2HIYA

The structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. (casp target)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
180
Chain Sequence
AMTRYALLVRGINVGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title The structure of conserved bacterial protein SP0830 from Streptococcus pneumoniae. (CASP Target)
rcsb
source organism Streptococcus pneumoniae
total genus 54
structure length 180
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08002 DUF1697 Protein of unknown function (DUF1697)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits bacterial protein sp0830 like 2hiyA02
3.30.70.1280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SP0830-like domains 2hiyA01
2HIYA
chains in the Genus database with same CATH superfamily
3JAMY 2GA7A 4OX8A 4QIEA 1SCJB 1K47A 1FKAF 4WF9Q 3OVSA 2IC3B 3SIPB 4CNYA 2Z4PA 1CJKB 1MMDA 2QA2A 1U6BA 2HMIA 1QLNA 2UUBF 3FEYB 2ZKUA 3SFGA 2O5DA 4JB8B 1N48A 2QLFB 1C1BB 1WG5A 1YQHA 2DCUB 2MKYA 4HI2A 4B9NA 4QW9A 2E5LF 3MEKA 2C2NA 4AL6A 3OXFA 4MKBA 2PMWA 2DGUA 1RKJA 4FPIA 3ZZ0A 3CC2S 1TP7A 2DHXA 2MQLA 1NDCA 4USKA 3T6JA 3GCXP 4I2PA 2MQ8A 5DM7Q 3EE3A 1S99A 4JI3J 4RNNA 1FK9A 3IXQA 3QRPA 2XBPA 2AJ0A 2G1HA 3NG8A 3KK3B 3NS5A 5HK4A 2OI2A 3EVWA 4DV7F 3FSYA 1GXLA 2LA6A 4USMA 4HR2A 1NJYA 5LSRA 4HYKA 3ISZA 1K1QA 3WQPA 1FFGB 3GB0A 1T3OA 4L72B 2PA3A 3CXCR 2YNGB 3CULA 5F8NA 3PXGa 1L3TA 1LNQA 1YITS 4RUBA 3M7VA 5B0EA 5F9NA 3LO3A 2VFTA 2YXLA 3L3CA 2Q6BA 1FRJA 2J8AA 2GW8A 1OJ4A 5D4OA 3GCWP 2DTJA 4U7UK 5KFNA 2AQ4A 4ZP8A 1I5OB 4B17A 1UL3A 2FLOA 4X4NA 3ITHA 2IJRA 4J9VA 4YR0A 2C3PA 5MAOA 4USWA 4LSNB 1RZMA 4ZOSA 4GC6A 2DITA 2R7SA 1NK4A 2HIQA 4K50A 1A6LA 1KVIA 5E3AA 1S76D 2HSEB 2HGMA 1X5OA 3VGSA 4A4JA 2OP5A 1RK8A 2VQFJ 1VLOA 3DLEA 3AA9A 4JI3F 2O3DA 5DGAA 3GV5B 2V4RA 2V94A 4KGZB 4DUTA 1SC6A 3IWXA 2BJEA 3UWTA 1UFLA 2PD1A 2HVIA 2ZBCA 1JLFA 3PV8A 3IBWA 5GMDA 1B70B 1R8PA 5DETA 3SZ2A 2A2CA 5KG1A 2UVRA 4TLQA 3PX6A 3JQMA 4Q5VA 2Z56B 3SMZA 5C2GA 1F9EB 1PILA 3PR4A 3O2IA 3QAUA 2R7WA 2IY5B 4DZDA 3HHKA 1Q1KA 4LQ3A 1H0HB 3TA0A 4YQWA 2HQGA 4KO0A 3J81j 4PAAA 3W2WB 1HNWJ 1CULB 1GQEA 1N88A 1LFPA 4LMZA 4LF6J 2WONA 1QSLA 2L08A 1QAYA 4PPDA 3TR5A 3VQSA 4W92B 4FBUA 2QA4S 1WEZA 1QM9A 5J2NB 3FFIB 3FZBA 6AT1B 2GVDA 1VQ8S 2JHEA 1IKXB 3W7BA 2CQ1A 3HFVA 5GAGU 3VZHA 1S5ZA 1LOUA 1SB6A 2FDNA 4NLQA 3O6QA 1SH0A 3C66A 4WCEQ 3UR0A 2VQFF 4RNMA 2KT2A 2MKCA 5FD1A 1V3ZA 2YWKA 4LBHA 5FJ4A 1AFJA 3KLHB 3R2CJ 2DRDA 2DVIA 3ENWA 5A8KA 4LVNP 3TANA 2DGSA 3CCES 4MKYA 5MLCV 2OIHA 2MTLA 1SJQA 4QW8A 1P9QC 4FS2A 1HARA 4KGXB 4TKTA 2CQPA 3MMCB 1S6PA 3KUEA 5CA5A 3MTJA 4JP8A 2HLTA 2DNPA 1YJVA 2VU5A 2XCPA 1HBMA 5A8RA 3Q83A 2V69A 1TL5A 2CKWA 1ZA2B 1HNWF 2GAGC 1SJ1A 3JS9A 4LF6F 4QWDA 3KNGA 2CVIA 2XWXA 1SH3A 3VR1A 2PSZA 3ZC4A 2C2OB 1FRLA 4YDXA 1R43A 3PEJA 4ZLPA 1SKWA 1NHUA 2L41A 1Q5VA 2JX2A 4FF1A 4NLWA 1AUDA 2VJVA 2BQUA 1UVKA 1SJ3P 1PYTA 4OYMA 2CFXA 1TL7B 2OPQB 3HP6A 1SC4B 1TFYA 4Y2IA 2DR6A 1HWLA 1C0TA 2ABYA 1M5SA 5HP1B 1FJEB 3L95X 2PI4A 4LIWA 3ILIA 2LEAA 5K14A 2CADA 3FC9A 4ELUA 2FTRA 4HHUA 2QYCA 4Q44A 1IN0A 1RT6A 2OMLA 1FKPB 3FCWA 3MAQA 2FZKB 3CDBA 3R1HA 3AODA 2DT9A 3A12A 2YNIA 2OLWA 4LR7A 1QAIA 1FT8A 1LWFB 2EKYA 2BW7A 3HD1A 4RWXA 3Q8PB 4O3OA 4B3MJ 2Q43A 3MEEB 1TVRB 2EC0A 3TW0A 2MZRA 2WCXA 2W8LA 3VHQA 2F9DA 4OI2A 1NB2A 5C25B 4R8UB 1RHJB 4ZPCA 2N4CA 4X4VA 3NRBA 2RKIA 3RGIA 3CIZA 1YJTA 3KFWX 1XJWB 3T19A 4ID8A 3I6PA 3E01A 5KFHA 5KFWA 1BLUA 4DN0A 1EQ0A 2RQKA 2C28A 1S9GB 4RR5A 3P4UB 3N5FA 2P6TA 3OD2A 3M30B 4RU2A 4ZVSB 1P1LA 1SKUB 1UW4A 4DQRA 1SL0A 2CNLB 3CD6S 3VVTA 1Z4UA 2ADCA 4NLXA 2MJNA 2GMLA 5F41A 3M8RA 3K2YA 1I94J 1FA0A 2ZKTA 3TVKA 4KPCA 3MR3A 2R2UA 2F4FA 2DNMA 5IT9U 3C19A 2WVEA 2HNZB 1S12A 4Q7AA 4G1IA 3TQEA 2Z57B 3Q8VA 2VG7A 3HSGA 2WVDA 4B3MF 5CH7B 1K44A 2A10A 2RQMA 3MM8B 2VOPA 2OD4A 2JC0A 5I3UB 3D9BA 1N5VA 3AB4B 2RMLA 2AJ4A 2ZOGA 3KK2B 3QO9A 2F3JA 2XB2D 4ZPBA 4B9TA 3MEGB 3D1OA 2AZ3A 4DLGA 3NNAA 1JJ4A 1ZPWX 1OWXA 1CC8A 1N34J 4AXIA 2GHWA 1XMBA 2DNRA 3D7SB 1JB0C 4FDFA 3IG1A 4ILRA 3CDAA 5EWFA 2NXEA 1ZM9A 1LWCB 4N5SA 2X1AA 2OPRB 1R6YA 1D8YA 1RT5A 3F44A 1IBLJ 3L09A 3BSCA 1H74A 4MMOA 1U49A 3AY0A 4ZVRB 1TUVA 4KHMA 2AW0A 1GX6A 1I94F 2W2NP 2CWKA 3PJWA 1KSPA 2CYYA 4Q0BB 1J5OA 1OO0B 5BXIA 2ZHAA 3KMSA 5KFSA 2X51A 2HS3A 5E3CA 4ID5B 3LP1B 2WVBA 3MMAB 1T02A 1SV5B 1D3WA 1ZA1B 3CJRA 1FX2A 2MGZA 1TKXB 2DNOA 4LR8A 1RAIB 2OSRA 5HN0A 1NK6A 2IAJB 3KJVA 1BUXA 1AB8A 4M8LA 4PXEA 2MPUA 2SXLA 3KMQA 4TY9A 3WC0A 3QGHA 4DFKA 2N7CA 3UR3C 1RBLA 1N34F 5H9EJ 3DFEA 5A2QY 3QNWB 1RTIA 4J90A 3WX8A 2IM3A 1M5VC 2H48B 4Y3CA 4L76A 3I0RA 2LP4A 4NE9C 1TK5A 5DDPC 2U1AA 5KG5A 1IBLF 3DCAA 4IG0B 3OJSA 3QYYA 2XS7A 1S79A 5ETOA 3M8QA 4F26A 1RWVB 4YOEA 5HLFB 4CLYA 1X4CA 1YK9A 5AXMA 2FLNA 4DBQA 1TAUA 3NWRA 3C3LA 4QYZJ 4C7QA 2N3LA 4HEA9 5AXLA 3M8ZA 1U2RA 5SZTA 2WTFA 4NRUA 4DV4J 3AJ1A 3QGPA 2WVFA 3UD5A 4PXCA 1HWJA 1HD1A 4OLPA 4X4PA 4LRFA 1P27B 3MPDA 5K8NA 2M9KA 3VAHA 1F2HA 3MPYA 4ELVA 2HWTA 1S48A 1U02A 1RWWB 4TU7A 2LEPA 4F04B 1HYSA 4DV5J 2YKAA 5K8OA 2WSCC 4ZN1A 1T9WA 2F8MA 4DDFA 3DLKA 1EJ7L 4K8RA 4ECSA 2EK1A 4DF8A 4WZQA 2X1GA 2FGCA 2AD9A 4EBEA 3RBDA 1B4SA 1S6UA 1MLAA 1BC6A 4LSZB 5HATA 4M5DB 1PGZA 1CVJA 4ERDA 2DISA 2ZVSA 2XNRA 2H5EA 3SQGB 5D4NA 3W3SA 3S1TA 4J9MA 3CCJS 1M1GA 2E5IA 1FX4A 1UEKA 3MM9A 1JK9B 3M2UA 4PG7A 4NRTA 1LK5A 3DLHA 4R0EA 3Q24A 2XSJB 1ZM4A 3HMJG 1UA1A 3Q89A 4FKXA 3BREA 2E5HA 1XR6A 2GX8A 1XIQA 4ZKAA 4BWMA 3P6YC 4K4UA 2YH0A 2GHVC 1PG5B 2IPOB 2RUGA 3FBEA 3KLFB 5D0EA 2HBQB 3PX4A 4OHWA 1TZ0A 3I55S 4CLTA 5LJ3Y 2HNDA 4DV4F 3GIMA 1NO8A 1EETA 1QE1B 3O8WA 1EARA 2H4WB 1Q53A 5B0GA 1YWXA 1IKVB 2KJVA 4UW2A 4CO1A 2KZZA 4EYIB 3MXHP 5L1IA 2JSXA 2UVVA 1IR0A 2ZE2B 4DV5F 3BSAA 3QLHB 3R1LA 2D9PA 3VALA 1S10A 2XYPB 1S72S 1B64A 2BKOA 2DGXA 4RZRA 1JLGB 2XY5A 1CBKA 4DX6A 3MR6A 3NAHA 4K2XA 2ZBPA 3SXLA 3AXKA 3SYZA 3HHLD 3HCXA 1LQ9A 3BV8A 4CCHA 2E29A 3MMBB 1UFWA 1TKZB 3OJUA 2LQ5A 5JXSA 3M6WA 1RHKB 4M5MA 3K0JA 2RU9A 1S0MA 3LP2B 4RW8A 4EWTA 3CCRS 4MH8A 4IDKA 3RB4A 3RB3A 1PC4A 1KS2A 3V6JA 3GP9A 1NK9A 3HZEA 1URRA 3CJ4A 4UUWA 4DL5A 3CCMS 1HBOA 4C8MA 3DLGB 4C48A 1ZTWA 3ZNJ1 2LECA 3A13A 3EUNA 4DS5A 3GV7B 3R3TA 4ZCMA 3M8WA 4RNFA 2XI3A 3PY8A 1M5KC 1FDNA 1VQYA 1W26A 4B08A 4OYWA 1XMOJ 2M7SA 1QTNB 3UQSA 3QZ7A 3R7NB 4QR1A 3A4TA 2KDOA 4P73A 4NMLA 1RAHB 4ZJQA 3E2EA 1JLEB 2HFNA 3CJ5A 4XTTA 3RB0A 2G0JA 3MTKA 4OX7A 5CYQB 5J1EB 5L8RC 1UJ5A 4DPYA 1KFSA 4USJC 3EMTA 2Z8QA 3M9NB 2IFXA 5HANA 1S57A 4D3GA 3QBCA 4B9LA 4H4KC 3DGPB 2BE2A 1QTMA 2K7JA 2M70A 5ADZA 2HURA 1CJUA 1FEEA 1N5YB 4NLDA 2W4DA 2BJDA 2MQNA 4CTAB 3UN5A 3JSYA 3CCUS 2DY9A 1X4EA 4OI1A 5KFPA 1L3KA 2LXFA 2YPYA 4KSEB 2I5JA 3PX0A 4WP3A 1H73A 2JZ5A 1XK8A 3TYTA 4DCJB 2AJFE 3M8YA 3KJFB 2KYXA 3LP0A 1UAWA 3GFZA 4P71A 1CJTB 2FC9A 3TARA 1LK7A 3PO5A 1HQ2A 4P2XA 5DQHA 4BWJA 1U1LA 3LPYA 2F40A 5HQLA 1E6VB 1CS4A 4H4KA 4QPTA 1CPZA 2DBBA 1FNXH 4NLSA 3RR8A 4DPOA 1FESA 4O3SA 3GIJA 1HMVA 2IJFA 1S4FA 1X4HA 1MU2B 4C8NA 3GYXB 5IWAJ 3QT7A 2CUYA 2DO0A 1S1VA 4IFVA 2HFUA 3TUJC 3M1VB 2P9GA 5E41A 3A3NB 3KOAA 1HNVB 4KGVB 1OQ3A 2ZNYA 1SUQA 2BW2A 1HR0J 4EO8A 2ERRA 3KLGB 3H0PA 4HT5A 4C0HA 2PEHA 1U7LA 2R8IA 2HZVA 3UE2A 4P72A 2O1PA 3R7SB 3AXMA 4OYPA 1WHWA 1RU2A 2NXCA 1RT7A 4ZCKA 3D1QA 5KT5A 3QIPA 4J9UE 1T0TV 3EPIA 3CIMA 3VVUA 2KI2A 2CPDA 4BS2A 3DI6B 4X84A 1PIEA 1OY6A 2ZM6J 3N01A 4CM0A 2WOMA 1FRHA 2QLBB 3ZTSA 1M0SA 4DPWA 1RWMB 2Y1RI 2NSBA 4FXWA 2OUGA 2K7KA 4C6AA 2QLWA 2GGPA 3C14A 4EU0A 5J2PA 3N0VA 2CZVC 1YRUA 3QSYB 3M8PA 3M6VA 2EG2A 1VHIA 1WDTA 3FUYA 3J80U 3TA1A 4BLGA 1J5EJ 1C4AA 1X5TA 5LM7E 5IWAF 5KFOA 1JLQA 2CQCA 4ZP7A 4EZ6A 4UT4A 2RRNA 3NGUA 4LR9A 4ICLB 1HR0F 2Y8WA 4AYBD 1HBUA 1TKTB 1G3OA 4L74A 4WFYA 4Y65A 3R27A 3QT5A 1TL1A 2IA0A 3R5JB 3S6EA 3A8JA 2JC1A 4DEZA 1GMVA 4CH0S 1S9FA 1RWNB 1WKLA 4LFCJ 1S1UA 1S0NA 3OW2R 2C3OA 3RUBL 2NXUA 2EC2A 2BEFA 2MY7A 1A9NB 4CO4A 1T3NA 1YDLA 3HT3A 5M2UA 1PJ7A 2XNQA 4YEAA 4KV8B 1OS5A 2PGCA 5E0OA 2ZM6F 1HHSA 3Q8RB 4BBYA 4NLTA 5LXRA 3R6LB 1DZ5A 3R5AA 5KG3A 3EWGA 4YS2A 2C3YA 3CCTA 2LDIA 5KFYA 5GAGI 3H7HB 2NUUG 2OO4A 2F1FA 1BD6A 2FHJA 1K0VA 4OZNA 4JV5J 3HD2A 3GE9A 1DY3A 1EP4A 3WIVA 1KC8T 1N6QB 1VK3A 1J5EF 4Y2AA 5C24B 2CZ4A 3IRWP 1Y9OA 4QIFA 4DFJA 2AEFA 3PW4A 2CJ9A 2QFIA 3IAS9 4ES2A 3BR8A 3OLAA 1HBNA 2ZDOA 4IRDA 4PZVA 2LA4A 1HHQA 4EBCA 1ICEB 1KLMB 4CLLA 1RWUA 2LMIA 3EGNA 4QOTA 4ED1A 3QFWA 1LXJA 2A1BA 3UDVA 3T5JA 2ZOMA 4I56A 2HLUA 1T95A 3D0HE 1U09A 1H7WA 2XMAA 2ZZNA 4LFCF 4CLUA 2H5IB 5B0FA 4UQTA 5A8WB 2I0XA 2YWGA 2LDYA 2XTJP 5FDLB 3KLEB 1FRXA 3MM5B 3J7YU 1U1NA 3CPWR 2HFZA 4C11A 1JKHA 2EI5A 1E6YA 4OZ0A 3SI8A 3UDEA 1S9EB 1HLWA 2GVZA 2XHCA 2WBRA 3EZ5A 4F2RA 4Z7CA 2XZWA 1VQNS 5CCLA 2Y1LB 2F9JA 4MFBB 4ZPVR 3KJQB 3KLVA 2RT3A 3IO1A 1M5HA 2ILZA 2D3O1 1R3NA 1Y0HA 4JYAJ 5F8LA 2UXCJ 4K0KJ 1X0PA 4WYLA 2HIYA 1CJVA 4JV5F 4MIWA 1WG4A 3P5TL 3KWMA 3G71S 2QL5B 3IC1A 3V81A 2CNOB 2W9AA 1S7HA 2OJ3A 3ZZRA 4P74A 2QE5A 4YP3A 2Q66A 1BQXA 1K8AT 1NAQA 5IC6B 2NZ4A 4U67Q 4H4OB 5CZVA 5KT2A 4YB5A 2IRUA 4USUA 1SJRA 1WNEA 3PFEA 1Y3KA 5DQGA 4TY8B 1R6VA 2LKZA 2AX1A 2XYGB 2MQQA 1RT4B 4LRAA 2DHSA 3Q8QB 1TV6A 3W61A 4ED7A 3BGRA 1AFIA 5LL6d 3AQOA 4M5NA 5D8HB 3ONQA 5ETPA 5KG6A 1BGXT 4ES3A 2J76E 4I7FB 4IR9A 3CO9A 3GSIA 2OSQA 3W5XA 4X65J 1NSKL 3Q8YA 3ICLA 1U47A 4CYUB 4OI6A 2C2EA 1UJ4A 1TL4A 3NGSA 3ZXWA 2DYAA 4O4GA 2HZAA 3GMGA 4JI0J 2A18A 4O44A 3LQVA 1FDBA 2CQ3A 2M88A 4V1Ak 5KFVA 3QGIA 5KFRA 4A8YA 2WBMA 3HI9A 4JYAF 3V6DB 2XEXA 2UXCF 1JWWA 4EGLA 3Q8UA 3IR6B 4CO3A 2BABA 3VZIA 3DM2B 3MAAB 2XO6A 4URSA 1ITPA 1RHUB 1RTDA 3NNCA 4RW7B 3TNVA 4QYRA 1VJQA 5CYJA 4DI6A 4UF4A 3PTWA 3PRDA 5HVGA 3C6TA 2VDHA 1HNZJ 2ZZTA 4I4BA 2XULA 1X9SA 2FVQA 3D67A 1L3UA 2JLFA 5KFGA 4JOUA 2BQ3A 1KTQA 5LMNJ 3BPDA 4JI6J 1RT1A 3PEHA 1PC5A 1HPZB 1D9FA 3L7PA 1X9MA 4PABA 1SC3B 5CYMA 3E51A 3UO0A 4X65F 5L1JA 1SJ4P 4CZCA 1KKHA 1U0HB 2B8QA 4DR3J 1D8ZA 2VG6B 4DL0C 3R2DJ 1GMUA 1M1HA 1IR2A 2AYMA 4JI0F 1C1BA 3CCSS 2E7WA 3G96A 4ILMA 4CLSA 4TQSA 3N79A 4RNHA 3FRYA 1RAGB 2P2CB 1LWEB 3NBPB 4R5PB 4Z7YA 