3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
2W48A 5IS2A 3O1LA 3ENVA 3U7JA 2RQKA 2WU1A 4R7TA 2LQJA 2GNPA 4PWUA 1M0SA 2J0XA 2I9SA 4TM7A 4L51A 1YBAA 1RWUA 3E15A 1VL1A 3IXQA 2DTJA 2QSWA 3MWBA 3HN6A 4GMKA 3MAHA 3DC2A 2OKGA 3AAWB 2KO1A 5JJBA 3AB4B 3LWDA 1HOTA 3E7FA 5T41A 3KV1A 3BXHA 4L4ZA 3OFHA 3S1TA 3L7OA 4OQPA 2QRRA 1NE7A 3AB2B 3P96A 1CD5A 2QMWA 5FIIA 3W7BA 3NWPA 2RE1A 4M8LA 2FGCA 1FS6A 4TM8A 1U8SA 1FSFA 4L4YA 3LOUA 4X84A 2P9EA 5IT4A 1FS5A 3N0VA 2MDAA 3DDNA 3LUYA 1Y89A 2PC6A 2RI0A 1LK7A 3OC6A 1HORA 4OQQA 1YGYA 3BXGA 2P9GA 2LVWA 3KWMA 1O8BA 3TUZC 3NZEA 1ZPVA 2PA3A 2BKXA 1Y7PA 4R9NA 5HJ5A 5IT0A 3BXEA 3DHXA 3TUJC 3EFBA 1LK5A 2F8MA 2CDQA 1UJ5A 2J0WA 3EB9A 4L5IA 1XTZA 4L5JA 1PBTA 4GO5X 2BKVA 1KS2A 4GO1A 2JHEA 4NMLA 3ENWA 1FQOA 3TUIC 3TX2A 3OFFA 3ENQA 2O0MA 2H9ZA 3MTJA 1UJ6A 2P9CA 2RI1A 1FRZA 2RQMA 4GO7X 1DEAA 2R5FA 4IO1A 3UW1A 1SC6A 3OBIA 4L50A 2JOQA 2ZHOA 3K5PA 1PSDA 3NRBA 2J0EA 3ICOA 2F1FA 2QMXA 3OFEA 3BXFA 1JT9A 3HHEA 3IBWA 1UJ4A 2NYIA 3CEDA 3CH7A 3CSSA 4LUBA 1LKZA 3DHWC 3OFGA 3LHIA 2DT9A
chains in the Genus database with same CATH superfamily
5HILA 1TDJA 5K05A 2QO3A 1RWKB 1K6MA 2MPUA 2CPIA 1ZH4A 4IAOA 3NKVA 4QVIA 3AD7C 4MA5A 2W9AA 4WTOA 1C7QA 4BKOA 2HBYB 1IQPA 3M2RA 1NXQA 3UR0A 3F74A 3ZDZB 3T7EA 4JHLA 1R4MB 3I53A 4BVBA 4LXXA 4ER8A 4UTPA 2ZB7A 4G2NA 1YRHA 4B81A 2ZFUA 5I3PA 1OBFO 4PQEA 5KU7A 2QRJA 4MLZA 4UOGA 2D2IA 3AESA 4DR3J 1J70A 3FSEA 4XUCA 4RQAA 3OSPA 4M1KA 1RC8A 3OLBA 4DLKA 4R9NA 1QIIA 1YB6A 3BXEA 3FFIA 4RVHA 5EZQA 4HYKA 4WHMA 5CX1A 1HNZJ 1WB5A 4P22A 4XAKA 4YRKA 4EHKA 2B5WA 3K30A 4GBJA 3T41A 2AV6A 4IUDS 2OAUA 4LCJA 2HWXA 3M9NB 5G0VA 3ICVA 1JLQA 3HJCA 4GC9A 1N3LA 3A0UA 2BRKA 1KO8A 3K6JA 1XDDA 4N8SA 1YKFA 2WG0A 3REQB 3VHRA 2O5VA 3C3MA 5BMVA 1X1EA 2J9DE 3P5BA 1NRJB 1IKWA 3CCBA 4QW8A 3MGAA 3ZU5A 2I76A 2DNQA 4EGCB 1SUPA 2OK7A 3QLHA 1CJKB 1N5YB 2CNDA 3RSCA 3TSAA 2ODPA 3O26A 3S81A 4HACA 1R10A 4OAQA 4WVLA 1JZTA 5K6AA 1JIVA 4C0LA 1F5NA 3PFHA 1WC3A 1T36B 1NJSA 1DHRA 1X4GA 5FOTA 3IO1A 4OFZA 1I30A 1BIFA 2PHZA 2VG7B 2J08A 1EVYA 2HT1A 3IBCB 3DCAA 3CD6S 3U09A 2XUHA 2W9BB 1PJ5A 3RKSA 2ZJFA 4KBIA 1H4QA 5HVFA 5A5VA 2V7QA 5JALA 3OZDA 3OPKA 4MUHA 1K0VA 4OHYA 1ZO8A 4UREA 2VA2A 2QA2A 1T8TA 4PYIA 1U11A 3IRWP 2F6RA 3BR8A 5FXMA 1PZHA 3TZYA 2EG5A 3H19A 3OQNA 2IPAB 3HXLA 3WLMA 2BISA 3X1KA 4NZPA 3PYEA 4DYVA 1VIYA 2AI3A 4Q05A 1T1IA 4DLVA 1NB7A 5CVJA 1NVMB 1EGHA 5FQNA 3ROEA 4EY5A 5EOVA 1I4EB 4J1TA 3HMKA 5BN3A 1NXIA 2Q4BA 3K09C 5AI6A 3MUVP 3TGPA 4CTAB 2EX4A 5GVQA 4J7AA 4DG1B 3T1YJ 1HZZC 3KEQA 4EMDA 4ZVPA 1B0AA 2G80A 4QTYA 1Z2PX 4YO8A 1QQTA 2OBNA 3QBJA 1FT8A 4JT8A 5I9IA 4BLGA 4AD8A 4B2LA 3C6QA 1PBTA 4YAEA 2C7GA 1D0EA 4OU4A 5L53A 4Q21A 3S1SA 2REOA 4UMFA 3H59A 1Q8IA 2FPOA 2AEJA 3ENQA 3VSBA 5KJ1A 1KHVA 5EHNA 3A3NB 1A7UA 3MEEB 3DQPA 2HK6A 3ZWWA 2ZWPA 2HU8A 4DDHA 5LP1A 4LFCJ 4JJZA 3T6JA 2PD6A 3GELA 4G1IA 3HWSA 3NL0A 1XALA 5FWDA 5ALMA 3JB9k 2BH9A 1CJUA 1D2GA 3GXOA 1TKXB 2L0XA 2O06A 2R0QC 1Y6FA 4ZI3A 2C61A 4DDFA 4RFLA 4PPFA 5JJBA 1GN8A 1Y3BE 2E66A 3W4JA 2AYYA 3LCJA 1QO9A 2Q6TA 1EDOA 4ND8B 1CUSA 4PV7A 4LF9F 3ESZA 2XH8A 3LFHA 2VRCA 2IZ6A 4BNUA 4KC5A 1WHXA 5IWCA 1UJNA 3GD5A 2ZRCA 2PWBA 1H2FA 1SC4A 5HMXA 3J7TA 1HORA 3W5VA 4B1FA 4LBVA 1C0TA 4QYSA 2DR9A 4DPTA 5K9ZA 1QGUA 4AC9A 3WGGA 4FW9A 3KZKA 3FNGA 1LWOA 2ZCJA 3KK3A 1R8XA 2H4WB 2HQIA 1BCSA 1DAIA 5JTTA 3FRJA 1QQAA 1LFPA 3KOYA 3I2IA 2IUYA 3DM9B 3NI2A 3PHCA 3FJOA 3OWXA 4E13A 2IV7A 3GLGA 1J24A 2XQIA 2FWNA 4RD2A 2CVPA 4FF2A 4RNMA 3NY0A 1H8EA 3O1IC 3ORYA 2VP2A 2DY1A 2AYZA 5CR9A 3UAWA 4JI8J 2XMBA 4CG0A 5BMVB 2Y66A 5DLDA 4MW9A 2OWDA 2P5SA 4YP7A 4FEAA 1OB2A 2EZ9A 2X42A 3CNOA 4IDCA 1TW3A 4IFYB 3QI7A 1D6JA 1DAXA 2HK9A 2D13A 5LJLA 2GF9A 1X14A 3EXFB 4IH6A 1S1VA 5DLEA 1SG9A 3NS7A 4ABTA 4FJ2A 4IH1A 4DR3B 2WU4A 1LWEA 4XWKA 5AUOB 3D4JA 1AKMA 2WSFC 3NVMB 2AUNA 2WWRA 1QV9A 4O44A 4C9DA 3JVUA 1ZGHA 4X3CA 5FHQA 1U6JA 3VKGA 4AROA 1HYQA 4F4KA 1PRYA 3U56A 4QX6A 3UJHA 2ROQA 7MHTA 4J03A 4OV6B 1PS8A 2K4MA 3Q11A 3IP1A 2ATIA 4CW7A 3DLEA 3MM7A 1QM5A 1V5IB 3L4SO 3C15B 3R0ZA 5CD9A 2FW9A 2PA8D 1P8JA 1B4DA 1NI3A 4YEDA 2QXUA 5IZCC 1WXDA 1L7PA 2DNKA 1OKKA 1KFBB 4IO0A 2FW6A 3UWSA 2RGXA 4D9HA 5UKDA 2QZ8A 3NTLA 1EQUA 3EQ8A 2X1VA 1WTAA 1Z4NA 5JZ9A 4M38A 4DL6A 2G09A 5D8HB 1QK5A 2FWBA 3WA7A 1K1SA 3V1LA 1UWVA 2VKTA 3UO0A 5JQWA 2MR5A 3HV0A 5SV2A 3DN9A 1DC4A 3OQVA 3BKWA 3KJFB 1PJTA 1MB0A 1SCBA 5DG9A 1FQOA 2XGOA 4BMYA 2OQVA 2PSFA 5B1DA 4IQFA 1E69A 5ELLA 3Q8LA 4WPGA 1F2TA 3V2UC 1YQHA 5JW6A 1U2CA 2TMYA 4ROTA 2HVIA 4KDCA 2VDRB 2QNIA 4UBMA 4DJBA 2O14A 3QWPA 5F23A 2V03A 3PENA 4A0RA 2XA1A 5EEHA 3NOXA 5T14A 4JKOA 1NP6A 5CZVA 1P1CA 1JMKC 4EBEA 3F0NA 3BJEA 5AVUA 2CUNA 3G5UA 1R0BA 4NEQA 4JVSB 3D1HA 4R6XA 3DRPA 4NBKA 1T2EA 5LMUB 1JKXA 3O9MA 1VJGA 5M04A 3ME5A 4JGIA 3LCMA 5ETKA 4ZVTB 4RW7A 5I47A 3P0EA 4CIAA 5KYWB 5JRZA 3ANSA 2RAFA 2ZJYA 3TCKA 4DM4A 4AQYF 5FUMA 4OXXA 1EXDA 3I62A 4PZLA 1U7LA 3G2KA 4I55B 1CBUA 4DMLA 3P97A 3MB8A 1KZ6A 4C7KA 3ZDXB 2QR5A 1L8QA 3SIWA 2FJPA 4JEMA 1XR5A 3GYGA 3VGSA 3ZX5A 1V6CA 4L8LA 