3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
1UJ4A 3O1LA 2QMWA 3KWMA 4R9NA 2PC6A 1VL1A 5HJ5A 3DHWC 2RI1A 1M0SA 3DHXA 2I9SA 1SC6A 1HOTA 2RQKA 5JJBA 4L4YA 3LWDA 3TUJC 2DT9A 4GO7X 2LQJA 2MDAA 3MTJA 3ENVA 3L7OA 3P96A 4X84A 2H9ZA 2J0XA 4GMKA 2WU1A 2RI0A 2RQMA 5IS2A 2F8MA 3NZEA 3NWPA 2W48A 1LKZA 3ENWA 1FS5A 4TM8A 2J0WA 2JHEA 1CD5A 3MWBA 3IBWA 2BKXA 4LUBA 3TX2A 2LVWA 3DC2A 2OKGA 3AB2B 4NMLA 3K5PA 2QMXA 1Y89A 3BXFA 3BXHA 1PSDA 4OQPA 1LK7A 2BKVA 1FQOA 5T41A 4GO5X 3OFEA 1UJ5A 3UW1A 3LUYA 3DDNA 2QSWA 3CH7A 2CDQA 3AB4B 2DTJA 1KS2A 1PBTA 1U8SA 3OC6A 2KO1A 4PWUA 3BXGA 3IXQA 3OFHA 3CEDA 1RWUA 4L51A 4L50A 2P9GA 3AAWB 4M8LA 1O8BA 1FS6A 1UJ6A 3OBIA 1LK5A 2ZHOA 3CSSA 1YGYA 1ZPVA 2GNPA 3HN6A 2RE1A 3EB9A 2P9CA 3E7FA 3ENQA 4TM7A 3W7BA 3EFBA 1HORA 3OFGA 4L5IA 5IT4A 1XTZA 5IT0A 2FGCA 3N0VA 3TUZC 1DEAA 4L4ZA 4IO1A 3ICOA 2J0EA 3KV1A 3NRBA 2QRRA 1YBAA 2NYIA 3LOUA 3BXEA 3E15A 1FSFA 3S1TA 1NE7A 2P9EA 1FRZA 3MAHA 3HHEA 3OFFA 1Y7PA 2O0MA 2JOQA 2R5FA 2F1FA 3LHIA 3U7JA 2PA3A 4OQQA 4R7TA 1JT9A 4GO1A 3TUIC 5FIIA 4L5JA
chains in the Genus database with same CATH superfamily
4KR0A 5H0IA 4Q7JB 2VNIA 4JGBA 4DCJA 3W1EA 1E62A 3PRKE 4NHOA 4KYTA 5L4SA 1EJ7L 1DQSA 3WQQA 1N5DA 3WI7A 3GL9A 2VPWA 1GU0A 2HHAA 2ZSKA 2JI7A 3Q8WA 4IG0A 2RK4A 3CW2C 1XU7A 1F6DA 1U4OA 1FYWA 3EUNA 4WVLA 2WLSA 5CBPB 3I83A 4QIWD 2WD8A 4IUDS 1GOTA 1UK7A 3DL2A 4N56A 4MB2A 2IP1A 1S6QB 1D2NA 1KSFX 1R4NA 3KEMA 3JRWA 3WLFA 1O4VA 3G2PA 1JF8A 1IG3A 3CLHA 4NQZA 1T9YA 4H9GA 1U6JA 4RY9A 5KFXA 1KJJA 1AURA 1GDHA 2J6TA 4ZVMA 4QRIA 4G5YA 2EW1A 4PVDA 4NBNA 2WK1A 5CAAA 1EUCA 3BJYA 4B3DA 1WV1A 4X71A 4X1YB 3R3YA 4RLHA 3OV7A 2NXJA 3V9AA 4B6EA 4DLWA 3TLCA 4MQEA 2BEUA 1F4VA 1FTWA 2HREA 1SCJB 4F6LA 3N5BA 2VNJA 3SIRA 1DAEA 1AUPA 3GFBA 3JQPA 1XRLA 4Y6IA 4P08A 4HWGA 2GPJA 2VJDA 1QDEA 2YNMD 2I2WA 3H5NA 3QP9A 4ID9A 3K8VA 1AYEA 3W9SA 1ZRSA 2G28A 1KQNA 4P81A 2LYVA 4AL7A 3BMOB 3ZZTA 4OK5A 3FWPA 2C3OA 4RIFA 1CUIA 2KH9A 4S05A 4NCGA 4LMPA 3TQEA 3NVAA 2XXJA 2UUTA 3DOMA 3GA0A 3P94A 3DMHA 4QT4A 3SQGA 2VFVA 3UB4A 2H48B 3ZV6A 3R7WA 5HZMA 4RSGA 4RZ2A 3I9V6 2O2YA 2B0JA 4QPNA 3UN1A 2H2HA 1NJXA 1E20A 4ZIWA 1E69A 3EFBA 5DSZA 1GL3A 5EGNA 2H54A 3E3NA 4B33A 2WJZB 4AF7A 2HSGA 3JB9k 4CRWB 1FDVA 4DCOA 3RRGA 1W1WA 5ELXA 5IANA 1N2HA 3PWTA 1E9EA 2IYWA 3L6CA 1OXMA 3F73A 4GKKJ 5IWAB 3DLEB 3D6NB 2GXUA 3KQVA 2XA2A 4FI3F 4JLSA 5DHSA 1QF7A 1U8WA 2MR5A 1MVNA 3AW8A 4G8CA 1EAYA 3DN9A 4X6LA 1YUMA 3KVNA 2D0IA 4MAKA 4R2LA 3RT7A 3GEGA 5EX0A 3F5MA 3ZZPA 1QP4A 2W43A 4ZVPA 3IQXA 4X94A 4OL8A 4HGNA 3UHFA 4LXTA 1MUUA 3C6XA 1NLKL 4ZP6A 4J0JA 4M88A 1URPA 3M30A 4RETA 3EWAA 2FMFA 4UHJA 4NMXA 1V8PA 4XLTA 3ZCTA 1U3DA 3PQ2A 3NHPA 2HNYB 4J0EA 4TSRA 2BVNA 2CV2A 4PXBA 3L77A 3UJDA 3JD4A 1SPBS 2YPYA 3G17A 2JJMA 4JFAA 5KOWA 5JO9A 3RT1A 1PR5A 3MUOA 4B7ZA 3EPHA 2XBUA 2I4TA 4FN4A 4YK7A 5AW9A 3U61B 3MWFA 1MU2B 5DYGA 3LQRA 2HPVA 3IVAA 1L7DA 2PMEA 4E1BA 3PHEA 1U1NA 3IPLA 2OV6A 1NVGA 4FKXA 3KR0A 5CJPA 1AKMA 1RADA 3NJ4A 3N6RA 1MW7A 4HS4A 1IB0A 5JFGA 3V80A 4DPMA 1V26A 2R7AA 4NH4A 1SV5B 2V3WA 1R16A 4C7OA 3FOEC 4AW9A 2LLZA 1PKXA 3E27A 1UZHA 3GZ4A 1GL9B 2ZIXA 4YR7A 1YC2A 2DPIA 1KORA 4O1HA 2MZTA 1SL1A 5AUNB 2AFVA 5HM8A 1MAHA 2BBSA 2QM8A 1VPEA 3DZCA 5EP2A 5I8ZA 5I9LA 4TL9A 3OL8A 4G84A 4FMPA 1IKVA 5LZ9A 4ZK6A 4MCHA 2Q0XA 3OEHA 1ATZA 4CTKA 2A7XA 4MWEA 3N3BC 5A0VA 1X7YA 2IYNA 2OPSB 1FXWF 4RADA 5JANA 5I7AA 4BJ3A 3EXAA 1H9AA 1RTTA 4GI2A 4DV1J 1QAOA 2QR2A 5AVJA 2G2YA 2F1FA 4W5JA 5AO9A 1RWNB 2HA4A 3GCGA 1I13A 3C8YA 1GG9A 3W5IA 3PRYA 5MGNA 2CFRA 1E58A 1HNZF 4ZRDA 4C1BA 2ACMA 5ECYA 4MRNA 4OYIA 3HM9A 3MAAC 3UXHA 3AESA 2ZBVA 2HHUA 4ZGGA 2QB5A 1YULA 2TSYB 1LI4A 4M5DA 2NXEA 5E7OB 5I4MA 5BWMA 3WDSA 3ND8A 2CJBA 1DKRA 3IUMA 3VJKA 3LFUA 1IMJA 4KQZA 3C1AA 1W93A 1Z39A 5A4FS 4H7PA 4M4SA 3UK6A 5KSZA 2GTHA 1MO6A 4JR2A 4C0LA 2OD4A 4QBKA 4WJLA 3KK1A 4G0YA 3IIJA 1Q0QA 3NGMA 1Z5UA 2QX6A 5HIKA 4N8DA 3SZRA 4BZQA 1SH7A 5HMWA 2ZZTA 1VMAA 1NT2A 4I1PA 3JQMA 2A4KA 4YCMA 5BQFA 3S1LA 3DD5A 2AKAB 1X5TA 4NOJA 3M9XA 4OEHA 3W1WA 4A6PA 3F8TA 1VBYA 3FMIA 2XMBA 4BU1A 4UD6A 1GEEA 4O4HA 2V03A 7ADHA 4RJVA 3MGBA 1OUMA 3QEMB 2ZYRA 1IUKA 4WW0A 3WO1A 4A8SA 1B43A 4BNMA 2HFUA 2BCJQ 3MMZA 3CCFA 1N3IA 4DL2A 2PFGA 2I3ZA 3MCVA 3UZUA 1AQIA 2O7NA 4X7BA 2KG1A 2XVZA 1G7TA 1AV7A 3KQKA 4WXWA 1ZEJA 4BKRA 4NG5A 5HS4A 1II9A 2FTKE 3H9UA 4AJ1A 4H3VA 4WCFC 3DJYA 2DJ5A 2GI4A 1L4YA 2ILVA 2W2KB 4E15A 1RTJB 1T2VA 1X7WA 4K6OA 3AUUA 1F2UA 2B34A 3Q8XB 4U8YA 5EY5B 4B2LA 3PNYA 1YWXA 2BPOA 2EAUA 3H2LA 1RB0A 3STXA 4UVGA 4KU4A 3EOZA 4N8NA 1FERA 3VAZA 1BH6A 2HIQA 1IZ0A 3I37X 1P1BA 1EDBA 1GGHA 4B9VA 5AXMA 3BMNB 4W6QA 1DTQB 1D4ZA 4MNTA 1P5RA 4ZC1A 2Q3LA 1Q5YA 1KC1A 3W8PA 3KDAA 1JEQA 3LXMA 3QT8A 2GB4A 3ERCA 3I28A 1GA6A 5CU7A 4XH9B 1LF0A 4DV4B 4UBIA 1IJFA 3AVUA 2MY8A 3AQOA 3KK1B 2ZH9A 3EEOA 4KP7A 3WJ1A 4MR8A 5AI4A 2FSVC 5BYRA 1IQUA 3SC4A 3ED1A 1BE0A 3HB5X 3T94A 4CQMB 4LT6A 4QHYA 2GW8A 1XMOJ 2GARA 3WOVA 4RQBA 3K5IA 5A02A 4CCWA 5EJFA 3T5TA 4XO0A 5JH7B 1S02A 1WKBA 3L6BA 2HRRA 4MUGA 4BFVA 4AECA 1UVNA 2R4QA 3UNYA 