2XY7A 2BM0A 4NMXA 1HQUB 3FKBA 3CCLS 1ZZNA 4O4RA 3T41A 1ZOTA 5F8IA 4M63A 4KGKA 5F0UA 2FZCB 2GJ2A 4WFAQ 5EX0A 1VISA 2JNJA 1QVGR 4B3SJ 1RADB 2XS5A 4CLWA 3KK3A 3AHPA 5HMXA 2IRYA 1SQFA 1HNZF 1P1TA 5KFXA 2NXNA 2U2FA 3C16B 2GV1A 3W9HA 1WF2A 4M5KA 2QX0A 3TAMA 5LMNF 4DHVA 4U95A 1C0UA 1RXOB 2ZUGA 2I9SA 1NMEB 3DMJB 1N36J 4MK7A 3PW5A 5JUMA 5L1KA 2XZTB 3G86A 2WK4A 4DR3F 1HNXJ 4A46A 3NXZA 4C8LA 2OEKA 2KN4A 4GVBB 3K17A 5THWA 3CJ0A 3HF5A 3T1HJ 2GQ2A 2G1DA 2APOA 4LSNA 3OFFA 4IYQA 1XC9A 4ZA1A 2VIHA 1VQ6S 2YX4A 5FIIA 2C2RA 3KXDA 4M5JA 3UI3A 3GIRA 1RAEB 3QRRA 4WK3A 1GMWA 1FRKA 1KRPA 3H2LA 2D74B 5F0WA 4B3SF 3G87A 4RUCA 2QJ3A 3SCLE 5HMYA 4DF4A 4Y34A 2FUG9 2JEIA 4HLBA 1YRTA 3H5SA 2Q79A 2PO4A 3PYEA 2EEYA 2AMCB 2PE8A 2V8HA 3QAEA 4WTOB 4RBVA 1GAOA 3MR5A 1N36F 2HWHA 5DJBA 1WI8A 2J9EA 5B0DA 2GZOA 5GAHI 5HI7A 2ZH9A 1I51B 2R42A 1QVFR 3NEKA 1NM2A 3PFOA 2FZGB 4P2SA 2MZSA 1HNXF 1FWLA 4I2PB 2XMMA 4DUZJ 1H98A 3KK1B 1FK9B 2V8GA 1RKIA 2DR7A 1VBYA 3T1HF 2IYGA 4IOCQ 3C6UA 4DSEA 4NZ6A 5J2NA 3H5XA 4JI7J 3TOQA 4Y28C 1EIYB 2GIRA 3P96A 4XK8C 2CPEA 3AD8C 1AXQA 4DR5F 2VODA 3QPIA 3ZO7A 3EX7B 1WC5A 3SBMA 2DNLA 1NKBA 4X62J 4W98A 4BCAA 2W9CA 4OIXA 2NLWA 1FDAA 4OV1A 3F0NA 4DWIA 3B78A 2MEWA 5LMUJ 3CGIA 1T8EA 2CZ9A 3I87A 2XYHB 3DDNA 3GYGA 3R5BA 1WHYA 2VL1A 3BKUA 2WB1D 2KTQA 2R7VA 2B8PA 2FLLA 4C0OC 4J9LA 2LXUA 4DV2J 1VQ5S 2LU1A 3M9MB 2HRYA 4LRCA 3MMCA 4J9RA 1Q86T 4OYXA 2PA8D 2VG5A 1EKSA 1REVB 4MYTA 2ACMA 1ZTTA 1WEYA 4IKAA 2WSEC 3H25A 5IXUA 2KL8A 1DQ9A 2AWZA 3ZTPA 1VGYA 1OYEA 2XMWA 4NYPA 2LYVA 4DUZF 3GTYX 3DLEB 4KH1B 5E7OB 1JLFB 4OYBA 2ZDPA 4JI7F 2GMJA 1NSQA 4DSLA 3DHXA 4PRFA 4FYVB 2B3TB 3D28A 2IJNA 3KTQA 1WC3A 2ROEA 1SL2A 4N8NA 2HVDA 2EWHA 3PR5B 2XSFA 3O44A 4X62F 1TL7A 2OPQA 3W8PA 3HVTA 2IBOA 2XM3A 2GMHA 4YR2A 4LBIA 2KT3A 3W2VB 1RABB 4GO7X 5LMUF 3P45B 1X5SA 2RU3A 4FNIA 4FPRA 4Z37A 1NB7A 1VS3A 4MIAA 3LUYA 3B4DA 5HP1A 2WONB 1OY8A 3GJSB 5BJRA 3BO4A 3BEGB 1YX2A 4DV2F 2DKOB 3HO1A 4AL7A 1RWOB 4I0WA 2PDAA 1M5OC 4ZCLA 2H54B 1TFWA 2JEGA 4L6V3 2GVDB 3IP0A 3CMAS 1KQGB 3IRXB 1NUEA 4FF4A 2LQ8A 1YSJA 4A8QA 1LWFA 1P6TA 1NK0A 2NUHA 4B3TJ 2QC3A 3VGUA 1JJCB 1NDPA 5KOXA 3S8SA 4Y2KA 1JXEA 2WRMA 3MEEA 3JB9k 2CJKA 2V8PA 1UA0A 1ZETA 3KJNB 4FYWB 4ZK7M 3JAMU 2NS1B 2Y0SD 3HJFA 3BZQA 1S0VA 2HVHA 4R8UA 5A8KB 1F5CA 2D3OR 3BN4A 2HBZB 4ZLJA 3MUTP 4Y0FA 5BYSA 5AE2A 1BQMB 3P8BB 5J2MB 8ATCB 1URNA 3GIKA 4YB1P 2M4MA 1BQNA 1RGVA 4PG4A 1R8AA 4Q2MA 4M94A 2FJDB 2PMHA 3RTVA 1N33J 3IA0A 1NRKA 3PNIA 3NAIA 2V8VA 1LXNA 2V4JA 1UMJA 4IO1A 4KPYA 4J9KA 3M30A 3F41A 1H2TZ 2BUNA 4KY3A 5LJ5Y 2PIIA 1YJWS 1HIYA 2CXEA 2HVZA 1MG7A 3PRVA 2YTCA 1T11A 4URQU 3HLUA 3VAFA 2FJWA 2VPZB 3OV7A 2CQIA 2XMTA 4OLOA 3GU0A 1TK8A 4Q45A 1VIXA 1NCLA 4B3TF 5CD4H 4OZ2A 1FERA 3PHEA 4X66J 4QWAA 4YY3J 3QATA 5KFIA 1IXKA 1R7IA 3TJAA 2HAFA 4XO0A 2PMZD 4KHRA 4K59A 2DNYA 2HRTA 2DR5A 2R7TA 5LSOA 5CZXA 2YVSA 4FZVA 2GO9A 4RWWA 3RBEA 4RUAA 1RT6B 3DNCA 5DLGA 5KFCA 4CNZA 1N33F 4HTIA 2P6SA 2YNIB 4OYAA 5F8JA 4UOFA 5E3QA 4ER8A 4R0JA 1LWCA 3TAPA 4C8ZA 1IKYB 2OPRA 1F1BB 2B7CB 3ILJA 2HQCA 4AUKA 3I96A 3G82B 1VIOA 3KHHA 2C2ZB 5AE3A 3IAM9 2K1RB 2M5YA 5A0YB 4JUZA 3E8OA 1YZ7A 2AEMA 2A6MA 2ZOFA 3THTA 2OEMA 1WTBA 2N82B 2IDEA 1U24A 6FD1A 2IVFB 5IOLA 1AW0A 2GHPA 1Y7PA 2UUAJ 3ZTOA 4ETXA 1F6TA 5L39A 4V19J 4X66F 3UDCA 5I42B 1IWAA 3MMAA 3NCRA 4YY3F 2HNYB 3NGDA 1KD1T 1RHMB 1KHWA 1TKXA 1SH2A 2ILYA 1IBMJ 4H54A 3DGVA 1QY7A 4XDDA 2I6WA 2DGTA 1IR1A 2IAJA 3W62A 3W8GA 1REGX 1Z1ZA 5DG9A 2ZJRQ 1C1CA 3H8YA 1F0XA 1FXLA 4OZ1A 3CMES 5L9XA 3OBIA 3POTA 1RHRB 3HHLA 2ZH4A 2AIRB 4AT1B 2C1EB 3EGWB 2V0NA 2O01C 4F4YA 2ASLA 2NQPA 4IG0A 4OJGA 3THPA 1R8HA 4E0DA 4NLYA 4DV6J 3Q22A 5D4PA 1IUJA 3I56S 3QGGA 1DTTB 2Z2ZA 1MWYA 1AZSB 3QO9B 2E9TA 2FHJD 4DSIA 4UQGA 2HK2A 3TZXA 4QIVA 3W9IA 2BM1A 3VQTA 2UUAF 4K7QA 1A0OB 2MDAA 1TQLA 4DR7J 2NYIA 5HAOA 2HHVA 1IKWA 3IG1B 1UVIA 1IBMF 3PJXA 1NBEB 3NOCA 1FFWB 4FVCA 1HL6A 4M95A 1RT5B 1FVSA 2QT7A 3MI7X 2EFGA 3GFXA 3HHDA 4B9UA 1WJ9A 3EZOA 2KFNA 2OD6A 1RYRA 2YQ3A 2VF3A 4U96A 3SEOA 4PG8A 1OMSA 5KT6A 4K4TA 4JI5J 3RG6A 1PAUB 1F5AA 2ZH2A 2VB6A 3HM9A 3RB6A 5U47A 2HHUA 4P52A 1J5OB 3TAQA 1UWAA 2CWXA 2G9OA 3OQ2A 3TWZA 2BE7D 3BDEA 2ASJA 3J7YI 3M2RA 4ZLLA 3EXCX 2EXUA 4MJKA 2MSSA 5LXYA 2B9EA 4XPCA 2XSJA 4DV6F 5DG7A 4ECYA 2V2VA 1T9VA 4C4WA 3MURP 4DV0J 2B5JB 1QAXA 4ZN3A 5D3GA 3KLFA 3LGHA 2BKNA 1S77D 5D4LA 1S0OA 1N0VC 3LGMA 4DR7F 1QE1A 2OMOA 4IUFA 4GMKA 4RPFA 1RTIB 2V2KA 2KVIA 2XLIA 3ZZZA 2H51B 4NLGA 4OI3A 4UUXA 3I0RB 4ZVOB 3B54A 1LWXA 4J37A 1SIZA 3RBZA 2BXJA 5ITHA 2ZE2A 4CDIA 2XHWA 2RQ4A 4CT8A 3QLHA 2KJWA 5E3PA 5HSPA 4WZMA 2FVSA 3M8QB 1F3VA 2EK6A 4ZVHA 5KFFA 2F4VJ 3CVKA 3TUZC 1JLGA 4K4YA 5K9FA 3IBCB 2VBXA 3JTOA 4Y2CA 3PYGA 2VA3A 2D41A 4UTGA 2C22A 4JI5F 3MMBA 2DH8A 2JEJA 2J9CA 2IVYA 3PIOQ 4KGMA 4YMEA 4YFUA 2MHEA 2X1BA 3HVRA 2DPIA 2E5GA 2DGVA 4A47A 3E3XA 2FVRA 1RLCL 3BYPA 1X4DA 3BBCA 3L9ZA 1UWBA 3MF5A 2AGQA 4EUVA 1U1QA 3DLGA 3DLBA 1HYSB 3D6FB 4P2FA 2OH2A 1ZM3A 4F0KA 3TRGA 1C2PA 1YGYA 3PKYA 4DV0F 1DAXA 3U1MA 4JBCA 3DLKB 1S7IA 1Q82T 1X31C 3GIIA 4RW4A 1CSJA 1R8BA 2VFRA 1UVNA 4RBTA 5KFZA 4K5SA 2BRKA 4XDCA 1NDKA 1XN9A 4OMFG 1JLEA 3HFKA 1HW8A 5KFAA 5C42A 3K7RA 4MKVA 2DR9A 3IWLA 2KZMA 3MM9B 3KHGA 2CPHA 2F4VF 3DHWC 1MWZA 3KDNA 4CLZA 4J9QA 5F8HA 2DPJA 4F3OA 4ECXA 2AZ1A 3DGPA 1WORA 3N4WA 1RWPB 2RHSB 2ZC3A 2J7KA 1N5YA 1DTQA 2KU7A 2DIUA 3UN3A 4CTAA 2EPIA 4OYZA 2CAJA 5IT4A 1HNIA 1S1XA 4FVMA 1FKOA 1EETB 3EGZA 4ES1A 1K0TA 1ACMB 2AF6A 2DB1A 2VBYA 2V68A 3DOLA 1C4CA 4ZVGA 3BKTA 1WOOA 2IA6A 2HYIB 2WHOA 3DDKA 3DRRB 2MKJA 2R7XA 3MGJA 3QJPA 4IFYA 1CJTA 3FNNA 2QZ8A 2RILA 4OHVA 3UCZP 2LLZA 1BE4A 1Y5LB 1KQSR 1QSSA 5G4DA 3J81Y 2JFDA 4OFZA 4J9SA 2FB0A 2EBEA 4ED5A 3GJQB 4ZVTB 1N5TA 4TYBA 3A3OB 2KRBA 4RW8B 3G6ES 1IM4A 1WOSA 1HFEL 2ZJQQ 4U9RA 1HBOB 3EXYA 1NEEA 3GV8B 1F3FA 3HVWA 3O3LA 3KLGA 2BJ7A 3H20A 1U1MA 4QU7A 4CLKA 1S59A 2EFOA 2VFUA 3ZZYA 2VA2A 3HHNB 3C15A 3D6TB 2DCLA 1UVMA 1AUSL 1RTHB 4JI8J 3UPFA 2DEJA 3KUGA 2MY8A 4A8MP 4N7TA 3CSKA 4ZVPB 1LV5A 4P7TA 3OXGA 3EYZA 2GAHC 3PVXA 2JFKA 1PYSB 3V5RA 3GG1A 4O3QA 4C97A 1ZAVA 5H1SV 2LQBA 1RCXB 2VQEJ 1Q8BA 1CJUB 3ISNC 3VWSA 3DRSA 1GMWD 3EDRB 5BYQA 3DOMA 7AT1B 3KLIA 2KM8B 1QSYA 4DX5A 1RUSA 3UN2A 4P2MA 2ADBA 4ILLA 4LFAJ 2CPYA 3I32A 3GJTB 4ZIVA 1MROA 2VHGA 2HBYB 3W64A 2I5JB 1QJHA 4WKYA 3UDLA 1G1XA 4ICLA 1X4AA 1T03B 3CJSA 4QIWD 3LP0B 1SQGA 3AJ2A 3ENQA 4HHJA 3WC2A 2EBGA 1FTRA 2RDJA 5BR8J 2DR8A 2HS0A 2J0XA 2NR0A 2RHQB 4DR2F 4JI8F 2MSTA 2CQ2A 1BWEA 3Q8SB 1HMVB 2UVUA 2B51A 3MCOA 1IJEB 3FSIA 3MPVA 4KV8A 2X1FA 2QL7B 1FJGJ 1QUPA 2IDLA 4CO2A 4JV2A 1S1VB 2ZUAA 1Z2LA 1WKKA 5EHHA 1SUQB 2HRUA 2W9BB 2VQEF 5G0RA 4I2QB 2YKMB 2N7YA 4USHA 4ECZA 2J6SA 5HQ8A 3JQJA 4UY8T 3OL8A 1RI7A 5E3RA 3D3CJ 3LA0A 5AXKA 2D7SA 4PXDA 4J9NA 4YHHF 1T9TA 1RT7B 5C24A 4LFAF 4I6WA 3AFGA 4DG1B 3KUHA 3BSOA 3QIPB 3KYLA 3NCQA 2EFQA 4G1PA 4TXSA 5C5JA 3LANA 2XG8A 5B0BA 3T9NA 2DRBA 1KLMA 2MHNA 2NYHA 4O0IA 4U8VA 1NK7A 3FQKA 2VC1A 2C3UA 1R0AA 3HVAA 5BR8F 2GGPB 3C14B 5J2PB 1YZ6A 1JNRB 3SDEA 5KT7A 2QYGA 1UTAA 1FI4A 1NHKL 3M8PB 4O3NA 4WJBA 1RAFB 5FDLA 2B9YA 3KLEA 3MM5A 3AAWB 2W7OA 2JWNA 2VH7A 4ED8A 3LAMA 2HEKA 4ZCIA 1FJGF 2BBEA 1Q7LB 3C8YA 3UW1A 4B3RJ 1XNRF 1P9YA 4KKOB 1NLKL 2DGWA 4B3OB 1R0BG 1JLAA 2ZH3A 2JDJA 3TUIC 1RTJA 4ZITA 4PPZA 3CJ8A 4DU7A 2P8IA 4YR3A 1CQNA 3PYFA 2W7AA 1MMLA 4LF4J 2H65B 4F7VA 4F02A 2CPXA 2YQ0A 2FHMA 2M52A 1S1UB 1OIAA 2RNEA 2R7QA 3PDNA 1FVQA 3OSPA 4QYZK 2VC0A 4F3MA 5J1PA 2QG9B 4MAKA 2ZHOA 1GX5A 4OYIA 2KFZA 3LH2S 2V9WA 2FJEB 3GG0A 4G1QB 3M8SA 4QPXA 3GONA 4HDHA 2HFVA 4X4QA 5D0GA 5HJXA 2YKPA 3DU5A 3AH6A 5ETKA 2UXDJ 2KO1A 4TN2A 3W5YA 3J7AN 4WP9A 3OLBA 3WDOA 4F4WA 5JVHQ 1L5UA 5GMEA 4UOHA 5CQGA 4I7FA 1SQEA 4PXBA 1EP4B 5IV4A 2OFHX 1ZZFA 4FYDA 5D78A 4CYUA 1F5BA 3JSMA 4B3RF 3B8HA 4HVZA 1B7YB 2DNHA 2RB7A 4ZLNA 4FBTA 1RTZA 2QLXA 5B0CA 1KQKA 1TU0B 2MKKA 2AT1B 4U8YA 3A8EA 4KJIA 3CD0A 4NZ7A 4WE1A 1QAJA 3O1LA 1GTHA 2XGQA 3ZZOA 4ED0A 4OHXA 2MLXA 4LF4F 3RRHA 3DM2A 1X9WA 2HHSA 2DXFA 4IH6A 4DOZA 5HL7Q 1G2EA 1W7WA 2ATCB 2MJUA 2CQGA 2B9WA 1DBDA 2HQIA 2HW3A 3Q23A 4C11B 4RW6B 1NKCA 1E6YB 3IFEA 1ELOA 3QT8A 2GVZB 1ZS6A 2BOAA 3NKYA 2W1BA 2FY1A 1WDDA 4OI0A 4LF9J 4AD6A 2XMUA 2V2ZA 4EO6A 4OJ3A 2W8KA 1EKRA 5KG4A 4W90B 1BHNA 2W24A 1MN9A 2PT0A 2R8HA 4OJHA 2UXDF 1FNOA 4QWBA 4K5RA 5GAHU 3H98A 1SKSA 2CPZA 2YWWA 1CJVB 2YWEA 4KT0C 1YBUA 4F36A 2MKIA 3OTDA 1U0HA 3PG9A 3OTBA 4NXNJ 3V81B 3JSRA 1Y11A 1PBUA 4QR2A 2EG1A 2VG6A 3UD3P 1SIWB 4BC9A 3CW2C 4CQ1A 3PIPQ 1J27A 3BGLA 4R25A 2W2OP 3AOCA 5L38A 2R2SA 1R31A 2GFFA 4JI1J 3MMJA 1I6JA 3JSBA 3HSJA 1FE4A 4XIUA 1KQFB 3OFEA 4ZHRA 1LWEA 3KKFA 3MEDB 3BGRB 1DQAA 3N6MA 2Y3YA 2HQ3A 2PFDA 2CG8A 3N6LA 4I67A 3HK2A 4ZDNA 3NOGA 5A76A 2E1RA 4A8WA 2GQCA 3DOKA 2BE9B 2CPIA 3ENVA 2J6UA 2E5JA 5IM0A 4LF9F 5T7LA 5H9FK 4O44B 3D4JA 3G2XA 3AJDA 1NZ8A 5GADI 3BH7B 3I9V9 3D1HA 1Y10A 2FHOB 2IM1A 1RISA 2DH7A 1NK8A 2VD3A 3FBBA 3R5DA 5DQIA 5KG0A 4M5GA 3MUVP 5J1NA 4NXNF 1NHVA 1EAYC 2PC6A 1T94A 3CCVS 4L75A 2IHR1 1Q81T 4FYXB 4KIAA 5CAAA 3HULA 4F2SA 2CDRB 1JMTA 2BKPA 4JI1F 4S0MA 1VBKA 3CJ2A 2HG4A 7FD1A 4UY85 3PRBA 3MR2A 3OL9A 5KAKA 1JLBB 3ADAC 3KDOA 3FVYA 2R3VA 1RT1B 4USVA 2XCAA 2R2RA 4BDPA 3MCSA 5CYMB 1HA1A 2LVWA 4FN5A 4NPOA 1XR7A 2EVZA 3CJQA 3CCZA 1H38A 1LW0A 1RSCA 1DQ8A 2ATLA 4GRSA 2W4CA 2QSFA 1S1TA 1VLYA 1V3SA 3BS9A 4OI4A 4X4RA 4FXVA 1FWKA 2ZC4A 4C3MA 3T5HA 3PKMA 4UZCA 2RIJA 1RAJA 4M5LA 2YX7A 2YWFA 1HW9A 5E5NA 5KTQA 5EN1A 3ZFVA 1WOPA 1KOOA 3M32B 4F67A 4CLPA 2I38A 4DL2A 4EEYA 3KK1A 2L48A 2LXIA 2UUTA 4IRCA 2OTJS 1PCAA 3D3BJ 4DPTA 5A6WA 3H90A 4MYUA 1NXIA 4MK9A 4NOHA 1VQMS 1VRUB 2AYGA 2ACYA 1YBAA 2CJQA 4USTA 2E7VA 9ATCB 2ALZA 1HQEB 2DXEA 4IG3B 1YJ9S 2CVEA 2OPSA 2Z2LA 3TAMB 4I68A 4ANEA 1LFWA 2YKQA 1C0UB 3TX0A 4NI2B 1H3DA 2JH3A 3H2VE 2FGOA 1VRTB 2RUSA 2DGOA 5AXNA 2YKNA 4JI2J 4RW9B 3Q2TC 2H5JB 2B6AA 1ZBTA 3IBFB 3JXOA 1RBAA 4WBFA 4PUOA 3B4MA 3DRPB 4DSJA 3IS9A 4LF7J 4DL3A 4PWDA 3CO0P 4F4XA 1VQKS 1G7CB 1REVA 1AYEA 1RDRA 4HI1A 4DR6J 5GMKa 3NGKA 4UZBA 4NASA 1NKEA 2KT5A 