3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
2RI1A 1Y89A 2W48A 2F8MA 2WU1A 4L5IA 3LHIA 3OFGA 1UJ6A 2QSWA 2J0XA 2OKGA 3ENWA 2P9GA 3S1TA 3CEDA 1UJ4A 4L5JA 5T41A 3CH7A 3NWPA 2J0WA 1KS2A 2JHEA 1NE7A 3HHEA 3TUJC 4L51A 1YBAA 2RE1A 5JJBA 3IBWA 3O1LA 1PSDA 1RWUA 3CSSA 3LUYA 4GO1A 4NMLA 3BXFA 2P9CA 2JOQA 1ZPVA 3KWMA 3ENQA 3LOUA 5IS2A 2PA3A 1DEAA 4GMKA 3OC6A 3DDNA 1FS5A 3LWDA 2O0MA 4OQPA 2P9EA 4R9NA 1JT9A 2KO1A 2QMWA 1LKZA 4L50A 2FGCA 2PC6A 3NZEA 1CD5A 1FQOA 4IO1A 2DT9A 3IXQA 1FS6A 3TX2A 4M8LA 3MAHA 1FRZA 3DHXA 2RQMA 3L7OA 3UW1A 2RQKA 2CDQA 3K5PA 5HJ5A 1U8SA 4X84A 3NRBA 2QMXA 3AB2B 3AAWB 3OBIA 3BXEA 2RI0A 3BXHA 1YGYA 4OQQA 5IT0A 2MDAA 3TUZC 1XTZA 1UJ5A 2DTJA 2H9ZA 2F1FA 2ZHOA 4GO7X 3EFBA 2LVWA 3OFHA 3E7FA 3OFEA 5IT4A 1LK5A 4LUBA 4L4YA 3OFFA 3U7JA 2LQJA 3DHWC 3AB4B 4PWUA 3TUIC 3ICOA 1VL1A 3BXGA 1Y7PA 3DC2A 3MTJA 4TM8A 2QRRA 4L4ZA 2I9SA 3KV1A 2R5FA 3HN6A 4R7TA 1HORA 2J0EA 1M0SA 3MWBA 3P96A 1HOTA 1O8BA 4GO5X 1FSFA 2BKVA 3E15A 4TM7A 3W7BA 2GNPA 1SC6A 2BKXA 2NYIA 5FIIA 1PBTA 3EB9A 3ENVA 1LK7A 3N0VA
chains in the Genus database with same CATH superfamily
3EQ2A 4BKUA 1P0CA 4KX5A 3SQNA 2Q3JA 2ZPTX 4BFCA 4TQAA 2ZTUA 2ESRA 2GPNA 3H0KA 1U1RA 5TF0A 1K0FA 3BHJA 4JNCA 3B8EA 4R8SA 4U63A 2PVCA 4ECEA 5E2QA 3JSAA 2DHQA 4WTOA 4N9QA 3U61B 3I92A 3N2GA 4HJXA 4P08A 4YCDA 3N2KA 1SXQA 4K4UA 4DLRA 4PVCA 4N82A 4U9HS 3B1WA 2PJDA 2AD1A 1K8ZB 3RRYA 2H9YA 3MMSA 2P7HA 5HX7A 3EAFA 1D5CA 4NFYA 3AUUA 4FZ5A 3P8ZA 4WK3A 1N9KA 1N5YB 4IDNA 3ZDDA 4A8SA 1ESNA 3RGIA 2XXAB 4NIMA 1F5CA 3KE8A 3NGSA 2DVIA 4KV9A 4BFYA 1U5BB 3W60A 2C82A 2QX4A 5TQ2A 1W85A 4TVAB 2UUCJ 1U80A 3NPMA 1QPGA 5L3RA 1OX6A 4G9EA 1H7XA 1W5EA 2W4IA 3CWQA 5I4CA 4MWCA 3L0DA 5IBRA 1QAXA 4Q43A 2FJWA 2BGKA 2RD5C 2E82A 2IFTA 1FEHA 3TM5A 4NLYA 3TZXA 2WI8A 1U0HC 1NAIA 3GCWP 1L4NA 1LCIA 3H8WA 3EAQA 4R1SA 2PZGA 1TCUA 1UEIA 5FLEX 4KO8A 1DPGA 3AF4A 3ODPA 1EUZA 1DADA 3ECCA 1JLCA 3BD8A 2D4HA 4U2FA 4X20B 1XCBA 4BZWA 4BQNA 4JKYA 1T4MA 3NGTA 1XLTA 1I9GA 2RBGA 3CF2A 1M5PC 5FIUA 4LHVA 3M49A 3GXOA 1Z6QA 3KX2A 1M6HA 1OTXA 4M9CA 5IZHA 1QK4A 2Z2YA 3B1VA 2ZFUA 2HMUA 5TIIA 2Q5FA 4B3OB 2OHHA 3SYKA 5D77A 1LSUA 4WOKA 2R8KA 4E5PA 2X7IA 3Q2IA 1LVUA 4AZWA 4NCNA 3K8ZA 1GTEA 1P9OA 1SL2A 1NUPA 2QN3A 3PA6A 1KYVA 3NTLA 1ZG3A 5HQ3B 3UOAB 2IZOA 2X3FA 3SHOA 4KIAA 1WF1A 3KUHA 5AT1B 3JARB 2V2VA 3LMKA 1DIAA 1GKKA 1UK6A 3C3MA 3RC9A 4DL6A 1RM3A 5AI8A 1GITA 4A8WA 2XWSA 1V96A 5DF1A 2Z30B 1UTAA 2H4YA 3RIXA 2F1JA 5HZMA 2FUCA 1H2EA 1I51B 1C4AA 3BR8A 3H9QA 4RHUA 1DAHA 2I7VA 1HLDA 3SXJA 4N41A 1NE2A 1B70B 4GR9A 2B9EA 2QF7A 3ANSA 3DCYA 2YBEA 1RVV1 1KZ9A 1T02A 2EWMA 4DA0A 4LOJA 2VJNA 2ZJ3A 1EZ1A 2ZVIA 3G2IA 3WK7A 1RLDA 1Q1NA 4H1UA 4F7VA 4LN1A 3MWBA 3FVRA 3ES9A 1DCKA 2DGOA 3NKLA 4F3NA 1OXBB 3QXGA 2WSEC 5HRAA 2VF4X 2VH7A 1HMVA 3ND6A 5G4KB 4FCCA 4JI1B 4LSZB 2AW5A 1HL6A 4LE2A 2RG1A 4R3UC 3DAYA 1QP4A 3AUXA 4DQKA 4P7KA 2OVBA 3O0TA 1G5IA 3I55S 2HCBA 1XB2A 2YY5A 3ENNA 1N2HA 3N70A 4MEBA 1YJTA 5FBKA 1ZD1A 1M3SA 2DH9A 3UANA 3U3RA 2JFQA 2PVSA 2WQZA 1ZIXA 2PT5A 3BGOP 1RQ2A 2MLZA 4EHNA 1RADA 3S4YA 3KKQA 1EBFA 1IG0A 3H98A 1IK6A 4O4JB 2AFIB 2PGCA 3GN2A 1IZ9A 5CJ2A 3V6KA 4XJXA 3NG8A 2CB0A 3W2FA 4RJJA 4FHFA 4WY8A 1NM2A 4WKBA 2YW2A 4LXHA 1GG2A 1C5KA 4ANFA 3QUTA 1M34E 4A47A 4QOFA 1VE1A 2M2BA 2Z2KA 1FKAF 4UXJA 8ABPA 2YV5A 3IT2A 2HNZB 4LYFA 3CEAA 1XHFA 2WWHA 1PLKA 1P81A 1CEXA 3QU5A 1W44A 3IT0A 1E5TA 4WKNA 1TKTA 4TTJA 2C5HA 3MMBB 4MS1A 1URRA 2QL7B 2A88A 4ZVOA 1RC8A 2A7XA 1DUSA 2EK6A 2WVBA 3KUDA 5CVCA 2O8BB 5F73A 1LWFB 3P2JA 3EVOA 1CFZA 3EBOA 4LWOA 2NXEA 1C1BB 3WB1A 3ZU2A 5L3QB 3IRXA 4DREA 4BZPA 2H2HA 4QO8A 1YDWA 2CZCA 5FOTA 4R9VA 2A59A 5JYDA 3OEED 1GU7A 2E6KA 4BKOA 2ZZNA 5B1SA 3WBBA 1PQPA 2IU0A 1JQ3A 5PGMA 4JOUA 1I5EA 3A10A 2YC4C 5MLCV 2GJIA 3AAWB 2KW5A 1TQHA 2JAOA 4O4LB 4LFCJ 3GIWA 3RB4A 1OYYA 3UV7A 3QTTA 1JDZA 1LDYA 1U0SY 4C4XA 2DCMA 4JAVC 5JQGA 4EO7A 2VK8A 1IKVB 1XTIA 2JHCA 4FPRA 1W4ZA 3HJRA 4ZIRB 2W6CX 2QLJB 1T2VA 3I9FA 3UUFA 4J94A 1WO8A 1O5OA 1E9EA 2F9DA 2WUFA 1VJ0A 2R42A 3N2ZB 3G8QA 2FMXA 2QSZA 1WHTA 1AB5A 3GIMA 4AJ2A 2X3YA 3MOJB 4ZYXA 5JMOA 3OUZA 2EBGA 1UBNA 5FBQB 3QKRB 4X1KA 1J27A 1D6MA 1MX1A 5D3ZA 5FNZA 1KH3A 3QZ8A 1IATA 5B09A 4M0EA 4PXYA 3VSEA 5DXJA 1H66A 4MYSA 3LXMA 1EM8A 1G9TA 5JADA 4PINA 1GCOA 1XXHE 2OO4A 1QUPA 3ZZYA 2RBEA 1IMJA 4CEIB 2Q9CA 2EF0A 2GPTA 3F46A 1V3TA 1IEVA 3QYAA 3NHLA 2K7JA 1PFQA 4YAUA 4JI0B 2AJ8A 3PUZA 5AOAA 3UOGA 1FK8A 3CJKA 1OVGA 1AW0A 3QMWA 2HMAA 4B3SF 1JKMA 4ROSA 1XWIA 4F5YA 3KKEA 5EOVA 1XJWB 4RLQA 4DPUA 4JI2B 2EV9A 3EXEA 1RKIA 4LF5J 2G2ZA 3RDPA 1PVOA 4PIVA 3IQIX 4XVUA 1EFCA 3CF6R 1S0VA 4E33A 3KV3O 1QOQB 2RGAA 4H7IA 2BGMA 4HK4A 3H11B 4RLSA 3OI7A 5E7MA 1C8LA 5THQA 1N36J 1JJ2R 3Q0AA 1C0TA 3IMGA 2GWHA 2CNBA 2PBZA 2PL1A 2I3BA 4ETNA 3L8ZA 4URXR 1VHLA 5F7JA 1Y98A 2AJ4A 2DCUA 4L74A 4H60A 4WNYA 4K8RA 5CIQA 1GPUA 1URNA 1G5FA 3HEMA 4RHEA 2H54A 4MUNA 2WF8A 3SSQA 3E01A 5KFFA 3HACA 4KR0B 3L4KA 3DNMA 4BQIA 1BH2A 2B8WA 1TF2A 1YBVA 2XMBA 2OM2A 3HN2A 5B7WA 4XDYA 4RNFA 3O92A 1B8UA 4XJSA 4GM4A 4NNOA 1JAYA 