3B54A

Saccharomyces cerevisiae nucleoside diphosphate kinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
152
structure length
145
Chain Sequence
b'SSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structure of Ynk1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 38
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3b54A00
3MPDA 4W98A 3FBFA 1HLWA 3Q8YA 1LEOA 2DY9A 4DUTA 3VGTA 1NDLA 1KDNA 1XQIA 5IOLA 2VU5A 3EE3A 3ELHA 4FKXA 3B6BA 4DI6A 1BE4A 2HVEA 3FBBA 3FKBA 3VVTA 2AZ3A 3VGVA 1PAEX 3FC9A 3Q83A 3GP9A 3ZTOA 3R9LA 4F4AA 4ANDA 2AZ1A 3FBEA 2HVDA 1U8WA 1NCLA 3L7UA 2DXDA 4WBFA 2BX6A 3EMTA 4KPCA 4O0NA 3Q86A 3BBFA 3EM1A 2ZUAA 4ENOA 1NB2A 3ETMA 3GPAA 3Q89A 1B4SA 2DXFA 2DXEA 3NGRA 3EICA 4ANCA 4UOHA 5BXIA 1F3FA 3Q8VA 3G2XA 1S57A 3EVOA 4C6AA 5CABA 1EHWA 1S59A 3NGTA 3PRVA 3JS9A 4FKYA 1HHQA 1F6TA 1LWXA 4CP5A 1NDKA 1BUXA 1NDPA 3WX8A 1NDCA 4DZ6A 2NCKL 1UCNA 1S5ZA 1NHKL 1NSPA 1VYAA 1WKJA 1WKKA 2HURA 1WKLA 3EVMA 2BEFA 2DYAA 5C7PA 1MN9A 3FBCA 3DKDA 1B99A 3BH6B 1HIYA 3BBBA 3NGUA 4S0MA 1NUEA 1JXVA 1NSQA 3ZTPA 1XIQA 3ZTQA 4UOGA 2B8PA 5CAAA 3EJMA 3EVWA 2CWKA 3VVUA 4UOFA 3ENAA 4ANEA 4HR2A 3VGSA 4F36A 1NSKL 3VGUA 2B8QA 3FCWA 3NGSA 1NLKL 1K44A 3DDIA 1MN7A 3ZTSA 3B54A 1NPKA 3BBCA 3FCVA 1PKUA 3Q8UA 3BH7B 3PJ9A 3ZTRA 4EK2A 1W7WA 1BHNA 1ZS6A
chains in the Genus database with same CATH superfamily
4DV5J 3Q8YA 2KVIA 2VQEF 1JXLA 1DHMA 4K4TA 1FDNA 2FZGB 3J7YI 1G3OA 3RW7A 2HK3A 1W2BR 4A8YA 4H4KA 2AWZA 1VQ7S 3FZBA 2BJ9A 2DNZA 4KYZA 4C4WA 3LPEA 3PVXA 3HFVA 3W5ZA 4K8RA 2OPQA 3GFXA 1YQHA 3I32A 2HHHF 3AB2B 3X3UA 5CA5A 1CULA 1ZPVA 4OZNA 2AEMA 4ZVGA 4J9RA 2FGCA 2RAQA 3M8YA 2DGQA 2GO8A 1SL0A 1RHUB 3CC7S 1OJ4A 3IMQJ 3TVKA 2DNNA 1NHVA 3QFHA 4Y2IA 2Y0SD 3UN2A 1MMLA 3C8YA 3ZZTA 3QZ8A 2VFTA 4OZLA 1WF0A 1IVZA 1FNMA 3U1LA 3N0VA 3MM6A 3PKYA 4NMXA 3DNCA 2LVWA 2NXJA 1AROP 4KGMA 1VRUA 5CH7B 4KHRA 1QUVA 5KFXA 4LF5J 1RTJA 4DV5F 2GJFA 2IJFA 4ENOA 1JKHB 1KTVA 2CVEA 2HIQA 5BXIA 3Q8QB 2D74B 2WSFC 4C48A 4MTPA 3E2EA 4C8ZA 1Q16B 1I51B 5EGYA 3UDVA 2CFXA 3MM5A 4KE5A 1KHWA 1F9EB 2QT7A 1MROB 2ACYA 4A8WA 3A13A 5DGBA 2ZJRQ 2RDDA 4CI0B 4BDPA 5KG4A 5GMKa 4EBCA 3QWPA 5IZHA 1CJVA 4TLRA 2BYCA 1RLDA 3A3PB 4CLSA 2H65B 4PYDA 2BZ2A 2MXYA 4RNHA 2NXEA 1U09A 4QCLA 3MZIA 4U8YA 5I42A 2OP5A 5KFRA 3QT7A 1NBEB 1UW4A 4R0EA 3L7OA 3J80Y 1RUSA 4DUTA 3M1VB 4OLOA 3BPSP 1JLEA 5F0UA 2EEYA 3I4HX 2MGZB 4ID5B 2GZOA 4LSZB 1TELA 2HVDA 5IXUA 4RUBA 3DRYA 2LU2A 4DQPA 2J6TA 3MM7A 3H8YA 1SL2A 2HLTA 1BLUA 5E3QA 3FEXB 4LF5F 2EXUA 3PIPQ 2GQCA 4NASA 3D1OA 1Q81T 4ER8A 2I38A 2UV8G 4BC7A 5KAKA 4K4SA 5D3GA 4CH1A 4EYHB 2QSFA 3BH6B 4DQIA 5CZXA 4KY3A 3EZ5A 3TVZA 2J8SA 2UXCF 4MFBA 4C3MA 4DSLA 1Q95G 4B3OB 3D3CJ 3NLCA 6FDRA 1S1VB 3DCAA 2W9BB 3QGPA 2ZUGA 1TKZB 1PJ7A 4OYBA 4X64F 2N3OA 2XHWA 1BD6A 1TR0A 1IN0A 2HHXA 4HI2A 2M5YA 2K1RA 9ATCB 3AODA 1SI9A 5J2PB 3BKFA 2JVOA 4IG3B 3OFHA 1VK8A 4O3SA 4NLOA 2C2MB 4ALZA 4CT9A 3MAHA 4ERDA 2V34A 4MK7A 3KMQA 5G4DA 3H4BA 4N7TA 1U49A 4ECQA 3OPKA 1T7PA 3I5AA 3GB0A 3CWJA 2BV3A 1JLFA 1YJUA 4ECWA 1YBUA 2R8HA 4ZP8A 1ROFA 4IR1A 3BQ2A 1PO6A 5E2QA 2MZSA 2IVFB 1UTAA 2BKPA 2Q6CA 4L72B 3HSDA 2NQPA 5A6PA 3OXLA 1NZAA 2F65A 1OSCA 3UD3P 2VC0A 2Y1RI 3MEEA 2F1FA 2P2CB 3ONQA 5HQLA 1JNRB 1I1GA 3ISZA 1M5HA 1GTHA 4R5PB 1AW0A 3AJ2A 3MTJA 5D0RA 3BDEA 4Y2AA 3EGWB 2FUG9 2M8DB 1O51A 5AXNA 2HLUA 4QW8A 5IWAF 3HFZB 3QZ7A 5DG7A 2PFDA 1U8WA 1PSDA 2L08A 3F56A 1U47A 3D28A 4J9MA 4OJGA 1WSRA 5LSRA 4WP9A 4FBTA 3T5KA 3FSIA 2W4CA 2LXIA 3GYXB 3V5RA 1F6TA 4YB5A 1KR4A 1TUVA 2HS4A 2KRBA 4PWUA 3FVYA 2PD1A 3BV8A 1NJZA 1JLGB 1VQ5S 2KFZA 1X9MA 3ZC4A 3V6DB 2W8LA 4PQAA 3ZTQA 4JI3J 3QRQA 2B51A 4B3TJ 4WTOB 2KDOA 1HBMB 2E44A 1U02A 1TKXB 3Q8PB 1UZDA 3FCWA 2IVMA 1UETA 2F9JA 3GONA 2G4BA 3BH7B 5HL7Q 4WFNQ 3LP0B 2LXUA 3K0JA 3M8ZA 4F0MA 3VR1A 2G0JA 2RVJA 3KJQB 3DM2B 4CLTA 3OTCA 2AYMA 2Z30B 1JIHA 2XZTB 2V8HA 3ENWA 1YBAA 2R7TA 4FXVA 2ZITA 1CC8A 2MQMA 2JOQA 3ENVA 4QR1A 3Q2SC 1WACA 2GHPA 1LWEB 4KRWA 1FKAF 5B0AA 5LSOA 3C16A 1EHWA 1S1WA 3CCVS 4G3IA 1DTTA 4ZA1A 2QYGA 3D4JA 1M5VC 3BN4A 1FK9A 2U1AA 1L3SA 3CB4A 5K14A 4WPAA 4W90B 2OPPA 4B3SJ 2VBXA 4X65J 4PXCA 1X0PA 3G82B 2B5JB 2R8KA 2ZBIA 3DI6A 2E7WA 3NGKA 4KO0A 2UUBJ 2C2DA 3FCHA 3KHHA 4ETXA 3J7YU 1JMTA 4OX9J 3BGRB 1T05B 5D0EA 2VBYA 3PX0A 1L3TA 4B9MA 1FT8A 2RB7A 2VPZB 4ED8A 1OPZA 1IKWA 4JI3F 5D0HA 4B3TF 4DR4J 4A8OA 3FFIB 4ZIWA 1NPPA 2AU0A 1TKTB 1U0HB 4DR5F 1NK7A 2RD5C 2X1AA 1YHQS 4WFBQ 4D3HA 1VS3A 4YHHF 2AKWB 2Y1JA 2FJWA 2OGUA 2EFOA 4NLRA 2BKNA 5C42A 1S0MA 4LRDA 3QO9B 2AP6A 1P9YA 2B56A 4FVCA 2Q6BA 2CWXA 1GFWB 2BW2A 1JX4A 2Q3PA 2ZC3A 4CTAA 1KTQA 2HW3A 4OX7A 1HI0P 1CJKB 1ZH5A 2Y3YA 4EEYA 4ILRA 3CVKA 3DKDA 1HPZB 5CHCB 1DTQA 1VC0A 2R2TA 1IBMJ 4ZVHA 4RW8B 2UXBJ 1FERA 1WWHA 4QR2A 4B3SF 1CS4A 2FVQA 2RDIA 1YTYA 8ATCB 2C3PA 3ZTRA 3PNIA 1R6YA 3BQ1A 3I6PA 1HBUB 2AX1A 4NRUA 1C1CA 4K50A 2UUBF 1CVJA 3F44A 1VQ4S 3ZZRA 2CVIA 1SJ4P 1RAEB 3DMJB 1RAIB 4OX9F 4XAKA 2BJ7A 1RT7B 4DPXA 3JSRA 3A8IA 2MHNA 2HG4A 2PEBA 1H72C 3GJTB 4DPOA 1AXQA 4DR4F 3RG6A 3HVAA 3LP2B 4PG6A 5IQQA 3GCWP 4UTGA 2Z4PA 5KFKA 2O01C 1SQFA 3H5UA 1VQYA 4QIWD 1WTBA 4ED7A 2DGSA 1WORA 3JSYA 3U27A 2B4PA 2CJAA 4USWA 5KFPA 1GXLA 5SZTA 3MD3A 4ZVOB 4TU7A 5BYQA 1J5OB 3BR9A 5E41A 1VIOA 3Q24A 4DF8A 4FXDA 3BEGB 4DR7F 3C14A 3IBFB 2PC6A 4E2FB 2FC9A 4KC5A 3VGSA 3VF0B 3DDIA 2HBQB 1M5KC 5KFFA 4DQRA 4P7TA 1WC1A 2GHWA 2YWWA 1IBMF 4PQUB 1HNWJ 3FBBA 2QSWA 3KLIB 1U6FA 1TL3B 1WG4A 3FBEA 3PDNA 1D8ZA 3MUMP 4Y2KA 4CLLA 2A18A 2NLWA 4RO0A 1UJ6A 3P49B 3D9BA 3IM8A 3I0SB 3QBCA 2IY5B 2XTJP 3N5BA 1BGXT 4B3MJ 3R5JB 1NRKA 1OQ6A 2GQ2A 1HWUA 3GV5B 2VIHA 5L1LA 2E5IA 4JI5F 1NDCA 3DGPB 2MKJA 4USMA 4G65A 2PGCA 4YDDB 5KFYA 3Q8SB 2HHTA 4URSA 3T3FA 2F9DA 2XMMA 1KQGB 4YFUA 1MWYA 1RTIA 2R7UA 1NH7A 3DOKB 2EC0A 4F3QA 5JMNA 5A8RB 3KK1B 2J7UA 2VOOA 3W5YA 3T1AA 1OIAA 2L9NA 1XEZA 1X5TA 2VFUA 3VGTA 3N28A 3QSIA 5KFOA 4K0KJ 2VU5A 5JXSA 2IBKA 2X1FA 4FF4A 3UR0A 4D3GA 2VG5B 3PG9A 2CPIA 4K59A 4UZCA 3HZEA 2ZNYA 2HGLA 2EBEA 4BS2A 5DDPC 1SB6A 2H3EB 5IV4A 1KFSA 1HNWF 5HVGA 3CD7A 1OPIA 3M2VB 2RILA 3BM7A 2XCAA 3E3XA 2MQNA 2Y9HA 3JS9A 3R5CA 4IQXA 3VCDA 4QWBA 1HBNB 2VFVA 1IKXA 5KFQA 3V2UC 2XS2A 3H0PA 5A8KA 1HL6A 1XNQJ 1FWKA 1J27A 3KDOA 2KJVA 3BBBA 3UD5A 3RB0A 3BGOP 1NKEA 2J8AA 4R8UA 1L3KA 4GO7X 4AXJA 3V4MA 1VGYA 5KG2A 4C3LA 1RWWB 1L3VA 3DOLB 4IO1A 1KSPA 2DNHA 3AY0A 4CDIA 2E9RX 5KFBA 3K2YA 4DFPA 4Q2MA 2FJDB 4URQU 4ZPTR 3EGVA 1GT8A 2ZFHA 4IG0B 2WONA 3JQJA 2DHXA 1QTMA 2NSCA 1UFLA 3OXFA 4OZ5A 3M2UA 3LW5C 1LOUA 2MJUA 1HNIB 4OHZA 2BR0A 5HSPA 2ZE2A 1CJUB 3KUEA 5LL6d 3HJFA 2ZH9A 4OYPA 1TP7A 3F41A 4F8RA 2FLNA 4OV1A 4J9UE 1LK7A 3V81B 2CJQA 4P52A 1S1UB 4DSFA 4NLVA 5KFIA 4H4MB 2BM0A 3FGVA 2LDYA 2P9EA 2KHCA 2XI2A 1QVFR 1RT1B 1JJ2R 4JP8A 2JRSA 2FDNA 3T5JA 1FKOB 3NKYA 3PYGA 5A0YA 2BVZA 4P72A 4YY3J 1XTZA 4IR9A 2QLBB 1HWIA 2MQQA 2Q43A 1QAIA 2ZHBA 5HP1A 5KFAA 5KFTA 1KLMA 3GSDA 2QA1A 4LSNB 6AT1B 4OHXA 2GMJA 3Q86A 2ZUAA 1PAUB 2NR0A 3IG1B 2CPFA 2WVDA 2NUUG 4K2XA 4CLYA 2NS1B 1SKRA 3NGTA 5THWA 3WC2A 2NREA 3W60A 2XLJA 3HHNB 4OX8A 3FSYA 2BDPA 1TV6B 2XMUA 2RKIB 1FEEA 4CH7A 4LR9A 1UVIA 3L09A 1X60A 2H5JB 1UA1A 3DLGB 1N5YB 1FVQA 2H54B 2MY7A 2VODA 4RX6A 3EJMA 1V3ZA 2JSXA 1YIJS 3HD2A 3SCIE 2YKOA 3MUTP 5DJBA 2EI5A 3RU0A 4IFVA 3IRWP 4PWWA 2DHGA 2NXCA 1U45A 1FE0A 1IBLF 5K8PA 2OEKA 2KI2A 1ZM3A 3SV3A 2HRTA 1R31A 1FESA 4LF7J 2KO1A 4WTYA 1VK3A 2DY1A 1BWVA 4QIFA 1RK8A 2I6WA 4Z2XA 4YY3F 4J9NA 5LXYA 1DLOA 3ZXWA 2COLA 3T6BA 3H7HB 3DHWC 1WI8A 2WVFA 3PXGa 3U1NA 4DQSA 3W9JA 3GLJA 3G8QA 2J9CA 3QLHB 1N88A 4RW7B 3TZYA 5DG8A 4RW6A 1XN9A 1WKLA 5ETPA 1S12A 5HMYA 4F2RA 3A12A 1S99A 1HIYA 5E3AA 4NLUA 2VQFJ 1QAJA 5J2QA 2FPHX 1RWMB 1DZ5A 2DGUA 1N33J 3V6JA 4NZ7A 1QTNB 2V5HG 1SJQA 3DYAA 7FD1A 3QMQA 3LGMA 2FB0A 2W1BA 4JI8J 2HHUA 2VBWA 3D0IE 1V3RA 2DKOB 2CNNB 1A0OB 3VWSA 3FKBA 2XCPA 3HHLA 5DZ6A 4RNMA 4DV2J 3RR8A 3KLEA 4NEYA 2B4OA 3RTVA 1U1RA 1N54B 1NMEB 1S6PA 1RISA 4B9LA 3C15B 4DJBA 3GPAA 5C24B 4M5JA 4YN3B 2C28A 1N36F 1T9VA 1N0VC 4ECXA 3THVA 4LF7F 4V19X 1S48A 3AA9A 3NS7B 3S01A 3GTYX 1X5OA 2NYHA 5H9FK 4HHHA 1MN9A 1R89A 3IWXA 1VOMA 2KXFA 3KG1A 1WUUA 5DDRC 4WK1A 3ZZZA 2J6SA 2V6AA 3BKUA 3N9UC 4WP8A 2GVZB 2IRUA 4ICLB 3A8EA 2ZH3A 4DU8A 3K59A 5HBMB 2QZ8A 3FCVA 2ZZNA 4L76A 2AW0A 5HROB 1ZS6A 3OHBA 4CLPA 3NCQA 2VQFF 1YWXA 4Y2CA 2V4JB 1N33F 1E6VB 2QO3A 2N82B 3MXHP 2J6UA 5L8RC 2W01A 1S1XB 2BJ3A 2KRRA 2QA4S 2YX4A 3OXGA 3ITHA 3TO8A 3M9NB 3GV8B 4JI8F 1WF1A 4DHVA 1YRUA 3MMCA 3VAGA 1T03A 2AT1B 3I0RA 5FLXU 4H4OA 5B0EA 2MZ1A 2D3UA 2HQIA 4ZLJA 4DV2F 2BE2A 3KJVA 1U6ZA 4UQGA 2O5DA 1VI7A 3MECA 3M8PA 1LNQA 2XMVA 4CNZA 2PIIA 4ES1A 1ZETA 2XNQA 1N34F 4OI1A 2EBGA 5F8JA 3OFEA 1RT6A 5CCMA 4GO5X 4WXOA 1QAXA 3SCJE 3HULA 2ZC4A 2DGVA 3D68A 4NL5A 5BR8J 2BXJA 1Z4UA 2RMLA 2ZKTA 1IKVB 4I56A 4ETZA 1S1TA 4YP3A 1M1HA 1U7LA 3I4PA 1WHVA 4FYVB 4A8KA 2DNLA 2Y0BB 2LU1A 2YH0A 3HVTB 2M0GB 3JB9k 3SCKE 1SIZA 2H5EA 2YKMB 2VZ9A 4MJKA 1LK5A 3TZWA 1UEVA 3FJ2A 2WBMA 4MK8A 2MPUA 2MKSA 1S59A 2SXLA 1PILA 2XC9A 5ETVA 4I68A 4ZKAA 2CQPA 1V3SA 4ECZA 5AT1B 2G0CA 3A8KA 3A1YG 1YKWA 3KNGA 2J5AA 4HH1A 1S77D 4OYAA 4P2XA 1XR6A 2YX7A 3BZQA 1ACMB 1ZM2A 2ZBPA 2GVDB 1M90T 1WHXA 2ADCA 3FQLA 3SV4A 4JV2A 3OSNA 3HPOA 1EP4B 1BQMA 1WG5A 2LXFA 1BHNA 1LV5A 2CJXB 1C4AA 3LAKA 4WJBA 4CM0A 3CC4S 5BR8F 3HSGA 3PFEA 3UCUP 2AMCB 1FX2A 5IT9U 3CJ2A 2MKIA 2DXDA 3TANA 1J2VA 4ATNA 5ETMA 4HL9A 4L73A 5K5MA 1W25A 3D1HA 1Q53A 2XYGB 2XS5A 1T0TV 3G87A 3HP6A 4PG4A 3DOMA 4ED6A 3R6GB 4JB8B 2AD9A 2GGPA 3V6HA 2OPQB 3IWLA 4B9VA 1HBOA 1UFKA 5J1EA 3JTOA 1CULB 1LWXA 3C2PA 3PW7A 4P7VA 3G4SS 4UT4A 2W2PP 4CLFA 1BY9A 3P96A 4O44B 2FVRA 4XPCA 1RTDA 1V6HA 3IS9A 4P75A 5AXLA 2BUNA 2P9CA 2MB0B 4A4JA 4B9TA 4RUAA 5L1IA 1Y0HA 2QC3A 3Q8UA 1HD0A 4QJVA 4KBIA 2XO6A 2OKQA 4C3KA 4OI2A 3H2LA 3NOCA 4RR5A 1BE4A 2FJXA 3OW2R 2UXDF 4F4AA 4JI0J 3CCUS 1N6QB 4FYXB 1VRUB 1TL4A 1YG0A 2JH3A 1S9GA 1RTJB 3HD1A 3J80U 4UOHA 1TL7B 2AF6A 3D1QA 4KFBA 4A8FA 4O23A 4J91A 4MIWA 4F3MA 2HS3A 2K8GA 4H4KC 1C1BB 5CYQA 4NWBA 5KT4A 4RBUA 1B0VA 2A10A 3EVMA 2L9DA 2K3IA 2DRDA 1UPPA 3B4MA 3W8GA 2RUSA 5KT5A 1RU2A 1WOOA 1C0TA 3CMQA 2UP1A 2AQ4A 4GKJJ 2R3VA 1CJVB 4DDFA 1RKJA 4LF8J 1WC4A 2EFVA 2V0NA 3DXSX 1S97A 3CCES 1YZ6A 1L3UA 5I42B 4QW9A 1UFWA 2KT5A 2KN4A 2BACA 4M5MA 1AYEA 1M0SA 2KTQA 4X84A 4DSIA 3EDQB 1JLEB 1YBTA 4H54A 3RW6A 2R7QA 4ZVSB 5ETNA 1VBKA 1SBRA 2ZNZA 2BW7A 2BJ8A 1Q86T 1LW0A 3T9ZA 4O0IA 4LR7A 3MEKA 1X8DA 1UZHA 2H5IB 5HQ8A 1VJQA 4JI0F 3MM7B 1R0AA 1OYEA 4PPDA 3EXYA 4K4XA 4PG7A 4M5IA 2MZTA 4RPFA 3KLVA 3CD5A 2VV5A 2EW9A 4WYWA 2ZH5A 1X4AA 4OYIA 3H90A 1RLCL 