2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
3GV7B 4R8UA 3DLKB 2O5DA 3CJ4A 3DRRB 4G3IA 5J2QB 1S48A 4G1QA 5L1KA 3UR0A 3KOAA 2W7PA 3MR6A 3T19A 5KFBA 3EZUA 1JLBA 2ATLA 5DLFA 4TY9A 3N6NA 4IRCA 5I3UA 4EYHB 4G1QB 3DM2B 3ICLA 2ASDA 4NRTA 3DOLA 4ZMMA 5L1JA 5KFGA 4Q45A 1JLBB 3OHAA 2ALZA 4ZPCA 5I3UB 1S6PA 2RKIA 5J2NA 4KBIA 1TL1A 1SV5A 4KV8A 5KFNA 1QAIA 3CJ3A 3RB6A 3DOLB 3LP2B 4ED6A 3KLGB 3M8QB 5FDLB 5J2NB 4RNMA 1TL1B 1SV5B 4KV8B 5KG1A 2VA2A 2IJFA 3CJ5A 2B43A 3FFIA 1TQLA 1TV6A 2AWZA 4RW8A 2IM0A 1MMLA 1C1CA 3TVKA 1DTTA 3HVAA 5KFVA 3I5AA 1RYSA 5C42B 2RDIA 2BANB 3FFIB 4EO8A 1JLEA 1TV6B 3MEGA 4RW8B 3KK3A 1C1CB 2IM3A 3RBEA 1DTTB 5J2PA 1S49A 1BQMA 3KK2A 2BRLA 2ZKUA 3H59A 3HHKA 5KT3A 1HMVB 3LAKA 1JLEB 3FRZA 3MF5A 3KK3B 3UPFA 4EO6A 5J2PB 2V4RA 1REVA 4PUOB 5KFKA 2W9CA 1S1WB 1QAJA 5L9XA 1ZETA 2VA3A 1BQMB 3I0RA 3KK2B 1VRTA 2AX0A 3BSOA 4J9RA 2ASLA 3QZ7A 4NCGA 4TN2A 3CJ0A 4IRDA 1FKPA 4O44B 3SFUA 1REVB 4KFBA 2W9CB 2C2RA 3I0RB 1VRTB 4ZPBA 4RZRA 3BSCA 4RUCA 4ED7A 4LQ9A 4WYLA 3V6HA 2UVRA 1C0TA 4J9QA 1S0OA 2E9RX 3Q8PB 3PVXA 4KFBB 2CKWA 4H4OA 3BQ0A 4MKBA 3IG1A 3HVTA 3CVKA 4NZ0A 1IM4A 4Y3CA 2VG6A 3V6KA 2BR0A 3NMAA 4H4OB 2V4QA 1RT5A 5KFRA 3FDSA 4ED2A 5T14A 4QWCA 4IR1A 3IG1B 3KK1B 2YNHA 4IG0A 1DLOA 1FK9A 2VG6B 3KLIA 5KFQA 1S1TA 3PW2A 3MECA 3DI6A 2R8KA 1SH2A 3DDKA 1D0EA 1RT5B 2UUTA 4ECXA 5CYQA 3H5YA 1HNIB 1N5YA 4ZHRA 3PHEA 4H4MA 4IG0B 5J2MB 1DLOB 3KLFB 5F9LA 1FK9B 2JC1A 3PW4A 3KLIB 3RAQA 2YKMA 3MECB 1HQEA 1TKZA 5HP1A 1ZTTA 2UUWA 2WB4A 3CDWA 5KT4A 5I42B 1ZTWA 1D1UA 2DPIA 1N5YB 4ZHRB 4Q0BA 4MK9A 4K4VA 3DLEA 4WFYA 4Y34A 2J6SA 3PW0A 2YKMB 1QUVA 3TQ1A 1HQEB 1TKZB 4I2PA 3DMJA 1FKOA 4RNOA 3C6UA 5L1IA 3GV8B 2FJVA 4Q0BB 2XWYA 2FVQA 2IM2A 3PR4A 1YVFA 4JV0A 1RTJA 1RT7A 5KFMA 4I2PB 2GC8A 3DMJB 1FKOB 3E51A 3C6UB 5KT5A 3QZ8A 1S9EA 3NBPB 3M8PA 4ICLA 1LWFA 3C6TA 4NLGA 4KE5A 4NLSA 2OPPA 5KFTA 1RYRA 1RT7B 2R8IA 2JC0A 3DOKA 2WRMA 4J9OA 1MU2A 4O3RA 4ZPDA 1S9EB 3M8PB 4ICLB 2W9BA 1LWFB 3C6TB 3QO9B 1RT6A 2OPPB 3T5HA 1S4FA 1UWBA 2HAIA 4WFXA 5DQGA 3DOKB 2XC9A 1MU2B 2VG7B 4LSNA 3QGHA 3ITHA 2W9BB 2IBKA 2VG5A 1RT6B 4JV2A 4RW4A 3EPGA 1UWBB 1VRUA 2WOMB 1JLQB 3ITHB 2C28A 2VG5B 3KHLA 4EBEA 4ECSA 2BQ3A 3CO9A 4RW4B 2WHOA 4R0EA 1RTIA 1JLFA 1SUQA 2ZD1A 4R8UB 1VRUB 1S97A 3LANA 2AGQA 4MIAA 4ECUA 2FVSA 4YMEA 3QLHA 3BR9A 2AQ4A 1S1UA 2AX1A 4IFYA 5KG0A 1RA6A 1RTIB 1JLFB 1SUQB 2ZD1B 5KFUA 2E9TA 5HROA 4I7FA 5KFXA 4URGA 4K4YA 4DL3A 2AGPA 4NLVA 3QLHB 1T3NA 2BQRA 1S1UB 2IC3A 4QWDA 1C0UA 4H54A 3MEDA 5DLGA 5HROB 4WZMA 1S6PB 2RKIB 4IG3A 2HMIA 2W7OA 2GIQA 4QWEA 1NHUA 2IC3B 3IGNA 3PW5A 5JUMA 4LQ3A 4EBDA 2D7SA 1C0UB 4B3OA 3MEDB 3NAIA 4HYKA 4IG3B 5HLFA 1S9GA 2HMIB 3BSAA 2BE2A 3G86A 3I5BA 4U6PA 4ED8A 3T5JA 4KAIA 1S6QA 2EC0A 3E01A 2XGPA 5KFHA 4B3OB 3Q8RB 5F8LA 5KT2A 4ECYA 2XCAA 1NNDA 5HLFB 1S9GB 4IQXA 2BE2B 3KMSA 4MH8A 1S6QB 1T05A 4TQSA 2GIRA 5KFCA 2B6AA 2OPQA 3MEGB 2W9AA 2JEJA 4ZP6A 2IM1A 4WZQA 4IH5A 4NLWA 4ZVEA 3N6MA 1T05B 3QYYA 1TVRA 4NLUA 2OPQB 1JX4A 3SFGA 4KSEB 4URQU 2D3UA 3BJYA 4IH7A 1TP7A 4O3PA 2WONA 2FVRA 3PJXA 2W8LA 2R8GA 4O4RA 3IN5A 4NCGB 4M95A 1RTHA 1BQNA 4NLRA 1FKPB 1IKYA 3BSNA 2UVUA 2UVWA 2I1RA 2WONB 2R2RA 4ZP8A 2J6TA 5KFAA 2C2DA 3PJWA 3KNAA 1RTHB 3RB3A 4RUAA 1C0TB 1IKYB 2HNYA 3CJ2A 3OL9A 4ED1A 4WXWA 5C24A 1I6JA 1JLGA 4XO0A 3HVTB 1S1VA 4KKOA 3NGDA 5DGBA 4ZVFA 3G6YA 3DYAA 2HNYB 4Y2AA 4GC6A 4TY8A 4IOBA 3I0SA 3MFIA 5DQHA 3Q8QB 5C24B 2YNHB 1S1VB 3KHHA 4KKOB 3JSMA 1K1SA 1RT2A 3DYAB 4ZVHA 1S1TB 3T5LA 4TY8B 3DI6B 3I0SB 2W8KA 4TQRA 5CYQB 1CSJA 1GX6A 5DQIA 4H4MB 1C1BA 3CDEA 4ECZA 3JSMB 2UVVA 1RT2B 4O3OA 2YKNA 5KG3A 3BGRA 3KJVA 5HP1B 1JLCA 4ECQA 4QWBA 4ZPAA 4M94A 4IDKA 2HNZA 1LWCA 4NLPA 4K4TA 1JXLA 2C22A 3RB4A 3KLHA 2YNIA 4PQUA 3BQ1A 1C1BB 3GV5B 3DLEB 1HPZA 4NLYA 2YKNB 3LAMA 1LW0A 1RDRA 3BGRB 3KJVB 4KHRA 1JLCB 4IFVA 1HARA 3LP0A 1RT3A 4IDKB 1W25A 1LWCB 4KHMA 2WTFA 4NLQA 4J9PA 4FS2A 2DPJA 4IR9A 3KLHB 2YNIB 4PQUB 1RT4A 5KT7A 1N48A 4IRKA 2E9ZA 1LW0B 1RTJB 2RF2A 4ZVGA 4ECWA 1RT3B 5F8MA 4K50A 4O3QA 4O4GA 5KFDA 1RA7A 4NLDA 3H2LA 4RW6A 1JKHA 2JEIA 1HNVA 2RF2B 5L1LA 3ISNC 3GIIA 3GIKA 4ZP7A 5EDWA 2IAJA 3KLEA 4O4GB 3V6JA 4MKAA 1S10A 4O3SA 4TYBA 4RW6B 1JKHB 3H4BA 1HNVB 4URSA 2HWIA 1XR6A 3KHRA 2R8HA 2FLPA 2ILZA 5K14A 1S1XA 4LSNB 5KFFA 5JXSA 2FVCA 2IAJB 