3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
b'EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
1HORA 1O8BA 5IT0A 4IO1A 3MAHA 3S1TA 1SC6A 3AB2B 4NMLA 4X84A 5JJBA 1PSDA 3E7FA 4R7TA 1FRZA 3BXFA 1FS5A 3HN6A 2LQJA 4OQPA 3DHXA 5HJ5A 3ICOA 2BKXA 1ZPVA 2RQMA 2RE1A 3DC2A 4L4ZA 3EFBA 3OFGA 1DEAA 4L50A 4M8LA 1LK7A 1YBAA 3IXQA 3E15A 4GO1A 2J0EA 4L4YA 2P9CA 2RI0A 1UJ5A 2LVWA 3DHWC 4TM8A 3EB9A 3DDNA 5IT4A 1FSFA 3OC6A 4L5JA 3K5PA 2R5FA 2DTJA 5FIIA 1M0SA 4LUBA 3LWDA 4GO7X 4OQQA 3MTJA 1PBTA 1VL1A 1LKZA 2JOQA 3TUZC 3W7BA 5T41A 2F1FA 3AAWB 2NYIA 2P9EA 4R9NA 3ENQA 3N0VA 3NRBA 2QSWA 2RQKA 3OBIA 3CH7A 2KO1A 1CD5A 2F8MA 1UJ6A 2WU1A 3NZEA 2PA3A 1FS6A 1FQOA 1LK5A 3U7JA 3KV1A 2ZHOA 2GNPA 2QMWA 3TUIC 3LHIA 4GO5X 4TM7A 1JT9A 2J0WA 3ENVA 3AB4B 3P96A 1Y89A 3NWPA 2BKVA 2H9ZA 3HHEA 2W48A 1RWUA 3OFEA 3L7OA 1NE7A 4L51A 3IBWA 3TX2A 3O1LA 2P9GA 2JHEA 2O0MA 3MWBA 2MDAA 2RI1A 3CEDA 2J0XA 2DT9A 3OFFA 3CSSA 3ENWA 2QRRA 2OKGA 4L5IA 3BXEA 2PC6A 3KWMA 2FGCA 3LOUA 4GMKA 3UW1A 3TUJC 1HOTA 1YGYA 1KS2A 2I9SA 2CDQA 1U8SA 3BXHA 3BXGA 3OFHA 1UJ4A 1Y7PA 2QMXA 5IS2A 4PWUA 3LUYA 1XTZA
chains in the Genus database with same CATH superfamily
2X9NA 1U4BA 1O8BA 5EXDA 1RWNB 4MR7B 3I58A 3KL2A 3D4JA 5A2QY 2DU8A 2A0FA 1AF4A 1JDNA 4ECSA 2H2GA 1TXGA 2CF5A 3AETB 2G9QA 2G0AA 1POXA 2RE1A 2CBZA 4BAUA 3AVTA 4B3XA 2AK2A 3ZCVA 1FP7A 1EVQA 4AKEA 4AG5A 2FZWA 1P1JA 2W7OA 1R0LA 3RYCB 3WZ2A 2QTLA 5K8UA 2IYYA 3G88A 1P4SA 5KOIA 3AIKA 3GNLA 1QS0A 2YS7A 4O29A 3NBZC 2HU7A 5D77A 4LSNB 4E03A 3RUAA 1P27B 5C37A 5IBPA 3E3AA 3QVXA 3V6JA 2NYRA 2RIPA 2NXNA 3G49A 4D9CA 4FIDA 1U2SA 3QP9A 1XEFA 3FBEA 5DYIA 1QKIA 4WXEA 2BHTA 4B32A 5F21A 1UAWA 2GAFA 4C97A 1SKAA 2PRSA 3QQPA 2IXFA 1DQSA 1CY1A 3HBMA 3QNWB 3O6QA 4I1IA 1P74A 3LZDA 4HDQB 3R3UA 4KAIA 4RX6A 4Q44A 1PLLA 4E3WA 2BMEA 3W6NA 2EW2A 3I6MA 3A31A 1I36A 3IEKA 4GWLA 4NZ7A 2PE8A 4Z6KA 4ZGBA 3NHJA 3H5AA 1LWXA 5DK4A 3ECCA 3K32A 4HWSA 4CGZA 5DWVA 4XIIA 5HKAA 3U4GA 1UH5A 1VYUA 2ZCUA 5ITVA 5BYKA 4ND5A 5HPYB 2Q0XA 4ZU6X 1OIXA 3AM3A 2A67A 4ZALA 1E6EA 3NAQA 1C3JA 2CMHA 3DOOA 1GQRA 1B7GO 3DAGA 3KTOA 1J9GA 4W82A 5IQQA 3CRZA 1RQNA 1VJGA 3NKVA 4DR1F 2DBYA 3ZGZA 4A8HA 2GDJA 2GPSA 3UDEA 4DX7A 4EJSB 3AB4B 1P44A 2X0NA 1FEEA 4OZNA 1X9GA 3SJBA 4NZ9A 4ZAWA 4LOIA 5CH3A 3Q9NA 2ZI9A 2V7QA 2NVOA 3D02A 1JJ7A 4RJKA 4EY6A 5BVHA 4Y34A 4RUBA 1ID1A 3NBUA 1EARA 2Q79A 1ZLYA 2HA5A 4KU4A 4LZLA 2ODNA 1PT6A 4HQNA 4K0KB 1HE2A 2J6HA 1DFIA 3EVAA 4QYMA 1RAHA 4KKVA 4KQ9A 5K14B 1MKYA 1Q6ZA 1X7ZA 2I62A 3GAMA 3IMFA 4L9WA 5DDIP 3BEOA 4O1IA 3NC0C 1N6RA 3OTOB 1R0RE 4WI1A 1FTGA 4L2IA 2VDMB 1Q1NA 2V6FA 5KFRA 3PNSA 5E3RA 1QYRA 2HK6A 2RD5C 3OZTA 3FMVA 2F2TA 1PKXA 3ETCA 1N2HA 1LPPA 4ECQA 1PYGA 1OY6A 3NT4A 3AWDA 1JFFB 1YTYA 1GLVA 2OBMA 4LF6F 2WFZA 3SJAA 1VMBA 3OIUA 1KP2A 1AT1A 4DF3A 4X54A 3W3ZB 3WGJA 1OX4A 3L02A 4CLOA 3ULHA 4AF6A 1FDNA 1M2OB 2ZYTX 4LQ9A 5SY4A 1Z0AA 5EPEA 2B7CB 5H7XA 3UANA 2GZSA 3INRA 4MQ5A 3UA4A 2LDIA 2OG2A 2W7PA 4U7UD 2A94A 5CVDA 3WGVA 4Q8FA 1QUPA 2XCAA 5JJCA 1ZGAA 2DE0X 4CLYA 1W6RA 2FFJA 2XSZD 2HWTA 5K6RA 5A6SB 1SUDA 1XVUA 4DBLC 2QJTA 2DFKB 3JARA 2IU0A 3TPFA 2OCKA 2CWXA 5ESRA 5CT8A 2W4PA 3PK0A 5F9MA 5HVFA 2B9YA 2XYQA 1GZ5A 3PDCA 5HILA 3W06A 5ETJA 1MW7A 1F0YA 4C3UA 3PS9A 4Q1VA 2JCVA 3E2PA 2J5BA 4QSMA 1L5LA 1WY7A 1GZSA 5MN4A 4UT4A 1MMNA 3GFBA 1HLDA 2UXBJ 3K70D 5LKAA 4X1IA 4X20B 1IXYA 1Y7LA 1HBOA 3RRJA 3U0VA 1RLJA 5H82A 2Z2LA 3AG5A 2HLDA 4TZ6A 2VBYA 3HSZA 3FDFA 3OQHA 2UU9B 1XP8A 2OFWA 5M7EA 1OLSB 1XZCA 3VUFA 1WMSA 4TQRA 3SBDA 4UFNA 1WLYA 1E1QD 1D2HA 4WOCA 2GF9A 1YBUA 2J07A 3FZBA 4F0MA 2WD7B 3CMQA 4YRPA 4EZEA 1U3TA 3AV0B 1YB5A 3MWDB 2AW5A 3TRKA 3UUGA 2XE4A 3RS3A 1G41A 4IINA 4A46A 4NX2A 4EJ0A 2R7KA 5E3CA 3K94A 3LVRE 2M6RA 5L95A 1OI7A 2NZYA 1I94B 3R7WA 1EE9A 4ZVHA 1ZL0A 5C7OO 4TXMA 4R1PA 1DJOA 4DR2J 3W2TA 4F02A 2HHPA 1FI4A 4A7PA 1GPH1 3PD1A 4OX9F 2C92A 1PC5A 3K5NA 5ALEA 5F8IA 4PGMA 4RSMA 3I9FA 2CJYA 5A4MS 1PR9A 5J1SB 4LQ4A 4A36A 1UOQA 5EEGA 1ADCA 3RYFB 5CCBA 2KO1A 4JC0A 2KRBA 4EVRA 4DS3A 4JZKA 2AYMA 5TF4A 2NYHA 1SKRA 4XGKA 3K2YA 1LJ8A 2D13A 4DLGA 4AZVA 1NXXA 1WC3A 2KB0A 3SQNA 1CJKA 5AHOA 4KLNA 2I78A 2QW1A 3BERA 3NDPA 4QHTA 5C2GA 1L7DA 3TX2A 1E2EA 1S6QB 1WY5A 4CIBA 2BR5A 2PPVA 3M83A 2E7WA 1I4DD 4RK6A 4MQ4A 5FPHA 2PT6A 4PNZA 4YCJA 1XNRF 5HMLA 1TRKA 2CLDX 3ADCA 1Y7PA 4YY3F 5DDPC 4NYIR 3S44A 4G4JA 2DKNA 1RQRA 1WDTA 2AJLI 3QX3A 3ZBQA 1G9SA 1X8LA 4LT6A 3PCTA 1OC2A 1X1TA 2R00A 2X1HA 4JC8A 4RDXA 4HI2A 3FETA 3LBNA 3H9BA 3ILJA 1PJRA 3FUYA 3R6WA 5HJ2A 1E7RA 4N5IX 4JB3A 3MMNA 1HOXA 1YJCA 3JTMA 2ADMA 1XMVA 5EJ9A 2JBAB 4P4TA 3OFKA 1CG2A 5CVVA 4ZYTA 4XASA 3U81A 1GYPA 5EJ2A 2BQRA 4HLQB 5AKYA 4LC0A 5EJGA 4ICLA 2Q3PA 3Q6MA 3SC2B 1VQNS 4MVJA 4LIRA 1DKNA 3T5CA 1TIPA 4NS1A 4QU5A 4B8WA 5A4FS 1PIWA 2QTVB 5DHQA 4NZOA 4X24A 2QYCA 3BSSA 1K1EA 3OKCA 4DV6J 2WOMA 3L4BC 3QY9A 1V5EA 4TYAA 4UOGA 4LF1A 3HP6A 4EJ6A 2WMNB 1QHFA 2RAFA 3SSSA 2OCAA 1ST2A 2QTCA 2I6WA 3TTTA 3FPEA 3DBHB 4PXAA 5BSEA 3HGQA 2PKCA 3FNRA 3QBCA 2LQJA 2VA3A 2FLPA 4UTXA 4GZ6A 1JLHA 4NLOA 4YO7A 4NATA 2PXHA 