1H0HA 4PEOA 4KQHA 3OT5A 1I2CA 4OLHA 3K31A 5B36A 2B6HA 3QVGB 2IPMA 1HI0P 4MR7A 3FTFA 5CDSA 2QX6A 1FX0A 2NO4A 3SJZA 2ILZA 5LM3A 4RIFA 4LECA 1G8AA 1SUEA 1MLDA 2BJ7A 3ISZA 3T9BA 2OG2A 2AX0A 2VDQB 1W26A 5LSLA 1BWSA 1N2XA 5B4TA 5C9ZA 5FRDA 3TLEA 4YO8A 5C1PA 3F9IA 1LW6E 2Y4NA 3BDIA 3RW9A 4LF8F 3L1HA 3L8HA 4R8UB 3B85A 4JV5F 1PUIA 1A77A 2XMVA 4HN2A 4RHCA 4RMHA 3SSMA 3F6PA 1C50A 4O8ZA 1QTIA 3CF4G 5G1OA 1GRQA 3L7KA 4B4UA 4HXYA 4B8ZA 5AXLA 4P4NA 5SZTA 4DFPA 1M10A 5FTWA 1SD5A 4JU8A 1FQWA 3I52A 2Z2XA 2LVWA 1JHUA 4RL6A 3T1AA 1D1QA 1ZC3A 4F4DA 4CL8A 1J90A 4ZOLA 4RWXA 3UK2A 3ZXUB 4E46A 4BNWA 1TX4B 3DXBA 3OM8A 3R0VA 1P5RA 1PAUB 1JEEA 2HWKA 4LXQA 3DXYA 1HF3A 4RW9B 1Q0NA 3EZ7A 4HQRA 3I39X 4G09A 1Q7RA 3AQIA 4C4RA 1VMDA 2HHXA 4OVKA 5JECA 5LKAA 3QLUA 5A9SA 2I9KA 2JANA 1NVEA 2ZI9A 2P8JA 4B3RJ 2P68A 4DANA 2WIAA 2EXXA 3X2EA 1XNQJ 2DBZA 2HWUA 5A6PA 2JD1A 1R9JA 5DULA 5FI3A 3SYTA 4ZYUA 5CXTA 4BVFA 2XQFA 1WSDA 2GAAA 4K9DA 2X1LA 4GXTA 5LJIA 3ST7A 3K5OA 5HMLA 1NK0A 2WB2A 3M8KA 3O4GA 4DY6A 3WSVA 2NN3C 2WJWA 5L9NA 5FL7A 1E60A 4TL8A 1CP2A 1WPGA 2YX4A 1Z33A 1YG0A 1WW3A 2QUAA 4XSGA 1G7TA 2FQXA 3K05A 4JKIA 4HDMA 1USIA 2Y6UA 2JJ8A 1JKJA 1KI6B 1K7SN 3ABQB 4LISA 3AEUA 2C2KB 2XYQA 2Q2QA 2FHJA 3DQQA 2BONA 4N6GA 1W73A 2QZ8A 3ILYA 2Y1OA 3A8IA 4MT1A 3GGGA 2B6NA 5J2UF 2XNHA 2A6PA 2FMFA 1CJTC 3F5SA 2B7BA 3K5NA 4CMIB 1WY5A 3N8IA 1Z12A 1WUHS 4CM3A 3LHIA 4GC7A 1VE9A 3HPQA 3ZLTA 4U2GA 5B7NA 4EABA 4UOHA 2SECE 5ALMA 3OPYA 4IIJA 4IGKA 1RT1A 3A05A 5F8MA 3HCWA 4LGYA 2GLUA 3BRWA 4ZLJA 2WD8A 4S2EA 3OAAA 2F65A 3C3PA 3W5AA 3SZ3A 1W5BA 4FF1A 1LJLA 3H2IA 4HTAA 1Z16A 3T6KA 3HVTA 2NU9B 3LC2O 3G6ES 2VC0A 1XX6A 1VBZA 4AL5A 3I0SA 2PGOA 3TSCA 5AVTA 1CQJA 2FDCA 4NCJA 3BIXA 1O95D 3HDVA 2A6MA 3G8TA 4NE9C 3BSYA 2Q5LA 2FZGB 3LPYA 3GWZA 3BD7A 4D9EA 3V9AA 2VV5A 2P4EA 2AJCA 4CQMB 2QMEA 3VNAA 1L3TA 4Z2XA 2XT0A 2ODNA 5A5EA 4CDRA 5HN0A 3ETGA 3WLAA 3A6DA 4ZP1A 3NMUF 1RAHB 5EMMA 1UXIA 3RG2A 3HHLB 4ZHRB 2IVFB 4PQEA 4P75A 1B26A 5ARDA 1UJ4A 2CL5A 1JFFB 3WZLA 4ESHA 5EWJA 5GZ1A 3D5EA 1ONBA 4Z4QA 3CUSA 3OF5A 3HUUA 5IZCC 1FMCA 3SC4A 4JI4J 4PANA 5E6UB 1FL9A 2BGIA 3U3MA 5G40A 4FZVA 4BNHA 2AFIE 1O57A 1RT9A 1EFRD 2DH8A 4S0ZA 2MQOA 3DKKA 4MOWA 5U1PA 4FFRA 3FFIA 3GEPA 2CMDA 2J3HA 4B2LA 4RJIA 3HA2A 1KIFA 2CN1A 3WGLA 1ZJ6A 3KJZA 1ZA1B 2JJQA 1ZQ9A 2SKCA 4RW8B 3CO0S 3E2PA 1RXOB 4AAYA 4DMFA 3FNIA 4EK9A 4UM8B 4UUQA 2W2MP 1KP6A 1Z26A 1XZHA 4IKEA 4E5YA 1S2NA 2HJ9A 4EUNA 3V5RA 1RP1A 2ZCVA 3B52X 3R7LA 3PGJA 1CUZA 1PR0A 5D3QA 4CL2A 3NXKA 3ZJVA 5A62A 5EUBA 5HVNA 3GJ8A 2IVZA 2IHVA 5DOVA 1UZLA 1SXLA 2X3DA 3FRIA 8OHMA 3ZK8A 3UQYS 1XR5A 4HEQA 2R6GA 4K9RA 221PA 3CC2S 4OX8A 4MITA 3D02A 2VXOA 1JJIA 2X4GA 2X9QA 4I55F 4OO3A 4QBHA 1NPDA 1RM4A 3TI7A 1K2VN 2OPQB 1LTKA 2GHPA 2CDRB 2N3LA 2E4AA 4NOKA 5ICEA 2GHQA 2VC1A 1NX6A 3MGJA 4F4JA 3D2AA 1SPXA 3H42A 3C8YA 4J9OA 2XUPA 3ZE0B 3GJSA 4IZIA 4LY3A 2PKEA 4H4EA 3ZIUA 4BAZA 2CPJA 5G0RA 2Y1WA 2GJFA 1SEVA 1D2RA 2GVDC 2ZHOA 2C22A 4DMMA 3FSGA 2D0PB 4NJMA 2XLJA 4MZXA 2O8EB 1FFBA 3UHFA 2Y8WA 1SQ0A 4CNQA 1LRKA 4Y6PA 2I9SA 2SXLA 2BEFA 2YNFA 2QLLA 3PB3A 1N0HA 2AR0A 3P9RA 5HVHA 4YVFA 4WWSA 1F06A 1HT1E 1B76A 1X2BA 4V19X 5CK4A 4QOHA 3FZYA 4NCXA 1Z0ZA 1PX2A 3P2YA 3SQMA 2YXEA 8ATCB 2VHQA 3OVMA 2JC1A 1JE1A 1GUFA 1GMVA 4ZAVA 3RRNA 4O33A 3OE7A 1LUAA 1QDLB 1YQTA 5FHRA 3FCCA 4P6VF 2OQRA 5JNLA 2OHDA 2MYPA 2BSQA 1WC4A 2FGCA 3TRFA 5CYFA 2VYCA 3O3CA 1E6WA 4MUJA 1T2NA 5FWDA 5FBHA 2VKRA 3BBCA 3NNNA 4M7OA 4IQ8A 2F9JA 4NBRA 5HJ2A 3M2RB 1QTRA 1DWOA 4IUBS 1G55A 2J1LA 5E6RA 3RVMA 1P5HA 4K9LA 5JVDF 2IW3A 1ZGAA 1XL0A 1YTYA 2P6PA 4B80A 2IZ0A 1XN9A 5FH9A 1AXQA 2IEDA 2B9WA 2FPRA 3OJXA 3UF0A 1Y1RA 3CCLS 3WJ1A 2D5LA 1V8OA 3VAYA 3RU0A 1EKXA 2CQPA 3GRAA 3ZDXB 2VG5B 1Q2XA 4BASA 4U8VA 1OWLA 2Z1DA 4V38A 3R20A 4GKKF 3QHPA 2EX4A 4ERXA 3W9BA 4CNZA 2PIIA 3MVEA 3RNLA 3A31A 3TLCA 4C78A 1JNZB 2HCRA 1NW4A 2IYXA 4I1VA 1RJJA 3WL7A 3SYZA 4ZP8A 3U09A 2C5AA 1RTHB 1RRPA 1RWOB 1RKBA 4HR7A 1PL6A 2ZC3A 3UWMA 4K50A 1DO0A 3MLEA 1WDMA 5HQ8A 3JWHA 1Q44A 4ILKA 1J2YA 1FK9B 3H5SA 4GOXA 1U6KA 1JQ5A 4J4TA 2MQLA 1YHNA 4QWDA 2Q9UA 5JZMA 1DKLA 1WPRA 4AMVA 1D2HA 2IU3A 4IOBA 3BK2A 3T3OA 2DFVA 2OZLA 4X3OA 2AMLA 4Q1EA 1URPA 4KMOA 2IIBA 1RP7A 1K08A 5E2BA 3MM9A 3UMCA 3S8YA 3USES 4CDIA 2QRVA 2FR1A 4N3AA 2CRLA 2VDJA 5FJIA 1HWJA 4FBTA 2RI1A 5TGDA 2B94A 2C7GA 4E14A 5TSDA 4QVGA 1Y9JA 1J8YF 3K0SA 2W7PA 5E3RA 2O5CA 3G2KA 4NEZA 4YYZA 3U3OA 4RMNA 1GZ3A 1NQWA 2W6NA 6AT1B 4Q37A 1HYEA 4L6AA 2RAQA 4X4UA 4DFJA 2EYQA 3GCXP 4YCSA 4AP9A 1UMJA 3DOMB 1ONNA 3QE0A 4A73A 5E3QA 4I3HA 5K9FA 3E8XA 3GBVA 2HQRA 4DQVA 1UMDA 2B0CA 3JVVA 2VIHA 2ZIGA 3K2EA 3HNOA 3HLYA 1LA2A 1NXQA 4J0KA 4QRIA 4DG9A 3SJBA 4OYRA 4ZI7F 3RTDA 5HFJA 3L0SA 3AHPA 4LIWA 4ZVMA 4H54A 4LNUA 4KN5A 5GPBA 2A3NA 3NNCA 2MB0B 2JBAB 1BDIA 1U1LA 2FPPA 4NP6A 2ZM5A 4BIMA 4J7CA 1T3SA 4A8XA 4LQLA 1H2RS 1WC3A 1C4OA 4Y9DA 4EEXA 1CNEA 4ILRA 1G291 1HHTP 2NYVA 3I45A 4JBLA 1WUTA 2JL1A 4HVLA 2MMYA 4RDXA 4DKXA 1EFPA 3OMXA 1G6KA 2A33A 4CQJA 3RVNA 3RWOA 2GLTA 2EFDB 3H8VA 3VR5D 3FBCA 2QYTA 3TNYA 