3MWYW 3MEDA 5HKLA 5T8KC 1KMMA 1P1LA 5E3IA 2B4KA 1OAKA 4ZN6A 3DOIA 5B4UA 3A58B 5AKKA 1FKOA 5D01A 5I4CA 1T9TA 3PKIA 1YDGA 4IBOA 4OOEA 4D3XA 4KN9S 4F4WA 5CIWA 4A0QA 4Z7YA 4ECWA 1JR3A 4R7TA 1LX7A 1H65A 4DPXA 1Z6YA 1H7WA 3LL4A 2DTJA 2XWBF 4RTPA 2X23A 3HGQA 2NVUB 1Z4QA 4JUAA 1M6HA 4MP6A 3PX3A 4DA4A 3MILA 2C4MA 1FQWA 1VRTA 2Z9BA 2Y1OA 3CWZA 4RE5A 2QM0A 1IZ9A 3JQ8B 4BKUA 5JSQA 3ZZZA 1VE6A 1CUHA 5AW0A 4NXMF 2LQ8A 3UDCA 1M1XB 4CM4B 3K0CC 1LW0B 4MVJH 3KSDO 1Q0PA 4HVAA 3TVDA 3OLWA 5IJ9A 1WVGA 2REBA 4LDNA 4DLEA 4DVJA 4JBCA 1NIJA 1RTJA 4ZRDA 1CJBA 3TLCA 3SQNA 2RK4A 4NS4A 4WXPA 3EQ7A 1LLQA 3B2NA 1UKEA 4GRDA 1FS4A 2WHXA 2PCLA 2X7JA 4Y2UA 3QEBZ 1GNVA 4LZPA 1FPQA 2Y9PB 4FR5A 4ZCRA 3R7SA 4POOA 3WGMA 4BMVA 1JW9B 5ALDA 5DE3A 1I33A 2YKAA 4L5AA 2NU7A 4CLLA 4AWAA 4QEZA 5E7MA 4Y3CA 2Z0MA 2E4WA 3E3OA 2HZAA 1KTVA 4H2DA 3BE4A 3R09A 2BOAA 1B8PA 4LRYA 1YJWS 4E4TA 3UA3A 4A2WA 1RXIA 1JKJA 4LF6F 4LVNA 1Y8RB 4AFFA 2FGJA 4HY3A 9LDTA 1FMFA 3QPDA 2B4YA 2D59A 3LM8A 5D3GB 4MKZA 4P83A 3GP5A 5LOQA 3C74A 1AZSA 2VPYA 5K4GA 3BE8A 1E4VA 2C0CA 2ZWAA 3EWSA 2IHTA 1O89A 5DGBA 3AL2A 4IYJA 2IZ0A 4HAXA 4R69A 3STYA 4CLXA 1YKWA 3LHSA 2VBCA 3HL4A 3WRYA 4MKBA 4MK8A 1UBFA 1Y63A 2MYUA 4LKRA 2Z5FA 4BNKA 2ASYA 5JY1A 4H4MB 2RUGA 3UWTA 1UPAA 1A2BA 3IEKA 1M2GA 2R84A 3MBOA 5JG7A 5L40A 3FB1A 5ICEA 3TA2A 3A7EA 4P71A 1ZRMA 3PR1A 3OICA 1AXGA 2M6RA 1MFZA 2AW5A 3GLHB 4JWKA 4YXWD 2B4OA 4JI2F 2E4YA 4IICA 3I5CA 4LIWA 2I2CA 4QAQA 3P8BB 4EYIB 1AK9A 1E6MA 2H57A 2VT7A 4DLAA 3M4NA 3IH5A 4XH9B 1S6YA 3F49S 1DBPA 3KC2A 1JHUA 3NGXA 3EICA 1DVRA 3QJPA 1PDOA 5CXUA 1HQUA 4G1CA 4LWOA 1Z5WA 1WIWA 3V1KA 1T9BA 1Q6ZA 4BNLA 4RHTA 3SICE 3HJTA 2BGNA 3K9GA 5GADl 1HBNB 2H2FA 2UYHA 1FJEB 1OFHA 1U1RA 1QOZA 4BVEA 1LK7A 4QOIA 2I6QA 4LFCF 4HUQA 2DFKB 2BLLA 2PFFB 1N5IA 1S0MA 3QTBA 1W2GA 2ZD1B 1V25A 2F67A 3A2MA 5BR8J 2BRUA 5JZOA 3HFRA 3R0JA 2RGUA 2BANA 1E1LA 3NDJA 3KHKA 1HL3A 1EE2A 4P2GA 3PDNA 5DHUA 1ZVVA 1OY8A 5E1DA 3PR5B 3QJJA 4I2PA 1O03A 1IEXA 4C8LA 3CE9A 4DV7J 4AZ3B 2EWWA 2R7TA 4X1IA 1CZHA 2QVCA 4YONB 2F1HA 3UQZA 4EO6A 3RG6A 4U1RA 4IDAA 3JQQA 2FN4A 2VH7A 4DWOA 4J0KA 4G4GA 3LW5C 3QGGA 2RK3A 1GNTA 2VH5R 5MHTA 3HNRA 5KHLB 2OPRB 4Q1VA 2OO3A 3N8NA 1HI8A 2NV0A 4XGNA 4BBYA 4LBWA 3N58A 4Y67A 4IIGA 1F1BA 4Q39A 2DR7A 4EGAA 3JQBC 4KZKA 2DHQA 4XX1A 3QIAA 2DGSA 3G6XA 1HWUA 4Y7CA 1TZCA 3TSYA 3NBFA 4D81A 3QE2A 4C06A 2RGRA 2ZSAA 3O2QB 4OGGA 5DKFA 3ZTYA 2VHTA 2R6AA 3ZV7A 3IO3A 4JI8F 3AKCA 1P9WA 1V1MB 1WNEA 5EKDA 4Q4CA 2GN2A 4B6FA 3ZLBA 1PGPA 3Q86A 1TTHB 1YZGA 4MJXA 1Y1PA 5CT4A 4ZIVA 1T0TV 1NRIA 3RVNA 3S44A 4B79A 2ZIXA 3KCQA 4EUNA 2YX7A 1EB0A 1C9YA 5K01A 1VL1A 1NMZA 4J49A 4HDCA 4BECA 3I52A 4WBFA 1O94D 3DC2A 1TIKA 1TP7A 5I7AA 3L7UA 4OZ5A 4OKSA 3I34X 3QLUC 3FBGA 2ZT5A 3RNLA 4J94A 2OPQB 3CJ0A 4ZP8A 4EDHA 4AMGA 4MAKA 4G9GA 1XVTA 1G16A 2FF5A 3ZE7A 3WBKA 4Z2AA 4MVYA 2JCBA 3U13A 1J9EA 4DSJA 5L6LB 4JOUA 3SQGA 3QOFA 3GJSB 4B5LA 5C42B 4IS3A 1U63A 2DQKA 2P11A 4CDNA 1N0UA 3CCTA 1KLNA 1BVHA 2Y0SD 8MHTA 2HNKA 3EZXA 4PX3A 1D9FA 2PD4A 2C96A 5B30A 3HKZD 1QUEA 1Y9AA 4LKOA 1WG1A 3DPSA 4WVFA 4WCVA 1GUZA 1QAMA 2R60A 1FFGB 3ZBUA 2CJWA 2KJVA 2EHDA 2OBFA 1ZD5A 3AJ1A 2CSXA 3NNDA 5CEEA 1MJGM 3RH0A 1LPOA 1S1MA 4X4VA 2A35A 3FB4A 3I9OA 3PE4A 4PG5A 1T4BA 2IYLD 2V6MA 2PYIA 2LMIA 4B3SJ 1S7IA 4HN4B 1N6KA 1WA5A 2GEBA 2RHCA 4AJNA 4MV4A 5EUQB 1HTBA 2RIJA 3TXXA 1NW4A 3BD9A 1RAFB 4ENTA 3EGWB 3EVGA 4D5EA 2MGZB 4Y28C 3LG2A 2NO0A 2CNBA 3QVSA 4H16A 4KMOA 2A5JA 4EUFA 4LOAA 5J4KA 1GTZA 4QG3A 2P9GA 3ZHRA 3U6BA 5BQOA 1IN4A 1R8SA 4HAZA 1GSIA 1EUYA 1L7AA 2W2TA 4Y2AA 2V97A 2IQ5A 4YGYA 3VZRA 1PLLA 5LYJB 4YFUA 1JEOA 3MS4A 1FFXA 3USCS 3MBIA 1JUDA 2VXCA 5KOHA 3M30A 3JQGB 3HZOA 3FCUB 2QORA 2H3HA 5KC8A 4BAUA 2WJ6A 4B02A 4MQUA 5F41A 3UOGA 4HH0A 2JB9A 4I46A 4X8MA 1SK8A 4GPZA 3P5SA 3W8PA 2M1XA 3I8OA 4MROA 5K8NA 5CEFA 3B6KA 4LZWA 3EVWA 4YUAA 3EGXB 2OP5A 1F2VA 3KKZA 1GO2A 4NLRA 1VA4A 3W3AA 4F6RA 3RUFA 3VOSA 1FXWA 3B51X 3RS0A 2SNIE 2J6BA 4CLOA 2BKLA 1J6UA 1UA0A 4JI5F 1IK6A 2CCJA 3PW0A 3RB4A 1N34J 4JQOA 2BTEA 5FR1A 3EOAI 2AMVA 2X2PA 3Q8QB 1XQYA 3GG0A 4BEWA 1VG9B 2CFCA 2DY9A 5DHPA 1Y9JA 3AFOA 4LY9A 3O2SB 1KDPA 2W58A 5CHCB 1P1BA 1NI4B 3QTLA 3PLNA 2HWWA 5KTMA 1AMUA 2XVZA 3WLOA 4RENA 4A6DA 3HCAA 1SQ5A 1MT0A 3UXHA 6ADHA 3IMCA 5FRDA 3RO7A 2QIFA 1XROA 2GXAA 3US5A 4QYRA 3KHRA 1DKUA 4CO4A 1CDOA 4EMTA 2VZLA 4ZGGA 5FD1A 2B1RA 1TUIA 2HK3A 2G1AA 5AXDA 2OFXA 4YRSA 1TUBB 3SS9X 3X1DA 3VYVA 2IYEA 4YEAA 3EQ2A 3DD5A 3HA5A 1Q0SA 1KMQA 3R2JA 4S1PA 2GAFA 3RU2A 3UGKA 3BHMA 2BBEA 3OJSA 5GIOE 4MCAA 5KG7A 4AX4A 4XJTA 2CK3A 4CM7A 2VK2A 5DVZA 3RFCA 2L17A 3UENA 1FEHA 3DCNA 2V8OA 3HRIA 4A7PA 4DAEA 1RAGA 5FLXY 3A1TA 4DZ6A 1WTBA 3LHDA 3KPYA 3ZZRA 1UKUA 4EZ9A 4Q02A 4ZVPB 3MJVA 1VLHA 4Y0AA 5C81A 1LWXA 4PAWA 4I3GA 3FM9A 4G0NA 2HMTA 3JATB 4KFBA 3ZGZA 3OLXA 2ODEA 3RVSA 3C4JA 3JAKA 2HSWA 5LXTA 4KE5A 4FQ8A 3AILA 1WKKA 1S1XB 2NO9A 1GWNA 1XK8A 1NMXA 4ELUA 2ZBUA 1N1DA 1GCIA 1AROP 2P8SA 5TT1A 3RC3A 4U9RA 3U3DA 2QMZA 1T43A 4RZHA 2QTGA 4LV8B 4XYEA 3NBAA 2QRVA 1HDYA 1N75A 5G3YA 1NULA 