3MEEB

Hiv-1 reverse transcriptase in complex with tmc278
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
401
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 106
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3meeB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeB04
4ZVHA 4MK7A 1J5OA 4EO6A 4MKAA 4M95A 5DQHA 2C28A 3CDEA 3KHRA 3DLGA 3Q8RB 3NMAA 4IFVA 5KFAA 3IS9A 4U6PA 2HWIA 4EBDA 3BQ1A 4ZMMA 5EWEA 2FJXA 4JV1A 3LP1B 4RNMA 1S9EA 2C2RA 5HROA 4Y3CA 4URGA 2W9AA 1QAIA 5KFQA 2UUTA 1LWEA 5CYQB 2IAJB 4H54A 4FS2A 2BQRA 2F8EX 3EPIA 1K1QA 3C6TB 5KFUA 2FLLA 1S1TB 2HNZA 4RNOA 2J6SA 5I3UA 3I5CA 3MEEB 4J9RA 4IG0A 3RB6A 1RT3A 4I7FA 2EC0A 4KKOA 2WOMB 4H4MA 4ZPDA 4WE1B 5EUHA 4EYIB 1C2PA 5DLGA 1HMVB 5J1EB 3E01A 1JLGB 4WFYA 1S0MA 4X2BA 4ZP6A 3KLGB 2UVUA 3I5AA 3PW2A 1T05B 3BQ2A 1N56A 4IR9A 4DL2A 3KNAA 3CJ0A 4K50A 5KFKA 1JKHA 3MR6A 2W9BB 1LWCA 1QE1A 1KLMB 3G86A 5DG8A 4FS1A 5F8GA 4ECUA 2FVQA 1NNDA 1RTHA 1S1VA 2VG6B 4GC6A 3GIIA 2V9WA 2XCPA 1ZETA 4FBUA 1RT1B 3MR5A 2B6AB 4RU9A 3DRSB 4MKBA 3PZPA 3ITHA 4LSLB 1HNIA 1UWBB 3N6MA 3JSMB 1T03B 4F4WA 1XR7A 1DLOB 3E51A 2HMIA 4WFXA 4YR3A 3KLEA 2AX0A 4WYLA 4K4SA 5KFNA 1S49A 2WONA 3GYNA 3MEGA 5DLFA 2W9CB 3M8PA 1RTDB 2CKWA 4DL6A 3KMSA 1EP4B 2YKNB 2ZKUA 5T14A 4MK9A 3OLAA 1RYRA 4NRUA 1MMLA 5HBMB 2AU0A 1RDRA 4H4OB 2I1RA 4ZPAA 4ECTA 1C1CB 5KFGA 2UUWA 3V4IB 3LP1A 4ED2A 3ISND 4XO0A 4ECZA 3LP0B 3BSCA 3BJYA 3EPGA 4O3OA 4DEZA 3C6UA 3GV7B 1C0UB 5KFIA 4QPXA 2BE2B 5CYQA 4ED6A 1RYSA 3I0SA 2V4RA 3KJVB 3NAIA 2R8HA 3C6TA 3QIDA 3V6KA 2FVSA 2D41A 5KG3A 3LAMA 3DLKB 4IFVB 3IS9B 4O3NA 3NBPB 3MEEA 3IRXA 4YR0A 2FLNA 2JEIA 2WOMA 4WE1A 2ASLA 4WZQA 3DRRB 1TKZB 3MF5A 5KFTA 4F4ZA 5J2NB 3BR9A 5J1EA 4Q0BA 1S9EB 4KFBB 1RA7A 2BANA 1JLGA 4O4GA 3SFGA 1IKWB 3KLGA 1XR6A 1T05A 4URSA 2WTFA 2VA3A 2FVCA 1EETB 3HKWA 3GIJA 3D5MA 4J9QA 5KG2A 4O3SA 1KLMA 4ZVFA 2D3UA 2XI3A 1FK9A 2B5JA 3G6YA 1RT3B 2VG6A 5FDLB 4NZ0A 2OPSB 2AGPA 2FJVA 3M9MB 3DRSA 5KG6A 4TLRA 3KHHA 3RB3A 2R2UA 4YMEA 2GC8A 4LSLA 4RNNA 1UWBA 4KAIA 1T03A 3QGIA 2JLEA 4F4YA 1DLOA 3DMJA 5KFSA 3TQ1A 1SH0A 1FKOA 5KT2A 2ILYA 2ATLA 4EBCA 3H40A 1RT7A 1VRUB 2D7SA 5KFOA 2JC0A 1BQNB 2JEJA 1RTHB 2W9CA 1RTDA 2C2DA 3MFHA 1EP4A 3LALA 2YKNA 1S0NA 3KK3B 3DLEB 5HBMA 1QAJA 4Y34A 4H4OA 3ITHB 2YNFA 4IRCA 2WCXA 3IGVA 3ISNC 3FQKA 2AQ4A 4K4VA 3H5XA 3IN5A 3BGRB 2HMIB 4U7CA 1C0UA 4EYHB 2J6UA 2BE2A 4FBTA 5KT7A 3MEGB 3KJVA 5F9NA 3M8PB 1JXLA 4KHRA 1CSJA 4IH5A 3DLKA 1W25A 4EO8A 3NBPA 4NLSA 2IJNA 2E9RX 3GIKA 4NYZA 5DQIA 3CJ2A 3DRRA 1TKZA 4MK8A 3SI8A 2YNGB 5J2NA 4TN2A 4KFBA 5KT4A 1ZTTA 5F9LA 4ECVA 3C6UB 2QE5A 1IKWA 2BRLA 4MH8A 1N4LA 1YVFA 1SV5B 1S10A 2IA6A 4JV0A 1SUQB 3I0SB 1ZTWA 1EETA 4YP3A 4QW9A 3Q8PB 4J9MA 3KHGA 2W7OA 1TKXB 3OSNA 3CJ3A 3IRXB 1K1SA 5FDLA 4ED1A 4NLVA 2V0NA 4ZP7A 4NLQA 2ZE2B 2OPSA 1TV6A 3CJ5A 3HVAA 4QWBA 4Q0BB 4RNFA 3MR3A 4ICLB 2BANB 2HNDA 4O4GB 1S6QA 1N6QB 4ED3A 4DL5A 1JLBA 2RF2B 3QIPA 4IQXA 3H4BA 4TQRA 3M9NB 4NLGA 1VRUA 3IG1B 4B3OA 5KFEA 1C1BA 1IKXB 1FK9B 5D3GB 1BQNA 2B5JB 3DRPB 5HP1B 5F8IA 1HQUB 3KK3A 3DLEA 3MTKA 1S9GA 2XGPA 4WFZA 3LP2B 3CIZA 1S1UB 3PR4A 4KE5A 4ECYA 3CJ4A 1TP7A 2R2SA 3BGRA 2VA2A 3M8QB 3DMJB 2OPQB 5DGBA 3M9OB 1FKOB 5KFBA 1RT7B 3DYAB 5CYMB 4RW6B 4DL7A 3H98A 3KLIB 1SH2A 3N6LA 1QUVA 3QGHA 4ECWA 5DG7A 2ALZA 5HLFA 1LWFB 3TVKA 4IH6A 4ZHRB 4IG3A 2GIRA 4JV2A 4IRDA 3Q8QB 4WYWA 3KOAA 3MECA 4IKAA 2E9ZA 2YNFB 3PJXA 4DL4A 3NAHA 4M94A 3QO9A 1RTIB 3HVTB 2YNGA 4KB7A 2FLPA 1U09A 1S1WB 3OL7A 3GILA 1SV5A 4O3PA 5I42B 2AX1A 1SUQA 4J9NA 1T3NA 4NLPA 3MFIA 1JLCA 3UR0A 1TKXA 1SH3A 2WB4A 4K4XA 3DM2B 4RW4B 3PJWA 4ZVEA 4GC7A 1JLEA 1R0AB 3PW4A 3RBEA 4Q8FA 4ID5B 4R5PA 2XWYA 1FKPB 3BSNA 5L1KA 3V6JA 2ZE2A 3UQSA 4G1QB 3OHBA 5F8NA 2ZD1A 2UVVA 4ICLA 4Q44A 3OSPA 2YNHB 3TAMA 1N6QA 2WRMA 2WHOA 5KFMA 2OH2A 2RF2A 3T5JA 3KMQA 2IM1A 3PVXA 4HYKA 5KFHA 4RW7B 1LW0B 1C0TB 2V4QA 1MU2A 3CO9A 5KG1A 3IG1A 2R8KA 5D3GA 1IKXA 1LW2B 2CJQA 4ECXA 3DRPA 5HP1A 2QV6A 1HQUA 4R8UB 1N48A 2C2EA 1TV6B 2XGQA 1D1UA 1RA6A 5F8JA 3SFUA 3LP2A 2HNDB 3KK2B 3CVKA 1S1UA 4DG1A 1S6QB 5K14B 1S4FA 4NLTA 4O4RA 1XR5A 5KFRA 1JLBB 3H5YA 3BSAA 2JEGA 3QIPB 4PUOB 4ZP9A 3M8QA 5KFFA 1RT2B 2OPQA 2OPPA 5F8MA 4KHMA 1N5YB 3GV5B 5L1LA 4NCGA 3DYAA 5CYMA 4B3OB 4RW6A 5KG0A 1C1BB 1IM4A 3QZ7A 3KLIA 2RDJA 4LSNA 4TY9A 4LQ9A 1LWFA 5KT6A 3PR5B 4TXSA 3KHLA 1RTJB 3FFIB 4ZHRA 1S9GB 4JUZA 4URQU 1GX6A 3LAKA 3D28A 4ZPBA 4TQSA 5KG4A 1RTIA 5J2PB 1KHWA 3HVTA 5F8LA 5KFJA 4NRTA 5C5JA 2C22A 2D3ZA 1S1WA 5KFYA 4IDKA 2FVPA 5KFDA 1JX4A 2VG5A 5I42A 2BR0A 2R2RA 1VRTA 5HLFB 4TYAA 4MFBB 4RW8B 3NGDA 4IG3B 2OPRB 3DM2A 1REVA 4RW4A 3PW5A 1R0AA 3IGNA 3MECB 4NLWA 4WXWA 2RKIB 4ID5A 3CDWA 3OL6A 1FKPA 4KO0B 3QLHB 3QO9B 5J2MA 1TL3A 4IOBA 4G1QA 4O3QA 1S6PB 4ED7A 4QWEA 2WK4A 3RAQA 1DTTA 3QZ8A 2YNHA 2AWZA 4ED8A 5JXSA 4NLOA 3UPFA 4RUCA 4HKQA 3I0RA 4F50A 5KT3A 1TKTB 4RW7A 2RDIA 1LW0A 1C0TA 4PQUB 5F8HA 3N6NA 1JLCB 3T1AA 2O5DA 1KHVA 3MEDA 1LW2A 1TL1B 3DOKB 1JLEB 3KLFB 4YQWA 2YKMA 2IM0A 4ZP8A 5KT5A 1JLQB 4G3IA 1TQLA 4R5PB 4Y2AA 3KK1B 4WXOA 4R8UA 4Q45A 2IC3A 3FSIA 1RT6A 4ECQA 