2AI1A 3S99A 4TWBA 4PLCA 4HBZA 2I6UA 5KJEA 1FVOA 4YRQA 4MMXB 1X9SA 5F64A 3P9KA 2JLEA 4USHA 4DN0A 3GQBA 4ENQA 4FUQA 1Q81T 4KDFA 2GILA 1J0BA 3ZV4A 3C1TA 3RS9A 4OIXA 4F2SA 4PSUA 5KTYA 1FUUA 1P6XA 4OF4A 2CV1A 6YASA 2R47A 1H2WA 2P9QA 2XZTB 3QIPB 3ESXA 4GF5A 3ZZZA 3M5CA 8AT1A 2BE2A 3OZRA 1DKRA 3DB2A 5EJ5A 5L6MB 1YQHA 1ZU5A 2XUGA 1CWUA 2RARA 4GRSA 1YBFA 2HHJA 3RJ9A 4Q1BA 2VBZA 3IR6B 2ECOA 4K5RA 3ZC3A 2BF4A 2J3QA 3N3BC 2Q46A 2VSOA 1X13A 4HRXA 2Y1GA 2QLFB 1L7OA 3E84A 2X8AA 2W5UA 4IRKA 2K7ZA 1FSSA 1OAOA 2P90A 1NTRA 2VL1A 3LQRA 3QQCD 3JAWA 4WZAA 3AOAA 2PNJA 1ACJA 5CG1A 3PIRA 2CLHB 2HEKA 2QM7A 4WKCA 2F8LA 3M8QB 4L8VA 2GFFA 2PPLA 3A9VA 4NYIR 5CCBA 5LC1A 3GIRA 3MMZA 4EARA 5HQTA 5J2UA 5EIBD 4KHPF 1SC9A 1HYQA 1O54A 4UMVA 3NS5A 2QTBA 3K7RA 3G89A 3ADAC 5EXPA 1XNRJ 4Q3NA 2FYXA 1SVIA 1S1TB 4M88A 5YASA 2F9LA 1VIXA 1H4SA 2PH3A 3D8HA 3QATA 5HK9A 2P27A 1X0XA 4HWKA 3JQMA 4JEIA 2VH5R 4WZBB 5AKKA 4MPDA 2IUEA 2ZIZA 2CA9A 2WW8A 3CLHA 2CNNB 3EQ9A 3SBEA 4X60A 3ZV6A 3DB1A 1KRXA 3OA2A 4N3GA 2I4MA 1R66A 4E2YA 4JS0A 1AXEA 2NV6A 3BULA 3N0RA 4NAVA 2XEDA 4CV2A 5KYUB 4UQGA 5H9FJ 1V1JA 2OKCA 2VTKA 1XRJA 4I8IA 2GNPA 3JTOA 4OCZA 1L3CA 1B3RA 5C7PA 3UN1A 2EZUA 3AL0C 3OLAA 4PO9A 3QPWA 1RU3A 1K9VF 3ER6A 1AS2A 5HMZA 5EKSA 4LYHA 1ZRMA 4FYJA 4K2AA 1HDIA 4ZOBA 3AILA 3BKUA 3OMLA 3H2BA 4X00A 1SVMA 3WLLA 4H1VA 3IBWA 2TYSB 4AM8A 3JZDA 3ND8A 3QKSA 1CQMA 3HFVA 4KO0A 4JJZA 5KSWB 2B4KA 5DHAA 5HXAA 3EMBA 1U8FO 3H5NA 2XMSA 1KOLA 1QE1A 4LPKA 1U3TA 4KJZA 4BGIA 3NBKA 4HAVA 3JQPA 4UZEA 3H4MA 3ONNA 1MB4A 2C96A 1UBHS 5HMWA 1SK8A 3IKJA 3WRXA 1J6UA 2O2EA 3QMQA 3G2LA 4YHHJ 4U96A 2V8OA 2R25B 3HB1A 5KQGA 3U4MA 3DLGA 4PCAA 3HCPA 5C35A 1DHRA 2PBLA 2HUPA 4QQBA 1LWEB 4YBRA 3ZD7A 2Q6VA 4N5DA 5I7FA 4CM8B 2ZB8A 1GVHA 3PKMA 2NZ4A 4K1LA 2GT1A 2Q3DA 2LA4A 4WLVA 3S7RA 4HNSA 2PSSA 2PLFA 1PJCA 1YMVA 4OZ1A 2PMDA 3ZU6A 5GAEU 4V1CB 5KSZA 5DQGA 3PWSA 3D3EA 4ZHQB 2DBRA 4MI1A 2Q79A 4LYGA 4CTJA 2DQ4A 3CZAA 2XLCA 2WILA 5E41A 2J67A 1VPDA 2FPIB 3LUJA 3LW7A 5BUQA 4K4VA 3NU1A 2C4KA 4LR7A 5EZYB 2OHFA 3ZTSA 1UWCA 4DR6F 2JGIA 2Q4OA 4OJMX 5IXJA 4P38A 1GU0A 2E5LJ 3G9ZA 1Y8QA 2EZ4A 4D44A 5FBVB 1WDDA 4WEQA 3AGPA 3DOJA 4PLTA 3Q3HA 4Q1AA 5ICMA 5DNAA 1XBWA 1NDPA 1N7IA 2YQ4A 2HGSA 2XITA 4C7KA 4JROA 3TNLA 4EBDA 3HSDA 2ZYDA 1JI3A 5NLLA 3E9YA 3WDLA 4XTCS 1SBIA 1T5OA 1PR9A 3KKZA 4DSKA 3GFHA 4LGMA 3QPAA 1BXGA 1M6VA 1H05A 3M9MB 1C3JA 1T0TV 3W7VA 1WZCA 1IKWA 3L41A 4Y2QA 3LCRA 3HCAA 1Q8KA 3BREA 3N0XA 3IOCA 4F11A 3QU2A 4OQZA 4ALLA 4OM7A 2VHEA 1A5SB 4OK3A 1THZA 3MXHP 1WIWA 1THGA 1YDEA 2BFEA 3AVPA 3ZDEA 3CEHA 1VG8A 4Y2CA 2EKQA 3R7SB 1GCGA 3SR0A 1BN7A 1KYWA 3W8NA 3H83A 2LQBA 2VDMB 2KN4A 1OLOA 4NX9A 4ONEA 1SC3A 1UBGA 3UCEA 2C00A 4ZC1A 2VL7A 1WF0A 3OHSX 1QQTA 5L46A 3GEGA 3RRGA 2QL5B 4OYIA 3FB1A 3JQBC 2QDXA 4O0IA 4RPGA 3CG4A 5LD2B 4MFBA 2F8SA 1F38A 1V9SA 4IDKB 4X6YA 2ZROA 2OO5A 3O8CA 2XQJA 3PKYA 5E6SA 2M2IA 3M9NB 1ZSNA 1SD1A 3ULHA 2OV2A 4NLUA 3B2EA 2EFPA 4TUYB 2A8YA 5IKEA 3FLAA 1VMEA 2RHDA 1QH1A 5CR9A 2JEGA 4FLMA 3QW2A 4B35A 4EUEA 5FL3A 1TM3E 3UUWA 3NXZA 3H8SA 2FB0A 1Y4DE 1C1XA 1JKIA 4IRXA 2ZYIA 3D9BA 1Z7EA 2FLPA 1QX3A 4OUDB 3OL6A 4DHWA 2GJAA 1OGJA 1M2EA 3PQ7A 3W78A 3IAS9 1FX1A 4AF6A 2FGJA 3LP1A 1OFHA 1CF2O 1SHKA 3MJDA 2WM8A 3I9V1 1Z5OA 3KSZO 3C66A 4YMIA 5TC4A 1HNIA 1QTNA 1Z4NA 3WOHA 3J80U 3CRW1 1T15A 1F2HA 5IG2A 1RB0A 2XGPA 1OFUA 1M5UA 2YNIA 4ELVA 4GUAA 5C0OE 5HQLA 1L5MA 2BACA 1ROFA 4MYTA 2L0XA 4YP5A 2DNYA 2F3RA 3EA4A 4X62J 1KQFA 3T9AA 4MXDA 5DGTA 3EDRB 5ECDA 3J7AN 3VR2A 1O0PA 4MVCA 2P11A 4ZRNA 4P58A 5LB2A 1UIRA 4H27A 3ZKAA 3PDUA 3I58A 4URWR 1DAMA 4PHTA 3CCSS 5GZ3A 1JAHA 1SC1B 2FHSA 2YWBA 3WFIA 3RC2A 2W4MA 3UV3A 3OF3A 5A2QY 3NY0A 4FHEA 1HOTA 4K6KA 5LJ3Y 2JJ1D 2D3ZA 4EMUA 2O0JA 2O1SA 1TA9A 3TQQA 4DT1B 4XW2A 3SEOA 4GPBA 2BE9A 1DBQA 3N39C 4FOTA 4MULA 8MHTA 4Y6GB 1S6OA 1OLXB 1RI4A 3GFOA 1N7GA 4DABA 5BVHB 1AKTA 2V96A 5JAMA 1FHTA 2HQSA 1RHMA 5AHWA 4QZVA 4OJKA 1SVSA 5EN1A 2MGZB 5DLGA 1V3QE 3T3PB 4RTNA 4DF4A 4DSJA 4KKVA 3SFTA 1AMOA 1J5OA 3C7CB 1YJNS 3B1ZA 4PO3X 3NGDA 3RYTC 4FNOA 3PYLA 1GRNA 2AK3A 4DDUA 4WNAA 1GPBA 2AOVA 1QQAA 2YJGA 5SZJA 3PC6A 1EVKA 1KETA 2DK2A 4YLEA 4TL7A 3FTCA 2ZREA 4XSHA 2SKDA 5C5DA 3W6ZA 3JYNA 1ZMRA 5DW0A 1Y5NB 2DKFA 2DHRA 1H2UX 4IDFA 3WWZA 2ZZMA 3IHTA 3KQMA 4OA5A 1GCAA 1VYHA 1X39A 2X5KO 3N01A 1XIQA 4PG4A 5EE0A 1RHRA 1R5BA 2ZBDA 5A8WB 1PGNA 5AXCA 2X5NA 1PQUA 4COOA 4MQBA 2RHGB 3MLBA 3G2NA 1NC3A 3ZOKA 3WZ0A 4X65B 4J0HA 2PQ6A 3PIOQ 2XS7A 1BE0A 4GX1A 1VFNA 1W76A 1TADA 1T1EA 1HXHA 3H1PA 1JDJA 1FP1D 3UKOA 1JB1A 2RGGA 2HBQB 1CZLA 4ZYYA 1ENOA 3PJGA 3SIWA 3OFKA 3W5VA 3WIVA 3T54A 2W4QA 3OPQA 2AEMA 3RO7A 5C34B 4F8YA 4HYTA 2WUWE 1WHSB 1JX4A 1UJ5A 4E4RA 5CB4B 2LKCA 1HQCA 2G82A 3H86A 1RAEB 3OFEA 4HVZA 4AY2A 4R2MA 3RRHA 1JDBC 4J0DA 2C5BA 1XSEA 1YQQA 3WLMA 2WWXA 1KFEB 3G8BA 2Z4TA 2PRYA 4ANCA 3EXHA 5DWDA 2JIZD 5IC4B 4F60A 4KN6A 2ZQ5A 1GKYA 2ZKLA 3D4BA 1XLWA 3CR7A 2YV1A 4P33A 3DUFA 5LDDC 4DJDC 4EUSA 4IDHA 2ORIA 3QX8A 2L18A 4FKXA 1PK7A 3JTEA 3ODGA 3MCNA 3RYLA 1F8XA 4PC3A 1IBCB 1GG8A 2YY6A 1OASA 