3L7OA

Crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
221
Chain Sequence
EELKKIAGVRAAQYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGLQVIGVTTSSRTTAQAQALGIPLKSIDEVDSVDVTVDGADEVDPNFNGIKGGGGALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREFEKKGYKPSFREYDGVRFVTDMKNFIIDLDLGSIPDPIAFGNMLDHQVGVVEHGLFNGMVNRVIVAGVRILEANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribose-5-phosphate isomerase A from streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l7oA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7oA01
2RQKA 1LKZA 4R7TA 3IXQA 3EB9A 2J0XA 3DDNA 4IO1A 1FSFA 2I9SA 1XTZA 3TUJC 2JOQA 3MTJA 1LK7A 1NE7A 2CDQA 2DTJA 2PA3A 4OQPA 2RE1A 4GMKA 2J0WA 4PWUA 3HHEA 2BKXA 2OKGA 2H9ZA 3E7FA 1RWUA 4OQQA 3OC6A 1YGYA 2QMXA 2QRRA 3BXGA 1UJ5A 3S1TA 5T41A 3BXHA 2LQJA 3OFHA 1U8SA 2MDAA 1PSDA 2F1FA 2ZHOA 3DHWC 2JHEA 4NMLA 2QSWA 1PBTA 1M0SA 3BXFA 2R5FA 2PC6A 1FRZA 1Y89A 3NRBA 4M8LA 1VL1A 3BXEA 3OBIA 3LOUA 3KV1A 3AB2B 1ZPVA 3AAWB 4GO1A 5FIIA 3U7JA 1CD5A 2KO1A 2LVWA 3W7BA 3KWMA 1KS2A 3K5PA 1Y7PA 3TUZC 3TUIC 4L51A 1HORA 3AB4B 2RI0A 3NZEA 2BKVA 3CH7A 2DT9A 1FS6A 2RQMA 1O8BA 1JT9A 3ENQA 3P96A 4L5JA 5JJBA 5IT0A 1LK5A 1DEAA 3OFEA 3IBWA 4TM7A 3MWBA 4L4ZA 3O1LA 1SC6A 3UW1A 3L7OA 4L5IA 2F8MA 3ENVA 2W48A 3CEDA 5IT4A 2FGCA 2GNPA 3HN6A 4L4YA 4L50A 4GO7X 1FQOA 3N0VA 3OFFA 4LUBA 3LUYA 3OFGA 3TX2A 1YBAA 4R9NA 3EFBA 2QMWA 2RI1A 2P9GA 4GO5X 2P9EA 1UJ4A 3CSSA 3DC2A 4X84A 3E15A 3ICOA 2J0EA 2NYIA 3DHXA 2WU1A 5HJ5A 3ENWA 3LHIA 2P9CA 3MAHA 5IS2A 3LWDA 2O0MA 1UJ6A 3NWPA 4TM8A 1FS5A 1HOTA
chains in the Genus database with same CATH superfamily
2JH8A 4MGYR 4X8LA 9LDBA 1VC2A 4M9UA 4A27A 5IJZA 4U6PA 3NETA 4KO4S 3T3HA 1WC1A 1EP9A 2A2CA 4HN4B 1RBAA 1WA5A 2K5UA 4I3FA 4N8SA 2HMAA 3KVRA 2VLIA 2V34A 2OZEA 4TWIA 2VDJA 5A3SA 2BH9A 4PAWA 1XTKA 3M2PA 5ILOA 4JODA 1PSZA 1VZ2A 1I1GA 3HJFA 4ZC1A 4U9RA 3AJAA 4HGZA 3VVLA 2OQRA 2YTZA 5B1DA 1WZ2A 1JPVA 1P19A 2WYVA 3MINB 1FQKA 1JI0A 4MVJM 1UKZA 3AERA 1L9XA 3Q4GA 4RLQA 1YKFA 2CJXA 1RTHA 1N7IA 3IOCA 4PHHA 1RLCL 3UV3A 4BV8A 3OVSA 1S4EA 2XR1A 3DVSX 1HWUA 3TRKA 2MQMA 4UOGA 4DV2F 3EXIA 1L1RA 1SXJC 4EEXA 1F48A 4BFSA 3KSZO 4ZVQA 5KAMA 5BWCA 2W8BB 2J48A 1TZKA 3RFUA 3DL4A 1DRJA 4YT5A 1DWPA 2I6UA 1X87A 2D4HA 2VG5A 2IYVA 1KSPA 2OD6A 5BMVF 2VJYA 2NU9B 3GLUA 3KOMA 4E09A 2VF4X 4GVXA 3TUPA 5I9NA 1FRFS 3VX3A 1S0MA 3J81k 3DZGA 3BB4A 3K32A 2ZUGA 2O7NA 1ZC3A 2QZSA 4D0GA 5DLGA 4FYWA 3IP8A 1F14A 4WBFA 1KR2A 1XFDA 3KG4A 4CKCA 3P8ZA 1KH1A 3IHTA 3MJHA 4ZXFA 1K4KA 4OKNA 3QVGA 4UZCA 5EMMA 2FVXA 5HFNA 1WCXA 3MS2A 4HDGA 1DC3A 4HFJA 4XARA 5E0OA 3NTUA 4PSDA 2UUAJ 4ZVOB 4C3LA 5AXLA 1PT5A 5HK9A 1PK9A 3W64A 3LQVA 2ISQA 4FGSA 2CWKA 3EEOA 5KDDA 1P2DA 1W4BA 2IUEA 2AFIA 1ZESA 3KTQA 3HNOA 1ADGA 4V03A 4FGLA 4WT7A 3P32A 2Y1GA 2WZQA 1JLBB 3DBRA 3PXUA 2AMFA 2LIVA 3R9LA 4QU6A 5E33A 2CGEA 4AF6A 5E9WA 1VIAA 2JRLA 5LJ3Y 2GCFA 5I7EA 2HCTA 3QLTA 2ZUUA 4PLWA 2X0NA 1TIBA 1DBRA 2R7LA 1H72C 4JNKA 4E6EA 2IUUA 2QUJA 1U48A 4Y28C 2C8JA 4DBVO 2YXNA 3WYFA 2J9FB 3GWGA 4I55A 2RD5C 2VFVA 1LDYA 1MNEA 2VG6A 3S4YA 1IIRA 2A57A 2R7XA 2EYUA 5M29A 3CSUA 4KZKA 1JG6A 1BXRA 4C3VA 2O8BB 4BECA 1JLHA 2PRIA 1UJ4A 3D8HA 5ALHA 3REOA 1P75A 4L3NA 3S28A 4UBKA 1SCUB 3ZKWA 5EJ7A 1YVEI 1HBUA 3IODA 1RCXB 1OAOC 3L7AA 1IB6A 2QRJA 3BKXA 1UKEA 2NQ2C 2H48A 2B1RA 3BTVA 5ETLA 1LWEB 4NMLA 3RE1A 2ZU6A 1G6Q1 3B9PA 1DIGA 3HVAA 4I69A 3BSAA 1W48A 4LFCB 2H1VA 2UVVA 1W5AA 3BB1A 5BN4B 4AQDA 1D4OA 3SDEA 1M6WA 3ABIA 2QD4A 4GKAA 4HJXA 3MBIA 1EDEA 1WKKA 4IIJA 1UBEA 4KFSA 4OLAA 2KW5A 1M5KC 4HPXB 3FNBA 4LC9A 2WWFA 3ILSA 5IT0A 4HS4A 2OV2A 3KMQA 3JSXA 3ZHYA 4C4ZA 2WK4A 2FMHA 2HNAA 2HH9A 2IHBA 3KK2B 1U63A 3L7YA 3RC7A 4BQEA 3WO1A 2A6MA 2F9JA 3OFGA 3DFEA 4DU8A 1FUEA 3A3YA 4X66F 4QM6A 2DFTA 1KVJA 4EELA 5HQLA 4RU2A 3ILHA 1R8YA 4DR4B 5H3LA 5I01A 4XB1A 4KOAA 3OFNA 2ANCA 2FPPB 4NJOA 2XCTB 4RX6A 1YHYA 4OQZA 1ECCA 4A8PA 7YASA 4HI0E 4GGPA 1W44A 1P1FA 5LM7E 2BJ9A 5CD9A 3GWCA 1TVRA 3LP2B 2YBEA 3PUJA 4W5QA 3TIFA 3E3LA 3W1YC 1T2EA 2KJWA 4R69A 2BBEA 3EVTA 3INYA 4DT1B 1ZAXA 1L7QA 3LUCA 3RIHA 3W0LB 1MIOA 4YRAA 4I1VA 4CTAA 2DH5A 2FMKA 2Q41A 3DMTA 3CUEF 4YJ2B 4I81A 3O8QA 4GKBA 5TDHA 3OFEA 1YC2A 3PX2A 3AR5A 3MLAA 2EXXA 2DWPA 2YMQA 1MZPA 3MELA 4DL3A 1OWPA 5KOHB 2HJGA 3Q8WA 3U17A 2JGKA 3NGRA 2WAXA 1ACJA 1LLQA 3LP6A 2YWDA 2GF0A 1DX4A 4WINA 4RPLA 3TW8B 3OJEA 2R6FA 2XD9A 4DG9A 3RKRA 4EHHA 1P6UA 4G63A 1V41E 2RF2A 1XZ8A 4BRZA 2NADA 3HSZA 1ODJA 4J07A 3FDJA 1NR1A 4TTQA 5JNWA 3RW9A 3KU1A 3DMRA 1IUJA 2P5UA 1AJEA 3OM8A 4OHMA 3D0KA 3QBTA 1KIMA 2O67A 3EGNA 1QKKA 1ZFNA 1XBWA 4HDNB 3MB8A 1MMLA 2NO5A 3PHCA 1G6OA 4V1CA 4NRDA 3RRBA 2WAQD 5DNDA 1C50A 2XT9A 3RT7A 5HMMA 2HFVA 3HBMA 2G1KA 1A4RA 3WYAA 3NOVA 1FA9A 4N8OA 5CFMA 2JI9A 3WWEA 1Y5NA 4QULA 2NLOA 4FFDA 4J6EA 4ZVSB 1C4AA 2BF7A 3PX7A 2FSVA 3CKKA 4ECVA 2W4MA 4K8OA 2VDQB 4OV6A 4WFQA 1R88A 1QIMA 2EJTA 4PGMA 2IM0A 3GFHA 1K8XB 1MXFA 1EJ7L 5TS3A 1A97A 1U1KA 2N75A 2Y93A 4YRCA 1X0PA 1P8AA 4D4IA 1RQ0A 1TMJA 3OICA 3PHGA 3EEIA 4C87A 2BGLA 3UK6A 4B4UA 1E3QA 4GM0A 5ALVA 3OAAA 4RPKA 4TLBA 2BTOA 1DDIA 4B3GA 2TS1A 3AOEA 2OLWA 