3DV9A 1CNEA 3PB3A 5DRYA 1FFAA 5DGIA 2QLXA 1CBKA 4Q6WA 3Q3EA 2P6OA 5KX5A 1J5OA 2O1PA 5J1TB 1X4DA 1CF2O 4ZZ0A 1WHTB 2JA2A 5BW6B 3R0JA 2IEGA 2V7WA 1ZJJA 4LIWA 1OA1A 3B5IA 1NHVA 3ENQA 4H1TA 5JSQA 3A27A 4S2UA 1SIZA 1C1DA 1P2DA 1GMUA 1SJRA 2AE1A 1W93A 1IUJA 3Q9UA 2IH4A 3LDGA 1S8AA 2KG1A 1CRPA 5KG3A 5IU6A 1CQJA 1QHSA 2A33A 3T9FA 4Z4QA 4G56A 3L7OA 3QEMB 3BHIA 3LDUA 2WWFA 4GM4A 3E4DA 2REBA 5K0TA 1NZJA 3CEHA 2EQBA 3RUCA 2OFHX 1HBUA 2HSJA 5A0TA 2W5UA 2RU9A 3C46A 4OHPA 2QA1A 3BV8A 4AJEA 2O7NA 1JXMA 2D8AA 1FX1A 3L6BA 3JR3A 2CQ4A 3D64A 1OLUA 5AI5A 1HYEA 3IVAA 1L9XA 5DYYA 1PL7A 4UTZA 4DMLA 3E3NA 2W4MA 4F4XA 3ZE0B 1WSWA 5B1EA 4DC0A 2FEXA 3ZYZA 4L72B 3C4VA 3ZV5A 3BG5A 2QJ3A 3FOCA 5B6PA 4H7HA 4GC7A 4IJ5A 5KNCA 3LX5A 5CIWA 1YKFA 4WKRA 4L8GA 1ZETA 2NPOA 2IBMA 1AGYA 2YJ3A 3CWZA 2V6MA 1C4WA 2PA3A 4HNHA 3VVBA 3MMBB 5ETSA 1C9NA 4PHGA 4AF7A 3GLFB 4IGEA 3LBHA 3TIIA 1WD6A 2WYUA 1ZXBA 4CM1A 3MJRA 5L3VA 5FH9A 3W5SA 2IUEA 1Q74A 2WT9A 1XMQB 3IFEA 3WGOA 5B53A 1ZKDA 4EMDA 4I66A 5HKKD 1YRLA 5CU7A 4UHBA 4FZ5A 4HR7A 4LF8J 4YRQA 4RACA 3FWNA 1DKOA 4YAWA 2H17A 5LZ5A 4YJ2F 2VYQA 3FZNA 4M7PA 2MSWA 3KJQA 4BNLA 2REQA 2B4PA 1N92A 2BUBA 5LQJA 1NYTA 2FZCA 3A8TA 1TD1A 1DC6A 4UOEA 4QIVA 2J0UA 3L0SA 3VGVA 2GGPA 4ZOQI 4GHWA 4XRRA 3D8SA 3JYLA 1VSVA 4ADSG 2DNYA 3EF3A 4CT8A 4WZAE 3TPZA 3LQYA 3D9QX 1JQJC 1TL7A 3B1XA 4EMBA 1P6UA 2FJDB 1M0EA 3BWBA 2RHCA 4HGPA 3LSYA 4ENTA 4USMA 2B7BB 2VOJA 2ZBDA 2V50A 4IYRA 3ME5A 4N9QA 5IEJA 2H4FA 2RHGB 4IILA 2QN3A 1MNEA 1U0SA 2C7RA 3OFEA 3TLBA 2ZBUA 3M8QA 1NDHA 4CCSA 5K8OA 3PHBE 4L8LA 3E27A 1A82A 4ZODA 1K7SN 5IT9U 1JHZA 1GL6A 4B85A 2GHPA 1E6MA 4CP5A 2B21A 5LBIA 4XUGB 1NBEB 3CLSD 4LJLA 4E0DA 4PW0A 4XGRA 4AKGA 4JD5A 3M2UA 2O8NA 2I80A 1GCGA 1NK8A 1KH1A 1MWQA 3HBLA 1UIMA 2ONJA 5TR9A 4NL4H 2EBEA 3LCUA 2XADA 1P1KA 2B1JA 4ZQCB 1I5RA 5F7OA 3DDNA 4HATA 2IW1A 4MW0A 4MVJP 2PSEA 1TA9A 1ZCFA 3PJDA 3S40A 4GMFA 4DUZF 1G2OA 1WMBA 3EVGA 3ZDXB 4QHYA 3AF3A 2BEVB 4K8OA 1Y3KA 3SIXA 4ER0A 2XUJA 3N9IA 1Y4ZB 1SC3B 3PYMA 4ZIRA 4R0VA 2H63A 2FP4B 3CZAA 2ZP1A 1YRYE 2J9DE 2J0WA 3LQFA 3OT1B 2YHAA 3UO8B 3G85A 2D9OA 3DCNA 3MAAC 1P5RA 4A91A 4II2A 4HDOB 2MSTA 3WK7A 1CV2A 4ZCSA 2R5NA 1EUQA 3CWQA 1T1SA 4X91A 4RJ2A 3KUEA 2YPYA 7ADHA 1WEXA 3OTQA 1S2NA 4CZCA 5TVGA 3SSNA 1DOZA 5BV8A 1EX8A 4O4HB 3ZVKA 3BVPA 2W6ZA 3JAKA 1IY2A 2Q5OA 4ZT7A 4PANA 4E5NA 1HYGA 4XX0B 4DQXA 1YR7A 4NSNA 2H1SA 1W5SA 3FJOA 5B3KA 2GIRA 4LWPA 1OCEA 3TIXB 4AB1A 3SCZA 3IAAA 1EZ4A 3DMNA 4E94A 5TC4A 4P2SA 4CLHA 5LP6C 2EDAA 1GU0A 2H2WA 2R9VA 1NX6A 2R1ZA 2CK3A 4RTSA 2HRUA 3WOHA 2OFGX 1R0CA 2QL9B 3GCGA 3AFHA 2QZJA 1CC1S 2QTAA 3CJ4A 1ZISA 3ETJA 3MUVP 1DJ0A 4BFSA 1TUEA 2M9KA 3ZDAA 1YF3A 3TK1A 3MMJA 4JKYA 3MECA 2C0PA 3AVPA 4JX9A 1FY2A 4LWZA 3GOQA 2Z5VA 1ENPA 5BNTA 1A9QA 3FC9A 1HRKA 1XUOA 3CVOA 1EVYA 2Q6LA 1RKVA 3NPMA 3WOVA 3IPXA 3UPFA 4FDLA 3PCXA 4J9RA 4NA2A 2W71A 3M1IA 2FF5A 4BNJA 1GYRA 5FXMA 4DR3F 1DIHA 3PDIA 1IZYA 2Q8PA 3CCJS 1N33B 4L74A 1OZ0A 2XWSA 1HL3A 1SXGA 5A0YB 3KTFA 1HNXB 3L6RA 1Y1LA 4QQBA 1E0AA 1XR5A 4US2R 4KDCA 4F3RA 1EWKA 2CLKB 4O3SA 2N1MA 1UBUS 1JJIA 1LTHR 3BSFA 3ZVRA 1E4YA 3Q2SC 2QT9A 1P80A 2H4ZA 2VNSA 4WX2B 1X5OA 4K9KA 4F9TA 4NEGA 3TOXA 4Y2GA 1QZ3A 2ACKA 2XT9A 5FA5A 1EE2A 1Q1AA 4QUKA 4X4QA 5KG0A 1ZA2A 1BMTA 3TSWA 1RC1A 3I1YA 3PW0A 1E5LA 3TJ8A 1FP1D 3HNOA 4X4RA 4XR9A 4YRJA 1X9MA 5COQA 1CUFA 5KYXB 1YIDA 3KFLA 5K3EA 4GI5A 2YKGA 4USTA 1UKVY 2VHUA 3TWOA 5GOTA 4LRWA 1PJ7A 1J97A 1ZK1A 3DUWA 1X7HA 2R6FA 2ONZA 3S2UA 2NZJA 2VTDA 4IVRA 1KEPA 1TKTB 1N9GB 1M8GA 4K0KJ 5I3PA 4XYMA 1KVUA 1IZ9A 1Y6RA 1C1BA 4X3CA 5L3QB 1BXRB 1S76D 2MR5A 3ZGXA 3P2JA 2AG1A 4PUOB 2XGQA 4W5RA 4NXNF 3KU1A 3FGOA 3JAMA 3OTOJ 2YXBA 3LWMA 3EJWA 1Z68A 4OXXA 3CLUD 1U1IA 3H8YA 1GZHB 1XN4A 4WJZA 3FOZA 1S7CA 2NQ2C 2CUTA 2D5LA 1BH6A 1FDOA 2YNHA 1AW0A 2I5JA 4N7TA 2JI7A 4N5MA 2HF9A 4BTVA 2QJWA 1P1FA 2O1EA 3VPXA 1HWIA 3USES 1X4EA 1KEEB 3H9CA 5DQHA 5I7RA 2FZEA 1EG2A 4X63A 3DDHA 5JH7B 1KO4A 4DSTA 1IIRA 4OYRA 3LT2A 2B6HA 1MN6A 4B40A 1DCMA 1AKRA 3FFBA 3V6LA 4WZ6A 1XCGB 1B4DA 2XCRB 5FIIA 3NORA 5AKHA 2FJPA 1FESA 2F1FA 3LVBA 3ZBUA 1MJNA 2C2KB 2MZSA 2P35A 3JASA 5IM0B 4DXAA 4QIEA 1DHTA 1E1DA 1N6KA 2VG7B 5GAEU 2Q4EA 2Z6UA 3RK0A 2H00A 1Y1PA 3H5UA 5EIFA 4NAHA 5CR9A 5DV9A 2C4MA 2C82A 1A8PA 2I4OA 1KFBB 4TLLB 3HB7A 2R1VB 4CWBA 4MI6A 1XXHB 4IX1A 2OM6A 3EG9A 4F3MA 2FEAA 1IG0A 1G7CA 3IMCA 1OZHA 3SZRA 1FXLA 2Z2ZA 3TX6A 4XM0A 1HNVA 5A8KB 1TZCA 1HDZA 3MGAA 3MXHP 5EX0A 4ZP9A 5E6RA 3CDWA 5F76A 5CG2A 1G17A 3QXJA 2VXCA 3TEFA 4EFNA 5F0WA 1IEVA 4KXYA 2J9FA 4P1ZA 2E1AA 1EAYA 4GT1A 1VSQA 3Q8RB 1ECJA 4YUWA 1OTYA 3PKZA 4P84A 2YX7A 4TYYA 4EO6A 2GBGA 2IDEA 3UN2A 1TVKB 4EYHB 1Y9JA 3O8OA 1CJUB 1NNDA 4L5BA 4BGEA 1E5QA 3KTDA 5AVTA 3IJEB 4WL0A 1K89A 3ABOB 1ODSA 2VG5B 5IXSA 1RP7A 4RSHA 5ITSA 1DZ5A 1TLFA 1ZGBA 1UDRA 5HBGA 2DQ4A 2B5VA 4ENVA 3VVTA 4URQU 1O58A 3NIGB 1RRKA 4B76A 2UZAA 1PG5B 1H0HA 1TL5A 5A9RA 1XPOA 3NEPX 3D54D 1W2WB 1E8DA 2GZRA 1KYQA 1Z7WA 4U6NA 4HAYA 3I6PA 4DJAA 3B89A 1EUDB 2CQBA 3DGFC 4P73A 2JLAA 5DTQA 3OKAA 2H9AA 1QKKA 5FNZA 3N8DA 