3BO4A 2DTJA 1NK8A 2VA2A 4UOCA 5D3GB 4EUVA 4NI2A 4UOGA 3LP1A 3LF0A 2CXEA 2KJWA 2DR6A 5DS7A 4MFBB 4QPTA 4XO0A 1ZZNA 2QMWA 2DCUB 3R3TA 2V67A 1N5VA 4GKJF 3HHKA 2NXNA 3MPUB 3KUHA 1NU4A 4LF8F 1NK0A 4M95A 4HACA 4ZP9A 4RUCA 3GFZA 3L3CA 1QUPA 1HD1A 5I3QA 3G9CA 3P5TL 4IRKA 2RE1A 3QJJA 3MR7A 5HLFA 3DRPA 4AL6A 2AGQA 2XEXA 5F3ZA 1X4EA 4NYPA 1D8YA 3EICA 2IC3B 4X4VA 1WEYA 1YJ7A 2MZRA 4O4RA 4LMZA 2E9TA 1BQXA 2HFOA 1FJCA 3VV2B 3BF4A 4O3PA 4K7QA 4RKUC 4C8LA 1CLFA 2JEGA 3PKMA 1RQ0A 3AJ1A 2C3OA 1Q8KA 4NLYA 1WKKA 2HMIA 5HQMA 5KFWA 4ELUA 4C8OA 1PYTA 3D0GE 1LQ9A 1W2IA 2J9EA 4N5SA 1FJGF 4UW2A 2F40A 2DVIA 3IWNC 3MEEB 3GSIA 4B17A 4ECUA 3QGIA 3UNGC 1QSYA 3OL6A 3QPIA 1JLBA 4OZ1A 1CG2A 1CQMA 3W63A 1FWLA 3MUVP 2Y8WA 3HF5A 2J9DA 1CJTA 1UWBB 4C11B 4CO2A 2LP4A 4Y65A 3MCOA 2VPWB 4ES2A 1S10A 2AX0A 4TLQA 4OHYA 5B0FA 3RBEA 4ECRA 1GMUA 4L75A 2AJQA 3I82A 2XSJA 1C0UA 4N56A 3E8OA 2ZHAA 5ETQA 4PWDA 2AEJA 2YVSA 8RUCA 3H25A 3Q23A 3TR5A 3LO3A 2OIHA 4CQ1A 3MR2A 4RW4A 1YJVA 4JI4J 4LF4J 1T3OA 4WFZA 2YNFA 1ZA2B 2V8DA 2WK4A 5A8WA 2ATLA 1VIXA 1JLCA 5DGAA 3GILA 4DSEA 3HZGA 2KFNA 2GMHA 3MM9A 3DRRB 5F3TA 1S76D 2V50A 2D3OR 5IV3A 1SL1A 3PIOQ 4DFKA 2QMUB 1RWVB 4HTJA 4HTIA 1VHIA 3IBWA 3DU6A 3MM8A 2JL9A 2OI2A 2HVZA 3NOGA 2F4FA 5KFMA 5FIIA 1NHUA 2DITA 2FZKB 2FJEB 2FZCB 1UJ4A 4PXEA 3PYEA 4DV7J 3RJMB 1RP5A 4CRJA 3O8WA 4LFAF 1XMBA 2HSEB 1O6XA 3NWRA 3SDEA 1SPBP 2C42A 3A8JA 4BLGA 3CJ0A 1WNEA 1HQEB 1FI4A 2MZQA 2PI4A 5ETLA 1S1WB 1X4DA 4YQWA 1NO8A 2J0QD 2A1BA 1XMQJ 5K14B 1TUGB 4F2SA 1RI7A 1RAAB 5KFCA 2J7WA 5DZ7A 3OT9A 1XIQA 3H42A 2W2QP 1YJWS 5KFJA 3DRSA 1FFWB 3RGIA 2XG8A 5BYRA 2CG4A 3EYZA 2VL1A 5KG6A 1B7FA 1KKHA 1U24A 5EX3A 1JNZB 4HLBA 3CDBA 1LFWA 3R27A 5F8IA 1LEOA 4LF4F 1T9UA 4JV1A 1RWNB 1IKWB 1HW8A 2CAJA 2FTRA 2R4FA 3S7RA 2YY3A 5IM0B 2XMTA 2J0WA 3NBPA 3DN9A 1YITS 1AFJA 4OJ3A 3IFEA 3SMZA 5GVQA 4J5OA 3GJRB 2HRYA 3NP5A 1RHQB 2DEIA 1SC4B 3Q8VA 4HDGA 4U6PA 1S57A 5C42B 3ET6A 2NSBA 3R2CJ 4MMOA 2H51B 1JKHA 4QWAA 2KZZA 5JJBA 2ASLA 2DHAA 3RAQA 2HNZB 1MROA 3SQGA 2R7OA 5JVHQ 3H2VE 5DLFA 2RU9A 1DTQB 4HR2A 5LT5A 1H73A 2WZ1A 3W2VA 5D0GA 1XMQF 1RAOA 3UW1A 3Q0AA 1SIWB 2KXHA 3AOCA 1CS4B 5LMNF 3OVAA 5FJ4A 1KC8T 2ALYB 3HSJA 2DY9A 2MJNA 3EE3A 3J81U 1C1CB 4IKAA 3WZ0A 3MEGB 2HVHA 5T7LA 3VAIA 3W62A 5D4NA 2WW8A 3MPWA 2OSRA 1O5JA 4DX8H 4EBDA 1UEKA 4PUOA 4DR2J 3M32A 3K5PA 3M1VA 3QNWB 3IGNA 1KP6A 3CMAS 2MGZA 1VRQC 1H3DA 4ZLPA 1Y11A 3OSPA 3F0NA 2DNYA 2I5JA 1NDKA 2YKPA 1RT3B 2P6TA 3LOUA 2XULA 1Y00A 3HKZD 4TQRA 1VQSA 4ECYA 1NK4A 3BO3A 2PMWA 2YWFA 3C14B 3PEHA 1M5SA 1T11A 1HR0J 1QM9A 3M6UA 4OHWA 2BM1A 2ZM6J 1RWKB 1TKZA 4P6QA 2FLLA 2NZ4A 4QIEA 4ECTA 3BGLA 1LW2A 3K8WA 4E98A 2OPRA 3UI3A 2DNMA 2GS8A 2CQ0A 5EN1A 3T1HJ 4YR3A 2IIHA 3U1MA 3EX7B 2IM1A 3KMSA 3CEDA 1MNEA 1Y4ZB 2ILZA 1RT2B 1WSVA 3SFUA 4DCPB 5HN0A 1HARA 4DR2F 3OL9A 2I2YA 1F3VA 1HKAA 2QLJB 2W4DA 2CPXA 3IN5A 3CCLS 4O3OA 1NJWA 4QIGA 4C7QA 3CD6S 4ZMMA 4URGA 4LVNP 2C2OB 2PSZA 4ES3A 1RYSA 3EPGA 3HFKA 1GTEA 1IBKF 2DIVA 2ZH4A 4ZLLA 5GADI 4RBTA 1RTIB 2UU9J 2B6AA 1YJ9S 1HW9A 1SH2A 3ZZPA 4RWXA 1WJ9A 4I2PA 2W2OP 1T9YA 5IT4A 2D9PA 2XMWA 2OTJS 2A6OA 3FC9A 1HR0F 2VOPA 2N7YA 4F0HA 4NLPA 2ZM6F 1HWLA 4AUKA 5AJ3J 2HQCA 3L4BC 3R5DA 2CNLB 2DXFA 2Z2ZA 3MFIA 4PXDA 1OO0B 4DFMA 2B4VA 2YXLA 1TK8A 3M2RA 3PZPA 2BJ1A 4KPYA 3ETOA 1U1PA 3T1HF 4NX9A 3QGHA 2XM3A 3LTOA 2LEAA 2IA0A 1SJFA 5KFLA 4ZHRA 2UV8A 2HNYA 5LOQA 4Y2MA 4RLEA 3CE8A 5A8KB 3MFHA 1EIYB 2V4RA 3K57A 3JQMA 1CBKA 5KG3A 2XLKA 2IM3A 1F5AA 3OUYB 1NK9A 3TEGA 5HMWA 3NWGA 2HHHJ 4R8UB 3A3NB 2KXNB 3D0HE 1IBCB 3UDEA 4DBQA 2OD6A 5E0OA 1TL1A 4I67A 5KFDA 2I0XA 5DRKA 3WHIA 1Q8IA 2UU9F 3B82A 1RA7A 2F8HA 4JYAJ 3GR1A 1DQ9A 1KONA 3CGIA 4CM2A 2WONB 2ASYA 1B4SA 2GV1A 3ENQA 4DPWA 3PX6A 4WKRA 1TL5A 3J7Z5 1SCJB 1R7IA 3HJVA 3TARA 2XZWA 5CABA 1GMVA 4DL2A 1XNRF 2ZE2B 2GC8A 5AJ3F 3OJSA 5L1KA 4KT0C 5I3UA 3IP0A 1VYAA 1KRPA 4IH6A 1D1UA 5D4LA 3R5BA 4N8OA 1Z2LA 5KG1A 2HQ3A 4DS5A 1NSQA 4X4OA 1RAGB 1MMNA 2K3KA 3D54A 5HMXA 2C2KB 2D9OA 1TQLA 2K7JA 4TVAB 2LCWA 5CQGA 5HJYA 1DURA 2UUCJ 1K1QA 4TYBA 2MKCA 3AFGA 1J5EJ 2HNDB 4MH8A 2EKYA 2Y1LB 4KGVB 3BJYA 1YJNS 4X62J 5A0YB 1E6YA 2R7SA 4CH0S 4RNFA 5HP1B 2RH3A 1LWFA 4EI2A 4P9SA 3M8RA 4C0BA 4ZPDA 4KH0B 3QT8A 2KH9A 2RQ4A 1PJ5A 1MMDA 3TA0A 4F02A 4JYAF 4PAAA 1RHMB 3GG1A 3QJPA 2V2ZA 2JFDA 5IT9Y 2LA4A 1R8HA 1XC9A 2R7XA 2P5VA 3M7VA 1QE1B 5M2UA 1URNA 5HMZA 2CDQA 2V8GA 2QV6A 4S0MA 1JXVA 2IDEA 4YR2A 2V9WA 3SBMA 2XQCA 2HFVA 3UDLA 4NLXA 4WCEQ 1X0FA 2CQCA 2OPSA 2R2SA 2CUYA 4OZ0A 1M5OC 3GU0A 3VAHA 3QWUA 5L1JA 4IFYA 1NEEA 3W66A 2APOA 2HBYB 2J0SD 5ETTA 3ZTOA 2UUCF 4DU7A 1UVLA 2LDIA 1FX4A 1J5EF 1BMQB 3BSOA 3THPA 2QGFB 2UXCJ 4LBHA 3DMJA 4MYTA 4X62F 4ILMA 4Y0FA 4I7FA 3DLKB 4X64J 3RB4A 3D6HB 4UUWA 1KFDA 3M6WA 1N4LA 2FYXA 3H40A 4FYWB 5F8MA 2NCKL 3FNNA 3JTPA 3FUYA 3RAMA 4DEZA 3CCMS 4J9PA 3KNAA 1FVSA 1OWXA 1XR5A 4RW6B 1SV5A 1HMVA 3DU5A 3P45B 3NMRA 3GFHA 3MOJB 4ZVFA 5J2QB 4UY8T 1UL3A 3RRKA 1R8BA 1TFWA 2YKNB 2FLOA 2ROGA 3DYAB 1A7GE 4NRTA 4RU2A 3KG4A 1RTHA 4AL7A 4NA1A 1DFDA 3ZNJ1 1SUQA 2GIFA 1R8PA 2CQDA 4ZITA 2ZH6A 1D9AA 2M9KA 4NLGA 2OSQA 2ZBCA 5LM7E 3KLEB 5K8NA 2X1GA 2CQBA 1TL3A 2NPFA 1S6PB 1EKRA 5CYMA 4O4GA 1REVA 1GMWD 3DFEA 3PM9A 5MLCV 2UUTA 2W7OA 3M8QA 3G6VA 2VG6A 1BUXA 2UVWA 1F2HA 4CCHA 1JJHA 2HZCA 1M5PC 3KKFA 4DV6F 1FRHA 4DL6A 3CCSS 5IWAJ 4W4MA 5J2NB 2WSCC 2R7RA 3KLFA 1T94A 1N8RT 1RAJA 1QLNA 4P71A 2HAFA 4P2MA 3N79A 2BOPA 4ZPCA 1TU0B 1IWAA 3IR7B 3QIPA 2QYCA 3ICLA 1QAYA 2U2FA 3W9IA 2LKZA 3GYNA 4C2MA 4G1QB 2E1RA 3KK1A 2X51A 1CPZA 3LWMA 2AYEA 2ZH7A 3W65A 1T95A 4QYZJ 2RUGA 2A2DA 2OFGX 3NCPA 3ULHA 4OZJA 3D2WA 1SC3B 3TP2A 2MLZA 3ITHB 4E0DA 1QJHA 1ZTTA 3UD4P 3GIJA 3G2XA 3MMCB 1WHWA 3IAM9 2KZMA 3HI9A 3PFOA 4NCAA 2OUGA 3HHLC 2RJZA 2WVEA 2BE2B 3KJVB 1BQNA 3E01B 1TUWA 3MECB 3M8PB 2BA9A 3N6LA 3I5BA 3TUPA 2IAJA 5GADU 4TY9A 2DYAA 2WB4A 2LEBA 2EPIA 1PCAA 1RT6B 2YNIA 4FN5A 1HWKA 3QFWA 4DV4J 2JLFA 4I69A 2DNGA 3PACA 3PHEA 1YK9A 2ZVSA 1JJ4A 2FHOB 4HT7A 1JK9B 4DL5A 1T9TA 2Z56B 1S1TB 2LQBA 3RUBL 3U02A 1U2FA 4NLWA 1FKPA 4FKXA 3K17A 4L74A 4DI6A 3R2DJ 5D4PA 3DOLA 4RW9A 4OJ1A 2NUHA 3I87A 2B9YA 3OR1A 1FXLA 2A2CA 1ZAXA 2L3MA 3D6MB 1KQSR 4UUXA 2G2YA 3Q89A 1TFYA 2XY5A 1WC0A 4ILLA 4ITSA 2IBOA 2K7KA 2DRBA 1H7WA 3RYLA 1G4CA 1JJCB 4U7UD 2ROPA 5DQIA 4F26A 3EWGA 2VASA 2H9ZA 3OLAA 5LJ3Y 3TRGA 4DR5J 3CJRA 2E1MC 3DLEA 3V81A 1FTRA 4CWBA 2M52A 1DBDA 2PMHA 1SJ1A 3FDSA 4YHHJ 1RCOB 1HNXJ 1VQ9S 4X4UA 4DG1A 4V19J 2ZWOA 3JAMU 2OAUA 1KWMA 2IVYA 1V9OA 4I0WA 1H2UX 3OR2A 4YB6A 4AFFA 2Z2MA 1PIEA 4CT8A 4DV4F 2D69A 2HK2A 4TXSA 4RBVA 5DM7Q 1VISA 4Z7YA 1AZSB 4F4WA 1N56A 1ZAWA 2B9WA 4XTTA 3DDKA 2ZBRA 1KOHA 4DMZA 4DX5A 4WWSA 4ZLNA 3M6VA 3DHXA 1G2EA 2JFKA 4ZN3A 3KTQA 2EK6A 2W2NP 4WKYA 4LUBA 4OX6A 3C6UB 4LSNA 4DWIA 1SH3A 5BYSA 3PRVA 1VMBA 3DOMB 2W9CA 4LQ3A 2O1PA 1K0VA 2GGPB 3GV7B 5G0RA 3WX8A 1K9MT 1HBOB 4IH7A 3AXKA 5J1EB 1RT4A 1S5ZA 5HVHA 4WE1A 4AL5A 4Q2LA 3KK3A 4KKOA 4USJC 4QWDA 3NNHA 3M9MB 4ID8A 4ZOSA 2DNPA 2GFFA 2ZZTA 1ZM4A 3VAMA 2RKIA 3O1LA 2MY8A 3OTOF 4DQQA 3IS9B 2HFZA 4PZVA 2YKQA 5E33A 3NGSA 1SKWA 4UY85 4ELTA 5CD4A 3CT9A 1YJRA 4KIAA 1AUSL 1RWOB 2WVBA 3AH6A 4QU7A 2IYIA 3MR6A 2PFFB 1TZ0A 1HNXF 2MZJA 4KQZA 4L3KA 3L95X 3PHTA 2VHGA 3JYTA 4RL1A 4NYZA 3T1YF 4WFYA 4OHVA 3O44A 4DR7J 4PXBA 4K5RA 2RNEA 2XS7A 3ETMA 1SXLA 2AEFA 4EYIB 1S9GB 4DL3A 2L9WA 3EZOA 2GO9A 1FDAA 4ZS6A 4TU8A 3BSNA 4LFBJ 1Y10A 4KFBB 2WTFA 2D3ZA 1AA1B 3T5LA 7FDRA 4G1PA 5CYQB 1WKJA 2KYZA 3IGVA 5D77A 4DR1J 4FYYB 1WG1A 5T41A 4GVLA 1Q1KA 5E3CA 3ZTPA 1Q78A 4RW7A 1C0TB 3CCTA 3KDNA 4M5KA 3NAHA 1VBZA 2G9OA 2O66A 3WIVA 2V2VA 2HWTA 1HNVB 4JI1J 1T3NA 2IM0A 4JI5J 2V9KA 2W24A 4FNHA 5A6WA 4YR0A 2AGPA 1FFGB 3VVTA 2RSQA 1WOSA 2PN6A 3UFCX 1IJEB 3NS5A 1F0XA 3OTDA 3MURP 4LVOP 2D3O1 1Q7LB 1DQ8A 5B0DA 2VONA 5E3RA 2CJKA 3N01A 2HQFA 4C8YA 1LW0B 2D7SA 4KTQA 3NMAA 2VBZA 1OY8A 1ZYQA 2I9SA 2F8MA 3J81Y 4J9LA 3C15A 3UVJA 3DLLQ 1R0AB 4N76A 4DLEA 1JLQA 1GNKA 3UN3A 4LIRA 3BQ0A 3A3OB 4Q8FA 4WP3A 2IMOA 2ALZA 4LFBF 3AD9C 1FEHA 3AOAA 1FFSB 1S4EA 3BB5A 3PEJA 4NI2B 3V6KA 4DR1F 3LP1B 3Q2TC 3GE9A 4QOTA 2LQJA 1IKYB 1NJXA 4LT6A 2MQLA 3MCNA 4K4ZA 3G8SA 4DX6A 3OFFA 2AJ2A 2BE7D 1G6BA 3OFGA 5HBMA 3HDSA 3CDUA 3VQTA 1UWAA 5GAHI 2DB1A 2HKEA 5B0GA 1T02A 4QBUA 3Q83A 3AXMA 4HACB 1FCAA 2OFHX 2AZ1A 4JI1F 1E6VA 1S7HA 1YJTA 3WBZA 2LFVA 2HBZB 4LIWA 2IRXA 4EZ6A 1RT5B 5HLFB 3DRPB 4ANCA 1F3FA 2FHJD 1RU1A 1UVMA 1X5PA 2CQIA 3FRZA 3MEDB 5AE1A 1X4BA 1TAUA 3OL7A 4DZ6A 3GMGA 2ZH1A 2YX1A 1N5QA 3RAXA 3MAAA 4EFAC 3POTA 3I31A 3KLGA 1DAXA 2DNKA 3PX4A 4PABA 5CD4H 1PGZA 4MT1A 3ZZ0A 4WYLA 3HT0A 4ECSA 1OSDA 2ROEA 2B9XA 5DQGA 5D6GA 2QJ3A 2IRYA 2VDIA 3G6XA 2HQDA 2ASDA 1R27B 6FD1A 4FXWA 2OJ3A 1RWUA 1NJYA 4NA2A 2CADA 3B4DA 3JSMA 5DQHA 2XMKA 4MKVA 2N4CA 3SI8A 1JLBB 4LF9J 4DFJA 2KT2A 2QTWA 3LA0A 4BC9A 1U2CA 4ZVRB 2BE9B 1CJTB 3SCLE 4USUA 1PC4A 3ZNUA 2W7PA 4EZ9A 4EO6A 4W92B 2Z8QA 3T41A 4X4SA 1FRKA 3J7AN 3QRPA 5HI7A 3CXCR 4A8QA 2JZ5A 3C46A 1C0UB 5EX0A 3MD1A 3PRBA 5FDLB 3QAUA 4I6WA 4EMDA 3TAMB 4PWDB 2VF3A 3ZFVA 3CJ3A 2DR8A 2F3JA 2WCXA 2B8PA 4USIA 1U0SA 1H0HB 4RW4B 3FZ2A 4DL0C 2FLPA 4DL4A 1ZAVA 3VGUA 4MYUA 4HYKA 5J2MA 1OY6A 4CO1A 2LQ9A 3SIPB 4MKYA 4EK2A 3MM9B 4ZN1A 3OVSA 2YH1A 4CO3A 2F4VF 1K1SA 2W8KA 5EWEA 3MMBA 5K8OA 4N41A 4A46A 4DCOB 1EP4A 3I55S 2QLXA 2X1BA 1JLAA 3MM8B 4DV3F 2E7VA 3P4UB 4JOUA 3H2UB 3G86A 2PMZD 4NXNJ 1X9SA 3D7SB 4I4BA 3KK2A 2RDJA 3TJAA 4L3NA 1RAFB 3ADAC 4LF9F 4QYRA 1DJ0A 2XY6A 4A48A 2X7IA 5EWGA 2R42A 3NNCA 1KLNA 2N4DA 4CZCA 2IPOB 3SDEB 1QY7A 4NLSA 5CXTA 1RBOB 1H38A 1CEZA 1IBLJ 1RACB 2ZH2A 1N32J 5F9LA 5D4OA 3BSCA 3OTEA 3S1TA 4KH1B 4A8MP 3NY0A 3CJKB 4O44A 2NZCA 3SFGA 1I6JA 1ZA1B 1HHTP 2ZWPA 3DRSB 1NPKA 4DN0A 2PT0A 3ILJA 5DLGA 1VDHA 2DH7A 4KAIA 4GMKA 1P6TA 4LSLB 4C9DA 4PG5A 1G7CB 2ZOGA 4IQMA 4IOAQ 4K4UA 1X4HA 3NBPB 2PA3A 3UN5A 5KG0A 2VICA 1LWCA 1N6QA 1NNDA 4Y00A 1RBLA 2LLZA 3MMJA 5JUMA 4NLDA 4NXNF 1ELOA 4FVMA 3SZ2A 2RQMA 3ET6B 4M5HA 3BKTA 1HQ2A 1VLYA 1UW9A 1TL7A 3IRXA 2JEJA 5CCLA 1RA6A 3OJUA 1AFIA 1NM2A 1K0TA 4HKQA 1C1BA 2VJUA 1K47A 4HH0A 4WK3A 2QA2A 1BXNA 4C0HA 5CAAA 1UKUA 3SQGB 3UO0A 4LBIA 4ZCIA 1N36J 3UCZP 1N32F 4KGZB 2GCFA 1FTCA 3W2VB 2GW8A 4P10A 2VKZG 1ZPWX 3CJTA 3CO9A 1TAQA 3SXLA 2XGQA 3DLJA 2PDAA 1Y5LB 3QATA 2XYHB 3TUZC 3W61A 4NLQA 5D15A 5T7LB 2VKRA 2JLGA 3MPYA 4WBFA 2CPDA 2YQ3A 4PUOB 3M32B 3CIZA 3DGVA 3G6YA 2R8IA 2XYPB 1WEZA 2V2QA 1FRJA 2BQUA 2AJFE 5C2CA 5F8LA 1PBAA 2RIJA 5A76A 5KFVA 2I5JB 2DR9A 1S6QB 2BEFA 2VFSA 2GNKA 1R0BG 4M5DA 2EFGA 2R9LA 1S6OA 1NUEA 1EETB 1R8CA 3VZHA 1Q82T 3OLBA 2DGOA 1FNXH 4OI3A 1WC6A 1VRTB 4ZVEA 4B02A 