2Z30B 3QT6A 5D0HA 3PZPA 1RWXB 2AJ2A 3ET6B 1N5SA 1VRQC 2CQ0A 4QWCA 1VOMA 2I1RA 1RCOB 4C3KA 2M8HA 1JNZB 1X4GA 1GNKA 3AD7C 3W1YC 4K4SA 4TU8A 3CUNA 4Q2LA 1FJ7A 1X7VA 4RU9A 2KG1A 1VQLS 3QWUA 1APSA 3LPEA 3OVAA 1WI6A 2J5AA 2B4OA 4WFXA 5ETVA 1KN6A 3GSDA 1RT3B 2E1PA 3TVYA 1VJWA 2YBVA 5E33A 2RE1A 1UETA 1RJJA 4RNOA 3P3DA 4P6QA 1JQGA 3CDUA 5EUHA 4IOBA 3Q0AA 2FIUA 3W2VA 3BN7A 1RA6A 4JI2F 3EZUA 1S97A 2OHDA 1XWLA 3OTOJ 1N8RT 2QIFA 3OT9A 1LEOA 1DLOB 4LF7F 3C6UB 4DL7A 2NXJA 4DN9A 2BQRA 1H6KX 2UP1A 3IRXA 4DR6F 1FO1A 4QWEA 3QRQA 4C3LA 1U8SA 3MM6A 4KBIA 2UVWA 2W9CB 2HQDA 1WF1A 1ZM2A 1WF0A 3X3UA 4H4MB 1BQMA 2YNFA 1F9FA 5J2MA 1RAAB 4G6VB 5GAEU 1SL1A 4TVAB 1GH8A 2ZZMA 5IS2A 1UKUA 1Y5NB 1Q4RA 2J0QD 2KB2A 1NPKA 4PG5A 2VG5B 3ZTQA 1HI1A 4DFPA 1VQPS 4ZVEA 3V2UC 1WC6A 2DD8S 4USIA 4LREA 2KFYA 1AA1B 4WIIA 2D3UA 5F3ZA 4M1KA 3R6GB 4ZMMA 3S7RA 4G3IA 5LSLA 3NWGA 1GTEA 3MD1A 3OTOF 2XY6A 1XERA 3V4IB 2J9DA 3LW5C 2OEJA 5F8MA 2VBWA 2QFJA 4NX9A 4ALZA 3T5LA 1OY9A 2PEBA 4PWWA 1R89A 3EDQB 3HPOA 5KFMA 4NCAA 4WTYA 5ETTA 3JQKA 2OGUA 1RYSA 5LT5A 3BQ2A 3TX8A 4AXJA 2E1MC 4ZVFA 2K2PA 2V67A 4HACA 4J9OA 4I64A 2DGQA 2C42A 2E44A 2KKHA 3BO2A 4LFBJ 5DGBA 3G8TA 3HVTB 5HBMB 3U02A 3IR5B 1WSVA 1YBTA 3LWMA 2NPFA 1PJ6A 2R8KA 1Y3JA 2AGOA 1D1UA 4UOGA 3G6YA 4GO5X 1WKJA 5K8PA 1O5JA 4LSLB 3MHYA 2RJZA 7FDRA 1U6ZA 3OR2A 5KFEA 1S6QA 1UPMB 3G9CA 3D6HB 1IM6A 1SC1B 5E2QA 4JV0A 2R7UA 4I69A 2VPWB 4F0MA 1GFWB 5IQ6A 5F9LA 2G4BA 4FF2A 1LW2B 2ZD1B 1RA7A 3BJYA 5IZHA 1VI7A 4A48A 2Y1IA 5SUHA 1U26A 3CJKA 3D5MA 1FEHA 1IKYA 4MKAA 2IM0A 4PR6A 2J6TA 2ZBRA 3I5AA 3G82A 3BB5A 5IFMA 2GNKA 3EVMA 2K1RA 5A0YA 1J2VA 1Q5YA 4B9VA 5KFTA 1T05B 4YDDB 4YB6A 3VAGA 3X1LB 1SBRA 1BQNB 1XTZA 4L73A 3DYAA 3I5BA 3FQLA 3TEGA 2FY8A 4ATNA 2E9ZA 3K5OA 2RF2B 2HZCA 1Z2ZA 2Z0GA 3ZZPA 4LFBF 2Y0BB 4PKDB 5I42A 1WEXA 1YVFA 1U2FA 2HNYA 2AKWB 4DQSA 3BKFA 2MYFA 2V4JB 1UZHA 1JLCA 3A8KA 3MOZA 3M2VB 4NLRA 3TJ8A 2RH3A 3GZ7A 5HVFA 4ED4A 1TKDA 3K8VA 4RLEA 3HKWA 1U6FA 2ZWOA 1NNDA 1BXNA 3NLCA 4C8KA 1ZYQA 5HROA 3ISND 4KHPJ 2DNNA 2V6AA 3MM7A 3DDIA 1ROFA 3AOBA 5D6GA 4CO5A 4KQZA 2O67A 2QA4G 5EGYA 4F25A 2OPPB 3EICA 2QMXA 9RUBA 5KT3A 3RR7A 3RZAA 1DTTA 2AYEA 1U1RA 1AZSA 3DU6A 3NGTA 1M1KT 2BX6A 3RRGA 2YWHA 4RKUC 3FCVA 3I0SA 4KFBA 2QN6B 1NJZA 2OELA 1SVDA 1RB0A 2BANA 5B7WA 3I31A 2HHHJ 2B0GA 1TL3A 5CABA 2MB0B 3UVJB 4NCGB 1VBZA 3BGUA 3I82A 1Q16B 3CWJA 1W2IA 2ROPA 2KXFA 4RUHA 4WP8A 1N52B 3EPGA 1XR5A 4A8KA 3ZTRA 2Z2YB 4P75A 2CQBA 5J2QA 5T14A 1HI8A 3JYTA 2V34A 1S1WB 4ZPTR 1F60B 1WWHA 2K06A 2IIHA 4ZJLA 3UNYA 4KHPF 4EBDA 3KG4A 2OTLS 2WAQD 3EJMA 5BYRA 2YNHB 3QSIA 1JXLA 1U4BA 2IC3A 3ENAA 4MIBA 1U8WA 2JRSA 1QD1A 2XI2A 1DURA 3HFZB 1UEVA 3BQ0A 1CJKA 3RW7A 1T9UA 1CC7A 4EMDA 4ZS6A 1IWGA 4OL8A 3R97A 4DCOB 1JXVA 4Z2XA 3MZIA 2XLKA 1Y4ZB 1FXDA 3LTOA 4PQUB 2AX0A 3CB4A 3W5ZA 2B5JA 3GFYA 4FF3A 3H2UB 4NA1A 1RU1A 2N3OA 1C1CB 4DR4J 4QCLA 4HL9A 3ELHA 1JX4A 1FD2A 2HHHF 3PHTA 3POTB 5EX3A 3HHLB 1RP5A 1GEHA 2BYCA 3MDFA 2G0CA 1HWKA 3CD7A 1UP1A 1DARA 2GCFA 2ZBIA 1HWUA 3UCGA 2YX1A 1RT2B 5ETLA 5DDQC 2MQMA 3TVZA 3GFHA 2YNGA 3H5UA 4RJVA 3TZWA 1HHTP 2BOPA 4IR1A 3A3PB 3J7A1 3MECB 4Y00A 1VR6A 2VONA 3OR1B 2V9KA 3HX9A 2MMYA 5KG2A 1TMMA 3QIDA 2XGPA 1VYAA 2GJFA 4RO0A 3HXMA 4DV3J 2DXDA 4N47A 4IH5A 1IKWB 2G0IA 2H9ZA 2V8DA 4CWBA 2WW8A 3HKZD 2MQOA 3SSQA 3IR7B 3OFHA 5IT0A 1N4LA 2ASYA 2EKNA 2B43A 2FYXA 2PFFB 3T3FA 2VOOA 3OUYB 4F4KA 3R9LA 4DZ6A 4LUBA 1XMQJ 2ZH7A 1XBWA 4F8RA 2VPXB 3J7ZT 4DR4F 4DR5J 4CH7A 4B9SA 1H2UX 1O0PA 2X7IA 1O6XA 1FF2A 1WC4A 1RBOB 1VQ4S 2KXNB 2Y9HA 3RW6A 3M2RB 5B09A 4EZ9A 2HMIB 1NPRA 1UVJA 3BQ1A 5C2CA 3CD5A 4P9SA 2BACA 4KAIA 3T1YJ 1B0VA 3MFIA 3F73A 2F65A 2BVZA 1IQTA 1VQSA 3SV3A 3KNAA 3SCJE 4DPUA 5D3GB 8RUCA 4O3PA 3SFUA 3W65A 2BJ3A 3CC4S 3QQCD 3W2WA 4X4OA 1WC0A 4IH7A 1KDNA 1NSAA 1CULA 1HD0A 4X64J 4DV3F 1OQ6A 4PEOA 1WACA 1EQMA 5ETMA 2BMBA 4N77A 1YIJS 3DRRA 3FFIA 5IT9Y 2Y8YA 4B02A 1PBAA 4PG6A 1IKXA 4LVOP 4NEZA 4F4ZA 4E2FB 2IMWP 1TUWA 3BBBA 2XO7A 3SSRA 5KFJA 1S4EA 3FEXB 1XMQF 2JOQA 4ZVUB 5HVHA 2ASDA 1WUUA 3KG0A 2X3DA 3NMAA 1SXLA 3KLHA 2EFPA 3FBCA 4NYOA 4NLVA 2W01A 3IM8A 1B3TA 2IYIA 4LRBA 4EK2A 4KTQA 5EWEA 1VQ7S 2DHHA 3M9OB 4C9DA 1FJCA 1UWBB 3CDEA 4X4SA 2FQQB 3BPSP 3OTCA 1B99A 1UJ6A 3TJ9A 3T1YF 3FMBA 5B08A 3ITHB 1TTHB 4FS1A 2KM8C 2AV5A 1T9XA 2QL9B 3KG1A 1L3SA 4N41A 1H2VZ 2C2DA 1FE0A 1CQMA 1TAQA 4RW4B 2AP6A 3SQOP 2EFVA 2VZ9A 4X64F 5EDWA 1RTHA 1MSWD 3W66A 2W25A 1N56A 3N6NA 4K4VA 4NZ0A 5C42B 5H9FJ 1M90T 3OFGA 4PCQA 3BGFA 2M8DB 1VMBA 5T41A 1AROP 4FYYB 1KEKA 4V19X 1XEZA 2XMVA 2EFNA 4FNHA 2FVCA 1WC1A 2ZITA 1S6OA 5L9NA 4WXWA 4KR0B 1DTQB 3DRYA 4IOAQ 3D0IE 3PW7A 4CH1A 2UU9J 3D6MB 5JJBA 1HNIB 2IRXA 2FJXA 4KO0B 1Q0NA 1S1XB 1ZH5A 1FKOB 4WPAA 3DXBA 3AA8A 4ELTA 4ED3A 3DOLB 1RHQB 2DNZA 3GWCA 3AQPA 4CI0B 3PJ9A 1N54B 8AT1B 3D2WA 3TP2A 4OZ5A 1T03A 1FKPA 4AQYJ 2RDIA 2MZJA 3G4SS 1U1KA 4O0NA 2AYBA 3FRZA 4YUDA 2DJWA 4ECTA 4IFYB 3R5CA 3KHLA 2OFGX 2VKZG 1NPPA 1NZAA 1M5PC 1XMOF 2F8EX 1RE1B 1O8BA 1BWVA 3G6VA 4GKJJ 2J8SA 5DM6Q 1TVRA 1ZAWA 2V5HG 3LGNA 3HT0A 5FLXU 4ED6A 4NA3A 5C25A 3K89A 3NP5A 3PACA 2R7OA 2ZH6A 2HFSA 4ZPWR 5GVQA 2K3KA 1KFDA 1CLFA 5KFUA 3JTPA 2R8JA 4ENOA 3RJMB 3PCOB 4NEYA 4P10A 3T1AA 1FD8A 1MW7A 3W60A 5K8MA 5JVGQ 4ECUA 2R7RA 2W9BA 3RAXA 3NCPA 4FKYA 5L1LA 4I2QA 2YKMA 1S6PB 3TUPA 2BV3A 3K57A 2VICA 3H42A 3A1YG 2HAIA 4DPXA 2QV6A 2UU9F 3NL0A 1HBMB 5A8RB 1S9GA 1D0EA 1FNMA 3C15B 2QO3A 4L3NA 1FHTA 5IQQA 3K8WA 2UV8A 4WU2A 4DG1A 4FXDA 1I1GA 4RBUA 1OSDA 3WHIA 3KHRA 1V5VA 2Q3PA 1ZAXA 3FMWA 3OL6A 4AQYF 2POKA 3BH6B 4DX7A 2CQ4A 4MTPA 4DMZA 2CQDA 2OAUA 4IO9Q 2HNZA 1W25A 4LQ9A 3UCUP 1VC6A 5DZ7A 3DRSB 4DXLA 4GKJF 4XPEA 3DOMB 3B6BA 4DU8A 3KLIB 3MM8A 2Z58B 3ZNUA 5I3UA 1Q8IA 4CP5A 1R27B 3BBFA 2HWIA 3DN9A 4OJ1A 1C0TB 3KK2A 2UV8G 2NCKL 4GKKJ 3LOUA 2P9EA 4J5OA 1HWIA 1NSPA 3MEGA 1MROB 4LF5J 4UOCA 5I3QA 4KKOA 2ZBQA 3FBFA 5K14B 4B3OA 3H4BA 3SV4A 4NLPA 2CJAA 3FGVA 4NYZA 4TQRA 2R9LA 2JJ4D 5AE1A 1KP6A 4WFNQ 2NREA 2G2OA 3SCIE 3J7Z5 1P8GA 2RQCA 1WSRA 2KRRA 2JLEA 2IBKA 3RBXA 4W4MA 4P7VA 4L3KA 3NNHA 1T9YA 2R4FA 4EYHB 4Q8FA 3MAHA 3O5TB 2BJ9A 3RRKA 4KB7A 1X60A 2RRBA 4HH1A 3DLJA 4OX6A 2G13A 3EGVA 3I4PA 3N9UC 4DL6A 4DCPB 2RKIB 2W2MP 2J0WA 2W4PA 3HJVA 4G1QA 5GADU 4Q0BA 2KHCA 3US5A 3FDSA 5L46A 5G0RB 3T6BA 3E01B 1NU4A 2RRAA 4ID5A 3LP1A 1R0CB 2F63A 4HH0A 3D54A 1KONA 3K5MA 1MMNA 4K2JA 2DIVA 1SV5A 4Q8EA 3OXLA 2DNGA 2CNKB 2GC8A 4CO0A 1NH7A 3D0GE 2BA9A 4I1TA 2D69A 4GKKF 4K4ZA 4HT7A 4LF5F 2XS2A 2DRAA 2HQFA 1R8CA 4LIRA 4LRDA 4X4UA 1TELA 3WIUA 1KTVA 4TU9A 1VQ9S 5GAEI 2Q6CA 2L9DA 2QTWA 2QA1A 4QR0A 4DUYJ 5DO2A 3BR9A 2FJVA 3CE8A 4OYOA 3GR0A 3MCMA 2VASA 1R0AB 2PN6A 4AFFA 3R7BB 2W2QP 3IWNC 2VG7B 1YI2S 2RS2A 2V50A 4WXOA 1F2GA 3SDEB 1UFKA 3CT9A 5HLFA 1V5IB 2F7VA 2QLJB 2L9WA 6FDRA 3K59A 2W2PP 2C2MB 4CT9A 3RAQA 4RW6A 2XQCA 3J81U 3MPUB 1V9OA 3RAMA 2GS8A 1MN7A 1Y00A 3QFHA 5D77A 2YPZA 3DC2A 3TEHB 2ZHBA 3K5LA 4OZJA 4HKQA 2K8GA 1TMJA 1WG1A 2DO4A 4XAKA 1JLAB 2QSWA 2VUGA 1RTJB 3NMRA 2AHOB 2LU2A 5DDRC 4O23A 2RS8A 3I4HX 1OPZA 2UXBJ 4ZPAA 3CMQA 3WZ0A 5F3TA 4CIOA 3W63A 2VFSA 4C8YA 4NXMJ 4KRWA 3M4XA 5I4MA 4M5IA 4DUYF 2ZVIA 3GR1A 3VV2B 1KLNA 2WVCA 2P9CA 4ANCA 4M5DA 2FLPA 2YKOA 1K73T 3SQGA 1T7PA 4DJBA 1BMQB 3CF5Q 2QRRA 4C8OA 3MEDA 3MFHA 1FCAA 4YB7A 3OVBA 2LQ9A 2H1YA 5D0RA 2B7BB 2I2YA 3I9ZA 1TR0A 3OSNA 3K5PA 1KVKA 1PSDA 1D9DA 2FJAB 5M2RA 2MGZB 2QMWA 4HHHA 1NJIT 4F0HA 2A3JA 4DR1J 3KJVB 4F50A 2RVJA 2HHWA 2HBRB 3JSMB 2J7UA 3LF0A 5IV3A 1U0SA 3BGOP 2XZDB 2LFVA 5B0AA 1IQZA 4F3QA 1UEUA 3BM7A 4WE1B 3TZZA 1YJRA 2YY3A 1FRMA 4OQJA 1IKVA 4K0KF 1K1SA 2JEFA 1KBRA 3NS7B 3AOAA 3N5BA 3N28A 4DQIA 2UXBF 3VAJA 1DFDA 2D1CA 3BDPA 3HZGA 4IRKA 4QZVB 2KVQE 4K4XA 3MUMP 4KYZA 1X0FA 2HGNA 3WX4A 2CJXB 3CJ3A 5DG8A 5HMWA 4NXMF 4DQQA 4LF2A 3L4BC 1RACB 1BY9A 2KHDA 3TZYA 3G8SA 4DLEA 3CJTA 3J80Y 1TKZA 4RX6A 3C46A 3H59A 4N56A 4OZ3A 3S01A 1JLBA 2K3IA 3LP2A 4A8OA 4DQPA 3H4DA 3P5BP 1D9AA 2LQJA 4DFMA 4NWBA 2DHGA 1Q7YT 2V63A 4DR1F 3V6KA 3OPKA 4Y6IA 3MPWA 2VJUA 1PAEX 1TUGB 1JJ2R 5CXTA 3IN5A 4N76A 2VBZA 2WSFC 1TK0A 4BC7A 4FP9A 2E7XA 2IVMA 1UZDA 4J9PA 2AEJA 4WIQA 2COLA 3SCKE 2RD5C 4ZHRB 2DNKA 3GJRB 1NK5A 1Q79A 2Y1JA 1IBKJ 5CYQA 5J1EA 1G6BA 3M32A 1NDLA 3M2UB 1U1OA 2CA9A 4ECWA 3TI0A 1VK8A 2MLYA 2NPIA 2DY1A 1WHXA 1RQ0A 3DOKB 3H40A 1VRUA 2BDPA 1SPBP 2P5VA 1I3OB 1HQEA 4QIGA 1FDDA 2KH9A 3UD4P 2XMKA 4IG3A 5IM0B 5JMNA 1KWMA 3AB2B 5T7LB 4JI4J 2HNDB 5KOWA 2D3ZA 4ECQA 5K5MA 2BJ8A 5HO4A 1FFSB 4JI6F 4WYWA 3L7OA 5DS7A 1OYDA 3M6XA 4NI2A 4LF8J 5CCMA 4PYDA 1YG0A 1WELA 5ETSA 5AJ3J 2DNQA 1VRTA 3PW0A 2QMUB 1OSCA 4OX9J 1H7XA 2A6OA 3PW2A 2V4QA 2CNNB 4AE5A 4RW9A 2HFOA 3CDWA 3G8QA 3TA2A 1JIHA 2AGPA 5CHCB 3TQ1A 3HHEA 3DRPA 2VKRA 1NJXA 3LWLA 1E6VA 4WWSA 3EM1A 4KH0B 4WK1A 4URGA 5C7PA 4A8XA 4HTJA 2BJ1A 3WBZA 2DEIA 4KC5A 1IBKF 1MU2A 1B0PA 2XLJA 4ZPDA 3U1NA 4NL5A 5D15A 3ET6A 4D3HA 4IDKB 2BRLA 2RDDA 1YHQS 2KYZA 1V6HA 1N5QA 3M1VA 1HNVA 2LEBA 3QZ8A 3BSNA 3CCQS 3IM9A 1LW0B 1X4BA 3OHBA 1V3RA 3D66A 3CC7S 4ANDA 2HHTA 2L9NA 3GQCA 1S1TB 4G65A 1RT3A 4DS4A 4JI4F 2HPUA 4CLFA 3HDSA 3F56A 4DR2J 4I6AA 2DK2A 1Q8KA 3BYRA 4LF8F 1NJWA 2GIQA 1EB0A 1SJFA 5A2QU 1MNEA 5AJ3F 3C2PA 3MR7A 4ECRA 1FWPA 3DI6A 4OX9F 3NS6A 3RU0A 2ZJPQ 1VDHA 2CRLA 1OPIA 2L3MA 4TLRA 2J0SD 1Q78A 2EW9A 4E98A 3HSDA 3VAIA 1YJNS 1VC0A 2BE2B 2YQ1A 1H72C 1DLOA 1CEZA 3R5GA 3AT1B 4IQMA 5CD4A 2QEXS 4TYAA 5KG7A 2NZCA 5M2PA 4A8FA 3FK4A 1F9HA 2OPSB 2CPFA 4A8SA 4YHHJ 4C2MA 2CJBA 5DRKA 1SKRA 5LOQA 2MZQA 3K5NA 3I5CA 2UUWA 1U1PA 3Q2SC 3M6UA 4C98A 2FVPA 1SI9A 2AJQA 1D09B 2VDIA 2YKNB 2HS4A 1TKTA 2KG0A 2MXYA 4WU3A 4H4MA 5I3PA 1KR4A 1YTYA 4WKRA 2HVEA 2F5GA 1VC5A 1Q8LA 2JLGA 2B6AB 3DXSX 2BR0A 2ZH1A 4PUOB 1UVLA 2M3DA 3IS9B 4YN3B 2MKSA 4AL5A 3CNQP 3R8YA 3D68A 1IJFB 5DZ6A 4PWDB 1CS4B 1GK8A 1B0TA 4X4TA 2JL9A 3FSXA 3CEDA 4GC7A 1FXRA 5KT4A 1N32J 1UPPA 1XNRJ 3U7JA 4IFVB 3IGNA 3NY0A 5HJYA 2IM2A 2MZTA 1WHVA 3CCWA 2LCWA 1K9MT 5K20B 3V4IA 4NLUA 2VPYB 1PKUA 3Q86A 5ETRA 3LAKA 2PI5A 1N6QA 4QQBA 3ETOA 1YKWA 4Q43A 4WFZA 4MK8A 2ZFHA 2UZAA 1VCTA 5HQMA 