3PFEA 1DTEA 3GJ5A 2A1BA 2OV3A 5KWJA 5CB6A 2IZ5A 5ADVA 4WTOB 2Z8ZA 1EE9A 2PN6A 3WZLA 1RAEB 3SSNA 3IA0A 1YL6A 4RVSA 3EMVA 1I2ZA 3FMWA 3W7AA 1NXOA 3BUSA 2VOJA 4UEKA 3SE7A 5DCWA 2Z95A 4I4TA 4U67Q 1L4KA 4WXYB 3LA0A 3DE4X 1SMKA 5B7QA 4NI5A 1TJ3A 4BQNA 2ZJ0A 3VNVA 3WZMA 4XD7A 3Q5DA 3S2UA 3CTMA 3LXUX 5ALOA 1KIMA 3MHPA 3PB3A 4CMCA 3O7MA 2NUUG 1PJAA 4QIVA 4D02A 1U2TA 1YDMA 3UDLA 2R7OA 5FV4A 4FXOA 1PVOA 5A02A 2F5GA 1YDHA 3G8SA 2G28A 3W5YA 3C1OA 1GX6A 1JHDA 3M2UB 1IDOA 1X5TA 1EA7A 3AKYA 4A15A 4IIJF 4BB9A 5LKAA 4ETWA 3LUCA 2WUVA 4K9RA 5DETA 1Y8RA 4S0XA 3D8HA 2REQA 3AEKB 2QU7A 1TVRB 4RNNA 4MULA 2VFUA 4IV0A 3GPIA 3I9LA 4I4TF 1XQ1A 1A7JA 4K2HA 2V45A 1ZN8A 1L5SA 4KCGA 3KB6A 4WXOA 4CM2A 2Z57A 4EPYA 2Z56A 1GMWD 1WD5A 5JASA 1MW8X 4YT5A 1AFIA 2P9TA 1H9AA 2Q3EA 1KJZA 1CLFA 1PG5A 1OIVA 4R1OA 2IPNA 4EY4A 3SC3A 3QG5A 2MKSA 2CJPA 5JCJD 5I42A 1QJCA 1ZOTA 3KVYA 2C9OA 1QFZA 3T3NA 5KFRA 5BT8A 3IUEA 3DLTA 4TL6A 3DO5A 3G0IA 3UFXA 5D5PA 2ZTUA 2VA9A 2V6BA 4CV2A 3TTVA 1RSZA 4I9NA 3MINA 1UFQA 2J9FB 1W59A 2I2FA 3KMQA 1XAIA 1AZWA 1TL7A 2FUEA 5TSDA 1C7IA 4HR2A 5MGNA 2BMAA 5AVJA 1XDSA 1D09A 4PF1A 2OGWA 4TLRA 2UZ1A 2GIRA 5AXKA 3V4ZA 4HATA 4PC3A 2VFTA 4MDHA 4DMHA 1I1QB 3V3KA 3G6WA 4PAQA 4PZYA 2H1OA 2KB2A 4JUCA 3N70A 2PCJA 4Z1MD 2YVLA 4C76A 4XWYA 1YJ5A 2O7RA 2G5GX 4RBTA 4ICIA 3I5AA 4QAJA 1UCFA 1RW4A 4ILKA 2VP4A 4V3CA 3HP4A 3K92A 3QW2A 1KDVA 4D3SA 3NGRA 4HVZA 5AKHA 3CEHA 5EE0A 4C8KA 2QRNA 5IDYA 3Q8RB 3L06A 5K3EA 5JNTA 1RYMA 4TQSA 1QX4A 1IUJA 3JARB 3DDWA 3AIKA 3FLMA 3V81A 2PA0A 5TVGA 2ZE6A 2IRXA 3S29A 2GGPA 3PVSA 4X94A 4FOLA 3WIVA 4DOMA 1CSEE 3ZTTA 3PFBA 3DMJB 4TQUS 2DEJA 1G2OA 3RAFC 3TNVA 1Q0QA 4NCKA 3T7CA 4TM8A 3CT6A 4XPIA 4U2BA 1M5SA 1J5EF 4M60A 4TT3D 4IGEA 3WX0A 3H1BA 2FPGB 1G20B 1GZ6A 3X43A 3ICEA 3C48A 3F71A 4I14A 3BSCA 4MVXA 4BZWA 2JGNA 4YASA 1HWIA 2EERA 1JR4A 1YZYA 5KYYB 3KUCA 2IOFA 3COSA 2HRCA 1F2TB 3HYTA 3UCZP 1T2AA 3RIHA 4USHA 1NY5A 3V4PB 3C1TA 3NMUF 4GMGA 1ZGGA 1XDUA 3QEAZ 3GZJA 3EF0A 5A6SB 2QOEA 5JFTA 5KFIA 1HNNA 4NBRA 3OZRA 3DBRA 1T36A 5EHIA 2XW6A 5H5JA 4PCUA 3INTA 3KHLA 1JB1A 2ZM6B 1TTHA 2E5GA 4UUQA 4LSWA 4ZYZA 4I9FA 1S9GB 1Y1RA 1NK4A 1R88A 2HUNA 4UMEA 1LWCB 1N2BA 1BN7A 2IRWA 2C95A 1RWWB 4ZO4A 3C16A 2I1LA 1U1EA 5HHTA 3AR4A 3RJZA 3QELB 3WFJA 3G9XA 1ZVJA 4Q34A 1KZGB 3A1VA 1QZ3A 1BHO1 1CJVC 3FCHA 4H59A 1T4GA 3LY5A 3B7WA 2D7SA 3JTPA 4IMJB 3WRWA 5SYMA 4O4GA 1OFUA 4URWR 5GZ1A 1ISPA 4KK3A 2D00A 1O57A 2C2ZA 1DDGA 3M7VA 4HX9A 3WRXC 2GKOA 3QMVA 1AS0A 5LT5A 3CLSC 3I5MA 2PXHA 3HD2A 3B4DA 3KDSE 4C3UA 3R7BA 4LHZA 1G5QA 1DC5A 1VYTA 3T7DA 3AVXA 1BQMA 2IODA 2HBQB 3OEEA 4B17A 4N47A 3BFXA 4OHCA 2WWGA 3DHEA 4Q1AA 3P5TL 1IH8A 2D06A 5F8GA 3K2IA 4Q48A 1TVEA 3OSUA 1OXMA 4CF7A 2BM0A 3DDHA 4NBUA 2XMDA 5IVPA 5IXSA 2NV6A 3IDQA 4A6PA 1B26A 2HJRA 2AFHE 1OVMA 5KQLA 3NBXX 4S12A 5KKCA 4DPOA 4IDPA 1N4DA 5BSMA 2NX2A 2IOFK 1ZK0A 1ZH6A 4KREA 1PC4A 2UUCB 3PACA 5JT1A 1JZSA 4A8TA 3WL4A 2IJFA 2C0QA 3HUFA 5HR5A 1DJPA 1RIIA 1OGIA 4E03A 2V6IA 4RQBA 5KTNA 4QG7A 1MVOA 2O07A 2GMWA 1UIMA 3BMOB 2J8AA 1FZTA 1JU4A 1ECFA 4XYLA 3WKAA 3RWOA 1QIEA 3FBWA 1TKRA 2O2SA 5ENDA 2QX7A 4MKRA 4NH4A 5LSOA 2AOTB 4C6TA 1IAQA 1MR3F 3GH1A 4DI6A 1OIAA 4QUEA 3ZWXA 1ZLYA 5F52A 2E9RX 3LBIA 4TTRA 1NXXA 1ZW1A 2B69A 3LUGA 3ETDA 2GRUA 4AQYB 2KG1A 2OEMA 4KE7A 1H38A 5AJ3F 1R0AB 4PX2A 2I9KA 4NL5A 2ZHBA 1EAMA 1WUHS 4CRJA 1UPXA 1E58A 2C78A 4F02A 4V1CI 2W2KA 3O4IA 5ER6A 4BNVA 2BW7A 2BUBA 1V5EA 5ES3A 3AOBA 5FF9A 4C4PA 4Z4IA 2O6HA 2YHUA 2HIHA 3Q3JB 1DKOA 3DBLB 5KTPA 2VHUA 4B4UA 1T0HB 4V0NA 4ZK6A 4DZTA 3DZGA 4CXMA 5BO5A 3DBOB 2JFKA 4ZCQA 2ATLA 3WICA 3NP5A 3EGNA 3V34A 2ZXUA 4CEJA 4QPZA 1UBSB 3PKJA 3VZPA 2VL7A 1EHCA 1P0CA 4K6FA 1JFSA 2X0RA 5LFAA 3P71T 1E0KA 3BMXA 3HCFA 2HA7A 3I76A 1YJ7A 1XBWA 4UCQA 4ER7A 4Q03A 2FVXA 1Y8QA 4IPTA 1ZHOA 2PWZA 3QMQA 4NXNB 3CCWA 4KC0A 4JI1F 4B3RB 5GP1A 3RVMA 2OO5A 2WD7B 2Z1NA 3L1VA 3HJGA 2LPMA 5GAGI 4JOCA 4TLQA 1RT6A 2PLRA 5EQJB 3LX5A 2CL0X 3RPEA 3HCEA 2D3TA 3GLFA 2P75A 1YS4A 1NJYA 2Q2QA 5B6IA 3OFHA 1QGDA 1CY1A 3GFRA 4XPZA 5EVCA 5KTTA 2XI3A 1U0GA 5FA6A 1RRPA 4P98A 2RHWA 3NC0C 1KN6A 1H9CA 4UVIA 1OYDA 4J29A 5K0CA 3R7WA 4KW7A 1DDIA 1EFCA 3ZCRA 1QH0A 3MYRA 1GQEA 1XTJA 2EK1A 3W1VA 2CNOB 5CM2Z 1LJ8A 3AKEA 3ILHA 4D82A 2L48A 2C77A 3TLMA 1UVIA 2DHXA 2QX9A 5T4HA 1NUQA 1IQUA 2HH9A 2YWKA 2D5CA 1D2MA 1Z36A 2IEBA 2V5VA 5CT6A 3NYIA 4DKJA 4JAVC 1P17A 4RSMA 1RU1A 4KI7A 1FUIA 4R1QA 3MCVA 2CYCA 3H4DA 5I4BA 3DUWA 3SSMA 8AT1B 5CLJA 4LVNP 4DYHA 2YN0A 4E7PA 1O95C 1YO6A 4XGIA 5B6PA 1TTTA 1O95A 3CH5A 3G0OA 5K0SA 2XBPA 4EU0A 4RW6A 5DWQA 4G84A 1P4RA 2WTEA 4IOCQ 3AY3A 3FUTA 4LGVA 2EFDB 1RJWA 4GUAA 1Y5IA 3C41J 3GPLA 3ZWOA 2HNAA 3UGJA 4TS4A 2AZTA 5FTKA 1S96A 2VH2A 3IAHA 4D44A 3U4DA 2V2QA 2P9EA 2N47A 4EKDA 3HXOA 5KYKA 5F4ZA 3WRVA 3NWGA 5DDOC 2Y92A 4USIA 2OXTA 1MH1A 3Q8SB 4MW0A 3GY0A 1LLUA 2GGSA 3RREA 2O3SA 2IBTA 1K8YB 3KSZO 1G5FA 5JC1A 3PIIA 5A9RA 1GD1O 1V11B 4G4SP 3WR5A 2R48A 4UE3S 5F9MA 3AW9A 1OBOA 2OORA 1VHWA 2B43A 5FL3A 3V4FA 1VJ1A 3CRW1 4W1PA 3UCGA 5FJJA 4O63O 4QTUB 1REGX 3TRGA 4F93B 