3MPDA

Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi, cubic form, apo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
147
structure length
147
Chain Sequence
MERTFIMIKPDAIKRRLISRIIQRFEEKGLYLAASKCVIPKREVLETHYSHLSSMPFFSEMVEDMMSGMVLAMVWVGKDAVSIGRKLIGETNPQAASVGTIRGDYGVSTGKNIIHGSDCVENAEKEIKLWIGDDVQPVSFFDKEWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi
rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 45
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3mpdA00
4W98A 4CP5A 4F36A 4UOHA 1KDNA 2DXFA 3Q89A 4FKXA 3NGRA 4HR2A 3EE3A 1PKUA 3VGSA 1HLWA 1WKKA 4ANEA 4ANCA 1NDKA 1NUEA 3EVOA 1LWXA 3VGVA 3BBFA 4UOFA 3VGUA 3JS9A 2NCKL 1S59A 3EM1A 4ENOA 1S5ZA 3WX8A 1F3FA 1EHWA 5C7PA 4KPCA 1K44A 2DXEA 4DZ6A 1HHQA 4EK2A 1NB2A 2BEFA 1NDCA 3MPDA 2DY9A 1ZS6A 2B8QA 2AZ1A 3ZTSA 3ZTPA 3NGSA 3Q86A 4O0NA 1B4SA 3FC9A 5CABA 2ZUAA 1NCLA 3Q8UA 1F6TA 1HIYA 3EVMA 3ZTOA 3B6BA 3B54A 2HURA 4F4AA 1WKJA 3VGTA 2HVDA 1NSPA 3EICA 3FBBA 1PAEX 3DKDA 3Q8YA 4UOGA 2DXDA 1NLKL 3DDIA 3FCVA 1JXVA 2VU5A 1BHNA 3BH7B 3BH6B 1U8WA 3BBBA 3FCWA 3GP9A 3L7UA 1BUXA 1NDPA 3EMTA 3PRVA 3Q83A 1XQIA 3ZTQA 1S57A 1XIQA 1VYAA 1NSQA 2BX6A 5IOLA 3ELHA 1BE4A 3ETMA 4DI6A 3VVTA 3R9LA 3FBFA 2CWKA 3EJMA 3ENAA 4C6AA 4S0MA 1MN7A 3BBCA 5BXIA 1NPKA 1UCNA 3G2XA 4WBFA 3ZTRA 1W7WA 1NDLA 1WKLA 4ANDA 3EVWA 4FKYA 2DYAA 4DUTA 1NHKL 3Q8VA 3GPAA 1LEOA 3VVUA 3FBEA 2AZ3A 3PJ9A 3FBCA 1MN9A 1B99A 2B8PA 3NGUA 5CAAA 3NGTA 3FKBA 1NSKL 2HVEA
chains in the Genus database with same CATH superfamily
4U95A 1JLCB 2C2OB 2YPZA 4QIFA 3EXYA 3MEDB 1SKUB 2VG7B 2HHQA 1RT2A 3MEGA 4IR9A 1UVNA 3T6BA 3OTOF 4NLTA 5KFWA 1I3OB 3LP0A 3QIDA 3H2UB 5D15A 5U47A 5HROA 5AE3A 1N56A 2LXUA 4WZMA 3HZGA 4X64J 4O3NA 1HI8A 1GTEA 5IS2A 5ADZA 3CVKA 3IAS9 4UOFA 5DQIA 2WB1D 4ZVPB 5K8OA 2JVOA 3MUMP 5HMXA 2WVCA 5A2QY 3N6LA 1DFDA 2K8GA 2VQEJ 1PC5A 2BJ3A 3MEGB 1FDDA 1NJXA 1H2TZ 1VQ8S 2PA8D 4PXBA 3PDNA 2PEBA 2YY3A 3HULA 1WORA 3UWTA 4F0MA 2MGZB 2M0GB 3MPDA 2MQPA 5GAHU 5F8MA 4B9NA 2FZCB 1X4AA 2MZRA 3DHXA 3UDLA 1JXLA 4DQRA 3D0HE 3ISZA 4TYAA 2VA2A 4QYZK 3I5BA 2WOMA 2VV5A 3NGSA 4NLXA 1BY9A 2BDPA 4NLVA 1RA7A 1S9GA 2GFFA 2DH7A 1JLFB 3CIZA 3PEJA 4LSNA 1KC8T 1WEYA 1HQEB 4Y28C 2HG4A 2DR9A 3ZO7A 4OX8A 1KRPA 3HX9A 1T8EA 1NBEB 1S97A 1UKUA 1MROB 1U0HB 3NBPB 3GSIA 1RWVB 1ZM9A 3P96A 4P2XA 5HBMA 4ZHRA 2XY6A 1PAEX 1NJYA 2HKEA 5KT7A 1TV6B 4CO1A 2HNDB 2UUCJ 4DMZA 4GKJF 1A0OB 2IMOA 2OPRB 3KLHA 3NG8A 3NCQA 3GJTB 3PTWA 1SBRA 3TZXA 4ECVA 1U6ZA 2IAJA 2EFGA 2ZOMA 2CQ0A 4CH1A 1N5YB 2UV8A 4FF3A 5KT4A 5KFIA 2QLFB 4NLWA 5A76A 1CJKB 4WXWA 5G0RA 4AQYJ 4J9VA 3EZUA 5G4DA 4J9OA 3ILIA 4KV8B 2XO7A 3Q2SC 2CRLA 4CT8A 1VBZA 2AWZA 3C14A 2HNZB 1FT8A 4Z37A 5SZTA 1VBKA 3VAMA 3PW2A 4L3NA 2IBOA 1WI8A 1WHXA 4LSLB 2R7QA 1X5TA 2F40A 3MMJA 4GVLA 2AIRB 5FLXU 4M5HA 4FF2A 3KG0A 3MCMA 2B4PA 2J5AA 4EYHB 2ASJA 3QRPA 5KOWA 3KXDA 4OI1A 2Z8QA 2YX4A 3PXGa 5A0YA 3KMQA 1LW0B 1SQEA 1R6VA 3DGPB 3NEKA 4RO0A 4C3MA 4PYAA 4CIOA 3RR8A 5E3QA 5KG5A 3R1LA 1RSCA 2M70A 5HQLA 4DPTA 2DH8A 2PD1A 3HFKA 3DI6A 4ILRA 1X4BA 1UCNA 4KAIA 2V94A 4CM2A 1YDLA 3V81B 4YFUA 2W8KA 1AW0A 2B43A 1VQ4S 4AE5A 2G4BA 4OZ1A 2EKYA 4KFBA 3TAMB 3PFEA 4C0HA 3KK2B 3M8SA 2UXBJ 2CQCA 3QMQA 4WIQA 2WBMA 4AFFA 2DYAA 3KWMA 2BJ7A 3Q8VA 5A8RA 3AJ1A 3CDUA 5C25A 3VAKA 1UVJA 4A8MP 1NRKA 2BMBA 1YRTA 5EHHA 3A8KA 3US5A 5DG9A 2B8PA 5GADU 2NQPA 1BD6A 2DVIA 3MM7B 3DRSA 4X65F 1T0TV 2JOQA 1TR0A 2LXFA 3CD0A 1AZSA 4Y65A 3Q8QB 4LRFA 2DHXA 2B9WA 3W2WB 2VBWA 3OTDA 2GVZB 1QY7A 3JTNA 2AV5A 2VZ9A 4OIXA 4USTA 5RUBA 1RE1B 1H7XA 4NWBA 5E3CA 3KJVA 4ECTA 3T1YJ 3GCWP 2BQUA 2UP1A 4C8NA 1ZM4A 5KFNA 2J6TA 1UL3A 1Q8KA 4QIEA 1OMSA 2QRRA 2BE9B 1BWVA 2CXEA 4CCHA 4F4XA 4A8SA 2HHTA 2ZH3A 2DBBA 1WF0A 2KXHA 2A6OA 3CMES 3AD8C 2ROGA 3GG1A 1S5ZA 2H4WB 2OIHA 3AQPA 1U2CA 3TZYA 5C7PA 1QSSA 3DDNA 4GKKJ 2C2DA 3SZ2A 3EXCX 4I2QB 5AXMA 3OFGA 2JEIA 2LU1A 3M8PA 2HWIA 4ICLB 4DWIA 2A18A 3ICLA 3MWBA 4AXIA 4RZRA 4CTAA 1EIYB 2IY5B 5IT9Y 3ZTSA 1RKJA 2M5YA 2RKIB 5KFKA 3EYZA 4PABA 3DXBA 2IMWP 4DU8A 4H4MA 3WHIA 2ASYA 5FD1A 3NLCA 4IH6A 3W9IA 4PG6A 5LSLA 4ECXA 2JVRA 2CG8A 4PEOA 1UFWA 2SXLA 4CLYA 3CCRS 3V6DB 5I4MA 3CJKA 1SC6A 3KFWX 4P10A 3WDOA 1IQTA 4NLRA 4F67A 3PW0A 4JBCA 4NA2A 1KVKA 4ECSA 1CJUB 1Y9OA 3SSRA 4I67A 1NLKL 2IYGA 3TJ9A 4JI3F 4KO0A 3VF0B 4HACB 1N36J 4QW8A 1WJ9A 4CO0A 3CPWR 1ZM3A 1RTIB 4YMEA 3FSIA 1C4AA 3KOAA 3IR7B 5B0CA 2D3OR 1N5TA 1TTHB 1N5SA 4BC7A 1IBLJ 2YNHB 3DGVA 4K4YA 4LF5F 1DURA 1LWCB 2ZHBA 2XC9A 2ZH1A 1F5CA 4DEZA 4KHMA 1R0AB 3HHDA 4PZVA 5KG7A 3TAPA 2VJUA 1GMUA 1S1VB 4M5JA 1ITPA 3UFCX 1EP4B 4RWXA 3O44A 1S57A 2ZEJA 4OLOA 4QWDA 3MFHA 4ZCKA 3DRPA 3R1HA 5ETKA 2IRUA 1HYSB 3QSIA 3ENVA 1AA1B 4ZP8A 4USWA 5C42A 3UNYA 2V5HG 2KG1A 5D8HB 1XNRF 5IT4A 1FTCA 4DS4A 1Q5VA 4ZK7M 4C11A 3T5JA 3GJQB 3R9LA 4O4RA 5EWEA 1YX2A 1S9FA 2YQ1A 4JV1A 2VKZG 3X1LB 5HBMB 2BM1A 2ZH8A 3QRRA 3DLBA 2XLJA 2BACA 5BXIA 1NK6A 5HLFB 2GMHA 2FC9A 3C15B 1LV5A 1V6HA 2YBVA 4P75A 3THTA 4ED8A 3D3CJ 3RBXA 1F9EB 2DD8S 1ZPWX 3HHLB 1RT5A 4OFZA 2YWHA 5KFVA 3VAIA 1Q7YT 4DQIA 3MR6A 4FXWA 1IR1A 2UVVA 2QA1A 3DU5A 4OI6A 3UD5A 2E1RA 1QTNB 1TL7A 2HQFA 1NJZA 3HI9A 3DFEA 3S6EA 5ETVA 3VQSA 1GMWA 3D1OA 2CJKA 2CVIA 1JLQA 3D6FB 3KJQB 4P6QA 4ZPBA 1VC0A 3NGUA 1FNXH 2XMWA 4ED1A 4B08A 2B4VA 3IXQA 5LJ5Y 3KTQA 3HSDA 4Y00A 4CWBA 1CLFA 3ZC4A 1HBNB 1XWLA 2GNKA 1HWJA 2CQ3A 2P6SA 3A8EA 2V8PA 3C6TB 3W1YC 2L41A 1KFDA 3UD4P 3CGIA 3HDSA 2Z57B 5DM7Q 2QLJB 4OMFG 4ZPWR 3MI7X 3VAFA 1TUVA 4IH7A 4QIWD 4IDKB 2MPUA 4LF2A 1EX8A 4ANEA 5DDPC 1WHYA 3HVWA 3EVOA 3J81Y 1KP6A 1JXEA 1UZHA 4Q5VA 2ZJQQ 5FJ4A 1HR0F 1JIHA 3JS9A 2NCKL 3W61A 4F3MA 1WC6A 3GYGA 1WC5A 2ILYA 5GAGI 2XI2A 4X4QA 2OKQA 4FYWB 2PGCA 2FY1A 4DLGA 2VC1A 1PYTA 3UPFA 4IR1A 3LAKA 1E6YB 3I0RA 4OL8A 2F4FA 3S7RA 1JLAA 1QSYA 1PC4A 1KR4A 2DRBA 3TQEA 3UR0A 1VQMS 5HVGA 1Y4ZB 1SH2A 3OT9A 4DV5F 2AD9A 3BJYA 2DGUA 4OZLA 3RB4A 4B3SJ 1NNDA 5DJBA 3C66A 4WP8A 4JP8A 1OS5A 1PO6A 1AZSB 1BLUA 3K7RA 2E1MC 3H40A 4DV3J 1JMTA 1P27B 2WVEA 3W5YA 3HK2A 4CNYA 1F6TA 4X62F 4U7UK 1FK9B 4DUZF 7AT1B 3DOMB 4F4YA 5E0OA 4H4MB 4RW9B 4USUA 1XTZA 3HHLD 2YNFB 4ZPCA 5LMUF 4FYDA 2OUGA 1YJUA 3LP2B 2PA3A 5HJXA 5A2QU 3AOAA 4C8OA 4JV2A 3G9CA 3BGFA 4UTGA 1HKAA 3UCUP 1FEHA 2XMUA 5DGBA 2IVMA 2YKNB 2DGTA 2AP6A 4YEAA 3T5HA 2HPUA 2CG4A 4KC5A 4U9RA 3TOQA 5H9EJ 1ZTTA 3GLJA 3UN5A 3BH6B 4NXMF 1J5OA 2I38A 1MW7A 3KLGA 3D0GE 3RBZA 4C2MA 1JKHB 3GIRA 1KTVA 3F41A 4ZIWA 1XMQF 5DDRC 2YPYA 2BKNA 3HD1A 2K3KA 3FMBA 2YNFA 2V50A 3VWSA 2IBKA 3HKWA 4ID5B 4DR4J 2DGOA 2JL9A 4DCPB 4LF8J 1Q8BA 1NXIA 3E2EA 3CW2C 1MSWD 3Q83A 4QYRA 5DGAA 2X1FA 5KFPA 1M0SA 4YB1P 2IA6A 4A8FA 3T1HF 4TU8A 4KT0C 3R2CJ 4JYAJ 5EX0A 1PYSB 4JI6F 5F3ZA 3KHHA 3BGLA 4JI5J 4K0KF 4IOAQ 1VYAA 4TKTA 1HARA 4FNIA 3MR2A 3RUBL 3F0NA 4WTOB 5CD4A 3MCSA 3UVJB 1C4CA 4CYUB 3LP1B 1AXQA 4F2RA 5ETSA 1T7PA 4O3RA 3QLHB 2HGLA 2EK1A 3FBFA 1XN9A 2C3UA 2XHCA 3A13A 4O4GB 3HVTB 4GC6A 1O0PA 3MM6A 4O3QA 1ULRA 4OX9F 1MMDA 3PNIA 2R2SA 2ZBRA 1MU2B 2UXCJ 4YOEA 3BBCA 2VBXA 4DV1F 1NPKA 2I1RA 3U1LA 4M5KA 1Q53A 3POTA 4HH1A 3X3UA 1B3TA 2IYIA 4LFAJ 2HEKA 2QC3A 4HHUA 4NOHA 2NR0A 3LP1A 1NKBA 4B3MF 2EPIA 3EVWA 3ITHA 3DRXA 4DV7J 3G6XA 5KG2A 4ZLNA 2FJVA 1F9HA 4QIVA 2EG2A 1HL6A 2D3ZA 3DMJA 4DV0J 2W9BA 2R8IA 1JQGA 1TKDA 1CQMA 1R8BA 4X4VA 1VOMA 3GR0A 1SV5B 2MQOA 1EP4A 1S72S 5D4PA 4KHPF 4NZ6A 4F8RA 1KLNA 3CTRA 1OPZA 3DRPB 1S10A 1VK8A 5D77A 2H5JB 4KE5A 1KDNA 3OHAA 4DFMA 2OEMA 1VRTB 4ZVEA 1L3KA 2NXNA 3G82B 2VIHA 2YXLA 2LQJA 5A8WB 2ZVIA 2Z56B 1Y3JA 1CSJA 1H3DA 4NI2A 1NUEA 1X4CA 4YR3A 3CJ5A 2YWFA 3C19A 3MURP 3TUPA 1HFEL 2ADBA 4EO6A 4BDPA 2A10A 2GQCA 2ZKTA 2MGZA 1AYEA 2I8EA 4NLOA 4NL5A 4WK1A 1OJ4A 2Y1JA 3CC4S 1X0PA 2UUBJ 4RWWA 3OUYB 2O66A 2CNKB 1NJWA 2HZAA 1S0MA 1M5PC 4PQAA 1RT5B 5IC4B 1RT6A 2V4JA 2QFIA 1VHFA 2KFZA 1U02A 1QE1A 4KKOA 1RAFB 4NX9A 4QPTA 2DY9A 4TU7A 5A8KA 3MM5B 5BR8J 1HQEA 3V6KA 4CLSA 3CJ4A 3PYFA 2NYHA 2HQGA 3FFIA 4RUHA 2DGWA 3I5AA 4MTPA 3P4UB 2PEHA 3OTCA 3AA9A 3Q86A 3I96A 2WZ1A 2QYGA 1X31C 3L09A 2DK2A 3W2VA 2DNZA 3ISNC 2DGVA 5C2CA 2OPSB 5K8MA 1S76D 4WZQA 2PIIA 1RBLA 3N79A 1HNXF 3M4XA 2AYGA 3ILLA 1C0UA 4RL1A 2EXUA 1NK9A 3DOKA 3HPOA 1TKXB 2ACYA 4ZVTB 1U2RA 3D0IE 2UUTA 2VC0A 2BRLA 4HI1A 5B0AA 4JUZA 3PEHA 2ZJRQ 1N5VA 2ZNZA 5KG1A 3C6UA 5F41A 4CDIA 1GXLA 5KOXA 1RAHB 1NPPA 1N5QA 4IYQA 1WEXA 3EDQB 4PR6A 3IWLA 5DLFA 2G0JA 3MMBA 3T19A 4B9UA 2J7UA 4OYAA 2GV1A 1NSAA 2V8HA 1NZAA 5BJRA 5AXNA 4I64A 5KT6A 1KD1T 3A3OB 4NRTA 3K58A 1K0TA 4DQSA 4HHHA 1EKRA 4USMA 2EEYA 2AYMA 2VF3A 2ZDOA 3BBBA 3CDEA 3AODA 3FCWA 4CM0A 4FS2A 2GX8A 3BGRA 4OZJA 4Q43A 1I1GA 1FHTA 3HFZB 4IUFA 1WI6A 1RAOA 4JI8F 3W2WA 2OEKA 4TY8A 4IO9Q 1RK8A 1FKPA 1RKIA 3RYLA 2MDAA 3M6XA 3KJVB 2W24A 3OL7A 2XQCA 4J7CA 2RE1A 3K17A 1OY8A 4LFCJ 3FCHA 2UUBF 2M88A 4RW6B 4IG3A 3O1LA 4B17A 1FCAA 1RWOB 2CQ4A 2PMZD 4ZLLA 4URSA 3CT9A 3TYTA 1RTHB 3LPEA 5AT1B 3D4JA 4FYYB 2KXFA 3SXLA 4DI6A 4CZCA 2FJAB 2XWYA 4ZVFA 4U7UD 1FESA 1GTHA 4MYTA 3SCJE 4RW9A 2OELA 4BCAA 2KFYA 3M8RA 1SC3B 3D68A 2XCPA 1VGYA 4IFVB 2K06A 1RAIB 4PAAA 2QLWA 1PGZA 3GWCA 4F25A 1KSPA 2MKCA 4I2QA 2DEJA 4IFYA 2M8HA 1YJNS 1S0OA 3M2UA 4Q0BB 4O0IA 3G6VA 2RQCA 4DV6F 2HHHF 4WE1A 4F4KA 3OSPA 4DR7J 5F8NA 1FERA 4K8RA 3GMGA 2WCXA 1RHKB 3GILA 1J5OB 3KDOA 1NHKL 2DGSA 4MIAA 3E8OA 5F8IA 1U1LA 1IKXB 5CD4H 3KLGB 4B3RJ 2P6TA 2DIUA 5AJ3J 1RHRB 2VBZA 3ETOA 1YZ6A 3BYRA 3G86A 3SYZA 1LW2B 4DR5J 3KLIA 4K4VA 3LPYA 4NXNF 2W2PP 1ZBTA 2ZBIA 1S1WA 3ITHB 4ID5A 5M2RA 1NMEB 1S48A 4P2FA 3SV4A 2Y1IA 2HMIA 3MZIA 4R0EA 2D3UA 3DNCA 4DR1J 1U25A 5I42B 4X4TA 5KFTA 2OPPA 4DV1J 4DQPA 4CYUA 4F0HA 1IKXA 3W63A 2R7OA 2M7SA 3OXLA 4OX9J 2NSBA 2H51B 2L9DA 3UVJA 3RB0A 4IRCA 2RF2B 3R8YA 3KLIB 5F3TA 4Z7CA 4R25A 4OI0A 2F9DA 4ED4A 5A0YB 3HVRA 2O5DA 3TVZA 3SCLE 4EZ9A 2ZDPA 2BABA 4BWMA 1KHVA 3PYGA 1ZZFA 4OYMA 1MG7A 4MK9A 3H4BA 1HBMB 3BS9A 3HO1A 3G87A 2FHOB 2I0XA 1VRQC 4RU9A 2EG1A 4RU2A 4J5OA 4LF7F 1DLOB 2JH3A 3OR1A 1RACB 4MIWA 3W66A 5B08A 4W90B 2UXDJ 2AZ1A 4OI3A 5E3AA 2C3OA 4XTTA 5EGYA 4XPCA 3MF5A 4CLTA 2NPIA 2OLWA 1JNRB 2QMUB 4CLLA 3GV7B 4N5SA 1ZYQA 4JI4F 4X4NA 2DNYA 1X4HA 1A6LA 3GFXA 3M6WA 5B0FA 2AEJA 1A7GE 1GX6A 4C8MA 3HHEA 4V19X 2FVPA 4NE9C 3EZOA 1K73T 3H59A 4DSKA 1YLXA 1KOOA 1IJFB 2C3PA 2IM2A 4RNOA 1FNOA 2J9DE 3DKDA 3IRWP 3DN9A 2DRDA 4ED7A 1KN6A 1LFPA 2MZJA 2OPSA 1C1CB 2GZOA 2HS0A 5C24A 1RUSA 4ED5A 1N33J 4RW4B 3QO9B 1EETA 4K5RA 5DM6Q 4DV3F 3HXMA 3M9MB 3OR2B 4UT4A 3D7SB 1SUQB 3E01A 4Y2IA 3OL6A 1U47A 2K7JA 4OLPA 5M2UA 3QT6A 1XERA 2DHHA 4ES3A 2HLTA 2COLA 1X9MA 2BOPA 4K2XA 2JLEA 5C42B 1CBKA 2JRSA 3MMBB 3HJFA 2ZWPA 2DNOA 3CO0P 3C3LA 3HD2A 3PV8A 1WOSA 4N47A 1N32F 