3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
2RI1A 5IS2A 3HN6A 1UJ4A 4GMKA 2KO1A 3AB2B 2J0WA 1U8SA 3LWDA 2GNPA 1ZPVA 2QRRA 2NYIA 2P9GA 1UJ6A 5HJ5A 2QMXA 4LUBA 2MDAA 2RE1A 2I9SA 3E7FA 3K5PA 3O1LA 1FQOA 3OBIA 3EB9A 1LKZA 1YBAA 1M0SA 3MTJA 4L5JA 3N0VA 3HHEA 2J0EA 1O8BA 1LK7A 3L7OA 3LUYA 3MAHA 3DHWC 2P9CA 2J0XA 2W48A 2DTJA 3DC2A 2H9ZA 2F8MA 2JOQA 1PBTA 3BXGA 2ZHOA 4R7TA 2LVWA 1KS2A 3ENWA 3ENVA 1LK5A 1FSFA 3TUJC 4L5IA 2F1FA 3NWPA 1YGYA 2QSWA 2DT9A 1Y7PA 4NMLA 1FRZA 3BXFA 3NRBA 4PWUA 1NE7A 4GO7X 4GO5X 3P96A 3OFGA 1RWUA 4OQQA 3LOUA 3OFHA 3AAWB 2R5FA 3LHIA 1SC6A 3KWMA 4L4YA 1VL1A 1PSDA 3ENQA 3NZEA 4X84A 2WU1A 2QMWA 3DDNA 4M8LA 3MWBA 3OFFA 5T41A 1JT9A 1DEAA 5FIIA 3CSSA 4TM8A 4TM7A 2RQMA 3S1TA 5JJBA 5IT4A 2JHEA 2OKGA 3IXQA 1HORA 3OFEA 1FS5A 2RQKA 3UW1A 4L51A 3TUIC 1FS6A 4L50A 2PA3A 3CEDA 1Y89A 2RI0A 4OQPA 2FGCA 3W7BA 2O0MA 2LQJA 3TX2A 3KV1A 3TUZC 3OC6A 3CH7A 3IBWA 2BKXA 3BXHA 3DHXA 3EFBA 3ICOA 4L4ZA 1UJ5A 3U7JA 4IO1A 3E15A 2P9EA 3AB4B 3BXEA 2PC6A 2BKVA 1XTZA 5IT0A 1CD5A 4GO1A 4R9NA 2CDQA 1HOTA
chains in the Genus database with same CATH superfamily
6AT1B 2WTBA 4RKWA 1TO6A 3KU4A 4HWTA 4K03A 3T3PB 4IRKA 5T7LA 1RW4A 4ZQCB 2F40A 2HQ3A 1Q44A 2Z6AA 3BSAA 3I2FA 2Z3VA 2IIPA 3MJHA 2JIDA 3HUEA 2ZQ5A 4FC7A 1QIIA 1QH8B 5FL7D 5CA0A 1GGEA 1W34A 3WDSA 1LDMA 3Q3CA 1FWLA 4D8XA 2HFKA 3SQXA 5DYGA 2CQ4A 1M2JA 1T4CA 1JQKA 1H2BA 3ZU2A 3DM9B 5ALIA 1ORIA 3REQB 1QSSA 4DLYA 1J0DA 3P9YA 1F14A 3Q8RB 4FPRA 3W2FA 3DL7A 3RTBA 3WIUA 3I76A 1Q1KA 4HACB 4IHJB 2C7GA 4FIDA 5MGNA 2G67A 3FOWA 1DMRA 3X3HA 1EVIA 1OPXA 3T6BA 4NBUA 2DPYA 2XCIA 4MUJA 3M2VB 1PG0A 3SWWA 4ONEA 3NV9A 1RJFA 5I42B 3T1QA 1S49A 1NJ6A 2GJ2A 2GX6A 1Z18A 3KR1A 4DLUA 4Q3OA 2JFOA 1RM0A 4P71A 2VG8A 5TX7A 1VHLA 5EI5A 4C3ZA 3U61B 4NLOA 1CHDA 3A3OA 2QYOA 1AKRA 1PK8A 5LSLA 3ZNQA 3DHNA 5JFOA 1PCXA 3FETA 3G8AA 2VQ6A 3L4SO 1QOQB 1KI7A 3O4IA 3V8VA 4FKBA 1EUQA 1V26A 3WB9A 3FNHA 2KJVA 1XGKA 3RSOA 4YO7A 3PRHA 1OLUB 4MUMA 3CRW1 2BOPA 3VNQA 1U7DA 4PXAA 5DYIA 1QIGA 3PTZA 2BP7B 4XE5A 4DPOA 1CVIA 2VP9A 3QIAA 5ALWA 5TQVA 5IMSA 5KYUB 5HMLA 1CQIA 2OCLA 4ZT3A 3Q10A 1GV1A 1O58A 4DA7A 1SC3A 2FN3A 2JNJA 3GG0A 3BG5A 1R4MB 5CJ2A 3RGGA 3WFIA 1U7OA 1JLFA 5KFFA 4AMUA 2XSJB 1KJNA 5IDXA 2OSVA 2M7SA 2OO5C 4DR3F 1TK9A 4IH9A 3LP5A 1ZS9A 2NXCA 3GFTA 4IFVB 4K05A 4RJLA 4URWR 4UTVA 4OJHA 1ELOA 1H22A 2GQ2A 4QR1A 1CS0B 2NUUG 6YASA 3JARB 1J06A 1X77A 5CD9A 4X3CA 3UE2A 4RSGA 3E8XA 2XMQA 3KIPA 3BEGB 4C4YA 5FAXA 3FLEA 1H8HD 4E03A 2FW0A 3GYBA 4QQFA 3EXFA 4HB3A 4NF2A 2AJQA 1XAJA 1WCIA 4J9PA 4PFJA 5LJLA 2OM6A 3OTOB 3PLNA 2X3GA 1FXLA 1FTNA 2ACMA 4CFSA 2DPJA 2WJGA 4LC9A 1NOIA 2ZRAA 2IYIA 1RYNA 5CLIA 4YP3A 4P74A 1T1EA 4RH0A 1QYIA 3KJIA 4RH3A 4Y30A 5ETLA 2R4TA 3HDGA 4WT7A 2K7KA 5LVAA 3HU2A 3V46A 3HN7A 4P3XA 3OPMA 3C48A 3T5AA 5JJKA 4OLJA 5EWMA 1SBTA 1YASA 3EOZA 4X97A 5ENVA 2NVBA 1G5IA 1JMTA 2DEUA 1DG3A 1MC5A 4LN1A 1RXWA 3KXIA 4EPYA 2OKQA 5TQ0B 3OEWA 1WPXA 3VALA 2QSJA 1GQQA 2B7BA 1US8B 2YBDA 3QX9A 2OSBA 1RTIA 4DUYJ 2WKRA 3UA4A 3PFFA 2WIKA 4KQIA 2Q9AA 2CNOB 4X4VA 5CH7B 4WE1A 1W1UA 4QC2A 3QSIA 2GZ3A 1L4HA 4XX1A 3A8KA 4QRDA 1YV9A 3IR6A 1EFVB 4J6FA 4ZV4A 3LWLA 4TPKA 3EE6A 3JATA 3K89A 4FFWA 5CG2A 3CISA 4H4OB 3E84A 1LDBA 3PXGa 2JK1A 2DHAA 1ZD9A 2Q62A 1IM2A 4CCYB 2JGRA 2GN8A 1U0HC 1GT6A 4DB2A 2BBWA 4R25A 3CLSC 4LFAF 1KZ9A 4MCAA 4I50F 2HHHB 2GRJA 1HK7A 2ZJAA 1QIFA 3T3HA 1EX7A 1T3GA 3H1BA 2O8CB 4NA3A 2ZRPA 4FLMA 3BRQA 2QU7A 3GV5B 5DSTA 4CKEB 3DRRA 3L40A 2IU3A 2DNLA 3OUUA 3UN5A 1IPHA 5TC4A 4MH8A 5DCYA 3KG4A 2X9GA 4NENB 3CZCA 3CJQA 4GGPA 4RV5A 4CM3A 3DE1X 3R0IA 3GLQA 4L95C 3X2FA 2BEVA 4J9NA 1QDLB 1E62A 2F8EX 4K9RA 1U9JA 4RL1A 1RJJA 1FFYA 5LQKA 4TTRA 3BE8A 5A71A 3E3MA 3LKVA 2CYBA 5ELLA 2GFFA 2XVYA 3EVCA 2CLSA 3Q40A 1C1HA 3OMWA 5CB4A 3ELWA 2F8SA 1AUSL 1CUCA 1G5FA 2CNLA 4KAXA 1ZETA 1K8AT 1U2ZA 1VR6A 3KHUA 4V3CA 2HHWA 1BXKA 5JAZA 2AZ4A 5JSYA 4KGVA 3L8EA 1BU8A 2XSJA 4KGXB 1NW9B 4WXWA 2D6FA 4LWZA 2VHVA 4IGEA 5IWCA 4ER6A 4JCCA 1TL1A 2ZBEA 4KXFB 1IN0A 5LIPA 1K7SN 2B2NA 5I3UB 5ETMA 4AYXA 1B7FA 5B2ZA 4QAJA 1XDBA 4ILMA 4WBNB 5AIBA 1ORHA 1EXWA 3SHVA 3UENA 3CVKA 3E9DA 1AKWA 4KXMA 1QKIA 1LUAA 5SYNA 1YZVA 5D8DA 1T43A 1VKHA 1XXHE 3PNYA 1WW2A 3VU1A 5ALUA 4MTLA 4USJC 3SOPA 4EBBA 4IJUA 3L5KA 2JD0A 4HI0E 2HY7A 4KIUA 1NRIA 1ZCZA 2I1RA 2AKWB 3LP8A 2VSNA 2CFOA 2J8AA 1KMQA 4MVJE 2YZ2A 2G9UA 3TVDA 1YTYA 2H59A 4MVJF 1JB9A 4DV2F 2J76E 4EPTA 2IC3A 3BJZA 2VS1A 4J4TA 2F9LA 3HHNB 4LRBA 2D3WA 3DM2A 5HBMA 2B1QA 2EX0A 1ZLYA 1SVMA 1PWEA 4DSIA 2E6UX 3L1KA 4AWAA 1Z2AA 1UBMS 3TRGA 3B6EA 5L95A 4X4NA 4DR3J 1Q1NA 1QTNA 1Y6GA 2MQMA 3PFEA 3MGJA 1FYXA 4LHVA 3OMXA 3W1EA 3M2RB 3C85A 3M6AA 4YLGA 3QOFA 2MQ8A 2E87A 2QVYX 3CEHA 3K8ZA 2VNJA 3T5LA 7GPBA 4NLVA 1CIJA 2VK4A 3HLUA 1DKMA 3KG2A 3V6KA 5DXAA 4BS9A 2CMGA 1HUQA 2WNHA 2ID9A 5KJEA 3E22A 3Q9NA 3SG0A 2BEWB 4R54A 5LNK6 2I6TA 4U7FA 3GOHA 2JGNA 1ESCA 1XNRJ 3GUHA 5FFNA 4DCTA 1L3TA 1T3TA 5K20A 4M55A 1P1RA 3EPLA 4IGIA 1DBRA 1XT6A 2BISA 4MLCA 2H1LA 3ITEA 3DKKA 1WCIB 1I3MA 1EFPB 1HT0A 3C3WA 1BMFA 3NI2A 1XNGA 