3B54A

Saccharomyces cerevisiae nucleoside diphosphate kinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
152
structure length
145
Chain Sequence
SSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structure of Ynk1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 38
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3b54A00
3GPAA 3Q8VA 2HURA 3R9LA 3FBBA 3DDIA 4C6AA 2DXDA 3EVOA 1NHKL 3FC9A 4O0NA 3NGSA 4KPCA 3JS9A 2BEFA 1HLWA 4EK2A 3BBCA 4HR2A 3PRVA 3EVWA 3MPDA 1NDLA 2ZUAA 1NSPA 3PJ9A 5BXIA 4UOHA 2DY9A 3B6BA 1UCNA 3NGTA 1PAEX 2BX6A 4S0MA 4F36A 3ZTQA 5C7PA 3ZTSA 5IOLA 3NGUA 1B4SA 3FCWA 1JXVA 3ENAA 1NDKA 3VGTA 1NB2A 1NSKL 2AZ1A 1S5ZA 3FCVA 4DUTA 1K44A 4FKXA 3EICA 2NCKL 4ANEA 3FBFA 3BBBA 1LWXA 2B8QA 1NLKL 3VGUA 3DKDA 3VVUA 2HVEA 1XQIA 1BE4A 3ELHA 3Q83A 4ENOA 3BH7B 3B54A 1XIQA 1EHWA 4W98A 4CP5A 2DXEA 3EVMA 3GP9A 1WKJA 3BBFA 3NGRA 1HHQA 1PKUA 4UOGA 3L7UA 3EM1A 1NCLA 1BHNA 4FKYA 4F4AA 1F6TA 1NUEA 5CAAA 1MN7A 4DI6A 3VGSA 2DXFA 1NSQA 3WX8A 3G2XA 1LEOA 3VGVA 1VYAA 2HVDA 3Q8YA 1S57A 3ZTRA 1HIYA 3Q8UA 3Q86A 1NPKA 1F3FA 1S59A 2AZ3A 3VVTA 2DYAA 1KDNA 1WKLA 4DZ6A 1NDCA 1ZS6A 3ZTPA 3EE3A 3EMTA 2CWKA 3FBCA 3Q89A 1BUXA 4WBFA 1MN9A 1W7WA 4UOFA 4ANDA 4ANCA 1B99A 3BH6B 3EJMA 2VU5A 1NDPA 1WKKA 1U8WA 2B8PA 3ETMA 3FBEA 3FKBA 3ZTOA 5CABA
chains in the Genus database with same CATH superfamily
1VLOA 1BY9A 3CJ8A 4ERDA 2QG9B 4LREA 3SZ2A 1CS4A 3D2WA 2XNRA 2EK6A 2XYHB 2PC6A 1S49A 2DVIA 3DLEB 1GXUA 4K4YA 1IR2A 2P9EA 1SJ3P 2N4DA 2ZC4A 5DG8A 3BBBA 1OY9A 3NBPA 2RDIA 4OZLA 4Z37A 3DOMA 3GIKA 1C1BA 2ZH7A 3BJYA 1CJKB 3PNIA 3PW5A 3IRXA 4RW9A 1MSWD 2H65B 3W2WB 1NPKA 2IYIA 1X9WA 4OX7A 1HBUA 1NK8A 1WEXA 1N0UA 2QSWA 4HT7A 1VC6A 3RW6A 1RA6A 3FBCA 2UU9F 3P45B 2XMUA 5F3ZA 4USHA 4TQSA 4DG1A 2ZH4A 2BR0A 1DQAA 2B51A 2K3IA 1A6LA 1KTVA 2YTCA 4DQSA 2F40A 2C42A 4JV5F 1IQZA 1GMUA 2YNHB 2UP1A 2KM8B 4I0WA 1WC3A 5U47A 5C7PA 4IG3B 5HMYA 1RUSA 4J9SA 3TQ1A 3HT3A 1Y5IB 5DGBA 4DJBA 4ILMA 5I42B 4LF2A 4JI1J 3CCSS 3T9NA 3L7PA 1KLNA 2C3UA 1IKXB 1WC5A 1BE4A 2M8HA 3ELHA 1W2IA 2MGZA 2F7VA 3DRSA 5KG5A 3P5TL 1V6HA 2YWHA 5DDRC 3UNYA 3TP2A 3Q2SC 4AL7A 4QIEA 4ZPVR 3MM8A 2CJ9A 4Q7AA 3PZPA 4N47A 3G82A 3UD4P 2JRSA 3HVTB 1ZM9A 4FP9A 4KY3A 2CRLA 3CC4S 2I38A 2W8LA 4BHQA 1FFSB 3GV5B 3QT5A 4FPIA 3N6NA 3TA0A 4QPTA 3BH6B 5GADU 2V6AA 2I8EA 3W66A 3ZTOA 1F9FA 2VC1A 1IBLJ 4NCBA 4CLYA 5AE3A 4USWA 4F50A 4IRCA 4LFBJ 3CDBA 1B3TA 4FXDA 5DDOC 1C2PA 1NPPA 4DV6J 2HHSA 4Q8FA 4C98A 2WVEA 3KLIB 3M2VA 4I56A 1S7HA 4LJMA 3LH2S 1GTHA 4MH8A 4PABA 1K44A 4AT1B 1CJKA 2EC2A 1Q5YA 1HL6A 4KH1B 2Y9HA 4JUZA 1S12A 3W2WA 4Y2KA 2GO8A 1KQGB 2ZDOA 2ZH2A 3Q22A 1Q78A 2BQUA 2VFSA 2YPZA 2C2OB 4DI6A 2V0NA 2DR7A 2PA3A 2E1RA 2RD5C 5A8KB 2MHEA 4NYZA 4X4UA 4FF1A 5HROB 2CQGA 1FERA 2ZHOA 1TVRA 5KFVA 3TANA 1SH2A 2BKNA 2C22A 1NDCA 1BWEA 2XMVA 2W7AA 4DPXA 4M5DB 3RYLA 1NDPA 2GFFA 4IG3A 1TK0A 2YWKA 2JLEA 3W2VB 2XGPA 5I42A 4F0KA 2ZNZA 1FE4A 4R0JA 2XGQA 3Q8RB 4FYYB 2UVWA 1IKXA 2ASYA 4ZCMA 2KHCA 2Y1JA 4KO0B 2L08A 1JLFB 2IC3B 3NMAA 4N5SA 1JNRB 3FBFA 2VB6A 4G1QB 1HQUB 2BJ3A 2QE5A 5HJYA 1VMBA 3FDSA 3D6HB 3HVTA 3L7UA 2KKHA 5GMEA 3JSYA 4DR6J 4WFAQ 4DQPA 2QLBB 3N5FA 5IT9Y 4GVBB 5LSRA 3CCLS 1HIYA 5BYRA 1YI2S 2AZ3A 2FJEB 1HNWF 3H8YA 3W5ZA 1SJFA 2LA4A 2HPUA 4LF8F 3KLIA 1SJQA 2M5YA 3S6EA 4P2XA 2W2QP 3NNAA 2XLJA 2X3GA 2YVSA 2G2OA 2QLXA 2YX1A 2L48A 3EDRB 2OPSB 3J80Y 4ZVRB 1FRHA 1SJ1A 3QGIA 3AT1B 3QYYA 1FXLA 3FSIA 2BJ8A 2A2CA 3UD5A 1H3DA 4PQAA 4BCAA 5A8KA 4FNHA 2Z0GA 4UTGA 1LXNA 3WQPA 2E5LF 1A7GE 3H42A 1JXEA 3SCLE 4AD6A 3G2XA 5D4LA 3HZEA 5G0RB 1P1LA 2DIVA 3Q0AA 2HW3A 5DJBA 5KG4A 4BLGA 1K0VA 2HRTA 4PXEA 3H4DA 5F8IA 2XMTA 3TAMA 4KTQA 4Q43A 1VIOA 3CCWA 1RWKB 1T3NA 3HFZB 5CZXA 1WSVA 3V5RA 4KO0A 1SXLA 1JLFA 1H72C 2IC3A 3SSQA 4FYDA 4KHMA 3ENQA 1FWPA 5KT2A 3HO1A 3V6KA 5HN0A 2CXEA 4G1QA 1FFGB 1U1OA 2OSQA 3H59A 3O2IA 4KB7A 1HQUA 4OYZA 4MYTA 4RUHA 2ZOMA 2IVYA 3EZ5A 1N4LA 1F0XA 1ZM2A 2BOAA 2FJAB 4EZ6A 1TMJA 2LU2A 4W92B 2BMBA 2G0CA 1U26A 3IRWP 5LSOA 2OH2A 5FDLB 2YKOA 3BSAA 2MJUA 5CA5A 4GVBA 4XPCA 4X4RA 3BZQA 2DRAA 1QY7A 1PC4A 2AIRB 4C0OC 3BPSP 2Q3PA 4NZ7A 5GAEU 4F4AA 2JH3A 4ED4A 3K58A 1R3NA 3CIZA 3GLJA 3TVYA 3D66A 2XY7A 1VYAA 3X1LB 2VKRA 2N7CA 3OFFA 4JI7J 5DG7A 1HA1A 3DLLQ 3R6LB 3K5PA 1FKAF 4OZ0A 5ADZA 2RIJA 1XMQJ 3MMCB 3V2UC 3BO3A 4C3LA 2OPSA 1TKTB 3LF0A 1MU2A 3DOKA 2OEJA 3PCOB 1UFWA 1U6FA 2DBBA 2H1YA 3K57A 2BEFA 5B0GA 1CJVB 4H4OB 3SMZA 3NGTA 1Y5LB 1I51B 3M1VB 4M63A 1NKCA 4O3RA 2GIFA 3I4PA 1NKBA 2HAIA 4ICLB 3QT6A 4EO8A 3VCDA 4G1PA 2ZE2B 2XO7A 1S76D 2Z4PA 5A8RB 5D6GA 5JVGQ 2GHWA 2F8HA 1VR6A 2J9EA 3EYZA 3BS9A 1IR1A 2AYBA 1SVDA 2DXFA 1RT1B 2PFFB 2V2QA 1Y4ZB 2GS8A 3DXBA 1LFPA 4DV7F 4G1IA 3CO9A 4AL5A 7FDRA 4OJHA 1IM6A 2D7SA 2HSEB 5M2RA 3C8YA 2B7CB 5KFLA 2DITA 2DISA 2YKNB 3OL9A 1D8YA 5IM0B 1KSPA 2W01A 1NJYA 3HMJG 1PYSB 4B9TA 1PYTA 2JX2A 2EI5A 3RRGA 1UMJA 4O4GB 5FDLA 5D4PA 5JXSA 1CEZA 3U1MA 4Y65A 4DSIA 3DM2B 4B3TF 2LQBA 2Z2ZA 3EWGA 1WC6A 4HLBA 3LQVA 1SKWA 3D67A 1UEVA 3M4XA 2BW2A 2DEJA 5CHCB 2QA2A 1YBAA 1DQ9A 2EBEA 2I5JB 1RA7A 1VS3A 3T3FA 3MZIA 4J9MA 4NASA 1CSJA 1PKUA 4NEYA 1TV6B 2XS5A 1ULRA 4HT5A 3MMCA 1Q53A 2FHOB 1TKTA 2D3OR 5L38A 4J7CA 3OVAA 2A3JA 4RR5A 4A8MP 1SKSA 1RYSA 2JLGA 1ROFA 1QUPA 1WORA 4DUYF 4OHWA 3K5NA 1CJVA 2VOOA 3I96A 2R8KA 3M1VA 2OPRB 5LOQA 3FQKA 4UUXA 4E0DA 2B3TB 3AXKA 2MSTA 5DM7Q 4JI3F 4NXMJ 2C28A 2WTFA 4ICLA 2HBYB 3A3NB 2ZE2A 2W7PA 5E2QA 1XNRF 4WTYA 5A8RA 2N4CA 2CZ4A 3IWNC 1TAQA 1ZTWA 2CQ4A 5KFWA 3N6MA 4KPYA 2OFHX 1RT1A 5ETLA 5ETMA 3Q83A 3OVSA 1JLQB 4LRDA 1RYRA 5DG9A 1SC6A 1RXOB 4DPYA 1UW4A 3UDCA 1Q5VA 4F4WA 1HD0A 3GR1A 1S79A 4MIWA 3UVJB 2MQLA 1X5OA 3IBCB 2XZTB 4U95A 3VZIA 5IM0A 3CTRA 1LV5A 1F2HA 3CMQA 3LO3A 4O44B 3K5OA 2LQJA 3S8SA 4O4GA 4Q2MA 1RACB 3T5KA 1WF0A 3DM2A 1CJTB 1QVGR 4YHHJ 3B8HA 1H2VZ 4NE9C 1U1QA 4FF2A 2KVQE 4WK3A 2J9DA 1KFDA 4TN2A 5ETOA 2I5JA 3EZOA 1WOSA 2GQCA 1YJVA 4DX5A 1LWXA 1BD6A 2F4FA 1IKWB 3OL8A 2BRKA 3N01A 1CQMA 1U2CA 4NCAA 1XIQA 4CH0S 3NGRA 2KYZA 1J2VA 2KB2A 1F6TA 5E33A 4CLTA 3AD7C 4EYHB 2Y0SD 2OPRA 5D4NA 3OQ2A 5L9XA 1K9MT 2V4RA 4HL9A 4A8YA 3IM8A 2DB1A 3TUJC 1RT5B 1YTYA 2UVUA 3EGZA 5LMNF 2E9TA 2C2EA 2Y0BB 5IV3A 4DR5J 3THVA 3Q8VA 2CQBA 5I3UB 3MF5A 2WOMA 4DV2J 5GAHU 2VV5A 4EWTA 3I4HX 2C3YA 2UXBF 4HI2A 4TLQA 3MEDB 1KVJA 4Q2LA 3K0JA 2BJ9A 2GV1A 2AEJA 2BA9A 3M8PB 4MK8A 4NLPA 3D5MA 2L9NA 3U7JA 3EGNA 2R8IA 2CYYA 1LKZA 2ERRA 3R27A 4JI0J 4LF6J 4M94A 1N36F 3TZYA 4JBCA 1N32J 1PC5A 2GCFA 4O44A 1AFJA 1VIXA 5GAGI 4PKDB 1NEEA 3OW2R 3AJ2A 5KOXA 1FDBA 1HWJA 1LWEB 5DGAA 4W90B 1CJTA 3ENWA 6FD1A 2OELA 2J7WA 3RBZA 1I1GA 1RTJB 2HGNA 4D3GA 3CB4A 3MOJB 3FFIB 2AYEA 4ANDA 3PO4A 3K5MA 1WSRA 1QLNA 2WRMA 2NXCA 3GPAA 2MKKA 1Y3JA 3TOQA 4A8OA 2ZHAA 4ZN1A 4X64F 2M70A 2AJQA 2P5VA 1DTQB 3AB4B 3MCSA 1OJ4A 2AD9A 2G0JA 1IKWA 4B3MF 2PI4A 3PJ9A 2AW0A 4LFCJ 2KL8A 2LA6A 2MQ8A 3SCJE 4LF5F 4PG5A 2VODA 3LOUA 5KFIA 4M5IA 3BGOP 3IC1A 4YY3F 5B08A 1T8EA 3CD0A 1UFKA 1U0SA 3CC7S 3NG8A 4DR7F 1DJ0A 3K59A 3N28A 3D3CJ 4U7UD 9RUBA 2HS3A 2RJZA 1RT5A 4M1KA 4YR3A 1HWLA 3OHAA 4X62F 5L1IA 2VPWB 3AY0A 1RWNB 3ILJA 3IM9A 3TUPA 2DHSA 4ELUA 4OZNA 5E3PA 2ZH1A 3F0NA 4DSJA 1LW0B 2YNIB 4H4MB 2R2TA 2ZUGA 3CW2C 1B0VA 1ZZFA 4HH0A 1OPZA 4FBTA 2AEFA 3MEDA 1IJFB 5KFGA 3SI8A 1B7YB 2AV5A 2YXLA 3AB2B 3LGHA 3SV3A 3MMAB 2A18A 5A76A 4WFXA 2APOA 4ECRA 3M8PA 4DL4A 3DRPB 1D9FA 3H20A 2YX7A 4DF4A 2UV8A 2X1BA 1T9WA 1WF1A 2XLKA 3RB4A 3M6VA 5LMUF 2L41A 3FSYA 1M5KC 2MLYA 1QTNB 1C0UB 4DUZJ 2H9ZA 1UZHA 1LWEA 1CQNA 3FVYA 3NS6A 2R7VA 1RTJA 3TX0A 5B0FA 2NLWA 5BR8F 3FFIA 2DRBA 4LFAJ 1H98A 3KLVA 2MSSA 1ACMB 1XR6A 1DTQA 1Z2ZA 1N33F 1ICEB 3S1TA 2DH7A 1O0PA 3ZO7A 5HK4A 3CPWR 1CJUB 4NLWA 1T9XA 2M8DB 2CQHA 5DZ6A 4ECWA 1P1TA 4OYBA 3D7SB 5LM7E 1J27A 5SZTA 2UUCJ 1UVLA 2PD1A 4NLGA 1FK9A 1TL4A 3BGUA 3J7A1 3ADAC 4NI2B 2AZ1A 2CVIA 2IY5B 4B3SF 4M5MA 4ANEA 4FF4A 2P8IA 3VVUA 4K5SA 3KTQA 3J7Z5 5IT4A 2K7KA 3DRRB 1SC3B 4TXSA 5DQHA 1FO1A 2UVVA 3CJ3A 3MFIA 3QPIA 4IR1A 1J5OA 1TP7A 3MUTP 1LW0A 2YNIA 3IR5B 3IA0A 1V5VA 3RTVA 3CCUS 1EETB 2VDIA 4K4UA 1ZA1B 4DR3F 2PEHA 3KLFA 3MMAA 5KT3A 2R7TA 3DRPA 2H48B 4Z7CA 1BC6A 5IFMA 3IGVA 2WVDA 4LF9F 2HFVA 4L74A 1L3SA 2HVHA 3LAKA 1SIZA 2WAQD 3IS9B 4DS5A 2PMHA 2UUAJ 4GKJF 3R7SB 2JLFA 2IM2A 4FXWA 1U25A 2YKPA 2OIHA 3AOCA 1C0UA 2C2RA 4A47A 2JC1A 2OD4A 4DV3J 3DN9A 1S77D 5D78A 2CJXB 2QIFA 3MEGB 4LIWA 1R6YA 3F56A 1T9TA 4NLQA 5CCLA 2RILA 4Y0FA 1NHVA 1HBOB 3W61A 5L1LA 4DWIA 3EGWB 4DV4J 1MWYA 5EWFA 1U6ZA 3NCRA 1VI7A 1TAUA 3FEXB 5KFCA 2GVDB 3OLBA 2EFPA 4HACB 1W26A 4NEZA 1OS5A 3CJ5A 1CJUA 3V6DB 1VQYA 1KDNA 2B6AB 2IIHA 1K1SA 5T41A 3W60A 4YOEA 1FHTA 1X8DA 4NCGB 4ZJQA 4FS1A 1FD2A 4F04B 2V9WA 4RPFA 3G6YA 4NI2A 4AE5A 2MQOA 2KI2A 1IBKJ 4PWUA 4CYUB 2CJKA 2PO4A 3PO5A 2HHVA 3OXFA 3UWTA 3R2DJ 3FEYB 2WZ1A 2XYPB 3M2UB 3BYPA 4LF4F 4RNFA 2CQ2A 3UE2A 1NPRA 3QSYB 2BZ2A 3MHYA 3DGVA 1EB0A 1EETA 4LBIA 2ATLA 4LQ9A 5DM6Q 1N5SA 1BHNA 2DPJA 2M0GB 1Z2LA 4ED2A 4JV5J 1NSAA 3H0PA 4K4ZA 3ITHB 3J81U 4ZK7M 2KT2A 1VK8A 1Q95G 5EGYA 4C3MA 4UW2A 2HHPA 2HAFA 4JI5F 1FKOB 2XG8A 5FIIA 2VU5A 1M90T 3NWGA 2DR8A 8AT1B 3D1HA 1VJQA 4JI4F 3MEGA 3JSBA 2C3OA 2LEAA 1UCNA 4J9OA 5IWAF 1HHTP 3DI6B 1HBOA 1IWAA 3R7BB 3F44A 3HK2A 2MMYA 3MD3A 3ZZPA 2XSJB 3HHKA 4HYKA 1XR7A 2GVDA 4DL3A 1FJ7A 3BH7B 3SSSA 5GMDA 3R1LA 4HACA 1M5OC 3GIJA 1QJHA 2R2SA 4X65J 3V6DA 4IO9Q 2UUBJ 2OJ3A 2B6AA 3HHEA 1X5PA 2ILZA 4OI1A 2ZBIA 2ATCB 3HJFA 4KGMA 2DGXA 1RTDB 3RU0A 1IKYB 2Q1LA 4NCGA 4WK1A 3PRBA 2GMHA 4C3KA 4F4KA 2IMOA 4EFAC 2FVSA 2QL5B 3RRHA 2V8GA 3A8EA 4OZ3A 4CYUA 1FFWB 3OPKA 3VQSA 1WD6A 2C2KB 3OL7A 4CWBA 1P9QC 4DFPA 4CM2A 3WC2A 4F0MA 2YNFB 2KXFA 3JSMB 3M2UA 1HD1A 2PEBA 4RX6A 4X84A 3E51A 1S4EA 4WFZA 2LU1A 3A8KA 4KRWA 1JJ4A 3GILA 1JLEB 2DD8S 3VV2B 1FD8A 2W25A 4XIUA 2IYGA 5F9LA 1X60A 2CQ3A 3ZZUA 2VF3A 6FDRA 3ITHA 4DV5F 1PG5B 4QR2A 4J9PA 2MPUA 4YDXA 3TJ8A 1FKOA 2RU3A 4IO1A 1SKRA 3Q8YA 4TY9A 4UY85 2F4VJ 4DCOB 1VHFA 2YKAA 4OFZA 3A12A 1TELA 2LXIA 2CPEA 1ZS6A 3NS5A 3KNGA 1E6YB 1NZ8A 4FDFA 2QYCA 3DI6A 1RBLA 4B3RJ 3NWRA 2E9RX 4C6AA 1F60B 2XSJA 2WB4A 1RISA 2NXNA 3LP2B 4QU7A 3NGUA 1M5SA 2PGCA 2MTLA 1WNEA 5HP1B 4XAKA 4LVOP 2LQ8A 3PW4A 1ZPVA 4WTOB 5EDWA 2E1AA 3V4IB 1JX4A 1RTDA 1IKYA 3CT9A 3U1NA 1S97A 2QA1A 3PR4A 3D6TB 1NK9A 3MPVA 4XK8C 1N48A 5HQ8A 3RB0A 3P6YC 2L9WA 4LR8A 5FLXU 3NLCA 2CQ1A 2HS4A 5CYJA 2YNFA 3JSMA 4EBEA 3RGIA 3VAJA 5IC6B 3L7OA 1F5CA 3AD9C 5J1EB 1NNDA 1JKHB 4U7UK 3B4DA 4JP8A 2PMWA 5DO2A 1JLEA 2CPIA 2QMUB 4OYPA 3P5BP 2CVEA 2E5LJ 2C2NA 1YZ6A 1U48A 2LEPA 3DC2A 3V81B 1MROB 1QAIA 3UDEA 2BBEA 1FDNA 1XEZA 2UVRA 1SQEA 5F8MA 3IAS9 