3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
1XTZA 3BXFA 4R7TA 1UJ5A 3UW1A 1PBTA 4L4ZA 3AB4B 1PSDA 1YGYA 2RE1A 3U7JA 3MTJA 1FRZA 4L5JA 2QMXA 5T41A 3KWMA 3OBIA 3OFGA 4L50A 1KS2A 4L4YA 2DTJA 2P9GA 1UJ6A 4L5IA 3OFHA 3DDNA 3E7FA 2MDAA 4R9NA 1Y7PA 3EFBA 2P9CA 2J0EA 3CEDA 3NRBA 5IS2A 2GNPA 3S1TA 4GMKA 3EB9A 1YBAA 1Y89A 5JJBA 3L7OA 1UJ4A 4GO1A 3BXHA 1FSFA 2O0MA 1LKZA 3IXQA 5IT4A 3CSSA 3ENVA 2R5FA 4GO7X 1FS5A 2F1FA 3K5PA 2F8MA 4PWUA 3BXEA 1FS6A 3DHWC 3KV1A 2LQJA 1U8SA 2ZHOA 5FIIA 1CD5A 1NE7A 1O8BA 3TX2A 1VL1A 2FGCA 3ENQA 3E15A 2I9SA 1SC6A 3ENWA 4X84A 4TM7A 2PC6A 2QSWA 2P9EA 1RWUA 2BKVA 3LUYA 3O1LA 3P96A 2RI0A 4OQQA 2QMWA 1HOTA 2JHEA 3TUJC 2KO1A 3DHXA 4L51A 2PA3A 1FQOA 4IO1A 1HORA 2RQKA 3LOUA 4LUBA 3CH7A 4GO5X 1ZPVA 2WU1A 2RI1A 3AAWB 4OQPA 3TUIC 3IBWA 3LHIA 3TUZC 2J0XA 3HN6A 3N0VA 3OC6A 3OFEA 2JOQA 2H9ZA 4NMLA 4M8LA 2W48A 2RQMA 3HHEA 3NWPA 1JT9A 3LWDA 5IT0A 2NYIA 2BKXA 3ICOA 4TM8A 2OKGA 1LK5A 2DT9A 1M0SA 2QRRA 3DC2A 2LVWA 3NZEA 2J0WA 2CDQA 1LK7A 3OFFA 3MWBA 3W7BA 1DEAA 3AB2B 3BXGA 3MAHA 5HJ5A
chains in the Genus database with same CATH superfamily
2G4LA 3NBFA 4G4GA 4I2PB 3REQA 2CZCA 2WM3A 3ZV4A 4TV8B 4A5SA 1DX9A 2KM8C 5B3KA 3LHKA 5MAOA 4UEQA 4G1BA 1IUKA 1N36J 2YJ4A 4EG0A 3DZFA 2OBLA 721PA 5IXYA 2GA9A 2AFVA 3G85A 4O2RA 2NO4A 5EJIA 1QYIA 1B99A 4HN9A 3OEEA 3CUNA 3FBBA 2DOKA 1JLLB 1C1XA 2CNWA 2PG3A 1QY7A 1O7JA 2YQ1A 5KQRA 2GPBA 4QPJC 1SQ0A 4IAOA 3NGXA 4QWBA 1M5PC 1E3WB 4DQKA 3FB1A 2IAJA 4ZQHA 3JXEA 1BY9A 4V3BA 2V3VA 1NNUA 4FMDF 1NDPA 4DMKA 3ZIAA 3OX3A 1NW8A 4AD8A 2QORA 4CO2A 4LG1A 1NJ2A 4RX1A 4MUEA 1UJBA 2C2DA 2MQOA 5CFPA 2VPXB 2HMWA 1X39A 3C5EA 5DHQA 5EG5A 4EYOA 1C9NA 3EWNA 2AFHE 2AG1A 1I3OA 1GZHB 1V7QA 3KYDA 2HQ3A 2A84A 4J0IA 1GV0A 5DOZA 2JWNA 3COPA 1TTHB 3HB4X 2XDAA 4QJ5A 3W66A 4LIPD 3NRCA 3UG6A 2XSZD 5A3QA 3FGNA 2B6AA 2Q0XA 3FPFA 2RK6A 5B7NA 4Y9TA 2Z1NA 2CHFA 2XGOA 4K7QA 2HWKA 5ALZA 4BRZA 2PD3A 3LHFA 1RBQA 3T3IA 3TS1A 5CPFA 1JNRB 2BGUA 2PZFA 3V2GA 3GIJA 4OUDB 2BUNA 5JXGA 3DV9A 4NFHA 2GJ9A 1KMMA 1NZJA 2B7CA 4MMZB 2R6CA 1X5SA 1K8RA 3VC1A 4QYIB 4FYXA 5IBPA 2BFEB 1JSRA 1Y5NA 1W73A 4ZYTA 2KZZA 2ACWA 2RU9A 2O0HA 3THSA 1CQXA 4F3KA 1SKUA 1L1EA 2WHPA 1GX6A 2LTAA 4KQ1A 9GPBA 2DECA 4CLHA 5HQ3A 2Y1JA 1PT5A 3D1HA 5DT9A 4KP7A 2HTFA 2QX6A 2VWQA 4J6FA 3UUWA 3CDEA 4HXFB 1GMVA 5CR9A 2B56A 1V39A 2O14A 3DU5A 4D4MA 5LQDA 3BDVA 3E8SA 4RW6B 2YJTD 2HXSA 2X9LA 1R8PA 2IJRA 3NNSA 4PBTA 1JSXA 1W88A 1YJBA 4R8MA 5F7XA 1Y5LB 2W93A 4LSLA 1W36B 1CG6A 4L0CA 1GZ5A 1IHPA 3QG1A 1PWHA 5HMXA 3PB3A 2YYAA 3K09A 1WXEA 4AXJA 2FWJA 3L79A 2B37A 4S04A 3RHTA 2UU9B 4ZICA 3DDHA 5E8RA 3GQVA 3PV0A 3CURA 3CLKA 2GYUA 3ABQB 4KAXA 3VZHA 1QZTA 2AFIB 2X2FA 1WUJS 3D8BA 1KBOA 1SKQA 5EHHA 3V6DA 2V7UA 2JGKA 3CEPB 3P9XA 4IG3B 2HWHA 2H11A 5AE2A 3MAAA 2J41A 1UBCA 1Z7BA 5LWQA 5THQA 2I3DA 3FAZA 3PX2A 1USUA 3BKWA 1X9GA 3D8HA 4BKOA 3KM0A 1WNTA 5H81A 3N0XA 2BONA 4L5AA 4K4XA 5AJTA 4GRIA 4IOLA 2H5JB 2C0CA 1Y82A 5JD4A 5CW1A 1M8GA 3C5WP 1P9QC 4JBWA 2WKPA 1PL0A 2ECFA 4QWAA 3HLTA 3DDOA 5LDDC 2IU6A 1QRSA 2AB0A 3LT5A 4K9KA 5BR7A 4MS3A 4R3NA 2G77B 4M53A 2P9BA 4W6ZA 2OPRB 4M5JA 3RF7A 2OH2A 3P0EA 3AH6A 5KT7A 3SIPB 1QG6A 3THXA 1JLEA 3UN5A 1SCJA 3K2BA 4DV0B 5P8WA 5FV7A 1AY0A 4GBED 1IR0A 1HHQA 4RS3A 3IBCA 2VB6A 2H3EA 3I9JA 2KG1A 1G4HA 1Z6AA 3OJCA 4OJYA 3NVDA 2RAFA 2A88A 3SX0A 4CYMA 2H4FA 1JIQA 3EXEA 2RQKA 4NZZA 1UDCA 3LKDA 4HAIA 3ZWBA 3FFXA 1PAUB 3KLFA 1I5EA 4D4JA 2WMDA 4UPEA 1OQ3A 1Y8CA 3DLHA 2A92A 3DRSB 1W5EA 3I1YA 2B7BB 4F04A 5A8KB 2HSZA 1LK7A 1M2HA 4KWEA 4QPCA 4MI1A 4FD2A 2MJUA 1U3VA 4H1UA 5K8LA 4BFWA 4ECTA 1FRZA 4ZP7A 1GN8A 2O8VA 3EGXA 4Y2JA 3D8TA 1ILWA 4GXNA 5B4UA 3VCDA 4MW6A 2ZE2A 1RXOB 4X6XA 1S4MA 4A8TA 5CA1B 3IFEA 4H60A 4G3IA 5LB2A 1PEDA 5IAKA 1K75A 3FTPA 4KXFB 2F1FA 2FYTA 4B9TA 5F5XA 3GRFA 1AN9A 2OKCA 5SYNA 1RXCA 4J0QA 2P1RA 1CHNA 3PNQA 2UP1A 3IDZA 3ICWA 1N7HA 4BNTA 5ETVA 1Y6GA 3BPDA 1K3TA 2WD7B 2MSEB 4B73A 3L1IA 3LAWA 1KYTA 3HKDA 4W98A 3KXIA 4H31A 1OE0A 4MPDA 521PA 3AF4A 4OJHA 2Z04A 3LGNA 1MDBA 4IJQA 1Q16A 1S3FA 4BJ1A 5DBHX 1S9HA 5REQB 5DNAA 4I1PA 4JI8F 1BMDA 3OT9A 4H6VA 1S3SA 3FM9A 4COOA 3W2TA 4YT4A 4AY2A 6REQB 4HF7A 4J9KA 1JKIA 1HO3A 2Y8EA 2HIMA 4FYJA 2AG0A 1H42A 2OPSB 2C3OA 1HNZJ 3NKYA 2C5EA 4FDFA 2GJ2A 4M9SA 2RGGA 2MR5A 3IRUA 4NBKA 3AKDA 3HACA 3QBVA 3FYHA 4BATA 3F8TA 1PGJA 1P75A 2CYYA 3DSRA 3K9BA 1OX4B 3G2QA 5THWA 3QO9B 1NSTA 1ZR2A 2ZUWA 2J9FA 5KSOA 4Z9AA 3EZUA 3Q4GA 4U8YA 1M1KT 5F1YA 3RFXA 3N2GA 2JHEA 2P9TA 1J2VA 2YRWA 2L41A 5E1BA 2C2GA 2R4TA 1UFRA 1UBLS 3EVAA 5I9LA 1KPIA 1IG3A 4F3YA 3VBCA 1ZRMA 2BFCA 3NOXA 4HVCA 1VISA 4B4WA 2XZWA 5JRDS 2H9ZA 5BUZA 3L8YA 1ORHA 1JRLA 3T6KA 1YQWA 4IDNA 4NS1A 2ATCA 3PO4A 4A16A 4EMBA 5FWDA 3HA2A 4LVNA 1EUZA 3LBAA 3BIWA 1OKKA 2NREA 3EXHA 3EH2A 2AE1A 1ESZA 1OI3A 1HQUA 3OLXA 4NAVA 4E98A 3AUAA 1BS9A 1E6VA 1DKMA 2VNSA 1ZJ5A 3H2IA 2PWYA 1N6PA 4N8EA 4HQ0A 1KFSA 2OXTA 1URPA 2P9CA 1YIJS 5IS2A 3VH4A 2A6MA 2P7HA 3MLAA 1E9BA 3JZIA 5DFAA 2ODEA 4B2YA 2ZXUA 1UFKA 3V9PA 3G2IA 2BA9A 1GITA 2O3JA 3R8CA 4BJ6A 3K5WA 4A8JA 