2ZD1B 3H5UA 4Y2CA 2UVRA 3KK2A 3PW0A 2AGQA 3TAMB 2DPIA 5K14A 2R8JA 1WNEA 1IKYA 5C24A 4PUOA 3H2LA 5C25B 1RT2A 3V6DB 2IM2A 1N5YA 4MIAA 1DTQA 2XC9A 1MU2B 4TY8B 3PW7A 1I6JA 4YR2A 3GV8B 3JYTB 2R8IA 2IM3A 4ECRA 1S9FA 3V6HA 2JC1A 1RTJA 3FFIA 1HQEA 1TVRB 2W7PA 3QGGA 1S48A 3RBDA 3NKYA 1HPZB 4DG1B 5KFWA 2I5JB 5J2PA 4I2PB 2XI2A 3KLVA 2AGOA 2OPPB 3FQLA 4DL3A 4O44B 4NCGB 5KFPA 4QWCA 3LANA 2J6TA 2YNIA 2VG7A 4LSNB 1RT5B 3T19A 2E9TA 3DDKA 1S0OA 4NLYA 4MFBA 4RW8A 2IBKA 4J9KA 2OPRA 2HAIA 3ICLA 1BQMA 2XCAA 4NLRA 4XPCA 2RKIA 4IFYB 3KLHB 2FJWA 2BQ3A 4KO0A 3QLHA 3CDUA 4PWDB 3H59A 3RB4A 4R0EA 1HARA 1S6PA 4KBIA 4Q8EA 4ED0A 3H5SA 4IDKB 1HYSB 3V81A 4EEYA 3OL8A 2VG5B 2DPJA 3OHAA 3VQSA 4J9SA 2JEFA 3DI6B 1RT4B 1TKTA 1IKVA 1S1XB 4PQUA 4RW9B 1VRTB 2FVRA 1HNVA 4KV8B 2GIQA 3FRZA 1JLFB 1JLAB 1TL1A 1REVB 3DOLB 3DOKA 4I2QB 3KLFA 1GX5A 4J9LA 1JLQA 5DGAA 5J2MB 3KK1A 3G6XA 4IRKA 1TL3B 3Q8SB 3T5HA 3GQCA 1DTTB 4QWAA 3OL9A 5J2QB 4LQ3A 2HNYB 5C42B 5L9XA 4K4ZA 5JUMA 3I0RB 5KG5A 2W8KA 5C25A 2ASJA 3V6DA 3HVWA 3T5KA 4K4YA 4TY8A 2IAJA 3MEDB 1J5OB 4TYBA 3JYTA 2YKMB 4RZRA 5EDWA 1OS5A 2BQUA 3NL0A 1S1TA 3DLGB 5KFLA 4J9OA 3I5BA 2IC3B 1TVRA 3RAXA 1RT6B 1D0EA 1HPZA 4XPEA 3BQ0A 2I5JA 4K4TA 3GIMA 5KFCA 4WZMA 1HMVA 1IKYB 4I2PA 5C24B 5KFZA 5HROB 4IH7A 5DG9A 1JIHA 1DTQB 4O44A 1LWEB 2BRKA 2ASDA 4K4UA 1S97A 4KSEB 1RT5A 2W9BA 2B43A 4MIBA 4ZVGA 2HNZB 1Z4UA 1HQEB 5I3UB 4RNHA 5DQGA 3G6VA 4IG0B 3QYYA 2R8GA 4I7FB 4EBEA 4KKOB 4H4MB 3KLHA 4IFYA 5EWFA 3EZUA 3HHKA 1RT1A 4QWDA 4PWDA 2B6AA 3PHEA 5EWGA 3OLBA 3BSOA 3E01B 5L1IA 4K4WA 3JSMA 2R2TA 5L1JA 4J9PA 1HYSA 4RUAA 3T5LA 2YNIB 3CWJA 2VG7B 3UDLA 3DI6A 1RT4A 2HWHA 1S1XA 1JKHB 2IJFA 3MR2A 1LWCB 1QE1B 4RW9A 4F4XA 4KV8A 4QW8A 1JLFA 1JLAA 2UVWA 3DOLA 1S1VB 4I2QA 1BQMB 3FDSA 1RAJA 1C1CA 4O3RA 2ILZA 4ZPCA 1HNIB 4NLXA 5J2QA 3H4DA 2HNYA 1T94A 5C42A 4OL8A 3V4IA 4Q43A 3V81B 2IMWP 3LP0A 4NLUA 4IR1A 4NLDA 2W8LA 3RB0A 5KFXA 1IKVB 1NHVA 3KLEB 5KFVA 1NHUA 5KG7A 3BREA 1HNVB 2WONB 4ECSA
chains in the Genus database with same CATH superfamily
4MK7A 4YHHJ 3KHRA 3E8OA 3BQ1A 4ZMMA 3HVRA 2QC3A 1GXTA 2HBQB 1QAIA 3MD3A 4BC7A 2YBVA 2UXBF 2KXHA 1ELOA 3PYEA 2VQFJ 3TWZA 4H4MA 4NASA 4EYIB 3SYZA 1UMJA 1IR1A 3IBWA 4IR9A 2Y1LB 1NKEA 1JKHA 3JTPA 1FEHA 4RU2A 2DKOB 4GC6A 3MR5A 1UWBB 1GTEA 2V4JA 2J9CA 3D67A 2DEIA 3OXGA 3RR7A 2ZKUA 2H5EA 3MUTP 9ATCB 3S01A 4DS4A 2E44A 4ECZA 3LP0B 3IC1A 1C0UB 3LWLA 5KFIA 3I0SA 1R0BG 2EFNA 1NK6A 3UR3C 2JEIA 2XY5A 2ASLA 4WZQA 1S9EB 2CAJA 2XSJB 3HKWA 3D5MA 5KG2A 3ZZPA 2PI4A 2Q79A 2WSFC 3DRSA 3KHHA 3RBXA 2ZH6A 1RHQB 2FJBB 2WBRA 4JYAF 4DV3F 2OEKA 1VI7A 2IVFB 1EP4A 3HD1A 3KK3B 1HHTP 1BLUA 1WKJA 2WZ1A 2PE8A 4L76A 2PA8D 1KQSR 3BH7B 5D4PA 4NLSA 2IJNA 4HH0A 2ZBRA 4L72B 3QBCA 2P6TA 4JI2F 4LIRA 2OJ3A 4LF7J 2B8QA 4ILLA 3SCIE 4CO1A 4NLQA 4OQJA 1BGXT 1S6QA 1RHUB 2CADA 1U6BA 2RF2B 2DNLA 2MKSA 2EEYA 3K57A 2LKZA 1X0FA 4OFZA 5B0DA 1OSDA 1S9GA 1H98A 3PR4A 1OY8A 2PDAA 2VOPA 3SDEA 2LU1A 1X4HA 3SQOP 4IRDA 1XIQA 3LF0A 3QO9A 1IWGA 2DT9A 2FLPA 3NOGA 5LT5A 1S7IA 4HT5A 2IJRA 1SH3A 2O01C 4Z7YA 3I4PA 1RP5A 4G1QB 1XMOF 4ECXA 1PCAA 3AOCA 1UPPA 5KFRA 1MMDA 1Q95G 4PZVA 2RAQA 3KDOA 2RDJA 1TKDA 4URQU 3G4SS 4YB6A 1F3VA 2ZBQA 1SC6A 3ET6B 2BA9A 3CJRA 2CQ3A 3M6VA 4IG3B 4OMFG 2OPRB 3TA0A 3PYDA 2YX1A 1H72C 4O3QA 2ZH4A 2JLFA 4K2XA 4MIWA 3MDFA 3UW1A 4WK3A 1U6FA 4RW7A 1LW0A 3TO8A 4M1KA 1JLCB 4D3GA 3GTYX 1TL1B 3CNQP 2ZM6J 3C46A 2NYIA 3PW0A 3CCUS 1ZAWA 3MAHA 3PCOB 1SXLA 2UUBJ 2ATCB 5KFWA 4DF4A 2WBMA 4JI6J 2HS4A 3S1TA 2GO9A 2ZWOA 3D6HB 3HCXA 2WAQD 1IBMF 3IM8A 2V2KA 1I94F 3MMCB 2RKIA 2HRUA 3QLHA 3DKDA 3LPYA 4USMA 3TZXA 4PQUA 2V67A 3EJMA 3S7RA 1Q78A 2C3OA 1REVB 4J9LA 4LREA 2VICA 4A8YA 3HHNB 3A8EA 3MWBA 4WIQA 2AIRB 1V5VA 1PSDA 5C25A 2W8KA 2J0SD 1HBNB 3T5KA 2IAJA 2HVHA 1QM9A 1M5OC 2GO8A 3I5BA 2UV8A 2IHR1 3BDEA 3V2UC 1HPZA 4K4TA 3M2UA 4G6VB 3IA0A 5KFZA 4BWJA 5DG9A 2BOAA 2Z0GA 1YQHA 3THTA 1FWLA 3VWSA 2MHNA 1RWWB 4RNHA 5DQGA 4RKUC 3I96A 1N52B 2VJVA 4DV2J 1WG1A 4WCEQ 2R7WA 3CPWR 1UEKA 2OSRA 4K7QA 3SSRA 1N34J 1JLAA 1HNXJ 3DOLA 2E7XA 1PBUA 1R6YA 1QLNA 1UAWA 4DFJA 4YB5A 1C1CA 1U45A 4Q43A 4IR1A 3GSIA 5KFVA 4J7CA 1YLXA 1R3NA 5KG7A 3WX8A 2BYCA 4YHHF 1QAXA 4UOFA 3W9JA 4Y3CA 3OFEA 5KFQA 3TAPA 3I87A 2XEXA 1KFSA 5F3ZA 3BBFA 2CFXA 2VQFF 4DSKA 3P5BP 4ZOSA 1LWCA 4I67A 3BGLA 2DNPA 1JB0C 2GNKA 4RU9A 3PZPA 3ITHA 1J27A 3N6MA 4ALZA 3P3DA 4F4WA 4LSZB 2KL8A 2W4PA 5IS2A 5DLFA 2VHGA 4BBYA 1RYRA 2XS5A 1BE4A 4H4OB 1RWMB 4PWUA 1XWLA 1NJZA 1GEHA 1F1BB 3HT3A 3ZFVA 4AXIA 5CD4H 3POTA 3TJAA 3HHLA 3GJSB 3AT1B 2FVCA 2MJNA 5DS7A 4ZN3A 3K0JA 3MPWA 1FK9A 5GVQA 2B5JA 3VAHA 4YMEA 3EZ5A 1UWBA 2OO4A 2F1FA 4DSLA 2CQ1A 4EBCA 3H0PA 3EDQB 2MZTA 3DLEB 4QIFA 4IRCA 2WCXA 5IM0B 2LDYA 2HBZB 4U7CA 1C0UA 2ZH7A 4A48A 5C2GA 2VFTA 1W25A 1TELA 3CJ2A 1JJ2R 3RW6A 4CLSA 1ZTTA 4CLTA 5F9LA 3CGIA 3EX7B 5EX3A 4KH0B 4YP3A 2OTLS 3T3FA 4J9MA 3OSNA 4LF7F 5A2QU 2JJ4D 1VK3A 1H2TZ 3FRYA 4NLGA 1NJWA 3NCPA 1VFJA 3VR1A 4ZVSB 3KK3A 4WFZA 1FXRA 1YZ7A 1KEKA 3DMJB 2XYHB 5FLXY 1VC0A 1JJ4A 1CJUB 2DO4A 4J9UE 1FJ7A 2IBOA 2MHEA 1RK8A 5A2QY 3NGSA 3TX0A 1XEZA 