3AGPA 2FP4A 3I9FA 3OTWA 2Y92A 4JENA 5H9VA 1P2UA 5JH7F 5J2QB 1XQWA 2RKWA 3QHPA 2HWIA 5EE3A 5BURA 1VI5A 4L8VA 2ZEJA 1QWSA 4MUMA 5BMOA 2L41A 5GVSA 3V6KA 3PD0A 1FRNA 1AXRA 3I2GA 3ROMA 1ND6A 1OYDA 2BJVA 1K8YB 2AF3C 5KOXA 1SKUA 2ZKIA 3VR5H 3JQEA 1L5UA 4KVFA 4PLPA 4AJ4A 2C2NA 2HRZA 4Q16A 2F9LA 4FYXA 1DX4A 4IG9A 3FCCA 4HDRB 1J8VA 2JCXA 1FKOA 2Q27A 2VQEB 1KSGA 2XMWA 1YRTA 2JFFA 3DCNA 2UKDA 3OPMA 4DV2F 4FYKA 3HGQA 4H1TA 1PS0A 3UMRA 1HDCA 3K7EA 1Y3FE 4GIBA 2VQEF 1E2NA 4Q6WA 1YGYA 4PXYA 2HDNB 4XUDA 1ZN7A 2XW6A 4QJ5A 4RD4A 2FC9A 2DCUA 4EENA 1KAQA 2H54B 3BX1A 5ALUA 2I55A 3A6KA 2B25A 2CW5A 4QJ3A 2Q2NA 3RNLA 2CVQA 3P0RA 2XWSA 1XCGB 3GRVA 2X0NA 2E4YA 1TU0A 1JNRB 1J5EF 4RKEA 2AGPA 4IKEA 2B7CB 4WNCA 1SB9A 1QRAA 3OFVA 1N8NA 1C9YA 1E18A 3FCEA 2NPOA 2R1VB 2CUZA 4FCWA 1FX4A 5FUXA 3I45A 3O91A 1K75A 1VYUA 2CKDA 4A8JA 2QTWA 2VJPA 1KTQA 4M0PA 2J3JA 3D02A 2B1GA 2BVZA 4P86A 3HJAA 1QV6A 4K7QA 1S77D 4JJEA 2JD2A 1CJMA 2A0YA 4P1ZA 1DC8A 3NNHA 1Q1AA 3JRNA 2JDJA 4RABA 1Y82A 1TL4A 4LMRA 4NL4H 3LXXA 1ACJA 1M5KC 4JKYA 2ALJA 2MR6A 1OXVA 1CEEA 2J3MA 1S6OA 4GXQA 5AE2A 1VSQA 1HWKA 4H4CA 1M1UA 3T1HF 4H16A 3WNQA 1VGQA 4IRDA 4JUIA 4G8DA 5BV2P 2YVAA 3NYIA 1M2FA 3WK4A 1W7AA 1C8LA 4IS2A 3IAS9 3O73A 5IG2A 2Z2ZA 3JQAD 1NXIA 1KZGB 4JJZA 4BQPA 1ZK1A 5CLFA 4X91A 4M7OA 5K05A 1NLZA 4X65J 1PS9A 3D6VA 3BO3A 4NJEB 1YUBA 1NXXA 2J9XB 4ZOCA 3U9LA 1IZ8A 5AKYA 3FOZA 1UXGA 1GNSA 1P2FA 5IXYA 3HR8A 3AO0B 1M6YA 1XD2B 2HBZA 3PVCA 4PTYA 3SQOA 1QYWA 3HWX1 1ZVJA 5H9WA 5GZ6A 4RPJA 1HQEB 1W49A 2L9NA 3AY0A 2IA5A 4B08A 1T6YA 4CMBA 1ZCFA 2WIJA 2DRDA 4FYYB 4C7VA 4OAOA 3PYEA 1N2XA 4YXWD 4YRTA 5AVUA 3VALA 3HVUA 4LI0A 4NC9A 4CM6A 4TYPA 1NOKA 3BPSP 2QO3A 4NWIA 1O08A 2FFJA 1X8XA 1QHSA 3A1YG 2IEGA 3BWXA 4FINA 4RANA 1YL7A 3OL7A 5DN6A 5JALA 1RACB 2QSUA 1WUTA 5DG9A 2CXHA 3BGSA 1N1MA 3FD8A 3DHEA 3EQZA 4FGSA 2VJNA 4ZO9A 1G0NA 3IAM6 3VTFA 3C19A 3H5YA 3K09C 1AA9A 1C14A 5ETVA 2WVFA 1U3WA 1AJEA 4KLAA 5GAHI 1TZ0A 3T1HB 1R50A 1DHRA 3QVGB 5M3BA 1H1LA 4KGVA 1PI3A 4P6VF 4URHA 1TYDE 1QYXA 1Z73A 3A9CA 5B0CA 4Q00A 4L72B 1FJGJ 2XDQA 1YJAA 1GNQA 3USES 2E44A 3TD2A 5JC1A 3ZZYA 4CHTA 5ARCA 1KY2A 2NU8A 3V4OA 3O3MB 1ECCA 3UNGC 1OD6A 5AK3A 1KYZA 1H65A 4QRDA 3O2SB 4F8EA 3RGIA 1DO8A 2XITA 5KMGA 4AN4A 2CCGA 4DV1B 3BXXA 3PIIA 1EFHA 4YPOA 3RRMA 2RDJA 1Y7LA 4WI1A 3LC2O 1JLQA 4P73A 4EARA 2VVTA 3WB1A 1F3LA 2XULA 3ZZ1A 1FXRA 1YI0A 3WYEA 2HN9A 1Q4RA 3QJJA 2FG7C 5I9SA 3ITEA 1VRCA 4LJRA 3EPKA 3ZDBA 1HT3A 1OI3A 3UO8B 2W42A 4CQNA 1DEHA 2EYQA 5JJLA 3BSFA 5EL0A 3M32A 1XMOF 2AZDA 4USHA 4DDKA 1A2QA 1DRWA 3FHJA 3V55A 1ZKMA 2PWYA 1E6LA 1NXPA 1W5FA 3PPIA 4WXYB 3TX2A 2YZNA 5FWXA 1NR7A 2EWMA 5FBLB 1ZAVA 3CJ0A 1IVNA 4O4RA 1FX2A 2WVJA 2JIDA 3C70A 1O95A 5HROB 4YP5A 3HYTA 4RTJA 3JX9A 1FNMA 2FLKA 3JTEA 3ZHCA 2D41A 3OIUA 1H7WA 1PNVA 4U2BA 5DHQA 2IMWP 1Q50A 4MVJP 1H74A 4FXDA 2QTHA 1PE0A 2C5FA 2R8ZA 2DCUB 3UD5A 4G86A 1TYZA 4GZLA 1F8YA 2RVJA 4F50A 4KHPJ 4TROA 4O29A 3IOEA 2NPFA 1E6WA 4UNIA 4EQ6B 3USZA 4EKNB 2CXRA 1I3CA 3GVIA 1SUSA 4BE4A 1VA5A 4YDDB 1AQJA 1UWCA 5GINE 3WMEA 3K73O 1I0ZA 3TL3A 1IBCA 4FYVB 3FMFA 1AZLA 1A2KC 1ADJA 3RSSA 2FJUA 3PLNA 1SG6A 3JYPA 3ET6A 2Q5JA 4LYJA 3P8ZA 1PF7E 2OTCA 3RS0A 2AFRA 4CUZA 2GCFA 1RJJA 1PAUB 1ZA1A 9LDBA 4NYIR 4C7KA 5BNIA 3SSQA 1TL1A 4GLJA 2J3HA 4Q47A 3IDQA 4D9GA 3E58A 1FP4B 1TRHA 4YRNA 3GOQA 1A76A 1ZCZA 1UZUA 1EFVB 2A7QA 2ZXEA 1TF7A 2ZATA 5JW6A 4OQ4A 2GN1A 4B3TJ 1I80A 4OX6A 5TY0A 1OBCA 4F36A 4KQHA 2PGIA 3U4IA 5BRAA 3P6YC 1A71A 4ML3A 1DV2A 1XMOB 5EPEA 3RSFA 1FVQA 2OBXA 3VZHA 1RU2A 2QMYA 3KV3O 4AP6A 1DT5A 2RGAA 4XD7A 5E4TA 2D62A 3U4MA 3ZCVA 1BLUA 4TV8F 2VAXA 2OJ3A 4YY3B 5A8RA 2OPRA 1OZ0A 4LV5B 4FBTA 1IVZA 2FSIA 2UZ1A 3KLOA 1YZYA 3ZDAA 3NHMA 3BE5A 2ZRJA 1X0PA 4K26A 1H3DA 3Q9SA 4H7IA 2DNZA 4KEAA 5JEEA 1OHHD 2VRCD 3T7IA 1RAGB 3MB8A 1W4LA 3M6AA 3ILIA 3IT1A 3EZ7A 3P9QA 1YB7A 2F3PA 4HXEB 1NONA 4GBGA 4JP3A 4JOCA 1FJEB 2XMKA 2WR8A 3I3SR 2Q3PA 1X14A 3GLRA 2NN3C 5ALZA 4EJ6A 4WBNA 5L3QB 2ZRCA 5HVGA 4LHVA 3CM0A 4V02A 1XCBA 3HL0A 2DO4A 4LQCA 4HT3B 3Q6NA 3GJZA 5B37A 4HLQB 1NBOA 3L6RA 3TQTA 1XALA 5A5VA 4OI1A 5GY7A 1U7DA 1Z68A 4NHEA 4BU0A 4K9OA 3O4RA 2XV1A 1QH1B 2CQ3A 5FFFA 3GEIA 5AK6A 2J33A 4GLOA 5ETRA 5HSPA 1C30B 3PTZA 1FB5A 1DBIA 3L8YA 5FH9A 4YRIA 1IPEA 3S1TA 3LXRA 3QPIA 2DHHA 3DV0B 3RSOA 3CD5A 2A2DA 2FGOA 4W8OA 1QOQB 2I6FA 4IH6A 3L41A 5A05A 1LOUA 4U2GA 3U2QA 1NVKA 4D3FA 4NCXA 2GIRA 4N76A 3VNRA 4P22A 2G7ZA 2BFFA 1EVKA 4MVJE 3SXLA 4DCPA 5JQGF 3W9JA 3ITHA 4UFOA 1MG5A 3ESDA 7REQB 3BSSA 4HSEA 2JC3A 4RUKA 3IALA 5EQFA 3R6TA 3ZV5A 1P3Y1 2Z8YA 3DBOB 4TLCA 1MO3A 2NQ2C 4U6QA 1N32F 1FLAA 1KS2A 4ITUA 3CISA 3LWZA 4HATA 2ERYA 4RZQA 3LA8A 5IJ0B 4Q4HB 1E3QA 1YRYE 4ER3A 5IJ0A 2RD5C 3JD2A 4XK8C 4P2XA 2H31A 3CNHA 1LI5A 1O8CA 2AFHE 2IU6A 1TZ2A 1VG9B 5U4QA 2ASYA 4MW5A 2SNIE 4YA6A 1KI9A 4DCSA 2GHPA 4RWXA 3QNWB 2PX6A 2ZAYA 3UWDA 3VAKA 4YCCA 2CN1A 4BC9A 3QTBA 4C1NA 1WKLA 4JI5F 3ZBUA 2VD3A 5AUQA 3BJIC 3C6BA 4QJVA 1RR6A 4R41A 3NTLA 3T9EA 2WE7A 4DQRA 4BV8A 2B7CA 3FNQA 1E6MA 1VBFA 5T3YA 4ISCA 1GUFA 2J4CA 2N75A 