H7H B;  1FVQ A;  4ES3 A;  3FK4 A;  2VBW A;  2H1Y A;  1LFP A;  1U8S A;  4P75 A;  3QPI A;  4Y2A A;  4NXM J;  3J80 U;  3MEE B;  1F9H A;  3R7N B;  1HNX J;  1GNK A;  2DNY A;  4NLQ A;  2PC6 A;  1YKW A;  2VU5 A;  3CD0 A;  4U8V A;  5D4L A;  2RS8 A;  3N5B A;  4H4O B;  4A8O A;  1RA7 A;  2MQP A;  3DOM A;  1WI8 A;  5D6G A;  3J80 Y;  1TAQ A;  1UPP A;  3UR3 C;  4YY3 J;  3DYA A;  3TX0 A;  4B17 A;  2AX1 A;  1SQG A;  1XN9 A;  4K4Z A;  4NLS A;  3OL6 A;  2HHX A;  3DDI A;  4YOE A;  1U24 A;  2EKY A;  4JI8 J;  1FNO A;  2I9S A;  3RAX A;  3MPU B;  2RVJ A;  5F8N A;  2Y8W A;  1RB0 A;  2MYF A;  3UCU P;  8AT1 B;  3N6N A;  4PUO B;  4YR2 A;  4WE1 B;  3ZTP A;  4L6V 3;  2GCF A;  4B3M F;  4ALZ A;  4KPY A;  3KLI B;  1UVN A;  4DR4 F;  2IC3 B;  1NHU A;  1SCJ B;  1SH3 A;  3HD1 A;  1QUV A;  1NK5 A;  1S1X B;  2ILZ A;  5B0B A;  4GVL A;  3POT B;  1VS3 A;  1YIJ S;  1MNE A;  2F63 A;  2QL5 B;  4AXJ A;  3C46 A;  3AD8 C;  2L9W A;  2ZHO A;  3FCH A;  1ZM4 A;  2N7C A;  3J7A N;  1BD6 A;  2FY1 A;  1SPB P;  4HDH A;  2OSR A;  1FKO B;  1U4B A;  4F4Z A;  2V34 A;  4OJH A;  1RHM B;  1W7W A;  2IJN A;  2FGO A;  3OR2 A;  1VMB A;  5CYQ A;  2OKQ A;  5B0F A;  1Q4R A;  2YBV A;  1TUG B;  2CQ3 A;  3TRG A;  3JYT B;  3IR5 B;  2DXF A;  1Q8L A;  1IQT A;  3O6Q A;  2JL9 A;  2EC2 A;  1PJ5 A;  1M1H A;  2J9E A;  2DVI A;  1FKP B;  1LXJ A;  3W5Y A;  2BKN A;  1P8G A;  3IR7 B;  4BLG A;  4ECW A;  1LWF A;  5LXY A;  2HS4 A;  2X1B A;  3LF0 A;  1D09 B;  3HP6 A;  2OML A;  5JUM A;  2RS2 A;  1IJF B;  3SFG A;  3PYE A;  5HVF A;  4C8Y A;  1T9V A;  4ZIV A;  2CAD A;  2M70 A;  4N41 A;  4A46 A;  1RAG B;  3EGW B;  2O01 C;  5FD1 A;  1B99 A;  4KGV B;  4WU2 A;  2BE2 A;  2B4O A;  3N9U C;  4OZL A;  1UTA A;  2Q6C A;  1ACM B;  2XCP A;  4X4R A;  4F25 A;  1X4F A;  2HQI A;  3G9C A;  1GK8 A;  1S6Q B;  2O67 A;  3GSD A;  1WNE A;  3BRE A;  3FVY A;  1RLD A;  3D7S B;  2EBG A;  2C2E A;  5THW A;  1AUS L;  2RKI A;  4LFB J;  3CCE S;  4DX6 A;  4N8N A;  3M8P B;  4C0B A;  1F6T A;  4UY8 T;  4DN0 A;  1L3T A;  3FRY A;  2HBQ B;  4OYI A;  3SIP B;  3SBM A;  4I6W A;  3KK2 B;  2IM3 A;  2DR8 A;  2BMB A;  4P52 A;  2XNQ A;  5K5M A;  3ENQ A;  1MWZ A;  2B8Q A;  1VQK S;  3KHR A;  4W90 B;  2KHC A;  1FFW B;  4JYA F;  1TR0 A;  4PPD A;  1RWK B;  3D0I E;  1MN9 A;  4F2S A;  4Q8F A;  2CWX A;  5EDW A;  2GGP B;  2JOQ A;  4K4X A;  4P10 A;  5H1S V;  3LGH A;  5C24 B;  2PT0 A;  2EEY A;  2Y0B B;  3KJV A;  1U1M A;  1FTC A;  1KFD A;  2QO3 A;  1F0X A;  4HHH A;  2AHO B;  2FJB B;  3OLA A;  3W66 A;  2HRU A;  5D77 A;  4A8Q A;  1TKX B;  1GMW A;  2F8M A;  5KFV A;  4QCL A;  2EFN A;  4KT0 C;  3CMQ A;  1DRZ A;  2XYH B;  2FQQ B;  1S0O A;  2QZ8 A;  3M8Y A;  2ACM A;  4YR0 A;  3LUY A;  2BVZ A;  2EFP A;  4F0M A;  5EN1 A;  2V4Q A;  3E8O A;  1UZD A;  1FXD A;  4RO0 A;  1SQE A;  2FZG B;  3W9H A;  3CD6 S;  4B9S A;  3WZ0 A;  4DR3 J;  4JV1 A;  5LM7 E;  3CJ4 A;  1HW9 A;  1PJ6 A;  4DX5 A;  2GNK A;  3KK1 B;  2PMW A;  2PMH A;  4MIW A;  4NI2 A;  4PR6 A;  1RWM B;  1JJC B;  3C14 B;  1XEZ A;  5IQ6 A;  2UXD F;  5AXM A;  3TUI C;  3J7A 1;  4AUK A;  2DH8 A;  4ZLJ A;  5IXU A;  4QWD A;  5T41 A;  2POK A;  2XMM A;  4PEO A;  4KPC A;  4ETZ A;  5HJY A;  3OUY A;  3MTJ A;  2AIR B;  2ZBI A;  1U49 A;  1RUS A;  5F3Z A;  2CNN B;  4DV6 J;  4EO8 A;  2PFF B;  1OY8 A;  2N7Y A;  1S97 A;  3SSR A;  3RBX A;  1NK8 A;  3EM1 A;  1URN A;  2MQ8 A;  3GG0 A;  1V3R A;  2VC1 A;  3RB0 A;  1HD0 A;  4Y3C A;  3PW4 A;  4F67 A;  2HNZ A;  2NUH A;  3J7Z 5;  3OXF A;  2M8H A;  2K8G A;  1C1C B;  2ZBC A;  2ERR A;  4ED3 A;  2PA3 A;  5GAE I;  2MY8 A;  4LRC A;  2C2Z B;  1TQL A;  2BJ1 A;  4NML A;  1SV5 B;  3PG9 A;  4USJ C;  3NBP B;  5DLG A;  2CYY A;  2VZ9 A;  1X31 C;  3RZA A;  4LFC J;  1OQ6 A;  1HHQ A;  3FGV A;  2QJ3 A;  1R27 B;  1NB2 A;  3UVJ B;  1X7V A;  1HFE L;  2NZC A;  2G2Y A;  4RBV A;  4H4K A;  3LAM A;  4N56 A;  1WDT A;  4M5J A;  3CJK A;  2NSC A;  1WSV A;  1UFW A;  2Z57 B;  1P9Q C;  4NLT A;  4DJB A;  1RT1 A;  4AL5 A;  1FDD A;  2QMW A;  2MGZ B;  4J37 A;  2VDH A;  1SJQ A;  1TKZ B;  3D3B J;  3CMA S;  2ZHB A;  4XTT A;  5FJ4 A;  1Y5N B;  4FPR A;  2P9E A;  5HN0 A;  4F02 A;  4F0K A;  2XY6 A;  4ED6 A;  3MR6 A;  5AJ3 F;  3HHL A;  2CQH A;  4DQP A;  3M9N B;  1IN0 A;  2FZK B;  4HTJ A;  4FNI A;  1NDK A;  4EEY A;  5KG1 A;  2V8V A;  5KG5 A;  1KBR A;  4RLE A;  1MN7 A;  1QD1 A;  4DF8 A;  1X4G A;  3BJY A;  5K14 A;  4FKX A;  2W4C A;  2QYC A;  1VR6 A;  5IFM A;  2UVV A;  2UP1 A;  3Q22 A;  1V3Z A;  4OZN A;  1BQM A;  2J6U A;  1XER A;  3DMJ B;  3PZP