4DX8H 5HBMA 3ULHA 3K58A 5KFBA 4I6YA 1QDUB 4ZVQB 2E1CA 2R8GA 4F4AA 5DDOC 2WOMB 3UFCX 4LSLA 4E8UA 2BZ2A 4Y2MA 3VCDA 2M2BA 2GIFA 2B4PA 3SSSA 1YRXA 5A8WA 1LW2A 2ZD1A 2ZWPA 3A8IA 3T5KA 5RUBA 4ZP6A 1N32F 1S9EA 5H9EK 2XMJA 1JLQB 5KFLA 3MM6B 3B82A 1GXUA 4MFBA 1DJ0A 2CQHA 4TNOA 4ZIWA 1X5PA 2FHKA 3P49B 5F8GA 1FTCA 1HBUB 1EHWA 4ECVA 5HMZA 1T05A 1PYOB 1GXTA 2YNFB 4LT6A 5ETQA 3EVOA 1TL1B 4CM2A 2ZH8A 4PYAA 2E9RX 1S49A 1IVZA 4EI2A 3CTRA 5KFDA 1UCNA 2HK3A 2RF2A 2ZNZA 2NSCA 4ED2A 1FRIA 4EFAC 2MKHA 2N4DA 4KE5A 1EX8A 4DSKA 3U1LA 1YJ7A 1RLDA 3BO3A 2HKEA 4DV1J 4H4OA 1HKAA 2M0GB 1A7GE 2C3MA 2C2KB 3FZ2A 1U48A 2D9OA 4TY8A 5DLFA 3M2VA 1MWQA 5KFKA 2CG4A 1RT4A 1CG2A 2WZ1A 1X4FA 2FPHX 3OHAA 3VAKA 4ETZA 4DSFA 2UUCJ 4WFBQ 2Z2MA 4J7CA 3THVA 2GJIA 3ILOA 4ZP9A 3T9ZA 3JTNA 1DRZA 2I8EA 5ETNA 2H3EB 3H5YA 3LALA 4HACB 1RAOA 2OPPA 4NCBA 1HBNB 1VFJA 3QWPA 2RAQA 3DLLQ 4K4WA 1KHVA 1WD6A 2GQQA 3VAMA 4U7CA 2G2YA 2B4UA 2B56A 1Q95G 3V6DA 4OZLA 2A2DA 1ZPVA 4QU6A 4IQXA 3OR2B 1S6QB 2JVRA 3FCHA 2XC9A 3OTEA 3VTIA 3MAAA 1VBXA 3ETMA 4DL4A 2ZEJA 4RW7A 1RWKB 4NLOA 5EWGA 2RSQA 2VV5A 1L3VA 4LBPA 5KFQA 3MOJB 3FEZA 1YJUA 3UVJA 4DV1F 2AU0A 2WW4A 2E1AA 1JKHB 1UW9A 4NCGA 4C0BA 3CJKB 4PQAA 2W7PA 1KVJA 4OV6A 2H4YB 3VGVA 2ALYB 4CRJA 3GLJA 2AJ1A 4GVLA 1JJHA 1U25A 3V4MA 4HDGA 2OKQA 1PJ5A 3V6HA 2HGLA 3HHLC 5AT1B 1S1WA 1NH8A 2UUCF 1HPZA 1VQOS 4J91A 3AD9C 3FJ2A 3GPAA 3DYAB 2YNHA 3ILLA 2IMOA 3PM9A 2DHAA 3GILA 4LJMA 2HHPA 1KNZA 2FD2A 1HI0P 2CDQA 3DRXA 2R2TA 2QGFB 5IC4B 2CPJA 2HHQA 4QBUA 3MD3A 1JLCB 1XQIA 2O66A 3QJLA 3G6XA 4PQUA 3PYDA 1YLXA 2MZ1A 3MCNA 3U27A 2CIMA 4U6PA 1VHFA 1B7FA 1TV6B 2GO8A 1XNQJ 3NBPA 4R5PA 3PO4A 1HQUA 4ZJOA 4M5HA 1Y5IB 3GYNA 3VGTA 2G2ZA 5HROB 3RYLA 1QUVA 2MLZA 3MM7B 3TO8A 1G4CA 3IGVA 2CJYB 1KOHA 2ZH5A 4N8OA 3ZZTA 4NA2A 5A6PA 2YH1A 3HSZA 2E66A 1EZZB 1LKZA 4MT1A 3IMQJ 2UUBJ 2F8HA 2WB4A 3C16A 1WTFA 3L7UA 4O4GB 2FJBB 1RT2A 3BF4A 4ITSA 2HHXA 3W9JA 4JV1A 1IBCB 1X8DA 3MWBA 4B9MA 2E5LJ 3DMJA 4OHYA 2A0FB 3DKDA 2X3GA 3MECA 4QJVA 1GT8A 4RL1A 3I0SB 3OR1A 4PWUA 4LF1A 4KFBB 1U2CA 2FC8A 3UNGC 2B9XA 2XWYA 2BANB 1AT1B 1O51A 1DHMA 2KXHA 1RTDB 3QJJA 3M05A 3OL7A 1TL3B 4GVBA 2V2QA 2J7WA 4OHZA 4U7UD 4X2BA 1U45A 4O3RA 1N0UA 4DV7J 2DH9A 1ULRA 2B4VA 3C6TB 3VF0B 2Q1LA 2JVOA 3ZZUA 1PO6A 3NGRA 5J2QB 2VFVA 3OUYA 4BHQA 1XNQF 2MQPA 1W2BR 3JYTB 2J9DE 3QMQA 2ROGA 5FLXY
chains in the Genus database with same CATH topology
2HIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIY A; 
#chains in the Genus database with same CATH topology
 3JAM Y;  2GA7 A;  4OX8 A;  4QIE A;  1SCJ B;  1K47 A;  1FKA F;  4WF9 Q;  3OVS A;  2IC3 B;  3SIP B;  4CNY A;  2Z4P A;  1CJK B;  1MMD A;  2QA2 A;  1U6B A;  2HMI A;  1QLN A;  2UUB F;  3FEY B;  2ZKU A;  3SFG A;  2O5D A;  4JB8 B;  1N48 A;  2QLF B;  1C1B B;  1WG5 A;  1YQH A;  2DCU B;  2MKY A;  4HI2 A;  4B9N A;  4QW9 A;  2E5L F;  3MEK A;  2C2N A;  4AL6 A;  3OXF A;  4MKB A;  2PMW A;  2DGU A;  1RKJ A;  4FPI A;  3ZZ0 A;  3CC2 S;  1TP7 A;  2DHX A;  2MQL A;  1NDC A;  4USK A;  3T6J A;  3GCX P;  4I2P A;  2MQ8 A;  5DM7 Q;  3EE3 A;  1S99 A;  4JI3 J;  4RNN A;  1FK9 A;  3IXQ A;  3QRP A;  2XBP A;  2AJ0 A;  2G1H A;  3NG8 A;  3KK3 B;  3NS5 A;  5HK4 A;  2OI2 A;  3EVW A;  4DV7 F;  3FSY A;  1GXL A;  2LA6 A;  4USM A;  4HR2 A;  1NJY A;  5LSR A;  4HYK A;  3ISZ A;  1K1Q A;  3WQP A;  1FFG B;  3GB0 A;  1T3O A;  4L72 B;  2PA3 A;  3CXC R;  2YNG B;  3CUL A;  5F8N A;  3PXG a;  1L3T A;  1LNQ A;  1YIT S;  4RUB A;  3M7V A;  5B0E A;  5F9N A;  3LO3 A;  2VFT A;  2YXL A;  3L3C A;  2Q6B A;  1FRJ A;  2J8A A;  2GW8 A;  1OJ4 A;  5D4O A;  3GCW P;  2DTJ A;  4U7U K;  5KFN A;  2AQ4 A;  4ZP8 A;  1I5O B;  4B17 A;  1UL3 A;  2FLO A;  4X4N A;  3ITH A;  2IJR A;  4J9V A;  4YR0 A;  2C3P A;  5MAO A;  4USW A;  4LSN B;  1RZM A;  4ZOS A;  4GC6 A;  2DIT A;  2R7S A;  1NK4 A;  2HIQ A;  4K50 A;  1A6L A;  1KVI A;  5E3A A;  1S76 D;  2HSE B;  2HGM A;  1X5O A;  3VGS A;  4A4J A;  2OP5 A;  1RK8 A;  2VQF J;  1VLO A;  3DLE A;  3AA9 A;  4JI3 F;  2O3D A;  5DGA A;  3GV5 B;  2V4R A;  2V94 A;  4KGZ B;  4DUT A;  1SC6 A;  3IWX A;  2BJE A;  3UWT A;  1UFL A;  2PD1 A;  2HVI A;  2ZBC A;  1JLF A;  3PV8 A;  3IBW A;  5GMD A;  1B70 B;  1R8P A;  5DET A;  3SZ2 A;  2A2C A;  5KG1 A;  2UVR A;  4TLQ A;  3PX6 A;  3JQM A;  4Q5V A;  2Z56 B;  3SMZ A;  5C2G A;  1F9E B;  1PIL A;  3PR4 A;  3O2I A;  3QAU A;  2R7W A;  2IY5 B;  4DZD A;  3HHK A;  1Q1K A;  4LQ3 A;  1H0H B;  3TA0 A;  4YQW A;  2HQG A;  4KO0 A;  3J81 j;  4PAA A;  3W2W B;  1HNW J;  1CUL B;  1GQE A;  1N88 A;  1LFP A;  4LMZ A;  4LF6 J;  2WON A;  1QSL A;  2L08 A;  1QAY A;  4PPD A;  3TR5 A;  3VQS A;  4W92 B;  4FBU A;  2QA4 S;  1WEZ A;  1QM9 A;  5J2N B;  3FFI B;  3FZB A;  6AT1 B;  2GVD A;  1VQ8 S;  2JHE A;  1IKX B;  3W7B A;  2CQ1 A;  3HFV A;  5GAG U;  3VZH A;  1S5Z A;  1LOU A;  1SB6 A;  2FDN A;  4NLQ A;  3O6Q A;  1SH0 A;  3C66 A;  4WCE Q;  3UR0 A;  2VQF F;  4RNM A;  2KT2 A;  2MKC A;  5FD1 A;  1V3Z A;  2YWK A;  4LBH A;  5FJ4 A;  1AFJ A;  3KLH B;  3R2C J;  2DRD A;  2DVI A;  3ENW A;  5A8K A;  4LVN P;  3TAN A;  2DGS A;  3CCE S;  4MKY A;  5MLC V;  2OIH A;  2MTL A;  1SJQ A;  4QW8 A;  1P9Q C;  4FS2 A;  1HAR A;  4KGX B;  4TKT A;  2CQP A;  3MMC B;  1S6P A;  3KUE A;  5CA5 A;  3MTJ A;  4JP8 A;  2HLT A;  2DNP A;  1YJV A;  2VU5 A;  2XCP A;  1HBM A;  5A8R A;  3Q83 A;  2V69 A;  1TL5 A;  2CKW A;  1ZA2 B;  1HNW F;  2GAG C;  1SJ1 A;  3JS9 A;  4LF6 F;  4QWD A;  3KNG A;  2CVI A;  2XWX A;  1SH3 A;  3VR1 A;  2PSZ A;  3ZC4 A;  2C2O B;  1FRL A;  4YDX A;  1R43 A;  3PEJ A;  4ZLP A;  1SKW A;  1NHU A;  2L41 A;  1Q5V A;  2JX2 A;  4FF1 A;  4NLW A;  1AUD A;  2VJV A;  2BQU A;  1UVK A;  1SJ3 P;  1PYT A;  4OYM A;  2CFX A;  1TL7 B;  2OPQ B;  3HP6 A;  1SC4 B;  1TFY A;  4Y2I A;  2DR6 A;  1HWL A;  1C0T A;  2ABY A;  1M5S A;  5HP1 B;  1FJE B;  3L95 X;  2PI4 A;  4LIW A;  3ILI A;  2LEA A;  5K14 A;  2CAD A;  3FC9 A;  4ELU A;  2FTR A;  4HHU A;  2QYC A;  4Q44 A;  1IN0 A;  1RT6 A;  2OML A;  1FKP B;  3FCW A;  3MAQ A;  2FZK B;  3CDB A;  3R1H A;  3AOD A;  2DT9 A;  3A12 A;  2YNI A;  2OLW A;  4LR7 A;  1QAI A;  1FT8 A;  1LWF B;  2EKY A;  2BW7 A;  3HD1 A;  4RWX A;  3Q8P B;  4O3O A;  4B3M J;  2Q43 A;  3MEE B;  1TVR B;  2EC0 A;  3TW0 A;  2MZR A;  2WCX A;  2W8L A;  3VHQ A;  2F9D A;  4OI2 A;  1NB2 A;  5C25 B;  4R8U B;  1RHJ B;  4ZPC A;  2N4C A;  4X4V A;  3NRB A;  2RKI A;  3RGI A;  3CIZ A;  1YJT A;  3KFW X;  1XJW B;  3T19 A;  4ID8 A;  3I6P A;  3E01 A;  5KFH A;  5KFW A;  1BLU A;  4DN0 A;  1EQ0 A;  2RQK A;  2C28 A;  1S9G B;  4RR5 A;  3P4U B;  3N5F A;  2P6T A;  3OD2 A;  3M30 B;  4RU2 A;  4ZVS B;  1P1L A;  1SKU B;  1UW4 A;  4DQR A;  1SL0 A;  2CNL B;  3CD6 S;  3VVT A;  1Z4U A;  2ADC A;  4NLX A;  2MJN A;  2GML A;  5F41 A;  3M8R A;  3K2Y A;  1I94 J;  1FA0 A;  2ZKT A;  3TVK A;  4KPC A;  3MR3 A;  2R2U A;  2F4F A;  2DNM A;  5IT9 U;  3C19 A;  2WVE A;  2HNZ B;  1S12 A;  4Q7A A;  4G1I A;  3TQE A;  2Z57 B;  3Q8V A;  2VG7 A;  3HSG A;  2WVD A;  4B3M F;  5CH7 B;  1K44 A;  2A10 A;  2RQM A;  3MM8 B;  2VOP A;  2OD4 A;  2JC0 A;  5I3U B;  3D9B A;  1N5V A;  3AB4 B;  2RML A;  2AJ4 A;  2ZOG A;  3KK2 B;  3QO9 A;  2F3J A;  2XB2 D;  4ZPB A;  4B9T A;  3MEG B;  3D1O A;  2AZ3 A;  4DLG A;  3NNA A;  1JJ4 A;  1ZPW X;  1OWX A;  1CC8 A;  1N34 J;  4AXI A;  2GHW A;  1XMB A;  2DNR A;  3D7S B;  1JB0 C;  4FDF A;  3IG1 A;  4ILR A;  3CDA A;  5EWF A;  2NXE A;  1ZM9 A;  1LWC B;  4N5S A;  2X1A A;  2OPR B;  1R6Y A;  1D8Y A;  1RT5 A;  3F44 A;  1IBL J;  3L09 A;  3BSC A;  1H74 A;  4MMO A;  1U49 A;  3AY0 A;  4ZVR B;  1TUV A;  4KHM A;  2AW0 A;  1GX6 A;  1I94 F;  2W2N P;  2CWK A;  3PJW A;  1KSP A;  2CYY A;  4Q0B B;  1J5O A;  1OO0 B;  5BXI A;  2ZHA A;  3KMS A;  5KFS A;  2X51 A;  2HS3 A;  5E3C A;  4ID5 B;  3LP1 B;  2WVB A;  3MMA B;  1T02 A;  1SV5 B;  1D3W A;  1ZA1 B;  3CJR A;  1FX2 A;  2MGZ A;  1TKX B;  2DNO A;  4LR8 A;  1RAI B;  2OSR A;  5HN0 A;  1NK6 A;  2IAJ B;  3KJV A;  1BUX A;  1AB8 A;  4M8L A;  4PXE A;  2MPU A;  2SXL A;  3KMQ A;  4TY9 A;  3WC0 A;  3QGH A;  4DFK A;  2N7C A;  3UR3 C;  1RBL A;  1N34 F;  5H9E J;  3DFE A;  5A2Q Y;  3QNW B;  1RTI A;  4J90 A;  3WX8 A;  2IM3 A;  1M5V C;  2H48 B;  4Y3C A;  4L76 A;  3I0R A;  2LP4 A;  4NE9 C;  1TK5 A;  5DDP C;  2U1A A;  5KG5 A;  1IBL F;  3DCA A;  4IG0 B;  3OJS A;  3QYY A;  2XS7 A;  1S79 A;  5ETO A;  3M8Q A;  4F26 A;  1RWV B;  4YOE A;  5HLF B;  4CLY A;  1X4C A;  1YK9 A;  5AXM A;  2FLN A;  4DBQ A;  1TAU A;  3NWR A;  3C3L A;  4QYZ J;  4C7Q A;  2N3L A;  4HEA 9;  5AXL A;  3M8Z A;  1U2R A;  5SZT A;  2WTF A;  4NRU A;  4DV4 J;  3AJ1 A;  3QGP A;  2WVF A;  3UD5 A;  4PXC A;  1HWJ A;  1HD1 A;  4OLP A;  4X4P A;  4LRF A;  1P27 B;  3MPD A;  5K8N A;  2M9K A;  3VAH A;  1F2H A;  3MPY A;  4ELV A;  2HWT A;  1S48 A;  1U02 A;  1RWW B;  4TU7 A;  2LEP A;  4F04 B;  1HYS A;  4DV5 J;  2YKA A;  5K8O A;  2WSC C;  4ZN1 A;  1T9W A;  2F8M A;  4DDF A;  3DLK A;  1EJ7 L;  4K8R A;  4ECS A;  2EK1 A;  4DF8 A;  4WZQ A;  2X1G A;  2FGC A;  2AD9 A;  4EBE A;  3RBD A;  1B4S A;  1S6U A;  1MLA A;  1BC6 A;  4LSZ B;  5HAT A;  4M5D B;  1PGZ A;  1CVJ A;  4ERD A;  2DIS A;  2ZVS A;  2XNR A;  2H5E A;  3SQG B;  5D4N A;  3W3S A;  3S1T A;  4J9M A;  3CCJ S;  1M1G A;  2E5I A;  1FX4 A;  1UEK A;  3MM9 A;  1JK9 B;  3M2U A;  4PG7 A;  4NRT A;  1LK5 A;  3DLH A;  4R0E A;  3Q24 A;  2XSJ B;  1ZM4 A;  3HMJ G;  1UA1 A;  3Q89 A;  4FKX A;  3BRE A;  2E5H A;  1XR6 A;  2GX8 A;  1XIQ A;  4ZKA A;  4BWM A;  3P6Y C;  4K4U A;  2YH0 A;  2GHV C;  1PG5 B;  2IPO B;  2RUG A;  3FBE A;  3KLF B;  5D0E A;  2HBQ B;  3PX4 A;  4OHW A;  1TZ0 A;  3I55 S;  4CLT A;  5LJ3 Y;  2HND A;  4DV4 F;  3GIM A;  1NO8 A;  1EET A;  1QE1 B;  3O8W A;  1EAR A;  2H4W B;  1Q53 A;  5B0G A;  1YWX A;  1IKV B;  2KJV A;  4UW2 A;  4CO1 A;  2KZZ A;  4EYI B;  3MXH P;  5L1I A;  2JSX A;  2UVV A;  1IR0 A;  2ZE2 B;  4DV5 F;  3BSA A;  3QLH B;  3R1L A;  2D9P A;  3VAL A;  1S10 A;  2XYP B;  1S72 S;  1B64 A;  2BKO A;  2DGX