4Q4HA 2QTZA 2M6RA 3PRHA 1EFCA 4CDRA 3CH4B 2HLUA 3AF2A 4E30A 1MIOB 1FMTA 3OTQA 4TLQA 1DKNA 4U5XA 2EFCB 2CKWA 2RARA 1ZU4A 3A9UA 1OKKA 4G5RA 2J5KA 1NBEB 1RWXB 2B4TO 4JB3A 3I3OA 3NGUA 2IPXA 3JSRA 2VK8A 1P81A 5K3CA 2BH9A 3S4YA 3I6PA 1R6XA 5A6VA 2ZH5A 3CX3A 4HQ0A 2E5JA 3UOWA 3DEZA 4K0RA 4E70A 1UVMA 2G40A 2J6SA 1JI3A 7AT1B 3K94A 1W52X 4U5QA 4NPCA 4E5UA 2HIYA 3Q7TA 5GAEI 2COEA 2V7GA 1NRIA 4KQ6A 3VPHA 4GM0A 4NLLA 4B74A 4GD3Q 3X3HA 3Q10A 2Y8YA 1ISIA 2QEXS 2KYXA 3S5UA 5SY6A 5B7WA 3NJRA 4QHTA 5KNCH 4NZ6A 4CIOA 2WF9A 3EGDA 3QOFA 4U8HA 1E99A 1C0LA 2QWXA 2YYZA 2QTFA 3JD1A 3N75A 1QZZA 2YJNA 1W76A 2COLA 3ILHA 2H9IA 3ZLVA 1JZSA 2ISQA 4G1CA 1B8NA 4EK2A 2Y05A 3RUDA 1HBNA 2XRYA 3LLVA 4Y2PA 5IEBA 2F3JA 5A4DA 3VVUA 3LYUA 2NXCA 2FP4B 1V9SA 3L1HA 4XTTA 2ACWA 3E7FA 2HGZA 5BO5A 1VSVA 5H5JA 1Q79A 1Y10A 3ISTA 1PGQA 4KUGA 3IYLW 3IP5A 5C8XA 4QO8A 1GQYA 3EZGA 4WKRA 3HJGA 3SPXA 1NDHA 5CW2A 3CONA 2DAPA 2Y1EA 3MQ2A 4LE2A 4Y9TA 2I2FA 3AY6A 2H5IB 2E5LF 2ZNYA 3WRYA 4LVNP 2Z2XA 3RYTC 3WLSA 2OPRB 4A47A 2BJ7A 4AM8A 3MDFA 3CMQA 2FUNB 5EWMB 2BANB 4B3TF 3MAAB 4Z0TA 3ELYA 3CRZA 3BMCB 5H02A 3QKSB 4PPDA 1JHQA 3QO9B 1IZYA 1XLTA 2QV7A 3ZTSA 3TLGA 1NPDA 5CYOA 4KQIA 4HRVA 4EG3A 3TLAA 4Z1MA 5BWLA 2KS6A 3W9YA 3CW9A 4U7WA 1K4KA 3GJ7A 4A23A 1OB5A 1H2HA 1G55A 2OZKA 1JMVA 4B6FA 3W2WA 3A8JA 1FSGA 5DV9A 3IV6A 4RORA 2VP6A 3PYDA 1E3SA 3DHYA 1J42A 8RUCA 1R3UA 5DXFA 1NYTA 2LKDA 4M7WA 2WUVA 3WSTA 5L8VA 3L82B 3UY4A 5L51A 3VSAA 3EX7C 3EZOA 1IM8A 1B1CA 2PU7A 2CEKA 1KJYA 4IIYA 4NI5A 3RUBL 3FRJA 1W30A 4CQMD 4DDUA 3PE4A 1YZKA 1X8JA 3DDWA 2KI5A 4X8LA 3KZKA 3CUEF 1DT3A 1FA9A 4P75A 4OSEA 4P98A 2GZOA 4FYDA 5FI3A 2GYUA 1VJ0A 4DLLA 4J29A 3HHKA 3RS8A 3IR6B 3B85A 4MWBA 3BN4A 1E3LA 2XHWA 4NYMQ 2REOA 5HP4A 2RGRA 1KTVA 2VP2A 4P32A 1GFIA 1BOOA 1RI5A 3QIPB 2G1HA 5D0HA 2V6IA 1U65A 4KKXB 1E2PA 5NLLA 2Q5FA 3VAYA 2ATCA 1IXZA 4M0EA 1SELA 1I5RA 3FSRA 1MGOA 3CEAA 3PP8A 4OVKA 5ALKA 5L3RA 1WG5A 1Q21A 3QBEA 5HGJA 1AK9A 3UH1A 4TKMA 4CFZA 4BATA 4DCMA 3O3CA 4DR7B 5AHKA 1X9WA 1QM9A 2IYAA 4OHFA 5J58A 4C0AC 4ZP8A 4UCXA 4LC0A 1KH2A 4G5HA 5JXHA 1T9HA 5I7RA 4LVOP 2GN8A 2JEFA 4WD3A 5H83A 3OJWA 4TKZA 3R5XA 2Q6TA 2HHCA 3DVLA 4G5QA 5FNZA 3IUPA 2QZSA 3GUZA 5K3SA 3NXKA 3BCRA 4LG1A 4MRRA 4FGZA 3D5QA 4WT7A 2DK2A 4KYVA 3UI3A 2VHVA 4OQMA 3QX3A 4NESA 4QQNA 3PDJA 3CJKA 4IIJF 4ED4A 4B6RA 3VAGA 1HQUA 2CL0X 4JLKA 2Y1GA 4C7QA 3FRYA 2IF2A 1HQKA 1XNQJ 1XX6A 4YXFA 1RZMA 4JB8A 2MHEA 3GCDA 3SQNA 1R4AA 2HURA 4Y1RA 1CJCA 3HD1A 5F5LA 2Q6LA 4PWYA 2V2ZA 4CNZA 3GEPA 3E0XA 1L5FA 3HCXA 5KG7A 2C4HA 5DIFA 4QULA 4NCHA 4FSXA 4KN5A 4NONA 3TSZA 4KTVE 1W29A 2W2OA 1S97A 2DFPA 3Q8UA 2O50A 2YY5A 5B1SA 4U3JA 4CIXA 3GWZA 3RHSA 5BWOA 2IYTA 4IIVA 1VE9A 5DP2A 5CLGA 2G80A 4RWWA 4S1NA 2J0XA 2DHDA 3RYIB 1AC5A 5ALXA 2F7VA 5JVDA 2MQ8A 1HNXJ 3IP3A 5LSRA 3UOGA 2CNNB 1EEHA 4WFJA 3ZWWA 2QLJB 1N2CB 1BQ4A 1P2DA 4AZWA 2P2CA 4PNPA 4ZPJA 4CF6A 1E8NA 4MKRA 5EJ8A 5DI9A 2V74B 5A0YB 1UWAA 4LSZB 4M49A 1GZ3A 4XPIB 3DE4X 3P97A 3JYQA 1YIAA 2GHQA 5A3SA 2CDBA 4MFBA 3QG1A 1ZIDA 1F8UA 4LSGA 4FQ7A 3D5EA 2BEVA 4ED1A 1LVHA 1BRMA 3BXEA 1DCKA 5JSFA 1ONOA 1NK7A 3EGWA 1R15A 4B47A 2BKNA 3KTAA 1S1CA 2ZJ7A 1BDBA 1DDIA 2Y67A 3H9GA 4PO1A 4A8JB 2RHBA 4K4ZA 1MROB 1FRVA 4UOEA 4U7FA 4CM4A 4FX5A 3GV5B 3GIIA 3VPGA 2EBHX 2VG7A 2PFDA 1LV5A 1VDZA 2F5GA 1TVKA 2X13A 3EN0A 2HYIB 2VDQB 2DMRA 5LOQA 4O44A 4KO2S 4KO8A 1SD5A 4QBUA 3T5JA 3IBCB 2HJSA 4KQEA 4YP6A 4FDAA 3MWGA 5C24B 4BCCA 2JARA 4LR7A 5CMLA 3VNSA 2HEGA 2B3TB 3QWAA 4OYYA 3L3BA 1DG3A 1V37A 2FKAA 3LZ6A 2F9JA 1MHPA 1L8OA 4FGWA 4EYHB 5JHGB 4LSNA 2IIHA 1MBZA 4F4CA 3DBIA 1EETA 2P62A 3DXXA 3C5VA 3UV6A 2WI8A 5G41A 3BDAA 4TYBA 1WVMA 5KFAA 2FPMA 3LE8A 4CN9A 2O2JA 2RG7A 4JL5A 1IBLJ 4X1KA 4MI9A 1CUHA 1IHXA 4MPJA 2R87A 1EKSA 1YRXA 1WB9A 3D6MA 5CIQA 4HB2A 4RW6B 5LKRA 1V4VA 1UJBA 4DV0J 2BISA 1PZMA 1IH8A 5LOVA 2QEQA 2DT5A 5BYBA 3TTWA 4IEEA 3GFZA 4R1NA 2WHPA 1R10A 3DR3A 4PZAA 1CD5A 1MIHA 1KOJA 2VT2A 3RFVA 1IONA 4N3GA 1F9FA 4CVNA 3VVLA 4M9XA 2AX1A 3AKDA 3R9XB 2QA5A 4C2UA 3HKDA 1FJ7A 3N8HA 1J49A 1U11A 3IDOA 2Q1TA 2D9OA 4IFVB 4L8GA 2WMDA 2O8VA 3T9FA 2C29D 4V3CA 2Y1RI 1EQMA 1M2WA 2C77A 4ALJA 1FKOB 4JU9A 4M89A 3GFQA 1PGZA 4G3IA 1J0XO 1ZA2B 2H1CA 4W9NC 4QD3A 4DSLA 1FP7A 4HKTA 1OLSA 5JSUA 4JJIA 5KVCA 4DGSA 2J7KA 1COWD 1D0VA 2O0HA 4BWVA 1VGYA 1Z82A 1NXWA 4CQMA 3HCOA 4PQYA 4W7IA 1FFGB 2HS3A 3M30B 1VQOS 1QVVA 2O3TA 4DLUA 2WPDA 2VHUA 1A1VA 3A6PC 3LGSA 4EDFA 3HYCA 4W4MA 3SSMA 1SXJB 1U6KA 4F26A 4WYLA 2OL4A 4ALNA 4Q43A 2XCQA 4Q3AA 5KTRA 4EZBA 3BQ9A 3L46A 1X7XB 2O57A 1EVYA 3SJAA 1ZXXA 4B79A 5T3UA 3GLIB 1RBZA 3IBGA 1W1UA 5ENVA 3NBFA 1WCIB 3AT1B 1I6LA 3ED5A 2Q9UA 2GQQA 1X1BA 2YJ6A 2MKJA 1Q95A 3TDMA 1JEJA 2BH2A 1XK7A 2BIFA 2IPLA 3C74A 3LQ1A 2I66A 4Q9NA 1A7GE 2CHEA 3LRTA 2XB9A 3GJQA 1KE2A 2HDWA 1PJTA 4WBFA 4GL4A 2R7XA 2UDPA 1P74A 2GEFA 4K6MA 1KYTA 1RQNA 1GTHA 5JSZA 5FWDA 3EEQA 3CD7A 5G0VA 821PA 3W0LB 1D09B 1XZIA 1GYQA 4F7DA 1U09A 5B0GA 4GP9A 2GPWA 2ON6A 2BQ3A 4C6RA 4LTNA 1LBEA 4PE5B 4KR0B 2ZWMA 3CE9A 2GK3A 2QX7A 3I4HX 4RVOA 5CYGA 1EB0A 2ZTSA 