3B54A

Saccharomyces cerevisiae nucleoside diphosphate kinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
152
structure length
145
Chain Sequence
SSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ynk1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 38
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3b54A00
1B99A 1NDLA 3WX8A 3FBFA 2ZUAA 2HVEA 1NHKL 3ZTQA 3ENAA 3G2XA 2HURA 4ANEA 1LWXA 1WKLA 2DYAA 1WKJA 3Q8UA 3MPDA 1WKKA 1MN7A 3PJ9A 3B54A 2BEFA 3BBBA 1PKUA 2B8QA 3BBCA 1NCLA 3VGTA 4HR2A 1JXVA 4EK2A 3Q89A 1NB2A 3EM1A 1BHNA 4S0MA 2AZ3A 1NSQA 4DI6A 3Q8YA 3EVMA 3Q83A 3EJMA 1BUXA 1S57A 1B4SA 3DDIA 3VGSA 1HHQA 4CP5A 3GPAA 2HVDA 5IOLA 2B8PA 1S5ZA 4ENOA 1F6TA 1NLKL 1NDCA 5CABA 1NDPA 3B6BA 3GP9A 1BE4A 2VU5A 1HLWA 1XQIA 3DKDA 3BH6B 3NGUA 2DXFA 1NUEA 3FC9A 3ZTRA 1NSKL 1HIYA 4O0NA 1VYAA 2DXDA 3BBFA 3R9LA 2BX6A 2CWKA 3VGVA 4ANDA 1NPKA 1ZS6A 3FCWA 3FBCA 3ZTOA 3FKBA 3ELHA 1W7WA 3ZTSA 1NSPA 4UOFA 4FKXA 5BXIA 4F4AA 3Q86A 3NGTA 1K44A 2DXEA 1UCNA 3FBEA 1LEOA 3L7UA 3PRVA 2NCKL 3FCVA 4WBFA 1EHWA 3Q8VA 3VGUA 4DUTA 1MN9A 3NGRA 1XIQA 3EMTA 3EVOA 1PAEX 2DY9A 4W98A 3EE3A 1U8WA 5C7PA 3FBBA 3VVTA 3NGSA 4UOGA 4F36A 4KPCA 3JS9A 2AZ1A 1KDNA 3EVWA 4ANCA 4C6AA 4FKYA 3VVUA 1S59A 5CAAA 1F3FA 3ETMA 3BH7B 4UOHA 1NDKA 4DZ6A 3ZTPA 3EICA
chains in the Genus database with same CATH superfamily
3GIKA 2KVIA 5HJYA 4UTGA 2CQ0A 5CZVA 2B7BB 4JI2J 3EXYA 2HVIA 4LSNB 2IDEA 2OPSB 3WX8A 1FVQA 3FJ2A 3TUZC 2PIIA 1UAWA 4OI0A 1W26A 3DMJA 2YNFA 1WORA 1B0TA 1WEXA 3D3BJ 4HT7A 4ILRA 5B7WA 2RILA 5F3ZA 3MR2A 2ZH4A 4X65F 1TL7B 1DURA 2QA2A 3IR7B 4JBCA 2WW4A 5LSRA 4M5IA 3OTEA 3VWSA 4DXLA 2C2KB 1FXLA 1KLMB 3PFEA 2RUGA 1N36J 2IMOA 3FMWA 4ILMA 2RD5C 2HZAA 3S6EA 1DHMA 1HNXF 4AFFA 2VQFF 2EW9A 1RISA 2DHSA 3UE2A 3OUYB 4KGZB 3RBDA 1J5EF 3AAWB 4HVZA 3PR5B 2CPXA 3FEYB 2GHPA 2XSFA 4RW7A 1TKTA 2EBGA 5DLGA 1HL6A 1QVFR 1FNXH 2XS5A 2OMLA 2BQRA 2MY7A 1S57A 1X4HA 2K1RB 4WU2A 3J80U 2V50A 3NAHA 5HL7Q 2ACYA 5DETA 4PRFA 2Y1RI 1S0MA 1H7XA 3EZ5A 2YX1A 4ATNA 1UVLA 5C42A 1UW9A 3EX7B 2B9WA 1S6OA 2ASLA 4TU8A 3HFZB 4I2PB 3MMCA 5KFYA 4NPOA 4ECXA 3DLBA 2EC2A 4A8KA 3I0SA 5JXSA 3T1YJ 1M90T 2B56A 2AYEA 1PJ5A 4QYRA 4ZLNA 2XGQA 2W9AA 3OSPA 1NSAA 2RRNA 4D3GA 2W4CA 1QSSA 1VRTA 2P2CB 2V8GA 4KV8B 1QVGR 1YK9A 2B6AB 3K5OA 2XHCA 1CJUA 3QIPA 5EHHA 2R7OA 1JLAA 2F7VA 1N6QA 3G86A 5K8PA 3B78A 2UV8G 5AE3A 1RQ0A 1U1OA 1WC5A 4KY3A 1FTCA 2LDIA 3H20A 1NU4A 1JXEA 2HWIA 3FBCA 5CCLA 5ETRA 4EBDA 2DCUB 3EXCX 4NYOA 2NYIA 3D2WA 1UTAA 2CZ9A 2DHAA 2B4UA 3AD9C 3IR5B 2FJDB 3VAJA 2ZWPA 3MEDB 3TANA 4NXMF 2KTQA 4JV5F 2YKNB 2MZ1A 2EC0A 3R5JB 1SUQB 2IVMA 2OFGX 3TR5A 3KHRA 5IT9Y 4X84A 1N48A 2L9DA 4J9VA 4CH1A 3BZQA 3DLHA 4QYZJ 4FF1A 5KFDA 2UUWA 1KSPA 4ED7A 4ELVA 1Q81T 3BYRA 3QGIA 5IM0B 3M4XA 1RK8A 1RLDA 3VTIA 1Q0NA 4A8MP 3VZIA 3N6NA 2FLPA 1EP4A 4DDFA 5E3QA 1UWBB 3TA2A 3H5XA 3MCNA 1S1WA 3EMTA 3DDKA 4FDFA 2LEAA 2DGUA 1AYEA 1NPPA 3OV7A 1HNWJ 1WF0A 2NZCA 3C46A 4DR3F 2CG8A 3CD5A 2HQDA 4YB5A 2W1BA 4LFCJ 4C8NA 1CS4A 1VFJA 1XC9A 1TAUA 2FD2A 4W90B 4DR7F 4OYOA 5JVGQ 1VC6A 1YKWA 2E5HA 1CLFA 4NLXA 3NBPB 4I67A 2E5IA 1T95A 3GFHA 2K2PA 3M8RA 5LMUF 4ZPDA 2HQ3A 1UW4A 3R2CJ 4PWDA 1FRHA 4Q8EA 2DNLA 1BD6A 1RLCL 2MKKA 5SZTA 4DFPA 2RSQA 2IM1A 2NZ4A 3KLGA 3P6YC 4UQGA 1UEVA 3D4JA 5LM7E 2PN6A 5GAEU 4U7UK 2HS3A 2MZSA 1HBUB 2KJWA 4HH0A 1RT6B 1S0OA 1MWQA 2YKNA 2I6WA 4ZCMA 4NLWA 4AQYF 1FK9B 1NZ8A 2FB0A 2XI2A 5LL6d 4A4JA 1T9UA 3RR8A 1K73T 4Q2LA 4PUOB 4I56A 2CJKA 2E7WA 2CWXA 1SJ3P 1U26A 2VBYA 4B3RF 2QG9B 1I5OB 2G2OA 3CCES 2V94A 4GC7A 1U1QA 1VJWA 4JI7F 3M8PA 2ZNYA 4L72B 5A8WA 3V6JA 3E51A 3LALA 5AJ3J 1HPZB 2DNOA 4DR1J 1S10A 4LUBA 5DG9A 3KNGA 1QUPA 2YWGA 1ACMB 3THPA 2DNZA 1BXNA 1DTQA 2OPRA 2VPXB 1WKKA 3LO3A 1B0VA 3D6TB 1TFYA 1V6HA 3HZGA 2OEJA 1OSCA 3D66A 3G82B 3S1TA 3NS5A 1Q95G 3TARA 2BQ3A 4BWJA 3CTRA 4RUBA 4PQUB 2ZD1A 4WCEQ 2H48B 2ALZA 4DV0J 4GRSA 2AJ0A 1H74A 3RJMB 4QWEA 4DR2F 4KKOA 1NJWA 3CDUA 3SI8A 4IOAQ 4C0BA 3GG1A 3BO3A 2F8HA 2QEXS 4OJ3A 2DNHA 2EFVA 1N0VC 3OFFA 3IC1A 5KG1A 1R31A 2DGOA 3BKFA 1HQUA 2CJAA 1ZYQA 2CFXA 3GMGA 6AT1B 4FF2A 1E6YB 2B4PA 2HBZB 1YGYA 5LMNJ 1CG2A 3D54A 3M32A 1JJHA 2I2YA 2QA4G 3AOCA 3KLEA 3BGRA 4F25A 4DR7J 1FKPB 2EFPA 3TAPA 1UL3A 3KLVA 2VU5A 2NXNA 4KBIA 1D8YA 2L08A 3DKDA 5B0GA 3KJNB 5F8MA 3HT3A 2VIHA 1VR6A 2AMCB 4M1KA 3G6YA 5LXYA 3Q23A 1NSKL 2FLOA 3IM9A 4DV4J 4XPCA 4YHHJ 2OPPB 1KLMA 3QRRA 2N3LA 3JSRA 3THTA 4NLUA 1XR7A 3OXGA 2QLWA 3FCWA 1M0SA 3MAHA 4ANDA 3FKBA 1F0XA 2WSEC 5HATA 5IM0A 1TL7A 1KC8T 4LF4F 2GQCA 1G7CB 4QWCA 1IQTA 1R0CB 4KGMA 2RDDA 1RU2A 4CNYA 2VUGA 4ZIWA 2HBYB 2AJ4A 2XEXA 2Q43A 3CO9A 3LGMA 4AUKA 4LSNA 3LUYA 4CO5A 4UZBA 1YX2A 3KLEB 4ECQA 2UXBJ 4ZVUB 2MQMA 3FBEA 3GG0A 2PT0A 1R6YA 3W62A 4DFJA 4WE1B 3BQ1A 4QR2A 2HRTA 4AXJA 2KZZA 3A4TA 1SJQA 1SV5A 4A8QA 3GFYA 5K14B 3K5LA 2C3MA 1C0TB 3I9V9 2AJ1A 3HKZD 4Q2MA 1VRQC 2ALYB 5HMYA 3S7RA 3UR0A 4DS5A 1IBKJ 4DV5F 4DL3A 1AB8A 1B70B 3QSYB 2YBVA 2N82B 2DNNA 5J2PA 2C28A 3S8SA 3T5HA 2ROEA 4URQU 3W2VA 1WG4A 2VOPA 1PBAA 4QR1A 4USJC 3IBWA 4WTOB 1D9DA 1HNIA 5F0WA 2XZTB 3HJFA 3OR1A 5J1EA 2Z56B 3QT7A 4FKYA 3MHYA 4I7FA 1C0TA 1N54B 5ETSA 3TAMA 1HBOB 2ADBA 1Y3KA 5KFRA 2HHHJ 1SI9A 2BKNA 3FRYA 2CNOB 2F8MA 3ONQA 1Q1KA 4DUZJ 5E41A 2HYIB 2HAIA 1F5CA 4WJBA 3CC2S 4ZP9A 2ABYA 2LMIA 4X65J 1NDLA 2H51B 5IC6B 3I32A 4FZVA 2HZCA 1AFIA 4N76A 4P75A 2D7SA 2OFHX 4B3OB 4RBUA 2O66A 1HR0F 4NLYA 1R6VA 4AL5A 2V2KA 4J9RA 1RTHA 1NJZA 3JQJA 4ES3A 3PYGA 2AQ4A 1JLCB 5DDQC 5C5JA 3S01A 4HEA9 2NREA 3JYTA 1V3RA 2V6AA 3D9BA 3HLUA 1I1GA 4TLQA 3RB4A 2J6TA 4RNOA 5GMEA 2IRXA 4B3SF 2YWKA 4TY8A 4DN9A 2AGPA 5CD4A 5L9NA 3CCVS 1PKUA 3R7BB 2HSEB 5C2CA 1NMEB 1EETB 1OJ4A 2B8QA 3Q2SC 4OJHA 4UQTA 2GJIA 1FX2A 5KFUA 1SL0A 1RAEB 1JXVA 1B7FA 5KG7A 4S0MA 4WFNQ 2OPQB 3GU0A 1Q5YA 5CCMA 4F50A 1NHVA 4ERDA 1HNIB 4DI6A 4ITSA 1RT3B 1VQKS 2CG4A 3HJVA 2JVOA 2PD1A 2WZ1A 1WDTA 5D15A 3KLFA 3RRKA 1O8BA 5HLFA 3I4PA 2NXUA 4KHPF 3FSXA 3QO9A 4BC7A 1FX4A 4ZVGA 4JUZA 2DPJA 5KFIA 1IXKA 3ZXWA 5AT1B 2HVDA 1GTEA 3P49B 2B8PA 1MU2B 5E7OB 3MM9B 4BWMA 3ULHA 3W5ZA 3OHAA 3CCRS 2DNPA 2V4JA 2LEPA 3L09A 2FZCB 3ZZUA 1RT5B 1Y10A 2QRRA 4FXWA 4IUFA 3B6BA 4DOZA 2XM3A 1P8GA 2RU3A 1UPMB 2GAHC 4C7QA 3CD6S 1IWGA 1R27B 3NGKA 3SV4A 5GAHI 2Q6CA 1RT2B 4I6WA 1CULA 2R3VA 1FRMA 1N34J 1C0UB 4J37A 2UU9F 2XMTA 5F8GA 4O0NA 3BBFA 5KFSA 4DHVA 4BS2A 3NCRA 2MYFA 3ELHA 3LA0A 4I2QB 2KH9A 1Y11A 4L3NA 2B9XA 2KJVA 3PJXA 1U2RA 4I64A 4OLOA 2CRLA 3SSQA 2E9TA 4TU7A 2ZITA 2VONA 4CT8A 2HHTA 2HFZA 4R0EA 4DV7F 3TEGA 4CTAA 3K17A 3QWUA 3TA0A 3AOBA 1F5BA 4OJGA 3HKWA 5SUHA 4RW6B 2UZAA 1BGXT 2X51A 2NLWA 3SEOA 3EDRB 4KHPJ 4OHVA 3BO4A 1VRTB 3H2UB 4KV8A 1IBMF 4W4MA 4ZP8A 3HDSA 5A0YB 1K0TA 3Q2TC 5BR8F 3UN3A 4Z37A 3RRGA 1CJKB 4XAKA 4C9DA 2R42A 4RU9A 4EWTA 4TQSA 1H38A 4Q0BB 1MMLA 2K3KA 2MMYA 1YBTA 2M2BA 2PMWA 3GJTB 2W24A 1RT5A 1SH2A 2KI2A 2PEBA 2FVPA 5L1LA 2J6SA 2BDPA 4I1TA 3BGUA 1PC4A 3J81j 1T03B 2ZH9A 1D9FA 3J7AN 3M6UA 3KK2A 3ISNC 4DV5J 1IKWA 2P9CA 3AD8C 1VQOS 2YKAA 1WF2A 4KHMA 5DLFA 3FDSA 3W3SA 3FQKA 4H4KA 3IA0A 4TQRA 4DQRA 3AT1B 1KVIA 5KFLA 1JKHA 2FYXA 3R5BA 1EARA 4YR3A 1MROB 4QOTA 1TR0A 3V6DA 2Q66A 4USUA 1KBRA 1NK8A 3G71S 4IH6A 2B4OA 4NLQA 3JAMU 3K5NA 4C8YA 1UFKA 2WTFA 5HP1B 2C2NA 1B99A 2DNQA 4HTJA 4MYTA 2RDIA 1S79A 2OP5A 4ICLB 3G6VA 3AODA 2UU9J 4ED8A 4IDKB 2J9DA 4IFYA 1FJEB 2CQIA 2IA6A 3D3CJ 2E1PA 4PKDB 4TYBA 3GQCA 4DS4A 3OTOJ 3ADAC 3IS9A 3EPIA 4ZLJA 1V3ZA 2C2DA 1TFWA 2KL8A 4RUHA 3BPDA 2FLLA 4E98A 2QT7A 1N52B 2EFGA 3MECA 1Q8IA 1WI6A 4USKA 1Q53A 3W1YC 2BEFA 3OXFA 2RQKA 4MFBB 4OMFG 4OYAA 3JXOA 2BJDA 1U1NA 2OKQA 1Y0HA 4CZCA 4PABA 1TK0A 6FDRA 4F02A 3DRRB 3A8JA 3LTOA 1R8AA 5THWA 1RWNB 4WE1A 3R97A 2Y1IA 2HHQA 1S72S 2MHEA 1TVRA 2HK3A 2IAJB 1VLYA 3EVMA 3LPEA 4DF8A 4RWWA 2R7SA 3UVJA 3OVBA 1T02A 1S7HA 4FN5A 1ICEB 1T8EA 5FLXY 4YR2A 5KFKA 4JI3F 2HHWA 2AD9A 3LPYA 5C24B 4B9NA 3VQSA 3SQGB 4Y2AA 5D8HB 5F8LA 2NXCA 2VC0A 2J0WA 3M8WA 4LFBJ 1IR0A 1YJUA 4N8OA 4WZQA 4L73A 2ADCA 4J9QA 5I42A 3MEGA 2JVRA 3HVTB 1PSDA 2EK1A 3QMQA 4LR7A 3U1NA 5RUBA 1NKCA 1RBOB 2MZJA 5A8RA 1CJTA 2ZH3A 4EBEA 4DMZA 2LA4A 1XERA 2BR0A 4IKAA 4YOEA 5IFMA 1K0VA 3B4MA 5AXKA 2DXFA 1RJJA 4CQ1A 3FC9A 2J0QD 1KD1T 4RW7B 1SUQA 2CJBA 1HIYA 2GV1A 4OZLA 2LQJA 5A6PA 1VQLS 4IOBA 1AW0A 3J7YU 3OLAA 2XWYA 2ZDPA 4A47A 2QMXA 1VQNS 5D0HA 4DPWA 2UXCJ 2CWKA 8ATCB 1T9VA 3LGNA 1ZTTA 3EUNA 2BJ3A 2G9OA 4WP8A 3R8YA 5KFTA 4DL0C 1LWCA 2W2NP 3M05A 3M2VB 3GSIA 1EKRA 4NI2B 5FDLB 5B09A 3QRQA 3V6KA 2M9KA 4OI1A 3T6JA 2MZTA 2AX1A 1UMJA 3BS9A 3H90A 3AXKA 3D67A 3Q86A 2WVFA 4NYPA 4F4AA 2E1MC 4X4UA 3A3NB 3CDWA 3DOLB 2DGWA 3MR5A 1NK7A 5HBMA 4NLTA 2W2MP 2V9KA 2YQ3A 4IQMA 1FJ7A 4DV1F 4CT9A 2PE8A 2ASJA 2DR5A 1S99A 2OO4A 2RB7A 1G1XA 1X9MA 3OD2A 4IH7A 1IJEB 2DHHA 4FNHA 4DG1A 2B4VA 4LR9A 4ETZA 1FJGF 2Q1LA 1YG0A 3JAMY 4U67Q 3RGIA 2FVRA 1TL5A 5ETLA 3KJVB 1SVDA 4LSLB 3M2VA 2WB4A 4NI2A 4FPRA 1UVIA 3BGLA 4EGLA 3AY0A 3NRBA 3H5YA 3MPYA 1PAUB 1ZAVA 4K0KJ 4CM0A 4YDDB 5AE1A 3JS9A 3C2PA 4DUZF 5HMZA 3BO2A 2MJNA 3BM7A 4A8WA 1ZAXA 3HCXA 1RTDA 1N32J 4DG1B 1W2BR 5CZXA 5DDPC 1LW2B 3DRYA 4Y2KA 2R7XA 4DSIA 3BKTA 1NDKA 1CULB 1REVB 1ZM4A 2KDOA 4DZ6A 4A8FA 4Y2IA 5HVFA 3HK2A 2ZH7A 4HDHA 1KWMA 1FESA 3OSNA 3CIZA 3FUYA 3LGHA 1EP4B 4EI2A 3TAQA 3TI0A 2VDIA 2UVRA 2A10A 2DKOB 3F0NA 4P72A 3G8TA 2XS2A 2J9CA 3KKFA 3QRPA 1TZ0A 5H9FK 1GH8A 4FXVA 2FUG9 2XCAA 4MAKA 2AKWB 4LSLA 3BN7A 4M5DA 4RX6A 2HURA 4B3TF 1UPPA 2IMWP 4AQYJ 4Y28C 5B08A 2E1CA 4M63A 3R7NB 1VQMS 1KRPA 1HFEL 3FZBA 3L9ZA 4JI4F 1VCTA 3FEZA 1LK5A 1WF1A 3CJTA 3CCQS 4DSFA 1V5IB 2XC9A 1SKRA 2DT9A 3E01A 4JYAJ 1YJRA 2DITA 2XZWA 3C15B 4H4OB 2EEYA 2MGZB 4QWAA 2VA2A 1YBAA 1R8CA 3AA9A 3TQEA 2QYGA 2M4MA 1LXJA 2I0XA 2FZKB 3Q8SB 1X4GA 2HQGA 5EWGA 3AJ1A 3CCJS 2AZ3A 1JNRB 2Y1JA 2PA3A 2XI3A 4MK9A 5LSOA 1NJXA 1SL2A 4LFCF 3CWJA 1R8HA 3SSRA 3G96A 2XB2D 3RYLA 1FJGJ 3HHEA 1NK4A 4GKJJ 2F1FA 3TVKA 2CPHA 3R3TA 3V2UC 4EZ9A 1RYRA 1YHQS 2IBOA 5F3TA 3N28A 1HBUA 4GO5X 4HKQA 4F4ZA 1FEEA 2GW8A 3ETOA 3FFIB 1NDCA 2ZBRA 1D9AA 1RCXB 3LQVA 5HQ8A 2JL9A 2IY5B 3KLGB 2FHKA 4P7TA 3KJFB 2YH0A 2OH2A 1BE4A 2XSJB 4KO0A 4O3RA 4MH8A 1HHSA 3PR4A 3KMQA 5F8IA 1OO0B 1VHFA 1RWMB 2QMWA 4G1QB 2Y9HA 2HFSA 5K8OA 2BZ2A 1VRUA 2HFUA 3MTKA 4OZ5A 2G1HA 4Y6IA 3NCPA 1QSLA 5IWAJ 1IKXA 1RA6A 1S4FA 3I9ZA 1RXOB 2D9PA 3TRGA 2DR8A 1YJNS 3KNAA 2V8VA 4U7CA 1JX4A 2AJFE 1MMDA 1VBYA 1B7YB 1KTVA 3CJ8A 2GZOA 4V1Ak 3TZZA 2DPIA 3W2VB 2HFVA 4FKXA 5AXMA 1HWJA 4AT1B 4ECSA 4DSKA 3E8OA 2AIRB 5D78A 1TVRB 5BXIA 1QTMA 1FXRA 2MQOA 2C42A 2CJ9A 4E0DA 4YN3B 1Y9OA 5KFVA 4F3MA 1MW7A 3CGIA 1X0FA 2QL9B 3TWZA 2HHVA 2KT5A 