3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
5JJBA 2NYIA 5HJ5A 2QMWA 4X84A 2RQMA 3K5PA 2DTJA 2P9GA 1FSFA 1UJ6A 3TUIC 3U7JA 5IS2A 4GO1A 2PA3A 3OFEA 4L50A 2P9EA 3AB4B 1VL1A 3ICOA 2J0WA 1SC6A 3ENVA 1M0SA 5IT4A 4R7TA 2LVWA 4L5JA 2LQJA 1HOTA 3KV1A 5T41A 1U8SA 3LHIA 4TM8A 1FS6A 2P9CA 1JT9A 3OFGA 4L51A 2RI0A 3BXHA 2GNPA 2QMXA 2ZHOA 2KO1A 2CDQA 2OKGA 3NWPA 5IT0A 4IO1A 2F1FA 1NE7A 3E7FA 1PBTA 2F8MA 3S1TA 1LKZA 3HHEA 2H9ZA 4L4ZA 2I9SA 3IBWA 3NZEA 3LWDA 3BXFA 3TUZC 3BXEA 3UW1A 2J0EA 2FGCA 2RE1A 1UJ4A 4OQPA 3DHWC 3P96A 3CH7A 3NRBA 3MWBA 3LUYA 4LUBA 2JHEA 2QRRA 2RI1A 4OQQA 3DC2A 2RQKA 1ZPVA 3W7BA 1UJ5A 2DT9A 1LK5A 1DEAA 2BKXA 3EB9A 2BKVA 3ENQA 4TM7A 4M8LA 3E15A 4R9NA 3LOUA 2R5FA 1Y89A 3TX2A 3IXQA 3HN6A 4GMKA 3OC6A 3DHXA 3MTJA 3L7OA 1PSDA 1FS5A 3AB2B 4GO7X 3OFFA 3OFHA 2J0XA 1HORA 3EFBA 3CEDA 1O8BA 2PC6A 3ENWA 3OBIA 3KWMA 3O1LA 3CSSA 1LK7A 3DDNA 1YGYA 3MAHA 2W48A 3BXGA 1CD5A 1XTZA 1KS2A 4NMLA 4PWUA 3AAWB 2JOQA 1YBAA 5FIIA 3N0VA 2WU1A 4L5IA 3TUJC 4L4YA 1RWUA 2MDAA 1Y7PA 1FQOA 1FRZA 2O0MA 2QSWA 4GO5X
chains in the Genus database with same CATH superfamily
1EVYA 3B5IA 1OHHA 3IBTA 1LCIA 4JN6B 2J0WA 4C7JA 2Q5CA 2PGJA 3WGZA 2HFOA 3IQXA 3P2IA 2GFHA 2OAUA 2G1DA 3JSYA 1LPNA 3OTDA 2XG8A 1VHWA 1DEOA 2UYYA 4IUFA 2HHWA 4IQ8A 1EFRA 5JT1A 1AA9A 2FY1A 3GRVA 3A9TA 4RLQA 3K72B 6PFKA 4GVPA 3W8DA 4IX9A 4LZNA 1BAPA 4HNHA 3RVMA 1UJ4A 4KXNA 4ZOBA 2AT1A 1SXJA 3ZD7A 4CEJA 4UTPA 5L6MB 1YKGA 2VZ0A 2Q1TA 2I8AA 3W4JA 1D0IA 1KQOA 4K5QA 2E1RA 3R5KA 4NYOA 2ACWA 5FLXA 2DKOB 3GP5A 5B2FA 2OPRA 1RZMA 4WK2B 1PGPA 2IM2A 4AZ3A 1I6JA 3V4IA 4A0SA 3QU4A 4LV5B 2OFHX 1N5IA 2XV1A 4IHQA 4OAPA 2YH2A 3EZXA 4FYWB 4W5RA 1TAGA 3A1YG 1CUWA 3CB2A 4LF6F 3M9OB 2B34A 1KO5A 1Q6YA 2QRVA 3IAUA 3H0PA 1Q1GA 5IH3A 1GKKA 3AF1A 2P2SA 2FTKE 4Z3KA 3WDOA 3T7AA 1E6KA 1VMBA 3HKDA 1Z5UA 4HX9A 1PSWA 1E0DA 3TQOA 1Q7BA 5BNWA 1CB7A 5FTJA 5HQMA 2Y92A 3LX4A 1LPSA 3DLCA 3VGPA 2A5YB 3GUHA 3BIFA 4M89A 2BKXA 4TV8F 2HHCA 1Y4SA 3UQYS 3ON5A 3L7JA 4BVHA 1O4WA 2QBYB 3GLIB 2WG2A 3NRJA 3NMAA 3R5DA 5LDGA 1U90A 3UJ7A 1VI6A 1JEQA 1LWCA 2MSCB 1BIFA 4KR6A 1LV5A 5JS7A 1VGYA 1MLDA 4V38A 4MIOA 1UW4A 4JI6J 4I6WA 2AEFA 3RRJA 4DIOA 2ANCA 1ZW6A 2XDQA 3OZFA 2FVRA 1E5XA 3HYCA 7AT1A 1U9JA 3ZJUA 1OXXK 5AW7A 4TVBA 5ELLA 4E3WA 5FBVB 4QZVA 3NOCA 5A62A 3OJCA 4A46A 3QEKA 2GNPA 2QN2A 3IRXB 4RABA 4I4TA 3FPGA 3KKOA 1OQ6A 1JKMA 1WHVA 1IXRC 4M49A 4OJNA 3GOHA 5B57C 1U63A 1AKWA 2F9FA 1Z2NX 1GH8A 2GZAA 4DRZA 1UM9A 2EJVA 3JQKA 4R05A 3UT6A 2WILA 2AYZA 3I6YA 1D04A 4KPUA 5CCEA 1X5PA 5K05A 2IYTA 1NMEA 1YJRA 2F8TA 1C1CB 1OH8A 5B08A 4GE3A 4BL5A 4WBNB 3TDMA 4BO6A 3ZGNA 4OPMA 5C1PA 4YCJA 4KRWA 3SFZA 1YR3A 4FFDA 1EGHA 4IMJB 1VIMA 2G4LA 1GZHB 3C16C 1S48A 4KAJA 4Q03A 4K28A 1Y5LA 2IL1A 3FFIB 4RCZA 3BH0A 3GT3A 4MA5A 3NGKA 1EZ4A 3ULHA 2XMUA 3VPDA 2HPVA 2WSIA 3M3HA 2L9WA 5J1TB 2NUAB 2FEMA 2O5RA 4WADA 1VLMA 4N6OA 1NP6A 2ZJ7A 4PHFA 5A4JA 1TB4A 1BFUA 3FUXA 3LP0A 4LW8A 2PI4A 3TUZC 4KWCA 5KT5A 1Z0SA 2YVQA 4IDDA 4B34A 3LLCA 4UMEA 4LUBA 1EQ0A 1LDEA 1YMQA 5CXXA 3FNFA 3DFIA 5G4LA 1OB2A 3I30X 4DG5A 2Q5FA 2XWQA 4DLWA 2J4CA 1NF8A 1C9MA 2OCBA 1RJEA 2IY5B 2VL7A 1G2QA 1XRQA 2Q45A 3GT4A 3ZTRA 3MR6A 3K0JA 2YFHA 3GCGA 2PE5A 5A9SA 5FEUA 2WWFA 4Z9XA 2ZD1A 2HHHB 3SSQA 1ELOA 4AZ0A 2A8YA 4UM9D 4D0GA 3E8XA 4RMIA 4MS3B 2H5IA 1P2FA 2CJQA 1WZCA 1M83A 1SA0B 3I1YA 2BZGA 1P4HA 2X5XA 5EKXA 1ODCA 4TSRA 1EFVB 4Q82A 1FDOA 5ETPA 1FYWA 4CM9D 1CQWA 3LVRE 4RU9A 3D4BA 1XR7A 4NCKA 2JGEA 1OASA 4MH8A 3LCCA 2CJPA 4HVLA 2B61A 4OMCA 1A8UA 1SJQA 3UB2A 3GJQB 2P35A 2NM0A 2O3TA 1LEOA 1MV8A 2WD7A 1RYBA 4A4JA 4FJ1A 3GCZA 1DG1G 1X2BA 4URGA 1GAXA 1GFWA 1Q0LA 3VRHA 4LF1A 5FUQA 3JRNA 1YFZA 2VNKA 3NC0C 1KDPA 1E32A 1FRHA 1HR0J 2XH8A 5LNK1 3ONNA 1RT6A 1PTJA 2VDWA 3R97A 1B7YB 4PQEA 2HJHA 3KKFA 3O21A 5KFOA 2QRLA 4ENTA 2AUMA 3JQDA 2Z2MA 1CLEA 3TE7A 5DISB 1RYRA 4KEAA 4EMBA 3F74A 4YAGA 2ACKA 1EHWA 3EMBA 3O4GA 3OSPA 3NIDB 2JFXA 4E6EA 3A4TA 8ATCB 3GLJA 2CEAA 2J9ZB 3UMSA 1YB4A 4CLPA 5DYTA 1VLYA 4I1IA 1C9JA 2B1GA 5KFTA 3FSGA 1BHJA 2IDZA 5KOYA 2VC2B 1KC3A 2OTCA 2HHJA 5KG5A 5CYMB 5AW8A 3EGXA 3DA8A 1ZD5A 3E3XA 3RFXA 5A3SA 4Z37A 3RHSA 3T1HF 3IT1A 2LP4Y 1VKNA 1J70A 5A2QY 5HBMB 4UOGA 3QVJA 3C39A 2GAIA 2B99A 1W88B 2ZIAA 4FKYA 1N34B 5JNRA 2C0CA 2FUG6 1Y3JA 1YHZA 1EYZA 3OX3A 2M2BA 2OCAA 3IILA 3QSYB 2WSCC 4RFVA 2A3JA 4X85A 4BFXA 3KKKA 3EPPA 4R81A 3G6KA 5CZXA 4WJBA 2LR0A 5D5PA 4G1QB 3MBOA 3HHDA 3ESCA 4MYCA 1TEHA 3JYLA 1LRLA 2X7IA 2D1SA 4CI0B 1ESCA 3L8YA 5DGCA 3VJMA 5CGZA 2AG0A 2VC0A 2QC3A 2PKQP 3P9IA 4TOIA 1I1OA 4TXSA 4KWIA 3MFQA 4PZUA 4YRPA 4P0TA 5BRAA 1KDNA 4YECA 3V8NA 1QHYA 1NHKL 2YN4A 2KO1A 1K68A 2AR0A 1KH1A 1HI9A 1RVDA 2OL4A 1SL1A 4EFAC 1E4EB 2DKOA 2XGQA 3MTBA 1X9HA 4G9GA 1ZPWX 3VXKA 1U8AA 1TKRA 2I3AA 4PO3X 5GP1A 4USVA 4EMUA 3ACCA 4Y2HA 3CVKA 1VHTA 3ICEA 5D6NA 1EXVA 1WCXA 2M3DA 3E5RA 3NT5A 4JVNA 3ADOA 4ME6A 2FF7A 3WIUA 4RKRA 5ITHA 5JWOA 2Y8YA 4TTRA 3WLJA 2O8EB 5FNVA 4IFVA 4TWAA 3LTOA 4FYWA 5D01A 1FRLA 4EF5A 5FJ4A 1WUTA 4L8WB 1ZGAA 2ZE5A 4CM5A 3A05A 3A1CA 3THOA 1B73A 3MXHP 