1QY7A 1Q15A 4IGFA 1GTG1 1WJ9A 3M6AA 1T0BA 5C0OE 1RAEA 4KMOA 2VYCA 2F90A 4NCIA 3A6LA 3G82A 1VBXA 2RE8A 1VQ5S 4S1VA 3R1LA 4YMTA 2Y2UA 2REXB 4EKDA 2BUAA 4URZR 3TE6A 1AC5A 1AS2A 2CBGA 3RUPA 4EJ2A 1F2GA 1FQKA 4Y18A 1U5CA 4LWQA 4JQOA 1YBHA 3NCRA 3MFIA 1ORTA 1QYXA 4M5GA 3BUSA 3BYPA 3R6LB 4K9MA 1FCJA 2XLIA 2JPDA 2J9CA 4EDHA 3L5OA 3MTKA 2IYOA 4O02B 4K46A 1HX7A 4QDKA 2FPUA 5IVIA 1MT3A 1C4XA 2GEJA 4KVAA 1A7KA 3RIYA 2FLKA 2OBFA 2O0MA 1P0QA 3IAS6 3DMRA 1N36B 1RHJB 4PYRA 1AO3A 3PRVA 3TRGA 1JDBB 2P4QA 5IKXA 2DH5A 3PRDA 3DMJA 2X41A 3I96A 1DAKA 2PGLA 4N7MA 1NZFA 1L8OA 1RUSA 3HCEA 2LEPA 1OFVA 4OVKA 4LQLA 1U11A 2YRXA 1S02A 3A1WA 4FB4A 1GQFA 3NDRA 3T9AA 3O9MA 3M5WA 3D3JA 4R51A 4DDWA 1ODIA 1R5JA 2CSXA 3Q9LA 5AVXA 2W6CX 2Q7DA 1F8FA 1W85A 1KQGA 4RZ3A 1QFSA 3WIUA 4ZARA 5L8VA 4RQUA 3TJ9A 2GDZA 4GSKA 1WSAA 3AR7A 1LKZA 1SUEA 3QLHA 3NWBA 1SU4A 1EZZA 5UKDA 2AJDA 3G2OA 3T1YF 5D6OA 1ECCA 4DXLA 1J5XA 3UHFA 2DNZA 1MC1A 4TMZA 4CH0S 3U1NA 5J2MA 3KB2A 1QIHA 1O0SA 1UKAA 1H5NA 5KINB 3MJEA 2A4MA 2X0IA 4A0QA 3AHDA 2WMDA 2V3CC 4IWXA 1IR0A 3UD4P 2O4UX 1M6WA 4F8JA 5DDOC 1WBBA 1MGPA 4ND4A 4O3PA 5HTKA 3DZJA 5EE1A 4IG3A 4MRMA 4B87A 2WT8A 5C8YB 4WFNQ 4AJPA 4QFMA 5DG8A 1KMNA 2RK6A 1R10A 4NJMB 2FA9A 2YNMA 1WX1A 4AN0A 1Z5NA 1G3IA 4D9JA 1CRWG 2JFYA 2WKSA 4BCDA 5CA0F 2YWXA 4JUBA 1JMKC 4BE9A 4ER7A 3WWDA 3F73A 2D4HA 3RNLA 5B3LA 3CTRA 3IP0A 1GVHA 5G0RB 3CNLA 5IABA 1NVTA 4OAOA 2KVIA 1FJCA 4JENA 3WWOA 4N39A 3M6FA 3SJUA 3RVRA 4CF5A 2GTHA 3FMBA 2X19A 3SXLA 4N3CA 3S2SA 3QHPA 2X1BA 5HF8A 1P8JA 1UC4B 4UQTA 5AHXA 3ZJTA 5CBPA 5IUNC 3W6OA 2R68A 4XARA 4JI2J 1ZIYA 2RRAA 4YRSA 4LMBA 3P0HA 1D09A 2C83A 1DLIA 2VPWB 4DSJA 1JHYA 4D4HA 2HA0A 2DCLA 3FTFA 2FVYA 4OP3A 1W36D 4DUYJ 3HKZD 4RWWA 3OZBA 3D3NA 1UKBA 1AQJA 3KHUA 3FCWA 5DEOA 3KQOA 3QBDA 3TQFA 4X64F 1IPFA 4KXNA 4PE5B 1YX2A 1ITZA 2Z8XA 4N01A 3OFHA 1LWCB 5KNDA 2JLRA 2XQIA 4XLZA 3U17A 4H16A 1ZIXA 2HCJB 3CBQA 1PC4A 3H4VA 3RIGA 3ICOA 1XVIA 1N2CE 4OFBA 1P1CA 3S7RA 1E0DA 2JHCA 2FMFA 4DFJA 2ZB3A 3KQTA 3DCYA 3MB5A 4WFJA 1VPEA 2P5UA 4KB5A 1LBTA 4YT2A 3QU5A 1DXYA 2FKAA 5JNTA 1NVGA 1SG9A 5AE2A 2IU4A 1PJ5A 4X90A 4ZJPA 2FB9A 5DWQA 1ZRSA 4Q1AA 1LSOA 1C9DB 4HGOA 3DVLA 3X1ZA 1TCBA 3F7NA 3QUQA 1MUUA 2ZSAA 3AG6A 4F96A 3H2JA 3L7CA 3SKXA 1N5YA 2QR3A 1RFLA 1JTEA 4TL7A 4ZDKA 1QIKA 1XNQB 2Z2XA 3IA2A 4HJXA 3TKLA 1XOIA 4Q15A 2DITA 2PSJA 1Q3HA 5B4VA 3NNCA 3AH6A 2B8QA 2AQ8A 5F8NA 2X1VA 3U4QA 3WDKA 3LD9A 3FRJA 4G84A 3ORFA 4DYDA 4TY9A 4QYXA 1W94A 1P31A 3V46A 1JU3A 1B41A 3KUXA 2ZU6A 1I4EB 3UCGA 1ESNA 3ZUGA 4ZOLB 2VO1A 1E5XA 2CQ2A 3U3XA 2EZ9A 4K7QA 5IUJC 1M8PA 4C4RA 1WOPA 4YQWA 1R4MB 3BQ0A 2A5DA 4RQBA 4MDYA 1XJ0A 2IPMA 2W8BB 4B3GA 3KKFA 2WD9A 3ABRB 4WZAA 1G66A 5MAOA 1OV6A 3OE1A 1EJ2A 3IR7A 5B7WA 2VAXA 1EFVA 3HYTA 3UV7A 5JAOA 3C1UA 3KJFA 3V8NA 3AJ8A 3ZIDA 3KTAB 5DS7A 4BY9E 4BRSA 1GP2A 4FDVA 1H3DA 2Y9MB 1HNIB 3HV0A 1XKXA 3PWKA 5AJZA 1S57A 1YJXA 3T6JA 1QSLA 2V5HG 3HVTA 4N7JA 1CETA 2UXBB 2BGMA 4MKXA 4Y1FA 2BJVA 1Y1RA 3QE9Y 3ZCSA 2OK8A 4N0DA 2AFHE 2Z58A 4M8IA 4A26A 1Y5LB 2XY4A 1QR2A 2OH2A 2XRMA 2FJBB 3LC7O 3LQ2A 3G5AA 4NF2A 3CCRS 4YMSA 3R7NA 2GN6A 3W2WB 3Q2TC 4X60A 3GLRA 3IDZA 4EMSA 1WC6A 2BZ1A 1VC5A 3R0QA 3P2MA 2ZSBA 1GGFA 4A2QA 4YXWA 1N25A 3VKUA 3LXUX 4IG4A 3MLEA 4YWHA 4BO6A 3U0BA 2ZC4A 2JVKA 3E2IA 4LYJA 1LPNA 3DOHA 2M88A 1O6FA 4BO9A 3TJAA 5IBCA 2JLEA 4I4CA 1B0ZA 1QIGA 4WK0B 2VQDA 4IH4A 3Q5EA 3A4VA 4RTLA 1KVRA 3K59A 2JVIA 2J9DA 3QJ5A 3WB9A 2C9CA 4FYHA 3RKUA 4DR2B 2CCKA 4FFBA 4E07A 1WKKA 1BE6A 2CHFA 1AQLA 4KNYA 1NOIA 2GZHA 5I6DA 1DCTA 3FK4A 4KIAA 1NH8A 3G02A 3GAFA 2Z2MA 4DX8H 4BC9A 1K27A 3SDEB 3J7YI 1U1PA 3GJZA 3EXEB 3O4GA 4NICA 3KR0A 1FDVA 4I6EA 1EBFA 2XWYA 2OO3A 4Y2HA 1WNTA 4BMPB 4Z53A 3OPYA 2WU8A 4KPCA 4MZXA 2YWCA 3DC7A 4FSXA 2BTEA 3LBAA 2NU8B 1UQTA 1RDFA 4TY8A 5E6SA 4NJEB 1HT1E 3L6CA 4MRSA 3LGSA 1NF2A 2O5RA 2RH5A 1SHUX 3BJIC 3C14A 4IQFA 4MS3B 1HZZC 1UWAA 2SECE 4BS9A 3ZGNA 4OKNA 4MV5A 1RSCA 4UM5A 3HZGA 4DQRA 2MYPA 4GR4A 5H80A 3HJGA 4MYTA 3TAPA 1YULA 3BE4A 2DB1A 3JD0A 1M1NA 3E8XA 3VNUA 3QVGB 1N33J 1NUHA 3OXLA 3MYYA 2C3UA 2CWWA 1HNXJ 2FSUA 2LLZA 1XZHA 4J0DA 4EHKA 3RGIA 1Z56C 2PX5A 3Q2IA 3N39C 3BREA 4I2QA 1S9HA 1KPIA 5F41A 2XDYA 3NQ41 3TSYA 5DK6A 2WVHA 2FJ0A 2A9PA 4IZHA 2TECE 4ZS6A 1Q11A 2X2PA 3AW9A 3KZOA 3EGWB 4DV6B 4LR8A 4GNRA 1ZS6A 3VKHA 4AJ4A 3ZTWA 5KYVA 2ORWA 3K3PA 5D5PA 2R3SA 5IC4B 3CMES 1VR6A 2RHBA 2Q45A 5M5BA 4U8HA 1GPBA 3C15C 2B2CA 3CINA 1ZPDA 4LV5B 4DMHA 1PJCA 4V1CA 2P30A 3QMWA 3LSTA 5IN4A 4G37A 1UBCA 2HPHA 1VISA 1JEJA 5KHAA 4W9RA 4EHIA 4KHRA 1RCFA 3ELHA 2W8KA 2GK4A 3ESQA 3SC6A 3HBJA 1BU8A 3SS8A 1G5FA 5EFOA 4U7UK 1F6BA 1K5DA 2IOYA 3NBPB 3GT0A 3LOPA 1CIVA 1JHOA 4DDUA 3FZ2A 4L3OA 2ZI5A 2WSFC 5ABPA 3BK2A 5E2QA 1RISA 4NOJA 2XXAB 3I2FA 1YZQA 2OUIA 3U80A 2HAIA 5F1PA 3US5A 2KJWA 4D9BA 4DLEA 4DAEA 2PQ0A 4RKUC 5C25B 2ZRJA 2LIVA 3ZY4A 3W8RA 3BGVA 2RHQB 1Q7BA 1AY0A 2CJFA 4ACAA 4CNZA 4K4VA 4Z51A 1THMA 3ADDA 1SFRA 2K1RA 4V0RA 4Z9BA 1WEYA 1AQNA 1FVXA 2TS1A 4P52A 5EWJA 5JANA 2VBXA 1HQCA 3C8ZA 1PR1A 1WU8A 1NK6A 1G8FA 1YKGA 2PJDA 2FWRA 