2A30A 3HYSA 4NCAA 4YPVA 4J0DA 4XPIB 4JP2A 2Q21A 2IAJA 3BGOP 5EEGA 1RM4A 4HLUC 1K6EA 1P33A 3R8YA 4IOMA 4UNQA 5JE8A 5AVZA 3ZIAD 5JW6A 1WSDA 1HDZA 1WI8A 1HT1E 2P9TA 1Q83A 4A6EA 4DSFA 1C9MA 2CL0X 1WF1A 1SC1B 2RCNA 3R6LB 1G7TA 2WRZA 5MF6A 1ZM3A 3HFVA 1YDWA 1RQ2A 2IHZA 5DSZA 1S7IA 3O2IA 2R85A 2DR2A 2HZAA 2CQ0A 1BFDA 2HRTA 1Y34E 3BIFA 3OXLA 1FQOA 1K92A 4D3YA 5A0VA 1LDEA 4N48A 3P2KA 1PG0A 2VIIA 3R2JA 3PXGA 3QVKA 5EMKA 2J67A 3WP1B 3EDMA 3VYVA 3TNJA 1XVIA 1CZNA 4U7UK 4QJ5A 2X22A 4IO1A 1PFQA 3LW7A 2HAIA 4FHEA 3MWDB 2EKNA 1G3UA 3K0CA 4CYMA 2IVFA 1IOLA 2B0GA 4ZA2A 1ISPA 2W8ZA 2EBFX 5JO0A 5A8WB 3E7FA 2LXFA 3DOCA 1ECBA 4KIFA 1DBVO 3IS3A 4HLUA 3LTOA 3FCOA 1BWQA 5DGIA 1NQVA 3GJRA 4KDFA 2IC3B 2P2CA 4BXOA 4OHZA 1N3YA 3EGWA 2EERA 1Z5OA 4PLZA 2M70A 4BLPA 2XCPA 1S6PA 5A4KA 2GZRA 4C03A 4N5HX 3K5PA 3AVOA 4LSMA 2IV7A 3QWHA 3HV2A 5H5JA 4RENA 3AF3A 4W9NA 2NU7A 2F9DA 1AGYA 2FX5A 3OCJA 2GR9A 2ECKA 1ZS9A 1FT8A 2CA9A 3WX4A 2R7NA 3W7AA 4PQYA 1T5TA 3UFBA 3IT3A 3JD2A 2CJFA 1Q0SA 2A2ZA 3PT9A 1K97A 1SCBA 1ZRHA 2IPNA 4A8JC 4UJ3A 5C46F 4CT8A 5JDCC 3U7RA 3UD4P 3KVVA 3TMKA 2B78A 1JR3A 2AXQA 1Z0FA 3LCRA 4IOBA 2A0FB 1E32A 5IX8A 2A67A 1N34J 2Q43A 1FD8A 3LAMA 3SJ7A 2BW2A 4BNIA 3KLVA 2HZVA 2OY0A 2II6A 3J81A 5K14B 2ZANA 5LSAA 2ILVA 4L7QA 4POAA 1D5CA 2IHKA 2IGTA 3U4HA 4Z3DA 1KVRA 3DKPA 1M2FA 1NVBA 1I24A 3D1LA 3IAM6 3NTQA 1UMBA 3PDIA 2BMDA 3M1AA 1CC7A 4CCAA 4EUEA 7ADHA 2VJUA 5F23A 5BWOA 5A8WA 4AY6A 2ZM6F 3OBIA 4ISBA 3EGZA 5KX5A 4K6OA 3R9KA 5DBEX 1W49A 1FRQA 3JQ7A 3O1IC 4H17A 1VLZA 4ARVA 1ABFA 4UUXA 5U47A 1L3SA 4JJGA 4K1XA 1URRA 4ITRC 1T91A 1HDYA 1LTHR 1OX4A 3BJZA 4CM5A 2I6TA 4Y9TA 4EG6A 2C42A 1PWZA 5DDQC 5HQMA 4RW9A 5H16A 4I2QB 1MW9X 2ZWAA 2XF8A 3C3LA 1SXJA 1DKPA 1ETUA 2IDEA 4BFZA 4JY7A 1XP8A 4I9FA 3GROA 5KJ6A 3MMNA 3LVRE 1B0ZA 2VO1A 4U00A 3A6PC 3HBFA 3GEMA 2JI4A 1TM2A 4LF4F 2OK7A 3RAQA 5AVYA 3RVDA 4PBTA 5JMWA 5K0CA 2RQKA 2X7IA 1N0IA 3DXBA 1I4LD 3MXHP 1OA1A 3BE4A 2IX3A 2B4QA 3DOUA 3OSPA 5IM4F 4Y34A 3VC7A 2O5CA 3P5BP 3ONDA 2EZUA 1UDWA 3I2GA 1BJKA 4ECSA 4U2DA 3MQ4A 5THWA 5FQOA 3KV3O 1YOVB 1GTVA 1Z17A 1CU1A 4XEHA 1BQ3A 4FXPA 5KQSA 2Q2WA 1T24A 3M6VA 1UJBA 4E14A 3MSXA 1N32F 2OA0A 2W8LA 2H9IA 2C4NA 4JWKA 3CC7S 4UPEA 4KX5A 4AYWA 1TU0B 4D9FA 3EE3A 4TMYA 1QX3A 3JALA 2OAEA 1I2CA 1H73A 4AO7A 1RWKB 2ERXA 1ZIXA 3IBGA 1P1RA 3MAJA 3ADDA 2LUOA 4IEFB 3W5YA 1J5PA 1UJ2A 2A9QA 3G5MA 4IHAA 1EXNA 1SUPA 3D7LA 1QIEA 2Q0QA 2AJTA 1ORRA 1BUXA 5K03A 4WY8A 1YK1A 1BMQA 4LF9J 4BP9A 2QA2A 4O02B 5FOUA 4F6CA 1EFHA 4H1UA 3WGTA 2QE6A 1WTFA 5LQUA 1VKHA 2ICAA 2P2LA 3I6BA 5FWYA 2WSFC 4LC0A 3PJFA 1XLUA 2BDUA 3V1YA 3SYRA 2RRBA 3L95X 4JJKA 5DMXA 2OZLA 2ZOFA 1SVMA 1SN7A 4C5CA 1ITPA 2D1RA 3FTCA 2N82B 4MSUA 1DQ9A 4B3JA 4B48A 1NQOA 1C30B 2IXAA 2DCUB 1ZYQA 1JNYA 4BTEA 3O8OA 2J87A 1M2VB 2YNHB 3AFGA 2GLTA 1A5TA 1E77A 2ZS8A 3PJDA 4TMKA 2FSIA 4J0GA 4EPVA 2Y8YA 1JHMA 3KKMA 3DG9A 5D0HA 3KQWA 4IDHA 4F4CA 1CR6A 4QDKA 1UWBB 2OUGA 3OFSA 2I62A 3QFCA 4QT0A 3WGNA 3ZWCA 5FEUA 3FEZA 4EGAA 2OM6A 2WR8A 4JYMA 1KEZA 1J5EJ 3CNNA 4JVLA 1X1BA 2OD7A 2PSZA 2DUMA 5KYUA 3AY3A 1MV8A 4PO1A 2O1EA 1P1LA 2ODAA 4QO8A 4ZHQF 3GLHE 1SXJD 1RT2A 2NO4A 4F3RA 2ZUFA 3W8PA 2OZVA 2EW9A 2H4ZA 3DLEA 3MT8A 1ZK4A 2GOYA 2KT3A 1RA6A 2QP3A 1ST2A 2DIVA 2B1JA 5A71A 1FFXB 5GM2A 4PEOA 2UVRA 3MUTP 3K70D 4MLDA 4U8GA 4EYIB 4JCOA 3T4UA 5ER9A 5KG1A 1F12A 1JJ2R 2UVPA 2DQYA 3LLSA 2HK6A 1ODLA 1SC9A 3E3NA 4QPDA 5SZKB 4D9BA 4LYJA 4W5WA 1MU2A 3LP8A 1TVCA 3BMQA 2QA4G 1WC5A 2YCLA 1E1CB 1AROP 4L3VA 4KRFA 2PRYA 1FFGB 5KFDA 3Q98A 1YRTA 1WF2A 4J7CA 2PD6A 2HDHA 2WU1A 1RLUA 1E0KA 1KD1T 4MYDA 4O4LB 1THMA 1Y6RA 5CCEA 1WZNA 2F8HA 2NWQA 2DB1A 4DKJA 4CKXA 3E5HA 4OK3A 4ND2A 3E18A 3UK2A 3CCTA 3CB4A 2ZKLA 4WCFC 1MGPA 2HMSA 4KWIA 2PI4A 4PO9A 4OMFG 4ZA1A 3HKWA 1Y9ZA 3BVPA 2FN7A 1BGWA 1DEXA 1AUSL 3C3JA 3KXLA 3KJIA 4M5HA 4KIGA 2RIJA 2YTCA 4HPJB 4G41A 1UWCA 4RXTA 3ZWAA 2B6AB 3GMSA 4CF5A 5LU8A 3GR1A 3UMVA 4H0NA 4NBTA 4M1KA 3DS8A 2A5GA 4CM3A 3QIVA 3HVWA 4K0KB 4EVRA 3ZZ1A 4JLBA 2BP7A 1M1XB 1R0XA 1GXSB 3ONEA 2H1OA 2GIFA 1QFJA 3LE8A 4E12A 4D0LB 5GAGI 2RBKA 1H6AA 3K0JA 4L9WA 5JXSA 2ZJQQ 4ZVHA 2AYBA 3DWIA 3ADAC 1RQ7A 3UA4A 3WLAA 2VAXA 1UA0A 1II8B 2EX1A 3R6TA 4EFNA 4AP6A 5H9WA 3FPGA 1KY5A 4KXFB 3E1GA 5GV8A 2O57A 2HAEA 3FMWA 1TQ6A 2J3QA 4HZGA 3GJYA 4BFTA 4OI0A 3A26A 4BE9A 2WTXA 3Q9NA 1Y42X 3CULA 1IBSA 1U1FA 3ZCTA 1Z6AA 5MHTA 4GZ5A 4O4LA 3HYTA 3GUCA 3OY7A 4XQGA 2PM8A 4D4LA 4OQXA 5B36A 1UP7A 3UZUA 5IPFA 3SHTA 4NLVA 5HKKD 3COPA 3MAAC 3SC3A 1HYBA 1H2TZ 1MW8X 3OIVA 4JT4A 4MITA 2JAHA 1T03B 1E1DA 1AIPA 1MA3A 3ICCA 3B4MA 4ANFA 4M1TA 1W2HA 2A6PA 3NHZA 1RAJA 3BKFA 3O94A 3QFRA 3ETCA 4A2QA 5HROA 1T9GS 4DUYJ 5J2TB 5ECGC 3C7KA 3G5TA 1O97C 1CQWA 1EQ0A 4DYDA 3MUOA 1FXLA 4LXTA 2P5YA 4QRIA 1G4AE 4O1MA 1XN4A 3I8SA 4PS1A 3HSSA 3RFTA 5NULA 5KG3A 4HP8A 3I73A 3TZ6A 4QU5A 1X1QA 3F49S 4ND5A 1KOLA 4D92A 4CMIB 1PILA 4B6FA 2XQKA 1L7EA 1NATA 5LT5A 1GAWA 3VNBA 1NSYA 4UQPA 4KH1B 1H4TA 2VHZA 1M10A 2C2MB 1ZOLA 2W2PA 2AQIA 4XAQA 1UXKA 1B0UA 2V7PA 3OJCA 5CVVA 1Q1KA 1NW8A 1R27B 4OKIA 2D7DA 2HYIC 2PT0A 1QH9A 5K09A 2A5YB 2RGGA 4O4JF 2ZM6B 4FQ8A 