2HIYA

The structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. (casp target)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
180
Chain Sequence
AMTRYALLVRGINVGKNKVVMAELRQELTNLGLEKVESYINSGNIFFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHITIRNAKTFDKIGQMLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title The structure of conserved bacterial protein SP0830 from Streptococcus pneumoniae. (CASP Target)
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 54
structure length 180
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08002 DUF1697 Protein of unknown function (DUF1697)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits bacterial protein sp0830 like 2hiyA02
3.30.70.1280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SP0830-like domains 2hiyA01
2HIYA
chains in the Genus database with same CATH superfamily
4OX7A 1JLAA 5A8KB 1XEZA 3IG1A 3PJXA 4PRFA 3OR1B 1RT7B 3V6DB 1KONA 2HNYB 2I38A 5B09A 2CQDA 3GILA 2GVDB 4X65F 2HGNA 3EZ5A 2EPIA 3DLGA 3OUYB 4ZP9A 3DRYA 4U7CA 3NGDA 3D6HB 1SIZA 2Z2MA 4TU9A 1MN9A 3FMBA 5D3GA 4IRCA 2MQMA 2DCUB 5T41A 1S9GB 2YVSA 1S5ZA 1TL7B 4B3MJ 3GFYA 1Q4RA 4WZMA 2HQGA 2UUBJ 4UUXA 5KFOA 3JSMB 1XN9A 2LFVA 4C3KA 3WIVA 4KO0A 2O01C 1FNOA 3HJVA 2MYFA 4YY3F 1AYEA 5C24A 1Q1KA 5D4LA 3PG9A 2H51B 2BM1A 2UUAF 4WP9A 4BBYA 2XSJB 4M95A 1SI9A 4IH5A 2QYCA 1RWNB 1LWCA 1P1LA 3H98A 2FLOA 2Y0BB 2KDOA 4MKVA 2OEMA 2DO4A 2DRBA 2A3JA 3D67A 3UI3A 2FB0A 4ETXA 3N6NA 2V8GA 2LDYA 5HMYA 1Q8BA 5MLCV 1RT6B 4DV4F 3H0PA 2UVWA 2Z2LA 5D0RA 3T1YF 2YQ1A 1EP4A 3U27A 4OJ1A 5FDLB 4D3HA 3TA2A 1SKWA 1CULB 4PKDB 1N56A 2P8IA 1WC3A 5F0UA 2Y8WA 4ERDA 1CVJA 2ZE2A 3HLUA 5HMWA 2AEMA 4USVA 2DGVA 4K4VA 1SH0A 3UE2A 2OFHX 2E7WA 2QSWA 2GMLA 2X1BA 4IQXA 2OTLS 1CG2A 4ZVGA 5DGAA 1C0TB 2AP6A 2CA9A 2DVIA 3DNCA 2AJ4A 4ZMMA 1KQKA 4QPXA 2FLLA 5T7LA 2HFNA 1HLWA 3PO5A 1BWEA 4DDFA 1CPZA 3HFZB 3EGZA 1P6TA 3FFIB 1G1XA 1U1NA 4EO6A 3MMBA 2J5AA 2DGSA 1U8WA 2LQ8A 2VFTA 2IM0A 4LF2A 3TVKA 5GAEU 3MHYA 3AJ1A 1APSA 2MMYA 1U24A 1U1LA 1SH2A 1PSDA 2RSQA 2DB1A 3CJQA 3ZZUA 3LGMA 1X5SA 1F5CA 2MY7A 3CJTA 3EZOA 2ZJQQ 3NY0A 2XY7A 3Q89A 6FD1A 4ZLPA 1UKUA 5KFBA 1T0TV 4YMEA 2AX0A 2K1RA 1CEZA 3T1AA 3OL8A 4B9NA 2QIFA 1FKPA 2JVRA 4GVLA 1VQ4S 1JNZB 5FLXU 5E3QA 5C42A 1TL4A 4KH0B 2ZH2A 2QJ3A 2F9DA 2XMAA 1HNIA 2OPPA 1T9XA 2GGPA 3OPKA 3OFHA 4DR6F 1N5YA 3QIPA 1I51B 1M5PC 1HQ2A 1RHQB 4UQGA 2XB2D 5HP1A 1WEZA 2BKNA 3CD5A 3W63A 1OO0B 5AXKA 1FT8A 1E6VB 2KTQA 3NGRA 3GJSB 2J0QD 3ENQA 1QLNA 3GYXB 4DR5J 4NXNJ 3ILJA 1KVIA 2LLZA 1RLCL 1L3VA 1RGVA 4Y3CA 1KTVA 2ZOFA 1X0PA 4HDGA 4OJHA 3DRXA 5F8MA 1H73A 3CUNA 3K0JA 1DHMA 3TZXA 1X9SA 1KWMA 1GTHA 3HT0A 2GA7A 1JLCA 1Y11A 3Q8QB 1B0VA 2IVFB 4MFBB 1RT1B 4DV1J 2AJFE 2B5JA 2DTJA 1TL3B 3QSYB 4DV2F 2X1AA 4RBUA 1U1RA 4EZ9A 4B3RF 3IRWP 4WXOA 1ZS6A 2IFXA 2LQ9A 2ZDPA 2VQFJ 2R2RA 1CJTB 2FDNA 7FD1A 3RU0A 3CCZA 3HP6A 2E5JA 4QCLA 4RW4B 1AXQA 3HFKA 4KAIA 4NYZA 4RWWA 4FPRA 2DR7A 3DLLQ 3R1HA 1YKWA 4M94A 3V4IA 3QJLA 4M5KA 2OPQB 5LMNF 1S4FA 1FXLA 2KU7A 4LF5F 2HIYA 4E98A 4CDIA 3DGPB 2AD9A 3FRZA 4A8QA 4GC7A 3BSOA 2K7JA 2MKKA 4OI4A 3DLEA 3CJ3A 4L72B 3A3NB 4E8UA 3QZ7A 4V19X 3PO4A 1SC1B 1RWXB 3SBMA 2WOMA 2OIHA 1FHTA 1O5JA 4DX5A 3FSIA 2YNIB 1X8DA 3ET6B 2R4FA 4ZJLA 2GO9A 1FJCA 5DM7Q 3GPAA 3KHGA 1GMWA 3D4JA 5J1EA 4LF4J 3PCOB 4OL8A 2KHDA 2MGZB 2XEXA 2WSFC 3AD9C 3LP1A 2D1CA 5H9EK 2XYPB 2DHGA 3PFOA 4CO1A 2YKMA 4LRFA 3DN9A 1U02A 1R0AB 3MPYA 1QJHA 1N34F 3KLIA 1FFSB 2DO0A 3MECA 2JC0A 5LSRA 3MPWA 4U7UD 2C3MA 5GADU 3Q8SB 3O5TB 3KK1A 4DEZA 3BSCA 4LMZA 1XMOF 1SC3B 4QOTA 3DI6B 5E5NA 4DR4J 5AE3A 1N6QA 1HNVA 2MLZA 5CYMA 1M1GA 4PWUA 2CWXA 2RD5C 3C6TB 4K2XA 3FEXB 4F4YA 2NS1B 4K4WA 3OL6A 4LRBA 2LCWA 2NUHA 3CCVS 4ZP8A 5EHHA 5LXRA 3G8SA 2D41A 1ZZNA 1RWOB 4RNFA 3GJQB 3PDNA 4IG0B 2RF2B 1NSKL 4L74A 4TY8B 3KLFB 4ZN3A 3PEJA 1GNKA 4FS1A 3W8GA 1AFJA 4F4AA 3TR5A 2W01A 1YIJS 4NA3A 5AJ3J 2RUGA 1DLOA 4RJVA 3JAMU 2PMHA 4DX7A 4U8YA 2KRBA 8ATCB 5KFCA 3D5MA 2KO1A 5H9EJ 1GAOA 1NZ8A 2X1FA 3EUNA 3UN5A 1MMNA 4C0BA 3GJTB 4AQYF 1D9DA 4NA2A 4ECRA 2EWHA 2ZJPQ 1S0VA 1UWAA 5AXNA 1ZA2B 3FSXA 4DFMA 2ILZA 5F8GA 2EFGA 1N0UA 2YNGB 3CJ2A 5HJXA 1EHWA 3HD1A 3G6VA 2FJVA 1GXUA 2XM3A 1BXNA 1RWMB 3CMES 4M63A 1AZSB 4YQWA 2V67A 4LJMA 3T6JA 2BA9A 2ZBRA 4J7CA 3K5LA 2KHCA 3C16A 3NOCA 2Z57B 1FVSA 1WORA 1T3NA 4LFBJ 4HL9A 3L7UA 5JXSA 3N5BA 2CJKA 1JLEA 4J9OA 1HNZJ 1SQEA 3HDSA 2AW0A 2AEJA 1FKOA 1FJGJ 2ZDOA 1K73T 1T9YA 2AGPA 2XG8A 4KSEB 4CYUB 2VPYB 3PZPA 2Z0GA 4I2QA 1FE0A 2V8HA 3LF0A 2WW4A 4ZVSB 1GEHA 4Q43A 2BJ1A 3NOGA 2RHSB 3R5JB 4RBTA 2AIRB 2H48B 1YRTA 4NLWA 4P9SA 4FBUA 3TAPA 3HO1A 2GO8A 1DBDA 4PG7A 4YB5A 2E1MC 3MEEA 2W2MP 1FRJA 1JLQA 2W25A 2WONB 2WZ1A 1QVGR 3C14A 3TJ8A 2ZH3A 5KG1A 1C1BA 2NR0A 3TO8A 5L46A 2XY6A 2Q79A 1UW4A 1TUWA 4ED2A 1EETB 1WOOA 1X4GA 3W5ZA 4LF9F 1RCXB 1YVFA 4A8YA 2VC0A 2CVIA 4HI2A 4Z2XA 3ITHA 3KHLA 3FQKA 2FJAB 4N47A 3IR6B 1TELA 3E01A 4S0MA 2M5YA 2H4WB 5EUHA 4KH1B 3BM7A 3A3OB 1RT5A 2BQRA 1O6XA 3MR5A 3BO3A 4CH7A 2XNRA 5GAHU 2CPEA 1URRA 5B0GA 3UWTA 2R8GA 3AD8C 2MLXA 2BE7D 3KK3A 1HHTP 2XYHB 4EFAC 5J2NA 2I5JA 2O3DA 4DV5F 2FPHX 3EGWB 3C15A 5IQ6A 5LMUJ 4DQRA 3EXCX 2FGCA 2PI5A 2FTRA 2HVZA 3QPIA 1V9OA 2XO6A 2C2EA 4NCGA 1LW2B 4NLGA 3O3LA 1S9EA 2JDJA 3HVAA 2JSXA 1S79A 3HK2A 3VALA 1N0VC 1MNEA 1IUJA 2BW7A 4C7QA 3MUMP 2WK4A 4Y2IA 4TYBA 2GFFA 2YNFB 1M1HA 3UD3P 1L3KA 3C46A 4F4WA 2J7KA 3HMJG 1GMUA 3D7SB 1W2BR 4ZPDA 4ZHRA 1U6BA 3UD4P 3MM8A 1ZTTA 2MSSA 5B0AA 3ZXWA 2RDIA 1BQNA 1P9QC 5J2MB 4YFUA 1W26A 4JI5J 3UO0A 1OIAA 2MY8A 1J2VA 1Y5NB 1UJ6A 3UN2A 3NP5A 4B3TJ 1KRPA 1JXLA 2JLGA 2DHAA 3GE9A 2BEFA 3CD7A 2V8VA 3NS5A 4DL5A 4JI8J 1NDCA 4Q44A 4KQZA 2IBOA 5DDRC 4MTPA 4KRWA 3JYTA 1FDDA 1VLOA 1X60A 2JJ4D 3N0VA 3M2UA 5J2QA 1UVMA 1XMBA 2ZZTA 1NHUA 3GG1A 3G9CA 1CJUA 2NXCA 3DU6A 3TA0A 5SUHA 1HNXJ 3WC0A 2W4DA 2ZNZA 1I3OB 4DUZJ 1R6YA 3HHEA 5CH7B 2HRUA 3C2PA 2VA2A 1JKHB 1RWVB 5D4OA 5LM7E 5HQLA 4FYXB 4WWSA 4ZP7A 2X51A 2QEXS 2PA8D 1TK0A 3N6LA 3QWPA 3RTVA 1WTBA 4OI2A 2E1AA 3A8JA 1RA6A 4ZJQA 1QSYA 2XS2A 3D0HE 1M0SA 2ZM6J 4K0KF 3I55S 4BWJA 1Y3JA 2DIVA 4NMLA 1TKZA 9RUBA 3DHXA 3QLHA 1TZ0A 3IS9A 4DF4A 1MN7A 2ALZA 4KFBB 3VAIA 1OPZA 3LANA 4ED0A 2VH7A 5CYJA 3QO9B 3MMAA 2DPJA 4BS2A 1M5SA 2KXHA 2HNZA 2E5IA 2CG8A 2IJFA 4X4SA 4OI3A 3H42A 2BM0A 3M2RA 4C2MA 2GVDA 4JI7F 3K58A 1RAFB 1DTQA 1U1KA 1EQMA 2IHR1 4LR8A 4YUDA 1I94F 2YNHB 1V5IB 2MHEA 3DRRB 2HEKA 4L73A 1YG0A 1Q16B 2DNHA 3A1YG 3GYNA 5HROA 4GO5X 1WHYA 2ASYA 3HVRA 1KLNA 4DV0F 3UD5A 3DOLB 4PCQA 3MDFA 2KG1A 4LF7J 2VBXA 1OMSA 2E1RA 3NCPA 1LFWA 2C3UA 5F8HA 1WC5A 1Q95G 2VQEF 2FHJD 1K9MT 2DHSA 1UEUA 1UVLA 4F25A 4ED1A 3PIOQ 1VFJA 3WHIA 2V8DA 5KG5A 4C8MA 2QLWA 3NXZA 3T5JA 5A0YA 3K5OA 4O3QA 4WFNQ 1H2VZ 2FYXA 2XYGB 2VUGA 3JXOA 3G86A 3HZGA 4KGMA 4DLEA 3AA8A 3GV7B 1REVB 3SV3A 4A4JA 2V9WA 3PACA 3O44A 4ED3A 2YWGA 1FTCA 1S9FA 4G1QA 1KHVA 1RT6A 2A2CA 3I82A 4I56A 5DQGA 4AFFA 3MMJA 5FDLA 3UQSA 2AJ2A 4GKJJ 2FY8A 2HZCA 5ETPA 1RB0A 2KKHA 2L41A 4RPFA 3KJFB 2HHUA 3K57A 4PEOA 3I32A 1RWWB 4JV1A 2NXUA 2DR6A 4PXDA 4OHXA 1B64A 1RHMB 1NDLA 2BKOA 2OAUA 3QWUA 1A6LA 3B78A 1F6TA 3W2VB 1Q78A 2IC3B 1H38A 2CKWA 1HI1A 4EGLA 5B0EA 3TEHB 2X3GA 4FKXA 4W4MA 4FYDA 2AEFA 2UUCF 2VG6B 3VF0B 3V6KA 3FJ2A 4ES1A 3AXKA 1JMTA 3RBZA 3C6UB 3PFEA 3NBPA 2H4YB 1ZM2A 1HQEB 3H4DA 4OZ5A 1NPRA 2YKQA 1TP7A 4QU7A 2KT3A 4ZLLA 3DLKB 3TI0A 4H4KC 2HHSA 3DOKA 4Y65A 2BQ3A 2NZCA 2GHPA 5ETSA 1R7IA 3CO0P 4Y34A 2HS0A 4B17A 3KYLA 3OFGA 2HAIA 2P9CA 3CPWR 3MURP 4IFVB 1NSQA 2WW8A 1JQGA 2YQ0A 4I69A 2CG4A 2BDPA 1H72C 4P2XA 1CJVB 3RYLA 1WOSA 2VICA 1LWFB 2J9CA 2L48A 5IWAJ 1JXVA 1J5OB 5LJ5Y 2GAGC 3LAKA 3HSGA 3FC9A 1TAUA 4ZVRB 4PXCA 4LR9A 2FJBB 5E3AA 4MKAA 4QIEA 5BYRA 4BCAA 2M4MA 1NJXA 2W24A 1FXDA 2GJIA 3W5XA 3GU0A 1UVIA 1RHJB 4DN9A 1YJUA 4CO4A 2PN6A 4DSIA 3SCLE 4MJKA 4PXEA 1YRUA 2GQQA 1L3UA 4M5JA 5EDWA 3HX9A 2CJQA 3G82B 1K44A 3JSBA 3CCQS 2VBZA 4JI0J 3WX4A 2V8PA 4WIIA 4F26A 1RA7A 2P6SA 1RT1A 1YJTA 1TL3A 1KNZA 2Q3PA 3K5PA 4FVCA 1IKYB 5D0EA 1S10A 1NEEA 2ZKTA 1CJTA 4ELVA 4OLOA 1PJ6A 3FSYA 3SCIE 3M8RA 3TOQA 1ULRA 2RHQB 1ZA1B 1CS4B 4ECUA 1WC6A 3QAEA 3VAMA 4NE9C 1N88A 1VCTA 2K7KA 2CIMA 4CT9A 2OD6A 5H1SV 3UPFA 3D1QA 3DFEA 2CPJA 1YQHA 3P4UB 4CO3A 2PFDA 4QYZJ 2WHOA 4A8OA 4WK1A 2FLPA 3ISZA 2KYZA 2WRMA 4N76A 2R2SA 3DDNA 3S8SA 2BQUA 1GX6A 2HG4A 1GXLA 3KUGA 2MSTA 1R8PA 1BQMB 1HBUA 1HBNB 2V68A 2AWZA 1PYOB 5JUMA 3ET6A 2IAJA 2CDRB 2HQIA 4B9VA 4ZVTB 2EFQA 1S6QB 2XY5A 4OMFG 2EXUA 4UOCA 3W62A 2NZ4A 1AW0A 1CQNA 3VZHA 2KVQE 3CDBA 4DPYA 2O66A 4JP8A 2RQKA 3PYEA 3N4WA 2VB6A 2V34A 1R0AA 3Q24A 1BE4A 2R7SA 3L09A 3OQ2A 4XAKA 2CYYA 5EWEA 3VGUA 4YR2A 3MOZA 3AD7C 5I3PA 3BKUA 3A12A 4OZ3A 2LQJA 3M9OB 5A8RA 2C42A 1UMJA 2VPWB 3DI6A 2OFGX 2KJWA 4OZNA 3BBBA 1F5BA 3TUJC 4O3RA 1F2GA 2PGCA 4WKYA 3ADAC 2IBKA 4NI2B 5CYQA 3I5BA 4O4GA 3CO9A 2O1PA 3X3UA 2ASLA 1HBMB 1Y9OA 4F50A 2B7CB 2OI2A 3EDQB 2CQGA 5L38A 3NNHA 5L1IA 1HIYA 3DU5A 2MZTA 4LF1A 3CNQP 2DR9A 3B4MA 5IFMA 2N3LA 3RBEA 1UFWA 1IKVA 3H40A 5IXUA 1AT1B 5HQMA 3LA0A 1UZHA 5CXTA 2GJ2A 4O44A 4EWTA 2HHXA 4KPYA 1Q86T 1FFWB 4DI6A 1NAQA 4XPEA 4NLXA 4TY8A 3KLFA 4F4XA 4GC6A 2V2KA 2ZJRQ 3R5DA 1MG7A 2VV5A 2PIIA 3CDAA 1U26A 1DURA 4G6VB 4NWBA 3DYAB 3BQ1A 3OJUA 2D74B 2IIHA 3GYGA 4F4ZA 4X64J 5KG7A 1HYSB 1FO1A 3MM7B 1A7GE 1S6PA 4YB7A 3OXLA 4JI4F 5FD1A 3QRPA 3IMQJ 1IR0A 1WSVA 1SB6A 2HZAA 1VI7A 2E66A 1XWLA 4ECYA 2POKA 2E5HA 3D9BA 2JC1A 3O6QA 3I56S 3AA9A 2A0FB 4H4KA 4LRAA 2QL5B 2FY1A 3RRKA 4LVNP 2DNZA 2V5HG 2WCXA 1JLFB 3AOAA 3QT7A 4CM0A 1RU2A 2FJEB 3JTOA 3K89A 3PRBA 1KVJA 2VJUA 4R5PB 3MTKA 4ICLB 2J76E 3BZQA 2JZ5A 1R8AA 1VQSA 3HVTA 4PYDA 2F9JA 5HVHA 1X5TA 1WKJA 2Q66A 5KFFA 2RVJA 5A2QY 1K1QA 4IR1A 5GAGU 1Y00A 4K5SA 3O8WA 1L5UA 1XC9A 2V0NA 2CPIA 1OY8A 4TQSA 5FIIA 4Q0BA 4YY3J 1U49A 3BF4A 3GWCA 4LSLB 3VVTA 2IM3A 3CJ5A 3J7AN 2R7XA 2W7OA 4NZ7A 3IBFB 3N9UC 2QRRA 4F2SA 2FVRA 3JSYA 4YHHF 3PYDA 1S1TB 2DNNA 3AB4B 2HK3A 3CCRS 3OLBA 2YX4A 5KT6A 2MZ1A 4X66F 1RBOB 3PTWA 4DUTA 2J6TA 2AX1A 5HSPA 4DR7J 3G6XA 4J91A 1LWEB 1R8HA 4DQPA 