2AMCB 2P40A 2CFSA 1G98A 1L2TA 2OECA 2FWPA 3L7DA 5I7UA 4M49A 3LPMA 3OBIA 1JDVA 3CGWA 1GIAA 1G8YA 2X5JO 3OLVA 4Z7CA 3BMXA 4CGYA 2C5LA 4MVJG 4JDUA 4G4SO 1ZH8A 2XSZA 1O95D 4GO5X 3HJNA 2JGMA 1SU8A 4OLOA 3ZTRA 3ZE2B 3A8EA 1NB2A 2HEKA 5L45A 2C2EA 3QFCA 2X3FA 3L4SO 3IEMA 5FBZA 4FWIB 1KJYA 4CCWA 3KU4A 1OX6A 1RIIA 2IOFK 4F45A 5JNUA 2CLOB 1AFIA 1P75A 4LHVA 4YUVA 4BJ6A 4GLFA 1M8KA 1J0CA 3BA6A 1E63A 4I7FB 1WNEA 3OCYA 3C5CA 4HACB 3LLUA 3JQBA 8GPBA 3LALA 1E58A 3PXAA 4DJBA 1YRWA 4DR5F 1GEGA 1E1QA 3F3SA 3QFRA 4JI3F 4PZAA 3EQZA 3V1TC 2DRAA 5GONA 4R9NA 3TRJA 1FUIA 1XAHA 2P1RA 2PYIA 2XVAA 3GJ5A 4H3KB 4V38A 1Z2PX 2EWWA 4NS4A 2FHJD 2QL5B 1VJ5A 4JYAB 2YW2A 1Q82T 4KIJA 3OJCA 4MCHA 3FWHA 4CTMA 3WLHA 3DNMA 1PJ6A 5JSZA 4KK4A 1QHEA 4ARIA 2HMYB 1D2RA 1QMPA 2IOFA 1U28A 1I4OA 3PFFA 3GDFA 3ZS9A 3E82A 4Q7EA 2AZ1A 3ZV3A 2XVYA 1RAFB 3GN2A 5I8PA 3RBXA 1AV6A 5F2NA 2O7SA 2GOYA 1F4PA 1SVSA 3OUZA 3QGIA 4Q3NA 2O9JA 1Y10A 2YNFA 3M2RB 4QOIA 1FNOA 5KTOA 1IZZA 4TXNA 2WWWA 1VQPS 1YQHA 4V19J 4K86A 2NU9B 2P11A 3ZLVA 2DT5A 2D59A 4J75A 3BF7A 3M2TA 4DU8A 2IHUA 2R8HA 3PVXA 1CWUA 1A95A 1RVDA 3I30X 3V4OA 4S0ZA 4ALJA 2W11A 1U3VA 3GUUA 3QM1A 2G77B 4CFYA 3B1KA 1JG1A 2Q6KA 1OFGA 4P4GA 1ULBA 1JLFA 1YOVB 4DLSA 4IQ8A 5HXAA 1Z2ZA 5EWFA 1CY0A 4RNNA 1NDKA 1QYWA 2GVDA 1L4KA 1Z25A 5I48A 2FNAA 3GFTA 1DQPA 1T36B 2QP9X 1N4DA 4AURA 5KTRA 1DAEA 2AD1A 3U61B 4GMKA 3DOKA 1M5OC 1HARA 3RB0A 4F8YA 4HRAA 5JCPA 3RUBL 3BRCA 1J1IA 1ZY2A 1BJRE 3IALA 4B33A 5IFMA 2JFXA 3SD7A 2W93A 6REQB 4CT0A 1CUEA 3DRSB 3ADOA 3GSDA 3IP3A 1V1RA 4GRIA 4ITVA 4E7PA 1TEVA 2C97A 2FZ5A 1X4HA 3AHJA 1YZUA 2BYCA 2XYGA 3CNHA 4K6OA 3E7DA 3DYAB 4G1QA 2Q0HA 4JVOA 1MX1A 2PRZA 4MEJA 2BACA 5TPZD 3ASYA 1XQWA 1KETA 3IAS1 3AM1A 1D1PA 2G9NA 2BFEB 3HJHA 1BVRA 1HWLA 7REQB 1A8HA 1C4CA 1QD1A 1QHHA 1NJWA 2VJLA 3AF2A 2I7XA 4HS4A 2V03A 1S3FA 1RMQA 3BQ2A 3V6KA 5IZHA 3ILYA 1DC8A 1U3GA 4M5JA 3HHEA 1K8QA 3H2GA 4CTAB 5BV2P 1U48A 3VF0B 5C4MA 5JXGA 3DKIA 1JHXA 2C2BA 3O92A 3ZHCA 5CNMA 4XQEA 5AXBA 2JNJA 2G2YA 3DI6B 1CB0A 3R7SA 1KRXA 2V8HA 3S2ZA 4QBUA 2DR8A 3EMBA 5IAJA 4YRCA 4X84A 5HMMA 2D5AA 3TM5A 4BX8A 3MGKA 3V6DB 1DG3A 3V48A 4BBJA 1T9AA 3NKFA 1RLCL 4UE3S 5KDLA 3HKEB 4ENRA 3FKBA 1C0UB 5ALGA 2AL7A 3EFBA 5CB4F 4YP6A 2O8EB 3V8PA 2O0JA 1LX6A 2Y1RI 1L3KA 4PYNA 1Z0SA 1AB5A 3EMDA 5AUNB 3OJOA 5CT6A 4GL4A 3DLLQ 3QXHA 3D4IA 3W9SA 1YC2A 2UYYA 2A1TR 1GZ4A 2Z8QA 5JZMA 2CJXA 1HEUA 2O23A 3Q40A 1O6BA 4AFFA 4XPZA 4MV8A 2ZE6A 1Y3DE 1ZK4A 4WZZA 2H54B 2HT6A 1FBTA 5FOVA 2VT3A 2GHRA 4WHMA 3EXHA 2HYIB 2HQ3A 2BTOA 2HRQA 1FQOA 2L0XA 2WJ6A 5J5AA 1G5IA 4N3BA 2JLYA 2DX7A 5FRDA 1U80A 4REQB 3PC8A 4DPOA 4KWCA 2YFHA 2A1UA 5C9ZA 1S2LA 4FMDB 1U2FA 2PBRA 3RRNA 1WDKA 5KU7A 2J3DA 1VYHA 2YRWA 5DOVA 4PXEA 1TUBB 2C2MA 1G1AA 4J1TA 2JFQA 3IUMA 5KG5A 5KIAA 3LKZA 1YI2S 3WYEA 4DLKA 3B60A 5FBWB 3O82A 1VDMA 1NQWA 1GKYA 1EGMB 1SK8A 3TGWA 3AD7C 1NV9A 3DBRB 5AJWA 4RNOA 1HQEB 4IVQA 4OEHA 4ERXA 2JIZD 4LISA 4MTLA 2BP7B 3MCSA 2R8RA 1UWBA 1I3CA 1PR0A 5KVSA 2WLTA 4DPUA 3O3CA 3DEFA 1G5QA 4FSHA 5ECDA 5KFSA 3PG9A 1S6OA 2XUPA 2JJ8A 3O8LA 1J70A 4HMQA 2XODA 4LY0A 5EI5A 4CT5A 4WKCA 2NUUG 5HKKA 3WMXA 3BH7B 4FFRA 3OX2A 4OYZA 4IDKB 1U9YA 2JAXA 3PP8A 2PO7A 4OB8A 2A6PA 4UU0A 2N42A 3AZPA 3ZE9A 2A58A 2B83A 3B1YA 1YWXA 3G87A 3EDOA 3KYBA 2O3DA 1Z88A 4TQAA 3HRHA 4KBIA 5B0AA 2AQ4A 4OHUA 1P1HA 4J9UE 1N2CA 2AG8A 4D3ZA 3ANSA 4TKTA 1WTAA 2DVIA 2XHCA 1XFAA 2H4JA 3MUNA 4M5NA 1XNQJ 4RY9A 1K8RA 5K5EA 5GADU 2XI4A 5AM5A 2XMBA 5JAZA 3QE3A 2I66A 4XLLA 1XCOA 5C81A 4PX2A 5CYMB 4FFOA 2MINB 1Z4QA 1K47A 5F8GA 1VBMA 2ZHBA 2PI4A 1D4AA 2ZJ1A 4P7VA 4CMKA 1HHQA 1JFVA 1ZNQO 3IIEA 3O38A 5AW8A 1YZ7A 1WE2A 1HNWB 1RT3A 4H6VA 5A05A 1MXHA 1Z5VA 2VTKA 2PEZA 1GAJA 2MHNA 1GPNA 1OU4A 4HTFB 2QQ0A 3B4DA 3EXCX 2DLNA 3RQSA 1JNZB 5TGZA 1AK2A 3BHMA 3OZWA 3FYHA 1YE5A 5T8KC 2HV8A 2NU6B 5G4LA 4JP8A 3PA8A 4UEJA 4IHAA 5B4TA 1H0KA 3DKPA 3CDEA 4PZPA 1W87A 2R7WA 3U02A 3ID6C 5EMNA 4JBNA 4EAAA 3KSDO 2PUGA 2GNAA 2NAFA 2Q50A 3FW1A 3G89A 4UNNA 2VH1A 3CLTC 3D0OA 2UUWA 5IPFA 2Q1XA 5KQSA 3OUUA 1K92A 4A0GA 3HC7A 1FX4A 2YX1A 2WAQD 5F0UA 1CLEA 2F64A 1RJEA 4KUEA 1AKUA 2VKZG 4DTCA 1UP6A 3CRMA 4Q7JB 2WNIA 4L5JA 2VK2A 4HF7A 1HMVB 1RZUA 2F3SA 4PZEA 1SXIA 1O6CA 4O0LA 1I24A 1FFYA 3MINB 4ED5A 5EEHA 1DPGA 4U3JB 1XAGA 3T5AA 1ESDA 4HXYA 3BBPA 4HG2A 1Z47A 3HHLC 3R5AA 2G88A 3RUIA 1VHIA 1XXLA 2AFHA 2IV2X 2PFKA 4F56A 2GK6A 2VXBA 2AJCA 2R7OA 4HDRB 1OAAA 1V5IA 4R2LA 4ZPBA 2IUFA 3AFOA 3QNMA 4C3MA 4MP8A 1B8NA 4JR0A 1RBQA 4KPEC 4U6QA 1JR2A 1GA1A 3C8HA 3IESA 3MGCA 2PGIA 2GZ1A 2IT1A 4FYDA 3AOCA 3SXJA 2FAXA 3LK7A 4OREX 5DHFA 3AR2A 4PX5A 4X95A 1LA2A 3H0KA 1R0AB 2OTCA 3SNHA 2O1XA 3TKYA 4J2HA 1SBZA 5I9BA 3SEAA 1US8A 2WOOA 3EGXA 2JH8A 4OLHA 1ZR4A 1NKTA 3QJYA 2F1RA 1RWOA 4MWGA 3TVDA 1EXNA 1L7XA 4NOLA 4D4GA 1KQFB 3D6AA 2V8GA 4I3HA 5AJTA 4M5MA 2BOVA 3ZC4A 1VBZA 2QM8A 1CULB 4YGYA 2A92A 3ELBA 5GV8A 4GWKA 4IUBS 1QKJA 3OZXA 2OZLA 2XXJA 4M8SA 1T3OA 3JS9A 5D15A 5F35A 5HROA 1TM2A 1M2FA 1O6XA 3DLEB 4JJFA 4ZHQB 4GX5A 2P9BA 4RD3A 3BGFA 4ZZIA 1BA2A 4RHTA 4UEQA 4YIKA 4BB9A 