1N5SA 3H7HB 4EUVA 1LW0B 3H59A 2OD4A 2DNKA 3PW7A 3QT6A 5CA5A 2EG2A 3JSBA 4ZVEA 1OQ6A 5J2NA 1U1RA 4DR6J 3PX0A 2E9ZA 2GMHA 4DUTA 1K9MT 3M6VA 5C2GA 3UO0A 4NL5A 3W5XA 1RYSA 2OPPA 3V81B 1EIYB 2RMLA 1RAIB 5KAKA 1REVA 3M1VB 1UZDA 1X5SA 2BYCA 5A2QY 3A3PB 1J27A 1RT1B 1PO6A 1ITPA 2Q79A 4TYAA 1RTJB 3MR3A 1AFJA 4I6YA 4C11A 2OUGA 3MDFA 3I5BA 5LXRA 3MMCB 4DV3F 3CMAS 1WELA 2XMKA 2BBEA 1OYEA 3ZZ0A 4G1PA 2V2ZA 1U6FA 4I69A 5KFXA 3A1YG 1BWVA 2IJRA 4OYPA 4OFZA 3VVUA 3D7SB 4USMA 4ZN3A 2BE9B 4M5NA 4AL6A 3H40A 3ITHB 2C2ZB 4WWSA 3TEHB 3C6UA 4PZVA 2KZMA 5IT0A 2V68A 4GMKA 4CO4A 5J1NA 4QYZK 3QATA 3D1OA 2ATCB 3HZEA 2HAFA 3KUHA 4I2PA 1R89A 3AHPA 3DLGA 3D6FB 3M8YA 1LWEB 4LRAA 3KK2B 3M8SA 1URNA 4Q0BA 4B3TJ 2OAUA 3KUEA 2HQCA 3FBFA 3HX9A 4CO1A 3V4IB 2DH9A 2ZJPQ 2CXEA 4H54A 4WXWA 3ZTQA 3W9IA 2AW0A 4KE5A 5L46A 3R6LB 1TKDA 3DRXA 3UDEA 4HI2A 4RW4A 3KK3B 2IPOB 3PACA 4WYWA 4Z2XA 2PGCA 1XR6A 1IM6A 3BN4A 1RT3A 3ILIA 4QWDA 4JI1F 4QU6A 1JLAB 2HNDB 1TMMA 2G1DA 3DRPB 1S1VB 3DOKA 3I82A 3NOCA 3QLHA 2YWEA 1VMBA 4ZA1A 1TU0B 3SMZA 3D1HA 3CJSA 2LXFA 4USWA 2F9DA 4X66F 1LWCB 2BJEA 2ZKUA 5G0RA 2WVDA 1U6BA 1RT7B 3ISZA 3DGPA 4KGXB 2GHVC 4JI3J 3PEHA 4RBVA 4Q8FA 1BC6A 4F67A 2VPYB 3NWRA 3UN2A 5BYRA 1SXLA 1N5YB 4X62J 1FRLA 2QMUB 4M5JA 4X64F 2BW7A 4TN2A 1RHQB 1WC6A 1IBLF 3GZ7A 3V4IA 1YDLA 1AT1B 4USTA 1P9QC 2AEFA 3DMJB 2Z2ZA 4PG7A 3G8SA 4A48A 1CS4B 1C0UA 1LKZA 2M7SA 4LF1A 3M2RA 3T41A 4UT4A 3P96A 1NPRA 3PW5A 2XQCA 1WTFA 4OHXA 2W7OA 1NJIT 3KOAA 7AT1B 2CZ4A 1S5ZA 3D0IE 1YI2S 5CYJA 1F6TA 4IO9Q 3AJ2A 2RKIB 1VBXA 3ILOA 1VLOA 4KQZA 1Q4RA 1PC5A 1WC1A 4KAIA 3GP9A 4DU8A 3PHTA 5CYQB 4LF2A 1UEUA 1WOOA 2CQ1A 3CD0A 4ZCKA 3C14A 2ZZTA 4Q43A 4O3SA 4KPYA 3KLIB 2V8DA 4DQPA 3MM5A 2C3UA 1RU1A 3HSJA 3M9OB 1L3UA 3VQTA 1PGZA 4M5KA 4R8UB 1C1BA 5J2MB 2MY8A 1NO8A 4JP8A 3KLFB 4LRDA 2ZHAA 3LP0A 2ZHBA 2HIYA 3MD1A 2YNHB 4HACB 2P9GA 5C24A 3AQOA 1XN9A 4G6VB 4L74A 3RTVA 1FE4A 2KRRA 4TVAB 3WC0A 4BC9A 1TKXA 3U27A 4DV0F 5MAOA 4H4MB 3UN5A 5DGBA 2GJ2A 5A2QU 2XLJA 3GILA 2R2RA 2R8GA 3CJKB 2MEWA 4TY8B 4OX8A 4DN0A 1OIAA 2IM0A 2A18A 2FJEB 2U2FA 5KFNA 3BQ0A 1QTNB 4TY9A 1S12A 3IRWP 1Q78A 1VISA 3TX8A 3OHBA 1N36F 2YPYA 1RB0A 2HNYA 2ZOFA 4EU0A 2VPZB 6FD1A 4WFAQ 1X4AA 4P2XA 4UF4A 3ENVA 5IXUA 3G8QA 2QFJA 5CXTA 2HVHA 2RF2A 3UD3P 2XG8A 1ELOA 1X5OA 3VV2B 4ES1A 4YR0A 1R0AB 3DLJA 3QQCD 3OJUA 2GMJA 4WKYA 3C15A 3FCHA 1FDBA 3NEKA 1HW9A 2P6TA 2BA9A 4FP9A 1V9OA 1GQEA 3PKYA 1M5SA 5KFZA 5K8NA 4OZ0A 3IS9B 2P8IA 1BQMA 2C1EB 3ENQA 1KFSA 1NB7A 3FFIA 3PVXA 4G3IA 2ZUGA 4ICLA 1S97A 1Y5NB 2ZE2B 4IDKA 5HMWA 4DPUA 5E3PA 2DJWA 5F8HA 2VFSA 1CJVB 1IKXB 2HFNA 1BQNA 4P2FA 1U48A 3M6XA 1ZBTA 3IGNA 3M9MB 1V3SA 4MKYA 3CJ5A 1F9EB 4OQJA 2RHSB 4I0WA 4O4RA 3KK3A 3JYTB 4K4WA 3VCDA 2D9OA 2HNDA 2CQBA 2HLUA 3DRPA 1GK8A 1CSJA 4CLKA 5J2PB 4YB1P 2W9CB 2LU2A 1F5AA 3N5BA 3H5SA 3R5DA 4CLUA 1QAIA 4LF7F 2VL1A 1EQMA 1F9FA 1QAJA 3W60A 5EWFA 2PFFB 4OX9F 2MQQA 5I3UB 1H2TZ 2CADA 2KYXA 3BREA 3FSYA 2WSCC 5EX0A 1LWXA 3DLEB 1T03A 2PEHA 1U09A 1WKJA 2IAJA 1UP1A 1YRTA 1TQLA 4PAAA 2ZE2A 4IR9A 3MZIA 3SYZA 3Q8UA 1CJKA 3NS6A 2V9WA 2K1RA 2CVEA 1WEYA 2DGXA 1JLEA 2QYCA 2F63A 3P5BP 3MAQA 3FNNA 2WVEA 3QYYA 1HA1A 1TL3B 3KG4A 3QNWB 4LRFA 4URSA 2J9DE 3QBCA 5A0YA 4DFMA 4C3KA 4JI8F 5IQ6A 4DSLA 1HYSA 4YY3J 2ZZNA 4EK2A 2YPZA 3EM1A 5J2QB 1IR2A 3AXMA 2HS0A 1Z1ZA 2MKSA 3BDEA 1WDDA 2KHDA 5KT6A 1RTJA 4PG5A 2EXUA 3MFIA 3VAFA 4PWWA 5K5MA 4LT6A 1VBZA 3T9ZA 2X3GA 4FVMA 1S6PA 2GIFA 2MZQA 2YX7A 1BLUA 3GLJA 4HDGA 4NRUA 4ZVQB 4ER8A 1D1UA 1I51B 3OTCA 3T5JA 4A8XA 1IKVB 1WUUA 2CUYA 3DLGB 2WVCA 3C19A 4NA3A 2Z30B 5DJBA 2ZM6F 5CABA 2K3IA 4ZVTB 2VQEJ 4DF4A 3BGOP 1MROA 4X4SA 1X9WA 2VFVA 1OY9A 1TL3A 2YWWA 1KOHA 1NHUA 2BXJA 3CVKA 1E6VA 2NSBA 3LWLA 2VPWB 4DR4J 3J7YI 3CC4S 2F40A 1YLXA 3M8QB 4LF5J 2CJXB 1KNZA 1A6LA 3WX4A 1XWLA 1S6UA 4H4KC 4WK3A 4KKOB 1A9NB 3K2YA 1DTTB 4I6AA 3W8GA 5L39A 2ZBCA 4NRTA 3IP0A 3OQ2A 1RAFB 2CQ3A 3TQ1A 1NM2A 4G1IA 1MMNA 2XSJA 4KO0B 2H5EA 2KM8B 2M70A 1S1WB 5KT7A 3BPSP 2B5JB 2X7IA 2V69A 5LT5A 2V63A 3CIMA 3OXLA 4LR8A 1KKHA 2ILYA 4ZKAA 4RO0A 2O01C 1Q8KA 3HHDA 5A8KB 4QW9A 3LOUA 1YJTA 2MKYA 3T1HF 4BDPA 1U24A 1OSDA 1UCNA 2DR7A 2JX2A 2LQ8A 4MKBA 3HHNB 3D5MA 1RADB 3OBIA 5IV4A 1TL1A 2FC8A 2VG6B 5E3AA 5E3CA 4DL2A 3MMBB 1T05A 5L1JA 2V2QA 4M95A 3NGRA 3CB4A 1DRZA 4LVOP 2QSWA 3CJ4A 5HI7A 1JK9B 1M1HA 2E44A 4W98A 3FZ2A 2VKRA 5JJBA 1M5HA 2OMOA 4O44B 2FY1A 4CLLA 3MPWA 4ZJOA 2PMZD 2XLIA 1VQPS 2GVDA 2C2RA 1SJRA 4J9KA 1ZM2A 4J9SA 4OYWA 5D0EA 3GE9A 4LF9J 2ZH2A 2UUBJ 1SJ1A 3A8KA 4DLGA 3TZWA 4WF9Q 1X5TA 2DGSA 1SQFA 3HULA 1HMVB 1HD0A 2BKOA 3LAKA 5HJXA 2GJFA 3U1LA 3UNYA 2RE1A 3CPWR 1C1BB 5LMNF 2C2MB 1F3FA 5J2MA 2UXDF 3MM8B 2MDAA 3H4BA 1PIEA 3HVTA 3CCLS 1H7WA 3M8ZA 4OJ1A 3W7BA 4ED1A 4F3OA 2KXFA 1CVJA 4OI2A 1C2PA 1Y5LB 2IC3B 1BQXA 2YNGA 3GCXP 1H6KX 4DR1F 2R7VA 4F0MA 2UUCF 4C11B 3RAMA 1MU2A 2XMJA 4DLEA 3KLIA 3T5KA 2BE7D 2XYPB 4FYXB 4J5OA 3OTBA 5D77A 3WIVA 1RWKB 1TV6A 5ETVA 3MURP 2CA9A 2W9BA 1X9SA 1Q79A 2BOPA 2BRKA 3ITHA 1U47A 2OELA 4FBUA 4ANEA 1KONA 2CQGA 1ZAWA 3LP1A 1LQ9A 1FDDA 5H9FJ 1XNQF 4QIGA 1JB0C 2DNRA 1JMTA 3BKUA 3TUJC 4IR1A 3PV8A 3QAEA 2BV3A 1KEKA 2AEMA 2RQCA 4ECVA 4R0JA 1I94F 1HNZJ 2H1YA 3BBBA 1LW2A 2HVZA 4O44A 4Y65A 1YIJS 2ACMA 1UJ4A 1S6PB 4FYDA 2RT3A 3VGTA 3RRHA 4MK7A 4U96A 2J9EA 2M0GB 2WONA 2VZ9A 1V5VA 3BEGB 3MEDA 4LRCA 4QIFA 2FJAB 4DCPB 2E7XA 4LBHA 2R2TA 4JV0A 1NSQA 3NMRA 3C6TA 1XMOJ 4NCAA 4OHYA 2F8EX 5T7LA 4QU7A 3WIUA 4YFUA 2J0XA 3UWTA 4ZK7M 2MSSA 1IKYB 2ZOMA 3M7VA 1B4SA 2IM2A 3J80Y 1ULRA 3MUVP 4RW4B 4Y2CA 1F3VA 4NASA 1MWZA 4CYUB 4ZITA 4DUYJ 3PY8A 1KN6A 4USIA 2N4CA 4YB7A 3TYTA 5KG3A 1H72C 4ZCIA 4ID5A 4C4WA 2JDJA 1QD1A 4ECYA 4OYZA 2M5YA 3OTOF 4TKTA 3NWGA 2LEBA 3MFHA 1HNVB 3GV8B 2O1PA 4QPTA 3SCIE 1ZTWA 1HLWA 5E3RA 5ADZA 2IIHA 4GKKJ 2VC1A 1KVKA 3D0HE 4UY8T 2D74B 1X31C 3IXQA 4QIWD 4IQXA 2ZZMA 1HBMB 4X4NA 2G2YA 1FCAA 1PILA 1R0BG 2DGTA 1HHTP 1MWYA 3GSDA 3QT8A 1JJ4A 1F2HA 5E33A 3R1LA 2XNRA 4YUDA 1FD2A 2XGPA 5IS2A 2W01A 2KB2A 3K58A 3O1LA 2MKIA 2COLA 2FVCA 2IYIA 2HHSA 2FHOB 1KQFB 3CXCR 2NUHA 4AE5A 4YP3A 3E2EA 1XEZA 4CO3A 4XPEA 2V0NA 3QT5A 4WP9A 1U1KA 3FK4A 4WZMA 1SC1B 3PIPQ 4BCAA 2R7TA 2AHOB 3TO8A 3RW7A 4JV5J 2OPSA 3BB5A 3MF5A 2DXEA 3P4UB 3GYGA 3RG6A 2YWFA 2MQNA 5DDRC 4ECZA 2MLYA 3G82A 5J1EB 2R2UA 4KGKA 1KHVA 3GWCA 1OMSA 1R8PA 1VIXA 4F7VA 2KXNB 2F4VF 2FGOA 1RP5A 2NUUG 4DFKA 4FPIA 3SDEA 3JSYA 1S49A 1B64A 1T3OA 3OL9A 2XYGB 1DTQB 2OPRB 1A7GE 3TVZA 3EE3A 3IG1A 2QJ3A 4Q44A 1VDHA 3VVTA 1U1LA 3KK1A 2J7WA 2GVZB 2WSFC 2C2OB 2BJ1A 3BGRB 3DRRA 3JQMA 5IC4B 1RSCA 2JJ4D 1T9TA 1YRXA 1S9GB 3GTYX 4QQBA 1RAHB 2H4YB 1JLCA 5GAHU 4RU2A 4F8RA 4Z7YA 2FHJA 3UR3C 2UVUA 4B9VA 4E2FB 4ECUA 3RB6A 2J7KA 2J7UA 4UY85 2ASYA 2JHEA 3DLKB 2DHXA 2LLZA 2PC6A 1HD1A 3B4DA 4F4WA 3CCMS 3NNAA 2EFQA 1CC7A 2WBMA 4OYBA 3SDEB 5KG6A 3UCUP 4QCLA 3V6HA 2CDRB 1RBAA 2AYMA 3HSGA 4P6QA 1WG1A 3PXGa 4DEZA 2N7CA 2R7WA 2HGLA 4HYKA 1ZA2B 2W8LA 3D1QA 4XIUA 3W61A 2CZVC 2ZBPA 3ENAA 2A0FB 4OYIA 2QZ8A 4U8VA 1JLQB 5I4MA 3DCAA 5DO2A 3T1YF 1I94J 4B9TA 2WCXA 3LANA 5H1SV 1HNZF 1X5PA 2NXJA 1LFWA 2HPUA 1AZSB 3P8BB 3FRZA 3K7RA 1JXLA 3D28A 1LW0A 1LXNA 1GX5A 3L7OA 3DLKA 3FGVA 1SB6A 4TU9A 1S1TB 2CPZA 1NCLA 1VQ6S 2GO9A 3PYEA 4NEZA 1Q82T 1ZM3A 2WW8A 3CCTA 1BHNA 5GAEI 2CPFA 3OT9A 3R5AA 1JJCB 3QAUA 1WWHA 4Y2MA 4C8MA 1FNOA 3I4HX 3M2UA 2M88A 9RUBA 5A8KA 5IZHA 3PIOQ 2NQPA 2DEIA 2X1GA 4OZ2A 4ZPCA 2CJYB 1HHQA 3VGSA 3HHLD 4CLPA 4F0HA 4YHHF 1JLQA 2DVIA 1TL1B 2VG6A 3OL6A 2QGFB 5CD4H 5IOLA 4KHRA 1URRA 5U47A 4ILLA 3VF0B 4DPYA 3HP6A 1EX8A 5ETMA 3GIIA 1T94A 2RUSA 4A8OA 2GIRA 4LIWA 4MIWA 4WFBQ 5HANA 1DLOA 4X4TA 3Q8RB 3C3LA 3IN5A 2CQ2A 2FQQB 2ZJRQ 1FTRA 2ZVSA 1NUEA 3IR6B 2QL7B 5KG2A 2VKZG 4P2SA 2A1BA 1YZ6A 2BE2A 4A8YA 1VYAA 1SC6A 2JWNA 2BW2A 2IFXA 2VBXA 3SIPB 3WHIA 3JQKA 3QLHB 4DV4F 1LWEA 4KFBB 3C8YA 3GIRA 2RHQB 3DM2A 3ZZRA 4I68A 3G6ES 3A8EA 1JLGB 2FDNA 3QJPA 2LCWA 3N6LA 2XZDB 4J9MA 3AFGA 2HGNA 3EPGA 1AROP 4PWDB 1K47A 2GGPA 2N3OA 2GFFA 1JWWA 2AT1B 3ILJA 3UCGA 4KFBA 5DQGA 5EWEA 4CCHA 2AJQA 5GADU 2OGUA 3OR2A 4MJKA 3LP2A 1F60B 2RQMA 1J5OB 1N33F 3C6TB 4X4OA 4LRBA 2KFYA 3CJ0A 4IH5A 3PO5A 5BJRA 4K4XA 2XY6A 1O5JA 2DY9A 4JV2A 1WD6A 4ZVPB 1UZHA 3OFHA 4YEAA 2R7RA 1P9YA 5ETTA 2LECA 2DD8S 3CCZA 3MPUB 5HP1A 3NGSA 3DLEA 5LJ5Y 5KFHA 1OPIA 1X7VA 2AZ1A 1FKOA 4ZLPA 1L5UA 3DU6A 1JLEB 1N88A 3EGZA 3MXHP 2GAGC 2JFDA 2BRLA 3ETMA 1X4BA 3T19A 4LFBF 1ZZFA 3T9NA 4OZNA 3MCSA 1S0NA 2DR6A 3QGHA 4JOUA 3J81Y 3HT0A 2AEJA 3MEEB 1PYOB 2KHCA 4LBIA 1JLGA 2BACA 4WFYA 2PA8D 2XTJP 5B0BA 2DB1A 2HHPA 2I1RA 2D3O1 1SH0A 2I8EA 1PBUA 2A3JA 3UNGC 3I56S 3I96A 2XMUA 1WNEA 2G13A 2YKMB 3DLLQ 1R3NA 2WRMA 5G4DA 2U1AA 5ETPA 2LFVA 2KO1A 5E5NA 3H8YA 4QJVA 3TUPA 3IAM9 4OZJA 4G1QA 4NLDA 3JSMA 4M94A 3EYZA 2JEGA 2DHGA 3IM8A 4KH0B 2IJFA 4PXCA 5KFJA 2XCPA 3HM9A 5AE2A 1TP7A 1HWIA 3HFVA 4RW6A 2EKNA 1REGX 1K8AT 1NKBA 1HNXJ 4GC6A 2UVVA 3GIJA 4JI1J 5A8RB 2KKHA 2FVQA 1VIOA 1JNZB 1GT8A 3O3LA 4PWUA 5HSPA 2IRUA 3BGFA 2ZJQQ 5LMUJ 1BQMB 1LOUA 1O51A 2HNYB 5I42B 4NYZA 3CD7A 3M8PB 2WBRA 1QDUB 4QZVB 1X4FA 2MPUA 4DR2J 2Y8WA 4PG8A 4EMDA 1EB0A 1CQMA 1IR1A 1EAYC 1FEHA 3ET6A 3OPKA 3Q83A 3CT9A 2L9NA 4N7TA 2N4DA 2WB1D 3W64A 4DQIA 4PUOA 3MOJB 1UWAA 2JC1A 5F8NA 3AQPA 4RUCA 4O4GA 2ZKTA 3CW2C 1XR5A 4MK8A 3WBZA 4P10A 4RNFA 1IJFB 2E29A 3GPAA 2ROPA 5ETOA 4IRDA 4JV1A 4B9UA 2VFUA 5K20B 5F8JA 2B5JA 2CNLB 2ZBQA 3AB2B 4NXNF 1NLKL 2HKEA 3NP5A 2LQ9A 1FK9A 2Z2LA 4PCQA 3W2WB 1YJVA 3OFGA 2R2SA 3C16A 1FRJA 3H42A 5KFCA 3GONA 3N4WA 3TUIC 1TAQA 5ETQA 1IUJA 3TOQA 4DCOB 4ZVFA 3HVRA 2J76E 1XQIA 3RBZA 3R1HA 2L41A 2V67A 1SQEA 1H73A 1FERA 3O8WA 3V6DB 4OHWA 1UVNA 4CDIA 1CEZA 5FLXU 4JI2F 2K7JA 1TL4A 5IT4A 2BX6A 2RS8A 2YNIB 2C2EA 2QLJB 4Y3CA 2GMLA 3W5YA 4KGVB 3WZ0A 3HHKA 4XK8C 8AT1B 2VFTA 2KXHA 1U2CA 2VJVA 2W25A 4IFYB 1J5OA 2HW3A 2R8JA 2NSCA 1P1LA 2DIVA 4UOFA 1KR4A 1PCAA 5DG8A 2KM8C 4PG4A 2F4VJ 3Q0AA 2CDQA 5AXLA 2PI4A 2NR0A 2JLGA 2WHOA 3PO4A 1L3VA 1FRIA 4L76A 1VGYA 4FS1A 3W2WA 3PW0A 1SC4B 1RTDB 1XJWB 1U0SA 1RWWB 2MZRA 4XTTA 2XULA 1E6VB 1KP6A 1WHXA 1UEKA 3GYXB 2PSZA 2W2QP 3L7UA 3M30B 3FCVA 1KVJA 5H9EK 4ZPBA 2YKQA 4IYQA 3DGPB 1HMVA 2ZVIA 3QIDA 4C48A 1E6YA 4NMLA 3VAKA 2W2PP 3ZZOA 2IRYA 5BR8J 2GO8A 1QAYA 4ELTA 2RH3A 3P3DA 4XO0A 4WK1A 2NXEA 2QLBB 1R7IA 2JEIA 5T14A 4M8LA 2HRUA 5KFMA 4J9UE 3HHLC 2O5DA 3F44A 1RWVB 3KLHA 2VICA 5CHCB 1W2IA 5B0AA 2XMWA 1DTTA 4WYLA 4WKRA 4U9RA 5D4OA 2BKPA 4KT0C 1KFDA 1Q7LB 2UUTA 3F41A 4ZS6A 4NXNJ 3PEJA 2QX0A 2QA1A 3JTOA 5F0UA 1SKUB 1N5VA 4Y0FA 4CIOA 2Y1LB 4MKVA 5C42B 2ASDA 4NMXA 1C4CA 2CJQA 3DN9A 4KYZA 4ZMMA 1NNDA 4CO0A 5HVGA 