2P3OA 4AF7A 4Y1EA 4XVHA 2QAGC 1KJJA 1RLTA 3SGLA 1W8DA 1GG5A 4WASA 4DRZA 2H4WB 3BCRA 1JLQB 4GFDA 1TK5A 4B3SJ 1EWKA 3DTVA 1Y80A 2I78A 4U4AA 1RRPA 1FDAA 4ENUA 1DAGA 2ZUGA 3LC2O 1ODFA 2JFWA 1F60B 4CFYA 1MQAA 3M82A 2O5EA 3N05A 5GPBA 3A7DA 2YWFA 5DDQC 2JZ5A 2PO4A 1JEAA 1J2VA 5HILA 4QL3A 3DWEX 3PACA 3UV6A 5AVQA 2NU7B 4MV9A 3Q7RA 1J24A 1NA5A 3ADOA 4FOOA 4DJAA 4RJTA 4DEZA 4ECWA 1H42A 5CD1A 4JY7A 3FPGA 5DOVA 4NPOA 1ZN9A 3EBPA 2UU9J 2LA6A 4HAIA 2WYHA 1Y1LA 3AV0B 3DB1A 4UY85 1R8QA 1U9IC 3H2IA 1S1TA 4R1UA 2BP7A 4JD5A 4MO2A 3UHPA 5JS7A 1JIUA 3MM6B 2ZE5A 1E6CA 3WX0A 4DBQA 5AXCA 3NVDA 5DMHA 3TOSA 2GN2A 1OBCA 4PWDB 2NQTA 1N2XA 2YIVX 1JMVA 1RZMA 4KIGA 4M89A 1Q5VA 3C16B 1O95C 3QQ5A 3ONVA 1ZIXA 2GM5A 1ZGJA 3N5KA 5DRKA 2PUEA 2Q3EA 3ESDA 4KHPB 3DP7A 2J3MA 2H4JA 3NIGB 1K2WA 3H83A 1U81A 3DHVA 4N39A 2YMPA 1I7QB 2DFKB 2ATEA 4ESVA 2HTFA 1IKYB 2X0DA 1ZUNB 1EWYA 4XQEA 3M9OB 4LF8J 2PXCA 1ZPVA 2IYXA 2JIZD 2WJZB 2JAHA 3DFEA 4PZVA 1QAQA 4GZ3A 2QV7A 5T4BA 2IRYA 1N5VA 2IPNA 3WAGA 5FI3A 3LPNA 4MLZA 3G6YA 2IOFA 2MSNA 2WG1A 3D7LA 4L2IB 1MEJA 4DCJB 1V5FA 1N5MA 2ZSDA 1R6XA 4TS3A 3ZTPA 5F8MA 2D62A 1D1SA 4RWXA 4RW8B 2GTPA 5DYTA 3T9NA 2JFQA 4LVUA 4NOLA 3KV3O 1RXCA 4I5GA 1FFSB 5AJYA 4P08A 4RK5A 2ABWA 7AT1A 4F25A 3HF5A 1OJ4A 4K6CA 4L4XA 4MCHA 4MIYA 5T7LB 3FUVA 2WVAA 4K1XA 3DMDA 1J9GA 2QROA 4G41A 1UXIA 1JEQA 5ER9A 3SLRA 2WJPA 1X13A 2F3PA 4Q4LA 2HJRA 5JH7B 4WXEA 4UUQA 3GH1A 1NQWA 1EM8B 2DG2A 3VUEA 1YR1A 1P77A 1W46A 4ARVA 3CLSD 1GPMA 4XUEA 3KJHA 4Q7QA 4KR0B 2QZPA 4MWTA 2FJEB 5SY4A 2GPSA 2M8HA 3FG9A 1BOFA 1QHEA 1NU8A 5T6MA 1X6VA 2JH3A 2WDPA 1NVGA 1IXYA 3IAM1 4QYTA 3BYPA 4BLTA 3TA0A 4IQ0A 4G6VB 1W26A 3IAEA 2QTLA 5EP3A 3IA2A 4MS4A 4IKAA 1GAQA 1OX4B 4UBIA 4DL6A 3ETDA 1U0OC 1RABB 3HRKA 3OP4A 3PT5A 4ZU6X 3EQ6A 2Q1YA 1I6MA 2JFKA 3N59A 1QUFA 5EC8A 3QPDA 3FPSA 3NC4A 4KLCA 1HTWA 5DU2A 4XK8C 1UFVA 4UJ5A 3E6AA 1JECA 2H63A 2FLWA 3SVLA 2J59A 1A2BA 3DBVO 1QJCA 3EGZA 1IFXA 1NCLA 2FVPA 4E6PA 3HCAA 3JS9A 3HB9A 4HB2A 3U7GA 1Y5LA 1MMDA 2GEKA 3S8EA 3E9YA 5JNUA 1P0MA 2XUAA 4LSWA 3D81A 3GQBA 3A1WA 4UDNA 1YJ9S 2ILVA 4IXDA 1LJ8A 1EKXA 4EMSA 3UXMA 1U47A 2Z43A 4OX9J 3LGSA 3OQ1A 1HNWJ 2PX2A 3BA6A 3F2IA 1RBOB 3IDQA 2RFLA 4JJ7A 1FYVA 1C1DA 1HPZA 4EARA 2I38A 2CDCA 3WYBA 1FFGA 2GDJA 2NPIA 2HQGA 1TZ2A 2VP2A 3IBFA 2RHOA 2H5JB 2ZIFA 2I2YA 5L53A 2WWFA 3Q9LA 2FK8A 5FKJA 3U26A 1K3UB 4GI7A 2IHKA 3DLIA 3QLEA 3HWWA 5F7ZA 2L42A 3HT3A 2WHXA 2NQ2C 4AMVA 4B3IA 5CU7A 3BGRB 4AXIA 2YNIB 3GV0A 3VU8A 3EWAA 3TRHA 1FKPB 4UUXA 1J6UA 3S29A 5COBA 4WK2B 4N82A 1USKA 5IKXA 1HEYA 3B2NA 3E53A 1CS0A 1S1UA 1WACA 3ASUA 2O67A 4P98A 3WYFA 1JHUA 4MPJA 2IOQA 3OTQA 2Y0BA 3Q7SA 4RVHA 2AI3A 1NF9A 3IHTA 1H69A 5I4IA 2ZI3A 1UKYA 4N48A 3N0TA 2OGUA 3PQ5A 3VOSA 3OTGA 5LLSA 4G5RA 3PXBA 4FFNA 3NMAA 4XJXA 1H5UA 1UXKA 2GD0A 4RUCA 3M9WA 3EVOA 1HARA 1DQNA 4BRSA 1A5BB 3NC1C 3V4VB 2J0EA 3G6ES 1CF4A 2ZULA 1IDOA 4UMFA 5U1PA 3GFZA 2E1MC 1XEWY 4PNEA 2IYZA 4H1VA 4IL5A 3RJ5A 2RG1A 1Z4QA 3WY9A 3ZU3A 5C1BA 1ZK0A 4G1IA 4F5YA 1OQ6A 1A72A 4OXNA 3GLFB 3OE5A 5EXEA 1S99A 1FDTA 3DE6X 3CVXA 2NZWA 2ZDPA 2FSSA 1SKSA 4OPMA 4ECZA 3BN7A 3TNDA 1SEPA 2PEHA 3R3SA 2ZDQA 2PNJA 1IYZA 2R8XA 2GC8A 2UV8G 2OB2A 1U6KA 2IITA 3K9LA 2DWPA 2TMYA 4FGLA 3CVOA 3K70B 5EE3A 4G0PA 5LP1A 3SM3A 2QVXX 1MF7A 3GT4A 2V6GA 3TLJA 1UL3A 1GNVA 4BQFA 4HTFA 2PRYA 4H18A 3NJRA 1NY5A 1YR9A 1EEXB 3H6HA 5BJRA 4MVJD 5JU6A 5CXSA 2KSQA 1ZAWA 2Q6OA 1Q7LB 3DFZA 4FBUA 1FSZA 1KAQA 4CT8A 2PMBA 4HVAA 4WSOA 4JZKA 3COJA 4WYWA 3UTDA 1KOGA 1FRHA 2PVCA 1KMHB 2M9KA 4R8LA 4ZVRA 3UANA 4X60A 4PR6A 3W5ZA 4P10A 1QIEA 4RADA 4XTCS 2UUCJ 2F43A 1ULTA 2F8MA 4AY4A 5IVDA 2B4VA 2FPMA 3A06A 4R05A 4EZIA 3ZD9A 3DOFA 1PD1A 3DVAA 2KB2A 3JQAA 3OFKA 2A1TR 4M1WA 5T67A 1S2GA 1ZMRA 4CGYA 1PZGA 1WDKA 4RPCA 5K0BA 1IB6A 2Y0BB 3KB2A 3KLVA 2FAXA 3SX2A 3WWDA 1D1UA 5K51A 1ZW6A 3TR0A 2ZVJA 4J9SA 2WMYA 1J5XA 1X5SA 4HH3C 3EQZA 1RM4A 4C5AA 3TLAA 3K31A 3MUMP 4DWVA 2H1RA 1HDEA 1XZPA 2JLCA 4TMWA 1YIJS 3VPSA 2A5JA 2OPBA 3E9ZA 1NVFA 1QGZA 3LLUA 4NU0A 1P3DA 1PW7A 3I0SB 3PNQA 4G07A 3RH0A 3G0CA 1BGXT 1XZMA 2FOLA 2Q2NA 4B3MJ 4HG2A 3G1TA 4ZVTB 3KJQB 1XNQJ 2HW8A 1BROA 1JPJA 2BVNA 1XE3A 1XL0A 2O0HA 3IUSA 4A8YA 3W5JA 2WT9A 4F0HA 1J2YA 1T2NA 2Z2YA 1ID8A 1NUUA 2GN6A 4IM7A 1G291 4WVLA 4QREA 3SR4A 3A4YA 2L9DA 4QO8A 2QLFA 3QPWA 5JJIA 2IEZA 2QV0A 1KVUA 2N7YA 2JFBA 4ZEOA 3UCGA 2GT1A 3TLYA 3P20A 1UWAA 4FMDB 4Q7MB 2VICA 4CKYA 5HROA 1M5UA 4YY3F 3FMFA 5FOWA 4AL5A 4L8WB 1O6BA 1YZUA 3R7WB 2F17A 3NGDA 3BWXA 4WVFA 5I7AA 1Q17A 3HZGA 3MTDA 4CM4B 2MR6A 4FHGA 1VHWA 3M5DA 1CR2A 4KQHA 4RW4A 2OEMA 2VPWA 4DR5F 5AI6A 4EA6A 2TMDA 4FQ8A 5EZYF 2YVSA 5AJVB 3QU7A 4ON9A 1HTBA 3H84A 1QDUA 4O4RA 1BS2A 2FZ5A 4RENA 4RW6B 3A13A 2H9ZA 2I6FA 1M76A 2ZJOA 3U4MA 1QHXA 3WDOA 1YB7A 1P4HA 3HFKA 1QY7A 1DRVA 3KK1B 2R7WA 2DP4E 1RPJA 4RPHA 3PB3A 3L92A 5ALDA 4XUDA 2I2WA 3UK0A 2V9CA 3MS4A 3AVYA 1FQKA 3LPAA 2CQ3A 3CS3A 1JLCA 4J1SA 1SVSA 5IANA 3NLLA 3V33A 2VTBB 1AD2A 5EWLB 4QYXA 1ABEA 1R9JA 1L5FA 2JI4A 2IZ6A 5H9FJ 1IR2A 3DO6A 3T9AA 1TM3E 2P8SA 4Q3BA 4CF3A 1FBTA 