4FYWB 4C11A 3W9HA 4DV4J 2VD3A 5KTQA 5I4MA 5JMNA 4XDDA 1Y4ZB 1RTIA 4DHVA 2DEJA 4PG6A 1NK6A 3EYZA 3DMJA 1RAAB 1UFKA 1S0NA 1QUPA 2D9OA 5KFQA 4P71A 4PG8A 3NEKA 2JOQA 1PCAA 3BYRA 1GMWD 5DQHA 2QZ8A 3LP2B 3MPVA 1NK8A 3GSDA 2KT5A 2CNLB 2PEHA 4JI2F 2NSCA 4B3OA 2GS8A 4IRKA 5HATA 4WE1B 2L9WA 3AFGA 2D3OR 1K0VA 5F8NA 1UEKA 3NS7B 3QRRA 3Q22A 2J8AA 3T5LA 3S6EA 1I1GA 1U6FA 4JUZA 4RNHA 3MEGA 2B9YA 4UY85 1GFWB 2Q43A 4LFAF 4MYTA 3I9ZA 3IGNA 5L8RC 1NJZA 1RYRA 4O0NA 2PEBA 1S7IA 4PYAA 2EVZA 2B4OA 2WVFA 2EW9A 3OTOF 2XLIA 2ZC3A 5DDOC 2XZTB 4FVMA 1EQ0A 5T14A 5F8IA 2MJNA 4CWBA 1OJ4A 2RDJA 4DR2F 2Z4PA 4B9LA 2KT2A 3PJWA 4IFYB 1H74A 2V9KA 3K59A 2M70A 2GHVC 5HLFA 3GIMA 1VC6A 4DR6J 1R0CB 4DFJA 1VBYA 4HH1A 3MF5A 1RAEB 2A10A 1U2CA 1TFWA 4NOHA 4A46A 3OVAA 5K8MA 3HFVA 2CQIA 2DXEA 2XTJP 4HTIA 3R7SB 2MXYA 5D8HB 2EI5A 2DY9A 1KC8T 3WZ0A 2XSFA 1S6OA 2V6AA 3CULA 2W9AA 4UTGA 2GW8A 1S6UA 3F0NA 5IT4A 4WP8A 4LF6F 2UXBJ 1IN0A 1GK8A 3JQJA 1SJFA 4DV2J 1Y5LB 1O0PA 4NZ0A 1KN6A 2ZHBA 1M5HA 4URGA 2R8KA 5CQGA 3GJRB 1BWVA 2DR5A 3P5TL 1Q8LA 2I1RA 5B7WA 3TYTA 1JJ2R 1S1XB 4WTYA 3GFXA 4DSFA 4OX6A 4DPOA 3BGOP 2FIUA 4O3NA 1TMMA 3I0SA 3W64A 1H7XA 3U7JA 1YJ7A 3U02A 4LF5J 1FEEA 2QMWA 4KFBA 5K14B 4D3GA 3CCTA 3R7NB 4TVAB 3V6HA 2DITA 3DC2A 3FK4A 2RDDA 5KFWA 5EX3A 2K3IA 4KTQA 2V94A 1OYDA 3QO9A 2BW2A 4ZKAA 4O0IA 4KHPF 1RWPB 5IC4B 2HGMA 3W2WB 1WDDA 4OI6A 2BE9B 1S0MA 1M5OC 3CB4A 1J5EF 1XTZA 2HBZB 1U0HA 1WOPA 1WI8A 2PE8A 4HT7A 4UUWA 3IC1A 4A47A 2W2NP 2YNHA 5CD4H 3EMTA 4Q7AA 2GZOA 3DRRA 3NAHA 3J80U 3RB3A 3RG6A 4OJ3A 1HARA 2CQ1A 2MKSA 3D0IE 1FD8A 2CQPA 3LWLA 4ETZA 2R2TA 3DOLA 3KLHA 1TAQA 1UL3A 5G4DA 1FRHA 1C4AA 3EXYA 3HHDA 3GMGA 4JI1J 2UVVA 3NLCA 1T94A 3MAHA 4ZS6A 2CWKA 3OHAA 1NH8A 2WVBA 4I7FB 2Z8QA 3LO3A 5B0CA 2MQNA 1TKTB 4ITSA 3K7RA 1FVQA 1ZETA 1N32F 1V3SA 5AXLA 2DRDA 2B9XA 2DKOB 1N34J 3M30A 3G8TA 2LECA 1K8AT 3MCOA 3R8YA 1NKEA 5A8WB 1AFIA 3PW7A 3G71S 3R7BB 3RB6A 2BE2B 1CQMA 1REVA 1GT8A 3QQCD 1S1VB 4N7TA 1RU1A 4P7TA 2Y1IA 1DQAA 3OT9A 2DPIA 4Y2MA 2GNKA 5DLGA 2CNKB 4WYLA 2UXDF 2Y1JA 4FXWA 2DNRA 4HTJA 3M32A 2HWIA 3AQPA 2Q1LA 2R7WA 5HVFA 2W1BA 2VHGA 1WEYA 2QE5A 1ROFA 4ZA1A 2M0GB 3POTA 3TAMB 1SKSA 2RMLA 3UVJB 2VPZB 3M8PB 4RW9A 1EARA 2NREA 4QIWD 1JLBA 4XTTA 4NCBA 4N8OA 1UVKA 2OKQA 4KB7A 1SL1A 1KS2A 1Z1ZA 2N4DA 3D2WA 2BOAA 2DNYA 4IR9A 1HBOA 4TU8A 4PPDA 1N33F 2BOPA 2HFSA 2CQ0A 4I2PB 2OUGA 4PQUB 3A8IA 3W5YA 2KXNB 1RT2B 2FZCB 1U0SA 3DDIA 4DN0A 4CLUA 3RB0A 3KDNA 1HA1A 2L08A 3TX0A 4X4PA 2JRSA 1KVKA 1EX8A 5LXYA 2LA4A 1TKDA 3BBCA 2NQPA 4OQJA 3CJ8A 3RZAA 2ZH9A 4USKA 4PG5A 2E1CA 2VQFF 3M1VB 3FEZA 1FDBA 5DG8A 3CWJA 2WAQD 4I6WA 1LW0B 1S1UB 2VIHA 2F8HA 2HHHF 2C1EB 3DDKA 2OPRB 4M5GA 5E2QA 4KT0C 3TARA 2X1GA 3W1YC 4QJVA 4QPTA 1FD2A 2J7UA 1CJVA 3MCNA 3B4DA 4PWDB 2WBMA 3R27A 1LWFA 3EX7B 2CJYB 4FF4A 3EJMA 3R5AA 4QR1A 1RTHA 3NMRA 3I0RA 1N5SA 1S72S 1UWBA 2RE1A 1L3SA 2EG1A 3PW2A 1MWYA 2RU9A 2VASA 1X5OA 1VQPS 3GR0A 3Q8UA 3I9V9 3M4XA 2G2ZA 1UVNA 4N41A 4L75A 2CPDA 4B08A 2ZWOA 4MT1A 3M2VB 3VAGA 3TX8A 1SL2A 4DQIA 4AXJA 1HWLA 3LP0A 2UZAA 3GFHA 3VAJA 3ZTSA 1NHVA 4DOZA 3MAAB 1QAXA 1X7VA 3CXCR 4UZCA 3P96A 3T3FA 3G82A 4OYBA 1U4BA 4PABA 1TTHB 4LF4F 2OELA 3TA1A 1CJKB 2ZD1B 4FF1A 3A4TA 3RR8A 3HSDA 1YWXA 1D9FA 3BO2A 4PUOA 4UOGA 1T05B 1J27A 1N4LA 1IBKF 1VISA 4DS4A 1VGYA 4DSJA 2XMUA 4BWMA 3NG8A 1FI4A 2XGPA 3FCHA 4LF9J 3GCXP 3D54A 2FVSA 4JV5F 3MZIA 1UP1A 2IPOB 1WI6A 1OWXA 1PAEX 3HHLB 3HJFA 1MU2B 4YN3B 3J7ZT 2HQ3A 1HR0J 1YDLA 2GV1A 2BBEA 1R89A 4YEAA 1KTQA 2BV3A 1NJYA 2LU1A 5F9NA 4KY3A 2NUUG 4DZDA 3CIMA 4WK3A 1KQGB 4XO0A 1U25A 1XERA 2R8IA 3OVBA 1IKWB 1KQFB 4HHHA 4AUKA 2KM8C 2HW3A 3MM6A 2UU9F 5I42B 1UA1A 2B56A 1HBNA 4X2BA 4ZVQB 5KFZA 4ELUA 1Q0NA 3DXBA 4I4BA 5C25A 3D28A 2PD1A 2OPSB 4F3QA 5KFTA 3T6BA 1S6QA 3CSKA 3QFWA 1IKXB 3KLGB 4RW6B 1AROP 2WSCC 5BR8F 2RJZA 5KFAA 5CCLA 1JJCB 5CAAA 2B51A 4I6YA 2LXFA 1FE4A 1M90T 4AT1B 3QIDA 5AJ3F 4CO5A 5EWGA 2GMJA 2Z30B 3THPA 1TV6B 4ZCMA 2BR0A 1HMVB 3M8QA 1YTYA 1D9AA 3BREA 2XMWA 2C2OB 2G2OA 2I8EA 1XK8A 1KD1T 1LXNA 2DNLA 2W9BB 4RZRA 2A6MA 1VMBA 2IMOA 1JLAB 3M05A 3UDEA 4P74A 3IG1B 4DV6F 1VJWA 3CMQA 2ACYA 3AODA 2DT9A 2WB4A 3L3CA 3BDPA 5FLXY 4GKKJ 3BGRA 3IBCB 3THTA 2L3MA 3K8WA 4CIOA 4ECWA 1MWQA 1F1BB 5D3GB 1EZZB 2XWYA 3MOJB 2DNOA 4KHMA 2KFNA 1YLXA 1HBMA 4UF4A 2HFOA 3NKYA 1YRXA 2GIFA 1HD1A 2OMOA 5A76A 4I1TA 4KYZA 2JEIA 4KO0B 2J8SA 5THWA 2PMZD 3PX6A 5LJ3Y 3H2LA 5C24B 3PKMA 5EGYA 1TL1A 4M5LA 5ETTA 1HNZF 1HWKA 2EG2A 4PPZA 1KSPA 4WPAA 4DCOB 4M5NA 4EBDA 2IM1A 3HD2A 1O8BA 4O3PA 1LWCB 4K0KJ 3MM9A 4RWXA 2F63A 2I0XA 2F1FA 1BQXA 9ATCB 3MD1A 2MZQA 4NMXA 4P2FA 2LXIA 2AF6A 4ZN1A 2V2QA 3IBWA 1DQ8A 2JLFA 2W8LA 4DWIA 4ED5A 3ZTPA 3FZBA 2GIQA 3H8YA 3GV8B 3SV4A 1F5AA 3H2UB 4MKBA 3A13A 2OSRA 1EP4B 2PSZA 3Q8PB 5KG0A 3PW5A 5AT1B 2HRTA 4KC5A 3HHKA 4G1IA 1RE1B 3TZZA 1SKUB 3UCZP 4YOEA 1NPKA 4JI7J 1FRMA 1NK0A 4ICLA 4Z7YA 1I94J 2R42A 5KFVA 5KFHA 4WU3A 2HMIA 2V2ZA 2HLUA 2NXJA 4DL4A 2VKRA 4KGXB 1C0UA 2DNKA 3A3PB 3VQSA 2ZWPA 3M8YA 2KJVA 5T7LB 1SH3A 2JEJA 3ICLA 4IOAQ 3H5UA 4Z37A 2UV8A 4ZCKA 3BS9A 3PIPQ 3IFEA 1T03B 3H5SA 2KYXA 4NLRA 1OY9A 3DRPA 3MMBB 1OQ6A 1HI8A 1FDNA 3CCSS 1RZMA 1S1TA 1TMJA 4R0EA 4U67Q 3R5GA 1B4SA 1QE1A 4IOCQ 3BH6B 1T9TA 2X3DA 2NPIA 2CAJA 1NDKA 4J9RA 2P9EA 2GC8A 4ID5A 2R7QA 1S48A 3DXSX 3NWGA 2ZITA 2CADA 3CJKA 2G4BA 2K1RB 1FKPB 2EK6A 3VQTA 3UCGA 4R8UB 4UY8T 3JQKA 2SXLA 2BABA 1YJVA 2V4RA 1JX4A 3CDWA 3T41A 2HBRB 4DQSA 3FUYA 2HS4A 3SCJE 2N3OA 4ED6A 4C6AA 1HNIB 2OPPB 3KNAA 2GGPB 2R7TA 1GMVA 5HMXA 4NL5A 5IS2A 4RNOA 3SSSA 3VWSA 1N5YB 2XCAA 2FVCA 5D6GA 4DR1F 1NPPA 1ZPWX 4MYUA 5HP1B 1YK9A 3QGPA 3LP2A 4LSNA 4ANEA 1FCAA 3PNIA 2BJ7A 2QGFB 2HVIA 3CW2C 2XO7A 3MM5A 1JWWA 2YPZA 4H4MA 1M5VC 2F4VJ 1QAIA 2APOA 4F7VA 4NYPA 3KLVA 1WHWA 3HZEA 5E33A 4WE1A 3NWRA 2B6AB 4CLFA 3KJVA 2U2FA 2ZHOA 1JLCB 1C4CA 1JLGB 3F73A 1EAYC 2IA6A 4EU0A 2I9SA 3F44A 4C8YA 1IWAA 1IBCB 4BC9A 4ELTA 1UVJA 1U48A 4W92B 1S1WA 2L9DA 1F3FA 4LREA 3U1MA 2M8HA 1RABB 2MQLA 4JOUA 2JWNA 1R43A 2G0CA 2WVEA 1CBKA 4FNIA 4CO2A 1WSRA 1W2IA 4M1KA 3JAMY 3DOMA 1P1TA 2F3JA 2DH9A 3V4IB 3KMSA 2C2DA 5ETKA 1ZAXA 5D0GA 2HK2A 4FYYB 4IFYA 4LUBA 5KT5A 2B4PA 3CTRA 2RAQA 2VKZG 3OTBA 2IVMA 4B9UA 2LVWA 5SZTA 1RT3A 4HDHA 1SC4B 3P6YC 4NLPA 2IDLA 1IM6A 1SPBP 3PW4A 1SC6A 2HHWA 2QSFA 2CQBA 3HSZA 3W65A 4NA1A 3DLEB 3BKFA 3J7A1 3UNGC 1QTMA 1ACMB 3J81U 3T1HJ 3EVWA 2LP4A 4KV8A 1N54B 5CZXA 3FCVA 2B43A 4LBHA 5C2GA 1FJ7A 5IM0A 3KXDA 3FBBA 2ABYA 1R0BG 1X9MA 2ROPA 4NPOA 1NSPA 1XQIA 3R5BA 1NK4A 5J1EB 2HGLA 2C2MB 1PIEA 1TL5A 2F65A 2DGUA 3MWBA 3SQOP 1PILA 5J2PA 2E9TA 4ATNA 5HQ8A 3Q8RB 4C8LA 1SJ4P 3LW5C 4YR3A 3LP1B 2VFRA 3Q8YA 3ZTOA 3U1NA 4K2JA 1T02A 3VGSA 4CLLA 2YKMB 1YI2S 2AZ3A 1S1XA 3M8SA 3KLIB 5D15A 1S57A 1DAXA 3MECB 4IDKA 4ANCA 4KHRA 3HHLC 1A0OB 1X4AA 5KFSA 1JJHA 4NX9A 1RBLA 3KK1B 1P9YA 5KFIA 4A8SA 4RR5A 2F40A 4HI1A 3ZTQA 5K14A 1FK9A 4B9TA 2ZZNA 1VDHA 2ASJA 1N6QB 1HNVB 2NXEA 1RDRA 5CYMB 5D78A 2LMIA 2VG7B 4U8VA 3NCQA 3TUPA 1YZ6A 2RU3A 4C98A 1T9WA 2CPZA 1SV5B 2D3UA 4WP3A 4G1PA 1BUXA 3AQOA 3ZZRA 4IG3A 4F8RA 3N5FA 4LBIA 4DXLA 3CMAS 2IY5B 1T9UA 3PRDA 3KLEB 4O3SA 2YKNA 4TKTA 2ZHAA 4F3MA 2W4PA 5KFYA 1D8ZA 3KJQB 4M5IA 3KMQA 3FRYA 3BBFA 2OEKA 4EBEA 1XNQJ 1BLUA 1RTZA 1VRUB 3GONA 3Q23A 1FEHA 4UW2A 2CQHA 4I6AA 2EKNA 4QW9A 1Z2ZA 3PW0A 1SVDA 2XLJA 4A8WA 1UPMB 2DNQA 3IR7B 3B54A 4I7FA 4JI3F 2DRAA 2MQPA 4I0WA 1TKTA 2J6SA 3WX8A 2XMVA 1NUEA 1Q7LB 4FP9A 4HVZA 2A2DA 2MTLA 1RKIA 2F8MA 2VOPA 5KFMA 3TNVA 2VDHA 2YWHA 2VF3A 4LFCF 3HKZD 1Q79A 1S1VA 3EM1A 3SQGA 1RT4B 4RUAA 2CJAA 2RQMA 1B99A 1OSDA 2B3TB 5BJRA 2I6WA 1LXJA 1NH7A 1G7CB 3MMCB 2YWWA 1DARA 4J9SA 2GIRA 4WZQA 5K20B 5CHCB 3BQ2A 1HI0P 5IWAF 4ZVPB 4J90A 3D66A 5MAOA 1KOHA 1Z2LA 1F9FA 1OSCA 3IXQA 4Y2KA 2AQ4A 3FVYA 3QJJA 2UUWA 3C16B 4ILRA 4LVOP 2C3PA 2HQFA 3HPOA 3UVJA 2KRRA 4AE5A 2Y1RI 2KL8A 3FNNA 3M8PA 2GMHA 4NRUA 5K9FA 1JLEB 4QIVA 2VL1A 3UDLA 1RK8A 2OLWA 3W9IA 2J0SD 4PXBA 2EKYA 2D3ZA 4ZCLA 3D3BJ 2AZ1A 3UDVA 2G9OA 5FJ4A 5K8PA 2AHOB 4TLRA 2BKPA 4P10A 4OV1A 4FPIA 3AOCA 2E7XA 4DR3J 5IV4A 4I2PA 4URQU 2OGUA 2EBGA 4DPWA 1HHQA 3D6TB 2NCKL 5KG3A 3KOAA 3OFFA 5HBMB 1ITPA 2CRLA 2XHCA 3G4SS 2X7IA 4H4OB 2FC8A 1XBWA 4PWWA 5IT0A 1F2HA 4J9PA 2JEFA 2LU2A 2WVCA 4QR0A 3D3CJ 2HNDB 1TK8A 1BGXT 3KK2A 3OTDA 3V5RA 1JLQB 1FKAF 4RW8A 5AXMA 4HHUA 3UW1A 3C3LA 3C14B 2KH9A 2FD2A 1LW0A 3RJMB 5CD4A 1C1BB 3RBDA 2B7BB 2QA2A 5C5JA 2OPRA 2AT1B 4MH8A 3DCAA 1TK5A 3KG4A 1ZOTA 2HVDA 4NLVA 3TP2A 2L9NA 1IQTA 5JVGQ 1H3DA 4DFPA 3ITHB 4PWDA 1YJNS 1WC0A 2ZH6A 2OH2A 1U47A 3E01B 2NLWA 1IJEB 4Z7CA 4GVBB 2BJDA 3G2XA 3EPIA 1ZPVA 1VHFA 1BC6A 2XMJA 1XMQJ 4YDDB 2DNMA 4CLPA 4EZ6A 1VQKS 2R7VA 1YJ9S 3VTIA 2AU0A 3CDEA 1N5QA 4P72A 3CEDA 2UXCJ 3AJDA 4CH0S 1TQLA 2HIQA 4USJC 5DO2A 4ZITA 4YHHJ 3T19A 1XR7A 2BJ9A 5J2NB 2I5JB 3P45B 1DTTB 3OFEA 1S76D 3C15B 3VGVA 1D8YA 4WBFA 4P73A 2ILYA 2CPXA 3VV2B 3MAAA 3FDSA 5M2RA 1HPZA 5DS7A 4YP3A 4CLSA 4CP5A 1FRKA 1S9EB 4Y2CA 2K2PA 4CLWA 1HL6A 2AYBA 1NM2A 2FVPA 4NLDA 3B8HA 1RUSA 1FRXA 4X62F 2ZD1A 3QGHA 3SDEA 2VFVA 4EMDA 2RS2A 2DNPA 1WF0A 2EEYA 2YH0A 4IQMA 3NCRA 3VR1A 4F3OA 4V1Ak 1BQNB 4N77A 1WNEA 1C2PA 2HS3A 1XR5A 3HF5A 2IDEA 2OP5A 4P75A 2K3KA 2VONA 3WDOA 3TVYA 2Y1LB 5B0FA 1B7FA 1TVRB 4ECQA 3HHLA 1MU2A 1KOOA 4Q2LA 1UA0A 4JI2J 3KHHA 2JFDA 2V4JB 2J9DE 2AGQA 1B70B 1V3RA 4OIXA 1ZYQA 3QATA 2IJRA 1RBAA 4OYPA 3M2UB 1IBMF 5J2QB 1LK7A 4C48A 3TWZA 3CCJS 1IKWA 2OTJS 1F9HA 3MUTP 5I42A 2Q6BA 4HT5A 5HL7Q 5DLFA 2UVUA 1T11A 4YR0A 4LFAJ 4TQRA 4OZ2A 1ZM9A 1CSJA 2ZEJA 2AYMA 1IKXA 3MI7X 1KLMA 2HZVA 2CNNB 2DJWA 1VRTB 2AJ1A 4QIGA 5LT5A 2K8GA 3MD3A 4X64F 3FGVA 5G0RA 3KJNB 2CDQA 1TV6A 2XGQA 4DR2J 2XS5A 5E3CA 1HMVA 3MEDA 2QYGA 2W9CB 1ZH5A 4KE5A 3AOBA 1N48A 5GAEI 4K8RA 4DSEA 4USIA 1GQEA 3MMAB 1RAHB 4ZVHA 1SUQA 1TUVA 1S0OA 1VIOA 2HNZB 2RS8A 3BV8A 3I5AA 4L76A 4DUYF 1IVZA 1ELOA 5A8KA 1VQMS 3M2RB 2BJ8A 4K4ZA 5I3QA 4K4YA 3OR1A 1NB7A 1RT7A 1RTJB 3HSJA 1DTQB 3V6DA 2A1BA 1RWUA 3CIZA 2HNYA 1S49A 2NPFA 3R97A 3C19A 2AYEA 5RUBA 4ZPVR 4J9MA 3OUYA 2KVIA 5HROB 2W7AA 1ZAVA 2QL7B 4LF6J 3BGUA 