1Q79A 1OSCA 2QL9B 3MFIA 3BS9A 3UR0A 3EUNA 4R5PA 3Q86A 2VB6A 2ZD1A 2UVVA 2LQBA 3PY8A 2RF2A 2RHSB 3AD7C 3U27A 4K0KJ 2V8GA 4FYXB 3R7BB 1KQKA 1X31C 2LXIA 4O4RA 2CIMA 2J0QD 3QQCD 4NCGA 4PYAA 4FN5A 1N36J 4WPAA 1HBMB 1TUGB 4BS2A 4DZ6A 1PAEX 4NRTA 1IXKA 1UPMB 4ZJLA 5HATA 1PILA 3PW5A 1S5ZA 1X0PA 1QSLA 3IBFB 2XSFA 4NLWA 4G1QA 2ZHAA 1OY9A 3MUMP 2Y8WA 1T9WA 2O5DA 1D9FA 4WBFA 2ZDPA 2YKMA 1O51A 1APSA 2ZM6F 4A8QA 2AGQA 1FTCA 4Y28C 1HWKA 1IJFB 4OHVA 4DQIA 1IQZA 3MCSA 3LGMA 2CQIA 4JI4J 4DG1B 2XHWA 3NOCA 2OP5A 2UUBF 3ET6A 3ZZRA 4JI6F 1ICEB 3G71S 3MPUB 3U7JA 5HJXA 1TMMA 1TFWA 2OPRA 2BABA 1BQMA 2XCAA 2CPXA 1K0TA 3J7YU 3AJDA 1AA1B 2QA4S 5I4MA 5DDPC 5D4NA 1TL1A 3EXCX 4WP3A 1QUPA 1U8SA 5F3TA 1NDCA 5GAEU 2FY1A 5JUMA 2D74B 2VJUA 3G96A 3OFHA 2DCLA 4TYBA 3RAXA 1NAQA 4PXDA 2GA7A 4LF1A 4K5SA 4M5DB 1FRJA 2DXFA 2I9SA 2M4MA 1U1MA 3EDRB 2NS1B 1CEZA 4ZPWR 2F65A 4DV2F 2ZBCA 2G2ZA 2G0JA 2YH1A 1N88A 2IJFA 1QE1B 1WOPA 4F3MA 1N34F 1HNXF 5CYJA 2PSZA 5KFXA 2BJ9A 1HNVB 2Y1RI 2V8HA 4JI8J 3R5JB 2X1BA 1W7WA 1OYDA 4DR5F 1SPBP 1RKIA 1WG5A 1RZMA 3NXZA 2J6SA 2B56A 3NMRA 4PXBA 1JLGB 3F44A 1XMQJ 2K7JA 3G86A 4MAKA 1NNDA 1UVLA 3MXHP 3CD7A 4HHHA 3C16B 2AX0A 1ZYQA 2DISA 1TL7B 2W9CB 2X1AA 2YKNB 4PYDA 4OHYA 1QVFR 1NXIA 1RDRA 1FJGJ 1O8BA 3SCKE 3V4IB 3K59A 1RKJA 3MMAB 2P8IA 2F8MA 4QPXA 2J8AA 3HMJG 1KTVA 2W2PP 3LAMA 3DLKB 4IFVB 1X9WA 1PG5B 4L3NA 3CCES 2O67A 4QIGA 4RUHA 3JQKA 2RVJA 3NP5A 5LJ3Y 1F60B 3UCUP 1EETB 1YIJS 4X84A 3F41A 1H6KX 4F4AA 2GGPB 3RJMB 3VF0B 3A8KA 3MM5B 2KM8B 4V1Ak 4H4OA 4ZVTB 4DQSA 3IGVA 3ZZ0A 1SJRA 4FP9A 2HQFA 3CT9A 3W2VB 2VD3A 2HW3A 1H2UX 2WVBA 1R31A 2JLGA 2ROPA 2XZDB 1PBAA 3Q8PB 3EVOA 2Z2ZA 1HKAA 3CJ3A 5IT9U 3IRXB 2Z8QA 3DRYA 3DLJA 3A8JA 1N6QB 2R7QA 3DN9A 3FMBA 2FJEB 1BWEA 4TQRA 5D3GB 3DLEA 3JAMY 3LP2B 2GHWA 4WIIA 5IM0A 1N33J 3M8QB 4J90A 3FVYA 3VGTA 3O8WA 4DL7A 3O1LA 2PMZD 5E3AA 4UOHA 1MWZA 1X4AA 3MMJA 5IT9Y 5IC6B 5GAHU 3CD0A 4Y2IA 3CCVS 3CXCR 2QT7A 1SJ4P 1JLEA 2QYGA 2BBEA 5KFMA 2DEJA 1D3WA 1KVJA 3HJVA 1Q0NA 4K0KF 4R8UB 5D0EA 3PRDA 1EHWA 4A46A 2HNDB 2J9EA 2H51B 4KHMA 4ZIVA 4ANCA 4B3OB 1TU0B 3OFGA 1EQ0A 1N36F 2NSBA 2L08A 5IOLA 4HT7A 4CWBA 2C22A 5RUBA 2BR0A 3GZ7A 3ZTPA 3MTJA 2AD9A 1MG7A 3R2CJ 3QT7A 1NMEB 3KG0A 3OJUA 4F50A 3OJSA 4Y2AA 3ZZUA 2XLJA 2HEKA 4CLWA 3H5UA 2UVRA 1NCLA 5C24A 2Y3YA 3UI3A 1TAUA 2QTWA 3HFVA 3DRXA 5BJRA 2LXFA 5AJ3J 2HG4A 3V6HA 2W7PA 4LRCA 1P1LA 3ELHA 4PG5A 3KLVA 4PR6A 6AT1B 4K2JA 3OT9A 2OELA 1UFWA 2DNKA 3TVYA 1PC5A 4HL9A 4CO2A 2ZUGA 4DX6A 4ES2A 1RCOB 2CQCA 3C3LA 4Q8EA 2G2OA 1G2EA 4YB7A 2E1PA 2JEFA 3DI6B 1IKVA 2K1RA 2CG4A 3HSDA 2RNEA 5DGAA 2EFQA 4UQGA 1F2GA 1Q16B 4LQ3A 3MOZA 2ASJA 4K4YA 3MEDB 1ZM2A 3NL0A 1S1TA 4DL0C 1JK9B 3R97A 3C15B 4IH7A 2KXNB 2MXYA 1LWEB 4KPYA 2VPWB 4ELVA 2E1RA 2EFVA 3FCHA 1BQXA 4RUBA 3D68A 5L1JA 2QA2A 1WWHA 3R27A 2JSXA 1AFIA 1FFGB 2DCUB 2ZH8A 1H2VZ 2J9DE 1A6LA 1NHVA 1RABB 3NS7B 4AL5A 3HJFA 4ECUA 3CCJS 3R5GA 5DQHA 3BEGB 3SSSA 2FGCA 4A4JA 2HWIA 4EBDA 1NO8A 1TZ0A 4JI8F 2DXDA 3D4JA 3O6QA 4M5DA 3HO1A 2BQRA 2F8EX 1GH8A 5HJYA 1FJEB 3MEEB 2KFYA 2JX2A 1T9YA 3W60A 1C2PA 1NBEB 4LF9F 1X8DA 5LM7E 2B51A 5AE2A 1XMQF 1QE1A 4FS1A 2HHXA 1RTHA 4E98A 3GIIA 2B6AB 1YJVA 4IOCQ 3N0VA 3HZEA 5JJBA 3GYNA 1NK9A 5DZ6A 3AHPA 2RU9A 1I1GA 4F4KA 3OTCA 1FJGF 4XO0A 1O5JA 4O3OA 4DEZA 2NXUA 4ED6A 1RWXB 2C2MB 1AZSB 2DGVA 2D41A 3IFEA 1ROFA 1LQ9A 1VQ8S 2BANA 3MURP 1JLGA 1QDUB 2V68A 2DNYA 2DH8A 2XI3A 4YN3B 2DVIA 1DURA 3J7Z5 2JLEA 8AT1B 1FKOA 5GADI 4B3SJ 3G8TA 1ZPWX 1TL7A 2W9CA 4RWWA 2BE9B 2YKNA 3OD2A 2IRUA 1U26A 3OVSA 4J91A 4DPOA 4ETXA 3MMAA 1VQNS 4OYMA 2H3EB 3MEGB 1A0OB 3I56S 1JXLA 5E5NA 2XG8A 2Q6BA 1W2BR 4IH5A 3DLKA 2CZVC 3QJLA 2HQCA 2J7UA 5ADZA 1SV5B 1ULRA 3KG1A 1EETA 2BW2A 2DIUA 2W7OA 1SJQA 1ZS6A 2L3MA 4NLVA 1UW4A 3ONQA 1JLBA 3NGTA 1FE4A 3ZTRA 4PRFA 1RAAB 1M5SA 2LLZA 3MTKA 1YRUA 2XGPA 2BJEA 4KE5A 1X4CA 2OKQA 2AYEA 5LOQA 1SC4B 3DDNA 1N33F 3RGIA 4W92B 3TUJC 2GIRA 5CHCB 2Y8YA 1S76D 4M94A 1KNZA 5ETKA 4KB7A 4ZCKA 3CJ8A 3EGNA 2HSEB 1VQ4S 2AEJA 1T3NA 2GJ2A 4K4XA 4RW4B 3PJWA 1ZPVA 1FKPB 1A7GE 2AW0A 2LU2A 2BJ1A 1NUEA 5E3RA 1N6QA 3R5DA 5AXMA 2OH2A 1VIXA 5DM7Q 5D3GA 4CO5A 4OYOA 4G1IA 3LP2A 4NLTA 3M8QA 1N5YB 1U2CA 1UFLA 2RQMA 3PR5B 4O0NA 2V2VA 1VJQA 2YPZA 4JUZA 1UVKA 3Q89A 1PJ5A 2A2CA 4NX9A 2Y0SD 1JWWA 1JX4A 2R2RA 4TYAA 2HZVA 2ZH5A 2YWHA 3CDWA 1V3ZA 1PJ7A 1KLNA 4W98A 1RHMB 2CQ4A 3N6NA 1IVZA 1UJ4A 3TI0A 4G3IA 4R8UA 4WXOA 2ADBA 4FPRA 3FCWA 2QGFB 3CF5Q 1WHVA 3B4DA 1U1QA 3M8ZA 5AJ3F 1FDNA 4CH1A 1YJUA 4ATNA 3OXLA 2Y1IA 1W2IA 4B02A 2OPPB 1T7PA 3AD9C 4MKYA 4QWCA 1Q81T 1TK8A 1YG0A 3JSYA 3CJQA 2B4PA 1NK0A 1G1XA 2QRRA 3H59A 4S0MA 4GVBB 2PEBA 2GMHA 1S1XB 4Z7CA 2CNKB 3VGVA 1R8PA 2POKA 3H42A 1DTTB 5KG5A 1ITPA 4D3HA 3OXFA 3DU5A 4DUZJ 3HKZD 3KFWX 4XPEA 1BMQB 3ZC4A 1JIHA 1DTQB 3KYLA 3AFGA 2CJYB 4E2FB 2QSWA 4IG0B 1FTRA 4NMLA 2C42A 3BSOA 3NGRA 1F9HA 2VG7B 3DI6A 4AD6A 2HVIA 5D0HA 4XDDA 1RAJA 2EKNA 3LUYA 1T94A 1UFKA 3CTRA 4N56A 5IT4A 4F0KA 4ED5A 2KFZA 2AYGA 1YX2A 2LQ5A 3C15A 2OMOA 5HMXA 1LWEA 4FS2A 1KN6A 3SV4A 3K5OA 5M2PA 3MPVA 3AODA 3EXYA 4FKYA 3H2VE 2R7RA 