5B0EA 3MEDA 2HHVA 1A9NB 2VL1A 3HJVA 3M8QB 4YHHJ 2LECA 1IBCB 4U7CA 1T3NA 1RABB 4RPFA 2FVQA 2KM8C 3WQPA 2B9EA 3ELHA 2IJNA 2R4FA 4BHQA 4K4ZA 1Q8IA 1YJTA 5KT2A 2ZH4A 1R27B 3SSQA 5J2NA 3FEXB 5LMNJ 4ZP9A 1VQNS 3HHNB 5KFXA 3ENAA 3R2DJ 3AB2B 3RRGA 1N88A 2E66A 2RILA 3C6UB 3CO9A 1S0NA 2O3DA 4Z7YA 3J7YI 2HIYA 4BC9A 2KYXA 4I7FA 4A8XA 3MR5A 3R7SB 2OH2A 4C0BA 1RYSA 3VZHA 3G6ES 2PFDA 2JEFA 4H54A 3R5BA 3THPA 4GMKA 1B70B 1H72C 4FPRA 2F9JA 2DISA 3T9ZA 1VBYA 1J5EF 3HP6A 1CEZA 5GAHI 1RT2B 1WC0A 2F7VA 2MZQA 1DRZA 2QX0A 3H5YA 5B7WA 4DPWA 2B4OA 2KT3A 4CLZA 3HHLC 2X1BA 4CO2A 4J9PA 4X4OA 3J7A1 3IA0A 3IM9A 4AT1B 3RU0A 1N54B 3BN7A 4UQTA 1G6BA 2V2ZA 1FX4A 3L7PA 4QWEA 2OMOA 3EE3A 1D8YA 4DPYA 4ZHRB 3VV2B 5JXSA 2NREA 3HCXA 4YR2A 2YNIA 3BF4A 4L72B 2B5JA 1V3ZA 2V6AA 3RZAA 3MUVP 4X2BA 1UMJA 3P5BP 4NMLA 5KG3A 2OPRA 3J80Y 3RAXA 2BZ2A 2IIHA 4C11B 1RHQB 2DITA 4MIBA 1JLAB 2JLFA 5J1EB 2FLLA 1QM9A 4YR0A 1TAQA 3NNHA 1WUUA 1SXLA 2HQCA 1YGYA 4KQZA 2Z4PA 5IC6B 2RRNA 4PPDA 4MJKA 4QBUA 2DXEA 2C3MA 3IWXA 2ERRA 2E5LF 1QLNA 3OFHA 1HI0P 2VFVA 4CQ1A 4TYBA 3C46A 3FVYA 2XSJB 2IPOB 5KFQA 2GO9A 3M32B 1GAOA 1LWFB 1R8AA 2DNHA 1UPPA 2LP4A 2YKQA 3LW5C 2R9LA 3QGGA 3QT8A 5D4NA 2E29A 4M5MA 4F04B 3RB3A 2OFGX 1KS2A 2ZBPA 1IBLF 5GAGU 2NZ4A 2IJRA 5D3GA 5AJ3F 4KHPJ 4U8VA 4KH0B 2VG6A 3MEEB 1B7YB 1N34J 4TLRA 1HIYA 1RT7A 3ZTOA 2KM8B 3LWLA 1B0PA 1FWLA 1NK0A 1ZETA 3BSCA 2DNRA 4ED2A 4YP3A 1NSPA 2R7WA 3A3NB 3ZZPA 1R6YA 3NOGA 4H4OB 3WIVA 1JKHA 3KLVA 1DBDA 4DPOA 4WF9Q 2IA0A 4LIWA 2HQDA 2QIFA 3IFEA 4OHXA 1O8BA 4OI2A 1RWMB 4PWUA 3BDPA 4QWAA 1RJJA 1BHNA 4LFAF 3CJ2A 5CYMA 1S1TB 2J8AA 1GMVA 4I6WA 1FRMA 5KG6A 1U8WA 5IM0B 2WTFA 2AJ4A 2W2OP 4OZ5A 1SQGA 3LWMA 4PRFA 1W26A 5DDQC 1RAEB 3G8QA 3SFUA 4DSFA 4NLGA 2JX2A 1AROP 3OR1B 3MM7A 2ZH7A 2HQ3A 1SJ3P 3U7JA 2HAIA 5BYSA 2JZ5A 4LBPA 1PJ6A 1YJVA 5KFOA 2J6SA 1DLOA 3OVAA 2GGPB 1WWHA 4EBCA 1TFYA 1S1TA 4KY3A 2B51A 4PG4A 5DETA 1O51A 2OGUA 1OWXA 4PG5A 2YH1A 3OBIA 3K2YA 3P3DA 1VBXA 1VCTA 4K0KJ 4A47A 1SVDA 3Q0AA 1RWUA 2IJFA 4GVBA 2E9TA 3ENWA 3KJFB 1RCXB 2OEJA 2QO3A 2PSZA 3CDBA 3W8PA 4KBIA 2UVWA 2ZKUA 4IOBA 2KL8A 3BSOA 4LF8F 2CWKA 4NA1A 3TA1A 1SPBP 3LUYA 4MKAA 4KSEB 2ZM6F 3IO1A 5L1LA 3OHBA 2KVIA 1I5OB 4FYXB 4Y34A 4YHHF 4CLUA 2DB1A 4WFZA 3TRGA 1U1PA 4KGXB 1IKWA 4ECQA 3QRQA 4DL0C 4G1QA 4KR0B 1XEZA 2BJEA 1I6JA 2I5JA 1QVFR 4M94A 2Z2MA 1LEOA 4K2JA 5G0RB 3UE2A 1LXJA 4FP9A 1J5EJ 3Q24A 1NK7A 4V1Ak 5KFSA 5I3PA 4ATNA 5B09A 4DUZJ 1RTZA 2HS4A 2YKAA 4WTYA 3K5LA 1TFWA 4X62J 3HM9A 1VFJA 3RBDA 4W98A 2W25A 1U48A 2PDAA 3I6PA 1U1MA 4Y2AA 1SC4B 3FZBA 3DRRA 2R7XA 4HVZA 1SQFA 3K8WA 3ZXWA 2CZVC 4XDDA 5BR8F 2WBRA 2HRYA 2WSCC 4L74A 4I56A 2VFRA 5LMNF 1YITS 3NL0A 4NCAA 2HBYB 3M1VB 1FTRA 1NKEA 3MPUB 4ILMA 2B0GA 1T9UA 1LWXA 1DTTA 1LW0A 1BQMA 1S49A 3CMQA 3D67A 2XMMA 3DGPA 3W8GA 5BYRA 1UA1A 2J0WA 2BYCA 2XZWA 4IG0B 1VHIA 1N32J 4J9QA 2WONA 3M2VA 2HBQB 4OQJA 1R8HA 1NB7A 2CPHA 4NLQA 3WX8A 1Q5YA 3KUGA 4ZCMA 5M2PA 2ZM6J 2DHSA 3BPSP 2ZH2A 3K5OA 2UXDF 3BR8A 1X5PA 4OYOA 1D9FA 1MWQA 1R31A 3CJ8A 2JWNA 1FK9A 2E1CA 1NDCA 2XMVA 4A8YA 3KG1A 1HBOB 3V6JA 4U96A 5B0DA 2HZCA 4FF4A 1RGVA 1WC3A 4PXCA 4AQYF 2BUNA 3EX7B 4URQU 5L1KA 1QAJA 2C2KB 1H2UX 4GO5X 1N33F 4K4XA 1M90T 3NXZA 3BO4A 4A8KA 2R2RA 3SV3A 1J27A 4TN2A 2MJUA 1YSJA 4DV0F 5H9FJ 5AXLA 3PX4A 2B9XA 1SKRA 3F56A 1RDRA 5A6PA 5CYQB 4AL7A 1Y10A 5L8RC 3V5RA 1TL3B 2MYFA 3CD5A 5BYQA 1X4FA 2LQ9A 3Q8YA 5DS7A 5J2PB 3M6UA 1DARA 3T5KA 4DL4A 5HQ8A 4JI0F 1IXKA 1WF1A 3AHPA 1RTJA 2Q6CA 3P6YC 3D2WA 4ECUA 1XNQJ 4JI4J 2JC1A 5CHCB 4RNFA 1KHWA 5KAKA 2Z30B 2UXCF 2N3LA 4TQRA 3VR1A 5MLCV 2A6MA 4B3RF 4ED6A 2ZBQA 1UWBB 1L5UA 5IT9U 2E5IA 4LF7J 3TI0A 1EJ7L 1U09A 2ZHOA 1RT6B 2ROEA 2XWXA 5L39A 3AXKA 3KLHB 1QE1B 1SIZA 1H98A 1LK5A 1X8DA 1YTYA 2CPFA 3PZPA 1MMNA 3R6GB 4USJC 2XG8A 4JYAF 3GIIA 2DT9A 3IBFB 4HI2A 5D4LA 4OYXA 1Z2ZA 2RT3A 1YWXA 2HFNA 1JLGB 2Z2LA 4QR1A 3MXHP 3IRXA 2DNPA 3GG0A 3V4IA 3A12A 3NY0A 2A2DA 5DG8A 4DF4A 4RUAA 3JYTB 1HQ2A 3MTJA 1CQNA 4NRUA 3NS5A 3LTOA 1PCAA 3AOCA 3C16A 2DNLA 4WIIA 5IQ6A 4ED0A 2ZFHA 3OFFA 3I0SA 3DHWC 4KO0B 1NJIT 1MWZA 1OPIA 3QGPA 2WW4A 4NXNJ 5KT5A 2NS1B 1GQEA 2KKHA 3BKTA 2OJ3A 2ZOFA 3IRXB 1FKOA 4ZPAA 4NZ7A 4OZ2A 4OYBA 3VQTA 4ES2A 3KHGA 4ERDA 1CULA 1REVB 3EGNA 2DCLA 2BW2A 2NUUG 2HBZB 1SIWB 3I5CA 4R5PA 2QMWA 3MFIA 1S6QA 5DDOC 3GQCA 1SJRA 3FKBA 2CAJA 6AT1B 3G8SA 1VDHA 3D54A 1ZM2A 2DNKA 3IBWA 3M8ZA 4A8WA 5LJ3Y 4B3SF 3PKMA 4DL2A 1SH0A 4AUKA 2Y9HA 4RKUC 2R7TA 3M7VA 5F8GA 5LXRA 2BRKA 2DR7A 2FJEB 3H8YA 4UUXA 2PC6A 3HF5A 3SBMA 1D9DA 2KZMA 2YWKA 5C25B 3A3PB 4IKAA 4P2MA 3LP2A 3DLGB 1U1QA 3CJ0A 5IFMA 2RVJA 2YKMB 3AFGA 1Q16B 1FXRA 2AF6A 1FE4A 2BE7D 3F44A 5KFAA 4EMDA 4F0KA 3EZ5A 1G7CB 1P8GA 3DXSX 1JWWA 1GEHA 1OY9A 1QDUB 1RT1B 3AH6A 3H7HB 1FO1A 1PBUA 3NGKA 4M5LA 1N6QB 1CS4B 1R0BG 2BJ8A 2D69A 4NLUA 1U0SA 2J8SA 4JI8J 4TQSA 2M2BA 3BPDA 4WJBA 4EK2A 3BKUA 3PW5A 2M52A 2XYHB 1Y0HA 2O01C 4OZ0A 5CXTA 4ZVQB 1S7IA 4C7QA 3QWUA 1S99A 1OIAA 3ZTPA 3QZ7A 1G3OA 5KFRA 2I5JB 2XZDB 4ZJQA 2KVQE 2NPFA 3QAEA 2QA4S 3R97A 1TK0A 2G0CA 1CS4A 1WG4A 3TP2A 2VBYA 1GT8A 2RQKA 1F3VA 4DFKA 2MB0B 3DC2A 3TX0A 5GADI 3NNAA 1YJ9S 2G1HA 2V69A 4MMOA 2XLIA 2HVIA 1FE0A 2E7VA 2JDJA 5D0HA 2HMIB 1KQSR 1H7WA 1QSLA 5HN0A 3A4TA 2UVUA 1S1UB 2NXCA 3IMQJ 3PIOQ 3FBBA 4IDKA 3MECB 2XZTB 3R5CA 3TWZA 3PRDA 5I42A 1TK8A 1JLFA 1HNXJ 5CZVA 2DXDA 3MMAB 3O8WA 1ZPVA 4TY8B 5HJYA 3N5BA 5F8LA 3BO3A 1FRKA 2UXBF 2G2YA 2W2QP 3CB4A 5HSPA 3BH7B 2GVDA 2R2UA 2QYCA 3H42A 5HO4A 4WFAQ 1V5VA 4R8UB 3ZZRA 3SCKE 3MM8B 2PO4A 4L73A 1PJ7A 1TV6A 2ZH9A 3OQ2A 1N34F 4DOZA 3GP9A 1FX2A 2ILZA 3GONA 4GC7A 4FYVB 2VOPA 2HHXA 4P2SA 2RH3A 1PG5B 1RT4A 5B0BA 4QWCA 5HP1B 2FB0A 2XI3A 4B3MJ 4IH5A 5HI7A 4E8UA 2CA9A 3MAAB 1KVJA 2QEXS 3H2VE 3S1TA 2F63A 2KRRA 2DGQA 2G0IA 1URNA 3NS7B 4KYZA 1VQOS 2RDDA 3QQCD 3PR4A 2P5VA 2Q3PA 3NS6A 1S79A 4KIAA 2R42A 4F3QA 2E5LJ 2OTLS 5IOLA 4C3KA 4LFBF 4ALZA 3ILOA 2K7KA 3H4DA 1WHWA 1R0AA 2VKRA 1XC9A 3TZZA 3E3XA 5J1EA 1WELA 2CQIA 3NMAA 3I87A 3JSYA 4OJ1A 4ECYA 3DRYA 5KT3A 3QFWA 2DIVA 4PUOA 3JQMA 4UQGA 3RBEA 1RTDA 3LQVA 2W9CB 3OFEA 4OZ3A 4H4KA 3NBPA 3LF0A 2IVFB 2CZ9A 1NM2A 1HYSA 1XMBA 2IM1A 4ZIVA 2HZVA 4AXJA 4I0WA 4G1PA 2LU2A 4LIRA 1QD1A 3TZWA 2W7OA 3UDEA 4KGMA 1FFSB 4GKJJ 4LVNP 4Q2LA 4R0JA 3W5XA 2P8IA 1RAJA 4C98A 1CC8A 4RBVA 1RZMA 2MY8A 2R3VA 4WFNQ 1XNQF 2BQ3A 4LSZB 4DR1F 2GMJA 4ECRA 4JI0J 2X1GA 2J9DA 1H2VZ 1NSKL 3J7YU 1FJEB 4LR8A 3Q2TC 5AXKA 3PYEA 4DL7A 5IT0A 3CDWA 2HWHA 1EZZB 5GAEU 3W5ZA 4J9LA 3BB5A 4E98A 2CPZA 4B02A 1HNWJ 1DTQB 4UOHA 3UDCA 2DXFA 3DOKB 3J81j 4YB5A 2JC0A 1WOOA 4ZVSB 3ZZOA 1TL7B 2BJ1A 5LMUJ 3KNGA 4OV6A 4W4MA 5KFGA 4DX8H 4RW8B 3U27A 1YJ7A 4YUDA 5ITHA 1T05A 4TU9A 2EI5A 4N56A 2AYEA 1NDKA 3D3BJ 4LR9A 2BV3A 4PKDB 5IZHA 1JLGA 2V2KA 4FDFA 1IR2A 3JYTA 4J90A 2W9AA 3CCES 2HHHJ 2J0SD 3W9JA 2HSEB 3V4IB 1UVLA 4OZNA 2FGCA 2EFNA 2MHEA 3W7BA 5LSOA 4B9LA 4JI6J 1LKZA 3QJPA 2GHPA 4EBEA 2ZHAA 2C22A 4C48A 1KVIA 3FFIB 2DJWA 4DV5J 2AGPA 1UP1A 4DZ6A 4Y0FA 4TXSA 3SSSA 2LQ8A 2EVZA 2DHGA 2GIQA 2QGFB 2N82B 4XAKA 4U67Q 4B3OA 2BW7A 2RJZA 4WXOA 5HMYA 1UEUA 3VHQA 3VALA 4F2SA 4ZVHA 3LOUA 2BKPA 3NAHA 3BR9A 3PJWA 5HMWA 4X65J 3JB9k 4JI2J 2GJFA 3OPKA 2LQ5A 4MKVA 2P9EA 5D6GA 2ZZTA 4PWDA 1IM4A 4G1IA 2Z2YB 4Q45A 1SUQA 1T3OA 2NXEA 3E01B 1H0HB 4KGVB 5KG0A 1WDTA 3B54A 4I2PB 1RHMB 1B0TA 2M9KA 1Y00A 2F8HA 3ET6A 1WKJA 3U1MA 2ZE2B 4F50A 4UZBA 4C4WA 3BQ0A 4UZCA 1HMVA 1HPZA 2Z58B 4QPXA 2HLUA 1OYDA 3QWPA 1FD2A 4GO7X 1IJEB 1U2FA 1HNIA 2NLWA 4OJGA 1RBAA 2EFOA 2RB7A 3ZZUA 2X1AA 2B5JB 4NYPA 2VG5B 2XULA 2VPYB 3SEOA 2RRAA 1L3UA 2DNQA 4Y2CA 3NGDA 3OVSA 3FRYA 4WFYA 1KONA 5KFCA 3HFVA 4NA3A 1TP7A 4DSIA 4RJVA 4EZ6A 4PQUB 1T9XA 2DO0A 4Y6IA 1V5IB 4LRBA 4BWJA 2HHWA 1D09B 2WHOA 3OLBA 1T9YA 2X3DA 1S77D 3MM9A 5B0GA 3WX4A 2VUGA 4ELUA 3QLHA 3GSDA 2ZD1B 3K8VA 2FJDB 2VPWB 4UOCA 3HSZA 1VRUA 1CULB 1VC5A 4ZJLA 1ZA2B 1LWCA 2BVZA 4NYOA 4OX6A 1TK5A 1XR7A 3JSBA 3QBCA 2N3OA 3AAWB 4QQBA 3CJQA 3W2VB 2CKWA 2F8MA 2XEXA 4LVOP 3KLEA 4IRKA 4LBIA 2HHPA 2XBPA 4ID8A 2X3GA 2UZAA 1OSDA 3LH2S 3T6JA 3QJJA 3RW6A 2AW0A 1N0UA 3MPVA 4MT1A 2VPZB 1LQ9A 1DAXA 4I6YA 4DR6F 2FJXA 4AD6A 5ETMA 2ZOGA 2FYXA 2DH9A 1T94A 4S0MA 4OI4A 3G2XA 3MPWA 4HTIA 3ZTRA 3AA8A 4H4OA 1W7WA 2CUYA 4G65A 4HEA9 5K9FA 2CDRB 5T41A 2CPYA 5L1IA 3ZNUA 4N76A 7FD1A 1WKLA 2QG9B 2D9PA 1F0XA 1S1XB 3UNGC 2OP5A 4XK8C 4PUOB 4CO4A 4M5DA 2OSQA 3QGIA 3TNVA 3Q22A 2C28A 2WRMA 5CYMB 5DZ6A 4IQXA 3R5DA 4C8LA 3K0JA 2D3O1 1UJ6A 5L9XA 3PJ9A 5IM0A 4LF5J 4YDDB 2OPPB 3HHLA 2ZBCA 3OVBA 4J91A 1MWYA 4DBQA 4FBUA 4TNOA 3CULA 2MLXA 1RT4B 3NMRA 3EUNA 4HDHA 2FGOA 5CYQA 1EAYC 2C2EA 3U02A 1RHUB 3JSMA 1UA0A 1GXTA 1S1XA 4DU7A 4X4PA 1HHTP 1FXLA 3SMZA 1C1BA 2QLXA 2FUG9 2VFSA 4M1KA 4NCGA 2GGPA 4EBDA 1NK8A 4DR7F 1IKYB 3AQOA 3DMJB 5K8NA 3I56S 1Y5IB 2YWWA 1I94J 3L7OA 3R5JB 2CIMA 4U8YA 4DHVA 2CQDA 3TR5A 3TJ8A 5JVGQ 3NWRA 1Q82T 4OYWA 3UR3C 3IN5A 1KNZA 3S01A 4ZN1A 4UY8T 2IAJB 3AT1B 3D1QA 4Q44A 2R7RA 3PO5A 1S6PA 2LDYA 1VC6A 3EM1A 3OL9A 2GIRA 2FD2A 2GC8A 2Y1LB 2L9WA 3O3LA 5D0GA 4JOUA 4Q8EA 1F60B 2ZWOA 3GYNA 3CCZA 3PM9A 2WB4A 3MHYA 1K44A 2B7CB 3H0PA 2BE2B 3MTKA 1C0UB 2HNZA 3S8SA 1EARA 1OSCA 2IC3B 4M8LA 4EI2A 4DS5A 5HQMA 4O3SA 4LFCF 1UETA 3C14B 4OHZA 1JJ2R 3C2PA 2ZC3A 2NXJA 3TUJC 1FRJA 1EB0A 2CVEA 2D74B 3ZZTA 3CF5Q 2WSFC 4QJVA 3EPIA 1S6PB 2HFUA 4AYBD 5HMZA 2FLOA 4DV4F 3LGHA 4F4WA 3RW7A 1KFSA 1N8RT 3R27A 1Q78A 5CA5A 3GIMA 4DF8A 2DPIA 2YKOA 2ZUAA 3I9ZA 3K5PA 3LALA 1R3NA 1MLAA 4MAKA 3JAMY 4DR4F 2K3IA 1YZ7A 3M2RA 4NLSA 3W62A 1S4EA 2HW3A 1FJCA 4I1TA 3VGTA 2HVDA 1FRIA 5EN1A 1JJ4A 2MJNA 2RDIA 1OQ3A 1UWBA 2IVYA 3N0VA 2ADCA 4PWDB 5F0UA 2RIJA 2XGQA 3L3CA 1UPMB 1K8AT 2FHJD 3OV7A 3CCJS 2F3JA 1RAAB 1IM6A 3H5XA 4DJBA 1TL4A 2E5JA 4G3IA 1LWEB 5H9FK 4I6AA 2Q6BA 1UTAA 5ETOA 1BGXT 3D5MA 3C8YA 2H65B 3P49B 3MDFA 3OTBA 1RT3B 1DY3A 2EWHA 2PMHA 5E3RA 1BUXA 1T11A 2HK3A 2VH7A 5GAEI 2EFPA 3RAQA 2XNRA 2BM0A 1PJ5A 3PRVA 1Y7PA 5AE1A 4HTJA 1W2IA 4JB8B 4O44B 2ASDA 2LEAA 2LCWA 5LL6d 4B3OB 4WYLA 4EO8A 1NK4A 2UUAF 2E7XA 3I4HX 4HH0A 1M5VC 3KYLA 2X51A 3SQGB 3ONQA 2OAUA 5T7LA 1VQ5S 1YI2S 4KGZB 2V34A 2Q43A 1U49A 1X5OA 2F4VF 2NZCA 3EGZA 3UN2A 4LF9F 1FDAA 3WIUA 4P7TA 2V4QA 1TUWA 1F5BA 2EW9A 3AD9C 3IAM9 4KH1B 4O44A 4WP9A 3T1YF 2CQHA 2UU9J 2GJIA 4YQWA 2XS2A 1CJTA 2C2ZB 4I2PA 1WTFA 5HAOA 3KLEB 2VICA 2MZTA 3GTYX 1VI7A 2AJ0A 3WC0A 1DHMA 4ZPDA 2KTQA 1NAQA 3GJRB 1UFKA 4L75A 3LGNA 2RSQA 4ICLA 3MMCB 4M5GA 5F0WA 2FJWA 2LXIA 3QATA 4FBTA 3H5UA 5CH7B 5D0EA 1IWGA 2BXJA 4A46A 5EWGA 2RKIA 4M95A 4WP3A 3GFYA 2B3TB 2CJ9A 1JLBA 3M05A 3SDEB 3N28A 4XIUA 1DQAA 2AZ3A 2H3EB 1D3WA 2OD6A 3BGUA 3FBCA 3PR5B 2IDLA 1TAUA 5D78A 