A;  4RZR A;  1JLG B;  2XY5 A;  1CBK A;  4DX6 A;  3MR6 A;  3NAH A;  4K2X A;  2ZBP A;  3SXL A;  3AXK A;  3SYZ A;  3HHL D;  3HCX A;  1LQ9 A;  3BV8 A;  4CCH A;  2E29 A;  3MMB B;  1UFW A;  1TKZ B;  3OJU A;  2LQ5 A;  5JXS A;  3M6W A;  1RHK B;  4M5M A;  3K0J A;  2RU9 A;  1S0M A;  3LP2 B;  4RW8 A;  4EWT A;  3CCR S;  4MH8 A;  4IDK A;  3RB4 A;  3RB3 A;  1PC4 A;  1KS2 A;  3V6J A;  3GP9 A;  1NK9 A;  3HZE A;  1URR A;  3CJ4 A;  4UUW A;  4DL5 A;  3CCM S;  1HBO A;  4C8M A;  3DLG B;  4C48 A;  1ZTW A;  3ZNJ 1;  2LEC A;  3A13 A;  3EUN A;  4DS5 A;  3GV7 B;  3R3T A;  4ZCM A;  3M8W A;  4RNF A;  2XI3 A;  3PY8 A;  1M5K C;  1FDN A;  1VQY A;  1W26 A;  4B08 A;  4OYW A;  1XMO J;  2M7S A;  1QTN B;  3UQS A;  3QZ7 A;  3R7N B;  4QR1 A;  3A4T A;  2KDO A;  4P73 A;  4NML A;  1RAH B;  4ZJQ A;  3E2E A;  1JLE B;  2HFN A;  3CJ5 A;  4XTT A;  3RB0 A;  2G0J A;  3MTK A;  4OX7 A;  5CYQ B;  5J1E B;  5L8R C;  1UJ5 A;  4DPY A;  1KFS A;  4USJ C;  3EMT A;  2Z8Q A;  3M9N B;  2IFX A;  5HAN A;  1S57 A;  4D3G A;  3QBC A;  4B9L A;  4H4K C;  3DGP B;  2BE2 A;  1QTM A;  2K7J A;  2M70 A;  5ADZ A;  2HUR A;  1CJU A;  1FEE A;  1N5Y B;  4NLD A;  2W4D A;  2BJD A;  2MQN A;  4CTA B;  3UN5 A;  3JSY A;  3CCU S;  2DY9 A;  1X4E A;  4OI1 A;  5KFP A;  1L3K A;  2LXF A;  2YPY A;  4KSE B;  2I5J A;  3PX0 A;  4WP3 A;  1H73 A;  2JZ5 A;  1XK8 A;  3TYT A;  4DCJ B;  2AJF E;  3M8Y A;  3KJF B;  2KYX A;  3LP0 A;  1UAW A;  3GFZ A;  4P71 A;  1CJT B;  2FC9 A;  3TAR A;  1LK7 A;  3PO5 A;  1HQ2 A;  4P2X A;  5DQH A;  4BWJ A;  1U1L A;  3LPY A;  2F40 A;  5HQL A;  1E6V B;  1CS4 A;  4H4K A;  4QPT A;  1CPZ A;  2DBB A;  1FNX H;  4NLS A;  3RR8 A;  4DPO A;  1FES A;  4O3S A;  3GIJ A;  1HMV A;  2IJF A;  1S4F A;  1X4H A;  1MU2 B;  4C8N A;  3GYX B;  5IWA J;  3QT7 A;  2CUY A;  2DO0 A;  1S1V A;  4IFV A;  2HFU A;  3TUJ C;  3M1V B;  2P9G A;  5E41 A;  3A3N B;  3KOA A;  1HNV B;  4KGV B;  1OQ3 A;  2ZNY A;  1SUQ A;  2BW2 A;  1HR0 J;  4EO8 A;  2ERR A;  3KLG B;  3H0P A;  4HT5 A;  4C0H A;  2PEH A;  1U7L A;  2R8I A;  2HZV A;  3UE2 A;  4P72 A;  2O1P A;  3R7S B;  3AXM A;  4OYP A;  1WHW A;  1RU2 A;  2NXC A;  1RT7 A;  4ZCK A;  3D1Q A;  5KT5 A;  3QIP A;  4J9U E;  1T0T V;  3EPI A;  3CIM A;  3VVU A;  2KI2 A;  2CPD A;  4BS2 A;  3DI6 B;  4X84 A;  1PIE A;  1OY6 A;  2ZM6 J;  3N01 A;  4CM0 A;  2WOM A;  1FRH A;  2QLB B;  3ZTS A;  1M0S A;  4DPW A;  1RWM B;  2Y1R I;  2NSB A;  4FXW A;  2OUG A;  2K7K A;  4C6A A;  2QLW A;  2GGP A;  3C14 A;  4EU0 A;  5J2P A;  3N0V A;  2CZV C;  1YRU A;  3QSY B;  3M8P A;  3M6V A;  2EG2 A;  1VHI A;  1WDT A;  3FUY A;  3J80 U;  3TA1 A;  4BLG A;  1J5E J;  1C4A A;  1X5T A;  5LM7 E;  5IWA F;  5KFO A;  1JLQ A;  2CQC A;  4ZP7 A;  4EZ6 A;  4UT4 A;  2RRN A;  3NGU A;  4LR9 A;  4ICL B;  1HR0 F;  2Y8W A;  4AYB D;  1HBU A;  1TKT B;  1G3O A;  4L74 A;  4WFY A;  4Y65 A;  3R27 A;  3QT5 A;  1TL1 A;  2IA0 A;  3R5J B;  3S6E A;  3A8J A;  2JC1 A;  4DEZ A;  1GMV A;  4CH0 S;  1S9F A;  1RWN B;  1WKL A;  4LFC J;  1S1U A;  1S0N A;  3OW2 R;  2C3O A;  3RUB L;  2NXU A;  2EC2 A;  2BEF A;  2MY7 A;  1A9N B;  4CO4 A;  1T3N A;  1YDL A;  3HT3 A;  5M2U A;  1PJ7 A;  2XNQ A;  4YEA A;  4KV8 B;  1OS5 A;  2PGC A;  5E0O A;  2ZM6 F;  1HHS A;  3Q8R B;  4BBY A;  4NLT A;  5LXR A;  3R6L B;  1DZ5 A;  3R5A A;  5KG3 A;  3EWG A;  4YS2 A;  2C3Y A;  3CCT A;  2LDI A;  5KFY A;  5GAG I;  3H7H B;  2NUU G;  2OO4 A;  2F1F A;  1BD6 A;  2FHJ A;  1K0V A;  4OZN A;  4JV5 J;  3HD2 A;  3GE9 A;  1DY3 A;  1EP4 A;  3WIV A;  1KC8 T;  1N6Q B;  1VK3 A;  1J5E F;  4Y2A A;  5C24 B;  2CZ4 A;  3IRW P;  1Y9O A;  4QIF A;  4DFJ A;  2AEF A;  3PW4 A;  2CJ9 A;  2QFI A;  3IAS 9;  4ES2 A;  3BR8 A;  3OLA A;  1HBN A;  2ZDO A;  4IRD A;  4PZV A;  2LA4 A;  1HHQ A;  4EBC A;  1ICE B;  1KLM B;  4CLL A;  1RWU A;  2LMI A;  3EGN A;  4QOT A;  4ED1 A;  3QFW A;  1LXJ A;  2A1B A;  3UDV A;  3T5J A;  2ZOM A;  4I56 A;  2HLU A;  1T95 A;  3D0H E;  1U09 A;  1H7W A;  2XMA A;  2ZZN A;  4LFC F;  4CLU A;  2H5I B;  5B0F A;  4UQT A;  5A8W B;  2I0X A;  2YWG A;  2LDY A;  2XTJ P;  5FDL B;  3KLE B;  1FRX A;  3MM5 B;  3J7Y U;  1U1N A;  3CPW R;  2HFZ A;  4C11 A;  1JKH A;  2EI5 A;  1E6Y A;  4OZ0 A;  3SI8 A;  3UDE A;  1S9E B;  1HLW A;  2GVZ A;  2XHC A;  2WBR A;  3EZ5 A;  4F2R A;  4Z7C A;  2XZW A;  1VQN S;  5CCL A;  2Y1L B;  2F9J A;  4MFB B;  4ZPV R;  3KJQ B;  3KLV A;  2RT3 A;  3IO1 A;  1M5H A;  2ILZ A;  2D3O 1;  1R3N A;  1Y0H A;  4JYA J;  5F8L A;  2UXC J;  4K0K J;  1X0P A;  4WYL A;  2HIY A;  1CJV A;  4JV5 F;  4MIW A;  1WG4 A;  3P5T L;  3KWM A;  3G71 S;  2QL5 B;  3IC1 A;  3V81 A;  2CNO B;  2W9A A;  1S7H A;  2OJ3 A;  3ZZR A;  4P74 A;  2QE5 A;  4YP3 A;  2Q66 A;  1BQX A;  1K8A T;  1NAQ A;  5IC6 B;  2NZ4 A;  4U67 Q;  4H4O B;  5CZV A;  5KT2 A;  4YB5 A;  2IRU A;  4USU A;  1SJR A;  1WNE A;  3PFE A;  1Y3K A;  5DQG A;  4TY8 B;  1R6V A;  2LKZ A;  2AX1 A;  2XYG B;  2MQQ A;  1RT4 B;  4LRA A;  2DHS A;  3Q8Q B;  1TV6 A;  3W61 A;  4ED7 A;  3BGR A;  1AFI A;  5LL6 d;  3AQO A;  4M5N A;  5D8H B;  3ONQ A;  5ETP A;  5KG6 A;  1BGX T;  4ES3 A;  2J76 E;  4I7F B;  4IR9 A;  3CO9 A;  3GSI A;  2OSQ A;  3W5X A;  4X65 J;  1NSK L;  3Q8Y A;  3ICL A;  1U47 A;  4CYU B;  4OI6 A;  2C2E A;  1UJ4 A;  1TL4 A;  3NGS A;  3ZXW A;  2DYA A;  4O4G A;  2HZA A;  3GMG A;  4JI0 J;  2A18 A;  4O44 A;  3LQV A;  1FDB A;  2CQ3 A;  2M88 A;  4V1A k;  5KFV A;  3QGI A;  5KFR A;  4A8Y A;  2WBM A;  3HI9 A;  4JYA F;  3V6D B;  2XEX A;  2UXC F;  1JWW A;  4EGL A;  3Q8U A;  3IR6 B;  4CO3 A;  2BAB A;  3VZI A;  3DM2 B;  3MAA B;  2XO6 A;  4URS A;  1ITP A;  1RHU B;  1RTD A;  3NNC A;  4RW7 B;  3TNV A;  4QYR A;  1VJQ A;  5CYJ A;  4DI6 A;  4UF4 A;  3PTW A;  3PRD A;  5HVG A;  3C6T A;  2VDH A;  1HNZ J;  2ZZT A;  4I4B A;  2XUL A;  1X9S A;  2FVQ A;  3D67 A;  1L3U A;  2JLF A;  5KFG A;  4JOU A;  2BQ3 A;  1KTQ A;  5LMN J;  3BPD A;  4JI6 J;  1RT1 A;  3PEH A;  1PC5 A;  1HPZ B;  1D9F A;  3L7P A;  1X9M A;  4PAB A;  1SC3 B;  5CYM A;  3E51 A;  3UO0 A;  4X65 F;  5L1J A;  1SJ4 P;  4CZC A;  1KKH A;  1U0H B;  2B8Q A;  4DR3 J;  1D8Z A;  2VG6 B;  4DL0 C;  3R2D J;  1GMU A;  1M1H A;  1IR2 A;  2AYM A;  4JI0 F;  1C1B A;  3CCS S;  2E7W A;  3G96 A;  4ILM A;  4CLS A;  4TQS A;  3N79 A;  4RNH A;  3FRY A;  1RAG B;  2P2C B;  1LWE B;  3NBP B;  4R5P B;  4Z7Y A;  2XY7 A;  2BM0 A;  4NMX A;  1HQU B;  3FKB A;  3CCL S;  1ZZN A;  4O4R A;  3T41 A;  1ZOT A;  5F8I A;  4M63 A;  4KGK A;  5F0U A;  2FZC B;  2GJ2 A;  4WFA Q;  5EX0 A;  1VIS A;  2JNJ A;  1QVG R;  4B3S J;  1RAD B;  2XS5 A;  4CLW A;  3KK3 A;  3AHP A;  5HMX A;  2IRY A;  1SQF A;  1HNZ F;  1P1T A;  5KFX A;  2NXN A;  2U2F A;  3C16 B;  2GV1 A;  3W9H A;  1WF2 A;  4M5K A;  2QX0 A;  3TAM A;  5LMN F;  4DHV A;  4U95 A;  1C0U A;  1RXO B;  2ZUG A;  2I9S A;  1NME B;  3DMJ B;  1N36 J;  4MK7 A;  3PW5 A;  5JUM A;  5L1K A;  2XZT B;  3G86 A;  2WK4 A;  4DR3 F;  1HNX J;  4A46 A;  3NXZ A;  4C8L A;  2OEK A;  2KN4 A;  4GVB B;  3K17 A;  5THW A;  3CJ0 A;  3HF5 A;  3T1H J;  2GQ2 A;  2G1D A;  2APO A;  4LSN A;  3OFF A;  4IYQ A;  1XC9 A;  4ZA1 A;  2VIH A;  1VQ6 S;  2YX4 A;  5FII A;  2C2R A;  3KXD A;  4M5J A;  3UI3 A;  3GIR A;  1RAE B;  3QRR A;  4WK3 A;  1GMW A;  1FRK A;  1KRP A;  3H2L A;  2D74 B;  5F0W A;  4B3S F;  3G87 A;  4RUC A;  2QJ3 A;  3SCL E;  5HMY A;  4DF4 A;  4Y34 A;  2FUG 9;  2JEI A;  4HLB A;  1YRT A;  3H5S A;  2Q79 A;  2PO4 A;  3PYE A;  2EEY A;  2AMC B;  2PE8 A;  2V8H A;  3QAE A;  4WTO B;  4RBV A;  1GAO A;  3MR5 A;  1N36 F;  2HWH A;  5DJB A;  1WI8 A;  2J9E A;  5B0D A;  2GZO A;  5GAH I;  5HI7 A;  2ZH9 A;  1I51 B;  2R42 A;  1QVF R;  3NEK A;  1NM2 A;  3PFO A;  2FZG B;  4P2S A;  2MZS A;  1HNX F;  1FWL A;  4I2P B;  2XMM A;  4DUZ J;  1H98 A;  3KK1 B;  1FK9 B;  2V8G A;  1RKI A;  2DR7 A;  1VBY A;  3T1H F;  2IYG A;  4IOC Q;  3C6U A;  4DSE A;  4NZ6 A;  5J2N A;  3H5X A;  4JI7 J;  3TOQ A;  4Y28 C;  1EIY B;  2GIR A;  3P96 A;  4XK8 C;  2CPE A;  3AD8 C;  1AXQ A;  4DR5 F;  2VOD A;  3QPI A;  3ZO7 A;  3EX7 B;  1WC5 A;  3SBM A;  2DNL A;  1NKB A;  4X62 J;  4W98 A;  4BCA A;  2W9C A;  4OIX A;  2NLW A;  1FDA A;  4OV1 A;  3F0N A;  4DWI A;  3B78 A;  2MEW A;  5LMU J;  3CGI A;  1T8E A;  2CZ9 A;  3I87 A;  2XYH B;  3DDN A;  3GYG A;  3R5B A;  1WHY A;  2VL1 A;  3BKU A;  2WB1 D;  2KTQ A;  2R7V A;  2B8P A;  2FLL A;  4C0O C;  4J9L A;  2LXU A;  4DV2 J;  1VQ5 S;  2LU1 A;  3M9M B;  2HRY A;  4LRC A;  3MMC A;  4J9R A;  1Q86 T;  4OYX A;  2PA8 D;  2VG5 A;  1EKS A;  1REV B;  4MYT A;  2ACM A;  1ZTT A;  1WEY A;  4IKA A;  2WSE C;  3H25 A;  5IXU A;  2KL8 A;  1DQ9 A;  2AWZ A;  3ZTP A;  1VGY A;  1OYE A;  2XMW A;  4NYP A;  2LYV A;  4DUZ F;  3GTY X;  3DLE B;  4KH1 B;  5E7O B;  1JLF B;  4OYB A;  2ZDP A;  4JI7 F;  2GMJ A;  1NSQ A;  4DSL A;  3DHX A;  4PRF A;  4FYV B;  2B3T B;  3D28 A;  2IJN A;  3KTQ A;  1WC3 A;  2ROE A;  1SL2 A;  4N8N A;  2HVD A;  2EWH A;  3PR5 B;  2XSF A;  3O44 A;  4X62 F;  1TL7 A;  2OPQ A;  3W8P A;  3HVT A;  2IBO A;  2XM3 A;  2GMH A;  4YR2 A;  4LBI A;  2KT3 A;  3W2V B;  1RAB B;  4GO7 X;  5LMU F;  3P45 B;  1X5S A;  2RU3 A;  4FNI A;  4FPR A;  4Z37 A;  1NB7 A;  1VS3 A;  4MIA A;  3LUY A;  3B4D A;  5HP1 A;  2WON B;  1OY8 A;  3GJS B;  5BJR A;  3BO4 A;  3BEG B;  1YX2 A;  4DV2 F;  2DKO B;  3HO1 A;  4AL7 A;  1RWO B;  4I0W A;  2PDA A;  1M5O C;  4ZCL A;  2H54 B;  1TFW A;  2JEG A;  4L6V 3;  2GVD B;  3IP0 A;  3CMA S;  1KQG B;  3IRX B;  1NUE A;  4FF4 A;  2LQ8 A;  1YSJ A;  4A8Q A;  1LWF A;  1P6T A;  1NK0 A;  2NUH A;  4B3T J;  2QC3 A;  3VGU A;  1JJC B;  1NDP A;  5KOX A;  3S8S A;  4Y2K A;  1JXE A;  2WRM A;  3MEE A;  3JB9 k;  2CJK A;  2V8P A;  1UA0 A;  1ZET A;  3KJN B;  4FYW B;  4ZK7 M;  3JAM U;  2NS1 B;  2Y0S D;  3HJF A;  3BZQ A;  1S0V A;  2HVH A;  4R8U A;  5A8K B;  1F5C A;  2D3O R;  3BN4 A;  2HBZ B;  4ZLJ A;  3MUT P;  4Y0F A;  5BYS A;  5AE2 A;  1BQM B;  3P8B B;  5J2M B;  8ATC B;  1URN A;  3GIK A;  4YB1 P;  2M4M A;  1BQN A;  1RGV A;  4PG4 A;  1R8A A;  4Q2M A;  4M94 A;  