3KLEB 5KFJA 2OPRA 5HBMA 2AU0A 3IRXA 3NAHA 5F8JA 1SH0A 1TL3A 3DRPA 4HKQA 1RAJA 3IS9A 1S1XB 1R0AA 4EYIB 3N6LA 4DG1A 5HBMB 3OLBA 3IRXB 5DG7A 4DEZA 1TL3B 3DRRA 5F9NA 3DRPB 3H4DA 5J2QA 1K1QA 1R0AB 4EEYA 4DG1B 1HQUA 4Q8FA 3OL8A 1EETA 1JIHA 2IMWP 2ILYA 4Q44A 4IFYB 1T03A 2RDJA 3PW7A 4TLRA 5KFPA 3HKWA 3DM2A 4I7FB 1Z4UA 1HQUB 3QIPA 1XR7A 1EETB 5KFLA 5KG6A 3QIDA 5DG9A 1T03B 2R2SA 4J9MA 2OPSA 1N6QA 4RW7A 1NHVA 5EWFA 1S9FA 4YR0A 4KB7A 4QPXA 4QW9A 3M9NB 4EBCA 3QIPB 3LP2A 1HYSA 2CJQA 3KLGA 3M8QA 4WE1A 2FLNA 5FDLA 4U7CA 4GC7A 2R2UA 5KFIA 2OPSB 1N6QB 4RW7B 4RNFA 3I5CA 4FBUA 3QGIA 3CDUA 2JLEA 1HYSB 4YP3A 4DL4A 3BREA 3TAMA 3E01B 3V81A 4J9KA 4WE1B 5DGAA 2V9WA 1RT1A 3FQKA 5KG2A 3EPIA 3DLGA 4DL6A 1LW2A 5C42A 5KG4A 5EWEA 3SI8A 2BANA 2WK4A 3NL0A 3TAMB 3V81B 3H98A 4ID5A 3GILA 2J6UA 1RT1B 4Q43A 4F50A 2B6AB 4NYZA 3OSPA 2FVPA 1IKXA 3H5SA 5KG7A 2JEGA 3DLGB 4O3NA 1LW2B 1HMVA 3MTKA 4ECRA 3BQ2A 4ZP9A 3H40A 4ID5B 5C25A 1S0NA 1TVRB 3ISND 1XR5A 4RU9A 3MR5A 4PUOA 3KMQA 1S1WA 1IKXB 1IKWA 3OL7A 5C5JA 1KHVA 4F4YA 4K4WA 5C25B 1U09A 2BQUA 2C2EA 1BQNB 2I5JA 4O44A 3JYTA 1RTDA 2WCXA 4WXOA 5KFEA 5KT6A 4ED0A 3RB0A 3MEEA 1IKWB 4F4WA 3FQLA 3V6DA 4RW9A 4MK8A 3MR2A 3GIJA 4JUZA 4R5PA 4X2BA 1DTQA 5KFYA 3KLVA 4MFBA 2I5JB 3JYTB 1RTDB 2XI3A 5KG5A 4YR2A 2QV6A 2XI2A 4WYWA 3MEEB 1KHWA 1TKTA 2ASJA 3GYNA 3V6DB 4DL7A 4RW9B 1JLGB 2R2TA 1N4LA 3IGVA 4R5PB 1DTQB 4MFBB 1N56A 1TKXA 3D28A 2XGQA 2BRKA 1JLAA 1TKTB 4RNNA 5F8HA 4MIBA 3KK1A 3M9MB 3CIZA 1IKVA 3LALA 2B5JA 1TKXB 3OLAA 4K4UA 5D3GA 1HNIA 4Y2CA 1JLAB 3D5MA 1QE1A 3OL6A 4DL5A 3KLFA 1IKVB 5J2MA 4QW8A 5KFSA 3Q8SB 2B5JB 5CYMA 3RAXA 1EP4A 5I42A 5D3GB 4OL8A 3MR3A 2IJNA 1QE1B 2HNZB 4PWDA 4K4XA 4ECTA 2FLLA 2HNDA 4I2QA 3NKYA 4FBTA 1GX5A 2V0NA 5EWGA 1HPZB 5CYMB 3KHGA 2ZE2A 2JEFA 1EP4B 5KFZA 1LWEA 5KFOA 4IFVB 4KO0A 3LP0B 2QE5A 4NLOA 1OS5A 5F8GA 4PWDB 4TXSA 4YR3A 4WFZA 3G6VA 3PZPA 2HNDB 4I2QB 2D41A 1RT4B 5F8IA 4QWAA 2AGOA 3FSIA 2ZE2B 4JV1A 1T94A 4ECVA 1LWEB 4LSLA 5F8NA 4KO0B 3NBPA 3OSNA 5KFWA 4YQWA 3PR5B 5J1EA 4FS1A 4J9NA 4XPCA 1J5OA 3M9OB 1S0MA 2R8JA 3HVWA 4TYAA 3GIMA 4RNHA 3V4IA 2YNFA 4IH6A 4MK7A 3MFHA 4DL2A 3T1AA 4XPEA 4LSLB 4NLXA 4F4XA 3QGGA 4Q8EA 5J1EB 3QO9A 1J5OB 2YNGA 3UQSA 2FJXA 5DG8A 2XCPA 3DRSA 3V4IB 2YNFB 4J9SA 2FJWA 1KLMA 2VG7A 3LP1A 3G6XA 5K14B 4K4SA 3UDLA 3OHBA 4ED3A 4F4ZA 4J9LA 2YNGB 2HWHA 5EUHA 3CWJA 2OPRB 3H5XA 3DRSB 3GQCA 4IKAA 3T5KA 3H5UA 2F8EX 1KLMB 3DLKA 2WOMA 3LP1B 1JLQA 2D3ZA 4NLTA 3IS9B 1SH3A 4K4ZA 1C2PA 3VQSA 2OH2A 1WNEA 3RBDA 2IA6A 4NRUA
chains in the Genus database with same CATH superfamily
2Q79A 2W7PA 2G0JA 5KFBA 5RUBA 4F26A 1UVMA 4AL5A 5KFGA 2PMZD 2V9KA 5J2NB 4DV3F 4JI4F 2LMIA 3CJ5A 1SKUB 1S77D 4HDHA 3HFVA 5K8MA 1C1CA 1DTTA 1NPRA 1XC9A 3EM1A 4CO2A 1FKAF 2HVEA 3S7RA 3KK3A 3RBEA 1GQEA 3RBZA 3NGRA 1HMVB 3MF5A 2DK2A 1S1WB 2KH9A 4NMXA 2B4OA 4DS5A 2BE7D 1H0HB 1U6BA 2NCKL 3FMWA 3R5CA 4LQ9A 3Q8PB 4KFBB 3K2YA 4MKBA 1SC3B 2BR0A 3J7AN 1GXTA 4ENOA 2RQ4A 1IM6A 3IC1A 4ZHRA 4MKYA 5D0EA 3RAQA 1HWLA 3UD5A 3DRYA 2KYXA 4ILMA 4FZVA 2IM2A 3HVRA 2PD1A 3G82B 2PFFB 3NBPB 2XSFA 1PYOB 5HJYA 2OPPA 4LJMA 1RBOB 1RAGB 2RDDA 1UWBA 1DZ5A 3GPAA 4X64J 2CUYA 1RTIA 4CDIA 3HSJA 1XMQJ 2FVSA 4YMEA 5HROA 2QJ3A 1BQXA 4JBCA 3D6HB 2IC3B 5JUMA 2VC0A 4B3OA 5B0DA 3C15A 2W2NP 1HBNB 4ZS6A 1FF2A 2BE2B 1KD1T 1S6QB 2CVEA 4DFJA 4DS4A 2UV8A 1R6VA 4RBVA 5EGYA 1JX4A 3GFZA 5F3TA 1NB2A 3QFHA 4P75A 3THTA 2UVWA 1KTVA 2A0FB 4ILRA 3PJWA 1NSPA 3FJ2A 1WWHA 1FTCA 4PCQA 2RU9A 3WDOA 4FDFA 3DFEA 4JI2J 2W4PA 3TRGA 4B3MF 5E3RA 3W61A 1CJVA 1HA1A 1WI8A 2VPWB 4YY3F 3CD5A 1C1BA 4KC5A 1GTEA 1X5TA 2C3UA 2MZSA 5T7LA 2EW9A 3Q86A 3BQ1A 1Q79A 2LLZA 3W66A 4ZPTR 2XEXA 1VQKS 5A2QY 2I0XA 1RA7A 5IM0B 3HMJG 2CWKA 1DY3A 4DV2J 3GIKA 4O3SA 3H4BA 2XNRA 1UFLA 5A0YA 1UVJA 3OFHA 4LRBA 2DH9A 5F9NA 3QRRA 1DQ9A 4EEYA 1SC1B 4DPWA 2LU2A 3SCLE 3KUHA 4Q44A 2VD3A 4TLRA 4UUXA 2G0IA 1HQUB 3D4JA 1V9OA 1YZ7A 2DR8A 2RB7A 2OPSB 1F3FA 2ZOFA 4DL4A 5CHCB 1X5PA 2FY1A 3FQKA 4LF2A 3QT8A 5EWEA 1HBOA 4PG6A 5HANA 3GILA 2OUGA 3CUNA 4O3NA 4UOCA 1K73T 3C16B 2I5JA 4QR0A 2XMKA 5IS2A 2PE8A 3JQKA 2AW0A 5F8HA 2FGOA 3G9CA 5D3GA 2ADBA 1YJVA 3KLFA 5KOWA 2V63A 1H7WA 1P8GA 4PWDA 2QA4S 1WEXA 2V0NA 1UKUA 4DSIA 2DHXA 2C2NA 1YBAA 2HFOA 2J0XA 2HNDB 2D41A 3F73A 3PNIA 1D8YA 1Q16B 1NH8A 3JTOA 