3MM9A 3CJQA 4PPZA 3BBFA 4RNHA 1RCXB 5J1PA 1S6PB 5EN1A 1FF2A 2RNEA 3KG1A 3PRDA 1E6YA 4CZCA 3VGVA 3C66A 3KLGB 4YUDA 2BABA 1QUVA 2ADCA 4QU6A 4WU2A 2VD3A 3HSGA 2I9SA 2B0GA 1JLBB 1BMQB 1WI8A 2ZOGA 2CWKA 1Q8LA 2Z58B 1RTIB 4CLZA 3KJNB 3EJMA 2DK2A 2KFNA 2YQ1A 4EYIB 2B5JB 4DU7A 3PX4A 5HP1A 2FLOA 2OPPB 2P9GA 2HWTA 4CO3A 4ED3A 2MZJA 2KVIA 4OI0A 1GMWD 3MECB 4TU8A 3V4IA 2WCXA 1XNQF 4BC7A 3KMQA 3FCHA 1NB2A 1RP5A 2IPOB 1Q1KA 5CCMA 2RQKA 4ALZA 5A8WB 2AKWB 5I4MA 2DNPA 3CJKB 2OEKA 3CJ0A 2EK1A 4OLOA 1ZOTA 3CNQP 4FS2A 2A6MA 2DXEA 3NRBA 2QMWA 5C2CA 4DN9A 3EDQB 1NBEB 2R8JA 1UVMA 3H4BA 5DDQC 3PJXA 4ZVPB 2F5GA 4EBCA 3GJTB 1S48A 2U1AA 3HSDA 3I0RB 1SQFA 3BV8A 1TK8A 1S59A 4ED8A 1JKHA 4Q45A 2DYAA 1PJ7A 5ETTA 4N8NA 3MAHA 1U09A 3R5GA 2V8PA 1I6JA 3DCAA 3UCUP 1ZAVA 5T7LB 3MM6B 3EXYA 3QJJA 3V81A 1CC7A 2RUSA 1MROA 2CADA 2GHPA 1DY3A 3MR3A 5KFEA 2HGLA 1WTFA 2DHAA 4F2RA 2FPHX 3FNNA 1Y7PA 1LQ9A 4E98A 2R7SA 1HPZB 1EQMA 2XO6A 2W4DA 2VA3A 4ZITA 2B4OA 2LQ9A 1KP6A 4UY8T 2J8AA 2ZM6F 4LF7F 4JI2J 2VDHA 4PG6A 2ZH6A 2FY1A 1GX5A 3KLGA 3QZ8A 5D0GA 2RVJA 2W4PA 2UXDF 1K0TA 1DARA 5GADI 2BYCA 1JLBA 2BJ1A 1EP4B 1RTIA 3CJSA 1UZDA 4JOUA 1Q4RA 3U1LA 1L3UA 3NP5A 2B5JA 1T7PA 5KFBA 3MCOA 2K3KA 4URSA 4QW9A 2OPPA 4B3TJ 5HVGA 1SPBP 2AP6A 3MECA 4TNOA 4DV1F 1FEEA 1ZA2B 1UWAA 1D9DA 4AQYF 2HFNA 3QWPA 3MPYA 4DF8A 1C4CA 1XTZA 3W5XA 1L5UA 2JSXA 5AXMA 3MPWA 3CJKA 2D9OA 4ZVOB 3NGDA 1RHUB 5A2QU 1U1KA 4BWMA 5EX0A 2OTLS 1NSKL 4NMXA 5K8MA 4DUTA 4FKXA 2NCKL 3CC2S 2KDOA 1NLKL 5F41A 2NPIA 4OLPA 4CLPA 1JLAB 3QIDA 4DUYJ 4MAKA 2M7SA 3KDOA 3RBXA 2QA4G 2XEXA 2MHNA 1URRA 4FYWB 2PA8D 3H90A 4JI3J 3KMSA 3MM6A 1WTBA 3QWUA 3MCMA 4QOTA 2NXEA 3BN4A 3CGIA 3H25A 2R7QA 5I3QA 1TKXB 4RJVA 3UD3P 1EAYC 2YH0A 1FRKA 2ASJA 1MW7A 1RAGB 2LKZA 1VC0A 3Q89A 3C2PA 2IM3A 1QE1A 2V4QA 2HVZA 2JFDA 3GV8B 2V5HG 1PAUB 4Y28C 2W8KA 3MPDA 4TQRA 2GIQA 2FY8A 4QBUA 4OJGA 2PE8A 3C16A 4HTIA 2BE7D 3H5UA 2Z30B 1QTMA 1MWZA 2HHTA 2AX0A 3P49B 2LVWA 5K8NA 2YX4A 4CH1A 1RT7A 1VRQC 1RGVA 3SSRA 3HSZA 3UPFA 1IKVA 3KDNA 2ZEJA 5DQIA 1B0TA 4Q0BB 2ACMA 3LPYA 3DLBA 2E5GA 4U9RA 3E3XA 4UZBA 3OV7A 1YJRA 4C48A 3H2VE 5M2PA 1XERA 4OX6A 3MD1A 3FZBA 4F3MA 2C2ZB 3LANA 3TNVA 3MM7B 1Q79A 3GB0A 2NXJA 3HSJA 2KXHA 4JI1F 4OI2A 3FBEA 5KFMA 1U0HA 3ILLA 2JZ5A 4JV1A 3DDIA 2M88A 2CFXA 3MEEB 3QQCD 5LL6d 2P6TA 1HQ2A 1UVJA 3JQJA 1GXLA 1JLAA 2VOPA 4P72A 1PILA 5E0OA 4F67A 2MZQA 3PV8A 2X1GA 1EX8A 2VPYB 1LOUA 2HVIA 4ELVA 2CPFA 4P9SA 3NAIA 5KFHA 4QCLA 9ATCB 3GFZA 1TL1B 3OFGA 3OVBA 3EM1A 4IDKB 2GIRA 1IBLF 1YJNS 2R8GA 2RS2A 4LFBF 2EG1A 1U1PA 2PT0A 2E9ZA 4H54A 4YR0A 4DV6F 2IJFA 3UO0A 1FXRA 5T14A 1RBOB 5AE1A 2VJVA 5F8NA 1B99A 5IQQA 4LRAA 4LF1A 1TQLA 2NZCA 2FHJD 3OSPA 2DH9A 4CO4A 4YEAA 4JI8J 4X66F 3OHBA 2QL7B 3TUZC 5HBMB 2CJBA 2MZTA 3CVKA 2ZUAA 3DU5A 4J9VA 4CLUA 1OO0B 5GAEI 3FMWA 3IG1B 4XDCA 1NDKA 2P2CB 1C0TB 4NL5A 4RNMA 1YRUA 1R27B 1FE0A 1QAYA 3CCTA 3VZHA 3GQCA 1ZH5A 1C1BB 2ZNYA 3C19A 1UP1A 2X1AA 2IA6A 4JI6J 1GMVA 2C3MA 1KEKA 3MFHA 2QLWA 4DZDA 3MEKA 4RW9B 2FLPA 1LEOA 3MM7A 3FUYA 2FDNA 4X64J 2VFUA 4L76A 1TL5A 3CCMS 3FRZA 3VVTA 4B3MJ 2B43A 1VC5A 1QAJA 3MEEA 3PG9A 1XMOF 4CCHA 4RBTA 2GJFA 4PR6A 4PWDB 4DG1B 4LF5J 1UA0A 3ETMA 1WG4A 1OQ3A 4OZ5A 3PYDA 4M5JA 4YY3J 4O0NA 2QO3A 4DQRA 4DSFA 2Q43A 1RT4A 2FTRA 2PFDA 4S0MA 1G3OA 2M2BA 1PSDA 1Q82T 4USMA 5ETRA 4J9NA 3MCNA 1TL1A 3OTBA 1UAWA 1RABB 3BSOA 4IDKA 3V4MA 1O51A 1X9SA 2IVMA 3VGUA 3UN2A 5D4OA 1XN9A 1KD1T 4U7CA 3N4WA 2XY6A 1F3VA 2HIYA 4WE1B 3HFKA 2LQ5A 2QN6B 1SKUB 2NREA 1U1NA 4KGZB 4NX9A 2ZZTA 5L39A 4OJ1A 1ZZNA 2G0IA 4Y2IA 3P8BB 4U6PA 3I5BA 3Q86A 2HZCA 5IV4A 3DMJB 2KXNB 1Y3KA 4OX9F 4PWWA 1A0OB 4Z7YA 4DR1J 5HBMA 1GMWA 2EKYA 4P75A 5LMUJ 3W1YC 3IG1A 1C0TA 3M8SA 1GX6A 3TZZA 4EEYA 3PR5B 3M2VB 2XLIA 2VICA 4C0HA 2V9KA 5BYQA 2Y3YA 2CQDA 1FNOA 2IRYA 3RZAA 2FJVA 1NO8A 1VQLS 4WPAA 1XQIA 4KGVB 1YBTA 3R5BA 1TKZA 4HDHA 1N33J 3J7YU 2KFZA 4CM0A 4AFFA 4N56A 2E29A 2HHWA 3G6ES 1YK9A 4WCEQ 2ZH5A 1YVFA 1N0VC 1MN7A 4I4BA 3I6PA 1AXQA 1PO6A 2JDJA 1XJWB 4PWDA 4QWDA 3BB5A 3CDUA 5ETNA 1VQPS 2RSQA 1TVRB 2DHXA 2E1CA 3RR8A 2CUYA 1NK4A 2RQCA 4X4QA 4MJKA 2GA7A 2HEKA 2WVBA 2HYIB 3Q8QB 2QLFB 3J81j 3VWSA 1T94A 3CF5Q 1SQGA 3FC9A 3DRXA 1NDLA 2CNKB 1DBDA 2Z2MA 3TEHB 4WE1A 3HF5A 2EEYA 4ECYA 1FRLA 4QR1A 1UWBB 4RW8B 4M95A 3T1AA 4JI7F 3R8YA 2HVEA 3CXCR 4J5OA 4C9DA 4ECSA 4I68A 1QSYA 3LUYA 1XMQF 5ETVA 4DR2J 4NLUA 3CUNA 3DMJA 5KFKA 4IH6A 1ZAWA 3ZNJ1 3ONQA 4LT6A 3WX4A 4IOBA 4QWEA 2OMLA 4LF9J 2E44A 1FNXH 2HMIB 3Q2TC 5L1KA 4GKJJ 2CJYB 3W9JA 2ASDA 2PN6A 4M8LA 1RJJA 1FDDA 2B4UA 4CLWA 3PIPQ 3L9ZA 4FNIA 5HLFB 5HQLA 4JV0A 5HMXA 2G2YA 2BJEA 5ITHA 1RADB 5THWA 2DJWA 3O6QA 5CABA 3OJUA 1TKDA 4ECVA 4K59A 3ZZZA 4ZLPA 1FESA 4YP3A 1N54B 3IWLA 4MT1A 3PRVA 5KT4A 3B6BA 3LA0A 1RHKB 1CLFA 4F7VA 3IR6B 2ILYA 3HLUA 2HHHJ 3THTA 5A6PA 4DV0F 3PXGa 1R8PA 5CD4H 5J1NA 4R5PB 4HHJA 5KG0A 5CZVA 2DR5A 1M0SA 2BXJA 1UVKA 3R5AA 3DRYA 1MMLA 4O3QA 3HI9A 1HBMB 2RHQB 3CCVS 1AA1B 1UVNA 3U27A 4KYZA 5F9NA 4MFBB 3GFHA 3WX8A 2OAUA 1X9MA 1HYSB 1XR5A 4USUA 3TAQA 5E3AA 4DPOA 4M5LA 2FJXA 5GAHI 3C14B 2E5HA 2YQ3A 4ZP7A 3GSIA 5IXUA 1H74A 2G2ZA 5JVHQ 3TAMB 1UVIA 2FJDB 4EO6A 5KFQA 4B9VA 2J0WA 1RHRB 4B08A 2IBOA 3GU0A 2VPZB 3KHRA 3M6UA 3VQTA 3PKYA 1WEZA 2DR6A 1VDHA 1EIYB 1UWBA 4UQGA 4RW8A 2YPYA 2RB7A 3DOLB 4ZIVA 3G87A 2RQ4A 3M7VA 5A6WA 1F9HA 1SL0A 4ZVTB 5KOWA 3CCES 1X4FA 1GAOA 2K7JA 4ETZA 3G8QA 3UDVA 5IT9U 1SC1B 1UPMB 3R1HA 2HMIA 2VFRA 4RUAA 5K5MA 2GNKA 3OTEA 3B4MA 4WWSA 1YGYA 3HFVA 1U24A 3VAGA 2NZ4A 3T6BA 1ITPA 2B9EA 5HLFA 3HX9A 4URQU 1VBYA 2RMLA 2RHSB 4EI2A 5AJ3F 3US5A 2RDJA 4NZ6A 2KT5A 2FVRA 4B9LA 5IWAJ 3CJ4A 2D9PA 4L3KA 3OTOF 3M2RB 2FB0A 3J80U 1N88A 5B0BA 2FVPA 1RWWB 1DRZA 3AD8C 1MU2B 3DOKB 4PZVA 4A48A 3R9LA 1DLOA 1O6XA 4ECUA 4P7VA 4R5PA 4K2XA 1HNXJ 2KJWA 2FD2A 1G6BA 3PW0A 1FVSA 1HBMA 2E7WA 2V68A 1LW2B 5L46A 2R7WA 2WSFC 2COLA 4MFBA 2UZAA 2JEIA 3A8IA 3DLKB 2DCLA 4DFMA 1HYSA 2CPYA 4C11B 5KT5A 1HNZJ 2EKNA 1T3OA 2RDDA 3GR0A 1N34J 3EVMA 3C14A 1JJ2R 2DH8A 5KFZA 3I56S 4QWAA 3D1QA 1RWPB 1NSQA 2XWXA 3LAMA 4CT9A 4GC7A 4YHHF 2WW8A 1REGX 4DS4A 1OPIA 2FHJA 2AGPA 4A8QA 2WVFA 1Q81T 5IC4B 4OZJA 1RAAB 1RTHB 1Q16B 3LPEA 1OYEA 3DOLA 4NLSA 5D0EA 5C2GA 2HHUA 3WIUA 1RDRA 2HQDA 3TJAA 3NCQA 5A0YB 2FLNA 4EBDA 1FDAA 3FSXA 3VALA 2ZJRQ 3ZZOA 2CPZA 1KLMB 3MR7A 3TEGA 3OTCA 3PJWA 1RHMB 4ECTA 1SH0A 1PBAA 4PRFA 1YLXA 5K20B 4NPOA 3NKYA 1JXLA 2BKOA 1YJ7A 4DX8H 2JVRA 2HS0A 4TU7A 3RUBL 3Q23A 2P6SA 1S1WB 2J0QD 4PXBA 1ZAXA 2B9WA 2O3DA 4CO0A 4GKKJ 3M2RA 2MLZA 4RBUA 2N82B 4K0KJ 3I31A 1UL3A 1FJEB 2ABYA 3AOBA 4NWBA 1W2BR 3OSNA 2CPHA 1D8ZA 4I64A 2XY5A 5A2QY 4K4TA 4GC6A 1PJ6A 2UUTA 2XI2A 3PKMA 5HQMA 1CG2A 1U02A 3MMJA 1OIAA 4WIIA 4B9NA 1LW2A 3CD7A 6AT1B 3D0IE 3MOZA 2VKZG 1I94F 3MXHP 1S1XB 2VG6B 2BW7A 1KHWA 2V67A 4ZLJA 1X4EA 4LF6F 3DLKA 4C11A 4CI0B 4P71A 1N32F 4YB5A 3OR2B 3CMES 1NK0A 4DPWA 1KVIA 3HPOA 3QATA 4ZVQB 3RG6A 1K73T 4BWJA 3N79A 5J2NB 3AXMA 1H7XA 2J6SA 4XPEA 1ZPWX 2MY7A 1U45A 2GC8A 4LQ3A 1FI4A 3D1OA 4RNOA 1Y00A 2DNLA 3KG4A 1OMSA 1RTHA 3HD2A 2F65A 4RZRA 4QIGA 2F1FA 4O3SA 4I2PB 3DNCA 1M5VC 2LEBA 4QYZK 1F3FA 1IQTA 1GK8A 2ALYB 5A0YA 4LFCF 1R0AB 1G7CB 2NPFA 2GZOA 1KLMA 4I67A 2BE2B 3BDEA 3IAM9 3HVWA 1X7VA 4A8XA 3GMGA 2WBMA 1V3RA 4YQWA 2ASLA 2NUUG 3VTIA 4P6QA 1NJIT 1S1VB 3ZTSA 5B09A 4C8OA 2BJDA 3VR1A 2DTJA 1S1WA 1OYDA 1UEUA 4USVA 5K14B 5C24B 3AOAA 4NLOA 5EUHA 1RWVB 1S5ZA 1X4CA 1VBXA 3D68A 2XM3A 4ZPCA 4NA3A 3ETOA 3NNCA 4FZVA 2XHCA 2R42A 4IH7A 3THPA 3TA2A 1HHQA 2CNLB 1D09B 2EFOA 3FEZA 1RLCL 5C25B 2Y1IA 5LSLA 8RUCA 4J9LA 4L3NA 2UUWA 4RNNA 3ZNUA 1U49A 1S0VA 1IBMF 1G4CA 3LALA 3HHLC 3Q8SB 3AH6A 1LWFB 3OXGA 4WFBQ 4E8UA 4A8FA 2R2UA 2MKJA 1S1XA 2VG6A 2ZVSA 2W4CA 4ZCIA 3L4BC 1WDTA 4YFUA 3MWBA 3K5LA 1B7FA 3OR2A 4OYOA 3KHLA 2OKQA 1S72S 4DUZF 2WOMB 3NGKA 1T95A 5DETA 3NEKA 1DHMA 5J2NA 5HAOA 2DY9A 3RW7A 3HULA 4X4SA 2JC0A 1QSLA 2XZDB 2FC9A 3RB6A 2RUGA 3D0HE 3BEGB 2O5DA 2G4BA 2H54B 1IUJA 1X0PA 2XMKA 4F3OA 4Y3CA 4CDIA 2BQ3A 4ZP9A 1QM9A 4I2PA 3GCXP 2JEFA 3TR5A 2HNDB 4RLEA 3FZ2A 5HSPA 1YWXA 2DO4A 3BGLA 1RQ0A 3CD6S 4NA2A 4ZPTR 2Y8WA 4B9MA 1R0AA 4HI1A 2I1RA 2DGTA 2G9OA 3JQKA 4C8KA 2LCWA 2BE2A 4Y2CA 3B82A 1EJ7L 2A2DA 3SDEB 1Q8IA 3EMTA 2UUCF 3BDPA 4WYWA 2H3EB 2M9KA 1S1VA 4LF7J 2EVZA 3AQOA 1CC8A 1NXIA 4OV6A 5K14A 5C24A 4OYIA 2BVZA 2MJNA 3K89A 3W8PA 1R8BA 3POTB 4P2FA 1T0TV 2UXDJ 4YN3B 5B0EA 4F36A 1XWLA 5DS7A 2ZH9A 3EICA 5C25A 5KG1A 3BR9A 1U1MA 3GFXA 4EMDA 4WZQA 4V1Ak 2MKHA 3X3UA 1FX2A 4G65A 1LWFA 3BO4A 3M8YA 4YB1P 1NK5A 1WF2A 4WFNQ 4AQYJ 2W24A 2UUAF 2RRAA 3HJVA 3UI3A 4LSZB 3HT0A 1WOPA 1X5SA 1IR0A 4USIA 3BQ0A 4DV3F 2YWEA 1FJGF 2MYFA 1R7IA 4RU9A 2E5JA 2ACYA 3OLAA 3T6JA 4TKTA 2BQRA 2L3MA 3EVWA 1T05B 3AQPA 2BM1A 2BX6A 1KKHA 1L3VA 1NKEA 2R7UA 2HNDA 3ZC4A 1KNZA 4A46A 1YRXA 4DBQA 2PSZA 5D8HB 2QRRA 3DU6A 3KYLA 3O3LA 2WONB 3SQGB 2Y1RI 4M5NA 2DGQA 4UUWA 1V9OA 4V19J 1PYOB 5E5NA 2XMAA 1UTAA 3KXDA 3SDEA 7AT1B 3PEHA 3BKUA 4RW6A 3ZZ0A 2DNOA 2OTJS 4IFVB 3EPIA 3QT7A 1JMTA 4KFBB 1N5YB 3I0SB 4PPDA 1IBKF 2BKPA 2NSBA 1WKLA 2Q6CA 4G3IA 2VQEJ 2OI2A 4PCQA 4ER8A 2MLXA 3UFCX 1Y10A 3POTA 1BUXA 5KFNA 1VBZA 5AXLA 4KHRA 4KIAA 2AX1A 1FRXA 3FKBA 4KT0C 2ROGA 4MTPA 4RO0A 2J6UA 2VQFJ 3AFGA 3G6VA 4OL8A 1RAFB 1J5EF 2EFVA 3MR6A 1Q8KA 1TZ0A 3DGPB 3E8OA 1FK9B 3HHLD 3MUMP 1KS2A 3P4UB 1URNA 1L3TA 3RRKA 3O5TB 4IR9A 3CSKA 1VJWA 1R8CA 1YBUA 1XC9A 3IWXA 1ZBTA 2UXCJ 4Y2AA 2FZGB 4QZVB 3QFWA 5KT7A 3EGVA 1J5OB 3GJQB 5CAAA 2QYGA 4J9RA 2XTJP 1S0NA 3E01B 1WDDA 4UZCA 1NU4A 1RT6B 1B0PA 3F41A 4PG4A 1TR0A 2FJWA 3KLFB 1N5TA 1SV5B 2V4JA 4B9UA 4QR0A 1VQMS 2XCAA 1T05A 3W3SA 4EZ9A 4PQUB 1N8RT 2B8PA 3HHDA 2QJ3A 1VOMA 4A4JA 5C5JA 3QGPA 4O23A 4TU9A 3H5SA 4X65F 2QTWA 5AT1B 1IXKA 5KG3A 2KYXA 2WONA 2D3O1 3SQGA 3LW5C 2UUBF 5HL7Q 3T5LA 1UJ4A 4OMFG 3Q8PB 1RU2A 3M32B 5DDPC 3WDOA 3DLEA 4KHPJ 4X4TA 1WG5A 3OXLA 1R89A 2XSFA 2DNGA 4XDDA 4ZLLA 3HKZD 2CQ0A 2MZSA 2AYMA 4IFVA 3CCQS 4ED1A 3ICLA 1A9NB 1AUDA 4KFBA 1N5YA 2PDAA 3I0SA 1X4AA 4DX6A 4EU0A 4GO7X 3W62A 4L72B 2GMLA 3QT8A 1H73A 2MB0B 1AZSB 1YKWA 4X66J 4K7QA 3H40A 3IGNA 1IWGA 1RLDA 1YX2A 2B4VA 2WBRA 1XK8A 1P9YA 1WACA 3SFGA 2C2DA 4ATNA 1GT8A 4LR9A 2NR0A 2O66A 4ZVEA 1FKPB 1SUQB 3R5CA 1OWXA 1KRPA 3DGPA 2XQCA 3H2LA 4MIBA 4KAIA 4ECXA 2AEMA 1PCAA 4HR2A 4ILRA 2YNHA 4KGXB 3FGVA 5MLCV 2VFVA 1U2RA 3D4JA 4DR4F 3RBDA 4DXLA 2F4VF 4ZN3A 5DQGA 4J91A 2Y1LB 2QMXA 1Q0NA 3KUGA 1DAXA 1VQSA 3E01A 3M9MB 3HZGA 2F8MA 2JJ4D 4F4XA 1HKAA 3T5HA 1XMOJ 1RT6A 2H4YB 5KAKA 3HD1A 4OZ2A 1SV5A 2Q79A 1Q8BA 4B3RF 2J7KA 1JNZB 1BQMB 3KUHA 3IR7B 2DT9A 2CWXA 4PQUA 3QAEA 4C7QA 2A10A 2RAQA 4D3HA 1UA1A 2SXLA 