2BI4A 1E7SA 4KMOA 4G8DA 4X9XA 5C1DA 4ZCTA 3BBBA 1CUDA 4PUOA 1RXUA 5ULLA 4P84A 2BH2A 4H3HB 3CZRA 3WC4A 2BFFB 2D13A 3UPUA 1IJEB 3IRUA 1SCUA 1YQXA 3DGFC 3FXAA 4NZ6A 5CB6A 1T8TA 3E9MA 1SRRA 3G2LA 3L7NA 1RAOA 1R8JA 1TC1A 5IC5A 4L6AA 4HZUA 3UENA 4LDQA 3KT8A 3DH0A 4DFDA 3OTEA 1QHNA 2L42A 3CUVA 4PO3X 4ZYLA 2KQUA 4KNVA 4RPGA 5CZXA 2DZDA 2PWZA 3U26A 1HW8A 2H52A 5G41A 1JUDA 3DFMA 1ACMA 3AKCA 1RKIA 4DCSA 4DQVA 4II3A 4F92B 4Q4DA 3QA9A 4N7BA 1MPTA 2FWBA 4K2XA 5HLFA 3LF2A 3H5LA 4X61A 3P8BB 4UNIA 3F0NA 1TEVA 3QW2A 5FI0B 3ZS8A 4S1WA 4JI1J 1TM3E 4M0LA 4ISCA 4TRJA 3DWGA 1O3YA 4P6VF 4DY4A 3KK2A 1SU7A 1QO0D 5EKXA 1Z83A 3EOBI 1DAFA 3SLKA 3D8UA 2XDYA 2NU7B 3BN7A 4NRUA 1H2WA 2G77B 4IJ5A 5D86A 4WKNA 1D0VA 1OIAA 1E8NA 3GNSA 3K96A 1PL7A 3RYTC 1U8YA 2LE0A 4DR1J 1OB5A 3ZCVA 4FSXA 2QRLA 3IUNA 3DLGA 3D7SA 3WV5A 1XJCA 2HWYA 1GGHA 1ORIA 2WJ3A 3MAHA 4U5XA 4UEKA 4EFLA 4MV5A 1AS0A 1ZW1A 2OBNA 3LXRA 3NX4A 5HR5A 3D3KA 4A8HA 1XU4A 1FDUA 2RVJA 5A9SA 4P0TA 4Y9DA 1QIIA 2IYUA 4IDBA 2VNIA 4CT9A 4JIMA 3D2BA 5HQJA 4LJSA 3VH2A 2ZRAA 3BIWA 1PKUA 3GPAA 1RADB 5A2QY 4PCUA 5IWCA 1EWTA 3OE4A 1K7FB 4M4SA 3A12A 2XKAA 3UN5A 1AXQA 1URNA 5F77A 5BV7A 2IOYA 1EX6A 4D3FA 1W581 3BFPA 3TAQA 2QV7A 3A1VA 3MLEA 3VKFA 3ET6A 4CLLA 3TW4A 5FFFA 5DI3B 1IN6A 4OYIA 2C9MA 2PUBA 1SU4A 4PHFA 1KVIA 3EVMA 3CIOA 2GVZB 3BQ0A 3DGEC 3N6XA 1VK8A 3KJGA 1HBJA 2JFQA 1UUFA 1RWVA 4Z7QB 3RYCA 1Y8RA 4Z4QA 5BN1A 2CV2A 2WFLA 1R6AA 4R0VA 3CLTC 4DY6A 4NARA 3QT7A 1KOOA 4FEEA 3CCFA 1O9HA 2FZVA 5CH5A 3B89A 1UEUA 4JJ7A 3H11B 4J90A 4PQUA 1KPHA 3ZD8A 4TYAA 4X6XA 2QRRA 4OB6A 3ER6A 2ROGA 4YFYA 3M82A 3C2PA 2JI8A 1DDGA 5BQPA 4OYMA 3P6YC 3RNLA 4YROA 4I4LA 3UJ8A 1XDZA 4MUKA 4ZEMA 3DFKA 1Y89A 1R1DA 5I48A 2Y9MB 5K20B 4ZVUA 5SYNA 2NLWA 4JI4F 4QYIA 4P80A 5FT9A 2JCVA 3IS9B 5DYWA 2VH1A 5B37A 5D4OA 5DM60 3AY7A 4X65B 2AP6A 3KYIB 1QAIA 4W1PA 3HP1A 4MDHA 3B5EA 1WU7A 1E2DA 2E5WA 2SCUA 3G6VA 2ATEA 1S9HA 4TGLA 4UZEA 1OFUX 2JZCA 4QVKA 3MMAB 1Z38A 3V4LA 5BN5B 3SMZA 4G2TA 2IJFA 3DAFA 4CN9A 1VMEA 1JIKA 2P9GA 1JR3D 1IN0A 3QYAA 5LJIA 4HBGA 1T0JB 3HC7A 1PR2A 1YE3A 1UJ6A 4XDZA 3GYNA 4IH7A 3Q0TA 4L74A 2UUWA 2BHSA 2H8GA 2Z30B 5M7EA 4H54A 4F4YA 1AGNA 3O3CA 2V98A 3GRFA 1F38A 5E1BA 2QJRA 1WDDA 2VSNA 2Z4SA 2C88A 2GSWA 1VKRA 2R8ZA 4IY1A 3L01A 3L93A 4RSGA 4N41A 3A6LA 2JK0A 2EZ8A 3IPYA 3QJ5A 1GYPA 1TK8A 3MMPA 5FPKA 1NVXQ 1G8FA 1U2EA 1VPEA 3AJEA 4YY3B 3HVRA 4EHAA 1A2BA 2AN3A 4FYXB 4XX0B 2R7OA 3PNKA 4HR2A 3LUKA 5DLEA 5JADA 4XIIA 4MA5A 3HD1A 3PRKE 3A6DA 1OOEA 3UEOA 4FKYA 1ZOPA 3L8GA 1KO4A 1FUIA 2GNOA 2ONZA 4BN4A 1NI4B 2NZXA 2YWHA 2BJWA 3IURA 3IVMA 5C5CA 1M1YA 4HYKA 2O5DA 1UT8A 2VWHA 4QUAA 1SVOA 2YV2A 4FUTA 2GK4A 4N4AA 6REQA 1HE2A 4FGJA 4TV9A 3U4IA 2A9RA 4N77A 4KUGA 4CDIA 4QPZA 1R9JA 4D5GA 4ZV7A 3NTXA 1B8UA 1SB8A 1W76A 3KUEA 2XMBA 2B4PA 2QIOA 2ZHAA 3P9ZA 3I05A 4TTIA 2A58A 3PC6A 3HJHA 1HWJA 3W2VA 1OZ0A 4PXSA 1RWPA 3FYSA 3FHJA 5EKSA 1YKWA 3FKQA 3PLNA 4FLFA 4GKKB 5LXTF 2B9EA 3I5XA 3T95A 4K6MA 4PO8A 4NXMF 3NGMA 5FPPA 3IGNA 4OI1A 1P0QA 3I6PA 4E0BA 1A2KC 5TE9A 1Y3JA 2JIZD 2AA3A 5G0WA 1HZZC 2F1OA 3JQAD 5I45A 2CXEA 5L6LB 5F76A 2V8PA 5E4YA 2AG1A 3EVBA 4C7QA 1SVNA 4KYIB 4B47A 1IY1A 4L3OA 3MTIA 1C4XA 2C2YA 4DPUA 3FFAA 3UQZA 2C07A 4UOHA 3CSSA 3IIKA 4HFMA 3V4ZA 4HWTA 2QPTA 4NCKA 4DBQA 4UVGA 4EEZA 3O5TB 1MEOA 3L7DA 3I6YA 2U2FA 2JJ8A 4C1BA 5JWHA 5DISB 4HACA 2QTNA 5AIAA 3VR3D 4G67A 3E7PA 3ORRA 4JXXA 4PR6A 1EKRA 2X6QA 2CD7A 2HEIA 1FEHA 3OC6A 4XDDA 3ZK8A 4TV9B 1S72S 2R2GA 3KUDA 3HJRA 4X93A 3NM6B 3D7RA 4LRCA 2QX8A 2PLFA 2NXCA 2KT2A 1NNLA 1B0PA 1H3EA 3PQEA 4YGXB 1CUCA 1ZVKA 2ID9A 1CEEA 2BE2B 5G3YA 3ICEA 5FWYB 3MM6A 3IAFA 4JU8A 3MJSA 2HFJA 3TWZA 4Y65A 2JBAB 3K6KA 4C3ZA 4OV6B 5E3PA 1XZJA 4YAFA 2C03A 3N59A 3X1JA 5F9FA 1F5NA 2FW6A 4BPRA 1PJBA 4UBJA 3BGLA 1MXHA 4QYSA 3VZIA 1WEYA 4CM6A 2CNLA 5LZ2A 3BD6A 4FBLA 1RAHA 1T5IA 1N77A 4G4IA 2TYSB 4HAVA 1G7SA 2AUTA 2QORA 4P32A 3FSGD 1N75A 3A9CA 2H3EB 4BO6A 1XQVA 1EFPB 1OV6A 4GH5A 5KYYB 2QJTA 4DV4J 2HNBA 5C2JB 1KYTA 3ZIUA 3EXYA 3ABRB 4GDFA 4BNTA 2SICE 4LNUA 1EP1B 4KRXA 2ZTMA 1TZCA 5DP2A 2WVEA 1JLFB 1ZK2A 1LX7A 2QAGB 4J9SA 1I4DD 2X8JB 3ZVLA 1VFJA 1UBUS 5H80A 4CL3A 1KZ9A 1I5EA 2V5HG 3R7SA 1VQ6S 2ZR7A 4AD8A 2H5JA 1X1RA 3GA5A 1LPOA 1GQEA 1CZUA 1AHPA 2J76E 1E2FA 2HCBA 3B2NA 1DADA 5U9CA 4EB0A 4WZQA 3BDIA 4CM7A 4Q18A 3W6PA 2F90A 3TZLA 3KYDB 4NMXB 4PVCA 1FNMA 3GCDA 5IKXA 5TEWA 4EWLA 4DDUA 3KB6A 3OQ1A 1NLFA 4CTAB 2QTLA 2WJAA 2NSBA 3E7DA 2PUEA 4Y1EA 3CMCO 1H2ZA 1I1OA 4YWHA 4KFRA 3EX7C 4NABA 4ZCQA 2XO6A 3R5CA 1VG9B 1LF0A 1RHJB 2N42A 4ED8A 1LB1B 1T5DX 3OZRA 2CE7A 1OH5A 4KH1A 3WAGA 2VASA 4I68A 2MKSA 2IU3A 2KRBA 3SV3A 2B4TO 4CLDA 1NXTA 5CXTA 4UQGA 1FP4B 2BFNA 2GHPA 2XQJA 2OLJA 1CR0A 1VK3A 4A4DA 1JXEA 2HV8A 2K7FA 3BQ1A 4N0EA 1U3CA 3WL6A 3IGVA 1IHXA 4FXVA 4LXQA 3NL0A 2ASYA 1IMOA 1FKPA 3SJCA 1EK1A 1CS4C 5JXWA 1WX1A 1TRHA 4MROA 1BHJA 5KC8A 1BE1A 1DNPA 4RY0A 3FBBA 1FBTA 3C7CB 2OT3B 2DNKA 1E3EA 1YRUA 1JN0A 4C88A 4HNRA 3NBPA 2XZTB 5EHIA 3CE6A 1ZWKA 1J2VA 3OJXA 1A5ZA 1SBYA 1NXXA 1LW0B 4ELTA 4BC9A 4OBEA 4R8UB 3EFEA 4MCJA 4GLJA 3KD3A 4JUCA 2HQRA 4ELUA 1CB7A 2DM6A 3ELYA 5KTPA 