4E2FB 5E3RA 5L1LA 4C8ZA 1S9GA 2KN4A 1TL7A 2IA0A 4OV6A 1FERA 2H65B 1U2RA 1SJQA 1TKXB 1R31A 1WWHA 3JSMA 4QWEA 1AUDA 2BRLA 2DD8S 3VAFA 2YKAA 3VCDA 1ZZFA 4CTAB 2H5JB 2EFVA 1WHXA 3VZIA 1WKKA 1BD6A 1VBXA 2HFVA 3T9NA 5A0YB 3IP0A 3QYYA 3CVKA 3R1LA 2XSJA 4ZPAA 4JI6J 3OD2A 4CT8A 2AMCB 4DR7F 3FMWA 2FZKB 4G1QB 1WDTA 3CJ4A 4RUBA 4X4VA 2NYHA 3IRXB 4K4TA 2E9RX 4KHPJ 2W7PA 4NYOA 4OX9F 2JH3A 4DG1B 1H0HB 2RRAA 1RCOB 1VQ5S 3IWNC 3OL9A 1J5EJ 1Y0HA 2G13A 2CXEA 1NMEB 3IAS9 5GMEA 4RLEA 4LIWA 1VK3A 1CULA 1JIHA 4WF9Q 1M5KC 3AH6A 3AT1B 1QY7A 5L1JA 5DDPC 3BPDA 4FDFA 4PQAA 1IBLF 3V4MA 1JB0C 3X1LB 3S01A 3MUVP 2VBWA 1C0TA 2BACA 2DGXA 3SYZA 4DQQA 2Z2YB 3UDCA 1WF1A 3KDOA 1T03A 1R6VA 2QA1A 2XI2A 1WD6A 3NBPB 4KKOB 4ANDA 4OHYA 1N32J 3OR2B 2AJ0A 4QZVB 3FFIA 3BN4A 5KFLA 3DOKB 1P27B 3RR7A 5CZVA 2XWXA 2VPXB 4NXMF 3PR4A 4C4WA 2E7VA 2GJFA 1LNQA 2ZNYA 4OFZA 3Q0AA 3SIPB 3PXGa 3PKYA 4K4XA 4USTA 3ZTRA 1YGYA 3F41A 3MEKA 4A8FA 2O67A 2H9ZA 4C97A 3Q2TC 4R8UA 4J9LA 2ATLA 1MSWD 3IM8A 2UXDJ 1Y7PA 5IT9Y 1YHQS 2MKIA 3LTOA 4LQ3A 2F5GA 1DRZA 4JV2A 1B0PA 1HWIA 2XS7A 2H1YA 3V81B 4C0OC 4F2RA 4QWCA 4J9UE 3FCWA 3IN5A 2MKYA 5J1PA 3PYFA 1FESA 1QAJA 1R3NA 5GADI 3IWLA 2J0XA 1G2EA 2ZH5A 3G6YA 1U2FA 4O3OA 3QGIA 3M9MB 4N56A 4KR0B 4DL2A 2CJ9A 1N33J 5JVHQ 1E6VA 4BDPA 1HNWJ 4A8KA 3VVUA 3CCES 1KBRA 2B6AA 1JLGA 5KAKA 1UW9A 4WFZA 3D68A 4MKYA 2UXBF 4CRJA 1XNRJ 2HHQA 2FHKA 2VODA 1E6YB 5EN1A 4MFBA 1Y5IB 2KFZA 4CM2A 3ILIA 3BJYA 3L7PA 4MIBA 2FJDB 2R7RA 2HHHJ 4KGZB 3GP9A 2OO4A 1VK8A 5ETNA 2JL9A 3KNGA 5HAOA 4N5SA 3RB4A 2B8PA 4RW4A 1KHWA 1U1PA 3EDRB 1T7PA 2CFXA 1R27B 2IMWP 4J5OA 4CZCA 4EI2A 2V2VA 4QIFA 2OPQA 4RU2A 4WYWA 1SJRA 2PO4A 1T8EA 1VQ6S 3H20A 1YZ7A 3ISNC 1FA0A 3TW0A 3H7HB 1OS5A 3DGPA 3GFZA 3R2DJ 3CJ0A 5F3ZA 4QQBA 4J9KA 1G4CA 4P2SA 2QMUB 3LOUA 2YWFA 4RKUC 2QC3A 2J9DA 1FRLA 1HBUB 2RB7A 1URNA 3OXFA 3E2EA 3Q86A 3I6PA 5AE2A 3OSPA 1WG5A 2IAJB 1QUVA 4WTOB 4DV3F 4NEYA 4Q2MA 4JYAF 5IQQA 3GG0A 3W3SA 2YNIA 5GMDA 1RADB 2M3DA 1TUGB 3OXGA 5KG6A 3L95X 2A18A 3WIUA 4ZJOA 4JI1F 1Q7YT 3QBCA 1MWZA 2Z56B 4LF8J 3VHQA 1SKRA 4ED4A 1IBKJ 4OHZA 3L4BC 2MGZA 4GRSA 4OI1A 2CVEA 4F36A 3ENWA 1WHVA 2VU5A 1NB2A 2ZH4A 1WG1A 4JV5J 3J7Z5 3I31A 3PY8A 3P49B 2ZBPA 4Y28C 5F8LA 3K17A 4F67A 4U7UK 5A8RB 1WF2A 2M88A 2YPYA 1X4CA 1D1UA 2LQ5A 4WFYA 4CO0A 2R2UA 2YX1A 3M7VA 2VG7A 5KT4A 1FX4A 2Z58B 5CYQB 4O4GB 3PX0A 3PYGA 2N4CA 1A9NB 1CC8A 1EIYB 2F7VA 1SV5A 5KFRA 4AXIA 2UU9J 2E1PA 1FWKA 2FZGB 2DHHA 1D09B 3C6TA 3RBXA 2ASDA 3QGGA 3CCWA 3OTEA 3KLEA 1IKVB 2WB1D 2KZMA 2C2NA 4O44B 5ETRA 5IZHA 3KTQA 3E3XA 3NGUA 2YQ3A 4CLTA 1MROB 3K5MA 1VRUA 4PZVA 2MHNA 1SQFA 3OL7A 3A8KA 5BR8J 2HBQB 4IG0A 2C2ZB 4A8XA 1MMLA 2LKZA 2RF2A 3C66A 4F04B 3PVXA 3K5NA 5GAHI 2QG9B 2QL9B 1H7WA 5C2CA 1FNXH 2B9EA 3LH2S 1NJWA 1S6PB 5J1NA 4R25A 2IRYA 5KFGA 3HHNB 2VG5B 4ED7A 4ES2A 3FZ2A 3GLJA 3JSRA 4DV6J 3N79A 4L6V3 2ERRA 4C0HA 1QTNB 1N8RT 3DM2B 1RT4A 4TU7A 3SSRA 1RQ0A 2UUTA 3R9LA 2JX2A 3ZNUA 1U1QA 3PHEA 2XI3A 3AXMA 3HVTB 5M2UA 4K4UA 2H3EB 3UFCX 3MMCA 4X65J 4WIQA 2YNGA 2CPFA 3ZZZA 5HANA 1FWLA 2HWTA 1RTDB 4F4KA 4JB8B 1EKRA 2XBPA 4QWAA 1AZSA 2HHPA 1FF2A 2C3OA 3W61A 4UT4A 1TU0B 4NLUA 4Q0BB 3CJSA 2RRBA 1S77D 1U1MA 4MK9A 2M8DB 2G0IA 4I68A 1GTEA 1D0EA 2R9LA 4P52A 2UUAJ 3CJRA 5A6WA 2IM2A 3RGIA 2HSEB 2QTWA 2MJUA 3S7RA 4CYUA 5KFNA 2NYIA 5HBMA 4DS5A 1N36F 4C11B 4H4OA 2E5LF 2IRUA 1XJWB 1NO8A 1H6KX 2HNDA 3TANA 2QV6A 1RTIB 1RXOB 1S12A 2Y9HA 1U6ZA 3CF5Q 1VQLS 2BANB 4QU6A 4ZLJA 3NGSA 3T1YJ 1YJRA 3DMJB 3I87A 2BJEA 2YH1A 2WONA 3OHBA 2BX6A 2VA3A 2F8EX 5L9XA 4RL1A 3BB5A 2JNJA 4DL7A 1EETA 4GVBA 3NGKA 1RHUB 4URSA 4DV7F 3NRBA 2YX7A 1WELA 4Y2AA 3UCUP 4B3OB 1HR0F 3OLAA 2CZVC 1AA1B 5DGBA 2ATCB 4ZVUB 3OBIA 4OYOA 2MZSA 2HFUA 3AHPA 3GIKA 4UOFA 3PX4A 1X4HA 3RW7A 1FDAA 1QVFR 2DHXA 1X31C 1DTTA 3BQ0A 1RI7A 2U1AA 4W98A 3J80Y 4R0JA 1H2UX 2DBBA 3MEGB 3HM9A 2C22A 4E0DA 2DY1A 5DJBA 4DF8A 2CZ4A 2GVZB 2GAHC 3THVA 6AT1B 2WTFA 1WKLA 2RQCA 4RBVA 4IO9Q 4X4OA 3MR2A 1L3TA 1LW2A 3BSAA 1RWKB 4RW7B 5A6PA 1I5OB 2HYIB 4V19J 3AAWB 2QT7A 4BHQA 1NK5A 2N7CA 5KG2A 2GCFA 2YNFA 4B3SF 3W66A 3TRGA 5HLFB 1OPIA 2Y0SD 1NXIA 3MXHP 1V3ZA 1YBTA 2M52A 2UP1A 3G96A 3TZWA 4DR1J 5J2MA 1CC7A 3CT9A 2JEGA 5EX0A 1VYAA 1TVRA 2W4CA 5F9LA 5ETVA 3ZZYA 5I3UB 1B7YB 2RT3A 2FQQB 4NZ6A 2V4JA 4GKKF 3US5A 1DJ0A 2FGOA 4K4SA 3TJAA 1NNDA 4MK8A 4PR6A 1IJFB 4LSZB 4NLSA 3D6MB 5DZ7A 2GQ2A 3I96A 2WBRA 4L3KA 3ZNJ1 2ZZMA 5HMZA 1KDNA 4B3MF 1RJJA 2RILA 5ETOA 2UUBF 3GCWP 2ZOMA 5B08A 2N82B 2DH8A 3GIJA 1U1OA 3NS6A 1V5VA 2ZH1A 1JKHA 4B3RJ 3MTJA 4L3NA 4ECXA 3PJ9A 2NXNA 3QT6A 2ZBQA 3W8PA 2XQCA 1VRTA 1JK9B 4U96A 3M6XA 3I0SB 4DJBA 1Q5YA 4B02A 2CNOB 2PC6A 2VDIA 1IM4A 4OHWA 2OMLA 2W9CA 5ETQA 3ZZPA 4OYWA 5LMNJ 4Y00A 1S59A 1U45A 4DZ6A 3RRHA 2BVZA 1W25A 1W7WA 1BY9A 5ITHA 3EPGA 4DPTA 3QZ8A 2IVYA 1U0HB 2MEWA 1RTJA 1IWGA 3QFHA 3PEHA 1RAIB 2CZ9A 4HR2A 5GVQA 4FXVA 1OQ3A 4ZVOB 3Q2SC 2YY3A 3LPEA 4ZVEA 2FHMA 1KR4A 2E29A 3JB9k 1I6JA 4GMKA 4F0MA 3KLHB 3BO4A 5K8OA 2OHDA 1NHKL 1TKXA 4AD6A 2HHTA 1ZBTA 4IUFA 2G1HA 4MIAA 3M6VA 4M5HA 3WBZA 3D6FB 3J7YU 2HRYA 4QR2A 4CTAA 4WKRA 1OY6A 1WTFA 2BRKA 1SBRA 1NU4A 1PC4A 3M30B 4CH1A 4C8KA 5KT7A 3BYPA 1RSCA 4QBUA 2MKHA 3IA0A 2LXUA 3TAQA 2FJXA 5BYQA 3IGVA 3B6BA 4LT6A 4WXWA 2EFOA 4NLYA 4DL6A 1VQ8S 2GHWA 3DRSB 1BMQB 2NSBA 2QLFB 3IRXA 1XMOJ 3OV7A 1SQGA 1LKZA 2RIJA 2W2OP 5L9NA 3M32B 4DG1A 1U8SA 3H90A 1UCNA 1MW7A 2RRNA 2V63A 2QMXA 4AL6A 4NLQA 3POTB 5K8NA 1HW8A 3L7OA 4YDXA 3KG1A 4XDCA 2PA3A 1X4DA 3T5KA 1DQ9A 3IWXA 1KFSA 4RW9B 2MDAA 4Q45A 2P2CB 1JLBB 4OYMA 4RX6A 2R7OA 3SI8A 1B3TA 2ZFHA 1HFEL 3DGVA 1XIQA 1HBOB 3W2VA 2IC3A 3FEYB 4H54A 2F4VF 4ENOA 4DSKA 5M2PA 2ZUAA 2ZC4A 4FZVA 4IKAA 3SFGA 4NXNF 4DR5F 2VG6A 5LL6d 1T3OA 4JI3J 1HQUB 4KKOA 4KJIA 3RAMA 1PJ7A 3OR2A 3C6UA 4F02A 2LEAA 5CCMA 1AUSL 3NNAA 4ZPBA 1HQEA 2VOOA 1DFDA 3TZYA 3HHLD 3GQCA 2DK2A 2H54B 4DV1F 2PDAA 4LFCJ 2VBYA 3DLKA 2A6OA 4RUCA 3BKTA 1JNRB 3HT3A 4AQYJ 4U6PA 1V6HA 4KGKA 4Q8EA 1SJ1A 2O5DA 3E8OA 3I5CA 3V6JA 4KIAA 3TEGA 2KXFA 4P2MA 4HACB 4IFVA 1PYTA 2Y8YA 2M9KA 4HH0A 1VRQC 4CLYA 1RTHB 4QYZK 4JBCA 3W60A 3I0RB 1N5TA 3V81A 2G2YA 1UWBB 1J5OA 1H98A 4KPCA 2F4FA 4X4TA 4CI0B 1LQ9A 2B9WA 2AYGA 2LA6A 1HHSA 1SL0A 5F8JA 2D7SA 2QLBB 4USHA 3T1HF 1C1CB 2QLXA 1WACA 4PG4A 2LYVA 3LP0B 3OW2R 4YS2A 1X5PA 2UV8G 1QD1A 4CCHA 2RKIB 4RNMA 4M5DB 2LEBA 2HQDA 3G8QA 2QN6B 4YB6A 3KG0A 3U1LA 1S99A 3M8ZA 1E6YA 4UZBA 3H4BA 2YKOA 1VBKA 3K8VA 2J6UA 3DKDA 4PUOB 2IJNA 2DGQA 4NEZA 2EFPA 1IKYA 2FJWA 3BGFA 4G3IA 4QYRA 1YJWS 2IYIA 4X4RA 1D3WA 4K5RA 3ZFVA 3EICA 3D0GE 4LIRA 1LK5A 3F56A 3GSIA 3ETMA 4I64A 3CC4S 2OEJA 2FUG9 4ILMA 2CPHA 4U9RA 4WU2A 1CS4A 4DPXA 2ZUGA 2E9ZA 3GIRA 5HI7A 3KUEA 3HXMA 5KFDA 4RUHA 1Y10A 4NRTA 4IOBA 4EK2A 3CCLS 2MLYA 2DGWA 4DR4F 5ADZA 1VC5A 3PM9A 1KKHA 5LSOA 3DHWC 3PRVA 1Z4UA 3I4HX 2KZZA 2P6TA 3MM6B 1PBUA 3WC2A 2J0WA 1NSAA 5DETA 3CD6S 1NDPA 1PGZA 3CCMS 4I67A 1VOMA 1WUUA 4DV5J 4B9MA 3T9ZA 4EUVA 1BQMA 4X4NA 3VAHA 5C25B 2FVQA 4CNZA 1PJ5A 1VLYA 4K7QA 2D69A 1VQOS 1XNQF 5GAGI 4KBIA 2WSEC 5IC6B 1TR0A 2E5GA 3FBFA 4X62J 2HBYB 2MB0B 3UN3A 3MCSA 1VQYA 4Y0FA 1N52B 3K2YA 2C2RA 4HKQA 1KP6A 3UR3C 4K50A 4J9NA 1F0XA 3ZZTA 3M8QB 1NKCA 4NASA 5HO4A 5IT9U 4FNHA 1F9EB 2BJ3A 1BHNA 2DNGA 4EYIB 1X4EA 2QX0A 2HAFA 3IR5B 4DCPB 3H5XA 4AL5A 1RISA 3O1LA 4RO0A 2VJVA 1ZTWA 2C2KB 3BH7B 4WFAQ 2CQ2A 1F3VA 3BGRB 1PG5B 5EWFA 3LPYA 3KUHA 2B4UA 4OZ0A 4WJBA 3B82A 3MR6A 3HVWA 2B0GA 4CLZA 1NBEB 4ZPCA 2W2PP 1IBMJ 2BXJA 3H2VE 3DLGB 2RQ4A 2YXLA 2R7UA 2V4QA 4ZIVA 4NI2A 1Q8IA 3CE8A 1QSSA 4DLGA 3LALA 3BEGB 7AT1B 1WC4A 1K1SA 1VHIA 1MLAA 2CJXB 3TVZA 3O2IA 1TL1B 4USWA 1HD0A 4N8NA 3ENVA 2HPUA 1MROA 2N7YA 3SSQA 4LFBF 2ZH7A 4IRDA 3ONQA 4OHVA 3M6WA 3MM9B 1NRKA 3M9NB 4CQ1A 4DR3F 2UVRA 4OX8A 1FJGF 1VQNS 4AL7A 3DYAA 2MKCA 4EEYA 1H2TZ 4KGVB 2ROGA 2QA4S 1K47A 5BXIA 1HYSA 3MM7A 3FBEA 2VG5A 2FLNA 4J37A 1WC1A 1LV5A 4O23A 5E3PA 4OZJA 3MCMA 2MPUA 4DUYJ 1DZ5A 3DM2A 3W9JA 4ZPTR 2IYGA 5C7PA 1G3OA 2DGOA 1JLFA 1LWXA 5HN0A 2PT0A 4P6QA 2H5IB 3HCXA 3RAXA 4R5PA 2HMIB 4WCEQ 2ZE2B 4Q5VA 3NAIA 1C0UB 2XMTA 4TNOA 1RTDA 5B0BA 1XMQF 4Q8FA 1UAWA 3N28A 1DY3A 3CGIA 2WVDA 4DV0J 3J81Y 2EK1A 3P5BP 1M1KT 3CCUS 2ADBA 2K06A 4FXDA 2UXCF 4FYVB 3DRPB 2XHWA 2ZVIA 4RNNA 4LSLA 3R5CA 2R8HA 3S1TA 2CPYA 2VQEJ 3CD0A 1PO6A 3NNCA 2EC2A 4TXSA 3R6LB 4IO1A 1QE1B 2GQCA 1FWPA 4XPCA 3DLBA 3RRGA 4FF2A 3EGNA 5HJYA 5KFEA 2Q6CA 4HYKA 2ZVSA 2VFUA 4ID5B 5LMUF 1EB0A 1X0FA 3ENAA 4LR7A 1PYSB 4ES3A 1HWJA 3CJKB 4MK7A 2ZOGA 2EFNA 3AB2B 3UR0A 3SFUA 1LWEA 1HW9A 4ZP6A 1X4FA 2FC9A 4OX9J 1RKJA 5LSLA 2BANA 2D9PA 5KOWA 1NK7A 2XLKA 6FDRA 2HVHA 5C42B 5KOXA 3HI9A 2CQCA 5KFJA 5D4PA 1LEOA 3BR8A 1NLKL 1O51A 3L9ZA 2AGOA 4ILLA 3IO1A 5L39A 3OTCA 4LSNB 3BR9A 4ECTA 3KKFA 3KFWX 1IBLJ 4JI5F 3QIPB 4UOHA 1T95A 3FQLA 3PV8A 2KB2A 1RP5A 3IM9A 3MM5B 2M7SA 1K0TA 4H4MB 1UEVA 3LGNA 4B3TF 1XR6A 2CUYA 1JXEA 2HLTA 2V69A 4WFBQ 2ALYB 1RAJA 5K5MA 2UUCJ 2HVEA 4JI8F 5KT2A 4FF3A 5HK4A 3KJVB 2YWEA 2PI4A 3QJPA 1RAGB 2QA4G 2VFSA 4BLGA 5KFUA 1ZAWA 5GMKa 4LBPA 2KFYA 2KM8B 1VS3A 1HNXF 4NXMJ 1SXLA 2HWHA 1QM9A 2BMBA 3CC7S 1S1WB 2B5JB 3EE3A 2GVZA 3AJ2A 4DUZF 4NLOA 2DISA 4ECZA 1Q81T 1QSLA 2HURA 1ZM4A 1R8BA 3ELHA 4J9VA 2HHVA 3QSIA 4HEA9 4MIWA 3J7YI 1PC5A 3DOMB 3LQVA 4RW7A 1NK9A 4C8NA 3CDUA 2H5EA 4QW8A 2Z2ZA 2ZM6F 3ETOA 4X4UA 2ROEA 1MMDA 1UFLA 1YX2A 3GB0A 3RUBL 3NGTA 4ER8A 3DLHA 1RT3B 2VC1A 4ID8A 1VJQA 2E44A 4O4RA 3PR5B 1N5VA 5A2QU 2AV5A 3EWGA 5I3UA 3GTYX 1U7LA 5KT3A 1NCLA 4KV8B 4C8OA 5IM0B 4YB1P 2C28A 2MZJA 3SMZA 2EBEA 2WOMB 2YBVA 1YBUA 2YTCA 3SCKE 3MPDA 2ZH8A 1Q5VA 4OYAA 3D1OA 1YBAA 2QFIA 4OYXA 1UZDA 2R3VA 2DR8A 3H25A 5J2PB 4ECVA 4Y6IA 2KI2A 4HHJA 3BN7A 4P7VA 2QO3A 3QAUA 2DH7A 4LF7F 4U95A 4DCJB 1NZAA 3E51A 5IV3A 3LGHA 4IDKB 2R8JA 1WG4A 3RW6A 2EC0A 4JI6F 4EBCA 3R3TA 3OJSA 2AKWB 2W2QP 1X9WA 3EGVA 5L1KA 3BSNA 1FK9B 2OD4A 4PAAA 3W7BA 4WFXA 2XMMA 3C8YA 1UETA 1KFDA 5HVGA 4F0HA 4OZ1A 4ZIWA 2JFKA 4XK8C 4ZDNA 3QMQA 2JVOA 5DQIA 2P5VA 2ADCA 4IG3B 1VC0A 2JLEA 3W2WA 3BPSP 4OLPA 3KWMA 1SJ3P 2XZWA 4GKJF 5CA5A 2YKNB 3RAQA 4OJGA 2HKEA 5KFPA 4DV3J 4NLTA 