3PQ4A 4PN7A 4FFSA 1E2HA 1NH8A 3JALB 3KDSE 5B7GA 4XDGA 3U16A 1CRPA 1M6VA 1RKVA 1T9GS 3AD7C 3GRZA 1L5SA 1RT2A 1E1DA 4RFVA 2ODWA 1M2VA 5E9WA 4B75A 1V3QE 1ABFA 4F56A 4HR2A 2XSFA 1XL0A 2DWPA 2ZK7A 4R5MA 3NP5A 2BDEA 2V7UA 1JNYA 2E6UX 1GDDA 5KTTA 1N2EA 4EABA 4OBWA 1E2FA 1IG0A 3OPXA 5ECDA 5JAUA 1RT6B 1BE6A 4EVIA 2D69A 3C6ZA 3LT2A 3KKMA 3MEDB 5HL7Q 1NJIT 2JVKA 3GDOA 3H0EA 5GVQA 5FUBA 3O4GA 2WSLA 3SU8A 2UVPB 3ZGXA 3SXJA 4Q3LA 1HNXF 3UD4P 4YFYA 1CS4B 4AULA 4JIMA 1RHJA 1ULZA 2X4GA 3FTNA 2VYND 2JW5A 2MSCB 2X3YA 3C2QA 2Y1XA 4BVBA 2W2PP 3NBYC 2JG3A 1WE2A 2XRFA 5CB4F 4JJ6A 3ZU3A 2R7QA 1FRMA 1NZ8A 1T0BA 2QRPA 3I9KA 3AONB 4NDNE 2Y0BA 5AI5A 1EE1A 5HYVA 4OYOA 2F1RA 1M76A 3L9ZA 4MQFB 4ZQFA 5DTQA 2MYPA 3LP0B 4X4NA 3NBUA 4BKUA 5H80A 3QUBA 3H8SA 2OPPA 3MELA 4JV5J 1ZW1A 3KYJB 1UMJA 3ZHRA 3HUFA 1FZQA 1ISFA 3K32A 3UMSA 5A1TA 2HF2A 3CWZA 2C2WA 1P29A 3V2UC 4XIGS 4BNKA 4I66A 4OUDA 4EO9A 4K6FA 1A9SA 2M52A 1IB6A 1ZSNA 1PGPA 4JODA 2HADA 1UCNA 2J30A 4DR7F 2CXEA 4TS3A 1S01A 5IWAF 3VPSA 3K0HA 4LBPA 3T6JA 3M6IA 3S55A 1TT5A 3SLRA 1WY7A 2OVFA 5BQOA 1N6QA 1NG1A 2ZAMA 1BCSB 1N0IA 2HOQA 1Z0UA 1U0NA 3X1KA 2QLLA 4XYEA 4KE7A 5AIBA 4ZEOA 3K35A 3HXLA 1RGVA 4DLKA 4IDHA 2GT1A 1ONBA 3A14A 2WV7A 3OURA 4LRDA 1ENPA 2RAUA 1OIVA 2BDPA 1Z5VA 4PFSA 2XT9A 2P6RA 5GJWC 4X45A 2Z1MA 1WOOA 1BGXT 1ICEB 3NBQA 1C1BA 3KQMA 1F1BB 5H8WA 1NQVA 2GZ1A 3AI1A 1JQKA 1ZAYA 3AI3A 1DIOB 5EUHA 4BEJA 1XMIA 4M1ZA 3RRNA 5EVJA 1PJ7A 4Y6QA 5JMPA 4BO6A 4WZBA 4BECA 3EULA 4LX8A 5FBZA 5DLQC 1WKCA 2NYVA 3HT0A 2WNIA 3BIXA 5HUQA 3IP8A 2P3OA 5DTEA 2VJVA 3UBTA 3R3HA 1DFDA 5KJEA 1SXPA 2Q5HA 3MR7A 1F0NA 1SO8A 3DUFA 2F67A 4P8RA 1U2EA 2IH5A 3I23A 2F8SA 3K9QO 1DEKA 4P4UA 3TOVA 3CIZA 1SQ0A 5C24A 4G09A 1BXZA 2Z6AA 5MLCV 2JIMA 2CJXB 4MUNA 4W1PA 2CMGA 4B9NA 5AM1A 2D5AA 2D6FA 5DNYB 1KNXA 3MBOA 1M34E 4Q12A 1QHHB 2GVZC 4S2EA 2RGNA 4MV7A 3AF6A 4X1YA 4JOQA 3V6JA 5C51B 2WFAA 4IHQA 4GDFA 3UHJA 4CEIB 2QUZA 1TVEA 3DCJA 1YKGA 2XQJA 5ANRB 2QAGA 2ZIWB 1VQSA 4OLHA 3KXLA 4KFUA 3C14C 3HNRA 1KONA 1WMDA 4XZ3A 3IMQJ 1YLXA 2CVEA 6Q21A 1ZAKA 1PSZA 1JUDA 4ZCTA 3NOOA 1SQ5A 1N34B 3OVAA 3CN7A 4JEHA 3JQ9C 4UDOA 4C98A 3AR7A 4AICA 1OFUX 5EP1A 4JBCA 4QPTA 2G07A 5LUAA 1K1QA 2IS4A 4UEOA 3R5GA 1W19A 2OLEA 4D74A 1JZQA 4RZHA 4KXVA 2QIPA 3LZDA 1CUDA 4ZODA 3RAQA 4Y67A 3N0VA 3W8NA 4I5EA 1M5PC 4HX5A 3ZE1B 4MHTA 3G6XA 8MHTA 3JQ8B 4BX3A 4WK4B 5CVUA 3LUFA 1MAUA 2J6CA 1GUYA 3KDNA 2ZBGA 3TRGA 1T8WA 5BR7A 2NO6A 3K70C 1OY9A 4LN1A 2KFYA 3KALA 3GE9A 3KDPA 1HXHA 3P2YA 1DTQA 2MQOA 1L7EA 3P2KA 5IJAA 3BJMA 2Q7DA 3PYGA 4K8OA 2GF2A 1V3TA 4KBIA 4N7MA 3FCOA 3O83A 5KQSA 1SQ6A 1DLIA 4JQZA 3M6FA 1P0PA 5J2MA 1F38A 2X23A 1KU6A 4LBHA 2LR0A 4IJVA 1CVLA 4UTXA 2AN1A 5IN4A 1WABA 3I6YA 2W70A 2BY4A 1M8JA 2A2ZA 1S12A 1N25A 4B9MA 2DPMA 4Q66C 1NMZA 4RJLA 2JLRA 3TNLA 1D6MA 3H9EO 2ZAGA 2VDHA 1OPZA 4C3OB 1P4GA 3ADAC 5HVHA 1A27A 4ZGWA 1MX9A 1TKBA 2J0SD 2R3VA 3CZRA 2AUNA 4B3BA 5D3KA 3RW7A 2R1ZA 4X1OA 1SVIA 3PGA1 2ZWIA 1EQUA 3WQHA 1ZHFA 2G76A 2AMLA 3RVRA 5SY9A 2OILA 3NBPA 4TT3D 2QYCA 1PLLA 2TMKA 3WX4A 2XM3A 3BGWA 4JYMA 5D00A 4DMCA 3KP1A 1VCHA 4V19J 1N3YA 3NS5A 1HL7A 4LYAA 5J1SB 1TKDA 4PICA 3UC9A 2W9CB 2R5WA 5H9FK 2F3TA 3DOHA 3VZRA 2H06A 2N7YA 3VHRA 1K63A 1KFKB 3J7YI 2QR5A 1TUIA 4DIBA 2EWWA 3IP9A 2OV4A 4TTIA 1AKWA 3CF2A 4I7EA 3H3FA 4N5LA 3N74A 3GJSB 4LCEA 1X4HA 3LHSA 5IN5A 4H1HA 1VGVA 1F3FA 1CDEA 3OUYB 1PTJA 1XTTA 4J6EA 2ZOMA 4IXTA 2AA3A 4ECRA 2JA2A 3MC1A 2MQMA 3NIFB 2NOAA 5D84A 1PDWA 3DMTA 2O5RA 2P27A 1SKAA 3HHLB 4LF8F 3LNTA 1N78A 3R5TA 2HO5A 4I3GA 3D7LA 2POCA 1Z3CA 4QZVA 5C25B 4E2YA 5ED4A 3HB1A 4DLAA 3WIEA 2E4ZA 2X7XA 3L1IA 3M33A 4DXAA 1Q92A 5A6SB 5SY4A 1QH1A 4YFUA 1V9OA 2Z56B 1ZS9A 5LBTA 3DOKA 1EIZA 3LUHA 4ADSG 3GZNA 1NNI1 4IMJB 4LISA 1H4TA 1C0UB 1EVEA 5AHWA 3DAGA 3IVCA 4KN8A 2XSJB 1QE3A 4CLXA 1NQOA 4RW4B 3FC9A 2H4XA 3L8GA 5FQOA 3T7DA 1I3LA 4N7RA 3MPOA 3OFKA 1KWKA 2YZKA 4GYWA 1C8BA 5KYYA 2ZB2A 3ILJA 1H42A 3S29A 3TDKA 3T3PB 3PZRA 3TEJA 3BE4A 4TQRA 1R64A 3M9OB 1MN7A 1FDUA 1OLXA 5EWGA 2FB9A 3CTMA 3OKAA 3VDMA 5F3WB 2G9QA 1K8AT 4RAOA 4GYJA 1JJ4A 3PDCA 2OEMA 2V54A 1YA8A 1JDJA 4AC9A 2DWUA 2DBVO 5IAOA 4IOMA 4NASA 2XNHA 4JITA 2AUTA 1XCPA 1GCGA 3QTTA 1W36D 4XWWA 2X1BA 5IBPA 1VCNA 1H2EA 2FPWA 3KZNA 5H3HA 5EPOA 3SSNA 3WYCA 1V3SA 4R1UA 2OLJA 5DCYA 2W9BA 4RPGA 5IBQA 3AMVA 3RQIA 1YCFA 2OEJA 2ZFUA 2MSDB 1SQFA 2HI0A 3X3UA 4MT1A 4TTAA 4Y2GA 2JDID 4G4SP 3TD9A 3BMCA 1EH5A 1T05B 3QI2A 4Q4LA 5LVAA 3T0FA 4QEDA 4QVKA 4DJFC 5ALHA 4YTEA 1EFRD 1ABBA 3O8OA 1ZTWA 5FCDA 5EPUA 4XUCA 3SJUA 4HDSA 3RANA 1NEEA 5JSQA 3KOMA 3BA1A 4FPIA 3E0QA 2IXEA 1I9CA 4D2IA 2DGTA 5E41A 2HV8A 3CY6A 1RWUA 2QVYX 5IARA 1VLJA 2Q0QA 4L0CA 4XPCA 1L7RA 4RK5A 3OIFA 3PW0A 2I2YA 1UK8A 2A9FA 3T3FA 4WIIA 2DEUA 2HSEA 5LQNA 2RE1A 1M8GA 2EDCA 1HORA 3HE3A 1ULTA 2NZ2A 4D98A 3LDHA 2WFLB 1TVRB 1P2GA 1IY0A 4ZS6A 2AXQA 3BL8A 3GNTA 3L43A 4TV9F 1PTKA 3WNZA 3PFIA 4I8DA 5KFKA 4MI6A 3B8HA 5B1IA 3LUBA 4QE3A 3BK1A 1XV5A 2IRWA 2P9TA 2C97A 2V3VA 2GSDA 4LCBA 1NKEA 4GP6A 4ENUA 4M5HA 4M9SA 4BO1A 2F4VF 1VJDA 2HW8A 4C9DA 