3TGWA 1Z22A 4C6TB 1EQAA 3I5UA 2IQ5A 4OZ0A 1EAYC 3IESA 3OCYA 5HUQA 3LGHA 5IAGA 4PZLA 1N5VA 4F02A 1GAEO 3FETA 4CDMA 1UVIA 4F4ZA 2D5IA 2MQ8A 1MEEA 4C3ZA 2DQKA 2N1BA 5BXYA 4NLGA 3WWDA 4EBBA 1AQJA 2RHWA 2PA8D 4XR4A 1ARZA 2E2WA 1UK8A 2DD8S 3CCTA 1FBTA 3GLIA 2QBYA 4BNUA 2XY6A 4N5IX 4IHKA 4OYYA 1H2VZ 2ZAOA 4MV6A 1X8LA 3VU1A 3A6HA 5KG0A 3HHNB 3JAMY 4RWWA 4LQCA 3N6MA 3R1LA 5D0RA 3L6EA 2B4UA 1DBRA 1X42A 2EOAA 3TJMA 4NNPA 2FFRA 2MR6A 3RAXA 4RETA 2R79A 3EGCA 4CLWA 4LF9B 3P2MA 5JCPA 5A6PA 5HF5A 2ZQ5A 4MUMA 4NHEA 1KQKA 4V0NA 4OHWA 3EMDA 2QMHA 3IRXA 2JDID 2JFKA 1WNFA 5LQNA 3H19A 1ZR4A 3BRQA 4ZVRB 1NW8A 5KX5B 4NAUA 1YU9A 2PLNA 2YH1A 1LC0A 1QYCA 4DCJA 2GIRA 1RWUA 4IGFA 2EPIA 5LXTF 3ZD8A 2UV8A 1DWPA 5K3DA 4PTZA 2EKLA 1KZGB 5KINB 2YWJA 3AU8A 4DF8A 1C1CA 3FBEA 2IPAB 4JL8A 4WBNA 2FR8A 3MWLA 4MW0A 2H0AA 3OX2A 3L0ZA 5ALTA 3SEOA 4ERNA 1TUEA 3BEDA 1XBWA 4Y6LA 1P2TA 3PJEA 3NYRA 2V6FA 1M5PC 2W2LD 2X9VA 4H27A 1X4BA 2XQKA 3FFIA 5E9WA 2ZYSA 2XMZA 2D4HA 2HT6A 3UGQA 4B3MJ 2PX4A 1R8BA 2IJGX 1Q3KA 1UC8A 3C8DA 1KAMA 1Y9ZA 4TWBA 1AN0A 1XJ5A 5AW5A 1P6QA 4CW7A 4MYHA 2NTNA 4KSCA 4X64J 3E2MA 5FPQA 3IXQA 4RQUA 5CD9A 2IXGA 2JLQA 2AW0A 3DMJB 2C9CA 4YB6A 3N0XA 4JI7B 2ASDA 1VHJA 2PZFA 2EF0A 3NALA 2NNLD 2Y6UA 1NVTA 2GPTA 3BK7A 4WKBA 4UZSA 3LP8A 2SNIE 1KJ9A 3ZKAA 1HH4A 4IV0A 4C0JA 4ZJZA 3URKA 2D0OB 1EB0A 3GFZA 1KFCB 1COWA 4GXRA 2ODPA 1BKSB 3GAMA 1PL7A 4V0QA 1Q22A 2JJ1D 3ZTSA 4DXHA 1NSAA 4JBIA 2VRCA 1WACA 1TCVA 4ECQA 1N32F 1X38A 1XZPA 3IO1A 4MVXA 1RWWB 3AHPA 5IJWA 2AFVA 1XF9A 2F3UA 5KFGA 2I2BA 4AY6A 3MS7A 1G18A 2KBEA 4B3DA 4OHXA 3FVVA 3BL8A 4QGFA 3T0GA 4CO1A 3O31A 4G0ZA 5DLGA 4DR3B 4Q7LA 3ONQA 4MS3A 3UO8B 1RT5B 3W9HA 3LPNA 4OSEA 1T0IA 2IXBA 2O0LA 1SA0A 1Y3AA 1TL7B 2QLFB 3LI2A 3JZFA 5THQA 1L3IA 1EFVA 4RY8A 3ONVA 4JK3A 4B3TF 4OHYA 1WETA 5EUMA 3J7AN 1PJ4A 4IR7A 2KU7A 2VFSA 2CN1A 4R2IA 3E9CA 4YAJA 3SWWA 3OHPA 4BNGA 4WK1A 5KHAA 1GSHA 2G17A 4YT8A 3K5IA 3O95A 3GJQA 3U1MA 4HEA6 2V7EA 4DG8A 2OHHA 4DHVA 1JYEA 5GOZA 1YR2A 3PDHA 4BKUA 4CFZA 2NPIA 3FUVA 2VNJA 3LIIA 1U7PA 4W82A 1GGHA 3NAIA 2ZE2B 1QS0B 1NRXA 3KOZA 2DWUA 3BRWA 3FRZA 4UT4A 1O51A 4EABA 4EPVA 4NZYA 1VSQA 3VHQA 4FB5A 2JK0A 4YDHB 1J90A 1KY5A 1H2TZ 1WZEA 3ZWBA 2HMUA 3KALA 1ZISA 3WXBA 5KS2A 4JX9A 1IN7A 8ATCA 1I94J 1J0CA 3TQFA 2P2LA 2OLJA 2GHWA 3HCOA 3UK0A 2GJKA 4B4VA 4AROA 1XLTA 4ALMA 4CLZA 1YI8A 2QPAA 3LP1B 5CYMA 4R3UC 5J4HA 2QAIA 4G65A 3GLHB 2IUUA 3AUJB 5KWSA 3RVNA 5J4KA 1SBNE 3IC1A 3UPDA 1H42A 4WACA 3ILHA 3HWWA 1HYSB 1FFDA 5HBMA 4LHSA 1Q2UA 3BE8A 4IVRA 3WK5A 3HBMA 1W88A 3ABRB 1QGYA 3A8JA 1QB7A 9LDTA 5B7NA 1RDRA 1M2EA 3NWJA 5CA0F 2QTNA 1DHRA 3KL2A 3GFPA 3QSYA 1BGVA 3ZLJA 4YRJA 4LPSA 3OSUA 3R0JA 3AFGA 3U17A 3KLPX 4G1QA 1Q95A 3WA6A 3WNZA 5AQ1A 3M6UA 1BO6A 2J9DA 1FQJA 5LZ5A 2G83A 2SBTA 2JS7A 4DIFA 4KXVA 3JVUA 4FW8A 1CJVB 1H73A 1R50A 2VFUA 3JTNA 3BGRB 1ZM3A 4TX1A 2MR5A 3K30A 4D44A 2PLRA 4MITA 3OIWA 2ZJ5A 2ATIA 4TUYB 3TKAA 3ASUA 3LRTA 1E4EA 3ABOB 2JI8A 2D1CA 2ZRQA 4XRRA 5JTUA 1F3VA 1KMMA 1XTKA 4DW8A 5UKDA 1W26A 1KQFB 2QYHA 2Q4DA 4WDRA 1RLMA 2LDYA 2DJIA 1YZ3A 2JFYA 2INGX 4MJLA 5LB4A 2O8EA 3HFJA 5TGZA 4K5RA 3ICPA 3KYDB 4CCYB 2ZZKA 2QTTA 4C6TA 5DTEA 5I9NA 4Q21A 3BK2A 3BVPA 3ORHA 1QYWA 3SYZA 2CUTA 5J2UF 3DDOA 3PSAA 5WRFA 3JXEA 2ZSIA 1USGA 1PEDA 3W6ZA 1RKBA 1RI7A 3GDGA 3KUKA 2DFLA 2J3IA 3W6PA 2I2YA 3BGUA 3IIIA 1U45A 4ZQCB 4PLFA 4JLWA 4GI5A 3TOSA 4N5HX 3VAKA 1Y81A 1DQSA 1KETA 3PGVA 4D56A 5E2BA 3VZIA 2GVZB 3GUUA 3KT0A 3FDZB 3TRIA 2XT0A 5ADUS 4EZ9A 3NCTA 1Z4MA 4DVGA 1YJBA 1QYRA 1LFPA 1SPBS 1RAIB 1XI2A 2D3ZA 1XZDA 2NZ4A 4NXNF 3AK4A 1OREA 2XKKA 4U39A 4BVKA 4TS3A 3GWGA 1MAUA 3UQZA 4IX1A 2ZUEA 2IPMA 3FBFA 4I68A 1AS3A 4NBLA 1NSPA 5B4UA 5G3ZA 2OPQB 1PBTA 1WF6A 3K70C 4L4ZA 2MZSA 5BY2A 5KX5A 2JH8A 3FIJA 4J94A 5K01A 5C8YB 1BLUA 5FTKA 2FEPA 5K99A 1U6JA 2B0CA 4DUZF 4I7FB 1G8SA 4TYMA 3FY4A 4QDUA 3G9XA 1RZ3A 4C3VA 3VOAA 1L0BA 1GQRA 4B3JA 2C2OB 2B83A 4IEFB 2ZT6A 4IG0B 2FNAA 5JWRA 3PXBA 1KVQA 1ZQ1A 4P2BA 1TL4A 1T2VA 4LOIA 5DHFA 1AUXA 3KHTA 4QFBA 2OYCA 1EP1B 5EGNA 3KK3B 3MURP 2BE2B 4FFSA 1I7NA 3ZZ1A 2LRHA 5FQOA 2ZBFA 3B1FA 4RA6B 4JL5A 1ZETA 4ZRDA 3SQOA 3IERA 4DV2J 5JYCA 2OMLA 1AYEA 4GLBA 2D00A 5J2MA 3LBAA 3FFBA 2H4JA 4MQLA 3WGIA 2VOEA 2COUA 4OQEA 5FB3A 3USES 3DMJA 2F9JA 1T3ZA 3AKDA 3FYSA 3R74A 3CTRA 2V9PA 4IYJA 3QPCA 4I66A 2YVUA 3T4XA 3TNFA 4A8WA 2PJRA 4FXOA 2P5VA 2D7DA 2PCLA 4TYWA 3EZOA 1QP4A 3MUOA 3NBFA 4WF9Q 2J0SD 3FK4A 5A4FS 2BJ9A 4YT4A 4QJ5A 2W58A 3OTQA 1MF7A 4ZQEA 1C1HA 4BMYA 3SCJE 3DHXA 3I9V9 4KO0B 1M1YE 3M83A 1GU1A 2IUFA 1NAHA 2D8AA 3DO8A 1RWWA 5JAQA 3K2IA 4DFDA 3TN7A 3KU4A 2HQGA 4K2HA 2WPDD 2GJFA 3M4NA 4KVFA 3ACDA 3RF6A 3R7NB 1HM5A 4IS3A 4UUOA 1NJ8A 4LK3A 3WYEA 5ECWA 3VZCA 1YBTA 4D9JA 1RT5A 1T2EA 2W6IA 5IT9A 1QYVA 2FEWB 2GO7A 1J0AA 1TL7A 2QLFA 2D2EA 2BC9A 4ITSA 1AB8A 5AW0A 1P1HA 1J9GA 2GZMA 1FP6A 5JZOA 1AG9A 2R1VB 4QTXA 3F46A 1KJZA 4FXPA 4Y2SA 3DAYA 1SXJD 2IXFA 4L74A 1NVVQ 3FKJA 3WLMA 1K98A 1SEVA 2OOSA 3W3ZB 1OPXA 2RK6A 2OGWA 1YC5A 3ZK8A 3LUPA 3T9FA 3AF4A 2Q99A 9ABPA 4DQKA 4QUIA 1EVJA 