3WO1A 1JLMA 1Q8KA 3OQJA 1YRBA 4TMWA 1T05A 4UAGA 3MCMA 2HJ9A 4G5YA 3VAKA 3HP4A 3JVIA 4DA8A 1P18A 3DDCA 4EFDA 4I8DA 4IRKA 3RTVA 2RK3A 1GZDA 3JQDA 2OCDA 2HRCA 3AEKB 3W5AA 4LCEA 3K96A 4KLAA 5T14A 3T4UA 4ZTZB 2H92A 2FQQA 1Z6GA 3CRVA 4RS4A 3RRYA 2AU0A 5DNAA 4TWBA 4Q1CA 4HH1A 5DH9A 3ZE8A 4ZVTA 2DO0A 3P0JA 4AF8A 4K6KA 4NP6A 4BMVA 5TVKA 1EDZA 5BURA 4NXMJ 3A1SA 3NWEA 1S7IA 2BZSA 4J0GA 3GV5B 5HIJA 2RJOA 2EW8A 1IG3A 1NR5A 2AJTA 1EWRA 1Z29A 3W2VA 3T8YA 2ZRBA 4GZ5A 3MD0A 4ZDNA 1PW5A 5FBQB 1Q57A 2R6AA 4DEYA 4D0LB 4FMCB 3A05A 3BT7A 4DREA 3JZDA 3DONA 4L16A 1NK0A 4NE9A 3JWJA 4B3CA 2N4CA 1KP3A 1FKOA 3IOEA 5BO5A 3T61A 4ARAA 2G67A 3F49S 1S3IA 4DX5A 2A5GA 2NXJA 4Y1RB 1GFIA 3J80A 1ND6A 3MNFA 3Q6IA 3CXCR 2AT1B 1T3ZA 1DKRA 4L4RA 5EZQA 3I05A 1FU8A 4ZQGA 3BRQA 4OFWA 3VQSA 1WBJB 1Y9ZA 2VWQA 4KKOB 1H72C 5ALDA 1EVKA 4YQZA 4PO3X 1U98A 3BMNB 1WXQA 1GEHA 3PKMA 1E2KA 3BS9A 2FZVA 1DWQA 4BRWA 3MEGA 4J3FA 4Z8YA 3HDVA 3RIEA 3NRJA 1EP2B 1YT5A 1FE4A 4DVGA 1XR3A 2KBEA 4F0JA 5JFGA 4CTOA 4KO2S 4US0R 1UANA 2Q6CA 2VSYA 3C16A 5IQ6A 2PUBA 1XMXA 1UFOA 4BB0A 3UWMA 3K4HA 4EMTA 4WOBA 2ZSEA 2JC1A 5JVDA 2G0JA 1TCCA 1HE5A 2HMSA 4RM3A 1CF4A 3RB8A 3V4MA 5K51A 3MZIA 1RJFA 2QEXS 4RDHA 4JI2B 2GO8A 4XD7D 3PV8A 2IXBA 2YJGA 2XKKA 1AZSA 2ZH7A 1EFRD 4UKDA 2ZIXA 4AZWA 3FKQA 3PX0A 2ZTHA 2QO3A 5B1IA 4QYWA 4DUYB 1UBLS 2FGOA 1OFHA 5I3ZA 4R1NA 1BD6A 4IIJF 2J5RA 2XYPB 3PQEA 1T3HA 3KUDA 4XDDA 1KMHA 1AH2A 3KQLA 1USGA 1NKSA 4UJ5A 5T4EA 4RA9B 2WF7A 3VJMA 3ZWWA 1LWEA 2XIJA 3DWFA 3WGUA 3D3BJ 1Z0JA 3H2ZA 3T4PA 4DILA 1R5NA 4PVDA 2P7HA 2QAGB 3MCZA 1KOOA 2O14A 3LE8A 1RT9A 2HJHA 3MJHA 4C7KA 1LNZA 2OPQA 2GJSA 1FS6A 4JV1A 3GAAA 2QAJA 2F1OA 4WXRA 3WDOA 1J5EJ 3KQNA 3A3NA 1NF8A 3UUFA 2WY2D 3E5MA 1UJ2A 2GCGA 3ZCPA 2QM0A 2WVJA 3EAGA 3PZBA 4N1AA 4EHHA 2X76A 1BMQA 3UFXA 2FEKA 4HWRA 3BTUA 3DD5A 4FM9A 4UVHA 4E7OA 5GAHU 3CKKA 1V6CA 3BL6A 2BMWA 1Y9OA 4JYAJ 1T13A 4AIRA 4JIGA 1HNZJ 3D6HA 1JZTA 1C3LA 4MDFA 1EDEA 1YJ7A 1JQ3A 1QDUA 4YQFA 4JLUA 4OZ0A 2NU7B 1E6VA 5L4NA 3E51A 3EPIA 3CURA 3H1BA 5C52B 3DO5A 1E6UA 3STTA 3KV3O 4GO7X 2VIIA 1VBYA 4FKMA 4CDNA 3QIAA 2MY7A 4HLUA 5KYWA 5THKA 1LFDB 3OKPA 1P60A 1TGVA 3IB6A 4L57A 3V33A 1XD2B 1F12A 3SQWA 3IP7A 3D54A 4UHKA 2NQTA 2HZVA 1WG8A 1B3BA 3QVKA 4P7FA 2BISA 5JYBA 2EVZA 3ZR4B 1UJCA 2JAQA 1UPPA 2OKQA 2IIVA 4MICA 4OJ3A 1CS0A 2EWVA 3RRMA 4JLMA 1HWKA 4AG6A 1QIJA 1SCDA 4IRMA 2AR9A 5FQOA 5BSUA 3HJAA 4OH7A 3H90A 3TW8B 3LA6A 1PR3A 2LP4A 2LZ0A 3MTQA 5AI8A 5C18A 2YWEA 1BFUA 5JQWA 2OPRB 1WKVA 2VUUA 1NG9A 3I9ZA 2YHIB 3OZIA 1U7HA 3H5RA 3M70A 4Q2LA 5IAKA 1J25A 2V97A 3LVQE 4PLYA 1VLZA 2Y1FA 4MO9A 2JLZA 4EYSA 1Y5NB 1NNUA 1J07A 5SYNA 2IIHA 3G9XA 5BVGA 4KC0A 2XEXA 4F4UA 4I5GA 1C8BA 1LSUA 1Y6QA 4B3DA 3F46A 2Y8WA 1OGJA 3T4EA 3DGPB 1DKLA 4CNYA 1DRKA 3HCFA 3K8VA 1XVLA 4KQJA 3CRNA 1IBMB 5KX5F 4ZHRA 1EE1A 2B9EA 4TXLA 1S49A 3E3OA 1OSNA 3N59A 3FHOA 5JW6A 3AJDA 3B3JA 1TU0B 4BX9A 2BYTA 2F8EX 3V6MA 4WKGA 3HJFA 1DAGA 4E6PA 2HS0A 1BWPA 2ADCA 3IXLA 3QBJA 2HGNA 3I34X 2KE5A 4YRZA 4WBNA 1NW8A 2AR7A 1IWPB 4FOTA 5LIRA 1OU0A 3HA3A 5F4ZA 1ZVMA 4PAWA 4Y3CA 4WP9A 4NI2B 2HNYA 1DURA 2O5EA 2GBFA 4JS0A 2MY8A 5AXKA 2HLNA 1ZH2A 4D7AA 1UBJS 2Y1OA 3UJNA 4RSRA 4WE3A 3DOLA 1DQNA 4AU1A 1JQBA 1T94A 4V3CA 5CLFA 2ZG6A 1YRHA 1NIJA 2EBGA 3OEHD 1E92A 3GFVA 2XJ4A 5IWAF 2GPYA 3K9NA 2HFNA 1KZHA 3IUPA 4PYDA 3TI9A 3S1AB 5I3QA 5CAEB 4GQIA 3MM6A 3UWKA 2ZJYA 3KDPA 3CCZA 5CLGA 4M1TA 2WJAA 3G0DA 4L5AA 2GBIA 4DHEA 3WDLA 4Z54A 4DMZA 2A0KA 1NUTA 4HGNA 3ADBA 3ZJVA 4B9TA 1GX5A 4NKRA 4CV1A 1TK0A 2HK9A 2BEKA 2J08A 3OIWA 4G5GA 1VHLA 1XEXB 4DLPA 4K8RB 3ZZNA 1RM5A 3I9NA 4YJ3F 2SICE 3MTBA 3IWLA 4BFUA 2WONA 1BZYA 2P6PA 3H2UB 3CN9A 2KYXA 1OUMA 2IBTA 1AQIA 2XLKA 4Y9RA 2ASVA 2HBZB 4KN6A 4B2LA 1S1XB 2FR0A 3CN7A 3PX4A 1IHPA 2QSFA 1Y6JA 2QLFB 1GH8A 4B45A 2O1SA 4COOA 4HB4A 5FPPA 2WSSD 3RLFA 2ZT7A 4NBUA 5WRFA 3UMMA 1U8YA 4PLHA 3MCNA 1RKUA 2ZRLA 5ITZA 3MM5A 1P5JA 4XYLA 3FNBA 4GE3A 4J1QA 5FL7D 1Y37A 3P2IA 3W77A 3PNYA 3CF6R 4RJTA 3RYHA 2P9CA 2HRRA 5ARBA 1W8DA 1AK9A 1EX6A 2P7IA 2YNIB 3D4OA 5JWRA 1U0HB 4MKAA 4WRRA 2OD6A 2VF4X 2D6FA 3L93A 4R8KA 3UJ9A 3RBEA 4JKOA 4R3NA 3ZNUA 3L0BA 4F91B 3UGQA 1Z22A 1F06A 5FNVF 1FXUA 1QSSA 5K8LA 3NUZA 4NLWA 3DNPA 4CL3A 4X4OA 4TZ0A 2G1HA 4L15A 1V1MA 3Q10A 4C0BA 3I5AA 4MUXA 1RQ2A 1TM7E 2ZE2B 1BWQA 3ASZA 4OTZA 2F8SA 4OHWA 4TTVA 1NRKA 4Y6GB 4K81B 4JELA 1FRIA 1NEEA 2ZNYA 1RJGA 1FOEB 1WQ4A 3T7DA 2QRLA 4AJHA 4IFYB 2ALYB 1XRNA 2QVBA 1LXCA 1K7YA 2ROPA 4NARA 2PA8D 1BTOA 3ADPA 1TPZA 2BFOA 1XLTC 4KQCA 1IHOA 1ZGJA 2R6DA 3L7JA 2W2QA 2XH8A 1FSGA 5DHRA 4A6EA 1CJTA 3FVVA 3BIWA 4WXYB 3TZQA 1YUBA 1PL6A 3DRXA 1ICEA 2Y93A 3OO1A 5AHRA 5LQAA 1FW6A 3TP2A 2NIPA 1W2HA 4Y8VA 5K7SA 2YZGA 1J0XO 1V8BA 3UF0A 1Z36A 1GCIA 2P2CA 4P5PA 5HP1B 1F5AA 1KKHA 3KZMA 3U3ZA 1BDJA 2XMPA 2H4YB 3OTCA 2SHKA 2WKPA 3MPVA 2DXFA 4ER5A 4LC9A 2H65B 4DFDA 2FW8A 4BVJA 4TYWA 2BTQA 5F52A 2CPFA 4OKSA 1SL2A 3ZHOA 3FDIA 4XTTA 1HNWJ 3UVJB 4OYYA 5J59A 4P54A 2WBLC 3RI3A 1QG0A 3JYNA 1N2OA 4A82A 3DE2X 1FFXB 1M83A 1R31A 3Q3VA 1JQDA 1VJCA 1UWCA 3OVSA 1R6AA 4I50B 