4L2IA 4Q18A 3LPCA 2ZRCA 3FPCA 4Q8EA 3W4JA 1PVOA 4G89A 3ZWOA 2ZM6B 4O2RA 4FXDA 1H9CA 2H9YA 1REQB 3MT7A 3EWSA 4Z4FA 1SIOA 4BHQA 3L4BA 2ZDGA 3O8LA 1W4AA 3SAJA 4QHYA 2YWHA 2H0QA 3DC2A 4ITVA 1H0RA 5CNIA 2QNIA 4GMDA 3VTAA 2O2HA 4X90A 4OIFA 3B1ZA 4LDRA 5BN4A 2VTBA 2ALZA 3DLGA 4RNOA 3MK31 4TYPA 3SEZA 3GB0A 2ZWPA 1UBEA 3W8DA 4EI9A 3ZXUB 1U7TA 5GAJA 4P4SB 3RLIA 3Q7QA 4OYMA 1I3OA 1XMPA 2G1AA 5BY2A 1UEUA 4QBFA 5IZ4A 1W88B 3EFOB 2GS8A 3QK7A 2ORED 2QD1A 5K0NA 1JTFA 3BXHA 3CIZA 3ZQJA 1KKMA 4IDNA 3OCJA 3O8NA 4DDHA 1GTEA 3KHLA 4XGQA 1N0HA 4MXDA 4WTOB 3S28A 2M6KA 1F06A 1F2VA 2IKQA 3DJFA 5SZJA 5HVGA 4EECA 2DKOA 5EWLA 2HRBA 3K6SA 4MAKA 1XROA 3GJRA 2VA9A 2P9CA 1OY9A 3SBDA 1YFLA 4D42A 3PR3A 2P41A 1A9XB 2DNKA 3ZZNA 4WUTA 4UHBA 5TJHA 4DDUA 2EG2A 2GF9A 2OFXA 3TGWA 2NYHA 5BR8J 3FE2A 3ROMA 2QMEA 2GPAA 3FDFA 8OHMA 3GC6A 2QAJA 3SZGA 4GPAA 2RK6A 2Q3FA 2BGIA 5AI0A 2W11A 1WXQA 2XYGB 2BTQA 3WB1A 5FX2A 4JUAA 2ATCB 2GPBA 3FNIA 1YR6A 2B82A 5C0OE 4BJHB 2OPSA 1T9XA 1CJMA 3K9BA 2B8WA 4XXHA 3ZTOA 3ONEA 4UULA 4DMRA 3FKQA 3OICA 1EQMA 3PYGA 3CBGA 2EGHA 3I2YX 1CVLA 2W4MA 3UT5B 2K3IA 4C0WA 1PYSB 1GEEA 2GO1A 4YDQA 2NU6A 3KNGA 3PU6A 1T9AA 1ODIA 3KJQA 4NE9C 4QJIA 4AROA 2W5UA 5LYYA 3PFIA 3RIMA 1KOHA 5ETVA 5HF9A 4TRRA 3O2IA 3T1TA 1LBTA 3OL8A 3P2MA 2AZDA 4XM0A 1G2OA 4KT0C 2CJYA 3ZVNA 4JI7F 1UPPA 5IM0A 3ZK9A 1JVSA 5L40A 4EA9A 2P75A 1NMZA 5JOQA 3RW6A 1TM7E 3QM1A 3TVZA 1YX2A 3I45A 1D4OA 3EUFA 4B44A 5E7IA 5JCPA 2E1AA 4ARUA 3A04A 3RTEA 3ZLUA 5C4GB 4ENVA 3QRQA 2ID4A 2V7WA 4Q66C 4JUZA 3EXIA 3EZFA 3OOYA 4NMHA 2CT8A 2A5GA 1W35A 1ODCA 5JAOA 3MD3A 1JJHA 2QO3A 3VZQA 2RQKA 3AGPA 2WVDA 3EXG1 1SRRA 1YONA 4TU7A 4NKRA 2QAGA 1ZGBA 4ER8A 4DR7F 5LCXA 3U3RA 5JZOA 5J9FA 1NYRA 4DSTA 4IQFA 3A7EA 3RVNA 4IMPA 2WHOA 2GZMA 5E1DA 4AQDA 1OH5A 1IY8A 2CL7X 3ZBTA 2E4YA 1NBEA 5RUBA 3OLYA 2FFQA 5EHIA 3DEKA 2VRCA 2H5LA 4UUMA 1T9VA 4PABA 4EI2A 2ZW9A 1IQRA 1JAYA 4F9EA 1ZGGA 5DH9A 3LZDA 4JQYA 5DK4A 5LQJA 1SPXA 4AJ4A 3W5SA 1UMCA 1YVEI 1PEAA 5AOAA 4V2IA 2IK8A 3GP8A 4FILA 5B1IA 5DM70 1QTQA 4ZOLB 3LOUA 3CD6S 5CR9A 3PDIB 2RHCA 1C9DB 4O4JA 4KC0A 5LQMA 2EKZA 1HZJA 3TEJA 3I87A 1JNYA 3FX2A 2RGRA 4Y2CA 1NK4A 5GAHU 2G9OA 3N0XA 5AJWA 3URMA 3LO8A 2DITA 1HBJA 2CB0A 3VR2D 3LD9A 4RNMA 4M1KA 4TXMA 1JXEA 2BDUA 4ZHSA 1OB2A 5GADl 4JI7J 3FBBA 4M5JA 1KK0A 2DHRA 4L78A 3E05A 1G6Q1 1L6RA 4IFBA 3UHAA 5A2QU 4ZU1X 1M6NA 1DDOA 3CMMA 3H1PA 2VH5R 2QRMA 3ZVKA 4FB5A 3I8XA 5EJGA 4C7VA 1K1SA 1TUGA 2LDBA 3IUMA 3L05A 3T3OA 1K73T 3RBAA 1KS2A 1OKKA 3VOAA 2P2GA 4OHCA 1RTHB 5IC6B 5FLXA 3KZMA 4HXGA 2JC0A 4Z4GA 1D8ZA 1MMLA 5HVNA 4TMYA 1WXDA 3R9IA 3JTPA 1DURA 2HHHJ 4GWKA 3IR7B 4QTZA 2P9FA 4KYZA 4DR1B 2CNBA 4QRIA 7MDHA 3UN1A 5LU9A 3EMDA 4RE6A 1P4AA 1JHVA 2IVMA 3FPJA 4LX0A 2BEUB 4XWYA 4ZEMA 5B3AA 4BWVA 5EERA 4DQRA 4P36A 1UL1X 4FKYA 2E4XA 2VYVA 2BANA 3OE7A 3BHIA 4W5QA 1QC5B 4UDOA 1XMQJ 2VP5A 5EUHA 1XB2A 1L5ZA 3O8OB 3U3DA 1KBRA 5JBQA 3J81U 1GXTA 1TUBA 2JVJA 1NHGA 1XTVA 3GU0A 2H8KA 5EWJB 2C04A 5IN5A 1XZNA 2PA0A 2HWTA 3U9LA 4X61A 4R3UC 1E2LA 3WSVA 3FSJX 2ADMA 5HMMA 3FI9A 2R97A 2VF8A 4K8OA 4OREX 2XYPB 3C3CA 2FHSA 2WMNB 2JHFA 1MXHA 4IYJA 3UFXA 5K8VA 5FWAA 2PZJA 4DFPA 1Q12A 2P2CB 2O05A 2FLOA 5AW7A 1JYSA 3KJFA 3KNAA 3S70A 1F6DA 2JI7A 3Q41A 2IZ5A 2XQVA 4WTYA 2FFHA 4MMOA 5BYQA 2FJPA 3L0CA 1CG2A 4O2AB 3HFVA 2VPZA 1C0LA 3RF6A 3QPUA 3K8YA 2Q5IA 3VU0A 3RAFC 1OROA 4ZAFA 3OX1A 3V8PA 2NSJA 4WZBB 3QJ5A 2BGNA 1Y5NA 4KHPF 5AKXA 1F0NA 2VTEA 4ZXFA 3LP2B 3THVA 4P7KA 2J7PA 2BJ1A 4X20B 4KIAA 1SVLA 2YNMC 3BAFA 2NSLA 3MUEA 4ES3A 1UKUA 1S02A 2ZJ1A 1HYSB 4QA9A 1YRLA 2CADA 1NB2A 3M9XA 3VKFA 4FFVA 5COAA 1ULHA 3BMCA 1TIBA 4OP1A 2Q1WA 1E2BA 3AF0A 2OHJA 4IQXA 1SVIA 3AD7C 3GJSA 3LWZA 4NS4A 2ZBDA 4ZPJA 1GPH1 3G59A 3LBNA 4HC4A 4NFLA 1DC4A 5EWGA 2VHXA 1AQLA 1NMYA 3FSGD 3QYPA 4II2A 2RKIB 2P27A 3RJZA 4XVUA 1CSEE 2BKNA 2OORA 2ISCA 4DQPA 3KQWA 3O75A 1D1PA 3OJOA 4LY0A 1C0IA 3LX5A 2B9YA 4JEUA 1VHQA 5AKIA 3DE4X 4XR9A 2HNDA 1QWOA 1FVXA 2AE2A 2HQFA 3TNVA 5J40A 2ZB3A 2X7IA 1HNZF 2W2PA 2PZEA 1S10A 3KWJA 4OOEA 4BC0A 4RDHA 2EFVA 3AG6A 2NCKL 4ZPAA 4ZGGA 5FADA 5EVJA 4IXWA 3JWEA 1TKBA 3N0VA 1SJFA 4JI0J 5BV8A 3OR1B 2FUNB 4O2BA 3PXUA 5DPMA 4UE3S 4QYRA 4L76A 2X3DA 1ZQ1A 4EG6A 3HXQA 1CEXA 4Y1RB 5A4FS 5IJAA 3QT7A 1O96A 4JNCA 4JP1A 2NVOA 5D2CA 3T1OA 4N4AA 5I9NA 3C5CA 3PQ7A 2MWMA 1X7WA 3H5AA 1U7UA 5E7MA 2DETA 4FC6A 5AK6A 2CUYA 1G20E 2WAAA 3K09C 5J43A 4YEDA 3AVQA 2FZWA 4OLBA 2Q3BA 3DG9A 3QE9Y 4P5PA 2P62A 1PGZA 4G1FA 4ZYUA 1Y10A 1MH1A 2PLNA 3HCNA 1NX9A 1G98A 1RZRD 4J07A 2WA2A 3RC2A 2AZXA 4L8YA 1AA6A 4LRQA 3TD9A 3CE9A 3FBFA 4OUKX 1JJAA 2ACYA 2ZXEA 4YR2A 2IXFA 1ZN7A 1NK9A 2RIRA 5G0UA 4WKNA 3RUAA 2GVNA 5BP7A 4HGQA 3N2EA 2YJ5A 1UCNA 5CIYA 5AIAA 5TV2A 5EKSA 4OHUA 2EGGA 3ZY3A 1Q8LA 4JQSA 5HFAA 1WPGA 1G55A 2XYRA 5JE8A 3IPLA 4ICLB 2O6HA 1XLUA 2Q3HA 4RU9A 4MRMA 4JBWA 2GM9A 5HOEA 4NRTA 3B2QA 4F45A 2MTLA 1S6QA 4WP9A 2AXNA 1PYGA 1BW9B 3AFHA 1WUHS 4A82A 1VG9B 3SEFA 4L3OA 2QNBA 2KYXA 1OGIA 1IBKJ 1FUEA 3HSKA 2MB0B 2EF1A 3K8QA 4JBCA 3ZE2B 4O4HF 2FKAA 2QDKA 4GYWA 3CLKA 4QBIA 3H3FA 