1W5TA 3HKWA 1NLMA 3I96A 3MRTA 4Q12A 5DNDA 4XX1A 2C9ZA 1GCIA 3ZZPA 3AQOA 1DEAA 1QNFA 1E7MA 3HDGA 2G70A 4TMVA 1OY8A 1OQAA 3ZI0A 1OXKB 2DPGA 4PIMA 4WZBE 2I38A 2J9FA 4YRRA 1YDLA 1GYPA 4G3IA 1VKRA 4WN3A 4JI1F 4M63A 4FINA 4G41A 5B3JC 2HU5A 1MO5A 5HTKA 4X84A 2HHQA 2FEMA 4F3CA 4ABYA 1N5VA 3FTPA 1GGNA 5K3CA 2OAQ1 3BZQA 5AJUA 5FLKA 1FFWB 1UXOA 1QDUA 4OX9J 4B4KA 3BH0A 1V8BA 3MI7X 4ZI3A 2YWHA 2BSXA 2VPWB 4DV0B 2XJ4A 5KJFA 3PCOB 3G5UA 1GADO 1NV9A 3FMGA 3RU9A 1FTWA 4MW9A 4G0PA 2Z9BA 2R3SA 4O4JF 4M0CA 3H99A 4IHJA 3S6JA 3C15B 2O2YA 3DYBA 9LDTA 2QIPA 2FW8A 1G2OA 5B58T 3K8YA 3CNEA 2AZXA 2RHBA 4FWTA 4JYZA 4GVPA 2ALYB 4KAAA 2ZIXA 2QUZA 5C52B 1Q8IA 4HQOA 3CH7A 2M9KA 1J07A 3GP3A 2QJWA 4N5HX 2POKA 5IWAB 1JU9A 4Y2PA 4KSEB 3I61A 4LY9A 1RLOA 2IE0A 1G5QA 4R9SA 1K66A 1AU9A 2W71A 1XYYA 4WINA 3PFWO 4J0IA 1MENA 3CS3A 3ETLA 4R1NA 1CHNA 4MIEA 3F96A 3ZBUA 5MDHA 4PZZA 1U8SA 2E66A 4QARA 1TJ5A 1MB3A 3KJGA 4ETWA 4HXGA 3CBQA 4QU7A 3PC3A 4DPTA 1T5SA 3BWBA 1S8AA 3VH3A 4I08A 5BSGA 2DGXA 4JNKA 1JG4A 1KVSA 3ZI4A 3JVEA 1M34A 1COWA 4DPKA 3G0IA 5C42B 3IALA 2F64A 2JIMA 3CCRS 2H63A 4AE5A 1HZJA 2WYHA 2WWVD 4KWTA 2QTRA 3IXLA 2HMYB 3T3DA 1CJVB 4O4LF 3P20A 5KHAA 6REQB 4C88A 4YV0A 4WXEA 1M90T 3X1YA 2GDZA 3AKCA 2EBUA 3KELA 1GPYA 1ND5A 2VUIB 3TR6A 1X31C 5BRNA 2R7WA 2Q4RA 2ZUDA 1GLNA 2I6WA 4Q9JA 4H3SA 1JR3A 2GIFA 2EG1A 2BOVA 1EHWA 2C59A 1T0HB 3CZ5A 3QUCA 1U2GC 2A84A 3NETA 3SZ2A 5ALQA 1GGVA 4PZEA 2CJXA 1N4AA 2F6RA 3EPPA 1Q17A 4RE6A 1TK9A 3NVKI 1XTKA 3Q7EA 5EL0A 4RHFA 4UHDA 2NP7A 3HJGA 3CNQS 2DR5A 1IEQA 1V5GA 1P75A 1ECPA 5EIHA 1DTTA 2XGGA 3BZWA 4RVGA 1QZ3A 2OHGA 3TF5A 1XLUA 5EFOA 1X7DA 4M0LA 3KUEA 4X7BA 5EIWA 3RWMB 2BJ9A 1MEJA 4L76A 1FFSA 3KR0A 2CKDA 3NOOA 5FUQA 1JFLA 1Z07A 4GWLA 4ZU1X 4WAUA 2QN2A 1NB2A 3L7BA 3R5XA 2J0UA 4TXHA 2VF5X 2ORWA 3HYCA 3WYEA 4UTVA 1VJWA 2C5LA 1LB1B 4CF4A 5FD1A 5DM7Q 4JI0F 2WJ6A 1RAFB 5ES3A 2F7VA 1QHFA 3Q8SB 3U7QA 2BFWA 1QE0A 5U4XA 3ZGOA 3RRFA 1Q53A 1C9DB 4ENRA 3RODA 3ZWOA 1YZNA 2DEJA 2FFHA 1A04A 4QNRA 1E7RA 4JI2F 4Y28C 1DAKA 4Z4IA 2IYPA 2V69A 1YOVA 1ZTWA 3GARA 4NBSA 2X77A 4AKGA 4MQFB 1AUSL 3A25A 2NZVG 3H3JA 1QZUA 3GJ4A 3IMCA 1GK8A 2WVFA 4YY3B 3MEGB 2H51A 3SS8A 1F48A 1UC4B 1ZJ5A 3EGVA 1RAAB 1XXHA 1UOEA 4ZPWR 1RT5B 3CR3C 5ALUA 2V50A 2DHSA 2ZE2A 1R6AA 4TRRA 1NOJA 1FQKA 4HLCA 3TOXA 2P4UA 4LKOA 1BJKA 3AVVA 1Z6TA 3A4LA 2YJ3A 1SQ5A 2GBIA 1ZP6A 3CDAA 2CFCA 2OAGA 3HGMA 5LMCA 4O3QA 4J75A 3AI2A 4YJDA 4Q16A 2D1RA 2B4AA 1S12A 1EVIA 4C7JA 2J9YB 4DV6J 5TV2A 5BYKA 2CPYA 3ISND 2G71A 2ZE7A 1JT2A 4CYUA 4NV3A 1AN9A 4DBLC 1DKUA 5EUQB 2GF9A 1LWNA 3RUFA 5IDXA 1XQVA 2WCXA 4LHXA 1ODFA 3WKDA 2ASJA 2R6AA 3IEUA 2WONA 4G36A 3PQ6A 3JQQA 1Z45A 1TVKA 1ZOPA 1TFWA 2HTFA 4A8PA 5IXYA 4UEOA 1PGQA 1JN0A 2D69A 2FD2A 2FJPA 2AC2A 4RTOA 2FLNA 4W9RA 4DUZJ 5KJ6A 2C9MA 2VIIA 1ZD4A 1V5EA 4HL9A 4RULA 1LSOA 4FDMA 3NTXA 5D8DA 2VPZA 4MYCA 4EKNB 4R7GA 4NULA 5ECWA 4MGHA 2BJEA 2O52A 1VIYA 4OFXA 4XQ9A 4XR4A 4PY2A 3FPHA 1IJEB 3RRXA 5KNBH 1V9LA 3R4CA 3I0RA 5FD8A 5D2CA 2CJBA 3BXFA 2LU2A 4O3PA 2JLQA 3P9CA 1QANA 3N7AA 3ZGZA 3P9IA 1X0PA 3R5TA 4PSAA 3NC1C 4CKEB 4ARCA 1N5YA 4CRJA 2P5TB 1TP7A 3CE6A 1RXYA 2IF0A 4C3KA 2WTXA 2FR8A 2ZSBA 4LJ6A 3SCKE 3H1FA 2LEPA 4JDPA 4EG5A 3CLUC 1Z37A 1ZJJA 5EHGA 3SR3A 3BFPA 1BJRE 4MAMA 1CLUA 1SHUX 2AVDA 3PNBA 3JTNA 3T5LA 5B3AA 3N2LA 1V47A 1G6OA 2NV2B 3MOIA 3PW2A 3PXAA 1J8QA 1E9CA 1OD6A 1SC6A 3ICEA 3ORRA 4PG7A 3I32A 3DGPA 4PQUB 1I36A 4LF7J 1KOJA 1FA0A 3QGHA 3N9IA 3WQPA 1KK0A 3ONVA 3RD5A 1WABA 2QI9C 3Q0EA 4UUAA 4C9BA 2HPHA 4BWVA 3N6NA 5EJMA 1N2ZA 2GSDA 3QRPA 4EK2A 3B1JA 2ZTMA 1YZUA 1W96A 4Y0FA 2WNHA 2GK7A 5J2TA 4EPRA 3THVA 2BGTA 2H4WB 3BE6A 4GT1A 4X20A 1G8MA 5HI7A 2I1QA 3CUVA 4CWAA 1GGFA 4BX9A 2J9DA 2C3YA 2MJNA 3RSLA 4DARA 4WRRA 2XB4A 4BE9A 3FJYA 1EG2A 4CH7A 3OJUA 4NG5A 5HTOA 4TSFD 4O3SA 1ECBA 1OXMA 1PTJA 4BGUA 1JB9A 2C20A 4X92A 5KYNA 1EIZA 3ABIA 4B3OA 3DFIA 3LF0A 1E3DA 5KG4A 2X8JB 1Z25A 3CUEF 3W8EA 1V16B 2XMJA 4M7WA 3JALB 2PIAA 1BWRA 4RTKA 3CMMA 5JDIC 3UR0A 5TXGA 4QU6A 2OLWA 4DUTA 2LEAA 3JRNA 4TTSA 3D54A 3CIOA 1T6XA 2XNDA 4X4NA 2AYEA 3UKJA 5EESA 4CLFA 5AT1A 3JARA 1SVUA 3F6CA 3TLXA 2VXYA 2X2PA 2ZDHA 1VHWA 2XF2A 4GOJA 1QGZA 2H1VA 1OFTA 3PUHA 3NBPA 1I0IA 4F9TA 1JXEA 1DLOB 1MN7A 1FS5A 2EC2A 2GF2A 5I4IA 4MAAA 4I6YA 3GUZA 1YWXA 3EUAA 4R0MA 4WVFA 1GA1A 1M74A 3DFUA 4W92B 4QTZA 1G3QA 3I76A 3KJXA 1GR0A 5D5HA 3K6RA 1KTIA 5AVQA 3HRKA 3FHOA 2O14A 2Y3YA 1J23A 3DF9A 2BM8A 1U7ZA 1EUDA 1QORA 3OTEA 1V11B 1QG4A 3IGVA 2CL6X 2PXHA 3Q12A 3FN4A 1IY8A 2O7RA 4KIWA 2B8QA 5G4KA 4UVIA 5JDCA 3H9CA 4CKXA 4LSZA 1V95A 3TG8A 2WOMB 1TU4A 4GL2A 1PYSB 2K3KA 4JL8A 2I4TA 4LR8A 2GJKA 3ZYCA 1R6TA 4NLOA 4NQZA 3M8PB 3NIBA 5I9TA 1CS4C 3F56A 3MWKA 1GAEO 5F0UA 1B7YB 5KU1A 5EMKA 2B43A 3B4DA 3DMPA 4PYJA 2G1PA 4IH4A 3X1JA 3R6GB 3LGHA 2C7BA 3N5KA 2GHWA 1W0CA 4X7RA 2OGWA 2PG3A 4O4JA 2AFIA 4GG1A 2YMLA 1ENYA 4TTVA 2OGZA 1RTDB 4TY8B 4U2BA 4YYEA 3I9JA 4ZARA 3N7UA 4IG9A 1I4WA 5H4GA 4J49A 1PWXA 4D9KA 4HGZA 3CX8A 5KFTA 2HNZA 1XAHA 4I2VA 2PSHA 3B3AA 5JEEA 1SIZA 2QL7A 5D5PA 4ZDJA 2WVDA 