1VHIA 2XCPA 1J2VA 1KLMA 4WU3A 5K14B 2HHSA 5CAAA 4U9RA 3DLKA 1JLQA 4DR3J 3G8SA 2ZH2A 3SCIE 3OPKA 3I82A 1UW9A 2ZM6F 3KXDA 1NK4A 2BBEA 1N32J 3T19A 4J9UE 4P7VA 3O3LA 5I3UA 1WC0A 3H7HB 3QWUA 4ZMMA 3OUYB 2ZH9A 2ZC3A 4P7TA 1SV5A 4IO1A 1FJCA 1NKEA 2MSTA 3D9BA 4WCEQ 4KV8B 2VA2A 4ID8A 3FFIA 1F60B 1RWNB 3FGVA 4QQBA 1UEUA 3BPDA 5KFVA 9ATCB 1IBLF 4EO8A 2DNLA 1TV6B 1NPKA 3B82A 1UEVA 1T7PA 3MMBA 4F04B 4B3RJ 1REVA 5KFKA 3D7SB 3W3SA 2AV5A 1EARA 4EU0A 2HHUA 4WYLA 3ETMA 4IOCQ 3LTOA 5DM7Q 1O5JA 2V4QA 4P2XA 1RT5A 4FF3A 5CZVA 4CNYA 2Y1IA 1U0HA 2F5GA 4Q5VA 2ZVIA 4M5HA 3PW4A 1VQPS 1GXLA 3Q2SC 2M0GB 4K0KF 4C2MA 4OX9J 3PR4A 2NXJA 2Z2YB 4WBFA 3DMJB 3QZ8A 4ZCKA 1X4HA 1WKKA 1TL5A 3K0JA 3DOKA 2WRMA 3M8ZA 4NA2A 3T9NA 1TUVA 1G3OA 2QX0A 4WFXA 1S4EA 2HLUA 3MZIA 5H9EK 2W25A 1SIWB 2VG5A 4DX5A 1AZSA 1DFDA 3NCPA 3FZBA 2G0CA 2WHOA 4DOZA 1SUQA 3I4PA 2AGQA 2C2KB 2MQLA 2AQ4A 1Q86T 1VQ6S 1YLXA 1RA6A 1JLFB 3I31A 1G1XA 3GJTB 2VH7A 2E5IA 5D0GA 2X51A 4PG8A 2W2PP 2N3LA 2PEBA 2I9SA 4P10A 3OTBA 1C0UB 2H4YB 4HYKA 2ZBIA 3G86A 4LT6A 1QLNA 2Y0SD 2NPFA 4RU2A 3D1HA 5E0OA 2OPQA 2EK1A 4ZP6A 3TJ8A 4Q2LA 2YH0A 3QJPA 2A2CA 1RHMB 4NCGB 4A8OA 5DO2A 4LIRA 1F2HA 4QYZJ 2F63A 2UU9F 2AHOB 2MLZA 3ONQA 4WXWA 1YI2S 3W63A 2X1GA 2PO4A 2DXDA 5IQQA 4LR9A 3IWNC 1RAOA 2PMHA 2RVJA 1N48A 4OQJA 1P1TA 2VKRA 4CLFA 1U02A 2UXCF 2MHEA 1LQ9A 4TYBA 1H2UX 5LMNF 3NP5A 4N76A 2RSQA 2KRBA 2ZHBA 4J9VA 1F3VA 1F5BA 3UNYA 3OLBA 1YJWS 4OLPA 3DRPB 4F0MA 1Q95G 1Z2LA 1TUGB 2YKOA 4DV5J 1FI4A 4PXDA 1R7IA 3EICA 5A8RB 3QIDA 1YRTA 5DG9A 4HH1A 1MLAA 4RW7A 8ATCB 4YR0A 4JI6J 1HYSA 1RXOB 4B02A 3FCHA 3EVMA 2FLNA 4DFMA 1RAFB 1WEZA 3UE2A 2IRXA 4EK2A 2V9WA 1CJUA 3PX0A 3DLGA 2KTQA 4U95A 1DQ8A 1S0NA 3IBFB 4FVMA 4RU9A 3MR5A 1WI6A 2IJRA 1U1NA 5GAGI 4OI0A 3MEEA 1DRZA 4MK8A 4ITSA 4MFBA 2JZ5A 3TVYA 1X9SA 1NK9A 1MG7A 3GYNA 3CJTA 4P74A 4V1Ak 1JLAA 1S76D 3Q8SB 3SQOP 1RQ0A 2ROPA 3D6MB 2CNOB 3GTYX 2HNZB 3MMCB 2E5GA 3CCJS 4FYDA 4DBQA 1OS5A 1RKIA 3G6VA 4I64A 2PI5A 2YBVA 3FSIA 4DV1F 4JV1A 4ECVA 2OD4A 5J1EA 3MD1A 4FS1A 4L73A 3MTJA 1TK0A 1RAEB 1VLOA 3TJ9A 1QD1A 2MGZA 3QGGA 2FJXA 4LF9J 3TW0A 2FB0A 2VG7A 2JOQA 3P3DA 3R5BA 3DRSB 3TUIC 1FRJA 2P9GA 2IA6A 4K4TA 5CCMA 5CQGA 3UR0A 3H2UB 2QYCA 2GZOA 1MROA 2H48B 3OHAA 4OYIA 2VBXA 3DC2A 4KBIA 3CJ3A 3SSSA 3TVZA 5KG1A 2R7UA 3TVKA 2DHAA 3I5AA 2ZWPA 3R1LA 2RDIA 2KU7A 4CLZA 1C1CB 1DTTB 3KG4A 1S49A 1T9WA 3NRBA 4OIXA 1N0UA 3KK3B 4HI2A 1M1KT 1BC6A 3QFWA 2BOPA 3BH6B 4PKDB 3A12A 1HWJA 5HJXA 4DQRA 3GIRA 4ZKAA 1JNZB 5M2UA 3FEXB 4Y3CA 4OYPA 4ED5A 3TA1A 4DR5J 3DI6A 5D6GA 1WOSA 2VBYA 1VLYA 1D1UA 4ZHRB 1N8RT 3DGPA 2Z30B 4I2PA 4JYAJ 2GCFA 4JI3F 1A0OB 3CO0P 3C6TA 1OPZA 4KPCA 3VVUA 3PRBA 1HI8A 2CQIA 2OPPB 2WB1D 3E2EA 2V8VA 1OY9A 1S5ZA 4J90A 2QMXA 2AYEA 1UWBB 2DJWA 2ZBCA 5B09A 3PX4A 4UF4A 3LANA 5GADU 1U6FA 1RTIB 3GG0A 1ZA1B 4H54A 5HROB 5HMWA 2UUBJ 4E8UA 2HURA 3NAIA 4OZLA 1YWXA 1PGZA 2F3JA 4GKJF 4B3OB 1L3VA 3C15B 2WVFA 4CCHA 2B6AA 3GJQB 5HAOA 3QYYA 2KFZA 2RMLA 1FJ7A 3TA0A 1BQNA 2HZAA 4OFZA 2C2DA 2NS1B 2Q3PA 4RUAA 2BOAA 1BWVA 2BJ9A 3G6YA 3OJUA 4I67A 2DNMA 4NXNF 1FERA 2YNHB 2XO7A 1I5OB 4TQRA 2D9OA 5CYQB 2EG2A 3A13A 1CJVB 1VC6A 2YX4A 2OEMA 3GG1A 3PV8A 4PQUA 1C1BB 1NMEB 1J5EJ 2DPJA 5T7LB 4NA3A 4C8YA 2M3DA 2U1AA 4C98A 1EX8A 1WKLA 1IXKA 4MYUA 2BKNA 4XIUA 3L7UA 4WTYA 3RYLA 3T1HJ 3HD2A 4WFAQ 4ZIVA 1HW8A 2GMLA 5A0YB 1ZPVA 3QNWB 1KTQA 1OPIA 1PJ6A 1XNRF 3RR7A 2A3JA 5AXLA 3ZO7A 1X5OA 5LJ3Y 3MWBA 4CYUA 4HL9A 2OTLS 1HNZJ 1GT8A 3HSDA 2F9DA 4NA1A 1M90T 4OYAA 2OP5A 5C42A 1UAWA 1URRA 1HBOB 5IT0A 2H51B 4Y28C 3R6GB 3AJ2A 4C3KA 2PFDA 3IR5B 2E7XA 2DVIA 3JYTA 1B7YB 1WHWA 3T6JA 4QBUA 3HHLD 4ETXA 3MR2A 2I5JB 5F0UA 1SI9A 3IBWA 3M05A 1EKRA 4N8NA 2QA4G 2MB0B 1D3WA 2KVIA 3ELHA 5D3GB 2E5LJ 4ECTA 3NMRA 2QE5A 4PWDB 1VRQC 1GTHA 1RT4B 3OT9A 1KSPA 4DCJB 2ZH6A 2FLOA 4ZLNA 1RJJA 4HH0A 2HKEA 3QRQA 2NUUG 3GCXP 3KFWX 4LF5F 1X0PA 1CBKA 1KLMB 2J9EA 3IS9B 1F6TA 3M32A 1WNEA 3CCLS 4NRUA 2CRLA 2GFFA 3R5GA 4M5LA 3DLKB 3KOAA 3MR6A 3PACA 4ZIWA 2ZJRQ 1P9YA 5CH7B 2ASDA 2V50A 2ALZA 3NS6A 5I3UB 2H65B 4JI5J 2E1CA 4ED6A 3ZFVA 1SV5B 1Y5LB 2GQ2A 4G1IA 1NHKL 2IM0A 4AE5A 2D1CA 5CD4A 2LQ5A 3FFIB 5KT3A 2M52A 2W9CA 1S0VA 1HNXF 4K2XA 1REVB 3D6TB 3AD8C 1U1OA 2B0GA 4OZNA 2DITA 3MPUB 5AJ3F 4Z7YA 1LFWA 4LF8J 2Q66A 3U7JA 2UZAA 4YB1P 3PIPQ 