2MKJA 4JYAJ 4ZCIA 1F60B 1WEXA 1RAOA 1X4BA 2HFZA 4IH6A 3N6MA 5DM6Q 2M2BA 5F41A 4W90B 4TYAA 5E7OB 3MAQA 3QT5A 2MZRA 4XIUA 3SZ2A 3MPUB 3T5HA 4TLQA 4ED8A 4AYBD 1IQZA 4DFKA 4C9DA 1T9VA 1UPPA 2OSQA 1QAYA 1FRIA 3TUZC 3ZO7A 1DLOB 4ALZA 3GV5B 3ZC4A 1PBAA 1CLFA 2Y3YA 1NKBA 1VIXA 4RU9A 2LDIA 1AB8A 1B0TA 5A8WA 1UJ4A 1SIWB 1FJEB 3JS9A 3SQGB 2C3YA 4EYHB 3DRSA 4OZLA 2BE2A 3QRQA 3ZZ0A 1P8GA 3MFIA 2COLA 3ISND 3BDEA 4NCAA 2XMKA 2HQCA 4F0KA 2GX8A 4CLKA 4DMZA 2AJQA 4DL3A 3BGLA 2DCLA 2DXFA 5IOLA 5ETLA 2DYAA 2G0JA 4MMOA 2G1DA 3TAMA 2D3O1 3M6UA 4LRDA 1GX5A 1S4EA 4TN2A 1YITS 2MQ8A 4C3MA 2B4VA 1FKOB 2LEPA 1HNWF 3Q83A 2LQBA 3EVOA 2J9EA 3ZZOA 3J81j 3JTPA 1Q53A 3FBCA 3OSNA 1HQUA 3H59A 3KHRA 4B9SA 1FFGB 4PQUA 4BC7A 2QLJB 4I2QB 1RT2A 3EZUA 3M8WA 2DIUA 1IXKA 3V2UC 1FNMA 2RH3A 2B8QA 1XNRF 5D77A 4LRCA 3AY0A 3MGJA 3R2CJ 3ILLA 4JI4J 1LOUA 4JI0F 4X4QA 3KK2B 5CABA 5DZ6A 2VZ9A 3I4PA 4RW8B 2BUNA 8RUCA 1VQ7S 1FX2A 3Q8VA 3QNWB 3M1VA 3MEEB 2XC9A 4EO8A 1S7HA 1EKSA 5KFXA 3HKWA 1S1UA 2FHJA 4DL0C 1RLDA 3A8EA 1PAUB 4A8MP 2MQQA 3ULHA 4HACA 1RHKB 1ZM3A 3TUIC 5U47A 2IRXA 1UTAA 4HLBA 4C3LA 1HKAA 1OYEA 4K59A 4ECSA 5E0OA 3LUYA 2OJ3A 5DDQC 2RUSA 1JJ4A 4DPUA 2RNEA 2ZKUA 3TQ1A 2CQ4A 3NL0A 1EJ7L 2CJBA 2PFFB 1RT5B 5KG4A 5AE1A 1U09A 2BYCA 4FN5A 4ZLNA 5D4NA 4QWBA 4M8LA 1RACB 1C1CA 3MR3A 3GR1A 5DG9A 1GXTA 1PKUA 2QFJA 3LAMA 5B0DA 3KK3B 3EVMA 1HPZB 3M2VA 4DSLA 3PHTA 1Y3KA 4DU8A 2RKIA 1RHRB 5BYSA 4M5DA 5D0HA 1N36J 5DRKA 4X66J 5KFKA 4NCGB 2E5LJ 2DGTA 2FHOB 3MR7A 3SDEB 3G6ES 3P3DA 4OYIA 5H9FK 3GIIA 4FS2A 2ACMA 3SEOA 4LF8F 4ZOSA 4JV0A 3SXLA 2P9GA 1CJKA 4A48A 4ZVFA 1TFYA 4OYZA 3GZ7A 2MQOA 1G6BA 1T05A 4ZHRB 3MM8B 1RYSA 4QWDA 3HULA 3NMAA 3UNYA 3ILOA 1FTRA 1NJIT 2PMWA 1R8CA 4DX8H 4DV7J 2ZBIA 1IR1A 3DLJA 3CC2S 1QDUB 2JHEA 2KG0A 2CQ3A 1Q8KA 4DX6A 3WQPA 3MFHA 4OI0A 2DXDA 3H5YA 2XULA 5F3TA 4USUA 3LWMA 5DG7A 3JYTB 1YSJA 2YKPA 5E41A 4IH7A 1GH8A 4LQ9A 7FDRA 1KEKA 4IYQA 3G87A 4MAKA 5F0WA 5ETMA 1CJUB 3IAM9 1ICEB 1SCJB 2I2YA 3FKBA 5JJBA 2YWKA 3P8BB 3VAKA 1FXRA 4USMA 3QT8A 4GO7X 1VQ9S 1VBZA 1KLMB 1UJ5A 3D1HA 4J9QA 1KQSR 2OPSA 3TQEA 2DEIA 3TJ9A 1REGX 3N01A 1Q82T 4DBQA 2XCPA 2ZBCA 4UQTA 3JTNA 4TY9A 3KLGA 5G0RB 4RW6A 4CNYA 5H9FJ 4G65A 3OTOJ 4DU7A 3JQMA 4FKYA 8AT1B 4B3SJ 2J7WA 1HWUA 1LFPA 3MEDB 3VGTA 1TKZB 3QLHB 4ZPWR 1WJ9A 2V50A 3OVSA 4M5MA 5LOQA 3IS9B 2XNQA 2W8KA 4X84A 1IR2A 1S97A 4FBTA 2BZ2A 1SUQB 3R6GB 4ZK7M 1VR6A 2XZDB 2W9BA
chains in the Genus database with same CATH topology
2HIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIY A; 
#chains in the Genus database with same CATH topology
 4OX7 A;  1JLA A;  5A8K B;  1XEZ A;  3IG1 A;  3PJX A;  4PRF A;  3OR1 B;  1RT7 B;  3V6D B;  1KON A;  2HNY B;  2I38 A;  5B09 A;  2CQD A;  3GIL A;  2GVD B;  4X65 F;  2HGN A;  3EZ5 A;  2EPI A;  3DLG A;  3OUY B;  4ZP9 A;  3DRY A;  4U7C A;  3NGD A;  3D6H B;  1SIZ A;  2Z2M A;  4TU9 A;  1MN9 A;  3FMB A;  5D3G A;  4IRC A;  2MQM A;  2DCU B;  5T41 A;  1S9G B;  2YVS A;  1S5Z A;  1TL7 B;  4B3M J;  3GFY A;  1Q4R A;  4WZM A;  2HQG A;  2UUB J;  4UUX A;  5KFO A;  3JSM B;  1XN9 A;  2LFV A;  4C3K A;  3WIV A;  4KO0 A;  2O01 C;  1FNO A;  3HJV A;  2MYF A;  4YY3 F;  1AYE A;  5C24 A;  1Q1K A;  5D4L A;  3PG9 A;  2H51 B;  2BM1 A;  2UUA F;  4WP9 A;  4BBY A;  2XSJ B;  4M95 A;  1SI9 A;  4IH5 A;  2QYC A;  1RWN B;  1LWC A;  1P1L A;  3H98 A;  2FLO A;  2Y0B B;  2KDO A;  4MKV A;  2OEM A;  2DO4 A;  2DRB A;  2A3J A;  3D67 A;  3UI3 A;  2FB0 A;  4ETX A;  3N6N A;  2V8G A;  2LDY A;  5HMY A;  1Q8B A;  5MLC V;  1RT6 B;  4DV4 F;  3H0P A;  2UVW A;  2Z2L A;  5D0R A;  3T1Y F;  2YQ1 A;  1EP4 A;  3U27 A;  4OJ1 A;  5FDL B;  4D3H A;  3TA2 A;  1SKW A;  1CUL B;  4PKD B;  1N56 A;  2P8I A;  1WC3 A;  5F0U A;  2Y8W A;  4ERD A;  1CVJ A;  2ZE2 A;  3HLU A;  5HMW A;  2AEM A;  4USV A;  2DGV A;  4K4V A;  1SH0 A;  3UE2 A;  2OFH X;  2E7W A;  2QSW A;  2GML A;  2X1B A;  4IQX A;  2OTL S;  1CG2 A;  4ZVG A;  5DGA A;  1C0T B;  2AP6 A;  2CA9 A;  2DVI A;  3DNC A;  2AJ4 A;  4ZMM A;  1KQK A;  4QPX A;  2FLL A;  5T7L A;  2HFN A;  1HLW A;  3PO5 A;  1BWE A;  4DDF A;  1CPZ A;  3HFZ B;  3EGZ A;  1P6T A;  3FFI B;  1G1X A;  1U1N A;  4EO6 A;  3MMB A;  2J5A A;  2DGS A;  1U8W A;  2LQ8 A;  2VFT A;  2IM0 A;  4LF2 A;  3TVK A;  5GAE U;  3MHY A;  3AJ1 A;  1APS A;  2MMY A;  1U24 A;  1U1L A;  1SH2 A;  1PSD A;  2RSQ A;  2DB1 A;  3CJQ A;  3ZZU A;  3LGM A;  1X5S A;  1F5C A;  2MY7 A;  3CJT A;  3EZO A;  2ZJQ Q;  3NY0 A;  2XY7 A;  3Q89 A;  6FD1 A;  4ZLP A;  1UKU A;  5KFB A;  1T0T V;  4YME A;  2AX0 A;  2K1R A;  1CEZ A;  3T1A A;  3OL8 A;  4B9N A;  2QIF A;  1FKP A;  2JVR A;  4GVL A;  1VQ4 S;  1JNZ B;  5FLX U;  5E3Q A;  5C42 A;  1TL4 A;  4KH0 B;  2ZH2 A;  2QJ3 A;  2F9D A;  2XMA A;  1HNI A;  2OPP A;  1T9X A;  2GGP A;  3OPK A;  3OFH A;  4DR6 F;  1N5Y A;  3QIP A;  1I51 B;  1M5P C;  1HQ2 A;  1RHQ B;  4UQG A;  2XB2 D;  5HP1 A;  1WEZ A;  2BKN A;  3CD5 A;  3W63 A;  1OO0 B;  5AXK A;  1FT8 A;  1E6V B;  2KTQ A;  3NGR A;  3GJS B;  2J0Q D;  3ENQ A;  1QLN A;  3GYX B;  4DR5 J;  4NXN J;  3ILJ A;  1KVI A;  2LLZ A;  1RLC L;  1L3V A;  1RGV A;  4Y3C A;  1KTV A;  2ZOF A;  1X0P A;  4HDG A;  4OJH A;  3DRX A;  5F8M A;  1H73 A;  3CUN A;  3K0J A;  1DHM A;  3TZX A;  1X9S A;  1KWM A;  1GTH A;  3HT0 A;  2GA7 A;  1JLC A;  1Y11 A;  3Q8Q B;  1B0V A;  2IVF B;  4MFB B;  1RT1 B;  4DV1 J;  2AJF E;  2B5J A;  2DTJ A;  1TL3 B;  3QSY B;  4DV2 F;  2X1A A;  4RBU A;  1U1R A;  4EZ9 A;  4B3R F;  3IRW P;  4WXO A;  1ZS6 A;  2IFX A;  2LQ9 A;  2ZDP A;  2VQF J;  2R2R A;  1CJT B;  2FDN A;  7FD1 A;  3RU0 A;  3CCZ A;  3HP6 A;  2E5J A;  4QCL A;  4RW4 B;  1AXQ A;  3HFK A;  4KAI A;  4NYZ A;  4RWW A;  4FPR A;  2DR7 A;  3DLL Q;  3R1H A;  1YKW A;  4M94 A;  3V4I A;  3QJL A;  4M5K A;  2OPQ B;  5LMN F;  1S4F A;  1FXL A;  2KU7 A;  4LF5 F;  2HIY A;  4E98 A;  4CDI A;  3DGP B;  2AD9 A;  3FRZ A;  4A8Q A;  4GC7 A;  3BSO A;  2K7J A;  2MKK A;  4OI4 A;  3DLE A;  3CJ3 A;  4L72 B;  3A3N B;  4E8U A;  3QZ7 A;  4V19 X;  3PO4 A;  1SC1 B;  1RWX B;  3SBM A;  2WOM A;  2OIH A;  1FHT A;  1O5J A;  4DX5 A;  3FSI A;  2YNI B;  1X8D A;  3ET6 B;  2R4F A;  4ZJL A;  2GO9 A;  1FJC A;  5DM7 Q;  3GPA A;  3KHG A;  1GMW A;  3D4J A;  5J1E A;  4LF4 J;  3PCO B;  4OL8 A;  2KHD A;  2MGZ B;  2XEX A;  2WSF C;  3AD9 C;  3LP1 A;  2D1C A;  5H9E K;  2XYP B;  2DHG A;  3PFO A;  4CO1 A;  2YKM A;  4LRF A;  3DN9 A;  1U02 A;  1R0A B;  3MPY A;  1QJH A;  1N34 F;  3KLI A;  1FFS B;  2DO0 A;  3MEC A;  2JC0 A;  5LSR A;  3MPW A;  4U7U D;  2C3M A;  5GAD U;  3Q8S B;  3O5T B;  3KK1 A;  4DEZ A;  3BSC A;  4LMZ A;  1XMO F;  1SC3 B;  4QOT A;  3DI6 B;  5E5N A;  4DR4 J;  5AE3 A;  1N6Q A;  1HNV A;  2MLZ A;  5CYM A;  1M1G A;  4PWU A;  2CWX A;  2RD5 C;  3C6T B;  4K2X A;  3FEX B;  4F4Y A;  2NS1 B;  4K4W A;  3OL6 A;  4LRB A;  2LCW A;  2NUH A;  3CCV S;  4ZP8 A;  5EHH A;  5LXR A;  3G8S A;  2D41 A;  1ZZN A;  1RWO B;  4RNF A;  3GJQ B;  3PDN A;  4IG0 B;  2RF2 B;  1NSK L;  4L74 A;  4TY8 B;  3KLF B;  4ZN3 A;  3PEJ A;  1GNK A;  4FS1 A;  3W8G A;  1AFJ A;  4F4A A;  3TR5 A;  2W01 A;  1YIJ S;  4NA3 A;  5AJ3 J;  2RUG A;  1DLO A;  4RJV A;  3JAM U;  2PMH A;  4DX7 A;  4U8Y A;  2KRB A;  8ATC B;  5KFC A;  3D5M A;  2KO1 A;  5H9E J;  1GAO A;  1NZ8 A;  2X1F A;  3EUN A;  3UN5 A;  1MMN A;  4C0B A;  3GJT B;  4AQY F;  1D9D A;  4NA2 A;  4ECR A;  2EWH A;  2ZJP Q;  1S0V A;  1UWA A;  5AXN A;  1ZA2 B;  3FSX A;  4DFM A;  2ILZ A;  5F8G A;  2EFG A;  1N0U A;  2YNG B;  3CJ2 A;  5HJX A;  1EHW A;  3HD1 A;  3G6V A;  2FJV A;  1GXU A;  2XM3 A;  1BXN A;  1RWM B;  3CME S;  4M63 A;  1AZS B;  4YQW A;  2V67 A;  4LJM A;  3T6J A;  2BA9 A;  2ZBR A;  4J7C A;  3K5L A;  2KHC A;  3C16 A;  3NOC A;  2Z57 B;  1FVS A;  1WOR A;  1T3N A;  4LFB J;  4HL9 A;  3L7U A;  5JXS A;  3N5B A;  2CJK A;  1JLE A;  4J9O A;  1HNZ J;  1SQE A;  3HDS A;  2AW0 A;  2AEJ A;  1FKO A;  1FJG J;  2ZDO A;  1K73 T;  1T9Y A;  2AGP A;  2XG8 A;  4KSE B;  4CYU B;  2VPY B;  3PZP A;  2Z0G A;  4I2Q A;  1FE0 A;  2V8H A;  3LF0 A;  2WW4 A;  4ZVS B;  1GEH A;  4Q43 A;  2BJ1 A;  3NOG A;  2RHS B;  3R5J B;  4RBT A;  2AIR B;  2H48 B;  1YRT A;  4NLW A;  4P9S A;  4FBU A;  3TAP A;  3HO1 A;  2GO8 A;  1DBD A;  4PG7 A;  4YB5 A;  2E1M C;  3MEE A;  2W2M P;  1FRJ A;  1JLQ A;  2W25 A;  2WON B;  2WZ1 A;  1QVG R;  3C14 A;  3TJ8 A;  2ZH3 A;  5KG1 A;  1C1B A;  2NR0 A;  3TO8 A;  5L46 A;  2XY6 A;  2Q79 A;  1UW4 A;  1TUW A;  4ED2 A;  1EET B;  1WOO A;  1X4G A;  3W5Z A;  4LF9 F;  1RCX B;  1YVF A;  4A8Y A;  2VC0 A;  2CVI A;  4HI2 A;  4Z2X A;  3ITH A;  3KHL A;  3FQK A;  2FJA B;  4N47 A;  3IR6 B;  1TEL A;  3E01 A;  4S0M A;  2M5Y A;  2H4W B;  5EUH A;  4KH1 B;  3BM7 A;  3A3O B;  1RT5 A;  2BQR A;  1O6X A;  3MR5 A;  3BO3 A;  4CH7 A;  2XNR A;  5GAH U;  2CPE A;  1URR A;  5B0G A;  3UWT A;  2R8G A;  3AD8 C;  2MLX A;  2BE7 D;  3KK3 A;  1HHT P;  2XYH B;  4EFA C;  5J2N A;  2I5J A;  2O3D A;  4DV5 F;  2FPH X;  3EGW B;  3C15 A;  5IQ6 A;  5LMU J;  4DQR A;  3EXC X;  2FGC A;  2PI5 A;  2FTR A;  2HVZ A;  3QPI A;  1V9O A;  2XO6 A;  2C2E A;  4NCG A;  1LW2 B;  4NLG A;  3O3L A;  1S9E A;  2JDJ A;  3HVA A;  2JSX A;  1S79 A;  3HK2 A;  3VAL A;  1N0V C;  1MNE A;  1IUJ A;  2BW7 A;  4C7Q A;  3MUM P;  2WK4 A;  4Y2I A;  4TYB A;  2GFF A;  2YNF B;  1M1H A;  3UD3 P;  1L3K A;  3C46 A;  4F4W A;  2J7K A;  3HMJ G;  1GMU A;  3D7S B;  1W2B R;  4ZPD A;  4ZHR A;  1U6B A;  3UD4 P;  3MM8 A;  1ZTT A;  2MSS A;  5B0A A;  3ZXW A;  2RDI A;  1BQN A;  1P9Q C;  5J2M B;  4YFU A;  1W26 A;  4JI5 J;  3UO0 A;  1OIA A;  2MY8 A;  1J2V A;  1Y5N B;  1UJ6 A;  3UN2 A;  3NP5 A;  4B3T J;  1KRP A;  1JXL A;  2JLG A;  2DHA A;  3GE9 A;  2BEF A;  3CD7 A;  2V8V A;  3NS5 A;  4DL5 A;  4JI8 J;  1NDC A;  4Q44 A;  4KQZ A;  2IBO A;  5DDR C;  4MTP A;  4KRW A;  3JYT A;  1FDD A;  1VLO A;  1X60 A;  2JJ4 D;  3N0V A;  3M2U A;  5J2Q A;  1UVM A;  1XMB A;  2ZZT A;  1NHU A;  3GG1 A;  3G9C A;  1CJU A;  2NXC A;  3DU6 A;  3TA0 A;  5SUH A;  1HNX J;  3WC0 A;  2W4D A;  2ZNZ A;  