3R44A 2BJEA 2A7QA 2WVGA 1XFAA 2I33A 3NHRA 2B6NA 2C99A 1AS2A 1OYVA 5BSKA 2UVQA 2FPGA 1P19A 5LMNB 4DR7B 1WC6A 3FCCA 4LC1A 3BB5A 3I37X 1FWKA 2XA2A 2NXNA 4M4SA 3E5HA 3QF7A 5DSXA 4LBPA 5FJIA 2OUKA 3IPXA 3TOZA 5ETNA 2YRXA 2ZRHA 4U96A 2QU8A 1TQLA 3SN6A 2D5BA 4IOCQ 3F67A 3RT7A 5A3JA 3M49A 1EFUA 1PE0A 3VA7A 2XQFA 1FBTA 4YRQA 4ZLPA 5T67A 2C2ZA 2PS9A 5G0UA 3VPHA 3CDAA 1S57A 3K5PA 3IBFA 4L6AA 4MKAA 1GMWA 4KK4A 1ECBA 1JUDA 2FF5A 1K7YA 5EN4A 4KYUA 4MW7A 4D6XA 3QOWA 1LC0A 4CJXA 1JWWA 2PVCA 2NSDA 1P5ZB 3KQMA 4V0ME 2JARA 2R6R1 4GPZA 4LK2A 4YMSA 3FSXA 3IIJA 2FMUA 3FVVA 2BMDA 2CPFA 4M7PA 4DILA 2NR0A 4NMLA 4Y6RA 4IFBA 3W4KA 2O07A 3OIYA 4DSOA 5AM4A 3P32A 5FP0A 1LBSA 2O2DA 3CLTD 3KV3O 3DEZA 4RWZA 5B4VA 3HU3A 3EYAA 1EK0A 1XMVA 4NPAA 2BX6A 4PZEA 2V58A 3EE3A 5F41A 2C9ZA 1ZYUA 4BNUA 5ICSA 3D9QX 4HBZA 5K8VA 3OLCX 5FI1B 3HKBA 4TLAA 3TAHA 3PJDA 1D8TA 1JK9B 2KYXA 1GYQA 4ED7A 3NBUA 4DSUA 1UC4B 2I62A 4UNIA 4TWAA 4UOCA 1T9HA 3EFBA 1C50A 3HDJA 3C1TA 1MKYA 4IDGA 4PLFA 4LFCB 2G80A 5DDRC 3CIZA 3JQQA 4D3DA 1MNEA 2R7WA 2K3KA 5J4HA 1REQA 5ETQA 3O8QB 1GDTA 1U7TA 1E9CA 5KKCA 4K03A 3G0HA 1CS4B 2RKIB 2WHQA 1BQEA 3F6BX 5I9TA 1YLXA 3CXUA 4KQFA 3G8AA 2PA3A 4IXMA 4FFPA 1S72S 3KAJA 1XZGA 5L95A 4XKJA 3DMPA 3CJ0A 3HHNB 4GE0A 5BV0A 5J4KA 2GILA 2GXQA 3M81A 1JEYB 2VTEA 2XUDA 3P5BP 1IIRA 3H5UA 3RIMA 5CVTA 2Q79A 2W7TA 1MTOA 2BH2A 4O3NA 2IOHA 1TM5E 2R7QA 2XNDD 4U2GA 4QTYA 1Z2OX 3H59A 4TV9B 1KI6A 1J07A 2ZAMA 1IFXA 1FA0A 5AK0A 1WEXA 2FEWB 4I4LA 5ALJA 1Z0DA 3MM4A 1HWLA 2P65A 4ZTZB 1XZDA 2E87A 3C6YA 3B3QA 4N5SA 3ENKA 3OCUA 4QUHA 4DDVA 1M1ZA 3HO6A 2HZAA 3BS4A 1Y0HA 1H2WA 2XGSA 3GGDA 4CL2A 4G67A 2E4WA 2E5WA 3W8DA 2XUQA 4XVUA 1UOOA 3OVSA 4P0PB 3QT7A 8AT1A 2V7EA 3BGUA 3V4OA 4KN9S 4CKBA 1NKSA 3QEOA 2QN6B 4I4NA 1GCIA 3AEUA 5CAAA 4J9PA 1ZZNA 4PRZA 3V2IA 4W9MC 3AY0A 4V0LA 2WJVA 5EPUA 3A14A 3RSGA 3ONNA 1HLWA 5KWJA 4GDMA 3HY6A 4HB3A 3IG1B 3NHUA 4Q02A 3EEOA 5HK8A 5EJ6A 1DFGA 5ALMA 4KTTE 3PFGA 5K0NA 3MTEA 5FIIA 4WNYA 5E5NA 5ALIA 4R5PB 1F5SA 1FU8A 5EUMA 1WXXA 2XWQA 4FYWB 3FYCA 4MQ5A 4YRCA 3C46A 4I9NA 4FLFA 4DDUA 3QQPA 2J9EA 3UH0A 2R8OA 4F4HA 3HHKA 4K4YA 1CQPA 5KYYA 1VQOS 3ANMA 2Y0BB 1MG0A 3JQAD 1N33B 2ZWAA 4DJBA 3TRHA 1XLVA 2X9VA 3L6OO 4BRUA 5KOXA 1NXXA 1O4WA 2Y93A 1GILA 3W77A 3M9LA 1DLIA 2RHJA 3KKZA 2M2IA 1V8BA 4WOCA 5JSQA 4EW2A 3CD6S 4L5JA 3GIRA 1WEHA 2VYNA 5K5MA 2WHEA 1FVSA 4BE4A 1DURA 3DRPB 2ZJQQ 3PJFA 3OCWA 1ICIA 1G5IA 4G1FA 2VJMA 3AIMA 3FBEA 4P22A 4JQYA 3S8YA 1PVDA 1Z8HA 1R64A 3INNA 1W7WA 3AO0B 3NFRA 2CG8A 1HNZF 421PA 3MCWA 3G4SS 4BP1A 1YBMA 4KXVA 3SAJA 1FZTA 1U2GA 3RTCA 3GB0A 3B6ZA 2OWEA 3ZXUB 1YACA 3V5NA 3L07A 4ZJOA 4IXTA 3QG5A 1ODCA 3PFIA 4FE4A 4LCEA 2G82A 3D4LA 1SQGA 1BXNA 1HWJA 3ZCPA 2I7CA 2CWXA 2EFCB 3LP0A 1R5BA 4X93A 1AXEA 1PKXA 3TUZC 2J9RA 1QFJA 1VS3A 3T1OA 1E1CA 4MS1B 4EW6A 1HFWA 3IUNA 5AVKA 1CZHA 2FHJD 1ULTA 1FYWA 2P62A 5LKRA 2VRNA 2C2OA 4DKJA 1R6DA 3K4QA 2PO4A 3W78A 5L6LB 3WXMA 2ERYA 4JD5A 2R1VA 2PX5A 3LPYA 1GL3A 2IQIA 4I56A 4C01A 1MENA 2C9YA 2FN4A 3NLLA 1WP4A 3P45A 3H99A 2E7ZA 2DGOA 3JW8A 4KR9A 2JL1A 5DHUA 2CFTA 4YJ3B 2OQ2A 4YMTA 5JS6A 1NV9A 1E7RA 3N7UA 2P3QA 4DEVA 1FCJA 3A37A 4MQEA 1EFLA 4AJEA 4C89A 2BQ3A 3BK2A 3H84A 3P0JA 2D5AA 1CNEA 3O8CA 1H2TZ 5CCEA 1VMEA 1VQYA 2ASEA 3RD5A 4HRAA 2DU8A 3NW9A 4XTCS 1RLJA 1HPZA 3W63A 1W8DA 1A2QA 4XDDA 1VKZA 4DTIA 4AF7A 2H1FA 3RC9A 3KTAB 2NO9A 3LZ6A 3ZQUA 5EJ5A 1MH1A 3C7DB 1T34A 4GO5X 3KK2B 4RVDA 4EVRA 4TMFA 3SF8A 6ADHA 4UVIA 2I1LA 5EN1A 2Y1DA 3UFCX 1N4AA 1FXLA 2VHUA 2NXUA 3BB4A 2NUBA 3EE6A 2QBYA 3HFVA 4UNQA 1R12A 3GILA 3NS5A 5DCUA 1BE4A 3AVTA 4TN2A 4BASA 3QPCA 1LA2A 5GMKa 4YJHA 5E1MA 4OAPA 2DR2A 1R9NA 3T6JA 4YRZA 3VPGA 1UK8A 2G0CA 3FDFA 2PGOA 2IRWA 3OHSX 3UXEA 1UQTA 4MI6A 6GPBA 2C9CA 2XULA 1AUOA 3G89A 1G9SA 2ONKA 2FVSA 3GR0A 1NB2A 3SXUA 3VVMA 2IEBA 2CN1A 2UVRA 3HCBA 3WGMA 4BMXA 4WK3A 1BQ3A 3DHVA 3LW5C 4A2CA 3RCBA 5CITA 2Q0QA 3AEKB 4EYSA 5EGYA 2FFJA 1EFAA 1OH6A 1LVHA 4URYR 2O8CB 3GN2A 2F4NA 2W37A 3DXSX 1Q0LA 2X58A 4LFAJ 3D4JA 3II6X 3Q9LA 1HWKA 1RTDB 5HRAA 1V3VA 2QTAA 1C1BB 3RFFA 1O6FA 1W93A 3N7AA 2WU4A 1YIDA 2P2SA 4WA7A 1U2TA 4M1EA 1TFYA 2PD1A 1R7RA 4EUSA 3BDPA 4US1R 3RRKA 4IH6A 4M9XA 4Z7YA 1LWCA 2Q66A 1F2TA 5IKXA 3O94A 2OO3A 4OBBA 1UMBA 1RLMA 2WVEA 4ZAXA 3MWEB 2FHMA 1N3BA 3OH8A 3ZZTA 1EFHA 4R5MA 3ADBA 4FP9A 1Z8DA 2FF7A 2RAPA 2G9NA 3GPLA 3DOOA 2QYTA 1XZAA 2PNFA 5A0VA 4FSDA 3PYGA 1MO5A 5GAHI 2XLBA 4H3HB 4HO1X 1UZUA 1EAYC 1IBLJ 4FF2A 4HVZA 4P4SB 1N1GA 3S3TA 5BNIA 5K0FA 2VRWA 5IM4A 4QYZK 1TU0B 3NH6A 1QYWA 3KTFA 1ZU4A 4UUNA 2Y1KA 1Z6GA 1JMKC 1F2UA 3EZFA 3V7NA 1B0AA 2OORA 3JQDA 1R6TA 1FW8A 1CEEA 1JTEA 3BRSA 2EBWA 4KKXB 2VJDA 4Z7CA 1DBDA 3CX8A 4HGQA 2ZR7A 1QO0A 5L8VA 4FYVA 4DUPA 1M34E 2DGXA 1XEXB 4CF4A 4FXWA 3OZFA 3C14C 2FR8A 4QZVA 5EMKA 4LZLA 3T7TA 3GJ3A 1PV2A 4E46A 2QEXS 2OAUA 4NXNF 3PFWO 2HSEB 2FPOA 3BJRA 3DKVA 2ETVA 4BX9A 4QARA 3ISJA 1NKBA 3OIDA 1N8NA 2EGHA 2JFPA 2ZVQX 3K30A 3HCAA 1T3LA 2Q7DA 5BVGB 1CJMA 2HA0A 3HO8A 2ACVA 4DCGA 3F4KA 4DF4A 2G76A 4MLCA 5LZ8A 4JYPA 3NXZA 3QA3E 3Q8RB 1BCSB 