3K58A 4M5GA 1WC4A 1FO1A 2KL8A 5T14A 2OKQA 3KLIA 2RRAA 1H6KX 1RT5B 3LWMA 5F9LA 4WU2A 1NLKL 5HP1A 2YPYA 3MM5A 4Q0BA 1K9MT 3DLEA 4N77A 3S8SA 4OI4A 3ET6A 1UW4A 1RT7A 3LQVA 4OJ3A 5CABA 3SZ2A 2HSEB 1MU2A 5DM6Q 2LEAA 2DTJA 3W8GA 2HAIA 3DOKB 2QTWA 3EPGA 2LQ8A 2C28A 1B0VA 2VG5B 4RO0A 1PAEX 5CA5A 1AZSB 3CPWR 1Q82T 1SUQB 4ZPWR 1RLCL 5GMDA 2E9TA 2XMAA 3OTDA 2RHQB 4WKRA 3QMQA 4K4YA 3AT1B 2ZITA 2MSSA 1RBAA 4CNZA 2J9CA 4YHHF 4DR7J 3M2UA 1PCAA 2KT5A 1N33F 1RHUB 3BN7A 1FDBA 3ZNJ1 4M5JA 2IYGA 3TEGA 4LF4F 2WZ1A 2E5HA 3KWMA 2BXJA 3Q8RB 4AL6A 1CJKA 4IQXA 3RZAA 1AROP 3QT7A 3AD9C 2E1RA 1U0SA 4ZDNA 2OPQB 4AYBD 2VL1A 3HKZD 1YSJA 4NLRA 4DQSA 2R2RA 3M2VA 2DCLA 5IV4A 3UD3P 4CZCA 5IC6B 2YVSA 1I6JA 3BN4A 4XO0A 1S1VA 1YDLA 3I0SA 3L3CA 2VQFJ 2MKKA 4L3KA 2CJ9A 4DR1F 1IQZA 1SL2A 3CJKA 4GVBA 2GA7A 2C22A 3K7RA 3VTIA 1F2GA 1L3TA 4NLYA 2R7VA 4F02A 2KM8C 2GMJA 4YUDA 1X9MA 4O4GA 4CO1A 4NLDA 2QFIA 1HNVA 3ISNC 2VUGA 3N79A 1M5PC 4MKAA 2ABYA 1GMWD 2MZ1A 2FLPA 2R8HA 3J7YI 1RACB 2HWTA 2DB1A 1F9EB 4ZN1A 5J2QA 2UUAJ 4C3LA 3IWLA 2VPYB 1KKHA 2R2SA 1N6QA 1RWMB 2BJ7A 5C2GA 1YTYA 4X65F 4RW7B 1G4CA 1RI7A 1BMQB 2EXUA 3DLJA 1HYSB 2CPHA 1AA1B 3E01B 2IBOA 4ZK7M 1SJ3P 1X8DA 2DNNA 1ZM2A 2J6UA 3EZOA 1CJUB 4Q43A 1NJXA 3R2CJ 3OVAA 3OXFA 3D6FB 3IR7B 4ERDA 5KG7A 3DLGB 4F25A 4DV3J 4JI4J 4DR2J 1IKWA 3OL7A 4OYBA 4F4YA 4A8SA 4DV0F 3ILLA 4ED0A 3JAMY 2R7QA 2BKOA 1VISA 1Q53A 3AH6A 1GFWB 1RUSA 3MEEB 5EN1A 1N4LA 4J91A 4MFBB 4QR2A 1UCNA 4I6AA 2Z57B 1TL7B 2HGLA 1X5SA 3VALA 2F4VF 1WUUA 1HNIA 5BR8F 1JLAB 3D5MA 3OL6A 4QW8A 2CJXB 2Q1LA 4FBTA 3WIVA 2HFZA 3KHGA 1X0FA 3EVWA 3W1YC 4YR3A 4X4QA 4I6WA 1NKBA 2VDHA 4HEA9 2HFUA 4DUYF 2R8JA 3HVWA 4IH6A 2B8QA 3QBCA 5J1EB 1YJRA 2MZJA 2F40A 2Z58B 1KNZA 3J81U 3CDAA 4NASA 1BD6A 2HWHA 3MPVA 2OPRB 2DD8S 1G7CB 4DQQA 4OHVA 2CDQA 2F8EX 2WOMA 4OJHA 3LUYA 2J8SA 3QGPA 3VAJA 2IVYA 2AKWB 2H1YA 3R7SB 2BJ1A 4CT8A 1KFDA 3IXQA 2XHCA 2Z2MA 3DOLA 3OXGA 3D0GE 2UUCF 2XMUA 1TL1A 3UWTA 3R27A 1MROB 1S6OA 2GIFA 4USTA 4OYOA 2IJFA 2BACA 1NO8A 5HVHA 4CH7A 1HLWA 1VI7A 2BRLA 2ZKUA 3H59A 1R6YA 5DS7A 5CXTA 2XS2A 2H4WB 5L9XA 1VRTA 4ZLJA 3KG0A 1XJWB 2UXDJ 1Q7LB 4ZPBA 1VC0A 3VGSA 4Y6IA 5K9FA 3CC7S 4IR1A 5F3ZA 2IRYA 3MOJB 1FK9A 3OBIA 1D0EA 2UUTA 1R89A 4ZCLA 4B3MJ 2MY7A 2ZHOA 3BS9A 2E1MC 4JV0A 4I2PB 4PPZA 4YY3J 3ENAA 1MWZA 2VB6A 3D0IE 3C6TB 3T5HA 4LSNA 2HGMA 3BM7A 4PYAA 1HD0A 1RZMA 3VAIA 2WW8A 1W7WA 2NPIA 3NCQA 1U49A 4TU7A 3V5RA 2XO6A 4LF6F 2MZQA 4Y2KA 4URGA 2AGPA 5A8KA 4X4PA 1KVIA 4JB8B 2ZC4A 3ZC4A 3BKTA 1UVNA 3IGNA 2GHPA 2C3OA 3BSAA 1Z1ZA 1KQKA 4DUTA 4RPFA 2H5JB 4ZOSA 4WJBA 3MEGB 4B9UA 2CADA 2JEJA 1FVQA 4NLWA 4KSEB 5KTQA 2FJEB 3B4MA 2O67A 5ETPA 2VU5A 1QAYA 1PSDA 4U8VA 2QRRA 4B9LA 4ZVFA 3DYAA 3W9JA 4IO9Q 4A8MP 1QSSA 1R0CB 1KBRA 2OEKA 3D1QA 4H4MB 5K5MA 2AP6A 1E6VA 3R5JB 4RWWA 1OIAA 3GV5B 2GVZA 4A8KA 3LP0A 1RT3A 4PQUB 2YWKA 4MAKA 4ER8A 5F8MA 1XMOF 4BWMA 2QA1A 3DN9A 3NS5A 1Q81T 2XYHB 5EDWA 1HIYA 5KFFA 3BKUA 1TL3A 1GNKA 3EZ5A 2GO9A 4EYIB 4KQZA 3FUYA 1VDHA 4HTJA 3QSYB 4PYDA 4C0OC 4C8NA 3NWRA 4XDCA 3O44A 1JJ4A 2JRSA 2VFSA 5GAEI 2XULA 1YZ6A 3FBCA 2ZBRA 3OFEA 1TUWA 1FDNA 4WE1A 2ZM6J 4RNFA 4L3NA 1VYAA 2M2BA 3TP2A 5D4OA 4DL6A 1LW2A 5B08A 1B0PA 3I9V9 4F50A 1NZAA 4PR6A 1IKXA 3H5SA 1RGVA 1HMVA 3BQ2A 1SVDA 4FXDA 5DJBA 1S1WA 4ZCMA 1RU1A 4OHYA 1B99A 4YN3B 1QJHA 5ETRA 1IBLJ 2KVQE 3GIJA 3JYTB 3CC2S 5D4PA 2J9DA 4NX9A 2R2TA 3IGVA 2J7KA 2XGQA 1VQ4S 4RNNA 3MCNA 4NMLA 4ZVRB 4QU6A 3N01A 3ZZRA 1IBKJ 2EFOA 1NZ8A 4IFVB 1P6TA 4XK8C 4LSLA 3NBPA 2LXFA 2IY5B 2Y1LB 1U1LA 4XPEA 2BZ2A 3AA8A 3H90A 1FWLA 4Q8EA 3NLCA 3GFHA 1R8HA 2FJWA 2HVIA 2DR9A 1QAXA 2I2YA 4LFBF 1V3RA 2XS7A 2HQIA 2GAHC 3RBDA 1ZAWA 3P5TL 3NCRA 3M32B 2U2FA 3N6NA 3A4TA 4DU8A 2LQJA 2CJBA 4EYHB 2UXBJ 4WIIA 1ZYQA 1VBKA 5ETLA 1VC5A 3BO3A 3MM9A 4L6V3 2CAJA 4G6VB 3RW7A 3NNAA 4QPTA 1DJ0A 2D74B 3W5XA 3B8HA 2LQBA 2FC8A 4EO6A 2AX0A 4ZVTB 2G4BA 2W9CB 4F2SA 2XY6A 3HHNB 3M7VA 2CKWA 1RAIB 3IG1A 5A6PA 3T1YF 3AB2B 4JI0F 2NXCA 1NSKL 1VQ5S 4N8OA 2R8KA 1N5YA 2UU9J 2IHR1 5A8WA 3KLIB 1I3OB 1SBRA 3NL0A 1Y11A 3VR1A 5D15A 1R8AA 4PWUA 4Y34A 2MDAA 3J80Y 2J6SA 2VJUA 1QTNB 1ZA2B 1YJ7A 2DH8A 3MM5B 2RRNA 4Q0BB 2XWYA 3KKFA 1DQAA 4TVAB 1F5CA 1P1LA 3ET6B 2P9CA 3E51A 1S9EA 3MAQA 5CCLA 1RT7B 3IFEA 5AXNA 1YBUA 3SSQA 3GJSB 2MEWA 3POTA 1MU2B 1U1MA 