2W4CA 2GAGC 2GA7A 2D9OA 3CCTA 3BQ2A 1FVQA 2YWGA 5KFLA 4J9NA 3HT3A 3MAHA 4M5DB 4DX5A 2Z2ZA 2CQPA 3MEEA 2PMWA 4CP5A 4W92B 5CZXA 1T95A 3GV8B 1UW4A 3V6DA 2Y0SD 4DV7F 2FIUA 2AJ1A 2M4MA 1NKCA 3A1YG 2VASA 3DLKA 3MMAA 3NGRA 4IO1A 4OV1A 4RBUA 2YNGA 4EGLA 2V8DA 1EQMA 3JSRA 2RU3A 5ETRA 1VMBA 2ZZMA 5KFDA 4Q8FA 3GV5B 2I2YA 2KFNA 4CLPA 3PHTA 3VZIA 4KTQA 1T9WA 3BBFA 1K9MT 4R8UA 2JFKA 3VGUA 3R5GA 1B0VA 2RMLA 5KFBA 4F02A 2LDIA 1DZ5A 3I9V9 4EWTA 1HWKA 1N48A 1RU2A 5HK4A 4C9DA 2P9GA 2CJBA 3RB6A 3QGHA 5HP1A 4UY85 2MLYA 2W7PA 1SL2A 3TEGA 3MAQA 1HHQA 2AX1A 1X60A 2BEFA 5IWAJ 2R7VA 2CJAA 3CMAS 3PYDA 5J1NA 2WVFA 1XNRJ 2LEBA 2IRXA 2IFXA 1UEKA 4HT5A 4NZ0A 4K4WA 3T1HJ 1F2HA 5LT5A 2ABYA 1RBOB 5FIIA 2R8HA 1HNVB 1OQ6A 2W7AA 4PWWA 3CCLS 1B4SA 4DFPA 1QAIA 1CJUA 5DQHA 1S6QB 3FC9A 4OJHA 1EQ0A 1KLMB 4QCLA 8ATCB 2Z0GA 3D9BA 3KK3A 5ETLA 1TKZA 1CJVA 3DLJA 3B6BA 4CO3A 2VDHA 3H20A 4QZVB 1RTDB 1TKTA 4UW2A 4ZP6A 2RUGA 2MKIA 1TMMA 1E6VA 1WSVA 3OTOJ 1RYRA 2G2ZA 3EPGA 1FKAF 2NXUA 3FEYB 4N77A 1T02A 4MK8A 4USKA 3T9NA 4V19J 1UZDA 1QJHA 3UCZP 1VIXA 4DR5F 4QIGA 4WU2A 2JSXA 3B4DA 2MSSA 3CEDA 2RQMA 4LQ9A 4Y2MA 4ZJOA 5IXUA 2VHGA 3TJAA 1M5SA 2J7KA 3Q23A 3PW4A 2G1DA 2UV8G 4LSLA 1BQXA 1KKHA 1PILA 4YS2A 2VQFF 3ISND 4I68A 1VQ7S 1TKTB 2NYIA 1YBAA 4OHVA 2G2OA 1VQLS 3KNAA 1FF2A 2V4RA 1HA1A 5FLXY 3ENQA 4DV6J 3G8TA 1WD6A 1QVGR 1ZAWA 4FVMA 3DM2B 3HVAA 6FDRA 4HKQA 1WNEA 2VQEF 1FWPA 1ZAXA 1XQIA 1HBNA 4FNHA 2C2RA 1IQZA 4ITSA 3TARA 2XB2D 2VB6A 3WZ0A 2XHWA 2H4YB 1JLEA 2RU9A 1N0VC 1YIJS 3FSXA 2HQIA 4EFAC 4PPZA 3T5LA 1XJWB 1BMQB 2DNMA 2HNYA 1TQLA 4OHWA 2VG6B 3QAUA 5HROB 3R5AA 3PX0A 2KO1A 2MMYA 4QU7A 4I69A 4DDFA 3CJSA 1BC6A 2CJXB 8RUCA 2FJBB 3CWJA 2A2CA 2FZGB 2KB2A 1X4GA 4CRJA 3KHRA 4GKKF 2H1YA 2LLZA 3KHLA 3TA0A 1TKXA 1AB8A 1HR0J 2XO6A 3DLEB 3Q8RB 2J9EA 1G4CA 2PE8A 4X4SA 2VFUA 4RUBA 2DR5A 3GFHA 3NWGA 4WBFA 2FVRA 2CPXA 2LFVA 1KEKA 2ACMA 3QSYB 4FN5A 3I32A 1DJ0A 2QA2A 3HHKA 5EUHA 5DQGA 3NNCA 3TO8A 1FWKA 1HBUB 5E5NA 4D3HA 2AT1B 1MN9A 2FHJA 1B99A 1PIEA 1NHVA 2DCUB 1I51B 3NGTA 3T1AA 2CPDA 4N8NA 1UAWA 3TA2A 3UI3A 4WKYA 4ZKAA 1CG2A 3KLFB 3JSMB 1P1TA 1S9GB 4LSNB 2BJ9A 4QW9A 4WYWA 3PIPQ 2WK4A 4PYDA 4QOTA 1NU4A 1R8CA 2YKPA 3Q89A 4RW6A 2DPJA 4JI7J 1IVZA 4LUBA 2FLPA 4YN3B 1MROA 1U0HA 3RAMA 1Q8LA 1WKKA 2ZNYA 3L9ZA 3QT5A 4N7TA 5SUHA 3E51A 4IG3B 5J2NB 4DCJB 2YKNA 5EDWA 4RNMA 5E2QA 2IRYA 5KFYA 4LF4F 5L9NA 3VGVA 1R7IA 2GS8A 1GH8A 2PT0A 1RTJB 2DHAA 5JMNA 2DNNA 3BGOP 4OYIA 1UJ5A 3IGNA 4YY3F 1LXNA 4F4ZA 1N5YA 2E5GA 1U1NA 4B9SA 2QT7A 4NLDA 4ZPVR 3QFHA 1VS3A 2FDNA 1X9WA 1GK8A 4IFVA 3FEZA 1CJKA 3CCSS 4PCQA 1IBKJ 2KHDA 3AJDA 2HHUA 1CVJA 2L9NA 4WWSA 3CIMA 4LJMA 2V9WA 4Y2KA 2OTJS 3O2IA 3DYAB 1Q79A 2CNLB 1VK3A 3LGMA 3M9NB 1FDNA 4KJIA 1RLCL 3M8WA 3MGJA 4NLYA 2Q66A 3TW0A 3MD3A 1RU1A 2OHDA 3G4SS 1NH7A 2JLGA 1JLCA 1HWLA 1XBWA 4LRAA 4EYIB 1IKVB 2KZZA 2DGXA 1BWEA 1REGX 4DCOB 3V6HA 1T03A 2VG7A 1YJWS 4Q7AA 2YNHA 1FNMA 3OXGA 5ETTA 3EVMA 1NHUA 4K4TA 3B78A 1MU2A 4LR7A 1FEEA 4L3KA 4DN0A 1U45A 2WOMB 3BEGB 1FA0A 2YNGB 2N4CA 3MM6B 1VQYA 8AT1B 4DR2F 1W2BR 3M1VA 5D4OA 3F73A 3TVYA 4DR2J 5F8JA 4K4SA 1OY6A 2OSRA 1N36F 1DTTB 1X4EA 2V2VA 1S9EA 3MAAA 4MH8A 4P72A 4JV5F 3RG6A 3D6HB 4O3OA 3PO4A 5LXYA 2EFVA 2VU5A 3MR7A 3ILJA 1W25A 2CQ2A 1WHVA 1HQUA 1X7VA 2U2FA 2V67A 3NCRA 4KRWA 2CQ1A 4MYUA 2OFHX 2W9BB 2VONA 2HVHA 2V9KA 5JUMA 1KTQA 2HGNA 3L7UA 4GVBB 1NDPA 4J9SA 2Q1LA 3BREA 3EMTA 1GXUA 3QT7A 1EETB 4FF1A 1VLOA 2O67A 1RWPB 2E7WA 3GU0A 1KWMA 2KHCA 2W4DA 3SFGA 1VLYA 3P45B 3HVTA 4RUCA 3GCXP 3C15A 3R3TA 3CJRA 3U1NA 1C0TB 2JFDA 3G96A 3H2LA 2JEJA 1NSQA 2E9RX 1FRLA 1U4BA 2QSFA 2AEMA 2WVDA 3CUNA 1SI9A 2KH9A 2CJQA 1ZZNA 3TX8A 3VVTA 3N5FA 3POTB 3HSJA 3JXOA 2W8LA 1X5SA 1VQ9S 2K1RA 4LRCA 2O1PA 1APSA 3EWGA 1M5KC 3N6MA 1TL3A 4ZVRB 4USVA 4KPYA 5E33A 2F1FA 2RS2A 3W65A 4KB7A 4FS1A 3RTVA 2OPQB 1B64A 3GFZA 4X66J 1P9QC 3UN3A 2X7IA 3OUYA 4F3OA 3CD7A 4WCEQ 2LA6A 2VODA 4OJ3A 3QZ8A 4XPEA 4A8OA 2PFFB 1H74A 2WSEC 1AFIA 3BYPA 2V63A 2YQ0A 1XMQJ 4WKRA 4FZVA 1O5JA 3DLEA 3OJUA 1T9TA 2CYYA 2NUHA 4CTAB 1T05B 3RR7A 1HW9A 2YTCA 3UO0A 2PN6A 4N41A 4NCGB 3G82A 2QTWA 4CI0B 1N4LA 4M5NA 4DN9A 5CQGA 4K4UA 4ETXA 3FQLA 2L08A 2RQ4A 1LFWA 1LK7A 4NXMJ 1WEZA 2HK2A 1ICEB 2MKJA 3LANA 3JAMU 3FNNA 2ATCB 1G1XA 4NEYA 2XMAA 2XY5A 4G1QB 3CJ3A 1SKWA 1BQNB 4FKXA 3PX6A 2EBGA 3BV8A 4BLGA 2FC8A 1JLEB 1Q0NA 2HNYB 3KDNA 1XK8A 3H98A 4ZCIA 3MD1A 3JQJA 3GB0A 2ALZA 1AFJA 2QSWA 1TL1B 5FDLB 4ANCA 1HD0A 4DZDA 3IWNC 1HBOA 1KQKA 3B4MA 4IOCQ 1Z1ZA 1Q86T 2CQBA 4BS2A 4DFJA 3CCMS 3DCAA 2H5EA 3DI6B 2FHMA 2GVDB 2YQ3A 2YX7A 3DRRB 1S59A 5KFFA 4ENOA 2GIFA 3FSYA 4B9VA 3QPIA 3D6TB 1WF2A 5HANA 1FI4A 1RQ0A 2I6WA 1O6XA 4KPCA 2LA4A 1ZTWA 4RLEA 2WAQD 1AUDA 1FKOB 3BGRB 4P74A 1MMLA 3A8IA 2MQQA 1NB2A 2MKYA 2H5IB 2YWEA 2NSCA 5HL7Q 3ET6B 3DU6A 4OYZA 3NP5A 3OL8A 1VJQA 3CE8A 1YBUA 1U1KA 2LEPA 1Y3KA 4NEZA 1Q1KA 4X4UA 1D1UA 3PFOA 4AL6A 1NPRA 4ZITA 3GIKA 3BN4A 4O0NA 3M2VB 3P8BB 4TY9A 3BKFA 4YB6A 3MECA 3W64A 3KUHA 2ZVSA 3M8PB 7FDRA 1LNQA 4IRDA 2AJ2A 2RUSA 4QR2A 3ADAC 5EX3A 3RJMB 5E41A 4DSEA 2XY7A 1NCLA 4HDGA 1VQSA 2XYPB 5IV3A 4PQUA 2XSJA 2B7BB 5JJBA 2HURA 3K5MA 4LMZA 1K47A 1PSDA 1U6FA 2N4DA 2W1BA 3MCNA 4HL9A 4KGKA 4B3TF 2PI4A 4C0OC 2OO4A 3NAIA 4DV2J 3MUTP 1D9AA 4CLKA 1C1BB 3AY0A 2ZD1A 2E44A 2KJVA 4YDXA 5HLFA 2FTRA 1RWXB 2XMKA 1PBAA 1RT7B 2YNIB 2QN6B 3CJKB 1HWUA 2BA9A 3V2UC 4QYZJ 2J76E 4A4JA 1FJ7A 1RT1A 3I55S 2AX0A 1N6QA 5CYJA 3UDVA 3PW7A 1X0FA 2VD3A 2IDEA 3VTIA 4X66F 3K59A 4LQ3A 3QIPA 2HYIB 3M8YA 2MEWA 1WOPA 4NMXA 3GIJA 1JLQB 1M1KT 3K5NA 2G13A 2HNDA 4DUYJ 1RTHA 1LW2A 4I4BA 5D0RA 4QU6A 2FZKB 2XTJP 4DXLA 4NCBA 2CWXA 3DLLQ 4ZMMA 1FFWB 3BM7A 1L3TA 2FVSA 1HD1A 4DLEA 1DTQA 2R8KA 1XR5A 5KFEA 1IKVA 2H9ZA 3V4MA 4P52A 3TVKA 3W60A 3QIPB 5F9LA 5F9NA 3TQ1A 2Y8WA 2HRTA 2KI2A 2V2QA 2XS7A 1RXOB 1M1GA 3M2UB 2QL5B 2B9YA 5D3GB 2R8JA 2QFJA 2GJ2A 4E0DA 1TU0B 2V8VA 4JV0A 2DRAA 4DL3A 5KG4A 3M2RB 1MN7A 3CCUS 3SDEA 1FDBA 2DKOB 2CNNB 1S9EB 4X64F 3MR3A 1S6UA 1RWKB 4MFBB 1WSRA 1JJHA 2A1BA 3K89A 3I4PA 2JNJA 3I0RB 3T3FA 4JV5J 2M8DB 2C1EB 2AMCB 4FKYA 4ZLJA 5K8PA 3CSKA 1RI7A 3LAMA 2F8EX 4YB7A 3JQKA 2YH0A 1P1LA 4C8KA 1V3RA 2AEFA 1R43A 4ZVOB 2A3JA 1C2PA 2VPXB 3DLKB 9ATCB 3I0SB 1SL0A 4JI3J 1YJRA 2CPIA 1M1HA 2QV6A 3L95X 2HVEA 3MCOA 3HZEA 4LF6F 3IS9A 2VDIA 2DEIA 1UVKA 3N6NA 1J2VA 2I9SA 3N9UC 4RX6A 4GRSA 4NASA 4RNNA 3VCDA 2JHEA 2BOAA 1YVFA 4F36A 4ELTA 4MK7A 1FJGF 2FHKA 5DZ7A 2B56A 5J2QA 1NZ8A 1F2GA 4HR2A 2D7SA 3SQGA 3UW1A 2GW8A 1PKUA 3IBCB 1D8ZA 1TL5A 3M6VA 4R5PB 4RW4A 3DDKA 2ZC4A 3GZ7A 3PVXA 2AQ4A 2UU9F 1ZH5A 4M5IA 1F5AA 4LF1A 5C24B 3OSNA 4WFXA 1SV5A 1ZAVA 4ER8A 2AKWB 5LOQA 2MXYA 3K57A 1RWNB 3VAGA 1X9SA 2W9CA 1IUJA 1YQHA 2GVZA 3LP0B 4QWBA 4UF4A 3MOJB 3H25A 1TL1A 1VRTA 5A6WA 2XS5A 1EHWA 1VQKS 1BQMB 2Q79A 4K5SA 3QNWB 5A8WA 5J2MA 3SCIE 3TAQA 2KXNB 3VAHA 3THVA 2ATLA 1IKWB 2HBRB 3MMCA 4RNHA 3IGVA 5C2GA 4ZPTR 4H4KC 2HAFA 3I31A 3IC1A 4P9SA 1P9YA 3N4WA 3ULHA 5K14A 4CH0S 4LRDA 4ZP7A 1PYOB 3OJSA 2BR0A 2HFZA 1D0EA 2VA3A 1WG5A 5EWFA 3O5TB 1VQ6S 2BKOA 2L48A 3G71S 1C1CA 1LWEA 1YHQS 1TZ0A 4J9UE 1G2EA 1HW8A 3FK4A 5H9EK 4NLPA 4J9RA 1FRXA 3WC2A 4ILLA 4KKOB 1QUPA 2R7UA 4DPXA 4DX7A 3J7ZT 3AD7C 2CFXA 2AHOB 1R8PA 1S4FA 2W2MP 4RW8A 5GMDA 5KFZA 4O23A 4CT9A 5KFMA 4C8YA 1FJGJ 4UOGA 1GMWD 1UJ4A 3TEHB 1IR0A 2C2NA 4ZDNA 2POKA 3IG1A 3DDIA 2AGQA 3GE9A 5FDLA 4LF6J 1JXVA 3MPYA 5IQQA 1ZA1B 3PKYA 2CJYB 5A8RB 1Y11A 2YX1A 2HFVA 3I82A 4WU3A 2V0NA 4DV4J 2HFSA 1U1RA 4FPIA 4ZS6A 4D3GA 3B82A 2XGPA 3NOCA 4ELVA 4J9MA 1S1UA 1E6YA 4ZOSA 2Y3YA 3G6YA 4DL5A 1R0CB 2IM3A 2DO4A 2J6UA 2GO8A 1YRUA 4EU0A 3IG1B 4FXDA 1SJQA 1JNZB 2CDQA 3D28A 5HVFA 4ZLPA 1U26A 3GJSB 4BBYA 1B7FA 3BSNA 4JI1F 1YBTA 3AOBA 4DL6A 4IFYB 5E7OB 3PRBA 2XSFA 2M3DA 2ZUGA 4WE1B 3J7Z5 5HVHA 1BE4A 2QJ3A 2HFOA 2U1AA 2XMJA 1HHSA 4J9KA 1GFWB 1YRXA 2HIQA 2QZ8A 5E3PA 3LO3A 4A8QA 2UUWA 5GMEA 3HLUA 1SL1A 1RA6A 3QYYA 4CLWA 5GMKa 3H5SA 4PXEA 2FY8A 3SIPB 5KFUA 1QUVA 1QTMA 5KFJA 2VQFJ 1UVIA 1F9FA 2RD5C 2DTJA 1SB6A 3OD2A 4XO0A 3NCPA 4O4GA 1RB0A 2CPEA 2MZSA 3R7NB 2BE2A 2DNGA 1UWAA 3MOZA 1IWAA 5AE2A 1WG1A 4P7VA 2H48B 3V81A 3KUEA 1FRHA 4LT6A 2RRBA 1AUSL 2C3YA 3M30B 3N01A 4MFBA 5CAAA 3NKYA 3WBZA 2R7SA 1VIOA 4DUTA 2EFQA 2OMLA 3PHEA 2UUCF 5HATA 1UFLA 3KLFA 3TANA 4WFBQ 4ECZA 3BZQA 4K50A 4DG1B 1IBMJ 4QR0A 2JEGA 4DSJA 2XMTA 1HLWA 2E9ZA 1V3SA 1ACMB 3FQKA 1URRA 3IS9B 2E1PA 4RW7B 5DLGA 2GHWA 1JK9B 2KRBA 4PXDA 1IBKF 2BANB 1L3SA 1GX5A 2LKZA 2V8GA 1DQ8A 5LM7E 2WVBA 2MQMA 4HLBA 5L1JA 3ZFVA 6FD1A 4JI5F 5J2QB 2H54B 3L4BC 1S12A 4O3PA 1FD8A 2W01A 4NPOA 4OYPA 3C16B 1ELOA 3IP0A 2J9CA 3M32A 4NI2B 1F3FA 4P71A 4DUYF 3CC7S 1JB0C 2Y0BB 3IR5B 3OTEA 4PG7A 3A8JA 3KK3B 5JVHQ 2RHQB 2MQLA 3EGVA 1CJVB 4OX7A 1ZS6A 1WACA 3GYXB 2CNOB 5DO2A 5I3UA 3KMSA 1T9VA 1FKPB 1C0TA 2ROPA 1HMVB 1HPZB 2CPJA 2XNQA 1H73A 2FQQB 1SKSA 4LBHA 4UUWA 2V4JB 1VJWA 3CNQP 1RWWB 5T7LB 4B9TA 1SJFA 2AJFE 5CABA 2K1RB 2KT5A 5A8KB 2GQQA 4NYZA 3Q8UA 1L3VA 3OR2A 1RAGB 4L76A 3SI8A 2EC0A 1RP5A 1AT1B 1Q7LB 2MKSA 4B3TJ 2OPQA 5C5JA 4L6V3 5I3UB 5K14B 1V9OA 4F4AA 5LSRA 2QA4G 2MHNA 4DX6A 1HQUB 1KQGB 3MM9B 1CJTB 5ETNA 4U6PA 2V68A 2W2NP 3VAJA 1UEVA 2GMLA 4P73A 4A48A 1Q4RA 3PJXA 1WC1A 4TVAB 4DR3F 2FVCA 2KYZA 3FRZA 4JI2F 4USIA 4RR5A 3AB4B 2YVSA 1Q95G 3DOLB 3TUIC 4HACA 5L38A 4LREA 1FFGB 3C6TA 1RTIA 5J1PA 1QAYA 2EC2A 2RS8A 1NEEA 1XR6A 3HT0A 3MM5A 4HHJA 1CPZA 3ZTQA 3D6MB 1IN0A 3ZNJ1 3FZ2A 1UW9A 3PY8A 1RHJB 4ZVGA 2FLNA 1U8SA 1KBRA 2ASLA 3BSAA 4I7FB 2GQ2A 2A0FB 2CQGA 1T03B 1WDDA 3DYAA 3ZZ0A 3CC2S 4WPAA 1U24A 5CCLA 2BX6A 5CCMA 4HYKA 1K1SA 3KJNB 1F1BB 1HNZJ 1S1VA 3CD6S 3ETMA 3CCWA 3OW2R 2Y8YA 3EDRB 2PI5A 1CC7A 2MLZA 5KFHA 5DRKA 2G9OA 2W4PA 3CCVS 4C8ZA 1HWIA 1R89A 1YKWA 2P2CB 2EKNA 1EKSA 2KU7A 4C6AA 1PAUB 2XYGB 2RNEA 1Z4UA 5KTQA 4MKBA 2DR6A 1HI1A 3M8QA 1RADB 3HSGA 4F7VA 2E1AA 4DQQA 2WW8A 3R6LB 2R8GA 1NDLA 3ZZZA 2RAQA 3R7BB 2ZJPQ 2J0XA 2B6AA 1NK5A 1JX4A 2HS3A 1Z2LA 1BXNA 1HBMA 1SCJB 5ETPA 5THWA 2ZH5A 4N8OA 3KK1A 1Q81T 1IBMF 4ZVUB 2F5GA 2KG0A 1SJ4P 1ZOTA 2E5HA 2J7WA 2BJDA 4M63A 1IKYA 1TUGB 3FBEA 4X84A 3VVUA 4IQMA 3MM8A 1QAXA 1X4DA 2LMIA 4K59A 3PACA 1HNWF 4Q0BA 1HNVA 1Y5LB 3H90A 2UVRA 1S0VA 9RUBA 2P9CA 1H38A 1MNEA 4ETZA 1ROFA 2FPHX 3TUZC 2D41A 2MQNA 2Y1RI 1U1OA 2IM0A 5ETQA 2CADA 1WTBA 2MY7A 5GVQA 4IG0A 5J2PA 3RRKA 2LYVA 1K1QA 2HRUA 1XMOF 3VGSA 5IWAF 2JJ4D 1RCOB 2RHSB 2WONB 3CJTA 2QL7B 3RGIA 1RISA 4URGA 3UCGA 4XDCA 1OYEA 4CH7A 2AYBA 4B9MA 4K7QA 4Y3CA 3AJ2A 2BBEA 3FUYA 2XCAA 3QO9A 2OI2A 5H1SV 4C97A 4LFBJ 2ZH6A 3MEKA 3P5TL 3CXCR 1TMJA 4DSLA 3RRHA 3PCOB 3JTOA 3O6QA 4KV8A 1KQFB 2RF2A 3J7AN 1JJCB 3IM8A 1FXDA 2VFTA 3T41A 4E2FB 1NO8A 2BQRA 1KLMA 1VISA 4JI1J 1I94F 2EBEA 3IR6B 4FVCA 2B8QA 2CZ4A 3Q8SB 1TKZB 2VJVA 4AL5A 2HHSA 2QLBB 5K20B 2B4UA 5F8HA 2KN4A 4PG8A 1H6KX 2MQ8A 4YY3J 2MTLA 3Q8PB 1S1WB 3M30A 1YK9A 5IV4A 2EK6A 2GAHC 3ZZYA 4J37A 1Y5NB 3FMWA 4LF4J 2N7YA 2IC3A 2XM3A 1XMOJ 2RDJA 1GNKA 1M5HA 2R2TA 3OXFA 1TELA 3EICA 1BQNA 4CLFA 4DG1A 3TAMA 3KK2A 4JI7F 1U6BA 3B8HA 3KKFA 2XLKA 2BANA 2MZ1A 1TVRA 3BQ1A 3FCVA 4ED3A 2J0QD 4RW7A 3DM2A 2MKHA 3DOMA 1NH8A 3FJ2A 1YG0A 3CCQS 2OD4A 3GR1A 2QL9B 1P6TA 4TLQA 3SQOP 4DV2F 1VQPS 2HWTA 5T14A 1UVMA 1HBUA 3W9HA 4DPUA 5K5MA 2C42A 3LA0A 3D66A 3EGWB 5MAOA 2AU0A 4USHA 4ZCLA 4LF9J 1K0VA 2KJWA 2VG5A 2F4VJ 4DR6J 4HT7A 4Z2XA 1LOUA 2QE5A 2ZITA 3DRSB 4CNZA 4G6VB 2DR8A 1TVRB 5L46A 3QJLA 1RLDA 4FXVA 4Q2MA 1XIQA 1N52B 2MKKA 3KG4A 1S7HA 2UUAJ 2K2PA 1SJ1A 3DLGA 2L3MA 5DG7A 3W3SA 2C2MB 3DLHA 1RT3A 1VRUB 4OHYA 3D1HA 3CDAA 1HNZF 2QMXA 2AJQA 4KFBB 2DY1A 2YKMA 1JLBB 1OO0B 2ALYB 2GCFA 3FGVA 3EJMA 2APOA 3BO2A 1E6VB 1KOHA 1S6OA 2MSTA 3PG9A 4MKYA 4ECWA 4X4RA 3BDEA 2GHVC 1REVA 3HMJG 2ZE2A 4EUVA 1WC4A 3J81U 5J2MB 3UD3P 2KT2A 3J80U 2N7CA 1M5OC 3JTPA 3UQSA 1SH3A 1HNIB 4CO5A 4KHRA 4ANDA 1SC1B 3M9OB 4WK3A 1VR6A 4RBTA 2VOOA 3FDSA 4ZN3A 4EEYA 3NRBA 3GPAA 2ZZNA 2HVZA 2AGOA 1DQ9A 1FVSA 4ES1A 2KDOA 2HGMA 3AXMA 4F26A 4ZA1A 5I3QA 4DR3J 1LWFA 2LQBA 2B6AB 2D1CA 2LVWA 1U7LA 3DOLA 3HKZD 2F65A 3OLAA 4C3LA 2IHR1 3KK1B