A;  3DC2 A;  1XMQ F;  2V6A A;  3RU0 A;  2VPW B;  3IO1 A;  5A6P A;  3G82 A;  3UN2 A;  2YX7 A;  1R8H A;  3MM9 A;  1WHV A;  1RTH A;  3OLB A;  3IS9 A;  5ETS A;  5T7L B;  1ZH5 A;  1NND A;  4DR7 F;  3K58 A;  4ELV A;  1S76 D;  3GCW P;  1KRP A;  3QYY A;  3RUB L;  2LXF A;  2C3M A;  1FDN A;  1R0B G;  3ET6 A;  1FJG F;  4DV1 F;  1FD2 A;  2QLB B;  2Y3Y A;  3HSD A;  2MST A;  3QSI A;  1VLO A;  1V9O A;  2JEG A;  1R0A A;  2C3Y A;  2X1A A;  3CCV S;  1N34 F;  3PEJ A;  2WK4 A;  3UR0 A;  4IFY A;  4CLP A;  2FJV A;  1RBL A;  4LSN A;  3FQL A;  4GO7 X;  4OJ1 A;  3W3S A;  4FYW B;  2CPY A;  4ZVH A;  3BZQ A;  1L3U A;  2HK3 A;  1V5I B;  1IJE B;  2DY1 A;  1OQ3 A;  2FHJ D;  4C3L A;  1Y3K A;  2GC8 A;  4D3H A;  3W62 A;  3TR5 A;  2VFU A;  2XHW A;  2BE7 D;  1XTZ A;  4G1P A;  3UCZ P;  3FSY A;  3C15 A;  2DRA A;  4C97 A;  4C48 A;  5D0H A;  5DGB A;  1TL5 A;  3GJR B;  3M9M B;  4X4T A;  4JI3 F;  3OD2 A;  2MZS A;  4FYX B;  4DQI A;  3BPS P;  4X65 J;  2G0C A;  4EO6 A;  3D5M A;  3NMR A;  2EKN A;  1OYE A;  5F0U A;  2FHM A;  4X84 A;  2VIC A;  4BBY A;  1TMJ A;  2J9D E;  4A4J A;  2HMI B;  4OI0 A;  3MD3 A;  3V4I B;  1ZTT A;  4E8U A;  4USH A;  4KTQ A;  4ETX A;  4K0K J;  4YB5 A;  3ZTO A;  4ZVP B;  2MMY A;  3M6X A;  2EK1 A;  3GYX B;  2DGW A;  2M7S A;  3D68 A;  4EGL A;  5GAG I;  3P45 B;  4OJ3 A;  2XQC A;  2XI3 A;  2W9B A;  2W4D A;  2WSE C;  3A8E A;  2KRR A;  5CA5 A;  5A8W A;  4CLW A;  5GAD U;  2PI5 A;  2BR0 A;  3DOL B;  4QPT A;  4R5P A;  2E5J A;  4OYZ A;  3HDS A;  2A6O A;  1VK3 A;  4DS5 A;  4IDK B;  1UL3 A;  4ANC A;  1FRM A;  2CPI A;  5CAA A;  3CXC R;  3M2R B;  3L3C A;  2N4C A;  1OMS A;  4NA3 A;  1XMB A;  1FDA A;  4A48 A;  1PBA A;  2OPR B;  4ZN3 A;  5F8L A;  3T1Y J;  3CJQ A;  2BAB A;  5KFG A;  1RTD B;  1IKX B;  3PYD A;  1UVL A;  3P5T L;  2XZD B;  1NDP A;  2AEF A;  4YP3 A;  1FD8 A;  3EPG A;  2CZV C;  4DUZ F;  3CCZ A;  1VIX A;  5F8I A;  1FWK A;  1HI0 P;  2KDO A;  4C3M A;  4OYO A;  3B78 A;  3WDO A;  3VAJ A;  2HVH A;  3DFE A;  4ECU A;  3C16 A;  2M9K A;  5A76 A;  3KYL A;  1RT6 A;  2CXE A;  1DQA A;  1GTH A;  1WHW A;  1HMV A;  3DN9 A;  2M4M A;  2H54 B;  2ZFH A;  3GWC A;  2GHW A;  3DLE B;  4Z7Y A;  3T5K A;  1HNI B;  3FNN A;  3ENW A;  1VDH A;  3JAM U;  1GEH A;  5L1K A;  3G6E S;  3P8B B;  4KO0 A;  3MMB B;  2X1G A;  2GO9 A;  4CO3 A;  3M8Q A;  1YX2 A;  1QAJ A;  1C1B B;  2DIU A;  4O0N A;  1DJ0 A;  4ZVG A;  4K8R A;  4F4X A;  3AOB A;  5LXR A;  3SYZ A;  2YH1 A;  5J1E B;  2VHG A;  1T05 B;  1JXV A;  3EZO A;  4MT1 A;  3UDE A;  3EDR B;  3M30 B;  2XGP A;  4NXN F;  2HRY A;  1HNW F;  5JXS A;  2IJR A;  2FLP A;  3J7Z T;  1WC4 A;  1OIA A;  2RHQ B;  2P5V A;  3BKT A;  2PEB A;  2R42 A;  1NHV A;  3MOZ A;  1X4C A;  1M0S A;  4LT6 A;  4QYR A;  4NCG B;  2FJA B;  2HAF A;  3M8S A;  1TL3 B;  1SC1 B;  1X5O A;  2GAH C;  1RAA B;  4ID5 A;  2PGC A;  3I55 S;  2JC0 A;  2J9C A;  4M1K A;  1Q53 A;  1N5S A;  4AQY J;  3GG1 A;  3CED A;  1JLG A;  4FDF A;  5DDR C;  5MLC V;  1KHV A;  4I67 A;  1LK7 A;  1YG0 A;  4IRD A;  4RJV A;  4FPI A;  3BGR A;  4LF6 J;  4U96 A;  3W5X A;  5IWA F;  3EVO A;  3GJS B;  5J2Q B;  5DM7 Q;  3IA0 A;  2N3L A;  1FE0 A;  2F4V F;  5A8R B;  2DR6 A;  1PKU A;  1U0H B;  2V8G A;  2E5G A;  3MR3 A;  4ID8 A;  4DSI A;  3PRB A;  3X3U A;  3BKU A;  1DLO A;  2ZKU A;  3ZNJ 1;  3RB4 A;  2MZR A;  1W2I A;  2LKZ A;  2X1F A;  4OHV A;  2B0G A;  4DV2 J;  2OSQ A;  3ILI A;  3KFW X;  2YNI A;  3US5 A;  3PYG A;  4J5O A;  2B9Y A;  1KLM A;  1WG1 A;  4QZV B;  3QIP B;  2CPX A;  3UI3 A;  5IM0 B;  5K9F A;  1E6Y B;  1Y10 A;  4J90 A;  3CPW R;  2YPY A;  1X4A A;  1VIS A;  4DR5 J;  2RQM A;  1NH7 A;  3SCJ E;  3KK3 A;  2GVZ B;  4O3O A;  2CAJ A;  1SC6 A;  5LOQ A;  2RQK A;  2MTL A;  3KDO A;  2CNO B;  1TL7 B;  1WKL A;  1D1U A;  2KG0 A;  2OFH X;  4UZC A;  3QRQ A;  2AKW B;  2WAQ D;  1NJY A;  3TUZ C;  2OAU A;  3HKZ D;  1GQE A;  3FZB A;  3UPF A;  4RW7 B;  4OFZ A;  4HHJ A;  1URR A;  1H2U X;  2UU9 J;  2YNG B;  2V2Q A;  5ETP A;  2IRX A;  1SJF A;  1VOM A;  2A1B A;  3PKM A;  3CCQ S;  3QT6 A;  4HDG A;  4ILR A;  3BYR A;  4QR2 A;  3Q8R B;  1KQG B;  1F5B A;  2HVZ A;  1K1Q A;  3E2E A;  2Y1R I;  1OY6 A;  2IDE A;  4C9D A;  1RCX B;  1JMT A;  1OPZ A;  4MIB A;  1KDN A;  3V6D B;  2WB1 D;  3HFZ B;  5CH7 B;  3RYL A;  2AV5 A;  1N5V A;  3E3X A;  1UCN A;  4KHM A;  2ZJR Q;  1Q8K A;  5HAT A;  2GO8 A;  4L73 A;  1U0S A;  4OYP A;  1TP7 A;  4M5M A;  3QMQ A;  4DFK A;  5KAK A;  3QFH A;  4A8F A;  4RW6 A;  5E2Q A;  2J0S D;  3QJL A;  1IBM F;  1FNX H;  1FE4 A;  5EHH