3CJ8A 4OZ1A 3UDCA 5JVGQ 2RJZA 2UXCJ 4KH0B 3KHLA 7FDRA 2HK2A 1WDTA 4R8UB 3HM9A 2XBPA 1RLDA 3BR9A 5F0WA 4A8WA 3CW2C 1UWAA 4NL5A 4KHPJ 1I94F 1Q5YA 3KJQB 2RKIB 2NSBA 2W7OA 2HHHJ 3RUBL 2G1DA 1VR6A 3ILJA 1NU4A 4ZJQA 3M2UB 4YS2A 2NQPA 2YWFA 4B3SF 1CJKB 4I1TA 2KZMA 4RWXA 2HBQB 3CMQA 2JFKA 4JI7F 2O1PA 4IH7A 1U1QA 1TP7A 2PA8D 4BS2A 2C3YA 1HQ2A 1IKYA 1RWOB 1TELA 3CCQS 3NGTA 2B9EA 2L08A 3RB3A 3R3TA 4OHZA 3N0VA 1NKCA 2N82B 1M5SA 4KRWA 3M2VB 5C24A 4JP8A 1HNWJ 4O0NA 4KKOA 2HRTA 3BBFA 1S1VB 2P6SA 1S1TB 3QQCD 3T5LA 4W92B 3I0SB 2BJEA 1CSJA 1HR0J 5E3AA 4ZVSB 4Y0FA 3KLHA 3CJKB 4GVBB 4KHMA 4IR9A 2C1EB 2L9NA 2RF2A 1ZM3A 1UVKA 3H2LA 1JKHA 1KWMA 4O4GB 3MUMP 1HNVB 5K14A 3SV4A 4AQYF 3HSGA 4JI1F 2FDNA 2FVCA 4DV1J 2J9DE 1RAJA 1WC1A 1UMJA 4L76A 1ZPWX 4HR2A 4DG1A 4PXEA 3IM8A 2BDPA 3H4DA 3DRXA 2ILYA 3KJNB 4NYPA 3L7PA 3ILOA 2CPYA 4N5SA 1N6QB 3I5CA 3W60A 3LO3A 1T9UA 3VHQA 4KYZA 4NEZA 1NB7A 1RT1A 2C2OB 4RBUA 2OFGX 4F67A 1HHTP 3CC4S 3QRPA 2XLJA 3R5DA 3EYZA 2CQ3A 3W7BA 2G9OA 1KHVA 1WD6A 3TOQA 5KT6A 4UY85 1IKWB 1WEYA 1XMBA 2HRUA 3KLVA 2BQUA 2XI3A 3M30A 4CLWA 1PAUB 3MAAA 2QEXS 3CIZA 3ZTPA 3AQOA 1ZZFA 1UETA 1L5UA 5HVGA 1N0VC 2HHVA 3RAXA 5DDQC 4NPOA 2FLLA 3QWPA 5KFZA 3CMAS 5KFOA 5HI7A 1U2CA 3MM6B 4WFZA 2AGOA 4USMA 4QIVA 3ILIA 3IWXA 2HQCA 2WBMA 3UR3C 5SZTA 4WP9A 3W2WB 3BO4A 5EUHA 4IKAA 1LFPA 4NLTA 4X84A 2BV3A 1NPPA 2DGUA 7AT1B 1RISA 1VQ7S 4Y65A 2PI4A 4G1QA 2OFHX 4EWTA 5C2CA 1EZZB 4RUHA 3LGNA 2FJAB 4IRCA 1BE4A 1TFYA 4CLUA 4LF1A 4BCAA 3T41A 4EMDA 2CZ4A 3FCVA 3G4SS 1QAIA 2V2QA 1WTBA 3FSYA 1Y4ZB 4GO5X 3DOLB 3LP2B 2RRBA 3M8QB 5FDLB 4BC9A 1TL1B 3HX9A 5HN0A 3PDNA 4P71A 4OYXA 2CQBA 6FD1A 1QY7A 1KEKA 5LJ5Y 2KG1A 3FRZA 1CG2A 4PUOB 2VA3A 2ASLA 4GKJJ 4NCGA 4DPTA 2LDIA 2PDAA 4KH1B 1VRTB 4X4RA 5HMYA 2ZKTA 2X1BA 4PG4A 2K7KA 4WKYA 2GNKA 1IM4A 2BE9B 1AXQA 3NMAA 4QWCA 1LXNA 3MECA 2ROEA 3DDKA 5HL7Q 5LOQA 1FK9B 2HRYA 1WSVA 1YITS 1TKZA 1ZTTA 5I42B 2DR6A 4C4WA 4MK9A 3TQ1A 2CQ1A 4NXNJ 3AD7C 3C6UA 2FVQA 2MKIA 4DQIA 2YH1A 3OW2R 1NJZA 3I55S 2HFNA 3H0PA 1L3UA 3GSDA 1RT6A 4C8LA 4ELVA 4DV7J 2QLJB 1HHSA 4M5IA 3RBXA 3LPEA 1HI0P 3HHEA 2Y1JA 5HO4A 1U45A 4X4TA 1XWLA 1RSCA 4DL3A 5A8RA 4ATNA 1LXJA 5A8KB 1EHWA 3ZTQA 2LYVA 2KKHA 3AJ1A 2XCAA 2MKYA 4KGXB 3F44A 5KFCA 1YJUA 3IAS9 2QIFA 1ZOTA 1X4AA 3SFGA 2D3UA 3CE8A 2R8GA 1WG5A 1RTHA 5DDPC 2MJUA 1UP1A 2UVUA 2R3VA 3KNAA 2HLTA 3CJ2A 1MMDA 2BVZA 2VQEJ 2J8AA 1V5VA 3UDVA 2ZUGA 4EZ9A 2Y8YA 2A6MA 3DYAB 4FYXB 2NXNA 1X4CA 1HD1A 2YKAA 4TNOA 1TAUA 2HNZA 1L3KA 5HK4A 1FNXH 1RDRA 1SJQA 4CLLA 4XTTA 1E6VB 1W25A 4FS2A 4TKTA 4DR3F 3NOCA 4AXIA 1RE1B 2GVZB 2MMYA 1D8ZA 1RT3B 5GAGU 2AZ3A 2ZDOA 1KDNA 1TK5A 4OZ5A 1Q8KA 2A6OA 2HHTA 2DNQA 3HP6A 3QPIA 5JXSA 3IRXA 2KDOA 3VV2B 4UQGA 2K1RA 2Q6BA 3VAGA 4P2FA 1GK8A 2DISA 1IWAA 4DEZA 1TL3B 4M5KA 1IR0A 1EETA 2VHGA 3GFXA 1SJRA 3HKWA 1Z4UA 1XR7A 4J9MA 4Q2MA 3Q22A 3V81A 4WE1B 4DUZJ 3SI8A 2X1FA 3CNQP 2B4VA 3P45B 1FNOA 1RWWB 2WVBA 1LW2B 1O0PA 4CLTA 4PQAA 1IKXB 3RB0A 4LFAJ 3FQLA 2SXLA 2B7BB 1K47A 1N34J 1SCJB 4IYQA 1CC7A 2DRDA 4R25A 3GB0A 1EP4A 4OL8A 4A8QA 1Y9OA 4I2QA 2LXIA 3VWSA 2JEFA 2ZE2A 2OMOA 5EX0A 4QWAA 3HHDA 3R5AA 4OZ3A 1EAYC 2YNFA 3CJRA 4LSLB 2LXUA 2DT9A 3OV7A 5IWAJ 4ZLLA 4EGLA 4F7VA 7FD1A 4DR6F 2YWWA 3G6XA 3VAFA 1ZAVA 3CWJA 1SH3A 2WSFC 2FHJA 3TR5A 4LBIA 3OR2A 3A8KA 4G3IA 2MZTA 1F5AA 1JLBA 2VODA 1CQMA 3CD0A 1WACA 3ICLA 3M6WA 5L1JA 3Q24A 1U1PA 4X4OA 2KXNB 1TMMA 3GSIA 5F41A 2RD5C 2FJBB 5A76A 3MM9B 2DNGA 3HVAA 1UTAA 4LIWA 2MTLA 6AT1B 1KFSA 1N33J 4P2SA 3PCOB 4N47A 3A8JA 3B6BA 3JSRA 2V4RA 3I0RA 3BSOA 9RUBA 2XMJA 2QLBB 4HT5A 4UOGA 4FP9A 2PIIA 3PVXA 3D0HE 4H4OA 2B4UA 3TQEA 3ZZZA 3IG1B 3KK1B 2YNHA 1RWPB 2B4PA 4FVCA 2XMTA 1WC3A 5CYQA 2KHCA 3PHEA 4JV5J 5J2MB 5DZ6A 1N5YB 2LP4A 3TZYA 5A8WB 3PW0A 4RNOA 5JMNA 1J27A 4ANDA 1KOHA 1BHNA 1FT8A 1XNQF 2EFQA 3P4UB 1NDCA 4GKKF 2KZZA 2CA9A 1DHMA 4K2JA 4GMKA 1YJNS 1FJGF 4ZPDA 2DGWA 1S9EB 3SXLA 2VBWA 3JB9k 3K5NA 1FX4A 2G13A 3POTB 1PYSB 2ZEJA 1S12A 1R0BG 2EVZA 4DJBA 3BO2A 2WVCA 1TTHB 3KTQA 3GZ7A 2AX1A 4NZ7A 4WK1A 4ZVUB 2POKA 4QWDA 2Z8QA 3MEDA 3AOAA 1R8CA 4C8KA 5KFHA 2QSWA 3MD3A 3KMSA 2HG4A 1PJ5A 2XSJA 4TQSA 2CDRB 2IM1A 1QDUB 1X4GA 4NLUA 5A2QU 3RG6A 3CCVS 3PJXA 1VQMS 1RU2A 2XNQA 5JJBA 4ZP8A 5KFAA 3PTWA 1R3NA 1IKYB 2JFDA 3GONA 2FHJD 3HVTB 4E2FB 3BKFA 1ULRA 