chains in the Genus database with same CATH topology
4W98A 4CP5A 4F36A 4UOHA 1KDNA 2DXFA 3Q89A 4FKXA 3NGRA 4HR2A 3EE3A 1PKUA 3VGSA 1HLWA 1WKKA 4ANEA 4ANCA 1NDKA 1NUEA 3EVOA 1LWXA 3VGVA 3BBFA 4UOFA 3VGUA 3JS9A 2NCKL 1S59A 3EM1A 4ENOA 1S5ZA 3WX8A 1F3FA 1EHWA 5C7PA 4KPCA 1K44A 2DXEA 4DZ6A 1HHQA 4EK2A 1NB2A 2BEFA 1NDCA 3MPDA 2DY9A 1ZS6A 2B8QA 2AZ1A 3ZTSA 3ZTPA 3NGSA 3Q86A 4O0NA 1B4SA 3FC9A 5CABA 2ZUAA 1NCLA 3Q8UA 1F6TA 1HIYA 3EVMA 3ZTOA 3B6BA 3B54A 2HURA 4F4AA 1WKJA 3VGTA 2HVDA 1NSPA 3EICA 3FBBA 1PAEX 3DKDA 3Q8YA 4UOGA 2DXDA 1NLKL 3DDIA 3FCVA 1JXVA 2VU5A 1BHNA 3BH7B 3BH6B 1U8WA 3BBBA 3FCWA 3GP9A 3L7UA 1BUXA 1NDPA 3EMTA 3PRVA 3Q83A 1XQIA 3ZTQA 1S57A 1XIQA 1VYAA 1NSQA 2BX6A 5IOLA 3ELHA 1BE4A 3ETMA 4DI6A 3VVTA 3R9LA 3FBFA 2CWKA 3EJMA 3ENAA 4C6AA 4S0MA 1MN7A 3BBCA 5BXIA 1NPKA 1UCNA 3G2XA 4WBFA 3ZTRA 1W7WA 1NDLA 1WKLA 4ANDA 3EVWA 4FKYA 2DYAA 4DUTA 1NHKL 3Q8VA 3GPAA 1LEOA 3VVUA 3FBEA 2AZ3A 3PJ9A 3FBCA 1MN9A 1B99A 2B8PA 3NGUA 5CAAA 3NGTA 3FKBA 1NSKL 2HVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W98 A;  4CP5 A;  4F36 A;  4UOH A;  1KDN A;  2DXF A;  3Q89 A;  4FKX A;  3NGR A;  4HR2 A;  3EE3 A;  1PKU A;  3VGS A;  1HLW A;  1WKK A;  4ANE A;  4ANC A;  1NDK A;  1NUE A;  3EVO A;  1LWX A;  3VGV A;  3BBF A;  4UOF A;  3VGU A;  3JS9 A;  2NCK L;  1S59 A;  3EM1 A;  4ENO A;  1S5Z A;  3WX8 A;  1F3F A;  1EHW A;  5C7P A;  4KPC A;  1K44 A;  2DXE A;  4DZ6 A;  1HHQ A;  4EK2 A;  1NB2 A;  2BEF A;  1NDC A;  3MPD A;  2DY9 A;  1ZS6 A;  2B8Q A;  2AZ1 A;  3ZTS A;  3ZTP A;  3NGS A;  3Q86 A;  4O0N A;  1B4S A;  3FC9 A;  5CAB A;  2ZUA A;  1NCL A;  3Q8U A;  1F6T A;  1HIY A;  3EVM A;  3ZTO A;  3B6B A;  3B54 A;  2HUR A;  4F4A A;  1WKJ A;  3VGT A;  2HVD A;  1NSP A;  3EIC A;  3FBB A;  1PAE X;  3DKD A;  3Q8Y A;  4UOG A;  2DXD A;  1NLK L;  3DDI A;  3FCV A;  1JXV A;  2VU5 A;  1BHN A;  3BH7 B;  3BH6 B;  1U8W A;  3BBB A;  3FCW A;  3GP9 A;  3L7U A;  1BUX A;  1NDP A;  3EMT A;  3PRV A;  3Q83 A;  1XQI A;  3ZTQ A;  1S57 A;  1XIQ A;  1VYA A;  1NSQ A;  2BX6 A;  5IOL A;  3ELH A;  1BE4 A;  3ETM A;  4DI6 A;  3VVT A;  3R9L A;  3FBF A;  2CWK A;  3EJM A;  3ENA A;  4C6A A;  4S0M A;  1MN7 A;  3BBC A;  5BXI A;  1NPK A;  1UCN A;  3G2X A;  4WBF A;  3ZTR A;  1W7W A;  1NDL A;  1WKL A;  4AND A;  3EVW A;  4FKY A;  2DYA A;  4DUT A;  1NHK L;  3Q8V A;  3GPA A;  1LEO A;  3VVU A;  3FBE A;  2AZ3 A;  3PJ9 A;  3FBC A;  1MN9 A;  1B99 A;  2B8P A;  3NGU A;  5CAA A;  3NGT A;  3FKB A;  1NSK L;  2HVE A; 
#chains in the Genus database with same CATH topology
 4U95 A;  1JLC B;  2C2O B;  2YPZ A;  4QIF A;  3EXY A;  3MED B;  1SKU B;  2VG7 B;  2HHQ A;  1RT2 A;  3MEG A;  4IR9 A;  1UVN A;  3T6B A;  3OTO F;  4NLT A;  5KFW A;  1I3O B;  3LP0 A;  3QID A;  3H2U B;  5D15 A;  5U47 A;  5HRO A;  5AE3 A;  1N56 A;  2LXU A;  4WZM A;  3HZG A;  4X64 J;  4O3N A;  1HI8 A;  1GTE A;  5IS2 A;  5ADZ A;  3CVK A;  3IAS 9;  4UOF A;  5DQI A;  2WB1 D;  4ZVP B;  5K8O A;  2JVO A;  3MUM P;  5HMX A;  2WVC A;  5A2Q Y;  3N6L A;  1DFD A;  2K8G A;  2VQE J;  1PC5 A;  2BJ3 A;  3MEG B;  1FDD A;  1NJX A;  1H2T Z;  1VQ8 S;  2PA8 D;  4PXB A;  3PDN A;  2PEB A;  2YY3 A;  3HUL A;  1WOR A;  3UWT A;  4F0M A;  2MGZ B;  2M0G B;  3MPD A;  2MQP A;  5GAH U;  5F8M A;  4B9N A;  2FZC B;  1X4A A;  2MZR A;  3DHX A;  3UDL A;  1JXL A;  4DQR A;  3D0H E;  3ISZ A;  4TYA A;  2VA2 A;  4QYZ K;  3I5B A;  2WOM A;  2VV5 A;  3NGS A;  4NLX A;  1BY9 A;  2BDP A;  4NLV A;  1RA7 A;  1S9G A;  2GFF A;  2DH7 A;  1JLF B;  3CIZ A;  3PEJ A;  4LSN A;  1KC8 T;  1WEY A;  1HQE B;  4Y28 C;  2HG4 A;  2DR9 A;  3ZO7 A;  4OX8 A;  1KRP A;  3HX9 A;  1T8E A;  1NBE B;  1S97 A;  1UKU A;  1MRO B;  1U0H B;  3NBP B;  3GSI A;  1RWV B;  1ZM9 A;  3P96 A;  4P2X A;  5HBM A;  4ZHR A;  2XY6 A;  1PAE X;  1NJY A;  2HKE A;  5KT7 A;  1TV6 B;  4CO1 A;  2HND B;  2UUC J;  4DMZ A;  4GKJ F;  1A0O B;  2IMO A;  2OPR B;  3KLH A;  3NG8 A;  3NCQ A;  3GJT B;  3PTW A;  1SBR A;  3TZX A;  4ECV A;  1U6Z A;  2IAJ A;  2EFG A;  2ZOM A;  2CQ0 A;  4CH1 A;  1N5Y B;  2UV8 A;  4FF3 A;  5KT4 A;  5KFI A;  2QLF B;  4NLW A;  5A76 A;  1CJK B;  4WXW A;  5G0R A;  4AQY J;  4J9V A;  3EZU A;  5G4D A;  4J9O A;  3ILI A;  4KV8 B;  2XO7 A;  3Q2S C;  2CRL A;  4CT8 A;  1VBZ A;  2AWZ A;  3C14 A;  2HNZ B;  1FT8 A;  4Z37 A;  5SZT A;  1VBK A;  3VAM A;  3PW2 A;  4L3N A;  2IBO A;  1WI8 A;  1WHX A;  4LSL B;  2R7Q A;  1X5T A;  2F40 A;  3MMJ A;  4GVL A;  2AIR B;  5FLX U;  4M5H A;  4FF2 A;  3KG0 A;  3MCM A;  2B4P A;  2J5A A;  4EYH B;  2ASJ A;  3QRP A;  5KOW A;  3KXD A;  4OI1 A;  2Z8Q A;  2YX4 A;  3PXG a;  5A0Y A;  3KMQ A;  1LW0 B;  1SQE A;  1R6V A;  3DGP B;  3NEK A;  4RO0 A;  4C3M A;  4PYA A;  4CIO A;  3RR8 A;  5E3Q A;  5KG5 A;  3R1L A;  1RSC A;  2M70 A;  5HQL A;  4DPT A;  2DH8 A;  2PD1 A;  3HFK A;  3DI6 A;  4ILR A;  1X4B A;  1UCN A;  4KAI A;  2V94 A;  4CM2 A;  1YDL A;  3V81 B;  4YFU A;  2W8K A;  1AW0 A;  2B43 A;  1VQ4 S;  4AE5 A;  2G4B A;  4OZ1 A;  2EKY A;  4KFB A;  3TAM B;  3PFE A;  4C0H A;  3KK2 B;  3M8S A;  2UXB J;  2CQC A;  3QMQ A;  4WIQ A;  2WBM A;  4AFF A;  2DYA A;  3KWM A;  2BJ7 A;  3Q8V A;  5A8R A;  3AJ1 A;  3CDU A;  5C25 A;  3VAK A;  1UVJ A;  4A8M P;  1NRK A;  2BMB A;  1YRT A;  5EHH A;  3A8K A;  3US5 A;  5DG9 A;  2B8P A;  5GAD U;  2NQP A;  1BD6 A;  2DVI A;  3MM7 B;  3DRS A;  4X65 F;  1T0T V;  2JOQ A;  1TR0 A;  2LXF A;  3CD0 A;  1AZS A;  4Y65 A;  3Q8Q B;  4LRF A;  2DHX A;  2B9W A;  3W2W B;  2VBW A;  3OTD A;  2GVZ B;  1QY7 A;  3JTN A;  2AV5 A;  2VZ9 A;  4OIX A;  4UST A;  5RUB A;  1RE1 B;  1H7X A;  4NWB A;  5E3C A;  3KJV A;  4ECT A;  3T1Y J;  3GCW P;  2BQU A;  2UP1 A;  4C8N A;  1ZM4 A;  5KFN A;  2J6T A;  1UL3 A;  1Q8K A;  4QIE A;  1OMS A;  2QRR A;  2BE9 B;  1BWV A;  2CXE A;  4CCH A;  4F4X A;  4A8S A;  2HHT A;  2ZH3 A;  2DBB A;  1WF0 A;  2KXH A;  2A6O A;  3CME S;  3AD8 C;  2ROG A;  3GG1 A;  1S5Z A;  2H4W B;  2OIH A;  3AQP A;  1U2C A;  3TZY A;  5C7P A;  1QSS A;  3DDN A;  4GKK J;  2C2D A;  3SZ2 A;  3EXC X;  4I2Q B;  5AXM A;  3OFG A;  2JEI A;  2LU1 A;  3M8P A;  2HWI A;  4ICL B;  4DWI A;  2A18 A;  3ICL A;  3MWB A;  4AXI A;  4RZR A;  4CTA A;  1EIY B;  2IY5 B;  5IT9 Y;  3ZTS A;  1RKJ A;  2M5Y A;  2RKI B;  5KFK A;  3EYZ A;  4PAB A;  3DXB A;  2IMW P;  4DU8 A;  4H4M A;  3WHI A;  2ASY A;  5FD1 A;  3NLC A;  4IH6 A;  3W9I A;  4PG6 A;  5LSL A;  4ECX A;  2JVR A;  2CG8 A;  4PEO A;  1UFW A;  2SXL A;  4CLY A;  3CCR S;  3V6D B;  5I4M A;  3CJK A;  1SC6 A;  3KFW X;  4P10 A;  3WDO A;  1IQT A;  4NLR A;  4F67 A;  3PW0 A;  4JBC A;  4NA2 A;  1KVK A;  4ECS A;  1CJU B;  1Y9O A;  3SSR A;  4I67 A;  1NLK L;  2IYG A;  3TJ9 A;  4JI3 F;  4KO0 A;  3VF0 B;  4HAC B;  1N36 J;  4QW8 A;  1WJ9 A;  4CO0 A;  3CPW R;  1ZM3 A;  1RTI B;  4YME A;  3FSI A;  1C4A A;  3KOA A;  3IR7 B;  5B0C A;  2D3O R;  1N5T A;  1TTH B;  1N5S A;  4BC7 A;  1IBL J;  2YNH B;  3DGV A;  4K4Y A;  4LF5 F;  1DUR A;  1LWC B;  2ZHB A;  2XC9 A;  2ZH1 A;  1F5C A;  4DEZ A;  4KHM A;  1R0A B;  3HHD A;  4PZV A;  5KG7 A;  3TAP A;  2VJU A;  1GMU A;  1S1V B;  4M5J A;  1ITP A;  3UFC X;  1EP4 B;  4RWX A;  3O44 A;  1S57 A;  2ZEJ A;  4OLO A;  4QWD A;  3MFH A;  4ZCK A;  3DRP A;  3R1H A;  5ETK A;  2IRU A;  1HYS B;  3QSI A;  3ENV A;  1AA1 B;  4ZP8 A;  4USW A;  5C42 A;  3UNY A;  2V5H G;  2KG1 A;  5D8H B;  1XNR F;  5IT4 A;  1FTC A;  4DS4 A;  1Q5V A;  4ZK7 M;  4C11 A;  3T5J A;  3GJQ B;  3R9L A;  4O4R A;  5EWE A;  1YX2 A;  1S9F A;  2YQ1 A;  4JV1 A;  2VKZ G;  3X1L B;  5HBM B;  2BM1 A;  2ZH8 A;  3QRR A;  3DLB A;  2XLJ A;  2BAC A;  5BXI A;  1NK6 A;  5HLF B;  2GMH A;  2FC9 A;  3C15 B;  1LV5 A;  1V6H A;  2YBV A;  4P75 A;  3THT A;  4ED8 A;  3D3C J;  3RBX A;  1F9E B;  2DD8 S;  1ZPW X;  3HHL B;  1RT5 A;  4OFZ A;  2YWH A;  5KFV A;  3VAI A;  1Q7Y T;  4DQI A;  3MR6 A;  4FXW A;  1IR1 A;  2UVV A;  2QA1 A;  3DU5 A;  4OI6 A;  3UD5 A;  2E1R A;  1QTN B;  1TL7 A;  2HQF A;  1NJZ A;  3HI9 A;  3DFE A;  3S6E A;  5ETV A;  3VQS A;  1GMW A;  3D1O A;  2CJK A;  2CVI A;  1JLQ A;  3D6F B;  3KJQ B;  4P6Q A;  4ZPB A;  1VC0 A;  3NGU A;  1FNX H;  2XMW A;  4ED1 A;  4B08 A;  2B4V A;  3IXQ A;  5LJ5 Y;  3KTQ A;  3HSD A;  4Y00 A;  4CWB A;  1CLF A;  3ZC4 A;  1HBN B;  1XWL A;  2GNK A;  1HWJ A;  2CQ3 A;  2P6S A;  3A8E A;  2V8P A;  3C6T B;  3W1Y C;  2L41 A;  1KFD A;  3UD4 P;  3CGI A;  3HDS A;  2Z57 B;  5DM7 Q;  2QLJ B;  4OMF G;  4ZPW R;  3MI7 X;  3VAF A;  1TUV A;  4IH7 A;  4QIW D;  4IDK B;  2MPU A;  4LF2 A;  1EX8 A;  4ANE A;  5DDP C;  1WHY A;  3HVW A;  3EVO A;  3J81 Y;  1KP6 A;  1JXE A;  1UZH A;  4Q5V A;  2ZJQ Q;  5FJ4 A;  1HR0 F;  1JIH A;  3JS9 A;  2NCK L;  3W61 A;  4F3M A;  1WC6 A;  3GYG A;  1WC5 A;  2ILY A;  5GAG I;  2XI2 A;  4X4Q A;  2OKQ A;  4FYW B;  2PGC A;  2FY1 A;  4DLG A;  2VC1 A;  1PYT A;  3UPF A;  4IR1 A;  3LAK A;  1E6Y B;  3I0R A;  4OL8 A;  2F4F A;  3S7R A;  1JLA A;  1QSY A;  1PC4 A;  1KR4 A;  2DRB A;  3TQE A;  3UR0 A;  1VQM S;  5HVG A;  1Y4Z B;  1SH2 A;  3OT9 A;  4DV5 F;  2AD9 A;  3BJY A;  2DGU A;  4OZL A;  3RB4 A;  4B3S J;  1NND A;  5DJB A;  3C66 A;  4WP8 A;  4JP8 A;  1OS5 A;  1PO6 A;  1AZS B;  1BLU A;  3K7R A;  2E1M C;  3H40 A;  