3BK7A 5F9MA 2LA4A 1HO3A 2DUWA 1KQPA 3I05A 1XYGA 2F6RA 3FPGA 2KBEA 2V6FA 3NOQA 5DRTA 9MHTA 4H27A 1R8XA 3ZY3A 2IYVA 3HDGA 1I3OA 1UJMA 3OETA 1OAOC 3DOLA 5CB8A 4KV9A 2Q3DA 3UWKA 5K0LA 4ES1A 5AJHA 5BT8A 2I4LA 5DM7Q 2YV3A 2HPUA 2DTEA 3DOJA 4GOJA 4CMEC 5FUWA 4LVOA 1CIVA 4G0ZA 4ARCA 3Q8PB 1R27A 2WB2A 2J3IA 2B5WA 3L8FA 3L6OO 3ASZA 4FXPA 1N54B 1N6NA 4GOKA 2QN8A 4JEIA 4J1NA 2GVNA 3OTOF 1SKQA 1WW8A 4M1SA 4RBTA 2ZH7A 5EKXA 2AGVA 4IDNA 5HI7A 3H8VA 3PJDA 2PYZA 1Q53A 1NBAA 1A9XB 3K6RA 4UNRA 5I4KA 2YWJA 5DHUA 9GPBA 1OYYA 3GLFA 1DKPA 2P9QA 2Z2YA 2FZCA 2B36A 1FSZA 2J5RA 2QRLA 1ZNZA 2A58A 2JVIA 3KC2A 4DEXA 3DM2B 2H5JB 4YUVA 2ZQ5A 1NPKA 2V4MA 3NALA 3MWBA 4P3PA 4CLOB 1HZZA 4RM2A 3KHTA 1FVOA 4ZOEA 2ZRFA 2QP9X 3MT9A 3GUVA 3CLVA 1HT1E 4P2GA 4GGOA 5ALPA 3FFIB 3QLEA 2MGZB 3UMGA 1T6XA 2BLNA 4DDWA 2XMZA 1SUWA 2P90A 3LY9A 4ECAA 2H17A 1GZDA 1RQRA 2OCIA 4LJSA 4M1QA 1FFSA 4PFKA 5CPFA 1V5VA 1YAJA 1RI1A 5PGMA 1RHKB 2XLCA 4U95A 1LNQA 1J97A 3FPAA 3WIVA 2M8DB 2VG8A 2O2IA 4IHJF 3O8QB 2NW6A 3DHXA 2UU9J 2D5CA 3COJA 2YV5A 2A3RA 2Z5FA 3ZGLA 1WDMA 2GMLA 4F91B 3BF8A 4JWTA 3QJGA 1UDRA 2FUKA 3BKTA 3ZGVA 1GQFA 3DO8A 2OEPA 3RR2A 3G5AA 3JARB 1ABEA 1XRPA 3ETCA 4WFZA 3HWSA 2FW0A 2B7LA 4DSKA 5IYZF 4FYYA 3K9FC 2CDQA 3HFKA 1MVLA 4ILEA 4EW1A 2Z8YM 4P52A 2HNZA 1EP1B 3TRIA 1BXRB 2IYFA 2IVYA 4WASA 2ZYTX 2R42A 3QELA 2BEJA 4WZAE 1BMTA 4XAQA 3RRYA 3MMAA 3QXJA 1NFQA 4YRMA 3QT7A 2ZOSA 2CJWB 2V6AA 1UWBA 2POKA 1DAPA 2XMVA 2E5GA 2KB2A 3ER6A 4XVUA 4I6GA 2XLIA 3KXKA 4PYLA 2ZM6B 3I8XA 3I6MA 5HCUA 2HVDA 2YW9A 2W71A 4ENWA 2HB6A 3LUCA 3STWA 1XZAA 5F8NA 2KM1A 4DRYA 1ZH4A 5JECA 3OCJA 4RVSA 2X9NA 3H13A 1B8VA 1YRWA 3QLUC 5IBRA 4JLBA 1XBWA 3SHVA 3RFXA 1CZUA 3WWYA 1PJ2A 5C2GA 1X4BA 2YVQA 1DARA 3PKIA 1QDUA 2MGZA 2HV9A 5I7WA 5C8YB 3AYXB 2ZYAA 4LC9A 1PN3A 1AX9A 4DMFA 4GO5X 1BEZA 3NIBA 2YVLA 3S99A 3SFZA 1RMTA 2ZJ3A 1QP8A 4O4JB 5MFPA 3B38A 4DUPA 3T5DA 4LJYA 1NHWA 3LUJA 3DBRA 4YN3B 4MUBA 3C7DB 5IX8A 1V1JA 2LXFA 2QLTA 1P1FA 4LV8B 4MGEA 1EA7A 1DJPA 3EVFA 4GS5A 5DT2A 1AUSL 4RC9A 2NTJA 4NRTA 3Q2SC 3TXAA 4EGLA 3NYRA 5J4HA 1R7RA 4YRQA 2BMEA 1B6GA 2FPIB 4NA1A 3X1ZA 1ZBDA 1J8FA 1TEZA 4U2KA 2BFDB 4W5NA 1GCUA 1W2GA 1NRJB 2FE4A 2FKNA 4DV6B 3A1EA 3PENA 2GCNA 3ZOKA 2R00A 4PHHA 3HUTA 2CJPA 3GLFE 5CM8B 1YVDA 3LP1A 4O25A 4D97A 4BVJA 4M53A 2QZ8A 4CMEA 1CZKA 1WQ1R 5C5EA 3US5A 2J9ZB 1SBRA 3E51A 2KN4A 2C31A 2FHPA 4FOSA 4YS2A 3GJTB 4DQVA 3AB2B 4DLSA 1HYSA 1MZPA 4G56A 3CTRA 1J33A 5IT5A 2WP0A 2E82A 4Y6OA 4F12A 2UUAF 5T4FA 3I01A 2NLOA 3ZWNA 1X4AA 4RSHA 5CXXA 1IXKA 1URRA 3CWCA 1GNLA 4P4LA 1Z4OA 4DKJA 4RH1A 4PQAA 4USTA 2AHRA 3A7EA 4C3KA 1I4TD 2VBXA 4KLCA 5A62A 2D3WA 4R3NA 4YR2A 2NZWA 2X5NA 2PZAA 3TE6A 2C54A 2YWDA 4MMYB 3G8AA 1HWIA 4KGXB 2VUIB 2JLXA 4I5IA 3E7PA 3KOZA 4EKYA 3BSAA 2V0NA 2HGSA 3U48A 3EH1A 1J70A 2DFKB 2D1SA 4AWXA 1YVPA 3LDFA 2HFZA 5LB2A 2VYFA 2VFUA 2UZAA 2EBWA 2ECPA 2PXHA 1YC5A 1NY5A 1TI7A 2WW4A 2AG8A 3W8DA 4MQLA 3DRPB 1C9EA 4ELTA 1EVLA 3LKDA 2DXIA 2VBFA 3HM2A 5F1YA 2PT9A 2W2QA 3IXQA 3OFHA 4YIHA 4NPHA 1RRPA 3VR4A 2HGMA 3FZ2A 1WU7A 2H4HA 5EIEA 4RM3A 4JX9A 1GQRA 4IIJB 4KHPF 4IQFA 2QIFA 1XRQA 4WN3A 1GPYA 4G9EA 3NKYA 3FUVA 1GTG1 1WW3A 2DQ4A 1QR6A 3G5TA 1TEXA 5MHTA 4FZJA 4YECA 2WYOA 4N54A 3IPYA 1UKVY 5IDYA 1AGXA 3PE6A 3HA3A 1BJTA 4TMVA 3PSHA 4CDNA 1HFJA 1OTHA 2NO7A 3UPTA 3GT3A 4DVJA 3F78A 1Q1QA 1IZ9A 1WF6A 5TS2A 3C3EA 1QHXA 3GT7A 3KG4A 2Z58A 1PUXA 3ZNNA 4ILKA 4NQRA 4BVKA 4A2CA 3P9XA 1JFSA 4UDYX 5KINB 1Q0SA 3DKIA 2I22A 5K8PA 4DF3A 5CB4B 4TM8A 5B7PA 2CIMA 2G0TA 4UNNA 4YXWA 1HYBA 5LQMA 3C24A 2V68A 4AUNA 3F9CA 1DCFA 1R5BA 1FMCA 4OYZA 3K2BA 4A1OA 1VB5A 2W2QP 4ZOLB 3VYRB 1Z8HA 2XSJA 2A9PA 4K8RB 2CZQA 1YSCA 1N5QA 4CIAA 2PD6A 1B0AA 5B4TA 4HNTA 4CLWA 5B4VA 1ZD1A 4G0UA 5LT5A 1LRJA 3MECA 2EFVA 4D99A 4J4HA 3LSTA 4URWR 3V9PA 1RBYA 2VHCA 2XMUA 3CCUS 4DOZA 2XB2D 4MO2A 3B2EA 4KQCA 1S4MA 4BY9E 4EL0A 4L4RA 1XA4A 2PKEA 3QTLA 1HT2E 4EUHA 4EGCB 3MAHA 1ZN2A 5FA6A 2E1AA 2BF7A 4RF4A 2QX4A 3L9XA 3TUIC 1KZHA 2FETA 2ZSIA 3G88A 5JBNA 1YH3A 3URMA 1Z75A 1PEKE 3FSYA 2BE2B 1QFMA 1E77A 3C6YA 5HF6A 3K5WA 3JPWA 4X2BA 3HB9A 4WA8A 4HNSA 2OWEA 4Z5XA 5JPCA 4QIFA 4FIDA 1ZR4A 4XPEA 1TYBE 4JI2F 3WIDA 1W4RA 3V8RA 1QJHA 2JJYA 1CULA 2NSBA 4MXDA 4WWHA 1LC3A 3T5LA 4P2MA 3GA7A 2W58A 1I6WA 3OFEA 1WI8A 5FA5A 1IWGA 3CIFA 4QIGA 5IVHA 1XWFA 2XI3A 1KI7A 2ECKA 1NPTO 2ZHOA 1PHRA 2DRBA 4HDHA 2FSVA 2PZJA 3UDEA 2JFBA 4E22A 3KHHA 4PLGA 4WCVA 5DJBA 2H65A 3CUTA 4AKTA 5A6PA 4L0MA 3DMRA 3OTOB 4S1OA 3SFVA 4R83A 2CLEB 3A27A 2HF7A 3PNVA 3CDAA 2GYYA 1ONSA 2NAFA 2P3LA 4S3MA 3IP7A 2DECA 2Q2VA 2AYEA 1RA7A 4J9QA 2E7WA 3AXKA 2YWKA 2WDPA 2WY2D 5E1OA 1GV1A 2Q3FA 1Y81A 1Q2UA 3DU5A 4RFSB 1XLWA 2VH5R 3CFYA 4MP3A 4QDTA 1PJQA 3MTBA 4IR1A 3MYYA 4BMOB 3QY0A 2AKWB 3ZEAA 3STVA 3A3NB 3TQ1A 3W64A 4H6WA 2EFOA 2CQ2A 3GMTA 3IBWA 3OQ2A 5E2IA 2VKZG 3AR6A 4DX8H 2MMYA 5IVPA 3OQMA 5C7OO 1K8ZB 4PGHA 3TZWA 1ESMA 5C3MA 2FPGB 2EFYA 4FLEA 2D1RA 4WEOA 3OOYA 4DUZB 2MKHA 3O6QA 4QHSA 3D3QA 2W8BA 2VH7A 2GBIA 1SL0A 2HHJA 1ISMA 5AXBA 1ZH2A 4YT5A 4EGJA 4J75A 3AK4A 2XBPA 4WN9A 