1XMBA 3ZFVA 2CZVC 3W9IA 2JHEA 3BR8A 4QWCA 4K4WA 1FTRA 2OD6A 2AQ4A 4P52A 3QLHB 3M32A 4DFJA 1OY6A 2HFZA 2U2FA 1FVQA 2J0XA 3NMRA 5F8JA 4HKQA 3AJ1A 1RE1B 3BN7A 3BO2A 4OYXA 4LSNB 2RU9A 4PUOB 3CO0P 2QLJB 5BYSA 1KFSA 4K2JA 3FCVA 3ET6B 4OJ3A 2B8QA 4C8YA 1XBWA 1AZSA 2NUHA 2KN4A 4OX9J 3G71S 1RT3B 3MGJA 1FTCA 2QFJA 3LP0B 4WYLA 3CDEA 4ZKAA 4CLSA 1WHYA 1FKPA 3EXCX 1X4HA 4ZVFA 1SUQA 5HROA 2AF6A 2H5IB 3H5XA 2W9BB 3WBZA 2IDEA 2GQ2A 4UF4A 2HIQA 3MPUB 4M5DA 5J2MB 4ZP6A 3JYTB 4CT8A 2X1FA 5HJXA 3W2VA 5E3QA 3VAIA 3GE9A 4DOZA 2KHDA 1BQXA 2MQNA 3VAMA 5BXIA 2IAJB 2WSCC 4I7FB 2O67A 2ALZA 1RBAA 5HMWA 2UU9J 3D6MB 3FMBA 4PEOA 3KK1B 2H4WB 2R2RA 2I2YA 2CG4A 2R7XA 3BQ1A 4P7TA 2FUG9 2MZRA 4DEZA 1BQMA 4ZDNA 3B54A 4M5HA 2KRRA 1Q86T 3C15B 3LWMA 2B9YA 1D9AA 2HQIA 1I3OB 5D3GB 2LFVA 4PXCA 2HVDA 2HWHA 4ZPDA 3T1HF 1S57A 2W9AA 4F2SA 3ZTRA 3Q8UA 1MMNA 2ZJQQ 3QLHA 1BWVA 1YG0A 4M5GA 4ZOSA 2AWZA 3MR2A 1MMDA 2OO4A 2ZKTA 2HQ3A 1GH8A 4NOHA 1W7WA 2QC3A 1H2TZ 4DDFA 2HBQB 4LSNA 1U8WA 3DDNA 4PUOA 3ZZRA 2BRLA 3R3TA 2E1MC 2R3VA 3GG0A 3ET6A 2VONA 4WZMA 2N3LA 3TARA 1RK8A 3HHLB 1RT3A 3NOGA 2QGFB 2E5IA 3LP0A 1LWCB 4P74A 3KUEA 4FVCA 4NMLA 2CDQA 3MI7X 4WF9Q 2GX8A 4YDDB 1NM2A 4ZHRB 4X4NA 4R0EA 4CRJA 2W9BA 2PI5A 4IH5A 1HI8A 5HVFA 5B0DA 1VQ9S 2CJAA 4KBIA 2J8SA 5KFJA 3D28A 5G0RA 1LNQA 5K9FA 2CJQA 4LBPA 2DHGA 5J2MA 3JYTA 2E7VA 1UJ5A 3O1LA 1BQNB 4QPXA 4OQJA 5LXRA 3J7ZT 3PACA 4H4KC 2HBZB 3PVXA 4IG0B 2KZZA 4RWXA 2FZCB 2LDIA 4TY8B 2DNQA 5KG7A 5ETKA 2IAJA 2H5EA 3UN5A 3JXOA 4I7FA 4JI2F 4DV0J 1D0EA 3VGTA 3FQLA 3NS7B 4ED6A 3SEOA 5L8RC 3KK1A 1HR0F 4GO5X 4YB6A 1CVJA 2KRBA 1JJCB 4ZPAA 4CTAB 4RBVA 3HXMA 3SV4A 1Y5NB 4V19X 5IOLA 4UQTA 1B4SA 3C15A 1SH3A 4F26A 2HZVA 3TO8A 3HVAA 2P9CA 1RI7A 3T1YF 2H51B 2YKMB 5DRKA 4DN0A 5HO4A 4YMEA 4QIFA 5D3GA 2I6WA 3W9HA 3PX0A 4ENOA 3KK3B 2HHXA 3MM9B 1CPZA 4NZ0A 1HMVB 1JK9B 2W2MP 1R8HA 1FNMA 4A8KA 3GWCA 3GIRA 5LXYA 3R97A 4DL2A 4WP8A 4L75A 4DQQA 2GQQA 2RKIB 5KFSA 3TUIC 2R7OA 2EFGA 4NLTA 1EQ0A 1N5QA 1WOOA 3M8RA 3UR0A 4IQXA 2C3PA 2IFXA 2JL9A 1TUVA 3H98A 2AU0A 4JYAF 1U8SA 5K8PA 4LR7A 1D1UA 5CQGA 3PHEA 3HHLA 4N8OA 2XB2D 3M6WA 1LWCA 2IMWP 3PYFA 4OYAA 2LP4A 4QW8A 1HNWJ 5KFDA 4H4OA 4ID5B 4ED0A 4OHXA 1UFLA 4ZHRA 2IJRA 4LF8J 2EC0A 1AW0A 5AJ3J 4LUBA 3MR5A 2RS8A 4RW4B 1HWIA 3OL6A 1FRMA 2VG5B 4MKAA 2V2VA 1IM4A 1YJ9S 4URGA 3RAMA 4MYUA 3CJTA 3D6FB 1JLGB 2G1HA 1BQNA 3OTOJ 1N5VA 4IG0A 2J0SD 2MQMA 1TFYA 4C97A 1F1BB 3F73A 4TY8A 3AAWB 3UDLA 2IRXA 1JLCB 2MQQA 1SIWB 2KJVA 2KG1A 1QAXA 3UN3A 4WP9A 4AXIA 4QIWD 4CTAA 1B64A 2DGOA 2OUGA 1VQ5S 1WC0A 4NXNF 2YKNA 1CBKA 2V8DA 4CO5A 4WKYA 4K50A 3JSRA 4WXWA 2MKSA 5F8HA 3HCXA 2ZVIA 4P2MA 2YKMA 3OFEA 4NLXA 1HNIB 3M8ZA 2EWHA 3KK3A 3OTDA 1HMVA 4DX7A 3QRRA 1VISA 2FLLA 5IS2A 5CYQB 5E41A 1BXNA 3D0GE 2QFIA 2AYGA 4LRFA 4C8LA 2OMOA 2MKIA 2RKIA 4ID8A 1O5JA 5IZHA 3EX7B 3W7BA 2JVOA 2DGSA 1M5HA 1REVB 4P2SA 3M9NB 2AJFE 1RWOB 3SFUA 3M9OB 3CWJA 1CULB 1TV6A 4Y00A 3VAFA 5E3CA 1RHJB 3J7AN 1ZM3A 3R7NB 3GV7B 2YWGA 1K47A 5H9FJ 2W9CB 4ZVUB 3JTPA 3MMBB 4IOAQ 1KBRA 2HQGA 1NK6A 4X4VA 1S1TB 3L09A 4XO0A 1QSSA 4ID5A 1RWUA 3M8WA 2DNMA 2N3OA 4P10A 3G8TA 5B0CA 1T11A 3LP1B 2POKA 2HURA 1AUSL 3A3PB 2N7YA 2D74B 2AJ1A 3J7YI 1HLWA 4ZA1A 3TVZA 4RW4A 1K8AT 1LK7A 3AODA 3KNAA 1L3KA 1V5IB 1UKUA 2V50A 2VG5A 4UOHA 4JB8B 4DLGA 1M1HA 2VPXB 2XS7A 1PBUA 1JLGA 3JAMU 2QSFA 1VQOS 3HKWA 1NK7A 1FEHA 1KTQA 2XYGB 3QJLA 3R5DA 1JIHA 1RB0A 2OSRA 1IBCB 5E7OB 3CDWA 3A1YG 4ILLA 1FCAA 1JLQA 1JLCA 3OFHA 3PX6A 1Y0HA 3E2EA 8ATCB 1WJ9A 1LFWA 3K7RA 1QD1A 3P3DA 3UQSA 1SCJB 1KONA 1U2FA 5JUMA 4ELTA 4JI8F 3UVJA 2GGPB 2BACA 4KC5A 4F3QA 1DTTB 2F3JA 4Y2MA 1I94J 2OHDA 2ZH3A 4HHHA 2RRNA 3T9ZA 3CJRA 2K06A 2ZWPA 1E6VB 1T9VA 2VHGA 3MURP 1QE1B 1YJWS 5KFOA 5H9FK 1HNIA 1HNVB 4F25A 3GTYX 2RRBA 1WKKA 5I3PA 5D0RA 3IBFB 1JJHA 3K17A 5CYQA 3A8JA 1NHUA 4WU3A 3KKFA 4DV7J 1Q7YT 4ZLNA 4N77A 4QIVA 2PIIA 2WW4A 1R31A 1PAEX 4JI6F 2OEMA 4DCJB 1WWHA 3QJPA 1REVA 2ZWOA 3C16B 1D3WA 2O1PA 2CNNB 1CULA 3PFEA 1NZAA 4ZIWA 1HQEB 4X4PA 1U4BA 2G1DA 1VQ8S 1WHWA 3W8GA 4M5KA 2W9CA 2D1CA 1RT7B 2DIUA 3QMQA 3GZ7A 3MMBA 4NYPA 1MNEA 4K4VA 3R6GB 2RH3A 5MAOA 2CPXA 2E66A 1IKVB 1S1TA 2EFQA 2XZWA 1HI0P 4PYDA 3QZ7A 4BDPA 3LP1A 1S9FA 1OQ6A 4C4WA 2OFGX 4ANCA 2DNRA 3RAXA 5HI7A 1M1GA 3N9UC 3QGHA 4OI4A 1U0HB 1N52B 3TA1A 2OP5A 5FD1A 2AJ2A 3MM5B 5I3UA 5F8LA 4U8YA 3ISNC 2QL9B 4DL6A 3EZUA 4R8UB 1KC8T 3NY0A 3KK2B 5AXNA 3OBIA 3A4TA 5LJ3Y 1HW9A 2ZOFA 1MG7A 4L6V3 4QYRA 5J2PB 1IBMJ 1TL7B 4KKOB 4KR0B 4PYAA 5EX3A 3JTOA 2GGPA 4DR1F 3HP6A 1DTTA 4OV1A 1AROP 2VC0A 4W4MA 1XNRJ 2ZFHA 5IQ6A 4ECQA 2VBWA 2ZBCA 1E6VA 2WHOA 2XCPA 5EWEA 1HNVA 5KFXA 3PFOA 2HZAA 2GJ2A 2KT3A 4ED7A 2V63A 4E2FB 2A6OA 4CO1A 3W64A 4MK7A 4J9QA 4LRCA 1S6UA 3OUYB 1YDLA 2OLWA 1S99A 3N5BA 4ZJOA 4WJBA 2J76E 1NJXA 1TMMA 4OYMA 2XULA 4F02A 2J5AA 4DPTA 4ECZA 1Y9OA 4DLEA 1HQEA 2VUGA 3BKFA 4C0BA 1T02A 3ILIA 2VG7B 2QX0A 2HHQA 3NNHA 1KQKA 4K5RA 4A8SA 2Z56B 4OI6A 1P27B 1KOOA 4QQBA 2XHWA 1HWKA 1EHWA 4G6VB 4ZJLA 1WKJA 1G2EA 5D15A 1X5TA 2VFTA 2GHVC 1VRTB 3VAKA 2HBRB 3EPGA 3A3OB 1S6QB 3T5JA 3CDAA 1SJ4P 1F9EB 5HMZA 2ROPA 2CIMA 3MM5A 3DDKA 1ZTTA 4HTJA 3OJSA 2YQ0A 3SCKE 1UW9A 1U47A 4H4MA 3I9ZA 1DQ8A 2LMIA 4R8UA 1VFJA 5KT6A 2VL1A 3KK2A 4IUFA 1SL2A 1GNKA 4L73A 4ES1A 2RF2B 3WIVA 5J2PA 1RT4B 1TL7A 4DR2F 4KKOA 4AL6A 2W2OP 2GO9A 3CD5A 4KV8B 3IFEA 1TL3B 3FCWA 5DLGA 2ZITA 3QRPA 2WB1D 4X2BA 2F9JA 2BANB 5LMNJ 1X4BA 3TVKA 4Q5VA 1EKRA 1N6QB 2ZBRA 1S9EB 2OGUA 4LMZA 2NSCA 4FBUA 4CLFA 2MY8A 3GIMA 3QRQA 2K1RB 5AE2A 4DSKA 3SIPB 1FJGJ 5KFYA 2XMJA 4AUKA 2UXBJ 4OX8A 4IQMA 1FRIA 3TWZA 1GXTA 2HRYA 3OUYA 5F0WA 3HVRA 4PAAA 3PDNA 4USJC 1AB8A 3MAQA 3MUVP 1YJUA 3V6JA 2VBZA 2VBXA 3UCZP 2HHHF 4MKBA 3TX8A 1RZMA 2YBVA 1N36J 3MTKA 3G86A 1PJ5A 1WC1A 1RAOA 2Z8QA 2VG7A 3I55S 1HI1A 7FD1A 1HW8A 3D54A 3BGRB 2HFSA 2ZD1B 1T03B 3NAHA 2LDYA 4N41A 4K8RA 1RT2B 4MK9A 1P6TA 1VK3A 1GFWB 2I0XA 2ZHBA 4DMZA 2X3DA 2CAJA 2Q66A 2EW9A 4RUCA 1OY8A 4YB7A 4YS2A 3KHGA 1TKZB 1VRTA 2KU7A 2V8VA 1S6QA 1SI9A 2CPJA 3QO9B 3DRRA 2XMWA 4EGLA 1ZM4A 1WHXA 3LGNA 3KOAA 1R6VA 4DSEA 2Z2YB 2ZDPA 1ZETA 2HK2A 2JFKA 1PIEA 3H7HB 2V69A 4I1TA 3ISND 4BS2A 2ZC3A 4PXDA 3HDSA 1VQ4S 2B4PA 2VASA 3TZWA 3CULA 2CQPA 1R8AA 4FN5A 1J5EJ 4B3OB 2RF2A 1G1XA 4LRBA 3PYEA 4DR7J 1EZZB 4DU8A 4KV8A 3CE8A 1NRKA 2V2KA 4DR6F 1TL3A 1C1CB 2ROEA 4O3NA 3J81Y 3PM9A 2LXUA 2DXDA 3IS9A 2BANA 1WEYA 2DRDA 4X62J 3BBCA 3M8QB 4IRKA 4ITSA 2GAGC 1UJ6A 1N6QA 4LBHA 1S9EA 4CNZA 4N76A 2C1EB 2K1RA 2HLUA 3P96A 2GAHC 3I82A 4C8ZA 5IT0A 1U1LA 2IRUA 2GMJA 3KHHA 1VLYA 3TAPA 2PMZD 4U96A 1FWLA 2HWIA 2AGQA 1QVFR 2QZ8A 3TW0A 1KR4A 3OR1B 1GQEA 3W65A 1KVKA 5L9NA 5EWGA 2JEGA 2NYHA 4ZS6A 1YZ7A 4PG7A 1HNXF 1JQGA 1X31C 2FQQB 3BGRA 2ZD1A 1T9YA 1T03A 2YWFA 3TJ9A 2W2NP 3LTOA 1GEHA 2BOPA 4DHVA 5KG2A 3QSIA 1RT2A 2OPQB 2EPIA 1S4FA 3DLJA 2BE9B 5BR8J 4H4KA 1UPPA 2HK3A 3LGMA 2V2ZA 5CYMB 1HNZF 1N34F 2FYXA 4NLYA 2Z2LA 1WHVA 1MWQA 4AYBD 2MEWA 5HVHA 1JXVA 3QO9A 5H1SV 2AMCB 3I87A 1TK5A 2CA9A 1FA0A 5RUBA 1GTEA 4QJVA 4ZMMA 2K2PA 3IMQJ 1EARA 1H6KX 4I2QB 1S0OA 2D3ZA 3V6HA 4Q8EA 3TYTA 4UOGA 2F9DA 1NCLA 4B3OA 1RU1A 1S6OA 2IA0A 1HFEL 2VBYA 4IRDA 2AJ0A 3QIPB 4B3SJ 3C6TB 1B70B 3GG1A 1C1CA 1HHSA 2XMMA 4ZP8A 3BREA 2E1PA 1TFWA 5LT5A 3M8QA 2XNQA 1NH8A 4WBFA 4WP3A 1QDUB 3GIIA 4DR4J 1SJRA 4KE5A 4B02A 2DEIA 2J6TA 5F8GA 1NB7A 1YJTA 1X4GA 1FRJA 4OHVA 2MQPA 3RR7A 1FXDA 4OHYA 2BDPA 5GAGU 4MKVA 2E7XA 2BJ7A 3DHXA 4DCPB 1F5BA 3RAQA 3ZXWA 3GONA 4DR3J 1K1QA 4X4OA 4RWWA 3HM9A 4GKKF 4FPRA 4K0KF 4N7TA 3QNWB 2IBKA 1RCOB 2NQPA 3CIMA 3FJ2A 1F2GA 3OR1A 4OYWA 4J37A 1VGYA 3NXZA 1Z1ZA 2FJBB 4LSLB 4HEA9 4K4XA 3JQMA 2DR9A 2HRUA 4W98A 2DY1A 4RKUC 5G4DA 1TUGB 5KFFA 3AHPA 3I9V9 4KH0B 2F8EX 4ZPWR 4F4YA 1Y11A 2OPQA 1ELOA 3C6UB 1V3ZA 2JOQA 1VQNS 1KN6A 4DZ6A 5CYMA 2KTQA 3ENVA 1RAIB 2VJUA 2DNHA 4DL7A 5B7WA 2QV6A 2MKCA 3GSDA 2BM0A 4I69A 1RKJA 1DLOB 4I6AA 2EXUA 4FVMA 4DSLA 3GJRB 5FLXY 4KPCA 1VRUB 1IJEB 2HGMA 3IN5A 2W1BA 3KLHB 5GMKa 4NRUA 2NXUA 2MKYA 3BGFA 2CQCA 5AXKA 4DL0C 4KQZA 2QT7A 4UOCA 1RSCA 3QGGA 1VHIA 5FJ4A 4I2QA 4O4RA 4B9SA 4K4SA 2YY3A 4ETXA 2ZH8A 2MZ1A 3VF0B 4BBYA 3QIPA 1P8GA 4I6WA 3C6TA 3DYAB 2ZJPQ 2DPIA 4DQIA 1H2UX 3TZXA 2ZBQA 2FZKB 3GCWP 2FGCA 2EBGA 4FKYA 4RW7B 3M30B 2KM8C 5J2QB 5F0UA 2CDRB 4HH1A 1W25A 4CLKA 4LF4J 4R25A 5CXTA 1Q7LB 1S10A 5JMNA 4WIQA 4ZCLA 4F4ZA 1OSDA 4IKAA 3AJDA 1O8BA 1ZYQA 3OD2A 1U1RA 3UNGC 4RL1A 3GYGA 4EK2A 2BV3A 1YQHA 4QWBA 1S1UB 4LSLA 2CG8A 3ULHA 2HKEA 3LP2A 3ZTQA 3SXLA 2LXFA 4JI5J 1VQ7S 4NA1A 2JWNA 3T1HJ 3O8WA 1AYEA 2FHMA 4NXMF 2EFNA 4JI4J 4NRTA 1UEKA 2FVCA 1Z4UA 3MTJA 3UR3C 3KFWX 2HNYB 3C6UA 2XBPA 2G13A 1M1KT 2H5JB 3ILOA 1H38A 4NYOA 2NS1B 2DGWA 3MAAB 1KHVA 4UT4A 4NLRA 2IM0A 2BUNA 3JAMY 2A0FB 1YRTA 5KFAA 1VRUA 2QA4S 5E3RA 4ES2A 1HARA 2V94A 3AA9A 3KLHA 2IM1A 1MN9A 2DO0A 4RUBA 2ZKUA 2JEJA 2ZZMA 3BYRA 1NJZA 2GVZB 1VBKA 3I5AA 5J1EA 1RAJA 2RQMA 5D0HA 1IN0A 3N0VA 1RAHB 2V8HA 3G9CA 4JV2A 4DPUA 3GFYA 2A1BA 4P73A 3BQ2A 3C46A 2HG4A 1NMEB 1WG1A 4ZPBA 3UCGA 4CIOA 1KWMA 2MXYA 3SQOP 3DYAA 2ZBPA 3L3CA 1C4AA 3PIOQ 2YKQA 4PG8A 4RW7A 3ZZTA 1S0MA 3SYZA 3DLHA 3M30A 5J2QA 2UV8G 1SC4B 1KOHA 3K8VA 2KH9A 3KJFB 4FYVB 4CP5A 4F0HA 2K8GA 2DGVA 2M4MA 2FC8A 3QFHA 1S6PA 1X0FA 5B0AA 3KJVB 3KLEB 5M2UA 2Y8YA 4A8WA 3PHTA 1HR0J 1FWKA 3GJSB 5KFUA 5SUHA 2HLTA 1UETA 4TLRA 5DLFA 1HWUA 1H7WA 3BF4A 5CH7B 4DV5J 3RB3A 1S1UA 2Q6BA 2O01C 2KFYA 1HBNB 3UW1A 4OHZA 2R9LA 2WK4A 3T1YJ 1H0HB 2XI3A 1V3SA 4C8MA 1RKIA 3W63A 2B7BB 4MIAA 4OI3A 2M3DA 4U8VA 1WELA 5KFTA 3BSCA 2QEXS 2DKOB 2HNYA 4QYZJ 1EKSA 3PY8A 3L95X 3SBMA 2DCUB 4BC9A 3CMAS 4DR5F 2R8HA 5A8WA 4U67Q 1NJWA 2IJNA 1YSJA 3D9BA 3CCZA 4DV2F 4JYAJ 2CNOB 3H5YA 3MAAA 2M52A 3GP9A 1DFDA 3HHNB 1U7LA 3LWLA 2HFUA 1TTHB 2D41A 2HQFA 4ED5A 1BLUA 2WVCA 4WXOA 3G96A 3S01A 2AGOA 2DNKA 2HNZB 1LK5A 4O3OA 2GVZA 3O44A 3I0RA 4FF3A 4NLVA 3CEDA 2XC9A 1IVZA 3G8SA 3GYXB 3K2YA 4JI0F 4FYXB 1X4DA 2LYVA 5T7LA 1YITS 2W2PP 2AJ4A 1F5AA 3JB9k 3SCIE 3K8WA 3ISZA 1NAQA 4EUVA 5KFRA 2HFOA 4F8RA 1NSPA 3VAHA 4HDGA 4CO2A 5EHHA 3BSNA 2WSEC 2CKWA 2W7OA 3W5YA 3PW7A 3KWMA 2D3UA 1BGXT 4TYAA 2YH1A 1HPZA 5ETSA 5KFPA 3C3LA 4WFYA 3KG0A 4AXJA 2YWWA 3IXQA 4IFYB 3G4SS 2NYIA 3DKDA 3KJVA 3JTNA 2R7RA 5JJBA 3KLEA 3VHQA 2VQEF 2XS2A 4IYQA 4Y6IA 1YIJS 3WZ0A 1FX4A 2YNGB 3TQEA 5GVQA 2VH7A 1T9UA 3CCJS 4NXNJ 5KG6A 1APSA 4XTTA 1EP4A 2DNNA 5DZ7A 1HBNA 2KO1A 2VQFF 4KJIA 4CQ1A 4YR2A 1RWMB 2V34A 4CNYA 3RJMB 1NH7A 2FGOA 1AT1B 2J7UA 4RU2A 1S9GB 2DNYA 2EG2A 5H9EJ 1LXJA 2CPDA 3OT9A 4Z2XA 1U6BA 2J9DE 2R4FA 4GRSA 1WC4A 3U02A 1I5OB 3JS9A 2AT1B 5F3TA 2CQIA 3FRYA 5HATA 2UXCF 3WHIA 2F63A 5C42B 1FJCA 4DFKA 2RT3A 3H2UB 3ENAA 3QAUA 5K8OA 3MDFA 3A13A 4MKYA 2XWYA 2GW8A 4USKA 2Z57B 4WKRA 4CH7A 2HNZA 1VQKS 3I5CA 3RBEA 2IDLA 2AHOB 4OIXA 4MMOA 1SL1A 3G6XA 4B17A 1WUUA 1XNQJ 3FK4A 2LECA 4C2MA 5L1JA 2X7IA 4HVZA 1R0CB 1SBRA 3T19A 1OSCA 4O3PA 2B9XA 1VQ6S 2J9CA 4KGKA 3GYNA 1TKXA 3DHWC 4DL5A 2KZMA 1AFIA 4KHPF 2VZ9A 3BM7A 3PEJA 3BPDA 1VCTA 2FHKA 1JWWA 4USTA 2IVFB 3TI0A 3NL0A 4GVLA 3FBBA 4LFAF 4OZ1A 4IFYA 5D77A 4CLLA 3AA8A 1YHQS 3DLGB 5H9EK 4HHUA 3T41A 4TYBA 4O0IA 1DZ5A 2YNGA 1TUWA 3IO1A 5LJ5Y 1KQSR 3EUNA 1CS4B 3I32A 2MDAA 3B78A 4I6YA 4TVAB 3DFEA 1R0BG 3CCRS 3PW2A 2C2MB 1N56A 5CD4A 4ZVHA 3D3BJ 2HQCA 1R43A 1TU0B 4C8NA 4LVNP 1RTZA 4RW6B 3VGSA 3NBPB 1S9GA 2GJIA 3PTWA 1JB0C 1DURA 3DOMB 2ZM6J 4Q0BA 2B56A 2DGUA 3N6LA 5ETQA 2L9DA 2CZ9A 4ES3A 4ZVGA 3ZZYA 3M05A 2IHR1 1M5PC 3ZTPA 1RWXB 1SB6A 3IBWA 3EE3A 1S7IA 3IRXB 2FVQA 4UOFA 5HANA 5C42A 1WI6A 3QBCA 1PGZA 3NCPA 4J9UE 1HBUB 4ZCKA 2ZZNA 2X51A 3EVOA 3DXSX 1NHKL 3NGSA 3S7RA 4IOCQ 3BKTA 4KSEB 4FXVA 4GMKA 1RAEB 3TRGA 2D69A 3R2CJ 2JNJA 3KJQB 3M6XA 2VIHA 2VA2A 4J90A 4J9KA 4DV1J 5KTQA 4Q44A 1RHQB 1FT8A 4ZVSB 3Q24A 5BJRA 3CJ2A 1NUEA 3IP0A 2DNZA 2FIUA 1KQFB 4Y34A 2RE1A 2MGZB 3WC0A 3DRSB 4NLDA 5ETPA 2ADBA 3PYGA 2V4JB 3MM8B 3DLGA 2KG0A 3NOCA 3R5JB 2DHHA 4DV4F 2LLZA 4LIRA 1MLAA 3G82B