A;  1FWL A;  1Q5Y A;  3T1A A;  5KG2 A;  1R0C B;  1S0N A;  3IGN A;  4J9K A;  1DUR A;  2WON B;  3KUH A;  1T95 A;  1HR0 J;  1IBL J;  3ETM A;  2KHD A;  4LF9 J;  1RTI B;  4OYA A;  4DL4 A;  3N28 A;  3NGT A;  2DNG A;  2JLE A;  5J2N A;  3NP5 A;  3AOA A;  4RKU C;  4YDD B;  2LQ8 A;  3LP1 B;  2NUU G;  1ROF A;  4NA1 A;  2LDY A;  2MQN A;  2KFN A;  3PDN A;  2FD2 A;  1NKB A;  5L1L A;  3WHI A;  5D4O A;  1NLK L;  3LA0 A;  5D3G A;  2UZA A;  3TNV A;  3M32 A;  4M63 A;  3AQP A;  4NLX A;  1ARO P;  3CJR A;  1S1W A;  2DGO A;  4IR1 A;  4DPT A;  2BYC A;  4UF4 A;  3FBF A;  1YJW S;  3CCJ S;  1T8E A;  5DQG A;  3PYF A;  3H2L A;  5I3U A;  1Y7P A;  2B5J A;  2BQ3 A;  2C2N A;  1T9W A;  3IBF B;  4ES1 A;  1NXI A;  1YZ6 A;  4LRF A;  3OL9 A;  2F4F A;  3TO8 A;  3Q23 A;  5ETL A;  2E5I A;  4KAI A;  1WEZ A;  3PXG a;  1SJ4 P;  2NYI A;  2DPJ A;  3PHE A;  3R7B B;  1RT2 A;  3RRK A;  3H5U A;  1HNZ F;  2I0X A;  1LFW A;  4LR7 A;  5KFJ A;  3D67 A;  2W9C A;  4ZP7 A;  2DNK A;  3PO4 A;  3M2V B;  3DOK A;  5K8M A;  2IFX A;  2VV5 A;  3D1Q A;  3MM6 A;  3MMA B;  3GSI A;  2KFZ A;  4LSL B;  2QL9 B;  2Z4P A;  3IG1 A;  1QSS A;  4LF7 J;  1CVJ A;  4CO5 A;  1QVG R;  3GQC A;  4KFB B;  3CCS S;  4B3S J;  2YKP A;  2NXN A;  3NXZ A;  4TY9 A;  1F3F A;  4K7Q A;  1FXL A;  1CJT B;  1YWX A;  3PFO A;  2W4P A;  3OTB A;  2YWW A;  1KVI A;  2GQC A;  2C2M B;  4DWI A;  4RW9 A;  4I2Q A;  3HUL A;  4E98 A;  2IM0 A;  4J9V A;  1AZS B;  1IR0 A;  1JNZ B;  2VL1 A;  1RJJ A;  4ZVT B;  1ELO A;  2QA4 S;  2CPF A;  1VQ4 S;  3EVM A;  3CC7 S;  3H8Y A;  1GX5 A;  2QA2 A;  3RRH A;  3R1H A;  3UD4 P;  3SDE A;  2BAN A;  1YBT A;  1N32 F;  4TNO A;  3GFX A;  3Q8P B;  5KFN A;  1Q1K A;  1XIQ A;  1JKH B;  4B3R J;  4U7C A;  1SXL A;  5DGA A;  1SUQ A;  4P6Q A;  2W9A A;  1FRX A;  3BDP A;  2HS3 A;  5BR8 J;  4DV7 F;  2AEJ A;  3C2P A;  3Q8Y A;  4KBI A;  3BH6 B;  2A18 A;  2V5H G;  1ZAX A;  4D3G A;  2WVD A;  2UUB F;  3GON A;  1MWY A;  3OSP A;  2YKQ A;  4KQZ A;  1NJZ A;  4HR2 A;  4DS4 A;  4UOG A;  1LW0 B;  2YKN A;  3B4M A;  1ZOT A;  4N47 A;  5KT2 A;  1X9S A;  2YY3 A;  2V2Z A;  4CP5 A;  1IKW A;  1DTQ A;  1TK0 A;  1ITP A;  2E9T A;  1S9F A;  4ELU A;  2BW7 A;  2AZ1 A;  4Q0B B;  3HF5 A;  1SJR A;  4WFA Q;  2C3U A;  4HLB A;  5HVG A;  3CWJ A;  1M5K C;  5KFB A;  5DDO C;  3Q8S B;  1HNV A;  1PCA A;  4DCP B;  4WTO B;  1H98 A;  1N4L A;  3K89 A;  4RBU A;  4RWW A;  1CC8 A;  5F9N A;  3NKY A;  1M5V C;  1Q8B A;  2CQ2 A;  1P1L A;  4ZHR B;  1HWU A;  4CO4 A;  1IKV B;  3FBC A;  2DHG A;  1S9G B;  2NXC A;  5F41 A;  5KFF A;  3M8Z A;  2IPO B;  3HK2 A;  3AHP A;  1YBA A;  3GIK A;  4G3I A;  1VQN S;  1RT3 A;  3J7Y U;  1OJ4 A;  4G1Q A;  5SZT A;  3PR4 A;  4IG3 B;  2QL7 B;  2ASJ A;  1G3O A;  4DFM A;  1WAC A;  1XR6 A;  3AJD A;  4C11 A;  2IRU A;  2OPP A;  5E3C A;  4F7V A;  3DRR B;  3W8G A;  4PKD B;  1HQ2 A;  4V19 J;  3AB2 B;  2W7A A;  2OTJ S;  4QWB A;  1CEZ A;  1MMN A;  5D15 A;  4F3Q A;  3ZFV A;  5GAD I;  3DI6 B;  5F0W A;  4C8N A;  6FDR A;  2H5J B;  2VF3 A;  1FEE A;  1T9X A;  1RTJ A;  3CJS A;  2NYH A;  3NCQ A;  1WC3 A;  1S5Z A;  4NOH A;  2BUN A;  1TZ0 A;  2OPS B;  4DSL A;  4QIV A;  1FJ7 A;  2DNN A;  5KFW A;  1T3O A;  3H0P A;  4RNH A;  1X9M A;  5KFT A;  3M05 A;  3KJF B;  2H65 B;  3ICL A;  3T19 A;  1JJ4 A;  1SC3 B;  4W4M A;  4RUC A;  4AL7 A;  2NXJ A;  1U1O A;  5A0Y B;  4JV2 A;  3LGM A;  3RG6 A;  2RHS B;  2GIQ A;  3UN3 A;  4B3M J;  4NYO A;  2YXL A;  4M5D B;  4CLU A;  3K5P A;  2V2V A;  4DV5 J;  4IQM A;  1QE1 A;  2OIH A;  4DR4 J;  2VBY A;  3GLJ A;  3KG4 A;  2DGU A;  3MGJ A;  2KZM A;  4PWD A;  1HBM B;  1XQI A;  3KXD A;  2X3G A;  4LFA F;  2W7P A;  2H4W B;  1HAR A;  3TAM A;  3VR1 A;  3UFC X;  2V4J A;  4EU0 A;  1RE1 B;  3Q83 A;  1ZAW A;  1CC7 A;  3VQS A;  2B6A B;  3OPK A;  2MLX A;  1NAQ A;  1T03 A;  1T94 A;  4XPE A;  3TW0 A;  3OQ2 A;  5F8J A;  4XIU A;  3SSS A;  4GKK J;  2DNO A;  3GIJ A;  3CC2 S;  4TU9 A;  1FRI A;  3W5Z A;  4OZ3 A;  5ETN A;  4YB1 P;  2JDJ A;  4ECR A;  4NLU A;  4N7T A;  4FBU A;  4TQS A;  3QWP A;  1VCT A;  2MZ1 A;  4J9O A;  2PI4 A;  4C8L A;  3V81 A;  2QC3 A;  4X66 F;  3G86 A;  1H7X A;  4JB8 B;  4ZVR B;  5GAH U;  3IGV A;  4AT1 B;  2XLJ A;  4P2M A;  4DV3 F;  3KLG A;  1HHS A;  2R7U A;  4ZA1 A;  3KLF B;  2IY5 B;  1TAU A;  4DN9 A;  4DOZ A;  2M52 A;  2QRR A;  3M2U B;  1G6B A;  3EXY A;  3GFY A;  4QW9 A;  2KTQ A;  2EFO A;  5I3Q A;  3BQ0 A;  2VQF J;  2AYM A;  1EP4 A;  2DNH A;  3ONQ A;  3WBZ A;  3NY0 A;  1ZYQ A;  2Q3P A;  4DPY A;  4ZPA A;  2D74 B;  1N5Q A;  2HS0 A;  