4DV3 J;  1JMT A;  1P27 B;  2WVE A;  3W5Y A;  3HK2 A;  4CNY A;  1F6T A;  4X62 F;  4U7U K;  1FK9 B;  4DUZ F;  7AT1 B;  3DOM B;  4F4Y A;  5E0O A;  4H4M B;  4RW9 B;  4USU A;  1XTZ A;  3HHL D;  2YNF B;  4ZPC A;  5LMU F;  4FYD A;  2OUG A;  1YJU A;  3LP2 B;  2PA3 A;  5HJX A;  5A2Q U;  3AOA A;  4C8O A;  4JV2 A;  3G9C A;  3BGF A;  4UTG A;  1HKA A;  3UCU P;  1FEH A;  2XMU A;  5DGB A;  2IVM A;  2YKN B;  2DGT A;  2AP6 A;  4YEA A;  3T5H A;  2HPU A;  2CG4 A;  4KC5 A;  4U9R A;  3TOQ A;  5H9E J;  1ZTT A;  3GLJ A;  3UN5 A;  3BH6 B;  4NXM F;  1J5O A;  2I38 A;  1MW7 A;  3KLG A;  3D0G E;  3RBZ A;  4C2M A;  1JKH B;  3GIR A;  1KTV A;  3F41 A;  4ZIW A;  1XMQ F;  5DDR C;  2YPY A;  2BKN A;  3HD1 A;  2K3K A;  3FMB A;  2YNF A;  2V50 A;  3VWS A;  2IBK A;  3HKW A;  4ID5 B;  4DR4 J;  2DGO A;  2JL9 A;  4DCP B;  4LF8 J;  1Q8B A;  1NXI A;  3E2E A;  3CW2 C;  1MSW D;  3Q83 A;  4QYR A;  5DGA A;  2X1F A;  5KFP A;  1M0S A;  4YB1 P;  2IA6 A;  4A8F A;  3T1H F;  4TU8 A;  4KT0 C;  3R2C J;  4JYA J;  5EX0 A;  1PYS B;  4JI6 F;  5F3Z A;  3KHH A;  3BGL A;  4JI5 J;  4K0K F;  4IOA Q;  1VYA A;  4TKT A;  1HAR A;  4FNI A;  3MR2 A;  3RUB L;  3F0N A;  4WTO B;  5CD4 A;  3MCS A;  3UVJ B;  1C4C A;  4CYU B;  3LP1 B;  1AXQ A;  4F2R A;  5ETS A;  1T7P A;  4O3R A;  3QLH B;  2HGL A;  2EK1 A;  3FBF A;  1XN9 A;  2C3U A;  2XHC A;  3A13 A;  4O4G B;  3HVT B;  4GC6 A;  1O0P A;  3MM6 A;  4O3Q A;  1ULR A;  4OX9 F;  1MMD A;  3PNI A;  2R2S A;  2ZBR A;  1MU2 B;  2UXC J;  4YOE A;  3BBC A;  2VBX A;  4DV1 F;  1NPK A;  2I1R A;  3U1L A;  4M5K A;  1Q53 A;  3POT A;  4HH1 A;  3X3U A;  1B3T A;  2IYI A;  4LFA J;  2HEK A;  2QC3 A;  4HHU A;  4NOH A;  2NR0 A;  3LP1 A;  1NKB A;  4B3M F;  2EPI A;  3EVW A;  3ITH A;  3DRX A;  4DV7 J;  3G6X A;  5KG2 A;  4ZLN A;  2FJV A;  1F9H A;  4QIV A;  2EG2 A;  1HL6 A;  2D3Z A;  3DMJ A;  4DV0 J;  2W9B A;  2R8I A;  1JQG A;  1TKD A;  1CQM A;  1R8B A;  4X4V A;  1VOM A;  3GR0 A;  1SV5 B;  2MQO A;  1EP4 A;  1S72 S;  5D4P A;  4KHP F;  4NZ6 A;  4F8R A;  1KLN A;  3CTR A;  1OPZ A;  3DRP B;  1S10 A;  1VK8 A;  5D77 A;  2H5J B;  4KE5 A;  1KDN A;  3OHA A;  4DFM A;  2OEM A;  1VRT B;  4ZVE A;  1L3K A;  2NXN A;  3G82 B;  2VIH A;  2YXL A;  2LQJ A;  5A8W B;  2ZVI A;  2Z56 B;  1Y3J A;  1CSJ A;  1H3D A;  4NI2 A;  1NUE A;  1X4C A;  4YR3 A;  3CJ5 A;  2YWF A;  3C19 A;  3MUR P;  3TUP A;  1HFE L;  2ADB A;  4EO6 A;  4BDP A;  2A10 A;  2GQC A;  2ZKT A;  2MGZ A;  1AYE A;  2I8E A;  4NLO A;  4NL5 A;  4WK1 A;  1OJ4 A;  2Y1J A;  3CC4 S;  1X0P A;  2UUB J;  4RWW A;  3OUY B;  2O66 A;  2CNK B;  1NJW A;  2HZA A;  1S0M A;  1M5P C;  4PQA A;  1RT5 B;  5IC4 B;  1RT6 A;  2V4J A;  2QFI A;  1VHF A;  2KFZ A;  1U02 A;  1QE1 A;  4KKO A;  1RAF B;  4NX9 A;  4QPT A;  2DY9 A;  4TU7 A;  5A8K A;  3MM5 B;  5BR8 J;  1HQE A;  3V6K A;  4CLS A;  3CJ4 A;  3PYF A;  2NYH A;  2HQG A;  3FFI A;  4RUH A;  2DGW A;  3I5A A;  4MTP A;  3P4U B;  2PEH A;  3OTC A;  3AA9 A;  3Q86 A;  3I96 A;  2WZ1 A;  2QYG A;  1X31 C;  3L09 A;  2DK2 A;  3W2V A;  2DNZ A;  3ISN C;  2DGV A;  5C2C A;  2OPS B;  5K8M A;  1S76 D;  4WZQ A;  2PII A;  1RBL A;  3N79 A;  1HNX F;  3M4X A;  2AYG A;  3ILL A;  1C0U A;  4RL1 A;  2EXU A;  1NK9 A;  3DOK A;  3HPO A;  1TKX B;  2ACY A;  4ZVT B;  1U2R A;  3D0I E;  2UUT A;  2VC0 A;  2BRL A;  4HI1 A;  5B0A A;  4JUZ A;  3PEH A;  2ZJR Q;  1N5V A;  2ZNZ A;  5KG1 A;  3C6U A;  5F41 A;  4CDI A;  1GXL A;  5KOX A;  1RAH B;  1NPP A;  1N5Q A;  4IYQ A;  1WEX A;  3EDQ B;  4PR6 A;  3IWL A;  5DLF A;  2G0J A;  3MMB A;  3T19 A;  4B9U A;  2J7U A;  4OYA A;  2GV1 A;  1NSA A;  2V8H A;  1NZA A;  5BJR A;  5AXN A;  4I64 A;  5KT6 A;  1KD1 T;  3A3O B;  4NRT A;  3K58 A;  1K0T A;  4DQS A;  4HHH A;  1EKR A;  4USM A;  2EEY A;  2AYM A;  2VF3 A;  2ZDO A;  3BBB A;  3CDE A;  3AOD A;  3FCW A;  4CM0 A;  4FS2 A;  2GX8 A;  3BGR A;  4OZJ A;  4Q43 A;  1I1G A;  1FHT A;  3HFZ B;  4IUF A;  1WI6 A;  1RAO A;  4JI8 F;  3W2W A;  2OEK A;  4TY8 A;  4IO9 Q;  1RK8 A;  1FKP A;  1RKI A;  3RYL A;  2MDA A;  3M6X A;  3KJV B;  2W24 A;  3OL7 A;  2XQC A;  4J7C A;  2RE1 A;  3K17 A;  1OY8 A;  4LFC J;  3FCH A;  2UUB F;  2M88 A;  4RW6 B;  4IG3 A;  3O1L A;  4B17 A;  1FCA A;  1RWO B;  2CQ4 A;  2PMZ D;  4ZLL A;  4URS A;  3CT9 A;  3TYT A;  1RTH B;  3LPE A;  5AT1 B;  3D4J A;  4FYY B;  2KXF A;  3SXL A;  4DI6 A;  4CZC A;  2FJA B;  2XWY A;  4ZVF A;  4U7U D;  1FES A;  1GTH A;  4MYT A;  3SCJ E;  4RW9 A;  2OEL A;  4BCA A;  2KFY A;  3M8R A;  1SC3 B;  3D68 A;  2XCP A;  1VGY A;  4IFV B;  2K06 A;  1RAI B;  4PAA A;  2QLW A;  1PGZ A;  3GWC A;  4F25 A;  1KSP A;  2MKC A;  4I2Q A;  2DEJ A;  4IFY A;  2M8H A;  1YJN S;  1S0O A;  3M2U A;  4Q0B B;  4O0I A;  3G6V A;  2RQC A;  4DV6 F;  2HHH F;  4WE1 A;  4F4K A;  3OSP A;  4DR7 J;  5F8N A;  1FER A;  4K8R A;  3GMG A;  2WCX A;  1RHK B;  3GIL A;  1J5O B;  3KDO A;  1NHK L;  2DGS A;  4MIA A;  3E8O A;  5F8I A;  1U1L A;  1IKX B;  5CD4 H;  3KLG B;  4B3R J;  2P6T A;  2DIU A;  5AJ3 J;  1RHR B;  2VBZ A;  3ETO A;  1YZ6 A;  3BYR A;  3G86 A;  3SYZ A;  1LW2 B;  4DR5 J;  3KLI A;  4K4V A;  3LPY A;  4NXN F;  2W2P P;  1ZBT A;  2ZBI A;  1S1W A;  3ITH B;  4ID5 A;  5M2R A;  1NME B;  1S48 A;  4P2F A;  3SV4 A;  2Y1I A;  2HMI A;  3MZI A;  4R0E A;  2D3U A;  3DNC A;  4DR1 J;  1U25 A;  5I42 B;  4X4T A;  5KFT A;  2OPP A;  4DV1 J;  4DQP A;  4CYU A;  4F0H A;  1IKX A;  3W63 A;  2R7O A;  2M7S A;  3OXL A;  4OX9 J;  2NSB A;  2H51 B;  2L9D A;  3UVJ A;  3RB0 A;  4IRC A;  2RF2 B;  3R8Y A;  3KLI B;  5F3T A;  4Z7C A;  4R25 A;  4OI0 A;  2F9D A;  4ED4 A;  5A0Y B;  3HVR A;  2O5D A;  3TVZ A;  3SCL E;  4EZ9 A;  2ZDP A;  2BAB A;  4BWM A;  1KHV A;  3PYG A;  1ZZF A;  4OYM A;  1MG7 A;  4MK9 A;  3H4B A;  1HBM B;  3BS9 A;  3HO1 A;  3G87 A;  2FHO B;  2I0X A;  1VRQ C;  4RU9 A;  2EG1 A;  4RU2 A;  4J5O A;  4LF7 F;  1DLO B;  2JH3 A;  3OR1 A;  1RAC B;  4MIW A;  3W66 A;  5B08 A;  4W90 B;  2UXD J;  2AZ1 A;  4OI3 A;  5E3A A;  2C3O A;  4XTT A;  5EGY A;  4XPC A;  3MF5 A;  4CLT A;  2NPI A;  2OLW A;  1JNR B;  2QMU B;  4CLL A;  3GV7 B;  4N5S A;  1ZYQ A;  4JI4 F;  4X4N A;  2DNY A;  1X4H A;  1A6L A;  3GFX A;  3M6W A;  5B0F A;  2AEJ A;  1A7G E;  1GX6 A;  4C8M A;  3HHE A;  4V19 X;  2FVP A;  4NE9 C;  3EZO A;  1K73 T;  3H59 A;  4DSK A;  1YLX A;  1KOO A;  1IJF B;  2C3P A;  2IM2 A;  4RNO A;  1FNO A;  2J9D E;  3DKD A;  3IRW P;  3DN9 A;  2DRD A;  4ED7 A;  1KN6 A;  1LFP A;  2MZJ A;  2OPS A;  1C1C B;  2GZO A;  2HS0 A;  5C24 A;  1RUS A;  4ED5 A;  1N33 J;  4RW4 B;  3QO9 B;  1EET A;  4K5R A;  5DM6 Q;  4DV3 F;  3HXM A;  3M9M B;  3OR2 B;  4UT4 A;  3D7S B;  1SUQ B;  3E01 A;  4Y2I A;  3OL6 A;  1U47 A;  2K7J A;  4OLP A;  5M2U A;  3QT6 A;  1XER A;  2DHH A;  4ES3 A;  2HLT A;  2COL A;  1X9M A;  2BOP A;  4K2X A;  2JLE A;  5C42 B;  1CBK A;  2JRS A;  3MMB B;  3HJF A;  2ZWP A;  2DNO A;  3CO0 P;  3C3L A;  3HD2 A;  3PV8 A;  1WOS A;  4N47 A;  1N32 F;  5B0E A;  3MED A;  2HHV A;  1A9N B;  2VL1 A;  3HJV A;  3M8Q B;  4YHH J;  2LEC A;  1IBC B;  4U7C A;  1T3N A;  1RAB B;  4RPF A;  2FVQ A;  2KM8 C;  3WQP A;  2B9E A;  3ELH A;  2IJN A;  2R4F A;  4BHQ A;  4K4Z A;  1Q8I A;  1YJT A;  5KT2 A;  2ZH4 A;  1R27 B;  3SSQ A;  5J2N A;  3FEX B;  5LMN J;  4ZP9 A;  1VQN S;  3HHN B;  5KFX A;  3ENA A;  3R2D J;  3AB2 B;  3RRG A;  1N88 A;  2E66 A;  2RIL A;  3C6U B;  3CO9 A;  1S0N A;  2O3D A;  4Z7Y A;  3J7Y I;  2HIY A;  4BC9 A;  2KYX A;  4I7F A;  4A8X A;  3MR5 A;  3R7S B;  2OH2 A;  4C0B A;  1RYS A;  3VZH A;  3G6E S;  2PFD A;  2JEF A;  4H54 A;  3R5B A;  3THP A;  4GMK A;  1B70 B;  1H72 C;  4FPR A;  2F9J A;  2DIS A;  3T9Z A;  1VBY A;  1J5E F;  3HP6 A;  1CEZ A;  5GAH I;  1RT2 B;  1WC0 A;  2F7V A;  2MZQ A;  1DRZ A;  2QX0 A;  3H5Y A;  5B7W A;  4DPW A;  2B4O A;  2KT3 A;  4CLZ A;  3HHL C;  2X1B A;  4CO2 A;  4J9P A;  4X4O A;  3J7A 1;  3IA0 A;  3IM9 A;  4AT1 B;  3RU0 A;  1N54 B;  3BN7 A;  4UQT A;  1G6B A;  2V2Z A;  1FX4 A;  3L7P A;  4QWE A;  2OMO A;  3EE3 A;  1D8Y A;  4DPY A;  4ZHR B;  3VV2 B;  5JXS A;  2NRE A;  3HCX A;  4YR2 A;  2YNI A;  3BF4 A;  4L72 B;  2B5J A;  1V3Z A;  2V6A A;  3RZA A;  3MUV P;  4X2B A;  1UMJ A;  3P5B P;  4NML A;  5KG3 A;  2OPR A;  3J80 Y;  3RAX A;  2BZ2 A;  2IIH A;  4C11 B;  1RHQ B;  2DIT A;  4MIB A;  1JLA B;  2JLF A;  5J1E B;  2FLL A;  1QM9 A;  4YR0 A;  1TAQ A;  3NNH A;  1WUU A;  1SXL A;  2HQC A;  1YGY A;  4KQZ A;  2Z4P A;  5IC6 B;  2RRN A;  4PPD A;  4MJK A;  4QBU A;  2DXE A;  2C3M A;  3IWX A;  2ERR A;  2E5L F;  1QLN A;  3OFH A;  1HI0 P;  2VFV A;  4CQ1 A;  4TYB A;  3C46 A;  3FVY A;  2XSJ B;  2IPO B;  5KFQ A;  2GO9 A;  3M32 B;  1GAO A;  1LWF B;  1R8A A;  2DNH A;  1UPP A;  2LP4 A;  2YKQ A;  3LW5 C;  2R9L A;  3QGG A;  3QT8 A;  5D4N A;  2E29 A;  4M5M A;  4F04 B;  3RB3 A;  2OFG X;  1KS2 A;  2ZBP A;  1IBL F;  5GAG U;  2NZ4 A;  2IJR A;  5D3G A;  5AJ3 F;  4KHP J;  4U8V A;  4KH0 B;  2VG6 A;  3MEE B;  1B7Y B;  1N34 J;  4TLR A;  1HIY A;  1RT7 A;  3ZTO A;  2KM8 B;  3LWL A;  1B0P A;  1FWL A;  1NK0 A;  1ZET A;  3BSC A;  2DNR A;  4ED2 A;  4YP3 A;  1NSP A;  2R7W A;  3A3N B;  3ZZP A;  1R6Y A;  3NOG A;  4H4O B;  3WIV A;  1JKH A;  3KLV A;  1DBD A;  4DPO A;  4WF9 Q;  2IA0 A;  4LIW A;  2HQD A;  2QIF A;  3IFE A;  4OHX A;  1O8B A;  4OI2 A;  1RWM B;  4PWU A;  3BDP A;  4QWA A;  1RJJ A;  1BHN A;  4LFA F;  3CJ2 A;  5CYM A;  1S1T B;  2J8A A;  1GMV A;  4I6W A;  1FRM A;  5KG6 A;  1U8W A;  5IM0 B;  2WTF A;  2AJ4 A;  2W2O P;  4OZ5 A;  1SQG A;  3LWM A;  4PRF A;  1W26 A;  5DDQ C;  1RAE B;  3G8Q A;  3SFU A;  4DSF A;  4NLG A;  2JX2 A;  1ARO P;  3OR1 B;  3MM7 A;  2ZH7 A;  2HQ3 A;  1SJ3 P;  3U7J A;  2HAI A;  5BYS A;  2JZ5 A;  4LBP A;  1PJ6 A;  1YJV A;  5KFO A;  2J6S A;  1DLO A;  3OVA A;  2GGP B;  1WWH A;  4EBC A;  1TFY A;  1S1T A;  4KY3 A;  2B51 A;  4PG4 A;  5DET A;  1O51 A;  2OGU A;  1OWX A;  4PG5 A;  2YH1 A;  3OBI A;  3K2Y A;  3P3D A;  1VBX A;  1VCT A;  4K0K J;  4A47 A;  1SVD A;  3Q0A A;  1RWU A;  2IJF A;  4GVB A;  2E9T A;  3ENW A;  3KJF B;  1RCX B;  2OEJ A;  2QO3 A;  2PSZ A;  3CDB A;  3W8P A;  4KBI A;  2UVW A;  2ZKU A;  4IOB A;  2KL8 A;  3BSO A;  4LF8 F;  2CWK A;  4NA1 A;  3TA1 A;  1SPB P;  3LUY A;  4MKA A;  4KSE B;  2ZM6 F;  3IO1 A;  5L1L A;  3OHB A;  2KVI A;  1I5O B;  4FYX B;  4Y34 A;  4YHH F;  4CLU A;  2DB1 A;  4WFZ A;  3TRG A;  1U1P A;  4KGX B;  1IKW A;  4ECQ A;  3QRQ A;  4DL0 C;  4G1Q A;  4KR0 B;  1XEZ A;  2BJE A;  1I6J A;  2I5J A;  1QVF R;  4M94 A;  2Z2M A;  1LEO A;  4K2J A;  5G0R B;  3UE2 A;  1LXJ A;  4FP9 A;  1J5E J;  3Q24 A;  1NK7 A;  4V1A k;  5KFS