1X0PA 1UVJA 3J81U 1APSA 3AB4B 2OTLS 3EWGA 1DQAA 1F2GA 1IKWB 1MLAA 4DZDA 3HVAA 2EG1A 2D3OR 4DL7A 4TNOA 3SQOP 3T6BA 4EO8A 2HZVA 1CJTB 2A2DA 4C8OA 1S1XA 4DJBA 1RWPB 2M52A 1JQGA 2HBRB 3CDAA 3QGGA 2R9LA 3MCMA 2DYAA 3CJKA 1JLFA 1T11A 3DI6A 4N56A 1S48A 2L9WA 4HHUA 2LVWA 4JB8B 4DU7A 2PFDA 2IM3A 4NLPA 4Q45A 1RWOB 1U7LA 1HBNA 4NCGB 1XNQJ 1MG7A 5DS7A 3T3FA 1RE1B 2ZOGA 3AJDA 2OHDA 3MM6B 4GKJF 2JEJA 1GMWD 3UFCX 4J9NA 3QWPA 1P27B 2Z8QA 1HI1A 3CMQA 4CYUA 5GAGU 1XNRJ 1VK3A 3Q89A 3MM9A 4EFAC 2OSRA 3SZ2A 4FXDA 3LW5C 2HBQB 2W7PA 3KLHB 2HMIB 2AGQA 2J0SD 1FVSA 2MQ8A 1BUXA 1UWBA 3ILLA 4YY3F 2WAQD 2MTLA 3CDEA 5ETNA 3W63A 1CQNA 3I0RB 5HBMB 3R6GB 3JTPA 4I2QA 4QW8A 5KFEA 4BHQA 2KFNA 1RHRB 1MSWD 4CP5A 3ZO7A 1WHWA 3LP2B 2HS4A 4LFAJ 2HQIA 4IRKA 2DIUA 3I31A 1DBDA 2RF2B 3QFHA 1RT6A 3R5GA 2KG1A 4KSEB 3N79A 3F73A 4B3MJ 3MM7A 2V4QA 1VS3A 1DY3A 2AX0A 2YQ1A 2MQPA 4M5LA 1QY7A 5KOXA 1OQ3A 2IA0A 2R7QA 1UA1A 4B3OA 1FD8A 3PYFA 2RAQA 3KXDA 1NK5A 1HWKA 1EKSA 1F9HA 5KFWA 4DV6J 3RBEA 3EGNA 2WONB 3ICLA 2FLNA 3TNVA 3UI3A 3TW0A 3LWMA 2ZH5A 1LV5A 1Z2LA 1QE1B 4ZP7A 3VGVA 2ZC3A 2MXYA 2QA4S 1YSJA 5I3UA 2JEFA 4OZ3A 2BUNA 3MM6A 1FHTA 2E5LJ 4R25A 3FVYA 3CCWA 5F9LA 2CIMA 3R5CA 3ZTSA 2V8PA 4I4BA 7FDRA 1Y5IB 4QWBA 4L3KA 5D4PA 5HVHA 4EEYA 3O5TB 4NZ0A 2UXBF 3SBMA 4DV7J 4ED0A 4J9OA 3JSMB 4CLYA 4J9PA 1FJCA 1YWXA 2KG0A 4CLSA 2YKMA 3HVWA 4DCJB 3KHLA 2VQFJ 2FHMA 4ECWA 5GVQA 2LDYA 3MI7X 4IFVB 5B0DA 2HNZB 2EPIA 4AXIA 1S4EA 4OHZA 3MUMP 4DUYF 1B3TA 4F2SA 2Z2YB 1S76D 4NXMJ 5HK4A 2VF3A 2QFIA 4QIVA 2B43A 5HMXA 3CJ3A 2Y0SD 2ZD1B 3UPFA 4IG3A 3UD4P 1YRUA 3C6UB 5KT3A 2H9ZA 2XBPA 2DGVA 4Y00A 1SL1A 2DH8A 2AJ2A 1RCOB 2BM1A 1ZH5A 2YKPA 4UUWA 5DZ6A 3PX6A 1WHVA 4BBYA 2XNQA 2CQCA 3GR0A 1HQEB 2KT3A 4RJVA 4CH0S 3OL8A 1VJQA 3G4SS 1IKVA 3CDBA 1HWLA 3POTA 1IWAA 4KPCA 3GV5B 2RDJA 2QLXA 2VA3A 3FQLA 2DNGA 4EBCA 2QLFB 1R8BA 1GMWA 4CTAB 1S0VA 1RKJA 1FWLA 2XHWA 1U45A 2VJUA 2JH3A 3SFGA 4MT1A 2ILZA 3K0JA 5D3GB 3I55S 3N0VA 5G0RB 1WEZA 1TUGB 1GEHA 2VV5A 3BR8A 3OR2B 5D4LA 5ITHA 1ZOTA 2WK4A 2Y3YA 3ZTPA 3A12A 4A46A 1Y00A 1XTZA 2HQFA 1S1VA 3DOKB 5GAGI 2L48A 5CYMB 1WC4A 1KHWA 1WSVA 1HR0J 3HSZA 1Y4ZB 1YTYA 3L4BC 2DGQA 2CKWA 2XO6A 2LYVA 4F4YA 3PG9A 1NHKL 4LF5F 1JKHB 4WPAA 4CLWA 1U02A 1IM4A 2ROGA 2EKYA 2WOMA 4M5HA 4X62F 1WKLA 3MAAB 3U7JA 4EYHB 4NLGA 2HMIA 3G6XA 1M1GA 2QL5B 3W9JA 1U1PA 4NA1A 4OI4A 2MLXA 3NLCA 2EVZA 4B3SJ 3VHQA 4JI4J 4NE9C 4RUAA 1HWUA 1GMVA 2Z58B 3G9CA 2HGMA 3QO9B 2AYBA 2HHXA 2GC8A 4ZPAA 3PFOA 2MKHA 3JTNA 3QZ7A 4IOCQ 4RNMA 1S6QA 3W9HA 3GFXA 3LAMA 1RI7A 4X4RA 2EFNA 3US5A 4JI7J 4DBQA 1NB2A 2RNEA 4DR3J 2W9CA 2CPYA 2H54B 5CYMA 4RKUC 3NGDA 2BQUA 1HNWF 2FZGB 3Q8PB 2MKJA 4KTQA 2PI5A 2CQPA 4BLGA 1TK5A 2G0JA 2D1CA 1SIZA 1UJ5A 5DM6Q 4YS2A 4DPTA 5LOQA 1JLBB 1S1UA 4DL5A 4E8UA 3KFWX 4KJIA 1BMQB 2IJNA 2WOMB 2JOQA 4CH7A 2I5JA 2VG7A 5A8WB 2YH1A 2UUCJ 4NLVA 1HPZA 3QJJA 3MGJA 4JI5F 1RAOA 1RDRA 1RHMB 3G87A 2Z0GA 1YJ9S 5KFOA 3DOLA 1UETA 1N56A 2P9EA 1H2VZ 4LF9F 1NDPA 2PMHA 1NK9A 1HYSB 4UZCA 3PRDA 1RTHB 4TXSA 3K57A 3NL0A 2RRBA 5LJ3Y 2DO4A 1RTIA 1ZA1B 4JI0F 4OV1A 3CUNA 2FC9A 4DR6F 3VAHA 3MEGB 3VAMA 2UXCF 4O3PA 5DRKA 2IVFB 2HRYA 2OIHA 5E2QA 1H0HB 1N32F 4DR5J 5L38A 2ZBIA 5I3PA 2FJXA 4J91A 4FVCA 4XDCA 3HI9A 2JNJA 3GCWP 3HD1A 8RUCA 4IG0B 1K44A 1BQNB 3BF4A 3P5TL 1S1TA 4U8YA 5D0GA 1WHYA 4C8KA 4LMZA 2RVJA 1FWKA 3CJRA 2AWZA 3HF5A 2HG4A 4O3QA 1D0EA 1NK6A 3SQGA 3NNCA 4NZ6A 4OIXA 3TZXA 4MTPA 3NBPA 1RT4B 1UKUA 1LNQA 3UW1A 3UD5A 2W4PA 4TLRA 4C8ZA 4X64J 4LF6J 1SC3B 1PAEX 3EVOA 4B9MA 1KOOA 1FA0A 2X1AA 1WTBA 1T3NA 4H4OA 1H2UX 5D4NA 2MGZA 2AYGA 2BJ7A 2UV8A 5C7PA 4HHJA 1IN0A 1XMOF 3OL7A 1B0PA 2Q3PA 4MYUA 1M5VC 4PG6A 1AXQA 3M9NB 4DX5A 5HROA 5KT2A 3CSKA 3QGPA 3PRBA 1EZZB 2P6SA 5CAAA 3GYNA 4J7CA 2J8AA 3CNQP 1X60A 3MM7B 1VBKA 3I0RA 1PJ7A 1ZPWX 2YNHA 5FIIA 4LF8J 3SCKE 4V19J 3CE8A 2XO7A 1NAQA 2MQLA 1G6BA 2NPIA 1TKXB 2OSQA 2XMVA 4K2JA 3RUBL 1N6QB 1PYTA 1HQ2A 2LQ5A 2OEKA 2DO0A 3EICA 4PEOA 1FXDA 2B6AA 2H5IB 3I5CA 3IO1A 3ZFVA 4CLFA 5HROB 1GNKA 3LP0B 2XS7A 1X8DA 4IG0A 1G2EA 4MMOA 2QV6A 2X1BA 4RW8A 3ZZTA 2G2ZA 2ZUAA 4WXOA 2HVEA 5K9FA 4R8UA 1MNEA 3L95X 2C22A 2POKA 3TAMB 3H4DA 3WC2A 3G2XA 3Q22A 3RR7A 3KHHA 3HMJG 4K4ZA 1U2FA 2LP4A 2JZ5A 4PPZA 1VRUB 1XNRF 1SH3A 1YQHA 1S77D 4ES2A 3ENWA 2CNNB 3M32B 2GIQA 3K5PA 2VOOA 4JYAF 4ED2A 5MLCV 4P9SA 4K0KF 3DFEA 2K7KA 2B3TB 4WP3A 3PHEA 2OJ3A 3NCQA 4K8RA 2IC3A 2FPHX 3IAS9 4HR2A 5C25B 1U49A 3VAGA 2IBKA 2H5JB 4AYBD 3NNHA 1GXLA 1RHUB 3BR9A 5FD1A 1D3WA 1RUSA 4N41A 3X1LB 1CJVA 1N5QA 4WFZA 2XMMA 2JRSA 4X4VA 4FNIA 5KG4A 3KK1B 3J7Z5 2C3OA 2A2CA 3DDIA 1HI0P 3T1AA 1RTZA 4ZVHA 4YB6A 2LXUA 4DL4A 3N9UC 1RTIB 2ZEJA 5BYSA 3VZHA 2CYYA 4ED6A 3RB0A 3QSIA 3NMAA 4KR0B 4GVLA 1UVMA 3E3XA 4D3HA 5FDLA 2UUBF 4C0OC 1NH8A 5DM7Q 1G4CA 3GJSB 2Q6BA 4ALZA 1KQSR 1XBWA 2L3MA 2QTWA 1L3SA 4NWBA 2OI2A 2GCFA 3BH6B 2E5LF 5KFFA 1ROFA 1ZZNA 1AA1B 4HTIA 2FY8A 3KG1A 3MUTP 4X2BA 1IQZA 2XY7A 4V19X 5KG5A 2F3JA 4OLPA 1NPKA 1ZS6A 2YNFB 3KWMA 3M30A 3GIMA 4MFBA 2E9RX 2M3DA 2UVWA 3DC2A 2GA7A 3LH2S 5KT5A 4QPXA 1U1MA 1WOSA 1S6QB 1RA7A 5KOWA 3TVYA 4C8LA 1OS5A 4ETXA 2VFRA 1IBCB 3K8VA 4CI0B 4L75A 2G0IA 2H65B 5KFPA 1N34F 2UUAF 1T9YA 4ZVSB 1U6ZA 2ZH8A 4O0IA 3IWNC 3NGTA 4ZJLA 3SV3A 2IDLA 3TP2A 3H0PA 2Z4PA 3GJRB 1LEOA 3FEXB 4QIEA 1XMQF 4DWIA 2KRBA 3N6MA 4ZVOB 4L6V3 4LBPA 4WBFA 5L1KA 2JFKA 1FI4A 2MSTA 2RJZA 3MAAA 3Q8VA 3KJQB 4K4TA 4LF6F 3PZPA 2VH7A 1RAJA 1PJ6A 4PQUA 5HO4A 1XIQA 2GX8A 3MM8A 4PYAA 1AZSA 5CQGA 3EDQB 3GFZA 3HHLB 4R5PA 1H3DA 2F65A 2MLZA 4ELUA 1J5EJ 1FE0A 2YNGB 3OW2R 3AH6A 2VHGA 2AF6A 2VDHA 1I6JA 4U7UD 4UOGA 1SJFA 1X4CA 2F9JA 2K8GA 4F36A 3CCUS 1RABB 4OV6A 4X66J 3MMAA 2BABA 1N5TA 5D6GA 1OY8A 4RW8B 1RHKB 4ANCA 1BWEA 3W8PA 4F26A 5DQHA 4WIIA 3O44A 1NKEA 3N01A 2VQEF 3L7PA 4LSZB 4RWXA 1LFPA 1FRKA 3K8WA 2QE5A 1LK7A 3R27A 4WTYA 5B0EA 2V4RA 1JJ2R 4C98A 1Z4UA 3UCZP 3CO0P 1Q5VA 2B9EA 1OYDA 4GO7X 4OX7A 4DX7A 4KC5A 4B3RJ 4MIBA 2GQQA 2GS8A 2AV5A 1CJUB 3POTB 3QIPB 4OYMA 3SCLE 3VR1A 2W8KA 4NOHA 4ZPTR 1SKWA 4GKKF 1TKZA 1O0PA 3PTWA 2R7UA 2X1FA 4LF7J 2BOAA 4NZ7A 4F04B 4NLOA 1N5YA 5I3QA 2G0CA 5F41A 4K5RA 4WFXA 1RZMA 3IRXA 2X3DA 1FFSB 3MR7A 4J90A 4N8NA 1SKSA 3J7A1 3UQSA 5L1IA 3MPDA 3QJLA 3IBFB 4EZ6A 3HD2A 3TJAA 4U6PA 3RAQA 2VG5A 3DYAA 5HN0A 3B54A 2CPJA 2C3YA 4C3LA 5KFBA 4DV3J 3AOAA 2KU7A 2BM0A 2H3EB 3BBCA 3RBXA 4J9LA 2DRBA 3I5AA 1VQYA 3AD7C 3BV8A 2MHNA 5KFQA 1T9WA 4K7QA 4C2MA 3BSCA 3Q8YA 4DQSA 5K14A 1QE1A 1HNVA 1SBRA 1N8RT 2GVDB 1UFWA 1UVKA 1L3KA 3KYLA 1RAGB 4X4PA 2AU0A 3CMES 1RAAB 1N33J 2LKZA 1OPZA 3MR6A 1VC5A 2BANA 1U4BA 1Q86T 3OUYA 4C0HA 2HHHF 4RLEA 2MKCA 3D68A 1S9FA 2ERRA 2DY1A 4LREA 2HK2A 1FKOB 1RBLA 4C97A 2CQDA 1N4LA 2WVBA 2BJ9A 4ZPVR 3IMQJ 4W92B 2EBEA 2RQ4A 4URGA 2HIQA 4X4QA 4B3MF 3I6PA 4ID8A 5GMKa 4P74A 4PXDA 1KLNA 3SFUA 5T41A 5L9XA 1BY9A 4LF4J 2VODA 2HHUA 2Z2MA 1Q8LA 4IRCA 3MWBA 1GAOA 4C3MA 3FSIA 4PXEA 3RU0A 3RAXA 3ZZYA 3HFKA 1Y3JA 2EI5A 2OLWA 3IG1B 3I0SB 4RNHA 5J2NB 2MB0B 3BSOA 3HPOA 4DSJA 1NSPA 4CO2A 2RS2A 2LQBA 4JI6F 4OX6A 3C14B 1C1CA 1GXTA 1P6TA 1XMQJ 4ZJQA 5T7LB 2RKIA 1RHJB 5A6WA 4F0KA 3MTJA 4K2XA 4NCGA 4ZN1A 2W9BB 2V8HA 3PRVA 5HAOA 1FFWB 1WC3A 1S7IA 2BANB 3DOMB 2DCLA 4DV6F 4F4KA 2M8HA 2ZDOA 3DM2B 1IBKF 5KFGA 4ED5A 1M5OC 4ZP6A 3D0GE 3VGUA 4G65A 1QJHA 4UOCA 4FYVB 4Q5VA 2IVYA 3M6WA 3GB0A 4B08A 3BSAA 4K50A 4FBTA 1U8WA 3HO1A 4O23A 5M2PA 3D6HB 3ZZZA 1RACB 3PYDA 4NCBA 1VQ5S 4CM2A 4ZLLA 2CNKB 4DPXA 1SPBP 2DH7A 2RRAA 4P73A 2R8KA 3MPVA 1D8ZA 3NG8A 4WU3A 1TKZB 1GTHA 2ZC4A 3EVWA 2JLFA 3CCSS 4MKAA 5LSLA 4K4UA 1Q16B 1VI7A 1Y7PA 3BH7B 3B82A 3EZOA 1IKYA 4P2MA 5IT9U 2E5JA 3PDNA 1KQGB 5IQQA 4N5SA 2YQ0A 3H25A 2HFOA 3IRXB 2UXDJ 3C16B 1SCJB 4RW9B 1WC0A 3V5RA 2R8IA 3KG0A 5KT4A 3EZUA 1T0TV 4PQAA 1OY6A 4PPDA 2KT2A 3UDCA 1GX6A 3MCOA 1KTQA 5KG0A 5K8MA 3M2UB 3O2IA 1U0HB 2DBBA 1AUSL 1C4AA 2GQ2A 5M2RA 3TX0A 4O4GB 1VQ4S 1DQ9A 9ATCB 1FRXA 4OI6A 4K4SA 1QAXA 2LXIA 1HARA 4LJMA 3GR1A 2F5GA 2W7AA 4QR0A 4UUXA 4ZHRA 2XMAA 4DX6A 3OJSA 1HBMA 4ZIVA 2LU1A 1FNMA 2R8HA 2SXLA 4IG3B 1P1TA 3PJ9A 2B51A 5DG7A 1DQ8A 3WDOA 4KH1B 3RW6A 1VQSA 4HHHA 1TV6B 1WI8A 2I5JB 2VG7B 4OYXA 1KQKA 3SSSA 4IFVA 1QM9A 3NS7B 4Z7CA 5JUMA 3BQ2A 2ZFHA 3PX4A 4M5MA 3NOGA 4M5DB 2HNZA 4K5SA 2KFZA 4P71A 3OVAA 2I9SA 2E1RA 2AP6A 3IWXA 1WACA 3HHLA 1K1QA 1SV5B 5FJ4A 4B9LA 1RWUA 2ZNZA 2YNIA 3EJMA 3M1VA 3U02A 4HI1A 2D41A 4NLSA 1Q7YT 5CYQA 5L8RC 1L3TA 2F4FA 1WOPA 1YJ7A 2DISA 2KVQE 4ZPWR 3X3UA 3V81A 1HKAA 1LWFB 1U25A 1S9GA 5GADI 3QZ8A 5J1PA 4LQ3A 4K4VA 1H98A 4ECTA 3KHGA 2GHWA 4CLTA 4ZHRB 1EJ7L 1IBMJ 3A3OB 4FS2A 1WG5A 2CAJA 3CJ2A 3K59A 5JMNA 3F56A 5IV3A 1U0HA 1NZAA 4U95A 4LQ9A 3FMBA 1XMBA 4GVBA 4B9SA 4PXBA 2O67A 1D09B 2YKOA 4PYDA 2FVSA 1QSYA 3PKMA 4N77A 1J2VA 3DXBA 5E0OA 1VHIA 3NGUA 4ZVRB 3ZTRA 2I38A 4F4XA 5J2QA 4FYWB 3MD3A 2KYZA 2D3ZA 3MECB 3J7ZT 1Q8BA 2HWHA 3ET6B 2KN4A 2FIUA 4HT5A 3ZNJ1 3VALA 4ECRA 2APOA 1CBKA 4YQWA 2D69A 2BVZA 1NEEA 4N47A 3BDPA 1FKPA 2RU9A 3DRSB 1RT4A 2BJ8A 2R4FA 3Q8QB 4YDXA 1CC8A 3BSNA 1YJWS 4JI0J 3U1MA 2EFOA 1X4EA 3TA1A 3DXSX 1VC0A 2OTJS 3AA8A 4WIQA 3DI6B 1FWPA 1T7PA 2OD6A 1SIWB 4QBUA 2VBWA 3W66A 4YMEA 1VQ7S 2E1AA 1RT7A 2DR9A 3DDNA 4M5GA 1HW8A 3NY0A 3GV7B 1HBOA 1QUVA 2YTCA 4OI3A 4RR5A 4EYIB 4DR5F 4O3NA 2ZM6J 2CQ4A 1FO1A 3MEEA 2FTRA 4DL6A 4OZ1A 1YITS 1TK8A 1FF2A 2E7VA 3LF0A 4NLRA 5B0CA 3NAIA 2V5HG 1NBEB 1MN9A 4CWBA 1IBLJ 4ED3A 1UA0A 1XK8A 3RB3A 2B7CB 1DFDA 3IGVA 3CJQA 1EQ0A 1VQ8S 3ZZPA 4EO6A 5KFAA 2BMBA 2FHJD 1SJ4P 1O6XA 3FBBA 2K06A 2O3DA 4FF4A 2ZWOA 5EDWA 2NYHA 1CPZA 3MMJA 5DZ7A 4P7VA 3A8IA 2Z57B 4USHA 5AXNA 4DX8H 1TKTB 7FD1A 2RIJA 2BE2B 3DU5A 3I87A 3O6QA 4C6AA 3TZYA 3QFWA 4LIRA 1PG5B 3Q24A 5HLFB 1OWXA 4NA2A 4K4YA 5JVHQ 2CVIA 1DLOB 3NKYA 1K1SA 3DRSA 4HLBA 2MJUA 4B17A 5ETKA 2QSFA 2QO3A 2XWXA 3L3CA 5IWAF 4KIAA 1FT8A 1NXIA 2EK6A 3IWLA 1X4DA 1T9XA 2QIFA 3R2DJ 4F2RA 4ID5B 4R5PB 4OX9J 1ZM9A 2VB6A 2NS1B 2J8SA 3K89A 4DV2F 1RT1A 1TMJA 1VK8A 3THVA 2E66A 5DQIA 1ZPVA 4UW2A 3TJ9A 1G3OA 3PW4A 1M5PC 1RT2A 3UDLA 3TJ8A 3V4MA 4DQQA 4ED4A 1TUWA 2HWTA 2YWHA 1IVZA 3MMAB 1NJYA 2A6OA 4H4MA 4DV1J 2DRAA 1R0AA 1RWXB 1MN7A 2V4JB 1I3OB 2XYHB 2H4WB 1LWFA 3PNIA 1GFWB 2ZHOA 1WSRA 2E5GA 2V34A 2P5VA 1N0UA 2PO4A 5DDOC 5AJ3F 1DZ5A 3PW2A 3BYPA 4JI8J 3C66A 2VD3A 4HH1A 1FDAA 3H98A 4CRJA 2XLKA 4HL9A 1FFGB 1JLFB 4NX9A 1JIHA 2LA6A 1Z2ZA 4GVBB 3KJVA 3GJQB 2DK2A 3B8HA 4KRWA 3OLBA 1YVFA 1UJ6A 2B0GA 4FYYB 2VG5B 3DYAB 5A76A 4O3OA 4RZRA 2YVSA 3ZNUA 1YBUA 3ISND 2AGOA 1NRKA 3LP1B 4AD6A 4LF8F 2Y8YA 4PR6A 3HXMA 3NXZA 1FDNA 2NPFA 5DGAA 3KDNA 2DNYA 4ENOA 1TELA 2OPQA 1HBNB 3WQPA 5D3GA 5HQMA 4DR4F 5F9NA 1DARA 3HSDA 2FJVA 1AUDA 1EETA 1VOMA 1NH7A 2FGCA 3IBCB 3T5LA 3D6MB 3DHWC 4FF3A 2FJBB 3PCOB 3H2VE 3DNCA 4AL7A 3DHXA 1FKAF 3JB9k 4RL1A 2JSXA 4JI6J 1NK0A 2DXDA 4DPOA 1A0OB 1S9EB 3H5UA 3R9LA 3N5FA 1HI8A 1WJ9A 3KMSA 3BJYA 4CLZA 4DSEA 4A8SA 4NEYA 1GMUA 2CPEA 3PM9A 3ZTOA 2PDAA 3DGVA 1W7WA 5EUHA 1T05B 2YX4A 2J6UA 4CNZA 2HLTA 3MMBA 3EGWB 3M2RB 2W2OP 1HQEA 3KDOA 4RPFA 4RW9A 4Y34A 3RZAA 5C25A 5KTQA 2IHR1 1U8SA 1UFLA 3PJWA 3R7SB 4RNNA 2D3UA 5CH7B 1ZETA 2FJWA 2V2VA 2ZH1A 4USVA 3T1HJ 2UP1A 2N7YA 3CC7S 2VBZA 1S9EA 5M2UA 3W65A 4XDDA 2YY3A 4MIAA 3E01B 3MEKA 3P45B 4Q7AA 2XY5A 2B9YA 2NCKL 2UUAJ 1EHWA 2DEJA 3KTQA 4P52A 1TTHB 4LVNP 3SXLA 4JI5J 1TUVA 2C3PA 3MM5B 1SQGA 3OR1B 2A6MA 2CPDA 2HEKA 3KUGA 3EGVA 4F3QA 5HQLA 4K59A 3K5MA 3CF5Q 4I7FB 2ATLA 2QN6B 2W4DA 5EGYA 3UDVA 5B0FA 1W25A 1JLBA 1S1UB 1DAXA 2ZH6A 4HACA 5EX3A 2GGPB 3H2LA 3CEDA 3OFEA 2YXLA 4IO1A 4ZOSA 2DTJA 3ZC4A 4B02A 5EN1A 1GXUA 4KB7A 4OL8A 3M8QA 3A13A 3DOMA 5D0RA 3IFEA 1DJ0A 1C1CB 4RBTA 4ZCLA 3CULA 1HQUB 1KDNA 2JC0A 3OVSA 1VQ9S 2VASA 4ZDNA 3OTDA 2OEMA 2EWHA 2Y0BB 1S59A 3UVJB 3QPIA 5H9EJ 1S1XB 2DRDA 2QC3A 1YZ7A 4LFAF 1M1KT 1M5KC 2J5AA 2CQHA 4UOHA 1R43A 1F1BB 1RGVA 5BYQA 3SCJE 2M8DB 2G4BA 3VAIA 5GMDA 2GNKA 2IYGA 1KS2A 2CPIA 3MOZA 1PYSB 2JLEA 2GVZA 1RKIA 1QLNA 4DV2J 2DNMA