3JQPA 2R6AA 1Y8RB 4C8YA 2EWMA 5ALTA 2PZBA 3PUJA 1TUIA 2E89A 1D2MA 3R6LB 4A6PA 3THTA 2EJTA 2G1DA 2J07A 3HHLD 5L38A 4U7GA 4FLEA 4MUXA 3QSGA 1J1UA 1JR4A 2F00A 1PT9A 4GLLA 3GFFA 3QEAZ 3AF3A 4MYRA 4YB5A 1KYYA 2W6IA 1C29B 1R64A 4GVBA 3TWZA 3QLHA 3GVPA 2NACA 3AR5A 4D0NA 1ABFA 4DZ6A 1NSYA 2DFTA 4CBVA 4NDAA 5FB3A 1NPTO 1FUYB 1TGVA 5LT5A 4ZQFA 3UUGA 4YECA 1YZ6A 2D2XA 1COZA 4EHHA 2ZRJA 5E6RA 4PVDA 3QLVA 4IKOA 3DM2B 4C0SA 4DXDA 4UVEA 4NMWA 2VPTA 1B0TA 1UMBA 4IV5A 2O0MA 4O3FA 4B45A 4J1QA 1E58A 1V9SA 3SFTA 2BEWA 4MI1A 1RWVA 2GVZA 4M9RA 2C9ZA 3CPSA 2G5PA 3KVYA 3X1WA 3BOSA 3DSRA 1ZHHA 3E2EA 5C5JA 1PX2A 3E2MA 2GESA 5DG9A 3K57A 5KQRA 3PCXA 1G6OA 1XEZA 3I82A 4QKQA 3RIXA 4EG1A 2LQBA 3MEEB 3FN4A 1VJWA 1RZUA 4RX1A 2NM0A 3N9IA 2B51A 1DAKA 1KRHA 3HB1A 1QP7A 2Y1DA 2I29A 1YK0A 3FWZA 5DLGA 1MRNA 4DUYB 5ER6A 5E41A 1E4VA 2Q2OA 3CJ5A 4FXWA 3HBMA 3E7DA 3OF5A 4DN6A 1TYDE 4AK9A 3MD9A 4Z3OA 1XO1A 1KO8A 2GXUA 2ZSBA 2R9VA 4BQRA 2WWXA 1XK6A 5BWNA 4HVZA 1MU2A 3GV8B 1Z68A 4TS9A 4Y1RA 3EZ9A 3ZE0B 2VJDA 4X62B 4TWZA 3BORA 3SM9A 4RANA 2WZDA 4YCDA 2FGCA 3TAXA 1VCNA 1N2CA 1W94A 1QF7A 2GA8A 4TTPA 1SK9A 5CT5A 1QRSA 2Y0CA 4EZ6A 3ETNA 4QATA 1RRGA 3T9ZA 5LMNJ 4G6ZA 4ZP6A 3EVDA 5JAHA 1DRZA 2EFJA 2WAMA 2UXBF 2KRBA 3UMSA 5LXYA 4CM9A 1T8WA 5BT9A 3M8WA 4R83A 3N2YA 2IEIA 221PA 1F2UB 4YRGA 4ASUA 3ETJA 3EICA 2ZUWA 4CKCB 1CNMA 2G8LA 1QHNA 2Q4EA 1O6ZA 2WUFA 1RAHB 3U6KA 2DNOA 2Y77A 3TL3A 1MO2A 1Q7YT 1PBNA 4FNIA 1QE1A 3EPGA 2HQIA 2PFDA 5BW8A 2D1CA 1VOTA 4LJ7A 2ZI4A 3R2DJ 1K86A 1CVJA 1XRLA 1RP7A 1Q6YA 2ZJ4A 1IWGA 5C7PA 3VX4A 4PLFA 3SQOP 1G8FA 4UMDA 2F64A 2FVQA 4ZPTR 3JYQA 3GXOA 4O2AF 3ZI0A 3DRRB 4PO9A 4OP3A 2QM7A 3L09A 3ZTTA 2DXIA 1HBUA 2PE8A 1ADGA 4RWZA 4NZZA 1K7YA 2ORIA 1GL6A 3L0DA 4G0OA 10MHA 2QPAA 5IAAA 5TS2A 1HDXA 2R1ZA 4C6TA 2LQ5A 1QCDA 2MZ1A 2JCSA 2BFFA 3H98A 1FDRA 2UVRA 2I8AA 1NYTA 4QDZA 1ZC3A 1WDTA 4KR6A 2B99A 1U90A 3D7SA 1QGED 2OUKA 4HB4A 4XIFA 1HNZB 3US5A 2VQEB 5ETOA 3ISVA 3KJVA 4NULA 4QYZK 1NATA 3OQ6A 3TLCA 2CAJA 4XWGA 3H4IA 5EKXA 1PE0A 1NP7A 3OTEA 1IN7A 1JIJA 2R00C 5ECYA 3EGWA 1EDOA 1XVUA 2O8CA 4C7KA 2AW3A 4HUQB 3DAFA 2R7MA 3DLTA 1BWSA 1KF0A 2HV8A 3IV7A 3AP1A 3PZRA 1UOQA 2ADCA 3ZS8A 2NUPB 1TYBE 3EXYA 3R41A 2ODAA 3CX4A 3OLZA 3OFNA 1CIVA 2HJ9A 1R8YA 2IW1A 2FJWA 1NDHA 1PGQA 3K9HA 1NK7A 4L3NA 3TA1A 5JNVA 1TUEA 1EM6A 1N7GA 4Q5IA 4MB6A 3RB3A 3TIVA 1KSJA 1RXOB 2VF7A 2QEQA 3EEIA 3AB4B 3H2HA 3MWJA 1V41E 2DYKA 4M6WB 3TSCA 4KDEA 3I5BA 3BB1A 4BTLA 4HDNB 5G0TA 1KYQA 3PC2A 1U45A 1K92A 3DFMA 3ZDZB 4IMIB 2BANB 1LBEA 4YCCA 1VQOS 3IR5B 1V3RA 3E4CA 5CCLA 1PZNA 1IM4A 3L4BC 1KAMA 4HCJA 2ZHAA 1TL3A 3WSWA 4P7VA 3ELHA 4AWBA 3BB3A 3HR7A 4FVTA 2OCKA 1X4EA 2J0VA 1WM1A 3GIKA 2FR1A 4C4WA 4LK2A 4YT2A 4AXJA 4MS1B 1KTIA 3ZV6A 4DNFA 2AZMA 3S3TA 3KO8A 4NZYA 3PJWA 4TZ0A 3ESZA 2WONA 3JZMA 1E79D 3K9WA 1NOKA 5D51S 3JYOA 1EKRA 5D5PA 1NUEA 5JH7A 2R48A 3GCZA 2OPSB 4TKMA 1L7VC 2WYIA 1T6ZA 5EN1A 3DCYA 1F2UA 1JR3D 1FMLA 3CU5A 2HMSA 1Z88A 4M83A 1O6GA 2PX5A 3HVKA 2AHOB 2MHEA 4TRNA 3K73O 4HEA9 5I7RA 5AHRA 4NI5A 1L3UA 1EP9A 2Q7OE 4LVOP 3OT9A 2IF0A 4U2BA 4PFSA 4H3KB 3A6GA 5G0VA 2VBIA 3R3YA 1H2RS 1BWVA 2VFSA 3OT5A 2CLDX 1LGYA 4YI3A 3MXHP 1IQTA 3ZZTA 2DQSA 3KHSA 3B53X 1BQNB 3GRCA 4DUZJ 4RELA 2VRNA 3UATA 5M2UA 1I4LD 3F8SA 1D2AA 1MORA 4BKPA 2MQNA 4HH1A 3WBKA 1LNQA 2OK7A 5DGHA 3H5OA 5JDIA 2XNKA 3RT9A 3CW8X 1LTQA 4I66A 4GKKJ 1C7QA 1QGUA 1LRJA 4Z7JA 1BCSA 3BSNA 4M94A 5H83A 4UE2A 2JIPA 2O3SA 2FC8A 3WGZA 4HUTA 4LFBJ 2QC3A 4G0UA 5T57A 2WM9B 2ET6A 2WUEA 5K4GA 2XB8A 2FVCA 2QTHA 4KVZA 3SF8A 3Q15C 2HXYA 4X7MA 2HJSA 2PKRA 3OPNA 3BMNA 5I8WA 4WDRA 3G2PA 3UKDA 4GF5A 1KSGA 1PGPA 1MRSA 2VRWA 3EZNA 3MFYA 4EYQA 5C5IA 3PI6A 1S8FA 3C19A 1Z0SA 4JA0A 2GCIA 4AXBA 3C3EA 2CXOA 4YRIA 2HBRA 4B83A 2AKEA 4KO2S 1HSOA 1S4MA 5ETQA 4EZBA 1ZNQO 1EK0A 1M1UA 3PQ8A 4R9VA 2H29A 4UDXX 4WFJA 4CF7A 2J0XA 3G8QA 4NK5A 4M7RA 2AXEA 3QVLA 3AEKB 4G25A 1LOUA 2B92A 2JIBA 4LC0A 4RFVA 1JRLA 4OP2A 3R5SA 4PWYA 2RF2B 3SQDA 4EFAC 1CJUA 4F06A 2D7SA 3IC1A 3HFRA 5JSHA 1LPNA 4B6PA 1RKJA 2A4KA 2WDZA 3LGAA 5KTOA 1DGQA 3CNBA 1GTJ1 2BKAA 3PYDA 3BH7B 3DFUA 3SF0A 3OOEA 5C42B 4IH4A 4WHMA 3R7BB 1FMFA 2VHTA 4DUGA 3C7TA 3NNAA 1U9IA 1WF1A 2D74A 2RHDA 3MJCA 1SKAA 2WT4A 2N1MA 3FRIA 5IMBA 2FPGA 1JFFA 2JCBA 4C01A 2WWRA 4OHVA 4ZVUB 2CHVA 4GWGA 3U1LA 4XAKA 5HDQA 3GAFA 4M95A 1QE5A 5B1HA 2BE7D 1OBOA 4HYKA 3PX4A 3R09A 4Q6WA 4J9RA 3GP3A 3V00A 3Q72A 1VRTB 1HI1A 3BULA 3NAGA 1OPRA 3OQJA 1GNTA 3T0FA 2AYBA 1XJ5A 4ARZB 4R84A 2RVJA 4NLUA 1T0IA 4KBFA 1UA0A 2DEIA 4BQSA 3JYHA 1KERA 5CUQA 1H2EA 4RUKA 2IH2A 3D6MA 2H07A 4HTIA 2JFFA 1X9IA 3IIEA 1NU4A 4L8LA 3NHFA 2ZYTX 4DL3A 2X23A 4JT8A 3EZ2A 3O3LA 2YCLA 1NDQA 2UVUA 3T5BA 2G7ZA 2I3GA 3OO1A 1L8QA 4J1NA 2V69A 5IT0A 4OI2A 3I9NA 3WMFA 1KY3A 1A82A 4ZT5A 1DQYA 4N5SA 1E2PA 4U7PB 2GFHA 3V2HA 1H2ZA 3MR3A 4Y6GB 1O8BA 4REQA 1KQ3A 3GOQA 3STVA 3D0OA 4QUAA 2L18A 1C1XA 2OT3B 2XGMA 1JTEA 3SMZA 1YVUA 5KTSA 5AT1B 1NLKL 1P0FA 1LSUA 3ONDA 4BNJA 4M54A 2L2QA 2G08A 4INZA 1AC5A 1S4EA 3KB6A 4WH0A 2KHCA 3IAS9 1SUDA 3BGDA 2XNRA 1U6BA 