1SUDA 3EAQA 4GLJA 4I8XA 3QE9Y 2UAGA 1W96A 5J2NB 3NL0A 4RJVA 5DK4A 4ID9A 2ZE2A 1QS0A 1IBKB 4FLEA 1SHJA 2R4TA 4X62B 4PWYA 3DG9A 2PLFA 3ANYB 1EWKA 1SKYE 4XUEA 5KEIA 3K9GA 4BN4A 1HE2A 3N7AA 4WNAB 2FE4A 2GS8A 2HTFA 3DKVA 2PD6A 1FXSA 2V6BA 4I9HA 3SZRA 4RU2A 3RW7A 1XLWA 3NEKA 3SC2B 1INLA 3MOJB 3BXHA 1Z3IX 2DBYA 3GR6A 1ZXXA 3NBQA 4PAWA 4HBGA 4QPTA 4IYRA 1UXKA 4Z9FA 1RXIA 1ZJZA 3LP1A 2LW7A 1S0OA 1Y1PA 4RVSA 3GLHA 2Q8QA 3ZY6A 1T0HB 3KKZA 4CQMB 4JOSA 5IAEA 2PEYA 3WJ1A 1C29B 1VE1A 2JLGA 4LBPA 1HYSA 2WFZA 2AFRA 2A1UB 3RIYA 2VJUA 2ENWA 3MEDB 3NXKA 3SHQA 1HEUA 3FUCA 1EHIA 4DFKA 2ROEA 1KEPA 1GM5A 1KR5A 4IAOA 3A6FA 1A95A 1DADA 2VN8A 3MAHA 3GZJA 4HYEA 5FF9A 1YZVA 3QGHA 2ZRNA 3U19A 4MV3A 3MJHA 4E98A 1EAMA 5ICFA 2JIMA 5DU2A 2AJ1A 3J81U 3ZWCA 1KS9A 1N1MA 4DCUA 1QNFA 2R7UA 2D3WA 3RYCB 1BJRE 1NR1A 1XMQF 4A8XA 2PD4A 1CJVA 2Y1OA 5C80A 3A0UA 3OSZA 3MWGA 3BGRA 5KU1A 1I3OB 2D2FA 1CW2B 4X4NA 1CUZA 1UFOA 1QQ7A 5I48A 4TUYA 4CL0A 5JVGQ 1OF1A 3RLIA 3ZTYA 4MEAA 1NLUA 3P2EA 3VKGA 4ZYTA 1DKQA 2X1LA 1NUUA 4NL5A 1LQ9A 3M05A 2WDPA 1KQFA 1MAAA 3KDNA 1M2JA 4XB2A 3PDUA 1XTSA 3L1VA 4D9MA 4KO4S 4H7HA 2JRSA 3OU7A 3GCWA 3IR5B 4PXSA 4B9EA 2B1IA 3LPMA 4CCYA 3I9MA 1QIDA 1XU9A 2XYVA 4MGYR 4CH7A 1LF0A 4QYZK 5AKGA 3WMFA 1WW3A 3OLZA 3AVYA 5EWLB 1POXA 4JI8J 2DNOA 4BUCA 3E8MA 4RHUA 3B3AA 1KU6A 2IUSA 2HZAA 4O08A 4W4MA 1WBDA 2GKOA 1VSUA 1GLGA 2XMTA 1IEWA 4Q48A 3VPFA 5L1JA 3Q98A 2FW6A 1FS4A 1JTVA 1ZM7A 1N2GA 3RGIA 1SRQA 3CXUA 3GH1A 4EX6A 4A8HA 2C22A 3GV0A 5D5QA 3IP9A 4CMAA 3VYSB 2HS4A 1VE9A 3DRXA 1GRRA 1CUXA 3SX4A 3E3NA 2N1MA 5IANA 2ZH5A 4LJ5A 1Y3CE 2K2QB 3HHPA 4UVGA 2GVZA 5FD1A 3FDZA 2BSQA 3GZTB 5ETSA 1W48A 4OIFA 4RWEA 3HJAA 3CF0A 1YZTA 4UAGA 3WP1B 3A4VA 3OHMA 1UBKS 1RAIA 1LK0A 2XMRA 3STYA 2WTEA 4RPHA 3N3BC 4L95C 1YKWA 1KQSR 2ZT8A 1ZVQA 3R0QA 1TEXA 1UDCA 1XTQA 3BR9A 2V6JA 4ILMA 3O8RA 5AJTA 5ILOA 1KMCA 3TK1A 3CZQA 3P2KA 5L3QB 5JJIA 2OPQA 3HU1A 3IUEA 4S0MA 4B6QA 4TMWA 4J07A 4IRUB 1YH3A 1Y7PA 4RLEA 2QAGB 3EVAA 3CJSA 3MLAA 3BPSA 2BHTA 1ZESA 2EJUA 3PEWA 2CNKB 5K3EA 4HLUA 4I7FA 3QU2A 1V11B 4J03A 4R0MA 4AWBA 2OHJA 3M70A 3TQQA 1I1NA 5IF3A 3ZDDA 4ESVA 3KU1A 4M7RA 2IE8A 4DPUA 1MRZA 2C2OA 2YHIB 1B0AA 2XXBA 3HV0A 3PFWO 4IG0A 1WDWB 1T9HA 4CRJA 5KQMA 3DXBA 4U2EA 2ZCJA 1XNQB 3PZPA 3KK3A 2BE2A 2HHXA 4Q8EA 2ZJ8A 4M37A 4GUAA 4ILKA 1D7OA 1SH2A 4RA6A 3ZDYB 5DHSA 2RHDA 2XR1A 1AUDA 1RYEA 1W36B 4LYEA 1WO8A 1RP5A 3BIOA 1S8NA 2AE1A 4OQYA 3CRW1 4Z2AA 5IRCD 3SS8A 3RZAA 3Q7QA 1GNPA 3DRYA 1MMFB 1JDBC 3S2ZA 2WMDA 4O3PA 1TCCA 5B3JC 3WLLA 2YX1A 4PCQA 2Z9DA 3BWYA 2DTJA 2C31A 3CX3A 5E7QA 2ACEA 2NPOA 3IDAA 4Q00A 2VYVA 1B99A 4PYIA 4QIVA 1A8HA 4AQYB 1U4SA 2CLEB 2IC5A 1YCHA 1UFVA 1ZDMA 2XGOA 4XPEA 1LSOA 3G9TA 3U44B 3HNRA 4I5FA 3OCUA 4CKXA 5C1BA 2YQ4A 4U7UK 1AHPA 3JVVA 4BLTA 5JAMA 5CEFA 1QR6A 3R7NA 1ZCBA 3V33A 4ETWA 2HCTA 1YOVB 3T7CA 3COSA 2QYSA 2W6QA 5CBPB 2CQHA 2DJ5A 3P7MA 1NPYA 2GESA 1RWOB 3BFKA 5AJHA 3FFAA 2ZYTX 2BFFB 1QTQA 3QFSA 1A5TA 1NU8A 1P8AA 4GR9A 3LBNA 3MYRA 3LFHA 3C15C 4FP9A 2NTEA 4WY2A 5DQGA 2H2DA 3TVKA 4J9OA 1AMOA 1QSYA 4ENQA 1EDDA 2UXCF 7MHTA 1NYTA 3C1UA 1SUEA 3SNKA 4MYDA 3H2IA 3W34A 4ARVA 3K09C 1LPOA 2V8VA 4HNSA 4QSMA 4KQ2A 1WEXA 3A3NB 5HVFA 5LMZA 4CLEA 4OGFA 3AIIA 5J2NA 1L1RA 4Q8FA 1E89A 1U3FA 1RM4A 4HTJA 2DAPA 4I55F 3Q7TA 3RBXA 2BRLA 4QICA 4ZPXA 1LFAA 3LT4A 4QTUB 4KWHA 4U7JA 2O57A 4UQTA 1UBNA 2AJCA 3IC5A 1AO0A 4P4NA 4MYUA 1WHYA 1TD9A 3K9NA 4DA4A 4TN1A 4O3QA 1N6QB 4EGLA 2ZVSA 4PRKA 3LW5C 1S6QB 2AKEA 1XKTA 2H18A 5K9FA 4PX2A 1DAPA 1JHQA 1XC7A 3WQPA 3ZZTA 4RQTA 3DLKB 1BCSB 2VQSA 1RAEB 1YSJA 2J3QA 3SC2A 3DDNA 4DLXA 3VDQA 1B00A 4DR6J 1FA0A 1WCWA 1HHQA 3PTAA 1T0BA 5EXPA 4F04B 3HT3A 1VDZA 3IDOA 1DHMA 2C7QA 3FPLA 3N74A 1YR8A 2JANA 4P3PA 3PYLA 2XB4A 4X65J 3F8SA 3IDSA 3IQIX 4N6NA 4R4JA 1NQUA 1BWRA 2Y1WA 3DE7X 2FWJA 3W9SA 2PLWA 2A1UA 4D9KA 4P9NA 5J4VA 3MEDA 5K6AA 5TDHA 4UAUA 3M9WA 3R6LB 5JS6A 1VIYA 4CFSA 3GP8A 3UJ6A 2OCPA 4Q3NA 2IHR1 3OA2A 2RHTA 4G26A 4J1NA 4O29A 3BZBA 1O1YA 3FROA 3SIXA 3LDUA 1Y48E 2EU8A 3U0VA 3CVYA 1JIJA 2JFHA 1UR5A 4UOQA 3TZQA 3AQOA 1HRKA 4DA8A 2D3OR 3OP1A 5K8LA 3Q3IA 4Z7CA 2OB1A 2PWAA 2I6TA 3DVLA 3RYCA 3VZQA 4DF4A 1Y1KE 3ZV5A 1CJUC 3A06A 1SUCA 3T1VA 1TJNA 2YBDA 3O2NA 5D15A 1YB7A 2PJUA 2YHBA 2Q3MA 1A9RA 2QSYA 4FUTA 1FLNA 2EWWA 3SXUB 2A7QA 1J99A 4AX8A 4I1UA 4JU9A 1T2FA 3Q72A 3MOGA 1RADB 3PVSA 4M54A 1TJ4A 5IEJA 4DHEA 3ZOKA 3QVMA 1N33B 3PLRA 3CV3A 3CZ5A 4QOSA 2BVZA 3A14A 1S1WB 3D31A 1HYGA 2WIBA 1O5JA 2PGDA 1SELA 1W2GA 4ES6A 4V19J 5BOSB 1KFDA 3LECA 9LDBA 3FZEA 1GTJ1 4EHBA 4UM8B 1WMBA 1SY7A 3B1KA 4J9RA 4F5WA 2QTGA 3E3AA 4UVIA 1TU0A 2YR0A 3IR5A 3P5TL 4NV1A 4CU2A 1I5OB 2JIRA 2H2IA 2BMJA 3HJVA 1Z2EA 4XUCA 2HLPA 3QV2A 2J07A 3I6MA 5CIWA 2FHJD 2WM3A 5EWLA 4YRFA 4BC7A 4MS1B 4Y2KA 3DLBA 4P4GA 3WMEA 3ZYCA 1KC8T 3HK2A 4P36A 5GADU 4UFPA 2MEWA 4CM1A 1T0PA 2XEXA 1PVDA 1UOOA 2DPHA 3K9HA 1W4CA 4L9AA 3EC1A 2GEFA 3LO8A 1Z29A 2XBUA 4XYLA 4EW6A 1L5KA 4IDHA 1AXGA 3PC2A 4QRDA 4UTOA 1XVVA 1R00A 4HADA 5I7VA 4J2TA 3QIDA 3KBOA 2B8PA 2FDXA 4H7JA 2EQAA 3CN7A 4OHPA 1COWD 