5JVGQ 1Q5YA 4I6YA 5GAGI 1HQUA 1PJ6A 3EDRB 2R2UA 2E1AA 1NDLA 4IH5A 2BRKA 2ZD1A 1N52B 4QZVB 1FD8A 2WOMA 3GIKA 4O3QA 1N34J 1RAHB 3OL8A 5C25A 1LW2B 4I2QA 3FMWA 4KPCA 2Q66A 3VTIA 2OPRB 4HI1A 4FPRA 2M4MA 1SQGA 2IC3A 2F7VA 4U7UK 2DO4A 1NSPA 3TX8A 5LSLA 4EGLA 3M30A 1IQTA 4OQJA 2FJBB 3HO1A 3HKWA 5K9FA 4F7VA 3AB4B 2POKA 3TQEA 3BREA 4PKDB 4P2FA 5J1PA 4J90A 5GAHU 4MKBA 4IDKA 1GH8A 4Q44A 3VHQA 2HHVA 4PYAA 4C98A 2B6AB 4PR6A 4I2PB 1Y3JA 5SUHA 3UE2A 1FRIA 1OY9A 3WIUA 4ZVTB 5U47A 4ZPAA 3EM1A 4NMLA 4C11A 1UWBA 2EG1A 2J9DE 2WAQD 2BMBA 3IA0A 2GIQA 1HYSA 4J9KA 1FRLA 3IC1A 5GMDA 1R3NA 2D1CA 2ZDOA 3M2RB 1S9EB 4DUYJ 1S4FA 1UVNA 4TY8A 3TUJC 2CQGA 1U1KA 4YMEA 2LQ8A 1GX6A 2DPIA 5AXMA 4V1Ak 5ETOA 4ZHRB 3D6TB 2HNYB 1RHKB 3GCXP 2A3JA 3V4IA 5HAOA 1K44A 3EPIA 2YQ1A 3WQPA 3L9ZA 4AT1B 1UPMB 1W7WA 4W98A 2LECA 4JI7J 3QAEA 1GX5A 5A2QU 4RZRA 3DRRA 4PCQA 1KNZA 4G6VB 1TL1B 2Z2LA 5C2GA 5ADZA 2M88A 4IYQA 2HPUA 1NAQA 4DPTA 4IOBA 3W7BA 1FJ7A 5KG5A 4GVBA 4O0NA 2C3YA 2YWGA 1U2RA 4GRSA 1EZZB 3N4WA 4KGKA 2DIUA 1NKBA 1YI2S 3GJSB 1RYRA 3H5XA 5DETA 2EG2A 2V94A 3O6QA 2CJ9A 4CYUA 1MU2A 3ILLA 4YEAA 4J9SA 3TZZA 3OD2A 1EKSA 2E5HA 2RQKA 2UXDJ 3AQPA 4ED4A 2OLWA 5I3UB 5HATA 1HQEA 1R0CB 1RADB 1B99A 4FP9A 2CDRB 5AXKA 4DUYF 4IOCQ 3RB6A 3QIDA 3HT3A 3TNVA 5B0BA 3VAFA 4NE9C 1MLAA 4LRBA 4QQBA 2OMLA 2GHVC 2BANA 3NG8A 3KG0A 3PR4A 4WU3A 2DO0A 2RF2A 4FDFA 3M8WA 5DO2A 4OYMA 1HLWA 3NCRA 4EWTA 5IOLA 2DISA 3B6BA 2M8HA 1F9HA 1ZZFA 1YSJA 2K2PA 2J7KA 4WF9Q 2XBPA 1E6YB 4JI7F 3UR3C 1KQKA 1SH0A 3JAMY 5IM0A 2ATCB 1LWFB 3MMAA 1Y5IB 3RB3A 2IM2A 2UVVA 2MYFA 2OO4A 2FJAB 2OEJA 2JEFA 4WU2A 5F41A 2M2BA 4ZPWR 3M9OB 3UWTA 3HX9A 3CJSA 4TU9A 4LR8A 2H4YB 4DSKA 2JVRA 4E8UA 4NOHA 3MM6B 4UOFA 2HNZA 1YGYA 4OI4A 2FIUA 4UQTA 4ZP6A 1U48A 1QD1A 2OPSB 4QU6A 1RTZA 2EFNA 4F4YA 3AAWB 2EFPA 2XZDB 4IFYB 5B7WA 3R9LA 4X65F 2R8JA 2DHHA 1RGVA 2OHDA 4DR3J 1FD2A 2DHSA 1MW7A 2W2MP 1VQ8S 2RRBA 1Q4RA 3MEGA 4HHUA 3MM5B 3CO0P 2KM8B 4QYZK 2CJYB 2YNHA 2HHWA 4K5SA 3GYGA 5K20B 3CCQS 1FA0A 2DGXA 2XWXA 2AGOA 3SEOA 2E5JA 4I7FB 5ITHA 4N47A 2MSSA 1C2PA 5B08A 5HK4A 4F0KA 4ED2A 2YNGA 2VG7A 1YRTA 5K8MA 2GJIA 5GMEA 1WOPA 3IXQA 1WHYA 3R5AA 1IXKA 1RT3A 3LGNA 4NYOA 1IJFB 3B78A 3US5A 4LRFA 4NCGA 1SV5B 4DSJA 1HMVB 2E7XA 2IA6A 1NSKL 2KYXA 2KFYA 2R8GA 2KG0A 2ZJPQ 1I94J 2DRAA 2XI3A 3D6FB 3R1LA 1UVKA 4U96A 1PC5A 4MK9A 2FGOA 1GEHA 3TX0A 1RTHB 1OS5A 2XMAA 3PJWA 1SUQB 3LGHA 4DV0J 4ZCLA 5L46A 3GR0A 1OYDA 3R7NB 2UXBF 4X4TA 2CZVC 2FVPA 2QG9B 1VR6A 3QSYB 1FJGJ 2CKWA 4DR3F 5HJXA 2ABYA 5CYMB 4M94A 1LXJA 4O4GB 1REVB 4QWCA 1QSLA 1Q0NA 3NAIA 2QL7B 2KM8C 3M8QB 1RT2A 1AUDA 2VG6B 2C2ZB 2CPZA 1SC6A 4KB7A 1QDUB 2GAGC 2JHEA 2IDLA 2C3UA 3ZZOA 3CTRA 4NPOA 1X31C 1P8GA 3TQ1A 5GAGU 4EU0A 1VQNS 3C6TA 2CQ4A 1VBYA 2ZJQQ 2MEWA 3VVUA 2GMLA 3KLFB 2QX0A 4B08A 1FWPA 3JQKA 2EKNA 2DEJA 4O3RA 2YPYA 2F5GA 3A4TA 1S72S 9RUBA 2K1RB 2Z57B 1GXTA 2PA8D 2EC2A 3FBFA 3VALA 3QIPB 1WC3A 3BSAA 1PAEX 2KL8A 4MIAA 4KV8A 1I94F 3MDFA 1I3OB 3D3BJ 3D67A 4JI2J 2MMYA 2XLIA 3IO1A 4ED1A 2WVCA 4HEA9 3IR5B 1CQNA 1D9FA 1JLFB 4Z37A 3UCGA 4DV0F 2JC0A 4N77A 2R7VA 1NH8A 2J0XA 2JEIA 1UCNA 2FY1A 3W5XA 4YS2A 3R6LB 5KOXA 1BQNB 3RBDA 2NYIA 2IAJB 3NGUA 1YX2A 2F63A 3TAPA 4N8NA 2ZEJA 3I9V9 4LFAJ 2YNIB 4WFXA 3LH2S 4B3MF 2WRMA 2EFQA 5IC4B 3OUYA 3MR3A 4U9RA 3ELHA 3OHAA 5D8HB 5F0WA 4P73A 2W25A 1TVRA 4G1IA 5KFNA 1FKPB 3O2IA 1RHJB 3KLHA 2FC8A 1WD6A 3QRRA 3MPVA 3CCWA 3J81j 4RW9B 3R5GA 3OR1B 2CRLA 2CZ9A 5H9EJ 4DL7A 4R0JA 1DARA 1VQPS 4C97A 5KT7A 4JI2F 1IM4A 3AQOA 2UUWA 1VQMS 3W2WA 3ZZYA 5GAEI 3KJFB 2RS2A 1VQLS 4XDDA 1U25A 4Q45A 4K0KF 4Q0BA 1DQAA 1VCTA 4O3NA 2HIYA 3CJ8A 5EWFA 3QT6A 2G2ZA 3AHPA 1SC1B 3CW2C 2B43A 3GQCA 1RZMA 3TJ8A 3EGZA 2MQ8A 2UZAA 3RBZA 3TA1A 3DLEB 3TVYA 3ZZUA 2E66A 3HCXA 3HHEA 3BBCA 4FBUA 1PKUA 4DG1B 2BQ3A 3M8SA 1VLOA 2HBRB 1U1QA 1APSA 2MHEA 1HHSA 3OR2B 2AJ1A 4X2BA 1XNQF 3AJDA 2HNDA 1SKUB 1S9FA 3C16B 5F8HA 2AYGA 1RWPB 1RSCA 5ETKA 1F5BA 1DTTB 4MAKA 2DXEA 3BS9A 4J37A 1FK9B 2JLEA 1UEUA 3PTWA 4I1TA 2OPPB 3W3SA 3NGDA 4LF6J 5LMNJ 1H98A 4KR0B 4FF1A 3DI6B 4KO0B 2W9CB 4PG8A 5L9NA 5G0RB 4U95A 4M1KA 5CZVA 2Y8YA 4TYAA 1RT4B 2RHQB 4WE1B 4P2SA 3KK3B 4KKOB 3G71S 4IRCA 1KN6A 4YB7A 5KOWA 4HT5A 2QEXS 3DDNA 2M70A 4C8NA 4Y3CA 2V8PA 1QE1A 4OMFG 3BYPA 3CC2S 4CO4A 3BGFA 2K06A 2CYYA 4KSEB 3SSSA 2MLXA 4OZ2A 3PYDA 3CCRS 3U7JA 2IYGA 2EVZA 2NXUA 1I5OB 3J7ZT 3T6JA 4OYWA 4F04B 3NS6A 4OYZA 3F73A 3PYFA 4DCJB 1A9NB 4YOEA 3JYTB 3EMTA 2KVQE 1VQOS 1UP1A 3W64A 2CA9A 1OQ3A 4CTAB 1XJWB 4LF2A 2OD4A 1S7IA 2ZBQA 1YZ7A 3I56S 2GQQA 4LRCA 3EGNA 2QA4G 5DG9A 4ZVQB 3DLKA 2DNQA 4LFCJ 1RBAA 4LF1A 3SYZA 3K89A 2Q79A 1H7XA 3KOAA 4QPXA 4HDHA 2RT3A 4LF6F 4XPEA 4F3OA 1P27B 1EARA 2CNOB 2MQPA 1SJ3P 4C8KA 1EAYC 2MKHA 3DLHA 4Q43A 3S6EA 2MTLA 2EWHA 3TUIC 4C8MA 1W26A 1WC5A 3QJLA 1N5TA 4ID5A 2BOAA 1R8AA 2BJDA 2YKNA 3N6MA 2JX2A 1T9XA 3BPDA 1KVJA 3RR7A 3CDEA 2CG8A 1FXRA 1IBKJ 1GQEA 1FXDA 3R7BB 1H2VZ 2KB2A 1B70B 4FZVA 1IWGA 3LUYA 4FKYA 1A6LA 5KFZA 1NK6A 5IC6B 3UVJB 5IQ6A 1DRZA 1JLQB 4ZP7A 4B3OA 1S1VA 3R97A 2W9BA 2P8IA 3ILIA 4ZJQA 5J2NA 4LFCF 1U1LA 4OLPA 3LALA 1HI8A 3W9HA 2ERRA 2C2NA 3UDCA 1EQMA 3GG0A 1OMSA 1GXUA 3RRGA 5J2PA 3G6ES 1UA0A 4ZDNA 4IG3A 1SJRA 2FJVA 5KFHA 1B7YB 4NZ0A 4RJVA 2CNKB 3H20A 3K5LA 2YWKA 4G1QA 2VH7A 1U1OA 2PEHA 3BBFA 2HGMA 4ZJOA 1NXIA 4PPZA 4LRAA 3AT1B 2ASJA 1PYSB 1TMJA 2V68A 3R7SB 4I6AA 4ED0A 2V63A 3VQSA 2H48B 1NHKL 1RE1B 4F50A 1FF2A 3VAJA 2FHKA 3MAAB 4NEZA 3POTB 3E01A 3KLGB 2G13A 2LEPA 4B3RJ 2IHR1 1HWJA 1P1TA 3CJQA 3CULA 3EVWA 4XDCA 2B8QA 1NLKL 3NL0A 2WB1D 4R5PA 1XNRJ 2G1DA 3TI0A 1REGX 1CC7A 3HHLD 2AYBA 2E5GA 2BABA 3K5OA 3JSMB 4FS2A 2AIRB 3H59A 2DR7A 4ZJLA 3VAKA 3PW5A 3T9NA 2ZZMA 3OBIA 1O8BA 1FDDA 1IQZA 2BJEA 5DM6Q 3IAS9 1IKXB 4OI0A 5CYJA 2VA3A 3PO5A 7AT1B 3GIIA 2GAHC 2V8VA 1NDPA 4I64A 1U8SA 1G1XA 2XMJA 2DJWA 1JLGA 1QSSA 3Q22A 1JQGA 1SKSA 3AOBA 5ETSA 3V6DA 5AE3A 4M5NA 1HBMA 1LKZA 3H5YA 2PI5A 1TKXA 1F1BB 4WZMA 3LQVA 4ED3A 5IFMA 4J9QA 3IR6B 4A47A 4LREA 3ENAA 4F36A 2JC1A 2DNRA 4P74A 3LP0A 3HHDA 2VDHA 2ZOMA 5J2MB 3EZUA 3IM9A 3PO4A 3GWCA 1Q79A 3DM2A 1U1MA 4B3RF 3TOQA 4B9NA 1KDNA 1WDTA 1IR1A 4DF4A 3CD0A 4GC7A 3I9ZA 3M2UB 4Q7AA 2HRUA 3MMBB 4UF4A 1X9WA 2DNOA 2FY8A 4FPIA 4ZK7M 3GIRA 5D78A 1JLAB 1EB0A 4C0OC 2UVRA 4IRDA 1ICEB 5GAEU 3NNAA 2KU7A 3KFWX 1LWEA 2XNRA 2WHOA 1AZSA 2XWYA 5J1NA 3KK2B 4OJHA 5IS2A 4BCAA 1Y7PA 1X4GA 4CLKA 3CSKA 5DDOC 1ULRA 2HZAA 5A2QY 2LYVA 2A6MA 3SSRA 4USTA 3G82A 2B5JA 3C6UA 1P9QC 5C7PA 2O3DA 2VD3A 1ZM9A 4AE5A 4AQYJ 2I8EA 3IBCB 3CF5Q 3BGRA 1T05A 3K8VA 1H6KX 1EJ7L 1FRMA 2GX8A 5B09A 3H4DA 3LAMA 3JTNA 1U4BA 1TMMA 3CCZA 2FD2A 2QN6B 3FFIA 1KLMB 1Y5NB 3PRDA 1TKTA 1U0HA 1NB7A 4ZPBA 1JWWA 2HVEA 3FEYB 3VGVA 2QL9B 2DGWA 2KG1A 4RU9A 3TAQA 2E5LJ 2CJBA 2HGNA 5KT2A 4F4KA 3M4XA 3P8BB 3L7UA 3TA2A 5KT3A 1R43A 3QO9A 4AXIA 1GAOA 1RDRA 2ILYA 4YUDA 4QIVA 2KHDA 1LWCB 4GC6A 4DV1J 3UPFA 3UQSA 3OV7A 2C2EA 1M1GA 1GMWA 3RZAA 3HM9A 3PR5B 5L9XA 2HVIA 4LQ9A 4OI6A 1CJKA 2CPJA 1UJ5A 3SSQA 1QVGR 1F9FA 2R2RA 4ZPVR 2YBVA 1HPZA 2X3DA 3O5TB 5M2RA 4RUHA 3IRXB 5L39A 4X4RA 2B7CB 4RW8A 2XGPA 5M2PA 3J7A1 2RRNA 2DH9A 1YDLA 2KT3A 1Q8BA 4UZBA 4DPUA 4IFVB 2BQRA 4ANEA 5ETRA 1HA1A 4KHMA 2MDAA 5KFUA 2ZVIA 1HBUA 2DGTA 4CLZA 1KVKA 2AJ4A 1VJWA 1WELA 3PJ9A 4A8XA 3L7PA 2HHPA 4AQYF 4CLWA 4OL8A 3PJXA 1X7VA 2XSFA 1RT7A 2CIMA 1IUJA 4DV6J 3P3DA 1HNVA 1LXNA 4DPYA 4JV5J 2ZDPA 1DLOB 4B9UA 1NCLA 3LP2A 1TK5A 1MWQA 2ZHOA 2W9AA 2HWIA 3N6NA 1IR2A 4WXWA 1T9WA 3I5CA 1WI6A 3FK4A 4RWWA 2E5LF 3DRXA 4C6AA 2MSTA 2HQGA 4KHPJ 2YWEA 1ZBTA 3UNYA 2Z58B 3TW0A 2PO4A 1J5OA 2E29A 3MCMA 1TKDA 4B9SA 1T8EA 3BDPA 4M8LA 4XIUA 1YVFA 4NXMJ 2HS0A 4WIIA 4DV1F 2MQOA 1F5CA 4QR0A 2C3MA 1V5VA 1AB8A 3ISND 5KFGA 4LJMA 4M5DB 5LMUJ 5T14A 2CWKA 2RHSB 1C4CA 2GA7A 2BBEA 3R8YA 5DDQC 2B3TB 1MN7A 3H5SA 1N0UA 1NKCA 1JB0C 4PQUA 3QYYA 2Z0GA 4K2JA 3HHLB 1B0PA 4WZQA 1FNOA 3KLIA 4ED5A 2W7AA 1HQUB 3W8PA 3WX4A 2HHQA 2KKHA 2VFRA 1IKYA 5EDWA 1EX8A 2V4QA 4JBCA 3D66A 2ZD1B 3LANA 1ITPA 1Z1ZA 4FNIA 2WOMB 4Q8EA 2W4PA 5E3PA 4NA3A 1TK0A 1B64A 1HFEL 1XR7A 3GFYA 3I0SA 4TN2A 4Y6IA 1NB2A 3HVRA 3C3LA 5C25B 2QFIA 4TNOA 4I2QB 5KFEA 2N7CA 4TQSA 2G2OA 2B7BB 2O67A 1O0PA 3QQCD 4JV5F 2AV5A 2RS8A 4JI6J 4CO5A 3DGPA 2XO7A 1RT5A 2ACMA 3FSXA 1URRA 4DOZA 1H2TZ 5MAOA 1KBRA 2IJNA 3MEDA 4F4ZA 1YRXA 3ZO7A 4KHPF 2AHOB 3M30B 1DY3A 3DOKA 5E5NA 2QRRA 2HAIA 5A8RA 2XY7A 3P6YC 2H1YA 2YQ0A 4MKAA 4NXMF 2NPIA 5LJ5Y 2DCLA 2F8EX 3CMES 2ZKUA 1S49A 4DXLA 4IDKB 5LMUF 1GK8A 5E7OB 2VG5A 2HWHA 1F60B 2M3DA 2E1CA 1T03B 1RJJA 2VUGA 2C1EB 3I0RB 1WF2A 4H4OB 3K5NA 1S0OA 1H74A 3AD7C 1WDDA 4GKKJ 3M2VA 3NGRA 1Q7YT 3M05A 3KJNB 2OTLS 3EVOA 3EUNA 4YDXA 4J7CA 3MF5A 1HYSB 3D5MA 3SQOP 1HBNA 1V5IB 4AYBD 3PW0A 3R1HA 3P5BP 1CSJA 4Z7CA 1FHTA 2JNJA 1FO1A 2MKYA 4ZCMA 4TY8B 5KFSA 2MKKA 4JI6F 4A8SA 2JJ4D 3CIMA 2Q1LA 3O3LA 5FDLA 3THTA 4DZDA 3K5MA 3TAMA 5HO4A 2N3LA 2J76E 2DH8A 1F2GA 3MWBA 5F8NA 2QLFB 3FMBA 1Y3KA 3GJQB 3V4IB 4HVZA 4Y34A 4BHQA 2CZ4A 3TEHB 2H4WB 2I1RA 1XQIA 4LBPA 4K4YA 3KHRA 2V69A 2VPXB 1U26A 4IG0A 1BC6A 2G1HA 4BWMA 2CPEA 2IJRA 4ANDA 2XHCA 1IR0A 3PCOB 3BO2A 2VC1A 3H98A 1HNIA 1M1KT 3OTOJ 1D9DA 4GVBB 4QWEA 1CJUA 3MR5A 1ZTWA 1VBXA 3T19A 1U6BA 3K7RA 4WIQA 2OELA 4ZVPB 3G8TA 2ZH8A 3KWMA 3QGGA 1S1UA 3B8HA 4OZ3A 4GKKF 3TJ9A 1K73T 4H4MA 4CYUB 4DUZJ 3K58A 2D41A 2BRLA 1MU2B 4J9VA 3T1YJ 1WEXA 2RU3A 1BQMB 2EK1A 4M5GA 4YB1P 2YKAA 1XK8A 1XBWA 1LFPA 4DS4A 1RT1A 4PEOA 2VPYB 1VHFA 1RXOB 5C5JA 3VZIA 5RUBA 4U8VA 2FQQB 3DXBA 3B54A 2M7SA 3G96A 1FKOA 2ZOFA 1NSAA 2BANB 3CJKA 3CDWA 2RF2B 3PV8A 1YLXA 2DPJA 4XK8C 3W1YC 1D3WA 4FF3A 5HVFA 2HZVA 1Z2ZA 1KEKA 1N5SA 1MG7A 2WW4A 1Y9OA 2VJVA 4FS1A 3IG1A 4USVA 1RB0A 2CQ3A 4JI4F 4X66J 5L38A 4LSLA 3C66A 2QFJA 4RNNA 5KG7A 2E9ZA 1K8AT 3E51A 1TV6A 2DK2A 3MMAB 4FF2A 1RTDB 1D09B 1X4FA 3KHGA 1XMOJ 1JXEA 4DN9A 3DLGA 1VQKS 2IMWP 4ELVA 2LA6A 1N5YA 3KYLA 1D0EA 2LMIA 4WFAQ 2Y1IA 4L6V3 4DV7F 2IFXA 5B0CA 1UMJA 2DBBA 4DUZF 2FVCA 2FHMA 3FQKA 2RQCA 3HVWA 3N5FA 3TYTA 1VQ6S 2Z2YB 5IT0A 1HNZJ 4K4VA 2DT9A 3KXDA 5BJRA 1Q8LA 2B9EA 3T5HA 3JXOA 5KTQA 4KGXB 2C2RA 4X4QA 2HFNA 2QE5A 1MSWD 4USHA 2YWHA 5FD1A 2DR5A 1XWLA 3CCJS 3CNQP 1SVDA 2FHJA 3MHYA 2WSEC 4PRFA 2YNHB 4NZ6A 1Q5VA 3HLUA 1HHQA 3QLHA 3MOZA 4X66F 2XB2D 1RABB 1NJIT 1X5SA 3CJ4A 4FYDA 2GIRA 1SQEA 3OQ2A 2FVSA 1N48A 2BKOA 4AD6A 4J9OA 2OH2A 2YNGB 2VG7B 5I3PA 3PW2A 1NK5A 2B4UA 1XMOF 1S6QA 4ZIVA 2B0GA 2LQ5A 2CPHA 3ISNC 3WC0A 4NCGB 1B0TA 1EETA 4CIOA 1RHRB 2OEMA 3MPDA 2HYIB 4BWJA 5EHHA 2RRAA 1KOOA 1VC5A 2E1PA 3AA8A 1VRTA 1FDBA 1UAWA 2AZ3A 4CLUA 5HANA 3HXMA 1HNZF 1TTHB 5C24A 1B3TA 1KQFB 2BX6A 2R7WA 4R25A 2CQ2A 1X4CA 4OV6A 2UUAJ 4X4PA 4Y28C 1NZ8A 3NXZA 2P6SA 4CO0A 4CNYA 5H9EK 4MIBA 2WBRA 4M63A 3BR8A 4M5LA 5I4MA 3OVBA 1PG5B 3CJ5A 4DLGA 3HK2A 4K4WA 1L5UA 3ILOA 2QMXA 2GVZA 2V2KA 4ICLA 5F8GA 2QLWA 3C6TB 3HSZA 5HROA 3ZTSA 1VC6A 2L41A 5AE2A 5EUHA 1MWZA 1RKIA 3AD8C 4ECVA 3HMJG 2V4JA 1RCXB 3MAQA 2AJ0A 3PW4A 1HI1A 4TKTA 3WDOA 1FJEB 1S1XA 3CDAA 2P9GA 3RRHA 4OYOA 2DD8S 4HHJA 4F4XA 4KV8B 4ZVUB 3TZXA 1KVIA 1S6UA 2JWNA 2VB6A 3C19A 4JUZA 3MI7X 5F9NA 4EBEA 4Q5VA 3BN7A 1S0NA 2HMIB 2L48A 3JSBA 5H1SV 2HFUA 1ZOTA 1KD1T 4EO8A 4DR6J 4CP5A 2F4VJ 3KUGA 3GIMA 8AT1B 4OIXA 2UUAF 3DLBA 3GZ7A 4OYXA 1UVJA 4F25A 3CUNA 2HURA 3PY8A 4DV3J 1S9EA 2CPYA 1KHVA 5KT6A 3LWLA 2HEKA 1PYOB 3BGUA 4OFZA 1FRXA 1XERA 2VQEJ 1IKVA 2G0IA 2GJ2A 3Q8RB 3FRYA 1FE4A 3MCSA 4BBYA 3BYRA 1R6VA 4JV0A 3MGJA 3TWZA 3CPWR 3LPYA 3HVTA 2MLYA 5FLXY 4IO9Q 3RBXA 4ZCKA 2A0FB 2X3GA 2YKMA 3MTKA 3I96A 3GP9A 1RWXB 3KHLA 1EQ0A 1IM6A 1TVRB 4RNOA 1AT1B 4X4NA 3S8SA 2OMOA 3KLHB 2XSJB 4F67A 1NPRA 4IUFA 2PE8A 1P1LA 3FEZA 3M6XA 2JDJA 2HFSA 4USKA 3DC2A 5LXRA 2YPZA 2HHSA 1S79A 5H9FJ 1PBUA 2QIFA 2CQHA 4U7CA 1KS2A 4NLTA 1BWEA 3OTBA 3W2WB 1S0VA 3X1LB 2ADBA 2YNFB 4Q0BB 1U1NA 2UVUA 5A8WB 1JLCB 3FBCA 1VFJA 4KJIA 2GVDA 4DR6F 4NCBA 2YTCA 2CQ1A 3QT5A 2QL5B 3NRBA 3EXCX 3NEKA 1WTFA 2C22A 4U67Q 4DX7A