chains in the Genus database with same CATH topology
1B99A 1NDLA 3WX8A 3FBFA 2ZUAA 2HVEA 1NHKL 3ZTQA 3ENAA 3G2XA 2HURA 4ANEA 1LWXA 1WKLA 2DYAA 1WKJA 3Q8UA 3MPDA 1WKKA 1MN7A 3PJ9A 3B54A 2BEFA 3BBBA 1PKUA 2B8QA 3BBCA 1NCLA 3VGTA 4HR2A 1JXVA 4EK2A 3Q89A 1NB2A 3EM1A 1BHNA 4S0MA 2AZ3A 1NSQA 4DI6A 3Q8YA 3EVMA 3Q83A 3EJMA 1BUXA 1S57A 1B4SA 3DDIA 3VGSA 1HHQA 4CP5A 3GPAA 2HVDA 5IOLA 2B8PA 1S5ZA 4ENOA 1F6TA 1NLKL 1NDCA 5CABA 1NDPA 3B6BA 3GP9A 1BE4A 2VU5A 1HLWA 1XQIA 3DKDA 3BH6B 3NGUA 2DXFA 1NUEA 3FC9A 3ZTRA 1NSKL 1HIYA 4O0NA 1VYAA 2DXDA 3BBFA 3R9LA 2BX6A 2CWKA 3VGVA 4ANDA 1NPKA 1ZS6A 3FCWA 3FBCA 3ZTOA 3FKBA 3ELHA 1W7WA 3ZTSA 1NSPA 4UOFA 4FKXA 5BXIA 4F4AA 3Q86A 3NGTA 1K44A 2DXEA 1UCNA 3FBEA 1LEOA 3L7UA 3PRVA 2NCKL 3FCVA 4WBFA 1EHWA 3Q8VA 3VGUA 4DUTA 1MN9A 3NGRA 1XIQA 3EMTA 3EVOA 1PAEX 2DY9A 4W98A 3EE3A 1U8WA 5C7PA 3FBBA 3VVTA 3NGSA 4UOGA 4F36A 4KPCA 3JS9A 2AZ1A 1KDNA 3EVWA 4ANCA 4C6AA 4FKYA 3VVUA 1S59A 5CAAA 1F3FA 3ETMA 3BH7B 4UOHA 1NDKA 4DZ6A 3ZTPA 3EICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B99 A;  1NDL A;  3WX8 A;  3FBF A;  2ZUA A;  2HVE A;  1NHK L;  3ZTQ A;  3ENA A;  3G2X A;  2HUR A;  4ANE A;  1LWX A;  1WKL A;  2DYA A;  1WKJ A;  3Q8U A;  3MPD A;  1WKK A;  1MN7 A;  3PJ9 A;  3B54 A;  2BEF A;  3BBB A;  1PKU A;  2B8Q A;  3BBC A;  1NCL A;  3VGT A;  4HR2 A;  1JXV A;  4EK2 A;  3Q89 A;  1NB2 A;  3EM1 A;  1BHN A;  4S0M A;  2AZ3 A;  1NSQ A;  4DI6 A;  3Q8Y A;  3EVM A;  3Q83 A;  3EJM A;  1BUX A;  1S57 A;  1B4S A;  3DDI A;  3VGS A;  1HHQ A;  4CP5 A;  3GPA A;  2HVD A;  5IOL A;  2B8P A;  1S5Z A;  4ENO A;  1F6T A;  1NLK L;  1NDC A;  5CAB A;  1NDP A;  3B6B A;  3GP9 A;  1BE4 A;  2VU5 A;  1HLW A;  1XQI A;  3DKD A;  3BH6 B;  3NGU A;  2DXF A;  1NUE A;  3FC9 A;  3ZTR A;  1NSK L;  1HIY A;  4O0N A;  1VYA A;  2DXD A;  3BBF A;  3R9L A;  2BX6 A;  2CWK A;  3VGV A;  4AND A;  1NPK A;  1ZS6 A;  3FCW A;  3FBC A;  3ZTO A;  3FKB A;  3ELH A;  1W7W A;  3ZTS A;  1NSP A;  4UOF A;  4FKX A;  5BXI A;  4F4A A;  3Q86 A;  3NGT A;  1K44 A;  2DXE A;  1UCN A;  3FBE A;  1LEO A;  3L7U A;  3PRV A;  2NCK L;  3FCV A;  4WBF A;  1EHW A;  3Q8V A;  3VGU A;  4DUT A;  1MN9 A;  3NGR A;  1XIQ A;  3EMT A;  3EVO A;  1PAE X;  2DY9 A;  4W98 A;  3EE3 A;  1U8W A;  5C7P A;  3FBB A;  3VVT A;  3NGS A;  4UOG A;  4F36 A;  4KPC A;  3JS9 A;  2AZ1 A;  1KDN A;  3EVW A;  4ANC A;  4C6A A;  4FKY A;  3VVU A;  1S59 A;  5CAA A;  1F3F A;  3ETM A;  3BH7 B;  4UOH A;  1NDK A;  4DZ6 A;  3ZTP A;  3EIC A; 
#chains in the Genus database with same CATH topology
 3GIK A;  2KVI A;  5HJY A;  4UTG A;  2CQ0 A;  5CZV A;  2B7B B;  4JI2 J;  3EXY A;  2HVI A;  4LSN B;  2IDE A;  2OPS B;  3WX8 A;  1FVQ A;  3FJ2 A;  3TUZ C;  2PII A;  1UAW A;  4OI0 A;  1W26 A;  3DMJ A;  2YNF A;  1WOR A;  1B0T A;  1WEX A;  3D3B J;  4HT7 A;  4ILR A;  5B7W A;  2RIL A;  5F3Z A;  3MR2 A;  2ZH4 A;  4X65 F;  1TL7 B;  1DUR A;  2QA2 A;  3IR7 B;  4JBC A;  2WW4 A;  5LSR A;  4M5I A;  3OTE A;  3VWS A;  4DXL A;  2C2K B;  1FXL A;  1KLM B;  3PFE A;  2RUG A;  1N36 J;  2IMO A;  3FMW A;  4ILM A;  2RD5 C;  2HZA A;  3S6E A;  1DHM A;  1HNX F;  4AFF A;  2VQF F;  2EW9 A;  1RIS A;  2DHS A;  3UE2 A;  3OUY B;  4KGZ B;  3RBD A;  1J5E F;  3AAW B;  4HVZ A;  3PR5 B;  2CPX A;  3FEY B;  2GHP A;  2XSF A;  4RW7 A;  1TKT A;  2EBG A;  5DLG A;  1HL6 A;  1QVF R;  1FNX H;  2XS5 A;  2OML A;  2BQR A;  2MY7 A;  1S57 A;  1X4H A;  2K1R B;  4WU2 A;  3J80 U;  2V50 A;  3NAH A;  5HL7 Q;  2ACY A;  5DET A;  4PRF A;  2Y1R I;  1S0M A;  1H7X A;  3EZ5 A;  2YX1 A;  4ATN A;  1UVL A;  5C42 A;  1UW9 A;  3EX7 B;  2B9W A;  1S6O A;  2ASL A;  4TU8 A;  3HFZ B;  4I2P B;  3MMC A;  5KFY A;  4NPO A;  4ECX A;  3DLB A;  2EC2 A;  4A8K A;  3I0S A;  5JXS A;  3T1Y J;  1M90 T;  2B56 A;  2AYE A;  1PJ5 A;  4QYR A;  4ZLN A;  2XGQ A;  2W9A A;  3OSP A;  1NSA A;  2RRN A;  4D3G A;  2W4C A;  1QSS A;  1VRT A;  2P2C B;  2V8G A;  4KV8 B;  1QVG R;  1YK9 A;  2B6A B;  3K5O A;  2XHC A;  1CJU A;  3QIP A;  5EHH A;  2R7O A;  1JLA A;  2F7V A;  1N6Q A;  3G86 A;  5K8P A;  3B78 A;  2UV8 G;  5AE3 A;  1RQ0 A;  1U1O A;  1WC5 A;  4KY3 A;  1FTC A;  2LDI A;  3H20 A;  1NU4 A;  1JXE A;  2HWI A;  3FBC A;  5CCL A;  5ETR A;  4EBD A;  2DCU B;  3EXC X;  4NYO A;  2NYI A;  3D2W A;  1UTA A;  2CZ9 A;  2DHA A;  2B4U A;  3AD9 C;  3IR5 B;  2FJD B;  3VAJ A;  2ZWP A;  3MED B;  3TAN A;  4NXM F;  2KTQ A;  4JV5 F;  2YKN B;  2MZ1 A;  2EC0 A;  3R5J B;  1SUQ B;  2IVM A;  2OFG X;  3TR5 A;  3KHR A;  5IT9 Y;  4X84 A;  1N48 A;  2L9D A;  4J9V A;  4CH1 A;  3BZQ A;  3DLH A;  4QYZ J;  4FF1 A;  5KFD A;  2UUW A;  1KSP A;  4ED7 A;  4ELV A;  1Q81 T;  3BYR A;  3QGI A;  5IM0 B;  3M4X A;  1RK8 A;  1RLD A;  3VTI A;  1Q0N A;  4A8M P;  3VZI A;  3N6N A;  2FLP A;  1EP4 A;  4DDF A;  5E3Q A;  1UWB B;  3TA2 A;  3H5X A;  3MCN A;  1S1W A;  3EMT A;  3DDK A;  4FDF A;  2LEA A;  2DGU A;  1AYE A;  1NPP A;  3OV7 A;  1HNW J;  1WF0 A;  2NZC A;  3C46 A;  4DR3 F;  2CG8 A;  3CD5 A;  2HQD A;  4YB5 A;  2W1B A;  4LFC J;  4C8N A;  1CS4 A;  1VFJ A;  1XC9 A;  1TAU A;  2FD2 A;  4W90 B;  4DR7 F;  4OYO A;  5JVG Q;  1VC6 A;  1YKW A;  2E5H A;  1CLF A;  4NLX A;  3NBP B;  4I67 A;  2E5I A;  1T95 A;  3GFH A;  2K2P A;  3M8R A;  5LMU F;  4ZPD A;  2HQ3 A;  1UW4 A;  3R2C J;  4PWD A;  1FRH A;  4Q8E A;  2DNL A;  1BD6 A;  1RLC L;  2MKK A;  5SZT A;  4DFP A;  2RSQ A;  2IM1 A;  2NZ4 A;  3KLG A;  3P6Y C;  4UQG A;  1UEV A;  3D4J A;  5LM7 E;  2PN6 A;  5GAE U;  4U7U K;  2HS3 A;  2MZS A;  1HBU B;  2KJW A;  4HH0 A;  1RT6 B;  1S0O A;  1MWQ A;  2YKN A;  2I6W A;  4ZCM A;  4NLW A;  4AQY F;  1FK9 B;  1NZ8 A;  2FB0 A;  2XI2 A;  5LL6 d;  4A4J A;  1T9U A;  3RR8 A;  1K73 T;  4Q2L A;  4PUO B;  4I56 A;  2CJK A;  2E7W A;  2CWX A;  1SJ3 P;  1U26 A;  2VBY A;  4B3R F;  2QG9 B;  1I5O B;  2G2O A;  3CCE S;  2V94 A;  4GC7 A;  1U1Q A;  1VJW A;  4JI7 F;  3M8P A;  2ZNY A;  4L72 B;  5A8W A;  3V6J A;  3E51 A;  3LAL A;  5AJ3 J;  1HPZ B;  2DNO A;  4DR1 J;  1S10 A;  4LUB A;  5DG9 A;  3KNG A;  1QUP A;  2YWG A;  1ACM B;  3THP A;  2DNZ A;  1BXN A;  1DTQ A;  2OPR A;  2VPX B;  1WKK A;  3LO3 A;  1B0V A;  3D6T B;  1TFY A;  1V6H A;  3HZG A;  2OEJ A;  1OSC A;  3D66 A;  3G82 B;  3S1T A;  3NS5 A;  1Q95 G;  3TAR A;  2BQ3 A;  4BWJ A;  3CTR A;  4RUB A;  4PQU B;  2ZD1 A;  4WCE Q;  2H48 B;  2ALZ A;  4DV0 J;  4GRS A;  2AJ0 A;  1H74 A;  3RJM B;  4QWE A;  4DR2 F;  4KKO A;  1NJW A;  3CDU A;  3SI8 A;  4IOA Q;  4C0B A;  3GG1 A;  3BO3 A;  2F8H A;  2QEX S;  4OJ3 A;  2DNH A;  2EFV A;  1N0V C;  3OFF A;  3IC1 A;  5KG1 A;  1R31 A;  2DGO A;  3BKF A;  1HQU A;  2CJA A;  1ZYQ A;  2CFX A;  3GMG A;  6AT1 B;  4FF2 A;  1E6Y B;  2B4P A;  2HBZ B;  1YGY A;  5LMN J;  1CG2 A;  3D54 A;  3M32 A;  1JJH A;  2I2Y A;  2QA4 G;  3AOC A;  3KLE A;  3BGR A;  4F25 A;  4DR7 J;  1FKP B;  2EFP A;  3TAP A;  1UL3 A;  3KLV A;  2VU5 A;  2NXN A;  4KBI A;  1D8Y A;  2L08 A;  3DKD A;  5B0G A;  3KJN B;  5F8M A;  3HT3 A;  2VIH A;  1VR6 A;  2AMC B;  4M1K A;  3G6Y A;  5LXY A;  3Q23 A;  1NSK L;  2FLO A;  3IM9 A;  4DV4 J;  4XPC A;  4YHH J;  2OPP B;  1KLM A;  3QRR A;  2N3L A;  3JSR A;  3THT A;  4NLU A;  1XR7 A;  3OXG A;  2QLW A;  3FCW A;  1M0S A;  3MAH A;  4AND A;  3FKB A;  1F0X A;  2WSE C;  5HAT A;  5IM0 A;  1TL7 A;  1KC8 T;  4LF4 F;  2GQC A;  1G7C B;  4QWC A;  1IQT A;  1R0C B;  4KGM A;  2RDD A;  1RU2 A;  4CNY A;  2VUG A;  4ZIW A;  2HBY B;  2AJ4 A;  2XEX A;  2Q43 A;  3CO9 A;  3LGM A;  4AUK A;  4LSN A;  3LUY A;  4CO5 A;  4UZB A;  1YX2 A;  3KLE B;  4ECQ A;  2UXB J;  4ZVU B;  2MQM A;  3FBE A;  3GG0 A;  2PT0 A;  1R6Y A;  3W62 A;  4DFJ A;  4WE1 B;  3BQ1 A;  4QR2 A;  2HRT A;  4AXJ A;  2KZZ A;  3A4T A;  1SJQ A;  1SV5 A;  4A8Q A;  3GFY A;  5K14 B;  3K5L A;  2C3M A;  1C0T B;  3I9V 9;  2AJ1 A;  3HKZ D;  4Q2M A;  1VRQ C;  2ALY B;  5HMY A;  3S7R A;  3UR0 A;  4DS5 A;  1IBK J;  4DV5 F;  4DL3 A;  1AB8 A;  1B70 B;  3QSY B;  2YBV A;  2N82 B;  2DNN A;  5J2P A;  2C28 A;  3S8S A;  3T5H A;  2ROE A;  4URQ U;  3W2V A;  1WG4 A;  2VOP A;  1PBA A;  4QR1 A;  4USJ C;  3IBW A;  4WTO B;  1D9D A;  1HNI A;  5F0W A;  2XZT B;  3HJF A;  3OR1 A;  5J1E A;  2Z56 B;  3QT7 A;  4FKY A;  3MHY A;  4I7F A;  1C0T A;  1N54 B;  5ETS A;  3TAM A;  1HBO B;  2ADB A;  1Y3K A;  5KFR A;  2HHH J;  1SI9 A;  2BKN A;  3FRY A;  2CNO B;  2F8M A;  3ONQ A;  1Q1K A;  4DUZ J;  5E41 A;  2HYI B;  2HAI A;  1F5C A;  4WJB A;  3CC2 S;  4ZP9 A;  2ABY A;  2LMI A;  4X65 J;  1NDL A;  2H51 B;  5IC6 B;  3I32 A;  4FZV A;  2HZC A;  1AFI A;  4N76 A;  4P75 A;  2D7S A;  2OFH X;  4B3O B;  4RBU A;  2O66 A;  1HR0 F;  4NLY A;  1R6V A;  4AL5 A;  2V2K A;  4J9R A;  1RTH A;  1NJZ A;  3JQJ A;  4ES3 A;  3PYG A;  2AQ4 A;  1JLC B;  5DDQ C;  5C5J A;  3S01 A;  4HEA 9;  2NRE A;  3JYT A;  1V3R A;  2V6A A;  3D9B A;  3HLU A;  1I1G A;  4TLQ A;  3RB4 A;  2J6T A;  4RNO A;  5GME A;  2IRX A;  4B3S F;  2YWK A;  4TY8 A;  4DN9 A;  2AGP A;  5CD4 A;  5L9N A;  3CCV S;  1PKU A;  3R7B B;  2HSE B;  5C2C A;  1NME B;  1EET B;  1OJ4 A;  2B8Q A;  3Q2S C;  4OJH A;  4UQT A;  2GJI A;  1FX2 A;  5KFU A;  1SL0 A;  1RAE B;  1JXV A;  1B7F A;  5KG7 A;  4S0M A;  4WFN Q;  2OPQ B;  3GU0 A;  1Q5Y A;  5CCM A;  4F50 A;  1NHV A;  4ERD A;  1HNI B;  4DI6 A;  4ITS A;  1RT3 B;  1VQK S;  