1I3O B;  4DUZ J;  1R6Y A;  3HHE A;  5CH7 B;  2HRU A;  3C2P A;  2VA2 A;  1JKH B;  1RWV B;  5D4O A;  5LM7 E;  5HQL A;  4FYX B;  4WWS A;  4ZP7 A;  2X51 A;  2QEX S;  2PA8 D;  1TK0 A;  3N6L A;  3QWP A;  3RTV A;  1WTB A;  4OI2 A;  2E1A A;  3A8J A;  1RA6 A;  4ZJQ A;  1QSY A;  2XS2 A;  3D0H E;  1M0S A;  2ZM6 J;  4K0K F;  3I55 S;  4BWJ A;  1Y3J A;  2DIV A;  4NML A;  1TKZ A;  9RUB A;  3DHX A;  3QLH A;  1TZ0 A;  3IS9 A;  4DF4 A;  1MN7 A;  2ALZ A;  4KFB B;  3VAI A;  1OPZ A;  3LAN A;  4ED0 A;  2VH7 A;  5CYJ A;  3QO9 B;  3MMA A;  2DPJ A;  4BS2 A;  1M5S A;  2KXH A;  2HNZ A;  2E5I A;  2CG8 A;  2IJF A;  4X4S A;  4OI3 A;  3H42 A;  2BM0 A;  3M2R A;  4C2M A;  2GVD A;  4JI7 F;  3K58 A;  1RAF B;  1DTQ A;  1U1K A;  1EQM A;  2IHR 1;  4LR8 A;  4YUD A;  1I94 F;  2YNH B;  1V5I B;  2MHE A;  3DRR B;  2HEK A;  4L73 A;  1YG0 A;  1Q16 B;  2DNH A;  3A1Y G;  3GYN A;  5HRO A;  4GO5 X;  1WHY A;  2ASY A;  3HVR A;  1KLN A;  4DV0 F;  3UD5 A;  3DOL B;  4PCQ A;  3MDF A;  2KG1 A;  4LF7 J;  2VBX A;  1OMS A;  2E1R A;  3NCP A;  1LFW A;  2C3U A;  5F8H A;  1WC5 A;  1Q95 G;  2VQE F;  2FHJ D;  1K9M T;  2DHS A;  1UEU A;  1UVL A;  4F25 A;  4ED1 A;  3PIO Q;  1VFJ A;  3WHI A;  2V8D A;  5KG5 A;  4C8M A;  2QLW A;  3NXZ A;  3T5J A;  5A0Y A;  3K5O A;  4O3Q A;  4WFN Q;  1H2V Z;  2FYX A;  2XYG B;  2VUG A;  3JXO A;  3G86 A;  3HZG A;  4KGM A;  4DLE A;  3AA8 A;  3GV7 B;  1REV B;  3SV3 A;  4A4J A;  2V9W A;  3PAC A;  3O44 A;  4ED3 A;  2YWG A;  1FTC A;  1S9F A;  4G1Q A;  1KHV A;  1RT6 A;  2A2C A;  3I82 A;  4I56 A;  5DQG A;  4AFF A;  3MMJ A;  5FDL A;  3UQS A;  2AJ2 A;  4GKJ J;  2FY8 A;  2HZC A;  5ETP A;  1RB0 A;  2KKH A;  2L41 A;  4RPF A;  3KJF B;  2HHU A;  3K57 A;  4PEO A;  3I32 A;  1RWW B;  4JV1 A;  2NXU A;  2DR6 A;  4PXD A;  4OHX A;  1B64 A;  1RHM B;  1NDL A;  2BKO A;  2OAU A;  3QWU A;  1A6L A;  3B78 A;  1F6T A;  3W2V B;  1Q78 A;  2IC3 B;  1H38 A;  2CKW A;  1HI1 A;  4EGL A;  5B0E A;  3TEH B;  2X3G A;  4FKX A;  4W4M A;  4FYD A;  2AEF A;  2UUC F;  2VG6 B;  3VF0 B;  3V6K A;  3FJ2 A;  4ES1 A;  3AXK A;  1JMT A;  3RBZ A;  3C6U B;  3PFE A;  3NBP A;  2H4Y B;  1ZM2 A;  1HQE B;  3H4D A;  4OZ5 A;  1NPR A;  2YKQ A;  1TP7 A;  4QU7 A;  2KT3 A;  4ZLL A;  3DLK B;  3TI0 A;  4H4K C;  2HHS A;  3DOK A;  4Y65 A;  2BQ3 A;  2NZC A;  2GHP A;  5ETS A;  1R7I A;  3CO0 P;  4Y34 A;  2HS0 A;  4B17 A;  3KYL A;  3OFG A;  2HAI A;  2P9C A;  3CPW R;  3MUR P;  4IFV B;  1NSQ A;  2WW8 A;  1JQG A;  2YQ0 A;  4I69 A;  2CG4 A;  2BDP A;  1H72 C;  4P2X A;  1CJV B;  3RYL A;  1WOS A;  2VIC A;  1LWF B;  2J9C A;  2L48 A;  5IWA J;  1JXV A;  1J5O B;  5LJ5 Y;  2GAG C;  3LAK A;  3HSG A;  3FC9 A;  1TAU A;  4ZVR B;  4PXC A;  4LR9 A;  2FJB B;  5E3A A;  4MKA A;  4QIE A;  5BYR A;  4BCA A;  2M4M A;  1NJX A;  2W24 A;  1FXD A;  2GJI A;  3W5X A;  3GU0 A;  1UVI A;  1RHJ B;  4DN9 A;  1YJU A;  4CO4 A;  2PN6 A;  4DSI A;  3SCL E;  4MJK A;  4PXE A;  1YRU A;  2GQQ A;  1L3U A;  4M5J A;  5EDW A;  3HX9 A;  2CJQ A;  3G82 B;  1K44 A;  3JSB A;  3CCQ S;  2VBZ A;  4JI0 J;  3WX4 A;  2V8P A;  4WII A;  4F26 A;  1RA7 A;  2P6S A;  1RT1 A;  1YJT A;  1TL3 A;  1KNZ A;  2Q3P A;  3K5P A;  4FVC A;  1IKY B;  5D0E A;  1S10 A;  1NEE A;  2ZKT A;  1CJT A;  4ELV A;  4OLO A;  1PJ6 A;  3FSY A;  3SCI E;  3M8R A;  3TOQ A;  1ULR A;  2RHQ B;  1ZA1 B;  1CS4 B;  4ECU A;  1WC6 A;  3QAE A;  3VAM A;  4NE9 C;  1N88 A;  1VCT A;  2K7K A;  2CIM A;  4CT9 A;  2OD6 A;  5H1S V;  3UPF A;  3D1Q A;  3DFE A;  2CPJ A;  1YQH A;  3P4U B;  4CO3 A;  2PFD A;  4QYZ J;  2WHO A;  4A8O A;  4WK1 A;  2FLP A;  3ISZ A;  2KYZ A;  2WRM A;  4N76 A;  2R2S A;  3DDN A;  3S8S A;  2BQU A;  1GX6 A;  2HG4 A;  1GXL A;  3KUG A;  2MST A;  1R8P A;  1BQM B;  1HBU A;  1HBN B;  2V68 A;  2AWZ A;  1PYO B;  5JUM A;  3ET6 A;  2IAJ A;  2CDR B;  2HQI A;  4B9V A;  4ZVT B;  2EFQ A;  1S6Q B;  2XY5 A;  4OMF G;  2EXU A;  4UOC A;  3W62 A;  2NZ4 A;  1AW0 A;  1CQN A;  3VZH A;  2KVQ E;  3CDB A;  4DPY A;  2O66 A;  4JP8 A;  2RQK A;  3PYE A;  3N4W A;  2VB6 A;  2V34 A;  1R0A A;  3Q24 A;  1BE4 A;  2R7S A;  3L09 A;  3OQ2 A;  4XAK A;  2CYY A;  5EWE A;  3VGU A;  4YR2 A;  3MOZ A;  3AD7 C;  5I3P A;  3BKU A;  3A12 A;  4OZ3 A;  2LQJ A;  3M9O B;  5A8R A;  2C42 A;  1UMJ A;  2VPW B;  3DI6 A;  2OFG X;  2KJW A;  4OZN A;  3BBB A;  1F5B A;  3TUJ C;  4O3R A;  1F2G A;  2PGC A;  4WKY A;  3ADA C;  2IBK A;  4NI2 B;  5CYQ A;  3I5B A;  4O4G A;  3CO9 A;  2O1P A;  3X3U A;  2ASL A;  1HBM B;  1Y9O A;  4F50 A;  2B7C B;  2OI2 A;  3EDQ B;  2CQG A;  5L38 A;  3NNH A;  5L1I A;  1HIY A;  3DU5 A;  2MZT A;  4LF1 A;  3CNQ P;  2DR9 A;  3B4M A;  5IFM A;  2N3L A;  3RBE A;  1UFW A;  1IKV A;  3H40 A;  5IXU A;  1AT1 B;  5HQM A;  3LA0 A;  1UZH A;  5CXT A;  2GJ2 A;  4O44 A;  4EWT A;  2HHX A;  4KPY A;  1Q86 T;  1FFW B;  4DI6 A;  1NAQ A;  4XPE A;  4NLX A;  4TY8 A;  3KLF A;  4F4X A;  4GC6 A;  2V2K A;  2ZJR Q;  3R5D A;  1MG7 A;  2VV5 A;  2PII A;  3CDA A;  1U26 A;  1DUR A;  4G6V B;  4NWB A;  3DYA B;  3BQ1 A;  3OJU A;  2D74 B;  2IIH A;  3GYG A;  4F4Z A;  4X64 J;  5KG7 A;  1HYS B;  1FO1 A;  3MM7 B;  1A7G E;  1S6P A;  4YB7 A;  3OXL A;  4JI4 F;  5FD1 A;  3QRP A;  3IMQ J;  1IR0 A;  1WSV A;  1SB6 A;  2HZA A;  1VI7 A;  2E66 A;  1XWL A;  4ECY A;  2POK A;  2E5H A;  3D9B A;  2JC1 A;  3O6Q A;  3I56 S;  3AA9 A;  2A0F B;  4H4K A;  4LRA A;  2QL5 B;  2FY1 A;  3RRK A;  4LVN P;  2DNZ A;  2V5H G;  2WCX A;  1JLF B;  3AOA A;  3QT7 A;  4CM0 A;  1RU2 A;  2FJE B;  3JTO A;  3K89 A;  3PRB A;  1KVJ A;  2VJU A;  4R5P B;  3MTK A;  4ICL B;  2J76 E;  3BZQ A;  2JZ5 A;  1R8A A;  1VQS A;  3HVT A;  4PYD A;  2F9J A;  5HVH A;  1X5T A;  1WKJ A;  2Q66 A;  5KFF A;  2RVJ A;  5A2Q Y;  1K1Q A;  4IR1 A;  5GAG U;  1Y00 A;  4K5S A;  3O8W A;  1L5U A;  1XC9 A;  2V0N A;  2CPI A;  1OY8 A;  4TQS A;  5FII A;  4Q0B A;  4YY3 J;  1U49 A;  3BF4 A;  3GWC A;  4LSL B;  3VVT A;  2IM3 A;  3CJ5 A;  3J7A N;  2R7X A;  2W7O A;  4NZ7 A;  3IBF B;  3N9U C;  2QRR A;  4F2S A;  2FVR A;  3JSY A;  4YHH F;  3PYD A;  1S1T B;  2DNN A;  3AB4 B;  2HK3 A;  3CCR S;  3OLB A;  2YX4 A;  5KT6 A;  2MZ1 A;  4X66 F;  1RBO B;  3PTW A;  4DUT A;  2J6T A;  2AX1 A;  5HSP A;  4DR7 J;  3G6X A;  4J91 A;  1LWE B;  1R8H A;  4DQP A;  4FYW B;  4C11 A;  3W9H A;  4DV4 J;  2VD3 A;  5KTQ A;  5I4M A;  5JMN A;  4XDD A;  1Y4Z B;  1RTI A;  4DHV A;  2DEJ A;  4PG6 A;  1NK6 A;  3EYZ A;  3DMJ A;  1RAA B;  1UFK A;  1S0N A;  1QUP A;  2D9O A;  5KFQ A;  4P71 A;  4PG8 A;  3NEK A;  2JOQ A;  1PCA A;  3BYR A;  1GMW D;  5DQH A;  2QZ8 A;  3LP2 B;  3MPV A;  1NK8 A;  3GSD A;  2KT5 A;  2CNL B;  2PEH A;  4JI2 F;  2NSC A;  4B3O A;  2GS8 A;  4IRK A;  5HAT A;  4WE1 B;  2L9W A;  3AFG A;  2D3O R;  1K0V A;  5F8N A;  1UEK A;  3NS7 B;  3QRR A;  3Q22 A;  2J8A A;  3T5L A;  3S6E A;  1I1G A;  1U6F A;  4JUZ A;  4RNH A;  3MEG A;  2B9Y A;  4UY8 5;  1GFW B;  2Q43 A;  4LFA F;  4MYT A;  3I9Z A;  3IGN A;  5L8R C;  1NJZ A;  1RYR A;  4O0N A;  2PEB A;  1S7I A;  4PYA A;  2EVZ A;  2B4O A;  2WVF A;  2EW9 A;  3OTO F;  2XLI A;  2ZC3 A;  5DDO C;  2XZT B;  4FVM A;  1EQ0 A;  5T14 A;  5F8I A;  2MJN A;  4CWB A;  1OJ4 A;  2RDJ A;  4DR2 F;  2Z4P A;  4B9L A;  2KT2 A;  3PJW A;  4IFY B;  1H74 A;  2V9K A;  3K59 A;  2M70 A;  2GHV C;  5HLF A;  3GIM A;  1VC6 A;  4DR6 J;  1R0C B;  4DFJ A;  1VBY A;  4HH1 A;  3MF5 A;  1RAE B;  2A10 A;  1U2C A;  1TFW A;  4NOH A;  4A46 A;  3OVA A;  5K8M A;  3HFV A;  2CQI A;  2DXE A;  2XTJ P;  4HTI A;  3R7S B;  2MXY A;  5D8H B;  2EI5 A;  2DY9 A;  1KC8 T;  3WZ0 A;  2XSF A;  1S6O A;  2V6A A;  3CUL A;  2W9A A;  4UTG A;  2GW8 A;  1S6U A;  3F0N A;  5IT4 A;  4WP8 A;  4LF6 F;  2UXB J;  1IN0 A;  1GK8 A;  3JQJ A;  1SJF A;  4DV2 J;  1Y5L B;  1O0P A;  4NZ0 A;  1KN6 A;  2ZHB A;  1M5H A;  4URG A;  2R8K A;  5CQG A;  3GJR B;  1BWV A;  2DR5 A;  3P5T L;  1Q8L A;  2I1R A;  5B7W A;  3TYT A;  1JJ2 R;  1S1X B;  4WTY A;  3GFX A;  4DSF A;  4OX6 A;  4DPO A;  3BGO P;  2FIU A;  4O3N A;  1TMM A;  3I0S A;  3W64 A;  1H7X A;  3U7J A;  1YJ7 A;  3U02 A;  4LF5 J;  1FEE A;  2QMW A;  4KFB A;  5K14 B;  4D3G A;  3CCT A;  3R7N B;  4TVA B;  3V6H A;  2DIT A;  3DC2 A;  3FK4 A;  2RDD A;  5KFW A;  5EX3 A;  2K3I A;  4KTQ A;  2V94 A;  1OYD A;  3QO9 A;  2BW2 A;  4ZKA A;  4O0I A;  4KHP F;  1RWP B;  5IC4 B;  2HGM A;  3W2W B;  1WDD A;  4OI6 A;  2BE9 B;  1S0M A;  1M5O C;  3CB4 A;  1J5E F;  1XTZ A;  2HBZ B;  1U0H A;  1WOP A;  1WI8 A;  2PE8 A;  4HT7 A;  4UUW A;  3IC1 A;  4A47 A;  2W2N P;  2YNH A;  5CD4 H;  3EMT A;  4Q7A A;  2GZO A;  3DRR A;  3NAH A;  3J80 U;  3RB3 A;  3RG6 A;  4OJ3 A;  1HAR A;  2CQ1 A;  2MKS A;  3D0I E;  1FD8 A;  2CQP A;  3LWL A;  4ETZ A;  2R2T A;  3DOL A;  3KLH A;  1TAQ A;  1UL3 A;  5G4D A;  1FRH A;  1C4A A;  3EXY A;  3HHD A;  3GMG A;  4JI1 J;  2UVV A;  3NLC A;  1T94 A;  3MAH A;  4ZS6 A;  2CWK A;  3OHA A;  1NH8 A;  2WVB A;  4I7F B;  2Z8Q A;  3LO3 A;  5B0C A;  2MQN A;  1TKT B;  4ITS A;  3K7R A;  1FVQ A;  1ZET A;  1N32 F;  1V3S A;  5AXL A;  2DRD A;  2B9X A;  2DKO B;  1N34 J;  3M30 A;  3G8T A;  2LEC A;  1K8A T;  3MCO A;  3R8Y A;  1NKE A;  5A8W B;  1AFI A;  3PW7 A;  3G71 S;  3R7B B;  3RB6 A;  2BE2 B;  1CQM A;  1REV A;  1GT8 A;  3QQC D;  1S1V B;  4N7T A;  1RU1 A;  4P7T A;  2Y1I A;  1DQA A;  3OT9 A;  2DPI A;  4Y2M A;  2GNK A;  5DLG A;  2CNK B;  4WYL A;  2UXD F;  2Y1J A;  4FXW A;  2DNR A;  4HTJ A;  3M32 A;  2HWI A;  3AQP A;  2Q1L A;  2R7W A;  5HVF A;  2W1B A;  2VHG A;  1WEY A;  2QE5 A;  1ROF A;  4ZA1 A;  2M0G B;  3POT A;  3TAM B;  1SKS A;  2RML A;  3UVJ B;  2VPZ B;  3M8P B;  4RW9 A;  1EAR A;  2NRE A;  4QIW D;  1JLB A;  4XTT A;  4NCB A;  4N8O A;  1UVK A;  2OKQ A;  4KB7 A;  1SL1 A;  1KS2 A;  1Z1Z A;  2N4D A;  3D2W A;  2BOA A;  2DNY A;  4IR9 A;  1HBO A;  4TU8 A;  4PPD A;  1N33 F;  2BOP A;  2HFS A;  2CQ0 A;  4I2P B;  2OUG A;  4PQU B;  3A8I A;  3W5Y A;  2KXN B;  1RT2 B;  2FZC B;  1U0S A;  3DDI A;  4DN0 A;  4CLU A;  3RB0 A;  3KDN A;  1HA1 A;  2L08 A;  3TX0 A;  4X4P A;  2JRS A;  1KVK A;  1EX8 A;  