chains in the Genus database with same CATH topology
3MPDA 4W98A 3FBFA 1HLWA 3Q8YA 1LEOA 2DY9A 4DUTA 3VGTA 1NDLA 1KDNA 1XQIA 5IOLA 2VU5A 3EE3A 3ELHA 4FKXA 3B6BA 4DI6A 1BE4A 2HVEA 3FBBA 3FKBA 3VVTA 2AZ3A 3VGVA 1PAEX 3FC9A 3Q83A 3GP9A 3ZTOA 3R9LA 4F4AA 4ANDA 2AZ1A 3FBEA 2HVDA 1U8WA 1NCLA 3L7UA 2DXDA 4WBFA 2BX6A 3EMTA 4KPCA 4O0NA 3Q86A 3BBFA 3EM1A 2ZUAA 4ENOA 1NB2A 3ETMA 3GPAA 3Q89A 1B4SA 2DXFA 2DXEA 3NGRA 3EICA 4ANCA 4UOHA 5BXIA 1F3FA 3Q8VA 3G2XA 1S57A 3EVOA 4C6AA 5CABA 1EHWA 1S59A 3NGTA 3PRVA 3JS9A 4FKYA 1HHQA 1F6TA 1LWXA 4CP5A 1NDKA 1BUXA 1NDPA 3WX8A 1NDCA 4DZ6A 2NCKL 1UCNA 1S5ZA 1NHKL 1NSPA 1VYAA 1WKJA 1WKKA 2HURA 1WKLA 3EVMA 2BEFA 2DYAA 5C7PA 1MN9A 3FBCA 3DKDA 1B99A 3BH6B 1HIYA 3BBBA 3NGUA 4S0MA 1NUEA 1JXVA 1NSQA 3ZTPA 1XIQA 3ZTQA 4UOGA 2B8PA 5CAAA 3EJMA 3EVWA 2CWKA 3VVUA 4UOFA 3ENAA 4ANEA 4HR2A 3VGSA 4F36A 1NSKL 3VGUA 2B8QA 3FCWA 3NGSA 1NLKL 1K44A 3DDIA 1MN7A 3ZTSA 3B54A 1NPKA 3BBCA 3FCVA 1PKUA 3Q8UA 3BH7B 3PJ9A 3ZTRA 4EK2A 1W7WA 1BHNA 1ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPD A;  4W98 A;  3FBF A;  1HLW A;  3Q8Y A;  1LEO A;  2DY9 A;  4DUT A;  3VGT A;  1NDL A;  1KDN A;  1XQI A;  5IOL A;  2VU5 A;  3EE3 A;  3ELH A;  4FKX A;  3B6B A;  4DI6 A;  1BE4 A;  2HVE A;  3FBB A;  3FKB A;  3VVT A;  2AZ3 A;  3VGV A;  1PAE X;  3FC9 A;  3Q83 A;  3GP9 A;  3ZTO A;  3R9L A;  4F4A A;  4AND A;  2AZ1 A;  3FBE A;  2HVD A;  1U8W A;  1NCL A;  3L7U A;  2DXD A;  4WBF A;  2BX6 A;  3EMT A;  4KPC A;  4O0N A;  3Q86 A;  3BBF A;  3EM1 A;  2ZUA A;  4ENO A;  1NB2 A;  3ETM A;  3GPA A;  3Q89 A;  1B4S A;  2DXF A;  2DXE A;  3NGR A;  3EIC A;  4ANC A;  4UOH A;  5BXI A;  1F3F A;  3Q8V A;  3G2X A;  1S57 A;  3EVO A;  4C6A A;  5CAB A;  1EHW A;  1S59 A;  3NGT A;  3PRV A;  3JS9 A;  4FKY A;  1HHQ A;  1F6T A;  1LWX A;  4CP5 A;  1NDK A;  1BUX A;  1NDP A;  3WX8 A;  1NDC A;  4DZ6 A;  2NCK L;  1UCN A;  1S5Z A;  1NHK L;  1NSP A;  1VYA A;  1WKJ A;  1WKK A;  2HUR A;  1WKL A;  3EVM A;  2BEF A;  2DYA A;  5C7P A;  1MN9 A;  3FBC A;  3DKD A;  1B99 A;  3BH6 B;  1HIY A;  3BBB A;  3NGU A;  4S0M A;  1NUE A;  1JXV A;  1NSQ A;  3ZTP A;  1XIQ A;  3ZTQ A;  4UOG A;  2B8P A;  5CAA A;  3EJM A;  3EVW A;  2CWK A;  3VVU A;  4UOF A;  3ENA A;  4ANE A;  4HR2 A;  3VGS A;  4F36 A;  1NSK L;  3VGU A;  2B8Q A;  3FCW A;  3NGS A;  1NLK L;  1K44 A;  3DDI A;  1MN7 A;  3ZTS A;  3B54 A;  1NPK A;  3BBC A;  3FCV A;  1PKU A;  3Q8U A;  3BH7 B;  3PJ9 A;  3ZTR A;  4EK2 A;  1W7W A;  1BHN A;  1ZS6 A; 
#chains in the Genus database with same CATH topology
 4DV5 J;  3Q8Y A;  2KVI A;  2VQE F;  1JXL A;  1DHM A;  4K4T A;  1FDN A;  2FZG B;  3J7Y I;  1G3O A;  3RW7 A;  2HK3 A;  1W2B R;  4A8Y A;  4H4K A;  2AWZ A;  1VQ7 S;  3FZB A;  2BJ9 A;  2DNZ A;  4KYZ A;  4C4W A;  3LPE A;  3PVX A;  3HFV A;  3W5Z A;  4K8R A;  2OPQ A;  3GFX A;  1YQH A;  3I32 A;  2HHH F;  3AB2 B;  3X3U A;  5CA5 A;  1CUL A;  1ZPV A;  4OZN A;  2AEM A;  4ZVG A;  4J9R A;  2FGC A;  2RAQ A;  3M8Y A;  2DGQ A;  2GO8 A;  1SL0 A;  1RHU B;  3CC7 S;  1OJ4 A;  3IMQ J;  3TVK A;  2DNN A;  1NHV A;  3QFH A;  4Y2I A;  2Y0S D;  3UN2 A;  1MML A;  3C8Y A;  3ZZT A;  3QZ8 A;  2VFT A;  4OZL A;  1WF0 A;  1IVZ A;  1FNM A;  3U1L A;  3N0V A;  3MM6 A;  3PKY A;  4NMX A;  3DNC A;  2LVW A;  2NXJ A;  1ARO P;  4KGM A;  1VRU A;  5CH7 B;  4KHR A;  1QUV A;  5KFX A;  4LF5 J;  1RTJ A;  4DV5 F;  2GJF A;  2IJF A;  4ENO A;  1JKH B;  1KTV A;  2CVE A;  2HIQ A;  5BXI A;  3Q8Q B;  2D74 B;  2WSF C;  4C48 A;  4MTP A;  3E2E A;  4C8Z A;  1Q16 B;  1I51 B;  5EGY A;  3UDV A;  2CFX A;  3MM5 A;  4KE5 A;  1KHW A;  1F9E B;  2QT7 A;  1MRO B;  2ACY A;  4A8W A;  3A13 A;  5DGB A;  2ZJR Q;  2RDD A;  4CI0 B;  4BDP A;  5KG4 A;  5GMK a;  4EBC A;  3QWP A;  5IZH A;  1CJV A;  4TLR A;  2BYC A;  1RLD A;  3A3P B;  4CLS A;  2H65 B;  4PYD A;  2BZ2 A;  2MXY A;  4RNH A;  2NXE A;  1U09 A;  4QCL A;  3MZI A;  4U8Y A;  5I42 A;  2OP5 A;  5KFR A;  3QT7 A;  1NBE B;  1UW4 A;  4R0E A;  3L7O A;  3J80 Y;  1RUS A;  4DUT A;  3M1V B;  4OLO A;  3BPS P;  1JLE A;  5F0U A;  2EEY A;  3I4H X;  2MGZ B;  4ID5 B;  2GZO A;  4LSZ B;  1TEL A;  2HVD A;  5IXU A;  4RUB A;  3DRY A;  2LU2 A;  4DQP A;  2J6T A;  3MM7 A;  3H8Y A;  1SL2 A;  2HLT A;  1BLU A;  5E3Q A;  3FEX B;  4LF5 F;  2EXU A;  3PIP Q;  2GQC A;  4NAS A;  3D1O A;  1Q81 T;  4ER8 A;  2I38 A;  2UV8 G;  4BC7 A;  5KAK A;  4K4S A;  5D3G A;  4CH1 A;  4EYH B;  2QSF A;  3BH6 B;  4DQI A;  5CZX A;  4KY3 A;  3EZ5 A;  3TVZ A;  2J8S A;  2UXC F;  4MFB A;  4C3M A;  4DSL A;  1Q95 G;  4B3O B;  3D3C J;  3NLC A;  6FDR A;  1S1V B;  3DCA A;  2W9B B;  3QGP A;  2ZUG A;  1TKZ B;  1PJ7 A;  4OYB A;  4X64 F;  2N3O A;  2XHW A;  1BD6 A;  1TR0 A;  1IN0 A;  2HHX A;  4HI2 A;  2M5Y A;  2K1R A;  9ATC B;  3AOD A;  1SI9 A;  5J2P B;  3BKF A;  2JVO A;  4IG3 B;  3OFH A;  1VK8 A;  4O3S A;  4NLO A;  2C2M B;  4ALZ A;  4CT9 A;  3MAH A;  4ERD A;  2V34 A;  4MK7 A;  3KMQ A;  5G4D A;  3H4B A;  4N7T A;  1U49 A;  4ECQ A;  3OPK A;  1T7P A;  3I5A A;  3GB0 A;  3CWJ A;  2BV3 A;  1JLF A;  1YJU A;  4ECW A;  1YBU A;  2R8H A;  4ZP8 A;  1ROF A;  4IR1 A;  3BQ2 A;  1PO6 A;  5E2Q A;  2MZS A;  2IVF B;  1UTA A;  2BKP A;  2Q6C A;  4L72 B;  3HSD A;  2NQP A;  5A6P A;  3OXL A;  1NZA A;  2F65 A;  1OSC A;  3UD3 P;  2VC0 A;  2Y1R I;  3MEE A;  2F1F A;  2P2C B;  3ONQ A;  5HQL A;  1JNR B;  1I1G A;  3ISZ A;  1M5H A;  1GTH A;  4R5P B;  1AW0 A;  3AJ2 A;  3MTJ A;  5D0R A;  3BDE A;  4Y2A A;  3EGW B;  2FUG 9;  2M8D B;  1O51 A;  5AXN A;  2HLU A;  4QW8 A;  5IWA F;  3HFZ B;  3QZ7 A;  5DG7 A;  2PFD A;  1U8W A;  1PSD A;  2L08 A;  3F56 A;  1U47 A;  3D28 A;  4J9M A;  4OJG A;  1WSR A;  5LSR A;  4WP9 A;  4FBT A;  3T5K A;  3FSI A;  2W4C A;  2LXI A;  3GYX B;  3V5R A;  1F6T A;  4YB5 A;  1KR4 A;  1TUV A;  2HS4 A;  2KRB A;  4PWU A;  3FVY A;  2PD1 A;  3BV8 A;  1NJZ A;  1JLG B;  1VQ5 S;  2KFZ A;  1X9M A;  3ZC4 A;  3V6D B;  2W8L A;  4PQA A;  3ZTQ A;  4JI3 J;  3QRQ A;  2B51 A;  4B3T J;  4WTO B;  2KDO A;  1HBM B;  2E44 A;  1U02 A;  1TKX B;  3Q8P B;  1UZD A;  3FCW A;  2IVM A;  1UET A;  2F9J A;  3GON A;  2G4B A;  3BH7 B;  5HL7 Q;  4WFN Q;  3LP0 B;  2LXU A;  3K0J A;  3M8Z A;  4F0M A;  3VR1 A;  2G0J A;  2RVJ A;  3KJQ B;  3DM2 B;  4CLT A;  3OTC A;  2AYM A;  2Z30 B;  1JIH A;  2XZT B;  2V8H A;  3ENW A;  1YBA A;  2R7T A;  4FXV A;  2ZIT A;  1CC8 A;  2MQM A;  2JOQ A;  3ENV A;  4QR1 A;  3Q2S C;  1WAC A;  2GHP A;  1LWE B;  4KRW A;  1FKA F;  5B0A A;  5LSO A;  3C16 A;  1EHW A;  1S1W A;  3CCV S;  4G3I A;  1DTT A;  4ZA1 A;  2QYG A;  3D4J A;  1M5V C;  3BN4 A;  1FK9 A;  2U1A A;  1L3S A;  3CB4 A;  5K14 A;  4WPA A;  4W90 B;  2OPP A;  4B3S J;  2VBX A;  4X65 J;  4PXC A;  1X0P A;  3G82 B;  2B5J B;  2R8K A;  2ZBI A;  3DI6 A;  2E7W A;  3NGK A;  4KO0 A;  2UUB J;  2C2D A;  3FCH A;  3KHH A;  4ETX A;  3J7Y U;  1JMT A;  4OX9 J;  3BGR B;  1T05 B;  5D0E A;  2VBY A;  3PX0 A;  1L3T A;  4B9M A;  1FT8 A;  2RB7 A;  2VPZ B;  4ED8 A;  1OPZ A;  1IKW A;  4JI3 F;  5D0H A;  4B3T F;  4DR4 J;  4A8O A;  3FFI B;  4ZIW A;  1NPP A;  2AU0 A;  1TKT B;  1U0H B;  4DR5 F;  1NK7 A;  2RD5 C;  2X1A A;  1YHQ S;  4WFB Q;  4D3H A;  1VS3 A;  4YHH F;  2AKW B;  2Y1J A;  2FJW A;  2OGU A;  2EFO A;  4NLR A;  2BKN A;  5C42 A;  1S0M A;  4LRD A;  3QO9 B;  2AP6 A;  1P9Y A;  2B56 A;  4FVC A;  2Q6B A;  2CWX A;  1GFW B;  2BW2 A;  1JX4 A;  2Q3P A;  2ZC3 A;  4CTA A;  1KTQ A;  2HW3 A;  4OX7 A;  1HI0 P;  1CJK B;  1ZH5 A;  2Y3Y A;  4EEY A;  4ILR A;  3CVK A;  3DKD A;  1HPZ B;  5CHC B;  1DTQ A;  1VC0 A;  2R2T A;  1IBM J;  4ZVH A;  4RW8 B;  2UXB J;  1FER A;  1WWH A;  4QR2 A;  4B3S F;  1CS4 A;  2FVQ A;  2RDI A;  1YTY A;  8ATC B;  2C3P A;  3ZTR A;  3PNI A;  1R6Y A;  3BQ1 A;  3I6P A;  1HBU B;  2AX1 A;  4NRU A;  1C1C A;  4K50 A;  2UUB F;  1CVJ A;  3F44 A;  1VQ4 S;  3ZZR A;  2CVI A;  1SJ4 P;  1RAE B;  3DMJ B;  1RAI B;  4OX9 F;  4XAK A;  2BJ7 A;  1RT7 B;  4DPX A;  3JSR A;  3A8I A;  2MHN A;  2HG4 A;  2PEB A;  1H72 C;  3GJT B;  4DPO A;  1AXQ A;  4DR4 F;  3RG6 A;  3HVA A;  3LP2 B;  4PG6 A;  5IQQ A;  3GCW P;  4UTG A;  2Z4P A;  5KFK A;  2O01 C;  1SQF A;  3H5U A;  1VQY A;  4QIW D;  1WTB A;  4ED7 A;  2DGS A;  1WOR A;  3JSY A;  3U27 A;  2B4P A;  2CJA A;  4USW A;  5KFP A;  1GXL A;  5SZT A;  3MD3 A;  4ZVO B;  4TU7 A;  5BYQ A;  1J5O B;  3BR9 A;  5E41 A;  1VIO A;  3Q24 A;  4DF8 A;  4FXD A;  3BEG B;  4DR7 F;  3C14 A;  3IBF B;  2PC6 A;  4E2F B;  2FC9 A;  4KC5 A;  3VGS A;  3VF0 B;  3DDI A;  2HBQ B;  1M5K C;  5KFF A;  4DQR A;  4P7T A;  1WC1 A;  2GHW A;  2YWW A;  1IBM F;  4PQU B;  1HNW J;  3FBB A;  2QSW A;  3KLI B;  1U6F A;  1TL3 B;  1WG4 A;  3FBE A;  3PDN A;  1D8Z A;  3MUM P;  4Y2K A;  4CLL A;  2A18 A;  2NLW A;  4RO0 A;  1UJ6 A;  3P49 B;  3D9B A;  3IM8 A;  3I0S B;  3QBC A;  2IY5 B;  2XTJ P;  3N5B A;  1BGX T;  4B3M J;  3R5J B;  1NRK A;  1OQ6 A;  2GQ2 A;  1HWU A;  3GV5 B;  2VIH A;  5L1L A;  2E5I A;  4JI5 F;  1NDC A;  3DGP B;  2MKJ A;  4USM A;  4G65 A;  2PGC A;  4YDD B;  5KFY A;  3Q8S B;  2HHT A;  4URS A;  3T3F A;  2F9D A;  2XMM A;  1KQG B;  4YFU A;  1MWY A;  1RTI A;  2R7U A;  1NH7 A;  3DOK B;  2EC0 A;  4F3Q A;  5JMN A;  5A8R B;  3KK1 B;  2J7U A;  2VOO A;  3W5Y A;  3T1A A;  1OIA A;  2L9N A;  1XEZ A;  1X5T A;  