5L39A 4B9MA 3CC7S 2QLJB 3HFZB 4WFYA 2R4FA 4M5NA 2HQ3A 2V9WA 3GMGA 1EJ7L 1XJWB 5IFMA 4YS2A 3FEZA 2GQ2A 4PEOA 4MK9A 2M2BA 2KFNA 4ECTA 4J9VA 2CNOB 1WC1A 1AFJA 2DY9A 2BJDA 3EYZA 2KKHA 5ETNA 2DH9A 1EAYC 2BE7D 1D8ZA 4YR0A 3MEEA 3OUYA 1B7FA 4FZVA 2CPZA 4NI2B 1XBWA 4ZVFA 4HLBA 1VC6A 2GC8A 2Z56B 4C8OA 1RT7A 1VRUB 2FIUA 2ZVIA 1AUSL 3VZHA 1NM2A 2RE1A 3IN5A 2G1DA 4LFCJ 3D6TB 2A0FB 2J6UA 2NUHA 1AZSA 3D3BJ 3L7PA 2W2MP 1YTYA 2A18A 1U1KA 1DJ0A 4WFAQ 4MH8A 4JV0A 1SUQB 1N54B 3ENAA 2A6MA 2HIQA 4OYXA 5LMUJ 4ED1A 4ZP7A 4DUTA 4O4GB 4DL5A 4M5IA 3TUPA 1TL5A 3IG1B 2RQCA 2R7TA 1RBOB 4ITSA 2NUUG 2UUCF 3M9OB 4AFFA 1IBLF 3QGHA 1QUVA 3ILLA 4JV2A 3MECA 1RWOB 3NAHA 3VGUA 4I0WA 1SV5A 4J9NA 1NDLA 4GC7A 5D0RA 4U8YA 7FD1A 4DN9A 2G0CA 1ZOTA 5KG1A 1FHTA 3GE9A 1D1UA 5HSPA 3S8SA 1S4FA 3H8YA 4PUOB 3GV5B 4LIWA 4TY9A 5K8OA 4LQ9A 2UXCJ 3K17A 4EMDA 4Q5VA 2QFJA 4Y0FA 2QMWA 4RW4A 3CCTA 3PXGa 1FKPA 3IM9A 5A76A 2R7UA 2VC1A 2JWNA 3BYRA 3B54A 1YJ9S 2NXJA 4A47A 1HLWA 1Q8BA 2X1GA 2XY6A 4Q45A 4B9TA 2ZBPA 1RT6A 3MCNA 4C8ZA 2NZCA 1IKYA 2PIIA 3FBFA 1N5YA 3PX0A 2Q6CA 2B4UA 2CJXB 4TY8B 3S6EA 2R8IA 2U1AA 1SL1A 2OD6A 4KY3A 1S48A 3IXQA 1PKUA 4K59A 1LXJA 2RQ4A 5B0AA 1VLOA 2W25A 4EUVA 2E9TA 2GX8A 3Q22A 1WHWA 5D78A 1FT8A 2GAGC 3CDUA 5THWA 2CDRB 4J9SA 4DV1J 3OV7A 2HHQA 1UL3A 2DHAA 3FJ2A 3W8PA 4C8LA 4RWXA 3HXMA 3TX8A 5EDWA 4DUZF 1B70B 5EGYA 4KR0B 4QQBA 2J7KA 1CJKB 1R7IA 1DBDA 2R7SA 4MIBA 5I3UB 5IV4A 1MN9A 2XWXA 3QFHA 5EWFA 1NK7A 3HD2A 4GVBA 3PHTA 3H2UB 3CUNA 2I6WA 3UDLA 1S1XA 4N77A 1NJIT 4OIXA 1XC9A 2FUG9 1X9MA 1AXQA 2KN4A 3EM1A 4ZVHA 2H4WB 3BO2A 3IS9A 3D7SB 2VDIA 4RNMA 4ZVUB 5KOXA 4WTOB 2UUTA 3RZAA 1FNXH 3CCMS 1NDKA 3U1NA 4DPTA 4J9RA 4IG0A 4BWMA 3NY0A 3M8YA 1YITS 3BQ2A 2Y0BB 3MGJA 3MCMA 2W9BB 2FVQA 3FSYA 2XCPA 2V9KA 1RT1B 3G9CA 2GFFA 1WF2A 4ZIWA 1FDAA 1TTHB 3I9V9 5H1SV 2P6SA 1T95A 1D9DA 2CQPA 4CLYA 2Y9HA 2DK2A 3RYLA 4ZVRB 3GJTB 3NAIA 3V6KA 3NBPB 1U8WA 2FB0A 4KTQA 1FA0A 1CS4B 3RW7A 2Q1LA 2FPHX 5FDLB 3QGIA 1V5IB 2GJIA 2ZJPQ 1Q1KA 4LFBJ 4F67A 2HMIB 2QA4G 2AJ1A 4XDCA 4LFCF 1NH8A 3VCDA 1M1HA 4EO8A 4O0IA 1S7HA 4BCAA 5DQIA 2VBZA 2YNGB 2CA9A 3A8IA 1V3RA 4HACB 4NI2A 2X51A 1GFWB 5LMUF 5IQ6A 4C48A 2DY1A 2QLFB 1VRUA 5KFEA 2DNMA 3QSIA 2V2ZA 5E33A 3B8HA 1Q4RA 1S1UB 2B4OA 3OR2B 4TNOA 1GMVA 3D6MB 5KFBA 4L75A 2V34A 1FVQA 1IN0A 3N6LA 3ZZOA 4OLOA 2KH9A 2E9ZA 3D3CJ 4V19J 3TZZA 2AX1A 1SUQA 2OD4A 4OZLA 3OTBA 1R0AB 3OHBA 5F8NA 3KKFA 1SC3B 3T5JA 2H1YA 2N3LA 3IG1A 2CJQA 2XBPA 1KRPA 2VH7A 2MLZA 1RA6A 3BSAA 3QIPB 2DHHA 3X3UA 5L1LA 2D69A 6FD1A 3UCGA 4LSNA 1MROB 3EGVA 4P71A 2QJ3A 2MZ1A 1IBKJ 2UXCF 1NDPA 2KO1A 1FFSB 2FVPA 2P2CB 3A3PB 2XNRA 1RUSA 3OL6A 5J2MA 3UD3P 4DV6J 2KTQA 3ENVA 3CD6S 3TQEA 3RG6A 2V6AA 2QG9B 4CP5A 4X62J 3I0RA 2RDIA 1UETA 4OZJA 1PYSB 3W5XA 3KLFB 1JLQB 2DNZA 2FQQB 1UEUA 4PUOA 4KQZA 3G6ES 4DPWA 2GV1A 2PC6A 3R3TA 2IDLA 4ECRA 3CC4S 3M2RA 3NCQA 1X5SA 3PIOQ 4JI1J 3Q8VA 4AL6A 1VJWA 4RL1A 5EN1A 3LPEA 4DL3A 3J80Y 1RT5B 4QBUA 3DDKA 1N8RT 2HAIA 2FC8A 4OZNA 1AUDA 4DDFA 1SJFA 5A8KA 1AT1B 1VRTB 4DV1F 3NNHA 2ZUAA 4PG4A 1RLCL 4QWAA 2HNYB 5L9XA 3PACA 1YKWA 4TY8A 4FVCA 8ATCB 3CCLS 4OI4A 1XMBA 3R6LB 4CO4A 2HFVA 4X4UA 5HK4A 1S6OA 1NKCA 2DGSA 1FRMA 1S97A 3J7YI 3ZTOA 2R8GA 2MTLA 1FD8A 4F2SA 2ZHBA 2DGWA 4RUAA 1O0PA 2XYGB 4PWWA 3O3LA 4QW8A 3K89A 2M5YA 5DDQC 3TRGA 4USVA 3BREA 5KOWA 3A4TA 2V4RA 1F5CA 3QRRA 3BR8A 4OYIA 2N7CA 4I56A 4ES3A 4NA3A 2JRSA 2W2OP 1UZHA 3OQ2A 1YBTA 4C8MA 3OVAA 5KFUA 2BV3A 4RNOA 3UCZP 5I3UA 3I5CA 3JTOA 2Y1JA 2DXEA 1SIWB 3I82A 3BN4A 4X4SA 2MQOA 2CPEA 4LSLB 4FXDA 1QSYA 1TR0A 3CW2C 5KFNA 1WACA 1FEEA 5ETTA 2APOA 2YXLA 4NRUA 4FPIA 1U2RA 2VIHA 2XY7A 2V8VA 2R7OA 3MAAA 2YPYA 5KG3A 3TZWA 4O3NA 3VAKA 4WFBQ 2IVMA 3DRRB 3BR9A 1T8EA 4KFBB 2VODA 1TUVA 1N5QA 1RT3B 4A8FA 1FCAA 2B7BB 1HHSA 4LFAJ 1BHNA 5KT2A 3J81Y 3DCAA 4IYQA 1Q82T 4BDPA 2PFDA 3R9LA 3MM8B 4LFBF 3FZBA 4DV7J 2IDEA 4KHRA 1P9YA 1CSJA 3NBPA 2YWKA 3QRPA 3R5AA 3SI8A 2FC9A 2Q3PA 4TN2A 1GMWA 1OJ4A 2YH0A 2BRLA 1CS4A 2FD2A 1Q86T 3KHGA 4KH1B 3U1LA 2KYZA 5FDLA 1M1KT 2RUSA 3D0GE 4Q0BB 3TJ8A 1CG2A 2VBWA 1YRXA 2MY8A 4FKXA 2AMCB 5EHHA 1U0HB 4PXEA 4NE9C 4CLFA 2KT3A 2MPUA 3CIZA 2CVIA 5DGBA 3Q0AA 4RW6B 3F56A 2CQHA 3H98A 1WHYA 5HLFA 4DCOB 3KOAA 1MWYA 4EK2A 4X4OA 4LT6A 2YNGA 1U6ZA 1RU1A 2I38A 2ZHOA 1U09A 4F7VA 2MZSA 4HACA 2C2KB 1V3SA 3G2XA 1U1NA 4Q44A 3OSPA 4OZ0A 2IM1A 4HTJA 2F5GA 4HYKA 5KFHA 1C0TB 1FRHA 5HAOA 4F04B 3OVBA 4P10A 5F8JA 2DR5A 1S1UA 3OR2A 1KDNA 2C3PA 4PG6A 1HA1A 5B0FA 4L6V3 3D1HA 5KG0A 4LBHA 3SZ2A 4LVNP 1IUJA 2FDNA 4TVAB 3D0IE 5J2PB 1IBKF 1IJEB 4NPOA 4DUYJ 5KFYA 1U47A 4DV5J 2VG5A 4F0HA 2ROEA 2VL1A 2OUGA 2XMUA 4RX6A 1R0AA 3BGUA 3CD5A 4DV6F 4HEA9 2HVEA 4HKQA 1GAOA 4DX8H 4X62F 4Q2MA 3LOUA 3KWMA 2IM0A 4I4BA 3TUZC 1R0CB 2EXUA 4ECQA 1Y5IB 3TAMB 1UP1A 1ZA2B 1WNEA 2LCWA 1Q8IA 1KSPA 1EIYB 4G1PA 2V5HG 3JYTB 2K2PA 4OX7A 5D8HB 3NKYA 2HLUA 3QWUA 2HKEA 3A12A 2EFGA 4EU0A 1XNQJ 3H25A 1FDDA 4WK1A 3GB0A 4X4VA 4JI1F 5KFPA 1NRKA 3T19A 2MMYA 5LSOA 2IBKA 2PMHA 1FFWB 2ZKTA 3VAIA 4ED0A 4IDKB 3OL8A 2DPJA 3OHAA 2IVYA 3HSZA 5HANA 2NXCA 3KLFA 1JLQA 1HWLA 3SCLE 