4I6YA 1RAGA 2PJZA 2MYNA 2G4LA 4P7GA 2C4NA 3REGA 3IS9B 3Q8YA 4Y9DA 3L95X 3URKA 1ONOA 2MQQA 3C7CB 5L40A 5J2PA 2H31A 1ZOLA 4QXPA 1NW7A 5BPFA 2B92A 2OAUA 3FDSA 1RT2B 5HF5A 3LTEA 2Q3BA 1UUFA 4BVHA 3N7TA 2GB4A 4H4KA 4DQIA 4KODA 3EVBA 2H2HA 2WE7A 2VQFF 2PWPA 4K03A 3HTXA 1Q16A 2B4YA 1E2FA 4YP0A 4Q1FA 4PZVA 2FP3A 5F3ZA 4YMGA 2VNJA 3KMSA 5JARA 1XRJA 3QUCA 3WISA 1PU2A 3X1YA 1V5FA 2G1DA 5MFPA 2C77A 3T54A 3I37X 3MYRA 3NNHA 4OSEA 3GR6A 3ZXXA 3PDJA 3MM7B 3EZXA 4RWEA 5LNK6 5L4LA 1PFQA 1PDOA 8AT1A 3ZK7A 4TN1A 1AV7A 1HFEL 3PR5B 1JG4A 4J2OA 1NPRA 5E1BA 2IOQA 4TV8A 4WGFA 4KO0B 1WXIA 4S12A 2ZBRA 3BD8A 2F5GA 3HI9A 4EHNA 2CFOA 3RBZA 1HFJA 1RT7A 5I3UB 3EE6A 3D68A 2C2GA 5A0VA 4CMGA 3MN1A 2VDLB 2PLFA 1U3WA 2DNQA 2Y1LA 4UNRA 2GJIA 3Q7TA 1SH2A 1W4ZA 3L0ZA 3IMEA 1QHYA 4NBLA 1QLHA 2ZUEA 3UT0A 3CUYA 2DIUA 4EX6A 2Z08A 1XA0A 4HQRA 3WLLA 1BO6A 3GLSA 1Q53A 4PHFA 4OJYA 1IBKF 1CEYA 3MR3A 5LA6A 1X9IA 3J7AC 5JO9A 2ZTLA 5D4PA 4USIA 4Y2SA 1E1RD 1NDCA 3SYKA 4GKJF 3O1LA 2V7TA 1U47A 1UWLA 1NBMD 2GRJA 2L9NA 3UE2A 1N34F 4OMDA 1E9FA 3AP3A 5CEJA 5JG7A 4K40A 2ZM6B 2HC9A 4ECWA 4QZVB 4MR8A 2W9CB 2CW5A 4NCJA 1ZAKA 1WF0A 1Z75A 621PA 2G9RA 2PVPA 5KAKA 4NLDA 3AJ9A 4H1HA 3BD9A 1NWCA 2NTEA 4IY1A 4HX9A 2QA5A 3HWX1 2H1HA 4NK5A 2JLQA 4FDAA 4D9MA 2QG6A 2ZH5A 2I65A 1VQOS 2AP6A 5B55A 4M86A 3HACA 3OHSX 4K3VA 3U26A 2G7MC 5F2OA 2CXQA 1U1EA 1ULHA 4QYZJ 2VLBA 5TV2A 4G5OA 3WSTA 2F3UA 2CVZA 1UAAA 2GETA 2MIIA 3G0HA 1JG2A 2XHEA 2C8KA 2DNLA 2NZ2A 4ZXFA 1LW2A 1EM8B 1M2JA 5HO4A 3KALA 3CC7S 3NXKA 1UT6A 1T1GA 2WYWA 3RJMA 5HMXA 2MKIA 1URPA 3BIJA 4LY9A 2D5IA 4JXJA 2P6MA 1OWNA 3W5ZA 3VPBA 1Z82A 4YCLA 2R1TA 3E9CA 4H08A 4PLFA 4JASB 3RIHA 4TXHA 3EIWA 4J7XA 4C4AA 5IKEA 4Z0PA 3EX7C 2HFJA 2W2QP 1K2WA 4YRLA 3V4IA 1DTWB 2VHQA 4H18A 5J2TA 2GWRA 2V7PA 4FDFA 3BGLA 1U7UA 1YITS 4N6NA 1S0MA 1NWHA 1SD2A 3TLKA 3GYXB 3MCOA 1RU2A 2GX6A 2NVUB 3VR3D 2D3O1 1RWKA 3ET4A 1P19A 4AY2A 3A4YA 2FVQA 5ALUA 2AN9A 4DQSA 3I9MA 2GCPA 4X1YB 3D3QA 1DXQA 2AGVA 3QOFA 3D3EA 3M9OB 2CXSA 2D4AA 2X1LA 2CJBA 3RT9A 1K6XA 2BSXA 5ADHA 1TVEA 4UBJA 1BGWA 3E48A 3OQPA 2XUIA 4CIDA 3IAHA 4I1TA 4XCVA 5F7ZA 4E70A 4V1Ak 1MG0A 4U7PB 1QF6A 4PKDB 1OB2A 2Y8YA 4MSUA 4JYZA 2I7DA 4G26A 5K0SA 5DGAA 2XWBF 4MGEA 3EDMA 3JQAB 1YE3A 3P9XA 3IG1A 1NRJB 1KHTA 2HBYA 1PK8A 2BJHA 2R44A 3TUPA 2Q4RA 3Q86A 1NDPA 1P2UA 3U9TA 1SQ5A 4K4WA 4ITUA 3IIMA 1VQ8S 3GLKA 2IVFA 4BQQA 2HWUA 2IH5A 2CDBA 5DNUA 2VDQB 4N5LA 4Q47A 1E3EA 3OG9A 3OZVA 2ATCB 1IJEA 1GTSA 1O95A 1YZTA 1YL7A 1GT6A 4LXTA 1NAQA 1N77A 2EFNA 4MH8A 1TM1E 1QBGA 3UIEA 1X7WA 2PUCA 1I1HA 2LKZA 4PRLA 4UU8A 4I2VA 3F9RA 2CJAA 5KMGA 3RSFA 3LUKA 2ID9A 2FR1A 3BF4A 1M1KT 2QVYX 1F0NA 2BDUA 4HNGA 4IMIB 4PWDB 4D0GA 4P0QB 1AGRA 4B6QA 4NQZA 4Y0VA 2R62A 1FP2A 2O06A 4R8VA 1ZBDA 5HQ3B 5KVCA 4FQ7A 2WD8A 2P90A 2POCA 2HQSA 3KO8A 3ANYB 1YDLA 4BEJA 5KYYB 4NRTA 1JAIA 2AGOA 4BBYA 1Z0UA 1T2UA 2O2HA 4FYXA 5I9SA 6YASA 5JCOA 3OFJA 2ID4A 1NZDA 4NHEA 4TUYF 4DR6B 4TYPA 2CNNB 2QNRA 4BLRA 4ZYUA 5KPDA 1JQLB 1T0PA 1Y81A 1F6WA 3RAJA 4DW8A 1OIVA 1X0FA 2FHJA 4RPIA 4A8SA 4IKEA 3BWVA 1H23A 1H38A 2WSYB 5AE3A 1KNZA 4U2CA 3J81U 5I9IA 1JLBA 3TZEA 3HFVA 4TTIA 4DF8A 1CUCA 4RD2A 4IIYA 1U9IC 4IH1A 3KK3A 1OLXA 1X7VA 4HH3C 3KXKA 1SRQA 5ITWA 1M6VB 1OBHA 3THXA 5CXUA 4IEFB 4JUCA 2DR9A 3BDIA 4KX5A 1U99A 2V9CA 1RT1A 3UK7A 2JHPA 1QO0D 5H83A 3H17A 3WKBA 1N9KA 1QAYA 3B7GA 2EL7A 2OHGA 3AESB 5A6WA 1T3LA 6NULA 3EZ2A 3SDZA 4YEAA 2NUAA 1F8UA 3L3CA 1RABA 4A1FA 4L75A 4LOJA 3GEMA 1RBLA 3HLYA 3THWA 3FRIA 3G23A 1Q22A 1RTIA 3M9MB 3MLBA 2HHTA 3UGKA 3WLKX 4RC9A 2VJOA 1P2VA 1JDUA 4QWEA 3CUWA 4FPRA 1TJ5A 4M76B 3D31A 1NLMA 5IZCA 1YIAA 2BEJA 2DKOB 2E44A 3L2OB 4B75A 2YN4A 4YASA 2CB9A 3VGJA 1Z37A 1NV8A 1FXDA 5CLIA 3WLJA 4PG6A 3BQNB 1KNQA 3KDOA 3KFVA 4K6GA 2IRUA 1KZYC 2OV2A 5U1PA 5JS8A 1C7ZA 4EY3A 2QMUB 4LHYA 4TS3A 3JW8A 4BVAA 4KV8B 4Q3OA 3W1VA 1BGXT 5K8NA 4DOZA 2QD5A 2VWGA 4P7JA 3W3AH 2Y71A 1A7UA 4DCJA 5U47A 2G04A 5HR5A 4OXQA 3FTQA 3K6JA 1M2EA 1CJMA 2J5KA 3T34A 2HDWA 4QYIB 1Z5WA 3RH0A 1H1DA 5IT5A 4FGWA 2RGXA 5JY6A 1IBMJ 1TJ4A 3K8YA 5DVZA 1U7XA 3IMGA 3PO5A 3MPUB 4U2EA 5TPZA 3LIIA 3DFEA 3BKFA 3IUYA 1HR0F 5FO0A 1MJGA 2BEUA 1L5NA 3ROKA 3ZLTA 2J45A 3I3SR 2NO1A 1PJBA 3X1KA 3E3LA 1AOXA 5THXA 3G6ES 3LM8A 4R05A 1YO6A 1LLFA 3DUFA 2G40A 3IAS9 3O73A 3A10A 4ES2A 1XFDA 1G5RA 3KQUA 2FDRA 4MUFA 1B0VA 3KQHA 1GUYA 3O47A 2GR9A 2RGEA 2YH2A 4X65J 4O23A 2X1FA 1GYQA 2ZC3A 2KDOA 3RRXA 1C41A 1Y98A 3JVVA 4BXOA 1UJMA 2O8VA 2I4LA 3AI1A 4ZD6A 4G0OA 4J4TA 4IKOA 1E94E 5BN5A 1Q0PA 3BFXA 1KTVA 2JEOA 2V4QA 1U6KA 3K0HA 3A0RB 3AY7A 1RBYA 1Q7TA 1YR1A 5K01A 2HK7A 2XB9A 1IVYA 4L8WB 2DXEA 4W7IA 3RS8A 3ZS8A 3C87A 2EG9A 3ZTOA 2QORA 1EQUA 3NGXA 3IX7A 3AHHA 1KYZA 4NVRA 3PXGA 2GYUA 3CEMA 4HWGA 1SHLA 2I03A 4J9VA 4B31A 2E55A 4GI1A 3TDMA 4CM9D 1Z6QA 2GJKA 5I8ZA 3E9YA 3TTUA 5E95A 2CJWB 5JXHA 2J7PD 2B9XA 4DQ0A 3QEKA 2XNJA 1YH3A 1X74A 3Q2OA 4EF4A 1M1UA 5AMXA 2ETXA 3LW7A 2KZZA 1SGWA 1J2VA 1EH5A 4JI7F 1ZMTA 3FTCA 1HTTA 4RA6A 5BNWA 1ECPA 1DQ9A 3FNFA 2QK4A 2E7VA 2MZRA 4NXMB 3IKLA 3HO6A 4CUKA 3EIQA 1IKXA 1YFJA 