2VFU A;  3VGT A;  3N28 A;  3QSI A;  5KFO A;  4K0K J;  2VU5 A;  5JXS A;  2IBK A;  2X1F A;  4FF4 A;  3UR0 A;  4D3G A;  2VG5 B;  3PG9 A;  2CPI A;  4K59 A;  4UZC A;  3HZE A;  2ZNY A;  2HGL A;  2EBE A;  4BS2 A;  5DDP C;  1SB6 A;  2H3E B;  5IV4 A;  1KFS A;  1HNW F;  5HVG A;  3CD7 A;  1OPI A;  3M2V B;  2RIL A;  3BM7 A;  2XCA A;  3E3X A;  2MQN A;  2Y9H A;  3JS9 A;  3R5C A;  4IQX A;  3VCD A;  4QWB A;  1HBN B;  2VFV A;  1IKX A;  5KFQ A;  3V2U C;  2XS2 A;  3H0P A;  5A8K A;  1HL6 A;  1XNQ J;  1FWK A;  1J27 A;  3KDO A;  2KJV A;  3BBB A;  3UD5 A;  3RB0 A;  3BGO P;  1NKE A;  2J8A A;  4R8U A;  1L3K A;  4GO7 X;  4AXJ A;  3V4M A;  1VGY A;  5KG2 A;  4C3L A;  1RWW B;  1L3V A;  3DOL B;  4IO1 A;  1KSP A;  2DNH A;  3AY0 A;  4CDI A;  2E9R X;  5KFB A;  3K2Y A;  4DFP A;  4Q2M A;  2FJD B;  4URQ U;  4ZPT R;  3EGV A;  1GT8 A;  2ZFH A;  4IG0 B;  2WON A;  3JQJ A;  2DHX A;  1QTM A;  2NSC A;  1UFL A;  3OXF A;  4OZ5 A;  3M2U A;  3LW5 C;  1LOU A;  2MJU A;  1HNI B;  4OHZ A;  2BR0 A;  5HSP A;  2ZE2 A;  1CJU B;  3KUE A;  5LL6 d;  3HJF A;  2ZH9 A;  4OYP A;  1TP7 A;  3F41 A;  4F8R A;  2FLN A;  4OV1 A;  4J9U E;  1LK7 A;  3V81 B;  2CJQ A;  4P52 A;  1S1U B;  4DSF A;  4NLV A;  5KFI A;  4H4M B;  2BM0 A;  3FGV A;  2LDY A;  2P9E A;  2KHC A;  2XI2 A;  1QVF R;  1RT1 B;  1JJ2 R;  4JP8 A;  2JRS A;  2FDN A;  3T5J A;  1FKO B;  3NKY A;  3PYG A;  5A0Y A;  2BVZ A;  4P72 A;  4YY3 J;  1XTZ A;  4IR9 A;  2QLB B;  1HWI A;  2MQQ A;  2Q43 A;  1QAI A;  2ZHB A;  5HP1 A;  5KFA A;  5KFT A;  1KLM A;  3GSD A;  2QA1 A;  4LSN B;  6AT1 B;  4OHX A;  2GMJ A;  3Q86 A;  2ZUA A;  1PAU B;  2NR0 A;  3IG1 B;  2CPF A;  2WVD A;  2NUU G;  4K2X A;  4CLY A;  2NS1 B;  1SKR A;  3NGT A;  5THW A;  3WC2 A;  2NRE A;  3W60 A;  2XLJ A;  3HHN B;  4OX8 A;  3FSY A;  2BDP A;  1TV6 B;  2XMU A;  2RKI B;  1FEE A;  4CH7 A;  4LR9 A;  1UVI A;  3L09 A;  1X60 A;  2H5J B;  1UA1 A;  3DLG B;  1N5Y B;  1FVQ A;  2H54 B;  2MY7 A;  2VOD A;  4RX6 A;  3EJM A;  1V3Z A;  2JSX A;  1YIJ S;  3HD2 A;  3SCI E;  2YKO A;  3MUT P;  5DJB A;  2EI5 A;  3RU0 A;  4IFV A;  3IRW P;  4PWW A;  2DHG A;  2NXC A;  1U45 A;  1FE0 A;  1IBL F;  5K8P A;  2OEK A;  2KI2 A;  1ZM3 A;  3SV3 A;  2HRT A;  1R31 A;  1FES A;  4LF7 J;  2KO1 A;  4WTY A;  1VK3 A;  2DY1 A;  1BWV A;  4QIF A;  1RK8 A;  2I6W A;  4Z2X A;  4YY3 F;  4J9N A;  5LXY A;  1DLO A;  3ZXW A;  2COL A;  3T6B A;  3H7H B;  3DHW C;  1WI8 A;  2WVF A;  3PXG a;  3U1N A;  4DQS A;  3W9J A;  3GLJ A;  3G8Q A;  2J9C A;  3QLH B;  1N88 A;  4RW7 B;  3TZY A;  5DG8 A;  4RW6 A;  1XN9 A;  1WKL A;  5ETP A;  1S12 A;  5HMY A;  4F2R A;  3A12 A;  1S99 A;  1HIY A;  5E3A A;  4NLU A;  2VQF J;  1QAJ A;  5J2Q A;  2FPH X;  1RWM B;  1DZ5 A;  2DGU A;  1N33 J;  3V6J A;  4NZ7 A;  1QTN B;  2V5H G;  1SJQ A;  3DYA A;  7FD1 A;  3QMQ A;  3LGM A;  2FB0 A;  2W1B A;  4JI8 J;  2HHU A;  2VBW A;  3D0I E;  1V3R A;  2DKO B;  2CNN B;  1A0O B;  3VWS A;  3FKB A;  2XCP A;  3HHL A;  5DZ6 A;  4RNM A;  4DV2 J;  3RR8 A;  3KLE A;  4NEY A;  2B4O A;  3RTV A;  1U1R A;  1N54 B;  1NME B;  1S6P A;  1RIS A;  4B9L A;  3C15 B;  4DJB A;  3GPA A;  5C24 B;  4M5J A;  4YN3 B;  2C28 A;  1N36 F;  1T9V A;  1N0V C;  4ECX A;  3THV A;  4LF7 F;  4V19 X;  1S48 A;  3AA9 A;  3NS7 B;  3S01 A;  3GTY X;  1X5O A;  2NYH A;  5H9F K;  4HHH A;  1MN9 A;  1R89 A;  3IWX A;  1VOM A;  2KXF A;  3KG1 A;  1WUU A;  5DDR C;  4WK1 A;  3ZZZ A;  2J6S A;  2V6A A;  3BKU A;  3N9U C;  4WP8 A;  2GVZ B;  2IRU A;  4ICL B;  3A8E A;  2ZH3 A;  4DU8 A;  3K59 A;  5HBM B;  2QZ8 A;  3FCV A;  2ZZN A;  4L76 A;  2AW0 A;  5HRO B;  1ZS6 A;  3OHB A;  4CLP A;  3NCQ A;  2VQF F;  1YWX A;  4Y2C A;  2V4J B;  1N33 F;  1E6V B;  2QO3 A;  2N82 B;  3MXH P;  2J6U A;  5L8R C;  2W01 A;  1S1X B;  2BJ3 A;  2KRR A;  2QA4 S;  2YX4 A;  3OXG A;  3ITH A;  3TO8 A;  3M9N B;  3GV8 B;  4JI8 F;  1WF1 A;  4DHV A;  1YRU A;  3MMC A;  3VAG A;  1T03 A;  2AT1 B;  3I0R A;  5FLX U;  4H4O A;  5B0E A;  2MZ1 A;  2D3U A;  2HQI A;  4ZLJ A;  4DV2 F;  2BE2 A;  3KJV A;  1U6Z A;  4UQG A;  2O5D A;  1VI7 A;  3MEC A;  3M8P A;  1LNQ A;  2XMV A;  4CNZ A;  2PII A;  4ES1 A;  1ZET A;  2XNQ A;  1N34 F;  4OI1 A;  2EBG A;  5F8J A;  3OFE A;  1RT6 A;  5CCM A;  4GO5 X;  4WXO A;  1QAX A;  3SCJ E;  3HUL A;  2ZC4 A;  2DGV A;  3D68 A;  4NL5 A;  5BR8 J;  2BXJ A;  1Z4U A;  2RML A;  2ZKT A;  1IKV B;  4I56 A;  4ETZ A;  1S1T A;  4YP3 A;  1M1H A;  1U7L A;  3I4P A;  1WHV A;  4FYV B;  4A8K A;  2DNL A;  2Y0B B;  2LU1 A;  2YH0 A;  3HVT B;  2M0G B;  3JB9 k;  3SCK E;  1SIZ A;  2H5E A;  2YKM B;  2VZ9 A;  4MJK A;  1LK5 A;  3TZW A;  1UEV A;  3FJ2 A;  2WBM A;  4MK8 A;  2MPU A;  2MKS A;  1S59 A;  2SXL A;  1PIL A;  2XC9 A;  5ETV A;  4I68 A;  4ZKA A;  2CQP A;  1V3S A;  4ECZ A;  5AT1 B;  2G0C A;  3A8K A;  3A1Y G;  1YKW A;  3KNG A;  2J5A A;  4HH1 A;  1S77 D;  4OYA A;  4P2X A;  1XR6 A;  2YX7 A;  3BZQ A;  1ACM B;  1ZM2 A;  2ZBP A;  2GVD B;  1M90 T;  1WHX A;  2ADC A;  3FQL A;  3SV4 A;  4JV2 A;  3OSN A;  3HPO A;  1EP4 B;  1BQM A;  1WG5 A;  2LXF A;  1BHN A;  1LV5 A;  2CJX B;  1C4A A;  3LAK A;  4WJB A;  4CM0 A;  3CC4 S;  5BR8 F;  3HSG A;  3PFE A;  3UCU P;  2AMC B;  1FX2 A;  5IT9 U;  3CJ2 A;  2MKI A;  2DXD A;  3TAN A;  1J2V A;  4ATN A;  5ETM A;  4HL9 A;  4L73 A;  5K5M A;  1W25 A;  3D1H A;  1Q53 A;  2XYG B;  2XS5 A;  1T0T V;  3G87 A;  3HP6 A;  4PG4 A;  3DOM A;  4ED6 A;  3R6G B;  4JB8 B;  2AD9 A;  2GGP A;  3V6H A;  2OPQ B;  3IWL A;  4B9V A;  1HBO A;  1UFK A;  5J1E A;  3JTO A;  1CUL B;  1LWX A;  3C2P A;  3PW7 A;  4P7V A;  3G4S S;  4UT4 A;  2W2P P;  4CLF A;  1BY9 A;  3P96 A;  4O44 B;  2FVR A;  4XPC A;  1RTD A;  1V6H A;  3IS9 A;  4P75 A;  5AXL A;  2BUN A;  2P9C A;  2MB0 B;  4A4J A;  4B9T A;  4RUA A;  5L1I A;  1Y0H A;  2QC3 A;  3Q8U A;  1HD0 A;  4QJV A;  4KBI A;  2XO6 A;  2OKQ A;  4C3K A;  4OI2 A;  3H2L A;  3NOC A;  4RR5 A;  1BE4 A;  2FJX A;  3OW2 R;  2UXD F;  4F4A A;  4JI0 J;  3CCU S;  1N6Q B;  4FYX B;  1VRU B;  1TL4 A;  1YG0 A;  2JH3 A;  1S9G A;  1RTJ B;  3HD1 A;  3J80 U;  4UOH A;  1TL7 B;  2AF6 A;  3D1Q A;  4KFB A;  4A8F A;  4O23 A;  4J91 A;  4MIW A;  4F3M A;  2HS3 A;  2K8G A;  4H4K C;  1C1B B;  5CYQ A;  4NWB A;  5KT4 A;  4RBU A;  1B0V A;  2A10 A;  3EVM A;  2L9D A;  2K3I A;  2DRD A;  1UPP A;  3B4M A;  3W8G A;  2RUS A;  5KT5 A;  1RU2 A;  1WOO A;  1C0T A;  3CMQ A;  2UP1 A;  2AQ4 A;  4GKJ J;  2R3V A;  1CJV B;  4DDF A;  1RKJ A;  4LF8 J;  1WC4 A;  2EFV A;  2V0N A;  3DXS X;  1S97 A;  3CCE S;  1YZ6 A;  1L3U A;  5I42 B;  4QW9 A;  1UFW A;  2KT5 A;  2KN4 A;  2BAC A;  4M5M A;  1AYE A;  1M0S A;  2KTQ A;  4X84 A;  4DSI A;  3EDQ B;  1JLE B;  1YBT A;  4H54 A;  3RW6 A;  2R7Q A;  4ZVS B;  5ETN A;  1VBK A;  1SBR A;  2ZNZ A;  2BW7 A;  2BJ8 A;  1Q86 T;  1LW0 A;  3T9Z A;  4O0I A;  4LR7 A;  3MEK A;  1X8D A;  1UZH A;  2H5I B;  5HQ8 A;  1VJQ A;  4JI0 F;  3MM7 B;  1R0A A;  1OYE A;  4PPD A;  3EXY A;  4K4X A;  4PG7 A;  4M5I A;  2MZT A;  4RPF A;  3KLV A;  3CD5 A;  2VV5 A;  2EW9 A;  4WYW A;  2ZH5 A;  1X4A A;  4OYI A;  3H90 A;  1RLC L;  3BO4 A;  2DTJ A;  1NK8 A;  2VA2 A;  4UOC A;  5D3G B;  4EUV A;  4NI2 A;  4UOG A;  3LP1 A;  3LF0 A;  2CXE A;  2KJW A;  2DR6 A;  5DS7 A;  4MFB B;  4QPT A;  4XO0 A;  1ZZN A;  2QMW A;  2DCU B;  3R3T A;  2V67 A;  1N5V A;  4GKJ F;  3HHK A;  2NXN A;  3MPU B;  3KUH A;  1NU4 A;  4LF8 F;  1NK0 A;  4M95 A;  4HAC A;  4ZP9 A;  4RUC A;  3GFZ A;  3L3C A;  1QUP A;  1HD1 A;  5I3Q A;  3G9C A;  3P5T L;  4IRK A;  2RE1 A;  3QJJ A;  3MR7 A;  5HLF A;  3DRP A;  4AL6 A;  2AGQ A;  2XEX A;  5F3Z A;  1X4E A;  4NYP A;  1D8Y A;  3EIC A;  2IC3 B;  4X4V A;  1WEY A;  1YJ7 A;  2MZR A;  4O4R A;  4LMZ A;  2E9T A;  1BQX A;  2HFO A;  1FJC A;  3VV2 B;  3BF4 A;  4O3P A;  4K7Q A;  4RKU C;  4C8L A;  1CLF A;  2JEG A;  3PKM A;  1RQ0 A;  3AJ1 A;  2C3O A;  1Q8K A;  4NLY A;  1WKK A;  2HMI A;  5HQM A;  5KFW A;  4ELU A;  4C8O A;  1PYT A;  3D0G E;  1LQ9 A;  1W2I A;  2J9E A;  4N5S A;  1FJG F;  4UW2 A;  2F40 A;  2DVI A;  3IWN C;  3MEE B;  3GSI A;  4B17 A;  4ECU A;  3QGI A;  3UNG C;  1QSY A;  3OL6 A;  3QPI A;  1JLB A;  4OZ1 A;  1CG2 A;  1CQM A;  3W63 A;  1FWL A;  3MUV P;  2Y8W A;  3HF5 A;  2J9D A;  1CJT A;  1UWB B;  4C11 B;  4CO2 A;  2LP4 A;  4Y65 A;  3MCO A;  2VPW B;  4ES2 A;  1S10 A;  2AX0 A;  4TLQ A;  4OHY A;  5B0F A;  3RBE A;  4ECR A;  1GMU A;  4L75 A;  2AJQ A;  3I82 A;  2XSJ A;  1C0U A;  4N56 A;  3E8O A;  2ZHA A;  5ETQ A;  4PWD A;  2AEJ A;  2YVS A;  8RUC A;  3H25 A;  3Q23 A;  3TR5 A;  3LO3 A;  2OIH A;  4CQ1 A;  3MR2 A;  4RW4 A;  1YJV A;  4JI4 J;  4LF4 J;  1T3O A;  4WFZ A;  2YNF A;  1ZA2 B;  2V8D A;  2WK4 A;  5A8W A;  2ATL A;  1VIX A;  1JLC A;  5DGA A;  3GIL A;  4DSE A;  3HZG A;  2KFN A;  2GMH A;  3MM9 A;  3DRR B;  5F3T A;  1S76 D;  2V50 A;  2D3O R;  5IV3 A;  1SL1 A;  3PIO Q;  4DFK A;  2QMU B;  1RWV B;  4HTJ A;  4HTI A;  1VHI A;  3IBW A;  3DU6 A;  3MM8 A;  2JL9 A;  2OI2 A;  2HVZ A;  3NOG A;  2F4F A;  5KFM A;  5FII A;  1NHU A;  2DIT A;  2FZK B;  2FJE B;  2FZC B;  1UJ4 A;  4PXE A;  3PYE A;  4DV7 J;  3RJM B;  1RP5 A;  4CRJ A;  3O8W A;  4LFA F;  1XMB A;  2HSE B;  1O6X A;  3NWR A;  3SDE A;  1SPB P;  2C42 A;  3A8J A;  4BLG A;  3CJ0 A;  1WNE A;  1HQE B;  1FI4 A;  2MZQ A;  2PI4 A;  5ETL A;  1S1W B;  1X4D A;  4YQW A;  1NO8 A;  2J0Q D;  2A1B A;  1XMQ J;  5K14 B;  1TUG B;  4F2S A;  1RI7 A;  1RAA B;  5KFC A;  2J7W A;  5DZ7 A;  3OT9 A;  1XIQ A;  3H42 A;  2W2Q P;  1YJW S;  5KFJ A;  3DRS A;  1FFW B;  3RGI A;  2XG8 A;  5BYR A;  2CG4 A;  3EYZ A;  2VL1 A;  5KG6 A;  1B7F A;  1KKH A;  1U24 A;  5EX3 A;  1JNZ B;  4HLB A;  3CDB A;  1LFW A;  3R27 A;  5F8I A;  1LEO A;  4LF4 F;  1T9U A;  4JV1 A;  1RWN B;  1IKW B;  1HW8 A;  2CAJ A;  2FTR A;  2R4F A;  3S7R A;  2YY3 A;  5IM0 B;  2XMT A;  2J0W A;  3NBP A;  3DN9 A;  1YIT S;  1AFJ A;  4OJ3 A;  3IFE A;  3SMZ A;  5GVQ A;  4J5O A;  3GJR B;  2HRY A;  3NP5 A;  1RHQ B;  2DEI A;  1SC4 B;  3Q8V A;  4HDG A;  4U6P A;  1S57 A;  5C42 B;  3ET6 A;  2NSB A;  3R2C J;  4MMO A;  2H51 B;  1JKH A;  4QWA A;  2KZZ A;  5JJB A;  2ASL A;  2DHA A;  3RAQ A;  2HNZ B;  1MRO A;  3SQG A;  2R7O A;  5JVH Q;  3H2V E;  5DLF A;  2RU9 A;  1DTQ B;  4HR2 A;  5LT5 A;  1H73 A;  2WZ1 A;  3W2V A;  5D0G A;  1XMQ F;  1RAO A;  3UW1 A;  3Q0A A;  1SIW B;  2KXH A;  3AOC A;  1CS4 B;  5LMN F;  3OVA A;  5FJ4 A;  1KC8 T;  2ALY B;  3HSJ A;  2DY9 A;  2MJN A;  3EE3 A;  3J81 U;  1C1C B;  4IKA A;  3WZ0 A;  3MEG B;  2HVH A;  5T7L A;  3VAI A;  3W62 A;  5D4N A;  2WW8 A;  3MPW A;  2OSR A;  1O5J A;  4DX8 H;  4EBD A;  1UEK