3WC2A 3LA0A 3Q8SB 3SBMA 3Q8UA 2M9KA 3WHIA 1WC4A 4F36A 2E1MC 5G4DA 2IC3B 2JHEA 3SXLA 3WQPA 4DU7A 2KT5A 2BRKA 4BC9A 5A0YB 2BACA 1RT5A 3NCRA 2EWHA 3R7NB 4ZK7M 3G6VA 3M4XA 3MAQA 4C8NA 3JSMA 4QU7A 3MM6B 3CWJA 3R6GB 3LQVA 1QTMA 5H9EJ 4LBIA 3SQGB 5D6GA 2QA1A 3FDSA 4NXNJ 4C0OC 2HNYA 5AXNA 3J7AN 5FD1A 2EVZA 2GVDB 3M1VB 1U7LA 3M30B 3GFXA 4M95A 3BDPA 3D6FB 1C4AA 2VF3A 1J5EJ 2FJXA 5LJ5Y 1F5BA 1P8GA 3KUGA 3AAWB 1S57A 1OIAA 2XMJA 1K1QA 4XTTA 3C6TB 3K5LA 2J9DA 3CCRS 1KFDA 4MYTA 4RR5A 1RU2A 2Z4PA 2DNGA 4OYZA 4ZP6A 2UVUA 1F9EB 2ZH1A 2LVWA 3HT0A 2LDIA 1VQ7S 3ZNUA 3BPSP 3CIMA 1JJHA 5IV3A 2HYIB 2CXEA 4WYLA 3W1YC 3AQOA 3M8PA 3KMSA 2CPJA 3CSKA 3CMQA 3THPA 4U7UD 3DXSX 4QJVA 3T6JA 2PEHA 2Q43A 4NCAA 5A6PA 3PX4A 4HR2A 1TKZB 5KFTA 2F7VA 2G4BA 3GWCA 4RBTA 4M5LA 2IYIA 3UNGC 2VA3A 2KM8C 3SEOA 2NPIA 4NZ0A 3CE8A 4U8VA 2FJVA 4LSLA 5IQQA 4KAIA 1YHQS 3T9ZA 4LFAF 2OSQA 4J5OA 4IO1A 1QAJA 4Y34A 5D0GA 5H9FK 3H7HB 1KOOA 2HHTA 3NS6A 4DV7F 3NRBA 3I4HX 2R9LA 4DQPA 4UZCA 3DRRA 1H7XA 4KFBA 3C6UB 1VYAA 1BC6A 5LL6d 4QW9A 1TKXB 3ETMA 2YTCA 4G65A 1DRZA 1LEOA 1A9NB 3HHEA 2EKYA 3AB4B 1SBRA 4P73A 1LV5A 2HQDA 4IQXA 2B8PA 5CA5A 3QPIA 5LSLA 4OX6A 1HQUB 5ETOA 1WKKA 3TR5A 1TP7A 4P7TA 3IR6B 3MM8A 5ETLA 3QT8A 4OYAA 2IYGA 4ECWA 2KU7A 4IKAA 3L4BC 2YNFB 5DRKA 1Q7LB 1S0VA 1WC3A 4X4NA 5AT1B 3T9NA 1S1WB 3OR1B 1L5UA 3ZO7A 3R1HA 3RBEA 3K8VA 4PPZA 1WC0A 2YNHB 2WVDA 2E29A 2WHOA 2Z30B 3KMQA 4OLPA 2IPOB 2CNLB 1UVNA 3VZIA 1NJXA 1U0HA 1MSWD 4OJ3A 1RAHB 1TV6B 2XLKA 2E7WA 1K8AT 4M5HA 4FF4A 4RW6A 4CLLA 1C1BB 3FK4A 2LEAA 4NEZA 3KHLA 1T3OA 4ZVQB 3O5TB 3D28A 2JL9A 3J7A1 3N01A 2FHMA 4CLZA 5KFDA 4DUYF 4DV5F 2ZITA 3KUHA 4OI6A 1Y00A 2MLYA 2HFZA 5DDOC 3QZ8A 1RB0A 2G13A 4OJ1A 2NPFA 1SQFA 1L3UA 2E66A 1C0TA 2ZZTA 3T1AA 1ZBTA 3W62A 1ACMB 1EKSA 4CTAB 2HK3A 4OX9J 1OMSA 4X65J 3CJKB 1R27B 5JMNA 1WSVA 3ZTQA 3P49B 2C3UA 1MU2B 1FWKA 3GJQB 3HPOA 3P45B 1S9FA 4HDGA 4ZJQA 3CCSS 4WFNQ 5J2PA 5DETA 3ISZA 2C2NA 2RH3A 1XNQF 2YNIA 5BYSA 2C3MA 1Y0HA 5CQGA 1YWXA 4C9DA 1M5KC 3GIRA 2GQQA 4DX5A 1TL3B 1QSSA 4DJBA 1LNQA 5J2QB 1NSQA 2ZH3A 2BM0A 1U4BA 2D3O1 2K3KA 4C8YA 1NK8A 1L3TA 2VC0A 3RR8A 3JYTA 5B0BA 1HWIA 1Y7PA 1JQGA 4P52A 4XK8C 2ASDA 5FIIA 2MZRA 4DSEA 3GJRB 2E5LJ 4USIA 5M2UA 1XERA 1HQEB 2I0XA 5HL7Q 4QWDA 2YKOA 3D9BA 3EMTA 4WJBA 2MYFA 1VGYA 2LEPA 1QJHA 4UY8T 2MJUA 2OLWA 3V81B 3TEHB 3LP0A 4NYPA 2WONB 2VFSA 4UUXA 2V8DA 3BM7A 3HP6A 2C28A 1WELA 1M1GA 4FVMA 4AYBD 4ZLJA 5FLXU 1S9EA 2C2RA 2HURA 2W9AA 1J5EF 1ZZFA 4H54A 5A0YA 4A8OA 2XSJA 5IC4B 3Q24A 5F0UA 3EICA 2NYHA 2WOMB 2F9DA 1HMVB 2FJDB 5E3QA 1EB0A 4CRJA 2E5HA 2ASYA 1OO0B 3MR6A 4JI5J 4CT8A 2QIFA 4UQTA 3SQGA 2AT1B 5EX0A 1KTQA 1MNEA 4ZITA 1GXLA 2DNHA 3M1VA 2N82B 3M30A 3X1LB 3P5TL 3EGZA 2UUWA 2KJVA 4FYYB 2KRBA 4R25A 3KTQA 2LFVA 2HLTA 3C6TA 3AB2B 3LW5C 1HWUA 3FKBA 2QMUB 2NREA 5HVHA 2K3IA 1FXDA 5BXIA 2JVRA 4RLEA 2UV8G 4TLRA 2LA6A 4F4YA 2R7VA 1CQNA 1BUXA 2HFSA 5KFOA 4V19X 3I6PA 3CMES 4NA2A 3U02A 4FNHA 2KT2A 1WG4A 4X4TA 3PRBA 2V69A 2AQ4A 4YOEA 2G0IA 4K4VA 5HQ8A 3SIPB 4FBTA 1NKBA 4NZ7A 2GMJA 3GIKA 2VZ9A 1IR0A 2KG0A 1TKZA 4DLGA 5B08A 2CJBA 2Q66A 1N4LA 3I0SB 3DLBA 4HH1A 3WIVA 1DY3A 3QMQA 3HVAA 4I69A 3MEKA 4QWBA 2RT3A 4IO9Q 2LYVA 4E0DA 2DR8A 1UJ6A 1SC1B 3H4BA 2UU9J 1T9TA 3SCJE 1R8AA 3JS9A 3U1MA 4LR8A 5DM6Q 3RRGA 2V94A 4USHA 4ELTA 5LXYA 4I1TA 4KYZA 4OHXA 4DU8A 2KXFA 2ABYA 1LWFB 2HK2A 4UOGA 4IG3A 3PFOA 4UW2A 5MLCV 2R3VA 2GJFA 3AXKA 3AA8A 5J1PA 2IA0A 4K5RA 3OL7A 3MD1A 3FCVA 1JLCA 1TKXA 3GR1A 3PW4A 2CPDA 3N28A 2E7VA 1WDDA 3BBBA 3MCOA 2VUGA 2DHGA 2LXUA 4ZPVR 4OI3A 2AZ3A 1VOMA 1PJ6A 4P2SA 1HQUA 4LBPA 4JYAJ 4C0BA 1S6QB 2DGTA 4M63A 4F2RA 4N41A 2PMWA 5D77A 1HQ2A 3US5A 2EFPA 3K8WA 2AYMA 5B0EA 2X1FA 1YJNS 4TXSA 1S9GB 1B7YB 4LRDA 3MMCA 1EARA 1S1WA 2MQNA 3OR1A 5B0GA 2MKHA 1REVA 3VGSA 4MJKA 4KO0B 3QO9B 3IR7B 3M8RA 2YNHA 5DO2A 3R2DJ 1FX4A 2RB7A 1HBNA 4Y00A 1NH7A 2LQJA 3V6DB 4OX9F 1B64A 4X65F 2O3DA 1I6JA 2CG8A 1RISA 4FF1A 2XMMA 3VALA 1K73T 3FGVA 3QGGA 4QR2A 4ELUA 4FF2A 1YK9A 3HZGA 2DNQA 1B99A 4N7TA 3IWNC 3UDCA 4OZ1A 4ZVPB 2CZ9A 1S99A 3PKYA 3UO0A 1EQMA 4IFYB 1S12A 2ZEJA 4PWDB 2VU5A 3DGPB 3P96A 3QWPA 2IRYA 3WC0A 4QR0A 3THVA 1RXOB 1JLFB 4CM0A 3O44A 2F40A 2EK6A 2OIHA 4NXMJ 4CTAA 4B9UA 3CJKA 1TUWA 2DRDA 2LP4A 4M5GA 1OS5A 4UF4A 1YDLA 1HD0A 4J9OA 3UDVA 4ZCLA 1LK7A 4CT9A 3FEXB 2PFFB 2HNZB 1RWVB 2E5LF 1PYOB 1RE1B 4OI0A 3PHEA 1WORA 1H3DA 5KTQA 1N0UA 3NNAA 2NZ4A 1S1VB 2DGXA 4DFPA 4P2FA 2PN6A 2P9GA 3KJQB 5J2QA 2CQBA 3D1QA 4OJGA 3OPKA 2K7KA 2W4CA 3JAMU 2KJWA 5L46A 2EPIA 2IAJB 3PNIA 4USWA 4B08A 4DZDA 4DV0J 4ZPDA 5EUHA 1ZM9A 1FE0A 2RRBA 3CDAA 5HO4A 4CQ1A 2NSCA 2ZNYA 1KLMB 2DGOA 2VG6B 5D4LA 4JI5F 2RHQB 2WVFA 1KOHA 1ZETA 8RUCA 2A3JA 2WONA 5T14A 1RWUA 3HSJA 2MKCA 1C1CB 2HGLA 4QIEA 4ANDA 3DLHA 3L95X 3JSRA 4ANEA 4WU3A 1HW8A 3QIDA 3RBZA 3CCQS 2FLNA 3KJFB 2RDDA 2ZJQQ 2WOMA 5GAGU 1TMJA 5J2NB 2HHWA 2CJ9A 3KG4A 1HI1A 5LXRA 1IKWB 1XR6A 2RSQA 2WTFA 4ENOA 2FJAB 2MQPA 2V8PA 4ID8A 1RTZA 3UD5A 4P72A 3RB3A 1YJ7A 3DMJA 5KFSA 1SH0A 1SKRA 3BV8A 2ATLA 3H40A 2XZTB 2A2DA 3MFHA 3LALA 1CJUA 4H4KA 3ITHB 3FBBA 3M7VA 4DR2J 