4D3DA 3ZDYB 2MJUA 3G0CA 1HLFA 4W9RA 2GDJA 4HI2A 3HHEA 5KOJB 4S1TA 4D57A 2KW5A 1Z2NX 1JT9A 4P0TA 4F9GA 4OV1A 5JS8A 2HEIA 2M6LA 1CJUB 1NWHA 4O0IA 3KG0A 4UOCA 4TQSA 2HRBA 1OIAA 4V2IA 2ENUA 5KWIA 1T8TA 4ONEA 1S9FA 1DG1G 3ZG6A 1NSTA 2B82A 3UCUP 2VBCA 2WJPA 4B7AA 3M4ZA 3AFIA 4UAUA 5JUWA 2FHKA 3I1JA 4D4IA 2GGPB 3T7SA 5LNK6 1SUAA 2DM6A 1DAHA 4FF4A 1UP1A 5DXAA 2KYRA 2EJTA 1SC1A 4CKYA 2CE7A 3LI2A 2YNGA 3UMYA 2D1CA 4BMPB 1P1IA 4L0QA 5CFNA 4XXHA 4BO3A 2JD0A 2F3RA 4BV3A 1HMVA 4KE9A 3MINA 1JJ2R 1E9FA 2YH0A 5HDBB 3U4GA 3PHGA 3I5YA 1I4EB 1L5HA 2FN9A 5DYIA 3CB2A 4WFIA 3SYTA 4RNCA 3QYPA 3ANTA 3ZWBA 1U2SA 3ZGOA 4BO4A 1QGYA 1VBKA 2G77B 4LF9J 4BNZA 4OLFA 1X8DA 3IIKA 4CODB 2CMDA 3D7RA 2B21A 2GGPA 3PNQA 1UP6A 3QLHA 2OGSA 3MMNA 1T5IA 3Q2OA 2HHHJ 3JWEA 2BFCA 3ZDZB 1HE3A 5IS2A 3IO1A 2AUMA 2P2NA 5KFCA 4BEVA 3RZAA 2FCRA 4UHBA 3KXPA 4II2A 3H9QA 3QYYA 2AC7A 1Q1GA 3ETEA 5JAOA 1M1NB 2XY4A 5LQDA 5KCMA 3MPVA 3NMUF 3BWBA 1PAEX 4WLEA 4OB7A 2RHRA 3O74A 2A0KA 3C16C 1YJUA 1VLHA 2DR2A 1ZM2A 4NYJR 3U9SA 2ZT7A 4ZOAA 3N87A 2PV7A 1ES9A 4R9VA 2XT6A 2J0UB 2QL5A 4HVCA 3PLRA 3D1LA 4FILA 5L3VA 4G63A 4HWRA 5JTTA 5C53B 1BWVA 1MA0A 1U4NA 4M86A 2QAIA 5F76A 2C5AA 3QJLA 3IE2A 3TWOA 4B5LA 3RVBA 1AO3A 2GJ9A 3K20A 1YR9A 3E2MA 1U2ZA 4XCVA 3QLJA 2PFKA 3MR6A 1YAHA 5KG5A 2VDKB 2HMVA 1WNTA 2EGUA 3L7PA 4TZ6A 2V8PA 3L2OB 1JLRA 4GG1A 2FLOA 3IRXA 3MTQA 1TKCA 4TUYB 3M9NB 2AVDA 5IJZA 3OVMA 1X4FA 2YMPA 3R7BA 2ZBEA 4C08A 4DZZA 3THSA 4M76B 3R0IA 4TRRA 2AF6A 2ADBA 2YV4A 1D2RA 1X9GA 2EG1A 1Y6RA 2WHQA 1ZMXA 2HLDD 3JAMU 3OL9A 1P72A 3VYWA 2DP4E 1R6VA 3IXMA 1VIXA 2JJ1A 2NXWA 5AJVB 2ZSHA 4GWGA 1L5QA 5LZ8A 3SOZA 1EX6A 2Y1DA 3A1FA 2HU8A 4MW2A 4ETWA 2XRZA 2IM1A 3OXLA 1A8SA 5J4LA 3W05A 2JANA 1LSSA 2Y99A 1SKMA 4V0LA 1H2FA 5EZSA 1QV7A 4LF6F 2VAMA 1N34J 4G5GA 1M1XB 3RW6A 3DKRA 3ZK9A 3DFZA 1L3SA 3V6DB 3ET4A 5E4JA 3CO5A 4A8OA 4IIEA 1BKSB 1IL0A 1GKLA 3IOBA 3LQ2A 1UMBB 4LSMA 1U0FA 1VQPS 1CS4A 3I5BA 2N46A 3ZZ0A 4DL3A 4MVCA 4CEHB 2I7TA 1BXGB 2EW9A 4JBXA 3U1VA 1Y3HA 3HH8A 3RAJA 3BH0A 1RP7A 3TLKA 3VQTA 4QX6A 1C0EA 2BMFA 3SVLA 4Y2RA 3LHKA 4G25A 1E5TA 1TE2A 4KFRA 3TYXA 1APBA 4Y6RA 3MR2A 2BYTA 1UBUS 4KGZB 3VYVA 1AXGA 3G68A 4DIUA 3EG5A 2NVWA 3AJDA 3TSWA 4BJHB 1SH2A 4CCYA 3W2TA 2JBHA 4MRAA 5LZ2A 3D43A 1OGIA 4LQ9A 3RSZA 2PO5A 4UTVA 4CQLB 2OM2A 2MYNA 3KX2A 2Q46A 2CDRA 3G59A 3S1AA 5E9AA 4B3JA 4CLLA 5KOYA 5C8ZA 5K8VA 1LA2A 3FMGA 2XZWA 4R8RA 4K4YA 4EJ2A 2NO4A 3OLQA 2FG5A 2N1MA 4I1OA 2ZWAA 1T35A 1WF1A 2GETA 1KEEA 1ZPWX 5KYUA 3GIRA 1V16B 4KR7A 2IUYA 3BB1A 1LWEA 4F7WA 4RTKA 2O0MA 3THXB 4XR4A 5P21A 5EJ9A 3SFGA 4PONA 3D28A 4AAYA 3CV3A 5HKKA 1Q7TA 4ENOA 4ED2A 4HMQA 3T1YJ 1DIBA 1P4SA 2GAOA 2QFIA 4ZRNA 4EJSC 1JPVA 4IJ6A 4LGMA 4ZVSA 4D3YA 2INGX 2LV8A 3M5CA 2XR1A 5A8WB 1SZPA 1Z2CA 3BGOP 1GZ4A 3BF4A 1EFPA 1V71A 2K5UA 5JG7A 3AFMA 4FNAA 3DQQA 5T4BA 1WEXA 1KWMA 3KQUA 3AHHA 1Q1EA 2JLCA 1UBGA 1SVWA 5BQ3A 4D8UA 2C2YA 4D9FA 3LP6A 2JDIA 5BSRA 2ZWOA 2Y1WA 3KLHA 1FXDA 3UW1A 1CS4C 1U1KA 2CYBA 3TLMA 1FMJA 4CMKA 1FE0A 5E6RB 5D4NA 2MKYA 1L1FA 2VP3A 2AE2A 2ZAOA 4MIOA 1YS9A 3CMES 4TMYA 3HVTB 3RADC 2GM3A 3WB0A 2P9CA 2AZ3A 3R0JA 2PHZA 1PHPA 3TTUA 4QWCA 4Q1DA 1C1CB 2QQEA 2FPSA 3M3PA 1XR5A 2ZIFA 2I8AA 3ZCUA 2QG6A 4ECVA 3BZBA 2CYYA 1NSPA 1A98A 2VQFJ 5K3DA 3QXGA 3LHIA 4KQKA 4PEVA 3OZVA 5L38A 3TOZA 1Y5LA 4I69A 1SXGA 3TL6A 4BC1A 1YGPA 4QQRA 1V7QA 2FR1A 3OFSA 1UEUA 3MA0A 2O4UX 3ZHUA 3D7SB 2X4DA 1GAEO 1GMVA 1XYVA 5CVDA 5F3TA 4Y8VA 3E4DA 1DHTA 3LGAA 3R7BB 1N2ZA 4RD2A 1Z2EA 2J7PA 3VR6H 2X5JO 3N01A 5T5QA 1FEZA 4N48A 4PZZA 1JIHA 1P61B 3R77A 2BEKA 3FX2A 1OJLA 3K1YA 1IDOA 2XWJI 2HHSA 1ZJWA 2GJ8A 1MG7A 3SCKE 1QS0B 3DLEA 1F6WA 5GMEA 3HPOA 4GQAA 2IC3B 2KI2A 1U8SA 3C16B 3OI7A 2W2VA 1F5NA 3OZSA 3KK2A 3CURA 1O8BA 3KHRA 1NMEB 3HR7A 1J4AA 2DNHA 2Q5EA 3CF4G 3DAOA 3FDJA 3H75A 4Y2QA 3F6CA 3HA5A 4OM8A 2DQSA 2P9JA 1U3TA 2XZDA 5AIAA 5CUQA 1IQZA 4U7TB 3V6LA 2IVZA 5LXTF 2WAXA 4C7JA 4L4UA 4QTUB 4R0EA 1NZJA 3CBGA 3RVPA 2CJYA 3R40A 1EARA 3N79A 2K2QB 4LF8B 3TJRA 4JLNA 2Y93A 1R89A 1FUKA 2UZ0A 3G49A 2V98A 4FFVA 3O1LA 3NY0A 4G89A 3CDBA 1Q12A 2KJQA 3SI8A 4GPBA 3TMYA 4D4LA 5JCPA 1WWKA 4MVJG 4RY2A 5CD1A 2PSFA 3DZGA 4CLZA 2AIRA 2Q9BA 3L04A 5DHFA 4HQ6A 2HAFA 2AN3A 4HAUA 1BMFD 1VQ9S 2Q7XA 2Z0MA 1PC4A 1DLJA 2HWXA 5AKJA 3L4SO 4RD6A 3UJBA 1KQGB 1KFCB 1UAGA 3QSYA 1E60A 1WZUA 4WZBE 2O14A 3IB6A 4ZI7A 1KQFA 3C7AA 1VP9A 4WLUA 1E6VA 1P2SA 1OWNA 4TV8A 2CL5A 3GMDA 4UQTA 1I30A 2I7XA 1USWA 3NPMA 1TP7A 3EGNA 3JAMY 4N77A 1Z17A 4UQOA 3ZLUA 2YYSA 3IUNA 3KWJA 1BW9A 5DOVA 1PV2A 4AZVA 3QFCA 1CJVC 2FSHA 2JI8A 3G1TA 4NRUA 4F5ZA 3N05A 3QKRB 3IT0A 3TG2A 3CJSA 3W79A 3FUCA 2WJVA 2RH9B 3PJEA 1KYIA 4AI6A 5KREA 4I64A 1R9GA 2PZ8A 2IITA 1MZVA 3JZDA 1K1SA 3KLIA 1T4MA 1U80A 1E5DA 2FXIA 4M0DA 3HY6A 2D06A 1JALA 2AJDA 1HQ2A 1E0AA 3LD9A 2O1EA 4UBMA 1N0WA 2DGOA 2C2DA 2UUBB 3G5MA 4NMMA 4PZDA 4LFBF 4CN8A 1LWEB 2RB4A 5MN6A 2ZBIA 5A06A 3A1WA 3UK1A 2E9ZA 4CDIA 2JGFA 5AXNA 2AD5A 2B8JA 3T1VA 2DY0A 4F4KA 1XTUA 4AO6A 1A9ZA 2ZIAA 1MX1A 4HAYA 3B1WA 1Y8CA 4DR5B 1ZUWA 3M8PB 4BNDA 2WJYA 