2CG4 A;  3HJV A;  2JVO A;  2PD1 A;  2WZ1 A;  1WDT A;  5D15 A;  3KLF A;  3RRK A;  1O8B A;  5HLF A;  3I4P A;  2NXU A;  4KHP F;  3FSX A;  3QO9 A;  4BC7 A;  1FX4 A;  4ZVG A;  4JUZ A;  2DPJ A;  5KFI A;  1IXK A;  3ZXW A;  5AT1 B;  2HVD A;  1GTE A;  3P49 B;  2B8P A;  1MU2 B;  5E7O B;  3MM9 B;  4BWM A;  3ULH A;  3W5Z A;  3OHA A;  3CCR S;  2DNP A;  2V4J A;  2LEP A;  3L09 A;  2FZC B;  3ZZU A;  1RT5 B;  1Y10 A;  2QRR A;  4FXW A;  4IUF A;  3B6B A;  4DOZ A;  2XM3 A;  1P8G A;  2RU3 A;  1UPM B;  2GAH C;  4C7Q A;  3CD6 S;  1IWG A;  1R27 B;  3NGK A;  3SV4 A;  5GAH I;  2Q6C A;  1RT2 B;  4I6W A;  1CUL A;  2R3V A;  1FRM A;  1N34 J;  1C0U B;  4J37 A;  2UU9 F;  2XMT A;  5F8G A;  4O0N A;  3BBF A;  5KFS A;  4DHV A;  4BS2 A;  3NCR A;  2MYF A;  3ELH A;  3LA0 A;  4I2Q B;  2KH9 A;  1Y11 A;  4L3N A;  2B9X A;  2KJV A;  3PJX A;  1U2R A;  4I64 A;  4OLO A;  2CRL A;  3SSQ A;  2E9T A;  4TU7 A;  2ZIT A;  2VON A;  4CT8 A;  2HHT A;  2HFZ A;  4R0E A;  4DV7 F;  3TEG A;  4CTA A;  3K17 A;  3QWU A;  3TA0 A;  3AOB A;  1F5B A;  4OJG A;  3HKW A;  5SUH A;  4RW6 B;  2UZA A;  1BGX T;  2X51 A;  2NLW A;  3SEO A;  3EDR B;  4KHP J;  4OHV A;  3BO4 A;  1VRT B;  3H2U B;  4KV8 A;  1IBM F;  4W4M A;  4ZP8 A;  3HDS A;  5A0Y B;  1K0T A;  3Q2T C;  5BR8 F;  3UN3 A;  4Z37 A;  3RRG A;  1CJK B;  4XAK A;  4C9D A;  2R42 A;  4RU9 A;  4EWT A;  4TQS A;  1H38 A;  4Q0B B;  1MML A;  2K3K A;  2MMY A;  1YBT A;  2M2B A;  2PMW A;  3GJT B;  2W24 A;  1RT5 A;  1SH2 A;  2KI2 A;  2PEB A;  2FVP A;  5L1L A;  2J6S A;  2BDP A;  4I1T A;  3BGU A;  1PC4 A;  3J81 j;  1T03 B;  2ZH9 A;  1D9F A;  3J7A N;  3M6U A;  3KK2 A;  3ISN C;  4DV5 J;  1IKW A;  2P9C A;  3AD8 C;  1VQO S;  2YKA A;  1WF2 A;  4KHM A;  5DLF A;  3FDS A;  3W3S A;  3FQK A;  4H4K A;  3IA0 A;  4TQR A;  4DQR A;  3AT1 B;  1KVI A;  5KFL A;  1JKH A;  2FYX A;  3R5B A;  1EAR A;  4YR3 A;  1MRO B;  4QOT A;  1TR0 A;  3V6D A;  2Q66 A;  4USU A;  1KBR A;  1NK8 A;  3G71 S;  4IH6 A;  2B4O A;  4NLQ A;  3JAM U;  3K5N A;  4C8Y A;  1UFK A;  2WTF A;  5HP1 B;  2C2N A;  1B99 A;  2DNQ A;  4HTJ A;  4MYT A;  2RDI A;  1S79 A;  2OP5 A;  4ICL B;  3G6V A;  3AOD A;  2UU9 J;  4ED8 A;  4IDK B;  2J9D A;  4IFY A;  1FJE B;  2CQI A;  2IA6 A;  3D3C J;  2E1P A;  4PKD B;  4TYB A;  3GQC A;  4DS4 A;  3OTO J;  3ADA C;  3IS9 A;  3EPI A;  4ZLJ A;  1V3Z A;  2C2D A;  1TFW A;  2KL8 A;  4RUH A;  3BPD A;  2FLL A;  4E98 A;  2QT7 A;  1N52 B;  2EFG A;  3MEC A;  1Q8I A;  1WI6 A;  4USK A;  1Q53 A;  3W1Y C;  2BEF A;  3OXF A;  2RQK A;  4MFB B;  4OMF G;  4OYA A;  3JXO A;  2BJD A;  1U1N A;  2OKQ A;  1Y0H A;  4CZC A;  4PAB A;  1TK0 A;  6FDR A;  4F02 A;  3DRR B;  3A8J A;  3LTO A;  1R8A A;  5THW A;  1RWN B;  4WE1 A;  3R97 A;  2Y1I A;  2HHQ A;  1S72 S;  2MHE A;  1TVR A;  2HK3 A;  2IAJ B;  1VLY A;  3EVM A;  3LPE A;  4DF8 A;  4RWW A;  2R7S A;  3UVJ A;  3OVB A;  1T02 A;  1S7H A;  4FN5 A;  1ICE B;  1T8E A;  5FLX Y;  4YR2 A;  5KFK A;  4JI3 F;  2HHW A;  2AD9 A;  3LPY A;  5C24 B;  4B9N A;  3VQS A;  3SQG B;  4Y2A A;  5D8H B;  5F8L A;  2NXC A;  2VC0 A;  2J0W A;  3M8W A;  4LFB J;  1IR0 A;  1YJU A;  4N8O A;  4WZQ A;  4L73 A;  2ADC A;  4J9Q A;  5I42 A;  3MEG A;  2JVR A;  3HVT B;  1PSD A;  2EK1 A;  3QMQ A;  4LR7 A;  3U1N A;  5RUB A;  1NKC A;  1RBO B;  2MZJ A;  5A8R A;  1CJT A;  2ZH3 A;  4EBE A;  4DMZ A;  2LA4 A;  1XER A;  2BR0 A;  4IKA A;  4YOE A;  5IFM A;  1K0V A;  3B4M A;  5AXK A;  2DXF A;  1RJJ A;  4CQ1 A;  3FC9 A;  2J0Q D;  1KD1 T;  4RW7 B;  1SUQ A;  2CJB A;  1HIY A;  2GV1 A;  4OZL A;  2LQJ A;  5A6P A;  1VQL S;  4IOB A;  1AW0 A;  3J7Y U;  3OLA A;  2XWY A;  2ZDP A;  4A47 A;  2QMX A;  1VQN S;  5D0H A;  4DPW A;  2UXC J;  2CWK A;  8ATC B;  1T9V A;  3LGN A;  1ZTT A;  3EUN A;  2BJ3 A;  2G9O A;  4WP8 A;  3R8Y A;  5KFT A;  4DL0 C;  1LWC A;  2W2N P;  3M05 A;  3M2V B;  3GSI A;  1EKR A;  4NI2 B;  5FDL B;  5B09 A;  3QRQ A;  3V6K A;  2M9K A;  4OI1 A;  3T6J A;  2MZT A;  2AX1 A;  1UMJ A;  3BS9 A;  3H90 A;  3AXK A;  3D67 A;  3Q86 A;  2WVF A;  4NYP A;  4F4A A;  2E1M C;  4X4U A;  3A3N B;  3CDW A;  3DOL B;  2DGW A;  3MR5 A;  1NK7 A;  5HBM A;  4NLT A;  2W2M P;  2V9K A;  2YQ3 A;  4IQM A;  1FJ7 A;  4DV1 F;  4CT9 A;  2PE8 A;  2ASJ A;  2DR5 A;  1S99 A;  2OO4 A;  2RB7 A;  1G1X A;  1X9M A;  3OD2 A;  4IH7 A;  1IJE B;  2DHH A;  4FNH A;  4DG1 A;  2B4V A;  4LR9 A;  4ETZ A;  1FJG F;  2Q1L A;  1YG0 A;  3JAM Y;  4U67 Q;  3RGI A;  2FVR A;  1TL5 A;  5ETL A;  3KJV B;  1SVD A;  4LSL B;  3M2V A;  2WB4 A;  4NI2 A;  4FPR A;  1UVI A;  3BGL A;  4EGL A;  3AY0 A;  3NRB A;  3H5Y A;  3MPY A;  1PAU B;  1ZAV A;  4K0K J;  4CM0 A;  4YDD B;  5AE1 A;  3JS9 A;  3C2P A;  4DUZ F;  5HMZ A;  3BO2 A;  2MJN A;  3BM7 A;  4A8W A;  1ZAX A;  3HCX A;  1RTD A;  1N32 J;  4DG1 B;  1W2B R;  5CZX A;  5DDP C;  1LW2 B;  3DRY A;  4Y2K A;  2R7X A;  4DSI A;  3BKT A;  1NDK A;  1CUL B;  1REV B;  1ZM4 A;  2KDO A;  4DZ6 A;  4A8F A;  4Y2I A;  5HVF A;  3HK2 A;  2ZH7 A;  4HDH A;  1KWM A;  1FES A;  3OSN A;  3CIZ A;  3FUY A;  3LGH A;  1EP4 B;  4EI2 A;  3TAQ A;  3TI0 A;  2VDI A;  2UVR A;  2A10 A;  2DKO B;  3F0N A;  4P72 A;  3G8T A;  2XS2 A;  2J9C A;  3KKF A;  3QRP A;  1TZ0 A;  5H9F K;  1GH8 A;  4FXV A;  2FUG 9;  2XCA A;  4MAK A;  2AKW B;  4LSL A;  3BN7 A;  4M5D A;  4RX6 A;  2HUR A;  4B3T F;  1UPP A;  2IMW P;  4AQY J;  4Y28 C;  5B08 A;  2E1C A;  4M63 A;  3R7N B;  1VQM S;  1KRP A;  1HFE L;  3FZB A;  3L9Z A;  4JI4 F;  1VCT A;  3FEZ A;  1LK5 A;  1WF1 A;  3CJT A;  3CCQ S;  4DSF A;  1V5I B;  2XC9 A;  1SKR A;  2DT9 A;  3E01 A;  4JYA J;  1YJR A;  2DIT A;  2XZW A;  3C15 B;  4H4O B;  2EEY A;  2MGZ B;  4QWA A;  2VA2 A;  1YBA A;  1R8C A;  3AA9 A;  3TQE A;  2QYG A;  2M4M A;  1LXJ A;  2I0X A;  2FZK B;  3Q8S B;  1X4G A;  2HQG A;  5EWG A;  3AJ1 A;  3CCJ S;  2AZ3 A;  1JNR B;  2Y1J A;  2PA3 A;  2XI3 A;  4MK9 A;  5LSO A;  1NJX A;  1SL2 A;  4LFC F;  3CWJ A;  1R8H A;  3SSR A;  3G96 A;  2XB2 D;  3RYL A;  1FJG J;  3HHE A;  1NK4 A;  4GKJ J;  2F1F A;  3TVK A;  2CPH A;  3R3T A;  3V2U C;  4EZ9 A;  1RYR A;  1YHQ S;  2IBO A;  5F3T A;  3N28 A;  1HBU A;  4GO5 X;  4HKQ A;  4F4Z A;  1FEE A;  2GW8 A;  3ETO A;  3FFI B;  1NDC A;  2ZBR A;  1D9A A;  1RCX B;  3LQV A;  5HQ8 A;  2JL9 A;  2IY5 B;  3KLG B;  2FHK A;  4P7T A;  3KJF B;  2YH0 A;  2OH2 A;  1BE4 A;  2XSJ B;  4KO0 A;  4O3R A;  4MH8 A;  1HHS A;  3PR4 A;  3KMQ A;  5F8I A;  1OO0 B;  1VHF A;  1RWM B;  2QMW A;  4G1Q B;  2Y9H A;  2HFS A;  5K8O A;  2BZ2 A;  1VRU A;  2HFU A;  3MTK A;  4OZ5 A;  2G1H A;  4Y6I A;  3NCP A;  1QSL A;  5IWA J;  1IKX A;  1RA6 A;  1S4F A;  3I9Z A;  1RXO B;  2D9P A;  3TRG A;  2DR8 A;  1YJN S;  3KNA A;  2V8V A;  4U7C A;  1JX4 A;  2AJF E;  1MMD A;  1VBY A;  1B7Y B;  1KTV A;  3CJ8 A;  2GZO A;  4V1A k;  3TZZ A;  2DPI A;  3W2V B;  2HFV A;  4FKX A;  5AXM A;  1HWJ A;  4AT1 B;  4ECS A;  4DSK A;  3E8O A;  2AIR B;  5D78 A;  1TVR B;  5BXI A;  1QTM A;  1FXR A;  2MQO A;  2C42 A;  2CJ9 A;  4E0D A;  4YN3 B;  1Y9O A;  5KFV A;  4F3M A;  1MW7 A;  3CGI A;  1X0F A;  2QL9 B;  3TWZ A;  2HHV A;  2KT5 A;  1N5S A;  3H7H B;  4EUV A;  1LW0 B;  3H59 A;  2OD4 A;  2DNK A;  3PW7 A;  3QT6 A;  5CA5 A;  2EG2 A;  3JSB A;  4ZVE A;  1OQ6 A;  5J2N A;  1U1R A;  4DR6 J;  3PX0 A;  2E9Z A;  2GMH A;  4DUT A;  1K9M T;  3M6V A;  5C2G A;  3UO0 A;  4NL5 A;  3W5X A;  1RYS A;  2OPP A;  3V81 B;  1EIY B;  2RML A;  1RAI B;  5KAK A;  1REV A;  3M1V B;  1UZD A;  1X5S A;  2BYC A;  5A2Q Y;  3A3P B;  1J27 A;  1RT1 B;  1PO6 A;  1ITP A;  2Q79 A;  4TYA A;  1RTJ B;  3MR3 A;  1AFJ A;  4I6Y A;  4C11 A;  2OUG A;  3MDF A;  3I5B A;  5LXR A;  3MMC B;  4DV3 F;  3CMA S;  1WEL A;  2XMK A;  2BBE A;  1OYE A;  3ZZ0 A;  4G1P A;  2V2Z A;  1U6F A;  4I69 A;  5KFX A;  3A1Y G;  1BWV A;  2IJR A;  4OYP A;  4OFZ A;  3VVU A;  3D7S B;  4USM A;  4ZN3 A;  2BE9 B;  4M5N A;  4AL6 A;  3H40 A;  3ITH B;  2C2Z B;  4WWS A;  3TEH B;  3C6U A;  4PZV A;  2KZM A;  5IT0 A;  2V68 A;  4GMK A;  4CO4 A;  5J1N A;  4QYZ K;  3QAT A;  3D1O A;  2ATC B;  3HZE A;  2HAF A;  3KUH A;  4I2P A;  1R89 A;  3AHP A;  3DLG A;  3D6F B;  3M8Y A;  1LWE B;  4LRA A;  3KK2 B;  3M8S A;  1URN A;  4Q0B A;  4B3T J;  2OAU A;  3KUE A;  2HQC A;  3FBF A;  3HX9 A;  4CO1 A;  3V4I B;  2DH9 A;  2ZJP Q;  2CXE A;  4H54 A;  4WXW A;  3ZTQ A;  3W9I A;  2AW0 A;  4KE5 A;  5L46 A;  3R6L B;  1TKD A;  3DRX A;  3UDE A;  4HI2 A;  4RW4 A;  3KK3 B;  2IPO B;  3PAC A;  4WYW A;  4Z2X A;  2PGC A;  1XR6 A;  1IM6 A;  3BN4 A;  1RT3 A;  3ILI A;  4QWD A;  4JI1 F;  4QU6 A;  1JLA B;  2HND B;  1TMM A;  2G1D A;  3DRP B;  1S1V B;  3DOK A;  3I82 A;  3NOC A;  3QLH A;  2YWE A;  1VMB A;  4ZA1 A;  1TU0 B;  3SMZ A;  3D1H A;  3CJS A;  2LXF A;  4USW A;  2F9D A;  4X66 F;  1LWC B;  2BJE A;  2ZKU A;  5G0R A;  2WVD A;  1U6B A;  1RT7 B;  3ISZ A;  3DGP A;  4KGX B;  2GHV C;  4JI3 J;  3PEH A;  4RBV A;  4Q8F A;  1BC6 A;  4F67 A;  2VPY B;  3NWR A;  3UN2 A;  5BYR A;  1SXL A;  1N5Y B;  4X62 J;  1FRL A;  2QMU B;  4M5J A;  4X64 F;  2BW7 A;  4TN2 A;  1RHQ B;  1WC6 A;  1IBL F;  3GZ7 A;  3V4I A;  1YDL A;  1AT1 B;  4UST A;  1P9Q C;  2AEF A;  3DMJ B;  2Z2Z A;  4PG7 A;  3G8S A;  4A48 A;  1CS4 B;  1C0U A;  1LKZ A;  2M7S A;  4LF1 A;  3M2R A;  3T41 A;  4UT4 A;  3P96 A;  1NPR A;  3PW5 A;  2XQC A;  1WTF A;  4OHX A;  2W7O A;  1NJI T;  3KOA A;  7AT1 B;  2CZ4 A;  1S5Z A;  3D0I E;  1YI2 S;  5CYJ A;  1F6T A;  4IO9 Q;  3AJ2 A;  2RKI B;  1VBX A;  3ILO A;  1VLO A;  4KQZ A;  1Q4R A;  1PC5 A;  1WC1 A;  4KAI A;  3GP9 A;  4DU8 A;  3PHT A;  5CYQ B;  4LF2 A;  1UEU A;  1WOO A;  2CQ1 A;  3CD0 A;  4ZCK A;  3C14 A;  2ZZT A;  4Q43 A;  4O3S A;  4KPY A;  3KLI B;  2V8D A;  4DQP A;  3MM5 A;  2C3U A;  1RU1 A;  3HSJ A;  3M9O B;  1L3U A;  3VQT A;  1PGZ A;  4M5K A;  4R8U B;  1C1B A;  5J2M B;  2MY8 A;  1NO8 A;  4JP8 A;  3KLF B;  4LRD A;  2ZHA A;  3LP0 A;  2ZHB A;  2HIY A;  3MD1 A;  2YNH B;  4HAC B;  2P9G A;  5C24 A;  3AQO A;  1XN9 A;  4G6V B;  4L74 A;  3RTV A;  1FE4 A;  2KRR A;  4TVA B;  3WC0 A;  4BC9 A;  1TKX A;  3U27 A;  4DV0 F;  5MAO A;  4H4M B;  3UN5 A;  5DGB A;  2GJ2 A;  5A2Q U;  2XLJ A;  3GIL A;  2R2R A;  2R8G A;  3CJK B;  2MEW A;  4TY8 B;  4OX8 A;  4DN0 A;  1OIA A;  2IM0 A;  2A18 A;  2FJE B;  2U2F A;  5KFN A;  3BQ0 A;  1QTN B;  4TY9 A;  1S12 A;  3IRW P;  1Q78 A;  1VIS A;  3TX8 A;  3OHB A;  1N36 F;  2YPY A;  1RB0 A;  2HNY A;  2ZOF A;  4EU0 A;  2VPZ B;  6FD1 A;  4WFA Q;  1X4A A;  4P2X A;  4UF4 A;  3ENV A;  5IXU A;  3G8Q A;  2QFJ A;  5CXT A;  2HVH A;  2RF2 A;  3UD3 P;  2XG8 A;  1ELO A;  1X5O A;  3VV2 B;  