4OHX A;  1IR2 A;  4NLO A;  1U26 A;  2ZBQ A;  3CE8 A;  2J5A A;  4OYX A;  4LRE A;  2CPD A;  4ZJO A;  2XYG B;  3W2V A;  2YNF B;  2XLK A;  4OZ0 A;  3LTO A;  3VGU A;  2FYX A;  2Z2L A;  2VQE F;  3U02 A;  4ENO A;  4MKB A;  1UFK A;  3DRX A;  1TK8 A;  2IVM A;  4KV8 B;  3MM7 A;  2V4R A;  2LQ9 A;  5ITH A;  1TVR B;  4J9S A;  5LMN F;  5G0R A;  3FC9 A;  1YIT S;  1S9E B;  4F3M A;  1N5T A;  3MED A;  4DQR A;  2RML A;  3D6M B;  3B82 A;  2C1E B;  1S1T A;  2K3I A;  4NZ7 A;  2L9N A;  5CZX A;  2KT5 A;  3HO1 A;  4JI2 F;  2FHJ A;  3BB5 A;  4L72 B;  2WHO A;  3H4D A;  2ZVI A;  4FXV A;  2MZJ A;  3OR1 A;  1TEL A;  2MZT A;  2QFJ A;  2B4P A;  5IOL A;  2AD9 A;  1X5T A;  5CAB A;  1NPR A;  3C6T B;  4DL5 A;  3V81 B;  1HYS B;  4I0W A;  2M2B A;  5HQL A;  5LSL A;  3PJ9 A;  2ZVS A;  4DI6 A;  2Z2Y B;  9ATC B;  2YQ1 A;  1UVI A;  2YNH A;  3QFW A;  3MMC A;  3IMQ J;  1NEE A;  4UST A;  4CYU A;  4I56 A;  3UNG C;  2R2S A;  1VQM S;  1LXN A;  2NZ4 A;  1YJV A;  4ZJQ A;  3D4J A;  1LNQ A;  2P2C B;  3GJQ B;  4LRA A;  5LJ3 Y;  1X9W A;  3Q8V A;  1HD1 A;  3JSM A;  1S1V B;  4K4V A;  1WOP A;  4JI5 J;  3V2U C;  4UQG A;  2ZE2 B;  1V6H A;  3FJ2 A;  4GKJ J;  5A8K B;  2XEX A;  4K4S A;  4NMX A;  3ZZP A;  2JFD A;  3K7R A;  2AJ2 A;  1F5A A;  2V0N A;  2VON A;  3MCO A;  5L38 A;  2GVD A;  2KZZ A;  4RNF A;  5B0E A;  1JLC A;  1JLQ B;  1HBN A;  4Q43 A;  1X4D A;  2DGS A;  4Z37 A;  4I2P B;  1KS2 A;  2GW8 A;  3OVB A;  1J5O A;  4WZM A;  1K73 T;  3THT A;  1UJ6 A;  2NPI A;  4BHQ A;  3WQP A;  4J9M A;  3JQJ A;  1N6Q A;  1S6P A;  3CD7 A;  1FRL A;  2CPZ A;  2EPI A;  2DT9 A;  1J5E F;  4DR1 F;  1EX8 A;  5D78 A;  4PWW A;  4YDX A;  3SQG A;  1Y3J A;  4URQ U;  5DQI A;  2IIH A;  4NZ0 A;  2XMU A;  4EBE A;  3PNI A;  2HBZ B;  4ZPD A;  5B0D A;  2WW4 A;  2GIF A;  3CNQ P;  3SXL A;  3H59 A;  4DQS A;  3CDE A;  4DR2 J;  2A10 A;  4DG1 B;  4FS1 A;  4XK8 C;  3I4H X;  1LW2 B;  2YWK A;  2J0Q D;  5HK4 A;  1Y5I B;  1VC0 A;  2BBE A;  2LXU A;  4Z7C A;  4ZIW A;  4LF2 A;  3BBF A;  3O2I A;  4N77 A;  5FDL A;  1SIZ A;  5HVH A;  2FLN A;  2J7W A;  5CYM B;  3EE3 A;  1KQS R;  4EMD A;  4QIW D;  2DGT A;  1QY7 A;  1A0O B;  5DJB A;  2HGN A;  2P6T A;  1KWM A;  4DU8 A;  5KFY A;  2G2O A;  1WEL A;  4Y34 A;  3VTI A;  2I5J B;  3MDF A;  3OSN A;  1HQE B;  4FXW A;  1VQL S;  3GV5 B;  1VIO A;  5CCL A;  3OTE A;  5K20 B;  1OWX A;  1MSW D;  1HNX F;  3D1H A;  1SKS A;  1BWE A;  1KHW A;  4OI4 A;  1W25 A;  3MEK A;  4QYZ J;  2R2T A;  2J9D A;  2ZJP Q;  1NH8 A;  2XMV A;  3KLH A;  4X4U A;  1SL0 A;  4M5I A;  5AXK A;  5KG3 A;  5HMX A;  1VRU B;  2GIR A;  4LVN P;  2V50 A;  1XMO F;  2DIV A;  3QLH A;  4F04 B;  3QAU A;  4YY3 F;  3G87 A;  2KM8 C;  3SCL E;  5AJ3 J;  1U1R A;  4O44 B;  1HPZ A;  5F9L A;  3OFF A;  4B3O A;  1JXE A;  3R5C A;  4FBT A;  4IUF A;  1PAU B;  4IFV B;  4O4G B;  4JI8 F;  3PW2 A;  2KO1 A;  2XC9 A;  1F1B B;  2ALY B;  4R0J A;  3I5C A;  2NSB A;  3KMQ A;  1S1U B;  3CJ0 A;  2J0X A;  4N8O A;  2IAJ A;  1C0T B;  4HAC A;  2KVI A;  4CTA B;  3VZI A;  2HFS A;  2Q66 A;  3MUV P;  1JLE A;  2QIF A;  1XMQ J;  2P8I A;  2N4D A;  5EX3 A;  3FEY B;  1MWQ A;  4MMO A;  4CQ1 A;  4XAK A;  3KNG A;  3BGF A;  4WJB A;  3QRR A;  4WTY A;  5I42 B;  2DR9 A;  3MM8 B;  4DR7 J;  1K0V A;  3EUN A;  3CCL S;  4A47 A;  3CW2 C;  4DL6 A;  2ZIT A;  1Y11 A;  4OYW A;  2DB1 A;  3I0R B;  1DAX A;  4M5G A;  3VVU A;  5HMY A;  3DKD A;  4TQR A;  4RW4 A;  2ZH8 A;  3DU5 A;  2MDA A;  1UVJ A;  5EWE A;  3JTN A;  2UUC J;  5CXT A;  1N34 J;  2VG6 B;  2NPF A;  1S6O A;  1SJ3 P;  2WW8 A;  3CIM A;  3QGG A;  1C4C A;  4O3R A;  3FDS A;  4OX6 A;  2CWK A;  4C8K A;  1Q16 B;  4LBI A;  4DV0 J;  3GPA A;  2WTF A;  4X4O A;  3CSK A;  2R3V A;  3AA9 A;  1JQG A;  5JVG Q;  3NS5 A;  3AOC A;  3DLG A;  2F7V A;  3U1M A;  5BYQ A;  1PYS B;  3I9V 9;  1NDL A;  2L08 A;  4JI3 J;  3MUR P;  1H2V Z;  1IXK A;  2MQL A;  4ZLL A;  2J0W A;  4UOF A;  1VJW A;  3D66 A;  2IVF B;  2XNR A;  2ZZT A;  4LQ9 A;  2DCL A;  1WF0 A;  2FVP A;  3K8V A;  1U8W A;  1IVZ A;  1RLC L;  1SI9 A;  2HBR B;  2HFO A;  1RT7 A;  1FNM A;  2D3U A;  1IQZ A;  2W2O P;  3IR6 B;  4USV A;  1ZM9 A;  4B9M A;  2XHC A;  1BLU A;  4JI0 F;  1WWH A;  5FLX U;  3S6E A;  2X7I A;  3GP9 A;  3IM9 A;  2QLJ B;  3K57 A;  1UKU A;  1UFL A;  2HHQ A;  4FYV B;  1UPM B;  5KT3 A;  4IYQ A;  2CQ0 A;  4NRT A;  2ZOM A;  2CQ4 A;  4QW8 A;  2XBP A;  4IOA Q;  5FLX Y;  4C2M A;  3DHW C;  5J2P A;  1FK9 B;  4CLS A;  2HQD A;  2VKR A;  5EUH A;  2CRL A;  1WG5 A;  2GJF A;  3LP2 B;  3HI9 A;  5HAO A;  5KFU A;  2GML