chains in the Genus database with same CATH topology
3GPAA 3Q8VA 2HURA 3R9LA 3FBBA 3DDIA 4C6AA 2DXDA 3EVOA 1NHKL 3FC9A 4O0NA 3NGSA 4KPCA 3JS9A 2BEFA 1HLWA 4EK2A 3BBCA 4HR2A 3PRVA 3EVWA 3MPDA 1NDLA 2ZUAA 1NSPA 3PJ9A 5BXIA 4UOHA 2DY9A 3B6BA 1UCNA 3NGTA 1PAEX 2BX6A 4S0MA 4F36A 3ZTQA 5C7PA 3ZTSA 5IOLA 3NGUA 1B4SA 3FCWA 1JXVA 3ENAA 1NDKA 3VGTA 1NB2A 1NSKL 2AZ1A 1S5ZA 3FCVA 4DUTA 1K44A 4FKXA 3EICA 2NCKL 4ANEA 3FBFA 3BBBA 1LWXA 2B8QA 1NLKL 3VGUA 3DKDA 3VVUA 2HVEA 1XQIA 1BE4A 3ELHA 3Q83A 4ENOA 3BH7B 3B54A 1XIQA 1EHWA 4W98A 4CP5A 2DXEA 3EVMA 3GP9A 1WKJA 3BBFA 3NGRA 1HHQA 1PKUA 4UOGA 3L7UA 3EM1A 1NCLA 1BHNA 4FKYA 4F4AA 1F6TA 1NUEA 5CAAA 1MN7A 4DI6A 3VGSA 2DXFA 1NSQA 3WX8A 3G2XA 1LEOA 3VGVA 1VYAA 2HVDA 3Q8YA 1S57A 3ZTRA 1HIYA 3Q8UA 3Q86A 1NPKA 1F3FA 1S59A 2AZ3A 3VVTA 2DYAA 1KDNA 1WKLA 4DZ6A 1NDCA 1ZS6A 3ZTPA 3EE3A 3EMTA 2CWKA 3FBCA 3Q89A 1BUXA 4WBFA 1MN9A 1W7WA 4UOFA 4ANDA 4ANCA 1B99A 3BH6B 3EJMA 2VU5A 1NDPA 1WKKA 1U8WA 2B8PA 3ETMA 3FBEA 3FKBA 3ZTOA 5CABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPA A;  3Q8V A;  2HUR A;  3R9L A;  3FBB A;  3DDI A;  4C6A A;  2DXD A;  3EVO A;  1NHK L;  3FC9 A;  4O0N A;  3NGS A;  4KPC A;  3JS9 A;  2BEF A;  1HLW A;  4EK2 A;  3BBC A;  4HR2 A;  3PRV A;  3EVW A;  3MPD A;  1NDL A;  2ZUA A;  1NSP A;  3PJ9 A;  5BXI A;  4UOH A;  2DY9 A;  3B6B A;  1UCN A;  3NGT A;  1PAE X;  2BX6 A;  4S0M A;  4F36 A;  3ZTQ A;  5C7P A;  3ZTS A;  5IOL A;  3NGU A;  1B4S A;  3FCW A;  1JXV A;  3ENA A;  1NDK A;  3VGT A;  1NB2 A;  1NSK L;  2AZ1 A;  1S5Z A;  3FCV A;  4DUT A;  1K44 A;  4FKX A;  3EIC A;  2NCK L;  4ANE A;  3FBF A;  3BBB A;  1LWX A;  2B8Q A;  1NLK L;  3VGU A;  3DKD A;  3VVU A;  2HVE A;  1XQI A;  1BE4 A;  3ELH A;  3Q83 A;  4ENO A;  3BH7 B;  3B54 A;  1XIQ A;  1EHW A;  4W98 A;  4CP5 A;  2DXE A;  3EVM A;  3GP9 A;  1WKJ A;  3BBF A;  3NGR A;  1HHQ A;  1PKU A;  4UOG A;  3L7U A;  3EM1 A;  1NCL A;  1BHN A;  4FKY A;  4F4A A;  1F6T A;  1NUE A;  5CAA A;  1MN7 A;  4DI6 A;  3VGS A;  2DXF A;  1NSQ A;  3WX8 A;  3G2X A;  1LEO A;  3VGV A;  1VYA A;  2HVD A;  3Q8Y A;  1S57 A;  3ZTR A;  1HIY A;  3Q8U A;  3Q86 A;  1NPK A;  1F3F A;  1S59 A;  2AZ3 A;  3VVT A;  2DYA A;  1KDN A;  1WKL A;  4DZ6 A;  1NDC A;  1ZS6 A;  3ZTP A;  3EE3 A;  3EMT A;  2CWK A;  3FBC A;  3Q89 A;  1BUX A;  4WBF A;  1MN9 A;  1W7W A;  4UOF A;  4AND A;  4ANC A;  1B99 A;  3BH6 B;  3EJM A;  2VU5 A;  1NDP A;  1WKK A;  1U8W A;  2B8P A;  3ETM A;  3FBE A;  3FKB A;  3ZTO A;  5CAB A; 
#chains in the Genus database with same CATH topology
 1VLO A;  1BY9 A;  3CJ8 A;  4ERD A;  2QG9 B;  4LRE A;  3SZ2 A;  1CS4 A;  3D2W A;  2XNR A;  2EK6 A;  2XYH B;  2PC6 A;  1S49 A;  2DVI A;  3DLE B;  1GXU A;  4K4Y A;  1IR2 A;  2P9E A;  1SJ3 P;  2N4D A;  2ZC4 A;  5DG8 A;  3BBB A;  1OY9 A;  3NBP A;  2RDI A;  4OZL A;  4Z37 A;  3DOM A;  3GIK A;  1C1B A;  2ZH7 A;  3BJY A;  1CJK B;  3PNI A;  3PW5 A;  3IRX A;  4RW9 A;  1MSW D;  2H65 B;  3W2W B;  1NPK A;  2IYI A;  1X9W A;  4OX7 A;  1HBU A;  1NK8 A;  1WEX A;  1N0U A;  2QSW A;  4HT7 A;  1VC6 A;  3RW6 A;  1RA6 A;  3FBC A;  2UU9 F;  3P45 B;  2XMU A;  5F3Z A;  4USH A;  4TQS A;  4DG1 A;  2ZH4 A;  2BR0 A;  1DQA A;  2B51 A;  2K3I A;  1A6L A;  1KTV A;  2YTC A;  4DQS A;  2F40 A;  2C42 A;  4JV5 F;  1IQZ A;  1GMU A;  2YNH B;  2UP1 A;  2KM8 B;  4I0W A;  1WC3 A;  5U47 A;  5C7P A;  4IG3 B;  5HMY A;  1RUS A;  4J9S A;  3TQ1 A;  3HT3 A;  1Y5I B;  5DGB A;  4DJB A;  4ILM A;  5I42 B;  4LF2 A;  4JI1 J;  3CCS S;  3T9N A;  3L7P A;  1KLN A;  2C3U A;  1IKX B;  1WC5 A;  1BE4 A;  2M8H A;  3ELH A;  1W2I A;  2MGZ A;  2F7V A;  3DRS A;  5KG5 A;  3P5T L;  1V6H A;  2YWH A;  5DDR C;  3UNY A;  3TP2 A;  3Q2S C;  4AL7 A;  4QIE A;  4ZPV R;  3MM8 A;  2CJ9 A;  4Q7A A;  3PZP A;  4N47 A;  3G82 A;  3UD4 P;  2JRS A;  3HVT B;  1ZM9 A;  4FP9 A;  4KY3 A;  2CRL A;  3CC4 S;  2I38 A;  2W8L A;  4BHQ A;  1FFS B;  3GV5 B;  3QT5 A;  4FPI A;  3N6N A;  3TA0 A;  4QPT A;  3BH6 B;  5GAD U;  2V6A A;  2I8E A;  3W66 A;  3ZTO A;  1F9F A;  2VC1 A;  1IBL J;  4NCB A;  4CLY A;  5AE3 A;  4USW A;  4F50 A;  4IRC A;  4LFB J;  3CDB A;  1B3T A;  4FXD A;  5DDO C;  1C2P A;  1NPP A;  4DV6 J;  2HHS A;  4Q8F A;  4C98 A;  2WVE A;  3KLI B;  3M2V A;  4I56 A;  1S7H A;  4LJM A;  3LH2 S;  1GTH A;  4MH8 A;  4PAB A;  1K44 A;  4AT1 B;  1CJK A;  2EC2 A;  1Q5Y A;  1HL6 A;  4KH1 B;  2Y9H A;  4JUZ A;  1S12 A;  3W2W A;  4Y2K A;  2GO8 A;  1KQG B;  2ZDO A;  2ZH2 A;  3Q22 A;  1Q78 A;  2BQU A;  2VFS A;  2YPZ A;  2C2O B;  4DI6 A;  2V0N A;  2DR7 A;  2PA3 A;  2E1R A;  2RD5 C;  5A8K B;  2MHE A;  4NYZ A;  4X4U A;  4FF1 A;  5HRO B;  2CQG A;  1FER A;  2ZHO A;  1TVR A;  5KFV A;  3TAN A;  1SH2 A;  2BKN A;  2C22 A;  1NDC A;  1BWE A;  2XMV A;  2W7A A;  4DPX A;  4M5D B;  3RYL A;  1NDP A;  2GFF A;  4IG3 A;  1TK0 A;  2YWK A;  2JLE A;  3W2V B;  2XGP A;  5I42 A;  4F0K A;  2ZNZ A;  1FE4 A;  4R0J A;  2XGQ A;  3Q8R B;  4FYY B;  2UVW A;  1IKX A;  2ASY A;  4ZCM A;  2KHC A;  2Y1J A;  4KO0 B;  2L08 A;  1JLF B;  2IC3 B;  3NMA A;  4N5S A;  1JNR B;  3FBF A;  2VB6 A;  4G1Q B;  1HQU B;  2BJ3 A;  2QE5 A;  5HJY A;  1VMB A;  3FDS A;  3D6H B;  3HVT A;  3L7U A;  2KKH A;  5GME A;  3JSY A;  4DR6 J;  4WFA Q;  4DQP A;  2QLB B;  3N5F A;  5IT9 Y;  4GVB B;  5LSR A;  3CCL S;  1HIY A;  5BYR A;  1YI2 S;  2AZ3 A;  2FJE B;  1HNW F;  3H8Y A;  3W5Z A;  1SJF A;  2LA4 A;  2HPU A;  4LF8 F;  3KLI A;  1SJQ A;  2M5Y A;  3S6E A;  4P2X A;  2W2Q P;  3NNA A;  2XLJ A;  2X3G A;  2YVS A;  2G2O A;  2QLX A;  2YX1 A;  2L48 A;  3EDR B;  2OPS B;  3J80 Y;  4ZVR B;  1FRH A;  1SJ1 A;  3QGI A;  3AT1 B;  3QYY A;  1FXL A;  3FSI A;  2BJ8 A;  2A2C A;  3UD5 A;  1H3D A;  4PQA A;  4BCA A;  5A8K A;  4FNH A;  2Z0G A;  4UTG A;  1LXN A;  3WQP A;  2E5L F;  1A7G E;  3H42 A;  1JXE A;  3SCL E;  4AD6 A;  3G2X A;  5D4L A;  3HZE A;  5G0R B;  1P1L A;  2DIV A;  3Q0A A;  2HW3 A;  5DJB A;  5KG4 A;  4BLG A;  1K0V A;  2HRT A;  4PXE A;  3H4D A;  5F8I A;  2XMT A;  3TAM A;  4KTQ A;  4Q43 A;  1VIO A;  3CCW A;  1RWK B;  1T3N A;  3HFZ B;  5CZX A;  1WSV A;  3V5R A;  4KO0 A;  1SXL A;  1JLF A;  1H72 C;  2IC3 A;  3SSQ A;  4FYD A;  4KHM A;  3ENQ A;  1FWP A;  5KT2 A;  3HO1 A;  3V6K A;  5HN0 A;  2CXE A;  4G1Q A;  1FFG B;  1U1O A;  2OSQ A;  3H59 A;  3O2I A;  4KB7 A;  1HQU A;  4OYZ A;  4MYT A;  4RUH A;  2ZOM A;  2IVY A;  3EZ5 A;  1N4L A;  1F0X A;  1ZM2 A;  2BOA A;  2FJA B;  4EZ6 A;  1TMJ A;  2LU2 A;  4W92 B;  2BMB A;  2G0C A;  1U26 A;  3IRW P;  5LSO A;  2OH2 A;  5FDL B;  2YKO A;  3BSA A;  2MJU A;  5CA5 A;  4GVB A;  4XPC A;  4X4R A;  3BZQ A;  2DRA A;  1QY7 A;  1PC4 A;  2AIR B;  4C0O C;  3BPS P;  2Q3P A;  4NZ7 A;  5GAE U;  4F4A A;  2JH3 A;  4ED4 A;  3K58 A;  1R3N A;  3CIZ A;  3GLJ A;  3TVY A;  3D66 A;  2XY7 A;  1VYA A;  3X1L B;  2VKR A;  2N7C A;  3OFF A;  4JI7 J;  5DG7 A;  1HA1 A;  3DLL Q;  3R6L B;  3K5P A;  1FKA F;  4OZ0 A;  5ADZ A;  2RIJ A;  1XMQ J;  3MMC B;  3V2U C;  3BO3 A;  4C3L A;  2OPS A;  1TKT B;  3LF0 A;  1MU2 A;  3DOK A;  2OEJ A;  3PCO B;  1UFW A;  1U6F A;  2DBB A;  2H1Y A;  3K57 A;  2BEF A;  5B0G A;  1CJV B;  4H4O B;  3SMZ A;  3NGT A;  1Y5L B;  1I51 B;  3M1V B;  4M63 A;  1NKC A;  4O3R A;  2GIF A;  3I4P A;  1NKB A;  2HAI A;  4ICL B;  3QT6 A;  4EO8 A;  3VCD A;  4G1P A;  2ZE2 B;  2XO7 A;  1S76 D;  2Z4P A;  5A8R B;  5D6G A;  5JVG Q;  2GHW A;  2F8H A;  1VR6 A;  2J9E A;  3EYZ A;  3BS9 A;  1IR1 A;  2AYB A;  1SVD A;  2DXF A;  1RT1 B;  2PFF B;  2V2Q A;  1Y4Z B;  2GS8 A;  3DXB A;  1LFP A;  4DV7 F;  4G1I A;  3CO9 A;  4AL5 A;  7FDR A;  4OJH A;  1IM6 A;  2D7S A;  2HSE B;  5M2R A;  3C8Y A;  2B7C B;  5KFL A;  2DIT A;  2DIS A;  2YKN B;  3OL9 A;  1D8Y A;  5IM0 B;  1KSP A;  2W01 A;  1NJY A;  3HMJ G;  1PYS B;  4B9T A;  1PYT A;  2JX2 A;  2EI5 A;  3RRG A;  1UMJ A;  4O4G B;  5FDL A;  5D4P A;  5JXS A;  1CEZ A;  3U1M A;  4Y65 A;  4DSI A;  3DM2 B;  4B3T F;  2LQB A;  2Z2Z A;  3EWG A;  1WC6 A;  4HLB A;  3LQV A;  1SKW A;  3D67 A;  1UEV A;  3M4X A;  2BW2 A;  2DEJ A;  5CHC B;  2QA2 A;  1YBA A;  1DQ9 A;  2EBE A;  2I5J B;  1RA7 A;  1VS3 A;  3T3F A;  3MZI A;  4J9M A;  4NAS A;  1CSJ A;  1PKU A;  4NEY A;  1TV6 B;  2XS5 A;  1ULR A;  4HT5 A;  3MMC A;  1Q53 A;  2FHO B;  1TKT A;  2D3O R;  5L38 A;  4J7C A;  3OVA A;  2A3J A;  4RR5 A;  4A8M P;  1SKS A;  1RYS A;  2JLG A;  1ROF A;  1QUP A;  1WOR A;  4DUY F;  4OHW A;  3K5N A;  1CJV A;  2VOO A;  3I96 A;  2R8K A;  3M1V A;  2OPR B;  5LOQ A;  3FQK A;  4UUX A;  4E0D A;  2B3T B;  3AXK A;  2MST A;  5DM7 Q;  4JI3 F;  4NXM J;  2C28 A;  2WTF A;  4ICL A;  2HBY B;  3A3N B;  2ZE2 A;  2W7P A;  5E2Q A;  1XNR F;  4WTY A;  5A8R A;  2N4C A;  2CZ4 A;  3IWN C;  1TAQ A;  1ZTW A;  2CQ4 A;  5KFW A;  3N6M A;  4KPY A;  2OFH X;  1RT1 A;  5ETL A;  5ETM A;  3Q83 A;  3OVS A;  1JLQ B;  4LRD A;  1RYR A;  5DG9 A;  1SC6 A;  1RXO B;  4DPY A;  1UW4 A;  3UDC A;  1Q5V A;  4F4W A;  1HD0 A;  3GR1 A;  1S79 A;  4MIW A;  3UVJ B;  2MQL A;  1X5O A;  3IBC B;  2XZT B;  4U95 A;  3VZI A;  5IM0 A;  3CTR A;  1LV5 A;  1F2H A;  3CMQ A;  3LO3 A;  4O44 B;  3K5O A;  2LQJ A;  3S8S A;  4O4G A;  4Q2M A;  1RAC B;  3T5K A;  1WF0 A;  3DM2 A;  1CJT B;  1QVG R;  4YHH J;  3B8H A;  1H2V Z;  4NE9 C;  1U1Q A;  4FF2 A;  2KVQ E;  4WK3 A;  2J9D