3DWFA 4N7BA 2QNBA 2WWFA 1CY7A 3F3SA 1NSAA 1P4HA 4NY1A 3S1AB 3KV1A 1SVKA 1LXJA 4PGAA 2I6UA 3ZTTA 4HH3C 4N41A 1R18A 3MGJA 5EZ5A 1IKWA 2VEOA 1U02A 2W98A 2YX4A 3UJAA 4F2DA 5FYDA 2NQPA 4FEEA 3HSYA 4UVIA 1H98A 3THXA 3JARA 3AOEA 3BYRA 1WUUA 1V11A 4ZT3A 3FWZA 3ZZUA 4KIUA 1E3IA 4K9SA 1ISRA 2B35A 2KHCA 4MDEA 5SZJA 4B83A 2F4NA 3PITA 2WKSA 3OJCA 3AJEA 2PK3A 4OQJA 2SKDA 4DSUA 3A3PA 3K58A 3EX7B 2HG4A 4ER5A 2EJUA 3RVMA 3HMJG 1G63A 4IJQA 2IPNA 5AW0A 5D51S 4KXNA 1TQHA 2HXSA 3E3OA 3EDQA 2JHGA 2IXDA 4XQ9A 4Q8FA 1QHIA 2XCRB 5JQGB 1LF5A 5BORA 4MGYR 1L4LA 4P82A 3J80A 4PRLA 2O01C 1VKZA 4KXQA 2LXIA 4DJJA 3LMKA 3T3IA 2AT1B 3VBEA 5JI2E 2N0SA 3QRWA 3QVOA 5L45A 1KDTA 1NBME 2C4VA 1BYIA 4OA8A 1TK8A 1YBFA 2BKLA 3LT4A 2ZM5A 4NXMF 3QUAA 1KRPA 3N0XA 4OMCA 1RHJB 4WE1A 3E48A 4R5PB 3N86A 1BMDA 3CPHA 3PFOA 2HC9A 5HMXA 3D3EA 3X44A 3IVGA 3TTSA 4CNQA 2IWRA 2OKCA 1C0TB 3PXBA 2HQIA 1C7FA 4Q18A 2RKBA 2ATCB 3TW0A 2ETVA 1JA9A 2BE2A 4C3LA 3OJOA 2WVCA 1S1VB 3CNQP 4IMPA 4OCZA 2K1RA 4A8YA 1HBOA 1TV6B 3LIPA 3UPUA 4FJ1A 2YFQA 5LJ5Y 2XY5A 4ED3A 2J67A 2CPZA 4ZYTA 2QSFA 4PAOA 1I0IA 1FESA 2XPCA 2BKUA 4Z8XA 3T7KA 3M8QA 3R3XA 3VO1A 5JCJD 4PYMA 3NGLA 1XPUA 1PZEA 3KB8A 1LS1A 3K9CA 3RG2A 2Z57B 1QKKA 3KLFA 3BB3A 3HEAA 4B3GA 1S79A 1UBJS 1HI1A 5I9BA 3EJWA 3MILA 4NFHA 3DXYA 1QRRA 3SHFA 4XGQA 3PUHA 3OEED 3SYMA 2X0EA 3BFJA 3WLIA 4FGLA 4Q7AA 1PJ6A 3D0HE 1SVUA 2L9WA 1WACA 5HJ5A 4R2JA 3WL4A 4EW3A 2GR9A 4NE9C 3C5CA 5M04A 1WORA 3HZRA 2QE6A 2LP4A 4PUOB 2KT3A 2JHCA 5AMXA 5BUQA 4FE7A 5FBRB 2D2XA 5IC6B 1UOOA 1U2GC 2EQAA 1PEDA 3TD6A 2D54A 4GC6A 3KOUA 1QHYA 4RX6A 4BLQA 1G3RA 3BR9A 3K5PA 2OCBA 3OX4A 4UJ5A 1WW2A 1CQZA 1US8A 2CFOA 2WUWE 3TPFA 3JQAA 4DARA 1DTTB 3FXAA 3H25A 3HEMA 3M6UA 4GKJF 5EXDA 1HYSB 1O94C 2IRUA 4F2SA 4M0MA 2FN8A 4ZVRA 5EKSA 3L6UA 4RTMA 1KI1A 1NAIA 3HPQA 3OWHA 3MQFA 4HGZA 2XSZD 4CKZA 2VDNB 1J99A 3H1AA 3O21A 1BXKA 2V0GA 2R8IA 3BA6A 4PKDB 1IJEA 4J1TA 4CL2A 4NEZA 3VGUA 4MPDA 1QIEA 1U7WA 2O2HA 2XOXA 5DM70 4QOTA 1ZC3A 4JHXA 1HNIA 2DR5A 3C4JA 1UL1X 1UDBA 4AMVA 4DANA 3JQRA 2JGDA 4ZVHA 3LHDA 1FS4A 4F3YA 1GM5A 1OMSA 3FCXA 1FK9B 4P3OA 1NFRA 3GPLA 4IFEA 1SFRA 4D9IA 2H65B 5K8NA 2IYGA 2DT8A 4MWGA 2OO5C 5KOHA 1UXJA 3C1TA 1Z6XA 3IR7B 2FQYA 4BIMA 2QRNA 3BIJA 3CVJA 1XDZA 3G85A 2OPHA 3NT2A 4Y1GA 3K0FB 3P9ZA 5TB5A 2RHJA 1A0OB 5CH7B 5DYTA 2EJBA 1SXJC 1Y00A 1E7SA 1M75A 1O9GA 4EHNA 1U48A 1EFKA 1XDDA 4MW0A 1QRSA 3DFEA 4JK3A 1YMQA 4EFAC 4DQIA 3V4SA 1QKIA 5HVFA 4JVOA 1AMUA 2PBRA 4AT1A 1Y4ZA 2HK2A 2F9MA 5EMLA 3JAWA 2IJNA 5TS3A 1NHUA 3VDQA 5DRKA 4FGKA 3G71S 4AN0A 1X86B 3SCIE 2V3CC 1LK0A 4NLWA 5FO0A 3K5MA 1D9AA 1F20A 4QEKA 3PUVA 5DWQA 2R6AA 4UFPA 4F0MA 2OFWA 1QQ6A 1PK7A 5H1SV 1AUVA 1K0VA 5D0RA 2YWBA 4ASUA 4R8VA 2ZR8A 3HDVA 5DEIA 2PJZA 4QZVB 1NDQA 1N36B 3TJ8A 2Y6VA 4PCUA 1FMFA 3QENA 2UXCJ 2ROPA 4LEIA 1CUZA 1YIOA 1NV9A 4B3SJ 1DJQA 3A3OA 4NBVA 4QLAA 4D3HA 1RYYA 1JKHA 3LKBA 3A9VA 2D2VA 2H1WA 1U47A 4CDMA 3CLSC 5DI3B 4K0KF 1LWCA 5I3CA 3K2QA 3MUTP 1MF7A 3UGJA 2VYNA 1PCXA 1HRKA 2WYHA 5CDHA 2PA3A 4YC7A 2HA5A 3AUYA 2QN6A 2B9VA 4ZYLA 2TMGA 1R2QA 5CW1A 4ENRA 4G1BA 4EPRA 1I2CA 4F4UA 2AJTA 2JEGA 3N6MA 1G6HA 4HWOA 4Y2IA 4F1JA 3IMEA 3F3KA 1SHLA 5TVKA 2Q8PA 1NIPA 2FPLA 5E3IA 3P9KA 4KYUA 3IBFA 3PJXA 4WKBA 4IIJA 4TKVA 2OOKA 4FPRA 4ZVFA 2EWVA 1NVFA 4CIWA 4B3SF 2R8JA 2ZPAA 2CNKB 1RT5B 3MZIA 5F51A 1NG9A 1UBCA 2ZR9A 2OO3A 4G07A 3K0BA 1EE9A 4H6VA 4QPCA 4ZVTA 2M3DA 5IBCA 3PHCA 3CSSA 2HBYA 4EG4A 4AMGA 4U7CA 4RE6A 3KE8A 3WGHA 3RK1A 1HFKA 2G13A 4K8RA 1EFLA 2A88A 3EWIA 3VPAA 1J0BA 3OG9A 4L9SA 1ZAXA 1JHXA 1HE4A 1EUQA 3PYLA 3UMBA 3AZOA 4K05A 4NJMA 2YQZA 2R8GA 1ZJYA 3TI7A 2KTQA 4JXZA 4KL8S 2D3OR 2FZGA 2BGJA 3K5LA 3RI3A 3EC7A 1EFAA 2RGEA 1CP3A 3QBTA 1GPDG 3CRQA 1MKYA 1G21A 1XQYA 4HL9A 1DFHA 2P2YA 2XODA 4W9NA 1ZM7A 3SZGA 3A1UA 4ZT6A 2GZHA 2AS0A 2HQFA 1Q57A 4QELA 2DIVA 1ZJJA 5JYCA 2QLMA 1NX6A 2HJHA 2NV0A 4B3RF 3ROPA 4LFCB 4BO0A 5F0UA 4DS4A 3BJEA 2RCNA 1YZNA 1QKJA 4MQ5A 4L6V3 3SHOA 4J4BA 3DW3X 3R0XA 4RYDA 3AJ1A 3RTGA 4BQRA 1FTCA 1QGAA 2RGGA 1WXGA 5GIOE 3HBLA 2BMWA 1WHYA 3J7A1 1UVJA 1P18A 5I9IA 3NR2A 5CH5A 3PCXA 1GN8A 1KU0A 4CV2A 1XPJA 3GAMA 4E14A 5BSGA 1HY3A 3GDHA 4OJKA 2YNIB 1D04A 4HVZA 5DBGA 1H3NA 2VSFA 2ZUVA 1E4EA 4ABTA 2O8CA 1LY1A 4NS1A 3SBEA 1RRCA 3MAGA 4BTLA 3A0UA 1CB7A 1JPNA 3RVOA 4AJNA 4CUJA 4BFTA 3NBAA 4I4TB 1NVBA 2ZVDA 1GN9A 2B2CA 4D4MA 4PYAA 1RQXA 1P45A 3K9LA 3PDHA 2BANA 1Q5PA 3KSUA 5BV1A 1QQBA 2HK8A 3GA5A 3AEUA 5JLJA 4Y30A 3DM5A 3O6VA 2P8SA 2FEXA 1FP4A 1HG1A 3SIXA 2FRVA 1Z4QA 4NCAA 2CXOA 2C9ZA 4RPKA 3THTA 2J87A 1RPZA 2XVYA 2GBLA 1J5EJ 4TVSA 3NVDA 2LCIA 4RMNA 3NTXA 2OYRA 2X6RA 1P62B 1O89A 1QRTA 1CJKB 2VP9A 3ZW9A 4CLSA 3A4VA 4O0LA 2V7EA 2ZSUA 1M6NA 2AOTB 3KHSA 1TL3A 1Y3IA 2E5WA 1N8KA 4ECSA 2OB2A 1SHTX 3BGVA 2B3DA 1ORHA 4ZVOA 4TV9B 2VSNA 2PWPA 1FP6A 2YNFA 4BO5A 2ZOFA 3ICEA 5LOVB 4MK8A 3NS7B 2XWXA 4QCLA 2RB7A 2XYVA 2HNZB 2PDAA 2V4ZA 1CY2A 5AJUA 1KAOA 3RAPR 1KR5A 5A9TA 2APJA 2MQPA 3F41A 2GRUA 3DHVA 1Z35A 5K0TA 1E4VA 3HXTA 4L5YA 2VWHA 1QYRA 1C0TA 4DBLC 2YQ1A 3SHTA 4OMFG 4RNFA 2CVFA 