1DAOA 5HLFB 1R8QA 4XDYA 3ORRA 4GR5A 5BXIA 4UT4A 1TUEA 5GJVC 2H54B 5DN6D 2NP6A 1FNNA 5A4MS 3ITKA 2IC3A 5TPZA 2DVMA 1U7WA 1JLAA 4XLZA 5K0FA 5DIFA 3PQFA 2P2CA 4KE6A 3M4ZA 4S0MA 3AYXB 2AOUB 3PX7A 4H0FA 2V7UA 4WP3A 2M52A 4ZQHA 4W5QA 2ZH9A 1WS6A 4YN3A 2IBSA 2AMFA 2B8TA 2XZTA 3OQJA 1DQ8A 3Q9SA 3VDXA 4L08A 4RS4A 3H2KA 4ZQFA 1RPJA 1DTTA 4PWWA 5DTEA 3THYA 1CY6A 3L95X 4KU4A 1JKFA 4Q4JB 1WQ4A 4ZO9A 1HYGA 4AWBA 3AR9A 4XRRA 2FLVA 1MU2A 4RPHA 1JWBB 4JCCA 4CMGA 4LGMA 3V32A 3SU8A 5JAPA 1H0SA 4CM4A 2WYWA 3KMSA 1BY9A 1F6DA 1UDWA 4EFLA 2I6FA 3QHPA 1CZRA 3QVWA 1RWOA 3H1PA 2YS7A 1U9IA 1MMNA 3WZ2A 3A04A 4B47A 3IUJA 4XKJA 4C0QC 3MM6A 2VJUA 4ZD6A 1JBEA 1JIXA 3O31A 3LQ1A 2TMKA 4PTZA 4ZFNA 4H35A 4C05A 2FSHA 4NLOA 3IS9A 5JD5A 3WL3A 3GTYX 5JSFA 3UNGC 2KZMA 1AUDA 4A1FA 5LQNA 2YRFA 1E6YA 4MEJA 1KQ3A 4F2PA 4RORA 1Y4UA 2CL6X 4WE1B 1FTNA 5CHYA 1N8NA 2N46A 2I99A 2YW9A 2I38A 3NHBA 4YH1A 4F36A 1IHPA 4WA7A 2R751 5HTOA 2GPYA 1OMSA 2X4IA 5FBHA 4EG0A 2V8PA 4KX3A 4ZZ0A 4OY3A 5JLJA 2EBEA 1BXGB 4YECA 2YFHA 3WVNA 3FMPB 5EVJA 3GVCA 3BMCB 3QIDA 3V8BA 1FE4A 1XL0A 3TQFA 3WWYA 3BB5A 1TF7A 4NCXA 3ZHBA 1R4NB 3JRNA 1UK7A 1VTKA 3SYZA 1UKZA 2HBZB 3MXTA 2GEFA 1JRLA 3AV3A 4Q3DA 2L2QA 3U1TA 1H8HA 5A5GA 1VLYA 2ZJPQ 2EXUA 5HI7A 1T05B 3PRJA 1X9GA 4XIGS 5CITA 2OAQ1 4CH7A 3IKVA 5DLPA 1YZHA 5FOVA 5JCXA 3G88A 1TM1E 3T1HJ 3GHHA 1JFTA 2HPZA 3UJ3X 1MMDA 4ECUA 2VHCA 1Z2DA 4IG0B 4B43A 2UVPA 3S1TA 2P9BA 2V4ZA 1EB9A 3VXKA 1PAUA 1ZTTA 1P6XA 1YR9A 3FYUB 4JMPA 2V8BA 2F9FA 1NAIA 1E3JA 3LQFA 5DN9A 3DE1X 1ZSNA 4QOEA 4PGAA 5LR6A 2EFPA 3NHYA 3KJQA 3V33A 3G2PA 5C53B 2ZUGA 3CIFA 1SD5A 5JFGA 4CL2A 5MFZA 2O2ZA 4FDVA 4PQUA 4P2FA 1UK8A 5DXJA 4X92A 4BZZA 3NS6A 1GXUA 4I08A 4BKQA 2CPYA 4I4IA 3R24A 2EL9A 5ALLA 4OGWA 2ILTA 4WU2A 3KOUA 3FPLA 2YHBA 4TV8F 5HBGA 2YXNA 1JKHA 1N6QB 4NCGA 1UPMB 5FPYA 4MI1A 3AA9A 1SK9A 2W8LA 3OFJA 3P26A 4UHFA 4PRLA 5KCZA 3KYIB 3WQRA 4FGJA 3ODPA 1K88A 3FYDA 4TQGA 2C03A 5T67A 4JLOA 1I14A 2WF9A 2INGX 2HDNB 1H23A 3BSYA 4EJSA 3OWOA 2FZLA 2CNKA 3H5AA 5A8KA 4DNXA 5KPDA 4NE7A 4B73A 4NI2A 5CXXA 1R9NA 4ZU3A 4DY4A 1MFPA 1TQHA 3TB6A 3JWPA 5E0OA 2O8CA 3NGDA 4LSNB 3JXEA 5REQA 4P9SA 1SQ6A 4IH7A 1AKTA 2BDPA 3LT4A 3AEZA 4HJXA 4XCXA 1QXSA 2B7BB 3R5JA 5KS2A 3IUPA 3MOJB 1T5DX 5E8JA 2WAAA 4P58A 4CF3A 2ZU0C 2ZBDA 4F91B 3OZEA 4XCVA 5ED4A 2P77A 3OZWA 4EG1A 1CJKA 2XY6A 3PHLA 4R2MA 4KPYA 3GCDA 5FEMA 3J81U 3LYAA 4RW8A 1ODTC 2ZJ6A 3OLCX 3ZGLA 1OUMA 1NHGA 1YRYE 3H9CA 4CV0A 1K4YA 3HHDA 2XBMA 1PUIA 2HRDA 3VO1A 4Y2YA 3IBFB 1DXHA 2Q45A 3VAHA 2FHPA 2ZROA 1RI4A 1GILA 3Q6IA 4CETA 2OL4A 5C8DA 2R4UA 5J58A 1ZUIA 2HRRA 5ED0A 4JI2J 3LOQA 3R6TA 1PWZA 4CMAA 2B6NA 2OHOA 4YRCA 2VSYA 3VYWA 3VAAA 2H4XA 4KK4A 4WZ6A 5FDLB 4MVJI 3OTHA 1NSPA 2YNGB 4FYHA 2R11A 4OHBA 2WMYA 4ZVGA 1P4JA 2GZ2A 4Q3CA 3Q1LA 1HWYA 2P6UA 2JRCA 3HB4X 2I6XA 1QLWA 2G2ZA 1T6NA 3QO9B 1TK8A 3F47A 4RGVA 4Y2IA 2C2HA 1JAZA 3E3XA 1CUEA 5DIZA 1RACA 3JX9A 1TL3B 2FG6C 2GYVA 3S01A 5HN0A 1IONA 5KDOA 5CAAA 3CDEA 1G21E 2O54A 3VMFA 3TTYA 1EUCA 1YOVB 1C3JA 2SKEA 5IM0A 2HMWA 3DOFA 3KKMA 1FTQA 1KFKB 3HHLA 1KH2A 2QN8A 2JCYA 4C20A 2XTNA 3EZFA 2AZMA 4C3VA 4I1VA 1KKLA 3HVHA 4WY2A 3KLGB 3D4NA 5BRAA 4EHBA 2VJNA 1YJUA 1I9CA 5DTJA 2X1HA 4YRQA 1ZNXA 1U8CB 1C30B 5JUMA 3L82B 3N4WA 1KNZA 4X62J 2HTEA 2B7CA 4UBNA 1D4AA 4R05A 2UUAJ 5FOSA 1KWMA 1IJFA 1YHZA 2YQ4A 4UNRA 3R0XA 2X2OA 2EJBA 2ZYIA 5FWNA 1J21A 3H05A 1K9SA 1T4DA 4ZLNA 4DIMA 2IM3A 4IIEA 2MKIA 1VE5A 4D4LA 4CHTA 3I0RA 1BVUA 2WQZA 3AHHA 3H9GA 3TSWA 1OJLA 2DZDA 4P1ZA 1J20A 3JTMA 4X65F 2K87A 4IHAA 5EJEA 3PXCX 4DF4A 4K5SA 4OZ3A 1KR5A 1FSZA 3G82A 1JLFB 4F04A 2Q2VA 5HATA 3RB0A 3KB8A 1FU8A 1OC4A 1NW9B 5FO1A 3S0JA 5TC4A 1IMJA 4E6EA 3I3SR 3KQVA 3QWHA 5LYJF 3TG2A 3RHTA 4GKVA 3QNWA 3WL6A 1VZ3A 2OO7A 3F5DA 3VBCA 2F9LA 4UW2A 3NCQA 1MLAA 4QUBA 2BKOA 1PU2A 4MFBB 4PIVA 3ZK8A 4S1OA 2ADOA 1M54A 1VGRA 4I8DA 4JB8A 2CLKB 3MPDA 1R89A 3IT1A 3VPBA 5F1YA 5F2OA 4QZVB 3RRBA 1ENYA 5IKMA 2FVRA 2FH5B 1SKUB 5FLXA 2ZIZA 3OLAA 3PW5A 1YHYA 1L3BA 1L5MA 2BP7B 2E5LB 3T3PB 2CLSA 2A9KA 4IFVA 4EIWA 1K0FA 4N8OA 4MQ4A 3OQ6A 1DIGA 5CYQA 1U1CA 1F17A 3PFIA 1NP3A 1HZZA 2ZRJA 4BJ5A 5GZ3A 1G9TA 2QI9F 1RCOB 3IWXA 1Q20A 2GHPA 1PR6A 3K57A 2FZCB 3ZXIA 3KOWA 1Q7EA 3T9DA 4O4HB 1W94A 2JK0A 1WXGA 1XLUA 4ZOCA 4WEOA 4BP9A 2Q21A 3L6CA 1HQEA 3EK2A 4DX5A 3KM0A 5FNVF 1XTRA 5JCZA 3ORQA 5FTJA 4K6GA 2X9NA 4K81B 4WLFA 2FE4A 3KAJA 5C7PA 4MHSA 4QATA 1JSCA 5ECYA 1PL8A 4JI5J 1Z82A 3AHDA 3FNHA 3IS9B 4KN8A 2KWIA 2ERYA 1IN0A 4YCCA 3PJEA 3P96A 4L3OA 1PDVA 2M1ZA 4CLRA 2Z5GA 4RULA 2F7SA 1Z4LA 3ZBTA 1CUXA 1BXNA 3CG0A 1EWKA 3LLVA 4RFSB 3U7QB 2PS9A 1KSPA 3KYDA 4OQQA 1MHPA 4KGKA 3NMAA 1NSFA 3HB5X 3WKCA 4K9QA 3MCMA 1MRZA 2DH5A 4UMDA 2IIPA 1PQPA 3W78A 4BN0A 5ECDA 4QGFA 2HEGA 1W85B 3QKRA 1R8AA 1YA8A 4M1QA 1RYNA 5F9HA 4Q9DA 1EA5A 1PR2A 1V43A 2V2ZA 2ALZA 2C0PA 4EABA 3GZ4A 1K7SN 2WA2A 2ON6A 1ZI8A 2DPIA 2XNHA 2IYQA 4OYAA 1V5GA 1EDZA 4C0OC 3UO8B 2XMGA 2ACWA 5IM0B 3GP3A 3IM9A 3G8TA 4PO1A 1M2HA 4QWCA 1RZVA 3IEUA 4NAHA 5GM1A 4L2IB 5ICMA 4BKMA 2MINA 3TVYA 4FCWA 2RGDA 3R97A 