3MPDA

Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi, cubic form, apo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
147
structure length
147
Chain Sequence
MERTFIMIKPDAIKRRLISRIIQRFEEKGLYLAASKCVIPKREVLETHYSHLSSMPFFSEMVEDMMSGMVLAMVWVGKDAVSIGRKLIGETNPQAASVGTIRGDYGVSTGKNIIHGSDCVENAEKEIKLWIGDDVQPVSFFDKEWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi
rcsb
source organism Encephalitozoon cuniculi
total genus 45
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3mpdA00
5CAAA 4CP5A 3Q89A 1VYAA 3PRVA 1NB2A 4ANCA 3FBFA 3PJ9A 2DY9A 1XQIA 3FCWA 1MN7A 1NCLA 3EMTA 1NPKA 2NCKL 3ZTRA 3Q83A 1NDKA 1K44A 1S5ZA 4W98A 3VGVA 1PKUA 1NDLA 1WKKA 3VGTA 4DI6A 4DZ6A 3B6BA 1F3FA 5BXIA 5CABA 3FCVA 1KDNA 4F36A 4DUTA 2VU5A 2DXEA 1NDCA 3FBCA 4KPCA 3ZTOA 1PAEX 3EE3A 3FBBA 3NGSA 3ZTPA 4O0NA 3EICA 3Q8VA 2HVEA 4C6AA 1NSKL 4WBFA 3ELHA 3VVTA 4UOFA 1BUXA 1WKJA 2CWKA 3VGUA 1NLKL 2B8QA 3BH6B 1JXVA 1UCNA 3ENAA 4UOHA 3Q86A 2DXFA 3VGSA 1BE4A 3DDIA 3L7UA 1S59A 2HVDA 3VVUA 4UOGA 3EVMA 3BBFA 3ZTQA 3WX8A 3JS9A 2BEFA 3BBCA 1HLWA 3ETMA 4HR2A 1NUEA 3Q8UA 3G2XA 3DKDA 1XIQA 1LWXA 1WKLA 5IOLA 1HIYA 1ZS6A 1B4SA 5C7PA 1EHWA 1F6TA 3GPAA 1W7WA 3NGUA 4ANEA 3FC9A 2AZ1A 4ANDA 1BHNA 1LEOA 4ENOA 3BH7B 2BX6A 3EJMA 3MPDA 2AZ3A 3R9LA 3EVOA 1MN9A 4S0MA 3EM1A 1B99A 3NGTA 2ZUAA 3NGRA 3FBEA 3GP9A 2B8PA 4FKXA 2DXDA 4EK2A 1NHKL 3FKBA 3ZTSA 2DYAA 3Q8YA 1S57A 1U8WA 1NDPA 2HURA 4FKYA 3B54A 1HHQA 3EVWA 1NSPA 3BBBA 1NSQA 4F4AA
chains in the Genus database with same CATH superfamily
5CAAA 5IZHA 1X4AA 3DI6B 4NLVA 1T9UA 5B0DA 1C1CB 3EMTA 4ZVSB 4P73A 2ZOFA 1RTDB 2BRLA 1QTNB 2HQ3A 4EYHB 4QIFA 4NRTA 3GIKA 1W25A 1LFPA 2E66A 5F3ZA 1J27A 4YB6A 3KJVB 5J2QA 3EZOA 2R7XA 4RW8A 5LOQA 2KG0A 5IT9Y 1KQFB 4Y2IA 2AX0A 2R7OA 4NLUA 3PV8A 2HWIA 3UFCX 4QZVB 1M5PC 4ZIVA 1OPIA 1VQPS 2IHR1 2GMHA 5H9EJ 1AZSB 4A4JA 4ZDNA 2BDPA 2R4FA 3I5CA 1VQ8S 3EJMA 3JQKA 3MAAA 3NS7B 3OFFA 5LMUJ 4F4YA 1Y0HA 1NZAA 3NGRA 1LK7A 4HTJA 2A1BA 5HSPA 1VR6A 4DL4A 3DYAA 5IV3A 1CG2A 5EX3A 4R5PB 4QCLA 2VQFF 1UEVA 3LP1A 3G6VA 2BQRA 2X3GA 3OJUA 4RNMA 3FCVA 4DUYF 1OY6A 2RF2A 2Y1LB 3OR2B 4DSEA 2HYIB 3KLIB 4DCPB 1HARA 3NGSA 1H7XA 1CC7A 3AJ1A 1JIHA 1S6OA 1EETA 3GILA 4DU8A 2WBMA 3HJVA 4A46A 4O3PA 1DARA 2IJNA 3DKDA 5KFAA 2BW2A 4FXDA 5A2QU 4PYDA 2FIUA 1KC8T 1L3VA 1U7LA 3P45B 1FD2A 4L6V3 1Y3JA 4NEYA 1U1MA 1D9AA 4PQUA 2W4DA 1ZA1B 2EI5A 1DZ5A 4IFYA 3B54A 5EWEA 4RU2A 4ED8A 5HJXA 3M8SA 4RJVA 5ITHA 1IBKJ 2A3JA 1NCLA 5K8MA 3HKWA 2HZAA 3HZEA 1JLFA 2ZBPA 2Y0BB 1IKYA 3QT5A 1UPPA 4PZVA 2CVIA 3K2YA 3BYRA 4X4VA 2D69A 2LEPA 2QA1A 4ZVRB 2V8DA 2V4JB 2M88A 2CA9A 5K8NA 4O44B 3QGHA 4FNIA 1UWBB 2YKQA 3I0SB 1F5CA 4HL9A 1FCAA 5A8KA 4O4GA 1P27B 3D68A 3D1HA 4HT5A 3AT1B 3J80Y 5E33A 1HNXF 1V5IB 5E2QA 4WFXA 3U02A 2ZOGA 2OPQB 5ETPA 2HNYB 5B0AA 3GV8B 4F4KA 3M32B 2DH9A 4ED1A 4ZP6A 1DY3A 3C8YA 3DM2B 4YB5A 2IMWP 1C2PA 2RDIA 2C2DA 3LOUA 1S5ZA 1WHVA 3C6UB 4RR5A 1U49A 3W5XA 4DV0F 3D67A 1YJUA 4RW9A 3M2VA 1KEKA 3CMES 4KRWA 2IYGA 2LEAA 3ZTOA 1DAXA 5KFXA 1FKOB 3MUVP 3PDNA 2DHXA 1VBKA 2IAJB 2CJKA 4LSNB 2IMOA 2KM8B 2V0NA 2MY7A 2XULA 5CCMA 3G9CA 3TZZA 1CBKA 2OPSB 4HI1A 5G4DA 2VASA 5DS7A 1R6YA 2VDIA 5HK4A 1XWLA 2FVCA 1OYDA 2JEJA 4V1Ak 3LTOA 1TV6A 4CWBA 1YZ6A 3H4BA 5T7LB 5A8RA 3BR8A 4G65A 4ELTA 4MYUA 3MHYA 3VAGA 4F7VA 3MMAB 4OHYA 3A8EA 3V4IA 5KFRA 2J0SD 1BC6A 3MFIA 2JX2A 1OYEA 3PW7A 1FDDA 4DV3J 2W2OP 1FKAF 2LYVA 3J7YI 4JI5J 3PTWA 3EE3A 3NCQA 1RT6B 1YTYA 3CDEA 2V63A 4C11B 2XZWA 5KOXA 5DDPC 3H40A 2OPRB 4M95A 2AX1A 4CLPA 1QM9A 1O51A 2PI4A 4WK1A 2MKYA 4JI7J 3M2RA 3UVJB 1JLGA 3O3LA 4C3MA 4F02A 2GJIA 2RDJA 4OYPA 3TAPA 1Y5LB 4CLUA 1GFWB 3V81A 3IRWP 2MQQA 2DO0A 2V2QA 2RE1A 2ZM6J 2ZVIA 1RGVA 3BM7A 3W62A 3ET6B 3QFHA 2XMWA 2FZCB 2M8HA 3BBBA 4JYAF 1ZPWX 4FPRA 2DNRA 2V8PA 1OY9A 4GC6A 1KVKA 3UCUP 4L72B 2JH3A 3MCNA 5I42B 1DJ0A 3JTPA 3SQGB 2CQPA 3LGMA 5EDWA 2J7WA 4C4WA 1IKXB 2ZHOA 3S6EA 2PA8D 3OTOJ 4KV8A 2G9OA 5D78A 4C2MA 2C28A 4B9TA 2CPEA 1RT7A 2C42A 3KLVA 2A2CA 4KH0B 4DR1J 2CWXA 4CYUB 1BQNA 5C5JA 2FJWA 4A48A 3L3CA 2MLYA 1HBUB 5KFEA 2R8IA 3P5TL 4IKAA 1Y4ZB 1LW0B 3N0VA 1J2VA 2QL7B 1AYEA 3F56A 4DR6J 1X5OA 2JJ4D 4Y28C 5LSRA 1HYSB 2B7CB 3LP2B 4QPTA 2W2MP 5THWA 2M7SA 3QIDA 4A8QA 1C0UA 2N7CA 5ETOA 1N8RT 3MF5A 2M5YA 2NXEA 5IT4A 2EC2A 4ZJOA 1U1LA 3W2VB 2IVMA 3PIOQ 4CTAA 3CCES 3CJ2A 3FBFA 5KFBA 2GJFA 5ETNA 2HQCA 3TYTA 3BEGB 1DURA 3JTOA 4DUZJ 2Z2MA 2DNGA 1T95A 3HPOA 4IRCA 4NLSA 3R5JB 2YH0A 1VQ4S 4MH8A 2HS3A 1V3RA 2FZGB 2KM8C 4ZHRA 3I31A 2RS8A 2BUNA 3HVTA 2Q43A 1TKTA 5JVGQ 1ZS6A 3EGNA 1U0HB 4RNOA 4PWDB 4ECSA 3FGVA 2VG5A 3H2LA 5G0RB 2GV1A 3OFHA 2FHKA 3QT8A 3RJMB 4JI3J 1UAWA 2MGZA 4KYZA 2DD8S 2QA4G 2DPJA 1WEYA 4X4QA 3MEDA 4A8SA 3ZXWA 3FSIA 1S9EA 2DH8A 4EK2A 3H90A 1UFLA 4I67A 1IM6A 2HURA 1SH0A 3N6LA 5MAOA 3AB2B 4CP5A 5J2NA 3NKYA 4Z2XA 5AT1B 1VGYA 1JJ2R 5J2QB 1MN7A 2W8LA 4RW8B 1ZETA 4DHVA 1S7HA 2ZHAA 1NDLA 1VK3A 2DY1A 1BMQB 1HW9A 1VC0A 3NBPA 3J81Y 1WC4A 2X1BA 2ZC3A 1UZDA 4OLOA 3GCWP 2AJ1A 5F0UA 1UVNA 2O67A 4LBPA 2HVIA 3H8YA 4LF9J 3R5BA 4FNHA 2P9EA 1CJUA 2KT2A 3QBCA 4PG8A 2JZ5A 3FMWA 2AJ0A 3MAAB 3IWXA 3KNAA 3ETMA 4DWIA 2DGUA 5BR8F 1T05A 3IC1A 3FRZA 2KT3A 3LP1B 3H5SA 4F3QA 3ZTSA 2DYAA 2RF2B 4MKVA 2BYCA 2OI2A 1TUGB 4IOBA 3DLGA 5KFGA 2NPIA 1PG5B 4PXCA 4K4VA 3QSIA 3GSIA 3QT6A 2PE8A 2VBXA 5IT9U 1URRA 2VQEJ 2F8EX 4URQU 3WC2A 1EETB 4WIIA 3PNIA 1WTBA 1NDCA 4B3SJ 3SYZA 2CZ4A 1RTJA 5IXUA 5L9XA 2LU2A 3NRBA 3AXMA 2CWKA 1S76D 3PRDA 3ZO7A 2E1MC 4OI0A 2BACA 2W1BA 1SI9A 4CO4A 3V6JA 4EMDA 4PG4A 1JKHA 1S79A 3NCPA 3K5OA 3J7A1 3QPIA 2MQ8A 4IFYB 2UUAF 1RSCA 3BGOP 2ASLA 3W3SA 4KO0A 4WKRA 2JC1A 1ZTWA 4PWUA 2JWNA 4ID5B 1RWNB 4FBTA 2UVWA 3MMBA 1JLFB 2ADBA 3FZBA 1XR5A 4JV5J 1IKYB 1HQ2A 3QSYB 4EU0A 4YB7A 2IY5B 4C8NA 2YWFA 3A13A 4WYLA 3IRXA 1M0SA 3A8KA 3W66A 1BLUA 1NNDA 1YBUA 5KT3A 3BYPA 2JFDA 2GAHC 2KJWA 2FY8A 5KFUA 1PIEA 2Z8QA 2GZOA 1HNVA 1G7CB 5FDLA 2KZMA 4CH7A 5U47A 1IVZA 2MHNA 4RNFA 5IWAJ 4ILRA 4FDFA 2RQKA 2HNZA 4KHMA 5IM0B 5A8KB 4O4GB 3ENQA 1NRKA 2BJ1A 4DG1A 1R31A 4FN5A 4RNHA 1WHYA 4RU9A 3P4UB 2ZH8A 2R3VA 2R8JA 5AXKA 1TELA 3IBWA 2MEWA 4WTYA 1XMBA 6FD1A 2N3OA 4FF1A 4J5OA 2VFSA 3UDEA 2Q3PA 3P6YC 4UY85 3ZZUA 5JUMA 5IQQA 2OH2A 2K7KA 2QA2A 3M2VB 4RW9B 2JDJA 2HQFA 2WAQD 2CJBA 3G8SA 4C8ZA 4OI6A 3M1VA 3C15A 3QJJA 1KHVA 2MQNA 4B9NA 1U6FA 2WBRA 2DNNA 2WVBA 5GAHU 3UN2A 2R7QA 4DZ6A 1F5BA 1FVSA 1R8HA 5B0EA 3QT7A 4NLXA 4ZPAA 3RB0A 3A3PB 3GFYA 2ZH2A 3AHPA 4IUFA 1M1HA 3J80U 2N3LA 4IR1A 5GAEU 2XQCA 1MNEA 2J9EA 2POKA 4C97A 1TV6B 4DR6F 1RAJA 1CS4A 1OSDA 2AD9A 5A8RB 4NL5A 4ZLPA 2EWHA 2NSCA 1VBZA 4WTOB 1F60B 3IM9A 4KY3A 5AE1A 2B4PA 2UUBJ 2GA7A 3KHRA 1X8DA 4C0HA 3W63A 2XTJP 1FJEB 3V4IB 2RRBA 1B99A 2G0JA 5E3RA 1E6VA 5J1EA 1DHMA 5KFJA 2GIRA 3AQOA 1GT8A 4E98A 4UUXA 4DUZF 1RA7A 4OLPA 1KR4A 4CO5A 4ZS6A 4DX8H 2H51B 2CJAA 2GGPA 3BSAA 2M9KA 4CLTA 2KL8A 1WF0A 7FDRA 1VQ6S 2AJ2A 4XO0A 3TVKA 3HK2A 1HMVA 1HI1A 2M0GB 2KFNA 3M2RB 4P74A 2LDIA 4H54A 4ECXA 2OLWA 4J9PA 1WKJA 2VJVA 1A9NB 1FT8A 3NP5A 1M5OC 3V81B 1S0MA 2B9XA 3FEZA 3X1LB 4QWCA 2XLKA 4P7VA 1WC3A 2B7BB 2ASJA 3Q8RB 3BSOA 3CE8A 3LALA 5ETSA 5T14A 3KLHA 4KHPJ 1T11A 2CDRB 3KMQA 3JQMA 5KFKA 1EB0A 1HNWJ 3CDWA 3O2IA 3O6QA 1GEHA 2GJ2A 3ZZOA 5KT2A 3T19A 4EWTA 4KV8B 2OIHA 2YKOA 3MPVA 1NO8A 4UZCA 4K2JA 8AT1B 1RT7B 2QGFB 1PJ6A 4BCAA 2KKHA 1NZ8A 4DV2J 3SXLA 2OHDA 4LF9F 4RWWA 3T6BA 1BQNB 4KIAA 3VF0B 3PXGa 5DLGA 2HHXA 5HAOA 2C3YA 2Q6BA 1V6HA 4A8YA 4LR9A 2W7AA 3Q8VA 1R8BA 3KLGA 2CQ0A 1NPPA 3QYYA 3P3DA 2FQQB 3C16A 1VQNS 3VVUA 3W2WA 3MFHA 2QYCA 1N5TA 2PT0A 4X64J 4KTQA 4KPYA 2RU9A 5BYRA 1S97A 1C0UB 2LFVA 2C2RA 3DU6A 3IA0A 4ZP8A 4OFZA 1WSVA 5JXSA 4K4UA 5LJ3Y 4CTAB 2PD1A 5IS2A 3QLHB 1SL0A 3GP9A 4NRUA 2HRYA 1RBLA 2J5AA 1GTHA 2K3KA 3MXHP 3SBMA 1HHQA 3EVWA 3EXYA 1NSQA 1N5YA 5HANA 5C42A 4RUHA 3NL0A 1X7VA 4TY8A 2JLFA 5F9LA 4B3SF 4OMFG 3UR0A 3O8WA 1SJ4P 3QJLA 4LF4F 4DFPA 2BQUA 5LM7E 4XPEA 4AE5A 3NMAA 2L3MA 4RWXA 1IBMJ 1YSJA 3G4SS 2PIIA 3HVTB 2DGQA 1HQUA 2FYXA 1RTIA 1XNRJ 4EI2A 2G0CA 2VHGA 2LA4A 3IM8A 1TKTB 1VC5A 3BQ2A 4KB7A 1FO1A 3X3UA 4LF7J 3ZZRA 3E8OA 3G8QA 3DDIA 2MGZB 2XZTB 4LFBJ 3CCWA 3ISZA 1S9GB 1RAFB 3E01B 4NPOA 5HO4A 3MEDB 4DR2J 2ZH6A 1G2EA 4OJHA 1S9EB 3TEGA 4NMLA 2NXCA 1EHWA 1DLOA 3DDKA 2KG1A 3KYLA 4OYIA 4JV5F 4YFUA 1VDHA 1T7PA 1R43A 5J2NB 2K3IA 2WSFC 1SVDA 1ELOA 2E9ZA 1FEHA 5I3PA 4KE5A 4P10A 5DG7A 1A6LA 2I6WA 2P9CA 2OEKA 4NA1A 3WZ0A 2UXBJ 3KLFA 1I51B 3S8SA 3CXCR 1HKAA 3UCGA 3K5MA 2RKIA 3H2VE 2VODA 5IWAF 1YRUA 3MUTP 2VONA 1S12A 2GVDA 1NJZA 4NLGA 3EPIA 3B6BA 1DQ9A 4K0KF 1CJUB 2VPYB 5CHCB 2CUYA 1XMQJ 4EO6A 2BANA 1JJCB 3ZZPA 4PABA 1HBNA 1XC9A 1U48A 5BYSA 3BO2A 4I2PA 2E5LJ 1NJYA 2QE5A 1BUXA 3GV5B 2A6MA 2BW7A 5A6PA 3BH6B 4ED5A 2JRSA 3HSJA 1T05B 1SQGA 3C6TA 3D0HE 1U45A 2OFHX 3G8TA 2W7OA 1C4CA 4JI1J 2MLXA 1ZYQA 1YLXA 4EYIB 4WJBA 2X1AA 2B4OA 3KUGA 4NXNJ 3EDQB 1RI7A 3ZZZA 2OGUA 3DLGB 1FXLA 1X31C 2J7KA 1BHNA 4DV1F 1TL3B 3MPDA 2KYXA 3R5GA 4F04B 1MMDA 5GMEA 1VJQA 1UTAA 2FHMA 4DX6A 2Y3YA 1FXDA 2HZCA 1RTJB 1KTQA 4NLTA 3OR1A 1VRTA 2ZJRQ 2D1CA 3ZTRA 3OHAA 3IR6B 1P8GA 4F36A 1F3VA 4LRBA 2CPHA 1JKHB 2V8GA 4JI4F 3T9NA 1KFSA 1KONA 4L76A 2YH1A 3R5DA 4N41A 3QRPA 4IO1A 5KFFA 3M9MB 2NLWA 4KO0B 4AQYF 4C8LA 2XWYA 1EIYB 4DFJA 3MEEA 2UUBF 3V4MA 3MMBB 2G1DA 2F5GA 5DO2A 2P8IA 4B08A 4OZ2A 1SIZA 1P9YA 2ZWOA 2BE7D 3MM5A 3IRXB 5KFNA 5HMZA 3B8HA 3MPWA 1QSSA 3CCZA 2XLIA 2A6OA 1EZZB 4BWMA 2CQ1A 3DMJA 2CZVC 3CW2C 5FDLB 2CADA 2RVJA 1I5OB 3DRXA 5A8WB 2H48B 2EFGA 4FVCA 1N54B 5KFWA 2BOPA 1H74A 3F73A 4DG1B 4ED2A 4F25A 2GQCA 2F63A 2N4DA 4ID8A 4USIA 4KT0C 3SV3A 4KPCA 4I7FA 2SXLA 1SPBP 2JOQA 4JI8J 4OZLA 2V2KA 2PC6A 4YDDB 3AJ2A 3HSDA 3Q2SC 5F0WA 3FEXB 1YG0A 4ECTA 3M7VA 2BJ9A 1RT2A 2YWEA 2VICA 4FBUA 3J7Z5 5F9NA 4KHPF 4ZVHA 3WIVA 4J90A 1RHMB 2J0XA 1X0FA 4NZ7A 1NJWA 3NCRA 3OQ2A 4ENOA 2BV3A 3NLCA 3M1VB 3C15B 4LT6A 1FDAA 3N6MA 4I2QA 3C66A 4AYBD 1RWXB 1NB7A 1SC4B 1S57A 4AD6A 3BSCA 4DV7J 4ED3A 3PJXA 2V34A 3VAMA 3K89A 3T5KA 1PYTA 4WWSA 1HNZF 4DL3A 2JHEA 4NMXA 2RU3A 4HLBA 1SJ1A 5H9FK 2BRKA 2W7PA 1XK8A 1RYSA 3KJNB 1CS4B 1RU2A 2MTLA 4QU6A 4KKOA 4DSIA 3KK3A 4KHRA 4OJGA 4PG7A 4DV6F 3HCXA 3IAS9 2XSFA 4A8XA 3D5MA 3UPFA 3DLJA 4LRFA 1TMJA 3CJ5A 5M2RA 5D3GA 2ZHBA 2XHCA 1V3SA 2EPIA 1E6VB 1RWWB 5J1EB 2QT7A 1S49A 3S01A 3PRBA 3SCKE 1VIOA 4ZVGA 3BO4A 3OUYA 3ILJA 5HBMA 5DRKA 2H65B 3FRYA 2XY5A 2GGPB 4N76A 2FLNA 1U2RA 1YBTA 4LSLA 4GC7A 1SIWB 4OYXA 3IFEA 2GVZA 2NS1B 4Z7YA 1HMVB 2WVCA 3HFZB 2KI2A 5KG3A 4CNYA 1WJ9A 2UVUA 4CT8A 4MIAA 4ZA1A 2G13A 3NGKA 4P71A 4USJC 1WC0A 3T1HJ 4TU8A 3MCSA 4LF7F 2ABYA 1D9DA 3WBZA 3KDNA 3NOCA 3AD7C 3U27A 4LFBF 