4ES1 A;  4YR0 A;  1R0A B;  3DLJ A;  3QQC D;  3OJU A;  2GMJ A;  4WKY A;  3C15 A;  3FCH A;  1FDB A;  3NEK A;  1HW9 A;  2P6T A;  2BA9 A;  4FP9 A;  1V9O A;  1GQE A;  3PKY A;  1M5S A;  5KFZ A;  5K8N A;  4OZ0 A;  3IS9 B;  2P8I A;  1BQM A;  2C1E B;  3ENQ A;  1KFS A;  1NB7 A;  3FFI A;  3PVX A;  4G3I A;  2ZUG A;  4ICL A;  1S97 A;  1Y5N B;  2ZE2 B;  4IDK A;  5HMW A;  4DPU A;  5E3P A;  2DJW A;  5F8H A;  2VFS A;  1CJV B;  1IKX B;  2HFN A;  1BQN A;  4P2F A;  1U48 A;  3M6X A;  1ZBT A;  3IGN A;  3M9M B;  1V3S A;  4MKY A;  3CJ5 A;  1F9E B;  4OQJ A;  2RHS B;  4I0W A;  4O4R A;  3KK3 A;  3JYT B;  4K4W A;  3VCD A;  2D9O A;  2HND A;  2CQB A;  2HLU A;  3DRP A;  1GK8 A;  1CSJ A;  4CLK A;  5J2P B;  4YB1 P;  2W9C B;  2LU2 A;  1F5A A;  3N5B A;  3H5S A;  3R5D A;  4CLU A;  1QAI A;  4LF7 F;  2VL1 A;  1EQM A;  1F9F A;  1QAJ A;  3W60 A;  5EWF A;  2PFF B;  4OX9 F;  2MQQ A;  5I3U B;  1H2T Z;  2CAD A;  2KYX A;  3BRE A;  3FSY A;  2WSC C;  5EX0 A;  1LWX A;  3DLE B;  1T03 A;  2PEH A;  1U09 A;  1WKJ A;  2IAJ A;  1UP1 A;  1YRT A;  1TQL A;  4PAA A;  2ZE2 A;  4IR9 A;  3MZI A;  3SYZ A;  3Q8U A;  1CJK A;  3NS6 A;  2V9W A;  2K1R A;  2CVE A;  1WEY A;  2DGX A;  1JLE A;  2QYC A;  2F63 A;  3P5B P;  3MAQ A;  3FNN A;  2WVE A;  3QYY A;  1HA1 A;  1TL3 B;  3KG4 A;  3QNW B;  4LRF A;  4URS A;  2J9D E;  3QBC A;  5A0Y A;  4DFM A;  4C3K A;  4JI8 F;  5IQ6 A;  4DSL A;  1HYS A;  4YY3 J;  2ZZN A;  4EK2 A;  2YPZ A;  3EM1 A;  5J2Q B;  1IR2 A;  3AXM A;  2HS0 A;  1Z1Z A;  2MKS A;  3BDE A;  1WDD A;  2KHD A;  5KT6 A;  1RTJ A;  4PG5 A;  2EXU A;  3MFI A;  3VAF A;  4PWW A;  5K5M A;  4LT6 A;  1VBZ A;  3T9Z A;  2X3G A;  4FVM A;  1S6P A;  2GIF A;  2MZQ A;  2YX7 A;  1BLU A;  3GLJ A;  4HDG A;  4NRU A;  4ZVQ B;  4ER8 A;  1D1U A;  1I51 B;  3OTC A;  3T5J A;  4A8X A;  1IKV B;  1WUU A;  2CUY A;  3DLG B;  2WVC A;  3C19 A;  4NA3 A;  2Z30 B;  5DJB A;  2ZM6 F;  5CAB A;  2K3I A;  4ZVT B;  2VQE J;  4DF4 A;  3BGO P;  1MRO A;  4X4S A;  1X9W A;  2VFV A;  1OY9 A;  1TL3 A;  2YWW A;  1KOH A;  1NHU A;  2BXJ A;  3CVK A;  1E6V A;  2NSB A;  3LWL A;  2VPW B;  4DR4 J;  3J7Y I;  3CC4 S;  2F40 A;  1YLX A;  3M8Q B;  4LF5 J;  2CJX B;  1KNZ A;  1A6L A;  3WX4 A;  1XWL A;  1S6U A;  4H4K C;  4WK3 A;  4KKO B;  1A9N B;  3K2Y A;  1DTT B;  4I6A A;  3W8G A;  5L39 A;  2ZBC A;  4NRT A;  3IP0 A;  3OQ2 A;  1RAF B;  2CQ3 A;  3TQ1 A;  1NM2 A;  4G1I A;  1MMN A;  2XSJ A;  4KO0 B;  2H5E A;  2KM8 B;  2M70 A;  1S1W B;  5KT7 A;  3BPS P;  2B5J B;  2X7I A;  2V69 A;  5LT5 A;  2V63 A;  3CIM A;  3OXL A;  4LR8 A;  1KKH A;  2ILY A;  4ZKA A;  4RO0 A;  2O01 C;  1Q8K A;  3HHD A;  5A8K B;  4QW9 A;  3LOU A;  1YJT A;  2MKY A;  3T1H F;  4BDP A;  1U24 A;  1OSD A;  1UCN A;  2DR7 A;  2JX2 A;  2LQ8 A;  4MKB A;  3HHN B;  3D5M A;  1RAD B;  3OBI A;  5IV4 A;  1TL1 A;  2FC8 A;  2VG6 B;  5E3A A;  5E3C A;  4DL2 A;  3MMB B;  1T05 A;  5L1J A;  2V2Q A;  4M95 A;  3NGR A;  3CB4 A;  1DRZ A;  4LVO P;  2QSW A;  3CJ4 A;  5HI7 A;  1JK9 B;  1M1H A;  2E44 A;  4W98 A;  3FZ2 A;  2VKR A;  5JJB A;  1M5H A;  2OMO A;  4O44 B;  2FY1 A;  4CLL A;  3MPW A;  4ZJO A;  2PMZ D;  2XLI A;  1VQP S;  2GVD A;  2C2R A;  1SJR A;  4J9K A;  1ZM2 A;  4J9S A;  4OYW A;  5D0E A;  3GE9 A;  4LF9 J;  2ZH2 A;  2UUB J;  1SJ1 A;  3A8K A;  4DLG A;  3TZW A;  4WF9 Q;  1X5T A;  2DGS A;  1SQF A;  3HUL A;  1HMV B;  1HD0 A;  2BKO A;  3LAK A;  5HJX A;  2GJF A;  3U1L A;  3UNY A;  2RE1 A;  3CPW R;  1C1B B;  5LMN F;  2C2M B;  1F3F A;  5J2M A;  2UXD F;  3MM8 B;  2MDA A;  3H4B A;  1PIE A;  3HVT A;  3CCL S;  1H7W A;  3M8Z A;  4OJ1 A;  3W7B A;  4ED1 A;  4F3O A;  2KXF A;  1CVJ A;  4OI2 A;  1C2P A;  1Y5L B;  2IC3 B;  1BQX A;  2YNG A;  3GCX P;  1H6K X;  4DR1 F;  2R7V A;  4F0M A;  2UUC F;  4C11 B;  3RAM A;  1MU2 A;  2XMJ A;  4DLE A;  3KLI A;  3T5K A;  2BE7 D;  2XYP B;  4FYX B;  4J5O A;  3OTB A;  5D77 A;  3WIV A;  1RWK B;  1TV6 A;  5ETV A;  3MUR P;  2CA9 A;  2W9B A;  1X9S A;  1Q79 A;  2BOP A;  2BRK A;  3ITH A;  1U47 A;  2OEL A;  4FBU A;  4ANE A;  1KON A;  2CQG A;  1ZAW A;  3LP1 A;  1LQ9 A;  1FDD A;  5H9F J;  1XNQ F;  4QIG A;  1JB0 C;  2DNR A;  1JMT A;  3BKU A;  3TUJ C;  4IR1 A;  3PV8 A;  3QAE A;  2BV3 A;  1KEK A;  2AEM A;  2RQC A;  4ECV A;  4R0J A;  1I94 F;  1HNZ J;  2H1Y A;  3BBB A;  1LW2 A;  2HVZ A;  4O44 A;  4Y65 A;  1YIJ S;  2ACM A;  1UJ4 A;  1S6P B;  4FYD A;  2RT3 A;  3VGT A;  3RRH A;  4MK7 A;  4U96 A;  2J9E A;  2M0G B;  2WON A;  2VZ9 A;  1V5V A;  3BEG B;  3MED A;  4LRC A;  4QIF A;  2FJA B;  4DCP B;  2E7X A;  4LBH A;  2R2T A;  4JV0 A;  1NSQ A;  3NMR A;  3C6T A;  1XMO J;  4NCA A;  4OHY A;  2F8E X;  5T7L A;  4QU7 A;  3WIU A;  4YFU A;  2J0X A;  3UWT A;  4ZK7 M;  2MSS A;  1IKY B;  2ZOM A;  3M7V A;  1B4S A;  2IM2 A;  3J80 Y;  1ULR A;  3MUV P;  4RW4 B;  4Y2C A;  1F3V A;  4NAS A;  1MWZ A;  4CYU B;  4ZIT A;  4DUY J;  3PY8 A;  1KN6 A;  4USI A;  2N4C A;  4YB7 A;  3TYT A;  5KG3 A;  1H72 C;  4ZCI A;  4ID5 A;  4C4W A;  2JDJ A;  1QD1 A;  4ECY A;  4OYZ A;  2M5Y A;  3OTO F;  4TKT A;  3NWG A;  2LEB A;  3MFH A;  1HNV B;  3GV8 B;  2O1P A;  4QPT A;  3SCI E;  1ZTW A;  1HLW A;  5E3R A;  5ADZ A;  2IIH A;  4GKK J;  2VC1 A;  1KVK A;  3D0H E;  4UY8 T;  2D74 B;  1X31 C;  3IXQ A;  4QIW D;  4IQX A;  2ZZM A;  1HBM B;  4X4N A;  2G2Y A;  1FCA A;  1PIL A;  1R0B G;  2DGT A;  1HHT P;  1MWY A;  3GSD A;  3QT8 A;  1JJ4 A;  1F2H A;  5E33 A;  3R1L A;  2XNR A;  4YUD A;  1FD2 A;  2XGP A;  5IS2 A;  2W01 A;  2KB2 A;  3K58 A;  3O1L A;  2MKI A;  2COL A;  2FVC A;  2IYI A;  2HHS A;  2FHO B;  1KQF B;  3CXC R;  2NUH A;  4AE5 A;  4YP3 A;  3E2E A;  1XEZ A;  4CO3 A;  4XPE A;  2V0N A;  3QT5 A;  4WP9 A;  1U1K A;  3FK4 A;  4WZM A;  1SC1 B;  3PIP Q;  4BCA A;  2R7T A;  2AHO B;  3TO8 A;  3RW7 A;  4JV5 J;  2OPS A;  3BB5 A;  3MF5 A;  2DXE A;  3P4U B;  3GYG A;  3RG6 A;  2YWF A;  2MQN A;  5DDR C;  4ECZ A;  2MLY A;  3G82 A;  5J1E B;  2R2U A;  4KGK A;  1KHV A;  3GWC A;  1OMS A;  1R8P A;  1VIX A;  4F7V A;  2KXN B;  2F4V F;  2FGO A;  1RP5 A;  2NUU G;  4DFK A;  4FPI A;  3SDE A;  3JSY A;  1S49 A;  1B64 A;  1T3O A;  3OL9 A;  2XYG B;  1DTQ B;  2OPR B;  1A7G E;  3TVZ A;  3EE3 A;  3IG1 A;  2QJ3 A;  4Q44 A;  1VDH A;  3VVT A;  1U1L A;  3KK1 A;  2J7W A;  2GVZ B;  2WSF C;  2C2O B;  2BJ1 A;  3BGR B;  3DRR A;  3JQM A;  5IC4 B;  1RSC A;  2JJ4 D;  1T9T A;  1YRX A;  1S9G B;  3GTY X;  4QQB A;  1RAH B;  2H4Y B;  1JLC A;  5GAH U;  4RU2 A;  4F8R A;  4Z7Y A;  2FHJ A;  3UR3 C;  2UVU A;  4B9V A;  4E2F B;  4ECU A;  3RB6 A;  2J7K A;  2J7U A;  4UY8 5;  2ASY A;  2JHE A;  3DLK B;  2DHX A;  2LLZ A;  2PC6 A;  1HD1 A;  3B4D A;  4F4W A;  3CCM S;  3NNA A;  2EFQ A;  1CC7 A;  2WBM A;  4OYB A;  3SDE B;  5KG6 A;  3UCU P;  4QCL A;  3V6H A;  2CDR B;  1RBA A;  2AYM A;  3HSG A;  4P6Q A;  1WG1 A;  3PXG a;  4DEZ A;  2N7C A;  2R7W A;  2HGL A;  4HYK A;  1ZA2 B;  2W8L A;  3D1Q A;  4XIU A;  3W61 A;  2CZV C;  2ZBP A;  3ENA A;  2A0F B;  4OYI A;  2QZ8 A;  4U8V A;  1JLQ B;  5I4M A;  3DCA A;  5DO2 A;  3T1Y F;  1I94 J;  4B9T A;  2WCX A;  3LAN A;  5H1S V;  1HNZ F;  1X5P A;  2NXJ A;  1LFW A;  2HPU A;  1AZS B;  3P8B B;  3FRZ A;  3K7R A;  1JXL A;  3D28 A;  1LW0 A;  1LXN A;  1GX5 A;  3L7O A;  3DLK A;  3FGV A;  1SB6 A;  4TU9 A;  1S1T B;  2CPZ A;  1NCL A;  1VQ6 S;  2GO9 A;  3PYE A;  4NEZ A;  1Q82 T;  1ZM3 A;  2WW8 A;  3CCT A;  1BHN A;  5GAE I;  2CPF A;  3OT9 A;  3R5A A;  1JJC B;  3QAU A;  1WWH A;  4Y2M A;  4C8M A;  1FNO A;  3I4H X;  3M2U A;  2M88 A;  9RUB A;  5A8K A;  5IZH A;  3PIO Q;  2NQP A;  2DEI A;  2X1G A;  4OZ2 A;  4ZPC A;  2CJY B;  1HHQ A;  3VGS A;  3HHL D;  4CLP A;  4F0H A;  4YHH F;  1JLQ A;  2DVI A;  1TL1 B;  2VG6 A;  3OL6 A;  2QGF B;  5CD4 H;  5IOL A;  4KHR A;  1URR A;  5U47 A;  4ILL A;  3VF0 B;  4DPY A;  3HP6 A;  1EX8 A;  5ETM A;  3GII A;  1T94 A;  2RUS A;  4A8O A;  2GIR A;  4LIW A;  4MIW A;  4WFB Q;  5HAN A;  1DLO A;  4X4T A;  3Q8R B;  3C3L A;  3IN5 A;  2CQ2 A;  2FQQ B;  2ZJR Q;  1FTR A;  2ZVS A;  1NUE A;  3IR6 B;  2QL7 B;  5KG2 A;  2VKZ G;  4P2S A;  2A1B A;  1YZ6 A;  2BE2 A;  4A8Y A;  1VYA A;  1SC6 A;  2JWN A;  2BW2 A;  2IFX A;  2VBX A;  3SIP B;  3WHI A;  3JQK A;  3QLH B;  4DV4 F;  1LWE A;  4KFB B;  3C8Y A;  3GIR A;  2RHQ B;  3DM2 A;  3ZZR A;  4I68 A;  3G6E S;  3A8E A;  1JLG B;  2FDN A;  3QJP A;  2LCW A;  3N6L A;  2XZD B;  4J9M A;  3AFG A;  2HGN A;  3EPG A;  1ARO P;  4PWD B;  1K47 A;  2GGP A;  2N3O A;  2GFF A;  1JWW A;  2AT1 B;  3ILJ A;  3UCG A;  4KFB A;  5DQG A;  5EWE A;  4CCH A;  2AJQ A;  5GAD U;  2OGU A;  3OR2 A;  4MJK A;  3LP2 A;  1F60 B;  2RQM A;  1J5O B;  1N33 F;  3C6T B;  4X4O A;  4LRB A;  2KFY A;  3CJ0 A;  4IH5 A;  3PO5 A;  5BJR A;  4K4X A;  2XY6 A;  1O5J A;  2DY9 A;  4JV2 A;  1WD6 A;  4ZVP B;  1UZH A;  3OFH A;  4YEA A;  2R7R A;  1P9Y A;  5ETT A;  2LEC A;  2DD8 S;  3CCZ A;  3MPU B;  5HP1 A;  3NGS A;  3DLE A;  5LJ5 Y;  5KFH A;  1OPI A;  1X7V A;  2AZ1 A;  1FKO A;  4ZLP A;  1L5U A;  3DU6 A;  1JLE B;  1N88 A;  3EGZ A;  3MXH P;  2GAG C;  2JFD A;  2BRL A;  3ETM A;  1X4B A;  3T19 A;  4LFB F;  1ZZF A;  3T9N A;  4OZN A;  3MCS A;  1S0N A;  2DR6 A;  3QGH A;  4JOU A;  3J81 Y;  3HT0 A;  2AEJ A;  3MEE B;  1PYO B;  2KHC A;  4LBI A;  1JLG A;  2BAC A;  4WFY A;  2PA8 D;  2XTJ P;  5B0B A;  2DB1 A;  2HHP A;  2I1R A;  2D3O 1;  1SH0 A;  2I8E A;  1PBU A;  2A3J A;  3UNG C;  3I56 S;  3I96 A;  2XMU A;  1WNE A;  2G13 A;  2YKM B;  3DLL Q;  1R3N A;  2WRM A;  5G4D A;  2U1A A;  5ETP A;  2LFV A;  2KO1 A;  5E5N A;  3H8Y A;  4QJV A;  3TUP A;  3IAM 9;  4OZJ A;  4G1Q A;  4NLD A;  3JSM A;  4M94 A;  3EYZ A;  2JEG A;  2DHG A;  3IM8 A;  4KH0 B;  2IJF A;  4PXC A;  5KFJ A;  2XCP A;  3HM9 A;  5AE2 A;  1TP7 A;  1HWI A;  3HFV A;  4RW6 A;  2EKN A;  1REG X;  1K8A T;  1NKB A;  1HNX J;  4GC6 A;  2UVV A;  3GIJ A;  4JI1 J;  5A8R B;  2KKH A;  2FVQ A;  1VIO A;  1JNZ B;  1GT8 A;  3O3L A;  4PWU A;  5HSP A;  2IRU A;  3BGF A;  2ZJQ Q;  5LMU J;  1BQM B;  1LOU A;  1O51 A;  2HNY B;  5I42 B;  4NYZ A;  3CD7 A;  3M8P B;  2WBR A;  1QDU B;  4QZV B;  1X4F A;  2MPU A;  4DR2 J;  2Y8W A;  4PG8 A;  4EMD A;  1EB0 A;  1CQM A;  1IR1 A;  1EAY C;  1FEH A;  3ET6 A;  3OPK A;  3Q83 A;  3CT9 A;  2L9N A;  4N7T A;  2N4D A;  2WB1 D;  3W64 A;  4DQI A;  4PUO A;  3MOJ B;  1UWA A;  2JC1 A;  5F8N A;  3AQP A;  4RUC A;  4O4G A;  2ZKT A;  3CW2 C;  1XR5 A;  4MK8 A;  3WBZ A;  4P10 A;  4RNF A;  1IJF B;  2E29 A;  3GPA A;  2ROP A;  5ETO A;  4IRD A;  4JV1 A;  4B9U A;  2VFU A;  5K20 B;  5F8J A;  2B5J A;  2CNL B;  2ZBQ A;  3AB2 B;  4NXN F;  1NLK