2DH7A 1X9MA 1STOA 3R41A 1OSCA 1TELA 1KI8A 3TTXA 4IH1A 4F6LA 5DT9A 2K1RA 4R5PB 5JI2E 1LTKA 5JSUA 4RD6A 2YC4C 1OFTA 2RHGB 1VQYA 2AWZA 3LFHA 3JYQA 3WL7A 2V74B 2XUFA 4FOOA 1XTPA 5D6NA 1DTWB 2OCLA 1VCOA 1AV7A 4EBFA 3HB5X 2AT1B 3C41J 3H9EO 2GC8A 4PZLA 2ADMA 1U0SA 1AB6A 4CI0B 2PBFA 2QVZX 3ZYCA 1N0VC 4ZDJA 2B9WA 4OI3A 3PEHA 1EJ6A 5AK6A 4ZOAA 2JIRA 4KLAA 5AVJA 2IOFA 3LXXA 1QP4A 3DT6A 4KO2S 4LZWA 1FVFA 5IMBA 4EBCA 5LZ7A 3DP9A 1RJDA 4JUIA 2YOGA 1OD6A 1EBUA 2B4UA 1GTHA 4J3NA 3DLHA 1KFCB 1L7AA 2CZ4A 1XTQA 5B55A 2GJ2A 3FGPA 5IV4A 4JC0A 5K8TA 4G84A 3ZDBA 5ETKA 2VYCA 2BRKA 1GMWD 2RJZA 4HUQA 2ZW9A 3FOZA 1UJ5A 1NLMA 1UAYA 2OQVA 5D5QA 3CDUA 4DILA 4OXRA 4LAFA 4IZOA 4ED3A 3VAZA 2VBYA 4S1NA 2GMLA 1SKAA 1L5YA 1LWFB 1D4AA 3Q1LA 4GBMA 2ISSD 4LVOP 3GR6A 4F67A 3UA3A 3QWIA 3VR6H 1WULS 2F1HA 2ZSAA 2IM2A 2XVYA 1PJ6A 2Z5LA 3T9AA 2LD4A 1AA6A 1Q1GA 2Q0SA 2W7TA 4A82A 4MIWA 3R3JA 3E0XA 2P9JA 1E6KA 5LB2A 3UUWA 2W4IA 4IGKA 4YOEA 4ILLA 4YI3A 4KQIA 1NK9A 3CEJA 3LP1A 2ZYWX 1PZGA 1Q22A 5AK5A 3ZHTA 4WX2B 2NSHA 3ZGOA 1YG0A 2VA9A 3VPFA 1H6KX 3EGEA 1W35A 3RANA 3DDWA 2HW8A 1QWOA 1REVA 2PXAA 1XHEA 3L7PA 3LWMA 3QYFA 4FE7A 3GLSA 4AJKA 3LU1A 4IXNA 1XTZA 3RK0A 3QKTA 4CQLA 1X1TA 3O3NB 4TUYB 3VALA 2VJMB 1OPIA 3RBVA 2DPHA 4KB7A 3O0DA 3A1EA 3WWYA 1N5VA 3L8MA 3QIPB 3SBOA 1ML3A 3B1XA 2O2DA 4DL4A 3WLHA 3U9LA 2QFIA 4ES3A 1IHDA 1KE1A 4X0EA 4ZLPA 4P38A 1WTBA 1RP1A 1S0UA 1Z5VA 4NEHB 3LRXA 4TOIA 3RWMB 4MCIA 3GRAA 4N0MA 4Q4HB 3TA1A 1WG5A 4PFQA 3FNHA 3F47A 4LBYA 1TJ5A 4BYGA 4GICA 3OQ6A 5CJPA 2WEKA 3CH5A 2CJ9A 2CNWD 1SUSA 3PNSA 1OWMA 4MLZA 4DL0C 2C5HA 1ISHA 2FKAA 2QGNA 2I1RA 3KRTA 5KVCA 1T6BY 3C3DA 5C8YB 3I0MA 3AJ2A 4LJAA 4DJ5X 2CQPA 2JG3A 2BTQA 2HCJB 4Y2RA 5ALQA 3V6HA 3RG2A 1NAQA 4E2FA 4KACA 4KO0A 2OCGA 2Q49A 2EAUA 2MZQA 2Z83A 4CLOB 3C3PA 3NYRA 1JI3A 1OB2A 4YRSA 3RC9A 1QD1A 5CFLA 4HDKB 4LF5B 3ICPA 5BMVA 4MIAA 3CVKA 3ZO7A 2FLPA 2EFNA 2DKOA 2W1BA 4ZU6X 4ND8A 2AOXA 4LRUA 1DG3A 4M6WA 3NANA 2VOJA 1OI7A 1ZSVA 3T1VA 3AF1A 4EJ2A 2FPIA 1ZYUA 3GHHA 3ZBTA 5EVJA 2AYMA 3FPJA 3THPA 1GP2A 3I6QA 3TR5A 1JLGB 1OYEA 3V6JA 2VNKA 3WSWA 3ZDRA 3CXUA 2VJMA 1R3DA 3KUXA 3DOJA 4NBNA 1XZFA 1CQPA 1WCWA 3D3EA 5F41A 3TM5A 1FBNA 2G40A 1P73A 4RAQA 2RI0A 5P8WA 4KDRA 1XCMA 5M3BA 3EF0A 1JLCB 1UK7A 2VTDA 4OA5A 1FW6A 1YB4A 4DIKA 1DLOB 4LRQA 3C3WA 1NRJB 3HFGA 5JJBA 5CFRA 4Q00A 3BG5A 4KGZA 4IYJA 3K9QO 4W1QA 1MO6A 1T5BA 3P5TL 2WONB 3F6CA 3TZCA 4KMSA 1ONOA 2Q66A 2ZVIA 4A03A 3TJAA 5LZ4A 1K86A 3NIFB 3UKJA 3W9BA 3IAHA 4NLRA 2D9OA 1KOJA 4KHMA 4DL2A 2CQ2A 1JLQB 5IWAJ 2DPLA 3JWJA 2QTCA 2L19A 4U6NA 5IEJA 2HHHB 2GZDA 4IR9A 1T6XA 5JYBA 5A1TA 2C31A 4G8BA 4ENWA 4WFYA 1JIUA 3A6JA 5IANA 2GVZA 2AGVA 1BS2A 4LF8J 4D3ZA 4PG5A 1KU6A 2DNRA 1V9CA 4FKBA 3REFA 3TOCA 4UU1A 4IUBS 3BKUA 3Q22A 2DYKA 2QYSA 4MW2A 4H31A 4X00A 2Z98A 4MR8B 4MQ5A 5BN3B 3HNPA 4GZLA 1U8EA 3FTDA 4JL5A 4HX2A 3CDAA 5CLJA 3M6UA 4NCBA 4P58A 1Y5MA 4B74A 4W82A 2JFNA 3WWDA 1T9AA 4JLOA 3H1PA 4BZZA 4W6ZA 4HWPA 5HKLA 3IC1A 3VHQA 1JFRA 5JH7A 1IUNA 3KQLA 1DIOB 1ULRA 4Q9LA 3TL6A 1UODA 4REOA 2BE7D 5K3BA 2DNPA 1R64A 3NUGA 2C2GA 5DHRA 3MSCA 4CUZA 2IXBA 4DSTA 5GZ3A 4JKIA 4N1AA 2J5RA 5G4LA 3VOBA 2FZCA 2V3WA 1NDQA 1JLQA 1DIHA 3T3OA 4NICA 2WTFA 1K5GA 2WBMA 4HEA1 1DI0A 4LTNA 3AOCA 3FBWA 1Z88A 4Z6KA 2A9VA 3EGWB 3DEHA 2ZHBA 2QMQA 2QNRA 3A1UA 4MAFA 4QPPA 1D6NA 3P27A 4DDFA 5L9NA 5FLYA 3MD1A 4FS2A 1XL0A 4PN7A 5ESWA 4HYEA 2UXBB 4DXDA 5CHYA 2GEJA 3DAOA 3WMWA 4RFLA 2I2WA 2OBFA 1SQSA 3COYA 3A3PB 4DABA 3QWAA 5EHZA 2O3SA 3HI6A 3CH7A 3MW8A 3PJGA 1SU8A 4N39A 3TAMA 2HB6A 3IUQA 3SI7A 1RJ9A 1YUBA 4IOLA 3ANNA 2HSEA 2IIVA 2W6OA 4G6ZA 4EM6A 3C6ZA 1RWWA 4D82A 4LJRA 3A6KA 2JSXA 4A91A 4I66A 5KFMA 4TS9A 2D8AA 2ODWA 3E9CA 3T5HA 3V2IA 2Y1IA 4P7GA 3FVWA 5KFGA 4YJ3F 5J47A 1XJWA 4F11A 4RUBA 2K6GA 1GEHA 3IPCA 1KQFB 5PGMA 3AEYA 4N3GA 1OROA 2SECE 3HY4A 4KOEC 3EB9A 1V43A 3I12A 3D4LA 4USVA 3BYRA 1K75A 4RPCA 5K8NA 3LQQA 2CYCA 2V63A 2GCOA 4UF4A 3LF1A 4X6UA 2QD2A 1JFSA 4N6OA 1L5WA 5B2ZA 4FSHA 3MHPA 1ZL0A 3CZQA 4EA8A 2H3HA 3R77A 4JR2A 3NDIA 5E3RA 3QHPA 5FWXA 621PA 2O8EB 1VJ0A 3MUFA 1BTOA 2NU6B 3SIPA 1XRRA 1K8RA 4I8IA 3KLMX 3ZJ5A 3TINA 2ZRFA 1XELA 1WEHA 1JKFA 3EA0A 3FB1A 4L8FA 2HHUA 1YMQA 5CPBA 1OKKD 4ZFNA 1DAOA 2WSLA 2J9DE 1FSSA 2RH8A 1MP0A 2RH9B 1GXLA 2XOXA 5LMUF 4OGKA 5K3DA 4RS3A 4ED2A 4WRRA 3OTOF 1P9NA 4NZZA 4WW0A 1H8HA 4DTIA 3KJQA 4E46A 1TM5E 3TAUA 3I55S 4IQ0A 1YI0A 1F8GA 3KJVB 3FFXA 2Z4PA 3TSWA 2WF7A 2FEPA 2WWWA 3LO8A 3E3MA 4NAHA 3G23A 4Y7CA 1EYZA 1KN6A 1WW2A 3I5BA 3I8XA 1E3IA 2PKWA 3UH0A 3UMGA 5CD4A 1J9ZA 4FC6A 1ZU4A 4ZHRB 1VMAA 2UU9B 3S29A 1O9BA 5HM6A 3FGZA 3L7UA 2JEOA 4EBBA 3HEMA 1FFSA 2OHXA 3AIKA 3W7VA 3WRXC 3CCLS 4D98A 3GJ0A 4V0RA 2IAJB 1ZK3A 2PPLA 1M0SA 1LDGA 1US8A 3MPWA 4NYZA 2IPLA 2ZXFA 5HG0A 1WHSB 3NIWA 3H2GA 3NXSA 2CSXA 4KAIA 4N3BA 2WOMA 2HA6A 2AU0A 4WIIA 2WPNA 5FJ4A 2IXTA 1E4VA 1FDWA 1IHYA 4ONEA 1FLAA 3JPWA 1KYIA 3CS3A 3NP7A 2POCA 2BWJA 4KHPB 4AUKA 4DA8A 1G20A 2K87A 2BE9A 2FXIA 3AXSA 2ODQA 1VGRA 5REQB 5DTIA 2QRMA 1JLAB 1R0WA 1PQ4A 2Z56A 3CB2A 1EMDA 3K2EA 3MUVP 2QLJB 1FRMA 5BSRA 1Z4NA 2GD0A 1T9HA 4B2IA 1B3BA 1KNZA 2EGGA 