2HVEA 4U9RA 4RW4A 4DR2F 2Y1RI 2CPFA 3KLHB 1VI7A 2YQ3A 2FC9A 4DPXA 4K4ZA 1N56A 4ECUA 3P49B 5LSOA 1PYOB 2MKKA 4YB1P 1S77D 4AXJA 2YWKA 2O5DA 4DN9A 4ANDA 2DR6A 2DR5A 4USVA 4MT1A 3CJKA 4Y2MA 3LW5C 2HBYB 2PMZD 1T9TA 3MR7A 2CQ2A 1RT5A 4YHHJ 2ZH5A 4B9MA 2B3TB 2B8PA 3GFZA 3CD0A 3CUNA 3SV4A 3KJFB 5KFZA 4RPFA 2I0XA 4TYAA 3AAWB 1RWVB 4ES1A 1TU0B 3HT0A 4HKQA 3CJSA 3PHTA 3KLGB 3SQOP 3C16B 1ZH5A 1FJGF 2HFOA 1R27B 4CI0B 3W2WB 2GX8A 2JVRA 3Q23A 2E5LF 1XNQJ 2FGOA 5DM6Q 1IJFB 4CO0A 4ZVFA 3ENWA 3LUYA 2AMCB 2ZOMA 4ZLNA 4JI1F 3ENAA 3GIRA 3PW4A 1U0SA 2CPDA 1F9EB 5B08A 2ZEJA 5HMYA 2GO9A 1R7IA 4ZJQA 3D2WA 2K06A 1UW4A 1TTHB 3BGUA 4J9VA 4TNOA 2HLTA 2ACMA 4WU2A 2PSZA 3E2EA 4NLYA 3MURP 3HZGA 1DRZA 2FJVA 4E0DA 4Q2LA 1Q5YA 1N5YB 4ZVTB 5C42B 1WDTA 1Q5VA 4OHXA 5IQ6A 1FF2A 3PW2A 4FYDA 5HP1A 2B9YA 2ZC4A 4TY8B 1N5VA 1J5OA 3DLHA 4QJVA 3UN3A 3W64A 4NCAA 2J76E 4NLRA 5HROA 3B78A 1OS5A 1C4AA 1WACA 2VPXB 1HQUB 2ZNYA 1RTIB 4XDDA 3DI6A 3V6KA 1L3KA 4IDKA 1NU4A 2MQLA 4B17A 1GQEA 1NDKA 2LLZA 4ATNA 3ENVA 3SZ2A 1RT1B 5E7OB 4ERDA 3V2UC 2YNFA 3VAIA 1N32J 2RHQB 4DV5J 4HDGA 3QFWA 4EGLA 2E7WA 2ASDA 1TK5A 3N28A 1UA1A 3RAXA 5D4LA 4EO8A 3D7SB 1PYSB 3R3TA 1DLOB 2J0QD 5DJBA 2V2VA 4BC9A 3FDSA 1WF1A 4H4KA 1JMTA 3UQSA 3NNCA 2J9CA 4IFVA 4MK8A 4K5SA 4TU7A 2HRUA 3GLJA 2HLUA 2MQPA 1WG1A 1F9FA 2FHOB 3CCSS 4JV2A 3KLFB 3KK2A 4FVMA 4PR6A 2W2PP 1TMMA 2WK4A 3N5BA 4GKJF 3R7BB 2RKIB 5GAHI 4DR5J 3DGPA 4I6YA 2A2DA 2IC3B 3PACA 2GVDB 4OZ1A 1NHKL 3GR0A 1SKWA 3BV8A 2LQ5A 5ADZA 5EWFA 2UV8A 4JI0J 2GIQA 1VQ5S 1BGXT 1JLCA 2BANB 4V19J 1HBNB 3R7NB 2HFZA 4I2PB 5GAEI 4J37A 1Q86T 3PZPA 2E5HA 1FEEA 3G96A 3QO9A 4D3GA 1UKUA 1HPZB 2IPOB 1KDNA 2I8EA 1VQ9S 3C6TB 2HG4A 1HWJA 3KLIA 4K59A 4NASA 1S1VA 1K9MT 2ZH7A 3SCLE 5T41A 3D6HB 3M9NB 1GMWA 1XERA 2LQ9A 2KXFA 2EXUA 6AT1B 4ZCLA 1SQEA 3Q86A 3VGSA 4ZN3A 2MPUA 4K4XA 1JLBA 5HQMA 5F8GA 1UETA 4N56A 3A3NB 4F0KA 2IJFA 1AROP 2CQHA 4RW6A 4I64A 3R1LA 2R2UA 1ZAVA 2L41A 1K8AT 1REGX 3D6FB 1AA1B 2OUGA 3OR1B 1VRTB 3K8VA 2HFNA 3PVXA 3KUEA 4F4ZA 3OTCA 1JWWA 3FKBA 3ILLA 5L39A 2KVIA 5B0CA 1HI8A 2DRDA 2V6AA 3PKMA 3DOMB 3EGVA 1F2HA 1FD8A 2RQMA 2AT1B 3IXQA 4WP9A 2DNLA 1VMBA 5HVGA 4LFCJ 5FLXU 3M8ZA 5HN0A 3MEEB 1D8YA 3TWZA 3N9UC 2MKIA 2U1AA 3SMZA 3MM5B 2DO4A 3PY8A 4B9VA 3FEYB 3CMQA 4RO0A 4P75A 2FJXA 4GMKA 3SSRA 3DMJB 3MM9A 3QGPA 4YR3A 4YEAA 3DRPA 1QE1A 3W8GA 1H72C 5KFVA 2IVYA 2AZ1A 2VH7A 4HACA 2MSTA 4QYRA 1VIXA 3EXCX 4USUA 2UZAA 2PMHA 3VCDA 3KHLA 4ZVOB 2VQFJ 4V19X 2NYHA 3O5TB 1N34F 1RHKB 4NLQA 3U1MA 4I7FB 2WB4A 3QNWB 2I38A 3ZNJ1 3MAHA 4DUYJ 3MGJA 2R7VA 5ETMA 3BS9A 2IM0A 5EUHA 2P2CB 3MTJA 4LF8F 2J8AA 1RT2B 3M6VA 3D28A 1X5SA 3HI9A 4UOFA 2LXFA 3HP6A 1L3SA 2E1AA 3HHLC 3W9IA 1P9QC 4YQWA 1HR0F 4FF3A 2XS2A 4X4OA 2FJEB 2E5GA 2W8KA 3QAEA 4YHHF 1WHXA 3ZNUA 3Q8SB 1DBDA 2E7VA 4MKAA 3GIIA 2ZBQA 1Q8LA 2MKCA 5KG4A 2MQMA 3KJQB 2BBEA 1NKCA 4FXWA 3FQKA 1Q53A 4PG6A 2VIHA 3G6ES 1RTHA 2H4WB 4DR7F 4LVOP 4K2XA 2V68A 4KKOB 3KK3B 4DR3F 3TJAA 2VB6A 1TFWA 1WC1A 1XNQF 2EFNA 4WFZA 5CCLA 5D3GB 3W61A 3HFVA 4J9KA 1TL1A 4ILMA 3G87A 4WBFA 1CQNA 2OPRA 1RWPB 4CH0S 1SKRA 5DZ7A 2VBZA 1X5TA 2MZQA 1BE4A 1B7YB 3MMCA 2CPJA 5SUHA 4NA2A 3CD7A 3DXSX 3CC4S 5D8HB 1YQHA 5HMXA 3FSXA 1NAQA 2XS7A 5AXMA 4LSLB 5C7PA 1HW8A 2DVIA 2C2MB 2GVZB 1LFWA 4CM0A 3WX4A 4ECQA 5EGYA 4Q2MA 1X4EA 3EVOA 1PC5A 2KFYA 3LF0A 1WOSA 3D6TB 2IM3A 3NNAA 2OTLS 1ZZNA 2W25A 4CLSA 1UL3A 4DV0J 2HHHJ 3K5NA 2CG4A 3Q83A 3V6HA 4RW4B 1N32F 4DV5F 1V3ZA 1C1BA 2QLBB 3SQGA 1X9SA 2FY1A 3I96A 2I2YA 1IKXA 2CXEA 4U7UK 5K20B 1Y9OA 1VLOA 3E51A 4LR7A 3W1YC 4OYBA 1D1UA 4YOEA 4WFAQ 1FRHA 1REVA 3CJKB 5CZVA 5D6GA 1PC4A 3JS9A 1SUQA 2BEFA 1RT5B 2LQ8A 4HR2A 2R8KA 4DX5A 2EC0A 1IWGA 1XEZA 5L46A 4PAAA 4DV4F 4QR0A 4DR5F 3TNVA 2XMTA 2D7SA 3G71S 4R8UA 2DGSA 4YR2A 5B7WA 3RB3A 1WOOA 4B3TJ 4NYPA 2GMJA 1XBWA 2FHJA 2CRLA 4OV6A 4ER8A 1MW7A 4EBEA 1NKEA 5IT0A 1B0TA 1UMJA 2ZNZA 5KG5A 3LP0A 3IMQJ 2CJYB 2CPYA 3FBBA 4DF4A 2VFVA 5B0BA 3PFEA 4C6AA 2OAUA 2FUG9 3IGNA 1UJ6A 2NUUG 3G82A 4UOHA 2D3OR 3H25A 2DXFA 2BABA 2CPZA 3D3CJ 2JLEA 3JSMB 2VBWA 3WQPA 3A3OB 5HP1B 1KD1T 1J5OB 1PJ7A 1YGYA 3DLEA 3PCOB 1CC8A 4O3SA 5HROB 1GAOA 3K8WA 2V50A 2LU1A 4DQQA 2ZUGA 1LEOA 1D8ZA 5HL7Q 1N36J 4IDKB 1GXUA 3NGTA 4UUWA 2WSCC 4JYAJ 1AB8A 1N52B 3ICLA 3D54A 2HAIA 2YNFB 2GHPA 1JNRB 4J7CA 2Q1LA 3MM6A 1KOOA 3BZQA 4LFCF 2DJWA 5DQIA 4P7TA 1VQOS 2YNHA 1X4DA 2HQIA 5M2UA 3M8QA 4U95A 4RL1A 5HMWA 2LQBA 3AH6A 1Z2LA 4IFVB 3CULA 4LF1A 4DOZA 3KK2B 2WB1D 5B0GA 4UOGA 4NA3A 3D9BA 3I55S 2DIUA 3AA9A 1Y11A 2F4FA 4URGA 3DGPB 2J9DE 4E8UA 4PRFA 3AOAA 1QY7A 1AT1B 4LRDA 2EVZA 1FRLA 2HVZA 2HFVA 4MKYA 3H20A 1Z1ZA 2Z30B 2ZH9A 1NXIA 2DR7A 1JLCB 4BS2A 2U2FA 4WU3A 2XMJA 3TJ8A 4BHQA 3QO9B 4QWAA 2I5JA 1N5SA 1FXRA 4F3OA 2A18A 3WIUA 4C8YA 1M1KT 1JJ4A 1S1VB 1FI4A 4WCEQ 2DHAA 2QSFA 3L7PA 3K57A 1FHTA 3KK1B 2FB0A 5IC6B 5DDRC 2XB2D 1JLBB 5LXYA 3PX4A 4NXMJ 2A0FB 3ELHA 3VGUA 4RW6B 3TJ9A 2RIJA 4NLOA 1FDBA 5ETTA 1Z2ZA 1VQKS 2ZWPA 4N77A 3FFIA 3G2XA 4XTTA 4C0BA 4C8OA 2UV8G 4N5SA 3FVYA 3GTYX 3Q24A 3NGUA 5LMNJ 3OHBA 1OO0B 3CMAS 3K5PA 1KTVA 1M5KC 4M8LA 4ID5A 5JMNA 2CQCA 3ZZTA 3DCAA 2DHGA 3TA1A 2ZFHA 1ZTTA 2MZSA 1RT4B 1CEZA 2VL1A 4I6AA 5C25A 4JI6J 3MAQA 2CG8A 2UXCF 2DY9A 1ZM9A 1WNEA 3EZUA 3NAHA 2G2ZA 1GX6A 2O1PA 4AT1B 1A0OB 4F50A 1TL7A 1Y00A 5IM0A 3MM9B 1AUSL 2EK6A 3DRPB 1QE1B 3GSDA 2H54B 3RG6A 2FJAB 3RAQA 5BR8J 4HACB 2R7RA 5KFTA 3SIPB 4N8NA 1BQXA 1GXLA 4PQAA 5CYMB 3MR6A 1LWFA 2WVDA 4KGXB 4MIWA 3EYZA 2W01A 2VPZB 1RTZA 1OSCA 1Q7LB 4Q8FA 3BDEA 2V69A 3PW5A 4LQ9A 5L1KA 1FESA 3N79A 4ZCMA 2RRNA 2XEXA 2CIMA 2YPZA 3A8IA 4DEZA 2HHHF 4FS2A 1NDPA 3SCJE 4B3MF 3I4PA 2R9LA 3TX8A 2QYGA 4K50A 2KU7A 2MDAA 2VPWB 4ALZA 2Q6CA 4W98A 1Q82T 2LVWA 2XBPA 3MI7X 1DQ8A 4H4KC 4UT4A 3CDAA 2VZ9A 5KT5A 3RYLA 1T03A 1APSA 4IH7A 3GJRB 2DITA 3W5YA 2NPFA 2VFUA 2YWWA 4ZMMA 4KGZB 3CCMS 3GJQB 1UVJA 1HI0P 2HGMA 2UUAJ 2CQGA 1YJRA 2R8GA 3HX9A 1VQMS 1TP7A 4DL7A 5KFCA 4WZMA 3GG0A 1RTHB 4QQBA 3HHLD 2HGNA 4J9QA 4F8RA 5DQGA 1KBRA 1XN9A 4B3TF 1CVJA 1F1BB 1KQGB 2QG9B 2CQ4A 1KN6A 2IFXA 3OL6A 3FSYA 2HK3A 4K5RA 2HNDA 1FRMA 1HBMB 2Y8WA 2AYGA 1TQLA 2C3PA 5B0FA 3VR1A 1S9FA 3MEGA 1TL1B 3AQPA 2B56A 3BGLA 2J6SA 4LRCA 3CO0P 2YNIA 5A2QY 4X4UA 3MMCB 2BXJA 2X7IA 3VQSA 3HHDA 4QU7A 2MZJA 4Q8EA 4NLWA 4KJIA 3NG8A 1YIJS 2GW8A 2QA4S 1HNIA 3MUMP 2FPHX 3CJRA 4TYBA 1QAYA 2J6UA 4CLKA 2ZD1A 1GMVA 5LT5A 3BBFA 1Q1KA 1SC1B 2QMXA 4DS4A 3Q0AA 3I82A 1N36F 1YZ7A 1QVGR 3IO1A 3AD8C 2NYIA 5E3QA 4WXWA 1WEXA 3VHQA 9RUBA 1IR0A 2ALYB 2HQDA 3SDEA 2DR8A 1S72S 3VALA 1C1BB 2DIVA 4J9RA 3T1AA 1WDDA 4DSLA 5DM7Q 4P2MA 4KBIA 4YUDA 2LA6A 2BOAA 2LXUA 4DPUA 2P5VA 2HHVA 1YK9A 1IKWA 2WOMA 1REVB 3JAMY 1RZMA 2ERRA 3QAUA 1SL1A 3RBZA 2LKZA 4NEZA 1SUQB 3DLLQ 3FJ2A 3RR7A 4NLPA 5KG0A 4ECYA 4O0IA 5GAGU 3CCTA 4IYQA 3VTIA 4Q7AA 4OZNA 2QIFA 4I0WA 4R8UB 1JX4A 5AXNA 3QZ7A 1ITPA 4M5MA 2ACYA 1T9XA 1T9VA 2D41A 2E5IA 5K8PA 3KHGA 1X5PA 3HXMA 1B64A 1BY9A 1IQTA 1U02A 2CNLB 3DXBA 4ZPDA 1PJ5A 3GYNA 3SI8A 3N4WA 3R6GB 2J9DA 3QLHA 4DS5A 2OD4A 1BD6A 2AP6A 1FERA 3LP0B 1WF2A 1I6JA 5E0OA 1FNXH 4NI2A 4F4WA 3VAFA 2FTRA 5FD1A 5L8RC 1Q78A 1QTMA 2R7UA 4P2SA 3FCWA 3F0NA 1B0PA 2DNHA 4ZVPB 1NBEB 4XDCA 2NXJA 3R2CJ 1FRXA 3MM8A 3G82B 2PDAA 3M8PA 5K9FA 4NXMF 2E5JA 3K7RA 3FBCA 2BMBA 3CEDA 2JEIA 2KN4A 4AXIA 4LF5J 4DDFA 5I3QA 3CJTA 3DLEB 2R2SA 1H2TZ 3DN9A 3BN4A 3DHXA 1M5SA 4P2FA 3T1YF 1Y10A 1J5EJ 3US5A 1NMEB 2VJUA 2ROGA 1F2GA 1S9GA 3T9ZA 5LMNF 3E01A 1MWQA 1XIQA 3CCVS 1U1QA 5F8NA 3AY0A 1NEEA 2L9WA 4HEA9 4NCGA 2ZDOA 1CJVA 4R25A 4C98A 3MM6B 2ZITA 5ETVA 5DLFA 2V9WA 5ETQA 3G6XA 1X4BA 5D0RA 4RKUC 2EFVA 4JI6F 2YNHB 1LW2A 4L3NA 4HTIA 3A1YG 4O3OA 2AGOA 3M8QB 2PMWA 2YKPA 3R8YA 4OHVA 5JJBA 1U2CA 2ATCB 3LWMA 1YJVA 4URSA 2BJ3A 3RU0A 2Y8YA 3UDLA 2YX1A 4DSKA 3BGFA 1IKVA 5EX0A 2W2NP 2ZJPQ 5HLFA 1MWZA 2L48A 3AOCA 4FP9A 2YX7A 3TUJC 1K0TA 2WRMA 3TEHB 1GMUA 2X1GA 4Q5VA 2HEKA 4B9LA 2I5JB 4NZ0A 2OPPA 4RUAA 3LPYA 2YQ0A 1CLFA 4WF9Q 1UEUA 3KHHA 1IN0A 2KRRA 3MR5A 1H2UX 5GADU 1TL3A 5K8OA 5D4NA 4UF4A 1R0CB 3KTQA 2HKEA 1NK9A 1JLQA 3EWGA 4RNNA 3CPWR 1ZAWA 1IM4A 1RKJA 3R1HA 4QW8A 2H4YB 1RK8A 4LF4J 4RW7A 1D3WA 3KXDA 1LOUA 2BVZA 1WI8A 1U25A 2C2OB 3IR7B 3IGVA 3GQCA 1UP1A 4EZ9A 2X3DA 2B5JA 3HHEA 2RDDA 2XMVA 3RB4A 3OLBA 2RQ4A 1YITS 1RT3B 3FFIB 1RWUA 5KT7A 1NK7A 4U7UD 5KFYA 2ROEA 3R7SB 1RCXB 1X0PA 1VQSA 5E3PA 2UUCJ 2RUSA 3HSGA 3I56S 2ZH3A 2BQ3A 4I6WA 3BSNA 3PR4A 2AWZA 4ZPWR 3GIJA 5DGAA 4KAIA 5IV4A 4DQPA 5IOLA 4F0MA 1QD1A 4TXSA 2IDLA 4UW2A 4QIVA 2HZVA 3O1LA 1IBCB 2YKMA 1OQ6A 5C25B 4OQJA 2L9NA 3BJYA 1DQAA 2OELA 4LFAF 2OMOA 2V94A 4J9SA 2MLZA 1ACMB 5C24A 2VKZG 4X4SA 1D0EA 3LAMA 2CQDA 1VC6A 5A8WA 1RACB 2AYEA 2BJEA 3JSBA 4NOHA 1TL7B 3BGRA 4Q44A 4K0KJ 3OW2R 4BC7A 1ZAXA 2F9JA 2ASYA 1RLCL 2VOOA 3M4XA 1IR1A 4L75A 2B43A 2DXEA 4EFAC 1CQMA 1U4BA 2HK2A 1LWFB 1H7WA 4HYKA 4FYVB 3UW1A 1CJKA 1TKXA 1QSLA 3M8RA 4PG5A 3DLKB 1RP5A 4ELUA 2AGQA 1S59A 2KHCA 2PEHA 5D15A 2DB1A 5L9NA 5KFSA 4DV1J 1NJIT 1UFKA 3VQTA 1ZZFA 1Q4RA 2EFPA 4GVBA 1QSYA 4IRDA 2Z4PA 2OTJS 2C2KB 1D9FA 2XS5A 4IH5A 3B82A 4R0JA 2F4VF 2DGWA 1CULA 2B4VA 1VBYA 3ZFVA 4Q0BA 3NNHA 2P6TA 3OLAA 4UY8T 4ANCA 1FX4A 4LF6F 1T03B 3PJ9A 1NPKA 2D3O1 2PO4A 2JFKA 3O44A 1T9YA 4JI4J 1LWEA 3RR8A 4EBCA 2UXDF 2CDQA 1HQEA 5EHHA 4AQYJ 2W2QP 2RNEA 2XZDB 2ZH4A 3TUZC 2KXHA 2RB7A 3MM7A 2HHWA 2PFFB 3ISND 3TR5A 3D4JA 1VFJA 1RXOB 2HNDB 2XMKA 5LXRA 2KXNB 1W7WA 4B3RF 1P1LA 3TVZA 2WW8A 2XI3A 3A4TA 3MEGB 3M8YA 2ADCA 3W9HA 4KFBB 3IBCB 4MIBA 4OX7A 3NS6A 2FLOA 3I5AA 4N8OA 2YNIB 4CLZA 4DXLA 1CSJA 4PWWA 4DLGA 2MSSA 4LBIA 2DNQA 3HLUA 2MKHA 1NB2A 2ALZA 3K0JA 2FGCA 4U7CA 3M05A 4ZK7M 1HNIB 3R6LB 2QFJA 3UN5A 4LF5F 4QOTA 2C2NA 1BQMA 5CABA 3QRQA 4MFBA 1WUUA 2ZD1B 1YX2A 4U96A 2JC0A 1YJ7A 3OJSA 1Q8IA 5GVQA 4MMOA 3T41A 1J5EF 4KGVB 1FTCA 2EW9A 4HT7A 4I1TA 4DQRA 2XMAA 3CD5A 5D0GA 3CB4A 3SDEB 2Q66A 2YKAA 3KLEA 1CJTA 3MDFA 3H98A 1U1KA 3DOKA 3RTVA 7AT1B 2ZKTA 3MR2A 1FA0A 2ZUAA 1IKWB 1TVRA 3ILIA 2OSQA 2ROPA 2WOMB 2IBKA 5KFOA 1HNZJ 1KS2A 4DR4F 2NXUA 3UWTA 1A7GE 4O3NA 1LNQA 1K44A 1DTQA 4USHA 2YWGA 1QAIA 5BXIA 3HD1A 1RAHB 2HWTA 5GMKa 4DV6J 2V2ZA 3ZTPA 4DPYA 4J91A 4DQSA 4P9SA 2B4UA 4HHHA 2QLFB 3C14A 4M5IA 3SSSA 2XCAA 4AL7A 4DPWA 1GX5A 2N7YA 4ITSA 5IFMA 4FPIA 2LQJA 3DOLB 2WSEC 3GPAA 4NI2B 3FNNA 1SQFA 2QTWA 5F3TA 5HQLA 3NEKA 3JAMU 1OWXA 4YP3A 1Y7PA 1Q16B 3CVKA 2DXDA 3H5XA 3MM8B 3UD4P 3M8PB 2PFDA 2C2EA 1RISA 2JLGA 1UVLA 3K59A 1VYAA 2DNOA 3KDOA 4B02A 2QN6B 4CM2A 2XYHB 4M5JA 4WPAA 4LUBA 2XSJA 2BE9B 2IDEA 3S1TA 1RT1A 4PPDA 1TL5A 3I6PA 2W4CA 4DL2A 2B9EA 2UUCF 5JVHQ 5LSLA 1SJ3P 4O0NA 4LJMA 2VC0A 1VQLS 3RBEA 2QFIA 2B0GA 4X4RA 2YY3A 3H42A 4X2BA 