2FJD B;  2PMH A;  3RTV A;  1N33 J;  3IA0 A;  1NRK A;  3PNI A;  3NAI A;  2V8V A;  1LXN A;  2V4J A;  1UMJ A;  4IO1 A;  4KPY A;  4J9K A;  3M30 A;  3F41 A;  1H2T Z;  2BUN A;  4KY3 A;  5LJ5 Y;  2PII A;  1YJW S;  1HIY A;  2CXE A;  2HVZ A;  1MG7 A;  3PRV A;  2YTC A;  1T11 A;  4URQ U;  3HLU A;  3VAF A;  2FJW A;  2VPZ B;  3OV7 A;  2CQI A;  2XMT A;  4OLO A;  3GU0 A;  1TK8 A;  4Q45 A;  1VIX A;  1NCL A;  4B3T F;  5CD4 H;  4OZ2 A;  1FER A;  3PHE A;  4X66 J;  4QWA A;  4YY3 J;  3QAT A;  5KFI A;  1IXK A;  1R7I A;  3TJA A;  2HAF A;  4XO0 A;  2PMZ D;  4KHR A;  4K59 A;  2DNY A;  2HRT A;  2DR5 A;  2R7T A;  5LSO A;  5CZX A;  2YVS A;  4FZV A;  2GO9 A;  4RWW A;  3RBE A;  4RUA A;  1RT6 B;  3DNC A;  5DLG A;  5KFC A;  4CNZ A;  1N33 F;  4HTI A;  2P6S A;  2YNI B;  4OYA A;  5F8J A;  4UOF A;  5E3Q A;  4ER8 A;  4R0J A;  1LWC A;  3TAP A;  4C8Z A;  1IKY B;  2OPR A;  1F1B B;  2B7C B;  3ILJ A;  2HQC A;  4AUK A;  3I96 A;  3G82 B;  1VIO A;  3KHH A;  2C2Z B;  5AE3 A;  3IAM 9;  2K1R B;  2M5Y A;  5A0Y B;  4JUZ A;  3E8O A;  1YZ7 A;  2AEM A;  2A6M A;  2ZOF A;  3THT A;  2OEM A;  1WTB A;  2N82 B;  2IDE A;  1U24 A;  6FD1 A;  2IVF B;  5IOL A;  1AW0 A;  2GHP A;  1Y7P A;  2UUA J;  3ZTO A;  4ETX A;  1F6T A;  5L39 A;  4V19 J;  4X66 F;  3UDC A;  5I42 B;  1IWA A;  3MMA A;  3NCR A;  4YY3 F;  2HNY B;  3NGD A;  1KD1 T;  1RHM B;  1KHW A;  1TKX A;  1SH2 A;  2ILY A;  1IBM J;  4H54 A;  3DGV A;  1QY7 A;  4XDD A;  2I6W A;  2DGT A;  1IR1 A;  2IAJ A;  3W62 A;  3W8G A;  1REG X;  1Z1Z A;  5DG9 A;  2ZJR Q;  1C1C A;  3H8Y A;  1F0X A;  1FXL A;  4OZ1 A;  3CME S;  5L9X A;  3OBI A;  3POT A;  1RHR B;  3HHL A;  2ZH4 A;  2AIR B;  4AT1 B;  2C1E B;  3EGW B;  2V0N A;  2O01 C;  4F4Y A;  2ASL A;  2NQP A;  4IG0 A;  4OJG A;  3THP A;  1R8H A;  4E0D A;  4NLY A;  4DV6 J;  3Q22 A;  5D4P A;  1IUJ A;  3I56 S;  3QGG A;  1DTT B;  2Z2Z A;  1MWY A;  1AZS B;  3QO9 B;  2E9T A;  2FHJ D;  4DSI A;  4UQG A;  2HK2 A;  3TZX A;  4QIV A;  3W9I A;  2BM1 A;  3VQT A;  2UUA F;  4K7Q A;  1A0O B;  2MDA A;  1TQL A;  4DR7 J;  2NYI A;  5HAO A;  2HHV A;  1IKW A;  3IG1 B;  1UVI A;  1IBM F;  3PJX A;  1NBE B;  3NOC A;  1FFW B;  4FVC A;  1HL6 A;  4M95 A;  1RT5 B;  1FVS A;  2QT7 A;  3MI7 X;  2EFG A;  3GFX A;  3HHD A;  4B9U A;  1WJ9 A;  3EZO A;  2KFN A;  2OD6 A;  1RYR A;  2YQ3 A;  2VF3 A;  4U96 A;  3SEO A;  4PG8 A;  1OMS A;  5KT6 A;  4K4T A;  4JI5 J;  3RG6 A;  1PAU B;  1F5A A;  2ZH2 A;  2VB6 A;  3HM9 A;  3RB6 A;  5U47 A;  2HHU A;  4P52 A;  1J5O B;  3TAQ A;  1UWA A;  2CWX A;  2G9O A;  3OQ2 A;  3TWZ A;  2BE7 D;  3BDE A;  2ASJ A;  3J7Y I;  3M2R A;  4ZLL A;  3EXC X;  2EXU A;  4MJK A;  2MSS A;  5LXY A;  2B9E A;  4XPC A;  2XSJ A;  4DV6 F;  5DG7 A;  4ECY A;  2V2V A;  1T9V A;  4C4W A;  3MUR P;  4DV0 J;  2B5J B;  1QAX A;  4ZN3 A;  5D3G A;  3KLF A;  3LGH A;  2BKN A;  1S77 D;  5D4L A;  1S0O A;  1N0V C;  3LGM A;  4DR7 F;  1QE1 A;  2OMO A;  4IUF A;  4GMK A;  4RPF A;  1RTI B;  2V2K A;  2KVI A;  2XLI A;  3ZZZ A;  2H51 B;  4NLG A;  4OI3 A;  4UUX A;  3I0R B;  4ZVO B;  3B54 A;  1LWX A;  4J37 A;  1SIZ A;  3RBZ A;  2BXJ A;  5ITH A;  2ZE2 A;  4CDI A;  2XHW A;  2RQ4 A;  4CT8 A;  3QLH A;  2KJW A;  5E3P A;  5HSP A;  4WZM A;  2FVS A;  3M8Q B;  1F3V A;  2EK6 A;  4ZVH A;  5KFF A;  2F4V J;  3CVK A;  3TUZ C;  1JLG A;  4K4Y A;  5K9F A;  3IBC B;  2VBX A;  3JTO A;  4Y2C A;  3PYG A;  2VA3 A;  2D41 A;  4UTG A;  2C22 A;  4JI5 F;  3MMB A;  2DH8 A;  2JEJ A;  2J9C A;  2IVY A;  3PIO Q;  4KGM A;  4YME A;  4YFU A;  2MHE A;  2X1B A;  3HVR A;  2DPI A;  2E5G A;  2DGV A;  4A47 A;  3E3X A;  2FVR A;  1RLC L;  3BYP A;  1X4D A;  3BBC A;  3L9Z A;  1UWB A;  3MF5 A;  2AGQ A;  4EUV A;  1U1Q A;  3DLG A;  3DLB A;  1HYS B;  3D6F B;  4P2F A;  2OH2 A;  1ZM3 A;  4F0K A;  3TRG A;  1C2P A;  1YGY A;  3PKY A;  4DV0 F;  1DAX A;  3U1M A;  4JBC A;  3DLK B;  1S7I A;  1Q82 T;  1X31 C;  3GII A;  4RW4 A;  1CSJ A;  1R8B A;  2VFR A;  1UVN A;  4RBT A;  5KFZ A;  4K5S A;  2BRK A;  4XDC A;  1NDK A;  1XN9 A;  4OMF G;  1JLE A;  3HFK A;  1HW8 A;  5KFA A;  5C42 A;  3K7R A;  4MKV A;  2DR9 A;  3IWL A;  2KZM A;  3MM9 B;  3KHG A;  2CPH A;  2F4V F;  3DHW C;  1MWZ A;  3KDN A;  4CLZ A;  4J9Q A;  5F8H A;  2DPJ A;  4F3O A;  4ECX A;  2AZ1 A;  3DGP A;  1WOR A;  3N4W A;  1RWP B;  2RHS B;  2ZC3 A;  2J7K A;  1N5Y A;  1DTQ A;  2KU7 A;  2DIU A;  3UN3 A;  4CTA A;  2EPI A;  4OYZ A;  2CAJ A;  5IT4 A;  1HNI A;  1S1X A;  4FVM A;  1FKO A;  1EET B;  3EGZ A;  4ES1 A;  1K0T A;  1ACM B;  2AF6 A;  2DB1 A;  2VBY A;  2V68 A;  3DOL A;  1C4C A;  4ZVG A;  3BKT A;  1WOO A;  2IA6 A;  2HYI B;  2WHO A;  3DDK A;  3DRR B;  2MKJ A;  2R7X A;  3MGJ A;  3QJP A;  4IFY A;  1CJT A;  3FNN A;  2QZ8 A;  2RIL A;  4OHV A;  3UCZ P;  2LLZ A;  1BE4 A;  1Y5L B;  1KQS R;  1QSS A;  5G4D A;  3J81 Y;  2JFD A;  4OFZ A;  4J9S A;  2FB0 A;  2EBE A;  4ED5 A;  3GJQ B;  4ZVT B;  1N5T A;  4TYB A;  3A3O B;  2KRB A;  4RW8 B;  3G6E S;  1IM4 A;  1WOS A;  1HFE L;  2ZJQ Q;  4U9R A;  1HBO B;  3EXY A;  1NEE A;  3GV8 B;  1F3F A;  3HVW A;  3O3L A;  3KLG A;  2BJ7 A;  3H20 A;  1U1M A;  4QU7 A;  4CLK A;  1S59 A;  2EFO A;  2VFU A;  3ZZY A;  2VA2 A;  3HHN B;  3C15 A;  3D6T B;  2DCL A;  1UVM A;  1AUS L;  1RTH B;  4JI8 J;  3UPF A;  2DEJ A;  3KUG A;  2MY8 A;  4A8M P;  4N7T A;  3CSK A;  4ZVP B;  1LV5 A;  4P7T A;  3OXG A;  3EYZ A;  2GAH C;  3PVX A;  2JFK A;  1PYS B;  3V5R A;  3GG1 A;  4O3Q A;  4C97 A;  1ZAV A;  5H1S V;  2LQB A;  1RCX B;  2VQE J;  1Q8B A;  1CJU B;  3ISN C;  3VWS A;  3DRS A;  1GMW D;  3EDR B;  5BYQ A;  3DOM A;  7AT1 B;  3KLI A;  2KM8 B;  1QSY A;  4DX5 A;  1RUS A;  3UN2 A;  4P2M A;  2ADB A;  4ILL A;  4LFA J;  2CPY A;  3I32 A;  3GJT B;  4ZIV A;  1MRO A;  2VHG A;  2HBY B;  3W64 A;  2I5J B;  1QJH A;  4WKY A;  3UDL A;  1G1X A;  4ICL A;  1X4A A;  1T03 B;  3CJS A;  4QIW D;  3LP0 B;  1SQG A;  3AJ2 A;  3ENQ A;  4HHJ A;  3WC2 A;  2EBG A;  1FTR A;  2RDJ A;  5BR8 J;  2DR8 A;  2HS0 A;  2J0X A;  2NR0 A;  2RHQ B;  4DR2 F;  4JI8 F;  2MST A;  2CQ2 A;  1BWE A;  3Q8S B;  1HMV B;  2UVU A;  2B51 A;  3MCO A;  1IJE B;  3FSI A;  3MPV A;  4KV8 A;  2X1F A;  2QL7 B;  1FJG J;  1QUP A;  2IDL A;  4CO2 A;  4JV2 A;  1S1V B;  2ZUA A;  1Z2L A;  1WKK A;  5EHH A;  1SUQ B;  2HRU A;  2W9B B;  2VQE F;  5G0R A;  4I2Q B;  2YKM B;  2N7Y A;  4USH A;  4ECZ A;  2J6S A;  5HQ8 A;  3JQJ A;  4UY8 T;  3OL8 A;  1RI7 A;  5E3R A;  3D3C J;  3LA0 A;  5AXK A;  2D7S A;  4PXD A;  4J9N A;  4YHH F;  1T9T A;  1RT7 B;  5C24 A;  4LFA F;  4I6W A;  3AFG A;  4DG1 B;  3KUH A;  3BSO A;  3QIP B;  3KYL A;  3NCQ A;  2EFQ A;  4G1P A;  4TXS A;  5C5J A;  3LAN A;  2XG8 A;  5B0B A;  3T9N A;  2DRB A;  1KLM A;  2MHN A;  2NYH A;  4O0I A;  4U8V A;  1NK7 A;  3FQK A;  2VC1 A;  2C3U A;  1R0A A;  3HVA A;  5BR8 F;  2GGP B;  3C14 B;  5J2P B;  1YZ6 A;  1JNR B;  3SDE A;  5KT7 A;  2QYG A;  1UTA A;  1FI4 A;  1NHK L;  3M8P B;  4O3N A;  4WJB A;  1RAF B;  5FDL A;  2B9Y A;  3KLE A;  3MM5 A;  3AAW B;  2W7O A;  2JWN A;  2VH7 A;  4ED8 A;  3LAM A;  2HEK A;  4ZCI A;  1FJG F;  2BBE A;  1Q7L B;  3C8Y A;  3UW1 A;  4B3R J;  1XNR F;  1P9Y A;  4KKO B;  1NLK L;  2DGW A;  4B3O B;  1R0B G;  1JLA A;  2ZH3 A;  2JDJ A;  3TUI C;  1RTJ A;  4ZIT A;  4PPZ A;  3CJ8 A;  4DU7 A;  2P8I A;  4YR3 A;  1CQN A;  3PYF A;  2W7A A;  1MML A;  4LF4 J;  2H65 B;  4F7V A;  4F02 A;  2CPX A;  2YQ0 A;  2FHM A;  2M52 A;  1S1U B;  1OIA A;  2RNE A;  2R7Q A;  3PDN A;  1FVQ A;  3OSP A;  4QYZ K;  2VC0 A;  4F3M A;  5J1P A;  2QG9 B;  4MAK A;  2ZHO A;  1GX5 A;  4OYI A;  2KFZ A;  3LH2 S;  2V9W A;  2FJE B;  3GG0 A;  4G1Q B;  3M8S A;  4QPX A;  3GON A;  4HDH A;  2HFV A;  4X4Q A;  5D0G A;  5HJX A;  2YKP A;  3DU5 A;  3AH6 A;  5ETK A;  2UXD J;  2KO1 A;  4TN2 A;  3W5Y A;  3J7A N;  4WP9 A;  3OLB A;  3WDO A;  4F4W A;  5JVH Q;  1L5U A;  5GME A;  4UOH A;  5CQG A;  4I7F A;  1SQE A;  4PXB A;  1EP4 B;  5IV4 A;  2OFH X;  1ZZF A;  4FYD A;  5D78 A;  4CYU A;  1F5B A;  3JSM A;  4B3R F;  3B8H A;  4HVZ A;  1B7Y B;  2DNH A;  2RB7 A;  4ZLN A;  4FBT A;  1RTZ A;  2QLX A;  5B0C A;  1KQK A;  1TU0 B;  2MKK A;  2AT1 B;  4U8Y A;  3A8E A;  4KJI A;  3CD0 A;  4NZ7 A;  4WE1 A;  1QAJ A;  3O1L A;  1GTH A;  2XGQ A;  3ZZO A;  4ED0 A;  4OHX A;  2MLX A;  4LF4 F;  3RRH A;  3DM2 A;  1X9W A;  2HHS A;  2DXF A;  4IH6 A;  4DOZ A;  5HL7 Q;  1G2E A;  1W7W A;  2ATC B;  2MJU A;  2CQG A;  2B9W A;  1DBD A;  2HQI A;  2HW3 A;  3Q23 A;  4C11 B;  4RW6 B;  1NKC A;  1E6Y B;  3IFE A;  1ELO A;  3QT8 A;  2GVZ B;  1ZS6 A;  2BOA A;  3NKY A;  2W1B A;  2FY1 A;  1WDD A;  4OI0 A;  4LF9 J;  4AD6 A;  2XMU A;  2V2Z A;  4EO6 A;  4OJ3 A;  2W8K A;  1EKR A;  5KG4 A;  4W90 B;  1BHN A;  2W24 A;  1MN9 A;  2PT0 A;  2R8H A;  4OJH A;  2UXD F;  1FNO A;  4QWB A;  4K5R A;  5GAH U;  3H98 A;  1SKS A;  2CPZ A;  2YWW A;  1CJV B;  2YWE A;  4KT0 C;  1YBU A;  4F36 A;  2MKI A;  3OTD A;  1U0H A;  3PG9 A;  3OTB A;  4NXN J;  3V81 B;  3JSR A;  1Y11 A;  1PBU A;  4QR2 A;  2EG1 A;  2VG6 A;  3UD3 P;  1SIW B;  4BC9 A;  3CW2 C;  4CQ1 A;  3PIP Q;  1J27 A;  3BGL A;  4R25 A;  2W2O P;  3AOC A;  5L38 A;  2R2S A;  1R31 A;  2GFF A;  4JI1 J;  3MMJ A;  1I6J A;  3JSB A;  3HSJ A;  1FE4 A;  4XIU A;  1KQF B;  3OFE A;  4ZHR A;  1LWE A;  3KKF A;  3MED B;  3BGR B;  1DQA A;  3N6M A;  2Y3Y A;  2HQ3 A;  2PFD A;  2CG8 A;  3N6L A;  4I67 A;  3HK2 A;  4ZDN A;  3NOG A;  5A76 A;  2E1R A;  4A8W A;  2GQC A;  3DOK A;  2BE9 B;  2CPI A;  3ENV A;  2J6U A;  2E5J A;  5IM0 A;  4LF9 F;  5T7L A;  5H9F K;  4O44 B;  3D4J A;  3G2X A;  3AJD A;  1NZ8 A;  5GAD I;  3BH7 B;  3I9V 9;  3D1H A;  1Y10 A;  2FHO B;  2IM1 A;  1RIS A;  2DH7 A;  1NK8 A;  2VD3 A;  3FBB A;  3R5D A;  5DQI A;  5KG0 A;  4M5G A;  3MUV P;  5J1N A;  4NXN F;  1NHV A;  1EAY C;  2PC6 A;  1T94 A;  3CCV S;  4L75 A;  2IHR 1;  1Q81 T;  4FYX B;  4KIA A;  5CAA A;  3HUL A;  4F2S A;  2CDR B;  1JMT A;  2BKP A;  4JI1 F;  4S0M A;  1VBK A;  3CJ2 A;  2HG4 A;  7FD1 A;  4UY8 5;  3PRB A;  3MR2 A;  3OL9 A;  5KAK A;  1JLB B;  3ADA C;  