2P78A 3NKFA 4MKRA 2B5WA 1Y4AE 1JK9B 1JJ7A 1KMQA 5E8RA 5FTWA 1WE2A 4AJNA 4JC8A 1GRCA 5CDHA 2I0FA 1J0BA 4DV3B 1IR0A 5AM2A 3ZZ0A 2ZLBA 3FYDA 3CRNA 4IDDA 4ARIA 5G53C 1PL8A 3FSJX 2YNFA 2AW5A 1XZPA 3WG9A 4LGYA 1RMTA 4IRMA 1AUOA 3KHSA 4Y2PA 4V19J 3TA2A 4C0WA 5BY2A 4IIDA 2J3MA 2CUYA 1I0ZA 1W0KA 2GQQA 4NL4H 2ZE2A 3OZ7A 2DQSA 4RD4A 1XVLA 4DV7B 3CCUS 2GJ9A 2WJHA 2XHZA 2BY4A 2ZOMA 3KR1A 3LT5A 1KH3A 1DZIA 2FY1A 3O6VA 5AJZA 5E3IA 1Z0KA 3TZHA 3P45B 1TPZA 1U1QA 1ENPA 4QA9A 4EKDA 1VMDA 4WHMA 2QYCA 2NT4A 4WBNB 4WLVA 2AXEA 3DBOB 4OQMA 4K50A 1AMNA 5REQA 2ALJA 3KUCA 4I5DA 5CLGA 3A1TA 2XNJA 4DF4A 4GUDA 1P72A 2W25A 4YB7A 4LF9F 4KGXA 3GJZA 2VP9A 2A1TS 3V81B 4NCJA 1VE6A 1W2IA 4GXQA 1V47A 2WSEC 4FDTA 2GQ2A 3KLEB 5IRCD 4PLTA 2BI7A 1Y5LB 2PX0A 3ICVA 4OLFA 4P4UA 2F55A 1DQNA 4RVOA 1W7AA 1H8HD 2YQ5A 1VSUA 2RHRA 3H5YA 2XNKA 2VQEF 3BSNA 2FZKB 5K8MA 1W34A 3LY7A 2QV6A 4LE2A 3L02A 2FWAA 2XUQA 4RMIA 2FHMA 3MWJA 2YNMD 3R27A 4RNOA 2G4BA 1A9PA 3R5JA 4BO7A 4H4OA 2Y1OA 2R1ZA 1FMCA 4LOIA 5MFZA 1ZVVA 3CNQS 2VT6A 1YR7A 2PD1A 4K03A 3A4IA 1G8KA 1MROA 2FC9A 1GAOA 4LUBA 2Z30A 3SZRA 1YIAA 3OO1A 1Q0UA 4LF6J 2FCAA 2N9UA 3C6KA 4MV4A 5AMXA 4BOYA 5CHCB 3A3OB 4CLXA 2B83A 1TF2A 5DP1A 1BQNB 1Q16B 1HDEA 4N3AA 4RD0A 4AKIA 5F73A 1WXGA 1WB9A 1K06A 1MV5A 4PIMA 4KN8A 2R8BA 1WCV1 1FL9A 2G4CA 4XSVA 3I1YA 1K7YA 3QIPA 2VP3A 2DQ4A 1S1VA 2FK8A 4GR5A 2P2SA 1MGOA 1YNSA 4CKZA 4P2MA 1QB8A 3GMGA 1UDXA 5DWQA 3KYDA 3ESYA 2WP0A 3GN1A 5HAOA 4WFBQ 2KJQA 3AA9A 3DOKA 3KXIA 2AGQA 4NC9A 5K51A 5CA1A 4DAOA 1GRNA 4RF2A 4EBDA 3HU1A 2DH8A 5EHGA 1VE1A 1J20A 1VSQA 3LWLA 4FZ3A 3VPGA 2R1TA 4LJ4A 2HW3A 4MVXA 3LCVB 4KEAA 1WCIB 4GP6A 4NTZA 3ZYZA 2PYDA 3RRHA 2KVIA 3ZKAA 1H5NA 1S96A 1ZISA 3KAKA 2PRJA 5EL0A 4CV2A 2UUCF 4LIWA 4HEA9 2XWXA 3PC2A 5JDIA 4JA2A 4Y1RA 3H8YA 2F67A 2NVBA 1HBOB 2ATXA 2HA2A 2OB2A 2O2EA 5KBYA 3RTBA 4YMEA 5C52B 4JJZA 3O4GA 1NHKL 5IT9A 2GZAA 3B53X 2D2FA 4G8JA 2VKZG 4LHEA 4ICIA 4ZALA 2LQ8A 4DCOA 4J4HA 1BX3A 1T43A 2QY6A 2YWFA 5JRDS 1OXVA 5CW1A 2ZYUX 3SX2A 2W6NA 2RIPA 4EGFA 1B8OA 4JV2A 3K92A 1X4DA 2ZWOA 5LWHA 3M8QA 3WRYA 1YDFA 4R83A 3DCIA 1F6BA 3F3KA 4JFAA 3AODA 5TQ0B 2R00C 4YUXA 2EXUA 3SHVA 1XERA 1VKJA 3KWLA 4ITVA 1T4BA 2BAGA 3FZ2A 1LK5A 3HLYA 2ECFA 4LWQA 1NUSA 1EQUA 4QUIA 4B3IA 4LMBA 5HK4A 1Q21A 6NULA 5BO5A 3I45A 2O52A 4IG3B 4ZYVA 1S1UA 4OYZA 3H3FA 1N5RA 3QVUA 4EHJA 1T6NA 1YAHA 3KAQA 2M98A 2GI4A 1CJBA 4B4WA 5T8KA 4ZLLA 4JC5A 2VNAA 3KL4A 5C81A 3CLSC 3U7EB 3MAGA 4F3YA 1PJQA 3P9CA 4G5GA 4RHFA 2IOQA 4KKVA 2XWYA 3LA0A 2IPAB 1UIMA 5FJJA 2Z57B 2J32A 3CUTA 1TKRA 2EC2A 1DTWA 3T3FA 2CF5A 4RIHA 4S0ZA 1QSSA 1G9XA 4EHNA 2UZ1B 3BE6A 1LEOA 2WE7A 5ADWA 4HN2A 4TVAB 2YVAA 4WSOA 2RD2A 3B1VA 4CKBB 3FRZA 4FDLA 2JLBA 1S59A 3IP0A 4WFAQ 2PBZA 4KXMA 5CLFA 1RWQA 2I55A 4PWDA 3FVTA 1WV0A 3IERA 3KQTA 1A27A 1SIUA 5K8VA 1N78A 4MK4A 3AEUA 4TM7A 1WBDA 3LZ6A 4RBTA 2R8JA 4FYVB 1H0RA 5CYQA 1NJIT 1NW9B 3IMCA 1YWXA 3Q6NA 5J4VA 2YMPA 4HY3A 5TC4A 4MAKA 4OBXA 2GN4A 4ZANA 1VMBA 2P77A 5KINB 5CB0A 1IKWA 4B6GA 1ULAA 1R6YA 2NSYA 5E1MA 3O31A 1O0PA 1Q14A 1D6SA 1UBOS 3QATA 1QH0A 5J1SB 3PDCA 4DV0B 2O7SA 3VZDA 1S0OA 1O5OA 1C4KA 3V6DA 3ND9A 1LC3A 3NH6A 4X7BA 4TY9A 4R81A 3V7WA 2HQCA 4OX9F 2J0QA 3DRXA 1D5WA 4GAEA 2XMRA 1G6HA 4XSHA 3GEPA 3KR2A 2PWPA 2HHCA 4AL5A 1EUQA 1E2KA 4ERDA 3IAM1 5EYPB 2FP4B 4LWOA 1Z07A 3T1HJ 2MEWA 1QQ5A 4Q3EA 3SF8B 2B94A 4M88A 4EG3A 4OJNA 3TD6A 4NA2A 4IQGA 1F2UA 2C3OA 1UMCB 1NT2A 1LK0A 4YAUA 5KFLA 1SVSA 3I3OA 1VLQA 1CHNA 5F9MA 3I9FA 4X45A 1RC1A 1Q4RA 3EUFA 2VL1A 2QUKA 4CNZA 3U3XA 4D8YA 3K0FA 5AXMA 3RTVA 5D0GA 3DD5A 4P81A 3KUGA 3B1YA 5BPHA 1ODFA 1W93A 1BE6A 3VYRB 2ZOGA 1SB6A 3TVTA 3V7NA 3AF4A 1LQTA 3BZWA 1JHZA 3BJYA 3EZ9A 4TUYA 4LF5J 3N6NA 2H51B 1PJZA 4CO0A 4IOAQ 1CY0A 1MC5A 5M2QA 4X65J 4D45A 5JNLA 2GB4A 4KQHA 2IELA 3QMQA 5KREA 4NYJR 5DYTA 1TU4A 3A8EA 3R3UA 3H9UA 3LA6A 2PLNA 4GKJF 4C7OB 3AB3A 1YB1A 3CNBA 1GTL1 1ZAYA 4IGIA 4XYMA 3QGHA 3T5AA 3EULA 4Q7QA 3ACBA 4YQWA 3IHLA 1S1MA 4D6PA 5DKFA 4J1SA 4CV0A 3DRRB 5GP1A 3VR4A 5LSLA 2J6BA 2L82A 4TYBA 1DTTB 3UICA 4W5JA 4CETA 3LFUA 3V7YA 2R7QA 4HMPA 4E2FB 3ZGLA 3B12A 3WNVA 4DJAA 1R0LA 4ECYA 3FCHA 5AE1A 3HSKA 3K0AB 4UVEA 1QIJA 4V2UA 5HW0A 3UOWA 2XMTA 3B1ZA 5D6GA 4CMAA 4BB5A 3L9WA 1V3ZA 4ZP9A 5DGCA 2ZRLA 3FPKA 2DTXA 4KT0C 4H08A 3KSMA 5IK2A 1XQ6A 3WSTA 2H1RA 1WHXA 1RLTA 4W98A 3QOXA 3OLWA 1D9XA 3TLYA 2XVZA 4U63A 2XZOA 2UAGA 3G8CA 3RWBA 1YI8A 4F7VA 1RM3A 2QMXA 4ARZA 3MM7B 1CJKA 5A04A 4G07A 2F00A 3H2IA 3OEEA 1RTIA 2OHJA 4PYMA 1Y37A 5JH7B 2WBLC 3HPRA 4JT9A 4KGZB 4X97A 3I42A 3D6MB 1QQTA 1JFTA 4I0WB 3ZQ6A 4CO2A 1TK2A 2XE6A 4EYHB 2YYZA 1X4AA 3JAWB 1N2CE 4GX1A 1QYVA 5TIIA 3IP7A 2CJBA 3IWNC 5DW3A 2G17A 2FQYA 2PA0A 1BMFD 3LQ4A 5A6WA 3FWKA 2WV9A 3NYQA 4HDHA 1ZOTA 2P9QA 4EMTA 3PQ4A 4ZVTA 1VQ4S 4ZI7A 4IIYA 3BN4A 2WJ6A 4IICA 1F7UA 3RJZA 3RUIA 2VH7A 4PLYA 3JQBC 1RT7B 3QPWA 1NP6A 3W4IA 1RZVA 1E1NA 3R5FA 2FN4A 4RPHA 4JI8B 4NVRA 5ELLA 2C3UA 4CP5A 2DNHA 2QL7B 1YUNA 4KR0B 5GONB 4MP6A 1HBNA 1XNQF 2UUPA 3FEXB 3T19A 1DV1A 3ITNA 3NJ4A 2PLRA 5B4VA 3FTPA 4K5SA 4G23A 3WY9A 4QW8A 5GVRA 2C4TA 3FOBA 2AWOA 3AW8A 3P9XA 3LK6A 3ODGA 3M33A 