4OV1A 1JJCB 4LF5J 2BXJA 1T9XA 3Q2TC 4DR1J 1RGVA 2B0GA 2ALYB 2HRTA 1FDBA 4U9RA 5K9FA 3FBCA 3E2EA 3HDSA 4R0JA 3POTB 3MR3A 5M2RA 3HHLB 3A3NB 1B0TA 2BKOA 2HFUA 1FK9B 2B5JB 3FMWA 4Z37A 2UU9F 3DRPB 1HBMA 4ECYA 4JI4F 1Q8LA 2GMLA 2R2SA 2VA2A 2ACMA 3W7BA 2DR6A 3TP2A 3VAGA 4DR6J 2VBXA 1RTIB 1HIYA 3TNVA 3G82B 1G4CA 5AE1A 3GR0A 2VASA 3UFCX 4NLPA 2GS8A 1LXNA 5U47A 2K06A 2YWGA 2EW9A 5L1KA 3DNCA 1I5OB 1SQEA 1RAFB 4FYVB 1KVKA 4CLUA 2QV6A 2C2EA 4DG1A 2FZGB 5F8MA 1NJYA 3HFKA 3PG9A 2BM1A 1LWFA 4OYPA 1HFEL 1RTJB 1RAEB 1K44A 1D09B 4DLEA 3LAKA 3QAUA 1WI8A 5HQLA 5F8LA 4JOUA 2BX6A 4X4QA 1BY9A 2GQCA 1IR2A 5A6WA 2FHJD 2H48B 5JXSA 5KT3A 5BR8J 1K47A 1CPZA 1K9MT 4R5PB 1X5TA 1YJWS 2ZD1B 3BGFA 5ETSA 1U25A 2R8JA 4ZCIA 1U1PA 5L38A 4MIAA 5HMWA 1U48A 2VBYA 3SSQA 5DDRC 2XMWA 2AEMA 2DR9A 3HLUA 1N5TA 2XI2A 4FXVA 2MY7A 1ZZNA 3FQLA 2CQ2A 4NCGB 2V2QA 1WD6A 2KRRA 3JB9k 4KT0C 4NLYA 2OHDA 2SXLA 2YQ1A 1FF2A 4NLRA 4KO0A 3TANA 1TFYA 1UEVA 1KONA 1RT4B 2RIJA 2MKIA 3HI9A 1HNVA 3NG8A 5A8WB 3GQCA 5C42B 4NXMF 3V6DA 2X7IA 5D15A 1J5OB 2YKMB 3GSDA 3DLGB 1E6YB 1UWAA 2VFVA 3GIMA 2Z58B 2N4CA 1W26A 3CO0P 5CAAA 1S59A 4N76A 4M8LA 3QYYA 4EBEA 4IFYA 1NEEA 3HHKA 4PWDA 4KGVB 2OTJS 3DGPA 4I6WA 4LRFA 3IAM9 2IMOA 4RJVA 2AZ1A 3C16A 1T9UA 2DB1A 3VVUA 1JLFA 5DZ7A 1BQMB 2ILZA 3H4DA 4OL8A 3V4IA 2DRAA 3KLEB 4OI1A 5G0RB 4I6AA 4LJMA 4IFVA 2PT0A 4L74A 3LP1B 4ZLPA 3EPIA 2HNZA 1NB7A 4CI0B 4DV0F 2XLIA 3W63A 2HQGA 1S0MA 2HPUA 4GO7X 1N56A 2GGPA 3MM5A 4M5JA 3AXMA 1S1VA 4PKDB 4OYWA 3CDBA 3TA2A 1T03B 4WFXA 4QYZK 3W2VA 1UCNA 3OLAA 1B3TA 3QT6A 2QO3A 5KAKA 3PO5A 4JB8B 2R8HA 1DHMA 3AD8C 1N32J 3IRXA 3FEYB 1NPRA 1RA7A 4OYBA 1YI2S 1T11A 5B09A 4J9QA 1KLMA 2WW8A 2G1HA 2VG6A 2KZZA 3MHYA 2EC0A 3D66A 1G7CB 4RNNA 1M0SA 4J37A 1YZ6A 1R89A 2ILYA 4L73A 4NOHA 1PGZA 4ERDA 2MZQA 4LRBA 2VPYB 3ISNC 4LVOP 4Z2XA 3FZ2A 4DR2F 3RUBL 4LF5F 2HQIA 1V9OA 4DR5J 4DR1F 3M32B 5J2NA 1WF0A 2ACYA 1IKWA 3MI7X 4TKTA 2BW7A 2W24A 3K7RA 3GP9A 2CQGA 3JTNA 2DO0A 2K8GA 1K1SA 4KC5A 1NSAA 1SQGA 2HNDA 4ED3A 2ZH9A 2FGOA 4B3OA 4N8NA 1HNZJ 3TARA 5F0WA 4CH7A 1WKLA 1FWPA 2HHPA 2V50A 3PDNA 4DFKA 1CBKA 2OPQB 5CYMB 1SH2A 3BF4A 2ALZA 4ZHRB 1VS3A 4DI6A 4DR6F 1XK8A 1FO1A 4OHZA 3R1LA 5H9EK 1HBUB 3V6JA 4ILRA 4P74A 1VBYA 1Y5NB 2YWEA 2V4QA 4LRAA 5JVGQ 4MMOA 1SVDA 3DRPA 3RRKA 1CC8A 3AA9A 5CZXA 1HW9A 2MSTA 3CVKA 5K14B 3H5YA 4A8SA 4DX7A 1IM4A 2UXDJ 2GZOA 1CQMA 2BVZA 3WDOA 4FDFA 1EX8A 1G3OA 4N8OA 2RU3A 5E0OA 5KG4A 1RTIA 2VKZG 4TU8A 3G82A 2D3ZA 5HQMA 1L3VA 2FTRA 1S6PB 4DQRA 4CLPA 4Y6IA 1R8CA 4A8WA 1TKTB 5F8HA 4B17A 3MEDA 3DOKB 5BR8F 1JLEB 1FRIA 3HM9A 3FSIA 3T6BA 4Y2CA 3DFEA 2LECA 4KGKA 2ZC3A 4KHPJ 1OY6A 3GV8B 2BZ2A 2AKWB 1RTJA 1TVRB 3D2WA 2I5JB 1VQOS 4QCLA 2HZCA 2RRAA 1QVGR 3LANA 2PD1A 2J8SA 4NL5A 3GFYA 4XPCA 1OQ3A 2OMLA 1N5SA 2M0GB 3VQSA 2JVOA 2Z2YB 3W2WB 1BXNA 3FRZA 4O23A 1AB8A 1WEZA 3FNNA 2QMXA 1VQLS 4Y65A 4WF9Q 1HBOB 1OYEA 3PYFA 1NSKL 5D4OA 4RZRA 2F3JA 5KFLA 3MM9B 5C24B 1N5VA 5GMKa 3QJPA 1NSPA 3JQMA 3KNGA 2MSSA 2CWXA 2JH3A 2B6AA 1P1TA 2BDPA 3GPAA 1RT4A 2HWHA 1F0XA 2L9DA 4FF3A 1JNRB 1QAYA 2BOPA 4B3SF 1X4FA 5A8WA 4U95A 5C42A 2B9EA 3ZNJ1 1QY7A 1IKVB 2K1RB 4ECSA 1J5OA 3LWMA 2ZZNA 3UN5A 3DLGA 5KFAA 1GMWD 1E6YA 1FRXA 4P7VA 2DGQA 4C3LA 2VQEJ 2E5IA 4JV1A 3UN2A 1SI9A 4GKJJ 4URGA 3PO4A 4RO0A 2W2QP 2XNQA 4DSJA 1S1TB 3RB6A 3ILOA 4WE1B 4OV6A 4BHQA 3MPYA 4U96A 1H7WA 4DL2A 2HHSA 1F6TA 2X3DA 2BJ3A 2QLWA 2HVZA 4ILMA 2XYPB 3AOAA 2ZDOA 4MKBA 4WKRA 1SKUB 2MGZB 2DNRA 3WX4A 2P5VA 4TU9A 4YR3A 3KLEA 5G0RA 3MEGA 2XMTA 1RTDB 1X4BA 2W7AA 1CULB 2KYXA 5KFGA 1VLYA 3LP1A 3ISND 3Q23A 1MN7A 1RYSA 1RBLA 2QLXA 2ZJRQ 3MPDA 2E1AA 1Z1ZA 1CC7A 5ETPA 4HVZA 3V4MA 1QTNB 1N32F 3MF5A 3M6UA 4JBCA 3T1YJ 1JNZB 3BBCA 2D3UA 4DCJB 2I2YA 1UVIA 4LUBA 1FKAF 3EVWA 4DV4J 2KG1A 1T03A 4P6QA 4FYDA 3GYGA 2DNOA 4UT4A 3K5PA 2JEJA 3MM7B 1RTHB 3Q83A 1S0NA 2MKKA 2AJFE 3KDNA 4OI2A 3W66A 3EVMA 1I3OB 1DAXA 2CUYA 2MKYA 2O1PA 4EYHB 3A13A 4F26A 3IBCB 1GXUA 3I31A 5CZVA 2AJ0A 1ZM4A 2CWKA 4X4RA 3UVJB 1H73A 5KT4A 4NCBA 2GVZB 2QE5A 4U7UK 2IA6A 2GAHC 3C19A 1VBXA 1PIEA 2ERRA 4LR9A 4LF9J 1EKRA 3BN7A 2ZE2B 2BANB 3AJ2A 4A8KA 3MZIA 3FC9A 5J1NA 3V5RA 4C3MA 5HP1B 5F8IA 3VAFA 1M5HA 4YUDA 1HNZF 1FKOB 3DYAB 1B4SA 3GFHA 4UY85 1XN9A 3GG0A 3M32A 3WBZA 1VHIA 4JV5J 3R8YA 3PX6A 3DXBA 4Q8FA 2A10A 1X4DA 4LR7A 4F02A 4B9VA 3H20A 3TZYA 1UJ5A 2VPXB 2FHKA 4OZ5A 1NPKA 2H5IB 1XR5A 2HGMA 1JLBB 1IWAA 4ZP9A 1U24A 1RT2B 2OPQA 4OHWA 2OPPA 2CRLA 5CYMA 4KGZB 2ZOMA 3FFIB 4ZHRA 3PM9A 1KVIA 2UXDF 3W64A 2EI5A 4TQSA 2YKAA 1RWNB 2AEFA 2F9JA 5KFJA 1G6BA 5C5JA 3JQJA 5T41A 4DPUA 1VQYA 2XM3A 1HBUA 3IAS9 5FJ4A 1CLFA 1YJTA 3W5YA 2JZ5A 4QWEA 1DTTA 3T1HJ 2AWZA 2QSFA 2FHJA 3G8QA 2CQDA 2B3TB 1U02A 1NLKL 4YQWA 3WIUA 2C1EB 5KT5A 2VFRA 4B3RJ 1KP6A 1M90T 5K14A 4DR3J 2IM2A 1DTQA 2XC9A 4KIAA 3PW7A 2ZFHA 4KHPF 1VMBA 2V63A 3QATA 1AW0A 2NXNA 2J6TA 2VG7A 2BEFA 2YQ0A 4DR7J 2LA4A 3ICLA 2B7CB 1FRKA 1HARA 1S6PA 4EEYA 4GO5X 1TKTA 2ZNZA 2FVRA 2GIQA 4ZCMA 3DOKA 1GX5A 4NWBA 3QGPA 1U49A 3G6XA 3IMQJ 2LEBA 3W9HA 3VAJA 4I64A 5I3QA 4I68A 3VHQA 2JOQA 1TVRA 1D0EA 3FBEA 4GVLA 2I5JA 