1UCNA 4NCGB 1OQ3A 1CJVB 2QMUB 3TRGA 2AJFE 3DRYA 3HHLA 5DQHA 3GJSB 4OJ1A 2MY8A 3RZAA 1UJ4A 1LW2B 4ZCKA 2NUHA 2HPUA 3D0GE 2HHSA 5D77A 2Z2LA 1ZM2A 3ULHA 4PPZA 3AFGA 2G1HA 5KG6A 1R0BG 1S0VA 2CAJA 1FVQA 2IC3A 2QX0A 5HATA 4M5HA 3GE9A 4PXEA 2MYFA 3D0IE 4F4AA 5J2MA 1FJGJ 1IKVB 1D09B 2V5HG 1S4EA 4IH6A 2XGPA 5HLFB 2OMLA 3EDRB 4OX9F 3TA0A 1HPZA 4KGKA 3MD3A 4DBQA 2EKYA 3FCHA 3W9JA 1MU2A 4ZOSA 4RLEA 4NLDA 1HHTP 2DKOB 5AXLA 2OPPB 1ULRA 3MR3A 4IOAQ 4YY3J 1K1QA 3Q22A 3BQ0A 2AF6A 2YWHA 1YVFA 3TQEA 1Q8BA 3MWBA 4TVAB 2XYPB 3BBCA 2RHSB 2DCUB 2LDYA 1R6VA 3J81U 1JLQB 2M8DB 2D9OA 4J9LA 2EBEA 4CH1A 2VA3A 1S6QB 2MZTA 2BJDA 1QDUB 3GONA 1WOPA 2X51A 4RW7B 4USMA 4ECRA 1G1XA 1NSAA 4TQRA 2E9RX 3K17A 3TW0A 1RBAA 3HULA 4N7TA 2B5JB 1I94F 2E7XA 4CQ1A 1Q0NA 2QLJB 4U67Q 4LREA 1VOMA 4IOCQ 2AJQA 3DOMA 1SCJB 3HT3A 1RABB 1K47A 1KQKA 1FE4A 1S6PB 3P5BP 3GCXP 3QATA 4QPXA 2MHEA 2HS4A 4HHJA 2DISA 2DNMA 2F3JA 2O01C 2VG7A 3NXZA 1NM2A 1ZM4A 1WC6A 4U8VA 4H4OA 4Y34A 2YKMB 4IG0B 1QVFR 3OXGA 1RWOB 2W9CA 4IQMA 5E3AA 4B9UA 5I3UA 2R7TA 5C24B 4W90B 5KG7A 2RUGA 4GKJJ 3OD2A 2HMIA 1RYRA 2JSXA 4DX7A 5E5NA 1NK0A 5ETLA 2VUGA 1VS3A 3BGRB 1KLNA 3FQLA 1X4FA 3OL7A 1HWLA 5CQGA 4DL0C 2F7VA 1U6BA 1NH7A 1NKBA 3RBXA 5DG8A 5LMUF 2VDHA 4Y6IA 4Z7CA 2RRAA 4Y0FA 2MJNA 5GAGI 1CJKB 1V9OA 4ECZA 4OJ3A 2ILZA 1TKXB 2JL9A 1FNMA 3MCOA 2EG2A 2XMUA 3D66A 3THVA 1UZHA 4C8MA 5EN1A 3TX0A 2L08A 4CLFA 3UCZP 4ILLA 2DHSA 3PEJA 3HVWA 3FUYA 1UWAA 3BKUA 1RQ0A 3PYEA 3RRGA 1W2BR 4GVBB 4J9UE 4IG3A 2AIRB 3EGWB 2J6TA 1TUWA 3EVMA 2NREA 1G4CA 2D3ZA 2OEJA 1CPZA 1CULB 2QL9B 2AEMA 4Q0BB 2ZZNA 1YJTA 1RAIB 5KFHA 1RHUB 4UZBA 3QIPA 2AYBA 2PA3A 3AODA 2XC9A 5D0HA 3V5RA 2OD6A 3J7ZT 1HA1A 1JLEA 1DTTA 4HI2A 4YR0A 4EBDA 1LWEB 4PYAA 3PFOA 3TZXA 2DBBA 1TK8A 3CSKA 3OTEA 1RWKB 3M8WA 1WC5A 2FC8A 1HQEB 2Y9HA 1RDRA 3H4DA 2HAFA 1WELA 1URNA 2XWXA 4PUOA 4ELVA 3MM7B 1QJHA 4WFNQ 1IBKF 2HHUA 2V4QA 3HFKA 4JB8B 4DPOA 1KLMA 3TQ1A 1EQMA 1T3OA 4ED4A 2LP4A 2VC1A 2LMIA 3NOGA 3JB9k 2H5JB 3LPEA 1NHUA 3OFEA 4MKBA 5ETKA 2LCWA 4OX8A 3W65A 3B4DA 4M5NA 3PM9A 4WZQA 4P6QA 1TUVA 2GQQA 3ZTQA 1WTFA 5C2CA 1VRUA 3DU5A 4OZ0A 3W5ZA 5KOWA 4EUVA 4QR2A 5J1PA 1JQGA 3CCJS 3NWRA 3PG9A 4J9OA 3L4BC 4RZRA 4CLYA 1H73A 4DN0A 4OI4A 2XO7A 5FJ4A 4CLLA 1YHQS 3GWCA 2VFRA 4WP8A 1MN9A 1N34J 1GK8A 1M5VC 3F41A 3VAKA 3KMSA 4DFMA 1BQMB 2PI5A 1LXNA 2KH9A 3DYAB 4MFBB 1RADB 3GIMA 4CCHA 3TVYA 1U2FA 2CQIA 1QLNA 2IM2A 4DZDA 3S7RA 2MJUA 2CPIA 1VCTA 2D9PA 4LF8J 1R3NA 4MYTA 3WDOA 1TKZA 1ROFA 2M52A 4AL5A 1MWYA 3HVRA 1P6TA 2KB2A 4FF4A 3QGGA 2W9AA 3DDNA 1RA6A 4WKYA 5M2PA 3KLEB 1CJTB 4MK9A 2C3UA 1HR0J 2V9KA 5GADI 3J7AN 2CQBA 3MECA 2WHOA 4WFBQ 1ZPVA 3DOKB 4EZ6A 4ED7A 3H5UA 1AFIA 2AYMA 2MZRA 2XLJA 2MXYA 1TVRB 3HHKA 5E3CA 1F6TA 3SEOA 1SBRA 4QWBA 3BH7B 3WHIA 3CJ4A 1YI2S 1G3OA 1X9MA 4PQUB 2P6SA 1VLYA 5MLCV 1MLAA 1DTQB 2DT9A 3HMJG 4DR7J 1KQSR 3MPUB 2BR0A 5DZ6A 5HI7A 1KFDA 2HQGA 1KKHA 4DR3J 3IS9A 2RS2A 2M2BA 3T6JA 3JQJA 4M1KA 3HKZD 3TANA 3THPA 5HVFA 3MPYA 3SSQA 3QJPA 3C14B 1FWPA 2QZ8A 3AA8A 1X9WA 4A8WA 1VISA 3QWUA 4BBYA 2HHQA 4RBUA 1U09A 4YY3F 4GVLA 4HDHA 1RWMB 3LO3A 2LECA 4DV3F 7FD1A 2VF3A 1FFWB 1EX8A 4FXVA 4JI5F 4OI2A 2CNNB 2UVVA 3H7HB 5D0EA 4NZ6A 4TY9A 2CYYA 3QZ8A 2CQ3A 3JSMA 1MG7A 1S1TA 1NUEA 3CTRA 1WSRA 4ETXA 1EP4A 1MMNA 3CGIA 1KVIA 5K14A 1B0VA 4JI7F 3BN7A 4IQXA 4M5LA 3I5BA 1N6QA 4DU7A 1EKSA 2BA9A 2V8VA 4AL6A 4HHUA 4G1PA 1RBOB 3GR1A 2HHTA 3FBEA 2DRBA 4OX6A 2XSJB 3D3BJ 4LSZB 4A8OA 5KTQA 1U1RA 3U1NA 2ZM6F 1P1TA 3PYFA 2DGVA 3FZ2A 1KOHA 4CLWA 1VBXA 2AEJA 1WKKA 2BKOA 4QIEA 3RRHA 2IJRA 2RH3A 4U6PA 1XR6A 1UPMB 3BB5A 2GHVC 3HHLB 2JVOA 4EEYA 3OSNA 3ZZ0A 3UO0A 1KSPA 3OTOF 4HVZA 1LKZA 5A6WA 4QWDA 1M1GA 3H2UB 1ZOTA 4J9NA 1X4HA 4MTPA 4DV4J 2DGTA 2DK2A 1U1PA 3C19A 3A8JA 2AQ4A 4DR1F 1HIYA 5F41A 1XMOJ 1NPRA 1HBOA 1E6YA 3DHWC 4LMZA 5J2MB 3R9LA 1JXLA 1RHJB 3GV7B 2Z0GA 4S0MA 1AUDA 2AU0A 5I4MA 1S99A 1GXTA 1MU2B 2PN6A 1ZM3A 3R5AA 4F0HA 3PO5A 8ATCB 4F26A 1OY8A 4LRAA 3KFWX 2HRTA 3QRRA 4CT9A 4M5DA 1IQZA 2G2YA 2DNPA 3VGVA 2HBQB 1HWKA 2NR0A 3KK1A 3DRSA 4KR0B 3FMBA 4Q45A 2DEJA 2DNZA 3MTKA 3EICA 4ES2A 1R0AA 4OZ5A 2NXNA 1R8AA 4K4YA 1PBAA 1N33J 3PR5B 3RW7A 5DDOC 4XPCA 5CYJA 4A47A 2WONA 1NH8A 2IYIA 3WX8A 3KG1A 4OHZA 2IRUA 3TI0A 4IRKA 5HQ8A 4AUKA 1S4FA 1XR7A 1FDNA 1JLGB 1B4SA 3CO9A 3GU0A 3ITHA 2Q79A 4D3HA 2WVEA 3RB6A 1GMWD 3K58A 1T3NA 5CZXA 4JI3F 4FKXA 1KRPA 4LBHA 3Q8YA 2DH7A 2DGOA 2CKWA 2FVPA 4FKYA 2XGQA 5KFDA 4QYZK 1RT4A 2PGCA 2E1CA 1ICEB 4Y3CA 2VFTA 3D1OA 3CC2S 4X4NA 3NGDA 2C2ZB 1R89A 2F9DA 4OI3A 2QO3A 5KG2A 2VG7B 2FJBB 1YKWA 4X65J 1S1UA 4Q43A 1Q81T 4ES3A 3C2PA 4QBUA 4H4OB 3DC2A 2AV5A 2GCFA 4DCJB 3D1QA 4LIWA 4OYMA 1WD6A 2W24A 2JNJA 3GYGA 2W9CB 1Z4UA 1IWAA 5I3UB 4WFYA 3HJFA 2HFUA 4GRSA 2QV6A 2HMIB 3CDUA 1IXKA 3TARA 4U8YA 1T9WA 3V6DA 1JJHA 2YX4A 5LJ5Y 5HJYA 2YBVA 1RAEB 5CYMA 2GQ2A 3CIZA 2QC3A 1YRXA 2GMLA 1UA0A 2E1PA 4TLQA 2OO4A 1RAGB 5DG9A 1BWEA 2F8MA 3P8BB 4O3RA 1T0TV 1C0TA 2EBGA 3T5HA 2WW4A 2F1FA 4FZVA 4WIQA 4ZLLA 3R27A 3BO3A 1U6ZA 2QJ3A 5AE3A 1XQIA 3PX6A 3R5CA 2VA2A 3HD2A 4IG3B 4IR9A 1S48A 1F3FA 2B9WA 4XK8C 2QSWA 3KWMA 3M6WA 1QAJA 1H0HB 2VQEF 3JTNA 4LQ3A 1S7IA 3OBIA 3LH2S 1N5QA 3UR3C 3L9ZA 2G4BA 1SKUB 2HHPA 4ZHRB 3QIPB 2ZJQQ 2GO8A 2AHOB 1RU1A 4ZVUB 3Q2TC 1HHSA 4ZP9A 2MB0B 2R2RA 3AXKA 2F65A 1JLEB 1DTTB 2VG5B 3W8PA 2E1RA 5CYQA 2K8GA 4Y2CA 2WTFA 5D4PA 2IRYA 2AW0A 3TA2A 4RBVA 2YKNA 2MZ1A 5F8LA 4O23A 4PUOB 4M94A 3TOQA 5A0YA 3AB4B 3CT9A 1HBMA 4BLGA 2NZCA 2UXCJ 1O5JA 1KLMB 1EQ0A 2HBZB 1B7FA 1Y5IB 4WE1A 3QQCD 4LR8A 2W9BA 2H9ZA 2GC8A 4DI6A 1YJ9S 4DQIA 3NBPB 2RMLA 3M6UA 2DCLA 1PAEX 4A8FA 1MMLA 1VRUB 2Z58B 1O0PA 1NSKL 3IR5B 2DTJA 2ZE2A 4JI2J 2RT3A 1FTRA 3PW0A 2OP5A 2CPXA 2H5EA 4CZCA 4H4MA 5LL6d 2BKNA 4CO2A 5AJ3J 3THTA 1F5AA 3OTBA 4QW9A 4A8KA 3DGVA 4NYOA 2YXLA 1MROA 1PILA 1Y5NB 4JBCA 3M9OB 5KFPA 1HFEL 3QWPA 3OT9A 4USTA 4G1QA 4XIUA 5FLXY 4N47A 3PHEA 4B3MJ 1KVJA 1JLAA 1JXEA 4PXDA 3KKFA 1TKZB 5DETA 3I9V9 5BYQA 3DRRA 4L74A 1V5VA 1AXQA 1QUVA 1L3UA 2YPYA 4P72A 1HD1A 4QWEA 3L95X 1BXNA 2ZBCA 2JEFA 2HSEB 1F0XA 4J9MA 1IBLJ 4RBTA 3MECB 2C3MA 2GS8A 2VU5A 1FWLA 1T8EA 3Q8QB 1FNOA 2Z57B 1WORA 4ZLJA 4ZVEA 3AJDA 4GO7X 2HBRB 3MOZA 3R2DJ 2ZVSA 2BE2A 2B8QA 4KH1B 1JNZB 2R2TA 3EX7B 2BM1A 2F40A 3NS5A 1XMOF 3HSZA 1I3OB 2IRXA 2WZ1A 4FS1A 2O66A 5SZTA 3POTA 1IUJA 3VWSA 2K1RA 3PJWA 3IS9B 3LA0A 4C3KA 3BKTA 2KRBA 1U8SA 4AFFA 2CZ9A 4Y2AA 3HM9A 4QIGA 4MJKA 3HF5A 3KG4A 5H9EK 3SFGA 3OL8A 4OYOA 2N4CA 3I4HX 3CCRS 2Y1IA 2UUTA 3FK4A 4CO1A 4DLEA 1AW0A 1S1WA 4NE9C 4Y00A 1LWCA 4QR1A 3CCUS 4YS2A 4G1IA 1JB0C 1FFGB 1HNVB 3ILOA 2ZZMA 4DSJA 4B3OA 4ICLA 1N33F 1S1TB 2HNZB 2R7WA 1IJEB 1EP4B 4W92B 4HH0A 1RJJA 3P96A 2FD2A 5KG1A 3T5JA 5K14B 3B4MA 3TAMA 3RGIA 4ZIWA 2FHJD 1N6QB 3AD9C 3I32A 2R8HA 3OPKA 3I0RA 3OVBA 2E29A 2EEYA 4M5KA 5J2PA 3QGIA 2KZZA 5F8IA 1JK9B 1O6XA 5E41A 3IAM9 4K8RA 2FZKB 2CJXB 2K2PA 2C1EB 3GFHA 4B9SA 4OZ3A 1NK6A 1TK0A 1SJRA 5RUBA 1KP6A 4NX9A 2CJ9A 5F8MA 1L5UA 1X60A 5KFQA 4L3KA 4X65F 1HNWF 2MKSA 2EFQA 2QLWA 4UOCA 4ZPVR 2CVEA 3N6NA 4LVNP 5IC4B 1LK5A 2Z2YB 4OZJA 3TO8A 2QEXS 3LANA 1SC6A 2J0WA 3IWNC 2RQCA 1RAAB 2DNYA 2FJDB 2Y1JA 2KDOA 4LIRA 2VBYA 3OVAA 4YMEA 4DV2F 2BJ7A 3C3LA 3N01A 3RAMA 1SJQA 3M2UA 2OJ3A 1PCAA 1NLKL 1HBOB 1E6YB 1B3TA 2H3EB 3L7UA 3RUBL 2RD5C 1PAUB 4XAKA 4RX6A 2FLPA 1LWXA 1QAXA 1B70B 5J1NA 1T94A 4F3MA 1PO6A 2GFFA 3ZZYA 3JYTA 2V8HA 4X64F 4BWJA 1DFDA 3G6YA 1L3TA 1BWVA 1NJXA 1YDLA 3IG1A 1FE0A 2ATLA 2AZ3A 2ZBIA 1X4GA 3CF5Q 3VAJA 2C22A 4M5DB 4M63A 1M90T 3DRSB 1N48A 5F8HA 2KT5A 1UVKA 5D4OA 3PO4A 3Q89A 4R0EA 3JXOA 2D3UA 1R0AB 2IBOA 3IBFB 4OL8A 1H38A 2UVRA 1Q79A 2XM3A 2WONB 1YWXA 3NAIA 3H5YA 4A8MP 1RT3A 4ZVQB 2H5IB 4JV0A 3BF4A 3T1YJ 1IBMF 1NK4A 1VRQC 3TAQA 2DR9A 2KO1A 4DFKA 4F2SA 3GJTB 4L73A 1XNRF 4CRJA 3ITHB 2J7UA 2RJZA 3GMGA 3OL9A 5DGBA 1SB6A 5CA5A 2KTQA 3N5FA 1FKPA 3HHNB 2RAQA 3BKFA 2XHWA 2IVFB 2XY7A 2A10A 5H9FJ 2BJ8A 4WYWA 2DRAA 3IP0A 4DL6A 2ZBRA 2E44A 1VJWA 3OXFA 4K4SA 4JOUA 2O3DA 1S1UB 1K1SA 2DPIA 4DMZA 3EZ5A 2D74B 3NWGA 1RHRB 1HWUA 4OI1A 1H3DA 2HVHA 3VAHA 5GMDA 4O3QA 4I4BA 1WG4A 2GIFA 1R8CA 3CNQP 2B6AA 5F8JA 1K0VA 2UXBF 3TP2A 2VG6A 1T02A 1MSWD 2B51A 3SFUA 2CNOB 1SV5A 2UP1A 1FJ7A 3V6DB 3PIPQ 2OSRA 2BZ2A 2XNRA 3OXLA 1UFWA 2HFSA 1YJWS 4JI2F 3PYDA 1N88A 1XMQF 3UNGC 4Z37A 3DNCA 5AJ3F 2DEIA 1I1GA 4OV1A 2YNGA 1TAUA 3DLKA 3KOAA 3UD3P 3L09A 4HH1A 2OFGX 2KVQE 4C9DA 2IM1A 1C0TB 3IWLA 2DGXA 5KT6A 2XCPA 4TKTA 4ZPBA 1FFSB 2GNKA 2DHHA 1S0OA 3G86A 8RUCA 1FK9A 2QLXA 4NXNF 4JUZA 4PXBA 3T5LA 1ZBTA 3A12A 2NSBA 4DL5A 2IA6A 3JSYA 3CIMA 1SH3A 1KWMA 3ISNC 1UW9A 1IBLF 3OV7A 3Q8PB 4G3IA 3M30A 2K7JA 2QL5B 3T3FA 1S1XA 1FX2A 4ZN1A 1H98A 2CJQA 4KC5A 3HO1A 4X66J 1WG5A 1SKSA 1WEZA 4CNZA 1C1CA 1LXJA 2E9TA 5H1SV 3GFXA 4YN3B 1N0UA 1OPZA 1S0NA 5CYQB 2ZKUA 1RTDA 1W26A 1HLWA 2YKNB 3J7YU 4X62J 3KJVA 1RCOB 2HW3A 4C7QA 5A0YB 4GO5X 4I68A 5DDQC 2YTCA 4DSFA 1M5HA 5FIIA 4LFAJ 2NZ4A 4JV1A 2UU9J 1FWKA 3LWLA 4WE1B 1VHIA 2W9BB 4P2XA 1U47A 4KFBA 1SC3B 1UJ5A 1HWIA 1AZSA 1YRTA 1U8WA 3CJ3A 5CD4A 4TU9A 2N82B 4ZPCA 1OJ4A 4WP3A 3R97A 3OVSA 2EKNA 1PKUA 3VGTA 2R7SA 3AOBA 4KGMA 2ZE2B 4DUTA 3CJ0A 3PX0A 4GKKJ 4H4MB 4R5PA 2MQOA 4C48A 1KHWA 2YQ1A 1UVIA 2FVQA 4I69A 5L1IA 1MROB 3KNGA 6FDRA 2FVRA 3QMQA 3DLBA 1W2IA 1FRIA 2HS0A 4RUCA 3RBDA 3OR2A 4JI8F 1H2VZ 2XI2A 2W4PA 4YDXA 4G1QB 3I9ZA 5B09A 3SCIE 3Q8UA 2CNKB 2QMWA 1JLAB 2LXIA 3TZWA 4W4MA 1TKDA 3ONQA 1PSDA 1XJWB 3DRRB 4TQSA 1RHQB 3LGHA 2F4VJ 3BPSP 2BX6A 4TN2A 2ILYA 4FYYB 3GYXB 2XNQA 3EM1A 3BR9A 1TR0A 4DJBA 3GG1A 4Y2KA 3LAKA 4LF6J 1U1OA 4MAKA 1TFYA 5ETRA 5KFMA 2RSQA 2C3OA 3PRVA 3W7BA 1UVMA 4DV7F 2NCKL 1RAOA 1HL6A 2AEFA 3TZYA 2XYGB 2BE2B 2UXDJ 1OIAA 2X1FA 4JP8A 2LEBA 4C3LA 4F2RA 2KHDA 3J81j 4QIWD 4ED0A 5EWGA 4TLRA 4M5GA 5CD4H 3CWJA 3POTB 1SH2A 4ZITA 2K1RB 2GAGC 4CIOA 1NK5A 2KFZA 1G6BA 4NYZA 9ATCB 2M70A 1EJ7L 2FDNA 3H59A 2MKJA 3CDBA 4B3RJ 3EGZA 3BPDA 3U1LA 1QUPA 4G6VB 2V4JA 3DOLA 4O44A 2XY6A 2R42A 1K73T 1VQYA 1UWBA 3I0SA 1S1WB 4PEOA 2YVSA 1GNKA 1LWCB 1RLDA 2EK1A 4DF8A 4I56A 3E3XA 3MEKA 1RKIA 4B3OB 4ICLB 3MOJB 4X84A 1U26A 4WXOA 4RUBA 1O8BA 2RILA 2OPQA 2ZZTA 4USWA 4K4WA 1FRJA 1TAQA 3TAMB 2HNYA 4OHWA 3L7OA 3M32A 1RB0A 4ECVA 4ZP7A 4K7QA 3I0RB 2M4MA 1F9HA 1RE1B 3DM2A 2EG1A 3T1HF 4MK7A 5J2PB 4DCOB 1EARA 5L1LA 1S6UA 3CJQA 2AJ4A 3C6UA 1Y3KA 4Y65A 3UE2A 1GTEA 2M3DA 2EFOA 4X4PA 4F4XA 1FKOA 1VK8A 1Q95G 4FYXB 1WI6A 5C2GA 2IAJA 4ED6A 4LSNA 4ANEA 4QYZJ 3UI3A 1U24A 3K5LA 2OPSA 4O4RA 2HIYA 3NY0A 4DR4J 4I2QB 3TUPA 2BKPA 3I87A 4WK3A 3BDPA 1WHWA 1OMSA 3GB0A 4CO3A 4F67A 2HGLA 4PKDB 3OSPA 5T7LA 2COLA 3CC7S 3M2UB 1YBAA 5L1JA 3MD1A 4E2FB 3OFGA 2APOA 4OYAA 2PEBA 4ECWA 1TL4A 2MMYA 3PYGA 5KFIA 4IO9Q 2AKWB 3MMAA 4FYWB 5L38A 2G2OA 3VZHA 2I1RA 3JYTB 2ZDPA 2QRRA 2WCXA 5KAKA 3IG1B 4DPTA 3CCLS 1RT6A 2XO6A 2J8SA 4ETZA 2VKRA 4NWBA 1WKLA 3PKYA 3ADAC 4C11A 3OUYB 3WC0A 5HBMB 3FC9A 1LQ9A 1S6QA 5CXTA 3UD5A 1HD0A 2I9SA 1KNZA 4PCQA 3JSRA 1VQ7S 1U1NA 4CDIA 3ETOA 3RRKA 3BQ1A 1HNXJ 3HVAA 2ZH1A 3UVJA 3UNYA 1YJNS 1X4CA 2XG8A 2UUWA 1EKRA 3D6MB 1N4LA 1SXLA 2IA0A 2HIQA 1Q7YT 1GH8A 4OIXA 1LV5A 1UEKA 3M6XA 1NHVA 2KYZA 4UTGA 4X66F 4ZPTR 3ET6A 1PBUA 2VD3A 1S6PA 3C46A 1SL2A 1FKPB 1H6KX 2Z56B 1ZA2B 4C0OC 3VVTA 5I42A 2XMMA 3BREA 2WVFA 1JXVA 2AGPA 4X62F 4IG0A 1N0VC 3U7JA 3GZ7A 1IR2A 4FF2A 2CFXA 3EPGA 2V67A 3MMJA 1XTZA 3PEHA 3F44A 3VV2B 4OYZA 2UU9F 2OEMA 2FLLA 2F8HA 2JEGA 1EAYC 2GHWA 4X4TA 5AE2A 5CH7B 3DFEA 3LGNA 4ZKAA 4CYUA 1AFJA 2B6AB 3UDVA 4UQGA 1HBUA 3KG0A 3CD6S 2VG6B 5BJRA 4ZCIA 4NCBA 1LW0A 4LF2A 1SV5B 2P9GA 2G0IA 1R8PA 3EUNA 1NSPA 3TUIC 4KSEB 5A76A 5KFLA 4OX9J 1HYSA 3OTDA 3LP2A 2Z2ZA 3ZC4A 4JI0F 4GKKF 4BDPA 2NQPA 3H0PA 2YNGB 1WWHA 3UDCA 3RW6A 3W60A 4UQTA 1FJCA 5HVHA 1PGZA 2H1YA 4ZJLA 1FRKA 3W2VA 1SJFA 3CJ8A 1RUSA 3HDSA 3IN5A 2DNKA 5KT4A 4KQZA 2Y0SD 2HVDA 3CCQS 1FK9B 2VOPA 2HWHA 2IIHA 2V4RA 1S10A 4OYWA 4USKA 3KUHA 1NK8A 1Q8KA 3MCMA 2KJVA 2L9DA 2FVSA 3MZIA 3NMRA 1I94J 3M30B 1S1XB 1U0HA 4PWDA 2VV5A 3LQVA 4C8KA 1TZ0A 5G0RA 2OKQA 4P52A 5K5MA 2BM0A 3VZIA 1VHFA 4K4TA