A;  4B9V A;  1YJU A;  1NK9 A;  3W2W A;  2QE5 A;  4DUZ J;  3MEG B;  4ZPB A;  1T9Y A;  3WC2 A;  4RW8 A;  3O8W A;  4DFJ A;  3EIC A;  4C8Z A;  4OYB A;  1NDC A;  3RB6 A;  4TN2 A;  2VFS A;  2GA7 A;  4DZD A;  2DGV A;  4EYI B;  2C2K B;  3L7U A;  3BN7 A;  1CQN A;  2KT3 A;  3DGP B;  4R8U B;  4ED8 A;  3AJ2 A;  1XJW B;  4R0E A;  5L46 A;  3HVA A;  4Q5V A;  1N36 F;  4X2B A;  3SFU A;  5IT4 A;  4K4W A;  3PIO Q;  1BQN B;  2FVC A;  3TEG A;  5KG6 A;  2DY9 A;  1M5O C;  4HTI A;  3OFH A;  3UD3 P;  2RQ4 A;  4UY8 5;  3IRX A;  4Q45 A;  2KL8 A;  4F36 A;  4MYT A;  3MCS A;  3ILO A;  3C6U A;  3OTC A;  4P74 A;  1LWC A;  4GVB B;  2X3D A;  3N5F A;  3JXO A;  1CUL B;  1JLA A;  3CO0 P;  3J81 U;  3L09 A;  1GH8 A;  4DR3 F;  2VG7 A;  2ALZ A;  4NXN J;  5L9X A;  1TKT B;  1YLX A;  2MZQ A;  4ITS A;  4DL0 C;  3AAW B;  1GTE A;  4RL1 A;  1TL1 B;  2YTC A;  4CLZ A;  2UXB J;  3BBB A;  2XY7 A;  4PQU A;  2ZH4 A;  1D8Z A;  3V5R A;  3BR8 A;  2NS1 B;  1M5S A;  3TJA A;  1U7L A;  4DEZ A;  2IM1 A;  4IR9 A;  3J81 Y;  3OHA A;  2MKC A;  1F2G A;  1DFD A;  1RT5 A;  2YH0 A;  2O5D A;  4Q44 A;  4H4K C;  4YHH J;  3V6J A;  3ZZT A;  2DHS A;  4DU7 A;  4CH0 S;  2UV8 G;  3LWM A;  3V4M A;  4CLY A;  4ZCK A;  4ZLP A;  4NCA A;  2Q79 A;  1FCA A;  4ED1 A;  2WVE A;  5C5J A;  2IYG A;  3BSA A;  3TVY A;  4BWJ A;  3C19 A;  3CCM S;  4ICL A;  1FWP A;  4X4N A;  5KFO A;  2AEM A;  1XK8 A;  1RHQ B;  1IKY A;  3S8S A;  3W9I A;  2MLZ A;  3HHL C;  1FXR A;  2RF2 B;  3ULH A;  2NRE A;  5GAH I;  3JSR A;  4NEZ A;  3EDQ B;  2AGQ A;  2B9E A;  2N82 B;  4LFC F;  2Z2M A;  4EZ6 A;  2CQC A;  3DLB A;  2D1C A;  2VG5 B;  1PYT A;  1OYD A;  2RD5 C;  3OXL A;  2F9J A;  1UP1 A;  2UUW A;  2CG8 A;  2G2Z A;  4IG0 A;  1RKJ A;  2YKM B;  1WEY A;  4BCA A;  3LWL A;  4IH7 A;  2YKA A;  3RW7 A;  2B7B B;  2VBX A;  1U1P A;  3QJJ A;  4H54 A;  2UXC F;  3HD2 A;  2HIQ A;  3QSY B;  3SCI E;  3W61 A;  4TLR A;  2L3M A;  2EW9 A;  2XCA A;  4EUV A;  3DXS X;  1S79 A;  3TAN A;  1DTT B;  2LA4 A;  3MZI A;  2LEC A;  5L1I A;  3NGU A;  5LMU J;  1R7I A;  2JNJ A;  3CME S;  4M5N A;  3ZZY A;  1EB0 A;  4TLQ A;  3MCM A;  3ENV A;  2WBM A;  1FJE B;  2E5H A;  2Z8Q A;  4DLE A;  3D6H B;  1N54 B;  3MM5 A;  1RAI B;  3PM9 A;  4F4Y A;  1O6X A;  4GC6 A;  3E01 A;  4MFB A;  2H5E A;  3H5X A;  5HLF B;  2QSW A;  4KGM A;  4CIO A;  2JEJ A;  4ZS6 A;  2LXI A;  4F4A A;  3ITH A;  4IKA A;  2E9Z A;  4TY8 A;  2ROE A;  3MUM P;  2FVQ A;  2O66 A;  3DRS B;  1CS4 B;  4HH0 A;  2K1R A;  1H2T Z;  3IWL A;  1IBM J;  3GIR A;  4MKV A;  4RNM A;  1CG2 A;  8RUC A;  1R43 A;  2HQC A;  5C7P A;  4I7F B;  1WEX A;  1KD1 T;  3DRP B;  3BBC A;  3FEX B;  3N0V A;  1YJ7 A;  1TU0 B;  4A8M P;  2B4V A;  3M1V B;  1RYS A;  3U1L A;  3D0H E;  2WOM B;  1HIY A;  3P3D A;  5KG0 A;  1BE4 A;  2AF6 A;  2EI5 A;  3GV8 B;  1VBZ A;  2E9R X;  5DS7 A;  1YQH A;  4RWX A;  1UWB A;  2Z30 B;  3QO9 A;  2C3O A;  2Q1L A;  5KFA A;  3I96 A;  3TA2 A;  1JJ2 R;  5LSR A;  2FJE B;  2IBK A;  3KHH A;  2LDI A;  5E3R A;  1QSY A;  3T3F A;  4M5H A;  3H98 A;  4C7Q A;  2JLG A;  3QID A;  5CZV A;  4TU8 A;  3AFG A;  5EWF A;  2HLU A;  2FLL A;  3MF5 A;  2HGM A;  5KFI A;  3DOM B;  2VJV A;  2C42 A;  4WFN Q;  2OPQ A;  2R7R A;  4ZLN A;  1NHK L;  3OL8 A;  1AXQ A;  1ZM3 A;  3I0S A;  2R8H A;  3HCX A;  5F3T A;  3DYA B;  3ZZU A;  4J9U E;  2CA9 A;  1VBX A;  1NK0 A;  1QUP A;  1ZET A;  2DH7 A;  2C3P A;  1HBO A;  4F4K A;  4LR9 A;  1QSL A;  1VLY A;  4MTP A;  2I8E A;  2NCK L;  4YB6 A;  2Z56 B;  1Q5V A;  3QQC D;  1BMQ B;  1C0U A;  5KOW A;  1NK7 A;  2BAC A;  3KLE A;  5KFX A;  4ZVS B;  2B8P A;  1SL2 A;  4IH5 A;  2AW0 A;  3C8Y A;  4V19 X;  1G7C B;  1Y5L B;  1KTV A;  5AE3 A;  1HBU A;  2QX0 A;  3C66 A;  4CDI A;  5C42 A;  3S7R A;  2XO7 A;  5DG7 A;  1S49 A;  2Q43 A;  1CJK A;  2KXN B;  5JVH Q;  2QGF B;  1RU1 A;  4LJM A;  2DK2 A;  5H9F J;  4O3S A;  1VHF A;  3D2W A;  4OLO A;  1R8C A;  1G4C A;  3T1Y F;  2Z58 B;  5D0G A;  1S59 A;  2M8D B;  4QU7 A;  1S72 S;  3ISN C;  4OQJ A;  2ZOF A;  3HX9 A;  1XNQ F;  3R3T A;  2KM8 B;  3MD1 A;  3RR8 A;  4H4M A;  3QJP A;  3D1O A;  1MML A;  3B54 A;  4Y2C A;  3CCR S;  4FF1 A;  1CJV A;  1B64 A;  4ED0 A;  3G6V A;  3R7S B;  2KXH A;  4UUW A;  5L8R C;  2J76 E;  3OR2 B;  3VWS A;  3AA8 A;  5CYQ B;  1FT8 A;  4WFZ A;  3OVA A;  4NL5 A;  1U1Q A;  4CLL A;  3JS9 A;  3ZC4 A;  5J2M A;  1FFS B;  3H2U B;  3NCR A;  3HXM A;  3SZ2 A;  4DHV A;  3ZZR A;  2JH3 A;  3BKF A;  4AFF A;  1JLB A;  1LWF B;  4KKO A;  4FVC A;  2RNE A;  4MK7 A;  4QR1 A;  4AYB D;  3H2V E;  3T9Z