A;  5I3P A;  4ATN A;  5B09 A;  4DUZ J;  1RTZ A;  2HS4 A;  2YKA A;  4WTY A;  3K5L A;  1TFW A;  4X62 J;  3HM9 A;  1VFJ A;  3RBD A;  4W98 A;  2W25 A;  1U48 A;  2PDA A;  3I6P A;  1U1M A;  4Y2A A;  1SC4 B;  3FZB A;  3DRR A;  2R7X A;  4HVZ A;  1SQF A;  3K8W A;  3ZXW A;  2CZV C;  4XDD A;  5BR8 F;  2WBR A;  2HRY A;  2WSC C;  4L74 A;  4I56 A;  2VFR A;  5LMN F;  1YIT S;  3NL0 A;  4NCA A;  2HBY B;  3M1V B;  1FTR A;  1NKE A;  3MPU B;  4ILM A;  2B0G A;  1T9U A;  1LWX A;  1DTT A;  1LW0 A;  1BQM A;  1S49 A;  3CMQ A;  3D67 A;  2XMM A;  3DGP A;  3W8G A;  5BYR A;  1UA1 A;  2J0W A;  2BYC A;  2XZW A;  4IG0 B;  1VHI A;  1N32 J;  4J9Q A;  2WON A;  3M2V A;  2HBQ B;  4OQJ A;  1R8H A;  1NB7 A;  2CPH A;  4NLQ A;  3WX8 A;  1Q5Y A;  3KUG A;  4ZCM A;  5M2P A;  2ZM6 J;  2DHS A;  3BPS P;  2ZH2 A;  3K5O A;  2UXD F;  3BR8 A;  1X5P A;  4OYO A;  1D9F A;  1MWQ A;  1R31 A;  3CJ8 A;  2JWN A;  1FK9 A;  2E1C A;  1NDC A;  2XMV A;  4A8Y A;  3KG1 A;  1HBO B;  3V6J A;  4U96 A;  5B0D A;  2HZC A;  4FF4 A;  1RGV A;  1WC3 A;  4PXC A;  4AQY F;  2BUN A;  3EX7 B;  4URQ U;  5L1K A;  1QAJ A;  2C2K B;  1H2U X;  4GO5 X;  1N33 F;  4K4X A;  1M90 T;  3NXZ A;  3BO4 A;  4A8K A;  2R2R A;  3SV3 A;  1J27 A;  4TN2 A;  2MJU A;  1YSJ A;  4DV0 F;  5H9F J;  5AXL A;  3PX4 A;  2B9X A;  1SKR A;  3F56 A;  1RDR A;  5A6P A;  5CYQ B;  4AL7 A;  1Y10 A;  5L8R C;  3V5R A;  1TL3 B;  2MYF A;  3CD5 A;  5BYQ A;  1X4F A;  2LQ9 A;  3Q8Y A;  5DS7 A;  5J2P B;  3M6U A;  1DAR A;  3T5K A;  4DL4 A;  5HQ8 A;  4JI0 F;  1IXK A;  1WF1 A;  3AHP A;  1RTJ A;  2Q6C A;  3P6Y C;  3D2W A;  4ECU A;  1XNQ J;  4JI4 J;  2JC1 A;  5CHC B;  4RNF A;  1KHW A;  5KAK A;  2Z30 B;  2UXC F;  2N3L A;  4TQR A;  3VR1 A;  5MLC V;  2A6M A;  4B3R F;  4ED6 A;  2ZBQ A;  1UWB B;  1L5U A;  5IT9 U;  2E5I A;  4LF7 J;  3TI0 A;  1EJ7 L;  1U09 A;  2ZHO A;  1RT6 B;  2ROE A;  2XWX A;  5L39 A;  3AXK A;  3KLH B;  1QE1 B;  1SIZ A;  1H98 A;  1LK5 A;  1X8D A;  1YTY A;  2CPF A;  3PZP A;  1MMN A;  3R6G B;  4USJ C;  2XG8 A;  4JYA F;  3GII A;  2DT9 A;  3IBF B;  4HI2 A;  5D4L A;  4OYX A;  1Z2Z A;  2RT3 A;  1YWX A;  2HFN A;  1JLG B;  2Z2L A;  4QR1 A;  3MXH P;  3IRX A;  2DNP A;  3GG0 A;  3V4I A;  3A12 A;  3NY0 A;  2A2D A;  5DG8 A;  4DF4 A;  4RUA A;  3JYT B;  1HQ2 A;  3MTJ A;  1CQN A;  4NRU A;  3NS5 A;  3LTO A;  1PCA A;  3AOC A;  3C16 A;  2DNL A;  4WII A;  5IQ6 A;  4ED0 A;  2ZFH A;  3OFF A;  3I0S A;  3DHW C;  4KO0 B;  1NJI T;  1MWZ A;  1OPI A;  3QGP A;  2WW4 A;  4NXN J;  5KT5 A;  2NS1 B;  1GQE A;  2KKH A;  3BKT A;  2OJ3 A;  2ZOF A;  3IRX B;  1FKO A;  4ZPA A;  4NZ7 A;  4OZ2 A;  4OYB A;  3VQT A;  4ES2 A;  3KHG A;  4ERD A;  1CUL A;  1REV B;  3EGN A;  2DCL A;  2BW2 A;  2NUU G;  2HBZ B;  1SIW B;  3I5C A;  4R5P A;  2QMW A;  3MFI A;  1S6Q A;  5DDO C;  3GQC A;  1SJR A;  3FKB A;  2CAJ A;  6AT1 B;  3G8S A;  1VDH A;  3D54 A;  1ZM2 A;  2DNK A;  3IBW A;  3M8Z A;  4A8W A;  5LJ3 Y;  4B3S F;  3PKM A;  4DL2 A;  1SH0 A;  4AUK A;  2Y9H A;  4RKU C;  2R7T A;  3M7V A;  5F8G A;  5LXR A;  2BRK A;  2DR7 A;  2FJE B;  3H8Y A;  4UUX A;  2PC6 A;  3HF5 A;  3SBM A;  1D9D A;  2KZM A;  2YWK A;  5C25 B;  3A3P B;  4IKA A;  4P2M A;  3LP2 A;  3DLG B;  1U1Q A;  3CJ0 A;  5IFM A;  2RVJ A;  2YKM B;  3AFG A;  1Q16 B;  1FXR A;  2AF6 A;  1FE4 A;  2BE7 D;  3F44 A;  5KFA A;  4EMD A;  4F0K A;  3EZ5 A;  1G7C B;  1P8G A;  3DXS X;  1JWW A;  1GEH A;  1OY9 A;  1QDU B;  1RT1 B;  3AH6 A;  3H7H B;  1FO1 A;  1PBU A;  3NGK A;  4M5L A;  1N6Q B;  1CS4 B;  1R0B G;  2BJ8 A;  2D69 A;  4NLU A;  1U0S A;  2J8S A;  4JI8 J;  4TQS A;  2M2B A;  3BPD A;  4WJB A;  4EK2 A;  3BKU A;  3PW5 A;  2M52 A;  2XYH B;  1Y0H A;  2O01 C;  4OZ0 A;  5CXT A;  4ZVQ B;  1S7I A;  4C7Q A;  3QWU A;  1S99 A;  1OIA A;  3ZTP A;  3QZ7 A;  1G3O A;  5KFR A;  2I5J B;  2XZD B;  4ZJQ A;  2KVQ E;  2NPF A;  3QAE A;  2QA4 S;  3R97 A;  1TK0 A;  2G0C A;  1CS4 A;  1WG4 A;  3TP2 A;  2VBY A;  1GT8 A;  2RQK A;  1F3V A;  4DFK A;  2MB0 B;  3DC2 A;  3TX0 A;  5GAD I;  3NNA A;  1YJ9 S;  2G1H A;  2V69 A;  4MMO A;  2XLI A;  2HVI A;  1FE0 A;  2E7V A;  2JDJ A;  5D0H A;  2HMI B;  1KQS R;  1H7W A;  1QSL A;  5HN0 A;  3A4T A;  2UVU A;  1S1U B;  2NXC A;  3IMQ J;  3PIO Q;  3FBB A;  4IDK A;  3MEC B;  2XZT B;  3R5C A;  3TWZ A;  3PRD A;  5I42 A;  1TK8 A;  1JLF A;  1HNX J;  5CZV A;  2DXD A;  3MMA B;  3O8W A;  1ZPV A;  4TY8 B;  5HJY A;  3N5B A;  5F8L A;  3BO3 A;  1FRK A;  2UXB F;  2G2Y A;  2W2Q P;  3CB4 A;  5HSP A;  3BH7 B;  2GVD A;  2R2U A;  2QYC A;  3H42 A;  5HO4 A;  4WFA Q;  1V5V A;  4R8U B;  3ZZR A;  3SCK E;  3MM8 B;  2PO4 A;  4L73 A;  1PJ7 A;  1TV6 A;  2ZH9 A;  3OQ2 A;  1N34 F;  4DOZ A;  3GP9 A;  1FX2 A;  2ILZ A;  3GON A;  4GC7 A;  4FYV B;  2VOP A;  2HHX A;  4P2S A;  2RH3 A;  1PG5 B;  1RT4 A;  5B0B A;  4QWC A;  5HP1 B;  2FB0 A;  2XI3 A;  4B3M J;  4IH5 A;  5HI7 A;  4E8U A;  2CA9 A;  3MAA B;  1KVJ A;  2QEX S;  3H2V E;  3S1T A;  2F63 A;  2KRR A;  2DGQ A;  2G0I A;  1URN A;  3NS7 B;  4KYZ A;  1VQO S;  2RDD A;  3QQC D;  3PR4 A;  2P5V A;  2Q3P A;  3NS6 A;  1S79 A;  4KIA A;  2R42 A;  4F3Q A;  2E5L J;  2OTL S;  5IOL A;  4C3K A;  4LFB F;  4ALZ A;  3ILO A;  2K7K A;  3H4D A;  1WHW A;  1R0A A;  2VKR A;  1XC9 A;  3TZZ A;  3E3X A;  5J1E A;  1WEL A;  2CQI A;  3NMA A;  3I87 A;  3JSY A;  4OJ1 A;  4ECY A;  3DRY A;  5KT3 A;  3QFW A;  2DIV A;  4PUO A;  3JQM A;  4UQG A;  3RBE A;  1RTD A;  3LQV A;  2W9C B;  3OFE A;  4OZ3 A;  4H4K A;  3NBP A;  3LF0 A;  2IVF B;  2CZ9 A;  1NM2 A;  1HYS A;  1XMB A;  2IM1 A;  4ZIV A;  2HZV A;  4AXJ A;  4I0W A;  4G1P A;  2LU2 A;  4LIR A;  1QD1 A;  3TZW A;  2W7O A;  3UDE A;  4KGM A;  1FFS B;  4GKJ J;  4LVN P;  4Q2L A;  4R0J A;  3W5X A;  2P8I A;  1RAJ A;  4C98 A;  1CC8 A;  4RBV A;  1RZM A;  2MY8 A;  2R3V A;  4WFN Q;  1XNQ F;  2BQ3 A;  4LSZ B;  4DR1 F;  2GMJ A;  4ECR A;  4JI0 J;  2X1G A;  2J9D A;  1H2V Z;  1NSK L;  3J7Y U;  1FJE B;  4LR8 A;  3Q2T C;  5AXK A;  3PYE A;  4DL7 A;  5IT0 A;  3CDW A;  2HWH A;  1EZZ B;  5GAE U;  3W5Z A;  4J9L A;  3BB5 A;  4E98 A;  2CPZ A;  4B02 A;  1HNW J;  1DTQ B;  4UOH A;  3UDC A;  2DXF A;  3DOK B;  3J81 j;  4YB5 A;  2JC0 A;  1WOO A;  4ZVS B;  3ZZO A;  1TL7 B;  2BJ1 A;  5LMU J;  3KNG A;  4OV6 A;  4W4M A;  5KFG A;  4DX8 H;  4RW8 B;  3U27 A;  1YJ7 A;  4YUD A;  5ITH A;  1T05 A;  4TU9 A;  2EI5 A;  4N56 A;  2AYE A;  1NDK A;  3D3B J;  4LR9 A;  2BV3 A;  4PKD B;  5IZH A;  1JLG A;  2V2K A;  4FDF A;  1IR2 A;  3JYT A;  4J90 A;  2W9A A;  3CCE S;  2HHH J;  2J0S D;  3W9J A;  2HSE B;  3V4I B;  1UVL A;  4OZN A;  2FGC A;  2EFN A;  2MHE A;  3W7B A;  5LSO A;  4B9L A;  4JI6 J;  1LKZ A;  3QJP A;  2GHP A;  4EBE A;  2ZHA A;  2C22 A;  4C48 A;  1KVI A;  3FFI B;  2DJW A;  4DV5 J;  2AGP A;  1UP1 A;  4DZ6 A;  4Y0F A;  4TXS A;  3SSS A;  2LQ8 A;  2EVZ A;  2DHG A;  2GIQ A;  2QGF B;  2N82 B;  4XAK A;  4U67 Q;  4B3O A;  2BW7 A;  2RJZ A;  4WXO A;  5HMY A;  1UEU A;  3VHQ A;  3VAL A;  4F2S A;  4ZVH A;  3LOU A;  2BKP A;  3NAH A;  3BR9 A;  3PJW A;  5HMW A;  4X65 J;  3JB9 k;  4JI2 J;  2GJF A;  3OPK A;  2LQ5 A;  4MKV A;  2P9E A;  5D6G A;  2ZZT A;  4PWD A;  1IM4 A;  4G1I A;  2Z2Y B;  4Q45 A;  1SUQ A;  1T3O A;  2NXE A;  3E01 B;  1H0H B;  4KGV B;  5KG0 A;  1WDT A;  3B54 A;  4I2P B;  1RHM B;  1B0T A;  2M9K A;  1Y00 A;  2F8H A;  3ET6 A;  1WKJ A;  3U1M A;  2ZE2 B;  4F50 A;  4UZB A;  4C4W A;  3BQ0 A;  4UZC A;  1HMV A;  1HPZ A;  2Z58 B;  4QPX A;  2HLU A;  1OYD A;  3QWP A;  1FD2 A;  4GO7 X;  1IJE B;  1U2F A;  1HNI A;  2NLW A;  4OJG A;  1RBA A;  2EFO A;  2RB7 A;  3ZZU A;  2X1A A;  2B5J B;  4NYP A;  2VG5 B;  2XUL A;  2VPY B;  3SEO A;  2RRA A;  1L3U A;  2DNQ A;  4Y2C A;  3NGD A;  3OVS A;  3FRY A;  4WFY A;  1KON A;  5KFC A;  3HFV A;  4NA3 A;  1TP7 A;  4DSI A;  4RJV A;  4EZ6 A;  4PQU B;  1T9X A;  2DO0 A;  4Y6I A;  1V5I B;  4LRB A;  4BWJ A;  2HHW A;  1D09 B;  2WHO A;  3OLB A;  1T9Y A;  2X3D A;  1S77 D;  3MM9 A;  5B0G A;  3WX4 A;  2VUG A;  4ELU A;  3QLH A;  3GSD A;  2ZD1 B;  3K8V A;  2FJD B;  2VPW B;  4UOC A;  3HSZ A;  1VRU A;  1CUL B;  1VC5 A;  4ZJL A;  1ZA2 B;  1LWC A;  2BVZ A;  4NYO A;  4OX6 A;  1TK5 A;  1XR7 A;  3JSB A;  3QBC A;  2N3O A;  3AAW B;  4QQB A;  3CJQ A;  3W2V B;  2CKW A;  2F8M A;  2XEX A;  4LVO P;  3KLE A;  4IRK A;  4LBI A;  2HHP A;  2XBP A;  4ID8 A;  2X3G A;  2UZA A;  1OSD A;  3LH2 S;  3T6J A;  3QJJ A;  3RW6 A;  2AW0 A;  1N0U A;  3MPV A;  4MT1 A;  2VPZ B;  1LQ9 A;  1DAX A;  4I6Y A;  4DR6 F;  2FJX A;  4AD6 A;  5ETM A;  2ZOG A;  2FYX A;  2DH9 A;  1T94 A;  4S0M A;  4OI4 A;  3G2X A;  3MPW A;  4HTI A;  3ZTR A;  3AA8 A;  4H4O A;  1W7W A;  2CUY A;  4G65 A;  4HEA 9;  5K9F A;  2CDR B;  5T41 A;  2CPY A;  5L1I A;  3ZNU A;  4N76 A;  7FD1 A;  1WKL A;  2QG9 B;  2D9P A;  1F0X A;  1S1X B;  3UNG C;  2OP5 A;  4XK8 C;  4PUO B;  4CO4 A;  4M5D A;  2OSQ A;  3QGI A;  3TNV A;  3Q22 A;  2C28 A;  2WRM A;  5CYM B;  5DZ6 A;  4IQX A;  3R5D A;  4C8L A;  3K0J A;  2D3O 1;  1UJ6 A;  5L9X A;  3PJ9 A;  5IM0 A;  4LF5 J;  4YDD B;  2OPP B;  3HHL A;  2ZBC A;  3OVB A;  4J91 A;  1MWY A;  4DBQ A;  4FBU A;  4TNO A;  3CUL A;  2MLX A;  1RT4 B;  3NMR A;  3EUN A;  4HDH A;  2FGO A;  5CYQ A;  1EAY C;  2C2E A;  3U02 A;  1RHU B;  3JSM A;  1UA0 A;  1GXT A;  1S1X A;  4DU7 A;  4X4P A;  1HHT P;  1FXL A;  3SMZ A;  1C1B A;  2QLX A;  2FUG 9;  2VFS A;  4M1K A;  4NCG A;  2GGP A;  4EBD A;  1NK8 A;  4DR7 F;  1IKY B;  3AQO A;  3DMJ B;  5K8N A;  3I56 S;  1Y5I B;  2YWW A;  1I94 J;  3L7O A;  3R5J B;  2CIM A;  4U8Y A;  4DHV A;  2CQD A;  3TR5 A;  3TJ8 A;  5JVG Q;  3NWR A;  1Q82 T;  4OYW A;  3UR3 C;  3IN5 A;  1KNZ A;  3S01 A;  4ZN1 A;  4UY8 T;  2IAJ B;  3AT1 B;  3D1Q A;  4Q44 A;  2R7R A;  3PO5 A;  1S6P A;  2LDY A;  1VC6 A;  3EM1 A;  3OL9 A;  2GIR A;  2FD2 A;  2GC8 A;  2Y1L B;  2L9W A;  3O3L A;  5D0G A;  4JOU A;  4Q8E A;  1F60 B;  2ZWO A;  3GYN A;  3CCZ A;  3PM9 A;  2WB4 A;  3MHY A;  1K44 A;  2B7C B;  3H0P A;  2BE2 B;  3MTK A;  1C0U B;  2HNZ A;  3S8S A;  1EAR A;  1OSC A;  2IC3 B;  4M8L A;  4EI2 A;  4DS5 A;  5HQM A;  4O3S A;  4LFC F;  1UET A;  3C14 B;  4OHZ A;  1JJ2 R;  3C2P A;  2ZC3 A;  2NXJ A;  3TUJ C;  1FRJ A;  1EB0 A;  2CVE A;  2D74 B;  3ZZT A;  3CF5 Q;  2WSF C;  4QJV A;  3EPI A;  1S6P B;  2HFU A;  4AYB D;  5HMZ A;  2FLO A;  4DV4 F;  3LGH A;  4F4W A;  3RW7 A;  1KFS A;  1N8R T;  3R27 A;  1Q78 A;  5CA5 A;  3GIM A;  4DF8 A;  2DPI A;  2YKO A;  2ZUA A;  3I9Z A;  3K5P A;  3LAL A;  1R3N A;  1MLA A;  4MAK A;  3JAM Y;  4DR4 F;  2K3I A;  1YZ7 A;  3M2R A;  4NLS A;  3W62 A;  1S4E A;  2HW3 A;  1FJC A;  4I1T A;  