5IM5A 1OJ7A 1WMFA 2QA4S 3EXG1 3MTQA 3JAWB 2PK3A 4XSVA 5A5GA 5FBQB 5DP2A 3TR6A 4DG5A 3LZDA 3HWX1 5ERYA 2IBKA 1BXRB 2FW8A 4GL4A 4A73A 5C7OO 5EVJA 1VKOA 2CDNA 2IM3A 1PR0A 1AK2A 3R9XA 4JKIA 1W46A 4OI0A 4E7OA 1PV1A 4RV4A 2OHHA 2R8RA 2AN3A 3K53A 3K9FC 3T1HJ 1WVIA 1ZNXA 4B0PA 5L51A 1N5VA 3GJ4A 3CBGA 1QIGA 4DSLA 5JQGB 2VKZG 1DJLA 2O57A 5K5EA 5B0BA 3ROFA 4ENUA 3GDWA 1NOKA 4HVAA 5CB8A 1DKUA 2CAJA 5ALLA 4R2MA 3BKXA 4C3VA 4FM9A 5C2JB 1JLQA 3GFSA 3CCRS 2E44A 1NN0A 4E1AA 2Y2VA 1Q7YT 4KB7A 5IK2A 1RQXA 1DBRA 4LYYA 4AY6A 1P33A 1U8EA 2VQSA 1V3SA 1S8AA 2AC7A 1EG2A 3TOCA 4CMAA 3TD9A 5ES4B 3BO4A 1H2RS 2W2VA 2I8AA 3TI7A 3ZBUA 1OFUX 4EDHA 4EY6A 1TB4A 3H6KA 5GJBA 2U1AA 4QTXA 1NK8A 4QYSA 4AYWA 3PFNA 5F7OA 1J9EA 2NIPA 3W3AH 2Q1SA 2P78A 2LA4A 3HPQA 3M6XA 2A2ZA 3L7CA 5M34A 4R8KA 4P2GA 1FFSB 4ID8A 1VGYA 4MP8A 1P4GA 3K0KA 4L2IB 2DFPA 4MB0A 4HR2A 4NEHB 4LR8A 3MPDA 3TNJA 3DF9A 3FDSA 1P0PA 3IPLA 4ENSA 4A47A 1HWYA 4RZHA 4L9RA 3W5CA 3WI7A 5FLXY 3LPDA 4E21A 1Q74A 3L5KA 3UJDA 1Y1TA 1VI6A 1WTBA 1ZK3A 4FX2A 2M1XA 1SIWB 3SLKA 1KYQA 1YVRA 4EGQA 2ZHOA 1G8YA 4ZKDA 4MIAA 1FKOA 1GYRA 3KDNA 4S1NA 3Q7TA 3FFIA 3WC2A 3SG0A 1CZOA 3BGDA 2ZROA 1V95A 2QLLA 3ET4A 3AOCA 4YHHB 2Z58B 3DN9A 2XIJA 4ZV7A 4QNMA 3JY6A 3KHUA 2ACEA 3PEUA 1P77A 2FUG9 5EPOA 2WF8A 5JY1A 3DT6A 3ITHA 2PBZA 2Q9CA 1E5QA 4E2FA 5JH7F 4F56A 2YY7A 5DBIA 1G7RA 3Q7EA 4TTJA 5JHGB 2AFHB 5AI9A 5KFZA 1HI0P 1NJXA 4WTYA 1TZJA 2GLUA 3U3JA 3LIIA 2VQEJ 2C2XA 4I66A 4U6PA 2VN8A 3IOMA 4AT1A 3G2NA 3SKVA 2P69A 1XTUA 2F63A 1RI7A 2CF6A 1YZ7A 3DHWC 3T5CA 2XMUA 3LT1A 4BNWA 2G4CA 1A50B 3MR7A 4GMHA 1SEVA 4JENA 2FJEB 5PNTA 3BMOB 3SCIE 2O0JA 1Y3CE 4A6XA 2YXPX 3LPAA 2OBXA 4RJTA 4Z4FA 4DZRA 1WXGA 3NBAA 4IS3A 5DHAA 1XR5A 4MV7A 4WF9Q 4MOWA 3CCUS 1I4EB 2I87A 1JKXA 1REGX 1NJSA 2P40A 4BAGA 3U4QA 2GHQA 1KRXA 3REGA 3M4XA 2H9AA 4IDOA 4BHQA 4KR0B 4Q1AA 4O8CA 3DVQX 1NSFA 3CT9A 3ROZA 1UFVA 3K5MA 2CFRA 4ZAZA 2P0AA 1C1DA 2V0NA 3ZTSA 1R9GA 5EX3A 5CYQA 3GJTB 4D0LB 1IEVA 4QXAA 2FOLA 3VR5D 2HNBA 1KEZA 4L4UA 3JD0A 3H97A 2QYSA 2HWXA 3I04A 1T5SA 2LCIA 1GVNB 4YDSA 4EZEA 5EZQA 4K2XA 2YOFA 5HBMA 2YCLA 2RAVA 3AF3A 1WF1A 4KQXA 2QLMA 1TECE 1ORRA 5B7GA 3BAFA 3GFZA 3CO9A 4CTMA 4MWSA 3ESXA 3B5EA 4CMIA 1XZMA 4ACBA 4E5UA 1N7IA 4DQUA 3NCRA 4KNVA 4RBTA 2WG1A 1VHFA 2EIHA 2V4RA 3P1JA 4MS4A 3W9HA 1IY9A 1NW6A 3EVBA 4FDMA 5AVJA 2LQ8A 3F78A 4DX6A 3BREA 4NSNA 4A26A 4CFZA 1FB5A 5CJ2A 5FPQA 1WWHA 1E5TA 2D7DA 3LRTA 2R7VA 1ZA2A 5K8IA 1T1JA 4PPNA 1HL6A 2ACKA 1V16A 2WTMA 3ZU3A 4QUEA 4MUAA 4HB0A 3AGPA 1WORA 2R6ZA 3VNQA 3AHIA 2HCTA 4DPMA 5D00A 2I38A 2OHOA 1I5OA 2O5DA 1K88A 5DM0A 4DA4A 4I50B 5E38A 1UL3A 4OXIA 4JP3A 4CCHA 4LFAF 3DCJA 3TE7A 2AZDA 5JJIA 3KJNB 5KVAA 3T7JA 3W7VA 2V2VA 1EESA 3L84A 2JI8A 1ZH6A 3EVFA 5HS6A 1WBBA 5FO0A 1GK8A 4IVPA 2E3JA 1DAHA 4ZHRB 1P9WA 3KU1A 5CJJA 2GBLA 1JH8A 2DY9A 3K0BA 3WWDA 2DWUA 3OPYB 1L5NA 3BMCB 2OV4A 2XDYA 1TM4E 5JCOA 1GAWA 1ZVMA 1L4HA 1PNVA 1MABA 4AURA 2E2WA 2BKAA 1SVIA 5ECWA 1KQGA 2XCQA 1IBLF 3N8KA 3OA2A 3BEOA 1A9XA 2I4TA 5DHPA 4IHJA 1YA4A 4M55A 1VRWA 1VRQC 2AYXA 1J7KA 2X23A 1BCRA 4O3FA 4DUGA 4Y6OA 1A5SB 5IYZF 5DNEA 4YCDA 4JUCA 2X1MA 3EUFA 4LQCA 2DCLA 2FCAA 1CJKB 2YJGA 3QEMA 1D07A 1T4MA 3T9NA 1XBTA 5DISB 3GFYA 4WFZA 3EDCA 2KMLA 2PUVA 1HT3A 4R9UC 1XWWA 4CW7A 1YTUA 3HXKA 1IY0A 1Z2ZA 6AT1A 2I6XA 2B1JA 1CZNA 1I10A 4PRFA 5B1YA 1GPH1 3VVLA 5EE3A 5TVGA 4PV7A 4HSEA 1VBFA 2IZ0A 3ABRB 3PFEA 3Q72A 4LX8A 1T3TA 2QE6A 3FZBA 4BNZA 3C70A 5A5DA 2ID9A 4OQFA 5G1OA 4HUQA 5KG3A 2RHSB 2KX7A 2VBZA 3GNSA 3TZWA 2PYIA 1UBFA 5LZ7A 3G8DA 1XE3A 4M7WA 3M33A 2YVQA 1TUGB 4WXMA 4B4DA 5IF9A 3CUTA 1PT8A 2G88A 2A9RA 3BE8A 5EIOA 4BCDA 4Z3DA 3CMQA 2E21A 1EYZA 4EPXA 4DUTA 4HDNA 1CUYA 1T9XA 4DLXA 3QOXA 1SQFA 1DZ5A 1UFQA 1J0DA 1BDIA 1P0QA 4HTFA 1LWEB 2LKZA 4UZBA 1W49A 2EVZA 2O8DA 4UBKA 4UTGA 2EHDA 3MEDA 4E1VA 1XN4A 2GH1A 2R6HA 4YN3A 3DPSA 1IR2A 1NQXA 3DOCA 1C0TB 2F3JA 4YCNA 2YH0A 4YXFA 4JOBA 4MP3A 3OE5A 4OXKA 3T1HF 2EZ9A 1W0JA 1ORIA 2A30A 5AXAA 4EUNA 1T9DA 1B4SA 4EHKA 5EZYF 2FZGB 3FCOA 5HBRA 2JH8A 2J8AA 4C8YA 5ITHA 1TR0A 3MYYA 5AWFC 1CY4A 2NO5A 5BOSA 3ZGOA 1DWUA 5U4QA 2O2XA 5JVDF 3TW8A 3RYTC 1F3LA 3HJBA 3QVVA 2EJBA 4JU8A 4QOJA 2G1JA 3FGVA 1CUJA 1TJ4A 3VJMA 2VNJA 4NOHA 4WKRA 2R6FA 1R0BA 2PZKA 5L3VA 2GBFA 2UXCJ 5AXNA 5G3ZA 3GRKA 2ZHBA 2VP3A 2LBPA 4X6UA 1Z15A 3V8VA 1T8UA 3EX7C 1G20A 4J9SA 4NMMA 4FD3A 2Q5CA 1XG5A 3HZHA 3IELA 3ACBA 2JHGA 1K68A 4MEAA 3A25A 4NJMA 5CGZA 2GYWA 5A3VA 1J23A 2ZQZA 3X44A 2X40A 3P2KA 3NVMB 4ZQCB 4EB8A 3I32A 4LF1A 2WUWE 2E5JA 3TJRA 3QT6A 3H2SA 1QTIA 3NTOA 1FDOA 4E09A 1KI3A 1U3TA 1XAGA 2HS3A 2GAAA 4XGNA 3V1YA 3TOQA 1UZDA 1ST3A 3F3KA 2AU0A 4LJKA 3W1WA 3JQAB 4MYDA 1U99A 4ZI7A 2RGEA 3OKAA 1FDDA 4WXOA 1NUUA 1FY2A 1S1UA 3ND8A 1FLDA 2ZIZA 3FNFA 2A4KA 2RGDA 1ODSA 2HNZB 3TANA 2VZLA 1YS7A 2HOQA 1EVZA 1FEZA 2V6IA 1TKXA 1MUUA 2UKDA 3I9V9 3EQ7A 4V1CB 2FJUA 1SBCA 1BA2A 5TQ0A 4J3JA 4I4CA 1ZJJA 4GZ5A 2WF7A 2GPYA 4DNQA 1V1RB 4MRSA 2X5NA 3MPVA 4WNAA 1MPTA 1UFOA 3L7JA 1UBOS 1KJNA 2DLDA 1ZI9A 3Q6IA 1FVHA 1VQSA 4I1OA 3ELDA 4N82A 5I3PA 3WC4A 