2EFOA 1WTCA 4JLAA 2NUTA 3WNQA 2JIZA 2H2AA 1YQGA 5CCXA 3K9QO 3RFXA 2GESA 4DZTA 4WK1A 1C4AA 3H9GA 1SCQA 1E4VA 3ETGA 4ESHA 5T6MA 2VJPA 1UQUA 2RHMA 3EGZA 4ZPCA 1II8B 1ZCAA 4URSA 1K4MA 2NO5A 1FJHA 2GBLC 3PO4A 2AZ3A 3V1KA 4GC5A 2B0GA 1N3YA 4NNJA 1H93A 2XMCA 1XMOB 5ALMA 4D4IA 4Y0NA 1U7WA 3VYUB 4MLCA 3JALB 1RWPB 1RTDA 3JQJA 2UUOA 3UXYA 1T9VA 3OL9A 1M2VA 1SBQA 4YN3A 1U9JA 4XWWA 2K7ZA 3B6MA 4RUCA 3TN7A 2QTGA 5JRJA 4MV0A 4ND8A 5BMVB 2Q5CA 4INAA 4MV4A 3LO3A 2AFRA 3ZWYA 2RKIB 2FG7C 4Z8XA 2EBFX 1FJ2A 4M6WA 4FT4A 2PCJA 2VD3A 3GGSA 3S0JA 1J8DA 4JC5A 2ZHAA 1IJFA 3E5NA 2JKYA 2FFBA 3FPSA 1VL2A 3P9QA 3FAZA 4AZSA 4RNCA 3BO4A 4X6UA 5JE8A 4MJ7A 3ZZTA 1RKIA 4I6JA 4AX4A 3O1JC 4FINA 3R9XB 1RT5A 3LWNA 1V9SA 4ED7A 1FE8A 9ABPA 1DARA 2XQVA 4YNBA 1V26A 4CT4B 2OY0A 3NP9A 3FHTA 5FFMA 1EJ0A 2C00A 1KBZA 2UYQA 3O83A 4DCVA 2W37A 5EHHA 4P36A 5FJJA 3RAMA 1GTJ1 4GPD1 4DIBA 1ZIPA 4MHOA 1F9HA 1H2UX 3QQ5A 1JFSA 1M3SA 4M1ZA 3UN3A 1T0UA 1XV5A 1SXJB 3QW2A 4KHPF 2CVOA 2ZJ0A 3MT7A 4DY6A 4IDHA 1U8CB 1E9RA 2JZCA 1NOJA 2X86A 3HZHA 1J8QA 3AA8A 4KH1B 3VO2A 4ECZA 1WDDA 2PRIA 1RYYA 4P3PA 1BYIA 3OQIB 1GARA 4PY2A 1PQWA 3EGNA 4FR2A 3M8ZA 3DMHA 4W98A 1RAOA 3FFTA 2KPOA 5FD1A 4LOKA 5FCDA 4KI7A 1J5EB 2PZAA 2QRQA 3LQVA 4HDSB 1R1DA 2PWZA 4PYOA 1S2DA 2M52A 2XKJE 1O6ZA 4NYIQ 2OM2A 3NKLA 5IYZA 4R81A 3ET5A 2WU4A 1T0JB 4H2DA 3AB2B 4IXDA 4B4DA 5IM5A 2WUEA 3E61A 3C2PA 2B99A 3ETHA 4XDZA 1SULA 2FEOA 4DT1A 2QMEA 3V2UA 4OGGA 2B3DA 3KWFA 2G1AA 4O4IB 3NHYA 1N6NA 4P3NA 2DQZA 1HNZB 2R3VA 4RMGA 2E49A 4DSOA 4RTRA 3TLMA 4DSAA 1TQHA 4J43A 3OZRA 2G70A 3FBFA 3EGOA 2YV5A 4MHSA 3PFBA 5KSPA 3PEJA 1UFVA 2Q3JA 5ADWA 3E8MA 2HHWA 3EUEA 2DWUA 4QUBA 4ATNA 2CNBA 2ZOSA 4L07A 2JFFA 3FYTA 1NBME 4D8UA 2QKYA 1EHWA 5IT9A 3HVRA 3GVXA 3MBIA 4MWTA 4RL1A 3OZ7A 4CM4A 4Q9DA 3WBKA 3CC2S 4IBOA 5ADVA 3ILHA 5A7HA 2CIMA 2XCOA 2RH9B 4WUTA 5EUQB 4JXXA 4ES1A 1L4HA 3T1VA 2GM5A 1K3FA 2BFPA 5KOXA 1PJLA 3GJRB 2KT2A 4PZDA 4RMNA 3MERA 4MARA 4ILMA 3KXIA 3JSXA 4PX9A 4C22A 2LXFA 2JS7A 2JIMA 3NFRA 1NU6A 2OPPA 1U9ZA 3B82A 1T02A 4BMDA 1FFWB 3T5KA 3K16A 3ZWXA 3JX9A 3JD4A 4GICA 3HY6A 4PZUA 4AY4A 4TL8A 4JSYA 3T5LA 3N2ZB 5FTKA 2EKPA 2FIUA 4CE6A 2ZM6J 3I0RA 2C0QA 2MLYA 3QOXA 3L43A 2DUWA 4UHFA 1TQ4A 3ELWA 1MU2A 5GMDA 2R4UA 3EH2A 2F4VJ 3A9SA 1IUOA 3TJRA 4KAAA 2FFRA 2ZCVA 1UXOA 3DQZA 4IIEA 4F6RA 1DTQB 1KO1A 1QH0A 4B8YA 1FSZA 1P2BA 5TQJA 2XV1A 3TQRA 2JB9A 1NMEB 3DBOB 4Z99A 3FNNA 4WV3A 4ZPDA 5L1KA 3UC9A 1A4IA 2XUQA 2YIJA 5H68A 2H5JB 3EZ5A 4KT0C 1RYDA 4U0JA 4RQTA 4OA8A 1YA4A 1R6TA 4EJFA 1RZMA 2A5JA 3D6JA 4FYPA 3BXFA 3HN6A 3KJVB 2RFLA 2WKRA 5ICCA 2RHWA 2BR3A 4LFCF 1XJ5A 1VLOA 1JWLA 2II6A 3PVCA 1KRHA 1N1GA 2BMDA 3KEMA 4WK6A 2G4BA 2BW2A 3EUWA 4EI7A 1NI4B 4C01A 3Q85A 2FPSA 2BM0A 1CZRA 2O2XA 3SXUA 3MZ0A 3EULA 1W9HA 4RBNA 5DPMA 2VZEA 4FQ5A 3WQPA 2OWEA 1O8CA 2QXYA 2O8CB 5B5SA 1XDZA 2FE4A 4OAPA 2WVAA 1WCYA 2DAPA 3HZZA 3RUEA 4FVMA 3CE8A 2YV1A 1R0WA 1AUPA 2ERRA 2RB7A 3IR5A 4OK3A 2DFVA 1YI0A 3HMKA 3KBBA 2HXSA 4JBCA 9GPBA 4CHTA 1E2MA 2QTRA 4DVJA 3OTWA 5LLDA 2P9JA 2JFOA 4XRGA 5E5NA 3I9V6 5BUQA 2XCTB 5JAHA 2JJ4D 3VGPA 4BCAA 2IJRA 1VQ7S 2ZR9A 1Y0BA 3GU3A 4BQIA 4RW8B 4Q4JA 5KYTA 4P2FA 2C7QA 5AO9A 2HHAA 2FTKE 3RVOA 3H97A 4NENA 3U3DA 5GVQA 4HWOA 3WC2A 2HW8A 3RE1A 4I5DA 3E7XA 1WIWA 3NV7A 1PUJA 3PJEA 1J8YF 2GXUA 3K1AB 1U4OA 3OWXA 2Y1GA 5ALKA 5DG7A 1SKUA 1DB3A 1FRHA 2YJZA 2D2FA 1P72A 3NNAA 3R3VA 1V4NA 1N48A 4XD7A 2HHHF 4N3GA 5HFJA 2HTFA 1EFRA 3V5NA 2QX9A 2B1IA 2YFKA 1WWKA 1XZBA 3GLGE 3CVKA 2X6QA 3BIXA 1WQ1R 6ABPA 1RWUA 4HZUA 3QGMA 2XZDB 3RS7A 3NGKA 4R2MA 1L5SA 3CMCO 4LY6A 5FFFA 1F60A 1P7ZA 4TMXA 2VHCA 2W9BA 2WTXA 1SKSA 2R79A 2IM3A 3U4CA 1MROA 5GADl 4NONA 1S6YA 4M36A 1GGHA 4BC1A 3PTLA 5EIXA 1U1FA 3ROFA 1G59A 5CCLA 2HIAA 4D02A 4IGKA 4EG0A 3KFXA 2YC4C 4RCYA 2ZH8A 4B3BA 1OY8A 1J0AA 4MVJM 2JIOA 3QIVA 3OESA 4MW2A 3HSDA 4NBKA 1WSBA 5BYQA 3FVQA 4H4OA 3EEFA 1OBFO 4WD3A 1DVRA 3FFIB 3HVAA 1T3TA 4GVXA 4H7EA 1UBNA 1M8JA 3REQA 1Z4IA 1Z45A 4RPHA 1P29A 4IDDA 4DR6J 1X2BA 4R25A 2AI3A 2ID8A 2CJPA 1QV9A 4FXDA 2Q6VA 4RW7B 3QLTA 1MHPA 4C87A 4EPVA 2RILA 4M9ZA 2GUGA 1E1KA 2QTBA 4XEHA 3V1UA 5IDXA 3N6MA 3GPCA 2C95A 4Y9SA 1I2ZA 4YAKA 4XA8A 5AVOA 4Y1EA 2GS9A 3GGGA 1ZL2A 2Y2VA 5B58T 1VYTA 3N2GA 5GPBA 2PKQO 1EESA 4I6GA 4ER6A 2WLSA 4YPVA 1MPTA 2OTLS 4A5OA 1Y6FA 4P4SA 3L5KA 5IVHA 1P7WA 4GNKA 5L7WA 3W5HA 1R8YA 5DM60 2WVCA 2WVBA 4NDNE 3PIOQ 3CF5Q 1NR1A 1WW8A 1CLUA 1SKBA 3KAPA 4A2CA 2IGBA 2D5BA 1SZDA 1RQLA 2QBYA 5KT7A 1OTHA 2HJVA 3C6UB 3VA7A 1ZNWA 1R64A 4C21A 4IJUA 1LQ9A 8MHTA 2CXOA 4ZPAA 5AJYA 1M34E 4EFKA 1KGSA 2ZE5A 3WQHA 2XSJB 1N54B 1XCLA 4IDNA 1E2JA 3IC1A 1H2FA 3FQLA 5A8WB 1OA0A 3AFGA 3ZDDA 2GZAA 2XWPA 2MSNA 3LLSA 2CXNA 4BQFA 3UKOA 5LJIA 4TKUA 1ILEA 1YZ3A 1T6XA 4OX9Y 3W6ZA 1IY1A 3MEQA 1TFWA 3SHQA 3NGSA 3LL4A 5EINA 1H9AA 2ZUTA 1PNOA 1DRWA 4HH4A 2VRCD 3EDRA 5TARA 2NSLA 3I42A 1I2BA 1WCWA 5BNIA 1K3TA 4GPBA 3LCMA 1S4EA 5AW1A 1GKUB 1VPLA 2WM9B 2FPRA 4A8QA 2QV7A 4WA8A 5D78A 4ROTA 4PRFA 3E58A 4B80A 5J2QB 2GMWA 3VBCA 3CPJB 5KHOC 1TL7C 1XKQA 3D81A 2MQLA 1HH4A 1A9TA 