A;  4PUO A;  4DR2 J;  3M32 A;  3K5P A;  3M1V A;  3QNW B;  3IGN A;  1KP6 A;  3CMA S;  2MGZ A;  1VRQ C;  1H3D A;  4ZLP A;  1Y11 A;  3OSP A;  3F0N A;  2DNY A;  2I5J A;  1NDK A;  2YKP A;  1RT3 B;  2P6T A;  3LOU A;  2XUL A;  1Y00 A;  3HKZ D;  4TQR A;  1VQS A;  4ECY A;  1NK4 A;  3BO3 A;  2PMW A;  2YWF A;  3C14 B;  3PEH A;  1M5S A;  1T11 A;  1HR0 J;  1QM9 A;  3M6U A;  4OHW A;  2BM1 A;  2ZM6 J;  1RWK B;  1TKZ A;  4P6Q A;  2FLL A;  2NZ4 A;  4QIE A;  4ECT A;  3BGL A;  1LW2 A;  3K8W A;  4E98 A;  2OPR A;  3UI3 A;  2DNM A;  2GS8 A;  2CQ0 A;  5EN1 A;  3T1H J;  4YR3 A;  2IIH A;  3U1M A;  3EX7 B;  2IM1 A;  3KMS A;  3CED A;  1MNE A;  1Y4Z B;  2ILZ A;  1RT2 B;  1WSV A;  3SFU A;  4DCP B;  5HN0 A;  1HAR A;  4DR2 F;  3OL9 A;  2I2Y A;  1F3V A;  1HKA A;  2QLJ B;  2W4D A;  2CPX A;  3IN5 A;  3CCL S;  4O3O A;  1NJW A;  4QIG A;  4C7Q A;  3CD6 S;  4ZMM A;  4URG A;  4LVN P;  2C2O B;  2PSZ A;  4ES3 A;  1RYS A;  3EPG A;  3HFK A;  1GTE A;  1IBK F;  2DIV A;  2ZH4 A;  4ZLL A;  5GAD I;  4RBT A;  1RTI B;  2UU9 J;  2B6A A;  1YJ9 S;  1HW9 A;  1SH2 A;  3ZZP A;  4RWX A;  1WJ9 A;  4I2P A;  2W2O P;  1T9Y A;  5IT4 A;  2D9P A;  2XMW A;  2OTJ S;  2A6O A;  3FC9 A;  1HR0 F;  2VOP A;  2N7Y A;  4F0H A;  4NLP A;  2ZM6 F;  1HWL A;  4AUK A;  5AJ3 J;  2HQC A;  3L4B C;  3R5D A;  2CNL B;  2DXF A;  2Z2Z A;  3MFI A;  4PXD A;  1OO0 B;  4DFM A;  2B4V A;  2YXL A;  1TK8 A;  3M2R A;  3PZP A;  2BJ1 A;  4KPY A;  3ETO A;  1U1P A;  3T1H F;  4NX9 A;  3QGH A;  2XM3 A;  3LTO A;  2LEA A;  2IA0 A;  1SJF A;  5KFL A;  4ZHR A;  2UV8 A;  2HNY A;  5LOQ A;  4Y2M A;  4RLE A;  3CE8 A;  5A8K B;  3MFH A;  1EIY B;  2V4R A;  3K57 A;  3JQM A;  1CBK A;  5KG3 A;  2XLK A;  2IM3 A;  1F5A A;  3OUY B;  1NK9 A;  3TEG A;  5HMW A;  3NWG A;  2HHH J;  4R8U B;  3A3N B;  2KXN B;  3D0H E;  1IBC B;  3UDE A;  4DBQ A;  2OD6 A;  5E0O A;  1TL1 A;  4I67 A;  5KFD A;  2I0X A;  5DRK A;  3WHI A;  1Q8I A;  2UU9 F;  3B82 A;  1RA7 A;  2F8H A;  4JYA J;  3GR1 A;  1DQ9 A;  1KON A;  3CGI A;  4CM2 A;  2WON B;  2ASY A;  1B4S A;  2GV1 A;  3ENQ A;  4DPW A;  3PX6 A;  4WKR A;  1TL5 A;  3J7Z 5;  1SCJ B;  1R7I A;  3HJV A;  3TAR A;  2XZW A;  5CAB A;  1GMV A;  4DL2 A;  1XNR F;  2ZE2 B;  2GC8 A;  5AJ3 F;  3OJS A;  5L1K A;  4KT0 C;  5I3U A;  3IP0 A;  1VYA A;  1KRP A;  4IH6 A;  1D1U A;  5D4L A;  3R5B A;  4N8O A;  1Z2L A;  5KG1 A;  2HQ3 A;  4DS5 A;  1NSQ A;  4X4O A;  1RAG B;  1MMN A;  2K3K A;  3D54 A;  5HMX A;  2C2K B;  2D9O A;  1TQL A;  2K7J A;  4TVA B;  2LCW A;  5CQG A;  5HJY A;  1DUR A;  2UUC J;  1K1Q A;  4TYB A;  2MKC A;  3AFG A;  1J5E J;  2HND B;  4MH8 A;  2EKY A;  2Y1L B;  4KGV B;  3BJY A;  1YJN S;  4X62 J;  5A0Y B;  1E6Y A;  2R7S A;  4CH0 S;  4RNF A;  5HP1 B;  2RH3 A;  1LWF A;  4EI2 A;  4P9S A;  3M8R A;  4C0B A;  4ZPD A;  4KH0 B;  3QT8 A;  2KH9 A;  2RQ4 A;  1PJ5 A;  1MMD A;  3TA0 A;  4F02 A;  4JYA F;  4PAA A;  1RHM B;  3GG1 A;  3QJP A;  2V2Z A;  2JFD A;  5IT9 Y;  2LA4 A;  1R8H A;  1XC9 A;  2R7X A;  2P5V A;  3M7V A;  1QE1 B;  5M2U A;  1URN A;  5HMZ A;  2CDQ A;  2V8G A;  2QV6 A;  4S0M A;  1JXV A;  2IDE A;  4YR2 A;  2V9W A;  3SBM A;  2XQC A;  2HFV A;  3UDL A;  4NLX A;  4WCE Q;  1X0F A;  2CQC A;  2OPS A;  2R2S A;  2CUY A;  4OZ0 A;  1M5O C;  3GU0 A;  3VAH A;  3QWU A;  5L1J A;  4IFY A;  1NEE A;  3W66 A;  2APO A;  2HBY B;  2J0S D;  5ETT A;  3ZTO A;  2UUC F;  4DU7 A;  1UVL A;  2LDI A;  1FX4 A;  1J5E F;  1BMQ B;  3BSO A;  3THP A;  2QGF B;  2UXC J;  4LBH A;  3DMJ A;  4MYT A;  4X62 F;  4ILM A;  4Y0F A;  4I7F A;  3DLK B;  4X64 J;  3RB4 A;  3D6H B;  4UUW A;  1KFD A;  3M6W A;  1N4L A;  2FYX A;  3H40 A;  4FYW B;  5F8M A;  2NCK L;  3FNN A;  3JTP A;  3FUY A;  3RAM A;  4DEZ A;  3CCM S;  4J9P A;  3KNA A;  1FVS A;  1OWX A;  1XR5 A;  4RW6 B;  1SV5 A;  1HMV A;  3DU5 A;  3P45 B;  3NMR A;  3GFH A;  3MOJ B;  4ZVF A;  5J2Q B;  4UY8 T;  1UL3 A;  3RRK A;  1R8B A;  1TFW A;  2YKN B;  2FLO A;  2ROG A;  3DYA B;  1A7G E;  4NRT A;  4RU2 A;  3KG4 A;  1RTH A;  4AL7 A;  4NA1 A;  1DFD A;  3ZNJ 1;  1SUQ A;  2GIF A;  1R8P A;  2CQD A;  4ZIT A;  2ZH6 A;  1D9A A;  2M9K A;  4NLG A;  2OSQ A;  2ZBC A;  5LM7 E;  3KLE B;  5K8N A;  2X1G A;  2CQB A;  1TL3 A;  2NPF A;  1S6P B;  1EKR A;  5CYM A;  4O4G A;  1REV A;  1GMW D;  3DFE A;  3PM9 A;  5MLC V;  2UUT A;  2W7O A;  3M8Q A;  3G6V A;  2VG6 A;  1BUX A;  2UVW A;  1F2H A;  4CCH A;  1JJH A;  2HZC A;  1M5P C;  3KKF A;  4DV6 F;  1FRH A;  4DL6 A;  3CCS S;  5IWA J;  4W4M A;  5J2N B;  2WSC C;  2R7R A;  3KLF A;  1T94 A;  1N8R T;  1RAJ A;  1QLN A;  4P71 A;  2HAF A;  4P2M A;  3N79 A;  2BOP A;  4ZPC A;  1TU0 B;  1IWA A;  3IR7 B;  3QIP A;  2QYC A;  3ICL A;  1QAY A;  2U2F A;  3W9I A;  2LKZ A;  3GYN A;  4C2M A;  4G1Q B;  2E1R A;  3KK1 A;  2X51 A;  1CPZ A;  3LWM A;  2AYE A;  2ZH7 A;  3W65 A;  1T95 A;  4QYZ J;  2RUG A;  2A2D A;  2OFG X;  3NCP A;  3ULH A;  4OZJ A;  3D2W A;  1SC3 B;  3TP2 A;  2MLZ A;  3ITH B;  4E0D A;  1QJH A;  1ZTT A;  3UD4 P;  3GIJ A;  3G2X A;  3MMC B;  1WHW A;  3IAM 9;  2KZM A;  3HI9 A;  3PFO A;  4NCA A;  2OUG A;  3HHL C;  2RJZ A;  2WVE A;  2BE2 B;  3KJV B;  1BQN A;  3E01 B;  1TUW A;  3MEC B;  3M8P B;  2BA9 A;  3N6L A;  3I5B A;  3TUP A;  2IAJ A;  5GAD U;  4TY9 A;  2DYA A;  2WB4 A;  2LEB A;  2EPI A;  1PCA A;  1RT6 B;  2YNI A;  4FN5 A;  1HWK A;  3QFW A;  4DV4 J;  2JLF A;  4I69 A;  2DNG A;  3PAC A;  3PHE A;  1YK9 A;  2ZVS A;  1JJ4 A;  2FHO B;  4HT7 A;  1JK9 B;  4DL5 A;  1T9T A;  2Z56 B;  1S1T B;  2LQB A;  3RUB L;  3U02 A;  1U2F A;  4NLW A;  1FKP A;  4FKX A;  3K17 A;  4L74 A;  4DI6 A;  3R2D J;  5D4P A;  3DOL A;  4RW9 A;  4OJ1 A;  2NUH A;  3I87 A;  2B9Y A;  3OR1 A;  1FXL A;  2A2C A;  1ZAX A;  2L3M A;  3D6M B;  1KQS R;  4UUX A;  2G2Y A;  3Q89 A;  1TFY A;  2XY5 A;  1WC0 A;  4ILL A;  4ITS A;  2IBO A;  2K7K A;  2DRB A;  1H7W A;  3RYL A;  1G4C A;  1JJC B;  4U7U D;  2ROP A;  5DQI A;  4F26 A;  3EWG A;  2VAS A;  2H9Z A;  3OLA A;  5LJ3 Y;  3TRG A;  4DR5 J;  3CJR A;  2E1M C;  3DLE A;  3V81 A;  1FTR A;  4CWB A;  2M52 A;  1DBD A;  2PMH A;  1SJ1 A;  3FDS A;  4YHH J;  1RCO B;  1HNX J;  1VQ9 S;  4X4U A;  4DG1 A;  4V19 J;  2ZWO A;  3JAM U;  2OAU A;  1KWM A;  2IVY A;  1V9O A;  4I0W A;  1H2U X;  3OR2 A;  4YB6 A;  4AFF A;  2Z2M A;  1PIE A;  4CT8 A;  4DV4 F;  2D69 A;  2HK2 A;  4TXS A;  4RBV A;  5DM7 Q;  1VIS A;  4Z7Y A;  1AZS B;  4F4W A;  1N56 A;  1ZAW A;  2B9W A;  4XTT A;  3DDK A;  2ZBR A;  1KOH A;  4DMZ A;  4DX5 A;  4WWS A;  4ZLN A;  3M6V A;  3DHX A;  1G2E A;  2JFK A;  4ZN3 A;  3KTQ A;  2EK6 A;  2W2N P;  4WKY A;  4LUB A;  4OX6 A;  3C6U B;  4LSN A;  4DWI A;  1SH3 A;  5BYS A;  3PRV A;  1VMB A;  3DOM B;  2W9C A;  4LQ3 A;  2O1P A;  1K0V A;  2GGP B;  3GV7 B;  5G0R A;  3WX8 A;  1K9M T;  1HBO B;  4IH7 A;  3AXK A;  5J1E B;  1RT4 A;  1S5Z A;  5HVH A;  4WE1 A;  4AL5 A;  4Q2L A;  3KK3 A;  4KKO A;  4USJ C;  4QWD A;  3NNH A;  3M9M B;  4ID8 A;  4ZOS A;  2DNP A;  2GFF A;  2ZZT A;  1ZM4 A;  3VAM A;  2RKI A;  3O1L A;  2MY8 A;  3OTO F;  4DQQ A;  3IS9 B;  2HFZ A;  4PZV A;  2YKQ A;  5E33 A;  3NGS A;  1SKW A;  4UY8 5;  4ELT A;  5CD4 A;  3CT9 A;  1YJR A;  4KIA A;  1AUS L;  1RWO B;  2WVB A;  3AH6 A;  4QU7 A;  2IYI A;  3MR6 A;  2PFF B;  1TZ0 A;  1HNX F;  2MZJ A;  4KQZ A;  4L3K A;  3L95 X;  3PHT A;  2VHG A;  3JYT A;  4RL1 A;  4NYZ A;  3T1Y F;  4WFY A;  4OHV A;  3O44 A;  4DR7 J;  4PXB A;  4K5R A;  2RNE A;  2XS7 A;  3ETM A;  1SXL A;  2AEF A;  4EYI B;  1S9G B;  4DL3 A;  2L9W A;  3EZO A;  2GO9 A;  1FDA A;  4ZS6 A;  4TU8 A;  3BSN A;  4LFB J;  1Y10 A;  4KFB B;  2WTF A;  2D3Z A;  1AA1 B;  3T5L A;  7FDR A;  4G1P A;  5CYQ B;  1WKJ A;  2KYZ A;  3IGV A;  5D77 A;  4DR1 J;  4FYY B;  1WG1 A;  5T41 A;  4GVL A;  1Q1K A;  5E3C A;  3ZTP A;  1Q78 A;  4RW7 A;  1C0T B;  3CCT A;  3KDN A;  4M5K A;  3NAH A;  1VBZ A;  2G9O A;  2O66 A;  3WIV A;  2V2V A;  2HWT A;  1HNV B;  4JI1 J;  1T3N A;  2IM0 A;  4JI5 J;  2V9K A;  2W24 A;  4FNH A;  5A6W A;  4YR0 A;  2AGP A;  1FFG B;  3VVT A;  2RSQ A;  1WOS A;  2PN6 A;  3UFC X;  1IJE B;  3NS5 A;  1F0X A;  3OTD A;  3MUR P;  4LVO P;  2D3O 1;  1Q7L B;  1DQ8 A;  5B0D A;  2VON A;  5E3R A;  2CJK A;  3N01 A;  2HQF A;  4C8Y A;  1LW0 B;  2D7S A;  4KTQ A;  3NMA A;  2VBZ A;  1OY8 A;  1ZYQ A;  2I9S A;  2F8M A;  3J81 Y;  4J9L A;  3C15 A;  3UVJ A;  3DLL Q;  1R0A B;  4N76 A;  4DLE A;  1JLQ A;  1GNK A;  3UN3 A;  4LIR A;  3BQ0 A;  3A3O B;  4Q8F A;  4WP3 A;  2IMO A;  2ALZ A;  4LFB F;  3AD9 C;  1FEH A;  3AOA A;  1FFS B;  1S4E A;  3BB5 A;  3PEJ A;  4NI2 B;  3V6K A;  4DR1 F;  3LP1 B;  3Q2T C;  3GE9 A;  4QOT A;  2LQJ A;  1IKY B;  1NJX A;  4LT6 A;  2MQL A;  3MCN A;  4K4Z A;  3G8S A;  4DX6 A;  3OFF A;  2AJ2 A;  2BE7 D;  1G6B A;  3OFG A;  5HBM A;  3HDS A;  3CDU A;  3VQT A;  1UWA A;  5GAH I;  2DB1 A;  2HKE A;  5B0G A;  1T02 A;  4QBU A;  3Q83 A;  3AXM A;  4HAC B;  1FCA A;  2OFH X;  2AZ1 A;  4JI1 F;  1E6V A;  1S7H A;  1YJT A;  3WBZ A;  2LFV A;  2HBZ B;  4LIW A;  2IRX A;  4EZ6 A;  1RT5 B;  5HLF B;  3DRP B;  4ANC A;  1F3F A;  2FHJ D;  1RU1 A;  1UVM A;  1X5P A;  2CQI A;  3FRZ A;  3MED B;  5AE1 A;  1X4B A;  1TAU A;  3OL7 A;  4DZ6 A;  3GMG A;  2ZH1 A;  2YX1 A;  1N5Q A;  3RAX A;  3MAA A;  4EFA C;  3POT A;  3I31 A;  3KLG A;  1DAX A;  2DNK A;  3PX4 A;  4PAB A;  5CD4 H;  1PGZ A;  4MT1 A;  3ZZ0 A;  4WYL A;  3HT0 A;  4ECS A;  1OSD A;  2ROE A;  2B9X A;  5DQG A;  5D6G A;  2QJ3 A;  2IRY A;  2VDI A;  3G6X A;  2HQD A;  2ASD A;  1R27 B;  6FD1 A;  4FXW A;  2OJ3 A;  1RWU A;  1NJY A;  4NA2 A;  2CAD A;  3B4D A;  3JSM A;  5DQH A;  2XMK A;  4MKV A;  2N4C A;  3SI8 A;  1JLB B;  4LF9 J;  4DFJ A;  2KT2 A;  2QTW A;  3LA0 A;  4BC9 A;  1U2C A;  4ZVR B;  2BE9 B;  1CJT B;  3SCL E;  4USU A;  1PC4 A;  3ZNU A;  2W7P A;  4EZ9 A;  4EO6 A;  4W92 B;  2Z8Q A;  3T41 A;  4X4S A;  1FRK A;  3J7A N;  3QRP A;  5HI7 A;  3CXC R;  4A8Q A;  2JZ5 A;  3C46 A;  1C0U B;  5EX0 A;  3MD1 A;  3PRB A;  5FDL B;  3QAU A;  4I6W A;  4EMD A;  3TAM B;  4PWD B;  2VF3 A;  3ZFV A;  3CJ3 A;  2DR8 A;  2F3J A;  2WCX A;  2B8P A;  4USI A;  1U0S A;  1H0H B;  4RW4 B;  3FZ2 A;  4DL0 C;  2FLP A;  4DL4 A;  1ZAV A;  3VGU A;  4MYU A;  4HYK A;  5J2M A;  1OY6 A;  4CO1 A;  2LQ9 A;  3SIP B;  4MKY A;  4EK2 A;  3MM9 B;  4ZN1 A;  3OVS A;  2YH1 A;  4CO3 A;  2F4V F;  1K1S A;  2W8K A;  5EWE A;  3MMB A;  5K8O A;  4N41 A;  4A46 A;  4DCO B;  1EP4 A;  3I55 S;  2QLX A;  2X1B A;  1JLA A;  3MM8 B;  4DV3 F;  2E7V A;  3P4U B;  4JOU A;  3H2U B;  3G86 A;  2PMZ D;  4NXN J;  1X9S A;  3D7S B;  4I4B A;  3KK2 A;  2RDJ A;  3TJA A;  