L;  2HKE A;  3NP5 A;  2LQ9 A;  1FK9 A;  2Z2L A;  4PCQ A;  3W2W B;  1YJV A;  3OFG A;  2R2S A;  3C16 A;  1FRJ A;  3H42 A;  5KFC A;  3GON A;  3N4W A;  3TUI C;  1TAQ A;  5ETQ A;  1IUJ A;  3TOQ A;  4DCO B;  4ZVF A;  3HVR A;  2J76 E;  1XQI A;  3RBZ A;  3R1H A;  2L41 A;  2V67 A;  1SQE A;  1H73 A;  1FER A;  3O8W A;  3V6D B;  4OHW A;  1UVN A;  4CDI A;  1CEZ A;  5FLX U;  4JI2 F;  2K7J A;  1TL4 A;  5IT4 A;  2BX6 A;  2RS8 A;  2YNI B;  2C2E A;  2QLJ B;  4Y3C A;  2GML A;  3W5Y A;  4KGV B;  3WZ0 A;  3HHK A;  4XK8 C;  8AT1 B;  2VFT A;  2KXH A;  1U2C A;  2VJV A;  2W25 A;  4IFY B;  1J5O A;  2HW3 A;  2R8J A;  2NSC A;  1P1L A;  2DIV A;  4UOF A;  1KR4 A;  1PCA A;  5DG8 A;  2KM8 C;  4PG4 A;  2F4V J;  3Q0A A;  2CDQ A;  5AXL A;  2PI4 A;  2NR0 A;  2JLG A;  2WHO A;  3PO4 A;  1L3V A;  1FRI A;  4L76 A;  1VGY A;  4FS1 A;  3W2W A;  3PW0 A;  1SC4 B;  1RTD B;  1XJW B;  1U0S A;  1RWW B;  2MZR A;  4XTT A;  2XUL A;  1E6V B;  1KP6 A;  1WHX A;  1UEK A;  3GYX B;  2PSZ A;  2W2Q P;  3L7U A;  3M30 B;  3FCV A;  1KVJ A;  5H9E K;  4ZPB A;  2YKQ A;  4IYQ A;  3DGP B;  1HMV A;  2ZVI A;  3QID A;  4C48 A;  1E6Y A;  4NML A;  3VAK A;  2W2P P;  3ZZO A;  2IRY A;  5BR8 J;  2GO8 A;  1QAY A;  4ELT A;  2RH3 A;  3P3D A;  4XO0 A;  4WK1 A;  2NXE A;  2QLB B;  1R7I A;  2JEI A;  5T14 A;  4M8L A;  2HRU A;  5KFM A;  4J9U E;  3HHL C;  2O5D A;  3F44 A;  1RWV B;  3KLH A;  2VIC A;  5CHC B;  1W2I A;  5B0A A;  2XMW A;  1DTT A;  4WYL A;  4WKR A;  4U9R A;  5D4O A;  2BKP A;  4KT0 C;  1KFD A;  1Q7L B;  2UUT A;  3F41 A;  4ZS6 A;  4NXN J;  3PEJ A;  2QX0 A;  2QA1 A;  3JTO A;  5F0U A;  1SKU B;  1N5V A;  4Y0F A;  4CIO A;  2Y1L B;  4MKV A;  5C42 B;  2ASD A;  4NMX A;  1C4C A;  2CJQ A;  3DN9 A;  4KYZ A;  4ZMM A;  1NND A;  4CO0 A;  5HVG A;  1X0P A;  1UVJ A;  3J81 U;  1APS A;  3AB4 B;  2OTL S;  3EWG A;  1DQA A;  1F2G A;  1IKW B;  1MLA A;  4DZD A;  3HVA A;  2EG1 A;  2D3O R;  4DL7 A;  4TNO A;  3SQO P;  3T6B A;  4EO8 A;  2HZV A;  1CJT B;  2A2D A;  4C8O A;  1S1X A;  4DJB A;  1RWP B;  2M52 A;  1JQG A;  2HBR B;  3CDA A;  3QGG A;  2R9L A;  3MCM A;  2DYA A;  3CJK A;  1JLF A;  1T11 A;  3DI6 A;  4N56 A;  1S48 A;  2L9W A;  4HHU A;  2LVW A;  4JB8 B;  4DU7 A;  2PFD A;  2IM3 A;  4NLP A;  4Q45 A;  1RWO B;  1U7L A;  1HBN A;  4NCG B;  1XNQ J;  1MG7 A;  5DS7 A;  3T3F A;  1RE1 B;  2ZOG A;  3AJD A;  2OHD A;  3MM6 B;  4GKJ F;  2JEJ A;  1GMW D;  3UFC X;  4J9N A;  3QWP A;  1P27 B;  2Z8Q A;  1HI1 A;  3CMQ A;  4CYU A;  5GAG U;  1XNR J;  1VK3 A;  3Q89 A;  3MM9 A;  4EFA C;  2OSR A;  3SZ2 A;  4FXD A;  3LW5 C;  2HBQ B;  2W7P A;  3KLH B;  2HMI B;  2AGQ A;  2J0S D;  1FVS A;  2MQ8 A;  1BUX A;  1UWB A;  3ILL A;  4YY3 F;  2WAQ D;  2MTL A;  3CDE A;  5ETN A;  3W63 A;  1CQN A;  3I0R B;  5HBM B;  3R6G B;  3JTP A;  4I2Q A;  4QW8 A;  5KFE A;  4BHQ A;  2KFN A;  1RHR B;  1MSW D;  4CP5 A;  3ZO7 A;  1WHW A;  3LP2 B;  2HS4 A;  4LFA J;  2HQI A;  4IRK A;  2DIU A;  3I31 A;  1DBD A;  2RF2 B;  3QFH A;  1RT6 A;  3R5G A;  2KG1 A;  4KSE B;  3N79 A;  3F73 A;  4B3M J;  3MM7 A;  2V4Q A;  1VS3 A;  1DY3 A;  2AX0 A;  2YQ1 A;  2MQP A;  4M5L A;  1QY7 A;  5KOX A;  1OQ3 A;  2IA0 A;  2R7Q A;  1UA1 A;  4B3O A;  1FD8 A;  3PYF A;  2RAQ A;  3KXD A;  1NK5 A;  1HWK A;  1EKS A;  1F9H A;  5KFW A;  4DV6 J;  3RBE A;  3EGN A;  2WON B;  3ICL A;  2FLN A;  3TNV A;  3UI3 A;  3TW0 A;  3LWM A;  2ZH5 A;  1LV5 A;  1Z2L A;  1QE1 B;  4ZP7 A;  3VGV A;  2ZC3 A;  2MXY A;  2QA4 S;  1YSJ A;  5I3U A;  2JEF A;  4OZ3 A;  2BUN A;  3MM6 A;  1FHT A;  2E5L J;  4R25 A;  3FVY A;  3CCW A;  5F9L A;  2CIM A;  3R5C A;  3ZTS A;  2V8P A;  4I4B A;  7FDR A;  1Y5I B;  4QWB A;  4L3K A;  5D4P A;  5HVH A;  4EEY A;  3O5T B;  4NZ0 A;  2UXB F;  3SBM A;  4DV7 J;  4ED0 A;  4J9O A;  3JSM B;  4CLY A;  4J9P A;  1FJC A;  1YWX A;  2KG0 A;  4CLS A;  2YKM A;  3HVW A;  4DCJ B;  3KHL A;  2VQF J;  2FHM A;  4ECW A;  5GVQ A;  2LDY A;  3MI7 X;  4IFV B;  5B0D A;  2HNZ B;  2EPI A;  4AXI A;  1S4E A;  4OHZ A;  3MUM P;  4DUY F;  1B3T A;  4F2S A;  2Z2Y B;  1S76 D;  4NXM J;  5HK4 A;  2VF3 A;  2QFI A;  4QIV A;  2B43 A;  5HMX A;  3CJ3 A;  2Y0S D;  2ZD1 B;  3UPF A;  4IG3 A;  3UD4 P;  1YRU A;  3C6U B;  5KT3 A;  2H9Z A;  2XBP A;  2DGV A;  4Y00 A;  1SL1 A;  2DH8 A;  2AJ2 A;  1RCO B;  2BM1 A;  1ZH5 A;  2YKP A;  4UUW A;  5DZ6 A;  3PX6 A;  1WHV A;  4BBY A;  2XNQ A;  2CQC A;  3GR0 A;  1HQE B;  2KT3 A;  4RJV A;  4CH0 S;  3OL8 A;  1VJQ A;  3G4S S;  1IKV A;  3CDB A;  1HWL A;  3POT A;  1IWA A;  4KPC A;  3GV5 B;  2RDJ A;  2QLX A;  2VA3 A;  3FQL A;  2DNG A;  4EBC A;  2QLF B;  1R8B A;  1GMW A;  4CTA B;  1S0V A;  1RKJ A;  1FWL A;  2XHW A;  1U45 A;  2VJU A;  2JH3 A;  3SFG A;  4MT1 A;  2ILZ A;  3K0J A;  5D3G B;  3I55 S;  3N0V A;  5G0R B;  1WEZ A;  1TUG B;  1GEH A;  2VV5 A;  3BR8 A;  3OR2 B;  5D4L A;  5ITH A;  1ZOT A;  2WK4 A;  2Y3Y A;  3ZTP A;  3A12 A;  4A46 A;  1Y00 A;  1XTZ A;  2HQF A;  1S1V A;  3DOK B;  5GAG I;  2L48 A;  5CYM B;  1WC4 A;  1KHW A;  1WSV A;  1HR0 J;  3HSZ A;  1Y4Z B;  1YTY A;  3L4B C;  2DGQ A;  2CKW A;  2XO6 A;  2LYV A;  4F4Y A;  3PG9 A;  1NHK L;  4LF5 F;  1JKH B;  4WPA A;  4CLW A;  1U02 A;  1IM4 A;  2ROG A;  2EKY A;  2WOM A;  4M5H A;  4X62 F;  1WKL A;  3MAA B;  3U7J A;  4EYH B;  4NLG A;  2HMI A;  3G6X A;  1M1G A;  2QL5 B;  3W9J A;  1U1P A;  4NA1 A;  4OI4 A;  2MLX A;  3NLC A;  2EVZ A;  4B3S J;  3VHQ A;  4JI4 J;  4NE9 C;  4RUA A;  1HWU A;  1GMV A;  2Z58 B;  3G9C A;  2HGM A;  3QO9 B;  2AYB A;  2HHX A;  2GC8 A;  4ZPA A;  3PFO A;  2MKH A;  3JTN A;  3QZ7 A;  4IOC Q;  4RNM A;  1S6Q A;  3W9H A;  3GFX A;  3LAM A;  1RI7 A;  4X4R A;  2EFN A;  3US5 A;  4JI7 J;  4DBQ A;  1NB2 A;  2RNE A;  4DR3 J;  2W9C A;  2CPY A;  2H54 B;  5CYM A;  4RKU C;  3NGD A;  2BQU A;  1HNW F;  2FZG B;  3Q8P B;  2MKJ A;  4KTQ A;  2PI5 A;  2CQP A;  4BLG A;  1TK5 A;  2G0J A;  2D1C A;  1SIZ A;  1UJ5 A;  5DM6 Q;  4YS2 A;  4DPT A;  5LOQ A;  1JLB B;  1S1U A;  4DL5 A;  4E8U A;  3KFW X;  4KJI A;  1BMQ B;  2IJN A;  2WOM B;  2JOQ A;  4CH7 A;  2I5J A;  2VG7 A;  5A8W B;  2YH1 A;  2UUC J;  4NLV A;  1HPZ A;  3QJJ A;  3MGJ A;  4JI5 F;  1RAO A;  1RDR A;  1RHM B;  3G87 A;  2Z0G A;  1YJ9 S;  5KFO A;  3DOL A;  1UET A;  1N56 A;  2P9E A;  1H2V Z;  4LF9 F;  1NDP A;  2PMH A;  1NK9 A;  1HYS B;  4UZC A;  3PRD A;  1RTH B;  4TXS A;  3K57 A;  3NL0 A;  2RRB A;  5LJ3 Y;  2DO4 A;  1RTI A;  1ZA1 B;  4JI0 F;  4OV1 A;  3CUN A;  2FC9 A;  4DR6 F;  3VAH A;  3MEG B;  3VAM A;  2UXC F;  4O3P A;  5DRK A;  2IVF B;  2HRY A;  2OIH A;  5E2Q A;  1H0H B;  1N32 F;  4DR5 J;  5L38 A;  2ZBI A;  5I3P A;  2FJX A;  4J91 A;  4FVC A;  4XDC A;  3HI9 A;  2JNJ A;  3GCW P;  3HD1 A;  8RUC A;  4IG0 B;  1K44 A;  1BQN B;  3BF4 A;  3P5T L;  1S1T A;  4U8Y A;  5D0G A;  1WHY A;  4C8K A;  4LMZ A;  2RVJ A;  1FWK A;  3CJR A;  2AWZ A;  3HF5 A;  2HG4 A;  4O3Q A;  1D0E A;  1NK6 A;  3SQG A;  3NNC A;  4NZ6 A;  4OIX A;  3TZX A;  4MTP A;  3NBP A;  1RT4 B;  1UKU A;  1LNQ A;  3UW1 A;  3UD5 A;  2W4P A;  4TLR A;  4C8Z A;  4X64 J;  4LF6 J;  1SC3 B;  1PAE X;  3EVO A;  4B9M A;  1KOO A;  1FA0 A;  2X1A A;  1WTB A;  1T3N A;  4H4O A;  1H2U X;  5D4N A;  2MGZ A;  2AYG A;  2BJ7 A;  2UV8 A;  5C7P A;  4HHJ A;  1IN0 A;  1XMO F;  3OL7 A;  1B0P A;  2Q3P A;  4MYU A;  1M5V C;  4PG6 A;  1AXQ A;  3M9N B;  4DX5 A;  5HRO A;  5KT2 A;  3CSK A;  3QGP A;  3PRB A;  1EZZ B;  2P6S A;  5CAA A;  3GYN A;  4J7C A;  2J8A A;  3CNQ P;  1X60 A;  3MM7 B;  1VBK A;  3I0R A;  1PJ7 A;  1ZPW X;  2YNH A;  5FII A;  4LF8 J;  3SCK E;  4V19 J;  3CE8 A;  2XO7 A;  1NAQ A;  2MQL A;  1G6B A;  2NPI A;  1TKX B;  2OSQ A;  2XMV A;  4K2J A;  3RUB L;  1N6Q B;  1PYT A;  1HQ2 A;  2LQ5 A;  2OEK A;  2DO0 A;  3EIC A;  4PEO A;  1FXD A;  2B6A A;  2H5I B;  3I5C A;  3IO1 A;  3ZFV A;  4CLF A;  5HRO B;  1GNK A;  3LP0 B;  2XS7 A;  1X8D A;  4IG0 A;  1G2E A;  4MMO A;  2QV6 A;  2X1B A;  4RW8 A;  3ZZT A;  2G2Z A;  2ZUA A;  4WXO A;  2HVE A;  5K9F A;  4R8U A;  1MNE A;  3L95 X;  2C22 A;  2POK A;  3TAM B;  3H4D A;  3WC2 A;  3G2X A;  3Q22 A;  3RR7 A;  3KHH A;  3HMJ G;  4K4Z A;  1U2F A;  2LP4 A;  2JZ5 A;  4PPZ A;  1VRU B;  1XNR F;  1SH3 A;  1YQH A;  1S77 D;  4ES2 A;  3ENW A;  2CNN B;  3M32 B;  2GIQ A;  3K5P A;  2VOO A;  4JYA F;  4ED2 A;  5MLC V;  4P9S A;  4K0K F;  3DFE A;  2K7K A;  2B3T B;  4WP3 A;  3PHE A;  2OJ3 A;  3NCQ A;  4K8R A;  2IC3 A;  2FPH X;  3IAS 9;  4HR2 A;  5C25 B;  1U49 A;  3VAG A;  2IBK A;  2H5J B;  4AYB D;  3NNH A;  1GXL A;  1RHU B;  3BR9 A;  5FD1 A;  1D3W A;  1RUS A;  4N41 A;  3X1L B;  1CJV A;  1N5Q A;  4WFZ A;  2XMM A;  2JRS A;  4X4V A;  4FNI A;  5KG4 A;  3KK1 B;  3J7Z 5;  2C3O A;  2A2C A;  3DDI A;  1HI0 P;  3T1A A;  1RTZ A;  4ZVH A;  4YB6 A;  2LXU A;  4DL4 A;  3N9U C;  1RTI B;  2ZEJ A;  5BYS A;  3VZH A;  2CYY A;  4ED6 A;  3RB0 A;  3QSI A;  3NMA A;  4KR0 B;  4GVL A;  1UVM A;  3E3X A;  4D3H A;  5FDL A;  2UUB F;  4C0O C;  1NH8 A;  5DM7 Q;  1G4C A;  3GJS B;  2Q6B A;  4ALZ A;  1KQS R;  1XBW A;  2L3M A;  2QTW A;  1L3S A;  4NWB A;  2OI2 A;  2GCF A;  3BH6 B;  2E5L F;  5KFF A;  1ROF A;  1ZZN A;  1AA1 B;  4HTI A;  2FY8 A;  3KG1 A;  3MUT P;  4X2B A;  1IQZ A;  2XY7 A;  4V19 X;  5KG5 A;  2F3J A;  4OLP A;  1NPK A;  1ZS6 A;  2YNF B;  3KWM A;  3M30 A;  3GIM A;  4MFB A;  2E9R X;  2M3D A;  2UVW A;  3DC2 A;  2GA7 A;  3LH2 S;  5KT5 A;  4QPX A;  1U1M A;  1WOS A;  1S6Q B;  1RA7 A;  5KOW A;  3TVY A;  4C8L A;  1OS5 A;  4ETX A;  2VFR A;  1IBC B;  3K8V A;  4CI0 B;  4L75 A;  2G0I A;  2H65 B;  5KFP A;  1N34 F;  2UUA F;  1T9Y A;  4ZVS B;  1U6Z A;  2ZH8 A;  4O0I A;  3IWN C;  3NGT A;  4ZJL A;  3SV3 A;  2IDL A;  3TP2 A;  3H0P A;  2Z4P A;  3GJR B;  1LEO A;  3FEX B;  4QIE A;  1XMQ F;  4DWI A;  2KRB A;  3N6M A;  4ZVO B;  4L6V 3;  4LBP A;  4WBF A;  5L1K A;  2JFK A;  1FI4 A;  2MST A;  2RJZ A;  3MAA A;  3Q8V A;  3KJQ B;  4K4T A;  4LF6 F;  3PZP A;  2VH7 A;  1RAJ A;  1PJ6 A;  4PQU A;  5HO4 A;  1XIQ A;  2GX8 A;  3MM8 A;  4PYA A;  1AZS A;  5CQG A;  3EDQ B;  3GFZ A;  3HHL B;  4R5P A;  1H3D A;  2F65 A;  2MLZ A;  4ELU A;  1J5E J;  1FE0 A;  2YNG B;  3OW2 R;  3AH6 A;  2VHG A;  2AF6 A;  2VDH A;  1I6J A;  4U7U D;  4UOG A;  1SJF A;  1X4C A;  2F9J A;  2K8G A;  4F36 A;  3CCU S;  1RAB B;  4OV6 A;  4X66 J;  3MMA A;  2BAB A;  1N5T A;  5D6G A;  1OY8 A;  4RW8 B;  1RHK B;  4ANC A;  1BWE A;  3W8P A;  4F26 A;  5DQH A;  4WII A;  3O44 A;  1NKE A;  3N01 A;  2VQE F;  3L7P A;  4LSZ B;  4RWX A;  1LFP A;  1FRK A;  3K8W A;  2QE5 A;  1LK7 A;  3R27 A;  4WTY A;  5B0E A;  2V4R A;  1JJ2 R;  4C98 A;  1Z4U