5LXY A;  2LA4 A;  1TKD A;  3BBC A;  2NQP A;  4OQJ A;  3CJ8 A;  3RZA A;  2ZH9 A;  4USK A;  4PG5 A;  2E1C A;  2VQF F;  3M1V B;  3FEZ A;  1FDB A;  5DG8 A;  3CWJ A;  2WAQ D;  4I6W A;  1LW0 B;  1S1U B;  2VIH A;  2F8H A;  2HHH F;  2C1E B;  3DDK A;  2OPR B;  4M5G A;  5E2Q A;  4KT0 C;  3TAR A;  2X1G A;  3W1Y C;  4QJV A;  4QPT A;  1FD2 A;  2J7U A;  1CJV A;  3MCN A;  3B4D A;  4PWD B;  2WBM A;  3R27 A;  1LWF A;  3EX7 B;  2CJY B;  4FF4 A;  3EJM A;  3R5A A;  4QR1 A;  1RTH A;  3NMR A;  3I0R A;  1N5S A;  1S72 S;  1UWB A;  2RE1 A;  1L3S A;  2EG1 A;  3PW2 A;  1MWY A;  2RU9 A;  2VAS A;  1X5O A;  1VQP S;  3GR0 A;  3Q8U A;  3I9V 9;  3M4X A;  2G2Z A;  1UVN A;  4N41 A;  4L75 A;  2CPD A;  4B08 A;  2ZWO A;  4MT1 A;  3M2V B;  3VAG A;  3TX8 A;  1SL2 A;  4DQI A;  4AXJ A;  1HWL A;  3LP0 A;  2UZA A;  3GFH A;  3VAJ A;  3ZTS A;  1NHV A;  4DOZ A;  3MAA B;  1QAX A;  1X7V A;  3CXC R;  4UZC A;  3P96 A;  3T3F A;  3G82 A;  4OYB A;  1U4B A;  4PAB A;  1TTH B;  4LF4 F;  2OEL A;  3TA1 A;  1CJK B;  2ZD1 B;  4FF1 A;  3A4T A;  3RR8 A;  3HSD A;  1YWX A;  1D9F A;  3BO2 A;  4PUO A;  4UOG A;  1T05 B;  1J27 A;  1N4L A;  1IBK F;  1VIS A;  4DS4 A;  1VGY A;  4DSJ A;  2XMU A;  4BWM A;  3NG8 A;  1FI4 A;  2XGP A;  3FCH A;  4LF9 J;  3GCX P;  3D54 A;  2FVS A;  4JV5 F;  3MZI A;  1UP1 A;  2IPO B;  1WI6 A;  1OWX A;  1PAE X;  3HHL B;  3HJF A;  1MU2 B;  4YN3 B;  3J7Z T;  2HQ3 A;  1HR0 J;  1YDL A;  2GV1 A;  2BBE A;  1R89 A;  4YEA A;  1KTQ A;  2BV3 A;  1NJY A;  2LU1 A;  5F9N A;  4KY3 A;  2NUU G;  4DZD A;  3CIM A;  4WK3 A;  1KQG B;  4XO0 A;  1U25 A;  1XER A;  2R8I A;  3OVB A;  1IKW B;  1KQF B;  4HHH A;  4AUK A;  2KM8 C;  2HW3 A;  3MM6 A;  2UU9 F;  5I42 B;  1UA1 A;  2B56 A;  1HBN A;  4X2B A;  4ZVQ B;  5KFZ A;  4ELU A;  1Q0N A;  3DXB A;  4I4B A;  5C25 A;  3D28 A;  2PD1 A;  2OPS B;  4F3Q A;  5KFT A;  3T6B A;  1S6Q A;  3CSK A;  3QFW A;  1IKX B;  3KLG B;  4RW6 B;  1ARO P;  2WSC C;  5BR8 F;  2RJZ A;  5KFA A;  5CCL A;  1JJC B;  5CAA A;  2B51 A;  4I6Y A;  2LXF A;  1FE4 A;  1M90 T;  4AT1 B;  3QID A;  5AJ3 F;  4CO5 A;  5EWG A;  2GMJ A;  2Z30 B;  3THP A;  1TV6 B;  4ZCM A;  2BR0 A;  1HMV B;  3M8Q A;  1YTY A;  1D9A A;  3BRE A;  2XMW A;  2C2O B;  2G2O A;  2I8E A;  1XK8 A;  1KD1 T;  1LXN A;  2DNL A;  2W9B B;  4RZR A;  2A6M A;  1VMB A;  2IMO A;  1JLA B;  3M05 A;  3UDE A;  4P74 A;  3IG1 B;  4DV6 F;  1VJW A;  3CMQ A;  2ACY A;  3AOD A;  2DT9 A;  2WB4 A;  3L3C A;  3BDP A;  5FLX Y;  4GKK J;  3BGR A;  3IBC B;  3THT A;  2L3M A;  3K8W A;  4CIO A;  4ECW A;  1MWQ A;  1F1B B;  5D3G B;  1EZZ B;  2XWY A;  3MOJ B;  2DNO A;  4KHM A;  2KFN A;  1YLX A;  1HBM A;  4UF4 A;  2HFO A;  3NKY A;  1YRX A;  2GIF A;  1HD1 A;  2OMO A;  5A76 A;  4I1T A;  4KYZ A;  2JEI A;  4KO0 B;  2J8S A;  5THW A;  2PMZ D;  3PX6 A;  5LJ3 Y;  3H2L A;  5C24 B;  3PKM A;  5EGY A;  1TL1 A;  4M5L A;  5ETT A;  1HNZ F;  1HWK A;  2EG2 A;  4PPZ A;  1KSP A;  4WPA A;  4DCO B;  4M5N A;  4EBD A;  2IM1 A;  3HD2 A;  1O8B A;  4O3P A;  1LWC B;  4K0K J;  3MM9 A;  4RWX A;  2F63 A;  2I0X A;  2F1F A;  1BQX A;  9ATC B;  3MD1 A;  2MZQ A;  4NMX A;  4P2F A;  2LXI A;  2AF6 A;  4ZN1 A;  2V2Q A;  3IBW A;  1DQ8 A;  2JLF A;  2W8L A;  4DWI A;  4ED5 A;  3ZTP A;  3FZB A;  2GIQ A;  3H8Y A;  3GV8 B;  3SV4 A;  1F5A A;  3H2U B;  4MKB A;  3A13 A;  2OSR A;  1EP4 B;  2PSZ A;  3Q8P B;  5KG0 A;  3PW5 A;  5AT1 B;  2HRT A;  4KC5 A;  3HHK A;  4G1I A;  1RE1 B;  3TZZ A;  1SKU B;  3UCZ P;  4YOE A;  1NPK A;  4JI7 J;  1FRM A;  1NK0 A;  4ICL A;  4Z7Y A;  1I94 J;  2R42 A;  5KFV A;  5KFH A;  4WU3 A;  2HMI A;  2V2Z A;  2HLU A;  2NXJ A;  4DL4 A;  2VKR A;  4KGX B;  1C0U A;  2DNK A;  3A3P B;  3VQS A;  2ZWP A;  3M8Y A;  2KJV A;  5T7L B;  1SH3 A;  2JEJ A;  3ICL A;  4IOA Q;  3H5U A;  4Z37 A;  2UV8 A;  4ZCK A;  3BS9 A;  3PIP Q;  3IFE A;  1T03 B;  3H5S A;  2KYX A;  4NLR A;  1OY9 A;  3DRP A;  3MMB B;  1OQ6 A;  1HI8 A;  1FDN A;  3CCS S;  1RZM A;  1S1T A;  1TMJ A;  4R0E A;  4U67 Q;  3R5G A;  1B4S A;  1QE1 A;  4IOC Q;  3BH6 B;  1T9T A;  2X3D A;  2NPI A;  2CAJ A;  1NDK A;  4J9R A;  2P9E A;  2GC8 A;  4ID5 A;  2R7Q A;  1S48 A;  3DXS X;  3NWG A;  2ZIT A;  2CAD A;  3CJK A;  2G4B A;  2K1R B;  1FKP B;  2EK6 A;  3VQT A;  3UCG A;  4R8U B;  4UY8 T;  3JQK A;  2SXL A;  2BAB A;  1YJV A;  2V4R A;  1JX4 A;  3CDW A;  3T41 A;  2HBR B;  4DQS A;  3FUY A;  2HS4 A;  3SCJ E;  2N3O A;  4ED6 A;  4C6A A;  1HNI B;  2OPP B;  3KNA A;  2GGP B;  2R7T A;  1GMV A;  5HMX A;  4NL5 A;  5IS2 A;  4RNO A;  3SSS A;  3VWS A;  1N5Y B;  2XCA A;  2FVC A;  5D6G A;  4DR1 F;  1NPP A;  1ZPW X;  4MYU A;  5HP1 B;  1YK9 A;  3QGP A;  3LP2 A;  4LSN A;  4ANE A;  1FCA A;  3PNI A;  2BJ7 A;  2QGF B;  2HVI A;  3CW2 C;  2XO7 A;  3MM5 A;  1JWW A;  2YPZ A;  4H4M A;  1M5V C;  2F4V J;  1QAI A;  2APO A;  4F7V A;  4NYP A;  3KLV A;  1WHW A;  3HZE A;  5E33 A;  4WE1 A;  3NWR A;  2B6A B;  4CLF A;  3KJV A;  2U2F A;  2ZHO A;  1JLC B;  1C4C A;  1JLG B;  3F73 A;  1EAY C;  2IA6 A;  4EU0 A;  2I9S A;  3F44 A;  4C8Y A;  1IWA A;  1IBC B;  4BC9 A;  4ELT A;  1UVJ A;  1U48 A;  4W92 B;  1S1W A;  2L9D A;  1F3F A;  4LRE A;  3U1M A;  2M8H A;  1RAB B;  2MQL A;  4JOU A;  2JWN A;  1R43 A;  2G0C A;  2WVE A;  1CBK A;  4FNI A;  4CO2 A;  1WSR A;  1W2I A;  4M1K A;  3JAM Y;  3DOM A;  1P1T A;  2F3J A;  2DH9 A;  3V4I B;  3KMS A;  2C2D A;  5ETK A;  1ZAX A;  5D0G A;  2HK2 A;  4FYY B;  4IFY A;  4LUB A;  5KT5 A;  2B4P A;  3CTR A;  2RAQ A;  2VKZ G;  3OTB A;  2IVM A;  4B9U A;  2LVW A;  5SZT A;  1RT3 A;  4HDH A;  1SC4 B;  3P6Y C;  4NLP A;  2IDL A;  1IM6 A;  1SPB P;  3PW4 A;  1SC6 A;  2HHW A;  2QSF A;  2CQB A;  3HSZ A;  3W65 A;  4NA1 A;  3DLE B;  3BKF A;  3J7A 1;  3UNG C;  1QTM A;  1ACM B;  3J81 U;  3T1H J;  3EVW A;  2LP4 A;  4KV8 A;  1N54 B;  5CZX A;  3FCV A;  2B43 A;  4LBH A;  5C2G A;  1FJ7 A;  5IM0 A;  3KXD A;  3FBB A;  2ABY A;  1R0B G;  1X9M A;  2ROP A;  4NPO A;  1NSP A;  1XQI A;  3R5B A;  1NK4 A;  5J1E B;  2HGL A;  2C2M B;  1PIE A;  1TL5 A;  2F65 A;  2DGU A;  3MWB A;  3SQO P;  1PIL A;  5J2P A;  2E9T A;  4ATN A;  5HQ8 A;  3Q8R B;  4C8L A;  1SJ4 P;  3LW5 C;  4YR3 A;  3LP1 B;  2VFR A;  3Q8Y A;  3ZTO A;  3U1N A;  4K2J A;  1T02 A;  3VGS A;  4CLL A;  2YKM B;  1YI2 S;  2AZ3 A;  1S1X A;  3M8S A;  3KLI B;  5D15 A;  1S57 A;  1DAX A;  3MEC B;  4IDK A;  4ANC A;  4KHR A;  3HHL C;  1A0O B;  1X4A A;  5KFS A;  1JJH A;  4NX9 A;  1RBL A;  3KK1 B;  1P9Y A;  5KFI A;  4A8S A;  4RR5 A;  2F40 A;  4HI1 A;  3ZTQ A;  5K14 A;  1FK9 A;  4B9T A;  2ZZN A;  1VDH A;  2ASJ A;  1N6Q B;  1HNV B;  2NXE A;  1RDR A;  5CYM B;  5D78 A;  2LMI A;  2VG7 B;  4U8V A;  3NCQ A;  3TUP A;  1YZ6 A;  2RU3 A;  4C98 A;  1T9W A;  2CPZ A;  1SV5 B;  2D3U A;  4WP3 A;  4G1P A;  1BUX A;  3AQO A;  3ZZR A;  4IG3 A;  4F8R A;  3N5F A;  4LBI A;  4DXL A;  3CMA S;  2IY5 B;  1T9U A;  3PRD A;  3KLE B;  4O3S A;  2YKN A;  4TKT A;  2ZHA A;  4F3M A;  2W4P A;  5KFY A;  1D8Z A;  3KJQ B;  4M5I A;  3KMQ A;  3FRY A;  3BBF A;  2OEK A;  4EBE A;  1XNQ J;  1BLU A;  1RTZ A;  1VRU B;  3GON A;  3Q23 A;  1FEH A;  4UW2 A;  2CQH A;  4I6A A;  2EKN A;  4QW9 A;  1Z2Z A;  3PW0 A;  1SVD A;  2XLJ A;  4A8W A;  1UPM B;  2DNQ A;  3IR7 B;  3B54 A;  4I7F A;  4JI3 F;  2DRA A;  2MQP A;  4I0W A;  1TKT A;  2J6S A;  3WX8 A;  2XMV A;  1NUE A;  1Q7L B;  4FP9 A;  4HVZ A;  2A2D A;  2MTL A;  1RKI A;  2F8M A;  2VOP A;  5KFM A;  3TNV A;  2VDH A;  2YWH A;  2VF3 A;  4LFC F;  3HKZ D;  1Q79 A;  1S1V A;  3EM1 A;  3SQG A;  1RT4 B;  4RUA A;  2CJA A;  2RQM A;  1B99 A;  1OSD A;  2B3T B;  5BJR A;  2I6W A;  1LXJ A;  1NH7 A;  1G7C B;  3MMC B;  2YWW A;  1DAR A;  4J9S A;  2GIR A;  4WZQ A;  5K20 B;  5CHC B;  3BQ2 A;  1HI0 P;  5IWA F;  4ZVP B;  4J90 A;  3D66 A;  5MAO A;  1KOH A;  1Z2L A;  1F9F A;  1OSC A;  3IXQ A;  4Y2K A;  2AQ4 A;  3FVY A;  3QJJ A;  2UUW A;  3C16 B;  4ILR A;  4LVO P;  2C3P A;  2HQF A;  3HPO A;  3UVJ A;  2KRR A;  4AE5 A;  2Y1R I;  2KL8 A;  3FNN A;  3M8P A;  2GMH A;  4NRU A;  5K9F A;  1JLE B;  4QIV A;  2VL1 A;  3UDL A;  1RK8 A;  2OLW A;  3W9I A;  2J0S D;  4PXB A;  2EKY A;  2D3Z A;  4ZCL A;  3D3B J;  2AZ1 A;  3UDV A;  2G9O A;  5FJ4 A;  5K8P A;  2AHO B;  4TLR A;  2BKP A;  4P10 A;  4OV1 A;  4FPI A;  3AOC A;  2E7X A;  4DR3 J;  5IV4 A;  4I2P A;  4URQ U;  2OGU A;  2EBG A;  4DPW A;  1HHQ A;  3D6T B;  2NCK L;  5KG3 A;  3KOA A;  3OFF A;  5HBM B;  1ITP A;  2CRL A;  2XHC A;  3G4S S;  2X7I A;  4H4O B;  2FC8 A;  1XBW A;  4PWW A;  5IT0 A;  1F2H A;  4J9P A;  2JEF A;  2LU2 A;  2WVC A;  4QR0 A;  3D3C J;  2HND B;  1TK8 A;  1BGX T;  3KK2 A;  3OTD A;  3V5R A;  1JLQ B;  1FKA F;  4RW8 A;  5AXM A;  4HHU A;  3UW1 A;  3C3L A;  3C14 B;  2KH9 A;  2FD2 A;  1LW0 A;  3RJM B;  5CD4 A;  1C1B B;  3RBD A;  2B7B B;  2QA2 A;  5C5J A;  2OPR A;  2AT1 B;  4MH8 A;  3DCA A;  1TK5 A;  3KG4 A;  1ZOT A;  2HVD A;  4NLV A;  3TP2 A;  2L9N A;  1IQT A;  5JVG Q;  1H3D A;  4DFP A;  3ITH B;  4PWD A;  1YJN S;  1WC0 A;  2ZH6 A;  2OH2 A;  1U47 A;  3E01 B;  2NLW A;  1IJE B;  4Z7C A;  4GVB B;  2BJD A;  3G2X A;  3EPI A;  1ZPV A;  1VHF A;  1BC6 A;  2XMJ A;  1XMQ J;  4YDD B;  2DNM A;  4CLP A;  4EZ6 A;  1VQK S;  2R7V A;  1YJ9 S;  3VTI A;  2AU0 A;  3CDE A;  1N5Q A;  4P72 A;  3CED A;  2UXC J;  3AJD A;  4CH0 S;  1TQL A;  2HIQ A;  4USJ C;  5DO2 A;  4ZIT A;  4YHH J;  3T19 A;  1XR7 A;  2BJ9 A;  5J2N B;  2I5J B;  3P45 B;  1DTT B;  3OFE A;  1S76 D;  3C15 B;  3VGV A;  1D8Y A;  4WBF A;  4P73 A;  2ILY A;  2CPX A;  3VV2 B;  3MAA A;  3FDS A;  5M2R A;  1HPZ A;  5DS7 A;  4YP3 A;  4CLS A;  4CP5 A;  1FRK A;  1S9E B;  4Y2C A;  2K2P A;  4CLW A;  1HL6 A;  2AYB A;  1NM2 A;  2FVP A;  4NLD A;  3B8H A;  1RUS A;  1FRX A;  4X62 F;  2ZD1 A;  3QGH A;  3SDE A;  2VFV A;  4EMD A;  2RS2 A;  2DNP A;  1WF0 A;  2EEY A;  2YH0 A;  4IQM A;  3NCR A;  3VR1 A;  4F3O A;  4V1A k;  1BQN B;  4N77 A;  1WNE A;  1C2P A;  2HS3 A;  1XR5 A;  3HF5 A;  2IDE A;  2OP5 A;  4P75 A;  2K3K A;  2VON A;  3WDO A;  3TVY A;  2Y1L B;  5B0F A;  1B7F A;  1TVR B;  