1XL1A 2CC2A 2ZSUA 4YOEA 4J1QA 1QGOA 2I22A 2ZLBA 2AG1A 2K3KA 3GSIA 3CT4A 1H0SA 3UN1A 1OWOA 3L04A 5D7NA 5T4EA 2VRCD 4Q24A 3WB2A 1YR7A 3R5FA 1CUDA 4XAKA 4TSFD 2I91A 5JSUA 1NPDA 2IYYA 1VPVA 2BHNA 1J9ZA 4Q9NA 5KSWB 1F2VA 5AM1A 4P54A 1N1DA 3G2IA 2RVJA 2B7BB 4JI3J 5DH9A 2XNDA 3HGTA 5EUCA 3HDHA 1CNEA 4XIUA 5ERGB 5L3QA 3K7EA 1H6DA 2OHVA 4XLLA 4OX9Y 4DR2F 4XGNA 2HADA 2QAGA 3O3CA 5LOVF 3CMCO 4GNRA 2O01C 1YBVA 2L0XA 2HU8A 2CNKA 4ZAGA 1X1RA 3NOQA 3MBKA 3LH2S 4QOJA 1QHXA 4M0UA 3ROKA 1V11A 1P0FA 2PL1A 1CRZA 3NWRA 5CT4A 3QKIA 1NBOA 3BGDA 1JR4A 5CDGA 1KVJA 4R6WA 1LJLA 3FPFA 4H1UA 1WI6A 1C9DB 1V5VA 2YHIA 2MKCA 4MGHA 1EB9A 5ANRB 2G9OA 1R0AB 4JT8A 4XWYA 5AVVA 1T1IA 1YZNA 4GEGA 4Y2QA 5DGBA 4BRZA 4LFAB 3VR2A 2RAUA 3DGVA 1K8RA 1RABB 4L8FA 3KL4A 1LC3A 1F2TB 1JHPA 1RLDA 3LVQE 5AVOA 3LP5A 4QAJA 3CUYA 3C8ZA 1G63A 1IY8A 4FOPA 5T14A 1OT5A 4YJKA 4LSMA 2W2MP 2AYEA 4YAUA 4B3XA 1C0EA 1P1BA 2V9KA 1U0HB 3ZU2A 3I39X 1Z18A 4DCSA 2IEIA 4DV7B 3TTTA 1BY9A 3EUAA 4EKYA 5KDDA 3L8DA 4UBKA 3JYNA 3Q87B 2RQKA 3PFIA 2RJZA 3CJ3A 3LYLA 1WXFA 3JD3A 4EKDA 3D6TB 2I2CA 2M9KA 4ZAXA 1HA1A 1UP7A 5J4YA 4L7VA 5AUNB 3OY7A 1EP3B 1Y5NB 2QRJA 4JOCA 1OLUB 1JI0A 4C7VA 3G2JA 3U44A 2A9PA 3DAGA 2WJGA 2G0TA 3VA7A 4CO0A 4Q3KA 1GYPA 1N2ZA 2DUUA 1EMDA 2X8LA 4A8TA 2ZRDA 1RPZA 3LQ1A 1UZLA 4H4KC 1AKTA 2V6AA 1DXYA 1QH1A 2DF8A 1YOVA 2K7ZA 2KX7A 2EFDB 1GX6A 2X5OA 1RAOA 1U2SA 1GN9A 2UU9B 3BWBA 5CLQA 5CBPA 4X95A 4LFCB 3FYUC 3SLGA 4REMA 1UIRA 2CNWA 2ZIXB 1YI1A 1RWOA 3RBZA 1DBSA 5COBA 2AC2A 4G6VB 3IE0A 2BHLA 3FAZA 3ND5A 1PJ6A 2BFFA 4Z4CA 1EKXA 1TUVA 3H8VA 1OIAA 1Z4JA 1MG7A 3W2WB 3ZNOA 3E81A 2HVIA 3FHTA 1ZGZA 1VQ6S 5C4MA 5AVTA 1BWVA 2WTNA 4COKA 3W6NA 2MYFA 3CJTA 2G4CA 3E01B 1E7MA 1QH9A 2B8TA 3LA8A 1NI4B 4P31A 4WW0A 5KAMA 1NFFA 1TO1E 1PLKA 3A3NA 2LMIA 3N7TA 2GXQA 1GWNA 1HLPA 3NTUA 4DADA 4Y28C 4A5OA 1XKXA 4I3FA 3EIUA 2AHOB 5JCOC 3U1LA 3X0DA 3I31A 3L18A 1N6QA 1S9GA 4RVDA 3S28A 3KSDO 1Z6GA 5EX3A 2D62A 2I0XA 1S6QA 3IOYA 1N36J 1JILA 1D7AA 5AI9A 2X4LA 1Z06A 1ZD4A 2V7XA 5G0RB 1BCSA 5HZGA 5JY1A 2O7QA 5BYBA 3HLKA 5CQGA 1YVEI 4EEKA 2O2JA 2ZIGA 1L4NA 1QU3A 3EEQA 3D8UA 3KEOA 4MZXA 5SY6A 3FD8A 4F04A 3OJ0A 4EJMA 2QW1A 3VKFA 1AHIA 2AZTA 4N18A 4WCVA 3OQJA 3IYLW 3N6NA 4XLZA 2DT9A 1UODA 3TFQA 4Z6KA 1DQAA 4AECA 1EDBA 2CQ3A 1XEZA 1WE2A 3ROQA 5HIAA 1FU4A 5IAKA 3ERCA 4F3QA 1QUPA 5DRYA 3K57A 4ECUA 2LA4A 3KWFA 3UVJB 3TVZA 3R6LA 1A8SA 2JDJA 3TRGA 2VJLA 1XIQA 3U3MA 3BSYA 3RAPR 4DDHA 4XJXA 3UTCA 4MQ6A 2WSFC 3LAMA 4PN3A 2JGJA 1L4FA 4G89A 5EX0A 2PNFA 2VCEA 4MMZB 2BAGA 2DUWA 1FUUA 4MIKA 5FDFA 2YVAA 4K0KF 1QZUA 3A9UA 2Q5JA 4WTOA 1PYDA 1GILA 4QBKA 5C1IA 4AMUA 2HQRA 4XIIA 4M3NA 3IEVA 3SXUA 3C3WA 3D2BA 5B0DA 4QU0A 4KAAA 2WFAA 4KFCA 2VP0A 4C76A 1NBME 2ORYA 1RADA 2HMIB 1B3BA 3W5SA 4AD8A 5HKKA 3THWB 4PG8A 3FOFC 2N4DA 4B2IA 1RWVB 5IXYA 4IIFA 4FI3C 5BOSA 1GG9A 1B6TA 3PNPA 1RVV1 1U28C 2GD0A 4U6PA 1ZRMA 1JQEA 5U4QA 4PBTA 2KHDA 3SJUA 1I5OA 2ZZNA 3NDIA 4YIKA 1OA0A 3LQ2A 1JG2A 4TVSA 4ED0A 4F60A 2OV2A 4Z2XA 5C52B 4NULA 3NGMA 4KJZA 3N8NA 1NFQA 3A6EA 4UHCA 4YAKA 3EG9B 4MS1A 1A7GE 3O26A 3NH6A 5ES3A 4YJ2F 2DYAA 3QT7A 2X51A 1IIRA 2P77A 3IUPA 4HDRB 3NEYA 1HE4A 3RYHA 5IZHA 1VJQA 3DLTA 3ZJVA 1NN5A 4ND3A 2KLHA 3DMNA 4LXQA 3NHPA 1CRPA 1Y1LA 2BV3A 4Q9KA 1I2AA 1VHIA 4LZAA 5IK2D 2MQQA 2YNFB 3VC3A 1GYRA 3EIEA 5EJ5A 4ALLA 4O0IA 3D2CA 1YTLA 4ZEMA 4CV3A 1ZGHA 4KIJA 1PW7A 3U2QA 5JAUA 5H9EJ 4Q34A 5EJEA 4NYMQ 3H7AA 1M1XB 2DSTA 2XMWA 3G8DA 5GINE 3Q83A 4N65A 2QTRA 3CJQA 2B7BA 3PGJA 3WV4A 2CQ4A 3U27A 3GLUA 2H31A 1Y1SA 3A25A 3KYIB 2ZYRA 5LP6F 1FPQA 2J0QA 1VIXA 4V1CB 3VF0B 3EA4A 4URXR 3IO5A 2W6ID 4C5CA 1SAYA 5CVCA 4CM8A 3VO2A 3OFVA 4DTCA 4CIXA 5IT4A 4H1WA 4UE3S 1OWXA 1W47A 1QAXA 5H02A 4TLRA 4YTEA 3WLAA 1CJTB 1N0VC 2WONB 2E4WA 2AMLA 4KREA 3CG4A 1R0AA 4X3CA 4MUGA 3GMGA 2ZWOA 1UVKA 1SM4A 1WQ1R 1BU5A 3BREA 4GSLA 1KVUA 1ULTA 1JZQA 3D3WB 3T3OA 1OE0A 3VYVA 1LZKA 4KQKA 1RABA 4DPXA 1K5GA 1VPDA 1T3LA 3UAYA 4HI0E 1F2TA 8RUCA 1D8YA 5BN4B 4AY2A 4RNCA 2RIPA 5GJWC 4B9MA 5KT6A 3GGJA 5CDSA 2RAQA 2PS1A 4R1LA 4WOJA 4ZJYA 3IEKA 2IHKA 4NLUA 2ZAMA 1G8HA 1Y4AE 4NV0A 1IH8A 3H9EO 1YK9A 3CWZA 2GEUA 2CJBA 1BJTA 2FJAB 3LWNA 5FUWA 4NLLA 5FV4A 3L7MA 3VJLA 4PIMA 1Q15A 1YZYA 3ENVA 1NKTA 4MPDA 3POTB 3C5WP 4O44B 3INRA 1OSNA 2BABA 4P32A 1XJQA 2MQPA 3OHSX 3EWIA 2H1SA 5HJXA 3ZJTA 1Y5NA 2G3YA 5EE5B 3DLIA 4MWZA 1OLUA 4CHGA 1SUQB 5CYQB 3BXEA 1NXQA 4X4QA 2D3UA 5DLDA 2VATA 4J9SA 2FW7A 1Z2DA 2XS2A 3ORYA 2O52A 5KFHA 4KVZA 1QFYA 3DZJA 3U5ZB 3FZQA 4FGLA 1HYHA 2L69A 3UJBA 2JLRA 1P60A 4ABTA 5IABA 1YAJA 2CXQA 2ZIXA 3Q40A 1NJGA 3SDSA 4O59O 3R24A 4XSHA 2XVYA 4YDQA 4O1MA 3T5LA 2R2GA 4CUZA 1YZQA 4GKJB 4WE1B 2CL5A 3LT2A 3W2WA 5DLFA 3IAM6 3K5PA 1KRHA 1MA0A 2PH3A 1JHMA 4BU0A 1MJGM 3PRDA 1IR1A 3CZMA 2X2PA 4V02A 2VLBA 1XTIA 3E01A 4KGDA 2YYSA 1NI4A 3L4EA 2Z6AA 3TZEA 4YALA 2EL7A 3OOYA 2J33A 4DQRA 1Q8IA 3BCRA 2IITA 4C7QA 3TTVA 5FRDA 1U3DA 1KI3A 2JFFA 1Y6RA 5LN1A 1QM9A 4RF5A 2G77B 3WWEA 3HV2A 2BH2A 3VALA 5EN4A 5HQJA 1WM1A 3ELYA 4RKQA 1LW0B 1R6VA 2AHOA 1PWHA 1F7VA 3VV3A 5ENDA 2VP4A 2C88A 1X1DA 3HZGA 4BEWA 5DN9A 2RBKA 5ENVA 2G80A 3W06A 3H42B 4TT8A 2Q5LA 3PHLA 2I66A 2WF5A 3QWUA 5G0RA 1QVZA 1AK1A 1GEEA 2JK1A 4K9LA 1YIDA 2ONJA 5J59A 5JBIA 1V6HA 4Y2TA 3OTBA 3RO7A 2Q6TA 2GQ2A 2QIPA 2WICA 2AOWA 2EARA 3C3KA 1ADJA 3NR2A 5AW9A 2HGZA 3OPQA 2VK2A 4C87A 4B17A 1W2IA 2QG4A 2B9VA 1HNZJ 1VQ1A 3DCYA 4IIUA 3EGEA 2R8OA 3K9FC 2ZUDA 1BRMA 2QE7D 5LFAA 1XDWA 3ZWWA 4POAA 3PNQA 2PUCA 2R9VA 5IDWA 4A0HA 3KQYA 5CHEA 2RGAA 1XVUA 4WFXA 4U02A 4AKHA 2BBWA 1K5PA 4YP3A 2HSWA 1E7QA 3H59A 4B3SJ 2O2IA 2ZYVX 2NXEA 2HFVA 3GIJA 3NHZA 4RZSA 3R2CJ 4P2FA 1NM5A 1XA0A 3L9ZA 1JXAA 3DAPA 2B35A 2WJ3A 2IA0A 2XVMA 3DW1X 4A8JC 3D6AA 4KGKA 2DFKB 4EK9A 3T95A 2FRDA 3U4IA 2DEIA 1HA3A 3R9KA 5IWAB 4NLWA 2C8LA 5JZBA 1EFUA 2VQEF 3HP1A 1HWUA 4IINA 2OXTA 2EF1A 4F3KA 2O5VA 1P1LA 5C2CA 4DLEA 3CNHA 3S2YA 1A04A 3NWEA 2HMIA 3THWA 2QT1A 2V2VA 2XZWA 3GQVA 3MRVA 3ROXA 2D2IA 1RWVA 1CF9A 1U6IA 3WJ7A 4XM0A 2ZNZA 2ZXUA 2E7ZA 2ZAGA 3N2KB 3OZRA 3VR1A 4YGYA 1HF3A 2P65A 3FIUA 3X2EA 4PICA 2CHQA 3S29A 3E7XA 3FFTA 4JR0A 2UUWA 4LC1A 2PSZA 1KP9A 2R1ZA 4OF4A 4OOFA 3VTIA 3I28A 4LZZA 2QRRA 2WK1A 2I2XB 3TRHA 3EG9A 3AFMA 4D3SA 4LISA 5ALNA 3ZI0A 3KE8A 2WT8A 3HCBA 3P5BA 1PS8A 3IQZA 4MCHA 3NHBA 1X7HA 1HG1A 2EV9A 3L8HA 2GBIA 3VNRA 3FKBA 4HDRA 3GYGA 3NNCA 2A0FB 3E9RA 5EHZA 4KHPF 2X1BA 2FETA 2ERYA 1QVGR 1T4BA 3DEIA 2YNFA 2VYVD 3QBDA 3TEFA 4IRMA 2FW8A 1IHYA 1LVUA 2J3JA 2DR5A 1I33A 4D4IA 4JFRA 2HAEA 1DBWA 3H2BA 4V0LA 2ZETA 2XA2A 3NX4A 1MHTA 4RGBA 1DAKA 3R2DJ 1RCXB 2PQ0A 2IYUA 3I64A 4AFFA 1R6AA 2QK4A 4GKKB 3D3QA 4N0MA 2RGNA 4QT4A 5CHCB 3W90A 1ZU4A 2NSBA 3RG2A 1UPFA 2NUAA 1KI8A 2OILA 2AD5A 3NIGB 3ZDAA 4L22A 1L7PA 1VECA 2WZDA 4L02A 5JR3A 2FJVA 2IDEA 3IAS6 5DTIA 3ZHTA 3PEFA 5F2OA 2BKVA 1ISHA 1F9HA 4QQFA 1PR0A 1G2OA 4ZVQB 2WJIA 1L7MA 3KJHA 4KTVE 1D3AA 2ODTX 4ZVOB 4TWZA 5J2QB 1RTIB 3U40A 1CJTA 3WVNA 4Q18A 2W2NP 3AAWB 1BWQA 2WONA 2MTBA 5C8ZA 2AMFA 2DX7A 5C3UA 3JQ9C 1SJ9A 3BO4A 2WQ6A 1F4LA 1TF5A 1ZZFA 3D3WA 1FDUA 3PC6A 4G1CA 2XE6A 1G0NA 5TE9A 1OC2A 3JVIA 3KJQB 1N5TA 5BN4A 5L38A 2QUIA 4EAAA 3C16B 4ZPCA 3T5MA 1ND6A 4C4YA 5B1HA 1GVHA 1D2CA 1ZD2P 4C0XA 3WL3A 1AHHA 2FEXA 1XT6A 4NNJA 4RFLA 3PHCA 1WSRA 2W0SA 1QF6A 3RT7A 5CW2A 3KWJA 5KFLA 1GDDA 2PMKA 4AU1A 3ZE0B 4O4LB 4NLSA 5CZVA 2XE7A 1XK7A 3VUFA 4DIBA 1ETUA 5EERA 1FP7A 3A7EA 1M6YA 1IWOA 5DNWA 4YJDA 2QLJB 1JW9B 2QN1A 5BXQC 3POTA 1CVRA 1PZMA 3WICA 4BLPA 3F2VA 4OZ3A 2FWAA 4O44A 4DTIA 4GSYA 2HRRA 3GLGE 5AK6A 1OXTA 5CR9A 3DZIA 4DNQA 2ODAA 4ZK7M 1V5IB 3B6IA 2P8IA 2Q7XA 2IGTA 2XQJA 1N6RA 4DQ0A 2D9OA 5CYQA 3T5JA 3U31A 1KVSA 5KFNA 3IN5A 1S1MA 1MGPA 3CLRD 4NABA 2ZJ4A 1QO7A 2L41A 1R16A 1IY0A 1E62A 3Q6MA 4EEZA 4L6IA 2E6UX 4D3XA 3M8RA 1GNTA 3QFHA 4BEVA 3L7CA 2V74B 2V69A 4UBIA 4B8WA 3GBPA 5DHPA 3NFRA 5KOHB 2KZMA 4Y6QA 5HMWA 5KFMA 1PV1A 4KLNA 3T7DA 1HKAA 1VJWA 4ROSA 4FPRA 2WVDA 4FONA 2W8KA 1NFRA 3O91A 4WE1A 4HNAB 5JNVA 2EEZA 1V16B 5MFZA 1O57A 1IL0A 3MTIA 4G5YA 5HOQA 5EHXA 4PSUA 2PX2A 2NXJA 4PSKA 1YASA 4Y00A 2GA7A 4P81A 4UCXA 1ZSNA 3EVDA 3DGPB 3DDHA 4ZYVA 4ANCA 3GCXA 4EHIA 1F5SA 3GLFB 3EGDB 2WAAA 1CVIA 2IPOB 4XVCA 1U9CA 1N8KA 2P78A 4A6XA 4IO0A 4WOCA 4EUNA 1E9SA 4P22A 4E5DA 3WLQA 2M6SA 1LW0A 4I5DA 4OSPA 3DBOB 4P73A 5IVDA 1JLAB 3MM9B 2VIIA 4OJQA 3ZV7A 3KNZA 5K0GA 3OL6A 4FDVA 3ICQB 1TQDA 1ZUD1 3OQNA 5M04A 3GI1A 1WXIA 1RTZA 4TMYA 1T34A 3H42A 1MB4A 5K5MA 3QJYA 2IU3A 4IJUA 3MFYA 4ZA1A 3CJ0A 3QE3A 1NZDA 5IQ6A 2H7VA 2DGWA 2Z43A 2DECA 4KQEA 3B3FA 3EY9A 4DF3A 2CEKA 1BU8A 1PJTA 2VF8A 1ZD1A 3AM4A 4RV9A 2PZJA 3KJGA 4HZGA 3H5YA 3SBEA 1K88A 1OYYA 2AYXA 1NJ5A 1VSBA 2L9DA 2B8QA 1PKEA 4ZYLA 3GZ7A 2V9ZA 1HBJA 3MHPA 4B2LA 1CUSA 3CE8A 2ZJ1A 3H40A 3FUWA 4XIYA 3ZD9A 4L50A 6YASA 4RBNA 4P4UA 2XNDD 1NN3A 5ALJA 4FX5A 4KXUA 4X0EA 5K2OA 2WWYA 1LZLA 1S97A 5AXLA 3QPVA 1QHSA 2P6MA 4WYWA 5CJ2A 4CRWB 2OBBA 1M34E 3WGQA 4XRGA 3RFCA 1TNDA 4CQJA 4LYHA 2ZVPX 3B9PA 3KZNA 1FJXA 2CQCA 3BD6A 1XMOB 4XTCS 2VUTA 2W37A 3HL0A 2I4MA 1P1IA 1FDSA 2VDKB 1DV1A 1P0PA 4M8LA 4DDVA 5FLXU 3D7RA 1LB1B 1VGRA 2ZI7A 4G97A 3KSAC 1SJ1A 3GGDA 2H11A 1Y5MA 4CIWA 4BEBA 5JPIA 2R5NA 3G0CA 5DTJA 3C46A 2R84A 2B30A 1FLDA 1OR8A 4DR5J 4C88A 4MWEA 3N2KA 1DSSG 4DEXA 3AUKA 3VR2D 1H2EA 4C4PA 3PGLA 1MT3A 2WHYA 2EC5A 1N0HA 5F2KA 4IIEA 5T7BA 1U1OA 2CWKA 1DTEA 3L40A 1SKWA 3S1SA 1QOZA 1W36D 2OY0A 4ZVRA 3BFVA 5C37A 1ULSA 5GONB 1Z7YA 2WW8A 1VPWA 4DSOA 3UWSA 4CKYA 1FKPB 3RJZA 3Q88A 2JGAA 2EZ8A 3KZVA 1BE6A 2A0FA 2Q5IA 2G06A 3SVLA 5FBLB 3UYLA 2IBOA 2YWWA 4NE9C 2OXCA 2ZDHA 3K2QA 2CLFB 2O8FB 3HZEA 3K35A 5I3ZA 1Q1AA 5SYAA 4HEQA 3CZPA 4PZ0A 4YUDA 4XX0B 1T3HA 3CEAA 1WZ2A 1FTRA 1N0IA 1Z16A 4KE7A 1DQZA 3G9ZA 3EMTA 1Q7TA 1BXKA 1D6NA 4NBVA 1EDOA 3GRUA 1EINA 3HUEA 2MCFA 2YJ3A 3L7NA 1G5PA 2V58A 3BYPA 2VQFJ 2PANA 3V6MA 5J1PA 4BJHB 3IAHA 1FFSB 4NP6A 1A9TA 2RARA 5AM5A 2HQFA 2QLXA 3WBJA 3ZZMA 3ANNA 3A28A 1Q78A 3R5TA 4YGXB 1T0UA 1HDGO 2W4CA 4DWWA 1AQLA 2N4CA 2JLCA 1KE2A 2CNWD 4LYFA 4JXXA 4F2GA 4JBHA 1UEJA 3GPDG 2LQBA 3HZZA 4FEYA 1OD6A 3DFKA 1QVWA 2YOHA 3UJCA 4PFQA 1WZIA 3AOEC 2IXEA 2WWTA 2ZHAA 4DNXA 4POOA 4ZVQA 1OFIA 