2YKAA 2VR1A 2V0NA 2OO3A 4F4ZA 1TZJA 3I4HX 5IC4B 3ETHA 1RQGA 3MWEB 3PIPQ 5F1OA 5CA0A 4B3TF 2I5JA 1GOTA 4IRUB 1J06A 1C3JA 4OYBA 4HL6A 4P3XA 2E5JA 2NV2B 3GSIA 1RI3A 2H4YA 5HF6A 2VK8A 2BFWA 4IQXA 4I6AA 1NJYA 4GOND 3A05A 4NLSA 1X3SA 3DVRX 2CBZA 3QVMA 4GDMA 4PZCA 3NV7A 1ZAVA 4RL1A 1V45E 2W6ZA 2K2QB 3L05A 4KXWA 3FQKA 1SXPA 3IIIA 3T0IA 5FADA 1NHUA 3HCBA 1N54B 4W5NA 1HL6A 3TVZA 1Q7EA 5INTA 5JISA 2W9BB 5CTJA 5LL6P 2KHZA 4GXTA 3MYRA 3PPIA 5IBPA 3M0EA 3A3KA 3GXOA 2VRBA 2W11A 1UVJA 5CU7A 4FPXA 1IBLF 2CUNA 5A9RA 4C08A 3WBJA 4YCSA 2YNIA 2Q8NA 2PSJA 2DULA 2IHJA 2FMXA 3LCUA 2OGWA 1ZVJA 3VTFA 3JSAA 3KCQA 1N2CB 5CB4A 3OA2A 2UZ3A 1PVOA 5M2PA 3J7A1 2FNAA 3U4MA 4Y0FA 4RSRA 4V19X 3LDGA 3OLYA 4DCUA 4FYMA 5L95A 2ZWPA 2PMHA 5D15A 1JEEA 4WESA 3ZDZB 3QX3A 2M9MA 2OMKA 3RNOA 3IUMA 4PF1A 3E2PA 3NGXA 1VYHA 2C9YA 4G1BA 2W4CA 3NLCA 1DO0A 1EVIA 1TNDA 3ONNA 5FBVB 1JKHA 4H6PA 3KDAA 2VQ6A 3TOXA 1HH4A 2QAIA 3BGOS 2XMJA 2D8MA 4UOZA 4NA1A 4Q0BB 4C22A 1DTQA 4CCWA 3D0GE 4BATA 4ZCRA 3JASA 4NK5A 3DLJA 3I52A 4OQPA 5D3ZA 4TLRA 4UBLA 4FGKA 4LVNP 3LCCA 5C24A 3OKCA 4YLYA 5IVHA 3RASA 5KJ1A 4OJKA 1C0PA 2MMCA 4I1IA 4CM9D 2Q9UA 3K05A 4ALZA 3VR2D 4CEHB 2R7UA 1Z4LA 1RWXB 1YHQS 3RTAA 1DEKA 1KAMA 1Z34A 4E07A 1AE1A 1PSWA 3LKDA 1R5NA 3CUWA 2CADA 4BNFA 2RUSA 3DTVB 4MW5A 4C6AA 3DEJA 4F4AA 1P62B 2WWVD 2CEAA 2FRDA 3MTGA 3WLOA 5BSFA 5THKA 4GMDA 2I6SA 4NFHA 1HI9A 1QUEA 2P9ZA 4LPKA 4PTYA 3OIWA 1FNSA 3V48A 1NJXA 1OLOA 4MVWA 1MN7A 4PPYA 4DNXA 1NHVA 4J9UE 5ER6A 1N5LA 3BRWA 3IXQA 3ZY6A 2J9FA 4I55B 1MRNA 1C2PA 3VTZA 1PNVA 4NXMJ 3M6IA 2FR8C 3TLKA 1AUXA 2IKQA 3KOYA 4WKYA 2E87A 2QAGA 4MQ6A 1R37A 2QBYB 5KFJA 2SXLA 3EEYA 4UTRA 2ORVA 1EFLA 3N4WA 5B58T 4JI6J 2G0TA 2I38A 2AZMA 5TQ0A 2X5NA 4CEHA 1JLAA 5EKDA 1QK5A 5FQNA 1F51E 3W9HA 2Q46A 4AD6A 4CG3A 3PCRB 1FMJA 4U7JA 4QVIA 4GXRA 1CVJA 4AM8A 2V4ZA 2N3LA 1XWLA 1B4SA 1FVXA 4J9QA 1RI5A 4WZAA 1TQ4A 3TXAA 1AN9A 1QP8A 5CVDA 1Z2AA 1EWKA 3M32B 3C6TA 1ZONA 2C82A 2QT9A 1GA4A 2ZULA 3S3TA 1UXGA 3DWEX 4FBGA 2VKRA 4Q5VA 1ZAKA 5B1IA 4IQ4A 3RS4A 4IX1A 1OH6A 2QNBA 3FTQA 1BVUA 1WHTA 4YN3B 5EWJB 1XEXB 5BUSA 2HEGA 2H2HA 3UUFA 4X1YA 2DNZA 2V7QA 3MFYA 4B9UA 1VRWA 4CFSA 1EU1A 3CD6S 2GJ8A 1POWA 1M6VB 1R50A 3C4QA 2ZBEA 2CE2X 4HADA 2UZ1A 1KC3A 2PKCA 3EHEA 1FNDA 1P7ZA 3A3NA 1RT4A 2VD3A 3ED1A 5FOWA 5I9BA 1W19A 1Z0UA 4F86A 2C96A 1LFWA 5DGBA 1DRUA 8GPBA 5AI6A 3KHUA 2YJ3A 3B5IA 1N2ZA 2U1AA 4OP1A 3B6ZA 4YAIA 4DB4A 1T2FA 3POTB 2QL9A 2QB5A 2ZB4A 3Q8XB 4DSLA 3OKFA 3RVPA 3F44A 2XRFA 3N6LA 5IARA 1XE3A 2DR3A 4QJVA 1GPUA 4GVBB 1Z7WA 3LVFO 1ZM4A 3VR5D 5C37A 2J3KA 2GAHC 5BNWA 3AVUA 2Q27A 1RYNA 3IPXA 2YX1A 4GR4A 2O23A 4E5KA 2H1LA 1NK7A 5KTYA 3FSEA 2M3DA 4L4SA 3B8HA 5LP6B 3OPYA 3H9GA 1XYGA 2CNOB 2XQCA 3TZZA 4F3QA 1RHUB 1Q77A 3BILA 2X8LA 1ONPA 3K59A 1ZICA 2FV8A 4Z1MA 3HI4A 1URPA 3RADC 2J3EA 1RT2B 1UEIA 1J2TA 3JARA 4C6HA 1D0IA 4OOFA 3SC2B 4ARSA 1NJFA 2NZ4A 2I4OA 4F3TA 5H7XA 3GJ7A 1N88A 4J03A 4P7TA 5C1OA 2AT1A 3PDUA 3AI1A 1R27A 4M9RA 3PNVA 1L5GB 1VL0A 2KWIA 3LP0A 2PK3A 1XCBA 1OAAA 4DHEA 2X1HA 3GRCA 3R40A 4UXIA 2CY0A 5FBLB 1N36J 1Z29A 2BABA 4CO1A 1MT0A 1TVMA 2FGKA 1YKGA 3NNNA 2OV8A 1R6UA 4EKGA 3DXYA 3PM9A 4YDDB 1E63A 1FDTA 2QIFA 4Q05A 3M2RA 3QXHA 4ZJYA 4H3SA 2QTWB 2R6HA 4Q7MB 4NV1A 3QPCA 1T6ZA 3DVAB 3P0JA 3OFHA 4CZ2A 2E5LJ 2RH3A 4DQSA 3HJGA 5FPHA 1IEWA 4G2NA 2MKHA 1TAUA 3L7KA 1X8KA 2W2TA 1P9WA 2B98A 5K2OA 4PYNA 2W2XA 2IF0A 4HN9A 4JBLA 1KQOA 2XF2A 2I54A 1SA0A 2PL5A 3P9SA 4EA6A 2HMVA 3IAM9 1M2OA 2FEOA 3IQWA 3Q41A 1LPSA 1GLVA 3PWTA 4KXNA 1OE0A 4TSKA 1I3KA 1B0TA 1TC2A 1ZMOA 3SIWA 1U4BA 4FS8A 1IFXA 1QTRA 3MILA 1SHLA 2BJ1A 1W1UA 3CFYA 4L28A 1P5FA 1RLOA 5B7PA 1DT5A 1NRIA 1DX9A 3FRIA 3Q5DA 3SLGA 2BFMA 1DQPA 5JSZA 1WOSA 1OA0A 5EJFA 3A4YA 3O8DA 1I3OB 4IDFA 1ZSYA 1V3SA 2G9QA 4OZ0A 3QELB 1P91A 3L04A 1EHYA 4L2IB 5HSGA 1HWYA 1G17A 4HAZA 1GG2A 1D8AA 4AP9A 4BCCA 3ABQB 4DZDA 4HQOA 3OHMA 2PSFA 4IZHA 1S9EB 2AJDA 3P49B 1ZGGA 2J9GA 2B5JA 4PRLA 3CCQS 4PXDA 1A2OA 5KG5A 1E0JA 4KWEA 4RXUA 4JUFA 2OV3A 1FE8A 1T94A 1O6FA 3ITKA 3WGHA 1DHRA 2XI4A 4IDGA 3KLIA 1H66A 3UXEA 3M05A 4V0NA 3IO3A 3UWDA 1K9VF 3QNWB 4QQ8A 2JZ5A 1FTSA 1E2BA 3ZBPA 5T6MA 1CJVC 3UHPA 4EATA 2B7CB 5KFCA 2I2YA 1JU4A 4K4ZA 2HHAA 5DHPA 1U04A 5C4IA 1E6YB 1R0SA 3WA6A 3D8BA 3AJ9A 3CNOA 5EMJA 2WSIA 4RFSB 1H85A 5FNVA 3EXHB 1VBYA 4DR3B 3FK4A 4XYGA 4IWNA 4C0SA 1P61B 4R7TA 4UDYX 5AJ3J 2DTDA 4IYQA 3D28A 1W9MA 4HJRA 1EK2A 5E6UB 3K8VA 2N0SA 3IMEA 3LX6A 4R5PA 1TL1A 3GP3A 3C5VA 3HMKA 1Q1ZA 3TEJA 3IQIX 4M0EA 4REQB 4BFCA 4AJ2A 1ZNZA 4JOQA 3TDKA 2A0FA 3M1LA 5I7WA 4PC1A 4OUDB 5B3KA 4HTFA 5JCOA 2QLFA 4TSRA 4C29A 4JEUA 3TVYA 3PGA1 4HYTA 3HA2A 3WK5A 4DLVA 4FDAA 2D7CA 3VO1A 4JB8A 1N2SA 1XQ1A 4B3MJ 4A92A 1XZAA 4DL5A 1RKQA 2VQFB 3GGOA 3W2GA 1NL3A 2JLEA 1TTQB 4JP3A 2O48X 4BWVA 3VV2B 2EVZA 3IAS1 1VC6A 3DLKA 3MR2A 2H08A 3SHQA 1CS4B 1UT6A 2JGAA 3SHWA 2D2VA 2WLTA 5L6MB 1PJ5A 2MYNA 1QDLB 2JLCA 3ANMA 4QWDA 2HS0A 1XTSA 5GMDA 2BA9A 1O7JA 2XIQA 5BR4A 1XZEA 4RWWA 4HTAA 3D1OA 3RHZA 2CEKA 1JSLA 2ATLA 1H3FA 1DUVG 4UAGA 3GMTA 1NIJA 4GE3A 4YCAA 5D3GA 3PW5A 2ZJ0A 1X38A 2P7HA 1JA0A 5JXJA 3PV8A 1LXNA 1ECJA 3DC7A 