3VGT A;  2HVD A;  1FRI A;  5EN1 A;  1JJ4 A;  2MJN A;  2RDI A;  1OQ3 A;  1UWB A;  2IVY A;  3N0V A;  2ADC A;  4PWD B;  5F0U A;  2RIJ A;  2XGQ A;  3L3C A;  1UPM B;  1K8A T;  2FHJ D;  3OV7 A;  3CCJ S;  2F3J A;  1RAA B;  1IM6 A;  3H5X A;  4DJB A;  1TL4 A;  2E5J A;  4G3I A;  1LWE B;  5H9F K;  4I6A A;  2Q6B A;  1UTA A;  5ETO A;  1BGX T;  3D5M A;  3C8Y A;  2H65 B;  3P49 B;  3MDF A;  3OTB A;  1RT3 B;  1DY3 A;  2EWH A;  2PMH A;  5E3R A;  1BUX A;  1T11 A;  2HK3 A;  2VH7 A;  5GAE I;  2EFP A;  3RAQ A;  2XNR A;  2BM0 A;  1PJ5 A;  3PRV A;  1Y7P A;  5AE1 A;  4HTJ A;  1W2I A;  4JB8 B;  4O44 B;  2ASD A;  2LEA A;  2LCW A;  5LL6 d;  4B3O B;  4WYL A;  4EO8 A;  1NK4 A;  2UUA F;  2E7X A;  3I4H X;  4HH0 A;  1M5V C;  3KYL A;  2X51 A;  3SQG B;  3ONQ A;  2OAU A;  5T7L A;  1VQ5 S;  1YI2 S;  4KGZ B;  2V34 A;  2Q43 A;  1U49 A;  1X5O A;  2F4V F;  2NZC A;  3EGZ A;  3UN2 A;  4LF9 F;  1FDA A;  3WIU A;  4P7T A;  2V4Q A;  1TUW A;  1F5B A;  2EW9 A;  3AD9 C;  3IAM 9;  4KH1 B;  4O44 A;  4WP9 A;  3T1Y F;  2CQH A;  2UU9 J;  2GJI A;  4YQW A;  2XS2 A;  1CJT A;  2C2Z B;  4I2P A;  1WTF A;  5HAO A;  3KLE B;  2VIC A;  2MZT A;  3GTY X;  1VI7 A;  2AJ0 A;  3WC0 A;  1DHM A;  4ZPD A;  2KTQ A;  1NAQ A;  3GJR B;  1UFK A;  4L75 A;  3LGN A;  2RSQ A;  4ICL A;  3MMC B;  4M5G A;  5F0W A;  2FJW A;  2LXI A;  3QAT A;  4FBT A;  3H5U A;  5CH7 B;  5D0E A;  1IWG A;  2BXJ A;  4A46 A;  5EWG A;  2RKI A;  4M95 A;  4WP3 A;  3GFY A;  2B3T B;  2CJ9 A;  1JLB A;  3M05 A;  3SDE B;  3N28 A;  4XIU A;  1DQA A;  2AZ3 A;  2H3E B;  1D3W A;  2OD6 A;  3BGU A;  3FBC A;  3PR5 B;  2IDL A;  1TAU A;  5D78 A;  2W4C A;  2GAG C;  2GA7 A;  2D9O A;  3CCT A;  3BQ2 A;  1FVQ A;  2YWG A;  5KFL A;  4J9N A;  3HT3 A;  3MAH A;  4M5D B;  4DX5 A;  2Z2Z A;  2CQP A;  3MEE A;  2PMW A;  4CP5 A;  4W92 B;  5CZX A;  1T95 A;  3GV8 B;  1UW4 A;  3V6D A;  2Y0S D;  4DV7 F;  2FIU A;  2AJ1 A;  2M4M A;  1NKC A;  3A1Y G;  2VAS A;  3DLK A;  3MMA A;  3NGR A;  4IO1 A;  4OV1 A;  4RBU A;  2YNG A;  4EGL A;  2V8D A;  1EQM A;  3JSR A;  2RU3 A;  5ETR A;  1VMB A;  2ZZM A;  5KFD A;  4Q8F A;  3GV5 B;  2I2Y A;  2KFN A;  4CLP A;  3PHT A;  3VZI A;  4KTQ A;  1T9W A;  3BBF A;  1K9M T;  4R8U A;  2JFK A;  3VGU A;  3R5G A;  1B0V A;  2RML A;  5KFB A;  4F02 A;  2LDI A;  1DZ5 A;  3I9V 9;  4EWT A;  1HWK A;  1N48 A;  1RU2 A;  5HK4 A;  4C9D A;  2P9G A;  2CJB A;  3RB6 A;  3QGH A;  5HP1 A;  4UY8 5;  2MLY A;  2W7P A;  1SL2 A;  3TEG A;  3MAQ A;  1HHQ A;  2AX1 A;  1X60 A;  2BEF A;  5IWA J;  2R7V A;  2CJA A;  3CMA S;  3PYD A;  5J1N A;  2WVF A;  1XNR J;  2LEB A;  2IRX A;  2IFX A;  1UEK A;  4HT5 A;  4NZ0 A;  4K4W A;  3T1H J;  1F2H A;  5LT5 A;  2ABY A;  1RBO B;  5FII A;  2R8H A;  1HNV B;  1OQ6 A;  2W7A A;  4PWW A;  3CCL S;  1B4S A;  4DFP A;  1QAI A;  1CJU A;  5DQH A;  1S6Q B;  3FC9 A;  4OJH A;  1EQ0 A;  1KLM B;  4QCL A;  8ATC B;  2Z0G A;  3D9B A;  3KK3 A;  5ETL A;  1TKZ A;  1CJV A;  3DLJ A;  3B6B A;  4CO3 A;  2VDH A;  3H20 A;  4QZV B;  1RTD B;  1TKT A;  4UW2 A;  4ZP6 A;  2RUG A;  2MKI A;  1TMM A;  1E6V A;  1WSV A;  3OTO J;  1RYR A;  2G2Z A;  3EPG A;  1FKA F;  2NXU A;  3FEY B;  4N77 A;  1T02 A;  4MK8 A;  4USK A;  3T9N A;  4V19 J;  1UZD A;  1QJH A;  3UCZ P;  1VIX A;  4DR5 F;  4QIG A;  4WU2 A;  2JSX A;  3B4D A;  2MSS A;  3CED A;  2RQM A;  4LQ9 A;  4Y2M A;  4ZJO A;  5IXU A;  2VHG A;  3TJA A;  1M5S A;  2J7K A;  3Q23 A;  3PW4 A;  2G1D A;  2UV8 G;  4LSL A;  1BQX A;  1KKH A;  1PIL A;  4YS2 A;  2VQF F;  3ISN D;  4I68 A;  1VQ7 S;  1TKT B;  2NYI A;  1YBA A;  4OHV A;  2G2O A;  1VQL S;  3KNA A;  1FF2 A;  2V4R A;  1HA1 A;  5FLX Y;  3ENQ A;  4DV6 J;  3G8T A;  1WD6 A;  1QVG R;  1ZAW A;  4FVM A;  3DM2 B;  3HVA A;  6FDR A;  4HKQ A;  1WNE A;  2VQE F;  1FWP A;  1ZAX A;  1XQI A;  1HBN A;  4FNH A;  2C2R A;  1IQZ A;  4ITS A;  3TAR A;  2XB2 D;  2VB6 A;  3WZ0 A;  2XHW A;  2H4Y B;  1JLE A;  2RU9 A;  1N0V C;  1YIJ S;  3FSX A;  2HQI A;  4EFA C;  4PPZ A;  3T5L A;  1XJW B;  1BMQ B;  2DNM A;  2HNY A;  1TQL A;  4OHW A;  2VG6 B;  3QAU A;  5HRO B;  3R5A A;  3PX0 A;  2KO1 A;  2MMY A;  4QU7 A;  4I69 A;  4DDF A;  3CJS A;  1BC6 A;  2CJX B;  8RUC A;  2FJB B;  3CWJ A;  2A2C A;  2FZG B;  2KB2 A;  1X4G A;  4CRJ A;  3KHR A;  4GKK F;  2H1Y A;  2LLZ A;  3KHL A;  3TA0 A;  1TKX A;  1AB8 A;  1HR0 J;  2XO6 A;  3DLE B;  3Q8R B;  2J9E A;  1G4C A;  2PE8 A;  4X4S A;  2VFU A;  4RUB A;  2DR5 A;  3GFH A;  3NWG A;  4WBF A;  2FVR A;  2CPX A;  2LFV A;  1KEK A;  2ACM A;  3QSY B;  4FN5 A;  3I32 A;  1DJ0 A;  2QA2 A;  3HHK A;  5EUH A;  5DQG A;  3NNC A;  3TO8 A;  1FWK A;  1HBU B;  5E5N A;  4D3H A;  2AT1 B;  1MN9 A;  2FHJ A;  1B99 A;  1PIE A;  1NHV A;  2DCU B;  1I51 B;  3NGT A;  3T1A A;  2CPD A;  4N8N A;  1UAW A;  3TA2 A;  3UI3 A;  4WKY A;  4ZKA A;  1CG2 A;  3KLF B;  3JSM B;  1P1T A;  1S9G B;  4LSN B;  2BJ9 A;  4QW9 A;  4WYW A;  3PIP Q;  2WK4 A;  4PYD A;  4QOT A;  1NU4 A;  1R8C A;  2YKP A;  3Q89 A;  4RW6 A;  2DPJ A;  4JI7 J;  1IVZ A;  4LUB A;  2FLP A;  4YN3 B;  1MRO A;  1U0H A;  3RAM A;  1Q8L A;  1WKK A;  2ZNY A;  3L9Z A;  3QT5 A;  4N7T A;  5SUH A;  3E51 A;  4IG3 B;  5J2N B;  4DCJ B;  2YKN A;  5EDW A;  4RNM A;  5E2Q A;  2IRY A;  5KFY A;  4LF4 F;  5L9N A;  3VGV A;  1R7I A;  2GS8 A;  1GH8 A;  2PT0 A;  1RTJ B;  2DHA A;  5JMN A;  2DNN A;  3BGO P;  4OYI A;  1UJ5 A;  3IGN A;  4YY3 F;  1LXN A;  4F4Z A;  1N5Y A;  2E5G A;  1U1N A;  4B9S A;  2QT7 A;  4NLD A;  4ZPV R;  3QFH A;  1VS3 A;  2FDN A;  1X9W A;  1GK8 A;  4IFV A;  3FEZ A;  1CJK A;  3CCS S;  4PCQ A;  1IBK J;  2KHD A;  3AJD A;  2HHU A;  1CVJ A;  2L9N A;  4WWS A;  3CIM A;  4LJM A;  2V9W A;  4Y2K A;  2OTJ S;  3O2I A;  3DYA B;  1Q79 A;  2CNL B;  1VK3 A;  3LGM A;  3M9N B;  1FDN A;  4KJI A;  1RLC L;  3M8W A;  3MGJ A;  4NLY A;  2Q66 A;  3TW0 A;  3MD3 A;  1RU1 A;  2OHD A;  3G4S S;  1NH7 A;  2JLG A;  1JLC A;  1HWL A;  1XBW A;  4LRA A;  4EYI B;  1IKV B;  2KZZ A;  2DGX A;  1BWE A;  1REG X;  4DCO B;  3V6H A;  1T03 A;  2VG7 A;  1YJW S;  4Q7A A;  2YNH A;  1FNM A;  3OXG A;  5ETT A;  3EVM A;  1NHU A;  4K4T A;  3B78 A;  1MU2 A;  4LR7 A;  1FEE A;  4L3K A;  4DN0 A;  1U45 A;  2WOM B;  3BEG B;  1FA0 A;  2YNG B;  2N4C A;  3MM6 B;  1VQY A;  8AT1 B;  4DR2 F;  1W2B R;  3M1V A;  5D4O A;  3F73 A;  3TVY A;  4DR2 J;  5F8J A;  4K4S A;  1OY6 A;  2OSR A;  1N36 F;  1DTT B;  1X4E A;  2V2V A;  1S9E A;  3MAA A;  4MH8 A;  4P72 A;  4JV5 F;  3RG6 A;  3D6H B;  4O3O A;  3PO4 A;  5LXY A;  2EFV A;  2VU5 A;  3MR7 A;  3ILJ A;  1W25 A;  2CQ2 A;  1WHV A;  1HQU A;  1X7V A;  2U2F A;  2V67 A;  3NCR A;  4KRW A;  2CQ1 A;  4MYU A;  2OFH X;  2W9B B;  2VON A;  2HVH A;  2V9K A;  5JUM A;  1KTQ A;  2HGN A;  3L7U A;  4GVB B;  1NDP A;  4J9S A;  2Q1L A;  3BRE A;  3EMT A;  1GXU A;  3QT7 A;  1EET B;  4FF1 A;  1VLO A;  2O67 A;  1RWP B;  2E7W A;  3GU0 A;  1KWM A;  2KHC A;  2W4D A;  3SFG A;  1VLY A;  3P45 B;  3HVT A;  4RUC A;  3GCX P;  3C15 A;  3R3T A;  3CJR A;  3U1N A;  1C0T B;  2JFD A;  3G96 A;  3H2L A;  2JEJ A;  1NSQ A;  2E9R X;  1FRL A;  1U4B A;  2QSF A;  2AEM A;  2WVD A;  3CUN A;  1SI9 A;  2KH9 A;  2CJQ A;  1ZZN A;  3TX8 A;  3VVT A;  3N5F A;  3POT B;  3HSJ A;  3JXO A;  2W8L A;  1X5S A;  1VQ9 S;  2K1R A;  4LRC A;  2O1P A;  1APS A;  3EWG A;  1M5K C;  3N6M A;  1TL3 A;  4ZVR B;  4USV A;  4KPY A;  5E33 A;  2F1F A;  2RS2 A;  3W65 A;  4KB7 A;  4FS1 A;  3RTV A;  2OPQ B;  1B64 A;  3GFZ A;  4X66 J;  1P9Q C;  3UN3 A;  2X7I A;  3OUY A;  4F3O A;  3CD7 A;  4WCE Q;  2LA6 A;  2VOD A;  4OJ3 A;  3QZ8 A;  4XPE A;  4A8O A;  2PFF B;  1H74 A;  2WSE C;  1AFI A;  3BYP A;  2V63 A;  2YQ0 A;  1XMQ J;  4WKR A;  4FZV A;  1O5J A;  3DLE A;  3OJU A;  1T9T A;  2CYY A;  2NUH A;  4CTA B;  1T05 B;  3RR7 A;  1HW9 A;  2YTC A;  3UO0 A;  2PN6 A;  4N41 A;  4NCG B;  3G82 A;  2QTW A;  4CI0 B;  1N4L A;  4M5N A;  4DN9 A;  5CQG A;  4K4U A;  4ETX A;  3FQL A;  2L08 A;  2RQ4 A;  1LFW A;  1LK7 A;  4NXM J;  1WEZ A;  2HK2 A;  1ICE B;  2MKJ A;  3LAN A;  3JAM U;  3FNN A;  2ATC B;  1G1X A;  4NEY A;  2XMA A;  2XY5 A;  4G1Q B;  3CJ3 A;  1SKW A;  1BQN B;  4FKX A;  3PX6 A;  2EBG A;  3BV8 A;  4BLG A;  2FC8 A;  1JLE B;  1Q0N A;  2HNY B;  3KDN A;  1XK8 A;  3H98 A;  4ZCI A;  3MD1 A;  3JQJ A;  3GB0 A;  2ALZ A;  1AFJ A;  2QSW A;  1TL1 B;  5FDL B;  4ANC A;  1HD0 A;  4DZD A;  3IWN C;  1HBO A;  1KQK A;  3B4M A;  4IOC Q;  1Z1Z A;  1Q86 T;  2CQB A;  4BS2 A;  4DFJ A;  3CCM S;  3DCA A;  2H5E A;  3DI6 B;  2FHM A;  2GVD B;  2YQ3 A;  2YX7 A;  3DRR B;  1S59 A;  5KFF A;  4ENO A;  2GIF A;  3FSY A;  4B9V A;  3QPI A;  3D6T B;  1WF2 A;  5HAN A;  1FI4 A;  1RQ0 A;  2I6W A;  1O6X A;  4KPC A;  2LA4 A;  1ZTW A;  4RLE A;  2WAQ D;  1AUD A;  1FKO B;  3BGR B;  4P74 A;  1MML A;  3A8I A;  2MQQ A;  1NB2 A;  2MKY A;  2H5I B;  2YWE A;  2NSC A;  5HL7 Q;  3ET6 B;  3DU6 A;  4OYZ A;  3NP5 A;  3OL8 A;  1VJQ A;  3CE8 A;  1YBU A;  1U1K A;  2LEP A;  1Y3K A;  4NEZ A;  1Q1K A;  4X4U A;  1D1U A;  3PFO A;  4AL6 A;  1NPR A;  4ZIT A;  3GIK A;  3BN4 A;  4O0N A;  3M2V B;  3P8B B;  4TY9 A;  3BKF A;  4YB6 A;  3MEC A;  3W64 A;  3KUH A;  2ZVS A;  3M8P B;  7FDR A;  1LNQ A;  4IRD A;  2AJ2 A;  2RUS A;  4QR2 A;  3ADA C;  5EX3 A;  3RJM B;  5E41 A;  4DSE A;  2XY7 A;  1NCL A;  4HDG A;  1VQS A;  2XYP B;  5IV3 A;  4PQU A;  2XSJ A;  2B7B B;  5JJB A;  2HUR A;  3K5M A;  4LMZ A;  1K47 A;  1PSD A;  1U6F A;  2N4D A;  2W1B A;  3MCN A;  4HL9 A;  4KGK A;  4B3T F;  2PI4 A;  4C0O C;  2OO4 A;  3NAI A;  4DV2 J;  3MUT P;  1D9A A;  4CLK A;  1C1B B;  3AY0 A;  2ZD1 A;  2E44 A;  2KJV A;  4YDX A;  5HLF A;  2FTR A;  1RWX B;  2XMK A;  1PBA A;  1RT7 B;  2YNI B;  2QN6 B;  3CJK B;  1HWU A;  2BA9 A;  3V2U C;  4QYZ J;  2J76 E;  4A4J A;  1FJ7 A;  1RT1 A;  3I55 S;  2AX0 A;  1N6Q A;  5CYJ A;  3UDV A;  3PW7 A;  1X0F A;  2VD3 A;  2IDE A;  3VTI A;  4X66 F;  3K59 A;  4LQ3 A;  3QIP A;  2HYI B;  3M8Y A;  2MEW A;  1WOP A;  4NMX A;  3GIJ A;  1JLQ B;  1M1K T;  3K5N A;  2G13 A;  2HND A;  4DUY J;  1RTH A;  1LW2 A;  4I4B A;  5D0R A;  4QU6 A;  2FZK B;  2XTJ P;  4DXL A;  4NCB A;  2CWX A;  3DLL Q;  4ZMM A;  1FFW B;  3BM7 A;  1L3T A;  2FVS A;  1HD1 A;  4DLE A;  1DTQ A;  2R8K A;  1XR5 A;  5KFE A;  1IKV A;  2H9Z A;  3V4M A;  4P52 A;  3TVK A;  3W60 A;  3QIP B;  5F9L A;  5F9N A;  3TQ1 A;  2Y8W A;  2HRT A;  2KI2 A;  2V2Q A;  2XS7 A;  1RXO B;  1M1G A;  3M2U B;  2QL5 B;  2B9Y A;  5D3G B;  2R8J A;  2QFJ A;  2GJ2 A;  4E0D A;  1TU0 B;  2V8V A;  4JV0 A;  2DRA A;  4DL3 A;  5KG4 A;  3M2R B;  1MN7 A;  3CCU S;  3SDE A;  1FDB A;  2DKO B;  2CNN B;  1S9E B;  4X64 F;  