4L3N A;  1RAF B;  3ADA C;  4LF9 F;  4QYR A;  1DJ0 A;  2XY6 A;  4A48 A;  2X7I A;  5EWG A;  2R42 A;  3NNC A;  1KLN A;  2N4D A;  4CZC A;  2IPO B;  3SDE B;  1QY7 A;  4NLS A;  5CXT A;  1RBO B;  1H38 A;  1CEZ A;  1IBL J;  1RAC B;  2ZH2 A;  1N32 J;  5F9L A;  5D4O A;  3BSC A;  3OTE A;  3S1T A;  4KH1 B;  4A8M P;  3NY0 A;  3CJK B;  4O44 A;  2NZC A;  3SFG A;  1I6J A;  1ZA1 B;  1HHT P;  2ZWP A;  3DRS B;  1NPK A;  4DN0 A;  2PT0 A;  3ILJ A;  5DLG A;  1VDH A;  2DH7 A;  4KAI A;  4GMK A;  1P6T A;  4LSL B;  4C9D A;  4PG5 A;  1G7C B;  2ZOG A;  4IQM A;  4IOA Q;  4K4U A;  1X4H A;  3NBP B;  2PA3 A;  3UN5 A;  5KG0 A;  2VIC A;  1LWC A;  1N6Q A;  1NND A;  4Y00 A;  1RBL A;  2LLZ A;  3MMJ A;  5JUM A;  4NLD A;  4NXN F;  1ELO A;  4FVM A;  3SZ2 A;  2RQM A;  3ET6 B;  4M5H A;  3BKT A;  1HQ2 A;  1VLY A;  1UW9 A;  1TL7 A;  3IRX A;  2JEJ A;  5CCL A;  1RA6 A;  3OJU A;  1AFI A;  1NM2 A;  1K0T A;  4HKQ A;  1C1B A;  2VJU A;  1K47 A;  4HH0 A;  4WK3 A;  2QA2 A;  1BXN A;  4C0H A;  5CAA A;  1UKU A;  3SQG B;  3UO0 A;  4LBI A;  4ZCI A;  1N36 J;  3UCZ P;  1N32 F;  4KGZ B;  2GCF A;  1FTC A;  3W2V B;  2GW8 A;  4P10 A;  2VKZ G;  1ZPW X;  3CJT A;  3CO9 A;  1TAQ A;  3SXL A;  2XGQ A;  3DLJ A;  2PDA A;  1Y5L B;  3QAT A;  2XYH B;  3TUZ C;  3W61 A;  4NLQ A;  5D15 A;  5T7L B;  2VKR A;  2JLG A;  3MPY A;  4WBF A;  2CPD A;  2YQ3 A;  4PUO B;  3M32 B;  3CIZ A;  3DGV A;  3G6Y A;  2R8I A;  2XYP B;  1WEZ A;  2V2Q A;  1FRJ A;  2BQU A;  2AJF E;  5C2C A;  5F8L A;  1PBA A;  2RIJ A;  5A76 A;  5KFV A;  2I5J B;  2DR9 A;  1S6Q B;  2BEF A;  2VFS A;  2GNK A;  1R0B G;  4M5D A;  2EFG A;  2R9L A;  1S6O A;  1NUE A;  1EET B;  1R8C A;  3VZH A;  1Q82 T;  3OLB A;  2DGO A;  1FNX H;  4OI3 A;  1WC6 A;  1VRT B;  4ZVE A;  4B02 A;  5JVG Q;  1Q5Y A;  4I6Y A;  5GAG I;  1HQU A;  1PJ6 A;  3EDR B;  2R2U A;  2E1A A;  1NDL A;  4IH5 A;  2BRK A;  2ZD1 A;  1N52 B;  4QZV B;  1FD8 A;  2WOM A;  3GIK A;  4O3Q A;  1N34 J;  1RAH B;  3OL8 A;  5C25 A;  1LW2 B;  4I2Q A;  3FMW A;  4KPC A;  2Q66 A;  3VTI A;  2OPR B;  4HI1 A;  4FPR A;  2M4M A;  1SQG A;  2IC3 A;  2F7V A;  4U7U K;  2DO4 A;  1NSP A;  3TX8 A;  5LSL A;  4EGL A;  3M30 A;  1IQT A;  4OQJ A;  2FJB B;  3HO1 A;  3HKW A;  5K9F A;  4F7V A;  3AB4 B;  2POK A;  3TQE A;  3BRE A;  4PKD B;  4P2F A;  5J1P A;  4J90 A;  5GAH U;  4MKB A;  4IDK A;  1GH8 A;  4Q44 A;  3VHQ A;  2HHV A;  4PYA A;  4C98 A;  2B6A B;  4PR6 A;  4I2P B;  1Y3J A;  5SUH A;  3UE2 A;  1FRI A;  1OY9 A;  3WIU A;  4ZVT B;  5U47 A;  4ZPA A;  3EM1 A;  4NML A;  4C11 A;  1UWB A;  2EG1 A;  2J9D E;  2WAQ D;  2BMB A;  3IA0 A;  2GIQ A;  1HYS A;  4J9K A;  1FRL A;  3IC1 A;  5GMD A;  1R3N A;  2D1C A;  2ZDO A;  3M2R B;  1S9E B;  4DUY J;  1S4F A;  1UVN A;  4TY8 A;  3TUJ C;  2CQG A;  1U1K A;  4YME A;  2LQ8 A;  1GX6 A;  2DPI A;  5AXM A;  4V1A k;  5ETO A;  4ZHR B;  3D6T B;  2HNY B;  1RHK B;  3GCX P;  2A3J A;  3V4I A;  5HAO A;  1K44 A;  3EPI A;  2YQ1 A;  3WQP A;  3L9Z A;  4AT1 B;  1UPM B;  1W7W A;  4W98 A;  2LEC A;  4JI7 J;  3QAE A;  1GX5 A;  5A2Q U;  4RZR A;  3DRR A;  4PCQ A;  1KNZ A;  4G6V B;  1TL1 B;  2Z2L A;  5C2G A;  5ADZ A;  2M88 A;  4IYQ A;  2HPU A;  1NAQ A;  4DPT A;  4IOB A;  3W7B A;  1FJ7 A;  5KG5 A;  4GVB A;  4O0N A;  2C3Y A;  2YWG A;  1U2R A;  4GRS A;  1EZZ B;  3N4W A;  4KGK A;  2DIU A;  1NKB A;  1YI2 S;  3GJS B;  1RYR A;  3H5X A;  5DET A;  2EG2 A;  2V94 A;  3O6Q A;  2CJ9 A;  4CYU A;  1MU2 A;  3ILL A;  4YEA A;  4J9S A;  3TZZ A;  3OD2 A;  1EKS A;  2E5H A;  2RQK A;  2UXD J;  3AQP A;  4ED4 A;  2OLW A;  5I3U B;  5HAT A;  1HQE A;  1R0C B;  1RAD B;  1B99 A;  4FP9 A;  2CDR B;  5AXK A;  4DUY F;  4IOC Q;  3RB6 A;  3QID A;  3HT3 A;  3TNV A;  5B0B A;  3VAF A;  4NE9 C;  1MLA A;  4LRB A;  4QQB A;  2OML A;  2GHV C;  2BAN A;  3NG8 A;  3KG0 A;  3PR4 A;  4WU3 A;  2DO0 A;  2RF2 A;  4FDF A;  3M8W A;  5DO2 A;  4OYM A;  1HLW A;  3NCR A;  4EWT A;  5IOL A;  2DIS A;  3B6B A;  2M8H A;  1F9H A;  1ZZF A;  1YSJ A;  2K2P A;  2J7K A;  4WF9 Q;  2XBP A;  1E6Y B;  4JI7 F;  3UR3 C;  1KQK A;  1SH0 A;  3JAM Y;  5IM0 A;  2ATC B;  1LWF B;  3MMA A;  1Y5I B;  3RB3 A;  2IM2 A;  2UVV A;  2MYF A;  2OO4 A;  2FJA B;  2OEJ A;  2JEF A;  4WU2 A;  5F41 A;  2M2B A;  4ZPW R;  3M9O B;  3UWT A;  3HX9 A;  3CJS A;  4TU9 A;  4LR8 A;  2H4Y B;  4DSK A;  2JVR A;  4E8U A;  4NOH A;  3MM6 B;  4UOF A;  2HNZ A;  1YGY A;  4OI4 A;  2FIU A;  4UQT A;  4ZP6 A;  1U48 A;  1QD1 A;  2OPS B;  4QU6 A;  1RTZ A;  2EFN A;  4F4Y A;  3AAW B;  2EFP A;  2XZD B;  4IFY B;  5B7W A;  3R9L A;  4X65 F;  2R8J A;  2DHH A;  1RGV A;  2OHD A;  4DR3 J;  1FD2 A;  2DHS A;  1MW7 A;  2W2M P;  1VQ8 S;  2RRB A;  1Q4R A;  3MEG A;  4HHU A;  3MM5 B;  3CO0 P;  2KM8 B;  4QYZ K;  2CJY B;  2YNH A;  2HHW A;  4K5S A;  3GYG A;  5K20 B;  3CCQ S;  1FA0 A;  2DGX A;  2XWX A;  2AGO A;  3SEO A;  2E5J A;  4I7F B;  5ITH A;  4N47 A;  2MSS A;  1C2P A;  5B08 A;  5HK4 A;  4F0K A;  4ED2 A;  2YNG A;  2VG7 A;  1YRT A;  5K8M A;  2GJI A;  5GME A;  1WOP A;  3IXQ A;  1WHY A;  3R5A A;  1IXK A;  1RT3 A;  3LGN A;  4NYO A;  1IJF B;  3B78 A;  3US5 A;  4LRF A;  4NCG A;  1SV5 B;  4DSJ A;  1HMV B;  2E7X A;  2IA6 A;  1NSK L;  2KYX A;  2KFY A;  2R8G A;  2KG0 A;  2ZJP Q;  1I94 J;  2DRA A;  2XI3 A;  3D6F B;  3R1L A;  1UVK A;  4U96 A;  1PC5 A;  4MK9 A;  2FGO A;  1GEH A;  3TX0 A;  1RTH B;  1OS5 A;  2XMA A;  3PJW A;  1SUQ B;  3LGH A;  4DV0 J;  4ZCL A;  5L46 A;  3GR0 A;  1OYD A;  3R7N B;  2UXB F;  4X4T A;  2CZV C;  2FVP A;  2QG9 B;  1VR6 A;  3QSY B;  1FJG J;  2CKW A;  4DR3 F;  5HJX A;  2ABY A;  5CYM B;  4M94 A;  1LXJ A;  4O4G B;  1REV B;  4QWC A;  1QSL A;  1Q0N A;  3NAI A;  2QL7 B;  2KM8 C;  3M8Q B;  1RT2 A;  1AUD A;  2VG6 B;  2C2Z B;  2CPZ A;  1SC6 A;  4KB7 A;  1QDU B;  2GAG C;  2JHE A;  2IDL A;  2C3U A;  3ZZO A;  3CTR A;  4NPO A;  1X31 C;  1P8G A;  3TQ1 A;  5GAG U;  4EU0 A;  1VQN S;  3C6T A;  2CQ4 A;  1VBY A;  2ZJQ Q;  2MEW A;  3VVU A;  2GML A;  3KLF B;  2QX0 A;  4B08 A;  1FWP A;  3JQK A;  2EKN A;  2DEJ A;  4O3R A;  2YPY A;  2F5G A;  3A4T A;  1S72 S;  9RUB A;  2K1R B;  2Z57 B;  1GXT A;  2PA8 D;  2EC2 A;  3FBF A;  3VAL A;  3QIP B;  1WC3 A;  3BSA A;  1PAE X;  2KL8 A;  4MIA A;  4KV8 A;  1I94 F;  3MDF A;  1I3O B;  3D3B J;  3D67 A;  4JI2 J;  2MMY A;  2XLI A;  3IO1 A;  4ED1 A;  2WVC A;  4HEA 9;  3IR5 B;  1CQN A;  1D9F A;  1JLF B;  4Z37 A;  3UCG A;  4DV0 F;  2JC0 A;  4N77 A;  2R7V A;  1NH8 A;  2J0X A;  2JEI A;  1UCN A;  2FY1 A;  3W5X A;  4YS2 A;  3R6L B;  5KOX A;  1BQN B;  3RBD A;  2NYI A;  2IAJ B;  3NGU A;  1YX2 A;  2F63 A;  3TAP A;  4N8N A;  2ZEJ A;  3I9V 9;  4LFA J;  2YNI B;  4WFX A;  3LH2 S;  4B3M F;  2WRM A;  2EFQ A;  5IC4 B;  3OUY A;  3MR3 A;  4U9R A;  3ELH A;  3OHA A;  5D8H B;  5F0W A;  4P73 A;  2W25 A;  1TVR A;  4G1I A;  5KFN A;  1FKP B;  3O2I A;  1RHJ B;  3KLH A;  2FC8 A;  1WD6 A;  3QRR A;  3MPV A;  3CCW A;  3J81 j;  4RW9 B;  3R5G A;  3OR1 B;  2CRL A;  2CZ9 A;  5H9E J;  4DL7 A;  4R0J A;  1DAR A;  1VQP S;  4C97 A;  5KT7 A;  4JI2 F;  1IM4 A;  3AQO A;  2UUW A;  1VQM S;  3W2W A;  3ZZY A;  5GAE I;  3KJF B;  2RS2 A;  1VQL S;  4XDD A;  1U25 A;  4Q45 A;  4K0K F;  4Q0B A;  1DQA A;  1VCT A;  4O3N A;  2HIY A;  3CJ8 A;  5EWF A;  3QT6 A;  2G2Z A;  3AHP A;  1SC1 B;  3CW2 C;  2B43 A;  3GQC A;  1RZM A;  3TJ8 A;  3EGZ A;  2MQ8 A;  2UZA A;  3RBZ A;  3TA1 A;  3DLE B;  3TVY A;  3ZZU A;  2E66 A;  3HCX A;  3HHE A;  3BBC A;  4FBU A;  1PKU A;  4DG1 B;  2BQ3 A;  3M8S A;  1VLO A;  2HBR B;  1U1Q A;  1APS A;  2MHE A;  1HHS A;  3OR2 B;  2AJ1 A;  4X2B A;  1XNQ F;  3AJD A;  2HND A;  1SKU B;  1S9F A;  3C16 B;  5F8H A;  2AYG A;  1RWP B;  1RSC A;  5ETK A;  1F5B A;  1DTT B;  4MAK A;  2DXE A;  3BS9 A;  4J37 A;  1FK9 B;  2JLE A;  1UEU A;  3PTW A;  4I1T A;  2OPP B;  3W3S A;  3NGD A;  4LF6 J;  5LMN J;  1H98 A;  4KR0 B;  4FF1 A;  3DI6 B;  4KO0 B;  2W9C B;  4PG8 A;  5L9N A;  5G0R B;  4U95 A;  4M1K A;  5CZV A;  2Y8Y A;  4TYA A;  1RT4 B;  2RHQ B;  4WE1 B;  4P2S A;  3KK3 B;  4KKO B;  3G71 S;  4IRC A;  1KN6 A;  4YB7 A;  5KOW A;  4HT5 A;  2QEX S;  3DDN A;  2M70 A;  4C8N A;  4Y3C A;  2V8P A;  1QE1 A;  4OMF G;  3BYP A;  3CC2 S;  4CO4 A;  3BGF A;  2K06 A;  2CYY A;  4KSE B;  3SSS A;  2MLX A;  4OZ2 A;  3PYD A;  3CCR S;  3U7J A;  2IYG A;  2EVZ A;  2NXU A;  1I5O B;  3J7Z T;  3T6J A;  4OYW A;  4F04 B;  3NS6 A;  4OYZ A;  3F73 A;  3PYF A;  4DCJ B;  1A9N B;  4YOE A;  3JYT B;  3EMT A;  2KVQ E;  1VQO S;  1UP1 A;  3W64 A;  2CA9 A;  1OQ3 A;  4CTA B;  1XJW B;  4LF2 A;  2OD4 A;  1S7I A;  2ZBQ A;  1YZ7 A;  3I56 S;  2GQQ A;  4LRC A;  3EGN A;  2QA4 G;  5DG9 A;  4ZVQ B;  3DLK A;  2DNQ A;  4LFC J;  1RBA A;  4LF1 A;  3SYZ A;  3K89 A;  2Q79 A;  1H7X A;  3KOA A;  4QPX A;  4HDH A;  2RT3 A;  4LF6 F;  4XPE A;  4F3O A;  1P27 B;  1EAR A;  2CNO B;  2MQP A;  1SJ3 P;  4C8K A;  1EAY C;  2MKH A;  3DLH A;  4Q43 A;  3S6E A;  2MTL A;  2EWH A;  3TUI C;  4C8M A;  1W26 A;  1WC5 A;  3QJL A;  1N5T A;  4ID5 A;  2BOA A;  1R8A A;  2BJD A;  2YKN A;  3N6M A;  2JX2 A;  1T9X A;  3BPD A;  1KVJ A;  3RR7 A;  3CDE A;  2CG8 A;  1FXR A;  1IBK J;  1GQE A;  1FXD A;  3R7B B;  1H2V Z;  2KB2 A;  1B70 B;  4FZV A;  1IWG A;  3LUY A;  4FKY A;  1A6L A;  5KFZ A;  1NK6 A;  5IC6 B;  3UVJ B;  5IQ6 A;  1DRZ A;  1JLQ B;  4ZP7 A;  4B3O A;  1S1V A;  3R97 A;  2W9B A;  2P8I A;  3ILI A;  4ZJQ A;  5J2N A;  4LFC F;  1U1L A;  4OLP A;  3LAL A;  1HI8 A;  3W9H A;  2ERR A;  2C2N A;  3UDC A;  1EQM A;  3GG0 A;  1OMS A;  1GXU A;  3RRG A;  5J2P A;  3G6E S;  1UA0 A;  4ZDN A;  4IG3 A;  1SJR A;  2FJV A;  5KFH A;  1B7Y B;  4NZ0 A;  4RJV A;  2CNK B;  3H20 A;  3K5L A;  2YWK A;  4G1Q A;  2VH7 A;  1U1O A;  2PEH A;  3BBF A;  2HGM A;  4ZJO A;  1NXI A;  4PPZ A;  4LRA A;  3AT1 B;  2ASJ A;  1PYS B;  1TMJ A;  2V68 A;  3R7S B;  4I6A A;  4ED0 A;  2V63 A;  3VQS A;  2H48 B;  1NHK L;  1RE1 B;  4F50 A;  1FF2 A;  3VAJ A;  2FHK A;  3MAA B;  4NEZ A;  3POT B;  3E01 A;  3KLG B;  2G13 A;  2LEP A;  4B3R J;  2IHR 1;  1HWJ A;  1P1T A;  3CJQ A;  3CUL A;  3EVW A;  4XDC A;  2B8Q A;  1NLK L;  3NL0 A;  2WB1 D;  4R5P A;  1XNR J;  2G1D A;  3TI0 A;  1REG X;  1CC7 A;  3HHL D;  2AYB A;  2E5G A;  2BAB A;  3K5O A;  3JSM B;  4FS2 A;  2AIR B;  3H59 A;  2DR7 A;  4ZJL A;  3VAK A;  3PW5 A;  3T9N A;  2ZZM A;  3OBI A;  1O8B A;  1FDD A;  1IQZ A;  2BJE A;  5DM6 Q;  3IAS 9;  1IKX B;  4OI0 A;  5CYJ A;  2VA3 A;  3PO5 A;  7AT1 B;  3GII A;  2GAH C;  2V8V A;  1NDP A;  4I64 A;  1U8S A;  1G1X A;  2XMJ A;  2DJW A;  1JLG A;  1QSS A;  3Q22 A;  1JQG A;  1SKS A;  3AOB A;  