1PTKA 1R8BA 1SG0A 4DPYA 1CDOA 4LJLA 4QYTA 2H5IA 1LWFA 3KXKA 2ZSJA 4F1KA 4MTCA 2YQZA 4N8SA 2NZ8A 1C1BA 5L3QA 3S70A 5DLPA 3HCRA 2JLYA 1P4RA 1PJ8A 3H16A 5J5CA 2JH9A 2WWWA 1QIEA 2FV8A 4F36A 1WU8A 1B0TA 2HWXA 1LSSA 5A6SB 4GMKA 4EMSA 3EZ5A 1S8FA 1GA6A 1I2DA 3DZIA 4P4GA 2H4HA 1QF6A 4ZI5A 4CZ2A 3B6ZA 5FEUA 1FF9A 2JEJA 2FVPA 5JCOC 7REQB 2O50A 2BOAA 2SHKA 1S5ZA 4D4MA 1IN5A 3DPSA 2KPOA 1V71A 5H16A 5BQFA 2RJ3A 1FRNA 3O93A 1LLFA 1D1SA 4C05A 2YCBA 4C30A 3AHGA 1L9KA 2XPCA 3A6KA 4AJOA 1N0UA 4DNQA 3IOMA 2QA4S 3R5HA 3BQ0A 1X1AA 4ANEA 4WVLA 3FKBA 1IXRC 1O96B 3G1UA 1NQUA 1WNEA 3QYJA 3FR8A 1NMXA 3PLAE 4DG1B 2H2AA 4ZVUA 1MJHA 3RK4A 1BHO1 1XRMA 4DUPA 1DEKA 1BA2A 2F8EX 4BVLA 1XPRA 2C31A 4CLEA 1W0JA 1ZNZA 5LQUA 1TEHA 1YBAA 4X54A 5IZ4A 2FTKE 3BWYA 3L0YA 3KWMA 4Z4EA 2HFSA 1FFDA 1T8RA 2GCOA 5CYGA 5FULA 3C45A 1JEJA 2WPNA 1VMKA 3GZTB 3GRKA 5CA0A 4U6QA 4Z9BA 1QRAA 1JLGB 2ZR8A 2DD8S 2G1DA 4WBNB 3PGLA 3LWLA 3TZQA 2AR9A 4HDHA 1WJ9A 4YP0A 1V35A 1FD2A 2M8DB 9ABPA 1H74A 2ZYAA 3GLIB 4YR3A 1UXGA 3HBMA 1UBEA 5J58A 1JPUA 2J32A 1SZDA 4C3VA 4CO2A 3JQ6A 3T7IA 1TUWA 4GGPA 4DC9A 1ZNWA 2BANB 3CKKA 3H5WA 3GP8A 1XJWA 3ED5A 3M1VB 2BAGA 1X6VA 4NPAA 2I67A 5TMDA 4KYZA 4ZVSA 2IXAA 4QJBA 3H17A 1JLKA 2WW4A 2RRNA 2GAGC 2WVGA 2IUYA 5I9NA 3JS5A 4IQ4A 3M70A 2ZPAA 2H11A 3GVCA 2C2ZB 4ZC8A 1GARA 3AETB 1JIQA 1QZTA 1PC5A 4RQUA 1LEOA 2AT1B 3JW8A 1ACLA 5EG5A 2ZWMA 4I3GA 5LDHA 3IVCA 2JVRA 4N0QA 4MDYA 4RPHA 5CYQB 5IJXA 4JY7A 4JXJA 3DTYA 1JKXA 1ZA2B 4OQFA 1QB7A 3EQ7A 2E37A 1I0LA 3WY9A 4B6PA 2WAYA 3PGKA 1MA3A 3ZWDA 3SV4A 2IHR1 2OEKA 5LCXA 1N8TA 3UHOA 4RW7B 3H8YA 2P1RA 4P82A 3CJ4A 1BKYA 3HMQA 1K8XB 4GVXA 1Y4ZA 1SI9A 4WZZA 1JRLA 3VBEA 3NHBA 1CJSA 1KDVA 3VC3A 1R27B 4TTPA 1CBUA 3QEOA 3GOHA 4LOHA 1RHJB 2DULA 5DWVA 3TQFA 1E9VA 2OHOA 3OJWA 2UVWA 1F2GA 2DBBA 4D5GA 4C8OA 1U81A 4B3BA 3D6FB 2DITA 3D5QA 1R9NA 5FA6A 3RLFA 2D2XA 4R2HA 4GSKA 1E69A 4DQRA 3LPMA 4QUAA 4IXNA 1U2PA 2KLBA 2LIVA 3SMQA 1DVRA 4R8UA 2EJUA 1D4FA 3UPTA 4DLNA 2RHWA 5HVGA 4D0RA 2GBPA 1QS0B 1W35A 4BMYA 2Q6CA 4M5DA 3BF8A 4DRZA 3OF2A 4TPKA 2SCUB 3SEAA 1W25A 1WPXA 3DG9A 3CLRC 5JIBA 1N56A 3PTZA 1U1PA 1YB4A 3VGPA 3WMGA 4BO0A 4Y2KA 1VHTA 2GM4A 1I3OA 1PFVA 5LZ5A 2PWYA 3EVAA 4N8OA 2JFYA 2W2XA 2ALZA 3KB1A 1F3FA 1SUPA 3ZV3A 3IURA 3FK4A 5K6AA 2ZR7A 2GNAA 2ZI4A 3W3ZB 1X0VA 2HF8A 3RVDA 7YASA 1JLAA 3E1GA 4UHHA 1NX9A 3R9IA 3DM5A 2ZRIA 2RHQB 1EM6A 1A27A 4HI1A 1X0FA 4FFLA 1RACB 3EDCA 3MS4A 2WF7A 3K0AB 4LX0A 4DPLA 4YRMA 1VYUA 3J81A 1UT8A 2CJQA 2Y0DA 2COLA 3UW3A 2VAXA 3ZH2A 2Q3HA 2OPRB 2ROEA 1LV8A 5F8IA 5BSTA 5A8KB 4FNHA 4DFMA 3OFNA 5AKEA 5HBGA 4FD2A 3HZOA 3ANNA 1T43A 2C78A 4BQOA 1IWBB 4FM9A 2ZDOA 1H2VZ 4PAOA 1GFSA 4J4BA 3ZQUA 3F74A 4DIKA 4CTAB 3D0HE 2XVMA 2B37A 3DQPA 1XZIA 3AFNA 3SKXA 5HMXA 1PG5B 1AFJA 4B44A 1B74A 4H1WA 1T91A 2O2XA 3DKIA 1J9GA 2CQ1A 4DA4A 3EMVA 3GEDA 4J7XA 1S1XB 5I48A 4IP0A 3F6BX 2AN4A 4EY8A 4I2PB 2YVQA 5CYPA 3FDZA 4PPNA 4IFYB 2P6UA 4FZ3A 2FN8A 4UQOA 1HGXA 1VC6A 3ZLJA 1YC5A 1M1HA 1DT5A 3ML1A 3A36A 3AHIA 4KN8A 2HRTA 2BCGY 2AEFA 1R0XA 1YB7A 3TD9A 4UTXA 4FLFA 1T6NA 1OV4A 3AFIA 1CUBA 5L4NA 5DCLA 2QBYB 1V4VA 3QWPA 2WA2A 4R1PA 1IVNA 3GG1A 2AG8A 4EEZA 1UZNA 2VCHA 3FJ2A 4WNIA 3F44A 1V41E 4FF2A 2AFVA 1L7RA 3LCMA 1T11A 2YUIA 3QKUA 3HU2A 2QX8A 2PJUA 2Y1FA 1LPNA 3C97A 1SK9A 3VNRA 2R8EA 4EYOA 1XMOB 2V8DA 2I78A 4JN6B 1P77A 4HDGA 2FZGA 3R3WA 3LOPA 2PUFA 1YI0A 3TR5A 4CQMA 1UMBB 2IKSA 2NREA 5J1EB 2XD9A 1UANA 4YP7A 4W5HA 1K9SA 2GV1A 3OWOA 5FTKA 5KG1A 2HHHB 2QROA 2W8KA 4B40A 3BXOA 4N5SA 2DGDA 1K27A 4KQWA 1UEUA 1SR8A 4LVOA 5K20A 1FU4A 1XD2B 4IV0A 4C6SA 5BSUA 3WLTA 1DQ9A 2VYND 2H16A 2WKWA 4FOLA 4DNOA 1I5OB 2VP5A 2GCFA 1E5XA 3JX9A 3QVMA 1ZH0A 3ETJA 5CLLA 3VNBA 3I87A 2CV0A 3W3AH 1IQTA 2QRZA 1SUIA 2RFLA 5H4HA 2R4UA 2XW6A 1BFDA 2MJUA 4EZBA 1NZAA 1L9XA 1YV9A 2ICAA 3PVXA 4DM7A 2D3TA 1UOPA 4GBMA 2GXQA 4ZT7A 4BU1A 3DC7A 1C8KA 2EEPA 2QR5A 4Q02A 2FRVA 1LD3A 1Y9EA 4RW8A 1KO4A 3NTVA 4OHFA 3D4JA 1A5BB 3OCXA 3K7EA 3V7UA 4Z7QB 3GMSA 5CNMA 3GLFB 1H9AA 2Q6BA 1QHSA 2O3DA 3R3JA 1JTVA 4ZHQF 4JUFA 1U2DC 3MCAA 5K3BA 3ZI7A 3G6YA 4RY9A 4P5EA 3U6BA 2O7VA 3IEKA 2JVJA 3V4VB 3T7KA 5CYJA 5EZYF 3QSYB 2BTEA 1JYEA 4YP9A 2PU5A 1C2YA 3KTQA 421PA 5E9WA 3DZGA 2VZ8A 4BFTA 4JR2A 1E7SA 5K0NA 2XYVA 4HH0A 2FWBA 4HYKA 1XQYA 3DTVD 3GSDA 2DP4E 3M6AA 3WYCA 3H3XA 1EP9A 2UUOA 1EP3B 3MF5A 4FOOA 3T95A 3CJ3A 5L9AA 3OFJA 3J80Y 2GNOA 2CDRA 5JY6A 1SC4A 2RC5A 4Q4JA 3B5EA 5LNK6 5TRTA 4IXDA 3LS2A 1B14A 2EW1A 5I42B 4C2TA 3B7GA 1PJ4A 4LBYA 5D6NA 3THWA 4DQIA 3IV7A 1NSFA 1T13A 2VPTA 2HSEA 4AYWA 4X4RA 5A5VA 4CEJB 1NK4A 1MX9A 4I5GA 1QHYA 4TKLA 3CRMA 4TRNA 1GT8A 3L7YA 5JSFA 5LZ4A 2PCLA 1E1QD 4UT4A 4R5MA 2P91A 1S9DA 3H6GA 3R7WB 1Z7GA 1U7PA 1RQ7A 1FSGA 2REQA 5AVOA 1I4DD 2EG9A 3ACBA 3CF4A 2RDJA 5AVXA 2PKRA 3AOEA 1K44A 1Y4AE 4MWDA 2BF7A 4ZO7A 4ZCLA 2HLUA 2MYTA 2OTJS 4DMZA 2IPOB 4X9XA 4XD2A 1Z4OA 1RC1A 3VR1A 1BS2A 3G9CA 3FX2A 2XNQA 1GQOA 4KZPA 1YZKA 2QN7A 2QL6A 1E3IA 2N42A 3TP2A 2OO7A 4KMSA 2WBMA 3MEKA 1Y9ZA 1UINA 3A0RB 4XQGA 3JAMU 4TUYF 1DZ5A 1LQ2A 4G8JA 4TXNA 3MB8A 3DP9A 