A;  1KFD A;  4TN2 A;  5ETO A;  2I5J A;  3EZO A;  1WOS A;  2GQC A;  1YJV A;  4DX5 A;  1LWX A;  1BD6 A;  2F4F A;  1IKW B;  3OL8 A;  2BRK A;  3N01 A;  1CQM A;  1U2C A;  4NCA A;  1XIQ A;  4CH0 S;  3NGR A;  2KYZ A;  1J2V A;  2KB2 A;  1F6T A;  5E33 A;  4CLT A;  3AD7 C;  4EYH B;  2Y0S D;  2OPR A;  5D4N A;  3OQ2 A;  5L9X A;  1K9M T;  2V4R A;  4HL9 A;  4A8Y A;  3IM8 A;  2DB1 A;  3TUJ C;  1RT5 B;  1YTY A;  2UVU A;  3EGZ A;  5LMN F;  2E9T A;  2C2E A;  2Y0B B;  5IV3 A;  4DR5 J;  3THV A;  3Q8V A;  2CQB A;  5I3U B;  3MF5 A;  2WOM A;  4DV2 J;  5GAH U;  2VV5 A;  4EWT A;  3I4H X;  2C3Y A;  2UXB F;  4HI2 A;  4TLQ A;  3MED B;  1KVJ A;  4Q2L A;  3K0J A;  2BJ9 A;  2GV1 A;  2AEJ A;  2BA9 A;  3M8P B;  4MK8 A;  4NLP A;  3D5M A;  2L9N A;  3U7J A;  3EGN A;  2R8I A;  2CYY A;  1LKZ A;  2ERR A;  3R27 A;  4JI0 J;  4LF6 J;  4M94 A;  1N36 F;  3TZY A;  4JBC A;  1N32 J;  1PC5 A;  2GCF A;  4O44 A;  1AFJ A;  1VIX A;  5GAG I;  4PKD B;  1NEE A;  3OW2 R;  3AJ2 A;  5KOX A;  1FDB A;  1HWJ A;  1LWE B;  5DGA A;  4W90 B;  1CJT A;  3ENW A;  6FD1 A;  2OEL A;  2J7W A;  3RBZ A;  1I1G A;  1RTJ B;  2HGN A;  4D3G A;  3CB4 A;  3MOJ B;  3FFI B;  2AYE A;  4AND A;  3PO4 A;  3K5M A;  1WSR A;  1QLN A;  2WRM A;  2NXC A;  3GPA A;  2MKK A;  1Y3J A;  3TOQ A;  4A8O A;  2ZHA A;  4ZN1 A;  4X64 F;  2M70 A;  2AJQ A;  2P5V A;  1DTQ B;  3AB4 B;  3MCS A;  1OJ4 A;  2AD9 A;  2G0J A;  1IKW A;  4B3M F;  2PI4 A;  3PJ9 A;  2AW0 A;  4LFC J;  2KL8 A;  2LA6 A;  2MQ8 A;  3SCJ E;  4LF5 F;  4PG5 A;  2VOD A;  3LOU A;  5KFI A;  4M5I A;  3BGO P;  3IC1 A;  4YY3 F;  5B08 A;  1T8E A;  3CD0 A;  1UFK A;  1U0S A;  3CC7 S;  3NG8 A;  4DR7 F;  1DJ0 A;  3K59 A;  3N28 A;  3D3C J;  4U7U D;  9RUB A;  2HS3 A;  2RJZ A;  1RT5 A;  4M1K A;  4YR3 A;  1HWL A;  3OHA A;  4X62 F;  5L1I A;  2VPW B;  3AY0 A;  1RWN B;  3ILJ A;  3IM9 A;  3TUP A;  2DHS A;  4ELU A;  4OZN A;  5E3P A;  2ZH1 A;  3F0N A;  4DSJ A;  1LW0 B;  2YNI B;  4H4M B;  2R2T A;  2ZUG A;  3CW2 C;  1B0V A;  1ZZF A;  4HH0 A;  1OPZ A;  4FBT A;  2AEF A;  3MED A;  1IJF B;  5KFG A;  3SI8 A;  1B7Y B;  2AV5 A;  2YXL A;  3AB2 B;  3LGH A;  3SV3 A;  3MMA B;  2A18 A;  5A76 A;  4WFX A;  2APO A;  4ECR A;  3M8P A;  4DL4 A;  3DRP B;  1D9F A;  3H20 A;  2YX7 A;  4DF4 A;  2UV8 A;  2X1B A;  1T9W A;  1WF1 A;  2XLK A;  3RB4 A;  3M6V A;  5LMU F;  2L41 A;  3FSY A;  1M5K C;  2MLY A;  1QTN B;  1C0U B;  4DUZ J;  2H9Z A;  1UZH A;  1LWE A;  1CQN A;  3FVY A;  3NS6 A;  2R7V A;  1RTJ A;  3TX0 A;  5B0F A;  2NLW A;  5BR8 F;  3FFI A;  2DRB A;  4LFA J;  1H98 A;  3KLV A;  2MSS A;  1ACM B;  1XR6 A;  1DTQ A;  1Z2Z A;  1N33 F;  1ICE B;  3S1T A;  2DH7 A;  1O0P A;  3ZO7 A;  5HK4 A;  3CPW R;  1CJU B;  4NLW A;  1T9X A;  2M8D B;  2CQH A;  5DZ6 A;  4ECW A;  1P1T A;  4OYB A;  3D7S B;  5LM7 E;  1J27 A;  5SZT A;  2UUC J;  1UVL A;  2PD1 A;  4NLG A;  1FK9 A;  1TL4 A;  3BGU A;  3J7A 1;  3ADA C;  4NI2 B;  2AZ1 A;  2CVI A;  2IY5 B;  4B3S F;  4M5M A;  4ANE A;  4FF4 A;  2P8I A;  3VVU A;  4K5S A;  3KTQ A;  3J7Z 5;  5IT4 A;  2K7K A;  3DRR B;  1SC3 B;  4TXS A;  5DQH A;  1FO1 A;  2UVV A;  3CJ3 A;  3MFI A;  3QPI A;  4IR1 A;  1J5O A;  1TP7 A;  3MUT P;  1LW0 A;  2YNI A;  3IR5 B;  3IA0 A;  1V5V A;  3RTV A;  3CCU S;  1EET B;  2VDI A;  4K4U A;  1ZA1 B;  4DR3 F;  2PEH A;  3KLF A;  3MMA A;  5KT3 A;  2R7T A;  3DRP A;  2H48 B;  4Z7C A;  1BC6 A;  5IFM A;  3IGV A;  2WVD A;  4LF9 F;  2HFV A;  4L74 A;  1L3S A;  2HVH A;  3LAK A;  1SIZ A;  2WAQ D;  3IS9 B;  4DS5 A;  2PMH A;  2UUA J;  4GKJ F;  3R7S B;  2JLF A;  2IM2 A;  4FXW A;  1U25 A;  2YKP A;  2OIH A;  3AOC A;  1C0U A;  2C2R A;  4A47 A;  2JC1 A;  2OD4 A;  4DV3 J;  3DN9 A;  1S77 D;  5D78 A;  2CJX B;  2QIF A;  3MEG B;  4LIW A;  1R6Y A;  3F56 A;  1T9T A;  4NLQ A;  5CCL A;  2RIL A;  4Y0F A;  1NHV A;  1HBO B;  3W61 A;  5L1L A;  4DWI A;  3EGW B;  4DV4 J;  1MWY A;  5EWF A;  1U6Z A;  3NCR A;  1VI7 A;  1TAU A;  3FEX B;  5KFC A;  2GVD B;  3OLB A;  2EFP A;  4HAC B;  1W26 A;  4NEZ A;  1OS5 A;  3CJ5 A;  1CJU A;  3V6D B;  1VQY A;  1KDN A;  2B6A B;  2IIH A;  1K1S A;  5T41 A;  3W60 A;  4YOE A;  1FHT A;  1X8D A;  4NCG B;  4ZJQ A;  4FS1 A;  1FD2 A;  4F04 B;  2V9W A;  4RPF A;  3G6Y A;  4NI2 A;  4AE5 A;  2MQO A;  2KI2 A;  1IBK J;  4PWU A;  4CYU B;  2CJK A;  2PO4 A;  3PO5 A;  2HHV A;  3OXF A;  3UWT A;  3R2D J;  3FEY B;  2WZ1 A;  2XYP B;  3M2U B;  3BYP A;  4LF4 F;  4RNF A;  2CQ2 A;  3UE2 A;  1NPR A;  3QSY B;  2BZ2 A;  3MHY A;  3DGV A;  1EB0 A;  1EET A;  4LBI A;  2ATL A;  4LQ9 A;  5DM6 Q;  1N5S A;  1BHN A;  2DPJ A;  2M0G B;  1Z2L A;  4ED2 A;  4JV5 J;  1NSA A;  3H0P A;  4K4Z A;  3ITH B;  3J81 U;  4ZK7 M;  2KT2 A;  1VK8 A;  1Q95 G;  5EGY A;  4C3M A;  4UW2 A;  2HHP A;  2HAF A;  4JI5 F;  1FKO B;  2XG8 A;  5FII A;  2VU5 A;  1M90 T;  3NWG A;  2DR8 A;  8AT1 B;  3D1H A;  1VJQ A;  4JI4 F;  3MEG A;  3JSB A;  2C3O A;  2LEA A;  1UCN A;  4J9O A;  5IWA F;  1HHT P;  3DI6 B;  1HBO A;  1IWA A;  3R7B B;  3F44 A;  3HK2 A;  2MMY A;  3MD3 A;  3ZZP A;  2XSJ B;  3HHK A;  4HYK A;  1XR7 A;  2GVD A;  4DL3 A;  1FJ7 A;  3BH7 B;  3SSS A;  5GMD A;  3R1L A;  4HAC A;  1M5O C;  3GIJ A;  1QJH A;  2R2S A;  4X65 J;  3V6D A;  4IO9 Q;  2UUB J;  2OJ3 A;  2B6A A;  3HHE A;  1X5P A;  2ILZ A;  4OI1 A;  2ZBI A;  2ATC B;  3HJF A;  4KGM A;  2DGX A;  1RTD B;  3RU0 A;  1IKY B;  2Q1L A;  4NCG A;  4WK1 A;  3PRB A;  2GMH A;  4C3K A;  4F4K A;  2IMO A;  4EFA C;  2FVS A;  2QL5 B;  3RRH A;  2V8G A;  3A8E A;  4OZ3 A;  4CYU A;  1FFW B;  3OPK A;  3VQS A;  1WD6 A;  2C2K B;  3OL7 A;  4CWB A;  1P9Q C;  4DFP A;  4CM2 A;  3WC2 A;  4F0M A;  2YNF B;  2KXF A;  3JSM B;  3M2U A;  1HD1 A;  2PEB A;  4RX6 A;  4X84 A;  3E51 A;  1S4E A;  4WFZ A;  2LU1 A;  3A8K A;  4KRW A;  1JJ4 A;  3GIL A;  1JLE B;  2DD8 S;  3VV2 B;  1FD8 A;  2W25 A;  4XIU A;  2IYG A;  5F9L A;  1X60 A;  2CQ3 A;  3ZZU A;  2VF3 A;  6FDR A;  3ITH A;  4DV5 F;  1PG5 B;  4QR2 A;  4J9P A;  2MPU A;  4YDX A;  3TJ8 A;  1FKO A;  2RU3 A;  4IO1 A;  1SKR A;  3Q8Y A;  4TY9 A;  4UY8 5;  2F4V J;  4DCO B;  1VHF A;  2YKA A;  4OFZ A;  3A12 A;  1TEL A;  2LXI A;  2CPE A;  1ZS6 A;  3NS5 A;  3KNG A;  1E6Y B;  1NZ8 A;  4FDF A;  2QYC A;  3DI6 A;  1RBL A;  4B3R J;  3NWR A;  2E9R X;  4C6A A;  1F60 B;  2XSJ A;  2WB4 A;  1RIS A;  2NXN A;  3LP2 B;  4QU7 A;  3NGU A;  1M5S A;  2PGC A;  2MTL A;  1WNE A;  5HP1 B;  4XAK A;  4LVO P;  2LQ8 A;  3PW4 A;  1ZPV A;  4WTO B;  5EDW A;  2E1A A;  3V4I B;  1JX4 A;  1RTD A;  1IKY A;  3CT9 A;  3U1N A;  1S97 A;  2QA1 A;  3PR4 A;  3D6T B;  1NK9 A;  3MPV A;  4XK8 C;  1N48 A;  5HQ8 A;  3RB0 A;  3P6Y C;  2L9W A;  4LR8 A;  5FLX U;  3NLC A;  2CQ1 A;  2HS4 A;  5CYJ A;  2YNF A;  3JSM A;  4EBE A;  3RGI A;  3VAJ A;  5IC6 B;  3L7O A;  1F5C A;  3AD9 C;  5J1E B;  1NND A;  1JKH B;  4U7U K;  3B4D A;  4JP8 A;  2PMW A;  5DO2 A;  1JLE A;  2CPI A;  2QMU B;  4OYP A;  3P5B P;  2CVE A;  2E5L J;  2C2N A;  1YZ6 A;  1U48 A;  2LEP A;  3DC2 A;  3V81 B;  1MRO B;  1QAI A;  3UDE A;  2BBE A;  1FDN A;  1XEZ A;  2UVR A;  1SQE A;  5F8M A;  3IAS 9;  3MM9 A;  3CJQ A;  4PPZ A;  3BBF A;  4RNH A;  1RCX B;  5J1P A;  1S6P B;  5EN1 A;  1FF2 A;  2RNE A;  3KG1 A;  3PRD A;  1E6Y A;  4CZC A;  3VGV A;  3C66 A;  3KLG B;  4YUD A;  2BAB A;  1QUV A;  2ADC A;  4QU6 A;  4WU2 A;  2VD3 A;  3HSG A;  2I9S A;  2B0G A;  1JLB B;  1BMQ B;  1WI8 A;  2ZOG A;  2CWK A;  1Q8L A;  2Z58 B;  1RTI B;  4CLZ A;  3KJN B;  3EJM A;  2DK2 A;  2KFN A;  2YQ1 A;  4EYI B;  2B5J B;  4DU7 A;  3PX4 A;  5HP1 A;  2FLO A;  2OPP B;  2P9G A;  2HWT A;  4CO3 A;  4ED3 A;  2MZJ A;  2KVI A;  4OI0 A;  1GMW D;  3MEC B;  4TU8 A;  3V4I A;  2WCX A;  1XNQ F;  4BC7 A;  3KMQ A;  3FCH A;  1NB2 A;  1RP5 A;  2IPO B;  1Q1K A;  5CCM A;  2RQK A;  4ALZ A;  5A8W B;  2AKW B;  5I4M A;  2DNP A;  3CJK B;  2OEK A;  3CJ0 A;  2EK1 A;  4OLO A;  1ZOT A;  3CNQ P;  4FS2 A;  2A6M A;  2DXE A;  3NRB A;  2QMW A;  5C2C A;  4DN9 A;  3EDQ B;  1NBE B;  2R8J A;  1UVM A;  3H4B A;  5DDQ C;  3PJX A;  4ZVP B;  2F5G A;  4EBC A;  3GJT B;  1S48 A;  2U1A A;  3HSD A;  3I0R B;  1SQF A;  3BV8 A;  1TK8 A;  1S59 A;  4ED8 A;  1JKH A;  4Q45 A;  2DYA A;  1PJ7 A;  5ETT A;  4N8N A;  3MAH A;  1U09 A;  3R5G A;  2V8P A;  1I6J A;  3DCA A;  3UCU P;  1ZAV A;  5T7L B;  3MM6 B;  3EXY A;  3QJJ A;  3V81 A;  1CC7 A;  2RUS A;  1MRO A;  2CAD A;  2GHP A;  1DY3 A;  3MR3 A;  5KFE A;  2HGL A;  1WTF A;  2DHA A;  4F2R A;  2FPH X;  3FNN A;  1Y7P A;  1LQ9 A;  4E98 A;  2R7S A;  1HPZ B;  1EQM A;  2XO6 A;  2W4D A;  2VA3 A;  4ZIT A;  2B4O A;  2LQ9 A;  1KP6 A;  4UY8 T;  2J8A A;  2ZM6 F;  4LF7 F;  4JI2 J;  2VDH A;  4PG6 A;  2ZH6 A;  2FY1 A;  1GX5 A;  3KLG A;  3QZ8 A;  5D0G A;  2RVJ A;  2W4P A;  2UXD F;  1K0T A;  1DAR A;  5GAD I;  2BYC A;  1JLB A;  2BJ1 A;  1EP4 B;  1RTI A;  3CJS A;  1UZD A;  4JOU A;  1Q4R A;  3U1L A;  1L3U A;  3NP5 A;  2B5J A;  1T7P A;  5KFB A;  3MCO A;  2K3K A;  4URS A;  4QW9 A;  2OPP A;  4B3T J;  5HVG A;  1SPB P;  2AP6 A;  3MEC A;  4TNO A;  4DV1 F;  1FEE A;  1ZA2 B;  1UWA A;  1D9D A;  4AQY F;  2HFN A;  3QWP A;  3MPY A;  4DF8 A;  1C4C A;  1XTZ A;  3W5X A;  1L5U A;  2JSX A;  5AXM A;  3MPW A;  3CJK A;  2D9O A;  4ZVO B;  3NGD A;  1RHU B;  5A2Q U;  1U1K A;  4BWM A;  5EX0 A;  2OTL S;  1NSK L;  4NMX A;  5K8M A;  4DUT A;  4FKX A;  2NCK L;  3CC2 S;  2KDO A;  1NLK L;  5F41 A;  2NPI A;  4OLP A;  4CLP A;  1JLA B;  3QID A;  4DUY J;  4MAK A;  2M7S A;  3KDO A;  3RBX A;  2QA4 G;  2XEX A;  2MHN A;  1URR A;  4FYW B;  2PA8 D;  3H90 A;  4JI3 J;  3KMS A;  3MM6 A;  1WTB A;  3QWU A;  3MCM A;  4QOT A;  2NXE A;  3BN4 A;  3CGI A;  3H25 A;  2R7Q A;  5I3Q A;  1TKX B;  4RJV A;  3UD3 P;  1EAY C;  2YH0 A;  1FRK A;  2ASJ A;  1MW7 A;  1RAG B;  2LKZ A;  1VC0 A;  3Q89 A;  3C2P A;  2IM3 A;  1QE1 A;  2V4Q A;  2HVZ A;  2JFD A;  3GV8 B;  2V5H G;  1PAU B;  4Y28 C;  2W8K A;  3MPD A;  4TQR A;  2GIQ A;  2FY8 A;  4QBU A;  4OJG A;  2PE8 A;  3C16 A;  4HTI A;  2BE7 D;  3H5U A;  2Z30 B;  1QTM A;  1MWZ A;  2HHT A;  2AX0 A;  3P49 B;  2LVW A;  5K8N A;  2YX4 A;  4CH1 A;  1RT7 A;  1VRQ C;  1RGV A;  3SSR A;  3HSZ A;  3UPF A;  1IKV A;  3KDN A;  2ZEJ A;  5DQI A;  1B0T A;  4Q0B B;  2ACM A;  3LPY A;  3DLB A;  2E5G A;  4U9R A;  3E3X A;  4UZB A;  3OV7 A;  1YJR A;  4C48 A;  3H2V E;  5M2P A;  1XER A;  4OX6 A;  3MD1 A;  3FZB A;  4F3M A;  2C2Z B;  3LAN A;  3TNV A;  3MM7 B;  1Q79 A;  3GB0 A;  2NXJ A;  3HSJ A;  2KXH A;  4JI1 F;  4OI2 A;  3FBE A;  5KFM A;  1U0H A;  3ILL A;  2JZ5 A;  4JV1 A;  3DDI A;  2M88 A;  2CFX A;  3MEE B;  3QQC D;  5LL6 d;  2P6T