chains in the Genus database with same CATH topology
5CAAA 4CP5A 3Q89A 1VYAA 3PRVA 1NB2A 4ANCA 3FBFA 3PJ9A 2DY9A 1XQIA 3FCWA 1MN7A 1NCLA 3EMTA 1NPKA 2NCKL 3ZTRA 3Q83A 1NDKA 1K44A 1S5ZA 4W98A 3VGVA 1PKUA 1NDLA 1WKKA 3VGTA 4DI6A 4DZ6A 3B6BA 1F3FA 5BXIA 5CABA 3FCVA 1KDNA 4F36A 4DUTA 2VU5A 2DXEA 1NDCA 3FBCA 4KPCA 3ZTOA 1PAEX 3EE3A 3FBBA 3NGSA 3ZTPA 4O0NA 3EICA 3Q8VA 2HVEA 4C6AA 1NSKL 4WBFA 3ELHA 3VVTA 4UOFA 1BUXA 1WKJA 2CWKA 3VGUA 1NLKL 2B8QA 3BH6B 1JXVA 1UCNA 3ENAA 4UOHA 3Q86A 2DXFA 3VGSA 1BE4A 3DDIA 3L7UA 1S59A 2HVDA 3VVUA 4UOGA 3EVMA 3BBFA 3ZTQA 3WX8A 3JS9A 2BEFA 3BBCA 1HLWA 3ETMA 4HR2A 1NUEA 3Q8UA 3G2XA 3DKDA 1XIQA 1LWXA 1WKLA 5IOLA 1HIYA 1ZS6A 1B4SA 5C7PA 1EHWA 1F6TA 3GPAA 1W7WA 3NGUA 4ANEA 3FC9A 2AZ1A 4ANDA 1BHNA 1LEOA 4ENOA 3BH7B 2BX6A 3EJMA 3MPDA 2AZ3A 3R9LA 3EVOA 1MN9A 4S0MA 3EM1A 1B99A 3NGTA 2ZUAA 3NGRA 3FBEA 3GP9A 2B8PA 4FKXA 2DXDA 4EK2A 1NHKL 3FKBA 3ZTSA 2DYAA 3Q8YA 1S57A 1U8WA 1NDPA 2HURA 4FKYA 3B54A 1HHQA 3EVWA 1NSPA 3BBBA 1NSQA 4F4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAA A;  4CP5 A;  3Q89 A;  1VYA A;  3PRV A;  1NB2 A;  4ANC A;  3FBF A;  3PJ9 A;  2DY9 A;  1XQI A;  3FCW A;  1MN7 A;  1NCL A;  3EMT A;  1NPK A;  2NCK L;  3ZTR A;  3Q83 A;  1NDK A;  1K44 A;  1S5Z A;  4W98 A;  3VGV A;  1PKU A;  1NDL A;  1WKK A;  3VGT A;  4DI6 A;  4DZ6 A;  3B6B A;  1F3F A;  5BXI A;  5CAB A;  3FCV A;  1KDN A;  4F36 A;  4DUT A;  2VU5 A;  2DXE A;  1NDC A;  3FBC A;  4KPC A;  3ZTO A;  1PAE X;  3EE3 A;  3FBB A;  3NGS A;  3ZTP A;  4O0N A;  3EIC A;  3Q8V A;  2HVE A;  4C6A A;  1NSK L;  4WBF A;  3ELH A;  3VVT A;  4UOF A;  1BUX A;  1WKJ A;  2CWK A;  3VGU A;  1NLK L;  2B8Q A;  3BH6 B;  1JXV A;  1UCN A;  3ENA A;  4UOH A;  3Q86 A;  2DXF A;  3VGS A;  1BE4 A;  3DDI A;  3L7U A;  1S59 A;  2HVD A;  3VVU A;  4UOG A;  3EVM A;  3BBF A;  3ZTQ A;  3WX8 A;  3JS9 A;  2BEF A;  3BBC A;  1HLW A;  3ETM A;  4HR2 A;  1NUE A;  3Q8U A;  3G2X A;  3DKD A;  1XIQ A;  1LWX A;  1WKL A;  5IOL A;  1HIY A;  1ZS6 A;  1B4S A;  5C7P A;  1EHW A;  1F6T A;  3GPA A;  1W7W A;  3NGU A;  4ANE A;  3FC9 A;  2AZ1 A;  4AND A;  1BHN A;  1LEO A;  4ENO A;  3BH7 B;  2BX6 A;  3EJM A;  3MPD A;  2AZ3 A;  3R9L A;  3EVO A;  1MN9 A;  4S0M A;  3EM1 A;  1B99 A;  3NGT A;  2ZUA A;  3NGR A;  3FBE A;  3GP9 A;  2B8P A;  4FKX A;  2DXD A;  4EK2 A;  1NHK L;  3FKB A;  3ZTS A;  2DYA A;  3Q8Y A;  1S57 A;  1U8W A;  1NDP A;  2HUR A;  4FKY A;  3B54 A;  1HHQ A;  3EVW A;  1NSP A;  3BBB A;  1NSQ A;  4F4A A; 
#chains in the Genus database with same CATH topology
 5CAA A;  5IZH A;  1X4A A;  3DI6 B;  4NLV A;  1T9U A;  5B0D A;  1C1C B;  3EMT A;  4ZVS B;  4P73 A;  2ZOF A;  1RTD B;  2BRL A;  1QTN B;  2HQ3 A;  4EYH B;  4QIF A;  4NRT A;  3GIK A;  1W25 A;  1LFP A;  2E66 A;  5F3Z A;  1J27 A;  4YB6 A;  3KJV B;  5J2Q A;  3EZO A;  2R7X A;  4RW8 A;  5LOQ A;  2KG0 A;  5IT9 Y;  1KQF B;  4Y2I A;  2AX0 A;  2R7O A;  4NLU A;  3PV8 A;  2HWI A;  3UFC X;  4QZV B;  1M5P C;  4ZIV A;  1OPI A;  1VQP S;  2IHR 1;  2GMH A;  5H9E J;  1AZS B;  4A4J A;  4ZDN A;  2BDP A;  2R4F A;  3I5C A;  1VQ8 S;  3EJM A;  3JQK A;  3MAA A;  3NS7 B;  3OFF A;  5LMU J;  4F4Y A;  1Y0H A;  1NZA A;  3NGR A;  1LK7 A;  4HTJ A;  2A1B A;  5HSP A;  1VR6 A;  4DL4 A;  3DYA A;  5IV3 A;  1CG2 A;  5EX3 A;  4R5P B;  4QCL A;  2VQF F;  1UEV A;  3LP1 A;  3G6V A;  2BQR A;  2X3G A;  3OJU A;  4RNM A;  3FCV A;  4DUY F;  1OY6 A;  2RF2 A;  2Y1L B;  3OR2 B;  4DSE A;  2HYI B;  3KLI B;  4DCP B;  1HAR A;  3NGS A;  1H7X A;  1CC7 A;  3AJ1 A;  1JIH A;  1S6O A;  1EET A;  3GIL A;  4DU8 A;  2WBM A;  3HJV A;  4A46 A;  4O3P A;  1DAR A;  2IJN A;  3DKD A;  5KFA A;  2BW2 A;  4FXD A;  5A2Q U;  4PYD A;  2FIU A;  1KC8 T;  1L3V A;  1U7L A;  3P45 B;  1FD2 A;  4L6V 3;  1Y3J A;  4NEY A;  1U1M A;  1D9A A;  4PQU A;  2W4D A;  1ZA1 B;  2EI5 A;  1DZ5 A;  4IFY A;  3B54 A;  5EWE A;  4RU2 A;  4ED8 A;  5HJX A;  3M8S A;  4RJV A;  5ITH A;  1IBK J;  2A3J A;  1NCL A;  5K8M A;  3HKW A;  2HZA A;  3HZE A;  1JLF A;  2ZBP A;  2Y0B B;  1IKY A;  3QT5 A;  1UPP A;  4PZV A;  2CVI A;  3K2Y A;  3BYR A;  4X4V A;  2D69 A;  2LEP A;  2QA1 A;  4ZVR B;  2V8D A;  2V4J B;  2M88 A;  2CA9 A;  5K8N A;  4O44 B;  3QGH A;  4FNI A;  1UWB B;  2YKQ A;  3I0S B;  1F5C A;  4HL9 A;  1FCA A;  5A8K A;  4O4G A;  1P27 B;  3D68 A;  3D1H A;  4HT5 A;  3AT1 B;  3J80 Y;  5E33 A;  1HNX F;  1V5I B;  5E2Q A;  4WFX A;  3U02 A;  2ZOG A;  2OPQ B;  5ETP A;  2HNY B;  5B0A A;  3GV8 B;  4F4K A;  3M32 B;  2DH9 A;  4ED1 A;  4ZP6 A;  1DY3 A;  3C8Y A;  3DM2 B;  4YB5 A;  2IMW P;  1C2P A;  2RDI A;  2C2D A;  3LOU A;  1S5Z A;  1WHV A;  3C6U B;  4RR5 A;  1U49 A;  3W5X A;  4DV0 F;  3D67 A;  1YJU A;  4RW9 A;  3M2V A;  1KEK A;  3CME S;  4KRW A;  2IYG A;  2LEA A;  3ZTO A;  1DAX A;  5KFX A;  1FKO B;  3MUV P;  3PDN A;  2DHX A;  1VBK A;  2IAJ B;  2CJK A;  4LSN B;  2IMO A;  2KM8 B;  2V0N A;  2MY7 A;  2XUL A;  5CCM A;  3G9C A;  3TZZ A;  1CBK A;  2OPS B;  4HI1 A;  5G4D A;  2VAS A;  5DS7 A;  1R6Y A;  2VDI A;  5HK4 A;  1XWL A;  2FVC A;  1OYD A;  2JEJ A;  4V1A k;  3LTO A;  1TV6 A;  4CWB A;  1YZ6 A;  3H4B A;  5T7L B;  5A8R A;  3BR8 A;  4G65 A;  4ELT A;  4MYU A;  3MHY A;  3VAG A;  4F7V A;  3MMA B;  4OHY A;  3A8E A;  3V4I A;  5KFR A;  2J0S D;  1BC6 A;  3MFI A;  2JX2 A;  1OYE A;  3PW7 A;  1FDD A;  4DV3 J;  2W2O P;  1FKA F;  2LYV A;  3J7Y I;  4JI5 J;  3PTW A;  3EE3 A;  3NCQ A;  1RT6 B;  1YTY A;  3CDE A;  2V63 A;  4C11 B;  2XZW A;  5KOX A;  5DDP C;  3H40 A;  2OPR B;  4M95 A;  2AX1 A;  4CLP A;  1QM9 A;  1O51 A;  2PI4 A;  4WK1 A;  2MKY A;  4JI7 J;  3M2R A;  3UVJ B;  1JLG A;  3O3L A;  4C3M A;  4F02 A;  2GJI A;  2RDJ A;  4OYP A;  3TAP A;  1Y5L B;  4CLU A;  1GFW B;  3V81 A;  3IRW P;  2MQQ A;  2DO0 A;  2V2Q A;  2RE1 A;  2ZM6 J;  2ZVI A;  1RGV A;  3BM7 A;  3W62 A;  3ET6 B;  3QFH A;  2XMW A;  2FZC B;  2M8H A;  3BBB A;  4JYA F;  1ZPW X;  4FPR A;  2DNR A;  2V8P A;  1OY9 A;  4GC6 A;  1KVK A;  3UCU P;  4L72 B;  2JH3 A;  3MCN A;  5I42 B;  1DJ0 A;  3JTP A;  3SQG B;  2CQP A;  3LGM A;  5EDW A;  2J7W A;  4C4W A;  1IKX B;  2ZHO A;  3S6E A;  2PA8 D;  3OTO J;  4KV8 A;  2G9O A;  5D78 A;  4C2M A;  2C28 A;  4B9T A;  2CPE A;  1RT7 A;  2C42 A;  3KLV A;  2A2C A;  4KH0 B;  4DR1 J;  2CWX A;  4CYU B;  1BQN A;  5C5J A;  2FJW A;  4A48 A;  3L3C A;  2MLY A;  1HBU B;  5KFE A;  2R8I A;  3P5T L;  4IKA A;  1Y4Z B;  1LW0 B;  3N0V A;  1J2V A;  2QL7 B;  1AYE A;  3F56 A;  4DR6 J;  1X5O A;  2JJ4 D;  4Y28 C;  5LSR A;  1HYS B;  2B7C B;  3LP2 B;  4QPT A;  2W2M P;  5THW A;  2M7S A;  3QID A;  4A8Q A;  1C0U A;  2N7C A;  5ETO A;  1N8R T;  3MF5 A;  2M5Y A;  2NXE A;  5IT4 A;  2EC2 A;  4ZJO A;  1U1L A;  3W2V B;  2IVM A;  3PIO Q;  4CTA A;  3CCE S;  3CJ2 A;  3FBF A;  5KFB A;  2GJF A;  5ETN A;  2HQC A;  3TYT A;  3BEG B;  1DUR A;  3JTO A;  4DUZ J;  2Z2M A;  2DNG A;  1T95 A;  3HPO A;  4IRC A;  4NLS A;  3R5J B;  2YH0 A;  1VQ4 S;  4MH8 A;  2HS3 A;  1V3R A;  2FZG B;  2KM8 C;  4ZHR A;  3I31 A;  2RS8 A;  2BUN A;  3HVT A;  2Q43 A;  1TKT A;  5JVG Q;  1ZS6 A;  3EGN A;  1U0H B;  4RNO A;  4PWD B;  4ECS A;  3FGV A;  2VG5 A;  3H2L A;  5G0R B;  2GV1 A;  3OFH A;  2FHK A;  3QT8 A;  3RJM B;  4JI3 J;  1UAW A;  2MGZ A;  4KYZ A;  2DD8 S;  2QA4 G;  2DPJ A;  1WEY A;  4X4Q A;  3MED A;  4A8S A;  3ZXW A;  3FSI A;  1S9E A;  2DH8 A;  4EK2 A;  3H90 A;  1UFL A;  4I67 A;  1IM6 A;  2HUR A;  1SH0 A;  3N6L A;  5MAO A;  3AB2 B;  4CP5 A;  5J2N A;  3NKY A;  4Z2X A;  5AT1 B;  1VGY A;  1JJ2 R;  5J2Q B;  1MN7 A;  2W8L A;  4RW8 B;  1ZET A;  4DHV A;  1S7H A;  2ZHA A;  1NDL A;  1VK3 A;  2DY1 A;  1BMQ B;  1HW9 A;  1VC0 A;  3NBP A;  3J81 Y;  1WC4 A;  2X1B A;  2ZC3 A;  1UZD A;  4OLO A;  3GCW P;  2AJ1 A;  5F0U A;  1UVN A;  2O67 A;  4LBP A;  2HVI A;  3H8Y A;  4LF9 J;  3R5B A;  4FNH A;  2P9E A;  1CJU A;  2KT2 A;  3QBC A;  4PG8 A;  2JZ5 A;  3FMW A;  2AJ0 A;  3MAA B;  3IWX A;  3KNA A;  3ETM A;  4DWI A;  2DGU A;  5BR8 F;  1T05 A;  3IC1 A;  3FRZ A;  2KT3 A;  3LP1 B;  3H5S A;  4F3Q A;  3ZTS A;  2DYA A;  2RF2 B;  4MKV A;  2BYC A;  2OI2 A;  1TUG B;  4IOB A;  3DLG A;  5KFG A;  2NPI A;  1PG5 B;  4PXC A;  4K4V A;  3QSI A;  3GSI A;  3QT6 A;  2PE8 A;  2VBX A;  5IT9 U;  1URR A;  2VQE J;  2F8E X;  4URQ U;  3WC2 A;  1EET B;  4WII A;  3PNI A;  1WTB A;  1NDC A;  4B3S J;  3SYZ A;  2CZ4 A;  1RTJ A;  5IXU A;  5L9X A;  2LU2 A;  3NRB A;  3AXM A;  2CWK A;  1S76 D;  3PRD A;  3ZO7 A;  2E1M C;  4OI0 A;  2BAC A;  2W1B A;  1SI9 A;  4CO4 A;  3V6J A;  4EMD A;  4PG4 A;  1JKH A;  1S79 A;  3NCP A;  3K5O A;  3J7A 1;  3QPI A;  2MQ8 A;  4IFY B;  2UUA F;  1RSC A;  3BGO P;  2ASL A;  3W3S A;  4KO0 A;  4WKR A;  2JC1 A;  1ZTW A;  4PWU A;  2JWN A;  4ID5 B;  1RWN B;  4FBT A;  2UVW A;  3MMB A;  1JLF B;  2ADB A;  3FZB A;  1XR5 A;  4JV5 J;  1IKY B;  1HQ2 A;  3QSY B;  4EU0 A;  4YB7 A;  2IY5 B;  4C8N A;  2YWF A;  3A13 A;  4WYL A;  3IRX A;  1M0S A;  3A8K A;  3W66 A;  1BLU A;  1NND A;  1YBU A;  5KT3 A;  3BYP A;  2JFD A;  2GAH C;  2KJW A;  2FY8 A;  5KFU A;  1PIE A;  2Z8Q A;  2GZO A;  1HNV A;  1G7C B;  5FDL A;  2KZM A;  4CH7 A;  5U47 A;  1IVZ A;  2MHN A;  4RNF A;  5IWA J;  4ILR A;  4FDF A;  2RQK A;  