1DRJA 4K6GA 2HDHA 3GLIE 2QSFA 1S3IA 4DG8A 4YCNA 1CSEE 1K2WA 3AUFA 3FHTA 4AL4A 4IHAA 4O1IA 5DNYB 1M75A 2VK4A 4HQNA 1BDJA 3DE3X 5E1BA 1EDDA 2V9CA 2C1EB 3SCIE 1E3JA 3SVZA 4M9RA 4IO0A 4ER6A 3HP6A 3PQEA 4JYMA 4MRAA 4QOTA 1OH8A 4H0CA 1X7WB 3AHHA 1ORHA 3SAJA 4HYQA 2XCTB 4K40A 2N0SA 4TSKA 5JS8A 3QXHA 3F6SA 4JASB 3HFGA 4NBVA 3H4TA 1OILA 3W63A 2V7XA 4FEYA 2J5RA 4G4JA 3L7PA 3OEHA 4IFIA 4TRJA 3U4QB 1NP7A 3MM5B 3RGWS 2QVYX 1GAXA 2B2XA 2XDQB 3ZH9B 3PXUA 3P8BB 4K81B 5D6GA 2BJ8A 5H80A 4L51A 2MCFA 3TXYA 3COSA 1RWOA 4M89A 4KGZA 2CFSA 1RYMA 3FNHA 4IWNA 1FK9A 3PUIA 3CKLA 2CE7A 4Y98A 4AYTA 4WLEA 4OX9Y 1QIGA 4ZV4A 4AXJA 4YAWA 3OJOA 3O6QA 3ZZTA 2K1RA 4ZYVA 4CGZA 3S1AA 1L7DA 5EQTA 2P8SA 1R0RE 4PO1A 2ZJPQ 3SDSA 1ULTA 4RLFA 4AJNA 1FFAA 2KG0A 2RKIB 1HPZB 2GM3A 4V0KA 3WGJA 3PP8A 1FNDA 3T5HA 1EK1A 3H5YA 1JR4A 3PIDA 1QGUB 4ED3A 3MTDA 1G66A 2PL9A 2ZB2A 5IV4A 3M6LA 4E5VA 2Z4SA 1IOVA 2QE7A 3IFEA 3IA2A 3QG1A 1ST2A 1WX1A 2U1AA 4KO2S 4WASA 3BJIC 3UA4A 4E30A 2FETA 4G0VA 1EDOA 4PICA 4EHAA 3RSQA 3IUEA 1D9FA 1I9CA 4OI3A 1UWLA 2WTNA 2YIVX 3PVCA 4IH7A 4JI7B 5I9LA 1SVKA 5AKXA 4EP1A 2DXDA 1GP2A 3VZPA 3T7EA 1ZLYA 3EGNA 3ICCA 2M6LA 3U1MA 1TK5A 2FZVA 1YH3A 3BQNB 1K73T 4YREA 4ZANA 3IB3A 3SVTA 3L7NA 2ZAMA 1EZZA 4X65F 5HROA 1KPGA 3CM0A 3S5UA 3T1TA 4YDDB 5DDOC 2JBAA 4DVJA 2I9PA 4ZVHA 2LQJA 1EX9A 3MOSA 1PT6A 2X6TA 1IKXB 3PPIA 4PPYA 3AX6A 2PX2A 3N6XA 3GAAA 4L4ZA 4TU9A 3AVTA 3IQEA 3CLSC 3OIUA 1PFWA 2J5AA 4XVQA 1SUDA 3AQPA 2RJZA 2PH1A 4RKUC 3OXLA 3GPIA 1RIFA 1PR6A 3OPXA 2J3MA 1BC5A 2I66A 5CB4F 3F2VA 1XJ5A 3O2JA 1S10A 3TRGA 3VO8A 3EC7A 4BMDA 3LUGA 3RS8A 4EJMA 2V4RA 5H9EJ 2PGNA 2QR3A 2PX0A 1IQPA 5BO5A 1RQLA 2AJBA 2JFFA 3RPEA 1OR8A 1K1EA 3ZNQA 1BZYA 1QXSA 4JA0A 4X1YB 4F4CA 4ED0A 4KPGA 5L4SA 1BX1A 1GGKA 3G6VA 1DAFA 5BSRA 2HHVA 4IW3B 3CJ0A 4RR5A 1UMCA 3UD3P 2ZJFA 4HWGA 1SB9A 3EOBI 4PWYA 5ELLA 1G2QA 2PKQO 2K6GA 2XZTA 1JHOA 4BDTA 5ETTA 1VJRA 1Q1QA 2FB9A 1VJTA 1SXJC 3QNWA 1LOUA 2V9PA 4P35A 2KM8C 1M73E 3IR6A 3EODA 2JI6A 2OHIA 4FGLA 3L40A 4PGFA 5KNDH 5E3PA 3HKBB 4IQFA 2O1EA 1AKRA 2HLHA 4N5MA 4IUCS 4CT0A 5JNTA 5CZXA 1EB9A 2LP4Y 1G2PA 4G37A 4Y1EA 4UARA 4KXMA 5FBWB 2BYTA 4OZ5A 2VLIA 3LU1A 5CD9A 2ZIFA 4DV0F 3QPBA 4KUEA 1W4LA 1S02A 3LUKA 1VL0A 2QK4A 4NA3A 5EIBC 4DEYA 3ENQA 2V68A 2DH7A 3IR7A 1VGVA 3QYYA 1O5IA 4DV2J 3VTIA 4OQPA 4C2MA 2VQEJ 2HKEA 2ODBA 4FD3A 4RNHA 4RE5A 4WZBA 3TKAA 4ZDKA 2MTBA 1RPZA 2HD4A 4XGKA 3OU2A 4ACBA 3HPOA 3GA5A 1VMAA 2GN1A 4LNAA 4GZMA 3CT4A 1A1SA 3ANTA 2CWKA 4F1JA 2HJVA 5IWAF 3BWCA 1EB0A 1HNNA 1N54B 1WC6A 1KZHA 4R40A 3I8OA 2XMZA 3UMMA 1F6TA 4R1LA 4FYXB 4E08A 1QRSA 2NZJA 1RRVA 1ZD5A 3W2VB 5DK6A 4D9CA 2QMQA 4QEDA 3DE0X 1E79D 1OXVA 3D1LA 1O8BA 1UP7A 3D68A 4B9NA 4KRGA 2QAGC 3IDOA 1KONA 2XWYA 5J2PA 2O7NA 3VSCA 4ND6A 1CVRA 2O57A 1SOVA 3WGIA 1QAIA 1ENZA 3P6YC 5HO4A 1MORA 2VJMA 1E59A 1QUFA 5GONB 3FF1A 1C4XA 2VA8A 4LXIA 2UXBF 4FOPA 2PS9A 3BDVA 3GLFE 4GSLA 3M6VA 4PLZA 4UAVA 3UA3A 1ILEA 1NGSA 1CZUA 3JASA 3FI9A 1RSZA 4I55A 5JAPA 1R0BG 5IULC 3GJQB 1G4HA 1H6CA 2RGWA 4LRUA 1BMDA 2D3OR 1DKPA 3ZFVA 3A6PC 3DOUA 2HBYB 2OBBA 1FX4A 4LQ9A 5EQJB 4FCVA 4TY9A 1UZMA 5JU6A 4M8NE 4UZBA 5SZIA 3EZ2A 1BUXA 4PRZA 4MQ5A 1G3UA 1O03A 3EVTA 5ESDA 4DX5A 4RL4A 2NZWA 3NXSA 3MCZA 2W93A 4YAJA 4D56A 1EDEA 2VODA 2XBPA 1FOEB 2H9IA 5ALJA 1CJKA 2R84A 4V1CA 1RK8A 2O3QA 5AK6A 2J0QA 1VE7A 1E4EA 2D41A 4WSOA 1TFRA 4HWTA 2FW0A 4BATA 2AFRA 2OD4A 3DWGA 2QGNA 1Z2EA 3NALA 3K09A 4J2OA 5EZYA 4PXAA 3TRIA 4ZT3A 4HWRA 2WJYA 1PSDA 3GU0A 4N3BA 3V4LA 2R3VA 4DU7A 1P0IA 2VZEA 3FYHA 1POWA 2B4PA 5DGIA 1WCXA 2GIQA 3PXGa 2VC2B 3JZIA 2HJRA 3VGTA 1QK3A 1KFSA 5G53C 3QITA 5L3VA 1C7QA 4TGLA 2R2UA 5KT4A 4PZUA 2CXQA 4J0GA 4NS4A 3IBCA 3B9QA 3EJ6A 1JMKC 5L1JA 2YVUA 4D9BA 3VPAA 4HB2A 5TX7A 4ETMA 1ANKA 5IJ0A 1OPXA 3TZBA 4OXYA 5K8PA 3CUUA 3ETDA 4CM0A 4I36A 2UZ3A 5JVDA 1Y42X 2QVBA 2R751 4ZVPB 1A5ZA 2P79A 2XZPA 2DUUA 3U31A 3OWHA 1EK2A 1P1IA 1EXDA 5JNUA 3ZWQA 4D3ZA 2WA1A 3X1KA 4YY3F 1QQ5A 5J59A 2QA2A 1Z0IA 4D97A 4TMKA 2B78A 2X1BA 4PLGA 1JHMA 4B3MB 3ZK7A 3K4HA 1TCVA 5D4OA 1U1NA 3PD0A 2QIOA 1Y3FE 3A6GA 3WNBA 3QIDA 3OY2A 2RUGA 3NWGA 3NTRA 4ER5A 2KJVA 3ZR4B 3MHPA 4O5AA 3L3CA 2KH9A 1T5BA 4IDKA 3NAZA 3GJRB 1E1DA 2VBWA 3K70B 3I1JA 1Y3CE 2XULA 4N7RA 4MRSA 2WQ6A 3GMTA 1G1AA 1C2PA 1HNWJ 4QGSA 2BR3A 4I4NA 3SG0A 4FFBB 3IKMB 1BCRB 3I01A 1FJGB 4TUYA 1J7KA 1Z63A 2XM3A 3WDKA 2YX7A 2A9VA 2CF5A 3BFVA 3F9RA 4PHGA 3VU9B 1NK7A 5JCJD 3TJ9A 3DTTA 2HMSA 5K8CA 1F20A 3GGOA 5CYMB 1IR2A 1ENPA 2GMWA 4H6XA 3WIEA 1PRYA 4HGRA 4DM4A 2DJ5A 4HWPA 2J8AA 4AWXA 1T4DA 3E1SA 1DARA 3OZAA 1S89A 3U81A 2HIHA 4I1OA 1BKDR 5EJ4A 3VDXA 2H1HA 3DVAA 3C1UA 1T10A 1Z13A 2DG2A 1XR6A 4UOCA 2YN4A 3J81j 4WN9A 1MG5A 1RQXA 1FWKA 3KEGA 4Q34A 3EDRA 2HFZA 2BM9A 1CYDA 2WVJA 4OHYA 3MAGA 1N6PA 2WIJA 3DXSX 2OCIA 4A3SA 2WBRA 1FXWF 4MK7A 1SMKA 1JKHB 3N9UC 3T7SA 3O03A 4Q3DA 2QJFA 2LBPA 2C88A 1E2UA 3DEYX 1COZA 3M6XA 3PQ5A 4KIGA 3FYDA 1YQXA 4YJFA 2GF0A 3UO0A 4RZXA 1XK6A 1HI8A 4UTNA 5EZSA 4KB7A 3O8NA 5F77A 4DT1A 1U3DA 4JC5A 4Y1GA 1SV5A 4L78A 3ZHQA 1BMFD 4ZI7A 2O4CA 