2ZZMA 2UUAJ 3DLLQ 4ZA1A 2AJQA 2XS2A 1RHRB 3OLBA 3VQTA 5L1IA 2R2TA 2AP6A 4PG7A 3W2WA 1UZDA 1Z2LA 3AH6A 1SJ3P 3ZTSA 4O3RA 2IMWP 1HBOA 2W8LA 4PCQA 1NZ8A 3OTOJ 1UA0A 4YY3J 3BKTA 3MM9A 3W61A 2L41A 2VQEF 5CYQB 4GKJF 2ZWPA 5HMZA 2B9YA 5CH7B 1HNWJ 2DH7A 5LSRA 1VISA 3BKFA 3PYGA 1E6VB 3KLGB 3I5AA 5KFKA 1M5VC 2AHOB 2PA3A 3H90A 4X66J 1Y3KA 2CJKA 1VBZA 1DLOB 4HHUA 4K4SA 4DCPB 3AQPA 1S49A 1CJVB 4GKKJ 2W2NP 2I1RA 2G9OA 2MZJA 3BJYA 1Y9OA 2IRXA 2RQKA 5E7OB 2H9ZA 1F2HA 5K5MA 4WE1A 2YVSA 4O4GA 3R7SB 3MUVP 4UUWA 2AF6A 4WP8A 2FZKB 4O3SA 2CDQA 3GONA 3T1YF 1DZ5A 2P9EA 3G6YA 5LMNJ 2MGZA 1VK8A 4DV4F 3TQ1A 4X64J 1Y11A 1RCXB 2F8HA 4QIVA 1BQNB 4DPYA 1RTDA 2C2DA 1L3KA 3ZZTA 4YDXA 1CULA 3UD4P 4AE5A 4N47A 5F9NA 1U2FA 4Q2LA 4MK8A 2HZAA 4C6AA 1PO6A 3J80U 1VIOA 4P2XA 4ECVA 1FNOA 3BH6B 1YVFA 2DJWA 1VBKA 1KKHA 2Z2MA 1BWVA 3PEJA 3OUYB 2V0NA 2L9NA 2MQQA 4RNFA 3C8YA 5K8MA 4JI7J 1IKXB 5BYRA 5HN0A 2H4YB 3MM7A 3R5CA 1FJCA 3GU0A 3W65A 2D3OR 4DFMA 1Y3JA 1RT7B 3KLIB 2BJ8A 4IH6A 1NPPA 3KUEA 1GQEA 2CNNB 3C66A 3PJXA 2CPIA 3UVJA 3HVTB 4ZS6A 2GVZA 2QFIA 2RD5C 4O3PA 5I42B 4JV5F 2KB2A 2WB4A 3P8BB 2ZOFA 2XWYA 2ZE2A 2VOOA 3UQSA 3R5BA 1AYEA 3I55S 2WRMA 2OI2A 5L8RC 3PVXA 3I32A 1LW2B 3JSBA 4IOAQ 5HP1A 5E2QA 2XGQA 4B9SA 4ZDNA 2YWFA 2AJ2A 3DYAA 4F0MA 3QZ7A 5CD4A 4FNIA 3HULA 2DHXA 3KJNB 1CJTB 2Z2LA 2AJ4A 3B82A 3ILIA 1X5OA 5GAEI 1UVJA 3NGDA 1I51B 4DMZA 3MECB 1Y4ZB 2OEMA 3RAQA 4ED8A 5T7LB 3UPFA 3L7OA 4OJHA 3T1HF 2NR0A 2QL5B 2WSCC 4RBUA 1CJKA 4B3RF 1RT2A 4QZVB 4CDIA 2LQ8A 3OBIA 4DR3F 2KVQE 4WU2A 3TAQA 2JC1A 3FFIA 3RBDA 2UUCJ 4EFAC 4PXCA 1Q5YA 1IBLJ 4QYRA 2KHDA 3PV8A 2PO4A 4HI1A 2HWTA 5HMYA 4ZLNA 5K8NA 4DR7F 1RSCA 2HFNA 2QLBB 2FZCB 2AV5A 3QNWB 4CLKA 2HVDA 5F41A 1NB2A 2F4VJ 2DR7A 2D9OA 1WI6A 2KZMA 2ZBIA 2ROGA 4K4ZA 3J81U 1MMNA 3W9IA 1Q8KA 1RAGB 2BUNA 3BPDA 2XTJP 1U1OA 1DARA 1RT6B 5IZHA 1ZAVA 5KFCA 2MQMA 1IKYB 4RPFA 1S4EA 5HROB 4YDDB 4K4UA 1IQTA 2QL7B 2UUAF 2C2ZB 4CO0A 5ETQA 2W9BA 1Z4UA 4HHJA 4DPXA 4I7FB 4KKOB 3MR7A 5B7WA 4KGXB 1RT1A 3EE3A 5CCLA 3TEGA 4M5KA 3F73A 1URRA 4J9PA 5I3PA 3MR2A 4F4XA 4TU7A 1VQMS 4C11B 3L3CA 5ETVA 3WZ0A 1EZZB 4F3OA 2EFOA 3CMAS 4NLXA 1VQKS 4A8MP 2W1BA 2XO6A 1NHUA 2C3YA 4EO6A 4MKAA 3Q8RB 3NMAA 3OTOF 4U6PA 4YY3F 1WF1A 5EWEA 3EWGA 2E5GA 1CVJA 3LO3A 2OEJA 1UA1A 1Q5VA 5H9FJ 1HNWF 3CC2S 5DLGA 1WSRA 5DJBA 2GW8A 2C2OB 3PW2A 2D9PA 3CJ0A 2YWWA 4KPCA 2XS7A 4WKYA 4K50A 2OFGX 4H4KC 5DG8A 2XQCA 1GMUA 1T02A 1HD1A 2XHCA 1XNRJ 2BMBA 2Z57B 2HMIA 3UN3A 4X66F 4DL6A 2UP1A 4MTPA 1MMLA 5HBMB 4GKKF 4LF6J 4IQMA 3BSCA 3EPGA 2FLOA 5K20B 3GV7B 2WVEA 2BE2B 5CYQA 2JFKA 3KJVB 2IFXA 2FVSA 1SKSA 3IS9B 4OZ3A 4WWSA 5GMDA 4DF8A 1E6VA 3KLGA 2VV5A 3GIJA 4P9SA 3G87A 4L3KA 1LFPA 2OPSB 1SCJB 5KG6A 5LMNF 2HAFA 1ZA1B 4F25A 1DLOA 2RS8A 5GAHI 2AYBA 1UKUA 3TOQA 2RJZA 2A6OA 2JC0A 3DOMB 4X64F 1CJVA 2M8HA 3ZZZA 3FQKA 3P6YC 3BGRB 5GAGI 5MAOA 2E9RX 3NWGA 2EC2A 2QN6B 3ENWA 5E3PA 1O6XA 2VONA 1S10A 1KQFB 3CEDA 5E41A 3ENQA 4EWTA 1WJ9A 1P9QC 1RHKB 2PGCA 2RUGA 3TVZA 3CJ5A 3VAMA 4ICLB 4U67Q 1P27B 3QIPA 1OPIA 4JI3J 2ZOGA 4JI7F 1BQNA 1MROA 5CABA 3M6WA 1FVSA 2PI5A 3GCWP 2N3OA 4E8UA 3DC2A 4LF4J 1R43A 3M8SA 4DL4A 1D9AA 1J2VA 3HK2A 2FYXA 3NEKA 4DXLA 1SL2A 1LOUA 1VDHA 3ADAC 3DM2B 4PG8A 2FHOB 3SMZA 1FRLA 5IXUA 3Q2SC 2ZH2A 3QAEA 2B9WA 4B9LA 3RRHA 2R8KA 1IKXA 4LMZA 2DTJA 3SFUA 3KK2B 3TUIC 4C8KA 2JEGA 2W4DA 4YEAA 3D54A 1KR4A 3KLIA 4ED4A 5AXLA 2QZ8A 1GX6A 3NGUA 3HVTA 2CPHA 4QOTA 4PABA 2N4DA 1FI4A 5I42A 4USJC 2EG1A 1VRTA 1SL0A 4RW8B 4AQYJ 4RBVA 3M2VB 4CNYA 1LFWA 4F8RA 4MKVA 1RJJA 1LW2A 4ZP8A 1FX2A 3KK1B 1TK0A 2QEXS 1MW7A 1GTHA 1OQ6A 1URNA 3HHDA 1IM6A 1RACB 1X4GA 1L3SA 3DGVA 1KS2A 1CJTA 3BO3A 3NGKA 4P75A 4LSNB 2ADCA 4DR4J 3DHXA 2ZVSA 3KLHB 1Y5LB 4R0EA 5IT0A 3CJSA 4KBIA 4WP9A 5T7LA 4NA1A 2RILA 1VQPS 4I2QB 2F4VF 5J2MB 3M05A 5ETMA 4YB1P 3OL9A 3I0RB 1NK5A 2VKRA 3IR5B 2JFDA 3ILJA 2MQLA 1VQ5S 1NU4A 3PEHA 1HWJA 4ZVGA 2X3GA 1S72S 1PC4A 3B78A 4YFUA 3M2RB 4A8XA 3EZUA 3E01B 4NZ6A 4K4WA 5ETRA 3T5LA 3N4WA 3AJ1A 1KD1T 1Q53A 3NNCA 1YSJA 2CYYA 4CYUB 2F63A 1HNIB 3BYPA 4C0HA 1WC5A 2GHVC 4NLUA 4NLDA 5A8KB 4USUA 3J81j 4NEYA 3CDEA 2HHUA 1BD6A 4AL7A 7FDRA 1RHJB 2KDOA 3LGHA 3PFEA 5HROA 4F3QA 4EZ6A 1VQ6S 1VCTA 3G8SA 1DQ9A 1V6HA 1RT3A 4I7FA 1SKWA 4KKOA 3IWLA 5J1EB 5A8RB 1IBCB 1R8HA 3I9ZA 4X2BA 1B0PA 4HTIA 1T05B 1LK5A 4HDHA 1H38A 5F8GA 4C11A 4W90B 4FBUA 5IWAJ 3D1OA 1H0HB 1NK4A 2J76E 3E51A 2DD8S 2P9CA 3CJTA 4GMKA 3UDEA 2H65B 5ITHA 1XNRF 2CKWA 2DBBA 2I8EA 2AU0A 4Y2KA 4ZPAA 4C3KA 4PQAA 5K8PA 3VTIA 1RAOA 4C7QA 4LF6F 3A3OB 4DBQA 1ZH5A 1SJ1A 3W8GA 2XO7A 2HHHJ 3MMBB 3CULA 3DDIA 4F4ZA 1FNMA 4Q0BA 3NLCA 4URSA 3TA1A 2XMVA 1UW9A 1NHKL 1YBAA 1TAQA 1UVMA 3QSYB 2L9WA 3M9MB 2HFOA 2IY5B 2ZC4A 5CXTA 4C97A 2WVCA 5HBMA 3PRVA 3RAMA 5HVGA 2HGNA 2WW4A 1FERA 2DIVA 4QPTA 4ER8A 4Q7AA 2BE2A 3ULHA 5KT7A 3KJVA 4JI0J 3HHLC 2XULA 3GLJA 1RI7A 1R6VA 3BKUA 4EGLA 1S77D 2NQPA 4DSIA 3MAAB 1YBUA 3QRQA 2XB2D 3B6BA 1RQ0A 3CCZA 4CNZA 2G2YA 1FESA 2OPSA 2CPFA 4B9NA 3HF5A 5SZTA 2GHPA 4XIUA 4KJIA 4EI2A 1ZM3A 2J0XA 2M8DB 3DOMA 3C14B 4JI3F 2CJAA 2XMKA 2EBGA 4EZ9A 1ZAXA 3BGRA 