2YXEA 3H9UA 3CXUA 2JVOA 2HO4A 2G2OA 3DW1X 4RU9A 2PD6A 3AR4A 2O8FA 3DULA 2DXDA 3W8FA 5E8JA 3MBOA 1WP9A 5DLPA 2QE5A 1QRSA 1E98A 3ZDRA 3N3AC 4QU8A 3QBEA 5EKDA 1F2UA 4N8EA 1YR9A 1AS0A 5KTMA 3PUXA 2OZPA 3R9LA 2XTZA 2GMJA 3LXMA 2J4DA 2CZGA 2GEFA 4KLCA 5K8CA 2G06A 3OEHA 2H1RA 3ZVMA 2HPZA 1D1TA 4UD6A 2YHUA 3DCAA 1OZAA 3KG1A 1PJZA 2WI8A 3CNBA 3Q3IA 2ZROA 1TTHA 1GQYA 3KZXA 2ZI6A 2P5VA 2F1IA 2FHSA 4CF6A 1CP3A 5TB5A 1PR2A 4U39A 1JJAA 1YJBA 2OL4A 3D5EA 1VB3A 4CMEC 1SG0A 5AD1A 1RBOB 1DKPA 5BN1A 3RF7A 4KGDA 3WGYA 3BGSA 1ESCA 4PSVA 3PNQA 1U1LA 5J4KA 5EE9A 5I4MA 1QPBA 5L3SA 2V6GA 1I3OA 5HAOA 3LGAA 2WZ1A 1YIJS 2R2AA 5BR4A 5H9WA 2WSSA 1T9WA 1Y5IA 4MJKA 4NH0A 2BSAA 3K8ZA 4UD2A 4A92A 3NONA 1D8ZA 4KPFC 3TVTA 3GFYA 3E9NA 1VZ3A 5K45A 2VAPA 2BGJA 4XUEA 5C24A 1ORHA 1SC4A 3MK31 5FEMA 3PQ5A 3RV4A 3VDRA 5FL7A 3QT5A 2A59A 4EL5A 4AKHA 3N01A 5C35A 1FRQA 4MRVA 2OENG 3AUUA 4RVCA 2BE2B 1DIGA 3MMCA 3CQ9A 1K75A 1DT5A 1QE3A 3S1TA 2W2VA 1EXVA 9LDTA 3ZJ5A 4U9RA 5HS6A 3NHPA 5CDTA 3FNHA 1AROP 3QXCA 4BEWA 1WD5A 1U09A 1A2OA 5IM4A 5A03A 2CLHB 2GZ3A 4E22A 5F8HA 2PSSA 1Z35A 1XTTA 4DG5A 2PN6A 3B38A 3GWCA 2I22A 3CVVA 5B0FA 1LQTA 2AEMA 1M6EX 4UDNA 3UPTA 5D8HB 3KK2A 3VAFA 1VQ1A 2IYEA 4K2JA 5DM70 1E9BA 3WHPA 4RGBA 2XC9A 3Q0EA 1KDPA 4PG7A 2C20A 3SR3A 3HX9A 1RP5A 1H1LB 3EE3A 4M9SA 3EF0A 4G63A 3OCJA 3BR8A 3AEQA 3ZDYB 4URGA 4C2AA 1IMJA 1UVIA 3KLEA 1Q0UA 1XMOJ 2ZIAA 1J49A 3CVXA 4X44A 2JHEA 4ZTUB 3ZOKA 3ONQA 4PYQA 4ZANA 2AXPA 4JV0A 3D0RA 5F5NA 3PJ9A 1U2RA 3PWSA 3ZH9B 1XKLA 1E6LA 3F4LA 1YJQA 3NIWA 2G0IA 3DRPA 4U2FA 1RHKB 4ZI7A 1TUGA 4HCJA 1VPWA 5CK5A 1IBCB 4CG1A 2FJWA 1Q0RA 4GO1A 4EY7A 1V8FA 3C85A 5HCUA 4IGAA 5AJUA 2RHLA 3FCHA 1J23A 1G2IA 3Q8SB 4RD4A 1Z4LA 1SUCA 3PXDA 3ET6A 4MW4A 1GAQA 3W2EA 2NV6A 4OHOA 2GEKA 3VHXB 3ELDA 1M74A 1K3UB 2LV8A 3BYRA 2V4JB 3THPA 3CLHA 2HRDA 4NFSA 1RS0A 1C0IA 2R8XA 3WYGA 2ZREA 4WY2A 4C4WA 5E4FA 3W4KA 4YV0A 2Q99A 4K4UA 2ZH1A 1S2GA 2H51A 2G5CA 1F2TB 2MOKA 1OGIA 2UXCF 2VN8A 1FP4B 2QWXA 3UV3A 2DUJA 4DNXA 4L6V3 3B5JA 5K8PA 1YB1A 3O31A 1Z7GA 3GA0A 4XDCA 1CQIB 1JP7A 2ATVA 3UZUA 4MAAA 3L7BA 1KSPA 4C4PA 1U2EA 1HQUB 4QXAA 1J8MF 2XCLA 3FPAA 3ZY5A 2ENWA 2VDWA 3CD7A 4ERDA 1BROA 1M2GA 1IY9A 2P1ZA 3AQ4A 1RJ9B 2I91A 2OK7A 3CMAS 5LYJA 5C31A 3RGWS 5JEEA 1K8YB 1N6OA 4LVOA 3FPKA 2FYXA 3OFGA 4J9MA 1ZBQA 4F0HA 5KFDA 2OP1A 3STYA 5BWCA 1UZDA 1Z39A 5CT5A 2Z04A 1RRVA 1PSZA 4Z9XA 4AS3A 5A76A 3I72A 3AONB 1T9DA 2WAXA 5JLJA 5D4OA 3A6FA 3BD7A 3OIFA 1GUAA 3QSYB 1ZW1A 4QX6A 5DBGA 2BW7A 3GFOA 4P82A 2M7SA 4NMXA 3U1MA 3U31A 4Z1MD 5C8XA 3DBLB 3GFGA 1WP4A 1RWWB 1NUUA 3W90A 4MQMA 2VCYA 1VRUB 4QQKA 2IC3B 5HVNA 4EU0A 1S9GB 2H2FA 2Y0DA 3GUHA 3ED5A 3GX1A 2GUWA 3O4VA 3H42A 4INPA 4CEJA 1I5OB 1HHSA 4XPCA 5DRTA 2XEDA 2QLLA 4F12A 1QANA 3VZSA 3F6CA 2DBBA 1TZ2A 5IMSA 1NUSA 5IVKA 1VQSA 1W76A 2MSDB 4C4TA 1VPDA 2GW8A 5KFWA 3F44A 1M8FA 5B64A 2I2XB 4EW3A 4HP8A 1HEYA 3UAWA 5F73A 2V6BA 1OTXA 2QLBB 4YR3A 4QQNA 1Z2OX 4M5HA 2GSDA 3IKJA 4QO8A 2IA6A 5AVWA 1BN7A 3L0YA 1B70B 3K20A 1N7HA 4BLSA 5LP1A 3KZ1E 2QD3A 2YC2C 1E1RA 2IGTA 4FF3A 1I51A 1KF0A 5L6LB 1HLFA 2FVRA 1JT2A 2VPXA 2QQFA 1NBMA 4PSCA 5FR1A 3KK1B 3OZGA 4MVJF 1P0CA 4NASA 1WUYA 2KH9A 3U27A 1PF7E 2YTCA 2FMTA 1VL5A 2OO7A 4YMIA 3ZDZB 5CLLA 1K6MA 4MQEB 1CTQA 3M34A 2DHHA 3HM9A 3Q7RA 2H2IA 3VISA 2IH2A 3VX3A 3W2HA 1CUAA 1TW2A 2QE7D 5JOQA 4BUJA 4FIZA 1FEHA 3MFQA 1PCXA 3I01M 1U8AA 3CVWA 1V7CA 2YPZA 4WCFB 3K9CA 3RSQA 2F3PA 1IZ8A 3RANA 5IS2A 1YJVA 4LS3A 2IYNA 1A0OA 3ZNOA 5EJFA 4CF4A 4CDGA 3QFHA 5I42A 3RC3A 1X42A 1RT4B 1X94A 4D5GA 4Q24A 3F7OA 4BLOA 2ILZA 1WDLA 3FH0A 2Q9BA 2W4IA 1IJKA 2PMWB 4LNUA 2WK1A 3E53A 2RF2A 3BR9A 4W5JA 3IAEA 3GIJA 2X0RA 1DC4A 4A8FA 4MLDA 3CVUA 1PGPA 3JWIA 5DCWA 2GAHC 1M7GA 2P2SA 2PUTA 3ROMA 2HTEA 5CVTA 5CXSA 2EEYA 5F8JA 3V7FA 2HBQB 1PG2A 3EA4A 3IGNA 3QVMA 1VI5A 3ZHBA 5I4IA 1PVVA 3EYWA 2Y0BB 3KPVA 2VHEA 4IH5A 2YQ0A 2BE9A 1JHPA 3VR3A 3BICA 3TQTA 1CUWA 3GUCA 1KSHA 1LW6E 4MJLA 2IUUA 1YGYA 4MCAA 1KVIA 3VZDA 1IOVA 5JCZA 4PQUB 1DEHA 2ZD1A 5I8WA 4X65B 1NI5A 3QE2A 1QGED 4P22A 2DNPA 2CNKB 4OFZA 1GPWB 2Z9BA 1FRZA 1XTJA 2LYVA 3GCWA 3VDXA 3WGIA 1WHSB 1P0MA 3IWNC 1SC1A 1R89A 2CFCA 2Q3DA 3AVQA 4DJEC 2V68A 3WP0A 1NQUA 1YKSA 4PZ0A 1WULS 1DLOA 1USUA 1T8TA 5EPOA 2VI5A 1NK9A 1ANKA 1W4BA 3KOXA 4D3FA 5HW0A 4CO0A 3N0RA 2VTBB 2FRVA 4B43A 2XGJA 4QARA 2BELA 4DRZA 3EQ2A 3VYSB 4LNHA 1XK6A 1VRVA 2QG9B 2NW6A 4P83A 2XF8A 1VC0A 3I9V1 2DSTA 2PR2A 4BNVA 3R40A 4KE5A 4ZTBA 3TAMB 3SLRA 3IQWA 3MM9B 3ZKWB 1R8JA 5FWXB 1WUHS 3K6KA 1LK5A 3FR8A 1X80A 3GEPA 3WB2A 5ETRA 4W5HA 4Q01A 2XMGA 4ECRA 3NBQA 3UK2A 4C4XA 3FEYB 8RUCA 3PX3A 2F48A 4ZC8A 4BWGA 1X77A 3HDQA 3U7EB 1XWIA 2Q4DA 1JALA 1JAXA 1S1WB 4BKMA 5JZBA 5KFBA 1MMFB 5KJCA 4HHUA 4MV3A 4OGKA 3PBKA 4AVYA 4LVOP 1NB7A 3SE7A 1LLQA 4BKPA 3RHZA 2AJ2A 3KVNA 1B8PA 4D92A 4I2PB 2VJNA 1T3NA 4J9OA 4Q03A 1QE1B 5CYQA 5KTYA 3AIOA 3ILIA 4OLBA 4O4LB 4J3JA 4YONB 3VYRB 1BE1A 4TWZA 2GIFA 2E4AA 1VHDA 4KQWA 4Y2QA 3COJA 4B02A 1T4CB 2QYGA 2Z2YB 2Q4OA 4FCCA 3WV4A 4ETXA 1F2HA 1PX0A 5JAIA 1HKUA 3HUFA 3CJKB 4M0KA 3QU2A 5L9AA