5IJZA 4Q9JA 3EH2A 1F8XA 1SZPA 3FCUB 1FTGA 2X9NA 3D1JA 5A9TA 1A8HA 1YJRA 1UK9A 3QWHA 4Y2GA 4TNOA 3P4XA 1N6IA 3PNLA 4LF5F 1R9GA 4NWIA 1KEEB 1ETHA 1MTOA 2DYAA 4MRSA 4OV6B 3GP5A 3IN5A 4OXKA 4DJDC 4EYIB 3RT1A 4XZ3A 1KFCB 4D8UA 5IASA 1R7IA 4BZWA 1YJXA 1TCAA 2VPQA 1WETA 1G3UA 1V8PA 3CEAA 1RBYA 3CCBA 1WQ4A 5F8IA 16PKA 4EG3A 1PF7E 2RJZA 5B7NA 4R16A 4DV3F 1X1SA 2Y0SD 4DG1A 1CDOA 3H8VA 4M5GA 2Q3CA 4PM4A 2QP9X 1IULA 4D45A 5DBFA 2IZ1A 5NLLA 1VKNA 3NAHA 3GJ3A 1L7OA 3NGMA 4A4JA 3BHNA 3W4KA 3ED1A 4CM4A 1FRJA 1PJ7A 2Z5FA 1E1MA 2FQWA 4AIIA 5HK9A 4A46A 1NBHA 2NNLD 4E2ZA 3GEBA 1WR8A 4PEOA 1XMIA 5K6AC 1EE2A 3JYNA 2IV7A 2AVDA 3IEPA 3TZXA 2W25A 2X1MA 3FHLA 5DLYA 2C4MA 3HBFA 1TX4B 1V2HE 2PFGA 2GN1A 1CUXA 2PNFA 4BKOA 3PEHA 1GILA 2JLWA 1IBKB 4FNOA 1BO6A 3SHTA 2YQ0A 2BFBB 2ZEJA 4PZYA 2DNGA 5CM8B 1RWKB 1QFYA 2OCIA 4GH5A 1KZ4A 1T9ZA 4H4MA 5DI3A 1U9CA 3UJAA 1F60A 5LMNB 4ACBA 3FCXA 3M1VA 1UEIA 3A36A 4D96A 1SUAA 4NMXB 4MEAA 2FPIB 3GA5A 3ABIA 2WBRA 5H16A 4JYCA 4Q4JA 4R5PA 4MDEA 4FYDA 1NQUA 4NLYA 4BFSA 2XKKA 4BFXA 5HNKA 4OJNA 2UVWA 5GONF 4P32A 1UBOS 2PMDA 3A12A 1UMCB 3GLSA 3GYXB 1QIKA 4A0FA 1COWA 2PXHA 2CYYA 4CL8A 2HIHA 1RWXB 1M90T 1PZXA 1F9HA 3LBAA 2O1XA 1LU9A 2K1RA 1N6RA 2R4FA 4Z7NB 3JAWB 2V1XA 4DOZA 3IHKA 1N32J 5CB0A 4EY6A 2HQDA 1JAXA 3GCWA 3BAZA 2WB4A 5K0EA 1YU6A 1KHVA 1XTKA 5E4YA 4OI0A 1AK1A 1DUSA 3PGMA 3G9UA 2BC9A 4CQNA 1UQTA 3ZHYA 2LKDA 5KOJB 3V9PA 1FXSA 5KFRA 2NZ4A 3INTA 2YQ5A 3DOMB 3QJGA 5B4UA 2XTNA 1UPMB 2XUKA 4GD3Q 2UZAA 2UXCF 3O73A 4ZVTA 3WL4A 3ROEA 2EW9A 2Q99A 4EMBA 1GZ3A 2AWZA 1H0HA 4BVLA 3GP9A 1OWLA 2HK7A 2E7WA 2F1JA 1GDHA 1NFQA 3AQOA 2GN0A 3M32B 5JVDF 2VUIB 3GNSA 2ASLA 3PY8A 2BR3A 2ZITA 1Q0ZA 4YHBA 1BQXA 1MTZA 1U1IA 3BXZA 3EVBA 1I3NA 4DM4A 1FQJA 4F6LA 2RB7A 1DAIA 2CKMA 2EFYA 2X3FA 2YV2A 3KUUA 5FWYB 1C1DB 4AYTA 2WCXA 4OJ3A 2QRVB 2PX8A 1D0SA 2E9ZA 1Z2LA 2CE7A 2QBYB 3D3QA 3JXEA 1U8EA 4ZCRA 2BSXA 5K3BA 5TXGA 4PTLA 3NIWA 3JASB 4N77A 5E3RA 4DX7A 4ZJUA 4ZAWA 2YFHA 4CTKA 2FJUA 2FB9A 1PTKA 4TV8B 5IVPA 4CUZA 4FTWA 2K1RB 4ZEWA 2VOEA 3IM9A 2YXLA 1VJGA 2GYYA 4YRAA 2OYRA 1U2RA 1OFHA 2DH5A 3N6RA 2A88A 1ZH5A 2C3YA 1M2OB 1ETUA 3SEQA 1NW8A 1TKTA 1GZSA 3FWHA 2FWNA 1RLCL 1RDFA 2I1QA 2W2QP 2R8PA 3FZYA 2GD1O 4MUHA 4RKEA 4QVIA 3EVAA 3QH4A 1G5QA 4POOA 3WE7A 2CQHA 1IR0A 4GOXA 4TQAA 1SZJG 4N5DA 3B1FA 5BUSA 4DOMA 5C37A 1X7YA 2QHXA 4DF3A 2QE6A 2GEFA 2CHQA 3KWLA 3HJCA 3J7A1 3SJCA 1XWFA 2YWRA 2ZU0C 4TYMA 3HABA 1BE0A 3V1KA 3CIFA 3EZLA 1M8JA 3PT9A 1QTRA 1CJVB 4NJEA 2QFIA 4TTSA 2Y1IA 2BZGA 5KSOA 3KOMA 4OQJA 1NF2A 2HF7A 4QG7A 4KDRA 1E7QA 1V9LA 5JAMA 2P1ZA 1CUBA 3KQMA 2SXLA 4F7WA 5CQGA 1QZTA 4JKOA 3KU1A 1T0TV 2ZOMA 3IESA 4PF1A 2FW1A 3TM5A 2WHEA 4FCTA 2Z95A 1I1NA 2X76A 1Q19A 3H2UB 1NJIT 3V7FA 3RYTC 3H2LA 3L4JA 4W5TA 2ABYA 4KIFA 1EE1A 4CKZA 5JXJA 1CP3A 3BL8A 1R9NA 4O3MA 1T36A 1CCWA 2W83A 3CR8A 1R74A 3DW1X 4XGNA 1AW0A 3BFXA 2KT3A 4QFBA 1WORA 3FK4A 2MOKA 4OFWA 4QFMA 2D0PB 4ZVEA 1QCYA 4K0RA 4BO4A 2Z1MA 5F2OA 2HNAA 4LHEA 1YOVB 1XWWA 4S1TA 3KDNA 2C7QA 2IUYA 1DTTB 4D92A 4K50A 1F0PA 2A9VA 3NDBB 3LLCA 5AE1A 4IDAA 4KE8A 1VBKA 1RACA 4BUZA 3D8RA 1EFHA 5E3QA 1T1GA 2ZVIA 3H9QA 2QL5A 2HAIA 4MP3A 2J7PD 4PFQA 4RQBA 9ATCA 3VKWA 5EZYB 5HSPA 2B8JA 3ZY4A 3K7RA 1J49A 4EUFA 1OAOA 4BMSA 5EZ6B 1BYUA 1HMVB 4U1RA 1I1QB 2JEIA 5H9FK 3E01B 4Q1AA 4MW1A 2HFJA 3U3JA 1GPNA 2R60A 3ILSA 3W04A 3QPVA 3BQ1A 3MMPA 2LP4Y 1F38A 3E0QA 2ATCA 4Y6SA 2ZTSA 2IPXA 4ZTZB 4E5YA 5FYDA 2YL2A 2IV3A 1LSSA 2WTUA 2A67A 4V0ME 2IXEA 1U8TA 2YIDA 1II8B 4ZO6A 4Q3LA 3ICVA 3UHOA 3SFUA 4P34A 1W5SA 2OYSA 3T06B 2KT2A 2GCFA 4PFKA 4EJSB 3ROQA 3V8BA 4FX5A 1NJWA 3ILXA 4C8KA 1RYZA 4PZ9A 3I6QA 2WTAA 4WZAE 3EY4A 3N2ZB 4BIMA 4DJ5X 5AVRA 1LWEA 1GJRA 4J16A 4QASA 1I8TA 3CCSS 1D3WA 1E9RA 4K2HA 5DT2A 2CWWA 2VZLA 1EJBA 4ED9A 2BFAA 3BKXA 3BXEA 1ENPA 1JLFB 2EW2A 4XPIA 2VHYA 3MFIA 3QA3E 1BUXA 3M34A 4FDAA 1YA8A 1JFLA 1FX1A 1KU0A 4I3FA 4GPD1 4L5BA 3B20A 1UBTS 1JE0A 1Q78A 4RO0A 3I28A 4TTQA 4DX6A 2O1SA 3KDSE 2D3O1 3HO8A 1UMJA 5A76A 1BN6A 2H54B 1S0OA 5ALZA 1EUYA 3FZEA 4EKNB 3NYRA 1PILA 2B9XA 3GWCA 1GN8A 1JG6A 3CJ8A 4BO3A 2QZ8A 3G8SA 2XSZA 2AOTA 1RCXB 3RBZA 4MQ4A 3SC3A 3IAS6 1DHTA 1OLUA 4M5MA 3QVXA 3PYLA 3RFFA 4MOWA 1Y6RA 1NURA 3QFFA 1H38A 3MGCA 1P75A 1CLFA 1Z15A 2YKNB 3ETGA 3I5XA 1I14A 4Z9AA 3OOHA 1V8ZA 2R8YA 2PXXA 3WYDA 2M5YA 4INAA 4NLSA 1N32F 1NJ1A 1QSYA 3L9WA 1B73A 2ZIEA 1VL5A 3SE7A 1SL1A 4S0MA 4R2JA 4BWMA 3Q12A 1WUJS 5FBZA 3D0GE 4JV5B 1AH2A 4ZZ3A 2BKEA 3PKMA 1LBSA 5BSWA 4D7AA 2FDNA 3CTMA 2Q4BA 3BMOB 4Z9BA 3KEFA 5T6BA 2MKJA 2Z4PA 3PXAA 3NAZA 3P8ZA 1I7NA 3RK0A 2P2LA 4LJSA 1DPGA 4NP6A 1HLWA 4A8XA 4AY6A 3F74A 1V11A 3NHRA 3ZCQA 2XDYA 4QNRA 2I5PO 4Q7JB 3MM6A 1NVMB 3SI7A 3H9GA 3AM4A 4P9SA 4WOBA 5LZ5A 1HE5A 4C7OA 1S2LA 4PLWA 3B36A 2HHSA 4QVKA 4QR2A 4KDCA 3O8WA 4PYOA 4CQJA 4K81B 2F62A 3TEFA 2BYTA 3T9CA 3M1AA 1TL1B 5BW4A 3T4EA 1XYGA 4EHIA 1DAPA 3SQMA 5TF0A 2YRFA 4KO0B 2B7CB 2HYIB 2VEOA 2O5DA 4G5GA 3RB8A 1IY0A 1IN4A 5JCOA 1LLUA 4RGYA 1Z4UA 4NA2A 2ZS8A 4H6VA 1VLQA 3AETA 4PGFA 1ZSVA 4UTPA 3Q8XB 1WMEA 5ALNA 3SV3A 3QIPA 