4MT1A 1RADB 5DG7A 1S79A 3TVKA 3N5BA 4LF4F 3M6XA 1B0VA 2B9XA 3IO1A 5B0CA 3GG1A 4BLGA 1SIZA 1JMTA 2XZWA 2OGUA 4C2MA 4ID5B 3BSNA 4ES1A 4AXJA 3AY0A 2E5JA 4Y2MA 3E3XA 4ICLA 1Z2ZA 3TAMA 3UE2A 1FXLA 3W5ZA 1RBAA 4FYWB 3BGOP 2OAUA 2EG2A 1WTFA 1AROP 3P4UB 7AT1B 2HS0A 2MB0B 2J0WA 1YJRA 4IDKA 3W3SA 3L7UA 5HLFB 4MFBB 3DM2A 1HR0J 4IOBA 4AQYF 1X9SA 4ED7A 3OW2R 4NLOA 5E3CA 4NXNF 1D8YA 1Q7YT 4UZBA 2HBRB 1TQLA 5BYQA 3FUYA 2IC3A 3KK2A 3K5NA 3K2YA 2DPIA 2H5JB 3EZOA 3CCWA 3NS5A 4AT1B 4YR2A 1RWPB 2DNNA 1XTZA 1F9FA 4LF8J 1PAUB 3EGWB 4UOCA 4I2PB 2EK1A 5AXKA 4O44B 3MM6A 1R8BA 4RW8A 3F0NA 2MDAA 2BQ3A 3BB5A 4DR4F 1LWXA 3M2VA 2M3DA 1HYSB 2VG5B 4B3MJ 4JP8A 4B3TJ 4RW9B 4KV8B 1M5PC 2GVDA 1HI8A 1VQ9S 2KVIA 1JXEA 2CPYA 3KK1A 3LGNA 3Q8YA 3T5HA 3HSGA 2BKNA 4PAAA 1DQ8A 2FY8A 4NMXA 2CQ0A 3IP0A 4USKA 2BQUA 3K5MA 4QR1A 4CO3A 3D0HE 2QX0A 4C98A 4WTYA 3M8WA 3UNYA 1WEYA 4K8RA 4KRWA 1OWXA 3VVTA 4KSEB 1WTBA 1DQAA 2NLWA 2N7YA 1UTAA 4H4MB 3KLHA 3ZZYA 3OFFA 1WHXA 5C7PA 1T0TV 2COLA 1JKHB 2HIYA 4I2QA 2RMLA 2R7XA 2U2FA 2V4JB 4DS5A 3RB0A 4LF2A 1GNKA 4QIWD 3RU0A 3FSXA 3QJJA 4ZN1A 1WEXA 4C4WA 3OTDA 1OPZA 2UXBJ 2RRNA 3DU6A 2FLLA 1RLDA 1LKZA 3AOBA 2M70A 3E01A 3A1YG 3N9UC 1TL4A 3KNAA 2M88A 2KHCA 4CYUA 2MLXA 3DRSB 4DWIA 1HNIA 1MWQA 5IWAF 3JSMB 4DHVA 1XR7A 2BKPA 2MEWA 1REGX 4DOZA 1WDTA 1EP4B 1MLAA 2WSEC 4TLQA 1VQSA 5SUHA 4ED2A 4KGMA 1F3FA 5GADU 1GK8A 3C6UA 1PYTA 1WOOA 2H54B 1VRQC 2D1CA 3HHLD 1WOSA 2HHHF 4DSFA 5J1EA 3ETOA 5A8RA 3SFGA 3PJ9A 1T05A 1KBRA 2J7WA 3L9ZA 3BO4A 2AGPA 1GT8A 1RAIB 1X4EA 4DV3J 2R2UA 4OZ2A 2LMIA 4CIOA 2MQ8A 2JDJA 2D7SA 1X7VA 5C2CA 1KQGB 2CZ4A 2YNFA 5GMEA 1NZAA 3H5XA 2W01A 1QD1A 4W4MA 3ZXWA 2YY3A 4I6YA 3SDEB 2VFUA 1U1LA 2J5AA 3OTEA 3T41A 4CM2A 3M8PB 1DFDA 1C4CA 2HS3A 4JI0F 3MMBA 3SV3A 4JI2J 4NYZA 3PIPQ 2DRBA 2M52A 3CB4A 3PKMA 3QT5A 1TK5A 1N0VC 1ZTWA 4HI2A 2CVEA 4UTGA 3K58A 3IRWP 3NWRA 2A1BA 1TV6A 1X60A 9RUBA 2EBEA 3M9NB 2F4FA 2HBYB 1C1BA 4AUKA 4OX8A 1S6UA 6FDRA 2YKPA 4M5MA 3CJ4A 1YRTA 1HHQA 2RS2A 4XAKA 5JVHQ 3B4MA 2VDHA 3GFZA 3Q8QB 4WYWA 4QU6A 4IUFA 3IWXA 3GILA 2DYAA 1X5PA 4ZVEA 2JNJA 5L9NA 3UWTA 3LH2S 1HL6A 4GRSA 2GIFA 1XMOJ 1WC6A 3GCXP 4RW7B 1LW0B 1MU2A 3CO9A 1YGYA 3O2IA 3N79A 3C14A 1N48A 2DHSA 4N5SA 2YKQA 2QYCA 5KFFA 1U1RA 2OFHX 2YX7A 2LQ9A 1T9VA 4CZCA 5KT6A 1SB6A 5HI7A 4X4PA 4ZPBA 3VV2B 1KHWA 2B4VA 3KXDA 4CCHA 1KWMA 3PTWA 3IGNA 1Y10A 5HVFA 4WXWA 2RKIB 4ID5A 3HX9A 3C2PA 3QLHB 1TL3A 1H74A 4P2MA 4DQQA 2WK4A 1HR0F 1JXVA 4RUCA 2M7SA 2XMAA 4PQUB 2VPZB 3BZQA 1KHVA 4DN0A 3DHWC 3H2LA 5C25B 5AE3A 2IM3A 1HQEA 2HRYA 2E1CA 2YQ3A 1KC8T 1HPZB 3M2UB 2BJ7A 1RWKB 1F5AA 2AGOA 1WUUA 2KI2A 4CH0S 3J7ZT 4LF8F 3TW0A 2UZAA 1IBMJ 1HI0P 1I94J 1S0OA 4MFBA 4J9KA 2R42A 3LTOA 2FJWA 4ETZA 3RB4A 3JXOA 3H5SA 1P6TA 2NCKL 3V81A 2L48A 1U0SA 4B3MF 1K0VA 1JLAB 3DOLB 4USTA 3GYXB 4B3TF 3N5FA 2HHVA 4IRKA 4ZLLA 4ZPTR 1VR6A 3HVWA 4PPDA 2DITA 2O66A 3RTVA 2NXEA 2DGUA 2IIHA 2MKJA 4ZVOB 3MOJB 3BQ0A 3L09A 4WZMA 1HMVA 4I2PA 4O44A 4QYZJ 4NYOA 4ZJOA 4FXWA 5CCMA 2B43A 1XQIA 5EWGA 2WB1D 2YX4A 1HYSA 2YNIB 1VHFA 1LWCB 4RW9A 4KV8A 2UVWA 2GCFA 1VC5A 1FD2A 4ZPCA 3TYTA 4MYUA 3TJ9A 4ZKAA 3QFWA
chains in the Genus database with same CATH topology
2VFSA 4UUXA 4MK7A 2V8DA 3BM7A 5IT4A 1UA0A 4ED5A 3HP6A 2C28A 2KFZA 1WELA 2AYGA 3KHRA 2LQ5A 4FVMA 4AYBD 3E8OA 3MM9A 3BQ1A 4ZMMA 3HVRA 2L41A 1S9EA 1GXTA 2C2RA 2W9AA 2VQEF 1QAIA 1J5EF 1ZZFA 3MD3A 2OMOA 4H54A 1LWEA 5CYQB 5A0YA 4BC7A 5HMXA 4A8OA 4FS2A 2XSJA 3K5OA 3Q24A 3SV4A 5HMZA 2B9YA 3MPVA 5M2PA 5CH7B 5F0UA 3EXYA 2DH7A 2UXBF 2KXHA 1ELOA 3H2VE 5LSRA 2WOMB 4H4MA 2R7RA 4EYIB 3SYZA 1UMJA 2F9DA 5L39A 4B9MA 1HMVB 3CC7S 3IBWA 2FJDB 1E6VB 2R4FA 4WFYA 5E3QA 3KLGB 3I5AA 4IR9A 2E5HA 2ASYA 1OO0B 5KFKA 1NKEA 1JKHA 3JTPA 3MR6A 1M5VC 2HQ3A 1FEHA 4CT8A 2QIFA 4RU2A 2PA3A 4GC6A 2V9WA 4UQTA 3SQGA 3MR5A 5EX0A 3GMGA 1KTQA 5IFMA 1MNEA 1UWBB 1GTEA 2V4JA 3FEZA 2J9CA 1Y3KA 2CJKA 1VBZA 1DLOB 2GQ2A 1GXLA 4K4SA 3AQPA 1S49A 2DNHA 3M1VA 3OXGA 2N82B 3RR7A 3M30A 2ZKUA 4MK9A 2M2BA 2KFNA 2H5EA 2I1RA 3X1LB 3MUTP 4ECTA 3P5TL 3EGZA 2UUWA 1AFJA 3S01A 2BJDA 2E44A 2KJVA 2G9OA 4ECZA 3EYZA 3LP0B 4DS4A 2MZJA 3BJYA 2KRBA 2KKHA 3IC1A 1Y9OA 1C0UB 4R25A 3LWLA 5KFIA 3KTQA 3I0SA 2DH9A 2HLTA 2IRXA 3C6TA 3AB2B 3LW5C 2RQKA 5E7OB 2EFNA 2H9ZA 1D8ZA 4YR0A 3MEEA 3UR3C 1NK6A 2JEIA 5K5MA 3OUYA 1B7FA 2XY5A 4WE1A 2ASLA 4WZQA 2YVSA 1S9EB 1HWUA 4FZVA 2CPZA 4O4GA 3MUVP 4UUWA 2AF6A 2XSJB 3HKWA 3D5MA 2NREA 5KG2A 1XBWA 3ZZPA 2CDQA 4O3SA 4ZVFA 2K3IA 2PI4A 1FXDA 3T1YF 1DZ5A 2P9EA 2Q79A 3G6YA 2WSFC 2JVRA 4RLEA 2UV8G 4HLBA 3DRSA 3KHHA 4TLRA 2ZH6A 2MGZA 1VC6A 2GC8A 2FJBB 2WBRA 4JYAF 1VK8A 4DV3F 2LA6A 4F4YA 4DV4F 2R7VA 1CQNA 3TQ1A 4C8OA 1RT7A 1VRUB 2F8HA 5KFOA 4QIVA 1BQNB 1VI7A 1RTDA 2IVFB 2FIUA 2C2DA 4V19X 1EP4A 3I6PA 3CMES 3KK3B 1HHTP 1BLUA 4NA2A 1L3KA 3ZZTA 4YDXA 3U02A 4FNHA 2KT2A 1WG4A 4X4TA 3UD4P 3PRBA 2PE8A 4YOEA 2AQ4A 3VZHA 4K4VA 2RE1A 2PA8D 3IN5A 4AE5A 2G1DA 1KQSR 5HQ8A 2J6UA 4N47A 4FBTA 5F9NA 2NUHA 5D4PA 1NKBA 3L7PA 1U2FA 4Q2LA 4NZ7A 4NLSA 2IJNA 2GMJA 4HH0A 3GIKA 2VZ9A 4L72B 1IR0A 4MK8A 2KG0A 1TKZA 1YTYA 1PO6A