3KDO A;  3FVY A;  2R3V A;  1RT1 B;  4USV A;  2XCA A;  2R2R A;  4BDP A;  3MCS A;  5CYM B;  1HA1 A;  2LVW A;  4FN5 A;  4NPO A;  1XR7 A;  2EVZ A;  3CJQ A;  3CCZ A;  1H38 A;  1LW0 A;  1RSC A;  1DQ8 A;  2ATL A;  4GRS A;  2W4C A;  2QSF A;  1S1T A;  1VLY A;  1V3S A;  3BS9 A;  4OI4 A;  4X4R A;  4FXV A;  1FWK A;  2ZC4 A;  4C3M A;  3T5H A;  3PKM A;  4UZC A;  2RIJ A;  1RAJ A;  4M5L A;  2YX7 A;  2YWF A;  1HW9 A;  5E5N A;  5KTQ A;  5EN1 A;  3ZFV A;  1WOP A;  1KOO A;  3M32 B;  4F67 A;  4CLP A;  2I38 A;  4DL2 A;  4EEY A;  3KK1 A;  2L48 A;  2LXI A;  2UUT A;  4IRC A;  2OTJ S;  1PCA A;  3D3B J;  4DPT A;  5A6W A;  3H90 A;  4MYU A;  1NXI A;  4MK9 A;  4NOH A;  1VQM S;  1VRU B;  2AYG A;  2ACY A;  1YBA A;  2CJQ A;  4UST A;  2E7V A;  9ATC B;  2ALZ A;  1HQE B;  2DXE A;  4IG3 B;  1YJ9 S;  2CVE A;  2OPS A;  2Z2L A;  3TAM B;  4I68 A;  4ANE A;  1LFW A;  2YKQ A;  1C0U B;  3TX0 A;  4NI2 B;  1H3D A;  2JH3 A;  3H2V E;  2FGO A;  1VRT B;  2RUS A;  2DGO A;  5AXN A;  2YKN A;  4JI2 J;  4RW9 B;  3Q2T C;  2H5J B;  2B6A A;  1ZBT A;  3IBF B;  3JXO A;  1RBA A;  4WBF A;  4PUO A;  3B4M A;  3DRP B;  4DSJ A;  3IS9 A;  4LF7 J;  4DL3 A;  4PWD A;  3CO0 P;  4F4X A;  1VQK S;  1G7C B;  1REV A;  1AYE A;  1RDR A;  4HI1 A;  4DR6 J;  5GMK a;  3NGK A;  4UZB A;  4NAS A;  1NKE A;  2KT5 A;  2Z30 B;  3QT6 A;  5D0H A;  3PZP A;  1RWX B;  2AJ2 A;  3ET6 B;  1N5S A;  1VRQ C;  2CQ0 A;  4QWC A;  1VOM A;  2I1R A;  1RCO B;  4C3K A;  2M8H A;  1JNZ B;  1X4G A;  1GNK A;  3AD7 C;  3W1Y C;  4K4S A;  4TU8 A;  3CUN A;  4Q2L A;  1FJ7 A;  1X7V A;  4RU9 A;  2KG1 A;  1VQL S;  3QWU A;  1APS A;  3LPE A;  3OVA A;  1WI6 A;  2J5A A;  2B4O A;  4WFX A;  5ETV A;  1KN6 A;  3GSD A;  1RT3 B;  2E1P A;  3TVY A;  1VJW A;  2YBV A;  5E33 A;  2RE1 A;  1UET A;  1RJJ A;  4RNO A;  3P3D A;  4P6Q A;  1JQG A;  3CDU A;  5EUH A;  4IOB A;  3Q0A A;  2FIU A;  3W2V A;  3BN7 A;  1RA6 A;  4JI2 F;  3EZU A;  1S97 A;  2OHD A;  1XWL A;  3OTO J;  1N8R T;  2QIF A;  3OT9 A;  1LEO A;  1DLO B;  4LF7 F;  3C6U B;  4DL7 A;  2NXJ A;  4DN9 A;  2BQR A;  1H6K X;  2UP1 A;  3IRX A;  4DR6 F;  1FO1 A;  4QWE A;  3QRQ A;  4C3L A;  1U8S A;  3MM6 A;  4KBI A;  2UVW A;  2W9C B;  2HQD A;  1WF1 A;  1ZM2 A;  1WF0 A;  3X3U A;  4H4M B;  1BQM A;  2YNF A;  1F9F A;  5J2M A;  1RAA B;  4G6V B;  5GAE U;  1SL1 A;  4TVA B;  1GH8 A;  2ZZM A;  5IS2 A;  1UKU A;  1Y5N B;  1Q4R A;  2J0Q D;  2KB2 A;  1NPK A;  4PG5 A;  2VG5 B;  3ZTQ A;  1HI1 A;  4DFP A;  1VQP S;  4ZVE A;  3V2U C;  1WC6 A;  2DD8 S;  4USI A;  4LRE A;  2KFY A;  1AA1 B;  4WII A;  2D3U A;  5F3Z A;  4M1K A;  3R6G B;  4ZMM A;  3S7R A;  4G3I A;  5LSL A;  3NWG A;  1GTE A;  3MD1 A;  3OTO F;  2XY6 A;  1XER A;  3V4I B;  2J9D A;  3LW5 C;  2OEJ A;  5F8M A;  2VBW A;  2QFJ A;  4NX9 A;  4ALZ A;  3T5L A;  1OY9 A;  2PEB A;  4PWW A;  1R89 A;  3EDQ B;  3HPO A;  5KFM A;  4NCA A;  4WTY A;  5ETT A;  3JQK A;  2OGU A;  1RYS A;  5LT5 A;  3BQ2 A;  3TX8 A;  4AXJ A;  2E1M C;  4ZVF A;  2K2P A;  2V67 A;  4HAC A;  4J9O A;  4I64 A;  2DGQ A;  2C42 A;  2E44 A;  2KKH A;  3BO2 A;  4LFB J;  5DGB A;  3G8T A;  3HVT B;  5HBM B;  3U02 A;  3IR5 B;  1WSV A;  1YBT A;  3LWM A;  2NPF A;  1PJ6 A;  2R8K A;  1Y3J A;  2AGO A;  1D1U A;  4UOG A;  3G6Y A;  4GO5 X;  1WKJ A;  5K8P A;  1O5J A;  4LSL B;  3MHY A;  2RJZ A;  7FDR A;  1U6Z A;  3OR2 A;  5KFE A;  1S6Q A;  1UPM B;  3G9C A;  3D6H B;  1IM6 A;  1SC1 B;  5E2Q A;  4JV0 A;  2R7U A;  4I69 A;  2VPW B;  4F0M A;  1GFW B;  5IQ6 A;  5F9L A;  2G4B A;  4FF2 A;  1LW2 B;  2ZD1 B;  1RA7 A;  3BJY A;  5IZH A;  1VI7 A;  4A48 A;  2Y1I A;  5SUH A;  1U26 A;  3CJK A;  3D5M A;  1FEH A;  1IKY A;  4MKA A;  2IM0 A;  4PR6 A;  2J6T A;  2ZBR A;  3I5A A;  3G82 A;  3BB5 A;  5IFM A;  2GNK A;  3EVM A;  2K1R A;  5A0Y A;  1J2V A;  1Q5Y A;  4B9V A;  5KFT A;  1T05 B;  4YDD B;  4YB6 A;  3VAG A;  3X1L B;  1SBR A;  1BQN B;  1XTZ A;  4L73 A;  3DYA A;  3I5B A;  3FQL A;  3TEG A;  2FY8 A;  4ATN A;  2E9Z A;  3K5O A;  2RF2 B;  2HZC A;  1Z2Z A;  2Z0G A;  3ZZP A;  4LFB F;  2Y0B B;  4PKD B;  5I42 A;  1WEX A;  1YVF A;  1U2F A;  2HNY A;  2AKW B;  4DQS A;  3BKF A;  2MYF A;  2V4J B;  1UZH A;  1JLC A;  3A8K A;  3MOZ A;  3M2V B;  4NLR A;  3TJ8 A;  2RH3 A;  3GZ7 A;  5HVF A;  4ED4 A;  1TKD A;  3K8V A;  4RLE A;  3HKW A;  1U6F A;  2ZWO A;  1NND A;  1BXN A;  3NLC A;  4C8K A;  1ZYQ A;  5HRO A;  3ISN D;  4KHP J;  2DNN A;  2V6A A;  3MM7 A;  3DDI A;  1ROF A;  3AOB A;  5D6G A;  4CO5 A;  4KQZ A;  2O67 A;  2QA4 G;  5EGY A;  4F25 A;  2OPP B;  3EIC A;  2QMX A;  9RUB A;  5KT3 A;  3RR7 A;  3RZA A;  1DTT A;  2AYE A;  1U1R A;  1AZS A;  3DU6 A;  3NGT A;  1M1K T;  2BX6 A;  3RRG A;  2YWH A;  4RKU C;  3FCV A;  3I0S A;  4KFB A;  2QN6 B;  1NJZ A;  2OEL A;  1SVD A;  1RB0 A;  2BAN A;  5B7W A;  3I31 A;  2HHH J;  2B0G A;  1TL3 A;  5CAB A;  2MB0 B;  3UVJ B;  4NCG B;  1VBZ A;  3BGU A;  3I82 A;  1Q16 B;  3CWJ A;  1W2I A;  2ROP A;  2KXF A;  4RUH A;  4WP8 A;  1N52 B;  3EPG A;  1XR5 A;  4A8K A;  3ZTR A;  2Z2Y B;  4P75 A;  2CQB A;  5J2Q A;  5T14 A;  1HI8 A;  3JYT A;  2V34 A;  1S1W B;  4ZPT R;  1F60 B;  1WWH A;  2K06 A;  2IIH A;  4ZJL A;  3UNY A;  4KHP F;  4EBD A;  3KG4 A;  2OTL S;  2WAQ D;  3EJM A;  5BYR A;  2YNH B;  3QSI A;  1JXL A;  1U4B A;  2IC3 A;  3ENA A;  4MIB A;  1U8W A;  2JRS A;  1QD1 A;  2XI2 A;  1DUR A;  3HFZ B;  1UEV A;  3BQ0 A;  1CJK A;  3RW7 A;  1T9U A;  1CC7 A;  4EMD A;  4ZS6 A;  1IWG A;  4OL8 A;  3R97 A;  4DCO B;  1JXV A;  4Z2X A;  3MZI A;  2XLK A;  1Y4Z B;  1FXD A;  3LTO A;  4PQU B;  2AX0 A;  3CB4 A;  3W5Z A;  2B5J A;  3GFY A;  4FF3 A;  3H2U B;  4NA1 A;  1RU1 A;  2N3O A;  1C1C B;  4DR4 J;  4QCL A;  4HL9 A;  3ELH A;  1JX4 A;  1FD2 A;  2HHH F;  3PHT A;  3POT B;  5EX3 A;  3HHL B;  1RP5 A;  1GEH A;  2BYC A;  3MDF A;  2G0C A;  1HWK A;  3CD7 A;  1UP1 A;  1DAR A;  2GCF A;  2ZBI A;  1HWU A;  3UCG A;  2YX1 A;  1RT2 B;  5ETL A;  5DDQ C;  2MQM A;  3TVZ A;  3GFH A;  2YNG A;  3H5U A;  4RJV A;  3TZW A;  1HHT P;  2BOP A;  4IR1 A;  3A3P B;  3J7A 1;  3MEC B;  4Y00 A;  1VR6 A;  2VON A;  3OR1 B;  2V9K A;  3HX9 A;  2MMY A;  5KG2 A;  1TMM A;  3QID A;  2XGP A;  1VYA A;  2GJF A;  4RO0 A;  3HXM A;  4DV3 J;  2DXD A;  4N47 A;  4IH5 A;  1IKW B;  2G0I A;  2H9Z A;  2V8D A;  4CWB A;  2WW8 A;  3HKZ D;  2MQO A;  3SSQ A;  3IR7 B;  3OFH A;  5IT0 A;  1N4L A;  2ASY A;  2EKN A;  2B43 A;  2FYX A;  2PFF B;  3T3F A;  2VOO A;  3OUY B;  4F4K A;  3R9L A;  4DZ6 A;  4LUB A;  1XMQ J;  2ZH7 A;  1XBW A;  4F8R A;  2VPX B;  3J7Z T;  4DR4 F;  4DR5 J;  4CH7 A;  4B9S A;  1H2U X;  1O0P A;  2X7I A;  1O6X A;  1FF2 A;  1WC4 A;  1RBO B;  1VQ4 S;  2KXN B;  2Y9H A;  3RW6 A;  3M2R B;  5B09 A;  4EZ9 A;  2HMI B;  1NPR A;  1UVJ A;  3BQ1 A;  5C2C A;  3CD5 A;  4P9S A;  2BAC A;  4KAI A;  3T1Y J;  1B0V A;  3MFI A;  3F73 A;  2F65 A;  2BVZ A;  1IQT A;  1VQS A;  3SV3 A;  3KNA A;  3SCJ E;  4DPU A;  5D3G B;  8RUC A;  4O3P A;  3SFU A;  3W65 A;  2BJ3 A;  3CC4 S;  3QQC D;  3W2W A;  4X4O A;  1WC0 A;  4IH7 A;  1KDN A;  1NSA A;  1CUL A;  1HD0 A;  4X64 J;  4DV3 F;  1OQ6 A;  4PEO A;  1WAC A;  1EQM A;  5ETM A;  2BMB A;  4N77 A;  1YIJ S;  3DRR A;  3FFI A;  5IT9 Y;  2Y8Y A;  4B02 A;  1PBA A;  4PG6 A;  1IKX A;  4LVO P;  4NEZ A;  4F4Z A;  4E2F B;  2IMW P;  1TUW A;  3BBB A;  2XO7 A;  3SSR A;  5KFJ A;  1S4E A;  3FEX B;  1XMQ F;  2JOQ A;  4ZVU B;  5HVH A;  2ASD A;  1WUU A;  3KG0 A;  2X3D A;  3NMA A;  1SXL A;  3KLH A;  2EFP A;  3FBC A;  4NYO A;  4NLV A;  2W01 A;  3IM8 A;  1B3T A;  2IYI A;  4LRB A;  4EK2 A;  4KTQ A;  5EWE A;  1VQ7 S;  2DHH A;  3M9O B;  4C9D A;  1FJC A;  1UWB B;  3CDE A;  4X4S A;  2FQQ B;  3BPS P;  3OTC A;  1B99 A;  1UJ6 A;  3TJ9 A;  3T1Y F;  3FMB A;  5B08 A;  3ITH B;  1TTH B;  4FS1 A;  2KM8 C;  2AV5 A;  1T9X A;  2QL9 B;  3KG1 A;  1L3S A;  4N41 A;  1H2V Z;  2C2D A;  1FE0 A;  1CQM A;  1TAQ A;  4RW4 B;  2AP6 A;  3SQO P;  2EFV A;  2VZ9 A;  4X64 F;  5EDW A;  1RTH A;  1MSW D;  3W66 A;  2W25 A;  1N56 A;  3N6N A;  4K4V A;  4NZ0 A;  5C42 B;  5H9F J;  1M90 T;  3OFG A;  4PCQ A;  3BGF A;  2M8D B;  1VMB A;  5T41 A;  1ARO P;  4FYY B;  1KEK A;  4V19 X;  1XEZ A;  2XMV A;  2EFN A;  4FNH A;  2FVC A;  1WC1 A;  2ZIT A;  1S6O A;  5L9N A;  4WXW A;  4KR0 B;  1DTQ B;  3DRY A;  4IOA Q;  3D0I E;  3PW7 A;  4CH1 A;  2UU9 J;  3D6M B;  5JJB A;  1HNI B;  2IRX A;  2FJX A;  4KO0 B;  1Q0N A;  1S1X B;  1ZH5 A;  1FKO B;  4WPA A;  3DXB A;  3AA8 A;  4ELT A;  4ED3 A;  3DOL B;  1RHQ B;  2DNZ A;  3GWC A;  3AQP A;  4CI0 B;  3PJ9 A;  1N54 B;  8AT1 B;  3D2W A;  3TP2 A;  4OZ5 A;  1T03 A;  1FKP A;  4AQY J;  2RDI A;  2MZJ A;  3G4S S;  1U1K A;  4O0N A;  2AYB A;  3FRZ A;  4YUD A;  2DJW A;  4ECT A;  4IFY B;  3R5C A;  3KHL A;  2OFG X;  2VKZ G;  1NPP A;  1NZA A;  1M5P C;  1XMO F;  2F8E X;  1RE1 B;  1O8B A;  1BWV A;  3G6V A;  4GKJ J;  2J8S A;  5DM6 Q;  1TVR A;  1ZAW A;  2V5H G;  3LGN A;  3HT0 A;  5FLX U;  4ED6 A;  4NA3 A;  5C25 A;  3K89 A;  3NP5 A;  3PAC A;  2R7O A;  2ZH6 A;  2HFS A;  4ZPW R;  5GVQ A;  2K3K A;  1KFD A;  1CLF A;  5KFU A;  3JTP A;  2R8J A;  4ENO A;  3RJM B;  3PCO B;  4NEY A;  4P10 A;  3T1A A;  1FD8 A;  1MW7 A;  3W60 A;  5K8M A;  5JVG Q;  4ECU A;  2R7R A;  2W9B A;  3RAX A;  3NCP A;  4FKY A;  5L1L A;  4I2Q A;  2YKM A;  1S6P B;  3TUP A;  2BV3 A;  3K57 A;  2VIC A;  3H42 A;  3A1Y G;  2HAI A;  4DPX A;  2QV6 A;  2UU9 F;  3NL0 A;  1HBM B;  5A8R B;  1S9G A;  1D0E A;  1FNM A;  3C15 B;  2QO3 A;  4L3N A;  1FHT A;  5IQQ A;  3K8W A;  2UV8 A;  4WU2 A;  4DG1 A;  4FXD A;  1I1G A;  4RBU A;  1OSD A;  3WHI A;  3KHR A;  1V5V A;  2Q3P A;  1ZAX A;  3FMW A;  3OL6 A;  4AQY F;  2POK A;  3BH6 B;  4DX7 A;  2CQ4 A;  4MTP A;  4DMZ A;  2CQD A;  2OAU A;  4IO9 Q;  2HNZ A;  1W25 A;  4LQ9 A;  3UCU P;  1VC6 A;  5DZ7 A;  3DRS B;  4DXL A;  4GKJ F;  4XPE A;  3DOM B;  3B6B A;  4DU8 A;  3KLI B;  3MM8 A;  2Z58 B;  3ZNU A;  5I3U A;  1Q8I A;  4CP5 A;  1R27 B;  3BBF A;  2HWI A;  3DN9 A;  4OJ1 A;  1C0T B;  3KK2 A;  2UV8 G;  2NCK L;  4GKK J;  3LOU A;  