2QLBA 3N2KA 1UK7A 1CR1A 3H5OA 3NCHA 3L0IB 2OO5A 3WNCA 4TKVA 4PQUB 3TR5A 1OWXA 3LX6A 2CNBA 3H2JA 3WLTA 3WGHA 3AI3A 2FB0A 4YJ2F 3PEJA 3O7MA 1SN7A 4MITA 3D2CA 3GMIA 5AK4A 5C53B 4XOUA 5JCJD 2PJDA 2QL6A 4CLRB 1APSA 2DETA 2XGMA 2ZPUA 3BGVA 4EHFA 5L9XA 5CBPA 2VZEA 4EEYA 4EF5A 3VUEA 4WFYA 3H0EA 1E3MA 1OBCA 1GG9A 2DGWA 4IRDA 2O7VA 1H22A 5IBCA 4GYYA 3K6SB 2A5YB 1T6YA 3B12A 1DAGA 5EIBD 3BMQA 1TL7B 2Y9HA 3ZXIA 3D4OA 1DQ9A 2RJOA 4DF8A 4KWTA 4DMLA 4JI0J 3PXUA 4G0OA 2BH9A 5TGDA 3SFGA 4R7GA 2ZSFA 5KG0A 3S1TA 1Z2CA 2GPTA 3C24A 3CZRA 4QWCA 4AX8A 3IMQJ 4BJ3A 2J9YB 2BTQB 1OH5A 1PFYA 3I6MA 1TA4A 1U5AA 4K2JA 4MVJM 3CCSS 4V2UA 3BAZA 4P54A 3DKPA 3AXKA 4JJ6A 1X1BA 3GLFE 1VI2A 3CNNA 2UZ4A 4LJ4A 3R8YA 1WU8A 4PHCA 4UHDA 5DLGA 1SA0B 3DFFA 4PPYA 1HZZC 3OCYA 2DM6A 2JGJA 3VGVA 3C48A 2WB2A 1P0CA 1V7CA 2V2QA 3KHKA 2AOTB 2CNKA 5KX5A 1A1VA 4WA8A 4I99A 3AEZA 3V4SA 2XLIA 3ONDA 1QE3A 3IEPA 1DBPA 1NNLA 2JFDA 4E6EA 3P4UA 2OV2A 3ZNNA 1U7HA 1YQUA 3WQPA 4Q3OA 1CJBA 1D1UA 1JILA 4RZXA 4FGZA 1RCTE 1K4KA 2W8LA 4ZI5A 5F3RA 2R8ZA 4KN5A 2DO0A 3THPA 2AUMA 1L8LA 4RXTA 3D5QA 1KFCB 3UCFA 3EYWA 2MHCA 4DWVA 3UDVA 2V8GA 4LZAA 5DZSA 2PZBA 1U7OA 5HS4A 3VNRA 1U0GA 3BN7A 4BYGA 2J0EA 2E49A 2VFSA 2ZD1B 1H66A 1X1RA 4J76A 3AU8A 3O0DA 3Q1KA 4R7ZA 3CYFA 1YE3A 3R5HA 2H0QA 3AHGA 3G6WA 5AO9A 5B1DA 4GKJJ 2YJZA 3RJ5A 3UT5A 4DNPA 3EFHA 3DFZA 4NRTA 3KUDA 5CFQA 1EXDA 4FNMA 4Q9KA 2R2AA 3C3DA 4Q1BA 1FL9A 2KWIA 4CIXA 4AB1A 2OZPA 3Q0EA 4BO5A 2QDXA 3WFIA 2XB2A 3FEXB 5DW3A 3SJCA 4U0JA 1TW3A 2C7QA 1QFSA 4NK5A 2KT3A 2QTBA 2GZDA 5GOTA 1HYQA 6Q21A 3T3FA 5KNCA 4MKBA 5K3OA 3SS9X 4RFLA 2B4TO 3Q9SA 1CJCA 3IKTA 2BV3A 4PRKA 3ER6A 3N59A 4OXYA 4F86A 3C16A 1X8XA 1JLGA 1RWWB 3AOAA 5IHPA 3BL5A 4P4NA 3RQSA 1Y7PA 3NNAA 2ZBGA 4KHPB 3I5UA 4GOJA 4AZTA 2WKWA 4P7GA 1GNSA 3MEKA 5ALHA 2HT1A 2ZUGA 1H3NA 1XU7A 1RKQA 1L4BA 2AYGA 1SH7A 4FMBB 3HG7A 3BH0A 5DTRA 4XOIA 3DTNA 3N53A 2C2MA 1JEAA 1SJQA 1U5CA 5JYCA 3E8MA 1KTQA 3BK1A 2YHUA 2IIHA 4KEAA 2V74B 4TXLA 2BJ7A 3K9GA 3D68A 4L6IA 4B6FA 4ENQA 3WFJA 2F5GA 2ZB2A 1GUYA 4RDXA 1J1ZA 4F9EA 2A1IA 3U16A 1G38A 2DR8A 4JN6B 1E3DA 3V2UC 2CJKA 4ENOA 4O4HA 3SHWA 4HEA6 1HR0B 4JQOA 1S6UA 2DNZA 3TIVA 2ZH3A 4LNUA 2AFRA 3IQHX 4ZT3A 2IJNA 3NU1A 2ES4A 3UOAB 1G5QA 4IJMA 4RTLA 1ZMRA 4EQ6B 1R15A 1YUNA 2DY1A 4B31A 4Y0AA 3M32B 1R00A 4ICIA 4OZ0A 4N65A 1ZBTA 4S2EA 1G2EA 1T4BA 2OD7A 3UBMA 1K2VN 1HYEA 4D0NA 5D6GA 2VHJA 1U8CB 2C5LA 4OFBA 3K0AB 1KC1A 3AH8A 1C4AA 1YA6A 5AYVA 5B3LA 5KYUB 2WB1D 2JIPA 1N9KA 3FJYA 2PZGA 1UC8A 1D1PA 1N6RA 3SI7A 5TPZD 3ICCA 4KQGA 4CEIB 3IUBA 1RWQA 4OFWA 3LQ2A 2WABA 2V4JA 2WNIA 1RT1A 1RZRA 4M8KA 5A4FS 5G4KB 2FIUA 4OQMA 1LEHA 5TQ2A 2EJUA 1L3KA 3AFNA 4HB4A 1I7SB 1F1BB 2Y71A 1L5SA 3TLMA 2GVZA 3RE1A 2F90A 2EVWX 1EXWA 3DH0A 1YJXA 3UTCA 2XODA 3C41J 4ZXPA 1GIAA 4NYPA 2XB9A 4LK3A 4LF8F 3KEOA 1EJBA 2QRVA 4BVAA 5FBRB 5ISMA 1WMSA 2UXCF 3CCQS 4LDNA 2DPYA 3B6IA 2CLEB 2HK7A 4Q7KA 3PYFA 3ROKA 3DNCA 2WHXA 2X51A 5AM2A 4YCCA 2YNIA 3MMSA 3U7RA 4IV5A 3D6MA 3OTDA 3QBTA 1U4BA 2OTJS 3CRMA 2BHSA 2V34A 4YBRA 2WYWA 2IYSA 1PK9A 3JYTB 5DK4A 5AJVB 3HXPA 2JIBA 4DGSA 1CJTC 3NUGA 4ECXA 3JQRA 3UJBA 1YFJA 1JPUA 1KAMA 1L4GA 4NENB 1IJEA 4YQWA 1KR2A 2NUAA 3LQRA 4O02B 2JHAA 1XEFA 4WIAA 4Z9FA 3C3AA 2YMLA 2WONB 3RQIA 2VFRA 2FWRA 2RHCA 3GB9A 4Y2XA 2IZ1A 2QE5A 3OXGA 5DLYA 5FEMA 1JYSA 2GZ1A 5FKJA 4PONA 3JQBC 1WCV1 3PGVA 1PUJA 3SHOA 4LRCA 1XNRB 4AZVA 3T4UA 3NV7A 2F1IA 2W4PA 3OUYA 3DE4X 5T8KA 4G26A 4QATA 1OF1A 2Q3CA 1T8WA 3RARA 3NAIA 1H1LA 1E0AA 4ZVSA 5BT8A 2GA7A 1SU7A 1DEKA 3UN2A 3RVPA 5DGXA 4KIWA 4CDGA 1Q5YA 1IN8A 1K5DA 5HCNA 3F4BA 4ZU1X 3P26A 1DV1A 4XM1A 1SG9A 1K9VF 5JALA 1FIUA 3QWPA 1E98A 4FZ3A 1VSUA 1WCYA 3LY7A 2OCXA 2E9ZA 3GLKA 4LR9A 3RYHB 1O5JA 4TS9A 3GZTB 4LJSA 4OJ1A 3MMAA 3RSZA 5JCPA 3DUFB 1SC1A 2CNLA 3PTAA 4TL8A 2IBTA 3LUFA 2W6ZA 4NKRA 4HACB 1Y6JA 1MJGA 5AJXA 2JIZA 1BJRE 5CT5A 2XHEA 1P81A 4WGFA 1L7PA 3G7SA 1FVQA 4TROA 2BKOA 2J85A 2BFDA 1NW9B 3TSWA 3GHHA 4WWHA 5LYJF 4MEBA 4QYXA 1JLBB 3IV7A 3B1FA 2D4HA 3TW4A 2IDEA 5CX1A 3DBIA 3FTCA 3VZCA 1BMFA 1KYVA 2VTVA 3C45A 4B75A 1JR2A 2Y05A 2CXNA 3G6ES 2ZDQA 3GRZA 2WQZA 3DLIA 5KAKA 2F8LA 4N3NA 4S0XA 4PWUA 5ICFA 1ID8A 4JI0F 3RK0A 4JBCA 5F8IA 4DBLE 1MJNA 4HJRA 2AKYA 3JCZA 1V0JA 2QAJA 2G9QA 4EJ2A 2YVSA 2DKFA 1Z37A 4PYOA 2DQ4A 3Q8LA 1TMKA 4N0PA 3GXBA 3OZIA 1YG0A 3H5AA 4NCHA 1QQ7A 3TFOA 3QE9Y 3VU9B 1IBRA 4JBLA 2PMZD 3LHIA 3KK1A 1WG8A 4GI3A 5IZHA 1TYZA 3A8TA 5GZ3A 1AV6A 1C1HA 4M0EA 4RC9A 3C4JA 1BE1A 2WTFA 1R6UA 4P7FA 3HK2A 5JZ9A 1TFWA 4PZYA 1Y7IA 3FVWA 2XT9A 5T4BA 3V6HA 4E4YA 4AFNA 2ZJOA 4D7AA 3PHIA 1UBTS 1HH4A 4LOJA 1J8DA 5IJZA 2QG9B 5A0FA 2BUCA 1Y5IB 4ES1A 1M34B 4IRXA 4RIHA 3SYRA 1TQ8A 3OJXA 4G41A 1WUTA 1Q84A 4N18A 3HJTA 3NDBB 1UKCA 5H9EJ 3SKYA 3BXEA 3PUYA 4UUWA 2PD4A 1WB6A 4F71A 2Q4RA 4MIWA 3SFUA 1BLUA 1N7JA 2HQRA 4II3A 2OYSA 4DG1A 4LJRA 5HGJA 1GLVA 1I4WA 2YY6A 5J9FA 1LLFA 1GLGA 4WESB 2NV6A 1F14A 2DXFA 1SL0A 1NL3A 2IRXA 4NLUA 1KZ1A 4OYYA 3DE5X 4HPJB 4F5WA 4K40A 2AEMA 4TMVA 1U28C 1ZK0A 5TLSA 1ZOOA 1UODA 2B4VA 1TQ6A 1PKEA 1EE1A 2EKLA 