1Q7CA 6ABPA 3L0OA 1EX6A 4LCEA 3K5OA 4JX8A 3FVWA 4XR4A 4P33A 1YZQA 4TVSA 2FJXA 1EESA 2DERA 1H9BA 3P19A 5T64A 1JMKC 4H59A 5HVFA 3CJTA 4EYOA 1S7CA 2UUAF 2BJ7A 5KFWA 1JQJC 1QBKC 1X86B 2A6MA 4H7PA 3MT9A 2PUGA 1WSDA 3CEDA 1J39A 3TCXB 3STHA 4MVJP 2P9ZA 1IUPA 5A62A 1LF5A 3P2OA 3MOGA 3U37A 4J3JA 5PNTA 1AS3A 1T3HA 2VNHA 3ZDXB 3RROA 3PGXA 1HMVA 1NHWA 4QWEA 3NYWA 4TWBA 1UOEA 4QARA 1TF2A 1WXEA 3CCFA 4C1BA 2GCNA 1J5EF 5MF6A 3A3YA 5EX0A 3SEOA 3UC9A 2OIHA 5ECDA 1GXSB 3I01M 2HH9A 1WHTB 5C8XA 2QRZA 1M2VA 4IOCQ 5K8CA 1Q20A 4HJXA 5THQA 1H74A 4R31A 3D43A 5DGTA 1IJKA 4BVJA 4HI2A 2IX9A 1T3SA 4RMIA 2H5EA 1QG0A 3NBPB 2XCUA 2YH2A 4U9RA 1EP1B 5KNCA 4YR9A 3TW6A 5F9MA 1AUQA 4J7XA 2KT5A 3T9FA 4Q4DA 4P4GA 2XSFA 3GDGA 1G4HA 2C9CA 2QN1A 2P4HX 3KZOA 2AIRA 4PG8A 4AW9A 2QXYA 4HGPA 4LWQA 3B6JA 3LFHA 3CPWR 2FPIA 4YBRA 1QR6A 4F7DA 2RDIA 3TXXA 4IFYB 4Z2YA 4B32A 4MARA 1D1QA 1N6KA 1Y5RA 2DPLA 2GPTA 4BRUA 3BF7A 4Q47A 1T36B 1R3NA 2ECQA 2E55A 3ZWMA 1RU2A 3PW0A 1KYXA 5DHAA 5CAEB 2V7VA 3BO4A 2ZE8A 2DJIA 5FYQA 3VR6D 4Q9DA 1QGYA 2LLZA 5A0YA 2H65A 2VF5X 5GINE 3LYUA 2CPDA 4IMRA 1NWHA 3WISA 3W2VA 4WGGA 1U4NA 1VGYA 4RLFA 5JCXA 9LDBA 5BSTA 3W7VA 3CURA 1M73E 3EXFB 4ALIA 3J7AC 3GIMA 3OJWA 2O4CA 2REQA 1TZBA 3MJSA 2DIUA 3BZQA 4O2BF 4COOA 2ST1A 4WLUA 3A27A 2QTBA 1SXLA 3CX8A 4NG5A 1WF3A 3HEMA 3H7AA 2YV5A 3NCRA 5KYKA 3G89A 5F78A 4LFCB 1V0JA 3PLRA 5CZVA 3LX4A 3KAJA 3M70A 2DLCX 5BN5B 5DIFA 2XVAA 4DG9A 3ECSA 5F1KA 4AMGA 2WHPB 2EJVA 3QG5A 1GPYA 3IRVA 1ZUIA 4MQBA 1PJRA 2C2KB 1MDBA 2VP0A 4ABTA 3KEOA 4ZYYA 2IDMA 2ODPA 4XTRA 2RAVA 1VIAA 4N40A 5E4FA 4IFYA 1HE4A 3WB0A 3D0IE 3A6ZA 5K14B 2G77B 3A1NA 5DEIA 1X1EA 1ZD3A 2XWSA 1BQEA 1MG5A 1UC4B 3DGFC 1Z37A 5DI9A 5L51A 2CLCX 4BNZA 4N6NA 4IIHA 3AJ1A 3ASZA 4LBVA 1Y1SA 5HIJA 1SG0A 4ZAVA 1MG0A 1PYDA 3FHJA 2IFXA 5AVJA 3SS8A 4XLLA 5L39A 5DG7A 4A2QA 5FLXY 5IUJC 2XZWA 4V0SA 4M5LA 1PFWA 2ZE7A 3IPRA 2V0CA 3TAUA 4NYMQ 2F1FA 1U0HB 4JMPA 2ZRDA 4ECSA 3ZWQA 1ZP6A 4YNBA 3Q0TA 3GTYX 1X8KA 1RWUA 2YCBA 4JI3J 3INRA 1MNEA 4ZPCA 1XFDA 2FR8C 1RTZA 2FI1A 3S2GA 1M8GA 5KSZA 4KQ1A 1DTSA 3I09A 2QI9C 5EOVA 1W4BA 4CTNA 2C3MA 1A8PA 4BNKA 1RYHA 5B1EA 3E7XA 4GG1A 4RTJA 2BJVA 2OBLA 4Q6BA 1JQAA 1AKEA 3R3WA 1TQHA 3VV2A 1D6NA 2C8KA 4MSUA 4MHTA 3NBUA 2X19A 4YV0A 3MGBA 3A1YG 1RVV1 4N7JA 1RGVA 5JARA 3C8YA 1WJ9A 3HVUA 2OGZA 1C9NA 3ECAA 2ZH7A 4RVDA 3EWGA 3T5GA 1WTBA 1C2PA 2NNWB 3TZZA 1FU8A 4KFUA 2VT6A 3SJBA 1LWFB 2YUTA 4C8OA 2GUWA 3WWOA 2X1FA 4X4OA 4NYJQ 2HPVA 3ZN2A 3WQHA 1MD9A 4OLHA 4V24A 1FWPA 1HKAA 2XITA 4OX9F 5KQLA 1BLUA 3HQ4O 1FRFS 2QYSA 3IVRA 4F8JA 1JP7A 3AHCA 3OHPA 1W5EA 4B4DA 4HADA 5KQPA 4B3OA 3GJYA 3RF7A 3I6PA 1KQNA 3I52A 3RS3A 2O6LA 2ZIGA 1VP3A 3LDAA 3KTDA 1BE8A 3O84A 1AUOA 2Z4RA 4MVWA 2LP4A 4GRDA 4EQ6A 4YQZA 1AK9A 3Q4GA 4LV5B 3FMBA 4OM8A 4MRMB 3FUXA 3QFTA 2XC9A 3R5CA 4CYUB 5A5FA 4O59O 5J4LA 2MSKA 1OIWA 1OZAA 1BWRA 1YR8A 3M1VB 5K3CA 4OGFA 5IYZA 4JKIA 1IMJA 1V11B 1Q2UA 1AGXA 3L7UA 4CLYA 3UPDA 3M89A 3DNCA 2ZIZA 3CPEA 1SCIA 2N3OA 3WDLA 3D28A 2PU7A 2ZC3A 2IM3A 1HFKA 2CPZA 3KXPA 1CC1S 2LV8A 1N2ZA 1CDDA 1NBMA 2NVUA 1Z5WA 3CLVA 1N5RA 1SXQA 2OZKA 5CNKA 2UUOA 5KFPA 4RA9A 1WEXA 4RBUA 1MT0A 4BE7B 1EHWA 2ODQA 3FJYA 1CEZA 3PR4A 1TZCA 5LOQA 2IPOA 2JD1A 1TOAA 4HPXB 1TE2A 3TI0A 4JEIA 1Z4JA 3EZ6A 2Y2VA 1OS5A 1Z5NA 1I4DD 6Q21A 1W1WA 2FB0A 3GVXA 2VT2A 2K2QB 3CJKB 1W4LA 1C2YA 5F1PA 2V6AA 2X7XA 2JFNA 4UBMA 2E5LJ 4F2DA 3G5MA 3T54A 1R8CA 3EIEA 2AOXA 3ZW9A 3BCHA 5THKA 3UJHA 1U99A 3DV2A 3OF3A 1DFHA 5HN0A 2HADA 3CMQA 2W6QA 4LTMA 4EMDA 2DR8A 4II7A 2QN2A 4PYIA 2Z58B 4V38A 3ZDBA 3OXGA 1E3TA 4PQUB 4BECA 4X65J 3QVKA 5LB2A 1GK8A 5I7WA 1CYDA 4OHRA 1NNLA 3AVWA 5DNDA 4KK3A 3EA4A 1DC8A 4FDUA 5KFCA 1TU3A 2Z0MA 4IWNA 1CIPA 5KT3A 3VTFA 1J5EB 4DEVA 1FJGF 2AG1A 4HDGA 5I7SA 1Z83A 1YRWA 5BYSA 3AUJB 5HQ3A 3Q9UA 2XUGA 3IELA 2IW3A 2OXCA 2ZSAA 1M0EA 5AHKA 5CTJA 4IIGA 1YA6A 2XMMA 2HBZB 3IOCA 2EXUA 4F3CA 4UEOA 2QP3A 2JRCA 2FPOA 3DLHA 5AT1A 1TP7A 3VH2A 3ZJVA 3LSYA 1S9EA 121PA 2VF3A 3W34A 5LDGA 4X91A 1PKXA 5EN4A 4CDRA 2MKCA 3H5UA 1M5SA 1WKVA 1QJ4A 3ZI4A 4BP1A 2FOIA 1ZSNA 3OQ2A 4H0FA 3POTB 4LR8A 3L02A 3TB4A 3AU9A 1TIKA 1JXVA 3C0KA 1UPBA 2AJBA 3KKZA 4HN4B 2VZEA 4Z7OB 4ARAA 4FCVA 3MB5A 4PICA 1OKKD 3GG2A 3STUA 3T7CA 4KRWA 3UJBA 5AHOA 3TOQA 2B8EA 3P52A 1R0BG 3H5XA 2GX8A 1DLOB 3L7PA 3U4GA 5EUBA 1N56A 2J1LA 2FTKE 1RS0A 2NPOA 5KTQA 2CNLB 4WCDA 4RNCA 1NQ5A 4S3MA 4TLAA 2XULA 2MDTA 3CW9A 3GIDA 3EDYA 1B16A 2IS6A 3PHIA 1B0UA 4TLBA 1O4WA 2OENG 2QXUA 1UC9A 4LRCA 3HP4A 3V6DA 1CUUA 5D0GA 1SU7A 1REVA 3DLCA 4C0LA 2WWIA 4RQAA 2FLLA 1A3CA 3LH5A 1MAVA 2V1UA 1OD6A 3DLJA 4BJ1A 1LPAB 1E3WB 1NK0A 5C7LO 2IP4A 4Z2AA 5GMEA 4A1OA 5I3ZA 2HW3A 4C2UA 3J80Y 4JBYA 2OHGA 3PGLA 5FXMA 3JSRA 3ID6C 4EFMA 3R74A 4ZAYA 4J0EA 2D2IA 2DHDA 2Z09A 4BFTA 3H20A 5JHHB 1NC1A 3H42B 2FWRA 4HL6A 3HLKA 4QCLA 5F9FA 3D6NB 1D7AA 4D3XA 3AUUA 2NZUG 3IRUA 3TQIA 4EW6A 2ZVPX 1NPDA 2Z2MA 1MJGM 2XB2A 1GYRA 4J9KA 4NCIA 3RHTA 2JBAA 3Q8VA 3JWHA 3ELDA 1Y1KE 2WVEA 1JKIA 4U63A 1WVGA 4C05A 5CYJA 2AT1B 2PGLA 3AWDA 4H35A 4BU0A 4FYPA 4EG7A 2C8LA 