A;  3M9O B;  1BC6 A;  4WXO A;  3PIP Q;  3I82 A;  2B4U A;  1OO0 B;  5B09 A;  2MKI A;  4I4B A;  4YFU A;  2JSX A;  4WFB Q;  4QR0 A;  1SKW A;  2E5L J;  1LK5 A;  1CQM A;  2BA9 A;  4YN3 B;  2BE2 B;  3NNC A;  3TJ8 A;  3IBC B;  2UUB J;  3T1H J;  2FHK A;  1JX4 A;  2DHX A;  3UDC A;  3CCW A;  3DU6 A;  3PX6 A;  3BO2 A;  3EZU A;  2AYG A;  1LKZ A;  2RIL A;  4Y0F A;  2A6M A;  3R27 A;  2VD3 A;  3AXM A;  3QNW B;  2RKI B;  3AD7 C;  4NZ6 A;  3TZZ A;  3HHK A;  5ETV A;  4DQQ A;  4LF8 F;  4AQY F;  3RRG A;  1RZM A;  1XC9 A;  1T0T V;  3RBZ A;  1SH0 A;  1L3K A;  3Q2T C;  3UQS A;  2PFD A;  5MAO A;  3G6Y A;  1VRQ C;  4X64 J;  1Z2Z A;  3DM2 A;  3LP0 A;  2F9D A;  4P73 A;  3VF0 B;  2RUS A;  2K7K A;  2HIY A;  1A6L A;  2GJ2 A;  2MHN A;  1I3O B;  4DR6 F;  1AFJ A;  2XSJ A;  4WII A;  4P72 A;  1ZM2 A;  4CLT A;  1JLF A;  4L3N A;  1H74 A;  8ATC B;  3PV8 A;  3O44 A;  5C2G A;  4LRB A;  2MSS A;  5E3Q A;  1XWL A;  3NWG A;  3SQO P;  1H3D A;  2HUR A;  4DV2 F;  3KJV B;  2OJ3 A;  1B7F A;  2ZZM A;  5LSO A;  2DHH A;  4RUA A;  3HHE A;  1LWE A;  3QGH A;  4NE9 C;  2DNL A;  5C25 A;  2BRK A;  4LF5 J;  1VC6 A;  1YSJ A;  3VGT A;  1AFI A;  1IWG A;  4DMZ A;  2UV8 A;  3DLK A;  1RWV B;  2VOD A;  1NB7 A;  2ADB A;  3SV4 A;  1GXU A;  1MU2 A;  4XO0 A;  2R8J A;  3AH6 A;  3K5L A;  2UVR A;  4NEY A;  1I5O B;  3HJF A;  4RNO A;  3NRB A;  1Q8I A;  3CDU A;  3I56 S;  3CJ2 A;  1N5Y A;  3QGP A;  3TJ9 A;  2UUA J;  2QA4 G;  1J2V A;  3H5Y A;  2HHH F;  3QRP A;  1RAJ A;  1H6K X;  3CTR A;  3GR1 A;  4NI2 B;  2FJX A;  4KH0 B;  4KGZ B;  2DRB A;  1QVF R;  3W1Y C;  3W60 A;  2UU9 F;  2SXL A;  3SSQ A;  4BDP A;  2XWY A;  1YJT A;  5DM6 Q;  4W98 A;  3NNA A;  1HQU A;  3NAH A;  3K5O A;  2H51 B;  1TTH B;  1YHQ S;  4UQT A;  1WG4 A;  5HQM A;  1F3V A;  3OUY B;  1M1K T;  4P7T A;  2FTR A;  4V1A k;  3B4D A;  3I32 A;  2JWN A;  3ELH A;  4BWM A;  2F8E X;  3MEC A;  2Y1L B;  4C8O A;  2F40 A;  2ZD1 A;  5KFC A;  1FER A;  1LOU A;  7FDR A;  3HFV A;  2D3Z A;  2OEK A;  2QMU B;  5HP1 A;  3THV A;  4LFA J;  3JSY A;  4CO1 A;  2HNZ B;  3FEZ A;  2KT2 A;  1PO6 A;  1BWV A;  1MRO A;  3MAH A;  1NSK L;  2OFG X;  5KOX A;  2G0J A;  2UUT A;  2XTJ P;  3GYG A;  1P9Y A;  3QGI A;  2FPH X;  2HSE B;  4DUY F;  4JI4 F;  3PVX A;  2ZBR A;  4QIE A;  3BQ1 A;  3DDK A;  2VPX B;  2KJV A;  3MHY A;  4OHY A;  1HR0 F;  2PA8 D;  4DSK A;  3GIL A;  1Q95 G;  2OHD A;  4LF9 F;  3IC1 A;  2CJQ A;  1B0V A;  2XMW A;  2YKO A;  3KUG A;  2GX8 A;  2E7W A;  4CLK A;  2G4B A;  3R5J B;  1L3V A;  3CJK B;  3R9L A;  4ECZ A;  3R97 A;  4KC5 A;  2VDI A;  2CPE A;  2VFT A;  1TV6 A;  3D6F B;  2P9G A;  1RT1 B;  2WSC C;  1WC1 A;  4ZP8 A;  3PFE A;  3TZY A;  2NR0 A;  2VB6 A;  3KUE A;  3M6V A;  1AUD A;  1CJU A;  5B7W A;  2LVW A;  5KTQ A;  2B9W A;  1VRT A;  4NLY A;  2COL A;  5HBM A;  5B0C A;  1KNZ A;  3HHL B;  3M6W A;  4I64 A;  4WK1 A;  1A9N B;  5D0E A;  4HHU A;  1N33 F;  2OEJ A;  2NXU A;  2XY5 A;  4YR3 A;  4AD6 A;  3L9Z A;  1WSR A;  1EZZ B;  2RRB A;  2YQ3 A;  1D9D A;  2HND A;  2JC1 A;  5K14 B;  5DDQ C;  1VQ9 S;  1IBC B;  5KFD A;  4ED5 A;  5BYR A;  5M2P A;  3B6B A;  1BQM B;  4ES2 A;  4WFY A;  2V8D A;  1WC0 A;  2W2N P;  4XDD A;  2GMJ A;  2CJK A;  3G82 B;  4MYU A;  2QMX A;  4L76 A;  1IBK J;  3MM9 B;  4LBH A;  2DD8 S;  2CQG A;  1RTH B;  5AE2 A;  5ETR A;  4PXC A;  3IS9 B;  3MTK A;  5HRO A;  4EBD A;  4UOC A;  4FF3 A;  1NO8 A;  4LF7 F;  1RT4 A;  2APO A;  2FGC A;  4B9T A;  4WWS A;  3BS9 A;  3ET6 B;  2PN6 A;  3Q24 A;  4WF9 Q;  4NLW A;  1YZ7 A;  3FBE A;  1K47 A;  1R0A B;  2QFI A;  3G71 S;  4ZPC A;  2DGQ A;  1BHN A;  3MAA A;  4ZK7 M;  4Q2M A;  4IFY B;  3R8Y A;  2XZT B;  3KHL A;  4LSN B;  3TUP A;  3MPD A;  4MKA A;  3T9N A;  1RDR A;  2FB0 A;  3LPY A;  1E6V A;  1RAO A;  2W2P P;  5J1P A;  4ERD A;  2DTJ A;  4RBT A;  3C15 B;  2XI2 A;  4OX9 F;  2KJW A;  4EYH B;  3MEE A;  5L9N A;  3BGO P;  2I1R A;  2C22 A;  1YDL A;  4B3R F;  2Z2Z A;  2VA3 A;  2FJD B;  3CUN A;  3PRD A;  2XB2 D;  5GMD A;  4H4O A;  4DLG A;  3JAM Y;  1X8D A;  2DRD A;  3BF4 A;  4CI0 B;  3R5B A;  2XMJ A;  2IJF A;  5DG8 A;  1R89 A;  1Z4U A;  5KFS A;  4ZVQ B;  4JBC A;  3VV2 B;  5A6W A;  2PO4 A;  3VAF A;  1DZ5 A;  5EWG A;  3DLH A;  2W25 A;  2W9B B;  2DNZ A;  2G9O A;  1BXN A;  5A8W B;  4CO0 A;  2XYP B;  5K8O A;  1AT1 B;  4K59 A;  4RZR A;  2V9K A;  1Y4Z B;  4PUO A;  2WSF C;  4R5P B;  4J91 A;  3A8I A;  3R1L A;  4WE1 A;  1Q79 A;  1SQF A;  3HZE A;  4URS A;  3WX8 A;  1RHR B;  1NSQ A;  3KLI A;  2QSF A;  3QT8 A;  3QT5 A;  2IC3 A;  4PCQ A;  3L7O A;  