2R8IA 5TF4A 3W3SA 4XR9A 4BRSA 2B98A 1EGVB 4LVNA 2D8MA 1EX8A 3FBCA 2IHUA 4ZVOA 5J2QA 4CMKA 1KBQA 3DL4A 1ZVMA 1RTIA 2QG9B 4R1OA 4Z3OA 1VKZA 4C5AA 4P75A 5IOLA 3WMWA 1YRHA 1CUUA 4AW9A 1Q44A 3PR5B 1GUYA 4UAJA 2JB9A 5KYKA 2H17A 4O6VA 2A10A 1MB9A 4XUDA 4MA4A 2PD1A 4LS3A 1X2EA 2X1GA 3T1YJ 1PDOA 1OHHD 4QLOA 5L9AA 5DXFA 2QQEA 1RXCA 3PQEA 3NG8A 2P68A 3PU6A 3MGGA 4Y2CA 3DFMA 4YQWA 3C16A 1ISJA 2LDIA 4ZO4A 5F7XA 1YVFA 5ARBA 2M6RA 5K20B 2IYRA 5F3ZA 4PX5A 1V1RB 1EFRD 1HNWB 3OTEA 3R7WB 1HNXF 4K1XA 2ZXEA 1MRSA 4G5RA 5FV7A 3F4BA 3H4BA 2W6PA 5CW1A 3IRWP 4K9DA 5T8KC 2AZDA 5I5EA 2YCBA 2KI5A 2QS9A 4X61A 3HXMA 3E6AA 3QKRB 4O4LA 4KTTE 1TZMA 2XODA 4EY4A 4W1QA 1MRNA 4RPFA 4O3OA 3K6KA 2QLJA 2GRAA 3FKSA 1QAOA 4JEIA 1E2PA 4N0DA 3O6VA 3RS0A 1SVLA 2GNKA 5KTQA 1V5IA 4JGIA 4A15A 3NZEA 2FGOA 2XMMA 1QTIA 1TU4A 3JTMA 1E9DA 2P2NA 2YBEA 3UOWA 2H4HA 3V5RA 4JBLA 5GWXA 1H98A 5A4AA 2CJYB 3EC7A 2K4MA 4YMWA 3ENQA 4YUYA 4O4HF 4FF4A 4FLMA 4YRLA 2BKAA 5E1OA 3AQIA 4A8PA 3BAFA 3HVKA 1QQAA 4KGZB 3QMPA 1PBNA 3M6WA 5KOHA 3OKAA 2ALYB 5KFXA 4FXDA 1LI5A 5DW0A 1SIZA 2V1XA 3WHLA 1MDBA 4Q7AA 4ZI7F 1IZZA 4NZPA 4OSOA 2XRFA 4NCGB 1E6UA 3ZDEA 4RTLA 5JQGF 1BDIA 4HNAA 3HG7A 4MNTA 1A7JA 4WLNA 2EVWX 4DUYF 1V16A 1XIVA 2CY0A 1HI1A 3B9QA 2DR2A 1SUWA 3AIMA 1MVLA 4IZOA 1TUWA 1TMOA 1L8QA 2A5LA 3FNBA 1QSSA 2YC2C 3DGPA 3W1VA 3GLFA 3L4JA 3EGDA 1NX9A 1R8XA 4KX3A 3WYFA 1U4NA 2IPOA 1AGYA 1EGMB 5HKKD 1JXLA 2CXNA 4OV1A 4GF5A 5J5CA 4J3FA 4TS1A 4K4SA 1R0ZA 3FTEA 1DOAA 2ZJQQ 1JLAA 2FEKA 4ZAWA 2XHWA 4EARA 1VBXA 1WHSB 1TM2A 2KHCA 3IH5A 3SZGA 1U0SA 2HQ3A 2VF2A 2EK1A 1J24A 3IWXA 1DLJA 3CRVA 3WLHA 4GDMA 3P20A 1LK7A 3L0PA 4FS3A 4GD3Q 4OMDA 1K89A 4CDGA 4LF8J 1JP7A 4HG2A 3QELB 3ESAA 2PSJA 1YR6A 1KNQA 4KAIA 4URHA 4FS1A 3A1WA 2AB0A 2IH5A 3H1GA 3UEOA 4HGYA 3KG2A 3AEZA 4EMTA 1IVZA 2GH1A 4JI5B 3O8CA 1XP5A 2C5BA 5ISMA 4HAWA 4EYQA 2ZJRQ 4JUFA 1AC5A 4I9UA 3GJTB 1TZBA 3WX4A 2GZ3A 4B6RA 1Z0JA 3Q8KA 1A9OA 5F41A 1RPTA 5HROB 2NU9B 5DEOA 2ZU0C 1IBMB 5GADl 3UXHA 3AR4A 3ZZZA 1YGPA 3UJAA 4KE5A 4MP6A 5CH3A 5CU7A 3L0OA 4B7CA 4I19A 3HVWA 3KYDA 3UAVA 2W2QP 1ZINA 3LDAA 4HAVA 3I42A 3A1NA 3QPDA 1GL7A 1M5SA 3KHGA 4M5HA 3ND6A 2O06A 1A3CA 2OHIA 3VTKA 4WX2B 1KWMA 1LJUA 4OL9A 3OZWA 3M2VB 4Y8VA 2YTZA 4URWR 2ZIFA 5A2GA 1RXWA 3A58B 2HU5A 2DHGA 1XTTA 1QONA 3ZU6A 1YJTA 3MAAC 4ND8B 1LW7A 3TSOA 2KN4A 3J81Y 3W2EA 4NK5A 3EA0A 1GZ3A 5D7BA 2B9YA 1DRUA 3L77A 3Q9UA 3HP6A 1U9IC 3BQMB 3G2HA 1N54B 3S70A 5KDOA 4K9RA 4X4OA 5JQWA 1MKYA 4YN3B 1K27A 4IMIB 2Y1CA 2OORC 3NW9A 2OSVA 3WNBA 3BCSA 1T3TA 3OMXA 2HIGA 5FUVA 4N7MA 1F0KA 2P5TB 5ED0A 1KEEB 2BUBA 5JHHB 4D0LB 3ROFA 3ZE6A 2W2PA 4G23A 3I83A 4D0SA 5AIBA 2L82A 1X60A 2VG5B 2GO1A 1RRGA 3FF4A 4DS3A 2QU8A 4DWJA 2OD4A 5EJAA 5DNYB 2YJNA 3CCBA 4LY9A 1JZSA 2HNYB 4IH5A 2GGPB 2YC4C 2JFVA 5K3BA 3ZWKA 2WG0A 4ITUA 1TKDA 1CYEA 1TGYA 1MC1A 1MB2A 5GONA 5C8YA 3MGKA 2PI5A 3GB0A 3PF9A 4B7ZA 1FKPA 1UL3A 4HLCA 2BFPA 2YQ0A 1EAYA 3DMHA 4AYXA 4RZ3A 3DTNA 2VBCA 3ZG6A 1HMPA 4PO9A 2JRCA 1OILA 2QORA 2O8FA 4I2NA 1QB8A 4XX0A 2UXBF 1CQPA 3CJ4A 1TVKB 5SUHA 2Y4NA 2N3LA 1QE0A 5KU7A 1DUVG 2LQJA 4L2IB 4TL7A 5FOWA 3ORFA 5DM70 1HLWA 2OV8A 2IRYA 2R7AA 1H8EA 3QIPB 1N7IA 2XUAA 3VTAA 1FFSA 4WKRA 5E9JA 3AESB 1RAGB 2VAPA 4MI9A 2G40A 1W85B 1QTNB 4QPXA 2R8XA 4I1RA 4FOOA 5M7EA 2GHIA 4EA6A 1R3DA 1GGNA 1Y7IA 3WK9A 3IPAA 3IBSA 1Y6FA 1BEUB 5JNLA 1NF3A 4OFXA 1K1EA 4UJ3A 1AU9A 1HQ2A 3ZVKA 3AU9A 3IP0A 1V48A 1KQNA 5CG2A 1VJTA 3EDOA 1Q7LB 5KFBA 3DZ8A 4GYWA 4ETMA 3K70B 4KYZA 2C2HA 1SZCA 4Z1MA 3HADA 4L3OA 3FSGD 4WP3A 2F4VF 2X0JA 3P4YA 3K71B 5LMUB 3L93A 2QG9A 4M99A 4E1BA 2EBGA 4LZJA 2D59A 3G2NA 2WTBA 2Z5VA 2LU2A 4KO0A 3B2QA 4KL8S 4QU5A 4IQGA 4LXHA 1IN6A 3VQTA 5BQ5A 4A27A 1RAFB 1NU4A 3UDVA 3BQ0A 1Z6XA 3BKTA 2YYAA 2B4QA 2QLTA 1TLFA 4MV0A 1X1BA 5CEEA 1B8NA 1SPBP 2JCYA 4OXRA 3PX6A 2ZRBA 3TA0A 4Z0PA 2FB9A 5K20A 1I3CA 4JV5B 3NNNA 2RKWA 1V1RA 1DC3A 1HX7A 3VR4H 4EL0A 2FN3A 2X23A 1CQIB 3EUEA 2R1UA 1CY4A 3EQ9A 5EC8A 5FPHA 4WZBB 2R1VA 1B15A 1YDWA 3NUGA 1S9EB 3QKRA 4E7PA 1N7JA 4JL6A 4MUEA 1D6MA 2AN3A 5LBTA 3CLVA 1JZTA 3DU6A 4AG3A 3N6XA 4ZOQI 1RSCA 3PFBA 4DN6A 3PKJA 4KQCA 2HH9A 4UZEA 1NNLA 2XOKA 5HANA 3W5HA 1ZJ6A 1L5FA 1T1GA 5AVRA 2YVLA 2NYHA 1XZKA 1G6HA 1Q7EA 3ZHRA 4GMXA 4M1OA 4JYAF 3NHFA 2W2TA 2X15A 3K59A 3TX8A 1DWOA 1GPMA 1HE8B 4L08A 1ATZA 5I3CA 3D1QA 3H7HB 4WNAA 2FVQA 4KGZA 1MO3A 3GELA 4HS4A 1NIJA 3FCUB 1J39A 3EARA 4HEA9 1OFHA 3A9SA 4TNOA 2JC1A 2WYUA 2DHXA 4NF2A 1YUNA 2R00C 3RRXA 3UUWA 3H16A 4NCGA 4C0KA 3UR3C 4M95A 5FBKA 4BBJA 2WF9A 1F17A 3PO4A 3MZ0A 1EUZA 3AETB 3T6BA 4F1WA 1I6WA 4CU5A 2P4SA 1C2PA 2BGIA 3FPEA 4YCAA 2R44A 5HRCA 3R5SA 1DC6A 1P4GA 2LV8A 4FZRA 5HVHA 3LC1O 3C6BA 1LOUA 1XMBA 3TO8A 4INOA 3EFBA 1YLXA 3RBAA 1QGZA 2IIQA 4CQMA 2C0PA 1P9NA 4EZIA 4LGVA 3DKKA 1M76A 1RFGE 2EVZA 2X22A 3H5WA 1G8JA 2QLLA 3I9V1 2H52A 3IJEB 3V8PA 2OFGX 2V5HG 3CJRA 1ESMA 3PXCX 4C22A 1EETB 1IOVA 1NJ1A 1XZ8A 3TKLA 1WHSA 5F4ZA 2J59A 5J23A 1R8YA 5F9MA 4CL2A 4A8KA 4QATA 2CDQA 3FEYB 2QMUB 5K8OA 1IJFB 3TMAA 2YL2A 3THYB 3E18A 4H4DA 2CMGA 5LMNF 4FE7A 