3MR3 A;  1S6U A;  1RWK B;  4MFB B;  1WSR A;  1JJH A;  2A1B A;  3K89 A;  3I4P A;  2JNJ A;  3I0R B;  3T3F A;  4JV5 J;  2M8D B;  2C1E B;  2AMC B;  4FKY A;  4ZLJ A;  5K8P A;  3CSK A;  1RI7 A;  3LAM A;  2F8E X;  4YB7 A;  3JQK A;  2YH0 A;  1P1L A;  4C8K A;  1V3R A;  2AEF A;  1R43 A;  4ZVO B;  2A3J A;  1C2P A;  2VPX B;  3DLK B;  9ATC B;  3I0S B;  1SL0 A;  4JI3 J;  1YJR A;  2CPI A;  1M1H A;  2QV6 A;  3L95 X;  2HVE A;  3MCO A;  3HZE A;  4LF6 F;  3IS9 A;  2VDI A;  2DEI A;  1UVK A;  3N6N A;  1J2V A;  2I9S A;  3N9U C;  4RX6 A;  4GRS A;  4NAS A;  4RNN A;  3VCD A;  2JHE A;  2BOA A;  1YVF A;  4F36 A;  4ELT A;  4MK7 A;  1FJG F;  2FHK A;  5DZ7 A;  2B56 A;  5J2Q A;  1NZ8 A;  1F2G A;  4HR2 A;  2D7S A;  3SQG A;  3UW1 A;  2GW8 A;  1PKU A;  3IBC B;  1D8Z A;  1TL5 A;  3M6V A;  4R5P B;  4RW4 A;  3DDK A;  2ZC4 A;  3GZ7 A;  3PVX A;  2AQ4 A;  2UU9 F;  1ZH5 A;  4M5I A;  1F5A A;  4LF1 A;  5C24 B;  3OSN A;  4WFX A;  1SV5 A;  1ZAV A;  4ER8 A;  2AKW B;  5LOQ A;  2MXY A;  3K57 A;  1RWN B;  3VAG A;  1X9S A;  2W9C A;  1IUJ A;  1YQH A;  2GVZ A;  3LP0 B;  4QWB A;  4UF4 A;  3MOJ B;  3H25 A;  1TL1 A;  1VRT A;  5A6W A;  2XS5 A;  1EHW A;  1VQK S;  1BQM B;  2Q79 A;  4K5S A;  3QNW B;  5A8W A;  5J2M A;  3SCI E;  3TAQ A;  2KXN B;  3VAH A;  3THV A;  2ATL A;  1IKW B;  2HBR B;  3MMC A;  4RNH A;  3IGV A;  5C2G A;  4ZPT R;  4H4K C;  2HAF A;  3I31 A;  3IC1 A;  4P9S A;  1P9Y A;  3N4W A;  3ULH A;  5K14 A;  4CH0 S;  4LRD A;  4ZP7 A;  1PYO B;  3OJS A;  2BR0 A;  2HFZ A;  1D0E A;  2VA3 A;  1WG5 A;  5EWF A;  3O5T B;  1VQ6 S;  2BKO A;  2L48 A;  3G71 S;  1C1C A;  1LWE A;  1YHQ S;  1TZ0 A;  4J9U E;  1G2E A;  1HW8 A;  3FK4 A;  5H9E K;  4NLP A;  4J9R A;  1FRX A;  3WC2 A;  4ILL A;  4KKO B;  1QUP A;  2R7U A;  4DPX A;  4DX7 A;  3J7Z T;  3AD7 C;  2CFX A;  2AHO B;  1R8P A;  1S4F A;  2W2M P;  4RW8 A;  5GMD A;  5KFZ A;  4O23 A;  4CT9 A;  5KFM A;  4C8Y A;  1FJG J;  4UOG A;  1GMW D;  1UJ4 A;  3TEH B;  1IR0 A;  2C2N A;  4ZDN A;  2POK A;  3IG1 A;  3DDI A;  2AGQ A;  3GE9 A;  5FDL A;  4LF6 J;  1JXV A;  3MPY A;  5IQQ A;  1ZA1 B;  3PKY A;  2CJY B;  5A8R B;  1Y11 A;  2YX1 A;  2HFV A;  3I82 A;  4WU3 A;  2V0N A;  4DV4 J;  2HFS A;  1U1R A;  4FPI A;  4ZS6 A;  4D3G A;  3B82 A;  2XGP A;  3NOC A;  4ELV A;  4J9M A;  1S1U A;  1E6Y A;  4ZOS A;  2Y3Y A;  3G6Y A;  4DL5 A;  1R0C B;  2IM3 A;  2DO4 A;  2J6U A;  2GO8 A;  1YRU A;  4EU0 A;  3IG1 B;  4FXD A;  1SJQ A;  1JNZ B;  2CDQ A;  3D28 A;  5HVF A;  4ZLP A;  1U26 A;  3GJS B;  4BBY A;  1B7F A;  3BSN A;  4JI1 F;  1YBT A;  3AOB A;  4DL6 A;  4IFY B;  5E7O B;  3PRB A;  2XSF A;  2M3D A;  2ZUG A;  4WE1 B;  3J7Z 5;  5HVH A;  1BE4 A;  2QJ3 A;  2HFO A;  2U1A A;  2XMJ A;  1HHS A;  4J9K A;  1GFW B;  1YRX A;  2HIQ A;  2QZ8 A;  5E3P A;  3LO3 A;  4A8Q A;  2UUW A;  5GME A;  3HLU A;  1SL1 A;  1RA6 A;  3QYY A;  4CLW A;  5GMK a;  3H5S A;  4PXE A;  2FY8 A;  3SIP B;  5KFU A;  1QUV A;  1QTM A;  5KFJ A;  2VQF J;  1UVI A;  1F9F A;  2RD5 C;  2DTJ A;  1SB6 A;  3OD2 A;  4XO0 A;  3NCP A;  4O4G A;  1RB0 A;  2CPE A;  2MZS A;  3R7N B;  2BE2 A;  2DNG A;  1UWA A;  3MOZ A;  1IWA A;  5AE2 A;  1WG1 A;  4P7V A;  2H48 B;  3V81 A;  3KUE A;  1FRH A;  4LT6 A;  2RRB A;  1AUS L;  2C3Y A;  3M30 B;  3N01 A;  4MFB A;  5CAA A;  3NKY A;  3WBZ A;  2R7S A;  1VIO A;  4DUT A;  2EFQ A;  2OML A;  3PHE A;  2UUC F;  5HAT A;  1UFL A;  3KLF A;  3TAN A;  4WFB Q;  4ECZ A;  3BZQ A;  4K50 A;  4DG1 B;  1IBM J;  4QR0 A;  2JEG A;  4DSJ A;  2XMT A;  1HLW A;  2E9Z A;  1V3S A;  1ACM B;  3FQK A;  1URR A;  3IS9 B;  2E1P A;  4RW7 B;  5DLG A;  2GHW A;  1JK9 B;  2KRB A;  4PXD A;  1IBK F;  2BAN B;  1L3S A;  1GX5 A;  2LKZ A;  2V8G A;  1DQ8 A;  5LM7 E;  2WVB A;  2MQM A;  4HLB A;  5L1J A;  3ZFV A;  6FD1 A;  4JI5 F;  5J2Q B;  2H54 B;  3L4B C;  1S12 A;  4O3P A;  1FD8 A;  2W01 A;  4NPO A;  4OYP A;  3C16 B;  1ELO A;  3IP0 A;  2J9C A;  3M32 A;  4NI2 B;  1F3F A;  4P71 A;  4DUY F;  3CC7 S;  1JB0 C;  2Y0B B;  3IR5 B;  3OTE A;  4PG7 A;  3A8J A;  3KK3 B;  5JVH Q;  2RHQ B;  2MQL A;  3EGV A;  1CJV B;  4OX7 A;  1ZS6 A;  1WAC A;  3GYX B;  2CNO B;  5DO2 A;  5I3U A;  3KMS A;  1T9V A;  1FKP B;  1C0T A;  2ROP A;  1HMV B;  1HPZ B;  2CPJ A;  2XNQ A;  1H73 A;  2FQQ B;  1SKS A;  4LBH A;  4UUW A;  2V4J B;  1VJW A;  3CNQ P;  1RWW B;  5T7L B;  4B9T A;  1SJF A;  2AJF E;  5CAB A;  2K1R B;  2KT5 A;  5A8K B;  2GQQ A;  4NYZ A;  3Q8U A;  1L3V A;  3OR2 A;  1RAG B;  4L76 A;  3SI8 A;  2EC0 A;  1RP5 A;  1AT1 B;  1Q7L B;  2MKS A;  4B3T J;  2OPQ A;  5C5J A;  4L6V 3;  5I3U B;  5K14 B;  1V9O A;  4F4A A;  5LSR A;  2QA4 G;  2MHN A;  4DX6 A;  1HQU B;  1KQG B;  3MM9 B;  1CJT B;  5ETN A;  4U6P A;  2V68 A;  2W2N P;  3VAJ A;  1UEV A;  2GML A;  4P73 A;  4A48 A;  1Q4R A;  3PJX A;  1WC1 A;  4TVA B;  4DR3 F;  2FVC A;  2KYZ A;  3FRZ A;  4JI2 F;  4USI A;  4RR5 A;  3AB4 B;  2YVS A;  1Q95 G;  3DOL B;  3TUI C;  4HAC A;  5L38 A;  4LRE A;  1FFG B;  3C6T A;  1RTI A;  5J1P A;  1QAY A;  2EC2 A;  2RS8 A;  1NEE A;  1XR6 A;  3HT0 A;  3MM5 A;  4HHJ A;  1CPZ A;  3ZTQ A;  3D6M B;  1IN0 A;  3ZNJ 1;  3FZ2 A;  1UW9 A;  3PY8 A;  1RHJ B;  4ZVG A;  2FLN A;  1U8S A;  1KBR A;  2ASL A;  3BSA A;  4I7F B;  2GQ2 A;  2A0F B;  2CQG A;  1T03 B;  1WDD A;  3DYA A;  3ZZ0 A;  3CC2 S;  4WPA A;  1U24 A;  5CCL A;  2BX6 A;  5CCM A;  4HYK A;  1K1S A;  3KJN B;  1F1B B;  1HNZ J;  1S1V A;  3CD6 S;  3ETM A;  3CCW A;  3OW2 R;  2Y8Y A;  3EDR B;  2PI5 A;  1CC7 A;  2MLZ A;  5KFH A;  5DRK A;  2G9O A;  2W4P A;  3CCV S;  4C8Z A;  1HWI A;  1R89 A;  1YKW A;  2P2C B;  2EKN A;  1EKS A;  2KU7 A;  4C6A A;  1PAU B;  2XYG B;  2RNE A;  1Z4U A;  5KTQ A;  4MKB A;  2DR6 A;  1HI1 A;  3M8Q A;  1RAD B;  3HSG A;  4F7V A;  2E1A A;  4DQQ A;  2WW8 A;  3R6L B;  2R8G A;  1NDL A;  3ZZZ A;  2RAQ A;  3R7B B;  2ZJP Q;  2J0X A;  2B6A A;  1NK5 A;  1JX4 A;  2HS3 A;  1Z2L A;  1BXN A;  1HBM A;  1SCJ B;  5ETP A;  5THW A;  2ZH5 A;  4N8O A;  3KK1 A;  1Q81 T;  1IBM F;  4ZVU B;  2F5G A;  2KG0 A;  1SJ4 P;  1ZOT A;  2E5H A;  2J7W A;  2BJD A;  4M63 A;  1IKY A;  1TUG B;  3FBE A;  4X84 A;  3VVU A;  4IQM A;  3MM8 A;  1QAX A;  1X4D A;  2LMI A;  4K59 A;  3PAC A;  1HNW F;  4Q0B A;  1HNV A;  1Y5L B;  3H90 A;  2UVR A;  1S0V A;  9RUB A;  2P9C A;  1H38 A;  1MNE A;  4ETZ A;  1ROF A;  2FPH X;  3TUZ C;  2D41 A;  2MQN A;  2Y1R I;  1U1O A;  2IM0 A;  5ETQ A;  2CAD A;  1WTB A;  2MY7 A;  5GVQ A;  4IG0 A;  5J2P A;  3RRK A;  2LYV A;  1K1Q A;  2HRU A;  1XMO F;  3VGS A;  5IWA F;  2JJ4 D;  1RCO B;  2RHS B;  2WON B;  3CJT A;  2QL7 B;  3RGI A;  1RIS A;  4URG A;  3UCG A;  4XDC A;  1OYE A;  4CH7 A;  2AYB A;  4B9M A;  4K7Q A;  4Y3C A;  3AJ2 A;  2BBE A;  3FUY A;  2XCA A;  3QO9 A;  2OI2 A;  5H1S V;  4C97 A;  4LFB J;  2ZH6 A;  3MEK A;  3P5T L;  3CXC R;  1TMJ A;  4DSL A;  3RRH A;  3PCO B;  3JTO A;  3O6Q A;  4KV8 A;  1KQF B;  2RF2 A;  3J7A N;  1JJC B;  3IM8 A;  1FXD A;  2VFT A;  3T41 A;  4E2F B;  1NO8 A;  2BQR A;  1KLM A;  1VIS A;  4JI1 J;  1I94 F;  2EBE A;  3IR6 B;  4FVC A;  2B8Q A;  2CZ4 A;  3Q8S B;  1TKZ B;  2VJV A;  4AL5 A;  2HHS A;  2QLB B;  5K20 B;  2B4U A;  5F8H A;  2KN4 A;  4PG8 A;  1H6K X;  2MQ8 A;  4YY3 J;  2MTL A;  3Q8P B;  1S1W B;  3M30 A;  1YK9 A;  5IV4 A;  2EK6 A;  2GAH C;  3ZZY A;  4J37 A;  1Y5N B;  3FMW A;  4LF4 J;  2N7Y A;  2IC3 A;  2XM3 A;  1XMO J;  2RDJ A;  1GNK A;  1M5H A;  2R2T A;  3OXF A;  1TEL A;  3EIC A;  1BQN A;  4CLF A;  4DG1 A;  3TAM A;  3KK2 A;  4JI7 F;  1U6B A;  3B8H A;  3KKF A;  2XLK A;  2BAN A;  2MZ1 A;  1TVR A;  3BQ1 A;  3FCV A;  4ED3 A;  2J0Q D;  4RW7 A;  3DM2 A;  2MKH A;  3DOM A;  1NH8 A;  3FJ2 A;  1YG0 A;  3CCQ S;  2OD4 A;  3GR1 A;  2QL9 B;  1P6T A;  4TLQ A;  3SQO P;  4DV2 F;  1VQP S;  2HWT A;  5T14 A;  1UVM A;  1HBU A;  3W9H A;  4DPU A;  5K5M A;  2C42 A;  3LA0 A;  3D66 A;  3EGW B;  5MAO A;  2AU0 A;  4USH A;  4ZCL A;  4LF9 J;  1K0V A;  2KJW A;  2VG5 A;  2F4V J;  4DR6 J;  4HT7 A;  4Z2X A;  1LOU A;  2QE5 A;  2ZIT A;  3DRS B;  4CNZ A;  4G6V B;  2DR8 A;  1TVR B;  5L46 A;  3QJL A;  1RLD A;  4FXV A;  4Q2M A;  1XIQ A;  1N52 B;  2MKK A;  3KG4 A;  1S7H A;  2UUA J;  2K2P A;  1SJ1 A;  3DLG A;  2L3M A;  5DG7 A;  3W3S A;  2C2M B;  3DLH A;  1RT3 A;  1VRU B;  4OHY A;  3D1H A;  3CDA A;  1HNZ F;  2QMX A;  2AJQ A;  4KFB B;  2DY1 A;  2YKM A;  1JLB B;  1OO0 B;  2ALY B;  2GCF A;  3FGV A;  3EJM A;  2APO A;  3BO2 A;  1E6V B;  1KOH A;  1S6O A;  2MST A;  3PG9 A;  4MKY A;  4ECW A;  4X4R A;  3BDE A;  2GHV C;  1REV A;  3HMJ G;  2ZE2 A;  4EUV A;  1WC4 A;  3J81 U;  5J2M B;  3UD3 P;  2KT2 A;  3J80 U;  2N7C A;  1M5O C;  3JTP A;  3UQS A;  1SH3 A;  1HNI B;  4CO5 A;  4KHR A;  4AND A;  1SC1 B;  3M9O B;  4WK3 A;  1VR6 A;  4RBT A;  2VOO A;  3FDS A;  4ZN3 A;  4EEY A;  3NRB A;  3GPA A;  2ZZN A;  2HVZ A;  2AGO A;  1DQ9 A;  1FVS A;  4ES1 A;  2KDO A;  2HGM A;  3AXM A;  4F26 A;  4ZA1 A;  5I3Q A;  4DR3 J;  1LWF A;  2LQB A;  2B6A B;  2D1C A;  2LVW A;  1U7L A;  3DOL A;  3HKZ D;  2F65 A;  3OLA A;  4C3L A;  2IHR 1;  3KK1 B; 
#chains in the Genus database with same CATH homology
 4W98 A;  4CP5 A;  4F36 A;  4UOH A;  1KDN A;  2DXF A;  3Q89 A;  4FKX A;  3NGR A;  4HR2 A;  3EE3 A;  1PKU A;  3VGS A;  1HLW A;  1WKK A;  4ANE A;  4ANC A;  1NDK A;  1NUE A;  3EVO A;  1LWX A;  3VGV A;  3BBF A;  4UOF A;  3VGU A;  3JS9 A;  2NCK L;  1S59 A;  3EM1 A;  4ENO A;  1S5Z A;  3WX8 A;  1F3F A;  1EHW A;  5C7P A;  4KPC A;  1K44 A;  2DXE A;  4DZ6 A;  1HHQ A;  4EK2 A;  1NB2 A;  2BEF A;  1NDC A;  3MPD A;  2DY9 A;  1ZS6 A;  2B8Q A;  2AZ1 A;  3ZTS A;  3ZTP A;  3NGS A;  3Q86 A;  4O0N A;  1B4S A;  3FC9 A;  5CAB A;  2ZUA A;  1NCL A;  3Q8U A;  1F6T A;  1HIY A;  3EVM A;  3ZTO A;  3B6B A;  3B54 A;  2HUR A;  4F4A A;  1WKJ A;  3VGT A;  2HVD A;  1NSP A;  3EIC A;  3FBB A;  1PAE X;  3DKD A;  3Q8Y A;  4UOG A;  2DXD A;  1NLK L;  3DDI A;  3FCV A;  1JXV A;  2VU5 A;  1BHN A;  3BH7 B;  3BH6 B;  1U8W A;  3BBB A;  3FCW A;  3GP9 A;  3L7U A;  1BUX A;  1NDP A;  3EMT A;  3PRV A;  3Q83 A;  1XQI A;  3ZTQ A;  1S57 A;  1XIQ A;  1VYA A;  1NSQ A;  2BX6 A;  5IOL A;  3ELH A;  1BE4 A;  3ETM A;  4DI6 A;  3VVT A;  3R9L A;  3FBF A;  2CWK A;  3EJM A;  3ENA A;  4C6A A;  4S0M A;  1MN7 A;  3BBC A;  5BXI A;  1NPK A;  1UCN A;  3G2X A;  4WBF A;  3ZTR A;  1W7W A;  1NDL A;  1WKL A;  4AND A;  3EVW A;  4FKY A;  2DYA A;  4DUT A;  1NHK L;  3Q8V A;  3GPA A;  1LEO A;  3VVU A;  3FBE A;  2AZ3 A;  3PJ9 A;  3FBC A;  1MN9 A;  1B99 A;  2B8P A;  3NGU A;  5CAA A;  3NGT A;  3FKB A;  1NSK L;  2HVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...