A;  3UCZ P;  3CO0 P;  1Q5V A;  2B9E A;  1OYD A;  4GO7 X;  4OX7 A;  4DX7 A;  4KC5 A;  4B3R J;  4MIB A;  2GQQ A;  2GS8 A;  2AV5 A;  1CJU B;  3POT B;  3QIP B;  4OYM A;  3SCL E;  3VR1 A;  2W8K A;  4NOH A;  4ZPT R;  1SKW A;  4GKK F;  1TKZ A;  1O0P A;  3PTW A;  2R7U A;  2X1F A;  4LF7 J;  2BOA A;  4NZ7 A;  4F04 B;  4NLO A;  1N5Y A;  5I3Q A;  2G0C A;  5F41 A;  4K5R A;  4WFX A;  1RZM A;  3IRX A;  2X3D A;  1FFS B;  3MR7 A;  4J90 A;  4N8N A;  1SKS A;  3J7A 1;  3UQS A;  5L1I A;  3MPD A;  3QJL A;  3IBF B;  4EZ6 A;  3HD2 A;  3TJA A;  4U6P A;  3RAQ A;  2VG5 A;  3DYA A;  5HN0 A;  3B54 A;  2CPJ A;  2C3Y A;  4C3L A;  5KFB A;  4DV3 J;  3AOA A;  2KU7 A;  2BM0 A;  2H3E B;  3BBC A;  3RBX A;  4J9L A;  2DRB A;  3I5A A;  1VQY A;  3AD7 C;  3BV8 A;  2MHN A;  5KFQ A;  1T9W A;  4K7Q A;  4C2M A;  3BSC A;  3Q8Y A;  4DQS A;  5K14 A;  1QE1 A;  1HNV A;  1SBR A;  1N8R T;  2GVD B;  1UFW A;  1UVK A;  1L3K A;  3KYL A;  1RAG B;  4X4P A;  2AU0 A;  3CME S;  1RAA B;  1N33 J;  2LKZ A;  1OPZ A;  3MR6 A;  1VC5 A;  2BAN A;  1U4B A;  1Q86 T;  3OUY A;  4C0H A;  2HHH F;  4RLE A;  2MKC A;  3D68 A;  1S9F A;  2ERR A;  2DY1 A;  4LRE A;  2HK2 A;  1FKO B;  1RBL A;  4C97 A;  2CQD A;  1N4L A;  2WVB A;  2BJ9 A;  4ZPV R;  3IMQ J;  4W92 B;  2EBE A;  2RQ4 A;  4URG A;  2HIQ A;  4X4Q A;  4B3M F;  3I6P A;  4ID8 A;  5GMK a;  4P74 A;  4PXD A;  1KLN A;  3SFU A;  5T41 A;  5L9X A;  1BY9 A;  4LF4 J;  2VOD A;  2HHU A;  2Z2M A;  1Q8L A;  4IRC A;  3MWB A;  1GAO A;  4C3M A;  3FSI A;  4PXE A;  3RU0 A;  3RAX A;  3ZZY A;  3HFK A;  1Y3J A;  2EI5 A;  2OLW A;  3IG1 B;  3I0S B;  4RNH A;  5J2N B;  2MB0 B;  3BSO A;  3HPO A;  4DSJ A;  1NSP A;  4CO2 A;  2RS2 A;  2LQB A;  4JI6 F;  4OX6 A;  3C14 B;  1C1C A;  1GXT A;  1P6T A;  1XMQ J;  4ZJQ A;  5T7L B;  2RKI A;  1RHJ B;  5A6W A;  4F0K A;  3MTJ A;  4K2X A;  4NCG A;  4ZN1 A;  2W9B B;  2V8H A;  3PRV A;  5HAO A;  1FFW B;  1WC3 A;  1S7I A;  2BAN B;  3DOM B;  2DCL A;  4DV6 F;  4F4K A;  2M8H A;  2ZDO A;  3DM2 B;  1IBK F;  5KFG A;  4ED5 A;  1M5O C;  4ZP6 A;  3D0G E;  3VGU A;  4G65 A;  1QJH A;  4UOC A;  4FYV B;  4Q5V A;  2IVY A;  3M6W A;  3GB0 A;  4B08 A;  3BSA A;  4K50 A;  4FBT A;  1U8W A;  3HO1 A;  4O23 A;  5M2P A;  3D6H B;  3ZZZ A;  1RAC B;  3PYD A;  4NCB A;  1VQ5 S;  4CM2 A;  4ZLL A;  2CNK B;  4DPX A;  1SPB P;  2DH7 A;  2RRA A;  4P73 A;  2R8K A;  3MPV A;  1D8Z A;  3NG8 A;  4WU3 A;  1TKZ B;  1GTH A;  2ZC4 A;  3EVW A;  2JLF A;  3CCS S;  4MKA A;  5LSL A;  4K4U A;  1Q16 B;  1VI7 A;  1Y7P A;  3BH7 B;  3B82 A;  3EZO A;  1IKY A;  4P2M A;  5IT9 U;  2E5J A;  3PDN A;  1KQG B;  5IQQ A;  4N5S A;  2YQ0 A;  3H25 A;  2HFO A;  3IRX B;  2UXD J;  3C16 B;  1SCJ B;  4RW9 B;  1WC0 A;  3V5R A;  2R8I A;  3KG0 A;  5KT4 A;  3EZU A;  1T0T V;  4PQA A;  1OY6 A;  4PPD A;  2KT2 A;  3UDC A;  1GX6 A;  3MCO A;  1KTQ A;  5KG0 A;  5K8M A;  3M2U B;  3O2I A;  1U0H B;  2DBB A;  1AUS L;  1C4A A;  2GQ2 A;  5M2R A;  3TX0 A;  4O4G B;  1VQ4 S;  1DQ9 A;  9ATC B;  1FRX A;  4OI6 A;  4K4S A;  1QAX A;  2LXI A;  1HAR A;  4LJM A;  3GR1 A;  2F5G A;  2W7A A;  4QR0 A;  4UUX A;  4ZHR A;  2XMA A;  4DX6 A;  3OJS A;  1HBM A;  4ZIV A;  2LU1 A;  1FNM A;  2R8H A;  2SXL A;  4IG3 B;  1P1T A;  3PJ9 A;  2B51 A;  5DG7 A;  1DQ8 A;  3WDO A;  4KH1 B;  3RW6 A;  1VQS A;  4HHH A;  1TV6 B;  1WI8 A;  2I5J B;  2VG7 B;  4OYX A;  1KQK A;  3SSS A;  4IFV A;  1QM9 A;  3NS7 B;  4Z7C A;  5JUM A;  3BQ2 A;  2ZFH A;  3PX4 A;  4M5M A;  3NOG A;  4M5D B;  2HNZ A;  4K5S A;  2KFZ A;  4P71 A;  3OVA A;  2I9S A;  2E1R A;  2AP6 A;  3IWX A;  1WAC A;  3HHL A;  1K1Q A;  1SV5 B;  5FJ4 A;  4B9L A;  1RWU A;  2ZNZ A;  2YNI A;  3EJM A;  3M1V A;  3U02 A;  4HI1 A;  2D41 A;  4NLS A;  1Q7Y T;  5CYQ A;  5L8R C;  1L3T A;  2F4F A;  1WOP A;  1YJ7 A;  2DIS A;  2KVQ E;  4ZPW R;  3X3U A;  3V81 A;  1HKA A;  1LWF B;  1U25 A;  1S9G A;  5GAD I;  3QZ8 A;  5J1P A;  4LQ3 A;  4K4V A;  1H98 A;  4ECT A;  3KHG A;  2GHW A;  4CLT A;  4ZHR B;  1EJ7 L;  1IBM J;  3A3O B;  4FS2 A;  1WG5 A;  2CAJ A;  3CJ2 A;  3K59 A;  5JMN A;  3F56 A;  5IV3 A;  1U0H A;  1NZA A;  4U95 A;  4LQ9 A;  3FMB A;  1XMB A;  4GVB A;  4B9S A;  4PXB A;  2O67 A;  1D09 B;  2YKO A;  4PYD A;  2FVS A;  1QSY A;  3PKM A;  4N77 A;  1J2V A;  3DXB A;  5E0O A;  1VHI A;  3NGU A;  4ZVR B;  3ZTR A;  2I38 A;  4F4X A;  5J2Q A;  4FYW B;  3MD3 A;  2KYZ A;  2D3Z A;  3MEC B;  3J7Z T;  1Q8B A;  2HWH A;  3ET6 B;  2KN4 A;  2FIU A;  4HT5 A;  3ZNJ 1;  3VAL A;  4ECR A;  2APO A;  1CBK A;  4YQW A;  2D69 A;  2BVZ A;  1NEE A;  4N47 A;  3BDP A;  1FKP A;  2RU9 A;  3DRS B;  1RT4 A;  2BJ8 A;  2R4F A;  3Q8Q B;  4YDX A;  1CC8 A;  3BSN A;  1YJW S;  4JI0 J;  3U1M A;  2EFO A;  1X4E A;  3TA1 A;  3DXS X;  1VC0 A;  2OTJ S;  3AA8 A;  4WIQ A;  3DI6 B;  1FWP A;  1T7P A;  2OD6 A;  1SIW B;  4QBU A;  2VBW A;  3W66 A;  4YME A;  1VQ7 S;  2E1A A;  1RT7 A;  2DR9 A;  3DDN A;  4M5G A;  1HW8 A;  3NY0 A;  3GV7 B;  1HBO A;  1QUV A;  2YTC A;  4OI3 A;  4RR5 A;  4EYI B;  4DR5 F;  4O3N A;  2ZM6 J;  2CQ4 A;  1FO1 A;  3MEE A;  2FTR A;  4DL6 A;  4OZ1 A;  1YIT S;  1TK8 A;  1FF2 A;  2E7V A;  3LF0 A;  4NLR A;  5B0C A;  3NAI A;  2V5H G;  1NBE B;  1MN9 A;  4CWB A;  1IBL J;  4ED3 A;  1UA0 A;  1XK8 A;  3RB3 A;  2B7C B;  1DFD A;  3IGV A;  3CJQ A;  1EQ0 A;  1VQ8 S;  3ZZP A;  4EO6 A;  5KFA A;  2BMB A;  2FHJ D;  1SJ4 P;  1O6X A;  3FBB A;  2K06 A;  2O3D A;  4FF4 A;  2ZWO A;  5EDW A;  2NYH A;  1CPZ A;  3MMJ A;  5DZ7 A;  4P7V A;  3A8I A;  2Z57 B;  4USH A;  5AXN A;  4DX8 H;  1TKT B;  7FD1 A;  2RIJ A;  2BE2 B;  3DU5 A;  3I87 A;  3O6Q A;  4C6A A;  3TZY A;  3QFW A;  4LIR A;  1PG5 B;  3Q24 A;  5HLF B;  1OWX A;  4NA2 A;  4K4Y A;  5JVH Q;  2CVI A;  1DLO B;  3NKY A;  1K1S A;  3DRS A;  4HLB A;  2MJU A;  4B17 A;  5ETK A;  2QSF A;  2QO3 A;  2XWX A;  3L3C A;  5IWA F;  4KIA A;  1FT8 A;  1NXI A;  2EK6 A;  3IWL A;  1X4D A;  1T9X A;  2QIF A;  3R2D J;  4F2R A;  4ID5 B;  4R5P B;  4OX9 J;  1ZM9 A;  2VB6 A;  2NS1 B;  2J8S A;  3K89 A;  4DV2 F;  1RT1 A;  1TMJ A;  1VK8 A;  3THV A;  2E66 A;  5DQI A;  1ZPV A;  4UW2 A;  3TJ9 A;  1G3O A;  3PW4 A;  1M5P C;  1RT2 A;  3UDL A;  3TJ8 A;  3V4M A;  4DQQ A;  4ED4 A;  1TUW A;  2HWT A;  2YWH A;  1IVZ A;  3MMA B;  1NJY A;  2A6O A;  4H4M A;  4DV1 J;  2DRA A;  1R0A A;  1RWX B;  1MN7 A;  2V4J B;  1I3O B;  2XYH B;  2H4W B;  1LWF A;  3PNI A;  1GFW B;  2ZHO A;  1WSR A;  2E5G A;  2V34 A;  2P5V A;  1N0U A;  2PO4 A;  5DDO C;  5AJ3 F;  1DZ5 A;  3PW2 A;  3BYP A;  4JI8 J;  3C66 A;  2VD3 A;  4HH1 A;  1FDA A;  3H98 A;  4CRJ A;  2XLK A;  4HL9 A;  1FFG B;  1JLF B;  4NX9 A;  1JIH A;  2LA6 A;  1Z2Z A;  4GVB B;  3KJV A;  3GJQ B;  2DK2 A;  3B8H A;  4KRW A;  3OLB A;  1YVF A;  1UJ6 A;  2B0G A;  4FYY B;  2VG5 B;  3DYA B;  5A76 A;  4O3O A;  4RZR A;  2YVS A;  3ZNU A;  1YBU A;  3ISN D;  2AGO A;  1NRK A;  3LP1 B;  4AD6 A;  4LF8 F;  2Y8Y A;  4PR6 A;  3HXM A;  3NXZ A;  1FDN A;  2NPF A;  5DGA A;  3KDN A;  2DNY A;  4ENO A;  1TEL A;  2OPQ A;  1HBN B;  3WQP A;  5D3G A;  5HQM A;  4DR4 F;  5F9N A;  1DAR A;  3HSD A;  2FJV A;  1AUD A;  1EET A;  1VOM A;  1NH7 A;  2FGC A;  3IBC B;  3T5L A;  3D6M B;  3DHW C;  4FF3 A;  2FJB B;  3PCO B;  3H2V E;  3DNC A;  4AL7 A;  3DHX A;  1FKA F;  3JB9 k;  4RL1 A;  2JSX A;  4JI6 J;  1NK0 A;  2DXD A;  4DPO A;  1A0O B;  1S9E B;  3H5U A;  3R9L A;  3N5F A;  1HI8 A;  1WJ9 A;  3KMS A;  3BJY A;  4CLZ A;  4DSE A;  4A8S A;  4NEY A;  1GMU A;  2CPE A;  3PM9 A;  3ZTO A;  2PDA A;  3DGV A;  1W7W A;  5EUH A;  1T05 B;  2YX4 A;  2J6U A;  4CNZ A;  2HLT A;  3MMB A;  3EGW B;  3M2R B;  2W2O P;  1HQE A;  3KDO A;  4RPF A;  4RW9 A;  4Y34 A;  3RZA A;  5C25 A;  5KTQ A;  2IHR 1;  1U8S A;  1UFL A;  3PJW A;  3R7S B;  4RNN A;  2D3U A;  5CH7 B;  1ZET A;  2FJW A;  2V2V A;  2ZH1 A;  4USV A;  3T1H J;  2UP1 A;  2N7Y A;  3CC7 S;  2VBZ A;  1S9E A;  5M2U A;  3W65 A;  4XDD A;  2YY3 A;  4MIA A;  3E01 B;  3MEK A;  3P45 B;  4Q7A A;  2XY5 A;  2B9Y A;  2NCK L;  2UUA J;  1EHW A;  2DEJ A;  3KTQ A;  4P52 A;  1TTH B;  4LVN P;  3SXL A;  4JI5 J;  1TUV A;  2C3P A;  3MM5 B;  1SQG A;  3OR1 B;  2A6M A;  2CPD A;  2HEK A;  3KUG A;  3EGV A;  4F3Q A;  5HQL A;  4K59 A;  3K5M A;  3CF5 Q;  4I7F B;  2ATL A;  2QN6 B;  2W4D A;  5EGY A;  3UDV A;  5B0F A;  1W25 A;  1JLB A;  1S1U B;  1DAX A;  2ZH6 A;  4HAC A;  5EX3 A;  2GGP B;  3H2L A;  3CED A;  3OFE A;  2YXL A;  4IO1 A;  4ZOS A;  2DTJ A;  3ZC4 A;  4B02 A;  5EN1 A;  1GXU A;  4KB7 A;  4OL8 A;  3M8Q A;  3A13 A;  3DOM A;  5D0R A;  3IFE A;  1DJ0 A;  1C1C B;  4RBT A;  4ZCL A;  3CUL A;  1HQU B;  1KDN A;  2JC0 A;  3OVS A;  1VQ9 S;  2VAS A;  4ZDN A;  3OTD A;  2OEM A;  2EWH A;  2Y0B B;  1S59 A;  3UVJ B;  3QPI A;  5H9E J;  1S1X B;  2DRD A;  2QC3 A;  1YZ7 A;  4LFA F;  1M1K T;  1M5K C;  2J5A A;  2CQH A;  4UOH A;  1R43 A;  1F1B B;  1RGV A;  5BYQ A;  3SCJ E;  2M8D B;  2G4B A;  3VAI A;  5GMD A;  2GNK A;  2IYG A;  1KS2 A;  2CPI A;  3MOZ A;  1PYS B;  2JLE A;  2GVZ A;  1RKI A;  1QLN A;  4DV2 J;  2DNM A; 
#chains in the Genus database with same CATH homology
 1B99 A;  1NDL A;  3WX8 A;  3FBF A;  2ZUA A;  2HVE A;  1NHK L;  3ZTQ A;  3ENA A;  3G2X A;  2HUR A;  4ANE A;  1LWX A;  1WKL A;  2DYA A;  1WKJ A;  3Q8U A;  3MPD A;  1WKK A;  1MN7 A;  3PJ9 A;  3B54 A;  2BEF A;  3BBB A;  1PKU A;  2B8Q A;  3BBC A;  1NCL A;  3VGT A;  4HR2 A;  1JXV A;  4EK2 A;  3Q89 A;  1NB2 A;  3EM1 A;  1BHN A;  4S0M A;  2AZ3 A;  1NSQ A;  4DI6 A;  3Q8Y A;  3EVM A;  3Q83 A;  3EJM A;  1BUX A;  1S57 A;  1B4S A;  3DDI A;  3VGS A;  1HHQ A;  4CP5 A;  3GPA A;  2HVD A;  5IOL A;  2B8P A;  1S5Z A;  4ENO A;  1F6T A;  1NLK L;  1NDC A;  5CAB A;  1NDP A;  3B6B A;  3GP9 A;  1BE4 A;  2VU5 A;  1HLW A;  1XQI A;  3DKD A;  3BH6 B;  3NGU A;  2DXF A;  1NUE A;  3FC9 A;  3ZTR A;  1NSK L;  1HIY A;  4O0N A;  1VYA A;  2DXD A;  3BBF A;  3R9L A;  2BX6 A;  2CWK A;  3VGV A;  4AND A;  1NPK A;  1ZS6 A;  3FCW A;  3FBC A;  3ZTO A;  3FKB A;  3ELH A;  1W7W A;  3ZTS A;  1NSP A;  4UOF A;  4FKX A;  5BXI A;  4F4A A;  3Q86 A;  3NGT A;  1K44 A;  2DXE A;  1UCN A;  3FBE A;  1LEO A;  3L7U A;  3PRV A;  2NCK L;  3FCV A;  4WBF A;  1EHW A;  3Q8V A;  3VGU A;  4DUT A;  1MN9 A;  3NGR A;  1XIQ A;  3EMT A;  3EVO A;  1PAE X;  2DY9 A;  4W98 A;  3EE3 A;  1U8W A;  5C7P A;  3FBB A;  3VVT A;  3NGS A;  4UOG A;  4F36 A;  4KPC A;  3JS9 A;  2AZ1 A;  1KDN A;  3EVW A;  4ANC A;  4C6A A;  4FKY A;  3VVU A;  1S59 A;  5CAA A;  1F3F A;  3ETM A;  3BH7 B;  4UOH A;  1NDK A;  4DZ6 A;  3ZTP A;  3EIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...