5JAIA 1L8XA 2OZEA 4P92A 2Z6QA 2R11A 3TL2A 1AKVA 1E8MA 1VIYA 3DAGA 1DFDA 5IN4A 3H2KA 2G36A 4TMKA 4KX5A 2HBRB 1KOOA 3RTVA 4DKXA 1DRJA 4A8JA 3PO4A 2WY2D 3ORYA 1PTJA 3EXEA 4HQLA 1P2FA 2ZZTA 1MABB 4PTZA 1GZDA 3WC2A 1S7GA 5IVKA 2LRHA 4C9DA 4QSMA 3GJ5A 1CUWA 1ZXXA 5C25A 3GVHA 9RUBA 2ZH4A 2ZAIA 2J0QD 3I1JA 2PUAA 3MQ2A 2AXQA 3CT9A 2C2KA 1NJGA 3IQZA 2IUTA 1U7ZA 3SZUA 4H6WA 4KXUA 2H16A 5CFRA 5HMWA 1UXOA 3GUUA 1RLIA 2QN3A 1S9DA 2AR7A 2I2CA 3LAWA 3RADC 5GTDA 1MB3A 4EPVA 3DD5A 1TA9A 2E3JA 3BDAA 4NPCA 2K3KA 2G72A 2IYYA 3TW8A 4DNPA 1M8KA 1CVRA 3QJPA 2QZ4A 4L6IA 6REQB 4YRQA 4BB6A 5CFPA 2WSYB 3L8MA 4R0EA 2QY6A 3DWGA 3SC2B 2PKCA 2OCBA 4Y6OA 4WXOA 4X5OA 3LWMA 5TQ2B 3KK3A 2X8BA 3AY3A 3OCCA 1SIWB 1TIPA 5LA6B 4NZ9A 3MUFA 1Z7YA 3UG6A 4Q0MA 3KE8A 3AKYA 4WBFA 2W0MA 5FO1A 3R5HA 4C21A 3NL0A 1G66A 3W8RA 3VHRA 3B78A 4EK2A 1FXDA 4PNHA 4R1MA 5IDWA 5BQPA 1SAYA 3F7MA 3NHPA 4BAZA 4ZCMA 4C8LA 1HHSA 3NW9A 3AHEA 3LRPA 4LJYA 5LL6P 4RZQA 1G3IA 2HRYA 1FT8A 1CRWG 1PR6A 3TJ9A 4YXFA 3AR7A 4R6XA 2VPPA 5BWMA 2LNDA 3GB9A 3ODPA 3EXG2 1Q92A 5CURA 1NBMD 3JQGA 1QLJA 3M5WA 4KO8A 4H54A 1RQXA 4MULA 1ZIDA 3FA2A 1JDTA 1VQKS 2P3QA 1JG2A 5KOJA 3UW1A 2BI7A 2XIQA 4X9XA 1LPBB 4UEKA 1GA6A 2FZEA 2CBXA 4IRXA 1L8LA 4ZO7A 3B38A 5DBEX 2Q1UA 2WE7A 1O3YA 4RNDB 2CUNA 1G4CA 4MRPA 1QC5A 3ZTSA 1OQAA 2ZZMA 1JG4A 2H31A 2UVDA 3RPEA 3M6VA 5KQSA 3HU3A 5EJ2A 5LJ5Y 4F3RA 2MR5A 3QU4A 3O4GA 2QTMA 3WZMA 5FJ4A 1K89A 2FMFA 3HEAA 4CRWB 3SYTA 5CW1A 3EN0A 1YBVA 1MV8A 4ND8A 2QAGB 2LYVA 4PBTA 5CYMB 3HX9A 1RM5A 3RLFA 3W5UA 5HK8A 1GGFA 1PJBA 5K2MA 3R8YA 2QTCA 1U0JA 5EAIA 4O63O 1Z5GA 1X4FA 1AHHA 4LOJA 1OLXB 2QE7A 4BX3A 3MR2A 1L4EA 1T9GS 2XCSB 1ZRMA 2XNJA 4I1SA 3FUUA 4TM8A 3IKVA 3I73A 1S1MA 3D2CA 3JAWA 1BWPA 4XD7D 4V2UA 2QJRA 1ESEA 5AK0A 1ZBQA 5DHRA 5EG5A 2Q8QA 5KG3A 4O25A 4R3NA 4Z9YA 1F8GA 2XBPA 4L5AA 2WFLB 1KDTA 4I4TB 4IJ5A 5ETSA 2IIVA 4RTPA 3ICQB 2IPMA 4F72A 4UM9B 3KB8A 3QKTA 4DV6J 4V0RA 1AUXA 2Q7DA 4C22A 2GV1A 1NVUQ 2W9XA 2VBCA 4B6JA 5J1EA 2YS7A 2O8EB 4XIYA 4BOYA 1AG9A 3R97A 1VB3A 1N2HA 2WKSA 3ZVLA 1G2QA 1F6TA 5IK2D 3O0DA 1O8CA 2Q1XA 3EDOA 5ICGA 3A3NB 4URZR 4LDJA 4LRUA 2OAP1 2DR5A 2FX5A 4Q4CA 4I9FA 1QIJA 2QUHA 1U7WA 3R1HA 3VPFA 3MCVA 3E61A 4C5CA 4YCAA 2PD1A 3SZMA 1P1KA 1NVVR 1QZUA 5G41A 4B76A 3L0PA 2RJNA 3L7LA 2B20A 4IX1A 1ZR4A 4H7JA 2C7OA 1VJ5A 5FIIA 2M98A 3K94A 1E5TA 1VL8A 5FD8A 2AMCB 4RA6A 2PUDA 1RMYA 4CKCA 3NX4A 1TCBA 2G6BA 4K4WA 5PGMA 4EUEA 2E5JA 1GNPA 2BDPA 1A9XA 3MM5B 1PG5B 2FN8A 2FSVC 4KR3A 3GJRB 3H1TA 2K6GA 3D9BA 1KBOA 4R1TA 5EQFA 2QZSA 1XTRA 4HAYA 3PXCX 4WEQA 2R1TB 1DP4A 2KM1A 5JG7A 1PNTA 3FOEC 2Z2ZA 3W2WA 1ZYUA 1LWCB 2FP3A 4DUZB 3L4KA 4FYYA 4PXSA 3EIOA 2H3EB 2JHGA 1PWXA 1K68A 2CCKA 4MMYB 5I9SA 3CKYA 3IDAA 1Z0ZA 1OC2A 3MAHA 2HSWA 4PPGA 3HKZD 3UA3A 4UXIA 3UIEA 4B7UA 1J7JA 3PUHA 1KEUA 5IABA 1EXNA 3VGJA 2OBXA 5L3QB 3VGUA 2SICE 3ITKA 1ORTA 3OR1A 4LR9A 1O0PA 3GLFE 1VMKA 5IEJA 2DISA 3REQA 2E2WA 3PEJA 4FONA 5DDIP 1G8YA 3KLEA 1AM4D 4BUJA 2Z83A 4KSCA 2MYNA 2XRYA 3V4ZA 3VU3A 4ZOEA 4TUYF 1BHNA 4G3XA 2GW8A 1SBNE 3X1MA 4K4VA 4UXHA 4CM7A 4P7GA 5DM60 3ICLA 2EKNA 1WB4A 4Z4HA 3IPYA 4D26A 1PN3A 5CVDA 1NLFA 5C81A 1MMFB 1KZHA 2BAGA 5ERGB 4Q9HA 3SPXA 2XDWA 2FC9A 2LE0A 3TO5A 2IS4A 2OD7A 2IYVA 2XKBA 4LSGA 1FRNA 5K6RA 3BD7A 5C8YF 2ZAMA 4RETA 4Y2TA 2SCUA 4ZT4A 1XOIA 2PZ8A 4M1QA 1YB4A 3C1OA 1SXPA 3ZHBA 5ESWA 3H99A 2HNYB 2ZIVB 4DQ0A 3KKLA 2GCOB 2VPWB 4RW4B 1OI2A 1ONNA 4UW2A 2WNIA 1EGQA 3HWSA 3BDPA 2AFRA 1CRPA 4AAYA 2C42A 4AJIA 2YMQA 4JVSB 3GA7A 3SC4A 5GV8A 3W2TA 3LH2S 1WG5A 1UAYA 5BMOA 4U7JA 1V3ZA 2YH1A 2O8FA 1FC0A 1C1CB 5B1SA 3WK9A 4TZTA 1X39A 1AF7A 4PVCA 3V4PB 4QD3A 2BR0A 4K59A 3OZEA 4DMGA 1SVNA 4A6DA 3V9AA 5DBOA 2PG3A 3DDSA 4W5WA 3VR6H 2A30A 1HWJA 1XALA 2XA2A 4ETMA 3PHTA 1MX9A 4ZLPA 3PEYA 3IE1A 4PRFA 4KNYA 2ORVA 3SIPB 3AR4A 4ZCPA 3UW3A 4QU6A 1RZ3A 1N8KA 2FHOB 4PSKA 1ULBA 4J0JA 3VSCA 2NX2A 2HGZA 4WNYA 4LF4F 1XJ0A 3RIEA 5CDHA 4UHJA 2X0EA 1QYWA 5C2GA 1MO6A 2AEEA 3G6VA 2BGRA 3A4VA 4HY3A 1IBCA 1XDZA 4KVGA 5IAGA 1A5TA 1LI5A 1I36A 4IIBA 1SBIA 4EAQA 2WAOA 1NBAA 1RI7A 2FUEA 1GNSA 1S2OA 3ZE7A 3DLGB 1C0KA 4Q0BA 2D5AA 1TYCA 2WB2A 2XRZA 2AX4A 2VBZA 5K3FA 2APOA 2ZJ8A 5J58A 4PTYA 3FWYA 4XCXA 2NP7A 4NLXA 4CM1A 3N6MA 1TL7B 4OSEA 1XEFA 5BNIA 3BBFA 1Z36A 1EQ0A 3WS7A 4IJWA 2NAFA 4EVRA 1XC9A 4ZOBA 1RHJA 3NNSA 2PD6A 1Y3DE 4CGZA 4RTRA 4U7UK 3VM6A 5J2PA 3OD5A 3A4IA 2B6AB 3G1WA 4DBVO 3O3OB 3E7FA 2IZ0A 4PWDA 4LXTA 2VN8A 3DQZA 5JHGB 5KYXB 4MGEA 1S5ZA 3DE2X 3I0SA 2OHFA 3W2IA 4ML3A 4KSBA 3CR3C 5AO9A 2X77A 4PC1A 1FI4A 1QE0A 4I1VA 4L5IA 3I1IA 4IG9A 5KT7A 5F1YA 4NFYA 2CJ9A 2FRXA 4NAVA 1U5CA 4AS1A 3L2OB 3IP0A 5FV4A 4MYSA 2AK3A 3B70A 5IEBA 4HLDA 2DWOA 3R77A 5F0UA 5AM0A 4F3KA 2C0QA 5D78A 2A9JA 4ECXA 1VS3A 4Z9FA 3KK3B 4NCBA 3ZHVA 4R40A 3I9V6 1S2IA 4TWIA 1ZINA 4EUVA 2OOSA 2GMHA 3W1WA 2HRZA 2ZAYA 3CLTD 2VDOB 2A7QA 4U5XA 4RIIA 4GKBA 4CV2A 3PDJA 1OXXK 2EBUA 2WI8A 2HHVA 4X3PA 1C9YA 2P5TB 3L3BA 4YALA 1FFHA 4J37A 1PAUB 4YMHA 3ORFA 5IXUA 5FL7A 1N0UA 1JQDA 1RHUB 3T1AA 2PUCA 3BSCA 3R9LA 4DSAA 2DFPA 1DTWB 2HX1A 