A;  1HQ2 A;  1UVJ A;  3JQJ A;  1GXL A;  1JLA A;  2VOP A;  4P72 A;  1PIL A;  5E0O A;  4F67 A;  2MZQ A;  3PV8 A;  2X1G A;  1EX8 A;  2VPY B;  1LOU A;  2HVI A;  4ELV A;  2CPF A;  4P9S A;  3NAI A;  5KFH A;  4QCL A;  9ATC B;  3GFZ A;  1TL1 B;  3OFG A;  3OVB A;  3EM1 A;  4IDK B;  2GIR A;  1IBL F;  1YJN S;  2R8G A;  2RS2 A;  4LFB F;  2EG1 A;  1U1P A;  2PT0 A;  2E9Z A;  4H54 A;  4YR0 A;  4DV6 F;  2IJF A;  3UO0 A;  1FXR A;  5T14 A;  1RBO B;  5AE1 A;  2VJV A;  5F8N A;  1B99 A;  5IQQ A;  4LRA A;  4LF1 A;  1TQL A;  2NZC A;  2FHJ D;  3OSP A;  2DH9 A;  4CO4 A;  4YEA A;  4JI8 J;  4X66 F;  3OHB A;  2QL7 B;  3TUZ C;  5HBM B;  2CJB A;  2MZT A;  3CVK A;  2ZUA A;  3DU5 A;  4J9V A;  4CLU A;  1OO0 B;  5GAE I;  3FMW A;  3IG1 B;  4XDC A;  1NDK A;  2P2C B;  1C0T B;  4NL5 A;  4RNM A;  1YRU A;  1R27 B;  1FE0 A;  1QAY A;  3CCT A;  3VZH A;  3GQC A;  1ZH5 A;  1C1B B;  2ZNY A;  3C19 A;  1UP1 A;  2X1A A;  2IA6 A;  4JI6 J;  1GMV A;  2C3M A;  1KEK A;  3MFH A;  2QLW A;  4DZD A;  3MEK A;  4RW9 B;  2FLP A;  1LEO A;  3MM7 A;  3FUY A;  2FDN A;  4X64 J;  2VFU A;  4L76 A;  1TL5 A;  3CCM S;  3FRZ A;  3VVT A;  4B3M J;  2B43 A;  1VC5 A;  1QAJ A;  3MEE A;  3PG9 A;  1XMO F;  4CCH A;  4RBT A;  2GJF A;  4PR6 A;  4PWD B;  4DG1 B;  4LF5 J;  1UA0 A;  3ETM A;  1WG4 A;  1OQ3 A;  4OZ5 A;  3PYD A;  4M5J A;  4YY3 J;  4O0N A;  2QO3 A;  4DQR A;  4DSF A;  2Q43 A;  1RT4 A;  2FTR A;  2PFD A;  4S0M A;  1G3O A;  2M2B A;  1PSD A;  1Q82 T;  4USM A;  5ETR A;  4J9N A;  3MCN A;  1TL1 A;  3OTB A;  1UAW A;  1RAB B;  3BSO A;  4IDK A;  3V4M A;  1O51 A;  1X9S A;  2IVM A;  3VGU A;  3UN2 A;  5D4O A;  1XN9 A;  1KD1 T;  4U7C A;  3N4W A;  2XY6 A;  1F3V A;  2HIY A;  4WE1 B;  3HFK A;  2LQ5 A;  2QN6 B;  1SKU B;  2NRE A;  1U1N A;  4KGZ B;  4NX9 A;  2ZZT A;  5L39 A;  4OJ1 A;  1ZZN A;  2G0I A;  4Y2I A;  3P8B B;  4U6P A;  3I5B A;  3Q86 A;  2HZC A;  5IV4 A;  3DMJ B;  2KXN B;  1Y3K A;  4OX9 F;  4PWW A;  1A0O B;  4Z7Y A;  4DR1 J;  5HBM A;  1GMW A;  2EKY A;  4P75 A;  5LMU J;  3W1Y C;  3IG1 A;  1C0T A;  3M8S A;  1GX6 A;  3TZZ A;  4EEY A;  3PR5 B;  3M2V B;  2XLI A;  2VIC A;  4C0H A;  2V9K A;  5BYQ A;  2Y3Y A;  2CQD A;  1FNO A;  2IRY A;  3RZA A;  2FJV A;  1NO8 A;  1VQL S;  4WPA A;  1XQI A;  4KGV B;  1YBT A;  3R5B A;  1TKZ A;  4HDH A;  1N33 J;  3J7Y U;  2KFZ A;  4CM0 A;  4AFF A;  4N56 A;  2E29 A;  2HHW A;  3G6E S;  1YK9 A;  4WCE Q;  2ZH5 A;  1YVF A;  1N0V C;  1MN7 A;  4I4B A;  3I6P A;  1AXQ A;  1PO6 A;  2JDJ A;  1XJW B;  4PWD A;  4QWD A;  3BB5 A;  3CDU A;  5ETN A;  1VQP S;  2RSQ A;  1TVR B;  2DHX A;  2E1C A;  3RR8 A;  2CUY A;  1NK4 A;  2RQC A;  4X4Q A;  4MJK A;  2GA7 A;  2HEK A;  2WVB A;  2HYI B;  3Q8Q B;  2QLF B;  3J81 j;  3VWS A;  1T94 A;  3CF5 Q;  1SQG A;  3FC9 A;  3DRX A;  1NDL A;  2CNK B;  1DBD A;  2Z2M A;  3TEH B;  4WE1 A;  3HF5 A;  2EEY A;  4ECY A;  1FRL A;  4QR1 A;  1UWB B;  4RW8 B;  4M95 A;  3T1A A;  4JI7 F;  3R8Y A;  2HVE A;  3CXC R;  4J5O A;  4C9D A;  4ECS A;  4I68 A;  1QSY A;  3LUY A;  1XMQ F;  5ETV A;  4DR2 J;  4NLU A;  3CUN A;  3DMJ A;  5KFK A;  4IH6 A;  1ZAW A;  3ZNJ 1;  3ONQ A;  4LT6 A;  3WX4 A;  4IOB A;  4QWE A;  2OML A;  4LF9 J;  2E44 A;  1FNX H;  2HMI B;  3Q2T C;  5L1K A;  4GKJ J;  2CJY B;  3W9J A;  2ASD A;  2PN6 A;  4M8L A;  1RJJ A;  1FDD A;  2B4U A;  4CLW A;  3PIP Q;  3L9Z A;  4FNI A;  5HLF B;  5HQL A;  4JV0 A;  5HMX A;  2G2Y A;  2BJE A;  5ITH A;  1RAD B;  5THW A;  2DJW A;  3O6Q A;  5CAB A;  3OJU A;  1TKD A;  4ECV A;  4K59 A;  3ZZZ A;  4ZLP A;  1FES A;  4YP3 A;  1N54 B;  3IWL A;  4MT1 A;  3PRV A;  5KT4 A;  3B6B A;  3LA0 A;  1RHK B;  1CLF A;  4F7V A;  3IR6 B;  2ILY A;  3HLU A;  2HHH J;  3THT A;  5A6P A;  4DV0 F;  3PXG a;  1R8P A;  5CD4 H;  5J1N A;  4R5P B;  4HHJ A;  5KG0 A;  5CZV A;  2DR5 A;  1M0S A;  2BXJ A;  1UVK A;  3R5A A;  3DRY A;  1MML A;  4O3Q A;  3HI9 A;  1HBM B;  2RHQ B;  3CCV S;  1AA1 B;  1UVN A;  3U27 A;  4KYZ A;  5F9N A;  4MFB B;  3GFH A;  3WX8 A;  2OAU A;  1X9M A;  1HYS B;  1XR5 A;  4USU A;  3TAQ A;  5E3A A;  4DPO A;  4M5L A;  2FJX A;  5GAH I;  3C14 B;  2E5H A;  2YQ3 A;  4ZP7 A;  3GSI A;  5IXU A;  1H74 A;  2G2Z A;  5JVH Q;  3TAM B;  1UVI A;  2FJD B;  4EO6 A;  5KFQ A;  4B9V A;  2J0W A;  1RHR B;  4B08 A;  2IBO A;  3GU0 A;  2VPZ B;  3KHR A;  3M6U A;  3VQT A;  3PKY A;  1WEZ A;  2DR6 A;  1VDH A;  1EIY B;  1UWB A;  4UQG A;  4RW8 A;  2YPY A;  2RB7 A;  3DOL B;  4ZIV A;  3G87 A;  2RQ4 A;  3M7V A;  5A6W A;  1F9H A;  1SL0 A;  4ZVT B;  5KOW A;  3CCE S;  1X4F A;  1GAO A;  2K7J A;  4ETZ A;  3G8Q A;  3UDV A;  5IT9 U;  1SC1 B;  1UPM B;  3R1H A;  2HMI A;  2VFR A;  4RUA A;  5K5M A;  2GNK A;  3OTE A;  3B4M A;  4WWS A;  1YGY A;  3HFV A;  1U24 A;  3VAG A;  2NZ4 A;  3T6B A;  1ITP A;  2B9E A;  5HLF A;  3HX9 A;  4URQ U;  1VBY A;  2RML A;  2RHS B;  4EI2 A;  5AJ3 F;  3US5 A;  2RDJ A;  4NZ6 A;  2KT5 A;  2FVR A;  4B9L A;  5IWA J;  3CJ4 A;  2D9P A;  4L3K A;  3OTO F;  3M2R B;  2FB0 A;  3J80 U;  1N88 A;  5B0B A;  2FVP A;  1RWW B;  1DRZ A;  3AD8 C;  1MU2 B;  3DOK B;  4PZV A;  4A48 A;  3R9L A;  1DLO A;  1O6X A;  4ECU A;  4P7V A;  4R5P A;  4K2X A;  1HNX J;  2KJW A;  2FD2 A;  1G6B A;  3PW0 A;  1FVS A;  1HBM A;  2E7W A;  2V68 A;  1LW2 B;  5L46 A;  2R7W A;  2WSF C;  2COL A;  4MFB A;  2UZA A;  2JEI A;  3A8I A;  3DLK B;  2DCL A;  4DFM A;  1HYS A;  2CPY A;  4C11 B;  5KT5 A;  1HNZ J;  2EKN A;  1T3O A;  2RDD A;  3GR0 A;  1N34 J;  3EVM A;  3C14 A;  1JJ2 R;  2DH8 A;  5KFZ A;  3I56 S;  4QWA A;  3D1Q A;  1RWP B;  1NSQ A;  2XWX A;  3LAM A;  4CT9 A;  4GC7 A;  4YHH F;  2WW8 A;  1REG X;  4DS4 A;  1OPI A;  2FHJ A;  2AGP A;  4A8Q A;  2WVF A;  1Q81 T;  5IC4 B;  4OZJ A;  1RAA B;  1RTH B;  1Q16 B;  3LPE A;  1OYE A;  3DOL A;  4NLS A;  5D0E A;  5C2G A;  2HHU A;  3WIU A;  1RDR A;  2HQD A;  3TJA A;  3NCQ A;  5A0Y B;  2FLN A;  4EBD A;  1FDA A;  3FSX A;  3VAL A;  2ZJR Q;  3ZZO A;  2CPZ A;  1KLM B;  3MR7 A;  3TEG A;  3OTC A;  3PJW A;  1RHM B;  4ECT A;  1SH0 A;  1PBA A;  4PRF A;  1YLX A;  5K20 B;  4NPO A;  3NKY A;  1JXL A;  2BKO A;  1YJ7 A;  4DX8 H;  2JVR A;  2HS0 A;  4TU7 A;  3RUB L;  3Q23 A;  2P6S A;  1S1W B;  2J0Q D;  4PXB A;  1ZAX A;  2B9W A;  2O3D A;  4CO0 A;  4GKK J;  3M2R A;  2MLZ A;  4RBU A;  2N82 B;  4K0K J;  3I31 A;  1UL3 A;  1FJE B;  2ABY A;  3AOB A;  4NWB A;  1W2B R;  3OSN A;  2CPH A;  1D8Z A;  4I64 A;  2XY5 A;  5A2Q Y;  4K4T A;  4GC6 A;  1PJ6 A;  2UUT A;  2XI2 A;  3PKM A;  5HQM A;  1CG2 A;  1U02 A;  3MMJ A;  1OIA A;  4WII A;  4B9N A;  1LW2 A;  3CD7 A;  6AT1 B;  3D0I E;  3MOZ A;  2VKZ G;  1I94 F;  3MXH P;  1S1X B;  2VG6 B;  2BW7 A;  1KHW A;  2V67 A;  4ZLJ A;  1X4E A;  4LF6 F;  3DLK A;  4C11 A;  4CI0 B;  4P71 A;  1N32 F;  4YB5 A;  3OR2 B;  3CME S;  1NK0 A;  4DPW A;  1KVI A;  3HPO A;  3QAT A;  4ZVQ B;  3RG6 A;  1K73 T;  4BWJ A;  3N79 A;  5J2N B;  3AXM A;  1H7X A;  2J6S A;  4XPE A;  1ZPW X;  2MY7 A;  1U45 A;  2GC8 A;  4LQ3 A;  1FI4 A;  3D1O A;  4RNO A;  1Y00 A;  2DNL A;  3KG4 A;  1OMS A;  1RTH A;  3HD2 A;  2F65 A;  4RZR A;  4QIG A;  2F1F A;  4O3S A;  4I2P B;  3DNC A;  1M5V C;  2LEB A;  4QYZ K;  1F3F A;  1IQT A;  1GK8 A;  2ALY B;  5A0Y A;  4LFC F;  1R0A B;  1G7C B;  2NPF A;  2GZO A;  1KLM A;  4I67 A;  2BE2 B;  3BDE A;  3IAM 9;  3HVW A;  1X7V A;  4A8X A;  3GMG A;  2WBM A;  1V3R A;  4YQW A;  2ASL A;  2NUU G;  3VTI A;  4P6Q A;  1NJI T;  1S1V B;  3ZTS A;  5B09 A;  4C8O A;  2BJD A;  3VR1 A;  2DTJ A;  1S1W A;  1OYD A;  1UEU A;  4USV A;  5K14 B;  5C24 B;  3AOA A;  4NLO A;  5EUH A;  1RWV B;  1S5Z A;  1X4C A;  1VBX A;  3D68 A;  2XM3 A;  4ZPC A;  4NA3 A;  3ETO A;  3NNC A;  4FZV A;  2XHC A;  2R42 A;  4IH7 A;  3THP A;  3TA2 A;  1HHQ A;  2CNL B;  1D09 B;  2EFO A;  3FEZ A;  1RLC L;  5C25 B;  2Y1I A;  5LSL A;  8RUC A;  4J9L A;  4L3N A;  2UUW A;  4RNN A;  3ZNU A;  1U49 A;  1S0V A;  1IBM F;  1G4C A;  3LAL A;  3HHL C;  3Q8S B;  3AH6 A;  1LWF B;  3OXG A;  4WFB Q;  4E8U A;  4A8F A;  2R2U A;  2MKJ A;  1S1X A;  2VG6 A;  2ZVS A;  2W4C A;  4ZCI A;  3L4B C;  1WDT A;  4YFU A;  3MWB A;  3K5L A;  1B7F A;  3OR2 A;  4OYO A;  3KHL A;  2OKQ A;  1S72 S;  4DUZ F;  2WOM B;  3NGK A;  1T95 A;  5DET A;  3NEK A;  1DHM A;  5J2N A;  5HAO A;  2DY9 A;  3RW7 A;  3HUL A;  4X4S A;  2JC0 A;  1QSL A;  2XZD B;  2FC9 A;  3RB6 A;  2RUG A;  3D0H E;  3BEG B;  2O5D A;  2G4B A;  2H54 B;  1IUJ A;  1X0P A;  2XMK A;  4F3O A;  4Y3C A;  4CDI A;  2BQ3 A;  4ZP9 A;  1QM9 A;  4I2P A;  3GCX P;  2JEF A;  3TR5 A;  2HND B;  4RLE A;  3FZ2 A;  5HSP A;  1YWX A;  2DO4 A;  3BGL A;  1RQ0 A;  3CD6 S;  4NA2 A;  4ZPT R;  2Y8W A;  4B9M A;  1R0A A;  4HI1 A;  2I1R A;  2DGT A;  2G9O A;  3JQK A;  4C8K A;  2LCW A;  2BE2 A;  4Y2C A;  3B82 A;  1EJ7 L;  2A2D A;  3SDE B;  1Q8I A;  3EMT A;  2UUC F;  3BDP A;  4WYW A;  2H3E B;  2M9K A;  1S1V A;  4LF7 J;  2EVZ A;  3AQO A;  1CC8 A;  1NXI A;  4OV6 A;  5K14 A;  5C24 A;  4OYI A;  2BVZ A;  2MJN A;  3K89 A;  3W8P A;  1R8B A;  3POT B;  4P2F A;  1T0T V;  2UXD J;  4YN3 B;  5B0E A;  4F36 A;  1XWL A;  5DS7 A;  2ZH9 A;  3EIC A;  5C25 A;  5KG1 A;  3BR9 A;  1U1M A;  3GFX A;  4EMD A;  4WZQ A;  4V1A k;  2MKH A;  3X3U A;  1FX2 A;  4G65 A;  1LWF A;  3BO4 A;  3M8Y A;  4YB1 P;  1NK5 A;  1WF2 A;  4WFN Q;  4AQY J;  2W24 A;  2UUA F;  2RRA A;  3HJV A;  3UI3 A;  4LSZ B;  3HT0 A;  1WOP A;  1X5S A;  1IR0 A;  4USI A;  3BQ0 A;  4DV3 F;  2YWE A;  1FJG F;  2MYF A;  1R7I A;  4RU9 A;  2E5J A;  2ACY A;  3OLA A;  3T6J A;  4TKT A;  2BQR A;  2L3M A;  3EVW A;  1T05 B;  3AQP A;  2BM1 A;  2BX6 A;  1KKH A;  1L3V A;  1NKE A;  2R7U A;  2HND A;  3ZC4 A;  1KNZ A;  4A46 A;  1YRX A;  4DBQ A;  2PSZ A;  5D8H B;  2QRR A;  3DU6 A;  3KYL A;  3O3L A;  2WON B;  3SQG B;  2Y1R I;  4M5N A;  2DGQ A;  4UUW A;  1V9O A;  4V19 J;  1PYO B;  5E5N A;  2XMA A;  1UTA A;  3KXD A;  3SDE A;  7AT1 B;  3PEH A;  3BKU A;  4RW6 A;  3ZZ0 A;  2DNO A;  2OTJ S;  4IFV B;  3EPI A;  3QT7 A;  1JMT A;  4KFB B;  1N5Y B;  3I0S B;  4PPD A;  1IBK F;  2BKP A;  2NSB A;  1WKL A;  2Q6C A;  4G3I A;  2VQE J;  2OI2 A;  4PCQ A;  4ER8 A;  2MLX A;  3UFC X;  1Y10 A;  3POT A;  1BUX A;  5KFN A;  1VBZ A;  5AXL A;  4KHR A;  4KIA A;  2AX1 A;  1FRX A;  3FKB A;  4KT0 C;  2ROG A;  4MTP A;  4RO0 A;  2J6U A;  2VQF J;  3AFG A;  3G6V A;  4OL8 A;  1RAF B;  1J5E F;  2EFV A;  3MR6 A;  1Q8K A;  1TZ0 A;  3DGP B;  3E8O A;  1FK9 B;  3HHL D;  3MUM P;  1KS2 A;  3P4U B;  1URN A;  1L3T A;  3RRK A;  3O5T B;  4IR9 A;  3CSK A;  1VJW A;  1R8C A;  1YBU A;  1XC9 A;  3IWX A;  1ZBT A;  2UXC J;  4Y2A A;  2FZG B;  4QZV B;  