4ECQ A;  3HHL A;  1MU2 A;  1KOO A;  4Q2L A;  1UA0 A;  4JI2 J;  3KHH A;  2JFD A;  2V4J B;  2J9D E;  2AGQ A;  1B70 B;  1V3R A;  4OIX A;  1ZYQ A;  3QAT A;  2IJR A;  1RBA A;  4OYP A;  3M2U B;  1IBM F;  5J2Q B;  1LK7 A;  4C48 A;  3TWZ A;  3CCJ S;  1IKW A;  2OTJ S;  1F9H A;  3MUT P;  5I42 A;  2Q6B A;  4HT5 A;  5HL7 Q;  5DLF A;  2UVU A;  1T11 A;  4YR0 A;  4LFA J;  4TQR A;  4OZ2 A;  1ZM9 A;  1CSJ A;  2ZEJ A;  2AYM A;  1IKX A;  3MI7 X;  1KLM A;  2HZV A;  2CNN B;  2DJW A;  1VRT B;  2AJ1 A;  4QIG A;  5LT5 A;  2K8G A;  3MD3 A;  4X64 F;  3FGV A;  5G0R A;  3KJN B;  2CDQ A;  1TV6 A;  2XGQ A;  4DR2 J;  2XS5 A;  5E3C A;  1HMV A;  3MED A;  2QYG A;  2W9C B;  1ZH5 A;  4KE5 A;  3AOB A;  1N48 A;  5GAE I;  4K8R A;  4DSE A;  4USI A;  1GQE A;  3MMA B;  1RAH B;  4ZVH A;  1SUQ A;  1TUV A;  1S0O A;  1VIO A;  2HNZ B;  2RS8 A;  3BV8 A;  3I5A A;  4L76 A;  4DUY F;  1IVZ A;  1ELO A;  5A8K A;  1VQM S;  3M2R B;  2BJ8 A;  4K4Z A;  5I3Q A;  4K4Y A;  3OR1 A;  1NB7 A;  1RT7 A;  1RTJ B;  3HSJ A;  1DTQ B;  3V6D A;  2A1B A;  1RWU A;  3CIZ A;  2HNY A;  1S49 A;  2NPF A;  3R97 A;  3C19 A;  2AYE A;  5RUB A;  4ZPV R;  4J9M A;  3OUY A;  2KVI A;  5HRO B;  2W7A A;  1ZAV A;  2QL7 B;  4LF6 J;  3BGU A;  4E2F B;  5E3R A;  5L1L A;  4C8Z A;  1S9G A;  2KN4 A;  1TL7 A;  2IA0 A;  4OV6 A;  1FER A;  2H65 B;  1U2R A;  1SJQ A;  1TKX B;  1R31 A;  1WWH A;  3JSM A;  4QWE A;  1AUD A;  2BRL A;  2DD8 S;  3VAF A;  2YKA A;  3VCD A;  1ZZF A;  4CTA B;  2H5J B;  2EFV A;  1WHX A;  3VZI A;  1WKK A;  1BD6 A;  1VBX A;  2HFV A;  3T9N A;  5A0Y B;  3IP0 A;  3QYY A;  3CVK A;  3R1L A;  2XSJ A;  4ZPA A;  4JI6 J;  3OD2 A;  4CT8 A;  2AMC B;  4DR7 F;  3FMW A;  2FZK B;  4G1Q B;  1WDT A;  3CJ4 A;  4RUB A;  4X4V A;  2NYH A;  3IRX B;  4K4T A;  2E9R X;  4KHP J;  2W7P A;  4NYO A;  4OX9 F;  2JH3 A;  4DG1 B;  1H0H B;  2RRA A;  1RCO B;  1VQ5 S;  3IWN C;  3OL9 A;  1J5E J;  1Y0H A;  2G13 A;  2CXE A;  1NME B;  3IAS 9;  5GME A;  4RLE A;  4LIW A;  1VK3 A;  1CUL A;  1JIH A;  4WF9 Q;  1M5K C;  3AH6 A;  3AT1 B;  1QY7 A;  5L1J A;  5DDP C;  3BPD A;  4FDF A;  4PQA A;  1IBL F;  3V4M A;  1JB0 C;  3X1L B;  3S01 A;  3MUV P;  2VBW A;  1C0T A;  2BAC A;  2DGX A;  3SYZ A;  4DQQ A;  2Z2Y B;  3UDC A;  1WF1 A;  3KDO A;  1T03 A;  1R6V A;  2QA1 A;  2XI2 A;  1WD6 A;  3NBP B;  4KKO B;  4AND A;  4OHY A;  1N32 J;  3OR2 B;  2AJ0 A;  4QZV B;  3FFI A;  3BN4 A;  5KFL A;  3DOK B;  1P27 B;  3RR7 A;  5CZV A;  2XWX A;  2VPX B;  4NXM F;  3PR4 A;  4C4W A;  2E7V A;  2GJF A;  1LNQ A;  2ZNY A;  4OFZ A;  3Q0A A;  3SIP B;  3PXG a;  3PKY A;  4K4X A;  4UST A;  3ZTR A;  1YGY A;  3F41 A;  3MEK A;  4A8F A;  2O67 A;  2H9Z A;  4C97 A;  3Q2T C;  4R8U A;  4J9L A;  2ATL A;  1MSW D;  3IM8 A;  2UXD J;  1Y7P A;  5IT9 Y;  1YHQ S;  2MKI A;  3LTO A;  4LQ3 A;  2F5G A;  1DRZ A;  4JV2 A;  1B0P A;  1HWI A;  2XS7 A;  2H1Y A;  3V81 B;  4C0O C;  4F2R A;  4QWC A;  4J9U E;  3FCW A;  3IN5 A;  2MKY A;  5J1P A;  3PYF A;  1FES A;  1QAJ A;  1R3N A;  5GAD I;  3IWL A;  2J0X A;  1G2E A;  2ZH5 A;  3G6Y A;  1U2F A;  4O3O A;  3QGI A;  3M9M B;  4N56 A;  4KR0 B;  4DL2 A;  2CJ9 A;  1N33 J;  5JVH Q;  1E6V A;  4BDP A;  1HNW J;  4A8K A;  3VVU A;  3CCE S;  1KBR A;  2B6A A;  1JLG A;  5KAK A;  1UW9 A;  4WFZ A;  3D68 A;  4MKY A;  2UXB F;  4CRJ A;  1XNR J;  2HHQ A;  2FHK A;  2VOD A;  1E6Y B;  5EN1 A;  4MFB A;  1Y5I B;  2KFZ A;  4CM2 A;  3ILI A;  3BJY A;  3L7P A;  4MIB A;  2FJD B;  2R7R A;  2HHH J;  4KGZ B;  3GP9 A;  2OO4 A;  1VK8 A;  5ETN A;  2JL9 A;  3KNG A;  5HAO A;  4N5S A;  3RB4 A;  2B8P A;  4RW4 A;  1KHW A;  1U1P A;  3EDR B;  1T7P A;  2CFX A;  1R27 B;  2IMW P;  4J5O A;  4CZC A;  4EI2 A;  2V2V A;  4QIF A;  2OPQ A;  4RU2 A;  4WYW A;  1SJR A;  2PO4 A;  1T8E A;  1VQ6 S;  3H20 A;  1YZ7 A;  3ISN C;  1FA0 A;  3TW0 A;  3H7H B;  1OS5 A;  3DGP A;  3GFZ A;  3R2D J;  3CJ0 A;  5F3Z A;  4QQB A;  4J9K A;  1G4C A;  4P2S A;  2QMU B;  3LOU A;  2YWF A;  4RKU C;  2QC3 A;  2J9D A;  1FRL A;  1HBU B;  2RB7 A;  1URN A;  3OXF A;  3E2E A;  3Q86 A;  3I6P A;  5AE2 A;  3OSP A;  1WG5 A;  2IAJ B;  1QUV A;  4WTO B;  4DV3 F;  4NEY A;  4Q2M A;  4JYA F;  5IQQ A;  3GG0 A;  3W3S A;  2YNI A;  5GMD A;  1RAD B;  2M3D A;  1TUG B;  3OXG A;  5KG6 A;  3L95 X;  2A18 A;  3WIU A;  4ZJO A;  4JI1 F;  1Q7Y T;  3QBC A;  1MWZ A;  2Z56 B;  4LF8 J;  3VHQ A;  1SKR A;  4ED4 A;  1IBK J;  4OHZ A;  3L4B C;  2MGZ A;  4GRS A;  4OI1 A;  2CVE A;  4F36 A;  3ENW A;  1WHV A;  2VU5 A;  1NB2 A;  2ZH4 A;  1WG1 A;  4JV5 J;  3J7Z 5;  3I31 A;  3PY8 A;  3P49 B;  2ZBP A;  4Y28 C;  5F8L A;  3K17 A;  4F67 A;  4U7U K;  5A8R B;  1WF2 A;  2M88 A;  2YPY A;  1X4C A;  1D1U A;  2LQ5 A;  4WFY A;  4CO0 A;  2R2U A;  2YX1 A;  3M7V A;  2VG7 A;  5KT4 A;  1FX4 A;  2Z58 B;  5CYQ B;  4O4G B;  3PX0 A;  3PYG A;  2N4C A;  1A9N B;  1CC8 A;  1EIY B;  2F7V A;  1SV5 A;  5KFR A;  4AXI A;  2UU9 J;  2E1P A;  1FWK A;  2FZG B;  2DHH A;  1D09 B;  3C6T A;  3RBX A;  2ASD A;  3QGG A;  3CCW A;  3OTE A;  3KLE A;  1IKV B;  2WB1 D;  2KZM A;  2C2N A;  4O44 B;  5ETR A;  5IZH A;  3KTQ A;  3E3X A;  3NGU A;  2YQ3 A;  4CLT A;  1MRO B;  3K5M A;  1VRU A;  4PZV A;  2MHN A;  1SQF A;  3OL7 A;  3A8K A;  5BR8 J;  2HBQ B;  4IG0 A;  2C2Z B;  4A8X A;  1MML A;  2LKZ A;  2RF2 A;  3C66 A;  4F04 B;  3PVX A;  3K5N A;  5GAH I;  2QG9 B;  2QL9 B;  1H7W A;  5C2C A;  1FNX H;  2B9E A;  3LH2 S;  1NJW A;  1S6P B;  5J1N A;  4R25 A;  2IRY A;  5KFG A;  3HHN B;  2VG5 B;  4ED7 A;  4ES2 A;  3FZ2 A;  3GLJ A;  3JSR A;  4DV6 J;  3N79 A;  4L6V 3;  2ERR A;  4C0H A;  1QTN B;  1N8R T;  3DM2 B;  1RT4 A;  4TU7 A;  3SSR A;  1RQ0 A;  2UUT A;  3R9L A;  2JX2 A;  3ZNU A;  1U1Q A;  3PHE A;  2XI3 A;  3AXM A;  3HVT B;  5M2U A;  4K4U A;  2H3E B;  3UFC X;  3MMC A;  4X65 J;  4WIQ A;  2YNG A;  2CPF A;  3ZZZ A;  5HAN A;  1FWL A;  2HWT A;  1RTD B;  4F4K A;  4JB8 B;  1EKR A;  2XBP A;  4QWA A;  1AZS A;  2HHP A;  1FF2 A;  2C3O A;  3W61 A;  4UT4 A;  1TU0 B;  4NLU A;  4Q0B B;  3CJS A;  2RRB A;  1S77 D;  1U1M A;  4MK9 A;  2M8D B;  2G0I A;  4I68 A;  1GTE A;  1D0E A;  2R9L A;  4P52 A;  2UUA J;  3CJR A;  5A6W A;  2IM2 A;  3RGI A;  2HSE B;  2QTW A;  2MJU A;  3S7R A;  4CYU A;  5KFN A;  2NYI A;  5HBM A;  4DS5 A;  1N36 F;  4C11 B;  4H4O A;  2E5L F;  2IRU A;  1XJW B;  1NO8 A;  1H6K X;  2HND A;  3TAN A;  2QV6 A;  1RTI B;  1RXO B;  1S12 A;  2Y9H A;  1U6Z A;  3CF5 Q;  1VQL S;  2BAN B;  4QU6 A;  4ZLJ A;  3NGS A;  3T1Y J;  1YJR A;  3DMJ B;  3I87 A;  2BJE A;  2YH1 A;  2WON A;  3OHB A;  2BX6 A;  2VA3 A;  2F8E X;  5L9X A;  4RL1 A;  3BB5 A;  2JNJ A;  4DL7 A;  1EET A;  4GVB A;  3NGK A;  1RHU B;  4URS A;  4DV7 F;  3NRB A;  2YX7 A;  1WEL A;  4Y2A A;  3UCU P;  4B3O B;  1HR0 F;  3OLA A;  2CZV C;  1AA1 B;  5DGB A;  2ATC B;  4ZVU B;  3OBI A;  4OYO A;  2MZS A;  2HFU A;  3AHP A;  3GIK A;  4UOF A;  3PX4 A;  1X4H A;  3RW7 A;  1FDA A;  1QVF R;  2DHX A;  1X31 C;  1DTT A;  3BQ0 A;  1RI7 A;  2U1A A;  4W98 A;  3J80 Y;  4R0J A;  1H2U X;  2DBB A;  3MEG B;  3HM9 A;  2C22 A;  4E0D A;  2DY1 A;  5DJB A;  4DF8 A;  2CZ4 A;  2GVZ B;  2GAH C;  3THV A;  6AT1 B;  2WTF A;  1WKL A;  2RQC A;  4RBV A;  4IO9 Q;  4X4O A;  3MR2 A;  1L3T A;  1LW2 A;  3BSA A;  1RWK B;  4RW7 B;  5A6P A;  1I5O B;  2HYI B;  4V19 J;  3AAW B;  2QT7 A;  4BHQ A;  1NK5 A;  2N7C A;  5KG2 A;  2GCF A;  2YNF A;  4B3S F;  3W66 A;  3TRG A;  5HLF B;  1OPI A;  2Y0S D;  1NXI A;  3MXH P;  1V3Z A;  1YBT A;  2M52 A;  2UP1 A;  3G96 A;  3TZW A;  4DR1 J;  5J2M A;  1CC7 A;  3CT9 A;  2JEG A;  5EX0 A;  1VYA A;  1TVR A;  2W4C A;  5F9L A;  5ETV A;  3ZZY A;  5I3U B;  1B7Y B;  2RT3 A;  2FQQ B;  4NZ6 A;  2V4J A;  4GKK F;  3US5 A;  1DJ0 A;  2FGO A;  4K4S A;  3TJA A;  1NND A;  4MK8 A;  4PR6 A;  1IJF B;  4LSZ B;  4NLS A;  3D6M B;  5DZ7 A;  2GQ2 A;  3I96 A;  2WBR A;  4L3K A;  3ZNJ 1;  2ZZM A;  5HMZ A;  1KDN A;  4B3M F;  1RJJ A;  2RIL A;  5ETO A;  2UUB F;  3GCW P;  2ZOM A;  5B08 A;  2N82 B;  2DH8 A;  3GIJ A;  1U1O A;  3NS6 A;  1V5V A;  2ZH1 A;  1JKH A;  4B3R J;  3MTJ A;  4L3N A;  4ECX A;  3PJ9 A;  2NXN A;  3QT6 A;  2ZBQ A;  3W8P A;  2XQC A;  1VRT A;  1JK9 B;  4U96 A;  3M6X A;  3I0S B;  4DJB A;  1Q5Y A;  4B02 A;  2CNO B;  2PC6 A;  2VDI A;  1IM4 A;  4OHW A;  2OML A;  2W9C A;  5ETQ A;  3ZZP A;  4OYW A;  5LMN J;  4Y00 A;  1S59 A;  1U45 A;  4DZ6 A;  3RRH A;  2BVZ A;  1W25 A;  1W7W A;  1BY9 A;  5ITH A;  3EPG A;  4DPT A;  3QZ8 A;  2IVY A;  1U0H B;  2MEW A;  1RTJ A;  1IWG A;  3QFH A;  3PEH A;  1RAI B;  2CZ9 A;  4HR2 A;  5GVQ A;  4FXV A;  1OQ3 A;  4ZVO B;  3Q2S C;  2YY3 A;  3LPE A;  4ZVE A;  2FHM A;  1KR4 A;  2E29 A;  3JB9 k;  1I6J A;  4GMK A;  4F0M A;  3KLH B;  3BO4 A;  5K8O A;  2OHD A;  1NHK L;  1TKX A;  4AD6 A;  2HHT A;  1ZBT A;  4IUF A;  2G1H A;  4MIA A;  3M6V A;  4M5H A;  3WBZ A;  3D6F B;  3J7Y U;  2HRY A;  4QR2 A;  4CTA A;  4WKR A;  1OY6 A;  1WTF A;  2BRK A;  1SBR A;  1NU4 A;  1PC4 A;  3M30 B;  4CH1 A;  4C8K A;  5KT7 A;  3BYP A;  1RSC A;  4QBU A;  2MKH A;  3IA0 A;  2LXU A;  3TAQ A;  2FJX A;  5BYQ A;  3IGV A;  3B6B A;  4LT6 A;  4WXW A;  2EFO A;  4NLY A;  4DL6 A;  1VQ8 S;  2GHW A;  3DRS B;  1BMQ B;  2NSB A;  2QLF B;  3IRX A;  1XMO J;  3OV7 A;  1SQG A;  1LKZ A;  2RIJ A;  2W2O P;  5L9N A;  3M32 B;  4DG1 A;  1U8S A;  3H90 A;  1UCN A;  1MW7 A;  2RRN A;  2V63 A;  2QMX A;  4AL6 A;  4NLQ A;  3POT B;  5K8N A;  1HW8 A;  3L7O A;  4YDX A;  3KG1 A;  4XDC A;  2PA3 A;  1X4D A;  3T5K A;  1DQ9 A;  3IWX A;  1KFS A;  4RW9 B;  2MDA A;  4Q45 A;  2P2C B;  1JLB B;  4OYM A;  4RX6 A;  2R7O A;  3SI8 A;  1B3T A;  2ZFH A;  1HFE L;  3DGV A;  1XIQ A;  1HBO B;  3W2V A;  2IC3 A;  3FEY B;  4H54 A;  2F4V F;  4ENO A;  4DSK A;  5M2P A;  2ZUA A;  2ZC4 A;  4FZV A;  4IKA A;  3SFG A;  4NXN F;  4DR5 F;  2VG6 A;  5LL6 d;  1T3O A;  4JI3 J;  1HQU B;  4KKO A;  4KJI A;  3RAM A;  1PJ7 A;  3OR2 A;  3C6U A;  4F02 A;  2LEA A;  5CCM A;  1AUS L;  3NNA A;  4ZPB A;  1HQE A;  2VOO A;  1DFD A;  3TZY A;  3HHL D;  3GQC A;  2DK2 A;  2H54 B;  4DV1 F;  2PDA A;  4LFC