2Y68A 1WHXA 1O6GA 3TTYA 1XLTC 4JV1A 4GP7A 2OPQA 2BJ8A 3LX6A 1IKYB 1G1MA 1XL1A 4ZLJA 2DHXA 1VIYA 5JXGA 2XY7A 2H5IA 3DXFA 4O4JF 2V6GA 1H94A 3O2QB 1NSYA 3CXUA 3GC6A 5D8HB 3JSMB 1D1UA 3UENA 1I7QB 1UK9A 1TK3A 5HK4A 4JB2A 4TS1A 1YZLA 3VVTA 4TKTA 3MEEA 5GMDA 1RNLA 4RA9A 2X2OA 2DVMA 4K4TA 1T9AA 1RHMB 1UQRA 1AZSC 1PQWA 3W5SA 5A2QY 1R9JA 4MGIR 1IQTA 2Y3YA 3UCEA 2FJDB 1QP7A 2I9KA 4IV8A 3VPFA 2E4XA 2LDBA 4ZMSA 3BORA 2B8WA 3R5KA 3H5WA 3E22A 1MWZA 2ZQYA 5JQGA 2V8GA 4DFMA 3GPBA 1G4AE 2ZD1A 4RBVA 2XYQA 2PUVA 2LECA 1U7UA 3M6XA 1OU4A 4F9EA 4GBED 2GMWA 3FTCA 3DRSA 5KTMA 4M7RA 3TR6A 1XSEA 4YCNA 3THWB 1NK5A 1DBPA 1JR3D 5B0EA 4KACA 1NK6A 5EJIA 2HYDA 3HUUA 2RH5A 3PQ3A 3C3LA 2B4QA 5TGDA 2GBLC 1GPWB 3G2KA 4Z86A 4ZU1X 3G6WA 2IEAA 3HULA 2PKYX 4DR4F 1C81A 1ZONA 1UZAA 4J2OA 1IK4A 3AKCA 1TFWA 2YWXA 3HJRA 2VC1A 4OOFA 2O8EA 1NJ2A 2PGXA 4S04A 5BSFA 1HGXA 4LRCA 4NU8X 4UZCA 2XE7A 3OTEA 4ZYVA 4ZICA 3B60A 4Z9YA 2HLTA 1ODLA 4GYKA 3L6DA 3WRXC 1PZFA 3WIUA 2FV8A 4V0RA 2J8ZA 3M8KA 1E5LA 1V8FA 2A84A 4YAFA 1H5UA 5CM2Z 1UPAA 1IEQA 4B6JA 1DAMA 1NLYA 1PT9A 3AI2A 3NNSA 2HSDA 4I9FA 2IV3A 3JQ8A 1JLEB 1PG2A 2FDCA 4ZOLA 4N3BA 1FFXA 2GS8A 2V8OA 5KNCD 1NQAO 1RTHA 1D09A 2VYCA 4ZQGA 3O47A 2TRSB 3CH6A 2WWHA 5LDGA 4BRZA 5ETMA 3VRHA 1KY3A 5LQKA 1YUNA 2X0KA 2AD9A 3VJMA 3PUZA 4NLGA 3WK6A 2Z58B 5BSMA 1T3OA 3USCS 4JI7F 4YMIA 1EIWA 5DOZA 2YWHA 4J37A 2WIGA 1KOGA 3ZZMA 5CA0F 1HFEL 2ATVA 2J07A 1HYGA 1S3SA 1XQ1A 3L18A 4U4AA 3KOAA 3CLTD 1J2RA 1TM7E 4AL5A 3L5OA 3I30X 3UIEA 3EHEA 2YDYA 1P6XA 1PFYA 2RJOA 3WTBA 2BI4A 3WL5A 4B3MJ 1E98A 4B9EA 5FULA 3VH3A 3PFNA 3OHSX 2B1JA 1WEKA 3QSYB 3FYTA 1KQGA 2UUAB 2W93A 3V5NA 1NHKL 4LECA 3PR2B 3AOBA 3GJ0A 2J5XA 2UZ1B 1QH8B 5I7HA 5ICMA 1J5OA 3OZBA 2QVZX 4BMDA 4L1KA 2YKPA 5DP1A 3UAVA 5E7MA 1EDDA 4I6JA 2OOSA 4NU6A 1UVIA 1YJ5A 1E1MA 4K5SA 5ARDA 3AX6A 5A1JA 2A67A 1M5RA 3BFKA 3GFPA 3NHRA 2B4PA 1G5FA 1G66A 3IPCA 3R7SB 3I32A 4Y2TA 3MM5A 5IM0B 3RU2A 1XOIA 4QT0A 1QHHA 3CNOA 2VG6B 2VRCA 4PLHA 4DF8A 5CIWA 1E6UA 4I2PB 1KC8T 3N70A 3GBPA 1DQ9A 1V43A 1IRIA 4X64B 3LGNA 4ICIA 3AHIA 2HHHB 1CVRA 2CG8A 5FX2A 1TW3A 1LRKA 2VO1A 1INLA 4ITRC 1M8FA 4QWDA 1MDFA 1KRWA 5EHNA 3LXUX 3IA2A 5KG0A 3DZJA 3T6BA 3C16A 1Y11A 1IQ0A 4MQ6A 3PF8A 2I65A 2J09A 2IHKA 3MOIA 1VSUA 2NS1B 2QX9A 2D13A 1B7YB 3DTVA 1B00A 2JWNA 3ET6B 2EV9A 1NB7A 1EXMA 4YH1A 1J1IA 5AE1A 5LJ3Y 2WSSD 1K68A 4QFBA 2V50A 1ORRA 2XB8A 2MINB 5JZVA 4L50A 3GP5A 4G1UC 2YKOA 3SSOA 1Z6AA 2FJAB 1ZJZA 4LYGA 3RB6A 3VGVA 4OJYA 5ED0A 4QBTA 2G5TA 3RBEA 5DZSA 2GVDA 3LP1B 2Q5QA 2Q4RA 3WK7A 4A6XA 1YJRA 2CYCA 3UFXB 1LD3A 4OPMA 4V0QA 2ZBRA 4P36A 3ZD8A 1CUXA 4EU0A 2Z9DA 1FRKA 1HBMA 2W7TA 4G85A 2E4AA 4EEZA 1GO2A 3PQCA 2PO7A 4CGZA 3S7TA 1YVEI 4MB6A 3I6QA 4HL6A 4GOND 4ZCIA 4NA2A 4J0HA 4CEIA 4DV3B 4LDPA 1FYEA 3PSAA 3QWFA 2R1UA 5JH7A 2B94A 3DC2A 1YWGO 2P8IA 2WM2A 1AGYA 3GAAA 2FFQA 5CNKA 3DDOA 1UFWA 4ZDIA 1TVCA 4N8SA 1TJ5A 2RHCA 1VPLA 2OBBA 4RGBA 4W6ZA 3DXSX 3LO8A 2OHJA 4LY3A 1O5JA 2WBLC 4EK9A 3KFXA 2HK3A 4LRQA 4TS9A 5FPQA 4B87A 1F9EB 2Q1YA 3Q8MA 3PHHA 4QUKA 3MJDA 4EZ6A 5LQCA 4YMSA 2WOOA 3B3QA 2QJTA 2NUPB 1GZVA 4IICA 3G0DA 4U2DA 1R66A 2Y4OA 4KX3A 5CNJA 4KDEA 3GLHE 1EGAA 3C5HA 4R2IA 4J0KA 4ND1A 4XCXA 4E5NA 3ZIDA 4MI3A 2QAJA 2IL1A 1XUOA 3IAUA 3MCZA 4TLAA 2HCBA 3DR5A 1X1RA 4MKBA 4Z49A 2PCJA 3PGJA 2OFHX 3OOHA 1CTQA 2ORYA 4LF8J 3UK2A 1L6RA 2P68A 3IT2A 1OO0B 1Y7TA 2DFNA 3DE3X 3WWOA 2V9WA 1E1QD 2W6JD 4L4XA 2B6AA 4TTSA 3THYB 1ZJ4A 4DR4J 5CEJA 4BAZA 1MB0A 1BXRA 3DNCA 4NK5A 2ZUSA 2MHNA 4ZN3A 1X80B 1KK3A 3OPYB 3Q9UA 3OLZA 2C04A 3M5DA 2JGNA 1NUTA 4LZOA 3AUXA 2NZJA 1VHLA 4S35A 3MM9A 1QGDA 3TZLA 2QG9B 3N2IA 4E4RA 1JBEA 5J2MB 4TVAB 2ONJA 2JJ2A 3B8EA 3P45B 3OM1A 3O4VA 5FAXA 3P8BB 3UAYA 1CC7A 4OZNA 3KPYA 1N2OA 4Z51A 2ZP1A 5HILA 2AHOA 1HTBA 4Q1CA 4P74A 2ZETA 4LZNA 4DGQA 4EHFA 3CVXA 1TTHA 2RKOA 2NX2A 1UA0A 3PUXA 3O8QA 4FCVA 3WFJA 3LQKA 4KIAA 1OFHA 2PIDA 2R6R1 3R5BA 4YFVA 4KRFA 3EQ8A 1T0IA 4HQFA 3AXMA 3VSBA 2BGMA 3WLNA 1XZEA 3KFVA 4I08A 3UVJB 1IQPA 3IESA 2JC0A 2B1RA 2AGOA 3COPA 1CEXA 4YJ2A 2HRCA 2BTQA 3KXDA 2QE7D 2BFCB 3NBPB 3GFOA 2RF2A 1LEHA 5JSYA 1WQ4A 3ABQB 3SQMA 3A26A 1C7JA 13PKA 1Z5WA 2HMTA 3CN9A 3T3EA 2ZJ8A 2HVHA 4NEHB 2AU0A 4MA5A 5KU1A 3R9LA 4LJ6A 1OXSC 4DQ0A 4IJKA 5TT1A 4K9KA 4EBDA 4LF5F 3DWEX 4LBVA 4X90A 4QWAA 3PKZA 4LK2A 5BR8F 5JE8A 5DNDA 3MPDA 3CUWA 4M7PA 2AR9A 1N5RA 5AVSA 1GG5A 2FZCB 2F62A 6ABPA 1J8YF 3FUUA 3A1NA 2HJWA 3HCBA 3I4CA 2XBLA 2IXTA 4DC0A 3IHWA 4L6IA 1JEEA 2LXUA 1NE2A 1TCCA 3HSSA 4TWAA 1X42A 1IEWA 2GUGA 4OHWA 1W87A 3D4OA 4HVAA 1DBQA 1Z6PA 2WD9A 4DMHA 3QLTA 1COZA 1SVNA 4WFYA 4OZ0A 4HVTA 2C1EB 3PRVA 4RPCA 3KKLA 1JHAA 1ULRA 4Z7JA 1DAGA 2WSFC 4C4AA 4GC7A 1J9EA 1QC5B 4LIWA 3NTUA 2ZTLA 3TGLA 4KQFA 4NOMA 4DHEA 3EPRA 2OFOA 1LC0A 1UFRA 3QMVA 5GV7A 5GQSA 3GCZA 4YAIA 2Q1WA 4DF4A 4HQRA 2P11A 2H5EA 1UAYA 3CG0A 1M74A 3R3TA 4JMLA 1T29A 4E09A 1PGJA 5CHCB 4DLNA 1QU3A 1U1QA 3CF0A 2OLKA 3H7AA 3ICLA 2DH7A 3GGPA 4ELUA 2CV0A 4C9BA 2CWKA 2PS0A 4YUYA 2I2CA 1LWFA 1WD6A 2ADMA 3DF7A 1TK5A 4BGIA 1MJGM 3G23A 4HGOA 4QXMA 2OCKA 2MKKA