3QFW A;  5KT7 A;  3EGV A;  1J5O B;  3GJQ B;  5CAA A;  2QYG A;  4J9R A;  2XTJ P;  1S0N A;  3E01 B;  1WDD A;  4UZC A;  1NU4 A;  1RT6 B;  1B0P A;  3F41 A;  4PG4 A;  1TR0 A;  2FJW A;  3KLF B;  1N5T A;  1SV5 B;  2V4J A;  4B9U A;  4QR0 A;  1VQM S;  2XCA A;  1T05 A;  3W3S A;  4EZ9 A;  4PQU B;  1N8R T;  2B8P A;  3HHD A;  2QJ3 A;  1VOM A;  4A4J A;  5C5J A;  3QGP A;  4O23 A;  4TU9 A;  3H5S A;  4X65 F;  2QTW A;  5AT1 B;  1IXK A;  5KG3 A;  2KYX A;  2WON A;  2D3O 1;  3SQG A;  3LW5 C;  2UUB F;  5HL7 Q;  3T5L A;  1UJ4 A;  4OMF G;  3Q8P B;  1RU2 A;  3M32 B;  5DDP C;  3WDO A;  3DLE A;  4KHP J;  4X4T A;  1WG5 A;  3OXL A;  1R89 A;  2XSF A;  2DNG A;  4XDD A;  4ZLL A;  3HKZ D;  2CQ0 A;  2MZS A;  2AYM A;  4IFV A;  3CCQ S;  4ED1 A;  3ICL A;  1A9N B;  1AUD A;  4KFB A;  1N5Y A;  2PDA A;  3I0S A;  1X4A A;  4DX6 A;  4EU0 A;  4GO7 X;  3W62 A;  4L72 B;  2GML A;  3QT8 A;  1H73 A;  2MB0 B;  1AZS B;  1YKW A;  4X66 J;  4K7Q A;  3H40 A;  3IGN A;  1IWG A;  1RLD A;  1YX2 A;  2B4V A;  2WBR A;  1XK8 A;  1P9Y A;  1WAC A;  3SFG A;  2C2D A;  4ATN A;  1GT8 A;  4LR9 A;  2NR0 A;  2O66 A;  4ZVE A;  1FKP B;  1SUQ B;  3R5C A;  1OWX A;  1KRP A;  3DGP A;  2XQC A;  3H2L A;  4MIB A;  4KAI A;  4ECX A;  2AEM A;  1PCA A;  4HR2 A;  4ILR A;  2YNH A;  4KGX B;  3FGV A;  5MLC V;  2VFV A;  1U2R A;  3D4J A;  4DR4 F;  3RBD A;  4DXL A;  2F4V F;  4ZN3 A;  5DQG A;  4J91 A;  2Y1L B;  2QMX A;  1Q0N A;  3KUG A;  1DAX A;  1VQS A;  3E01 A;  3M9M B;  3HZG A;  2F8M A;  2JJ4 D;  4F4X A;  1HKA A;  3T5H A;  1XMO J;  1RT6 A;  2H4Y B;  5KAK A;  3HD1 A;  4OZ2 A;  1SV5 A;  2Q79 A;  1Q8B A;  4B3R F;  2J7K A;  1JNZ B;  1BQM B;  3KUH A;  3IR7 B;  2DT9 A;  2CWX A;  4PQU A;  3QAE A;  4C7Q A;  2A10 A;  2RAQ A;  4D3H A;  1UA1 A;  2SXL A;  1XMB A;  3ZFV A;  2CZV C;  3W9I A;  2JHE A;  3BR8 A;  4QWC A;  4K4W A;  1FTR A;  2OD6 A;  2AQ4 A;  4P52 A;  3QLH B;  3M32 A;  4DFJ A;  1OY6 A;  2HFZ A;  2U2F A;  1FVQ A;  2J0X A;  3NMR A;  5F8J A;  4HKQ A;  3AJ1 A;  1RE1 B;  3BN7 A;  3BO2 A;  4OYX A;  4LSN B;  2RU9 A;  4PUO B;  3CO0 P;  2QLJ B;  5BYS A;  1KFS A;  4K2J A;  3FCV A;  3ET6 B;  4OJ3 A;  2B8Q A;  4C8Y A;  1XBW A;  1AZS A;  2NUH A;  2KN4 A;  4OX9 J;  3G71 S;  1RT3 B;  3MGJ A;  1FTC A;  2QFJ A;  3LP0 B;  4WYL A;  3CDE A;  4ZKA A;  4CLS A;  1WHY A;  1FKP A;  3EXC X;  1X4H A;  4ZVF A;  1SUQ A;  5HRO A;  2AF6 A;  2H5I B;  3H5X A;  2W9B B;  3WBZ A;  2IDE A;  2GQ2 A;  4UF4 A;  2HIQ A;  3MPU B;  4M5D A;  5J2M B;  4ZP6 A;  3JYT B;  4CT8 A;  2X1F A;  5HJX A;  3W2V A;  5E3Q A;  3VAI A;  3GE9 A;  4DOZ A;  2KHD A;  1BQX A;  2MQN A;  3VAM A;  5BXI A;  2IAJ B;  2WSC C;  4I7F B;  2O67 A;  2ALZ A;  1RBA A;  5HMW A;  2UU9 J;  3D6M B;  3FMB A;  4PEO A;  3KK1 B;  2H4W B;  2R2R A;  2I2Y A;  2CG4 A;  2R7X A;  3BQ1 A;  4P7T A;  2FUG 9;  2MZR A;  4DEZ A;  1BQM A;  4ZDN A;  3B54 A;  4M5H A;  2KRR A;  1Q86 T;  3C15 B;  3LWM A;  2B9Y A;  1D9A A;  2HQI A;  1I3O B;  5D3G B;  2LFV A;  4PXC A;  2HVD A;  2HWH A;  4ZPD A;  3T1H F;  1S57 A;  2W9A A;  4F2S A;  3ZTR A;  3Q8U A;  1MMN A;  2ZJQ Q;  3QLH A;  1BWV A;  1YG0 A;  4M5G A;  4ZOS A;  2AWZ A;  3MR2 A;  1MMD A;  2OO4 A;  2ZKT A;  2HQ3 A;  1GH8 A;  4NOH A;  1W7W A;  2QC3 A;  1H2T Z;  4DDF A;  2HBQ B;  4LSN A;  1U8W A;  3DDN A;  4PUO A;  3ZZR A;  2BRL A;  3R3T A;  2E1M C;  2R3V A;  3GG0 A;  3ET6 A;  2VON A;  4WZM A;  2N3L A;  3TAR A;  1RK8 A;  3HHL B;  1RT3 A;  3NOG A;  2QGF B;  2E5I A;  3LP0 A;  1LWC B;  4P74 A;  3KUE A;  4FVC A;  4NML A;  2CDQ A;  3MI7 X;  4WF9 Q;  2GX8 A;  4YDD B;  1NM2 A;  4ZHR B;  4X4N A;  4R0E A;  4CRJ A;  2W9B A;  2PI5 A;  4IH5 A;  1HI8 A;  5HVF A;  5B0D A;  1VQ9 S;  2CJA A;  4KBI A;  2J8S A;  5KFJ A;  3D28 A;  5G0R A;  1LNQ A;  5K9F A;  2CJQ A;  4LBP A;  2DHG A;  5J2M A;  3JYT A;  2E7V A;  1UJ5 A;  3O1L A;  1BQN B;  4QPX A;  4OQJ A;  5LXR A;  3J7Z T;  3PAC A;  4H4K C;  2HBZ B;  3PVX A;  4IG0 B;  2KZZ A;  4RWX A;  2FZC B;  2LDI A;  4TY8 B;  2DNQ A;  5KG7 A;  5ETK A;  2IAJ A;  2H5E A;  3UN5 A;  3JXO A;  4I7F A;  4JI2 F;  4DV0 J;  1D0E A;  3VGT A;  3FQL A;  3NS7 B;  4ED6 A;  3SEO A;  5L8R C;  3KK1 A;  1HR0 F;  4GO5 X;  4YB6 A;  1CVJ A;  2KRB A;  1JJC B;  4ZPA A;  4CTA B;  4RBV A;  3HXM A;  3SV4 A;  1Y5N B;  4V19 X;  5IOL A;  4UQT A;  1B4S A;  3C15 A;  1SH3 A;  4F26 A;  2HZV A;  3TO8 A;  3HVA A;  2P9C A;  1RI7 A;  3T1Y F;  2H51 B;  2YKM B;  5DRK A;  4DN0 A;  5HO4 A;  4YME A;  4QIF A;  5D3G A;  2I6W A;  3W9H A;  3PX0 A;  4ENO A;  3KK3 B;  2HHX A;  3MM9 B;  1CPZ A;  4NZ0 A;  1HMV B;  1JK9 B;  2W2M P;  1R8H A;  1FNM A;  4A8K A;  3GWC A;  3GIR A;  5LXY A;  3R97 A;  4DL2 A;  4WP8 A;  4L75 A;  4DQQ A;  2GQQ A;  2RKI B;  5KFS A;  3TUI C;  2R7O A;  2EFG A;  4NLT A;  1EQ0 A;  1N5Q A;  1WOO A;  3M8R A;  3UR0 A;  4IQX A;  2C3P A;  2IFX A;  2JL9 A;  1TUV A;  3H98 A;  2AU0 A;  4JYA F;  1U8S A;  5K8P A;  4LR7 A;  1D1U A;  5CQG A;  3PHE A;  3HHL A;  4N8O A;  2XB2 D;  3M6W A;  1LWC A;  2IMW P;  3PYF A;  4OYA A;  2LP4 A;  4QW8 A;  1HNW J;  5KFD A;  4H4O A;  4ID5 B;  4ED0 A;  4OHX A;  1UFL A;  4ZHR A;  2IJR A;  4LF8 J;  2EC0 A;  1AW0 A;  5AJ3 J;  4LUB A;  3MR5 A;  2RS8 A;  4RW4 B;  1HWI A;  3OL6 A;  1FRM A;  2VG5 B;  4MKA A;  2V2V A;  1IM4 A;  1YJ9 S;  4URG A;  3RAM A;  4MYU A;  3CJT A;  3D6F B;  1JLG B;  2G1H A;  1BQN A;  3OTO J;  1N5V A;  4IG0 A;  2J0S D;  2MQM A;  1TFY A;  4C97 A;  1F1B B;  3F73 A;  4TY8 A;  3AAW B;  3UDL A;  2IRX A;  1JLC B;  2MQQ A;  1SIW B;  2KJV A;  2KG1 A;  1QAX A;  3UN3 A;  4WP9 A;  4AXI A;  4QIW D;  4CTA A;  1B64 A;  2DGO A;  2OUG A;  1VQ5 S;  1WC0 A;  4NXN F;  2YKN A;  1CBK A;  2V8D A;  4CO5 A;  4WKY A;  4K50 A;  3JSR A;  4WXW A;  2MKS A;  5F8H A;  3HCX A;  2ZVI A;  4P2M A;  2YKM A;  3OFE A;  4NLX A;  1HNI B;  3M8Z A;  2EWH A;  3KK3 A;  3OTD A;  1HMV A;  4DX7 A;  3QRR A;  1VIS A;  2FLL A;  5IS2 A;  5CYQ B;  5E41 A;  1BXN A;  3D0G E;  2QFI A;  2AYG A;  4LRF A;  4C8L A;  2OMO A;  2MKI A;  2RKI A;  4ID8 A;  1O5J A;  5IZH A;  3EX7 B;  3W7B A;  2JVO A;  2DGS A;  1M5H A;  1REV B;  4P2S A;  3M9N B;  2AJF E;  1RWO B;  3SFU A;  3M9O B;  3CWJ A;  1CUL B;  1TV6 A;  4Y00 A;  3VAF A;  5E3C A;  1RHJ B;  3J7A N;  1ZM3 A;  3R7N B;  3GV7 B;  2YWG A;  1K47 A;  5H9F J;  2W9C B;  4ZVU B;  3JTP A;  3MMB B;  4IOA Q;  1KBR A;  2HQG A;  1NK6 A;  4X4V A;  1S1T B;  3L09 A;  4XO0 A;  1QSS A;  4ID5 A;  1RWU A;  3M8W A;  2DNM A;  2N3O A;  4P10 A;  3G8T A;  5B0C A;  1T11 A;  3LP1 B;  2POK A;  2HUR A;  1AUS L;  3A3P B;  2N7Y A;  2D74 B;  2AJ1 A;  3J7Y I;  1HLW A;  4ZA1 A;  3TVZ A;  4RW4 A;  1K8A T;  1LK7 A;  3AOD A;  3KNA A;  1L3K A;  1V5I B;  1UKU A;  2V50 A;  2VG5 A;  4UOH A;  4JB8 B;  4DLG A;  1M1H A;  2VPX B;  2XS7 A;  1PBU A;  1JLG A;  3JAM U;  2QSF A;  1VQO S;  3HKW A;  1NK7 A;  1FEH A;  1KTQ A;  2XYG B;  3QJL A;  3R5D A;  1JIH A;  1RB0 A;  2OSR A;  1IBC B;  5E7O B;  3CDW A;  3A1Y G;  4ILL A;  1FCA A;  1JLQ A;  1JLC A;  3OFH A;  3PX6 A;  1Y0H A;  3E2E A;  8ATC B;  1WJ9 A;  1LFW A;  3K7R A;  1QD1 A;  3P3D A;  3UQS A;  1SCJ B;  1KON A;  1U2F A;  5JUM A;  4ELT A;  4JI8 F;  3UVJ A;  2GGP B;  2BAC A;  4KC5 A;  4F3Q A;  1DTT B;  2F3J A;  4Y2M A;  1I94 J;  2OHD A;  2ZH3 A;  4HHH A;  2RRN A;  3T9Z A;  3CJR A;  2K06 A;  2ZWP A;  1E6V B;  1T9V A;  2VHG A;  3MUR P;  1QE1 B;  1YJW S;  5KFO A;  5H9F K;  1HNI A;  1HNV B;  4F25 A;  3GTY X;  2RRB A;  1WKK A;  5I3P A;  5D0R A;  3IBF B;  1JJH A;  3K17 A;  5CYQ A;  3A8J A;  1NHU A;  4WU3 A;  3KKF A;  4DV7 J;  1Q7Y T;  4ZLN A;  4N77 A;  4QIV A;  2PII A;  2WW4 A;  1R31 A;  1PAE X;  4JI6 F;  2OEM A;  4DCJ B;  1WWH A;  3QJP A;  1REV A;  2ZWO A;  3C16 B;  1D3W A;  2O1P A;  2CNN B;  1CUL A;  3PFE A;  1NZA A;  4ZIW A;  1HQE B;  4X4P A;  1U4B A;  2G1D A;  1VQ8 S;  1WHW A;  3W8G A;  4M5K A;  2W9C A;  2D1C A;  1RT7 B;  2DIU A;  3QMQ A;  3GZ7 A;  3MMB A;  4NYP A;  1MNE A;  4K4V A;  3R6G B;  2RH3 A;  5MAO A;  2CPX A;  2E66 A;  1IKV B;  1S1T A;  2EFQ A;  2XZW A;  1HI0 P;  4PYD A;  3QZ7 A;  4BDP A;  3LP1 A;  1S9F A;  1OQ6 A;  4C4W A;  2OFG X;  4ANC A;  2DNR A;  3RAX A;  5HI7 A;  1M1G A;  3N9U C;  3QGH A;  4OI4 A;  1U0H B;  1N52 B;  3TA1 A;  2OP5 A;  5FD1 A;  2AJ2 A;  3MM5 B;  5I3U A;  5F8L A;  4U8Y A;  3ISN C;  2QL9 B;  4DL6 A;  3EZU A;  4R8U B;  1KC8 T;  3NY0 A;  3KK2 B;  5AXN A;  3OBI A;  3A4T A;  5LJ3 Y;  1HW9 A;  2ZOF A;  1MG7 A;  4L6V 3;  4QYR A;  5J2P B;  1IBM J;  1TL7 B;  4KKO B;  4KR0 B;  4PYA A;  5EX3 A;  3JTO A;  2GGP A;  4DR1 F;  3HP6 A;  1DTT A;  4OV1 A;  1ARO P;  2VC0 A;  4W4M A;  1XNR J;  2ZFH A;  5IQ6 A;  4ECQ A;  2VBW A;  2ZBC A;  1E6V A;  2WHO A;  2XCP A;  5EWE A;  1HNV A;  5KFX A;  3PFO A;  2HZA A;  2GJ2 A;  2KT3 A;  4ED7 A;  2V63 A;  4E2F B;  2A6O A;  4CO1 A;  3W64 A;  4MK7 A;  4J9Q A;  4LRC A;  1S6U A;  3OUY B;  1YDL A;  2OLW A;  1S99 A;  3N5B A;  4ZJO A;  4WJB A;  2J76 E;  1NJX A;  1TMM A;  4OYM A;  2XUL A;  4F02 A;  2J5A A;  4DPT A;  4ECZ A;  1Y9O A;  4DLE A;  1HQE A;  2VUG A;  3BKF A;  4C0B A;  1T02 A;  3ILI A;  2VG7 B;  2QX0 A;  2HHQ A;  3NNH A;  1KQK A;  4K5R A;  4A8S A;  2Z56 B;  4OI6 A;  1P27 B;  1KOO A;  4QQB A;  2XHW A;  1HWK A;  1EHW A;  4G6V B;  4ZJL A;  1WKJ A;  1G2E A;  5D15 A;  1X5T A;  2VFT A;  2GHV C;  1VRT B;  3VAK A;  2HBR B;  3EPG A;  3A3O B;  1S6Q B;  3T5J A;  3CDA A;  1SJ4 P;  1F9E B;  5HMZ A;  2ROP A;  2CIM A;  3MM5 A;  3DDK A;  1ZTT A;  4HTJ A;  3OJS A;  2YQ0 A;  3SCK E;  1UW9 A;  1U47 A;  4H4M A;  3I9Z A;  1DQ8 A;  2LMI A;  4R8U A;  1VFJ A;  5KT6 A;  2VL1 A;  3KK2 A;  4IUF A;  1SL2 A;  1GNK A;  4L73 A;  4ES1 A;  2RF2 B;  3WIV A;  5J2P A;  1RT4 B;  1TL7 A;  4DR2 F;  4KKO A;  4AL6 A;  2W2O P;  2GO9 A;  3CD5 A;  4KV8 B;  3IFE A;  1TL3 B;  3FCW A;  5DLG A;  2ZIT A;  3QRP A;  2WB1 D;  4X2B A;  2F9J A;  2BAN B;  5LMN J;  1X4B A;  3TVK A;  4Q5V A;  1EKR A;  1N6Q B;  2ZBR A;  1S9E B;  2OGU A;  4LMZ A;  2NSC A;  4FBU A;  4CLF A;  2MY8 A;  3GIM A;  3QRQ A;  2K1R B;  5AE2 A;  4DSK A;  3SIP B;  1FJG J;  5KFY A;  2XMJ A;  4AUK A;  2UXB J;  4OX8 A;  4IQM A;  1FRI A;  3TWZ A;  1GXT A;  2HRY A;  3OUY A;  5F0W A;  3HVR A;  4PAA A;  3PDN A;  4USJ C;  1AB8 A;  3MAQ A;  3MUV P;  1YJU A;  3V6J A;  2VBZ A;  2VBX A;  3UCZ P;  2HHH F;  4MKB A;  3TX8 A;  1RZM A;  2YBV A;  1N36 J;  3MTK A;  3G86 A;  1PJ5 A;  1WC1 A;  1RAO A;  2Z8Q A;  2VG7 A;  3I55 S;  1HI1 A;  7FD1 A;  1HW8 A;  3D54 A;  3BGR B;  2HFS A;  2ZD1 B;  1T03 B;  3NAH A;  2LDY A;  4N41 A;  4K8R A;  1RT2 B;  4MK9 