5DGBA 4X4UA 1M0SA 5C24B 4DV0J 2HFSA 5BYSA 4KKOB 5AXKA 4C6AA 3TI0A 2KXHA 1GX6A 2V34A 3DXBA 4O3OA 2RE1A 1C4CA 2YNIA 3E8OA 4FN5A 3HJVA 2HVHA 2WTFA 3TUJC 3HT3A 3BGUA 3KLHB 3DDNA 1RT4A 2F4VJ 4ZVGA 5BR8J 1N5TA 2BJ3A 4ES1A 2I38A 2G2ZA 3G87A 2RF2B 3C3LA 3GIIA 2EPIA 4KGVB 3HZGA 1W2BR 2DNHA 1JKHB 3K8WA 2XWXA 3AXMA 3CULA 2R7OA 3B54A 2IRUA 2PA3A 5DDRC 3M8SA 3IS9A 1R0AA 4DUYJ 3BB5A 4X4NA 3S6EA 1URNA 3MPYA 4P72A 1SB6A 4DG1B 2DIUA 3C46A 3CGIA 2HHQA 4I7FB 4DMZA 4M1KA 4A47A 3G8QA 1VK8A 1H2VZ 3H8YA 3BV8A 5EWFA 5E3CA 1PC4A 2GJIA 1UA1A 1UFKA 2DY1A 3VAHA 4GO7X 3TYTA 5ETQA 1RT1B 4NYZA 2FVPA 3IM9A 2QLXA 8AT1B 2P2CB 4UUWA 3MTKA 1XN9A 3H40A 5C25A 2DR7A 3BGFA 3D67A 1BWEA 3UN5A 3OTOF 2CG8A 1U09A 3AA9A 1RTDA 1KQSR 5THWA 1YJ9S 3R97A 3V6DA 4X4VA 3HSZA 5KG5A 2M7SA 1CC8A 1KHWA 2HIQA 4L75A 3M30B 3PYFA 2P8IA 3PIOQ 4U8YA 4P6QA 1IKVA 3G96A 3MAAB 2EFPA 1NUEA 4F3OA 2B9XA 3WC2A 1U26A 2LDYA 1LKZA 3D1OA 5EWGA 1HPZB 3M6UA 5FIIA 1RWXB 3Q8UA 1OSCA 5F8IA 2OD6A 3BH7B 3J7Z5 3OFGA 4DSEA 4JOUA 4YQWA 2F1FA 1S0MA 1FD8A 3GR0A 3M6VA 4YB5A 4NLXA 4F4XA 2C2ZB 2YNGA 3K5OA 1WF2A 4Y2IA 3OHBA 4F4ZA 1N5VA 1H72C 2XTJP 2CJAA 4NYOA 4K4ZA 1S72S 1FE0A 5D77A 4LRAA 3K17A 4G1QB 2DEJA 1YBTA 4B9VA 2PEHA 3UVJA 3TAPA 2YTCA 2EK6A 2IFXA 2JNJA 1Q8LA 4LF6J 2AWZA 1MMLA 1CEZA 4UW2A 1T9TA 3K5LA 1V5IB 1Y3KA 4W90B 3LAKA 4N56A 4FPIA 4OZ0A 4W98A 4YDDB 3RRKA 1QTMA 1R8BA 3IP0A 5D4LA 5MLCV 3N5BA 4RUCA 5I3QA 4J9QA 2HQFA 4OV1A 5H9FK 1D9AA 2RU3A 4NZ0A 3C2PA 2VG6A 2J7WA 2HW3A 1X4DA 2L41A 4ES3A 3SV3A 1YK9A 2FHKA 2DHSA 3MECB 4K59A 3CCRS 2HGNA 3TARA 3T1HF 2XY7A 1TKZB 3ZZPA 4QCLA 1FKOA 1U47A 4I6YA 1YVFA 4RBTA 4QYZK 3C6UB 5KT5A 2R42A 3X1LB 2JC0A 2W9BA 1JJCB 1OQ3A 5DQGA 2JDJA 4ETZA 1RT6B 1U4BA 2CQGA 1XMOJ 4IUFA 3HT0A 2DKOB 2BQ3A 1HNZF 2AJFE 3CCMS 2ZZTA 1ROFA 2ZD1A 2VOPA 1B0TA 1WJ9A 2DNYA 2AMCB 3KDOA 1WHVA 3I96A 1XIQA 4X66F 4C0BA 3LGHA 1EIYB 3O5TB 2KJVA 1VOMA 1WG4A 1NBEB 4NXMF 2D7SA 4RR5A 1VJWA 1RAAB 5HLFA 4U6PA 3I5BA 4C8MA 1VBXA 3E01A 4ANEA 1KQGB 2COLA 5IZHA 5KT2A 4V19J 2BJ8A 2IPOB 3J7YU 3GFYA 2W9AA 4IH5A 3EGNA 4C97A 3N6MA 1VQYA 4OJGA 5MAOA 4O3PA 2VJVA 1IBCB 3LGMA 1FRXA 6FDRA 1RTHB 2GJFA 1C0TB 3DGVA 4ED1A 4I68A 1T02A 4V19X 3ZZYA 3BDEA 4TY8A 4IOBA 1SC6A 1WOPA 2FC9A 1TL7A 3T6BA 2GMHA 2K2PA 4PWWA 1RT2A 3FZ2A 3PYGA 1DAXA 4Q7AA 2NXUA 4ZPAA 4IDKA 4C0HA 5FLXU 5IXUA 1R27B 2EFNA 3E3XA 4J9PA 1P27B 4NLQA 4WK3A 2E9ZA 5KT7A 5HMZA 4ECWA 1FDAA 3HPOA 2AD9A 2YQ1A 1JXEA 3J81j 1OYDA 2CJKA 2ILZA 1S1XA 5D0HA 5KFJA 2OPRA 4JI5F 2M4MA 1SH0A 4K8RA 3WQPA 2GS8A 3OJSA 4BLGA 3IRXB 5IV3A 3NWGA 2K1RB 4RUBA 1XK8A 3AJDA 4RL1A 3HI9A 2ACYA 4LFBJ 4LF7J 3Q83A 1EETB 5KFLA 2G2OA 3NG8A 4UZCA 5HVFA 4YEAA 3DU5A 3W2VA 1FXLA 5E5NA 5ETOA 3CDUA 1N36F 4UOFA 4J9KA 1EB0A 3W8PA 1WC5A 3V81B 2DGSA 1UPPA 4OZ2A 3QSIA 4A8FA 3B4DA 1M5KC 2NSCA 4EUVA 2W2MP 3MM7B 2Y1RI 2WCXA 4F4WA 3CMES 2XB2D 3J7A1 1Y7PA 3RAMA 2XMWA 4TU9A 2WSEC 2LCWA 3AQPA 5D4NA 4Y2CA 4DL5A 2P6TA 1DURA 3EUNA 1AFJA 1YRUA 2PGCA 4JI0J 2V6AA 1EP4B 4DZDA 4DCPB 2AYGA 4ZVPB 4DU7A 4I2QB 4HHUA 3THPA 2ZE2B 1Q5VA 1H74A 1H2TZ 4TYAA 3S1TA 4I4BA 2D3O1 1FE4A 2N4CA 1NK8A 1OY8A 2CPEA 2YNFB 4CT9A 5LMUF 5B0CA 3H2VE 2DNPA 4A8XA 3CJQA 1UA0A 2DNRA 2O01C 5B7WA 2LQ9A 2JWNA 2R7WA 1IJFB 3GMGA 1W2IA 3OR2B 2ZZNA 3A3PB 3DM2B 2CZVC 4DV6F 4BBYA 4PAAA 1JLBB 1NDKA 1NK5A 1HWKA 3DLBA 3A3NB 5HATA 5L8RC 2MKSA 1KRPA 3SBMA 1RCOB 4WP8A 4RW8A 4FYYB 1CVJA 1RYSA 2BANB 1I94J 1JLEA 4DHVA 3MEGA 1FFWB 2VQFF 1VBYA 5L38A 1RKJA 2WSCC 4CRJA 1NSQA 1LEOA 4Z37A 1Q78A 4CLPA 3I0RB 2IDLA 3V6HA 1D09B 1FEEA 4K5RA 3OVSA 3AXKA 2JVRA 4H4OB 3MMAB 1LK7A 1DARA 5ETNA 1NEEA 2BABA 3TZXA 4ECXA 3H5YA 4LRFA 4H4MA 2JC1A 2E1PA 2YKMA 1U25A 4WFYA 1U6ZA 4OJ1A 4OX6A 5C7PA 2J0SD 5H1SV 1UVLA 3IMQJ 5GAHU 2OTJS 3TEHB 1LWFA 4QR1A 1EQMA 4B17A 5KFTA 3ZZUA 2UUAF 1XBWA 2ZOMA 2FGCA 1K44A 1VQNS 3ITHA 4RW4A 4FF4A 1VQOS 1MMNA 1U48A 2NLWA 2HK3A 3TWZA 3G71S 5B0GA 2DGQA 3QLHA 1TMJA 1WOOA 4HHHA 4AQYJ 4JI1J 3EXCX 1M1GA 4WZMA 1YG0A 4DR2F 3GLJA 3MEDB 3G8TA 5K20B 2EC0A 1FHTA 5K8OA 1O6XA 4R0JA 2FUG9 1S59A 4WZQA 1AFIA 2XSJB 3GU0A 1T95A 3HFZB 3BJYA 4LFCJ 1U7LA 2FD2A 1GMUA 1I1GA 2H5EA 1NJYA 2I8EA 3K57A 1FKPB 1FXDA 2HNYA 5GAEU 3EGVA 4OYWA 5ADZA 3THVA 3MR7A 2KI2A 3MCMA 4Y2AA 3MFIA 4DDFA 1X60A 3JSMA 4G1PA 2YKQA 2HQDA 1GH8A 2D3OR 1WORA 1SL1A 3K89A 2NYIA 4EI2A 