2HNZ A;  4KHM A;  5IM0 B;  5A8K B;  4O4G B;  3ENQ A;  1NRK A;  2BJ1 A;  4DG1 A;  1R31 A;  4FN5 A;  4RNH A;  1WHY A;  4RU9 A;  3P4U B;  2ZH8 A;  2R3V A;  2R8J A;  5AXK A;  1TEL A;  3IBW A;  2MEW A;  4WTY A;  1XMB A;  6FD1 A;  2N3O A;  4FF1 A;  4J5O A;  2VFS A;  3UDE A;  2Q3P A;  3P6Y C;  4UY8 5;  3ZZU A;  5JUM A;  5IQQ A;  2OH2 A;  2K7K A;  2QA2 A;  3M2V B;  4RW9 B;  2JDJ A;  2HQF A;  2WAQ D;  2CJB A;  3G8S A;  4C8Z A;  4OI6 A;  3M1V A;  3C15 A;  3QJJ A;  1KHV A;  2MQN A;  4B9N A;  1U6F A;  2WBR A;  2DNN A;  2WVB A;  5GAH U;  3UN2 A;  2R7Q A;  4DZ6 A;  1F5B A;  1FVS A;  1R8H A;  5B0E A;  3QT7 A;  4NLX A;  4ZPA A;  3RB0 A;  3A3P B;  3GFY A;  2ZH2 A;  3AHP A;  4IUF A;  1M1H A;  3J80 U;  2N3L A;  4IR1 A;  5GAE U;  2XQC A;  1MNE A;  2J9E A;  2POK A;  4C97 A;  1TV6 B;  4DR6 F;  1RAJ A;  1CS4 A;  1OSD A;  2AD9 A;  5A8R B;  4NL5 A;  4ZLP A;  2EWH A;  2NSC A;  1VBZ A;  4WTO B;  1F60 B;  3IM9 A;  4KY3 A;  5AE1 A;  2B4P A;  2UUB J;  2GA7 A;  3KHR A;  1X8D A;  4C0H A;  3W63 A;  2XTJ P;  1FJE B;  3V4I B;  2RRB A;  1B99 A;  2G0J A;  5E3R A;  1E6V A;  5J1E A;  1DHM A;  5KFJ A;  2GIR A;  3AQO A;  1GT8 A;  4E98 A;  4UUX A;  4DUZ F;  1RA7 A;  4OLP A;  1KR4 A;  4CO5 A;  4ZS6 A;  4DX8 H;  2H51 B;  2CJA A;  2GGP A;  3BSA A;  2M9K A;  4CLT A;  2KL8 A;  1WF0 A;  7FDR A;  1VQ6 S;  2AJ2 A;  4XO0 A;  3TVK A;  3HK2 A;  1HMV A;  1HI1 A;  2M0G B;  2KFN A;  3M2R B;  4P74 A;  2LDI A;  4H54 A;  4ECX A;  2OLW A;  4J9P A;  1WKJ A;  2VJV A;  1A9N B;  1FT8 A;  3NP5 A;  1M5O C;  3V81 B;  1S0M A;  2B9X A;  3FEZ A;  3X1L B;  4QWC A;  2XLK A;  4P7V A;  1WC3 A;  2B7B B;  2ASJ A;  3Q8R B;  3BSO A;  3CE8 A;  3LAL A;  5ETS A;  5T14 A;  3KLH A;  4KHP J;  1T11 A;  2CDR B;  3KMQ A;  3JQM A;  5KFK A;  1EB0 A;  1HNW J;  3CDW A;  3O2I A;  3O6Q A;  1GEH A;  2GJ2 A;  3ZZO A;  5KT2 A;  3T19 A;  4EWT A;  4KV8 B;  2OIH A;  2YKO A;  3MPV A;  1NO8 A;  4UZC A;  4K2J A;  8AT1 B;  1RT7 B;  2QGF B;  1PJ6 A;  4BCA A;  2KKH A;  1NZ8 A;  4DV2 J;  3SXL A;  2OHD A;  4LF9 F;  4RWW A;  3T6B A;  1BQN B;  4KIA A;  3VF0 B;  3PXG a;  5DLG A;  2HHX A;  5HAO A;  2C3Y A;  2Q6B A;  1V6H A;  4A8Y A;  4LR9 A;  2W7A A;  3Q8V A;  1R8B A;  3KLG A;  2CQ0 A;  1NPP A;  3QYY A;  3P3D A;  2FQQ B;  3C16 A;  1VQN S;  3VVU A;  3W2W A;  3MFH A;  2QYC A;  1N5T A;  2PT0 A;  4X64 J;  4KTQ A;  4KPY A;  2RU9 A;  5BYR A;  1S97 A;  1C0U B;  2LFV A;  2C2R A;  3DU6 A;  3IA0 A;  4ZP8 A;  4OFZ A;  1WSV A;  5JXS A;  4K4U A;  5LJ3 Y;  4CTA B;  2PD1 A;  5IS2 A;  3QLH B;  1SL0 A;  3GP9 A;  4NRU A;  2HRY A;  1RBL A;  2J5A A;  1GTH A;  2K3K A;  3MXH P;  3SBM A;  1HHQ A;  3EVW A;  3EXY A;  1NSQ A;  1N5Y A;  5HAN A;  5C42 A;  4RUH A;  3NL0 A;  1X7V A;  4TY8 A;  2JLF A;  5F9L A;  4B3S F;  4OMF G;  3UR0 A;  3O8W A;  1SJ4 P;  3QJL A;  4LF4 F;  4DFP A;  2BQU A;  5LM7 E;  4XPE A;  4AE5 A;  3NMA A;  2L3M A;  4RWX A;  1IBM J;  1YSJ A;  3G4S S;  2PII A;  3HVT B;  2DGQ A;  1HQU A;  2FYX A;  1RTI A;  1XNR J;  4EI2 A;  2G0C A;  2VHG A;  2LA4 A;  3IM8 A;  1TKT B;  1VC5 A;  3BQ2 A;  4KB7 A;  1FO1 A;  3X3U A;  4LF7 J;  3ZZR A;  3E8O A;  3G8Q A;  3DDI A;  2MGZ B;  2XZT B;  4LFB J;  3CCW A;  3ISZ A;  1S9G B;  1RAF B;  3E01 B;  4NPO A;  5HO4 A;  3MED B;  4DR2 J;  2ZH6 A;  1G2E A;  4OJH A;  1S9E B;  3TEG A;  4NML A;  2NXC A;  1EHW A;  1DLO A;  3DDK A;  2KG1 A;  3KYL A;  4OYI A;  4JV5 F;  4YFU A;  1VDH A;  1T7P A;  1R43 A;  5J2N B;  2K3I A;  2WSF C;  1SVD A;  1ELO A;  2E9Z A;  1FEH A;  5I3P A;  4KE5 A;  4P10 A;  5DG7 A;  1A6L A;  2I6W A;  2P9C A;  2OEK A;  4NA1 A;  3WZ0 A;  2UXB J;  3KLF A;  1I51 B;  3S8S A;  3CXC R;  1HKA A;  3UCG A;  3K5M A;  2RKI A;  3H2V E;  2VOD A;  5IWA F;  1YRU A;  3MUT P;  2VON A;  1S12 A;  2GVD A;  1NJZ A;  4NLG A;  3EPI A;  3B6B A;  1DQ9 A;  4K0K F;  1CJU B;  2VPY B;  5CHC B;  2CUY A;  1XMQ J;  4EO6 A;  2BAN A;  1JJC B;  3ZZP A;  4PAB A;  1HBN A;  1XC9 A;  1U48 A;  5BYS A;  3BO2 A;  4I2P A;  2E5L J;  1NJY A;  2QE5 A;  1BUX A;  3GV5 B;  2A6M A;  2BW7 A;  5A6P A;  3BH6 B;  4ED5 A;  2JRS A;  3HSJ A;  1T05 B;  1SQG A;  3C6T A;  3D0H E;  1U45 A;  2OFH X;  3G8T A;  2W7O A;  1C4C A;  4JI1 J;  2MLX A;  1ZYQ A;  1YLX A;  4EYI B;  4WJB A;  2X1A A;  2B4O A;  3KUG A;  4NXN J;  3EDQ B;  1RI7 A;  3ZZZ A;  2OGU A;  3DLG B;  1FXL A;  1X31 C;  2J7K A;  1BHN A;  4DV1 F;  1TL3 B;  3MPD A;  2KYX A;  3R5G A;  4F04 B;  1MMD A;  5GME A;  1VJQ A;  1UTA A;  2FHM A;  4DX6 A;  2Y3Y A;  1FXD A;  2HZC A;  1RTJ B;  1KTQ A;  4NLT A;  3OR1 A;  1VRT A;  2ZJR Q;  2D1C A;  3ZTR A;  3OHA A;  3IR6 B;  1P8G A;  4F36 A;  1F3V A;  4LRB A;  2CPH A;  1JKH B;  2V8G A;  4JI4 F;  3T9N A;  1KFS A;  1KON A;  4L76 A;  2YH1 A;  3R5D A;  4N41 A;  3QRP A;  4IO1 A;  5KFF A;  3M9M B;  2NLW A;  4KO0 B;  4AQY F;  4C8L A;  2XWY A;  1EIY B;  4DFJ A;  3MEE A;  2UUB F;  3V4M A;  3MMB B;  2G1D A;  2F5G A;  5DO2 A;  2P8I A;  4B08 A;  4OZ2 A;  1SIZ A;  1P9Y A;  2ZWO A;  2BE7 D;  3MM5 A;  3IRX B;  5KFN A;  5HMZ A;  3B8H A;  3MPW A;  1QSS A;  3CCZ A;  2XLI A;  2A6O A;  1EZZ B;  4BWM A;  2CQ1 A;  3DMJ A;  2CZV C;  3CW2 C;  5FDL B;  2CAD A;  2RVJ A;  1I5O B;  3DRX A;  5A8W B;  2H48 B;  2EFG A;  4FVC A;  1N54 B;  5KFW A;  2BOP A;  1H74 A;  3F73 A;  4DG1 B;  4ED2 A;  4F25 A;  2GQC A;  2F63 A;  2N4D A;  4ID8 A;  4USI A;  4KT0 C;  3SV3 A;  4KPC A;  4I7F A;  2SXL A;  1SPB P;  2JOQ A;  4JI8 J;  4OZL A;  2V2K A;  2PC6 A;  4YDD B;  3AJ2 A;  3HSD A;  3Q2S C;  5F0W A;  3FEX B;  1YG0 A;  4ECT A;  3M7V A;  2BJ9 A;  1RT2 A;  2YWE A;  2VIC A;  4FBU A;  3J7Z 5;  5F9N A;  4KHP F;  4ZVH A;  3WIV A;  4J90 A;  1RHM B;  2J0X A;  1X0F A;  4NZ7 A;  1NJW A;  3NCR A;  3OQ2 A;  4ENO A;  2BV3 A;  3NLC A;  3M1V B;  3C15 B;  4LT6 A;  1FDA A;  3N6M A;  4I2Q A;  3C66 A;  4AYB D;  1RWX B;  1NB7 A;  1SC4 B;  1S57 A;  4AD6 A;  3BSC A;  4DV7 J;  4ED3 A;  3PJX A;  2V34 A;  3VAM A;  3K89 A;  3T5K A;  1PYT A;  4WWS A;  1HNZ F;  4DL3 A;  2JHE A;  4NMX A;  2RU3 A;  4HLB A;  1SJ1 A;  5H9F K;  2BRK A;  2W7P A;  1XK8 A;  1RYS A;  3KJN B;  1CS4 B;  1RU2 A;  2MTL A;  4QU6 A;  4KKO A;  4DSI A;  3KK3 A;  4KHR A;  4OJG A;  4PG7 A;  4DV6 F;  3HCX A;  3IAS 9;  2XSF A;  4A8X A;  3D5M A;  3UPF A;  3DLJ A;  4LRF A;  1TMJ A;  3CJ5 A;  5M2R A;  5D3G A;  2ZHB A;  2XHC A;  1V3S A;  2EPI A;  1E6V B;  1RWW B;  5J1E B;  2QT7 A;  1S49 A;  3S01 A;  3PRB A;  3SCK E;  1VIO A;  4ZVG A;  3BO4 A;  3OUY A;  3ILJ A;  5HBM A;  5DRK A;  2H65 B;  3FRY A;  2XY5 A;  2GGP B;  4N76 A;  2FLN A;  1U2R A;  1YBT A;  4LSL A;  4GC7 A;  1SIW B;  4OYX A;  3IFE A;  2GVZ A;  2NS1 B;  4Z7Y A;  1HMV B;  2WVC A;  3HFZ B;  2KI2 A;  5KG3 A;  4CNY A;  1WJ9 A;  2UVU A;  4CT8 A;  4MIA A;  4ZA1 A;  2G13 A;  3NGK A;  4P71 A;  4USJ C;  1WC0 A;  3T1H J;  4TU8 A;  3MCS A;  4LF7 F;  2ABY A;  1D9D A;  3WBZ A;  3KDN A;  3NOC A;  3AD7 C;  3U27 A;  4LFB F;  2HVE A;  4U9R A;  4RW4 A;  4DR2 F;  2Y1R I;  2CPF A;  3KLH B;  1VI7 A;  2YQ3 A;  2FC9 A;  4DPX A;  4K4Z A;  1N56 A;  4ECU A;  3P49 B;  5LSO A;  1PYO B;  2MKK A;  4YB1 P;  1S77 D;  4AXJ A;  2YWK A;  2O5D A;  4DN9 A;  4AND A;  2DR6 A;  2DR5 A;  4USV A;  4MT1 A;  3CJK A;  4Y2M A;  3LW5 C;  2HBY B;  2PMZ D;  1T9T A;  3MR7 A;  2CQ2 A;  1RT5 A;  4YHH J;  2ZH5 A;  4B9M A;  2B3T B;  2B8P A;  3GFZ A;  3CD0 A;  3CUN A;  3SV4 A;  3KJF B;  5KFZ A;  4RPF A;  2I0X A;  4TYA A;  3AAW B;  1RWV B;  4ES1 A;  1TU0 B;  3HT0 A;  4HKQ A;  3CJS A;  3PHT A;  3KLG B;  3SQO P;  3C16 B;  1ZH5 A;  1FJG F;  2HFO A;  1R27 B;  4CI0 B;  3W2W B;  2GX8 A;  2JVR A;  3Q23 A;  2E5L F;  1XNQ J;  2FGO A;  5DM6 Q;  1IJF B;  4CO0 A;  4ZVF A;  3ENW A;  3LUY A;  2AMC B;  2ZOM A;  4ZLN A;  4JI1 F;  3ENA A;  3GIR A;  3PW4 A;  1U0S A;  2CPD A;  1F9E B;  5B08 A;  2ZEJ A;  5HMY A;  2GO9 A;  1R7I A;  4ZJQ A;  3D2W A;  2K06 A;  1UW4 A;  1TTH B;  3BGU A;  4J9V A;  4TNO A;  2HLT A;  2ACM A;  4WU2 A;  2PSZ A;  3E2E A;  4NLY A;  3MUR P;  3HZG A;  1DRZ A;  2FJV A;  4E0D A;  4Q2L A;  1Q5Y A;  1N5Y B;  4ZVT B;  5C42 B;  1WDT A;  1Q5V A;  4OHX A;  5IQ6 A;  1FF2 A;  3PW2 A;  4FYD A;  5HP1 A;  2B9Y A;  2ZC4 A;  4TY8 B;  1N5V A;  1J5O A;  3DLH A;  4QJV A;  3UN3 A;  3W64 A;  4NCA A;  2J76 E;  4NLR A;  5HRO A;  3B78 A;  1OS5 A;  1C4A A;  1WAC A;  2VPX B;  1HQU B;  2ZNY A;  1RTI B;  4XDD A;  3DI6 A;  3V6K A;  1L3K A;  4IDK A;  1NU4 A;  2MQL A;  4B17 A;  1GQE A;  1NDK A;  2LLZ A;  4ATN A;  3ENV A;  3SZ2 A;  1RT1 B;  5E7O B;  4ERD A;  3V2U C;  2YNF A;  3VAI A;  1N32 J;  2RHQ B;  4DV5 J;  4HDG A;  3QFW A;  4EGL A;  2E7W A;  2ASD A;  1TK5 A;  3N28 A;  1UA1 A;  3RAX A;  5D4L A;  4EO8 A;  3D7S B;  1PYS B;  3R3T A;  1DLO B;  2J0Q D;  5DJB A;  2V2V A;  4BC9 A;  3FDS A;  1WF1 A;  4H4K A;  1JMT A;  3UQS A;  3NNC A;  2J9C A;  4IFV A;  4MK8 A;  4K5S A;  4TU7 A;  2HRU A;  3GLJ A;  2HLU A;  2MQP A;  1WG1 A;  1F9F A;  2FHO B;  3CCS S;  4JV2 A;  3KLF B;  3KK2 A;  4FVM A;  4PR6 A;  2W2P P;  1TMM A;  2WK4 A;  3N5B A;  4GKJ F;  3R7B B;  2RKI B;  5GAH I;  4DR5 J;  3DGP A;  4I6Y A;  2A2D A;  2IC3 B;  3PAC A;  2GVD B;  4OZ1 A;  1NHK L;  3GR0 A;  1SKW A;  3BV8 A;  2LQ5 A;  5ADZ A;  5EWF A;  2UV8 A;  4JI0 J;  2GIQ A;  1VQ5 S;  1BGX T;  1JLC A;  2BAN B;  4V19 J;  1HBN B;  3R7N B;  2HFZ A;  4I2P B;  5GAE I;  4J37 A;  1Q86 T;  3PZP A;  2E5H A;  1FEE A;  3G96 A;  3QO9 A;  4D3G A;  1UKU A;  1HPZ B;  2IPO B;  1KDN A;  2I8E A;  1VQ9 S;  3C6T B;  2HG4 A;  1HWJ A;  3KLI A;  4K59 A;  4NAS A;  1S1V A;  1K9M T;  2ZH7 A;  3SCL E;  5T41 A;  3D6H B;  3M9N B;  1GMW A;  1XER A;  2LQ9 A;  2KXF A;  2EXU A;  6AT1 B;  4ZCL A;  1SQE A;  3Q86 A;  3VGS A;  4ZN3 A;  2MPU A;  4K4X A;  1JLB A;  5HQM A;  5F8G A;  1UET A;  4N56 A;  3A3N B;  4F0K A;  2IJF A;  1ARO P;  2CQH A;  4RW6 A;  4I64 A;  3R1L A;  2R2U A;  1ZAV A;  2L41 A;  1K8A T;  1REG X;  3D6F B;  1AA1 B;  2OUG A;  3OR1 B;  1VRT B;  3K8V A;  2HFN A;  3PVX A;  3KUE A;  4F4Z A;  3OTC A;  1JWW A;  3FKB A;  3ILL A;  5L39 A;  2KVI A;  5B0C A;  1HI8 A;  2DRD A;  2V6A A;  3PKM A;  3DOM B;  3EGV A;  1F2H A;  1FD8 A;  2RQM A;  2AT1 B;  3IXQ A;  4WP9 A;  2DNL A;  1VMB A;  5HVG A;  4LFC J;  5FLX U;  3M8Z A;  5HN0 A;  3MEE B;  1D8Y A;  3TWZ A;  3N9U C;  2MKI A;  2U1A A;  3SMZ A;  3MM5 B;  2DO4 A;  3PY8 A;  4B9V A;  3FEY B;  3CMQ A;  4RO0 A;  4P75 A;  2FJX A;  4GMK A;  3SSR A;  3DMJ B;  3MM9 A;  3QGP A;  4YR3 A;  4YEA A;  3DRP A;  1QE1 A;  3W8G A;  1H72 C;  5KFV A;  2IVY A;  2AZ1 A;  2VH7 A;  4HAC A;  2MST A;  4QYR A;  1VIX A;  3EXC X;  4USU