1BS9A 2GZMA 3STYA 4J3JA 3JQFC 1NRWA 5AUQA 3L9XA 5E0KB 2MHCA 4YRZA 1Z4LA 2WIFA 5BVHA 2A35A 2YASA 1PS0A 2RGNA 4J03A 1XROA 4Y65A 3D8NA 1VQ8S 3M81A 4ZPAA 2MGZA 4L1KA 3BFKA 2FG7C 4FHGA 3C19A 5C2JB 3KNGA 2XKJE 3VNQA 4DC0A 4JJIA 4ILEA 4MQEA 1E3SA 1TKDA 1X4AA 1P2UA 1HLFA 4G5XA 1U0NA 3TZZA 2HIYA 2FDXA 4IEIA 1H6AA 2Z1MA 4IDAA 1AF7A 5JMWA 2JDIA 2NT4A 2Z5LA 2HF7A 1QM9A 5CDFE 5EMJA 1WOPA 3ADCA 5D51S 4LOIA 1GEHA 4FIZA 1GAQA 1YK9A 4MW4A 3ZNPA 4AG5A 4BDPA 3KLFA 1XDGA 2PDAA 2DTJA 4HLDA 2W37A 3HWX1 4OH1A 4JC4A 3TIIA 1LXNA 4Y6RA 3QQ5A 4M22A 1SJ4P 1KYXA 2O48X 1J2VA 2G8LA 4YQEA 4AG6A 4DL3A 4OX7A 4E98A 4TM8A 1RWPB 3CTMA 3L8DA 4DR4J 1SEPA 1WELA 1RQ0A 1CVJA 2CQDA 2QRLA 1FE4A 4ECZA 3EEYA 5A8WA 3B70A 2B98A 1IQ0A 2MKCA 3HR8A 3HNRA 3PU6A 2YS7A 2IYQA 3C85A 1UFLA 4B46A 2C2OA 4KLNA 1QP7A 2Z0GA 5LMNJ 5T6MA 2JAWA 5D7BA 1M7HA 4ER7A 1G21B 3MUEA 2PCJA 1OYDA 1I5RA 5BNTA 4BDSA 3PI7A 4LRXA 3VTZA 1C7FA 3RSSA 5I3CA 2PFGA 1N2SA 4PQRA 4BGVA 3WNCA 2NS1B 3MDFA 3EDOA 1V1MB 3F8TA 5HQJA 2BEVB 3S55A 2JF0A 4LV5B 2A9RA 4BNVA 1RAEA 3MPUB 5COQA 3KQNA 5A02A 3H87A 2VKTA 1A82A 4ZPCA 4L9RA 1GHTA 4KIJA 5DSXA 1NVXQ 1CF4A 2ILTA 3LAWA 5IC4A 4DSUA 1Q95G 4B81A 4JP1A 4IIGA 3MELA 1HQKA 1HA1A 3Q10A 1O9BA 3U37A 5CCEA 1JMVA 3RB6A 1SIOA 4I99A 2YWDA 2XQCA 2J30A 1E89A 2UXCB 1IBCA 2FUNB 4XCXA 3CWCA 1I7QB 5AOCA 3NASA 1WWHA 2BX6A 1OBCA 5DM4A 3BL6A 4DR2B 4Q8EA 1SG9A 4GYJA 2ZJ2A 2GM9A 1UK9A 5T57A 2OCBA 4INZA 2AUTA 3PSHA 4WLNA 3IQWA 3WO0A 2J5KA 1HT0A 4TWIA 1I01A 2PSJA 3R5JA 2U2FA 2HK6A 4GUDA 3S5JA 2AIRB 2Q5QA 1DHTA 3V8BA 4N56A 2UVPA 2NVOA 3I5YA 4RU1A 4WGFA 5HF8A 2ATLA 5E1MA 2RDDA 4AMYA 3I6BA 2F1HA 4OI2A 3MS2A 5BPFA 1XD9A 3CDUA 2H4JA 4W99A 3AFHA 4RA6A 4TX1A 3LVRE 4CW7A 4EFNA 3MM6A 1ZKMA 2UXBB 2QN6A 3VZQA 1N6QA 3TVKA 3BSOA 2VPWA 2XSZD 3CVJA 5EMHA 4OQYA 1Z2DA 2ORVA 3RNOA 3OCZA 1UA0A 4AJIA 2YNMD 4K9NA 1EVEA 3TW6A 2X9NA 3VGSA 3FDFA 1SHLA 3QPIA 1UVJA 1FRKA 1K4YA 2J3KA 5IP5A 4QYMA 1HI1A 2ZI7A 3H90A 4LYEA 5KNCH 1PCAA 3CN9A 1NA5A 1X8XA 4P54A 3O75A 2CKWA 1T9HA 4O3FA 2PMZD 3Q4GA 2B4YA 2QRMA 1BQNB 1QC5B 4CLPA 4R31A 2JHGA 5JWHA 2JIDA 4ZVKA 1EBBA 4TZ6A 3ZGYA 1HQUA 4MGKR 1U28C 2ZTVA 1NK9A 5JMPA 4OYMA 3AINA 5EHNA 3OTQA 4EG3A 1TEZA 2VONA 4P3KA 4A0RA 1PFYA 1K86A 3MECA 4QTYA 1AKMA 1MO2A 2ZHAA 5ALXA 3LWBA 2OZPA 3G68A 1NG9A 4WCFB 1A96A 1ADBA 3KDSE 3GR0A 5B12A 1Z68A 4G89A 2YKOA 4J37A 1NHVA 3HBAA 5DBFA 5LDGA 3QHAA 5JHGB 3ME5A 3NBXX 3CRNA 4Y2AA 3CN7A 4QXOA 3QLVA 4M87A 1N0IA 4IDEA 3H9GA 2NQTA 1ZGGA 1ZGBA 1ZM2A 2CJAA 2HQDA 2BA9A 3HJVA 3B3GA 4J1TA 1QIDA 2XF8A 5AM4A 3OOJA 3FYUA 3CONA 4RIGA 5D78A 1G98A 2W2LD 2P6RA 1NRXA 2HQ1A 2A9KA 5CB0A 3IMFA 5IS2A 4HZUA 2CQ2A 4P4LA 1TIKA 5JFGA 1WPQA 1L7PA 2F9MA 3NBFA 1V5IB 1HNXB 2VJVA 1CEZA 4TL6A 4JWTA 3IX7A 2OWDA 2C4WA 1ZAKA 4HAOA 1XTQA 2W2VA 2HV8A 4RVHA 2PUTA 4WJZA 3BXHA 2VQFJ 2JBWA 3CB4A 2H1WA 5GADl 3PX2A 4FF3A 2X86A 2YR0A 4QJ5A 2RB4A 4EHIA 3E03A 2X13A 4ZV9A 1RT3A 3KSMA 5E3CA 3LYUA 5SY6A 2RVJA 1CEEA 4GLBA 4KLCA 5ULLA 2Y1XA 4WBNF 4KLRA 4XLLA 3V2UC 5AH0A 3IP6A 2F9FA 2P9YA 1YOBA 5ED0A 5BXQC 2JHFA 2O2DA 1RA6A 4YALA 4D9MA 1JAXA 3DBRA 4UHEA 4R5PB 1QH8A 3FBFA 5LOQA 1BGXT 1YLXA 3JB9k 4BQPA 2Z5VA 3HYTA 3RFCA 1ULRA 3LRXA 3ILSA 4QOGA 5LQMA 3R44A 1FU8A 4LY0A 4BNGA 4L8GA 1B0AA 5EEHA 1H0KA 3KOXA 5GINE 3BD6A 1S2OA 3BWVA 4L4SA 3W4IA 3MEGA 2A94A 5IN5A 4MHOA 5HVFA 3COWA 4LXXA 3Q5EA 1Q21A 2EERA 3SC6A 3ZHRA 1R43A 4LF1A 1EK6A 4TLAA 2J0SA 1I4OA 2Q3LA 1X5TA 2WKPA 3GL9A 3ECSA 1OWNA 4QC2A 2Y05A 5I7OA 1CULB 3CRZA 1DELA 3IJPA 3RSZA 1FTNA 1RHQB 2NUPB 3K8OE 3WI7A 4I1SA 2QJ3A 4X2BA 4BY9E 1UIMA 2XLIA 3CZQA 1ZETA 2FPSA 4CDGA 2JIPA 3KQPA 1S99A 1OBHA 4DA7A 3QFTA 4XIFA 5B1EA 3SQWA 4RPIA 2UVQA 3NWBA 3ISNC 3LF1A 1Y6RA 3GFGA 2Q3CA 1I33A 4W63A 1M2WA 1QRDA 2XXBA 3FE2A 3PUKA 4EGLA 2W42A 4RY8A 4PQFA 3ZE2B 3NT4A 3G5TA 2V8GA 5ERXA 3O3LA 2XXAA 2CKMA 1VOMA 2V7TA 1UOOA 1JECA 1UVMA 4C0AC 5IK2D 2R5NA 1UKCA 1U5BA 4UM9D 5HIMA 2QTAA 4NE2A 3A32A 1UEXC 2W4DA 4DIBA 2WZ1A 2MSTA 4MGEA 3JQ8B 3AUYA 3K8VA 2X4LA 2VK1A 2QEQA 3CR8A 1X1DA 4N1AA 4CCHA 1SJ9A 1TV6B 3GVXA 4ZKEA 1MOPA 2P2CB 4AIIA 1S7IA 1U0RA 4KSCA 3HMJG 2B2CA 1D2CA 5AW8A 3O8OB 4JI6J 4E6EA 5C1BA 3K30A 1BIFA 2ZBCA 4GLLA 5IVHA 2JRSA 2Q1WA 2MSNA 4XJTA 2DB3A 2DHCA 3A0UA 4KH0B 1H65A 4HKQA 4LF4J 4UE2A 1BVYF 3SE7A 3WYFA 2RHOA 1E3QA 5BYJA 2R7AA 4QX6A 4XDGA 2XGMA 5EZ5A 5AXBA 1H73A 1P61B 3QYFA 1FP2A 2I6GA 3D1JA 3IAS1 1DT3A 4LOAA 1A9SA 4E31A 1N33J 2BFNA 3PXCX 1RZRA 2J33A 2AWNA 5L7YA 5EHXA 2PC6A 1M7GA 1ULBA 1XYVA 5FT9A 1FNMA 3PFNA 4BJ1A 1YA6A 4U6PA 3LYHA 3HXPA 2VJOA 1JDTA 3KHUA 1BG6A 3B54A 1KO5A 4Z54A 3SCZA 5KO2A 2W25A 2YJTD 1FTQA 2C3MA 4WXMA 1ZLXA 3D31A 3DKVA 5HQ3A 2FP3A 3AM3A 2ZHBA 5EKUA 3UT0A 4PQUA 4F3KA 2W7AA 2JZOA 2KI2A 2J0EA 1GDTA 3OTDA 3ANXA 5IYZB 5JFTA 4NDNE 2YH1A 1GG9A 1QJ4A 3AR5A 2P2NA 4J9MA 4LC9A 1NBME 5CT6A 1G21E 2LYVA 2BKLA 2XY5A 2PIDA 5L9XA 1CQZA 2Z30A 4C48A 5EP1A 3HB4X 1I51A 4JX9A 4ZZ0A 3PDNA 4JC8A 5BNIA 1PEDA 2VYVA 4DSIA 3GCGA 2MZ1A 2HFVA 2KYRA 4GWGA 3FY4A 1H1DA 2QPTA 2XE6A 3BK7A 4Y6LA 5EE5B 2XGOA 1ISPA 3KQSA 3CWJA 5BN5B 4X91A 