1ZBDA 1NI4B 3R7NB 2GRUA 3G2HA 3MB8A 1VRTB 1VSQA 2AV6A 1Y33E 2KRBA 5TMDA 3O1HB 2DWQA 4FZVA 2V69A 3KMQA 2QRZA 3H5VA 4JI6J 1M5RA 4IDKA 1JX4A 1TF2A 2CKWA 2DERA 1FHTA 4W1SA 4ZPCA 3GVCA 3E2MA 4E4RA 1M6VB 1QTNA 1NPYA 4XLLA 2CJXB 4A8XA 4ALJA 4CE6A 4OD0A 4DUZJ 3BX1A 3QFHA 1N36F 1T0UA 2WK4A 2GAIA 4KVAA 3O2IA 2FR0A 1GXSB 5HMLA 4JQZA 1VPTA 3Q8WA 4DM4A 1KORA 1ZH5A 4ZXFA 1O6CA 3R9IA 1XRJA 4KE6A 4YDHB 3ZY5A 2GCNA 1EJ7L 3BBLA 3L7LA 4WXEA 4BWVA 4FYDA 4NQRA 2XLJA 3AKEA 1T5OA 4IO0A 2VK2A 4MYHA 5HKLA 5FHQA 4IJUA 4X4OA 5EMNA 1TI7A 3QP9A 1CPZA 1UPTA 4LAFA 5LL6P 4IYJA 4FXPA 1PIWA 5LZ2A 3TTSA 2DHCA 4PINA 1RXEA 3CISA 4RKFA 3N5FA 3DQQA 5ABPA 2NP6A 9ATCA 3IQXA 3L6BA 4R4JA 3KQUA 4IMJB 2W71A 1UBHS 2D5LA 4E4TA 1GRQA 1GFIA 2FG6C 1QIEA 3RODA 3E82A 3QXCA 3T1YB 1G64A 2W0MA 3CULA 4I0WA 4JI5B 4FR2A 2J6IA 3H42B 3PV8A 4WFNQ 3WGKA 3QBEA 1RLUA 4LF9J 2VZ9A 4LYGA 1EE9A 2P5TB 1G3MA 1G8AA 1GYPA 4ZALA 3G68A 1C2YA 2AN5A 4ILLA 5L39A 3HGMA 1LDGA 4PRLA 5FWXA 4LQLA 1HSOA 4M0KA 5G4LA 4MMOA 2VHWA 4YS2A 2VJLA 2AKEA 4ZYZA 3IXLA 3TFQA 2IPAB 1RT5B 3C2PA 3JQ7A 1T0JB 2HQSA 4R98A 5F77A 3D4BA 2FHOB 2I6FA 2WIGA 2QC3A 2PX6A 3FNRA 3SICE 2BEWB 4CT9A 3E22A 3FOEC 1U1EA 4R41A 3RAJA 5I4BA 1D2NA 3SYLA 1HYGA 4P7VA 4OBXA 5AM3A 1H73A 3IDFA 3CNBA 2NQTA 5D7NA 3H20A 4I4TB 1PHPA 3JSMA 2JLFA 3RBXA 4ER5A 5K6AC 1BYIA 1P9RA 2DB1A 1XJWB 1GPDG 4P7TA 1DSSG 4RORA 1YUBA 2BE2A 5H9FK 1XNJA 2VPPA 1E1KA 4PPGA 1RAEA 2XTAA 5KG1A 2PPVA 2VZ8A 4PX3A 2Q7XA 2V7QA 2D7CA 1CIJA 3BFVA 3NHPA 4GM1A 4MVJG 2WT9A 2PQ0A 3UPUA 3LUYA 3WLJA 4GLBA 2JK1A 1RKXA 2GJSA 3SJUA 4DPKA 4TTTS 4NA2A 1XQ9A 2ZWMA 5DCLA 5B1HA 4GI5A 3ZHOA 3F5MA 4K4VA 4EHLA 5BSHA 4O0NA 1IQRA 4LYJA 3M8SA 3FPCA 5HKKD 4DA8A 1EVQA 1LI4A 5EWJA 1KEEB 4PYMA 3GGOA 2ZZNA 1VCNA 1O2DA 3USES 5ESDA 3QGGA 3BXFA 4B81A 3O9ZA 1HBMA 2OZVA 4BLUA 4P3NA 1FU7A 1YJNS 1MAHA 1EQAA 1MLDA 4CEHB 4I1UA 4GOMD 5LUAA 3DHEA 4ECRA 1B3TA 3MJCA 4YP7A 3LL7A 4HHHA 5AE1A 4WKCA 1GPWB 3HY3A 3U13A 3AETB 3BV8A 1NY5A 1EVKA 3OOWA 3RG6A 3IP7A 3BJIC 4E32A 1JVBA 3U3ZA 5ADVA 5AUQA 3GK3A 2PWZA 5CJPA 2RI0A 1ZC3A 3OQ6A 1Q7CA 3OIVA 4CCYB 4N56A 3UPTA 4KJIA 1PX2A 2CQ2A 2NT3A 3SE7A 2B8PA 1P1CA 3A8EA 5K8NA 4KT0C 3H6GA 5LZ4A 3CJKB 1ZYQA 1AA1B 2FQXA 2FK8A 1S9EB 4DLBA 9LDTA 5KS2A 1S7CA 2HNYB 2HAEA 5EZ5A 2C2KA 3D3WA 3RWOA 5CFNA 3EMVA 1MB2A 4R83A 4BFXA 2WSSD 2PBRA 3KHSA 1WDLA 3DE6X 4QGBA 3RVBA 2P67A 4P9SA 3ZWCA 1CC1S 2XHWA 2ABWA 4NDAA 1R6VA 3EC2A 1G2IA 2BFWA 2L0XA 4URWR 3F98A 4FKZA 4F7VA 1IHDA 4KV8B 3QYJA 2FPXA 1ELOA 4ZVRA 3IT3A 3LW7A 5T7LB 1XDSA 4CRJA 1X86B 4QLAA 4NLRA 2V9PA 1QRAA 1DEXA 3BWDD 2G1HA 5C1PA 1X7ZB 5E9AA 2IXTA 2YL2A 5FCDA 1T0IA 4H17A 4MMXB 1TVKB 4P2FA 2BGIA 2GZAA 4C11A 1HYSA 4X4RA 3LLCA 5KHLB 2VIHA 3RHZA 1N2GA 4C20A 1FXDA 1A8SA 3K0FB 1D2CA 3M8PA 2Y77A 3A2KA 5D0EA 3HB7A 4O2AA 3BRCA 3FDIA 4NXMJ 4EO4A 3WL3A 3G5UA 1UKVY 2A1UB 3UUFA 4EMTA 1XWLA 3EDRA 1Q5PA 2P75A 3W8EA 4OY3A 3U02A 2MMGA 2FQYA 4CCWA 2W6IA 1SK8A 4O5OA 3GFHA 5FLXA 2HJSA 1YOVA 2FW1A 3KJVB 4MWOA 4ZD6A 3DDNA 1UVLA 4XE5A 2HWUA 3V4IB 2Y67A 3SVZA 5ANRB 4UUXA 3DV0A 4F5DA 3ZK8A 2I2AA 4AJLA 1IOWA 4ER6A 4BNJA 5B36A 3WA7A 5BRAA 1UXIA 3EBOA 2RRBA 2Q43A 1T36B 4QPZA 3JTNA 4ED5A 4FGWA 1EXVA 1EGHA 2FXVA 3H2BA 3HL4A 4DS3A 3HEAA 3P2JA 1Y80A 2CLSA 3ZWAA 2W9BB 3AERB 5LSRA 2MGZA 2Q3JA 2QTWB 1OHHD 2O20A 4MR7A 4PO1A 2QD1A 2L9DA 5B6JA 1G8SA 4JOCA 1Q7TA 4K9SA 3I4CA 3AOGA 3N8GA 1L7RA 2EFJA 5IJAA 1OI7A 3GFGA 3DE7X 1WELA 1UJ5A 2WZQA 2VJNA 3R6LA 2Q3FA 4YUYA 1M83A 3ZJUA 1SKWA 4FYHA 1RAOA 2BD0A 2FZ5A 2M52A 4FOLA 3LRXA 2P30A 3AW9A 2DVMA 4IVNA 1CETA 1PBNA 3QU7A 2Z2MA 1GR1A 3CCJS 1T8TA 1FNBA 4DPWA 2NS1B 3PNIA 2VUTA 4IIJB 3UKOA 1U2CA 1U8FO 1U81A 2O3UA 2NO7A 4HMPA 1URRA 5GVSA 1A7AA 4ICLA 4C76A 3RVDA 5EWLA 2EEYA 2DYAA 5DGAA 2XKKA 4NG5A 4XXHA 2C57A 2GN9A 2WZBA 4E5YA 4CO5A 2VPWB 4HR7A 3QMMA 4Z4EA 1SBHA 2E4UA 2IUYA 5DBEX 3KUKA 3O2QB 1TPYA 4OCZA 4DUZF 3ZWWA 3DXYA 3WO0A 1X1DA 5KVVA 2YYSA 4MVJF 3F74A 5EXSA 1FTWA 1KDTA 3MM9A 1PNQA 4QXMA 1A0OA 1ZESA 1X7HA 4LPKA 5IXUA 2QLWA 3PC2A 3UEOA 1WC4A 2YWXA 4F9GA 5A2GA 4RGBA 3CJ5A 4Y2IA 3O03A 1JJ4A 2XVXA 2BM0A 1MV8A 4BLRA 3DLTA 2C7GA 1BRTA 3AYXB 4BBPA 1ZC4A 1CVLA 3WK7A 1YK1A 3RBAA 1X9WA 2I8EA 3I58A 3KXPA 1E2NA 1RACA 2GEUA 3RBVA 5JAIA 4Y7DA 1W6RA 1HXHA 3NIFB 3U7IA 4KSCA 3UFBA 4NQZA 4GYWA 4BMYA 4K6HA 1YDFA 1T26A 2B5JA 2OPPB 5CH7B 2WRZA 1PX0A 1R8AA 2B1QA 2A58A 3TEGA 3DW1X 3R9LA 4RF4A 2ZWPA 3W6NA 2ZYTX 5E4FA 1P39A 1WB5A 4JXJA 5CDUA 1JR3A 1ZL2A 1I1QB 3PJ9A 3RW7A 2BE7D 1R8YA 1YZLA 2FWIA 5IPFA 1KLNA 1X80A 1A27A 4C06A 4ZK2A 3SJ7A 3ZD7A 4NZ0A 1AZSA 1YDWA 4Q1EA 2ROPA 3QY0A 4CM9A 5C35A 1U9ZA 5C8VA 4EJSB 4U2KA 4EO6A 3PQ3A 4LF9F 4AS3A 4R2XA 3GG2A 3RTVA 2EERA 1Z6ZA 2JCXA 2CUZA 2CB0A 1P9OA 1F20A 1IKWB 5K20A 4N40A 1EZZA 3Q2IA 2K8GA 4NYIQ 1AXRA 2W6CX 1IOVA 1VQ8S 5H16A 3T3HA 2HV8A 1PFVA 1RK8A 1BS1A 3CVXA 1JHDA 4C8KA 3H5IA 2I2WA 4USWA 2WFZA 1Q79A 2WIAA 5BMVA 2C98A 2QVGA 1MRZA 2E48A 5BYAA 2RGRA 2X8AA 3D02A 5CFMA 4Y2HA 1OXKB 2JVKA 1P29A 2WDPA 3PNVA 3KV1A 2QYOA 1U2DA 1HRKA 2AS0A 3L82B 4LVNP 5EWMA 5C81A 4G36A 1IKXA 4YK7A 4EKGA 