5GVQA 3BGRA 1JLCA 3KJFB 3TJAA 4QWBA 3ZNUA 4QIEA 4KJIA 1UEKA 1LW0A 3I9ZA 4IFVA 3ENWA 2YNIB 4LSZB 1HWIA 1IQTA 2XQCA 2MZRA 1T9YA 1FEHA 3VAMA 3JXOA 3GP9A 4QIWD 2ZWOA 2ZH4A 5CYJA 4HTIA 1G6BA 2HWIA 5HQMA 3WIUA 5ETSA 4HHJA 1HKAA 3OD2A 2ZH8A 1R0AB 3FC9A 4Q8FA 4USJC 1T03A 3RU0A 2LVWA 2MQPA 2YWGA 4CI0B 1YGYA 2J7UA 2UXDF 2YXLA 1FJEB 4AUKA 5KOXA 2A2DA 2C42A 3DCAA 3MM8A 2JEGA 1TL4A 2GHVC 2FIUA 1TVRB 4A48A 2OIHA 3KMQA 5C25B 2QL5B 2YWHA 2MXYA 4TLQA 4MKVA 5L9NA 2Y3YA 4R5PA 1RTDB 4YR2A 2XI2A 4BC7A 3EMTA 3V6DB 4DL7A 3D28A 2AZ1A 2EBGA 3JSYA 2RH3A 1VHFA 2CYYA 1IKVB 3SIPB 2GW8A 4Y00A 3K8VA 3AY0A 2EEYA 3Q8YA 2YY3A 1JWWA 2E1AA 4B9SA 1NJIT 4XPCA 1J5OA 1EQ0A 1FDDA 2IVFB 2XY5A 4CH0S 1S7IA 3MUVP 3CCES 1WDDA 2YNGB 3H5XA 3ENVA 3W65A 3MI7X 1U2FA 1RWVB 1C2PA 3U1NA 4B3TJ 2J0WA 2OH2A 3AB4B 4HACA 1WHXA 4FNHA 5B0EA 4R8UA 3DRRB 1D9DA 5L1KA 2BKPA 4CM0A 3EZUA 2BA9A 3HXMA 1MWYA 3KUGA 2RKIA 5EX3A 2WVEA 5HSPA 3W9HA 3KLGB 4HI1A 3UVJB 2B43A 3ISZA 3VZIA 1TQLA 2CZ9A 2EWHA 1KS2A 2BMBA 1SIZA 2YPZA 1BQMA 3HHKA 4CO5A 1YRXA 4OX7A 4CTAA 3M1VB 2CNKB 1QAJA 3GR1A 3I6PA 2Q6CA 1NCLA 1UJ4A 2C2RA 1AUDA 1S0OA 2BW2A 1X4EA 2GO8A 3MEKA 1RABB 2VIHA 2J0QD 2DNZA 1FFSB 3K5PA 4QU7A 3FDSA 4IG0A 4I56A 2VG6B 4X62J 1S1TA 2CPFA 1FNMA 2E7VA 4DX7A 2C3MA 5FJ4A 5IT9U 2CPJA 2X1AA 3CDWA 2KN4A 1WKJA 3KUEA 4HVZA 2J5AA 3P5BP 1FKOB 1HFEL 4B9NA 3NNHA 2V69A 4KE5A 4NLSA 2L3MA 4F36A 3DLHA 3AHPA 3A8EA 3IO1A 4J9OA 3QO9B 1UJ6A 4F4KA 1S4FA 4KR0B 2XC9A 3VGTA 2W9BB 2YWEA 1U24A 5E33A 3M2RA 2OLWA 1R43A 2QMUB 3BPSP 4KGMA 1U2RA 1NAQA 4QJVA 4MIAA 3BBCA 1S1UA 2KFNA 2ZD1B 1SQGA 4F3QA 5BXIA 2DXEA 4F2RA 2XLKA 4UY8T 3CXCR 1S6PB 3WC0A 4WPAA 4DPOA 1NHUA 3PW5A 1RP5A 4KGKA 4ZVQB 2MQMA 2VPZB 4FKXA 3PG9A 4D3HA 5HLFB 2XHWA 2V67A 2IMOA 3NGSA 2CQPA 2FVRA 2W8LA 2VKZG 1UZDA 2HBYB 3UI3A 5K8NA 2H5IB 1VQSA 1YIJS 1RAHB 1IBKF 3D54A 2HS4A 2DGVA 4CLSA 2PMWA 3PO5A 4N7TA 4XDDA 5H9EJ 2J76E 3LPYA 4TY8B 4C7QA 2YQ3A 1RT2B 4DPUA 3NS7B 1RHJB 2WAQD 1SKSA 3PO4A 2H54B 2GQCA 3CCZA 1HARA 4IDKB 3MM6A 3DOMA 3O2IA 4IRKA 1Q1KA 1RTJB 2V2ZA 5KFDA 2JEIA 4NOHA 3EWGA 4LR7A 3I32A 2DNOA 1RWKB 2B9WA 3W2WA 2UXBF 2RQMA 2QFJA 4NE9C 3HHLC 5HBMA 2WW4A 4ES2A 1S1XB 3WZ0A 5DG7A 3F56A 3JAMU 1TKDA 4DR6J 5G0RA 4IFYB 2LU1A 4J5OA 4M5MA 4ZPVR 5H9FJ 3L09A 5B0BA 1NHVA 2DY9A 1OJ4A 3LP2A 2CJQA 3CB4A 3M8QA 2QL7B 5FDLA 3N9UC 4U7CA 2R2UA 4FBUA 3PHTA 1YJTA 2AJ0A 1IBMF 3PM9A 1U1KA 4MYTA 3W2VB 2VASA 4OI3A 1YKWA 1CQNA 3MPWA 3W5YA 1VJQA 3DLLQ 2RNEA 4DR4F 4PUOA 1V3ZA 3I56S 3HULA 5SUHA 2M8DB 3MGJA 3MMJA 1DTQA 2NR0A 3C14B 2CPDA 1JLGB 4DV4F 2GAGC 1TKXA 3F0NA 3AOCA 2HQ3A 4CO4A 4WIQA 2HHPA 4K4UA 2IA0A 4H4KC 3PEJA 1WTFA 2B56A 5I42A 3H25A 2IJNA 1R31A 2ADCA 1LWEA 1PJ7A 5DRKA 5F8GA 4BDPA 1ZH5A 3UW1A 3PY8A 1LWXA 4DXLA 1D9FA 4UQTA 1HI1A 4MK7A 4DL2A 3T1AA 1VIOA 4IOAQ 5FD1A 3FVYA 4KHPF 3L9ZA 1XNQJ 3P8BB 2HHHF 4GKKJ 4MMOA 1I51B 2LEPA 5CD4H 1BGXT 3NY0A 1FJGJ 4KTQA 3CJ4A 4DL0C 2Z2LA 5FLXY 4JI8F 4Z7CA 4NRTA 4ANCA 3GYGA 5KFNA 3JS9A 1T9XA 1BXNA 1FWPA 5AT1B 4C8ZA 2ACMA 2GJ2A 2JLGA 4FYVB 1APSA 1LNQA 2YKPA 4RW8B 2ATCB 2CG4A 1HNWF 3Q2TC 1AUSL 1UJ5A 2EBEA 3EGZA 4DN0A 1JLEB 3EX7B 1JB0C 3PKYA 1ZETA 1BY9A 4OLOA 1HR0F 1F1BB 4O44B 2Y0BB 1KN6A 2CJYB 2VF3A 4RZRA 1VFJA 3BSCA 1VBZA 2ROGA 2VZ9A 2KHDA 4OYMA 2JJ4D 3O1LA 2M5YA 5KFRA 4P2MA 1XQIA 3PW2A 2M88A 1T8EA 3IRWP 4F0HA 2X3GA 1NDLA 1Y5NB 2YKMB 2ZBPA 5L1IA 3KYLA 2GQQA 3MDFA 5KFMA 4WWSA 3FEZA 1LV5A 2KB2A 2M70A 4YFUA 2HS3A 2W24A 1TU0B 1LWFB 1FA0A 1OYEA 3A1YG 4PABA 3QGHA 2GVDA 2DRAA 4LVOP 1VRUA 3PRDA 2A10A 3ITHB 1O8BA 3CO9A 4RW4B 1JQGA 4U7UK 2ERRA 1Q0NA 2E29A 1ZZNA 2KO1A 3LWLA 5G4DA 1H73A 3ZTRA 3QLHB 2XS5A 1CJTA 4EBDA 1SJ4P 1TFWA 1S9GA 5L39A 3NXZA 1SJ1A 2ASYA 1JK9B 1TAQA 3R8YA 2OHDA 2VFUA 1T05A 1Z2ZA 4P73A 3M8YA 3NGKA 3FKBA 4ZVOB 2WONA 4HDGA 4WP3A 3EE3A 2AF6A 2ZDPA 2N4DA 1N52B 4FXWA 2D9PA 3UO0A 4NCAA 4ELTA 2VBZA 4X4SA 4DCOB 4UZBA 2MKJA 1R8PA 1AT1B 3OTCA 2HNYB 3OTOJ 5E3PA 2EKNA 1REGX 1PILA 2O3DA 2HYIB 1KVJA 4HT7A 3JSMB 2BYCA 1PKUA 4DN9A 4ECQA 1LWCA 2CPXA 1JXLA 4DLEA 3LAMA 3BGRB 1JLCB 3CDBA 4F8RA 2CNNB 3ZTSA 1RBLA 1LW0B 4U7UD 4PXBA 1QSLA 1RHRB 2IAJA 3HHLA 1BLUA 1S10A 1G2EA 4URSA 4U67Q 4K0KJ 4AFFA 4F0KA 3MXHP 1NJWA 4USHA 4WF9Q 2W2QP 4CQ1A 3OL8A 1JIHA 1AB8A 2NXEA 2M9KA 1T03B 1VS3A 2YQ0A 2BUNA 4QPXA 4B08A 1HBMA 5KFIA 4RKUC 