4L7QA 1BMQB 3KPYA 3IVRA 2OC4A 4P36A 4WKYA 5ITZB 5KQLA 3ZZ0A 3TARA 5CT9A 2X8JA 2GH1A 4GP7A 1YGYA 4Y34A 2REBA 4Z9XA 5EAIA 4A6EA 3NEJA 1V16A 1IXSB 3I05A 1KRHA 3GVHA 2OLKA 3EYZA 3ROTA 3OQNA 1LW2B 4N0PA 1Z4PX 4I6JA 2CFIA 1WKCA 1Z5GA 4DHVA 1A9ZA 3KAPA 1YZQA 1G5HA 1Y7IA 2SICE 3JR7A 4DS3A 1XMOF 2O4UX 1V37A 4XYLA 4OLAA 3Q8UA 4I9HA 3QKTA 2IIPA 3O8DA 4CKWB 1HURA 1YZ6A 1ZJYA 4RK1A 5A4KA 3AFGA 3ZYZA 3B6MA 3FVTA 3BGFA 2REOA 5C5CA 3D7NA 3NP5A 3TLZA 3QWHA 2HHHF 4JQSA 2I6XA 4QLOA 2XQIA 2WT8A 3DOEA 2VP0A 2BVZA 4H4CA 4K1XA 2J3LA 5LIRA 2RS8A 1MFZA 4Y2VA 4AECA 3W1YC 1MDFA 3LX4A 3PYGA 5DP1A 1ULUA 4B5KA 1TL7C 3R5AA 3L4SO 5JYCA 1WOOA 4KW7A 4E2WA 1F5SA 1GTVA 3O2IA 3U17A 2F3PA 4UHJA 4JVNA 3CHYA 4W6ZA 4HWOA 4D41A 1OC2A 1WI8A 3HB5X 2UV8G 3WO1A 5DI3B 1C9KA 4TQSA 4P1ZA 4AY5A 3MMBA 2QYHA 4J16A 4Y67A 4RHYA 3WBFA 1FPQA 2RMLA 2UZ1B 2O8BA 4O2AB 1N2OA 2HDWA 3HFJA 5BOSB 2GQ2A 2X8WA 2QKYA 1B7FA 3LLSA 3ILVA 1TYBE 1ZN2A 1U4OA 4I6WA 2LDXA 2B6AB 3MCWA 1GL3A 2FC9A 4F3OA 3TI9A 5KNBA 1M6WA 4LJ5A 4OG2A 3UMSA 4BKMA 2LZ0A 1Z8NA 2QT1A 4HPXB 1Q0HA 1QYDA 4AZTA 4J9RA 2NNLD 1KR2A 5AKYA 2V3CC 1NH8A 5LPNA 1TMKA 3KOZA 4D3HA 4DDFA 4UHBA 4O4LA 4G1UC 1NQOA 1TTQB 4TY8A 5HLFB 2PUBA 1R74A 5KFOA 2WDZA 2DQKA 4CE6A 1MU0A 1JBKA 4X97A 1IKVA 3CUTA 4LVOP 4OXNA 3IE0A 4ZTUB 4TTAA 4XIGS 2PHZA 1PJRA 4V1CI 5B2ZA 1RS0A 4ZIRA 2QLJA 2CZ9A 3ZLBA 3CZCA 1DDIA 3LWMA 1LI5A 1AF4A 5J40A 3HO8A 4EG8A 16PKA 1L5WA 5DIFA 3EICA 1XFAA 4DCOB 1K3FA 3QX9A 1HSZA 4ZP6A 1S76D 2OBYA 2Q41A 3E51A 1GPAA 1P0PA 4BLVA 4BBPA 4Q3OA 4LHWA 1EQ2A 4WFKA 3G96A 5JI2E 4KOAA 2PEZA 3QKRA 4HHHA 2K7KA 3QVWA 3L06A 5LP1A 1JVBA 4Q4AB 2I6SA 4DSOA 1YB1A 1DAEA 2GHRA 4MJ3A 1V8FA 4NCAA 4NFHA 3EEIA 2F8MA 3SSSA 2C5GA 3CD0A 1A9XB 4OREX 1IIRA 2IEIA 2VAWA 3MQ4A 4U9IS 3F97A 3KAJA 3DF7A 4CEIA 5IEJA 2P2LA 4PNEA 3SQGB 3JYTB 4BB9A 3TTYA 3JSXA 3U1LA 2CPHA 4L2IB 1XZMA 1Q15A 4RGYA 4L0MA 4KC5A 4LXYA 4EBFA 3HSJA 2HLPA 1QSSA 4W1SA 1AQJA 3QUSA 1X9MA 5CPFA 4ZDWA 3E7WA 3AY0A 2RG7A 1ZAXA 2XMTA 1W9HA 1YTLA 2QE6A 3HB9A 5ICFA 2KHCA 1IAVA 4NMHA 1IY0A 4WBFA 3UG6A 3FHJA 2ZQYA 1O96A 2PMCA 3OP4A 3EC2A 5I7HA 4AP6A 4DN6A 3H11A 3NDJA 2NX2A 3X1WA 4Y30A 3VR4D 1NR5A 1JSLA 5BVGB 1SBZA 5G4DA 3GGPA 3HDTA 3K2QA 2YPYA 3I2GA 3PNSA 1Z2ZA 1RWMB 5CFRA 5JO0A 5ILGA 1H85A 1CRLA 2HLDA 1TCAA 3QELB 2WDPA 5TT1A 4JI8B 2APOA 3ZBQA 4JSRA 4BGDA 1E2JA 4KR0A 2OY0A 4PM4A 5DLQC 1ZOOA 4F2WA 3HGQA 4D9HA 3LY8A 3G2MA 5I7AA 4LZZA 3DL0A 4L4XA 1L3BA 3I28A 1FE0A 2AX3A 3BS4A 3RT7A 2WOJA 4JEUA 2RH4A 1NH7A 3RUEA 2QV6A 1WOSA 1EARA 3JVDA 3UUGA 3A2MA 1V0JA 1JILA 3HZGA 2FOLA 4ZZ1A 4L3VA 2QVCA 3T38A 3VUEA 3PRBA 4LF6J 3QVGA 2R8GA 1GAWA 1JHAA 4BTVA 2Z4RA 5K8UA 5CDUA 2WUDA 3KM0A 1ZIPA 1KC1A 3DTNA 1QYIA 2BFBB 2H9ZA 4YH1A 1IBMB 1UZDA 2HIAA 4G1BA 4ENPA 1DXHA 2YY3A 5IHPA 2VWHA 3QI7A 2D8AA 3TCKA 3WMRA 1H4QA 2UXDB 3IXMA 1Z1ZA 4JLKA 1CUDA 1NSTA 2BI4A 4XFDA 2AT1A 1SUQB 2VHUA 4N7TA 2RH8A 2DGWA 4U7UD 1W4CA 5CYQA 2PUCA 5ICCA 2FOIA 3L46A 1FW8A 4KGDA 1XMQJ 3LCVB 4CP5A 1YHZA 2OA0A 4EJSB 4NEHB 1T6ZA 1TU0B 1FBTA 1RT4B 2X9VA 3BBFA 1G17A 3O9MA 1F9FA 5HK8A 4YECA 2I2FA 5AI6A 4AYBD 2H3HA 4BUCA 3LC1O 2VFTA 1UBRS 2W0MA 4Q7QA 2VNKA 5GGYA 4JUBA 2JJYA 3W62A 1PAUA 1YK1A 4KHMA 5A4DA 3SHFA 4RW9A 4KV8B 1VKNA 4LR9A 1QGYA 4CU5A 4D26A 2UVRA 1R27A 1CQPA 1P0QA 4HH4A 5LOVB 1CIPA 1S8NA 2A57A 2OCGA 3H04A 4JI7F 2XCUA 2DR9A 5IANA 2AXPA 3D6FA 4AWAA 3ZDCA 1IWGA 5THXA 4QQ8A 1F4PA 3T61A 3TQTA 3M05A 2V98A 3NONA 2EHDA 3QBEA 5AJTA 1EQ0A 5IQQA 3TI0A 4UDOA 1LPPA 3G59A 1R0AB 1MO3A 1XTVA 4RW4B 2C7PA 4LBPA 1H9BA 1EVZA 4M37A 4EZ9A 2RNEA 5C8ZA 1WCIB 4DJAA 1MH9A 2ZPUA 3R0IA 1KI6A 4NMLA 2RT3A 2C2KA 2VDLB 3IA7A 5HKLA 3SEZA 5CFPA 1JDVA 2H1RA 3KT8A 3W04A 5DT2A 4WI1A 1P74A 4JSYA 1N9ZA 1CVLA 2XC9A 2UZ0A 3W5UA 4QPPA 2I2WA 4A0FA 3WX0A 2ZUFA 1ZH2A 2VHJA 2OK7A 3EZNA 3PACA 4QYWA 4CMIA 2G77B 3PHCA 2BW2A 2PR7A 5A3RA 4GQIA 1YZYA 2DFTA 1GXTA 2AJTA 4PV7A 2QJOA 3GYXB 3I5BA 4ZMBA 3K73O 2G1UA 1NL3A 1NRKA 1FMTA 3MUFA 2H7CA 5HIAA 1N92A 3STVA 5G0SA 2GRUA 2CF6A 4CLKA 5BN3B 3AA8A 3S2GA 3LHFA 5DB4A 5A8KA 5JJIA 3R3YA 3H5TA 2NU9A 3THXB 3FDIA 4Q7AA 3C2PA 4Y1FA 2HQIA 1A7UA 3KXPA 2YNGB 3BF4A 2B4QA 1J1IA 1AE1A 4CTAA 3ABSB 1CUJA 2INGX 3FUCA 1REVB 2PQMA 4HHEA 1ZSVA 3T4EA 4ZVGA 2UU9B 3ASZA 5K1ZA 1O95C 3ESDA 2FQQB 4OHXA 5C2GA 3CZRA 1UBKS 3ZDBA 3U7GA 2P62A 2AKEA 1S1XA 4H4OB 2JLXA 4DX6A 3NR2A 4LC0A 3VVBA 4BUJA 2RKWA 3DYAB 3E9NA 4EDHA 2CSUA 1RAHA 2KMLA 4O4HB 4HVCA 1NLZA 2WU0A 3K0FB 3HHLA 1JJVA 1ZK4A 4ZHRA 3FAZA 2IVFA 2EVWX 4AJLA 2ECFA 3L82B 3WBKA 1CVIA 1YFZA 1JFFA 1VQKS 5G2OA 3SQXA 1EE2A 1FYDA 2HWYA 2OBMA 2W6ID 3O8QB 4YTEA 3RV3A 5ALTA 4GC9A 2BISA 5E6UA 4ANDA 2B51A 2H0RA 3N86A 3JPWA 1DC3A 4HX5A 5JD6A 1DB3A 3DWEX 3LV8A 4FHDA 1RWKB 2R7TA 2ERYA 2KVIA 3AL3A 4M55A 2QD3A 2AR7A 4M8SA 1PX0A 3QEBZ 4QE3A 3RZAA 1ZA1A 1WNFA 5JI3E 1N52B 2RJNA 2Q45A 5KU7A 5HJYA 2A3JA 3DD1A 1XD8A 4GRDA 2EBHX 1X1SA 3WXMA 4QU0A 1QO9A 3WS7A 3PHIA 4P72A 5I9BA 1KO1A 2HGLA 2PD4A 1NT2A 1UFOA 1P62B 4XYBA 4HFMA 3DZBA 4WXHA 4AL7A 4JT8A 2J5BA 5J1EA 2C03A 1Z34A 4B5LA 2J7PD 2P67A 2Q6KA 1QAJA 4ZEOA 1H8EA