1SKU B;  2WCX A;  4OMF G;  2I6W A;  1S1X A;  1J5E J;  2HFV A;  4DR1 J;  5L1J A;  4ED7 A;  1OS5 A;  3POT A;  3G6X A;  4KHP F;  1RWU A;  4RX6 A;  3IN5 A;  3ZZO A;  1Z2L A;  3HSJ A;  3HMJ G;  4TVA B;  2J8A A;  4DX7 A;  3K5N A;  4JI7 F;  3BEG B;  4DL3 A;  5DG9 A;  4YUD A;  3FKB A;  4JV5 F;  1FHT A;  2HAI A;  1Y0H A;  2BJ9 A;  2G13 A;  1EQ0 A;  3KDN A;  3K59 A;  3C16 B;  3CGI A;  3JSB A;  4PAB A;  4UT4 A;  2K06 A;  4BS2 A;  2ZWO A;  1RT6 B;  2G1H A;  2H9Z A;  2LQ5 A;  1HMV B;  4ECT A;  1FKO A;  2CNK B;  7AT1 B;  1E6V B;  5KFR A;  4Y28 C;  1U02 A;  1GT8 A;  2XGQ A;  4KIA A;  3JYT A;  2XWX A;  1F9F A;  4FN5 A;  4KO0 B;  4KGX B;  1FTR A;  3M8Q B;  2ZZN A;  4QU6 A;  3ENA A;  2YQ0 A;  1RAE B;  1X0F A;  3K8W A;  2HFZ A;  2QV6 A;  3ZZ0 A;  1FKP A;  3IP0 A;  3GU0 A;  2DO0 A;  3PW0 A;  6AT1 B;  1NM2 A;  4PAA A;  5KT4 A;  2Y8Y A;  2DJW A;  4ZCI A;  1XMO J;  1B0P A;  1UET A;  3FMB A;  3PRV A;  4MAK A;  1R6Y A;  4C98 A;  3A3P B;  1JB0 C;  2LU1 A;  1TL4 A;  2U2F A;  1KVK A;  3JTO A;  2HHT A;  2RDD A;  4PQA A;  2F3J A;  3TUJ C;  3EXC X;  1WD6 A;  1S6Q A;  4F4W A;  4LF1 A;  4ZVF A;  2LFV A;  4TYB A;  3CDB A;  4JI1 J;  4MJK A;  1R3N A;  4ID5 B;  4DV5 F;  4LR8 A;  3LAK A;  4C4W A;  1UVK A;  4C3K A;  1X5S A;  4IO1 A;  2R8K A;  1HI1 A;  3M8P A;  1JLG B;  2IM2 A;  3QZ7 A;  3EVW A;  4A8S A;  5HL7 Q;  2YPZ A;  3U27 A;  4QBU A;  2ZWP A;  2CJB A;  5ADZ A;  3BGR B;  1SVD A;  3DCA A;  4K2X A;  4KB7 A;  2Y1J A;  3KK2 A;  1B3T A;  2ACY A;  4Y2K A;  2PMZ D;  6FD1 A;  2ZHA A;  3W63 A;  4CWB A;  5GME A;  4F2R A;  3CO9 A;  1S4E A;  1U48 A;  1VK8 A;  1DLO B;  1RHU B;  4GKK F;  4QWE A;  3W64 A;  2GGP A;  4MIA A;  3H25 A;  5CYJ A;  4GC7 A;  3EJM A;  5C24 A;  2BZ2 A;  2YNI B;  4AL6 A;  1QDU B;  1G2E A;  1KLM B;  2GAG C;  1FRH A;  5H9F K;  1N88 A;  5LJ5 Y;  2OEM A;  1TKX A;  4K2J A;  4U8Y A;  4O3Q A;  1PG5 B;  2DYA A;  3KK3 B;  3KJQ B;  3EGV A;  4U95 A;  2M3D A;  5F8H A;  3F56 A;  4FYD A;  1RWP B;  2LMI A;  4KJI A;  1X5P A;  5AE1 A;  3MFI A;  2V8H A;  3VAM A;  3GJT B;  2QYG A;  1VQY A;  1BGX T;  2R4F A;  4G65 A;  2FZC B;  4X4S A;  4Y2I A;  3T6B A;  3WIV A;  1FRK A;  1HI8 A;  3KK1 A;  2VQF F;  2JJ4 D;  3K2Y A;  3C14 A;  3Q89 A;  4XPC A;  3WIU A;  3A4T A;  3G8Q A;  3D54 A;  4JI0 J;  4OJG A;  3H40 A;  1PC4 A;  3X1L B;  2K7J A;  2DIS A;  2F5G A;  4U67 Q;  3UCG A;  3GFH A;  1N0V C;  2HYI B;  2D9P A;  4I69 A;  4OHW A;  2LQJ A;  2VUG A;  2HWI A;  3OTO J;  3HHN B;  3ILL A;  1T02 A;  2FDN A;  1XBW A;  1T7P A;  2OO4 A;  3PCO B;  1PBU A;  4RUH A;  2V68 A;  2VFR A;  2E1A A;  3GV7 B;  2HZV A;  5KFK A;  4PRF A;  4OV1 A;  2J7U A;  4WIQ A;  2J6T A;  1C4A A;  3RBE A;  2F65 A;  3O5T B;  4RW6 B;  3FRZ A;  1C1C A;  3P5B P;  4JI6 J;  2ZDP A;  3R5G A;  4WZQ A;  2IA0 A;  1KOH A;  4RNN A;  1XR5 A;  3PW5 A;  1R31 A;  3D28 A;  4ZVU B;  1DBD A;  1SV5 A;  3NBP A;  2W1B A;  4ED2 A;  1I51 B;  3MFH A;  1U1N A;  1WTF A;  3Q0A A;  2JRS A;  3DHX A;  1N36 J;  3UVJ A;  1MW7 A;  5JJB A;  3AY0 A;  5J2N B;  1HWJ A;  2WBR A;  3VAK A;  3ZTS A;  4HVZ A;  1K44 A;  4DX8 H;  2HVD A;  4OZJ A;  4ILL A;  4QQB A;  2DEI A;  5D3G B;  1WC6 A;  2GJI A;  2WRM A;  1W2B R;  2MGZ A;  1S7H A;  4NLP A;  2HWH A;  2BM1 A;  1TKZ A;  2DHA A;  3M32 B;  1GX6 A;  2ZEJ A;  1S1W B;  1Q86 T;  3H5S A;  5HMW A;  1T3N A;  1OY9 A;  4IRK A;  4WP3 A;  2EWH A;  2KRB A;  4CM0 A;  2DXD A;  5B0G A;  1RXO B;  5I3U B;  3PX0 A;  2B5J B;  4JI5 F;  3ISZ A;  1NK4 A;  1LEO A;  3VCD A;  3CUL A;  2DIT A;  3OT9 A;  2B56 A;  1UA0 A;  4GKJ F;  2XSF A;  1XNR F;  4USU A;  1QJH A;  1WKJ A;  5EX0 A;  2PEH A;  2RIJ A;  2K3K A;  1ZS6 A;  3NNH A;  1EAR A;  1RU2 A;  3I6P A;  1UA1 A;  1K1S A;  1NRK A;  1RT2 B;  1T9T A;  1O51 A;  1AW0 A;  2W9C B;  3V6K A;  3RB3 A;  4DPX A;  3DMJ A;  1IM6 A;  1ZA2 B;  2WB4 A;  3MOJ B;  3OFE A;  1RAB B;  3OXG A;  3DOK B;  2WVF A;  2HBY B;  2RT3 A;  4N5S A;  2HRT A;  3MM6 B;  5KG4 A;  3TAQ A;  2OD4 A;  2EG1 A;  3QAT A;  5T7L A;  1UW9 A;  3IG1 B;  2LCW A;  3BYP A;  5HMZ A;  3FSI A;  1KKH A;  3ZNU A;  1U2C A;  4BC7 A;  4K50 A;  4Z2X A;  3NGR A;  4CT8 A;  4I1T A;  2ZJQ Q;  4ZMM A;  3TP2 A;  4LF4 F;  4KH1 B;  2CFX A;  4DR2 F;  1NJI T;  2CKW A;  2P9C A;  2RQC A;  3FSX A;  4RW9 B;  4I2Q B;  4QPX A;  3FFI A;  5KT5 A;  4KYZ A;  3G96 A;  2GQQ A;  1SL1 A;  1Q82 T;  4OLP A;  4DV4 J;  1H73 A;  3FQK A;  1VQS A;  2CJX B;  2O3D A;  4KSE B;  1T9U A;  3SDE B;  4DBQ A;  2BAN B;  2J6S A;  4HH1 A;  2E7X A;  1EAY C;  2D69 A;  5GMK a;  2RJZ A;  4NA2 A;  2UXC J;  1QAY A;  2RSQ A;  5L39 A;  1SUQ B;  4EBC A;  1VQ7 S;  2H48 B;  4ECX A;  3PJX A;  2EK6 A;  4J9P A;  1I94 F;  2R7V A;  1WI6 A;  2UVW A;  3A1Y G;  3DNC A;  1M5P C;  2NQP A;  2PSZ A;  3CDW A;  2XZW A;  5JMN A;  4RU9 A;  2HMI A;  3V4I A;  4P2F A;  4M94 A;  3HT3 A;  3KNA A;  4PXD A;  4MK9 A;  5SUH A;  4DSJ A;  2ZH6 A;  5IC4 B;  4J9Q A;  2CDR B;  2EG2 A;  2YKN B;  2AWZ A;  5KG7 A;  3K0J A;  1ZZN A;  1FA0 A;  1HWK A;  1IKW B;  1DTQ B;  2WVB A;  4CCH A;  3N6M A;  3PTW A;  4CNY A;  4ER8 A;  1U45 A;  3O1L A;  3DOL A;  2CZ4 A;  2QTW A;  4HT7 A;  2E1C A;  2D3O 1;  4IDK A;  2ZM6 F;  2OGU A;  3M2R A;  4FYY B;  5C2C A;  2B51 A;  2OPR A;  2K2P A;  4WU3 A;  1RTD A;  1IKX A;  2IYI A;  1HNV B;  4B3T F;  1B4S A;  4Y65 A;  4FP9 A;  3BGU A;  3KKF A;  4BC9 A;  3FCW A;  3BM7 A;  2RDI A;  4NLD A;  1RWO B;  3IAS 9;  4X62 F;  3FFI B;  2DNP A;  4OZ1 A;  1D9A A;  2CQI A;  2UUC F;  3SEO A;  3NAI A;  2DR5 A;  1JNR B;  1RA6 A;  3A13 A;  1HWI A;  4DCO B;  1X4H A;  2VC0 A;  4MH8 A;  2E66 A;  3IXQ A;  3NOC A;  1KON A;  1RT3 B;  3MXH P;  2CQ1 A;  3DLE A;  3UO0 A;  3HPO A;  2CVE A;  2W7O A;  4DV0 F;  1K8A T;  1RP5 A;  4G1Q B;  1HNI A;  1REV A;  4PPZ A;  3A8J A;  1RWX B;  1ZPW X;  2MJU A;  2GMH A;  2R8G A;  3MMB A;  4C11 B;  2OPP B;  2AJF E;  2QLF B;  1JXL A;  2DXE A;  2AU0 A;  2Z0G A;  1P6T A;  2EXU A;  1RIS A;  1C1B A;  3TA1 A;  4UUX A;  1KOO A;  3CC4 S;  4WXW A;  3I87 A;  4HI2 A;  1L3S A;  2OLW A;  2R2U A;  4K4Y A;  2U1A A;  5J1E A;  5BXI A;  1Q0N A;  1T05 A;  3WC0 A;  1RTJ B;  3D6T B;  5KFE A;  4IRC A;  5BJR A;  3M30 A;  4OX8 A;  1NCL A;  4UW2 A;  1X4B A;  1SH2 A;  3LGN A;  3TVK A;  4OI2 A;  3CVK A;  5E0O A;  4O23 A;  1RI7 A;  4MKY A;  2JVO A;  3CJ3 A;  4NCG A;  1CSJ A;  3QWU A;  4YEA A;  2GQ2 A;  4C0O C;  1TL3 A;  1QM9 A;  4GO5 X;  4ZCM A;  3QAE A;  3BO4 A;  1QE1 B;  1V5V A;  1WHX A;  1NK6 A;  3OVS A;  3UDL A;  3VAG A;  4FZV A;  4PWD B;  3VAL A;  1WUU A;  2RRA A;  3FCV A;  3VZH A;  1D9F A;  1HW8 A;  4NAS A;  3TAM B;  2JLF A;  2G0I A;  2AP6 A;  2V4J B;  2JFK A;  1XNQ J;  3THP A;  5ETQ A;  2MQM A;  2RU3 A;  2ZNY A;  4WKR A;  4L74 A;  5J2Q A;  3NS6 A;  1T03 B;  2PDA A;  4J7C A;  4R25 A;  5A8R A;  1D8Y A;  2OTL S;  3CF5 Q;  5H9E J;  1U0H A;  2A3J A;  5LL6 d;  4PZV A;  4JYA J;  2GV1 A;  2W2Q P;  1TFW A;  2FUG 9;  1H0H B;  1REV B;  5E33 A;  1RKI A;  1UWA A;  2DH9 A;  3I9Z A;  3MMJ A;  2RRN A;  1FDB A;  3H42 A;  5ETT A;  1DY3 A;  3QIP A;  2LU2 A;  4OI3 A;  1UVM A;  3M7V A;  2XM3 A;  5IM0 A;  1E6Y A;  4FXD A;  1FI4 A;  2ZOG A;  4OV6 A;  4DPW A;  2HPU A;  3FMW A;  2GVZ A;  3MPW A;  2YVS A;  4PG8 A;  4DSF A;  3LAN A;  3KLG B;  3BSN A;  3N01 A;  4PXB A;  2KVQ E;  2YX4 A;  1O8B A;  3PAC A;  1TL7 A;  4O0I A;  2UXB F;  4ANE A;  1FFG B;  1EP4 B;  1TUV A;  3L7P A;  4ZJL A;  4RU2 A;  4RW7 A;  2YNG A;  5HSP A;  2HNY A;  1FF2 A;  2UXD J;  1S48 A;  2ZH5 A;  1ZAV A;  1NKE A;  1IM4 A;  3L4B C;  2HEK A;  1N56 A;  1KC8 T;  1REG X;  2EBE A;  1KLN A;  2NLW A;  4KRW A;  4YHH F;  5EGY A;  2LEA A;  3W2V B;  2VH7 A;  2EFV A;  2BOA A;  1SKR A;  1GFW B;  5KFP A;  3IRW P;  1VBK A;  2V67 A;  3LO3 A;  4LF8 J;  4QIF A;  3T41 A;  3V6D A;  3EGZ A;  5IC6 B;  2R7X A;  3MM7 B;  2KH9 A;  2LA6 A;  4ECQ A;  3NLC A;  2CQD A;  5G0R B;  3MED B;  3GE9 A;  4LRD A;  1U6B A;  2QN6 B;  4AE5 A;  1TUW A;  1S1T B;  4DR6 J;  3GII A;  1VQP S;  3OV7 A;  4M8L A;  4I68 A;  2HHP A;  2BQR A;  4U7U D;  1BUX A;  1VJQ A;  1OPI A;  2FY8 A;  5K8P A;  3JQK A;  2VFV A;  4J9L A;  2RAQ A;  3OR1 B;  4OI1 A;  2GHV C;  2YX1 A;  2WON A;  2BV3 A;  4P7V A;  3TEH B;  2FHO B;  1RTI A;  3HSZ A;  3GR0 A;  2ROG A;  1S99 A;  1YBU A;  1ZTW A;  4B9U A; 
#chains in the Genus database with same CATH homology
 1TMJ A;  2QX0 A;  1EQM A;  3HSJ A;  3ILI A;  4M5J A;  3MCO A;  3HD1 A;  2F65 A;  1F9H A;  5ETR A;  4CRJ A;  3ILO A;  3HCX A;  4F7V A;  2BMB A;  1IM6 A;  2CG8 A;  3HD2 A;  4M5L A;  4M5K A;  4M5I A;  3UD5 A;  1RU2 A;  4M5H A;  3MCM A;  4M5M A;  5ETV A;  3KUG A;  1RTZ A;  1HQ2 A;  5ETK A;  3UDV A;  4AD6 A;  4CYU B;  3HSZ A;  1RU1 A;  4M5G A;  5ETQ A;  5ETM A;  5ETN A;  5ETT A;  5ETL A;  4PZV A;  5ETS A;  3HSG A;  2F63 A;  1TMM A;  1HKA A;  3MCN A;  1DY3 A;  5ETP A;  1KBR A;  3HSD A;  3IP0 A;  3KUE A;  1EQ0 A;  1EX8 A;  3ILL A;  5ETO A;  1RB0 A;  3ILJ A;  3KUH A;  1G4C A;  1RAO A;  3UDE A;  3QBC A;  4CYU A;  3HT0 A;  1CBK A;  4M5N A;  4CWB A;  1Q0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...