4ANCA 4TL8A 3QGHA 5G4KA 1T6YA 2FY8A 3S55A 1GL9B 3O2IA 4FDMA 2GDZA 2G25A 4E07A 4V0MA 3BWMA 1RQPA 3A1SA 2W4QA 1ACLA 3EUAA 4PG7A 3F3MA 2Q79A 4URSA 2AC4A 3WJ2A 2BEVA 3SZMA 2X3FA 3A1UA 3HUUA 4UKDA 1SUCA 2JGLA 2QEXS 4WYLA 2HGLA 4ID5B 5CA0B 3QUAA 4JBGA 4MWOA 4COOA 3EJWA 5M2RA 3GILA 2A2ZA 4DA8A 3BCHA 4X1KB 4CO3A 1TJPB 1YZQA 4KGMA 4LJ9A 5TE9A 4I9UA 4CBVA 4OHXA 3FHCB 1FKAF 3AHEA 4TV9F 4A6EA 1MOPA 1MG5A 2WJJA 3R0IA 3MPYA 2MYFA 5EIEA 4LR7A 4I4CA 1AGNA 2WHEA 4FHCA 4JL5A 4F0JA 1M8FA 4B4VA 4EBCA 4DUGA 1U5BB 2ALJA 1G6BA 3AF3A 5KNCH 4BWFB 3VAYA 3I2JA 5MGBA 4D45A 3G23A 4TS1A 1BNCA 4L78A 3T54A 1I2AA 4IJQA 2NZ8A 4EG4A 3HADA 3QPWA 2YPZA 1BMTA 1CQJA 1YFJA 3VJLA 4J9PA 4MYUA 1M73E 1AU9A 3CXRA 5BT9A 7ABPA 5EMMA 2GZHA 3SFGA 4DREA 4YJ2F 1N56A 3H1GA 3T8YA 3ET5A 2EKDA 4UTNA 1QU3A 1CV2A 4R1TA 3M3PA 2DWOA 1Q8BA 2YV2A 1N0IA 1G4AE 1I51A 1RQ2A 1ZM9A 3LZCA 3UCUP 4REOA 1JVBA 4YP9A 2AJ4A 1XJWA 4JJ8A 3Q1KA 3ZXUB 4Y9RA 1JJAA 1I3OA 4TPKA 1C0LA 2VDJA 3ZDRA 4MUBA 4R9VA 4EPVA 3OU2A 1RQ0A 4M5MA 4ANFA 4HDHA 2GCOA 2Z3WA 2HA0A 4DQXA 1BOFA 3LVBA 3GWZA 2WTBA 5HUJA 1VFPA 3BSWA 3WAJA 1ZC3A 3T9AA 3CUUA 5H3HA 1A72A 1CNFA 2H00A 2AW3A 1OILA 2R8XA 4ZYWA 2UYOA 1T9YA 3W8EA 1GRQA 2FEXA 3G9QA 1W7AA 4RIHA 5BPFA 4JXZA 3G0DA 4J3JA 1P61B 5KG0A 1PZGA 1T11A 4Q9IA 1SVDA 2O8EA 2YWWA 2PWAA 4DFKA 2HCTA 2AJDA 4JNCA 1LVGA 3KZNA 2DPJA 1EXVA 2DU8A 4GX1A 4ECXA 4GPBA 1P1KA 3NDBB 5JSUA 1RZUA 1QC5A 3P6YC 4CEIB 4FMBB 4ZRNA 4KQ1A 3ROMA 1RC1A 4ZJYA 5CDUA 1W4BA 3KZVA 3LWNA 2DCLA 3QFHA 5DNUA 1LQUA 1D4OA 2F64A 3DE5X 1D6NA 5L4NA 4F9TA 1B99A 1REQB 3CCMS 1AT1A 4U2CA 4M89A 3TLGA 2Y68A 5GWXA 4EWTA 5HKOA 5DYIA 2VN8A 2OV8A 4I5FA 2VG5A 2PX3A 1R27B 9RUBA 4YP6A 1SC1A 3CULA 4KXQA 3WYEA 1ITPA 5JQGA 3F97A 4Y2KA 4BN4A 1N7GA 4J76A 1C9KA 3TZXA 3SLKA 1VQ8S 2ZP1A 1BMQB 1WOPA 1M6VB 3F1KA 2HPAA 4IIVA 3CW2C 2H5IA 1M8GA 5CFMA 2F8LA 2ID9A 2Y3YA 3LO5A 1EU1A 1K92A 3EA4A 3O7WA 1FD8A 4E4RA 5T4BA 1WW3A 1G291 4FT4A 2AFHA 4BOYA 1RKUA 1ZCFA 3IVXA 3UUWA 2ECQA 4R5MA 1RTHA 4E2ZA 2OSQA 1CLEA 1FQJA 1FXSA 3IQGX 1ZWKA 2PBZA 2H1CA 3S6EA 4LF5F 5ALEA 4QT0A 4X65B 5D5HA 3K8ZA 2I3AA 3KPJA 1M66A 4YJFA 2W2LD 3LV8A 2Z8XA 3BDAA 2G0AA 3MMXA 1UINA 1B1AA 3OKFA 3K5PA 3OLZA 3MR6A 1PT5A 1T10A 5IF3A 3ROQA 4CQMA 2CJQA 2EFHB 2GAIA 5KFPA 4TL7A 2R68A 3C6XA 2Q9BA 3LVRE 3AODA 4GI5A 4TKUB 4NARA 2W01A 3TL3A 5F0WA 4HX5A 2Q3HA 4GOKA 4NU8X 3HD1A 3GL9A 2AVDA 2IT1A 1OYWA 2G9UA 1ISGA 3P9SA 1UZUA 2VHXA 2VYND 4N6NA 4P82A 1C3OA 1TCAA 1SEVA 4QIGA 4LZNA 1SCKA 3O82A 5AHOA 2YMPA 2R1TB 2AQHA 3INRA 2BXJA 5HAOA 2UYQA 3U4IA 2D8AA 2IC3B 2C28A 2A1UB 1SGWA 4ECVA 3PEUA 2JA2A 9ATCA 4JDPA 4GKKJ 1QP8A 3HM2A 1Y5NB 1W34A 3THSA 3E4CA 4K46A 2ZJRQ 3F1LA 1AJEA 4HHEA 3ADBA 1CEZA 1SJ1A 2VNIA 4P3NA 4Y18A 1Q5YA 5BW6B 2ZIFA 1TIBA 3TJZA 4K4YA 1BMFD 4Q5VA 5IANA 5EJ2A 3ICQB 4Y2JA 1ECLA 4LS3A 1VBXA 2JGJA 1Z0ZA 4YX9A 4UU0A 5C51B 1X0XA 3UK2A 2VAXA 1H5NA 2DCUA 2DETA 4NLSA 2DPGA 2XB2D 4BVKA 4YALA 4RCYA 1SXJB 3MN1A 1M1YE 2H4WA 1RWUA 4B40A 3ETLA 3FPHA 2W2OP 1UBMS 1MT3A 1XIVA 3UUGA 2W4DA 1EJ7L 4UQGA 2YKGA 1WKBA 4OQFA 3M89A 1HV8A 1CQZA 4RUHA 1GDTA 5FJIA 4YS2A 3EOZA 3EIUA 5E3PA 1FRQA 4RABA 5AW2A 1XR3A 5HIJA 3GGJA 3VVUA 4AIIA 1YBUA 2QN9A 4XDGA 3S7RA 2KRBA 3PP8A 4UVEA 4D5GA 1FF9A 3KKLA 4WN9B 1NRWA 3QMMA 3VO8A 5JNRA 3EBLA 1AA1B 3CZ5A 2WHOA 3HNOA 3NBYC 1GU0A 1N92A 4DCVA 3D6MB 3VSCA 2W9CA 5JH7F 3BKTA 1C5KA 1JV2B 4WXMA 5ERXA 1FP2A 3CF2A 3RJMA 4MR9A 2YX4A 4LK2A 2R42A 1VHJA 2KYXA 5AK3A 1Z0DA 3P2EA 4CYUB 3FGPA 2LEBA 2X41A 3HDQA 2RNEA 4HPJB 4D8WA 5BN3B 2ZJ5A 1LI5A 3R0VA 3I73A 3CDAA 4AYBD 1ARZA 2AKAB 4PCVA 2D3UA 1A7AA 2Q0XA 3PRHA 2WHPA 2FUG1 1F0XA 2ZRFA 3CCRS 2ZSDA 2R2TA 4M46A 2H59A 3BICA 3DXSX 2VQEF 4IG4A 4RY8A 4BFXA 4BX9A 5CUQA 5TQ0A 3EEFA 4I3FA 1C1HA 1ZQ1A 3ADDA 1EXMA 2B83A 3ZHCA 2XSJA 3IGNA 3QBVA 1OLSA 2Z5VA 2W1BA 3PUIA 5I7RA 4DNOA 3MS7A 3VSDA 4JP1A 4H4KA 4H3VA 1J39A 4JLKA 2CFXA 4L15A 1KI8A 1HZJA 1L4LA 4PPYA 2EQ5A 1USUA 4O3SA 1JE1A 2BE7D 4GVLA 1IJEA 2H2GA 5IN4A 5ESWA 2E29A 5K09A 3EEYA 2A5LA 3L0CA 4J91A 1O96B 2FK8A 4HLNA 3ZCUA 4Z7OB 4IWYA 4KO1S 1ZUWA 2LD4A 3IRXB 2FSFA 2ZZNA 2EFQA 4JI6B 4BAGA 1KNXA 3K9NA 2XWXA 1CIVA 3ICCA 2R6DA 2Y1WA 3LT0A 2M88A 3CYFA 1D7OA 3E61A 3LLSA 5AE2A 2AFIB 4XB1A 2XRMA 1M8PA 3MMJA 5TEVA 4NICA 4GEGA 4QVGA 3LRPA 4CNBA 2Z4RA 5DJBA 4ZTZB 4ECQA 3FWPA 1CC1S 4EAQA 1Y4ZB 3OTWA 1D1QA 3KFVA 4HNSA 5THWA 3ZOZA 3OG9A 3IAS1 3JSAA 3HLYA 4MWDA 3W6PA 3QKSB 3G2NA 1HOXA 1XZGA 4UVHA 3LW7A 4MWBA 4ZVQA 3HSZA 4HQNA 3ET6B 4WH0A 2IVYA 1FNBA 2CVEA 5H1YA 3F90A 2VC2B 2HJ9A 1PTJA 3L4JA 1RBYA 3L09A 1U8UA 3JSMB 1WZ2A 3NC4A 1WU7A 1OI7A 4YDXA 4K6MA 3RK1A 1WPXA 4JB2A 3NEKA 4TTJA 4OATA 4EW6A 4FYXB 3PC7A 2HK8A 4FNAA 5KCMA 5KFGA 1W88A 1U8WA 2CY0A 3N53A 5ES4B 1HWJA 4IYRA 3AETA 5A4IS 1T03A 4D3HA 3R2CJ 3G9ZA 3Q3CA 3W7VA 5D6NA 1R12A 5DBFA 3PGXA 1IUOA 3QF4A 1YOBA 2FETA 4JI4B 1GT8A 1MO2A 3HI4A 2WOMA 4DYDA 1UXHA 2P4UA 5LVAA 3WYFA 5JS1A 4QUIA 1GKUB 1NDQA 5CYMB 3T7SA 3RBZA 2O2DA 1V8BA 1JLLB 4EARA 3R5XA 2ZB8A 1Y6RA 3VR5A 2CYBA 1K5HA 2E5JA 2OOKA 1IHYA 3NT5A 5K3BA 3DTVD 1DBDA 2M32A 4UXJA 5JJCA 