1BXKA 5IW8A 5AESA 1EX8A 5K6RA 1T8YA 2FDRA 2YV5A 5IWAF 1APBA 2A33A 3C6MA 1J22A 5AJYA 4X71A 1AUVA 2YJZA 1UTAA 3FR7A 2XTJP 1FRNA 1U24A 2VQFF 4YASA 4IDKB 3DE7X 4OHCA 3NCRA 1DINA 4N7MA 1RTIB 3Q8RB 1YH3A 1ZBDA 2JNWA 4V2IA 1Z37A 1HEIA 3QTTA 4F2SA 3LO5A 3ZCPA 5JD5A 2WW8A 2AD9A 3DC2A 5JY1A 3ZJYA 5KNBH 3EAGA 1WUHS 2EG5A 4EQZA 4DV0F 2WT9A 5FLXY 3BJRA 4LYGA 1NMSA 1D2HA 2IJRA 3R5TA 1G4HA 3D1HA 1DIAA 3TQIA 2XMAA 1J33A 3M30B 4OX9B 2D3UA 1OO0B 3I5MA 1U7XA 2CPZA 1RWUA 3WAKA 2VZ8A 3K1YA 3DE4X 2I7CA 4Q8EA 5HI7A 2HIAA 2D5LA 2DHAA 1GILA 3PFNA 2QVBA 3EIQA 5I7RA 1K6XA 4RJLA 1N9KA 1PVVA 1N6RA 2CW5A 1L7NA 2BACA 1ZMRA 5BWNA 2QUBA 3I9JA 1U02A 1G5QA 4Q9NA 1NE2A 2BL4A 3QBEA 2R65A 1GPJA 3TQCA 3CJ2A 1HQYE 3F7TA 3ZBQA 3ETGA 5L40A 1C8LA 5IVIA 1RWWB 3ESAA 2C3YA 3RSOA 3R8CA 2ZFUA 3LXUX 2NPFA 1B3RA 4RMHA 1FX1A 1XQIA 3IB3A 5E6SB 1E9RA 4MFBA 2QSZA 4KBIA 4MQBA 1DAMA 5ILQA 1G18A 5ALYA 1I32A 1DP4A 3N5KA 1VCIA 4KBGA 2IPXA 4RY9A 4EJMA 3K4HA 1YVUA 4LXIA 3LHSA 1Z35A 5A4DA 5LBUA 1OH7A 2X4DA 5AHKA 3THWB 4TWRA 2GMHA 1OYWA 3NCTA 4ZWNA 1TK5A 1GV1A 3VZRA 4A1OA 2CVPA 4FNMA 2ARKA 3U4QB 1H4SA 2PX8A 4FLMA 1SC1A 2RFLA 3W2TA 3Q89A 4MHSA 2YV1A 3MM9A 3GFGA 2C2XA 5EQJB 4MTCA 4WLFA 4P93A 3KTAA 4YNBA 2IEBA 2AFHA 4PKDB 5G0SA 2ZYHA 3NGSA 3MEGA 4FKXA 1N6QB 3G59A 3F8WA 1RBQA 4CTNA 5LPNA 1AFIA 1W73A 3RHSA 4GSLA 3LIPA 2YASA 1UZAA 3CCZA 4B9LA 2QVLA 1DO2A 2RC6A 4CJXA 3MZ0A 2VF7A 3AETB 5HDBB 4CIDA 2ZS7A 3MDFA 4MW6A 4CH1A 1RT9A 3ABSB 1QGOA 1T1SA 1JFFA 1FP1D 3JD4A 4C8LA 4R1OA 2G5CA 4ZDNA 3J81j 3S1AA 4ZQCB 1X60A 4DL6A 3EGXB 5AR1A 1QF9A 2CXUA 3W5UA 5DN6A 1AK9A 4B6SA 2I3BA 3SF0A 2NU8B 5HS6A 1NUAA 1SKUB 4Q21A 4TKZA 4LT6A 1K1EA 1MOSA 3TLZA 2VFTA 4K9OA 3T5BA 1W1IA 3AB8A 5IHPA 1H1LA 3CWCA 4U96A 3FBTA 2OUKA 1JP7A 1RAEB 4HV4A 5J1EA 2NAFA 4BNDB 1JKHB 4ES6A 4EY5A 4JYAF 3N39C 3SWWA 2FJBB 1M8KA 3EUAA 2R44A 4DSJA 1AUQA 2Q5FA 3PP8A 3Q9UA 3CZCA 4I4CA 2JRSA 2XTAA 1KY2A 3R3YA 4IO0A 4PZVA 2V0CA 2DNLA 2H51A 4H7DA 1Z6XA 4YV7A 1HZJA 2AI2A 1FESA 2Q3PA 3CVJA 4XX0A 3OLXA 4C8MA 2JH9A 1V5WA 5F2NA 1UDRA 3CLUC 3WJAA 2RNEA 2P5TB 4UD2A 1THGA 4WBNF 1XI2A 3D2LA 1CY6A 5L3VA 1LSUA 4C7OA 1V4BA 2I8EA 5CLLA 3WZLA 4X66J 1YB2A 2MWMA 1KMMA 1BXZA 2ZRBA 2WPDA 3SBDA 1SD5A 5KS2A 1Z4KA 1VCHA 3NBUA 1YQGA 1ZD5A 1FDBA 1UL3A 4F8RA 2Y4NA 3JATB 4NFLA 1X0FA 4MICA 3DD1A 4HWGA 5EP2A 5KX5B 2RAVA 4K9SA 2NUTB 2ZYAA 4JSYA 1VISA 3IWLA 1D8TA 1IE3A 2EW8A 1P2UA 3IT2A 4H7JA 1TFWA 2WAAA 5F78A 3RSZA 4RCYA 3THRA 1KONA 5KWVA 4HVAA 2HZ7A 4ZV4A 4OI4A 2AGOA 3V9PA 4DCCA 5EWFA 3MM4A 2IFTA 4QEZA 5I7FA 5FEMA 5FDLB 3EWIA 2Q9BA 1OFGA 2DBBA 2W43A 5A0YA 1AB5A 1CPZA 5LQMA 1FLVA 1ODCA 4IVRA 3H4BA 4I14A 2O14A 2X8AA 4Q9HA 4YHBA 4L78A 4P6QA 3ROFA 1SOVA 3UR3C 1R0CB 3HBAA 2FN3A 2B4VA 1R5BA 3REQB 1J42A 4WJKB 1R4AA 3WKDA 3ITHB 3QXGA 2HNYB 1S2LA 1FF9A 2HVDA 1ZR4A 2W2OP 4UW2A 2K06A 3CDBA 4X1KA 1K9SA 3H1BA 4WPAA 2AEJA 4FIDA 1XU7A 2NUPA 3ELBA 4ZVVA 3LBAA 2B5OA 1KBOA 2Y1JA 5SY9A 3NYWA 1K8ZB 1EDOA 1Z56C 2PGAA 5I9LA 2GJKA 4JLDA 1M8GA 3ZG6A 5JBNA 1Y5LA 2CMDA 3VAHA 5GAJA 2O2YA 4M5LA 3OJOA 3UVJB 3GJ5A 2IE0A 2WVJA 3BEGB 2IH4A 4X7PA 1T1IA 4PCQA 3L1UA 2O8CA 2HI0A 3GG2A 1K2WA 2GFHA 4HAOA 1BGVA 4CXMA 2OHVA 2IRXA 4I9NA 4EKNB 5MAOA 3PR1A 1XPUA 1O6BA 2BM1A 2C4HA 2KYRA 4ZOLB 1WC6A 1NP7A 4RVGA 4OSEA 3GZ7A 3MCAA 4WU3A 1P80A 3QFWA 2BISA 2L9WA 1EXMA 3ND8A 1R7RA 1ZMBA 2IU0A 3RW7A 4QGAA 1PX0A 5KU1A 4PSKA 1U0TA 3AXKA 3H19A 2Z9DA 3DGPB 3WC2A 1RTJA 1JHRA 1G66A 4L4RA 2EKZA 4QDOA 3GG1A 3ADOA 3SHFA 5KG0A 4G5SA 2XMZA 1VPTA 1JQLB 3CMES 4J2TA 3M9OB 2XQVA 4NBLA 3K5OA 4DV0J 3JWPA 4TLEA 2H07A 3P2JA 2CB0A 4DS5A 2PMFA 1HLWA 5TX7A 1YJAA 2XCUA 2OL4A 3FSYA 1U7LA 4IMPA 3KKKA 4DX5A 3MJ4A 1LBEA 5ALIA 4S1VA 4JT2A 3OJFA 3GJ6A 4A48A 3Q23A 3E9YA 2ZU0C 1DV2A 2Z3ZA 4IFIA 3NI2A 4M0UA 2W83A 4YH1A 2R1TB 4F4KA 3F98A 3KNGA 4CEJA 1ZAWA 4IDQA 2JFDA 2CPIA 1QPZA 3UDEA 4EHBA 1WHTB 1CJTA 4JUAA 4AL6A 2ZFHA 3DW3X 1KE2A 3A9RA 5C3UA 3B2QA 4ND7A 3F3SA 1CY4A 1RACB 1YJTA 1XLTC 3IM8A 3HUTA 5LMUJ 1ZOOA 1KHHA 3YASA 3K31A 2ASEA 3K94A 4AJPA 1TL4A 2F8EX 1XIVA 5HKBA 2BMBA 3A3NB 4PWWA 3GGGA 5GQSA 3FSIA 1UKBA 1S3IA 3ICLA 3QVVA 1QO9A 3WKAA 1LI5A 4O3MA 2X5XA 5EC8A 1Y4ZA 2VDNB 3GDGA 1PFWA 4JQZA 4WF9Q 2VK2A 3GA0A 3U3JA 4BU0A 4ALJA 1KSHA 5L3SB 4JU9A 4EENA 4Q48A 2CJKA 2ZE2B 4JI0J 3PQ5A 2K8GA 4AULA 3ZD6A 1FP4A 2JZOA 5GOTA 1XQ9A 3SQMA 5JJIA 2WM8A 1O5TA 3CIFA 4PLFA 1ZM2A 1E6UA 1F20A 1HC7A 1EE2A 2WU0A 5C31A 3CT6A 4MP3A 2GT1A 1G7CB 4OLPA 4WOJA 4A0HA 4YS2A 3ZHCA 4ZMSA 4RAOA 4ZT3A 2WJVA 1P8GA 3OR2B 1RD4A 4DMLA 2LIPA 3QYYA 1OBFO 3RU9A 2E5HA 1U0OC 5DYGA 1M34B 3ZZMA 4EW6A 1IZZA 1WXDA 3HBNA 3MGJA 3Q8SB 3ZZUA 1N9ZA 1CETA 4BQPA 3FE2A 3WMGA 3CNQP 4HX5A 5ECYA 5F1PA 5IULC 3CF5Q 2G6TA 4DLUA 3DWFA 1JLSA 5H9FK 1I3NA 1Y8RB 5ESDA 2C78A 2JVRA 4M1SA 4HYQA 5AKJA 2FP3A 4PZUA 4FU0A 3VNAA 3FWNA 3W9JA 1Y80A 3HYCA 4OHYA 3EDOA 3C4JA 4CKBA 3L0YA 3D6HA 4BDSA 3HA5A 2CBGA 1HR0J 2EQ5A 2F4FA 4LBWA 1I2MA 3QXCA 5IC4A 4ZV9A 1J07A 2VBWA 5CUQA 1W36B 2X13A 1S3FA 1TT5A 4BO2A 3P0HA 3WK8A 2DR6A 1JDUA 5HJ7A 1QJ4A 3RBEA 3V7UA 3G82C 4MV1A 5DHUA 3HRKA 2WFMA 4ND3A 2OBLA 3DOFA 1PN3A 3IDAA 4DF8A 3ZCUA 2R2TA 2IS4A 