J;  2VBY A;  3DLK A;  2A6O A;  4RUC A;  3BKT A;  1JNR B;  3HT3 A;  4AQY J;  4U6P A;  1V6H A;  4KGK A;  4Q8E A;  1SJ1 A;  2O5D A;  3E8O A;  3I5C A;  3V6J A;  4KIA A;  3TEG A;  2KXF A;  4P2M A;  4HAC B;  4IFV A;  1PYT A;  2Y8Y A;  2M9K A;  4HH0 A;  1VRQ C;  4CLY A;  1RTH B;  4QYZ K;  4JBC A;  3W60 A;  3I0R B;  1N5T A;  3V81 A;  2G2Y A;  1UWB B;  1J5O A;  1H98 A;  4KPC A;  2F4F A;  4X4T A;  4CI0 B;  1LQ9 A;  2B9W A;  2AYG A;  2LA6 A;  1HHS A;  1SL0 A;  5F8J A;  2D7S A;  2QLB B;  4USH A;  3T1H F;  1C1C B;  2QLX A;  1WAC A;  4PG4 A;  2LYV A;  3LP0 B;  3OW2 R;  4YS2 A;  1X5P A;  2UV8 G;  1QD1 A;  4CCH A;  2RKI B;  4RNM A;  4M5D B;  2LEB A;  2HQD A;  3G8Q A;  2QN6 B;  4YB6 A;  3KG0 A;  3U1L A;  1S99 A;  3M8Z A;  1E6Y A;  4UZB A;  3H4B A;  2YKO A;  1VBK A;  3K8V A;  2J6U A;  3DKD A;  4PUO B;  2IJN A;  2DGQ A;  4NEZ A;  2EFP A;  1IKY A;  2FJW A;  3BGF A;  4G3I A;  4QYR A;  1YJW S;  2IYI A;  4X4R A;  1D3W A;  4K5R A;  3ZFV A;  3EIC A;  3D0G E;  4LIR A;  1LK5 A;  3F56 A;  3GSI A;  3ETM A;  4I64 A;  3CC4 S;  2OEJ A;  2FUG 9;  4ILM A;  2CPH A;  4U9R A;  4WU2 A;  1CS4 A;  4DPX A;  2ZUG A;  2E9Z A;  3GIR A;  5HI7 A;  3KUE A;  3HXM A;  5KFD A;  4RUH A;  1Y10 A;  4NRT A;  4IOB A;  4EK2 A;  3CCL S;  2MLY A;  2DGW A;  4DR4 F;  5ADZ A;  1VC5 A;  3PM9 A;  1KKH A;  5LSO A;  3DHW C;  3PRV A;  1Z4U A;  3I4H X;  2KZZ A;  2P6T A;  3MM6 B;  1PBU A;  3WC2 A;  2J0W A;  1NSA A;  5DET A;  3CD6 S;  1NDP A;  1PGZ A;  3CCM S;  4I67 A;  1VOM A;  1WUU A;  4DV5 J;  4B9M A;  3T9Z A;  4EUV A;  1BQM A;  4X4N A;  3VAH A;  5C25 B;  2FVQ A;  4CNZ A;  1PJ5 A;  1VLY A;  4K7Q A;  2D69 A;  1VQO S;  1XNQ F;  5GAG I;  4KBI A;  2WSE C;  5IC6 B;  1TR0 A;  2E5G A;  3FBF A;  4X62 J;  2HBY B;  2MB0 B;  3UN3 A;  3MCS A;  1VQY A;  4Y0F A;  1N52 B;  3K2Y A;  2C2R A;  4HKQ A;  1KP6 A;  3UR3 C;  4K50 A;  4J9N A;  1F0X A;  3ZZT A;  3M8Q B;  1NKC A;  4NAS A;  5HO4 A;  5IT9 U;  4FNH A;  1F9E B;  2BJ3 A;  1BHN A;  2DNG A;  4EYI B;  1X4E A;  2QX0 A;  2HAF A;  3IR5 B;  4DCP B;  3H5X A;  4AL5 A;  1RIS A;  3O1L A;  4RO0 A;  2VJV A;  1ZTW A;  2C2K B;  3BH7 B;  4WFA Q;  2CQ2 A;  1F3V A;  3BGR B;  1PG5 B;  5EWF A;  3LPY A;  3KUH A;  2B4U A;  4OZ0 A;  4WJB A;  3B82 A;  3MR6 A;  3HVW A;  2B0G A;  4CLZ A;  1NBE B;  4ZPC A;  2W2P P;  1IBM J;  2BXJ A;  3H2V E;  3DLG B;  2RQ4 A;  2YXL A;  2R7U A;  2V4Q A;  4ZIV A;  4NI2 A;  1Q8I A;  3CE8 A;  1QSS A;  4DLG A;  3LAL A;  3BEG B;  7AT1 B;  1WC4 A;  1K1S A;  1VHI A;  1MLA A;  2CJX B;  3TVZ A;  3O2I A;  1TL1 B;  4USW A;  1HD0 A;  4N8N A;  3ENV A;  2HPU A;  1MRO A;  2N7Y A;  3SSQ A;  4LFB F;  2ZH7 A;  4IRD A;  3ONQ A;  4OHV A;  3M6W A;  3MM9 B;  1NRK A;  3M9N B;  4CQ1 A;  4DR3 F;  2UVR A;  4OX8 A;  1FJG F;  1VQN S;  4AL7 A;  3DYA A;  2MKC A;  4EEY A;  1H2T Z;  4KGV B;  2ROG A;  2QA4 S;  1K47 A;  5BXI A;  1HYS A;  3MM7 A;  3FBE A;  2VG5 A;  2FLN A;  4J37 A;  1WC1 A;  1LV5 A;  4O23 A;  5E3P A;  4OZJ A;  3MCM A;  2MPU A;  4DUY J;  1DZ5 A;  3DM2 A;  3W9J A;  4ZPT R;  2IYG A;  5C7P A;  1G3O A;  2DGO A;  1JLF A;  1LWX A;  5HN0 A;  2PT0 A;  4P6Q A;  2H5I B;  3HCX A;  3RAX A;  4R5P A;  2HMI B;  4WCE Q;  2ZE2 B;  4Q5V A;  3NAI A;  1C0U B;  2XMT A;  4TNO A;  1RTD A;  5B0B A;  1XMQ F;  4Q8F A;  1UAW A;  3N28 A;  1DY3 A;  3CGI A;  2WVD A;  4DV0 J;  3J81 Y;  2EK1 A;  3P5B P;  1M1K T;  3CCU S;  2ADB A;  2K06 A;  4FXD A;  2UXC F;  4FYV B;  3DRP B;  2XHW A;  2ZVI A;  4RNN A;  4LSL A;  3R5C A;  2R8H A;  3S1T A;  2CPY A;  2VQE J;  3CD0 A;  1PO6 A;  3NNC A;  2EC2 A;  4TXS A;  3R6L B;  4IO1 A;  1QE1 B;  2GQC A;  1FWP A;  4XPC A;  3DLB A;  3RRG A;  4FF2 A;  3EGN A;  5HJY A;  5KFE A;  2Q6C A;  4HYK A;  2ZVS A;  2VFU A;  4ID5 B;  5LMU F;  1EB0 A;  1X0F A;  3ENA A;  4LR7 A;  1PYS B;  4ES3 A;  1HWJ A;  3CJK B;  4MK7 A;  2ZOG A;  2EFN A;  3AB2 B;  3UR0 A;  3SFU A;  1LWE A;  1HW9 A;  4ZP6 A;  1X4F A;  2FC9 A;  4OX9 J;  1RKJ A;  5LSL A;  2BAN A;  2D9P A;  5KOW A;  1NK7 A;  2XLK A;  6FDR A;  2HVH A;  5C42 B;  5KOX A;  3HI9 A;  2CQC A;  5KFJ A;  5D4P A;  1LEO A;  3BR8 A;  1NLK L;  1O51 A;  3L9Z A;  2AGO A;  4ILL A;  3IO1 A;  5L39 A;  3OTC A;  4LSN B;  3BR9 A;  4ECT A;  3KKF A;  3KFW X;  1IBL J;  4JI5 F;  3QIP B;  4UOH A;  1T95 A;  3FQL A;  3PV8 A;  2KB2 A;  1RP5 A;  3IM9 A;  3MM5 B;  2M7S A;  1K0T A;  4H4M B;  1UEV A;  3LGN A;  4B3T F;  1XR6 A;  2CUY A;  1JXE A;  2HLT A;  2V69 A;  4WFB Q;  2ALY B;  1RAJ A;  5K5M A;  2UUC J;  2HVE A;  4JI8 F;  5KT2 A;  4FF3 A;  5HK4 A;  3KJV B;  2YWE A;  2PI4 A;  3QJP A;  1RAG B;  2QA4 G;  2VFS A;  4BLG A;  5KFU A;  1ZAW A;  5GMK a;  4LBP A;  2KFY A;  2KM8 B;  1VS3 A;  1HNX F;  4NXM J;  1SXL A;  2HWH A;  1QM9 A;  2BMB A;  3CC7 S;  1S1W B;  2B5J B;  3EE3 A;  2GVZ A;  3AJ2 A;  4DUZ F;  4NLO A;  2DIS A;  4ECZ A;  1Q81 T;  1QSL A;  2HUR A;  1ZM4 A;  1R8B A;  3ELH A;  4J9V A;  2HHV A;  3QSI A;  4HEA 9;  4MIW A;  3J7Y I;  1PC5 A;  3DOM B;  3LQV A;  4RW7 A;  1NK9 A;  4C8N A;  3CDU A;  2H5E A;  4QW8 A;  2Z2Z A;  2ZM6 F;  3ETO A;  4X4U A;  2ROE A;  1MMD A;  1UFL A;  1YX2 A;  3GB0 A;  3RUB L;  3NGT A;  4ER8 A;  3DLH A;  1RT3 B;  2VC1 A;  4ID8 A;  1VJQ A;  2E44 A;  4O4R A;  3PR5 B;  1N5V A;  5A2Q U;  2AV5 A;  3EWG A;  5I3U A;  3GTY X;  1U7L A;  5KT3 A;  1NCL A;  4KV8 B;  4C8O A;  5IM0 B;  4YB1 P;  2C28 A;  2MZJ A;  3SMZ A;  2EBE A;  2WOM B;  2YBV A;  1YBU A;  2YTC A;  3SCK E;  3MPD A;  2ZH8 A;  1Q5V A;  4OYA A;  3D1O A;  1YBA A;  2QFI A;  4OYX A;  1UZD A;  2R3V A;  2DR8 A;  3H25 A;  5J2P B;  4ECV A;  4Y6I A;  2KI2 A;  4HHJ A;  3BN7 A;  4P7V A;  2QO3 A;  3QAU A;  2DH7 A;  4LF7 F;  4U95 A;  4DCJ B;  1NZA A;  3E51 A;  5IV3 A;  3LGH A;  4IDK B;  2R8J A;  1WG4 A;  3RW6 A;  2EC0 A;  4JI6 F;  4EBC A;  3R3T A;  3OJS A;  2AKW B;  2W2Q P;  1X9W A;  3EGV A;  5L1K A;  3BSN A;  1FK9 B;  2OD4 A;  4PAA A;  3W7B A;  4WFX A;  2XMM A;  3C8Y A;  1UET A;  1KFD A;  5HVG A;  4F0H A;  4OZ1 A;  4ZIW A;  2JFK A;  4XK8 C;  4ZDN A;  3QMQ A;  2JVO A;  5DQI A;  2P5V A;  2ADC A;  4IG3 B;  1VC0 A;  2JLE A;  3W2W A;  3BPS P;  4OLP A;  3KWM A;  1SJ3 P;  2XZW A;  4GKJ F;  5CA5 A;  2YKN B;  3RAQ A;  4OJG A;  2HKE A;  5KFP A;  4DV3 J;  4NLT A;  2MKJ A;  4JYA J;  4ZCI A;  1F60 B;  1WEX A;  1RAO A;  1X4B A;  2HFZ A;  4IH6 A;  3N6M A;  5DM6 Q;  2M2B A;  5F41 A;  4W90 B;  4TYA A;  5E7O B;  3MAQ A;  3QT5 A;  2MZR A;  4XIU A;  3SZ2 A;  3MPU B;  3T5H A;  4TLQ A;  4ED8 A;  4AYB D;  1IQZ A;  4DFK A;  4C9D A;  1T9V A;  1UPP A;  2OSQ A;  1QAY A;  1FRI A;  3TUZ C;  3ZO7 A;  1DLO B;  4ALZ A;  3GV5 B;  3ZC4 A;  1PBA A;  1CLF A;  2Y3Y A;  1NKB A;  1VIX A;  4RU9 A;  2LDI A;  1AB8 A;  1B0T A;  5A8W A;  1UJ4 A;  1SIW B;  1FJE B;  3JS9 A;  3SQG B;  2C3Y A;  4EYH B;  3DRS A;  4OZL A;  2BE2 A;  3QRQ A;  3ZZ0 A;  1P8G A;  3MFI A;  2COL A;  3ISN D;  3BDE A;  4NCA A;  2XMK A;  2HQC A;  4F0K A;  2GX8 A;  4CLK A;  4DMZ A;  2AJQ A;  4DL3 A;  3BGL A;  2DCL A;  2DXF A;  5IOL A;  5ETL A;  2DYA A;  2G0J A;  4MMO A;  2G1D A;  3TAM A;  2D3O 1;  3M6U A;  4LRD A;  1GX5 A;  1S4E A;  4TN2 A;  1YIT S;  2MQ8 A;  4C3M A;  2B4V A;  1FKO B;  2LEP A;  1HNW F;  3Q83 A;  2LQB A;  3EVO A;  2J9E A;  3ZZO A;  3J81 j;  3JTP A;  1Q53 A;  3FBC A;  3OSN A;  1HQU A;  3H59 A;  3KHR A;  4B9S A;  1FFG B;  4PQU A;  4BC7 A;  2QLJ B;  4I2Q B;  1RT2 A;  3EZU A;  3M8W A;  2DIU A;  1IXK A;  3V2U C;  1FNM A;  2RH3 A;  2B8Q A;  1XNR F;  5D77 A;  4LRC A;  3AY0 A;  3MGJ A;  3R2C J;  3ILL A;  4JI4 J;  1LOU A;  4JI0 F;  4X4Q A;  3KK2 B;  5CAB A;  5DZ6 A;  2VZ9 A;  3I4P A;  4RW8 B;  2BUN A;  8RUC A;  1VQ7 S;  1FX2 A;  3Q8V A;  3QNW B;  3M1V A;  3MEE B;  2XC9 A;  4EO8 A;  1S7H A;  1EKS A;  5KFX A;  3HKW A;  1S1U A;  2FHJ A;  4DL0 C;  1RLD A;  3A8E A;  1PAU B;  4A8M P;  2MQQ A;  3ULH A;  4HAC A;  1RHK B;  1ZM3 A;  3TUI C;  5U47 A;  2IRX A;  1UTA A;  4HLB A;  4C3L A;  1HKA A;  1OYE A;  4K59 A;  4ECS A;  5E0O A;  3LUY A;  2OJ3 A;  5DDQ C;  2RUS A;  1JJ4 A;  4DPU A;  2RNE A;  2ZKU A;  3TQ1 A;  2CQ4 A;  3NL0 A;  1EJ7 L;  2CJB A;  2PFF B;  1RT5 B;  5KG4 A;  5AE1 A;  1U09 A;  2BYC A;  4FN5 A;  4ZLN A;  5D4N A;  4QWB A;  4M8L A;  1RAC B;  1C1C A;  3MR3 A;  3GR1 A;  5DG9 A;  1GXT A;  1PKU A;  2QFJ A;  3LAM A;  5B0D A;  3KK3 B;  3EVM A;  1HPZ B;  3M2V A;  4DSL A;  3PHT A;  1Y3K A;  4DU8 A;  2RKI A;  1RHR B;  5BYS A;  4M5D A;  5D0H A;  1N36 J;  5DRK A;  4X66 J;  5KFK A;  4NCG B;  2E5L J;  2DGT A;  2FHO B;  3MR7 A;  3SDE B;  3G6E S;  3P3D A;  4OYI A;  5H9F K;  3GII A;  4FS2 A;  2ACM A;  3SEO A;  4LF8 F;  4ZOS A;  4JV0 A;  3SXL A;  2P9G A;  1CJK A;  4A48 A;  4ZVF A;  1TFY A;  4OYZ A;  3GZ7 A;  2MQO A;  1G6B A;  1T05 A;  4ZHR B;  3MM8 B;  1RYS A;  4QWD A;  3HUL A;  3NMA A;  3UNY A;  3ILO A;  1FTR A;  1NJI T;  2PMW A;  1R8C A;  4DX8 H;  4DV7 J;  2ZBI A;  1IR1 A;  3DLJ A;  3CC2 S;  1QDU B;  2JHE A;  2KG0 A;  2CQ3 A;  1Q8K A;  4DX6 A;  3WQP A;  3MFH A;  4OI0 A;  2DXD A;  3H5Y A;  2XUL A;  5F3T A;  4USU A;  3LWM A;  5DG7 A;  3JYT B;  1YSJ A;  2YKP A;  5E41 A;  4IH7 A;  1GH8 A;  4LQ9 A;  7FDR A;  1KEK A;  4IYQ A;  3G87 A;  4MAK A;  5F0W A;  5ETM A;  1CJU B;  3IAM 9;  1ICE B;  1SCJ B;  2I2Y A;  3FKB A;  5JJB A;  2YWK A;  3P8B B;  3VAK A;  1FXR A;  4USM A;  3QT8 A;  4GO7 X;  1VQ9 S;  1VBZ A;  1KLM B;  1UJ5 A;  3D1H A;  4J9Q A;  1KQS R;  2OPS A;  3TQE A;  2DEI A;  3TJ9 A;  1REG X;  3N01 A;  1Q82 T;  4DBQ A;  2XCP A;  2ZBC A;  4UQT A;  3JTN A;  4TY9 A;  3KLG A;  5G0R B;  4RW6 A;  4CNY A;  5H9F J;  4G65 A;  3OTO J;  4DU7 A;  3JQM A;  4FKY A;  8AT1 B;  4B3S J;  2J7W A;  1HWU A;  1LFP A;  3MED B;  3VGT A;  1TKZ B;  3QLH B;  4ZPW R;  1WJ9 A;  2V50 A;  3OVS A;  4M5M A;  5LOQ A;  3IS9 B;  2XNQ A;  2W8K A;  4X84 A;  1IR2 A;  1S97 A;  4FBT A;  2BZ2 A;  1SUQ B;  3R6G B;  4ZK7 M;  1VR6 A;  2XZD B;  2W9B A; 
#chains in the Genus database with same CATH homology
 2HIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...