4WPGA 1RR6A 3NHBA 2A0UA 4JELA 1K9SA 3VDQA 5KG4A 1N2IA 5G41A 2JL9A 1RKJA 4TVAB 2CXOA 3ET6B 3PDUA 3M1VA 1V2HE 1SAYA 5IC6A 5KSWB 3ZHVA 4E2ZA 1Q7LB 1VJWA 3ROGA 4F4XA 4J6EA 1P1RA 3GIKA 3A1DA 2QUJA 3H11B 2ZDOA 3TZYA 5IASA 1XJ0A 2FJWA 3ZJTA 3GP8A 2H2FA 3H8VA 1SXHA 4WDQA 4YQFA 3K6JA 3UZUA 4H0FA 4TTVA 3G8TA 1N3YA 1PL7A 3QVWA 4UBLA 4LXGA 4ANCA 2A3RA 5LXTB 2M4MA 4U7UD 4OP3A 1EGMB 3ROMA 1KGSA 4F96A 1X1CA 2W98A 2GVDB 1M2EA 5L46A 3FH0A 2I6QA 3D4NA 4FWIB 5KJCA 1XZBA 2V6BA 1HDXA 1C3LA 4YMEA 4ZFNA 1QDEA 2O5VA 2HFSA 2RUSA 3EFOA 5K3SA 5LQRA 3R7SB 4LF4J 4FOPA 5IAJA 4DR5B 4O63O 3MMCB 3KQSA 2D13A 4FDTA 5ALQA 5E2QA 1Q22A 2PJUA 5GP1A 4MUNA 3Q8QB 2WLSA 4W63A 2ZRPA 2XSJB 5FLKA 2WMNB 1S0NA 4GX5A 3GLFB 1Z4MA 2FV8A 4QPXA 3DZ8A 1TQ4A 1V41E 4IQFA 3EZLA 2NUTA 3FE2A 3GMGA 3WYDA 2NU8A 1NBME 5DEOA 4UEWA 1I3KA 3D6FB 4G23A 4B3DA 2O8BA 2CPEA 3IP8A 3ONQA 4BNNA 3POTB 5IZCC 2IEAA 3ZCVA 2HL6A 3E9QA 3T1NA 4S1TA 1U1QA 2O2CA 3KUCA 2QQFA 4M1QA 1KPGA 3U31A 1D0SA 4TWIA 3KETA 2B3DA 4HWSA 1JLAB 2ZB8A 4F21A 2IGTA 2O8FA 1CJVB 3EMTA 1SL1A 5JMTA 1SC6A 2QX9A 4N7JA 3C3KA 3RRJA 5LXYA 3N5KA 2C42A 2HYIB 1TZCA 2W2KB 3QEAZ 1P6QA 2YOGA 3I8OA 4W5OA 3GDHA 3M2RA 4C3MA 5C24B 1J5PA 5A9RA 4KYTA 1ZD8A 3OU2A 2NTJA 4L5YA 1NSAA 2VNKA 4Q0BB 4WINA 2VKRA 4S1PA 4G4IA 4KGVA 3HD1A 1ZTWA 1IK6A 5ITVA 5FLYA 5IC4A 2G9VA 3ZHXA 3OPMA 1DKNA 2Y1XA 3TVTA 1Q50A 4RSGA 4D9KA 2P11A 1W4LA 3I62A 3AA8A 2GFHA 2QUBA 4WFQA 2BP7B 3I2FA 4QQ8A 4JQSA 4NPHA 3C2QA 1TK8A 2XNJA 4B2LA 4GL2A 4PIPA 1U2RA 1UR5A 3RIXA 2AGPA 3TQTA 1YCFA 4BX8A 3FSGA 3CKLA 1RLIA 4J9RA 2DHGA 3P6YC 4QBKA 1OB2A 2D1RA 4H6WA 1H0HB 4RF3A 2PFSA 4HLUC 3R7WA 5CEJA 2Z2LA 4NULA 2GHRA 2O2HA 3ENQA 1CS0B 4CQMA 3IAS6 1L6IA 2FLKA 1YJ8A 2WKRA 3T94A 4AZ0A 1QHNA 2G9ZA 1NPKA 4OUKX 2O4UX 1S01A 3N2YA 1EAYA 4R1OA 1RYSA 3FMGA 2HZBA 4Y2SA 3OUTA 5DTJA 3EEFA 4WEQA 4ESVA 3Q5EA 3JVEA 3BHJA 4JJGA 2YIMA 4OQYA 1V1MB 2ZIXA 4IMIB 1FJ7A 2ZE5A 5C4MA 1WLSA 2D3WA 1FXRA 3GLJA 1I6LA 3FBFA 3MPWA 4J0EA 4BNFA 2DGUA 2MPUA 2IYQA 1MNAA 4Z3OA 4QJIA 3W3AD 1C5KA 3VNUA 1P2TA 4DCOA 4USHA 3OFHA 4EFNA 1NSKL 1V4NA 2I5JB 2XGPA 4FGUA 2KVQE 2PUEA 2UVWA 3C14A 4ZCPA 1LB1B 2B4KA 4B34A 4RCVA 1D04A 4UBMA 5KTMA 4RMHA 2D69A 4C48A 2D1FA 4PZDA 3ZGVA 3NBYC 5LOVB 3G6VA 3W7AA 2DX7A 3LCVB 3D7MA 3U7HB 1SCNE 2V7PA 4OA5A 4ZQEA 1SC4A 2J07A 3UN3A 3K4PA 5CCXA 1M73E 1L5RA 3K32A 4CKEA 2D7SA 4QDKA 1A04A 3QU9A 1W94A 3BA6A 4TY8B 5ALDA 5T4HA 2V5HG 4TS1A 4LHWA 2PT9A 3O83A 3RWBA 1XDDA 2JDID 2VUHB 1JJFA 5ULLA 4AUEA 1EM8A 2OPBA 2WILA 4ID5B 5J5AA 4HL9A 5F1OA 1KI8A 1ACMA 1C29B 3MUNA 1PZEA 3MTJA 3T7DA 1JE0A 4IG0A 4QOFA 4XYEA 4XPIA 1V3TA 1CULB 2WW4A 1W4ZA 2OXEA 3HVKA 1S6OA 1D7OA 4DAEA 3WB1A 2XSFA 3E3NA 4UUAA 1FSPA 2CMKA 4O4RA 3N76A 1V8PA 3VC7A 2VYFA 5IDQA 3VTIA 1QNFA 2Q4EA 1A8QA 2R6GA 3IA7A 2ATEA 5FNVB 2HBYA 4NI2B 2Z83A 2ANBA 4RK0A 5B58C 4H15A 3MMBA 1Z2DA 4LF7J 2P6OA 2VTBA 3L0SA 3W90A 4QIWD 4X66B 7AT1B 2Q4OA 2AJ8A 3MT7A 1J9ZA 4XR9A 3PFHA 4I5IA 4A8KA 4WK4B 1L4KA 1YDHA 5AW0A 2HEIA 4PPZA 2WC1A 3OICA 2O3DA 1VSBA 1OZGA 4ZVPA 5JR3A 4PYAA 4L9SA 1VKJA 4IWXA 3I4FA 4UVGA 3GQBA 1S6QA 1EK5A 1U2PA 3FUUA 3ZD8A 1SH2A 3RVMA 4DKXA 2QSFA 3W60A 5DQGA 4P74A 5JWRA 2VDHA 1U6FA 2B9YA 4DUYB 2BW2A 5DNYB 1HL7A 3FSRA 2PX8A 4X8HA 2OD4A 3GJYA 2J9ZB 5FO1A 3GCXA 4YB5A 1C3OA 2EBFX 4Z7QB 4M95A 2VF7A 3PUHA 4DFDA 4HYEA 2R2SA 2ZWIA 1FFWA 1PYSB 4CF6A 2C8KA 2FSVC 3LO3A 5HOEA 1R4ZA 4LSMA 2O2IA 1T3OA 2QTTA 1XZ8A 3OD1A 4ZC8A 5EMHA 2XITA 5GV7A 2BGGA 4Z1MD 1E59A 3MWDB 4M7RA 2FD2A 3RJ9A 4X1KA 4DBQA 2XEDA 2Q3BA 4CV0A 3Q1LA 2FPIA 1KDYA 3ORRA 5IM0A 3THVA 3ZTQA 3V8RA 2BZSA 1E3EA 1OLSA 1U47A 4BIMA 2DUUA 4HT3B 1JKJB 1P60A 5HK9A 2IZ5A 4TSFD 1MT0A 2IBOA 5A71A 3CO0P 2UXDB 4HB2A 3TE6A 1WOYA 2V9CA 4F06A 3OBIA 2FSIA 4HNRA 3A2LA 5C31A 1BKYA 3IEVA 1XMQJ 3DFEA 5I7UA 1QF7A 3RYFA 4X8LA 4LJ5A 2VDIA 4NCIA 4EFLA 1QVAA 4QDUA 2OVBA 2B1IA 3MC1A 3CSKA 1QAIA 4EFAC 1YK9A 3NHWA 3PKMA 1QSSA 4URHA 2GUWA 3G5MA 2CQ3A 1V3ZA 2A18A 2PN6A 2Z2KA 1RJ9A 4QKQA 2JIRA 4Q16A 2OZKA 2DR0A 1S1WB 4WIIA 1U80A 2FMKA 1HBOA 1Z29A 4WJKB 2IM1A 1GFWA 4E51A 1GZ4A 5I9NA 3VPAA 1A7UA 2PZ8A 1T1IA 1TYDE 4TSKA 4Q4JB 4ED1A 4M37A 4LF4F 1XR6A 3UG7A 1FXUA 4NBLA 4ZA1A 1U1MA 4X65J 3GWZA 3QGIA 1Z2AA 1NM2A 2A0YA 1VHIA 4L4ZA 2TMKA 3QE0A 4DR2B 3ED5A 1DC7A 3RYCB 3ILSA 1GDHA 1DQPA 1XQWA 4PAOA 3TTXA 4KFUA 4ZANA 2FVYA 2GKOA 3TLGA 1R3NA 5TQJA 2C2RA 4AJIA 4BO1A 1Y1QA 3JQMA 4KFRA 4YEAA 2X5JO 1MC1A 2AW5A 4WZBE 3MA0A 4QRHA 5A4MS 4UHCA 3D3EA 2WFLB 3BPSA 1KBRA 1QAJA 1PR9A 3QKTA 4AS1A 5LQUA 4UM7A 1EDZA 3E7PA 2H1CA 2WPNA 5HJYA 1E0DA 1LPOA 5F3WB 4JCCA 221PA 1LPMA 4CM6A 1BQMB 1WUUA 4O6VA 4Z99A 1GFSA 3E0XA 2F62A 4JVMA 4FS3A 1VDZA 2HIGA 1FMTA 2I78A 3KZKA 3BL6A 3LWLA 2HGNA 3S2IA 4OZ5A 4NLLA 1SXQA 3T4EA 2AJ2A 4E12A 1V8FA 1T3GA 4GYKA 4A92A 3NATA 4KHMA 4WJBA 2NZYA 3PIIA 3KAKA 3JAKB 2RMKA 1H3DA 5A7HA 2RS2A 2MJNA 3CJTA 1OI4A 2GAFA 3EZNA 2XMPA 1Y6QA 2JI6A 3HUFA 2JFWA 4ZITA 2OBMA 1WBDA 1K1SA 1H7WA 1ULHA 4NE9A 4TLDA 3AM1A 3BXOA 5B2ZA 5C8ZA 1JPJA 1QGOA 1B8UA 4E3ZA 3PYDA 1SZJG 2EYQA 2PZJA 2GFIA 4PYQA 4M36A 2F3SA 2VFTA 