3BRWA 4ND6A 4WKYA 5BNZA 3ICWA 1NW7A 3S70A 3V5NA 2DH6A 3GRYA 4BGEA 1GPNA 1D9ZA 4IEEA 3DDZX 1IVSA 1R00A 5K0EA 1RYEA 4WZAB 1XWIA 3E22B 3WWEA 5GJCA 3DLLQ 1CR2A 1EB8A 2XADA 3L9WA 3NM5A 1SELA 5EXDA 2BJ1A 1MP0A 4ELVA 3KKNA 1L7NA 3CLRD 5KFBA 4KHZA 2CFRA 1JHYA 1T8UA 2RDDA 2EF0A 5LXTB 4YRZA 1OLUB 3QX7A 3MD1A 4RCZA 3OE1A 2NS1B 1YDEA 3RUEA 4ZVUA 3BO4A 4DV0B 4MHOA 4Q82A 3VR6A 1BE8A 1LXCA 1B93A 1XEWY 3L04A 3O3OB 4JVMA 1BA3A 1G21A 3D1LA 2VAMA 3G7UA 1CJUC 4EHIA 1RYSA 3AFMA 4GLFA 3GROA 4G1EB 3KUUA 5FI1B 4KXFB 4BV8A 2PZLA 1KGSA 4DIKA 5AIAA 2LDBA 2W2MP 4QR1A 2GXQA 5HS4A 2W70A 1GCOA 2HQDA 2IDMA 3IJPA 1G2QA 3A32A 4ES1A 3D64A 3WMEA 3FTPA 3NTVA 3CPEA 2F4NA 5EZ6B 3IJ5A 1IBLJ 1Z88A 3ZEAA 2BW2A 4BCCA 1R0WA 2FJUA 3GRCA 3AI7A 4AXJA 1H4TA 1PGOA 4I9HA 3CF0A 5LNK6 2JASA 3NDPA 3PQ4A 5ALJA 3HU3A 1NVKA 5L1KA 2CUKA 1E63A 1E2QA 4KSCA 5D0EA 1A6LA 3KSMA 3QPBA 1V0JA 4BNGA 3G5MA 5CDFE 3BWYA 2U2FA 1A77A 1NSTA 4DR2B 4OVKA 3KWFA 4MRPA 5EIBC 4D57A 5BP7A 2ASJA 4F9GA 3U7HB 1H2EA 2FLLA 2WSSD 5DPMA 1RJDA 3M82A 3ROGA 1PJCA 4JS0A 1HR0B 1B6SA 4CN8A 4QU5A 1EBUA 1AS2A 4HAUA 4Q1BA 2B36A 4WZMA 1A2OA 4WKBA 1DFDA 1RJFA 3KDPA 2W7AA 4BGUA 4UTGA 3JQAA 2CXNA 2V7EA 2BE2A 5IJ0A 1DT5A 1JJCB 1USVA 4N3GA 2NZUG 3PUWA 2XLKA 3BQMB 4FJ0A 4CCWA 2HM7A 1N88A 3EHDA 3P32A 3CKYA 1EZZA 3LTOA 4WWSA 1TZ2A 2YNIB 3GCWP 1G8PA 2U1AA 4TX1A 4AZ3A 4DILA 4MHTA 2FLKA 2QTLA 2QYCA 1CQPA 1GL3A 1Z5VA 4NMMA 5CAEA 5HSPA 4ID9A 4C98A 4G8JA 4GOLD 1WSVA 2N7YA 3GCWA 3G6VA 4F3QA 3PITA 4BFZA 1W8DA 1W0JA 1LRKA 2XF8A 1YHQS 2AEMA 4JUBA 2B5JB 5B0FA 5I9NA 2FC8A 3NBPB 3POTA 3Q8YA 4I55F 1A1VA 2X8JB 2RQCA 4G01B 5COBA 1X19A 2VPXA 3SQMA 3CR7A 2W25A 4XIIA 3NAMA 5DB4A 3FPCA 4E08A 3LPYA 4MS1A 4PICA 4Z4QA 2VF4X 3RAPR 5DM2A 1TTQB 3DM5A 4PZCA 1II8B 1SIBE 3VGUA 3DULA 1LF5A 1GPUA 1JQLB 1SZCA 3FUYA 1P74A 5EGSA 2ZRDA 4CRWB 1N54B 4NS1A 1X60A 1Q57A 2GXUA 3GJZA 1C9DB 3PIRA 4RVUA 1RACB 3D6HB 1YNSA 1RBZA 4WLNA 3VKVA 4FFBA 4PXEA 3M30B 2A33A 2MQ8A 1KVQA 1S97A 3MM5A 3CH6A 2F7VA 1SZJG 5E7JA 5SZKB 3NJ8A 4P54A 3FC9A 4CI0B 5KOHB 1NBMD 1EVZA 1RWVB 3TJ9A 4OBWA 3MOZA 3K8YA 2C2OA 3KELA 4D2IA 1MHTA 1DQ9A 1U25A 4LF9J 1SAYA 2Q7OE 3B3JA 3TAMA 3JAMU 1JJ4A 4YXFA 2QRLA 4WFZA 2ZJ4A 3NNHA 1SKSA 4K03A 4EZEA 3WIDA 3RRKA 4NLDA 4HX2A 3A6JA 5DI9A 1YS9A 2UKDA 2PZEA 2F3UA 2G76A 5FWYB 2XO6A 4KIUA 4QYIB 1ZOLA 1TK2A 2QN6A 1UXIA 3MEDB 2EW9A 1ESDA 4IFYA 2CE7A 4BRSA 1OBCA 3DT8A 3CJ3A 4CGYA 3MFQA 1PS9A 4B6GA 2RG7A 1JQ5A 4EI8A 3LKBA 3TEMA 3TXAA 2PZAA 3OI7A 2GTIA 1O8CA 5CCEA 1R0XA 4J9MA 1HEYA 1WKVA 4RZSA 1CYEA 1QSSA 4YDRA 3MGJA 2YIVX 2BIFA 1CR4A 4N5MA 4PG4A 1CZNA 4P10A 3QVXA 1NJIT 1B4SA 1X4EA 1TCBA 1MPXA 5T4EA 3LAKA 1CD5A 4FHDA 2XMKA 3PRYA 4B9UA 3PDWA 4ZCKA 3SC6A 4WU3A 4DLXA 1CKEA 4P34A 5JAZA 3GLVA 4IHJB 3LPMA 2EFYA 1KONA 1NJFA 3CIMA 3EDQA 4RZXA 4KIWA 3MEEA 1G2EA 5B1IA 5ICFA 4QGSA 3EG5A 4P84A 5JDIA 4YB8A 2X13A 3T0IA 2X3DA 3AOEA 3ELHA 4UE2A 1Y48E 5K3SA 3L6OO 2IV2X 5JHHB 2J9CA 5A4FS 3AM4A 3NHSA 4RW4B 1SFRA 4RJ2A 5JEEA 4EA9A 1N36F 2OK8A 3HHNB 3HMQA 5EIHA 3V8NA 1EK5A 1O87A 3RUHA 1M1UA 2YJZA 4EY8A 2GHVC 4Y6RA 1GZUA 5KNLA 1VC0A 4NNOA 2PK3A 1YVRA 1ZPWX 3THXA 1QQ5A 4FXWA 3MF4A 3T0GA 1UC5B 2ZUAA 1W96A 4R8LA 3ZW7A 4K9KA 4X41A 2XNDD 4F3YA 2N3OA 3FZ2A 5C5CA 1C3EA 3PNKA 5AXNA 1YT5A 3I58A 3CE6A 1T35A 3GFSA 1GGKA 3ENZA 3UFBA 3MMNA 1L8XA 3QGPA 1YB1A 4AY5A 1YZLA 3REGA 3DV2A 3VPXA 2Q1UA 2XXBA 3R6WA 1NVVQ 4S04A 1YC2A 2P90A 1I3OB 1XNGA 3VX4A 4JBXA 2PMHA 1GEEA 2ADMA 2EOAA 4MQLA 4XYMA 3ZNOA 2AMCB 3CWQA 1JTFA 1RM4A 1OYYA 2M6KA 5F5LA 1AGYA 4NLVA 3HO6A 3C5CA 1JSRA 2QGZA 4LIRA 4J9RA 1WUUA 1ECPA 1HG0A 4PQGA 1RPZA 2IHKA 1SJ3P 1VDMA 3TNFA 3GLUA 2FFJA 4Y2RA 3VC3A 2HWUA 4MMZB 1T6XA 2PT9A 1A8HA 2FRXA 5BUQA 5FL7A 1SXQA 4I8IA 4I55A 4F06A 1QJHA 5FI0B 2C04A 5HANA 4JI6J 1QC5B 3SJUA 4J2TA 3RSOA 1U7XA 3M3DA 1IBSA 3M2RB 5JYEA 5AW1A 3CSUA 2PMWB 3SXUB 4AYTA 4C6TB 4DXLA 1M5VC 4LGCA 1LBEA 1GPDG 3JVDA 2EBFX 4OB8A 4R98A 4OXIA 4F4IA 4QTXA 2YHIB 1WXIA 4UFNA 3JQ6A 1GPMA 2EU8A 5HCNA 3D68A 3ZHZA 3A6EA 2O3RA 2IVMA 4P3OA 3KT8A 1KSGA 5BPHA 3QQPA 5AFSA 5KWIA 2BM1A 1ZXXA 4CQNA 1BFDA 1TADA 2RHQB 5FOXA 4HLQB 3SQWA 1IIBA 1QG6A 2GA8A 3W77A 3VZIA 3KVRA 2G08A 1DCFA 2CLHB 2B0CA 4HGNA 2B6AA 2B1GA 3OZ7A 1NUAA 3I8SA 1KY5A 2PT0A 1KSHA 1F8YA 4J37A 2A9PA 2PUFA 5D0RA 1A04A 1Z7GA 1S2DA 1XSEA 4F96A 4MSUA 4RNFA 4CEJB 2E7WA 4LFBJ 3LIIA 4KFSA 3FBBA 2JVRA 4Q8EA 2NSBA 2EFJA 2VEDA 2I33A 1C9MA 3UW3A 4RS3A 4GI7A 3ZZOA 4GS5A 4MGYR 3AJRA 5EJ7A 5KNBH 5HPYB 4C30A 2R6CA 2E9ZA 5I9SA 4TY8B 1RPNA 1UAAA 5L1JA 4H17A 2NO1A 1SIZA 2XMJA 5P21A 4MCJA 4JI4J 1IAVA 1U1NA 3OESA 1X38A 1M1NA 2FF7A 1FYFA 1NKCA 3BTSA 1X0FA 3EDRA 3HU1A 4U7FA 3PYGA 2J07A 1IBLF 3T1TA 3GGCA 4IUYA 4ED5A 2FW7A 4WNYA 5EP2A 4HAVA 1SXPA 4PQAA 3UCXA 2CXRA 4Y2HA 2CB0A 4MYTA 1TYAE 4LCEA 1LTHR 5LC1A 2AVNA 1JT9A 2RHLA 3OOSA 4Q24A 1FDIA 1NVGA 3ITDA 3OBBA 1P9RA 1CUBA 3VKFA 3YASA 3OM8A 1X7VA 3H5UA 2I9SA 1P8AA 2NZWA 5CPBA 5JECA 3G5AA 3QKRB 4LF7F 1HBJA 2W9XA 3KE8A 3RBAA 2GCIA 3A25A 2ZH2A 1U3VA 2YVKA 3KKKA 2CG4A 1IK4A 1YZ7A 1BN6A 1MOSA 1HT0A 5IVIA 2MSTA 3HX9A 