A;  2UZA A;  2PMH A;  3VCD A;  3KHL A;  4ZVO B;  2VQF J;  4V19 X;  2NYH A;  3O5T B;  1N34 F;  1RHK B;  4NLQ A;  3U1M A;  4I7F B;  2WB4 A;  3QNW B;  2I38 A;  3ZNJ 1;  3MAH A;  4DUY J;  3MGJ A;  2R7V A;  5ETM A;  3BS9 A;  2IM0 A;  5EUH A;  2P2C B;  3MTJ A;  4LF8 F;  2J8A A;  1RT2 B;  3M6V A;  3D28 A;  1X5S A;  3HI9 A;  4UOF A;  2LXF A;  3HP6 A;  1L3S A;  2E1A A;  3HHL C;  3W9I A;  1P9Q C;  4YQW A;  1HR0 F;  4FF3 A;  2XS2 A;  4X4O A;  2FJE B;  2E5G A;  2W8K A;  3QAE A;  4YHH F;  1WHX A;  3ZNU A;  3Q8S B;  1DBD A;  2E7V A;  4MKA A;  3GII A;  2ZBQ A;  1Q8L A;  2MKC A;  5KG4 A;  2MQM A;  3KJQ B;  2BBE A;  1NKC A;  4FXW A;  3FQK A;  1Q53 A;  4PG6 A;  2VIH A;  3G6E S;  1RTH A;  2H4W B;  4DR7 F;  4LVO P;  4K2X A;  2V68 A;  4KKO B;  3KK3 B;  4DR3 F;  3TJA A;  2VB6 A;  1TFW A;  1WC1 A;  1XNQ F;  2EFN A;  4WFZ A;  5CCL A;  5D3G B;  3W61 A;  3HFV A;  4J9K A;  1TL1 A;  4ILM A;  3G87 A;  4WBF A;  1CQN A;  2OPR A;  1RWP B;  4CH0 S;  1SKR A;  5DZ7 A;  2VBZ A;  1X5T A;  2MZQ A;  1BE4 A;  1B7Y B;  3MMC A;  2CPJ A;  5SUH A;  4NA2 A;  3CD7 A;  3DXS X;  3CC4 S;  5D8H B;  1YQH A;  5HMX A;  3FSX A;  1NAQ A;  2XS7 A;  5AXM A;  4LSL B;  5C7P A;  1HW8 A;  2DVI A;  2C2M B;  2GVZ B;  1LFW A;  4CM0 A;  3WX4 A;  4ECQ A;  5EGY A;  4Q2M A;  1X4E A;  3EVO A;  1PC5 A;  2KFY A;  3LF0 A;  1WOS A;  3D6T B;  2IM3 A;  3NNA A;  2OTL S;  1ZZN A;  2W25 A;  4CLS A;  1UL3 A;  4DV0 J;  2HHH J;  3K5N A;  2CG4 A;  3Q83 A;  3V6H A;  4RW4 B;  1N32 F;  4DV5 F;  1V3Z A;  1C1B A;  2QLB B;  3SQG A;  1X9S A;  2FY1 A;  3I96 A;  2I2Y A;  1IKX A;  2CXE A;  4U7U K;  5K20 B;  1Y9O A;  1VLO A;  3E51 A;  4LR7 A;  3W1Y C;  4OYB A;  1D1U A;  4YOE A;  4WFA Q;  1FRH A;  1REV A;  3CJK B;  5CZV A;  5D6G A;  1PC4 A;  3JS9 A;  1SUQ A;  2BEF A;  1RT5 B;  2LQ8 A;  4HR2 A;  2R8K A;  4DX5 A;  2EC0 A;  1IWG A;  1XEZ A;  5L46 A;  4PAA A;  4DV4 F;  4QR0 A;  4DR5 F;  3TNV A;  2XMT A;  2D7S A;  3G71 S;  4R8U A;  2DGS A;  4YR2 A;  5B7W A;  3RB3 A;  1WOO A;  4B3T J;  4NYP A;  2GMJ A;  1XBW A;  2FHJ A;  2CRL A;  4OV6 A;  4ER8 A;  1MW7 A;  4EBE A;  1NKE A;  5IT0 A;  1B0T A;  1UMJ A;  2ZNZ A;  5KG5 A;  3LP0 A;  3IMQ J;  2CJY B;  2CPY A;  3FBB A;  4DF4 A;  2VFV A;  5B0B A;  3PFE A;  4C6A A;  2OAU A;  2FUG 9;  3IGN A;  1UJ6 A;  2NUU G;  3G82 A;  4UOH A;  2D3O R;  3H25 A;  2DXF A;  2BAB A;  2CPZ A;  3D3C J;  2JLE A;  3JSM B;  2VBW A;  3WQP A;  3A3O B;  5HP1 B;  1KD1 T;  1J5O B;  1PJ7 A;  1YGY A;  3DLE A;  3PCO B;  1CC8 A;  4O3S A;  5HRO B;  1GAO A;  3K8W A;  2V50 A;  2LU1 A;  4DQQ A;  2ZUG A;  1LEO A;  1D8Z A;  5HL7 Q;  1N36 J;  4IDK B;  1GXU A;  3NGT A;  4UUW A;  2WSC C;  4JYA J;  1AB8 A;  1N52 B;  3ICL A;  3D54 A;  2HAI A;  2YNF B;  2GHP A;  1JNR B;  4J7C A;  2Q1L A;  3MM6 A;  1KOO A;  3BZQ A;  4LFC F;  2DJW A;  5DQI A;  4P7T A;  1VQO S;  2YNH A;  1X4D A;  2HQI A;  5M2U A;  3M8Q A;  4U95 A;  4RL1 A;  5HMW A;  2LQB A;  3AH6 A;  1Z2L A;  4IFV B;  3CUL A;  4LF1 A;  4DOZ A;  3KK2 B;  2WB1 D;  5B0G A;  4UOG A;  4NA3 A;  3D9B A;  3I55 S;  2DIU A;  3AA9 A;  1Y11 A;  2F4F A;  4URG A;  3DGP B;  2J9D E;  4E8U A;  4PRF A;  3AOA A;  1QY7 A;  1AT1 B;  4LRD A;  2EVZ A;  1FRL A;  2HVZ A;  2HFV A;  4MKY A;  3H20 A;  1Z1Z A;  2Z30 B;  2ZH9 A;  1NXI A;  2DR7 A;  1JLC B;  4BS2 A;  2U2F A;  4WU3 A;  2XMJ A;  3TJ8 A;  4BHQ A;  3QO9 B;  4QWA A;  2I5J A;  1N5S A;  1FXR A;  4F3O A;  2A18 A;  3WIU A;  4C8Y A;  1M1K T;  1JJ4 A;  1S1V B;  1FI4 A;  4WCE Q;  2DHA A;  2QSF A;  3L7P A;  3K57 A;  1FHT A;  3KK1 B;  2FB0 A;  5IC6 B;  5DDR C;  2XB2 D;  1JLB B;  5LXY A;  3PX4 A;  4NXM J;  2A0F B;  3ELH A;  3VGU A;  4RW6 B;  3TJ9 A;  2RIJ A;  4NLO A;  1FDB A;  5ETT A;  1Z2Z A;  1VQK S;  2ZWP A;  4N77 A;  3FFI A;  3G2X A;  4XTT A;  4C0B A;  4C8O A;  2UV8 G;  4N5S A;  3FVY A;  3GTY X;  3Q24 A;  3NGU A;  5LMN J;  3OHB A;  1OO0 B;  3CMA S;  3K5P A;  1KTV A;  1M5K C;  4M8L A;  4ID5 A;  5JMN A;  2CQC A;  3ZZT A;  3DCA A;  2DHG A;  3TA1 A;  2ZFH A;  1ZTT A;  2MZS A;  1RT4 B;  1CEZ A;  2VL1 A;  4I6A A;  5C25 A;  4JI6 J;  3MAQ A;  2CG8 A;  2UXC F;  2DY9 A;  1ZM9 A;  1WNE A;  3EZU A;  3NAH A;  2G2Z A;  1GX6 A;  2O1P A;  4AT1 B;  1A0O B;  4F50 A;  1TL7 A;  1Y00 A;  5IM0 A;  3MM9 B;  1AUS L;  2EK6 A;  3DRP B;  1QE1 B;  3GSD A;  2H54 B;  3RG6 A;  2FJA B;  3RAQ A;  5BR8 J;  4HAC B;  2R7R A;  5KFT A;  3SIP B;  4N8N A;  1BQX A;  1GXL A;  4PQA A;  5CYM B;  3MR6 A;  1LWF A;  2WVD A;  4KGX B;  4MIW A;  3EYZ A;  2W01 A;  2VPZ B;  1RTZ A;  1OSC A;  1Q7L B;  4Q8F A;  3BDE A;  2V69 A;  3PW5 A;  4LQ9 A;  5L1K A;  1FES A;  3N79 A;  4ZCM A;  2RRN A;  2XEX A;  2CIM A;  2YPZ A;  3A8I A;  4DEZ A;  2HHH F;  4FS2 A;  1NDP A;  3SCJ E;  4B3M F;  3I4P A;  2R9L A;  3TX8 A;  2QYG A;  4K50 A;  2KU7 A;  2MDA A;  2VPW B;  4ALZ A;  2Q6C A;  4W98 A;  1Q82 T;  2LVW A;  2XBP A;  3MI7 X;  1DQ8 A;  4H4K C;  4UT4 A;  3CDA A;  2VZ9 A;  5KT5 A;  3RYL A;  1T03 A;  1APS A;  4IH7 A;  3GJR B;  2DIT A;  3W5Y A;  2NPF A;  2VFU A;  2YWW A;  4ZMM A;  4KGZ B;  3CCM S;  3GJQ B;  1UVJ A;  1HI0 P;  2HGM A;  2UUA J;  2CQG A;  1YJR A;  2R8G A;  3HX9 A;  1VQM S;  1TP7 A;  4DL7 A;  5KFC A;  4WZM A;  3GG0 A;  1RTH B;  4QQB A;  3HHL D;  2HGN A;  4J9Q A;  4F8R A;  5DQG A;  1KBR A;  1XN9 A;  4B3T F;  1CVJ A;  1F1B B;  1KQG B;  2QG9 B;  2CQ4 A;  1KN6 A;  2IFX A;  3OL6 A;  3FSY A;  2HK3 A;  4K5R A;  2HND A;  1FRM A;  1HBM B;  2Y8W A;  2AYG A;  1TQL A;  2C3P A;  5B0F A;  3VR1 A;  1S9F A;  3MEG A;  1TL1 B;  3AQP A;  2B56 A;  3BGL A;  2J6S A;  4LRC A;  3CO0 P;  2YNI A;  5A2Q Y;  4X4U A;  3MMC B;  2BXJ A;  2X7I A;  3VQS A;  3HHD A;  4QU7 A;  2MZJ A;  4Q8E A;  4NLW A;  4KJI A;  3NG8 A;  1YIJ S;  2GW8 A;  2QA4 S;  1HNI A;  3MUM P;  2FPH X;  3CJR A;  4TYB A;  1QAY A;  2J6U A;  4CLK A;  2ZD1 A;  1GMV A;  5LT5 A;  3BBF A;  1Q1K A;  1SC1 B;  2QMX A;  4DS4 A;  3Q0A A;  3I82 A;  1N36 F;  1YZ7 A;  1QVG R;  3IO1 A;  3AD8 C;  2NYI A;  5E3Q A;  4WXW A;  1WEX A;  3VHQ A;  9RUB A;  1IR0 A;  2ALY B;  2HQD A;  3SDE A;  2DR8 A;  1S72 S;  3VAL A;  1C1B B;  2DIV A;  4J9R A;  3T1A A;  1WDD A;  4DSL A;  5DM7 Q;  4P2M A;  4KBI A;  4YUD A;  2LA6 A;  2BOA A;  2LXU A;  4DPU A;  2P5V A;  2HHV A;  1YK9 A;  1IKW A;  2WOM A;  1REV B;  3JAM Y;  1RZM A;  2ERR A;  3QAU A;  1SL1 A;  3RBZ A;  2LKZ A;  4NEZ A;  1SUQ B;  3DLL Q;  3FJ2 A;  3RR7 A;  4NLP A;  5KG0 A;  4ECY A;  4O0I A;  5GAG U;  3CCT A;  4IYQ A;  3VTI A;  4Q7A A;  4OZN A;  2QIF A;  4I0W A;  4R8U B;  1JX4 A;  5AXN A;  3QZ7 A;  1ITP A;  4M5M A;  2ACY A;  1T9X A;  1T9V A;  2D41 A;  2E5I A;  5K8P A;  3KHG A;  1X5P A;  3HXM A;  1B64 A;  1BY9 A;  1IQT A;  1U02 A;  2CNL B;  3DXB A;  4ZPD A;  1PJ5 A;  3GYN A;  3SI8 A;  3N4W A;  3R6G B;  2J9D A;  3QLH A;  4DS5 A;  2OD4 A;  1BD6 A;  2AP6 A;  1FER A;  3LP0 B;  1WF2 A;  1I6J A;  5E0O A;  1FNX H;  4NI2 A;  4F4W A;  3VAF A;  2FTR A;  5FD1 A;  5L8R C;  1Q78 A;  1QTM A;  2R7U A;  4P2S A;  3FCW A;  3F0N A;  1B0P A;  2DNH A;  4ZVP B;  1NBE B;  4XDC A;  2NXJ A;  3R2C J;  1FRX A;  3MM8 A;  3G82 B;  2PDA A;  3M8P A;  5K9F A;  4NXM F;  2E5J A;  3K7R A;  3FBC A;  2BMB A;  3CED A;  2JEI A;  2KN4 A;  4AXI A;  4LF5 J;  4DDF A;  5I3Q A;  3CJT A;  3DLE B;  2R2S A;  1H2T Z;  3DN9 A;  3BN4 A;  3DHX A;  1M5S A;  4P2F A;  3T1Y F;  1Y10 A;  1J5E J;  3US5 A;  1NME B;  2VJU A;  2ROG A;  1F2G A;  1S9G A;  3T9Z A;  5LMN F;  3E01 A;  1MWQ A;  1XIQ A;  3CCV S;  1U1Q A;  5F8N A;  3AY0 A;  1NEE A;  2L9W A;  4HEA 9;  4NCG A;  2ZDO A;  1CJV A;  4R25 A;  4C98 A;  3MM6 B;  2ZIT A;  5ETV A;  5DLF A;  2V9W A;  5ETQ A;  3G6X A;  1X4B A;  5D0R A;  4RKU C;  2EFV A;  4JI6 F;  2YNH B;  1LW2 A;  4L3N A;  4HTI A;  3A1Y G;  4O3O A;  2AGO A;  3M8Q B;  2PMW A;  2YKP A;  3R8Y A;  4OHV A;  5JJB A;  1U2C A;  2ATC B;  3LWM A;  1YJV A;  4URS A;  2BJ3 A;  3RU0 A;  2Y8Y A;  3UDL A;  2YX1 A;  4DSK A;  3BGF A;  1IKV A;  5EX0 A;  2W2N P;  2ZJP Q;  5HLF A;  1MWZ A;  2L48 A;  3AOC A;  4FP9 A;  2YX7 A;  3TUJ C;  1K0T A;  2WRM A;  3TEH B;  1GMU A;  2X1G A;  4Q5V A;  2HEK A;  4B9L A;  2I5J B;  4NZ0 A;  2OPP A;  4RUA A;  3LPY A;  2YQ0 A;  1CLF A;  4WF9 Q;  1UEU A;  3KHH A;  1IN0 A;  2KRR A;  3MR5 A;  1H2U X;  5GAD U;  1TL3 A;  5K8O A;  5D4N A;  4UF4 A;  1R0C B;  3KTQ A;  2HKE A;  1NK9 A;  1JLQ A;  3EWG A;  4RNN A;  3CPW R;  1ZAW A;  1IM4 A;  1RKJ A;  3R1H A;  4QW8 A;  2H4Y B;  1RK8 A;  4LF4 J;  4RW7 A;  1D3W A;  3KXD A;  1LOU A;  2BVZ A;  1WI8 A;  1U25 A;  2C2O B;  3IR7 B;  3IGV A;  3GQC A;  1UP1 A;  4EZ9 A;  2X3D A;  2B5J A;  3HHE A;  2RDD A;  2XMV A;  3RB4 A;  3OLB A;  2RQ4 A;  1YIT S;  1RT3 B;  3FFI B;  1RWU A;  5KT7 A;  1NK7 A;  4U7U D;  5KFY A;  2ROE A;  3R7S B;  1RCX B;  1X0P A;  1VQS A;  5E3P A;  2UUC J;  2RUS A;  3HSG A;  3I56 S;  2ZH3 A;  2BQ3 A;  4I6W A;  3BSN A;  3PR4 A;  2AWZ A;  4ZPW R;  3GIJ A;  5DGA A;  4KAI A;  5IV4 A;  4DQP A;  5IOL A;  4F0M A;  1QD1 A;  4TXS A;  2IDL A;  4UW2 A;  4QIV A;  2HZV A;  3O1L A;  1IBC B;  2YKM A;  1OQ6 A;  5C25 B;  4OQJ A;  2L9N A;  3BJY A;  1DQA A;  2OEL A;  4LFA F;  2OMO A;  2V94 A;  4J9S A;  2MLZ A;  1ACM B;  5C24 A;  2VKZ G;  4X4S A;  1D0E A;  3LAM A;  2CQD A;  1VC6 A;  5A8W A;  1RAC B;  2AYE A;  2BJE A;  3JSB A;  4NOH A;  1TL7 B;  3BGR A;  4Q44 A;  4K0K J;  3OW2 R;  4BC7 A;  1ZAX A;  2F9J A;  2ASY A;  1RLC L;  2VOO A;  3M4X A;  1IR1 A;  4L75 A;  2B43 A;  2DXE A;  4EFA C;  1CQM A;  1U4B A;  2HK2 A;  1LWF B;  1H7W A;  4HYK A;  4FYV B;  3UW1 A;  1CJK A;  1TKX A;  1QSL A;  3M8R A;  4PG5 A;  3DLK B;  1RP5 A;  4ELU A;  2AGQ A;  1S59 A;  2KHC A;  2PEH A;  5D15 A;  2DB1 A;  5L9N A;  5KFS A;  4DV1 J;  1NJI T;  1UFK A;  3VQT A;  1ZZF A;  1Q4R A;  2EFP A;  4GVB A;  1QSY A;  4IRD A;  2Z4P A;  2OTJ S;  2C2K B;  1D9F A;  2XS5 A;  4IH5 A;  3B82 A;  4R0J A;  2F4V F;  2DGW A;  1CUL A;  2B4V A;  1VBY A;  3ZFV A;  4Q0B A;  3NNH A;  2P6T A;  3OLA A;  4UY8 T;  4ANC A;  1FX4 A;  4LF6 F;  1T03 B;  3PJ9 A;  1NPK A;  2D3O 1;  2PO4 A;  2JFK A;  3O44 A;  1T9Y A;  4JI4 J;  1LWE A;  3RR8 A;  4EBC A;  2UXD F;  2CDQ A;  1HQE A;  5EHH A;  4AQY J;  2W2Q P;  2RNE A;  2XZD B;  2ZH4 A;  3TUZ C;  2KXH A;  2RB7 A;  3MM7 A;  2HHW A;  2PFF B;  3ISN D;  3TR5 A;  3D4J A;  1VFJ A;  1RXO B;  2HND B;  2XMK A;  5LXR A;  2KXN B;  1W7W A;  4B3R F;  1P1L A;  3TVZ A;  2WW8 A;  2XI3 A;  3A4T A;  3MEG B;  3M8Y A;  2ADC A;  3W9H A;  4KFB B;  3IBC B;  4MIB A;  4OX7 A;  3NS6 A;  2FLO A;  3I5A A;  4N8O A;  2YNI B;  4CLZ A;  4DXL A;  1CSJ A;  4PWW A;  