1MXFA 3OLAA 5TXGA 4LZNA 5THKA 3VF0B 3EXG2 4AG3A 3WGZA 1CUDA 4NMWA 3QT5A 1QGUB 4W8GA 1XQ1A 2PSSA 4RL6A 3ENNA 3TBKA 2OPQA 4GMGA 1VMAA 4LHYA 5CD1A 3ZZNA 4RJVA 2C59A 4QOHA 3HSYA 2R9LA 3JSAA 4EYIB 2XGGA 3ZJ5A 2PWPA 4FK8A 4IUCS 1ZJZA 5KAMA 4RVUA 3GLGE 1TD9A 2RHRA 3HEBA 4IOMA 1OTHA 1RZMA 1UUFA 3M8RA 1JT9A 3IESA 4N47A 1H9BA 5E6RB 2WJHA 1RWPB 2V4ZA 4C1BA 5F8MA 3L1UA 5IYZA 5JNTA 5BWLA 4QYZJ 2DB3A 1H9CA 3ZBTA 1XF9A 1E2BA 4XLTA 2FQQB 1UJNA 4B43A 1C0UA 4X94A 4WE3A 1MX5A 1PNTA 3DR5A 4BN4A 2VQEF 4NE7A 3FPJA 2WTUA 4USKA 4PLYA 4B33A 1YX2A 1T91A 4B02A 3CC4S 2EFOA 3WIOA 2R5WA 1JZSA 3OE1A 1L3UA 6NULA 3C87A 3VALA 3BBFA 3VKHA 3RANA 3ILIA 4BWFB 2I71A 4EEZA 1I5RA 1RKIA 1VBNA 3HFZB 2IS6A 4C3LA 3I8SA 3U44B 4ZMRA 3Q11A 1MW7A 3I9NA 4PSAA 1DHMA 1Y6FA 1N6NA 4KI0A 1DXQA 2AD1A 1Y98A 4W4TA 1HFEL 1OI2A 4NCBA 2OZLB 5GINE 2HHHB 3M6UA 1VL8A 4DV4J 4WRRA 3E61A 2R65A 4C0AC 2ZJ0A 3SMVA 4D4IA 2CG4A 1UAAA 3NKLA 1WD7A 4TSRA 1IKVA 1PR5A 1G4CA 5AK3A 1KRWA 1WF0A 1TL1B 1FLNA 1JL3A 5I7FA 1A9SA 2PO7A 5EEGA 3QELB 5BYSA 4IGAA 3FMOB 1UPFA 2MSWA 5JBIA 1E6YB 2FWBA 3OJFA 5KZMB 4JODA 3S99A 2DTJA 2ORED 4WCFB 1VECA 4FU0A 2Z8XA 1HQDA 2SCUA 4NEYA 2AHOB 4YQYA 3IIIA 4B46A 4C3OB 4DLZA 2WV7A 1NXQA 4PGAA 1ZM2A 1OH7A 2ZSUA 4OJNA 1MJHA 1FDSA 1VOTA 5MLCV 4X85A 2EX1A 2PSEA 3BRWD 3ABZA 2J45A 3C3MA 4KPYA 3SZ3A 5EZYA 3IUPA 1TKRA 3JVUA 1VE7A 5ALXA 2LVBA 4WGGA 1S8NA 4LJMA 4R01A 3KK0A 4TYYA 5EJ7A 1ZRHA 2V55B 1WZEA 4G5GA 1N2SA 1ZAWA 2KZMA 1M1UA 3HMQA 3LT0A 5ITSA 4PCQA 3IS9B 1DQRA 1BQNB 4LF7F 1HBNA 2F1OA 2NGRA 3DNFA 1GX5A 4LIWA 2BR3A 4INAA 1W19A 4ZN6A 3KB1A 3AQ4A 3EZ7A 4YV2A 4ZPAA 2DUMA 1Z6PA 4PX9A 2Z4PA 2J0SD 5H0IA 2BEUB 3WKEA 3D6TB 1LZLA 4Q4DA 1XHEA 1JXEA 4B8YA 4OQNA 4JEUA 2UUTA 3KRTA 3L6DA 1IBMJ 3GCZA 2PGXA 3RS2A 5H3HA 3HUDA 1B74A 1UAGA 1H2UX 1KH1A 1RTJA 2ZHAA 1KSJA 1R8HA 3PLAE 4P33A 1O0BA 4HMQA 3DQPA 2ZH1A 3FDXA 3OVBA 5IH3A 2Q3HA 5DGBA 3FETA 4DXDA 2ZYHA 3QYPA 3DCYA 3ZHTA 2OFWA 2V7BA 2HRBA 3Q85A 2C5AA 4YP1A 3ESCA 1W96A 2ZQYA 2DIVA 4U9UA 3R6TA 3ZFVA 4HOYA 5I4KA 4BP3A 2XMTA 4A91A 2XTZA 4NLTA 1RISA 4JOQA 3PQ2A 1JDZA 2X1GA 3A4TA 3D1VA 1E99A 2YNMC 2QRGA 5JMOA 1Z45A 1LI5A 5CNMA 1U7UA 2PT5A 4COKA 1P2VA 2FG7C 1XTKA 3KJZA 3CWZA 4YALA 4EY8A 5AJUA 4UMEA 4QUAA 5FOTA 4BKRA 1LNZA 1CPYA 3OR1B 2QEQA 1EFVB 1BVHA 2FSPA 1ADGA 2JPDA 3U4AA 2TS1A 4ECQA 3NAQA 4UTPA 4GKAA 4NBWA 4YAJA 1YU9A 1LRJA 2IOFK 2WV9A 4YRLA 3LFTA 3CCWA 4WBNF 3Q8KA 3F6RA 2G25A 5L1LA 3VNBA 3UC5A 2G2OA 2Q1LA 4KAJA 4MAAA 1Q1BA 3K1AB 4LXTA 4N9QA 3F96A 1QLNA 1XMQF 5IW8A 3AQPA 4MRMB 1I51B 4A4JA 4IS2A 2O7SA 1TXGA 3MT8A 3U4MA 5BUQA 3SDBA 1UM9B 4C0BA 1XTIA 2EG5A 2W6PA 3KE9A 2QPLA 1N2ZA 4Q18A 4Y2MA 5AXBA 2DPMA 2PKQP 4C7KA 1S0UA 4JBNA 2PZAA 3Q6MA 1MROA 3K05A 3LUCA 1CDDA 3UV3A 4JAVC 1AT1A 3KOAA 4X4UA 1A7JA 1F6TA 1S4FA 3INGA 4ZT4A 3PPYA 1XZFA 3B13B 5D3MB 4GGPA 5DSTA 4ZEMA 3OETA 3M30A 1OJ4A 4K5RA 4IHQA 5KTNA 2AIRB 2WHYA 3UC9A 2W6QA 1V2GA 3TQOA 3GLVA 4M7OA 5L53A 5IKOA 5DHTA 2EL9A 4PSKA 4P93A 3L4BC 4QFBA 4X65F 2F43B 4XPCA 3VAFA 1MV5A 3DMRA 3PWTA 3PJWA 1NVAA 3E9YA 1U5BA 1K4YA 2LA6A 2HA6A 4QU7A 1YL6A 3ABSB 1XZLA 1P18A 3G8QA 2ECPA 2A33A 3OTGA 4EG6A 4ESHA 1SUIA 3BGSA 3KLVA 1JHAA 1OCEA 3PHBE 4A2PA 4JB8B 1SCUA 3LUGA 2V0GA 5E8JA 1N6QA 4NCGA 4KH1B 4KLNA 4B7ZA 1VGRA 3DEYX 4NCXA 2ZU6A 2H8KA 3T4PA 4DMMA 621PA 2ETXA 1RHJB 1M2OA 4O59O 4ZP1A 3WKBA 4MYCA 1Q7BA 1WF3A 2OD9A 3HHEA 3ZWMA 3IEIA 3RG2A 1IB0A 3ZV5A 2ILYA 1HZZA 1I0IA 5EKTA 4XDGA 2VJBA 4ZPXA 3VI3B 3HV2A 2FX2A 4OLFA 2BT4A 2R8PA 3EMDA 2Y1EA 4J8PA 2J3HA 4DR4B 4LXIA 3AB8A 4OYHA 1NW7A 3PYEA 4AIRA 2I80A 3UFXB 2EC2A 1YZ3A 3U17A 3HTXA 3HF5A 3OFJA 4R5HA 1JXMA 4LSWA 1FDAA 2ZG6A 1YJRA 3H8WA 3SFTA 2D74B 5DN6A 3QRPA 3UMYA 4JUIA 5ETKA 3NBPA 4MX8A 2DHDA 4IDBA 3HCFA 4GO1A 2NACA 1MC8A 2XZPA 2CNNA 1FK8A 2QN7A 2HQ1A 3FPHA 1WCIA 4C9BA 4L6V3 3L01A 1JZTA 1VCIA 4B6RA 2CJFA 4TLEA 1RVDA 1THZA 3WGJA 4CKZA 1QFZA 5H02A 2CXEA 3QUTA 3LY8A 3GPCA 1SCAA 5CA5A 4UCWA 1VJDA 4HWGA 1AUPA 5DO2A 4LXYA 1KZ4A 1SQSA 1A4RA 4K1LA 3FGOA 4LDJA 4CV1A 1JAIA 3A04A 3AF1A 2ROGA 5ER9A 3X0DA 5LMUJ 4DCUA 2E7XA 5AVTA 3EFEA 3NWJA 4MJLA 2PLRA 3MQ4A 2PS3A 3L7DA 1S4QA 4KPEC 3GH3A 3CIOA 4AJ2A 1ADBA 2F8HA 4NBVA 1M5KC 4QUKA 2BQUA 1RAHB 4I2QA 3NMAA 3HDQA 3WX8A 4QGFA 2XVZA 2VTKA 5ILOA 3A12A 5DI9A 3GYXB 1O54A 4FYIA 2W8BB 3M8KA 1GNRA 4BB9A 3ECCA 4PVCA 3U3KA 4TT3A 1H8HA 1KE1A 3KLEA 1G2QA 2ZBVA 2VTDA 4JWKA 1T9VA 1A82A 1IRIA 1ZVJA 1I4DD 3EPIA 4DWOA 3P49B 1I2BA 2MWMA 3S70A 2CZ4A 3VDMA 4N5DA 1IJFA 1NATA 2E1RA 5BN3B 1RHMB 2O5CA 1LW2A 2H9IA 4FPIA 3ZDBA 4NLOA 4PZ0A 5CVEA 1E0SA 4V02A 1GXUA 1YJ7A 4L72B 1YONA 3CZQA 3R5FA 1X8JA 4QDZA 3W9UA 2AWOA 4FS8A 1OPIA 1S6PA 4JITA 4DDHA 3UHFA 3QHQA 4IZ6A 5AHXA 4FLEA 1Y9AA 5J1EB 4HWKA 1GQEA 3NT4A 4D0SA 2UU9J 1ZI8A 1LQ9A 3IKLA 5C8YB 3RVJA 2YNFA 5HGXA 4H4MA 5WRFA 4K4ZA 3N1UA 3E5NA 2VEOA 4DV4F 3EQ6A 3V2UA 4R3UC 5I3UA 2RD2A 3BPSP 5EHGA 3CEHA 2WAQD 3OE7A 2VCYA 5AR1A 4RKUC 1FT8A 1O8CA 2Q2OA 3K96A 4XYLA 4KE8A 1IXZA 1IWOA 5FLXU 2W22A 5DG7A 5BQXA 3Q7PA 2HK9A 3TZLA 3K2QA 1UVMA 5C80A 1HDIA 4WOBA 1DUVG 2M6LA 3A4IA 