5CURA 2PRSA 3H3XA 2MHEA 4MGKR 3SG0A 5C42A 4QEDA 2P9FA 4RJTA 4Q12A 3OR2B 4XD2A 3W64A 1VQ7S 1DZ5A 1ZOOA 4LI3X 1CS4B 4B7AA 3BIJA 3I09A 5CH3A 4J90A 3MZ0A 1TTPB 1KC1A 1NI4A 1HKUA 4MUEA 4BC0A 4LTNA 3KKFA 5BSWA 3QX9A 3RT9A 3PRVA 1GUDA 2IS4A 3NNAA 4EO9A 2XZDA 4L0QA 4XB6B 2P7HA 2JH8A 1CS0A 4RY9A 2BFBB 1O0PA 3MCSA 1T5TA 4EW3A 4BLWA 1NDHA 2RKWA 3EX7C 4MIAA 4JR2A 4U3JA 3LUKA 1S7GA 3RSQA 3E9RA 1ZKMA 5AKGA 1EFKA 1ZMXA 1ZS9A 4DX8H 3HVAA 1TUBA 4ZPVR 3UDVA 1UMBB 3FCCA 2OXCA 3UDEA 3RU7A 1ZQ9A 3PNIA 1N5OX 1L7OA 4B33A 5A6SA 1O95D 3SBXA 3MOGA 1ZMTA 5C7YA 2JGDB 3COVA 3VH4A 4PUOA 2QN2A 2MIIA 5H9FJ 1KJJA 1ONPA 1GQSA 1HHTP 4O1HA 4TLLB 1ZNWA 5CXTA 5I01A 1CX9B 3MTBA 4G4SO 3D6AA 4G0QA 4UUPA 3G2MA 3QHQA 4PONA 4X1IB 4GRIA 3O75A 4L5JA 1J5OA 3HUEA 2RE8A 1YB7A 1NHUA 4ZPJA 1KR2A 2XNRA 2HSZA 4ETNA 4FFMA 4B35A 5H68A 3OM0A 3H2HA 3ILIA 2SBTA 2CVZA 1QAYA 1X39A 3ICOA 5CDGA 1Z1ZA 1QRRA 2R7KA 4KFTA 2BSXA 1YF3A 1RWBA 2H2WA 2UXDJ 1Q16A 2D1QA 3KK2B 1TQ6A 4EMUA 1RA7A 3ZV3A 5JXWA 1XAJA 3EGXA 5LCXA 3PEHA 2C9MA 3H75A 2NU8A 1RI3A 3TX6A 4MPPA 5HGJA 2BABA 3KLGA 2ZAMA 3UA4A 5DASA 1X94A 2AMYA 3I56S 1T5HX 1MC5A 1UDXA 2B30A 2Z30B 1X1RA 3ZY5A 3JPWA 5ICSA 3BDEA 5C3MA 1DX9A 2V4RA 6YASA 4RDHA 5EN1A 4HTFA 1NK0A 4WCFC 1RWOB 1YZTA 1P5JA 2HFZA 2OVBA 3VCDA 1JR3D 5T57A 2NQ8A 1T5SA 5TGTA 2FR0A 2MZQA 4JQZA 1E5XA 1W93A 4A10A 4WXEA 4QHYA 4V2IA 2G04A 1FJGJ 1EP4A 1RT3A 4ID3A 1ULHA 4ER5A 3SIRA 3SX0A 2C1ZA 2PXCA 2YY6A 4J9VA 2VWHA 2HHHF 2I7TA 3VR0A 3QKWA 4URFA 5CVVA 3LHKA 1RHKA 4MK9A 1KJWA 1H6DA 4G0UA 3BQNB 3H17A 3BYRA 2SICE 4FYVB 1UC8A 3EC2A 3M9OB 2FW1A 2WV7A 3WDKA 1FXUA 3EDYA 3PC8C 4XPCA 4N49A 4MAAA 1U1PA 3NHWA 2WRMA 3KUEA 4CQLB 1ZMBA 3AO0B 4DR7B 4Q7AA 5L3VA 2BQUA 4IZ6A 2NNWB 3K15A 2Y9MB 2JHAA 2P6OA 2XCUA 4DNPA 2OTLS 4ZEOA 2PGOA 5DN6A 1RWQA 5AOAA 4Z53A 3JYNA 2O1XA 1XZ8A 1W0KA 4KKVA 4PYLA 4OP2A 3V6HA 4ARIA 3T3DA 3TWOA 4I0WA 3AT1A 5JJ5A 3W5HA 5J1PA 2OORC 1U65A 3PXUA 4YFYA 1FU4A 2C2YA 3WLIA 5EX3A 1K0UA 1ND6A 3OFVA 2EFOA 3DKRA 3TAHA 4PR0A 3GARA 4LVOP 2JANA 5FNVB 1Z68A 1FSSA 3NX4A 1EETA 2CUYA 3GCXA 2BFDB 4CWBA 4PRFA 4CCYA 4RV5A 2XYPA 2GPWA 1YQDA 2ZYVX 2WE7A 3BGLA 4BUCA 4TRNA 4B9SA 4KL8S 1KOOA 4CFSA 1B0PA 4LX0A 1VLLA 3S2EA 1ENOA 2YUTA 3ZWBA 1PR4A 3CDBA 1Y9EA 2O9JA 2X8WA 3GPDG 2P35A 5C2GA 1E8DA 4LF4F 1M1GA 3TLKA 2YINC 2ZUUA 4CMIA 4XUGB 4XX0B 3PNVA 3I6YA 2V8HA 5K14A 3SI7A 5HJ7A 3HCWA 3FOWA 2CV1A 3M4YA 1XZQA 2YOGA 4J0DA 2DISA 3Q2TC 2OMOA 3FTNA 5C1OA 2MZJA 1XEAA 4JXJA 2XI2A 2KYZA 1IHUA 4Q3AA 4KR7A 4Y6SA 1NLZA 5IT9Y 2VLIA 5KSPA 2GEVA 2GJ9A 2IUFA 2YHAA 2JFPA 3R7WB 1T1GA 1YSJA 2PVSA 3HU5A 5KG1A 3NGLA 4KIAA 3NIDB 3E4DA 1GUYA 4XOUA 5F2EA 2HHUA 2BQRA 4LHWA 4R1PA 3VR4A 5B2ZA 4YV1A 6REQB 2JW5A 3Q3HA 3E3MA 2Q6LA 1MB4A 1KO7A 1NT2A 4IQGA 1WV1A 1W4RA 5T7LB 5PGMA 1G7TA 2H0AA 4L0DA 1V35A 4QOGA 3U7RA 4JX8A 1XDBA 2IY8A 1M34B 1BA2A 3KQPA 3HU2A 3T4UA 2QJTA 3T5BA 4JV5B 3FOFC 1XG5A 1XNRJ 3GJSA 2I54A 4N0MA 3FWZA 4QASA 3CPSA 3WNQA 2K2WA 1CRLA 4FHGA 3V7UA 4ITUA 5FPQA 3WIEA 3NCPA 1Q3KA 1FI4A 4M76B 2FE1A 4I36A 4O5AA 5JSZB 3HVIA 4DMCA 3CJ4A 1SXJA 2XNJA 4ALJA 4JQYA 4BATA 1GN9A 3QZ8A 3VVLA 1P2VA 2DCUB 2V0CA 1KAMA 3URMA 2XE7A 4JI0J 5A8RA 2GO1A 1XQ6A 4YLGA 2WIAA 4GMHA 1JR3E 2P69A 1ZDMA 1VK8A 1Q92A 1A88A 1AVTA 1WUYA 2HHWA 1CEXA 1VJTA 4REQB 1M1HA 3N3AC 1XL1A 3GJYA 1M67A 2FPSA 5KUTA 1RTZA 1TU3A 1KQGB 3ZCXA 1RJGA 4YIKA 2B8JA 2WD8A 2HLHA 3D8NA 2NU9A 1COWA 1QZXA 1K7EB 3DO8A 3T6KA 5A5DA 5C7OO 1HXHA 4ZXFA 5L1IA 5EJ6A 2XNCA 1MC1A 2NAPA 2FN8A 3EAQA 2XUZA 4M1MA 3EFOB 1B6GA 4MR7B 2F40A 4CMJA 1MABA 1AYEA 1WSDA 4KKOA 4HR7A 3PQ6A 1RB0A 4UM8B 1SI9A 1KRXA 1NXVA 5LYJA 4BAZA 1GFSA 2V54A 1HEIA 2OYCA 3V2HA 4JYPA 2W2QP 3VVMA 4HPXB 2Y4NA 4ZDIA 1ZUHA 3UD4P 1YRWA 3A36A 3P27A 1DAKA 5D1NA 4GU5A 5EGNA 2RIRA 3I37X 1INLA 3WDMA 2FA9A 3MT7A 4FOTA 3EH2A 3ST7A 1U0RA 4AY6A 3I23A 3EXG1 5C9ZA 1SXJE 2C9ZA 3ETNA 1F4VA 2VNSA 3OIUA 1WEXA 3HJVA 3LDAA 2CCGA 4HYTA 4BWMA 4F6RB 5AYVA 4DJFC 2WE8A 2XUGA 1N2HA 2GIFA 2QAGC 3ICPA 1D8ZA 3OLYA 2KBFA 4R5PB 1Z35A 1DPGA 1BD4A 3TA1A 1QIHA 3NS5A 3NEYA 4F4YA 3SAJA 5F35A 2RRAA 1R37A 2PX2A 2C3YA 3AAWB 2RI6A 3IFEA 1P9QC 2FUCA 4C8NA 1Q6YA 1FVSA 4K0KF 2G7MC 4JBIA 5BYRA 1KAEA 4EG7A 2FJAB 3SWWA 1J9GA 3PEJA 1U2RA 4LF1A 4KGXB 1YGYA 3A3YA 4INPA 4JLUA 2PUTA 2IOHA 1RAJA 4J16A 1SUQA 4ZIRB 2WF7A 4QYXA 1S9FA 3DNMA 4DV1F 5GPBA 1ZYUA 2O6LA 2XYQA 2MZ1A 2WJPA 1GTL1 4UDYX 4H3SA 5IBPA 3L49A 2D3WA 4YP5A 4C5BA 4CF5A 5F9NA 4P92A 4B71A 4OXRA 3CUSA 2HCBA 1EXNA 4AN4A 3GAFA 4ME6A 3W90A 2JFOA 5GGXA 1CRWG 4F2GA 5A2QU 3K58A 3MD3A 3KQMA 5A7HA 2CWDA 1NX6A 3CGWA 1WF0A 3O0TA 4KR0A 3OL9A 4WNAA 1WDDA 2KVIA 2H2IA 4IJKA 3OEED 1PKUA 3UV3A 3DRXA 1VRQC 2DYAA 4LMZA 4CLUA 2HHQA 3P45A 1E59A 2OIHA 3O84A 3CTRA 3EGEA 4YHHJ 1GMVA 5KTSA 2HO4A 3F2VA 3B8HA 1EP2B 1S0VA 4OAPA 5LQDA 3OZGA 1KVIA 2IDZA 2I2AA 1S76D 4S24A 3GLJA 1CIJA 1YFLA 1OV4A 4LIPD 1B6RA 5KEIA 2QMUB 1KO5A 4F1KA 4MWTA 2J7WA 4HAYA 1AA9A 1QBKC 2FPUA 4V0RA 5ADUS 2ODWA 1RMYA 3NKLA 2IYTA 4HFJA 2WG1A 4OSPA 1W0KD 4UUOA 2I2YA 3GEMA 1Y0HA 5EIFA 3OPNA 1QCYA 1FFDA 4GZMA 1M6EX 3I01A 