3HI4A 1W5EA 3QELA 2BANB 4ZDKA 1MG0A 3A1SA 2MYTA 2YKAA 4KH1B 3V4RA 1I3OA 2HXGA 2Q4RA 2HSGA 1FTNA 1MO6A 2ZM5A 4DR4B 2HBQB 3UNXA 2RGRA 4GM1A 2D41A 2WIGA 2C0QA 2EX1A 3AR8A 3OZGA 3JWHA 5AP9A 2IHJA 3GJTA 2GM3A 3OLXA 4DV1F 1Q1BA 1RXOB 4ZPTR 3HVTB 3KEMA 2VJAA 2EZ4A 1UJNA 5B6JA 1QHFA 1NDPA 4O5OA 4CDRA 2WTUA 5FT9A 1CHDA 1MN6A 3N70A 4DAOA 4X00A 1AV6A 4UBOA 5CLLA 1U5AA 3LQKA 3QVXA 2Y68A 2JGIA 3H84A 3BA6A 4B8ZA 4ONEA 2AV5A 4MRAA 4EVQA 1G2PA 3I53A 2ZH9A 3M2VA 2OMKA 4LWPA 4R2HA 4U1RA 5IUNC 2XKAA 5EP2A 4PRZA 2KJWA 3VR6H 4ZN1A 4RJTA 4QDXA 5F8HA 1M33A 5HIMA 5DJ5A 3PYXA 1JBEA 4QYSA 4RUAA 1L3BA 4ND8A 4DR7J 1USUA 1I6LA 1FB5A 2B2XA 3HA5A 1GKUB 4BP3A 3BBBA 2P9JA 2MPUA 1I9GA 1P8GA 3W05A 1ITPA 2IHTA 4PR3A 2RC6A 4YN3A 4NLXA 3JR7A 1E6MA 2V4QA 5C34B 2G1HA 1NH8A 4NBRA 4DLYA 3AT1B 1TD1A 2O1WA 3M9XA 1KEEA 2HJWA 3I58A 3EICA 2HIQA 1PQ4A 4O8ZA 1EK6A 2PA0A 2VG5A 2WA1A 2RBGA 3CONA 4JI1B 3KJEA 1AB5A 1YQQA 4YEAA 3HUTA 2HNYA 1I14A 1RQNA 4AF6A 1DKMA 4IR1A 2MYNA 1FDNA 2GGPA 1TKBA 1BOOA 4XWTA 4TMFA 3KG1A 2R7NA 4IM7A 3B6BA 4C29A 3ESZA 2COKA 1HNNA 4X4PA 1DX6A 2PMDA 4I4IA 2QP9X 1F9AA 3FJYA 3HO6A 2Y0BB 1L7NA 3RNOA 2QTCA 3KK2B 5IJAA 5BUCA 3ZTOA 2JHEA 4ZYZA 3R23A 4KR2A 4Z9YA 5AVJA 5B4TA 1WC4A 2CSXA 2LKZA 1TVKA 3HA7A 3P9SA 3R40A 1TQHA 2FJBB 1SC1B 4UHBA 2OD2A 5L4SA 4L2IA 3UPUA 4LOJA 5F8MA 2FZ4A 2ZJBA 2P4QA 3G82C 1ZOOA 2Z3VA 5LU9A 4CLLA 3QIPA 4Q2MA 1ZS6A 3AESA 1RAGA 2UUBB 3UICA 4DSKA 4G6ZA 3FCVA 1M7GA 3BRWD 2GSWA 2Y2UA 4BNDB 4XWWA 1W85A 1QTNA 4NA3A 3RRHA 4D8UA 4RTQA 2HBYB 1KI4A 3KG4A 1M0EA 3WLFA 2RGYA 4XA8A 5GAEU 2AJFE 2JGRA 4ALNA 4DBLC 1IJKA 1ANKA 3W5IA 2HEIA 3A6KA 1GSIA 4C9BA 3LUFA 2ZJZA 1XFDA 4LOLA 5HFNA 1D1PA 3SYNA 4E03A 5B2EA 3ITNA 1J0DA 4HX5A 1DJLA 4KXFB 2GJAA 2BI7A 3GX1A 4Q1AA 3H9CA 1YB2A 3T9NA 2DVIA 2YZNA 3NHWA 3VMFA 4Y2YA 5MF6A 2GWRA 4A8MP 5IYZB 3Q11A 5FUBA 2F8LA 3EMVA 4PG7A 1KFKB 1SURA 3CZCA 1U0TA 1SVIA 2KE5A 2Y1RI 2LKCA 4ZT4A 1UBLS 4D74A 2OV3A 5D8HB 3ASVA 3PPXA 4Q4CA 1RKIA 1DP4A 1RAFA 1L4HA 1YK0A 1G7CB 3FGNA 4A0GA 5AE2A 4CG0A 4KJXA 4NK4A 2NN3C 1RRVA 1TK2A 4UCFA 1SIBE 5KNDA 1JXMA 2Q0XA 4M94A 3CINA 4MWGA 3DQPA 1T3SA 1IULA 5ETOA 2JGDB 1CQIA 3QNUA 1DRVA 4JD5A 3MWJA 4WZBA 3E58A 5AO9A 2IV2X 5BWCA 1S9EA 4LJSA 2F65A 1PJ8A 1Q84A 3V80A 3D8NA 1DG9A 1I30A 2PZBA 1VLZA 3L9XA 3TSYA 2JFUA 1FEHA 3F2IA 4UXHA 1H5UA 5AKLA 1JDBB 4DLTA 4JI2B 2Z08A 1HL6A 3K8OE 3PUIA 2VAMA 1GGFA 4IRCA 4EG4A 3MAJA 5SZJA 3UAZA 1ZCZA 2QEQA 5HPYB 3G2KA 4KHRA 3N2EA 2YS6A 5GGYA 5KFVA 4OU4A 4B3RB 1S01A 1ZL0A 5JY6A 4RNOA 1PT6A 4DLAA 4GVLA 1Q83A 3OOSA 4RACA 3SZLA 3ZW9A 2R2UA 2X2FA 2ZB2A 4DV4J 3G8YA 1DMRA 1ZS9A 3R7AA 4D3YA 5KYVA 3D5MA 3OQ1A 2CLOB 2IYWA 2BRKA 3E03A 3M4JA 4P5EA 1RQGA 5IT9U 3UO0A 5J58A 3DLKA 4DV5B 4BIMA 1RAEA 3KDOA 4HR2A 4YR0A 4WZAB 1IBLB 5DYNA 3UW3A 4MW9A 3DULA 1KN6A 2CGEA 2N9UA 1GCAA 2CD9A 3K0AB 3QG1A 5IKEA 3VDXA 3LU1A 2ZAIA 4M1KA 5HS6A 3AINA 1JALA 3KQHA 2YTCA 1FX1A 3R75A 4LBWA 4EUFA 4BBPA 1CDOA 3C15B 3K96A 4KMRA 5DP2A 4M76B 4TMZA 3KQSA 1RM5A 4AL7A 2FZEA 2RKOA 2IVFB 2V03A 3BUSA 2FSUA 2FZCB 4G3IA 3ASZA 1Q7GA 1JH8A 4FFPA 2CRLA 2Y4OA 3LA6A 1NATA 3EE3A 4HNTA 4DMHA 4MR7B 3GIMA 3UC9A 1MX3A 1XV5A 3DGEC 1NSFA 1NKEA 2B5OA 3B1WA 2AL7A 3CUWA 2I2WA 2YKMB 5E2QA 5KFZA 1T05B 1GPLA 5C4GB 3K4PA 3QT6A 2DISA 2ASYA 2QMUA 1IJFA 2EHJA 2REQB 2BQ3A 1LVGA 2PYZA 3THYA 2FOLA 1CJKC 1YHQS 4EI9A 3SKVA 3W5JA 3ORSA 2BANA 4UW2A 4Q5IA 2Q5EA 1VQYA 1R74A 1Q77A 4KH1A 1OXUA 3OFNA 2IRXA 2GK6A 3ICOA 2JLYA 3P4UB 1KGSA 2OHDA 2HBQA 3HY4A 5AUPB 1WEKA 4DWOA 4GZ3A 4C08A 4YI3A 3HDJA 1VLHA 1GCUA 5E9QA 1YJ7A 2JI6A 1PV2A 4UATA 3FPKA 4ESOA 1S1WA 2A1TS 2ILTA 3JYHA 4IQFA 4E70A 4K46A 3OECA 4JI4F 2O2EA 1Y11A 1C0UB 1X7DA 4ZC8A 4DEVA 4UBLA 3HVTA 2C5LA 2AJ0A 2XE4A 2Y0SD 2JGFA 3GNTA 3V6LA 2EYQA 4HDHA 1YS9A 5ALXA 3IFSA 2ATXA 1PUXA 1PE0A 2XCOA 3M3PA 3KMQA 5D84A 3SSSA 5DOZA 5E2IA 7ADHA 1NBWB 2LPMA 5I7HA 3RFFA 2HK2A 2IP1A 3LVBA 2W6JA 3AEKB 4LHEA 1P0IA 2UZAA 1Y98A 3I3OA 2V2KA 1S9DA 4D9BA 4DDWA 4IDEA 1PFWA 4IXTA 1TQLA 5JG7A 3DCNA 1E59A 3ZUPA 2LNDA 1JV2B 2ZOFA 4BLSA 1XE3A 1QV9A 1CJUB 4WIIA 1DO0A 3SFUA 2RU9A 2CL7X 2FRXA 1QP7A 3ETDA 1QX4A 2PFSA 4WL0A 1YV9A 2UYOA 2QGFB 3BH6B 1V8OA 2O3JA 2G2OA 3VJKA 3H4TA 3AT1A 4E0BA 4PYKA 5CD4A 2QTHA 5HL7Q 1BFKA 3T61A 1H6CA 3EDYA 1FFWB 3P94A 4MYTA 2JATA 2VDPB 3AM5A 4L1KA 2HHVA 5J4LA 4KN9S 3SMZA 5IN5A 3SEZA 5AM4A 2KT3A 3F6SA 1CUBA 1O0BA 4YWHA 5HZKA 5LBIA 4PTLA 1DKNA 5JVDB 5A6WA 1P9WA 1PJ5A 2FPSA 4R51A 5I9TA 2B25A 4XW2A 3Q85A 3KQWA 4LFBJ 5BR8J 2HWWA 1WKBA 5L46A 2AXNA 3PUKA 4CIDA 3TBHA 2UUAF 1H4VB 3WJ2A 1CJMA 4HNVA 2IPXA 2Q0SA 2Y0BA 1YUBA 1CQMA 1YDGA 4HTFB 3OR1B 4KZKA 1FRIA 2CZGA 1WOYA 1RWNB 3KVNA 3L7PA 3EPKA 4WEOA 3TM5A 3MMBB 4O2LA 3W5XA 3FOZA 2V68A 3ADAC 1SC1A 4I99A 1C9YA 1T9XA 4DXDA 2SXLA 3EODA 3LFTA 1BE4A 1PKXA 4XWKA 3BBFA 1IC6A 1TCAA 1RKJA 4YRSA 1W8DA 4GPEA 4FU0A 5MN6A 2LD4A 2XLBA 4EMDA 1PJCA 1F51E 4DC1A 3WKDA 1O6GA 4W63A 4DDTA 4BNDA 2ZP1A 2NX2A 2MDTA 4BNWA 3LUKA 2GPSA 2HBYA 4UEQA 5EZYB 4C8KA 3HHLC 1U0HA 2R6FA 4OD0A 2HPZA 4LT6A 3AFNA 1JPVA 5KTKA 4B2PA 3LS2A 2OG2A 2W70A 