4DLG A;  2MSS A;  4LBI A;  2DNQ A;  3HLU A;  2MKH A;  1NB2 A;  2ALZ A;  3K0J A;  2FGC A;  4U7C A;  3M05 A;  4ZK7 M;  1HNI B;  3R6L B;  2QFJ A;  3UN5 A;  4LF5 F;  4QOT A;  2C2N A;  1BQM A;  5CAB A;  3QRQ A;  4MFB A;  1WUU A;  2ZD1 B;  1YX2 A;  4U96 A;  2JC0 A;  1YJ7 A;  3OJS A;  1Q8I A;  5GVQ A;  4MMO A;  3T41 A;  1J5E F;  4KGV B;  1FTC A;  2EW9 A;  4HT7 A;  4I1T A;  4DQR A;  2XMA A;  3CD5 A;  5D0G A;  3CB4 A;  3SDE B;  2Q66 A;  2YKA A;  3KLE A;  1CJT A;  3MDF A;  3H98 A;  1U1K A;  3DOK A;  3RTV A;  7AT1 B;  2ZKT A;  3MR2 A;  1FA0 A;  2ZUA A;  1IKW B;  1TVR A;  3ILI A;  2OSQ A;  2ROP A;  2WOM B;  2IBK A;  5KFO A;  1HNZ J;  1KS2 A;  4DR4 F;  2NXU A;  3UWT A;  1A7G E;  4O3N A;  1LNQ A;  1K44 A;  1DTQ A;  4USH A;  2YWG A;  1QAI A;  5BXI A;  3HD1 A;  1RAH B;  2HWT A;  5GMK a;  4DV6 J;  2V2Z A;  3ZTP A;  4DPY A;  4J91 A;  4DQS A;  4P9S A;  2B4U A;  4HHH A;  2QLF B;  3C14 A;  4M5I A;  3SSS A;  2XCA A;  4AL7 A;  4DPW A;  1GX5 A;  2N7Y A;  4ITS A;  5IFM A;  4FPI A;  2LQJ A;  3DOL B;  2WSE C;  3GPA A;  4NI2 B;  3FNN A;  1SQF A;  2QTW A;  5F3T A;  5HQL A;  3NEK A;  3JAM U;  1OWX A;  4YP3 A;  1Y7P A;  1Q16 B;  3CVK A;  2DXD A;  3H5X A;  3MM8 B;  3UD4 P;  3M8P B;  2PFD A;  2C2E A;  1RIS A;  2JLG A;  1UVL A;  3K59 A;  1VYA A;  2DNO A;  3KDO A;  4B02 A;  2QN6 B;  4CM2 A;  2XYH B;  4M5J A;  4WPA A;  4LUB A;  2XSJ A;  2BE9 B;  2IDE A;  3S1T A;  1RT1 A;  4PPD A;  1TL5 A;  3I6P A;  2W4C A;  4DL2 A;  2B9E A;  2UUC F;  5JVH Q;  5LSL A;  1SJ3 P;  4O0N A;  4LJM A;  2VC0 A;  1VQL S;  3RBE A;  2QFI A;  2B0G A;  4X4R A;  2YY3 A;  3H42 A;  4X2B A;  1UCN A;  4NCG B;  1OQ3 A;  1CJV B;  2QMU B;  3TRG A;  2AJF E;  3DRY A;  3HHL A;  5DQH A;  3GJS B;  4OJ1 A;  2MY8 A;  3RZA A;  1UJ4 A;  1LW2 B;  4ZCK A;  2NUH A;  2HPU A;  3D0G E;  2HHS A;  5D77 A;  2Z2L A;  1ZM2 A;  3ULH A;  4PPZ A;  3AFG A;  2G1H A;  5KG6 A;  1R0B G;  1S0V A;  2CAJ A;  1FVQ A;  2IC3 A;  2QX0 A;  5HAT A;  4M5H A;  3GE9 A;  4PXE A;  2MYF A;  3D0I E;  4F4A A;  5J2M A;  1FJG J;  1IKV B;  1D09 B;  2V5H G;  1S4E A;  4IH6 A;  2XGP A;  5HLF B;  2OML A;  3EDR B;  4OX9 F;  3TA0 A;  1HPZ A;  4KGK A;  3MD3 A;  4DBQ A;  2EKY A;  3FCH A;  3W9J A;  1MU2 A;  4ZOS A;  4RLE A;  4NLD A;  1HHT P;  2DKO B;  5AXL A;  2OPP B;  1ULR A;  3MR3 A;  4IOA Q;  4YY3 J;  1K1Q A;  3Q22 A;  3BQ0 A;  2AF6 A;  2YWH A;  1YVF A;  3TQE A;  1Q8B A;  3MWB A;  4TVA B;  2XYP B;  3BBC A;  2RHS B;  2DCU B;  2LDY A;  1R6V A;  3J81 U;  1JLQ B;  2M8D B;  2D9O A;  4J9L A;  2EBE A;  4CH1 A;  2VA3 A;  1S6Q B;  2MZT A;  2BJD A;  1QDU B;  3GON A;  1WOP A;  2X51 A;  4RW7 B;  4USM A;  4ECR A;  1G1X A;  1NSA A;  4TQR A;  2E9R X;  3K17 A;  3TW0 A;  1RBA A;  3HUL A;  4N7T A;  2B5J B;  1I94 F;  2E7X A;  4CQ1 A;  1Q0N A;  2QLJ B;  4U67 Q;  4LRE A;  1VOM A;  4IOC Q;  2AJQ A;  3DOM A;  1SCJ B;  3HT3 A;  1RAB B;  1K47 A;  1KQK A;  1FE4 A;  1S6P B;  3P5B P;  3GCX P;  3QAT A;  4QPX A;  2MHE A;  2HS4 A;  4HHJ A;  2DIS A;  2DNM A;  2F3J A;  2O01 C;  2VG7 A;  3NXZ A;  1NM2 A;  1ZM4 A;  1WC6 A;  4U8V A;  4H4O A;  4Y34 A;  2YKM B;  4IG0 B;  1QVF R;  3OXG A;  1RWO B;  2W9C A;  4IQM A;  5E3A A;  4B9U A;  5I3U A;  2R7T A;  5C24 B;  4W90 B;  5KG7 A;  2RUG A;  4GKJ J;  3OD2 A;  2HMI A;  1RYR A;  2JSX A;  4DX7 A;  5E5N A;  1NK0 A;  5ETL A;  2VUG A;  1VS3 A;  3BGR B;  1KLN A;  3FQL A;  1X4F A;  3OL7 A;  1HWL A;  5CQG A;  4DL0 C;  2F7V A;  1U6B A;  1NH7 A;  1NKB A;  3RBX A;  5DG8 A;  5LMU F;  2VDH A;  4Y6I A;  4Z7C A;  2RRA A;  4Y0F A;  2MJN A;  5GAG I;  1CJK B;  1V9O A;  4ECZ A;  4OJ3 A;  2ILZ A;  1TKX B;  2JL9 A;  1FNM A;  3MCO A;  2EG2 A;  2XMU A;  3D66 A;  3THV A;  1UZH A;  4C8M A;  5EN1 A;  3TX0 A;  2L08 A;  4CLF A;  3UCZ P;  4ILL A;  2DHS A;  3PEJ A;  3HVW A;  3FUY A;  1UWA A;  3BKU A;  1RQ0 A;  3PYE A;  3RRG A;  1W2B R;  4GVB B;  4J9U E;  4IG3 A;  2AIR B;  3EGW B;  2J6T A;  1TUW A;  3EVM A;  2NRE A;  1G4C A;  2D3Z A;  2OEJ A;  1CPZ A;  1CUL B;  2QL9 B;  2AEM A;  4Q0B B;  2ZZN A;  1YJT A;  1RAI B;  5KFH A;  1RHU B;  4UZB A;  3QIP A;  2AYB A;  2PA3 A;  3AOD A;  2XC9 A;  5D0H A;  3V5R A;  2OD6 A;  3J7Z T;  1HA1 A;  1JLE A;  1DTT A;  4HI2 A;  4YR0 A;  4EBD A;  1LWE B;  4PYA A;  3PFO A;  3TZX A;  2DBB A;  1TK8 A;  3CSK A;  3OTE A;  1RWK B;  3M8W A;  1WC5 A;  2FC8 A;  1HQE B;  2Y9H A;  1RDR A;  3H4D A;  2HAF A;  1WEL A;  1URN A;  2XWX A;  4PUO A;  4ELV A;  3MM7 B;  1QJH A;  4WFN Q;  1IBK F;  2HHU A;  2V4Q A;  3HFK A;  4JB8 B;  4DPO A;  1KLM A;  3TQ1 A;  1EQM A;  1T3O A;  4ED4 A;  2LP4 A;  2VC1 A;  2LMI A;  3NOG A;  3JB9 k;  2H5J B;  3LPE A;  1NHU A;  3OFE A;  4MKB A;  5ETK A;  2LCW A;  4OX8 A;  3W65 A;  3B4D A;  4M5N A;  3PM9 A;  4WZQ A;  4P6Q A;  1TUV A;  2GQQ A;  3ZTQ A;  1WTF A;  5C2C A;  1VRU A;  3DU5 A;  4OZ0 A;  3W5Z A;  5KOW A;  4EUV A;  4QR2 A;  5J1P A;  1JQG A;  3CCJ S;  3NWR A;  3PG9 A;  4J9O A;  3L4B C;  4RZR A;  4CLY A;  1H73 A;  4DN0 A;  4OI4 A;  2XO7 A;  5FJ4 A;  4CLL A;  1YHQ S;  3GWC A;  2VFR A;  4WP8 A;  1MN9 A;  1N34 J;  1GK8 A;  1M5V C;  3F41 A;  3VAK A;  3KMS A;  4DFM A;  1BQM B;  2PI5 A;  1LXN A;  2KH9 A;  3DYA B;  4MFB B;  1RAD B;  3GIM A;  4CCH A;  3TVY A;  1U2F A;  2CQI A;  1QLN A;  2IM2 A;  4DZD A;  3S7R A;  2MJU A;  2CPI A;  1VCT A;  2D9P A;  4LF8 J;  1R3N A;  4MYT A;  3WDO A;  1TKZ A;  1ROF A;  2M52 A;  4AL5 A;  1MWY A;  3HVR A;  1P6T A;  2KB2 A;  4FF4 A;  3QGG A;  2W9A A;  3DDN A;  1RA6 A;  4WKY A;  5M2P A;  3KLE B;  1CJT B;  4MK9 A;  2C3U A;  1HR0 J;  2V9K A;  5GAD I;  3J7A N;  2CQB A;  3MEC A;  2WHO A;  4WFB Q;  1ZPV A;  3DOK B;  4EZ6 A;  4ED7 A;  3H5U A;  1AFI A;  2AYM A;  2MZR A;  2XLJ A;  2MXY A;  1TVR B;  3HHK A;  5E3C A;  1F6T A;  3SEO A;  1SBR A;  4QWB A;  3BH7 B;  3WHI A;  3CJ4 A;  1YI2 S;  1G3O A;  1X9M A;  4PQU B;  2P6S A;  1VLY A;  5MLC V;  1MLA A;  1DTQ B;  2DT9 A;  3HMJ G;  4DR7 J;  1KQS R;  3MPU B;  2BR0 A;  5DZ6 A;  5HI7 A;  1KFD A;  2HQG A;  1KKH A;  4DR3 J;  3IS9 A;  2RS2 A;  2M2B A;  3T6J A;  3JQJ A;  4M1K A;  3HKZ D;  3TAN A;  3THP A;  5HVF A;  3MPY A;  3SSQ A;  3QJP A;  3C14 B;  1FWP A;  2QZ8 A;  3AA8 A;  1X9W A;  4A8W A;  1VIS A;  3QWU A;  4BBY A;  2HHQ A;  4RBU A;  1U09 A;  4YY3 F;  4GVL A;  4HDH A;  1RWM B;  3LO3 A;  2LEC A;  4DV3 F;  7FD1 A;  2VF3 A;  1FFW B;  1EX8 A;  4FXV A;  4JI5 F;  4OI2 A;  2CNN B;  2UVV A;  3H7H B;  5D0E A;  4NZ6 A;  4TY9 A;  2CYY A;  3QZ8 A;  2CQ3 A;  3JSM A;  1MG7 A;  1S1T A;  1NUE A;  3CTR A;  1WSR A;  4ETX A;  1EP4 A;  1MMN A;  3CGI A;  1KVI A;  5K14 A;  1B0V A;  4JI7 F;  3BN7 A;  4IQX A;  4M5L A;  3I5B A;  1N6Q A;  4DU7 A;  1EKS A;  2BA9 A;  2V8V A;  4AL6 A;  4HHU A;  4G1P A;  1RBO B;  3GR1 A;  2HHT A;  3FBE A;  2DRB A;  4OX6 A;  2XSJ B;  3D3B J;  4LSZ B;  4A8O A;  5KTQ A;  1U1R A;  3U1N A;  2ZM6 F;  1P1T A;  3PYF A;  2DGV A;  3FZ2 A;  1KOH A;  4CLW A;  1VBX A;  2AEJ A;  1WKK A;  2BKO A;  4QIE A;  3RRH A;  2IJR A;  2RH3 A;  4U6P A;  1XR6 A;  1UPM B;  3BB5 A;  2GHV C;  3HHL B;  2JVO A;  4EEY A;  3OSN A;  3ZZ0 A;  3UO0 A;  1KSP A;  3OTO F;  4HVZ A;  1LKZ A;  5A6W A;  4QWD A;  1M1G A;  3H2U B;  1ZOT A;  4J9N A;  1X4H A;  4MTP A;  4DV4 J;  2DGT A;  2DK2 A;  1U1P A;  3C19 A;  3A8J A;  2AQ4 A;  4DR1 F;  1HIY A;  5F41 A;  1XMO J;  1NPR A;  1HBO A;  1E6Y A;  3DHW C;  4LMZ A;  5J2M B;  3R9L A;  1JXL A;  1RHJ B;  3GV7 B;  2Z0G A;  4S0M A;  1AUD A;  2AU0 A;  5I4M A;  1S99 A;  1GXT A;  1MU2 B;  2PN6 A;  1ZM3 A;  3R5A A;  4F0H A;  3PO5 A;  8ATC B;  4F26 A;  1OY8 A;  4LRA A;  3KFW X;  2HRT A;  3QRR A;  4CT9 A;  4M5D A;  1IQZ A;  2G2Y A;  2DNP A;  3VGV A;  2HBQ B;  1HWK A;  2NR0 A;  3KK1 A;  3DRS A;  4KR0 B;  3FMB A;  4Q45 A;  2DEJ A;  2DNZ A;  3MTK A;  3EIC A;  4ES2 A;  1R0A A;  4OZ5 A;  2NXN A;  1R8A A;  4K4Y A;  1PBA A;  1N33 J;  3PR5 B;  3RW7 A;  5DDO C;  4XPC A;  5CYJ A;  4A47 A;  2WON A;  1NH8 A;  2IYI A;  3WX8 A;  3KG1 A;  4OHZ A;  2IRU A;  3TI0 A;  4IRK A;  5HQ8 A;  4AUK A;  1S4F A;  1XR7 A;  1FDN A;  1JLG B;  1B4S A;  3CO9 A;  3GU0 A;  3ITH A;  2Q79 A;  4D3H A;  2WVE A;  3RB6 A;  1GMW D;  3K58 A;  1T3N A;  5CZX A;  4JI3 F;  4FKX A;  1KRP A;  4LBH A;  3Q8Y A;  2DH7 A;  2DGO A;  2CKW A;  2FVP A;  4FKY A;  2XGQ A;  5KFD A;  4QYZ K;  1RT4 A;  2PGC A;  2E1C A;  1ICE B;  4Y3C A;  2VFT A;  3D1O A;  3CC2 S;  4X4N A;  3NGD A;  2C2Z B;  1R89 A;  2F9D A;  4OI3 A;  2QO3 A;  5KG2 A;  2VG7 B;  2FJB B;  1YKW A;  4X65 J;  1S1U A;  4Q43 A;  1Q81 T;  4ES3 A;  3C2P A;  4QBU A;  4H4O B;  3DC2 A;  2AV5 A;  2GCF A;  4DCJ B;  3D1Q A;  4LIW A;  4OYM A;  1WD6 A;  2W24 A;  2JNJ A;  3GYG A;  2W9C B;  1Z4U A;  1IWA A;  5I3U B;  4WFY A;  3HJF A;  2HFU A;  4GRS A;  2QV6 A;  2HMI B;  3CDU A;  1IXK A;  3TAR A;  4U8Y A;  1T9W A;  3V6D A;  1JJH A;  2YX4 A;  5LJ5 Y;  5HJY A;  2YBV A;  1RAE B;  5CYM A;  2GQ2 A;  3CIZ A;  2QC3 A;  1YRX A;  2GML A;  1UA0 A;  2E1P A;  4TLQ A;  2OO4 A;  1RAG B;  5DG9 A;  1BWE A;  2F8M A;  3P8B B;  4O3R A;  1T0T V;  1C0T A;  2EBG A;  3T5H A;  2WW4 A;  2F1F A;  4FZV A;  4WIQ A;  4ZLL A;  3R27 A;  3BO3 A;  1U6Z A;  2QJ3 A;  5AE3 A;  1XQI A;  3PX6 A;  3R5C A;  2VA2 A;  3HD2 A;  4IG3 B;  4IR9 A;  1S48 A;  1F3F A;  2B9W A;  4XK8 C;  2QSW A;  3KWM A;  3M6W A;  1QAJ A;  1H0H B;  2VQE F;  3JTN A;  4LQ3 A;  1S7I A;  3OBI A;  3LH2 S;  1N5Q A;  3UR3 C;  3L9Z A;  2G4B A;  1SKU B;  2HHP A;  4ZHR B;  3QIP B;  2ZJQ Q;  2GO8 A;  2AHO B;  1RU1 A;  4ZVU B;  3Q2T C;  1HHS A;  4ZP9 A;  2MB0 B;  2R2R A;  3AXK A;  2F65 A;  1JLE B;  1DTT B;  2VG5 B;  3W8P A;  2E1R A;  5CYQ A;  2K8G A;  4Y2C A;  2WTF A;  5D4P A;  2IRY A;  2AW0 A;  3TA2 A;  4RBV A;  2YKN A;  2MZ1 A;  5F8L A;  4O23 A;  4PUO B;  4M94 A;  3TOQ A;  5A0Y A;  3AB4 B;  3CT9 A;  1HBM A;  4BLG A;  2NZC A;  2UXC J;  1O5J A;  1KLM B;  1EQ0 A;  2HBZ B;  1B7F A;  1Y5I B;  4WE1 A;  3QQC D;  4LR8 A;  2W9B A;  2H9Z A;  2GC8 A;  4DI6 A;  1YJ9 S;  4DQI A;  3NBP B;  2RML A;  3M6U A;  2DCL A;  1PAE X;  4A8F A;  1MML A;  1VRU B;  2Z58 B;  1O0P A;  1NSK L;  3IR5 B;  2DTJ A;  2ZE2 A;  4JI2 J;  2RT3 A;  1FTR A;  3PW0 A;  2OP5 A;  2CPX A;  2H5E A;  4CZC A;  4H4M A;  5LL6 d;  2BKN A;  4CO2 A;  5AJ3 J;  3THT A;  1F5A A;  3OTB A;  4QW9 A;  4A8K A;  3DGV A;  4NYO A;  2YXL A;  1MRO A;  1PIL A;  1Y5N B;  4JBC A;  3M9O B;  5KFP A;  1HFE L;  3QWP A;  3OT9 A;  4UST A;  4G1Q A;  4XIU A;  5FLX Y;  4N47 A;  3PHE A;  4B3M J;  1KVJ A;  1JLA A;  1JXE A;  4PXD A;  3KKF A;  1TKZ B;  5DET A;  3I9V 9;  5BYQ A;  3DRR A;  4L74 A;  