3V4RA 1XMPA 2MQPA 4ZEMA 5DP2A 3ZTRA 4PC2A 5L7YA 5J2UA 4UCWA 1IY2A 1KP9A 4MS3A 2QYOA 1ILWA 3VI4B 1BX3A 1DMRA 2Z6QA 4K5QA 1I7LA 5IH7A 5KINB 4WIIA 4CPDA 3FWHA 4EWLA 1E7QA 2XTAA 1A76A 3VR2D 2F1KA 2ONZA 1N6QA 1FA9A 3RTAA 2K2PA 2JFBA 5IASA 3KQWA 3IV6A 4JV5J 4QPXA 4YO7A 1XNRB 2P3OA 1Z6GA 1HNWB 1U47A 4HNAB 1SIUA 1M2FA 3B1ZA 3C15C 4N9QA 4WFBQ 3CRVA 4QDXA 5E3CA 1DHTA 1RHRA 1IN1A 4CM6A 4JBHA 3RVQA 5KX5B 2JFYA 4HV4A 3ZWDA 3TZZA 1YVDA 4KNYA 2ZE7A 1FWLA 3HA2A 1OIWA 2YC2C 3PNSA 4U2KA 2AOTA 3K9QO 3BEGB 3HCXA 2HC9A 4ZAGA 3VU3A 3TRFA 1CWUA 1PZXA 4WFJA 1B0TA 4U8YA 4FYMA 4K6KA 2PKYX 1RLJA 3RV3A 1GUBA 3ZE8A 4TTAA 3B9RA 1N2EA 1E94E 1GL6A 2AN9A 4NZMA 4H27A 7GPBA 5I8WA 5A6WA 2Q4EA 3AF1A 3EXYA 4HNRA 4P53A 1AQYA 1JS1X 3SSAA 1DBVO 1EX7A 4ID5A 3KYLA 3RGWS 1X8XA 5ANRB 4K26A 4UNNA 1BKSB 4RK5A 4OP1A 2GD0A 4XVUA 3GOQA 1U28C 3FY4A 5FAKA 1IKXA 1OVGA 4TKVB 2WAMA 4JSTA 4IG0A 2BGTA 3L6BA 3BC1A 3O8OA 1H74A 1GV1A 3V2GA 1JDTA 3KZ1E 5ILQA 1MSWD 2JZOA 1E9SA 1TUGA 5L3SA 3TJMA 4QIHA 1D09B 1VJ0A 4TTTS 2DJWA 3OU6A 4FD2A 2MKYA 2QAJA 3TVTA 4RIGA 4DR6J 1TEXA 3TZKA 1VOMA 2Y0BB 3WI7A 3O47A 3HVTB 3UZUA 3KYDB 4QO7A 2RK6A 4YIHA 3WGHA 1CPZA 5DNDA 3SBOA 1BWEA 1DARA 3B8EA 2E5FA 3BILA 4NJEA 1HFKA 1U4OA 2WLSA 4IIFA 1KDYA 3MUTP 1D8YA 2R1VB 3AHGA 5ETPA 5BN1A 3X0DA 5J43A 3TDNA 1XPJA 2FDXA 2V58A 1IXKA 4MV1A 1SUIA 1HDGO 4YR2A 3AV0B 1PT6A 1ULBA 2D1RA 4DDTA 3EMKA 1UMDB 1E1RD 2O57A 3SF8A 2FKNA 4X54A 1NUSA 1PJLA 2WVJA 4XRGA 1NFRA 3JQ9C 4HRVA 2DGXA 3P9ZA 3CRMA 2EKPA 2IEAA 2ZIVB 1QBGA 1JALA 3MM6B 3BRQA 5DYWA 4KTTE 1JKMA 2Y3IA 2NYUA 1GM5A 4ZYVA 1XQIA 4QARA 1JEAA 3PNYA 2EIXA 2Z8YM 3SBMA 2GN9A 3M2VB 3X2EA 2WBRA 5LJ3Y 3EYAA 1WACA 4I2QB 3Q7EA 3ADKA 3RC7A 1P2GA 3DMNA 3U26A 1R1DA 2J48A 1T0BA 3Q15C 2O2HA 4GXQA 4MS1B 4W6ZA 4BEVA 2ZBEA 4RD4A 1EP9A 3S2FA 4R7ZA 4HRXA 1I5EA 1Z47A 3ZHXA 2QROA 2B9YA 3W2VA 4JEHA 4LE1A 4DQKA 4BHQA 5CNMA 2W90A 4K2XA 5IQQA 1FMJA 4Y9TA 3ONNA 4MRVA 3ETMA 2BGMA 3AEQB 5EGYA 3NC1C 3MK31 3LQ4A 1E7RA 3VR5H 3O5TB 4MFBA 1PJ2A 1TZBA 2L82A 4B7XA 4ERNA 2MTLA 4IJ5A 3UYKA 3UWDA 1XMBA 3G8CA 4IUBS 1SV5A 4D0SA 4YAUA 5IDXA 2QLBA 3JQRA 4FFBB 5BQ3A 4GGMX 4IFVB 3HGMA 4RD1A 5THQA 3R1HA 4QIEA 1DV2A 3O6QA 4FEGA 3TBHA 4DPWA 3HSYA 3GUYA 3W04A 4KAXA 2M6LA 1I5RA 4ECEA 5BNTA 1RP1A 2QRKA 3BE5A 3GXBA 2Y4OA 3QLEA 4I6WA 4BEJA 2V2VA 4R1LA 3DGPA 2X6QA 4KYUA 1KA9H 1JEQA 3ZWMA 1VSUA 4MPDA 2ORED 4LZAA 4DJTA 5B3AA 2HA2A 3THWA 2VPPA 4UNIA 3IJEB 2I0FA 2VHZA 5JSYA 3UFCX 3TCNA 3KV1A 5KJFA 5DHRA 2YMMA 5KQPA 3IHKA 1XZPA 3T6BA 1WKCA 5HKKD 2BFEB 4RA6A 1NK7A 5FPHA 5CK4A 2Q4OA 2AD9A 1Y8QB 3CDWA 3IIIA 4MUXA 1DQAA 4V2UA 4XSHA 1Y6JA 1WHSA 3B3QA 3UI3A 4ACAA 3T1OA 4IHJF 2ZI4A 2VJLA 3JVEA 4KO4S 1RTIA 3QATA 4DR5B 3GMTA 5J2QB 2AJLI 4L8FA 1G8GA 3SIXA 5K5MA 2W9BA 5DTRA 3LRTA 1GA4A 3HHLC 4KMRA 1E9RA 2W6JD 3PUJA 2Q9CA 2POCA 5F3DA 1OCEA 3ADPA 2OPPB 3QPIA 3RTVA 1V2GA 5BN4A 5I7WA 1XYYA 4CLSA 2H9IA 4C4YA 1Z6ZA 4YPOA 3RKRA 3MEGB 4UEJA 3FJYA 4LFAF 2PVCA 3VU1A 2IA6A 1N1EA 4FU0A 3MQFA 1BZYA 3CTPA 9ATCB 2AQ8A 3IV9A 4JT2A 3LT2A 1Z33A 5D15A 4NOLA 4WE1A 1TVKB 1R4ZA 1IDN1 2R3SA 2K7KA 1V4VA 3IE1A 4OXNA 4MMYB 3D54A 2SCUA 3BWXA 3MR2A 4DV0F 2ZRAA 1Y89A 1W2WB 2RJOA 3WZ0A 1T1RA 4FFRA 1E6LA 1S6PA 1QG2A 4MLCA 1T1JA 4N1AA 4EI2A 3HYRA 4BKRA 4N54A 3CCSS 1XBTA 4AB1A 1J00A 3NPAA 2GMJA 3NOOA 2VCHA 4I1PA 2WPDD 3PFGA 4IDEA 1F9FA 3EVTA 2H51A 2WM2A 3LTEA 4HKQA 2WJYA 3AF6A 3B4MA 2IYYA 5JR3A 2IK8A 4F3NA 1M7HA 1HMVA 2VWPA 4FN5A 1S1UB 4TYPA 4WFQA 1JWWA 2IDLA 2JGAA 1RP7A 2Q43A 1RYDA 4W8OA 5AW3A 4Q43A 1DRVA 1GOTA 3MIZA 1RCXB 3KVVA 3DZ8A 3FH0A 5A9SA 1JNYA 2MJNA 3ADAC 1MXHA 4J2HA 2XKJE 1SCUA 4DSTA 2HA3A 3E3NA 2YFQA 3CBQA 4WJBA 4NV3A 1P75A 2VZ8A 1YB2A 5TQVA 3AU8A 4OZJA 2AX3A 4QBUA 3DDCA 1ZGAA 2DHRA 2YNGA 4MP8A 4QBIA 3WGZA 2HNZB 2O8DA 5IC6A 2GH1A 1WC4A 4PNHA 1EM6A 1ZN2A 3L1KA 1IZ7A 2C9CA 4HAWA 3OAAD 2RONA 5JNUA 2VICA 3WRYC 2WABA 4RD0A 4FYWB 1XD8A 4KGXA 5D4OA 2ZEJA 2IJGX 4C7VA 3M8KA 1TM2A 4AZVA 4MS4B 2VJOA 5JDIC 3H20A 3D59A 3PXDA 4LDPA 2I7XA 2NTJA 3GVPA 4FYKA 3AG6A 4IDNA 4TTVA 1MNEA 4PWDB 1JLGB 3HHLB 2ACVA 3T12A 2JOQA 3A06A 4TN2A 3TYXA 4DZZA 4WEQA 1L5WA 1RKQA 3DLCA 4TWZA 2BR3A 3PUYA 4RYDA 1ZIPA 4D3YA 3C8DA 3LDHA 4OAOA 4OYLA 3TZBA 1FOEB 1L5HA 3K94A 2C7BA 4HHHA 2GYWA 4N77A 4KTQA 4MLDA 4Y6OA 2VDNB 2ISCA 3OFNA 4IJWA 1VR6A 4FS3A 4BPBA 5F98A 4N01A 4D0LB 1VP9A 1FKPB 3OECA 3NNSA 1DKNA 4LJ6A 2BMBA 5CG2A 1RYBA 4G41A 1S1VB 3DVRX 5JHGB 1Z0AA 4OYZA 3PSHA 1JVSA 2LQ9A 1AV6A 3R3YA 3BSOA 2PRZA 1QZUA 3N8GA 3DQZA 2ZUWA 4C22A 2Z2LA 1C2PA 4XWWA 2ZKUA 3H83A 2R4TA 2ZIUB 1TFUA 2HLDD 2I6TA 1UEKA 4PRKA 2O66A 4EKIA 1MWYA 2JEIA 2G9VA 4BX8A 2O2JA 1RM0A 3BWCA 4IXTA 2I1QA 3BCUA 1S6QB 3IRXA 1YJCA 3NXSA 3CH7A 4RSHA 1OU0A 2XWPA 2RH9B 3INYA 1E3TA 1CFZA 1G55A 1P0PA 4X7PA 3ZDYB 1NXTA 2ZJ2A 4AZ0B 1U9IC 4B85A 3TZ6A 3SC2A 4BZXA 3MWBA 4JX9A 2JKVA 1XVAA 3AUKA 4FDFA 2D0PB 5KHAA 2Z58A 2RHGB 1Z0SA 3NXZA 4USVA 1USGA 3O21A 4E5DA 5FWXB 1N1GA 4HEA6 5MAOA 4WN3A 1WCIA 3D6MA 2SCUB 1B76A 2R8YA 2I8EA 4OLJA 4DOZA 5CCLA 2ZSKA 3PCRB 3KJEA 4X3OA 3WV5A 3LPDA 3WB9A 2D2EA 3F6SA 1K47A