4IWNA 1MU0A 5HCUA 3B1XA 1L5MA 3G0IA 4DCMA 1LPMA 5IYZA 4GWLA 1LNZA 1ZMRA 2UUOA 1IQ0A 1QK4A 2Y0DA 1T0TV 3ZZNA 4LSWA 5DNCA 1NASA 3S1AB 1FSPA 2YCLA 3OA0A 2WW4A 3RK1A 4Q66C 6FDRA 5CMLA 2QZPA 4F06A 4UNIA 3QJPA 2BE9B 1JLKA 4E5VA 1RCOB 3TBFA 5KYUB 1G7CA 5EWMB 1SXHA 2MQMA 1F8FA 3WB9A 4CIYA 2ZBCA 4CMJA 4N7JA 2ZH2A 3MUNA 3G2XA 4K0RA 3TCNA 3UKJA 2FJDB 1F14A 3AR2A 1IM8A 2L48A 4DMCA 1FSGA 2GDZA 2OUIA 4I8IA 3HABA 2JGDA 3WA7A 2PUEA 3I8OA 1PJSA 1IAQA 2EAUA 4K6FA 3MM5B 1QVFR 2C5GA 4OQZA 1YR9A 2QN3A 5G4DA 3UJ8A 3HKBB 4K6CA 3RSGA 1PR9A 4QSHA 2AF3C 4OUDB 1I51B 4ARAA 6GPBA 1M1UA 1GLNA 3J7Z5 4P38A 3WL8A 4UC0A 5JI2E 4B43A 4JMLA 5HCIA 1ROFA 5B3JA 4LJMA 4OUKX 3LH5A 4LJYA 1NYQA 4WZZA 3PKIA 2XNCA 1X39A 3JZMA 2ONYA 4KVGA 5KTRA 3F7NA 3EULA 1AMUA 2P3SA 4E4TA 4WK0B 1U2DC 1M5RA 3HSDA 3JQEA 2QJRA 3SEQA 1AUQA 1NT4A 2E18A 4KYUA 2FN4A 3BJZA 4N8EA 1UP4A 2GC8A 4K05A 2G9VA 4LWOA 1P7WA 2WU8A 3BKXA 3U1NA 2XBLA 1Y9OA 2PGLA 1H0RA 1Z17A 3V5NA 2VRNA 2M7SA 3KZOA 1ZPDA 3CPHA 6Q21A 1EX1A 2YJ5A 2PMEA 2I6QA 3FYUB 5JZVA 4YUVA 1IM4A 4WZAA 4KRXA 4I4LA 2CV1A 1TYBE 4II2A 2M70A 3K0AA 1FRXA 4DR6B 4OYZA 3GDWA 1L2TA 4JI0F 4ECAA 1ODIA 3I9OA 2HUNA 3IOBA 3C15A 2DFNA 1CEQA 4D9GA 3Q0IA 1TC1A 2IVFA 4X65B 3K5NA 2FZCA 2ZTSA 4XQCA 5ICGA 1UC9A 4HNGA 1NPKA 4LF7F 1FFEA 3IM9A 5K8IA 2DFVA 3RREA 1GA6A 2F63A 4BNHA 4TU9A 3AI2A 4MR7A 4E13A 3AR7A 3UVJA 2KB2A 3OAAA 3K09A 4ZO6A 4M86A 5FIUA 1Z4NA 3W9BA 4EJ0A 5E6SB 5EXEA 2YKMA 1UPXA 3OFGA 5FEMA 4BGUA 1T05A 5ITZB 2YWDA 3HY6A 3N9UC 1E3WB 2RBEA 3G23A 3QNWB 2XUDA 2REQA 1DZIA 4RVGA 2BELA 4X1IB 2FSFA 1V9LA 1DQ8A 4PR6A 4PLTA 4N9QA 4U6SA 3RAFC 3GPBA 1USIA 2QB5A 5KMGB 3MTGA 1A7AA 1FUEA 2DT5A 3P4UA 1YKSA 1W4ZA 4PLZA 3T9ZA 2FYTA 1Z7GA 5EIEA 3OF3A 3VU9B 4MVJF 2AC4A 4YUXA 3B6MA 2QQ5A 2VI5A 3DOUA 3BXGA 3WC4A 3RABA 5BSVA 4CM3A 4OX6A 2H65B 1JU9A 1C0UA 1JWAB 3OJXA 3BBLA 5K5EA 3A11A 1M2WA 2IM0A 4HDMB 1O2DA 1BMQB 2QTZA 1JNZB 1L7AA 2HW8A 1SC3B 3BM5A 4DV0F 4MI3A 1BRTA 2UZ3A 2M8DB 3LX5A 3HZHA 1X7GA 4PXBA 2I65A 2ZRLA 1SUIA 3N5BA 5J63A 3ECSA 2BOVA 4L5JA 4DV6B 2R2RA 2LECA 2OGSA 4C4WA 3O74A 3QRWA 3GG1A 4DHWA 1DY3A 1LBTA 3OU6A 3RTGA 4QTTB 3JZAA 2LIPA 3AEKA 4ZDWA 4LE2A 3ONEA 2Q28A 1ABBA 4CQ1A 1PK8A 3WTBA 4HAZA 4L3WA 1FMFA 1J22A 1YCDA 3EZ5A 3DW3X 2JBHA 1CJUA 1I4LD 3ER8A 4OKSA 4Z1MD 2J87A 3ICWA 4YUWA 3G2MA 2RHJA 2V98A 4X94A 2QGFA 4NLDA 3BH6A 3CSSA 4WFNQ 1S2NA 1X9WA 3GVPA 2DBQA 3ISNC 1ORVA 4I36A 3OXLA 1AZLA 1U11A 2B3DA 3VFDA 5GVQA 4C4OA 3ND9A 3TR5A 3WK6A 5H80A 1D03A 5GQSA 4DG9A 4WU2A 1MWYA 1JQLB 4E09A 3PNIA 2FP4B 1C7QA 2W7OA 3NNHA 2LYVA 1DAEA 5FYQA 2WUDA 4KRYA 1U0FA 4K4VA 5G0SA 1GXTA 2MSEB 3H13A 4AZWA 5JVDA 4W6QA 4V1CA 2VTDA 1D4FA 4AJEA 4KHMA 3BMXA 3IWLA 3NHMA 3K1TA 4TZ6A 3LTNC 2PFGA 3FBWA 3N2ZB 5EJMA 3G86A 4Y2PA 3ZJYA 1AO3A 4BN0A 2HQCA 3SP1A 3ZZYA 1NZFA 1WCIB 1JQAA 1BDHA 4HTFA 3OR1A 4HD8A 3IHWA 1RWNA 1UBGA 4QXOA 8LDHA 1W9MA 4F7WA 3MMBA 4QQNA 1F8YA 5EMLA 1P75A 2FOXA 2XOKD 3DOHA 4F2HA 2AFIE 1EG2A 2PZEA 2C2NA 3M6AA 2F5GA 3K15A 1C3XA 1ZAYA 2E1CA 2LQ5A 2C1EB 3SG0A 3N0TA 3DU5A 2XS5A 4EF4A 5ADHA 3P9KA 1M90T 3B6JA 1X86B 3H2HA 1MOSA 1L8AA 3PQ7A 3UPTA 4HLBA 3C6YA 4YHHB 1Q0ZA 3Q4GA 4K3VA 2BSAA 5EN1A 2IJNA 4CODB 1JVBA 4Y0FA 5EZYA 3LCRA 5A8WB 3D0OA 3F9CA 3H4MA 3PIDA 2YHUA 5DWQA 4S35A 3PNVA 3EMKA 1Y1TA 2XGGA 2FE1A 5EJ9A 4EK2A 5LQAA 4HFJA 4CMCA 1P6XA 3W4KA 3RVKA 2ECQA 5TARA 3I1FA 3DRSB 3ZCVA 1NW4A 3Q3VA 4ETIA 3IAAA 4QGGA 4E22A 1VSTA 1UWAA 2YVKA 3UMGA 5C46F 1PLJA 4KLZA 4CQMD 1SUQA 3ETNA 3S1AA 4KH0B 3BHJA 3MYYA 4GQBA 1DCFA 1VE3A 4G0QA 3F3KA 4BV2A 5KYUA 1Q8LA 3LYHA 4BJ3A 5EWMA 2DPYA 1THGA 4HLDA 4NZ9A 1VS3A 2XCUA 4PWUA 5F8JA 1JG7A 3R9IA 1CUVA 3U9SA 1A72A 4HX2A 2IYVA 1FQOA 1JTFA 5K8UA 4BO8A 3ZW8A 4RUKA 4DOZA 4UTGA 3PYGA 3W78A 3ZXIA 3CUUA 1SQGA 2ZANA 4MKHA 3ZZPA 2O2DA 1IG0A 3MM5A 4OYBA 1FMLA 3DOCA 2WJVA 1UAYA 4NPHA 3HKBA 2PK3A 4GR4A 4OUDA 4YB1P 3AWDA 1I51A 3BQNB 4RBUA 3KVRA 1G5HA 1XJ0A 2Y3YA 1S57A 1T5SA 2WNSA 4IZHA 3BSSA 2YNIB 3FA2A 3KHKA 1ZITA 5EMNA 4LY3A 5JJCA 4K7JA 5AJXA 3MWBA 3RS7A 2XNHA 4MARA 3AJEA 5KTTA 4PS1A 4OJYA 4RHEA 3RM3A 3PX7A 2B51A 1BFDA 1RISA 2P6RA 2RT3A 3H90A 3PXAA 4JV1A 2JFDA 2WEKA 1XR5A 4N0QA 1WF2A 4B9AA 3TZHA 1EX6A 3C45A 1YCFA 3DMTC 1F3FA 3IAXA 4Q45A 2Z8XA 1DL5A 4NA2A 3JXOA 3I9NA 3B5EA 4BB6A 1RXVA 2DWQA 1XNRJ 4K59A 1TAHA 3Q8RB 3DHNA 4FWTA 4H4KA 2WJZB 3MC1A 5HMLA 1A88A 2RQMA 1RRMA 2KXFA 2CYAA 3TG8A 1WSVA 3DWFA 2PHZA 3FYUA 5KCZA 3F4LA 2OVFA 4U8HA 4N39A 3O1HB 2Y1LB 2EDAA 3FWHA 5F51A 2HL6A 5GM1A 2JA1A 1XTJA 3HCNA 4C2AA 4KN6A 2FFHA 1JA9A 5E4FA 2CQ1A 1UVNA 4NPOA 5JXJA 3A3YA 1L1QA 4CQLB 2VF3A 5HSGA 3RBEA 4L85A 1ZWKA 5L7WA 3B48A 3MS4A 1DWUA 5HO4A 5AHOA 3THVA 1WF0A 3PKYA 1XZCA 3HM2A 3A31A 3PNKA 4P8RA 2JLAA 3ISZA 4RVCA 1ACMB 5J47A 1MC4A 5MN5A 1MR3F 1XZEA 3ABSB 4OK6A 4RGVA 2JZOA 3B13B 4WK4B 421PA 4EYIB 2CDBA 3PWSA 1HIYA 2WABA 2BMBA 1TM4E 3RSCA 4UUQA 5ITZA 5BRJA 4U7CA 3P9YA 1E3WA 1DCMA 4IOLA 5FI3A 3HYTA 2P90A 4DSNA 1C4KA 4QRIA 3KQPA 4LJRA 1GVNB 1JFFB 5JCOA 4E2XA 2IVYA 1T95A 4X1IA 1GGVA 2NTJA 5H3HA 4M55A 4EZ6A 1KIAA 3V1KA 4IOAQ 1DQRA 1TFRA 5KMGA