A;  1P6T A;  1VK3 A;  1GFW B;  2I0X A;  2ZHB A;  4DMZ A;  2X3D A;  2CAJ A;  2Q66 A;  2EW9 A;  4RUC A;  1OY8 A;  4YB7 A;  4YS2 A;  3KHG A;  1TKZ B;  1VRT A;  2KU7 A;  2V8V A;  1S6Q A;  1SI9 A;  2CPJ A;  3QO9 B;  3DRR A;  2XMW A;  4EGL A;  1ZM4 A;  1WHX A;  3LGN A;  3KOA A;  1R6V A;  4DSE A;  2Z2Y B;  2ZDP A;  1ZET A;  2HK2 A;  2JFK A;  1PIE A;  3H7H B;  2V69 A;  4I1T A;  3ISN D;  4BS2 A;  2ZC3 A;  4PXD A;  3HDS A;  1VQ4 S;  2B4P A;  2VAS A;  3TZW A;  3CUL A;  2CQP A;  1R8A A;  4FN5 A;  1J5E J;  4B3O B;  2RF2 A;  1G1X A;  4LRB A;  3PYE A;  4DR7 J;  1EZZ B;  4DU8 A;  4KV8 A;  3CE8 A;  1NRK A;  2V2K A;  4DR6 F;  1TL3 A;  1C1C B;  2ROE A;  4O3N A;  3J81 Y;  3PM9 A;  2LXU A;  2DXD A;  3IS9 A;  2BAN A;  1WEY A;  2DRD A;  4X62 J;  3BBC A;  3M8Q B;  4IRK A;  4ITS A;  2GAG C;  1UJ6 A;  1N6Q A;  4LBH A;  1S9E A;  4CNZ A;  4N76 A;  2C1E B;  2K1R A;  2HLU A;  3P96 A;  2GAH C;  3I82 A;  4C8Z A;  5IT0 A;  1U1L A;  2IRU A;  2GMJ A;  3KHH A;  1VLY A;  3TAP A;  2PMZ D;  4U96 A;  1FWL A;  2HWI A;  2AGQ A;  1QVF R;  2QZ8 A;  3TW0 A;  1KR4 A;  3OR1 B;  1GQE A;  3W65 A;  1KVK A;  5L9N A;  5EWG A;  2JEG A;  2NYH A;  4ZS6 A;  1YZ7 A;  4PG7 A;  1HNX F;  1JQG A;  1X31 C;  2FQQ B;  3BGR A;  2ZD1 A;  1T9Y A;  1T03 A;  2YWF A;  3TJ9 A;  2W2N P;  3LTO A;  1GEH A;  2BOP A;  4DHV A;  5KG2 A;  3QSI A;  1RT2 A;  2OPQ B;  2EPI A;  1S4F A;  3DLJ A;  2BE9 B;  5BR8 J;  4H4K A;  1UPP A;  2HK3 A;  3LGM A;  2V2Z A;  5CYM B;  1HNZ F;  1N34 F;  2FYX A;  4NLY A;  2Z2L A;  1WHV A;  1MWQ A;  4AYB D;  2MEW A;  5HVH A;  1JXV A;  3QO9 A;  5H1S V;  2AMC B;  3I87 A;  1TK5 A;  2CA9 A;  1FA0 A;  5RUB A;  1GTE A;  4QJV A;  4ZMM A;  2K2P A;  3IMQ J;  1EAR A;  1H6K X;  4I2Q B;  1S0O A;  2D3Z A;  3V6H A;  4Q8E A;  3TYT A;  4UOG A;  2F9D A;  1NCL A;  4B3O A;  1RU1 A;  1S6O A;  2IA0 A;  1HFE L;  2VBY A;  4IRD A;  2AJ0 A;  3QIP B;  4B3S J;  3C6T B;  1B70 B;  3GG1 A;  1C1C A;  1HHS A;  2XMM A;  4ZP8 A;  3BRE A;  2E1P A;  1TFW A;  5LT5 A;  3M8Q A;  2XNQ A;  1NH8 A;  4WBF A;  4WP3 A;  1QDU B;  3GII A;  4DR4 J;  1SJR A;  4KE5 A;  4B02 A;  2DEI A;  2J6T A;  5F8G A;  1NB7 A;  1YJT A;  1X4G A;  1FRJ A;  4OHV A;  2MQP A;  3RR7 A;  1FXD A;  4OHY A;  2BDP A;  5GAG U;  4MKV A;  2E7X A;  2BJ7 A;  3DHX A;  4DCP B;  1F5B A;  3RAQ A;  3ZXW A;  3GON A;  4DR3 J;  1K1Q A;  4X4O A;  4RWW A;  3HM9 A;  4GKK F;  4FPR A;  4K0K F;  4N7T A;  3QNW B;  2IBK A;  1RCO B;  2NQP A;  3CIM A;  3FJ2 A;  1F2G A;  3OR1 A;  4OYW A;  4J37 A;  1VGY A;  3NXZ A;  1Z1Z A;  2FJB B;  4LSL B;  4HEA 9;  4K4X A;  3JQM A;  2DR9 A;  2HRU A;  4W98 A;  2DY1 A;  4RKU C;  5G4D A;  1TUG B;  5KFF A;  3AHP A;  3I9V 9;  4KH0 B;  2F8E X;  4ZPW R;  4F4Y A;  1Y11 A;  2OPQ A;  1ELO A;  3C6U B;  1V3Z A;  2JOQ A;  1VQN S;  1KN6 A;  4DZ6 A;  5CYM A;  2KTQ A;  3ENV A;  1RAI B;  2VJU A;  2DNH A;  4DL7 A;  5B7W A;  2QV6 A;  2MKC A;  3GSD A;  2BM0 A;  4I69 A;  1RKJ A;  1DLO B;  4I6A A;  2EXU A;  4FVM A;  4DSL A;  3GJR B;  5FLX Y;  4KPC A;  1VRU B;  1IJE B;  2HGM A;  3IN5 A;  2W1B A;  3KLH B;  5GMK a;  4NRU A;  2NXU A;  2MKY A;  3BGF A;  2CQC A;  5AXK A;  4DL0 C;  4KQZ A;  2QT7 A;  4UOC A;  1RSC A;  3QGG A;  1VHI A;  5FJ4 A;  4I2Q A;  4O4R A;  4B9S A;  4K4S A;  2YY3 A;  4ETX A;  2ZH8 A;  2MZ1 A;  3VF0 B;  4BBY A;  3QIP A;  1P8G A;  4I6W A;  3C6T A;  3DYA B;  2ZJP Q;  2DPI A;  4DQI A;  1H2U X;  3TZX A;  2ZBQ A;  2FZK B;  3GCW P;  2FGC A;  2EBG A;  4FKY A;  4RW7 B;  3M30 B;  2KM8 C;  5J2Q B;  5F0U A;  2CDR B;  4HH1 A;  1W25 A;  4CLK A;  4LF4 J;  4R25 A;  5CXT A;  1Q7L B;  1S10 A;  5JMN A;  4WIQ A;  4ZCL A;  4F4Z A;  1OSD A;  4IKA A;  3AJD A;  1O8B A;  1ZYQ A;  3OD2 A;  1U1R A;  3UNG C;  4RL1 A;  3GYG A;  4EK2 A;  2BV3 A;  1YQH A;  4QWB A;  1S1U B;  4LSL A;  2CG8 A;  3ULH A;  2HKE A;  3LP2 A;  3ZTQ A;  3SXL A;  2LXF A;  4JI5 J;  1VQ7 S;  4NA1 A;  2JWN A;  3T1H J;  3O8W A;  1AYE A;  2FHM A;  4NXM F;  2EFN A;  4JI4 J;  4NRT A;  1UEK A;  2FVC A;  1Z4U A;  3MTJ A;  3UR3 C;  3KFW X;  2HNY B;  3C6U A;  2XBP A;  2G13 A;  1M1K T;  2H5J B;  3ILO A;  1H38 A;  4NYO A;  2NS1 B;  2DGW A;  3MAA B;  1KHV A;  4UT4 A;  4NLR A;  2IM0 A;  2BUN A;  3JAM Y;  2A0F B;  1YRT A;  5KFA A;  1VRU A;  2QA4 S;  5E3R A;  4ES2 A;  1HAR A;  2V94 A;  3AA9 A;  3KLH A;  2IM1 A;  1MN9 A;  2DO0 A;  4RUB A;  2ZKU A;  2JEJ A;  2ZZM A;  3BYR A;  1NJZ A;  2GVZ B;  1VBK A;  3I5A A;  5J1E A;  1RAJ A;  2RQM A;  5D0H A;  1IN0 A;  3N0V A;  1RAH B;  2V8H A;  3G9C A;  4JV2 A;  4DPU A;  3GFY A;  2A1B A;  4P73 A;  3BQ2 A;  3C46 A;  2HG4 A;  1NME B;  1WG1 A;  4ZPB A;  3UCG A;  4CIO A;  1KWM A;  2MXY A;  3SQO P;  3DYA A;  2ZBP A;  3L3C A;  1C4A A;  3PIO Q;  2YKQ A;  4PG8 A;  4RW7 A;  3ZZT A;  1S0M A;  3SYZ A;  3DLH A;  3M30 A;  5J2Q A;  2UV8 G;  1SC4 B;  1KOH A;  3K8V A;  2KH9 A;  3KJF B;  4FYV B;  4CP5 A;  4F0H A;  2K8G A;  2DGV A;  2M4M A;  2FC8 A;  3QFH A;  1S6P A;  1X0F A;  5B0A A;  3KJV B;  3KLE B;  5M2U A;  2Y8Y A;  4A8W A;  3PHT A;  1HR0 J;  1FWK A;  3GJS B;  5KFU A;  5SUH A;  2HLT A;  1UET A;  4TLR A;  5DLF A;  1HWU A;  1H7W A;  3BF4 A;  5CH7 B;  4DV5 J;  3RB3 A;  1S1U A;  2Q6B A;  2O01 C;  2KFY A;  1HBN B;  3UW1 A;  4OHZ A;  2R9L A;  2WK4 A;  3T1Y J;  1H0H B;  2XI3 A;  1V3S A;  4C8M A;  1RKI A;  3W63 A;  2B7B B;  4MIA A;  4OI3 A;  2M3D A;  4U8V A;  1WEL A;  5KFT A;  3BSC A;  2QEX S;  2DKO B;  2HNY A;  4QYZ J;  1EKS A;  3PY8 A;  3L95 X;  3SBM A;  2DCU B;  4BC9 A;  3CMA S;  4DR5 F;  2R8H A;  5A8W A;  4U67 Q;  1NJW A;  2IJN A;  1YSJ A;  3D9B A;  3CCZ A;  4DV2 F;  4JYA J;  2CNO B;  3H5Y A;  3MAA A;  2M52 A;  3GP9 A;  1DFD A;  3HHN B;  1U7L A;  3LWL A;  2HFU A;  1TTH B;  2D41 A;  2HQF A;  4ED5 A;  1BLU A;  2WVC A;  4WXO A;  3G96 A;  3S01 A;  2AGO A;  2DNK A;  2HNZ B;  1LK5 A;  4O3O A;  2GVZ A;  3O44 A;  3I0R A;  4FF3 A;  4NLV A;  3CED A;  2XC9 A;  1IVZ A;  3G8S A;  3GYX B;  3K2Y A;  4JI0 F;  4FYX B;  1X4D A;  2LYV A;  5T7L A;  1YIT S;  2W2P P;  2AJ4 A;  1F5A A;  3JB9 k;  3SCI E;  3K8W A;  3ISZ A;  1NAQ A;  4EUV A;  5KFR A;  2HFO A;  4F8R A;  1NSP A;  3VAH A;  4HDG A;  4CO2 A;  5EHH A;  3BSN A;  2WSE C;  2CKW A;  2W7O A;  3W5Y A;  3PW7 A;  3KWM A;  2D3U A;  1BGX T;  4TYA A;  2YH1 A;  1HPZ A;  5ETS A;  5KFP A;  3C3L A;  4WFY A;  3KG0 A;  4AXJ A;  2YWW A;  3IXQ A;  4IFY B;  3G4S S;  2NYI A;  3DKD A;  3KJV A;  3JTN A;  2R7R A;  5JJB A;  3KLE A;  3VHQ A;  2VQE F;  2XS2 A;  4IYQ A;  4Y6I A;  1YIJ S;  3WZ0 A;  1FX4 A;  2YNG B;  3TQE A;  5GVQ A;  2VH7 A;  1T9U A;  3CCJ S;  4NXN J;  5KG6 A;  1APS A;  4XTT A;  1EP4 A;  2DNN A;  5DZ7 A;  1HBN A;  2KO1 A;  2VQF F;  4KJI A;  4CQ1 A;  4YR2 A;  1RWM B;  2V34 A;  4CNY A;  3RJM B;  1NH7 A;  2FGO A;  1AT1 B;  2J7U A;  4RU2 A;  1S9G B;  2DNY A;  2EG2 A;  5H9E J;  1LXJ A;  2CPD A;  3OT9 A;  4Z2X A;  1U6B A;  2J9D E;  2R4F A;  4GRS A;  1WC4 A;  3U02 A;  1I5O B;  3JS9 A;  2AT1 B;  5F3T A;  2CQI A;  3FRY A;  5HAT A;  2UXC F;  3WHI A;  2F63 A;  5C42 B;  1FJC A;  4DFK A;  2RT3 A;  3H2U B;  3ENA A;  3QAU A;  5K8O A;  3MDF A;  3A13 A;  4MKY A;  2XWY A;  2GW8 A;  4USK A;  2Z57 B;  4WKR A;  4CH7 A;  2HNZ A;  1VQK S;  3I5C A;  3RBE A;  2IDL A;  2AHO B;  4OIX A;  4MMO A;  1SL1 A;  3G6X A;  4B17 A;  1WUU A;  1XNQ J;  3FK4 A;  2LEC A;  4C2M A;  5L1J A;  2X7I A;  4HVZ A;  1R0C B;  1SBR A;  3T19 A;  1OSC A;  4O3P A;  2B9X A;  1VQ6 S;  2J9C A;  4KGK A;  3GYN A;  1TKX A;  3DHW C;  4DL5 A;  2KZM A;  1AFI A;  4KHP F;  2VZ9 A;  3BM7 A;  3PEJ A;  3BPD A;  1VCT A;  2FHK A;  1JWW A;  4UST A;  2IVF B;  3TI0 A;  3NL0 A;  4GVL A;  3FBB A;  4LFA F;  4OZ1 A;  4IFY A;  5D77 A;  4CLL A;  3AA8 A;  1YHQ S;  3DLG B;  5H9E K;  4HHU A;  3T41 A;  4TYB A;  4O0I A;  1DZ5 A;  2YNG A;  1TUW A;  3IO1 A;  5LJ5 Y;  1KQS R;  3EUN A;  1CS4 B;  3I32 A;  2MDA A;  3B78 A;  4I6Y A;  4TVA B;  3DFE A;  1R0B G;  3CCR S;  3PW2 A;  2C2M B;  1N56 A;  5CD4 A;  4ZVH A;  3D3B J;  2HQC A;  1R43 A;  1TU0 B;  4C8N A;  4LVN P;  1RTZ A;  4RW6 B;  3VGS A;  3NBP B;  1S9G A;  2GJI A;  3PTW A;  1JB0 C;  1DUR A;  3DOM B;  2ZM6 J;  4Q0B A;  2B56 A;  2DGU A;  3N6L A;  5ETQ A;  2L9D A;  2CZ9 A;  4ES3 A;  4ZVG A;  3ZZY A;  3M05 A;  2IHR 1;  1M5P C;  3ZTP A;  1RWX B;  1SB6 A;  3IBW A;  3EE3 A;  1S7I A;  3IRX B;  2FVQ A;  4UOF A;  5HAN A;  5C42 A;  1WI6 A;  3QBC A;  1PGZ A;  3NCP A;  4J9U E;  1HBU B;  4ZCK A;  2ZZN A;  2X51 A;  3EVO A;  3DXS X;  1NHK L;  3NGS A;  3S7R A;  4IOC Q;  3BKT A;  4KSE B;  4FXV A;  4GMK A;  1RAE B;  3TRG A;  2D69 A;  3R2C J;  2JNJ A;  3KJQ B;  3M6X A;  2VIH A;  2VA2 A;  4J90 A;  4J9K A;  4DV1 J;  5KTQ A;  4Q44 A;  1RHQ B;  1FT8 A;  4ZVS B;  3Q24 A;  5BJR A;  3CJ2 A;  1NUE A;  3IP0 A;  2DNZ A;  2FIU A;  1KQF B;  4Y34 A;  2RE1 A;  2MGZ B;  3WC0 A;  3DRS B;  4NLD A;  5ETP A;  2ADB A;  3PYG A;  2V4J B;  3MM8 B;  3DLG A;  2KG0 A;  3NOC A;  3R5J B;  2DHH A;  4DV4 F;  2LLZ A;  4LIR A;  1MLA A;  3G82 B; 
#chains in the Genus database with same CATH homology
 3GPA A;  3Q8V A;  2HUR A;  3R9L A;  3FBB A;  3DDI A;  4C6A A;  2DXD A;  3EVO A;  1NHK L;  3FC9 A;  4O0N A;  3NGS A;  4KPC A;  3JS9 A;  2BEF A;  1HLW A;  4EK2 A;  3BBC A;  4HR2 A;  3PRV A;  3EVW A;  3MPD A;  1NDL A;  2ZUA A;  1NSP A;  3PJ9 A;  5BXI A;  4UOH A;  2DY9 A;  3B6B A;  1UCN A;  3NGT A;  1PAE X;  2BX6 A;  4S0M A;  4F36 A;  3ZTQ A;  5C7P A;  3ZTS A;  5IOL A;  3NGU A;  1B4S A;  3FCW A;  1JXV A;  3ENA A;  1NDK A;  3VGT A;  1NB2 A;  1NSK L;  2AZ1 A;  1S5Z A;  3FCV A;  4DUT A;  1K44 A;  4FKX A;  3EIC A;  2NCK L;  4ANE A;  3FBF A;  3BBB A;  1LWX A;  2B8Q A;  1NLK L;  3VGU A;  3DKD A;  3VVU A;  2HVE A;  1XQI A;  1BE4 A;  3ELH A;  3Q83 A;  4ENO A;  3BH7 B;  3B54 A;  1XIQ A;  1EHW A;  4W98 A;  4CP5 A;  2DXE A;  3EVM A;  3GP9 A;  1WKJ A;  3BBF A;  3NGR A;  1HHQ A;  1PKU A;  4UOG A;  3L7U A;  3EM1 A;  1NCL A;  1BHN A;  4FKY A;  4F4A A;  1F6T A;  1NUE A;  5CAA A;  1MN7 A;  4DI6 A;  3VGS A;  2DXF A;  1NSQ A;  3WX8 A;  3G2X A;  1LEO A;  3VGV A;  1VYA A;  2HVD A;  3Q8Y A;  1S57 A;  3ZTR A;  1HIY A;  3Q8U A;  3Q86 A;  1NPK A;  1F3F A;  1S59 A;  2AZ3 A;  3VVT A;  2DYA A;  1KDN A;  1WKL A;  4DZ6 A;  1NDC A;  1ZS6 A;  3ZTP A;  3EE3 A;  3EMT A;  2CWK A;  3FBC A;  3Q89 A;  1BUX A;  4WBF A;  1MN9 A;  1W7W A;  4UOF A;  4AND A;  4ANC A;  1B99 A;  3BH6 B;  3EJM A;  2VU5 A;  1NDP A;  1WKK A;  1U8W A;  2B8P A;  3ETM A;  3FBE A;  3FKB A;  3ZTO A;  5CAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...