5ETS A;  3V6D A;  5AE3 A;  4M5N A;  1HBM A;  1LKZ A;  3H5Y A;  2PI5 A;  1TKX A;  1F1B B;  4WZM A;  3LQV A;  4ED3 A;  5IFM A;  4J9Q A;  3IR6 B;  4A47 A;  4LRE A;  3ENA A;  4F36 A;  2JC1 A;  2DNR A;  4P74 A;  3LP0 A;  3HHD A;  2VDH A;  2ZOM A;  5J2M B;  3EZU A;  3IM9 A;  3PO4 A;  3GWC A;  1Q79 A;  3DM2 A;  1U1M A;  4B3R F;  3TOQ A;  4B9N A;  1KDN A;  1WDT A;  1IR1 A;  4DF4 A;  3CD0 A;  4GC7 A;  3I9Z A;  3M2U B;  4Q7A A;  2HRU A;  3MMB B;  4UF4 A;  1X9W A;  2DNO A;  2FY8 A;  4FPI A;  4ZK7 M;  3GIR A;  5D78 A;  1JLA B;  1EB0 A;  4C0O C;  2UVR A;  4IRD A;  1ICE B;  5GAE U;  3NNA A;  2KU7 A;  3KFW X;  1LWE A;  2XNR A;  2WHO A;  1AZS A;  2XWY A;  5J1N A;  3KK2 B;  4OJH A;  5IS2 A;  4BCA A;  1Y7P A;  1X4G A;  4CLK A;  3CSK A;  5DDO C;  1ULR A;  2HZA A;  5A2Q Y;  2LYV A;  2A6M A;  3SSR A;  4UST A;  3G82 A;  2B5J A;  3C6U A;  1P9Q C;  5C7P A;  2O3D A;  2VD3 A;  1ZM9 A;  4AE5 A;  4AQY J;  2I8E A;  3IBC B;  3CF5 Q;  3BGR A;  1T05 A;  3K8V A;  1H6K X;  1EJ7 L;  1FRM A;  2GX8 A;  5B09 A;  3H4D A;  3LAM A;  3JTN A;  1U4B A;  1TMM A;  3CCZ A;  2FD2 A;  2QN6 B;  3FFI A;  1KLM B;  1Y5N B;  3PRD A;  1TKT A;  1U0H A;  1NB7 A;  4ZPB A;  1JWW A;  2HVE A;  3FEY B;  3VGV A;  2QL9 B;  2DGW A;  2KG1 A;  4RU9 A;  3TAQ A;  2E5L J;  2CJB A;  2HGN A;  5KT2 A;  4F4K A;  3M4X A;  3P8B B;  3L7U A;  3TA2 A;  5KT3 A;  1R43 A;  3QO9 A;  4AXI A;  1GAO A;  1RDR A;  2ILY A;  4YUD A;  4QIV A;  2KHD A;  1LWC B;  4GC6 A;  4DV1 J;  3UPF A;  3UQS A;  3OV7 A;  2C2E A;  1M1G A;  1GMW A;  3RZA A;  3HM9 A;  3PR5 B;  5L9X A;  2HVI A;  4LQ9 A;  4OI6 A;  1CJK A;  2CPJ A;  1UJ5 A;  3SSQ A;  1QVG R;  1F9F A;  2R2R A;  4ZPV R;  2YBV A;  1HPZ A;  2X3D A;  3O5T B;  5M2R A;  4RUH A;  3IRX B;  5L39 A;  4X4R A;  2B7C B;  4RW8 A;  2XGP A;  5M2P A;  3J7A 1;  2RRN A;  2DH9 A;  1YDL A;  2KT3 A;  1Q8B A;  4UZB A;  4DPU A;  4IFV B;  2BQR A;  4ANE A;  5ETR A;  1HA1 A;  4KHM A;  2MDA A;  5KFU A;  2ZVI A;  1HBU A;  2DGT A;  4CLZ A;  1KVK A;  2AJ4 A;  1VJW A;  1WEL A;  3PJ9 A;  4A8X A;  3L7P A;  2HHP A;  4AQY F;  4CLW A;  4OL8 A;  3PJX A;  1X7V A;  2XSF A;  1RT7 A;  2CIM A;  1IUJ A;  4DV6 J;  3P3D A;  1HNV A;  1LXN A;  4DPY A;  4JV5 J;  2ZDP A;  1DLO B;  4B9U A;  1NCL A;  3LP2 A;  1TK5 A;  1MWQ A;  2ZHO A;  2W9A A;  2HWI A;  3N6N A;  1IR2 A;  4WXW A;  1T9W A;  3I5C A;  1WI6 A;  3FK4 A;  4RWW A;  2E5L F;  3DRX A;  4C6A A;  2MST A;  2HQG A;  4KHP J;  2YWE A;  1ZBT A;  3UNY A;  2Z58 B;  3TW0 A;  2PO4 A;  1J5O A;  2E29 A;  3MCM A;  1TKD A;  4B9S A;  1T8E A;  3BDP A;  4M8L A;  4XIU A;  1YVF A;  4NXM J;  2HS0 A;  4WII A;  4DV1 F;  2MQO A;  1F5C A;  4QR0 A;  2C3M A;  1V5V A;  1AB8 A;  3ISN D;  5KFG A;  4LJM A;  4M5D B;  5LMU J;  5T14 A;  2CWK A;  2RHS B;  1C4C A;  2GA7 A;  2BBE A;  3R8Y A;  5DDQ C;  2B3T B;  1MN7 A;  3H5S A;  1N0U A;  1NKC A;  1JB0 C;  4PQU A;  3QYY A;  2Z0G A;  4K2J A;  3HHL B;  1B0P A;  4WZQ A;  1FNO A;  3KLI A;  4ED5 A;  2W7A A;  1HQU B;  3W8P A;  3WX4 A;  2HHQ A;  2KKH A;  2VFR A;  1IKY A;  5EDW A;  1EX8 A;  2V4Q A;  4JBC A;  3D66 A;  2ZD1 B;  3LAN A;  1ITP A;  1Z1Z A;  4FNI A;  2WOM B;  4Q8E A;  2W4P A;  5E3P A;  4NA3 A;  1TK0 A;  1B64 A;  1HFE L;  1XR7 A;  3GFY A;  3I0S A;  4TN2 A;  4Y6I A;  1NB2 A;  3HVR A;  3C3L A;  5C25 B;  2QFI A;  4TNO A;  4I2Q B;  5KFE A;  2N7C A;  4TQS A;  2G2O A;  2B7B B;  2O67 A;  1O0P A;  3QQC D;  4JV5 F;  2AV5 A;  2RS8 A;  4JI6 J;  4CO5 A;  3DGP A;  2XO7 A;  1RT5 A;  2ACM A;  3FSX A;  1URR A;  4DOZ A;  1H2T Z;  5MAO A;  1KBR A;  2IJN A;  3MED A;  4F4Z A;  1YRX A;  3ZO7 A;  4KHP F;  2AHO B;  3M30 B;  1DY3 A;  3DOK A;  5E5N A;  2QRR A;  2HAI A;  5A8R A;  2XY7 A;  3P6Y C;  2H1Y A;  2YQ0 A;  4MKA A;  4NXM F;  2NPI A;  5LJ5 Y;  2DCL A;  2F8E X;  3CME S;  2ZKU A;  1S49 A;  4DXL A;  4IDK B;  5LMU F;  1GK8 A;  5E7O B;  2VG5 A;  2HWH A;  1F60 B;  2M3D A;  2E1C A;  1T03 B;  1RJJ A;  2VUG A;  2C1E B;  3I0R B;  1WF2 A;  4H4O B;  3K5N A;  1S0O A;  1H74 A;  3AD7 C;  1WDD A;  4GKK J;  3M2V A;  3NGR A;  1Q7Y T;  3M05 A;  3KJN B;  2OTL S;  3EVO A;  3EUN A;  4YDX A;  4J7C A;  3MF5 A;  1HYS B;  3D5M A;  3SQO P;  1HBN A;  1V5I B;  4AYB D;  3PW0 A;  3R1H A;  3P5B P;  1CSJ A;  4Z7C A;  1FHT A;  2JNJ A;  1FO1 A;  2MKY A;  4ZCM A;  4TY8 B;  5KFS A;  2MKK A;  4JI6 F;  4A8S A;  2JJ4 D;  3CIM A;  2Q1L A;  3O3L A;  5FDL A;  3THT A;  4DZD A;  3K5M A;  3TAM A;  5HO4 A;  2N3L A;  2J76 E;  2DH8 A;  1F2G A;  3MWB A;  5F8N A;  2QLF B;  3FMB A;  1Y3K A;  3GJQ B;  3V4I B;  4HVZ A;  4Y34 A;  4BHQ A;  2CZ4 A;  3TEH B;  2H4W B;  2I1R A;  1XQI A;  4LBP A;  4K4Y A;  3KHR A;  2V69 A;  2VPX B;  1U26 A;  4IG0 A;  1BC6 A;  2G1H A;  4BWM A;  2CPE A;  2IJR A;  4AND A;  2XHC A;  1IR0 A;  3PCO B;  3BO2 A;  2VC1 A;  3H98 A;  1HNI A;  1M1K T;  3OTO J;  1D9D A;  4GVB B;  4QWE A;  1CJU A;  3MR5 A;  1ZTW A;  1VBX A;  3T19 A;  1U6B A;  3K7R A;  4WIQ A;  2OEL A;  4ZVP B;  3G8T A;  2ZH8 A;  3KWM A;  3QGG A;  1S1U A;  3B8H A;  4OZ3 A;  4GKK F;  3TJ9 A;  1K73 T;  4H4M A;  4CYU B;  4DUZ J;  3K58 A;  2D41 A;  2BRL A;  1MU2 B;  4J9V A;  3T1Y J;  1WEX A;  2RU3 A;  1BQM B;  2EK1 A;  4M5G A;  4YB1 P;  2YKA A;  1XK8 A;  1XBW A;  1LFP A;  4DS4 A;  1RT1 A;  4PEO A;  2VPY B;  1VHF A;  1RXO B;  5C5J A;  3VZI A;  5RUB A;  4U8V A;  2FQQ B;  3DXB A;  3B54 A;  2M7S A;  3G96 A;  1FKO A;  2ZOF A;  1NSA A;  2BAN B;  3CJK A;  3CDW A;  2RF2 B;  3PV8 A;  1YLX A;  2DPJ A;  4XK8 C;  3W1Y C;  1D3W A;  4FF3 A;  5HVF A;  2HZV A;  1Z2Z A;  1KEK A;  1N5S A;  1MG7 A;  2WW4 A;  1Y9O A;  2VJV A;  4FS1 A;  3IG1 A;  4USV A;  1RB0 A;  2CQ3 A;  4JI4 F;  4X66 J;  5L38 A;  4LSL A;  3C66 A;  2QFJ A;  4RNN A;  5KG7 A;  2E9Z A;  1K8A T;  3E51 A;  1TV6 A;  2DK2 A;  3MMA B;  4FF2 A;  1RTD B;  1D09 B;  1X4F A;  3KHG A;  1XMO J;  1JXE A;  4DN9 A;  3DLG A;  1VQK S;  2IMW P;  4ELV A;  2LA6 A;  1N5Y A;  3KYL A;  1D0E A;  2LMI A;  4WFA Q;  2Y1I A;  4L6V 3;  4DV7 F;  2IFX A;  5B0C A;  1UMJ A;  2DBB A;  4DUZ F;  2FVC A;  2FHM A;  3FQK A;  2RQC A;  3HVW A;  3N5F A;  3TYT A;  1VQ6 S;  2Z2Y B;  5IT0 A;  1HNZ J;  4K4V A;  2DT9 A;  3KXD A;  5BJR A;  1Q8L A;  2B9E A;  3T5H A;  3JXO A;  5KTQ A;  4KGX B;  2C2R A;  4X4Q A;  2HFN A;  2QE5 A;  1MSW D;  4USH A;  2YWH A;  5FD1 A;  2DR5 A;  1XWL A;  3CCJ S;  3CNQ P;  1SVD A;  2FHJ A;  3MHY A;  2WSE C;  4PRF A;  2YNH B;  4NZ6 A;  1Q5V A;  3HLU A;  1HHQ A;  3QLH A;  3MOZ A;  4X66 F;  2XB2 D;  1RAB B;  1NJI T;  1X5S A;  3CJ4 A;  4FYD A;  2GIR A;  1SQE A;  3OQ2 A;  2FVS A;  1N48 A;  2BKO A;  4AD6 A;  4J9O A;  2OH2 A;  2YNG B;  2VG7 B;  5I3P A;  3PW2 A;  1NK5 A;  2B4U A;  1XMO F;  1S6Q A;  4ZIV A;  2B0G A;  2LQ5 A;  2CPH A;  3ISN C;  3WC0 A;  4NCG B;  1B0T A;  1EET A;  4CIO A;  1RHR B;  2OEM A;  3MPD A;  2HYI B;  4BWJ A;  5EHH A;  2RRA A;  1KOO A;  1VC5 A;  2E1P A;  3AA8 A;  1VRT A;  1FDB A;  1UAW A;  2AZ3 A;  4CLU A;  5HAN A;  3HXM A;  1HNZ F;  1TTH B;  5C24 A;  1B3T A;  1KQF B;  2BX6 A;  2R7W A;  4R25 A;  2CQ2 A;  1X4C A;  4OV6 A;  2UUA J;  4X4P A;  4Y28 C;  1NZ8 A;  3NXZ A;  2P6S A;  4CO0 A;  4CNY A;  5H9E K;  4MIB A;  2WBR A;  4M63 A;  3BR8 A;  4M5L A;  5I4M A;  3OVB A;  1PG5 B;  3CJ5 A;  4DLG A;  3HK2 A;  4K4W A;  1L5U A;  3ILO A;  2QMX A;  2GVZ A;  2V2K A;  4ICL A;  5F8G A;  2QLW A;  3C6T B;  3HSZ A;  5HRO A;  3ZTS A;  1VC6 A;  2L41 A;  5AE2 A;  5EUH A;  1MWZ A;  1RKI A;  3AD8 C;  4ECV A;  3HMJ G;  2V4J A;  1RCX B;  3MAQ A;  2AJ0 A;  3PW4 A;  1HI1 A;  4TKT A;  3WDO A;  1FJE B;  1S1X A;  3CDA A;  2P9G A;  3RRH A;  4OYO A;  2DD8 S;  4HHJ A;  4F4X A;  4KV8 B;  4ZVU B;  3TZX A;  1KVI A;  1S6U A;  2JWN A;  2VB6 A;  3C19 A;  4JUZ A;  3MI7 X;  5F9N A;  4EBE A;  4Q5V A;  3BN7 A;  1S0N A;  2HMI B;  2L48 A;  3JSB A;  5H1S V;  2HFU A;  1ZOT A;  1KD1 T;  4EO8 A;  4DR6 J;  4CP5 A;  2F4V J;  3KUG A;  3GIM A;  8AT1 B;  4OIX A;  2UUA F;  3DLB A;  3GZ7 A;  4OYX A;  1UVJ A;  4F25 A;  3CUN A;  2HUR A;  3PY8 A;  4DV3 J;  1S9E A;  2CPY A;  1KHV A;  5KT6 A;  3LWL A;  2HEK A;  1PYO B;  3BGU A;  4OFZ A;  1FRX A;  1XER A;  2VQE J;  1IKV A;  2G0I A;  2GJ2 A;  3Q8R B;  3FRY A;  1FE4 A;  3MCS A;  4BBY A;  3BYR A;  1R6V A;  4JV0 A;  3MGJ A;  3TWZ A;  3CPW R;  3LPY A;  3HVT A;  2MLY A;  5FLX Y;  4IO9 Q;  3RBX A;  4ZCK A;  2A0F B;  2X3G A;  2YKM A;  3MTK A;  3I96 A;  3GP9 A;  1RWX B;  3KHL A;  1EQ0 A;  1IM6 A;  1TVR B;  4RNO A;  1AT1 B;  4X4N A;  3S8S A;  2OMO A;  3KLH B;  2XSJ B;  4F67 A;  1NPR A;  4IUF A;  2PE8 A;  1P1L A;  3FEZ A;  3M6X A;  2JDJ A;  2HFS A;  4USK A;  3DC2 A;  5LXR A;  2YPZ A;  2HHS A;  1S79 A;  5H9F J;  1PBU A;  2QIF A;  2CQH A;  4U7C A;  1KS2 A;  4NLT A;  1BWE A;  3OTB A;  3W2W B;  1S0V A;  3X1L B;  2ADB A;  2YNF B;  4Q0B B;  1U1N A;  2UVU A;  5A8W B;  1JLC B;  3FBC A;  1VFJ A;  4KJI A;  2GVD A;  4DR6 F;  4NCB A;  2YTC A;  2CQ1 A;  3QT5 A;  2QL5 B;  3NRB A;  3EXC X;  3NEK A;  1WTF A;  2C22 A;  4U67 Q;  4DX7 A; 
#chains in the Genus database with same CATH homology
 3MPD A;  4W98 A;  3FBF A;  1HLW A;  3Q8Y A;  1LEO A;  2DY9 A;  4DUT A;  3VGT A;  1NDL A;  1KDN A;  1XQI A;  5IOL A;  2VU5 A;  3EE3 A;  3ELH A;  4FKX A;  3B6B A;  4DI6 A;  1BE4 A;  2HVE A;  3FBB A;  3FKB A;  3VVT A;  2AZ3 A;  3VGV A;  1PAE X;  3FC9 A;  3Q83 A;  3GP9 A;  3ZTO A;  3R9L A;  4F4A A;  4AND A;  2AZ1 A;  3FBE A;  2HVD A;  1U8W A;  1NCL A;  3L7U A;  2DXD A;  4WBF A;  2BX6 A;  3EMT A;  4KPC A;  4O0N A;  3Q86 A;  3BBF A;  3EM1 A;  2ZUA A;  4ENO A;  1NB2 A;  3ETM A;  3GPA A;  3Q89 A;  1B4S A;  2DXF A;  2DXE A;  3NGR A;  3EIC A;  4ANC A;  4UOH A;  5BXI A;  1F3F A;  3Q8V A;  3G2X A;  1S57 A;  3EVO A;  4C6A A;  5CAB A;  1EHW A;  1S59 A;  3NGT A;  3PRV A;  3JS9 A;  4FKY A;  1HHQ A;  1F6T A;  1LWX A;  4CP5 A;  1NDK A;  1BUX A;  1NDP A;  3WX8 A;  1NDC A;  4DZ6 A;  2NCK L;  1UCN A;  1S5Z A;  1NHK L;  1NSP A;  1VYA A;  1WKJ A;  1WKK A;  2HUR A;  1WKL A;  3EVM A;  2BEF A;  2DYA A;  5C7P A;  1MN9 A;  3FBC A;  3DKD A;  1B99 A;  3BH6 B;  1HIY A;  3BBB A;  3NGU A;  4S0M A;  1NUE A;  1JXV A;  1NSQ A;  3ZTP A;  1XIQ A;  3ZTQ A;  4UOG A;  2B8P A;  5CAA A;  3EJM A;  3EVW A;  2CWK A;  3VVU A;  4UOF A;  3ENA A;  4ANE A;  4HR2 A;  3VGS A;  4F36 A;  1NSK L;  3VGU A;  2B8Q A;  3FCW A;  3NGS A;  1NLK L;  1K44 A;  3DDI A;  1MN7 A;  3ZTS A;  3B54 A;  1NPK A;  3BBC A;  3FCV A;  1PKU A;  3Q8U A;  3BH7 B;  3PJ9 A;  3ZTR A;  4EK2 A;  1W7W A;  1BHN A;  1ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...