3NGSA 1T1GA 1WY5A 2AE2A 5DWQA 5HN0A 3WBFA 5KSPA 1U63A 1GPUA 3IALA 5KG6A 4F91B 5J40A 2RSLA 3R23A 3K0SA 1EEHA 5A9SB 1T0TV 4H0CA 4R8VA 1MDFA 3IXMA 5L9AA 2QGNA 5C1OA 5E4JA 2WAMA 3U37A 4OZJA 2VEDA 1W44A 2VDUE 1AKEA 2CLCX 2IHBA 2AQ4A 1LNSA 4DRXB 1RYFA 3H0PA 2GEJA 4WYWA 1DT3A 3HNPA 2G9OA 4CKXA 1N52B 4B3XA 5F35A 1KBZA 1Z83A 3ADPA 2FPPA 1BNCA 3EG5A 4ETMA 4Z0TA 2YKMA 2ZBEA 4MINA 3A3NB 1L8QA 4AN0A 1OQ6A 4BVHA 5ADZA 4XQ9A 1SXLA 1VL0A 4KAAA 2WOOA 3AZQA 4BU0A 3EPKA 4TT8A 1IBMF 4GKJF 4PLVA 2V0CA 4H4CA 3QVMA 1MNQA 2HC9A 2ZJ8A 2RJZA 4G5YA 1H5NA 2WWWA 2W2LA 4LI3X 2HR1A 1KO1A 3OLZA 5K99A 4QOEA 3EICA 3Q3EA 1TT7A 2ERXA 3QFRA 1GNLA 5AP9A 4TY9A 4HEHA 4KWCA 1S2OA 3BA1A 3TA1A 1M6YA 4Z5XA 4QG3A 4L85A 1OWLA 2HCFA 1O94C 3C85A 2KFNA 1WZCA 2C3UA 2IUFA 5ESRA 3WAGA 4AX4A 1WG5A 2WJYA 1YE8A 1ZPWX 3AIOA 1JTFA 1KFEB 1FSGA 3RUEA 4DIFA 3WWEA 3PL5A 3W9SA 3CZMA 3KU4A 4MGEA 3MD1A 2OR3A 1X8LA 3FTFA 3LDAA 4G89A 3LOPA 2XB4A 2CQPA 5EY5B 2DNHA 3SSNA 1TDJA 3F8SA 1WW3A 2JFBA 3EIXA 3UY4A 2QMUB 2WHRA 3BK7A 1DFIA 2BSXA 1PZNA 4UOZA 4OLBA 1WXWA 1DTTB 1H2FA 2X7HA 3M8ZA 1SI9A 2QA2A 4MTPA 1SQ5A 1DJNA 3MUOA 3NIDB 2B5VA 3C6QA 5HLFB 3GVPA 4MH8A 1XMBA 3MBKA 1JFSA 1KVSA 3CF6R 5E3IA 3HWWA 4DCTA 4GC5A 3ETJA 2R47A 3IE1A 4ZDIA 3I0MA 1J97A 3W9YA 1C7JA 5FOUA 1LZKA 3FAKA 3FN4A 1F3FA 1LOUA 1Y7HA 2EQ5A 4EDFA 1P7YA 1KMHB 1PLJA 1YV9A 1EWRA 1S79A 2K7JA 1ZG3A 1WKCA 2ZRDA 2HRZA 5C8XA 2DQZA 1L8XA 4ZIRA 1WDKA 3AF5A 3CLRC 4PNPA 4MV0A 1ZX1A 5BYRA 1JQ5A 5EJMA 4W5TA 2Q4TA 4K9LA 3MYRA 2VT2A 1MOQA 1ANKA 4TLRA 3HPRA 3SHTA 1UK9A 4BNLA 5D3GB 4MA4A 3TTWA 2O2ZA 5I7VA 2OCLA 4PSVA 4KACA 4RBUA 2DR3A 3IPAA 3PI7A 1KKHA 4Q9NA 1YE5A 4JDUA 4OOEA 4XWGA 1QGAA 5KOHB 1M90T 4CLEA 3DAOA 2OAQ1 3AF0A 3R4CA 2C8VA 1XQIA 1IMJA 3A6ZA 1LW0A 2ZJFA 3UOGA 4V19X 2BEKA 2PYZA 1KL7A 4L27A 3ZE9A 1EU1A 1UC5B 1UXKA 4Y2YA 2QTMA 3UVEA 4UQTA 4DRYA 4QJ3A 3MJVA 1APBA 4DJEC 4OL8A 4JUFA 4D8VA 2EWHA 2GAGC 1L5QA 2AA3A 2C2EA 5FBKA 4CRWB 2XMCA 1QZ3A 3I3OA 1N92A 3MMJA 1ZBQA 2HMIA 2QX4A 1JEQB 3GW8A 1GUZA 2NUPA 4B4KA 1FFXB 2WUDA 2J3QA 3FIUA 3HXLA 4M5DB 3L0YA 2YUTA 4JKOA 3HDHA 3K0CC 1TJPB 3HFRA 3S2ZA 3N0TA 3CDWA 3BKUA 4B3CA 3NRBA 4PEOA 3B3GA 2HB6A 1CIVA 4IOAQ 3QYAA 5HJXA 2OHJA 1KMQA 4L16A 1C8LA 1E2HA 3E1GA 1QAMA 2XMKA 4YBZA 4UTRA 4QWEA 3GROA 2J3KA 4DPTA 3CC7S 3NMRA 4AN1A 2YWGA 1CU1A 1DRVA 3KSZO 3KZVA 2D00A 1OBOA 4EP1A 3GEHA 2HW8A 3M3PA 2F9JA 3EMBA 4NWIA 1XFDA 5HSGA 1G3IA 1P4SA 4FCWA 2E0IA 2NZUG 4DC0A 3PX3A 4Q3LA 4JEHA 3SHFA 2XWBF 2XD9A 4HX5A 1PR3A 1IY8A 2P2CB 3H1GA 1LDMA 1Q21A 4MWDA 1OLUA 5TT1A 2MLXA 4PAAA 2VSOA 5FEUA 1RI3A 2ZT7A 1DDGA 4HC4A 1NMEB 4JASB 1E3SA 1U28A 1U04A 1WLYA 3ADAC 1U1GA 3RVKA 5EQFA 3ZXXA 1J33A 5LMUF 5BRJA 1G7CA 1PLLA 4OSOA 1GKIA 3WMFA 4GKKJ 1WVGA 2JLCA 1JS1X 4GO7X 2XMQA 2JASA 5FLEX 4P8RA 1ETUA 2QQEA 1FRVA 1SHKA 2VH2A 3VNVA 2OSQA 1LVUA 4NYZA 3I1IA 3L09A 4QU9A 2C9BA 4H59A 3KLGB 2VHQA 3KL2A 3EN0A 4G8BA 1FRMA 5I8ZA 2HNKA 2AEJA 3TCXB 2VP4A 2UUBB 1RPJA 3QE2A 3WLSA 4IGIA 4C2MA 3CDBA 4B3MB 4FPXA 1T3SA 3H9UA 2X7JA 5FTLA 4IDAA 4HEQA 3NY0A 1A5ZA 4KRXA 3KB8A 1W36C 3K9HA 2ZIFA 3DOFA 3OECA 5L7WA 4MVXA 4YB8A 1L5GB 4A8HA 2HIHA 2GSWA 3RBEA 2QSUA 1QP4A 5ICGA 1E9AA 2XDQA 3KUXA 3Q87B 4D44A 3G9UA 4O2LA 1KONA 3ICEA 2Q9UA 2J5RA 3NTQA 5GAJA 3JRWA 5FB3A 5AI6A 2FW7A 3HE3A 2W58A 2MMYA 5CIYA 2VK4A 2XRMA 4JBIA 4PU0A 2VWPA 3BCRA 2UU9F 3A9TA 2BHTA 2FUG1 3WP1B 4HDOB 2JAXA 4EVIA 2XNHA 4F3TA 4KAIA 1OXUA 1RRMA 4HKTA 1XD2A 2MYPA 3TX0A 1YWXA 3F9RA 5IUNC 3EVGA 2ZI9A 5LBIA 4ZIVA 4L95C 1EARA 5HWSA 1TEXA 3JS9A 2XECA 1ZEMA 1SOVA 5TB5A 3U3MA 2FY1A 4RDIA 3WL7A 1VDHA 2ZT6A 1CQJA 4Q4AB 4RHFA 2K6GA 4UCQA 1MWZA 5A8WB 1V5VA 1VB3A 4MR8A 1KYXA 1UBJS 3D1QA 4JI7B 4WK0B 1JQJC 3H2KA 3ZXYA 2NZWA 4ZZIA 1U4NA 2EBGA 3JZDA 2Q21A 4W6QA 3TUPA 4WYLA 2EU8A 1L5WA 4LSNB 4F60A 5BR8J 7REQA 3Q5GA 1AKWA 1IBCA 1VPDA 1PFKA 1WIWA 3MG9A 4RY9A 3UR0A 1P73A 3HRIA 3L1JA 1G5FA 3I9OA 2FTKE 4F02A 3PNYA 3NH9A 3SSMA 4AECA 4IRMA 2A9JA 1E8MA 1SD1A 1GL9B 2HQBA 3DKIA 4JUDX 1Z36A 1HG1A 2WOJA 4R0VA 1PDWA 1T2EA 4LF6B 3CVJA 4EYEA 5K6AA 3KJFA 3UWKA 2CQDA 2FRDC 1OR8A 3ROXA 2VHZA 3ZHZA 2RJ3A 3NNHA 3B5JA 1Z39A 1KVJA 3WRYC 2G09A 1DWOA 3H13A 4IXNA 4IRCA 3A6LA 2XYPA 1JWBB 5I5GA 1Q92A 1BH2A 1VCHA 2DGTA 3IAM6 2J0QA 1LXJA 4L0DA 3PG9A 2CJWB 1UZAA 1KDVA 1HWIA 4WADA 4ARVA 1Z28A 1CYEA 3IWXA 3M6LA 3V1LA 2C4UA 3GLIA 1T8SA 3KPWA 4JI6F 5CXTA 1X38A 4OM8A 1KTVA 3N8IA 3L77A 2ORWA 4GVLA 4RTKA 3AESA 4D25A 1I7NA 3ZWDA 5TS2A 2HHJA 1AGRA 1IUNA 3E51A 4CLOB 1MA0A 3ZVLA 3OQHA 1JJAA 1II8B 2IW1A 3Q8MA 4DCPA 5CLIA 3W8RA 1WXDA 1QHGA 2AI3A 2QTNA 4N3CA 3ZOKA 4E5SA 4OU5A 2N7CA 2IDMA 4ITUA 3GE9A 2ON6A 2Y1WA 3CUWA 1EVEA 2O2JA 4JJEA 4LC0A 3MOZA 2YIJA 5JAPA 1BX3A 3CO5A 3PGKA 4KY3A 3ESYA 1I3LA 1D6JA 1NFRA 1VGQA 4A10A 2ZI5A 1NK6A 4UOFA 4WZBB 2E89A 2CCGA 3VDXA 5CT8A 5M3BA 4JCOA 2DPGA 2EFPA 2BBEA 3HA5A 1S2MA 2G6TA 4X4PA 4FWBA 4H7KA 3GT3A 5CVJA 1XVUA 3GCWA 1OD6A 3Q9UA 5CYJA 4K6FA 2GKSA 3EZ6A 2PMWB 5SZIA 4I3HA 5CFRA 1XPRA 2X0DA 2B2CA 3BH6A 2HDOA 2Q5LA 4WE1A 3MPUA 3PIOQ 4RBNA 2HJRA 1TK2A 1OUMA 4L76A 1AB5A 2FLOA 1MX1A