1V5V A;  1AXQ A;  1QUV A;  1L3U A;  2YPY A;  4P72 A;  1HD1 A;  4QWE A;  3L95 X;  1BXN A;  2ZBC A;  2JEF A;  2HSE B;  1F0X A;  4J9M A;  1IBL J;  4RBT A;  3MEC B;  2C3M A;  2GS8 A;  2VU5 A;  1FWL A;  1T8E A;  3Q8Q B;  1FNO A;  2Z57 B;  1WOR A;  4ZLJ A;  4ZVE A;  3AJD A;  4GO7 X;  2HBR B;  3MOZ A;  3R2D J;  2ZVS A;  2BE2 A;  2B8Q A;  4KH1 B;  1JNZ B;  2R2T A;  3EX7 B;  2BM1 A;  2F40 A;  3NS5 A;  1XMO F;  3HSZ A;  1I3O B;  2IRX A;  2WZ1 A;  4FS1 A;  2O66 A;  5SZT A;  3POT A;  1IUJ A;  3VWS A;  2K1R A;  3PJW A;  3IS9 B;  3LA0 A;  4C3K A;  3BKT A;  2KRB A;  1U8S A;  4AFF A;  2CZ9 A;  4Y2A A;  3HM9 A;  4QIG A;  4MJK A;  3HF5 A;  3KG4 A;  5H9E K;  3SFG A;  3OL8 A;  4OYO A;  2N4C A;  3I4H X;  3CCR S;  2Y1I A;  2UUT A;  3FK4 A;  4CO1 A;  4DLE A;  1AW0 A;  1S1W A;  4NE9 C;  4Y00 A;  1LWC A;  4QR1 A;  3CCU S;  4YS2 A;  4G1I A;  1JB0 C;  1FFG B;  1HNV B;  3ILO A;  2ZZM A;  4DSJ A;  4B3O A;  4ICL A;  1N33 F;  1S1T B;  2HNZ B;  2R7W A;  1IJE B;  1EP4 B;  4W92 B;  4HH0 A;  1RJJ A;  3P96 A;  2FD2 A;  5KG1 A;  3T5J A;  5K14 B;  3B4M A;  3TAM A;  3RGI A;  4ZIW A;  2FHJ D;  1N6Q B;  3AD9 C;  3I32 A;  2R8H A;  3OPK A;  3I0R A;  3OVB A;  2E29 A;  2EEY A;  4M5K A;  5J2P A;  3QGI A;  2KZZ A;  5F8I A;  1JK9 B;  1O6X A;  5E41 A;  3IAM 9;  4K8R A;  2FZK B;  2CJX B;  2K2P A;  2C1E B;  3GFH A;  4B9S A;  4OZ3 A;  1NK6 A;  1TK0 A;  1SJR A;  5RUB A;  1KP6 A;  4NX9 A;  2CJ9 A;  5F8M A;  1L5U A;  1X60 A;  5KFQ A;  4L3K A;  4X65 F;  1HNW F;  2MKS A;  2EFQ A;  2QLW A;  4UOC A;  4ZPV R;  2CVE A;  3N6N A;  4LVN P;  5IC4 B;  1LK5 A;  2Z2Y B;  4OZJ A;  3TO8 A;  2QEX S;  3LAN A;  1SC6 A;  2J0W A;  3IWN C;  2RQC A;  1RAA B;  2DNY A;  2FJD B;  2Y1J A;  2KDO A;  4LIR A;  2VBY A;  3OVA A;  4YME A;  4DV2 F;  2BJ7 A;  3C3L A;  3N01 A;  3RAM A;  1SJQ A;  3M2U A;  2OJ3 A;  1PCA A;  1NLK L;  1HBO B;  1E6Y B;  1B3T A;  2H3E B;  3L7U A;  3RUB L;  2RD5 C;  1PAU B;  4XAK A;  4RX6 A;  2FLP A;  1LWX A;  1QAX A;  1B70 B;  5J1N A;  1T94 A;  4F3M A;  1PO6 A;  2GFF A;  3ZZY A;  3JYT A;  2V8H A;  4X64 F;  4BWJ A;  1DFD A;  3G6Y A;  1L3T A;  1BWV A;  1NJX A;  1YDL A;  3IG1 A;  1FE0 A;  2ATL A;  2AZ3 A;  2ZBI A;  1X4G A;  3CF5 Q;  3VAJ A;  2C22 A;  4M5D B;  4M63 A;  1M90 T;  3DRS B;  1N48 A;  5F8H A;  2KT5 A;  1UVK A;  5D4O A;  3PO4 A;  3Q89 A;  4R0E A;  3JXO A;  2D3U A;  1R0A B;  2IBO A;  3IBF B;  4OL8 A;  1H38 A;  2UVR A;  1Q79 A;  2XM3 A;  2WON B;  1YWX A;  3NAI A;  3H5Y A;  4A8M P;  1RT3 A;  4ZVQ B;  2H5I B;  4JV0 A;  3BF4 A;  3T1Y J;  1IBM F;  1NK4 A;  1VRQ C;  3TAQ A;  2DR9 A;  2KO1 A;  4DFK A;  4F2S A;  3GJT B;  4L73 A;  1XNR F;  4CRJ A;  3ITH B;  2J7U A;  2RJZ A;  3GMG A;  3OL9 A;  5DGB A;  1SB6 A;  5CA5 A;  2KTQ A;  3N5F A;  1FKP A;  3HHN B;  2RAQ A;  3BKF A;  2XHW A;  2IVF B;  2XY7 A;  2A10 A;  5H9F J;  2BJ8 A;  4WYW A;  2DRA A;  3IP0 A;  4DL6 A;  2ZBR A;  2E44 A;  1VJW A;  3OXF A;  4K4S A;  4JOU A;  2O3D A;  1S1U B;  1K1S A;  2DPI A;  4DMZ A;  3EZ5 A;  2D74 B;  3NWG A;  1RHR B;  1HWU A;  4OI1 A;  1H3D A;  2HVH A;  3VAH A;  5GMD A;  4O3Q A;  4I4B A;  1WG4 A;  2GIF A;  1R8C A;  3CNQ P;  2B6A A;  5F8J A;  1K0V A;  2UXB F;  3TP2 A;  2VG6 A;  1T02 A;  1MSW D;  2B51 A;  3SFU A;  2CNO B;  1SV5 A;  2UP1 A;  1FJ7 A;  3V6D B;  3PIP Q;  2OSR A;  2BZ2 A;  2XNR A;  3OXL A;  1UFW A;  2HFS A;  1YJW S;  4JI2 F;  3PYD A;  1N88 A;  1XMQ F;  3UNG C;  4Z37 A;  3DNC A;  5AJ3 F;  2DEI A;  1I1G A;  4OV1 A;  2YNG A;  1TAU A;  3DLK A;  3KOA A;  3UD3 P;  3L09 A;  4HH1 A;  2OFG X;  2KVQ E;  4C9D A;  2IM1 A;  1C0T B;  3IWL A;  2DGX A;  5KT6 A;  2XCP A;  4TKT A;  4ZPB A;  1FFS B;  2GNK A;  2DHH A;  1S0O A;  3G86 A;  8RUC A;  1FK9 A;  2QLX A;  4NXN F;  4JUZ A;  4PXB A;  3T5L A;  1ZBT A;  3A12 A;  2NSB A;  4DL5 A;  2IA6 A;  3JSY A;  3CIM A;  1SH3 A;  1KWM A;  3ISN C;  1UW9 A;  1IBL F;  3OV7 A;  3Q8P B;  4G3I A;  3M30 A;  2K7J A;  2QL5 B;  3T3F A;  1S1X A;  1FX2 A;  4ZN1 A;  1H98 A;  2CJQ A;  4KC5 A;  3HO1 A;  4X66 J;  1WG5 A;  1SKS A;  1WEZ A;  4CNZ A;  1C1C A;  1LXJ A;  2E9T A;  5H1S V;  3GFX A;  4YN3 B;  1N0U A;  1OPZ A;  1S0N A;  5CYQ B;  2ZKU A;  1RTD A;  1W26 A;  1HLW A;  2YKN B;  3J7Y U;  4X62 J;  3KJV A;  1RCO B;  2HW3 A;  4C7Q A;  5A0Y B;  4GO5 X;  4I68 A;  5DDQ C;  2YTC A;  4DSF A;  1M5H A;  5FII A;  4LFA J;  2NZ4 A;  4JV1 A;  2UU9 J;  1FWK A;  3LWL A;  4WE1 B;  1VHI A;  2W9B B;  4P2X A;  1U47 A;  4KFB A;  1SC3 B;  1UJ5 A;  1HWI A;  1AZS A;  1YRT A;  1U8W A;  3CJ3 A;  5CD4 A;  4TU9 A;  2N82 B;  4ZPC A;  1OJ4 A;  4WP3 A;  3R97 A;  3OVS A;  2EKN A;  1PKU A;  3VGT A;  2R7S A;  3AOB A;  4KGM A;  2ZE2 B;  4DUT A;  3CJ0 A;  3PX0 A;  4GKK J;  4H4M B;  4R5P A;  2MQO A;  4C48 A;  1KHW A;  2YQ1 A;  1UVI A;  2FVQ A;  4I69 A;  5L1I A;  1MRO B;  3KNG A;  6FDR A;  2FVR A;  3QMQ A;  3DLB A;  1W2I A;  1FRI A;  2HS0 A;  4RUC A;  3RBD A;  3OR2 A;  4JI8 F;  1H2V Z;  2XI2 A;  2W4P A;  4YDX A;  4G1Q B;  3I9Z A;  5B09 A;  3SCI E;  3Q8U A;  2CNK B;  2QMW A;  1JLA B;  2LXI A;  3TZW A;  4W4M A;  1TKD A;  3ONQ A;  1PSD A;  1XJW B;  3DRR B;  4TQS A;  1RHQ B;  3LGH A;  2F4V J;  3BPS P;  2BX6 A;  4TN2 A;  2ILY A;  4FYY B;  3GYX B;  2XNQ A;  3EM1 A;  3BR9 A;  1TR0 A;  4DJB A;  3GG1 A;  4Y2K A;  3LAK A;  4LF6 J;  1U1O A;  4MAK A;  1TFY A;  5ETR A;  5KFM A;  2RSQ A;  2C3O A;  3PRV A;  3W7B A;  1UVM A;  4DV7 F;  2NCK L;  1RAO A;  1HL6 A;  2AEF A;  3TZY A;  2XYG B;  2BE2 B;  2UXD J;  1OIA A;  2X1F A;  4JP8 A;  2LEB A;  4C3L A;  4F2R A;  2KHD A;  3J81 j;  4QIW D;  4ED0 A;  5EWG A;  4TLR A;  4M5G A;  5CD4 H;  3CWJ A;  3POT B;  1SH2 A;  4ZIT A;  2K1R B;  2GAG C;  4CIO A;  1NK5 A;  2KFZ A;  1G6B A;  4NYZ A;  9ATC B;  2M70 A;  1EJ7 L;  2FDN A;  3H59 A;  2MKJ A;  3CDB A;  4B3R J;  3EGZ A;  3BPD A;  3U1L A;  1QUP A;  4G6V B;  2V4J A;  3DOL A;  4O44 A;  2XY6 A;  2R42 A;  1K73 T;  1VQY A;  1UWB A;  3I0S A;  1S1W B;  4PEO A;  2YVS A;  1GNK A;  1LWC B;  1RLD A;  2EK1 A;  4DF8 A;  4I56 A;  3E3X A;  3MEK A;  1RKI A;  4B3O B;  4ICL B;  3MOJ B;  4X84 A;  1U26 A;  4WXO A;  4RUB A;  1O8B A;  2RIL A;  2OPQ A;  2ZZT A;  4USW A;  4K4W A;  1FRJ A;  1TAQ A;  3TAM B;  2HNY A;  4OHW A;  3L7O A;  3M32 A;  1RB0 A;  4ECV A;  4ZP7 A;  4K7Q A;  3I0R B;  2M4M A;  1F9H A;  1RE1 B;  3DM2 A;  2EG1 A;  3T1H F;  4MK7 A;  5J2P B;  4DCO B;  1EAR A;  5L1L A;  1S6U A;  3CJQ A;  2AJ4 A;  3C6U A;  1Y3K A;  4Y65 A;  3UE2 A;  1GTE A;  2M3D A;  2EFO A;  4X4P A;  4F4X A;  1FKO A;  1VK8 A;  1Q95 G;  4FYX B;  1WI6 A;  5C2G A;  2IAJ A;  4ED6 A;  4LSN A;  4ANE A;  4QYZ J;  3UI3 A;  1U24 A;  3K5L A;  2OPS A;  4O4R A;  2HIY A;  3NY0 A;  4DR4 J;  4I2Q B;  3TUP A;  2BKP A;  3I87 A;  4WK3 A;  3BDP A;  1WHW A;  1OMS A;  3GB0 A;  4CO3 A;  4F67 A;  2HGL A;  4PKD B;  3OSP A;  5T7L A;  2COL A;  3CC7 S;  3M2U B;  1YBA A;  5L1J A;  3MD1 A;  4E2F B;  3OFG A;  2APO A;  4OYA A;  2PEB A;  4ECW A;  1TL4 A;  2MMY A;  3PYG A;  5KFI A;  4IO9 Q;  2AKW B;  3MMA A;  4FYW B;  5L38 A;  2G2O A;  3VZH A;  2I1R A;  3JYT B;  2ZDP A;  2QRR A;  2WCX A;  5KAK A;  3IG1 B;  4DPT A;  3CCL S;  1RT6 A;  2XO6 A;  2J8S A;  4ETZ A;  2VKR A;  4NWB A;  1WKL A;  3PKY A;  3ADA C;  4C11 A;  3OUY B;  3WC0 A;  5HBM B;  3FC9 A;  1LQ9 A;  1S6Q A;  5CXT A;  3UD5 A;  1HD0 A;  2I9S A;  1KNZ A;  4PCQ A;  3JSR A;  1VQ7 S;  1U1N A;  4CDI A;  3ETO A;  3RRK A;  3BQ1 A;  1HNX J;  3HVA A;  2ZH1 A;  3UVJ A;  3UNY A;  1YJN S;  1X4C A;  2XG8 A;  2UUW A;  1EKR A;  3D6M B;  1N4L A;  1SXL A;  2IA0 A;  2HIQ A;  1Q7Y T;  1GH8 A;  4OIX A;  1LV5 A;  1UEK A;  3M6X A;  1NHV A;  2KYZ A;  4UTG A;  4X66 F;  4ZPT R;  3ET6 A;  1PBU A;  2VD3 A;  1S6P A;  3C46 A;  1SL2 A;  1FKP B;  1H6K X;  2Z56 B;  1ZA2 B;  4C0O C;  3VVT A;  5I42 A;  2XMM A;  3BRE A;  2WVF A;  1JXV A;  2AGP A;  4X62 F;  4IG0 A;  1N0V C;  3U7J A;  3GZ7 A;  1IR2 A;  4FF2 A;  2CFX A;  3EPG A;  2V67 A;  3MMJ A;  1XTZ A;  3PEH A;  3F44 A;  3VV2 B;  4OYZ A;  2UU9 F;  2OEM A;  2FLL A;  2F8H A;  2JEG A;  1EAY C;  2GHW A;  4X4T A;  5AE2 A;  5CH7 B;  3DFE A;  3LGN A;  4ZKA A;  4CYU A;  1AFJ A;  2B6A B;  3UDV A;  4UQG A;  1HBU A;  3KG0 A;  3CD6 S;  2VG6 B;  5BJR A;  4ZCI A;  4NCB A;  1LW0 A;  4LF2 A;  1SV5 B;  2P9G A;  2G0I A;  1R8P A;  3EUN A;  1NSP A;  3TUI C;  4KSE B;  5A76 A;  5KFL A;  4OX9 J;  1HYS A;  3OTD A;  3LP2 A;  2Z2Z A;  3ZC4 A;  4JI0 F;  4GKK F;  4BDP A;  2NQP A;  3H0P A;  2YNG B;  1WWH A;  3UDC A;  3RW6 A;  3W60 A;  4UQT A;  1FJC A;  5HVH A;  1PGZ A;  2H1Y A;  4ZJL A;  1FRK A;  3W2V A;  1SJF A;  3CJ8 A;  1RUS A;  3HDS A;  3IN5 A;  2DNK A;  5KT4 A;  4KQZ A;  2Y0S D;  2HVD A;  3CCQ S;  1FK9 B;  2VOP A;  2HWH A;  2IIH A;  2V4R A;  1S10 A;  4OYW A;  4USK A;  3KUH A;  1NK8 A;  1Q8K A;  3MCM A;  2KJV A;  2L9D A;  2FVS A;  3MZI A;  3NMR A;  1I94 J;  3M30 B;  1S1X B;  1U0H A;  4PWD A;  2VV5 A;  3LQV A;  4C8K A;  1TZ0 A;  5G0R A;  2OKQ A;  4P52 A;  5K5M A;  2BM0 A;  3VZI A;  1VHF A;  4K4T A; 
#chains in the Genus database with same CATH homology
 5CAA A;  4CP5 A;  3Q89 A;  1VYA A;  3PRV A;  1NB2 A;  4ANC A;  3FBF A;  3PJ9 A;  2DY9 A;  1XQI A;  3FCW A;  1MN7 A;  1NCL A;  3EMT A;  1NPK A;  2NCK L;  3ZTR A;  3Q83 A;  1NDK A;  1K44 A;  1S5Z A;  4W98 A;  3VGV A;  1PKU A;  1NDL A;  1WKK A;  3VGT A;  4DI6 A;  4DZ6 A;  3B6B A;  1F3F A;  5BXI A;  5CAB A;  3FCV A;  1KDN A;  4F36 A;  4DUT A;  2VU5 A;  2DXE A;  1NDC A;  3FBC A;  4KPC A;  3ZTO A;  1PAE X;  3EE3 A;  3FBB A;  3NGS A;  3ZTP A;  4O0N A;  3EIC A;  3Q8V A;  2HVE A;  4C6A A;  1NSK L;  4WBF A;  3ELH A;  3VVT A;  4UOF A;  1BUX A;  1WKJ A;  2CWK A;  3VGU A;  1NLK L;  2B8Q A;  3BH6 B;  1JXV A;  1UCN A;  3ENA A;  4UOH A;  3Q86 A;  2DXF A;  3VGS A;  1BE4 A;  3DDI A;  3L7U A;  1S59 A;  2HVD A;  3VVU A;  4UOG A;  3EVM A;  3BBF A;  3ZTQ A;  3WX8 A;  3JS9 A;  2BEF A;  3BBC A;  1HLW A;  3ETM A;  4HR2 A;  1NUE A;  3Q8U A;  3G2X A;  3DKD A;  1XIQ A;  1LWX A;  1WKL A;  5IOL A;  1HIY A;  1ZS6 A;  1B4S A;  5C7P A;  1EHW A;  1F6T A;  3GPA A;  1W7W A;  3NGU A;  4ANE A;  3FC9 A;  2AZ1 A;  4AND A;  1BHN A;  1LEO A;  4ENO A;  3BH7 B;  2BX6 A;  3EJM A;  3MPD A;  2AZ3 A;  3R9L A;  3EVO A;  1MN9 A;  4S0M A;  3EM1 A;  1B99 A;  3NGT A;  2ZUA A;  3NGR A;  3FBE A;  3GP9 A;  2B8P A;  4FKX A;  2DXD A;  4EK2 A;  1NHK L;  3FKB A;  3ZTS A;  2DYA A;  3Q8Y A;  1S57 A;  1U8W A;  1NDP A;  2HUR A;  4FKY A;  3B54 A;  1HHQ A;  3EVW A;  1NSP A;  3BBB A;  1NSQ A;  4F4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...