3W8DA 2HNZA 1PLKA 2I34A 4CF3A 3FNQA 3BRWD 3ZOZA 1DCTA 4V0KA 4S2UA 1OLUA 3HUDA 4Q7LA 2AKYA 2W9AA 3EPIA 4BFYA 4LBHA 4OTZA 2JLSA 1O77A 2HQFA 1IZ0A 2WHEA 1YFLA 4JEHA 2J0WA 2I7VA 4A2PA 5JTUA 2Y3YA 1JJHA 5T41A 1E1MA 3BR8A 4X8OA 4V1CI 4DLRA 1Z4UA 1MH9A 3FNGA 4YJDA 1RTHB 3NFRA 4OHOA 3HEAA 3WGLA 4ZVLA 4L8WB 4LYEA 4LA4A 4YR2A 2PNFA 3OQOA 2AZDA 3AM3A 2EHJA 3NHBA 1AKTA 3SYTA 1SD2A 3NM5A 3E8OA 4LFAJ 2YFHA 1MNQA 2CRLA 4GFDA 3IA2A 4QYWA 1DUSA 1JZTA 4QRDA 2VDWA 1E5LA 3QPDA 2I8CA 1Q8IA 3EZNA 1ZH5A 2ECQA 4HNGA 1SC6A 3W78A 1M0WA 4RYDA 1Z3IX 2B56A 3A6ZA 3PEEA 3JSRA 5HBGA 1NCLA 5L7WA 3U27A 3BA1A 2FVQA 3HRIA 2G9UA 3OWHA 2VDIA 2CFOA 5KG2A 1L5SA 3KTFA 1QK3A 3DO6A 2TMGA 3SCIE 1GA6A 3TFOA 1H65A 4EUFA 2ZSUA 3QU7A 1JXMA 1KS9A 4OJMX 1T29A 4KI0A 4ALKA 3CRQA 2Q3MA 4P31A 2PDAA 2FFRA 5A3QA 3NTOA 4NULA 4Z1MD 1T0BA 2YQ1A 3NOOA 4A8TA 2YRFA 2ZBIA 2Y2VA 4ZVRA 1EZ4A 1ZPVA 1M75A 3W62A 3GEEA 1TFYA 1KAEA 3KK1B 2EBEA 4B8ZA 2XMVA 1NBAA 4QPJC 4R3UC 5FJIA 1SI9A 2TSYB 1A5SB 1ZSNA 3FCCA 1AQYA 1KK0A 3IALA 2C84A 1XDUA 4ZI2A 3TOZA 1QRAA 5FULA 5AK3A 1DPFA 4YMUA 4AQYB 1T2CA 4AZ3B 4O2LA 2YXDA 5JZBA 1SL2A 4P3KA 3SXUA 4B3MB 3EIUA 5JZ9A 2QENA 2UZIR 3WGMA 3BT7A 2EEZA 2UUTA 2GMWA 1MRZA 2WYHA 4XIGS 4BJ6A 4MKGA 3ZTRA 5F4BA 2ILZA 3ET6B 3M2VA 4CL8A 3H59A 3WRXA 3W34A 1NN5A 1XNHA 4ARZB 3ZCQA 2IYGA 5FA8A 2JJ2D 3TCXB 3OQVA 4KQWA 3ORHA 5K0BA 1OMSA 2X40A 3UT5A 3E51A 3D4PA 4RX1A 3MLBA 1MWZA 4CLRB 4CLHA 3QRQA 1P6XA 3H5OA 3U44A 2Y0BB 2DVMA 5AHRA 3C14C 4WH0A 3BJIC 2P30A 2HHJA 3RUEA 3C19A 1VM6A 5L45A 1S9DA 5KFVA 1DDOA 4AS3A 2NTNA 2LDIA 2C4UA 3ES9A 4B71A 4JK3A 2X2FA 1Z18A 2VA8A 4YONB 4ED0A 3RWOA 3KKFA 5H02A 3Q3JB 2XC9A 2C77A 2OG1A 2VBIA 2ZVPX 1I1NA 4JL6A 2FY8A 3LPEA 1GAEO 2BEVA 1E2JA 3FYUB 3HKBB 4LXGA 1SUFA 1VI7A 4Q16A 3AOBA 2H4WA 4RKYA 4PPZA 3I30X 5HKKA 4OY3A 3RK4A 1DCMA 2ZIZA 2RJ3A 3EY9A 2WZDA 4ZPCA 5EMHA 3GJQB 1KHWA 3DZFA 5KFWA 1QB7A 1ONBA 5AWFC 2ZBFA 4WNIA 1EA7A 5EWJA 1S5PA 2Q3FA 1L4YA 2JCBA 4IHKA 1UFKA 4BZWA 3GZNA 2Z8YM 2BANA 4YACA 2KM8B 1CUFA 3IVXA 3L43A 1UMCA 4LYAA 5BYSA 1GNSA 3ECCA 1GV0A 3AVTA 1YJ7A 1WOMA 4ZPJA 2OORA 1NLUA 3TLEA 3TSAA 1TUGA 4DQXA 1Y7LA 2J5QA 3PEJA 1WW3A 4C6TA 2YH2A 2FEXA 1USWA 4HOYA 2JDIA 3PDJA 3D2WA 3HCNA 4JI5B 1ORTA 4ZZIA 4XM2A 4ZYYA 5BXYA 1HYSB 4D0RA 4OJ3A 2QA5A 1Q3KA 1LXCA 1I6MA 4WNAB 4LFCJ 1I94J 2XZDB 1XCJA 2XOKA 1JLKA 4P3YA 2XT6A 2HGNA 4EKEA 1N3IA 3MUEA 3ILYA 1GDDA 4XR4A 3A9VA 2ZREA 2OXFA 3MEDB 2P2ZA 3B1FA 5CIWA 4D6XA 5CH3A 1KK2A 4MR9B 1Z4MA 3H9BA 5BOSA 5HCUA 2YHSA 3EGXA 1NKTA 3ELWA 3G7SA 2VJAA 1SBCA 4LSLB 2AC2A 5B57C 3TR0A 1Q0HA 4RTJA 4IUYA 3E1SA 3HDQA 3QUQA 4R8RA 2WF9A 2O6HA 3HVJA 4J76A 3Q3EA 1WUUA 3MT9A 1B3TA 1HV8A 4HRYA 4DIBA 3K1AB 3P19A 2A94A 4UT4A 3W2VB 4B40A 5HJEA 4FR0A 1L4GA 1RWPB 2EVWX 4X4QA 1Q6YA 3RVRA 3PIDA 4V3CA 3U7GA 2ZT5A 5HZHA 2ID4A 4O2AF 1RJ9B 3L0CA 2R1VA 1FIUA 3ZY5A 2LYVA 1S8NA 2N1BA 4HAYA 2FF5A 2ZVJA 3CTPA 3KT3A 5BQ5A 1GL6A 2YWCA 3UV7A 2HT1A 2O05A 3GT4A 3K89A 1E7YA 1G8GA 2F1KA 1Y1SA 4BZXA 4D96A 3R74A 2BJ8A 3STVA 3FHTA 6AT1B 2LCWA 3FOAA 2VWPA 4WL0A 3ZWQA 1N5YA 1Y1KE 1WKCA 3ZUGA 1P4JA 3M8YA 3J7YI 4WCFA 4EZEA 1L5LA 4AZWA 5EJGA 4JC4A 1NU4A 1KYXA 5BT8A 2W9XA 4M53A 4QPXA 3QGMA 1GL7A 1JIXA 1YR1A 4NZPA 2EFOA 4Y6QA 2QMOA 1Q0NA 1EAYC 1CD5A 4UHJA 3P1JA 2NACA 1RI4A 2ROQA 4JQOA 4MQEB 3QEAZ 2Y1RI 3AB4B 4BU1A 5A6PA 4MR9A 2VQFJ 3SFTA 3STUA 3DYVA 1R00A 5AE2A 1ACLA 3OAAD 1EP3B 1U8CB 1FKOA 3OH8A 2QROA 1S8OA 1X80A 4MWGA 5KIAA 2A3NA 2HHHJ 4XPCA 1N5JA 3C39A 3UG7A 2WWGA 4BPBA 3PWSA 1QHEA 3WAJA 3K1AA 4LFAF 4UZSA 2CDAA 2AD1A 4F56A 2QL7A 4R98A 3CEAA 3RUBL 4WOKA 3GCXP 3FI0A 1Q7YT 1PO7A 3N0TA 1SVUA 4DNQA 4CTKA 1LQ2A 3C3CA 3HVTA 3SS9X 2AFIE 1J49A 1A71A 3EX7B 1V8BA 1ZUNB 1YULA 1J9EA 3BWCA 3FBFA 1CZKA 1EA5A 3A6HA 4TV8A 2F4VB 3ZBUA 3FVYA 4GKKF 3IIJA 1NXVA 4GQAA 3TSOA 3OOJA 3V8NA 1LA2A 1EVEA 1JTFA 5JUWA 2YX4A 6AT1A 1Q6ZA 5LC1A 2J6UA 3LPAA 2C4KA 5A62A 2XUIA 4OXKA 3VCDA 2XS5A 2QRPA 1FFDA 2GARA 3H5TA 5IH3A 1YZYA 2WWTA 2VT3A 5HVHA 4ID3A 4M1ZA 5CD4H 5CM9C 5HYVA 2Z5GA 2R2SA 1PQUA 2APJA 5KFBA 2ZB2A 4KKXB 1FF2A 3ZTSA 2XECA 4NE2A 2VZLA 2E5LB 4EX6A 1DAXA 4AP5A 3SOZA 4UY8T 4ZPAA 1KRXA 5K0SA 2QW8A 2O4CA 3PW0A 1P81A 4RJIA 4KPGA 1Y81A 1II9A 3ZVRA 5TGTA 2MLXA 5EIOA 3T9FA 1NWCA 3AVPA 2DHHA 1RS0A 4D97A 3PACA 2C20A 4YN3A 2ZI3A 3RYFB 1KTQA 2QLJA 3WNDA 1AA1B 2I87A 4ZEOA 2I33A 2OP1A 3P2YA 3MM6B 3VH4A 1Z2OX 2ZBVA 3B7GA 4MIOA 5KTMA 2V8VA 4PQAA 3LLVA 1IRXA 2E3JA 2H1CA 2R6JA 3JRXA 3DHYA 3J7AC 1CV2A 2CVOA 3U2QA 3I9V9 5THQA 3DT9A 4H60A 4P4LA 2ZIUB 3Q72A 4QGSA 5E9JA 3CX8A 2Y6UA 1QP0A 4QUDA 4XOIA 4NZMA 3NT5A 3FBGA 4Y6LA 5AQEA 4IMIB 4UTGA 2JCYA 1S99A 4MTLA 2JFKA 1P0FA 3QLHA 1HYHA 4QXRA 1RJGA 1JG3A 1Z36A 2VHUA 4MVJG 3ISND 1HPLA 1OIWA 1GARA 1CJSA 2EX0A 3EFOA 3UAXA 4DMCA 2XB8A 3PC8C 4ZHQA 2BOVA 3JVUA 4CCSA 1MB3A 2P27A 4DUZF 2VTVA 5F3WB 4TY8B 1JG4A 3JQ7B 4EO6A 4ASUD 5DNYB 1KVSA 5EWEA 3PBKA 3VR4D 3EZFA 1M2EA 1HBUB 2FC8A 1AYEA 2ZE7A 1WVMA 3AR7A 4YMTA 5KWSA 2MSWA 3SC2A 3EPGA 4C0AC 5A8KB 3B2EA 1YXMA 3V81A 2P1ZA 1CXZA 3CRVA 2JEZA 4UBIA 3KV1A 3ZHXA 2R8IA 5FIIA 2OXEA 2KXFA 4UMEA 2DKOB 3PQ2A 2FR8A 3A9TA 2H1HA 2W70A 1TVEA 4KVGA