2P9E A;  4J5O A;  1HWI A;  1NSP A;  3MEG A;  1MRO B;  4LF5 J;  4UOC A;  5I3Q A;  4KKO A;  2ZBQ A;  3FBF A;  5K14 B;  4B3O A;  3H4B A;  3SV4 A;  4NLP A;  2CJA A;  3FGV A;  4NYZ A;  4TQR A;  2R9L A;  2JJ4 D;  5AE1 A;  1KP6 A;  4WFN Q;  2NRE A;  2G2O A;  3SCI E;  3J7Z 5;  1P8G A;  2RQC A;  1WSR A;  2KRR A;  2JLE A;  2IBK A;  3RBX A;  4W4M A;  4P7V A;  4L3K A;  3NNH A;  1T9Y A;  2R4F A;  4EYH B;  4Q8F A;  3MAH A;  3O5T B;  2BJ9 A;  3RRK A;  4KB7 A;  1X60 A;  2RRB A;  4HH1 A;  3DLJ A;  4OX6 A;  2G13 A;  3EGV A;  3I4P A;  3N9U C;  4DL6 A;  4DCP B;  2RKI B;  2W2M P;  2J0W A;  2W4P A;  3HJV A;  4G1Q A;  5GAD U;  4Q0B A;  2KHC A;  3US5 A;  3FDS A;  5L46 A;  5G0R B;  3T6B A;  3E01 B;  1NU4 A;  2RRA A;  4ID5 A;  3LP1 A;  1R0C B;  2F63 A;  4HH0 A;  3D54 A;  1KON A;  3K5M A;  1MMN A;  4K2J A;  2DIV A;  1SV5 A;  4Q8E A;  3OXL A;  2DNG A;  2CNK B;  2GC8 A;  4CO0 A;  1NH7 A;  3D0G E;  2BA9 A;  4I1T A;  2D69 A;  4GKK F;  4K4Z A;  4HT7 A;  4LF5 F;  2XS2 A;  2DRA A;  2HQF A;  1R8C A;  4LIR A;  4LRD A;  4X4U A;  1TEL A;  3WIU A;  1KTV A;  4TU9 A;  1VQ9 S;  5GAE I;  2Q6C A;  2L9D A;  2QTW A;  2QA1 A;  4QR0 A;  4DUY J;  5DO2 A;  3BR9 A;  2FJV A;  3CE8 A;  4OYO A;  3GR0 A;  3MCM A;  2VAS A;  1R0A B;  2PN6 A;  4AFF A;  3R7B B;  2W2Q P;  3IWN C;  2VG7 B;  1YI2 S;  2RS2 A;  2V50 A;  4WXO A;  1F2G A;  3SDE B;  1UFK A;  3CT9 A;  5HLF A;  1V5I B;  2F7V A;  2QLJ B;  2L9W A;  6FDR A;  3K59 A;  2W2P P;  2C2M B;  4CT9 A;  3RAQ A;  4RW6 A;  2XQC A;  3J81 U;  3MPU B;  1V9O A;  3RAM A;  2GS8 A;  1MN7 A;  1Y00 A;  3QFH A;  5D77 A;  2YPZ A;  3DC2 A;  3TEH B;  2ZHB A;  3K5L A;  4OZJ A;  4HKQ A;  2K8G A;  1TMJ A;  1WG1 A;  2DO4 A;  4XAK A;  1JLA B;  2QSW A;  2VUG A;  1RTJ B;  3NMR A;  2AHO B;  2LU2 A;  5DDR C;  4O23 A;  2RS8 A;  3I4H X;  1OPZ A;  2UXB J;  4ZPA A;  3CMQ A;  3WZ0 A;  5F3T A;  4CIO A;  3W63 A;  2VFS A;  4C8Y A;  4NXM J;  4KRW A;  3M4X A;  5I4M A;  4M5I A;  4DUY F;  2ZVI A;  3GR1 A;  3VV2 B;  1KLN A;  2WVC A;  2P9C A;  4ANC A;  4M5D A;  2FLP A;  2YKO A;  1K73 T;  3SQG A;  1T7P A;  4DJB A;  1BMQ B;  3CF5 Q;  2QRR A;  4C8O A;  3MED A;  3MFH A;  1FCA A;  4YB7 A;  3OVB A;  2LQ9 A;  2H1Y A;  5D0R A;  2B7B B;  2I2Y A;  3I9Z A;  1TR0 A;  3OSN A;  3K5P A;  1KVK A;  1PSD A;  1D9D A;  2FJA B;  5M2R A;  2MGZ B;  2QMW A;  4HHH A;  1NJI T;  4F0H A;  2A3J A;  4DR1 J;  3KJV B;  4F50 A;  2RVJ A;  2HHW A;  2HBR B;  3JSM B;  2J7U A;  3LF0 A;  5IV3 A;  1U0S A;  3BGO P;  2XZD B;  2LFV A;  5B0A A;  1IQZ A;  4F3Q A;  1UEU A;  3BM7 A;  4WE1 B;  3TZZ A;  1YJR A;  2YY3 A;  1FRM A;  4OQJ A;  1IKV A;  4K0K F;  1K1S A;  2JEF A;  1KBR A;  3NS7 B;  3AOA A;  3N5B A;  3N28 A;  4DQI A;  2UXB F;  3VAJ A;  1DFD A;  2D1C A;  3BDP A;  3HZG A;  4IRK A;  4QZV B;  2KVQ E;  4K4X A;  3MUM P;  4KYZ A;  1X0F A;  2HGN A;  3WX4 A;  2CJX B;  3CJ3 A;  5DG8 A;  5HMW A;  4NXM F;  4DQQ A;  4LF2 A;  3L4B C;  1RAC B;  1BY9 A;  2KHD A;  3TZY A;  3G8S A;  4DLE A;  3CJT A;  3J80 Y;  1TKZ A;  4RX6 A;  3C46 A;  3H59 A;  4N56 A;  4OZ3 A;  3S01 A;  1JLB A;  2K3I A;  3LP2 A;  4A8O A;  4DQP A;  3H4D A;  3P5B P;  1D9A A;  2LQJ A;  4DFM A;  4NWB A;  2DHG A;  1Q7Y T;  2V63 A;  4DR1 F;  3V6K A;  3OPK A;  4Y6I A;  3MPW A;  2VJU A;  1PAE X;  1TUG B;  1JJ2 R;  5CXT A;  3IN5 A;  4N76 A;  2VBZ A;  2WSF C;  1TK0 A;  4BC7 A;  4FP9 A;  2E7X A;  2IVM A;  1UZD A;  4J9P A;  2AEJ A;  4WIQ A;  2COL A;  3SCK E;  2RD5 C;  4ZHR B;  2DNK A;  3GJR B;  1NK5 A;  1Q79 A;  2Y1J A;  1IBK J;  5CYQ A;  5J1E A;  1G6B A;  3M32 A;  1NDL A;  3M2U B;  1U1O A;  2CA9 A;  4ECW A;  3TI0 A;  1VK8 A;  2MLY A;  2NPI A;  2DY1 A;  1WHX A;  1RQ0 A;  3DOK B;  3H40 A;  1VRU A;  2BDP A;  1SPB P;  2P5V A;  1I3O B;  1HQE A;  4QIG A;  1FDD A;  2KH9 A;  3UD4 P;  2XMK A;  4IG3 A;  5IM0 B;  5JMN A;  1KWM A;  3AB2 B;  5T7L B;  4JI4 J;  2HND B;  5KOW A;  2D3Z A;  4ECQ A;  5K5M A;  2BJ8 A;  5HO4 A;  1FFS B;  4JI6 F;  4WYW A;  3L7O A;  5DS7 A;  1OYD A;  3M6X A;  4NI2 A;  4LF8 J;  5CCM A;  4PYD A;  1YG0 A;  1WEL A;  5ETS A;  5AJ3 J;  2DNQ A;  1VRT A;  3PW0 A;  2QMU B;  1OSC A;  4OX9 J;  1H7X A;  2A6O A;  3PW2 A;  2V4Q A;  2CNN B;  4AE5 A;  4RW9 A;  2HFO A;  3CDW A;  3G8Q A;  3TA2 A;  1JIH A;  2AGP A;  5CHC B;  3TQ1 A;  3HHE A;  3DRP A;  2VKR A;  1NJX A;  3LWL A;  1E6V A;  4WWS A;  3EM1 A;  4KH0 B;  4WK1 A;  4URG A;  5C7P A;  4A8X A;  4HTJ A;  2BJ1 A;  3WBZ A;  2DEI A;  4KC5 A;  1IBK F;  1MU2 A;  1B0P A;  2XLJ A;  4ZPD A;  3U1N A;  4NL5 A;  5D15 A;  3ET6 A;  4D3H A;  4IDK B;  2BRL A;  2RDD A;  1YHQ S;  2KYZ A;  1V6H A;  1N5Q A;  3M1V A;  1HNV A;  2LEB A;  3QZ8 A;  3BSN A;  3CCQ S;  3IM9 A;  1LW0 B;  1X4B A;  3OHB A;  1V3R A;  3D66 A;  3CC7 S;  4AND A;  2HHT A;  2L9N A;  3GQC A;  1S1T B;  4G65 A;  1RT3 A;  4DS4 A;  4JI4 F;  2HPU A;  4CLF A;  3HDS A;  3F56 A;  4DR2 J;  4I6A A;  2DK2 A;  1Q8K A;  3BYR A;  4LF8 F;  1NJW A;  2GIQ A;  1EB0 A;  1SJF A;  5A2Q U;  1MNE A;  5AJ3 F;  3C2P A;  3MR7 A;  4ECR A;  1FWP A;  3DI6 A;  4OX9 F;  3NS6 A;  3RU0 A;  2ZJP Q;  1VDH A;  2CRL A;  1OPI A;  2L3M A;  4TLR A;  2J0S D;  1Q78 A;  2EW9 A;  4E98 A;  3HSD A;  3VAI A;  1YJN S;  1VC0 A;  2BE2 B;  2YQ1 A;  1H72 C;  1DLO A;  1CEZ A;  3R5G A;  3AT1 B;  4IQM A;  5CD4 A;  2QEX S;  4TYA A;  5KG7 A;  2NZC A;  5M2P A;  4A8F A;  3FK4 A;  1F9H A;  2OPS B;  2CPF A;  4A8S A;  4YHH J;  4C2M A;  2CJB A;  5DRK A;  1SKR A;  5LOQ A;  2MZQ A;  3K5N A;  3I5C A;  2UUW A;  1U1P A;  3Q2S C;  3M6U A;  4C98 A;  2FVP A;  1SI9 A;  2AJQ A;  1D09 B;  2VDI A;  2YKN B;  2HS4 A;  1TKT A;  2KG0 A;  2MXY A;  4WU3 A;  4H4M A;  5I3P A;  1KR4 A;  1YTY A;  4WKR A;  2HVE A;  2F5G A;  1VC5 A;  1Q8L A;  2JLG A;  2B6A B;  3DXS X;  2BR0 A;  2ZH1 A;  4PUO B;  1UVL A;  2M3D A;  3IS9 B;  4YN3 B;  2MKS A;  4AL5 A;  3CNQ P;  3R8Y A;  3D68 A;  1IJF B;  5DZ6 A;  4PWD B;  1CS4 B;  1GK8 A;  1B0T A;  4X4T A;  2JL9 A;  3FSX A;  3CED A;  4GC7 A;  1FXR A;  5KT4 A;  1N32 J;  1UPP A;  1XNR J;  3U7J A;  4IFV B;  3IGN A;  3NY0 A;  5HJY A;  2IM2 A;  2MZT A;  1WHV A;  3CCW A;  2LCW A;  1K9M T;  5K20 B;  3V4I A;  4NLU A;  2VPY B;  1PKU A;  3Q86 A;  5ETR A;  3LAK A;  2PI5 A;  1N6Q A;  4QQB A;  3ETO A;  1YKW A;  4Q43 A;  4WFZ A;  4MK8 A;  2ZFH A;  2UZA A;  1VCT A;  5HQM A;  4DX8 H;  5HBM A;  3ULH A;  3K58 A;  5KFB A;  4I6Y A;  1QDU B;  4ZVQ B;  2E1C A;  2R8G A;  4F4A A;  5DDO C;  2WOM B;  3UFC X;  4LSL A;  4E8U A;  2BZ2 A;  4Y2M A;  3VCD A;  2M2B A;  2GIF A;  2B4P A;  3SSS A;  1YRX A;  5A8W A;  1LW2 A;  2ZD1 A;  2ZWP A;  3A8I A;  3T5K A;  5RUB A;  4ZP6 A;  1N32 F;  1S9E A;  5H9E K;  2XMJ A;  1JLQ B;  5KFL A;  3MM6 B;  3B82 A;  1GXU A;  4MFB A;  1DJ0 A;  2CQH A;  4TNO A;  4ZIW A;  1X5P A;  2FHK A;  3P49 B;  5F8G A;  1FTC A;  1HBU B;  1EHW A;  4ECV A;  5HMZ A;  1T05 A;  1PYO B;  1GXT A;  2YNF B;  4LT6 A;  5ETQ A;  3EVO A;  1TL1 B;  4CM2 A;  2ZH8 A;  4PYA A;  2E9R X;  1S49 A;  1IVZ A;  4EI2 A;  3CTR A;  5KFD A;  1UCN A;  2HK3 A;  2RF2 A;  2ZNZ A;  2NSC A;  4ED2 A;  1FRI A;  4EFA C;  2MKH A;  2N4D A;  4KE5 A;  1EX8 A;  4DSK A;  3U1L A;  1YJ7 A;  1RLD A;  3BO3 A;  2HKE A;  4DV1 J;  4H4O A;  1HKA A;  2M0G B;  1A7G E;  2C3M A;  2C2K B;  3FZ2 A;  1U48 A;  2D9O A;  4TY8 A;  5DLF A;  3M2V A;  1MWQ A;  5KFK A;  2CG4 A;  1RT4 A;  1CG2 A;  2WZ1 A;  1X4F A;  2FPH X;  3OHA A;  3VAK A;  4ETZ A;  4DSF A;  2UUC J;  4WFB Q;  2Z2M A;  4J7C A;  3THV A;  2GJI A;  3ILO A;  4ZP9 A;  3T9Z A;  3JTN A;  1DRZ A;  2I8E A;  5ETN A;  2H3E B;  3H5Y A;  3LAL A;  4HAC B;  1RAO A;  2OPP A;  4NCB A;  1HBN B;  1VFJ A;  3QWP A;  2RAQ A;  3DLL Q;  4K4W A;  1KHV A;  1WD6 A;  2GQQ A;  3VAM A;  4U7C A;  2G2Y A;  2B4U A;  2B56 A;  1Q95 G;  3V6D A;  4OZL A;  2A2D A;  1ZPV A;  4QU6 A;  4IQX A;  3OR2 B;  1S6Q B;  2JVR A;  3FCH A;  2XC9 A;  3OTE A;  3VTI A;  3MAA A;  1VBX A;  3ETM A;  4DL4 A;  2ZEJ A;  4RW7 A;  1RWK B;  4NLO A;  5EWG A;  2RSQ A;  2VV5 A;  1L3V A;  4LBP A;  5KFQ A;  3MOJ B;  3FEZ A;  1YJU A;  3UVJ A;  4DV1 F;  2AU0 A;  2WW4 A;  2E1A A;  1JKH B;  1UW9 A;  4NCG A;  4C0B A;  3CJK B;  4PQA A;  2W7P A;  1KVJ A;  4OV6 A;  2H4Y B;  3VGV A;  2ALY B;  4CRJ A;  3GLJ A;  2AJ1 A;  4GVL A;  1JJH A;  1U25 A;  3V4M A;  4HDG A;  2OKQ A;  1PJ5 A;  3V6H A;  2HGL A;  3HHL C;  5AT1 B;  1S1W A;  1NH8 A;  2UUC F;  1HPZ A;  1VQO S;  4J91 A;  3AD9 C;  3FJ2 A;  3GPA A;  3DYA B;  2YNH A;  3ILL A;  2IMO A;  3PM9 A;  2DHA A;  3GIL A;  4LJM A;  2HHP A;  1KNZ A;  2FD2 A;  1HI0 P;  2CDQ A;  3DRX A;  2R2T A;  2QGF B;  5IC4 B;  2CPJ A;  2HHQ A;  4QBU A;  3MD3 A;  1JLC B;  1XQI A;  2O66 A;  3QJL A;  3G6X A;  4PQU A;  3PYD A;  1YLX A;  2MZ1 A;  3MCN A;  3U27 A;  2CIM A;  4U6P A;  1VHF A;  1B7F A;  1TV6 B;  2GO8 A;  1XNQ J;  3NBP A;  4R5P A;  3PO4 A;  1HQU A;  4ZJO A;  4M5H A;  1Y5I B;  3GYN A;  3VGT A;  2G2Z A;  5HRO B;  3RYL A;  1QUV A;  2MLZ A;  3MM7 B;  3TO8 A;  1G4C A;  3IGV A;  2CJY B;  1KOH A;  2ZH5 A;  4N8O A;  3ZZT A;  4NA2 A;  5A6P A;  2YH1 A;  3HSZ A;  2E66 A;  1EZZ B;  1LKZ A;  4MT1 A;  3IMQ J;  2UUB J;  2F8H A;  2WB4 A;  3C16 A;  1WTF A;  3L7U A;  4O4G B;  2FJB B;  1RT2 A;  3BF4 A;  4ITS A;  2HHX A;  3W9J A;  4JV1 A;  1IBC B;  1X8D A;  3MWB A;  4B9M A;  2E5L J;  3DMJ A;  4OHY A;  2A0F B;  3DKD A;  2X3G A;  3MEC A;  4QJV A;  1GT8 A;  4RL1 A;  3I0S B;  3OR1 A;  4PWU A;  4LF1 A;  4KFB B;  1U2C A;  2FC8 A;  3UNG C;  2B9X A;  2XWY A;  2BAN B;  1AT1 B;  1O51 A;  1DHM A;  2KXH A;  1RTD B;  3QJJ A;  3M05 A;  3OL7 A;  1TL3 B;  4GVB A;  2V2Q A;  2J7W A;  4OHZ A;  4U7U D;  4X2B A;  1U45 A;  4O3R A;  1N0U A;  4DV7 J;  2DH9 A;  1ULR A;  2B4V A;  3C6T B;  3VF0 B;  2Q1L A;  2JVO A;  3ZZU A;  1PO6 A;  3NGR A;  5J2Q B;  2VFV A;  3OUY A;  4BHQ A;  1XNQ F;  2MQP A;  1W2B R;  3JYT B;  2J9D E;  3QMQ A;  2ROG A;  5FLX Y; 
#chains in the Genus database with same CATH homology
 2HIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...