2XZTA 1POXA 3EH1A 4ZQBA 2J31A 1N6HA 2D54A 1QB8A 4BKUA 2GEBA 2CXQA 2VJKA 4ESHA 4JV5J 2ZS9A 1FVOA 2ILZA 1B93A 2HLDD 1LS6A 3AEQA 2P7HA 4X65B 3K8VA 1OI3A 3HXPA 5JAPA 2IYAA 2MPUA 3SHWA 3K20A 2HYDA 3WLRA 3RANA 2FFBA 1C2TA 4DQQA 1VZ3A 4RS3A 4TRMA 3TQQA 4N3AA 5DHUA 3TSAA 3A2MA 2O01C 1OLXA 4UOFA 4TM7A 4TXSA 3T0IA 1GL7A 1SQEA 5F3TA 2RS8A 4FN5A 2G28A 1N3YA 1AF4A 4YB1P 3M7VA 2QLLA 2BCGY 1ONSA 3W9HA 4S04A 4IMJB 2O50A 3DDWA 4GC7A 1M5KC 4UQGA 4YGXB 4DV4B 4WNCA 2WBLC 1DQSA 4IG0A 3ZVRA 2WG0A 4RD2A 2FYXA 3FOBA 2CJQA 1HE2A 4LXIA 3D3JA 4IXNA 4L4SA 2HCFA 3JVEA 1L5WA 1IOLA 2VZ8A 3ACCA 1DQPA 4F0MA 1LWOA 1UWVA 3IT1A 2XT9A 2PGDA 5HWSA 1Z4LA 3KTQA 4RUHA 4L9SA 2IXAA 4E33A 4FYVB 4AJKA 1HZZC 4S35A 4EFKA 1NPRA 1WSBA 3LDHA 4J0CA 521PA 2FSFA 1WIWA 1YR7A 1ZMOA 4V0MA 5I7FA 3I4FA 3C14C 3MW8A 3DKPA 3L84A 4PO1A 2P35A 2OELA 1NE7A 4RW9B 2UU9B 4R69A 4LR7A 3D67A 4Y2MA 2XDQB 3BDIA 2E5LF 1GUZA 3GJXC 5GJVC 2X13A 5B57C 5KU1A 5H1SV 2FNAA 3DT6A 5B6PA 3ZUPA 3F8WA 4YRTA 5KDDA 3NHBA 4JOSA 1XYYA 1R8AA 5AVUA 3GNLA 4E5VA 1OH6A 4D6XA 2OFPA 3WGOA 2XHCA 3EDCA 4UBOA 3AF5A 3TVYA 2BGTA 2QTVA 4KXVA 8MHTA 5AM1A 5JSKA 3LPYA 3NWGA 3MCZA 4P3OA 5DNYB 3D2AA 3GGPA 1O6FA 2EFCB 5GADU 4LS3A 2MKYA 3EULA 4Q4JB 4I6GA 1IWBB 4M0CA 3GT7A 2XTMA 4HFMA 2HZ7A 1P8JA 2XOEA 1KBQA 1Q8KA 3NG8A 1V45E 5JS8A 3C8MA 1TELA 3WGVA 4I3HA 3ETHA 2E4UA 3RB4A 3UVEA 1U4OA 4BNGA 3UR0A 1C0PA 1HBMB 3RARA 4AZVA 2NWQA 2PX6A 4KGVB 1Z5PA 1RPAA 1G5HA 3NP5A 3X1LB 2QTWA 4Q12A 2OL4A 2CWKA 2HWYA 4YPOA 4PANA 3LUDA 1T2DA 4JUIA 4DTIA 2F7VA 1UZLA 1A5AB 4XSVA 1B6GA 3B4DA 1TK0A 2DU8A 2V6MA 3C3YA 2XQGA 5IJ0B 1YWGO 3M33A 3OVSA 1KWMA 1NJFA 3PFWO 1EX8A 1C8KA 5JLJA 1G8GA 3CNOA 3PC8C 4EELA 4NHOA 2FTRA 2ETXA 1IG3A 2PT6A 4ALJA 4QYIB 5JAQA 3ZLJA 5IVIA 2PFKA 2I9PA 3VCDA 1L5SA 2XZTB 3FYDA 4GRAA 3RAMA 3K2IA 3MZ0A 5BXQC 4O0NA 2VNAA 3QKRA 4P4SA 2VTVA 2NO4A 5HS6A 4G1QB 2HHTA 5JEDA 1ZNWA 3KTOA 3LA0A 2CHFA 3RRMA 4K88A 4WZAB 1GPKA 2FWIA 3RU2A 3GGCA 2YNFA 1IKWA 4URXR 3QOYA 4IZIA 1Y81A 3GLKA 2WJJA 4KPCA 4E30A 1F17A 4MMZB 4YWJA 2ERXA 5J2TA 1H6BA 1IQPA 4X8MA 3LPDA 4DLLA 2HNZA 3HS3A 4E94A 4MX8A 5ALSA 1IEVA 2XBLA 2OLKA 2Z9DA 4Q7AA 5DMXA 2JK0A 5KHLB 3CY6A 1UBGA 4ZZ1A 3GDOA 2GNAA 5CDGA 1V5IA 1S0VA 2QVGA 3GJQB 4LJ8A 2NTNA 1RTIB 1I5OB 4UNIA 3OX2A 1P2UA 4DUTA 1FMTA 3THWB 4E98A 5I42A 4LF4B 1J23A 5HZMA 2XS7A 1EA5A 4EWTA 3FIJA 3MTQA 2RGBA 1LVHA 1CY7A 2H57A 3D54D 3TYXA 1Q50A 3H8JA 2G0CA 3UTCA 3EUAA 1EWQA 4V1Ak 4CMIB 1QQTA 4KJZA 1TKDA 1MX5A 1TD1A 4JI0F 4UZSA 4YMEA 4QDKA 3U5ZB 5JXGA 4LGVA 1QH8A 3RASA 3HKDB 2ZRGA 4LT6A 4N5MA 3BL5A 1NLZA 3MTIA 1W4RA 2CDAA 2HGMA 3DW3X 3SLKA 5BSGA 3B1WA 2OQRA 2P9TA 4Q82A 4MK9A 4C0XA 1FERA 4OBBA 3D7RA 5B3KA 3OQVA 2O0KA 2RGWA 1DEAA 1BMQA 1RXYA 1P27B 1UZDA 2BJHA 4PLHA 5MFPA 2LZ0A 1JJ7A 4QIGA 2FWJA 2XO7A 1EXDA 1AUDA 2P3LA 4AN4A 5T4EA 2DHHA 1NY6A 5FLXU 3ZE9A 4G3IA 4M63A 3C4JA 3UWMA 2IYLD 1WP9A 3EYAA 4MKRA 3DOCA 2KE5A 1TTQB 2FQ1A 5BQOA 2B4OA 5LU8A 5K20B 2G0NA 4MV5A 1AGRA 1P5RA 1ECCA 1RWQA 3QLUC 4JUBA 2K7ZA 7MHTA 2C2OB 1BCRA 2VTKA 2HTEA 2XY5A 3K35A 4YB6A 4BCDA 1QR2A 3AMVA 3TIFA 3R2JA 4D5EA 3JYTA 2I62A 5HGJA 2XWBF 2OHDA 5KMGB 1L2TA 3KZVA 1SRQA 1N3LA 2BBOA 1OC4A 2EARA 2NXEA 1R0CB 2NU8B 3IO5A 4B81A 4F5WA 1ZUD1 4U2DA 1CJSA 4EYKA 1O5OA 3H2JA 5DHSA 4CYUA 4HPJB 3F0NA 4DRXA 2IF2A 3S8MA 2AB0A 3SD7A 2ILYA 2YRXA 2CWXA 3KAKA 4P9NA 4HNVA 3GLIB 5BT8A 4IS3A 2OSRA 1HW8A 3K32A 1MJNA 3P0EA 2EQ5A 3PSAA 3L06A 3V4LA 2ZTHA 5C5CA 4D56A 3RBEA 2W8LA 3GJ8A 1XRJA 4YVFA 4L85A 2X15A 1CQPA 2MKIA 4OA8A 4LF6B 3IAM6 3O3MB 3OOJA 1RT6B 2O23A 1XZQA 1H7XA 3PUWA 1FESA 4A8QA 3EZOA 5CH8A 3RC1A 3GFRA 1GCOA 2Z08A 4DUZF 3MS7A 4KGMA 3HV2A 2YVKA 2MU1A 3TJMA 3PJEA 1TKRA 3ZIUA 3CZQA 1S9FA 3E3LA 4K46A 5LBTA 3MINA 3DT9A 2EBEA 4WPAA 4JLKA 4V0NA 4B47A 1T4CB 3N7UA 1JIIA 4R98A 2X4GA 1JXMA 1W52X 2B69A 4XD2A 2YRWA 1USVA 1CUEA 3CLUC 5KNCD 2HS4A 3K4PA 1IH8A 3KQTA 2QMWA 3OFFA 4Q05A 3I56S 1GG9A 4D4JA 1UH5A 3IURA 4B3HA 4HKQA 4X24A 2PD3A 4XI9A 3OIGA 1N2GA 1CZKA 2VNSA 2UZIR 4KKVA 4DMFA 2J3IA 1KO4A 4UU0A 3W5XA 1TFYA 5DIZA 5FI1B 4JLOA 4BC1A 1Q8BA 3CEPB 3BS4A 3E9CA 3OQBA 1B4SA 1VISA 4JN6B 1E3JA 2UZ4A 1U4SA 2NYIA 1XQYA 4OFXA 4CKWA 2I6UA 1ECBA 1CZRA 1UJMA 2YVUA 4MKZA 1C4WA 2AX0A 1KZ1A 1JQ5A 5JAUA 1FNDA 1RISA 3LRXA 2JEOA 4N0PA 5GVSA 5LSAA 3N01A 5ALLA 2G8NA 1P61B 3U2QA 3EIUA 1HL3A 1B76A 1UKAA 2IYGA 4J8PA 1VMDA 3P2EA 2Q45A 2VJCA 4NCAA 4GM0A 4CDGA 2JDJA 5AFSA 3EYZA 1LDNA 1A8UA 1MB4A 3NTVA 4PYDA 4X54A 2FN4A 1S76D 3UXEA 2IMOA 1H2XA 3ZTWA 3QVUA 4PAWA 2XY7A 5JQWA 4MFBA 1RPNA 3ETLA 3OY2A 1Y1RA 2MKSA 2RGYA 1ZNXA 1SXJC 4ZANA 2AGPA 3CN7A 4DVJA 1EYZA 2BZ2A 5L1IA 1ZISA 4ZK2A 4PSVA 1LCIA 2XE6A 1U1QA 2C96A 3BZWA 4RMGA 4DYDA 1B7GO 3KUCA 4NIMA 1SZCA 4F12A 5KJCA 4GO1A 3BD6A 2GZ2A 2QTWB 3DBHA 4OYOA 4YHHB 1P45A 4EJ2A 4ELVA 2O8EA 4XDCA 2CWDA 1GN9A 3L07A 5H4GA 2W4DA 3NDRA 1I7SB 2RCNA 1W6UA 2PI5A 4BCCA 3TDKA 3HL0A 3K5HA 2UDPA 2R7XA 2FV8A 5KFVA 1URNA 3MAAC 2Y0DA 4IEEA 1M2NA 5K3AA 3UMMA 2NUBA 4B31A 2GAGC 2F55A 3PDWA 4QDUA 1Y3HA 3UV7A 2B0CA 5FPSA 1B6SA 5AKKA 4CW7A 1UOPA 1EDEA 2CXTA 1FDOA