1IWGA 2JLEA 3TAMA 5KG2A 2PT0A 2NREA 5KG4A 3H98A 4ID5A 1YQHA 3G6ES 1FD2A 3IAM9 4FXVA 5K8PA 1Y5IB 3ISND 2DXFA 3MM8B 1H7XA 5IQ6A 1NDPA 3M6XA 2HHWA 2RUSA 2OI2A 4RW9A 5KAKA 5KFYA 1KR4A 1X4FA 4GRSA 4R5PB 3PFEA 3VZHA 2AJ2A 3M9MB 2MLXA 4H4KA 3KK1A 2DGOA 3LALA 3FBFA 1KVKA 2AT1B 1VQ9S 1QE1A 5J2MA 2V5HG 1B64A 1HBUA 3I4HX 1KP6A 4DV7F 1FWKA 2ZOGA 2DR5A 3RRGA 3DHWC 2IVMA 1WC6A 2HZCA 2KRRA 4YDXA 4DQPA 3UDEA 2F4FA 1J5OB 4TU8A 2V94A 1OO0B 5BYQA 1T3OA 4C48A 1BUXA 2D69A 2KYZA 2ZHAA 2W7AA 2BW7A 2D3ZA 2DRBA 2AEFA 3HCXA 3N5FA 1SL0A 4QOTA 4HACB 2V8PA 4AT1B 4DX6A 2K3KA 1RHKB 1YHQS 5LMNJ 1WF1A 2OAUA 2LA4A 3AOBA 1Y10A 4X66J 2LECA 2EI5A 3O6QA 3EDQB 3J80U 4AL7A 1ZBTA 2IM3A 5J2PA 4Y2MA 4NXMJ 1CS4A 3KK2A 2VQEF 3QJJA 2HBZB 2IIHA 5EHHA 1M1HA 1BQMB 2DNKA 2R7XA 4J9RA 2JLFA 1P9QC 4FKYA 3CJ0A 4CTAB 4DZ6A 4ED7A 4N41A 2UVRA 2E9RX 1IN0A 3BYRA 3HVTA 3V6KA 4OI1A 1QSYA 4ED2A 3BDPA 1DLOA 1V6HA 2K8GA 4DPXA 4IG0B 3KLFB 3QATA 2CPZA 1AW0A 1HQEA 2V8HA 2LKZA 4PEOA 2ALYB 3PYEA 5DZ7A 2ZJQQ 1ZAXA 2NYHA 1DBDA 3SMZA 2MJNA 2MQOA 1EJ7L 3M8PA 4NLGA 2AIRB 3MOZA 3B78A 2QC3A 2YX7A 3A8IA 2IBKA 3VGVA 4K5SA 2FYXA 2QA2A 1JLQB 4EBEA 2KXFA 3M2RB 5CZXA 4DUZF 1CLFA 4UOHA 2VC1A 4I7FA 4NI2A 1TR0A 4NLVA 1S1UB 3OR1A 2E44A 1B4SA 2HMIA 4QWEA 4DLGA 4PXCA 4LFAF 4MT1A 5F8LA 2F9JA 5L46A 4XAKA 3FNNA 4C11A 1GMWA 1N34F 2VICA 3MMBB 4ZVEA 2XLIA 3TNVA 4I0WA 3DHXA 1N36J 3UCZP 3W64A 3IN5A 3BSNA 2I1RA 1C4AA 1IR1A 3J7ZT 3TUPA 4CO0A 1RCXB 3NGDA 2Z0GA 3VVTA 2RQCA 4GC6A 3Q8QB 4L72B 1JNRB 1OMSA 1U0HB 3VGUA 1PG5B 4DF8A 5IWAF 4DPYA 5KG3A 2P5VA 3KJVA 3HZEA 1VK3A 4M94A 4FPRA 4NLPA 4DFPA 5D8HB 1HPZA 2BJDA 4QZVB 2LEBA 3LH2S 3UFCX 4X64F 4ELUA 4USUA 1HHQA 1T9VA 2AJ4A 3DOMB 2W4CA 3C66A 1X7VA 3KLEA 1XMQF 2JL9A 1N54B 3WBZA 2K7JA 1HWUA 2V8GA 4HKQA 4ZCIA 3RW6A 3UN3A 2RT3A 4JI3J 5I3PA 5HBMB 4IQMA 3ADAC 5IT9Y 4QYRA 1K1QA 4OYZA 5LMUJ 3N4WA 2RDJA 3FK4A 3RGIA 5KFPA 2E66A 1IVZA 3QIPA 3TUZC 5G0RB 1FRIA 1PO6A 3CEDA 3RR8A 1QVFR 1S79A 2XZDB 2W4DA 3D2WA 2ZVSA 4YP3A 1H98A 5DGAA 4DV6J 3EPIA 1PC5A 1Q4RA 1TZ0A 3OSPA 1EKSA 3VQTA 1VQ8S 2APOA 1N5SA 1JJHA 4ECRA 4JI2F 4RX6A 4OHWA 1XEZA 2UV8G 2C2EA 4JV5F 2L9DA 4DI6A 4RLEA 4NEYA 3EDRB 5ETVA 4JUZA 2OO4A 2ZH3A 2ZNYA 3SQGA 2QV6A 2K06A 2ZNZA 3CTRA 2AJQA 4GVLA 1DTQB 3QAEA 1S99A 1VMBA 2BRKA 3DXSX 3DDIA 4S0MA 1TKXB 2DCUB 2FPHX 2DO0A 3IBCB 5ETKA 2NZ4A 4K4XA 4DV2F 4KO0A 4FF2A 2VONA 1LWEB 5F8NA 3PR5B 3BYPA 4J9NA 3M9OB 2RQKA 4DWIA 4DSLA 3V4IA 1F0XA 1FRKA 2QO3A 3ZZTA 1M5VC 3UQSA 3N28A 3MCSA 4WTOB 3UDLA 5A6WA 4PPDA 5J1NA 1CULA 1S48A 1M5OC 2ATLA 5DLFA 4TY9A 3IR6B 3MCOA 2CVIA 2E7WA 2FZCB 3ZZ0A 4CO3A 3KG1A 3FEYB 3CT9A 1MN7A 1XNRJ 4NWBA 4YB6A 4C9DA 2DH7A 3S01A 4OI6A 1S57A 3J81Y 2VFTA 4ALZA 3UPFA 1JXVA 3HJFA 1JJ2R 3QZ7A 4LBHA 4TN2A 4IRDA 3SFUA 2GGPA 5E7OB 5LSOA 1C0TA 2RILA 2XMVA 3RJMB 4EFAC 3BZQA 3RRHA 5U47A 1SH2A 3D3BJ 2DO4A 2ZZMA 4E0DA 2WB4A 2Z4PA 1L3SA 4E98A 2H3EB 3VF0B 2MQQA 1VGYA 4ZA1A 2OSRA 4ICLA 1MSWD 1MNEA 4PG7A 2R8IA 3SDEA 2FY8A 2MGZB 3WX8A 1N32F 2VG7B 1FESA 1GEHA 4JV2A 2JVOA 1FX2A 4MIWA 2AEJA 2GVDB 2V4JA 3R7NB 4ECSA 2MPUA 3EJMA 2HPUA 1VRUB 1S97A 4A8YA 1PBUA 2VPXB 1ACMB 2A18A 2HEKA 5KFUA 4KY3A 2UP1A 2BQRA 2MHNA 5T41A 5DETA 3Q0AA 4IG3A 1SPBP 4HLBA 4LF5J 2GIQA 5GMKa 3LW5C 4USKA 4LREA 2E5JA 4B3RF 1Y0HA 2QYGA 4KAIA 1CJTB 2XGPA 4DX8H 4ZJOA 1S9GB 1Q7YT 4MH8A 2VDIA 5I4MA 4DSKA 4LBPA 1ZM9A 1T05B 1SQFA 1FRMA 4URQU 4QIGA 4A4JA 1HW9A 3MM7A 4ZLPA 4M95A 1U8WA 3T3FA 3R6LB 2WONB 4U96A 1NH7A 2F7VA 2QMWA 3OL9A 2KJWA 1GMVA 5LM7E 4NZ6A 2FZKB 1K1SA 4OX9F 4EZ6A 3DI6B 2OSQA 5DDOC 1XERA 2DEIA 2HS0A 2JH3A 5DQIA 1HNXJ 5GADI 2QG9B 1O51A 4DSJA 3CDEA 2VV5A 2YKNA 1VIXA 3VCDA 1CPZA 2DHHA 1FRLA 5AJ3J 4CH1A 3DGPB 1LWCB 2KT2A 1YX2A 3AFGA 3KDNA 4P9SA 2CPIA 4RW6A 3M8RA 2ZH1A 4ZITA 3G2XA 2V2KA 1TK8A 3BBBA 3OVBA 2IAJB 2AU0A 3QAUA 3HHLB 3CD7A 4W4MA 2G2YA 2R9LA 2XMMA 1LOUA 2R7SA 3U02A 3DU6A 2OEJA 4I69A 2VFRA 3PW7A 4M5DA 3DM2A 3P49B 5JVHQ 1NRKA 2AYBA 2HQGA 1S9FA 5HQLA 1KOOA 2GX8A 1ZS6A 2FTRA 3PEHA 3OXLA 1PBAA 2KFYA 2QN6B 1HBMB 5BJRA 3K5MA 2L48A 3D3CJ 2MLYA 2BANA 1RK8A 3TAMB 1WELA 2B6AB 4BWJA 5GAHI 2EFVA 3Q23A 4YHHJ 4ID5B 2HVZA 5B0AA 1FXRA 1RADB 5IT4A 4YB7A 1BQNB 4WXOA 2OJ3A 1E6YA 4LF4J 2LA6A 4FF1A 1MWQA 1M5HA 2EG1A 1TKTA 2ASJA 4RW9B 1K0TA 3MMAA 3QT5A 2EFGA 3PRVA 2B5JA 3BGLA 3Q8VA 3MUTP 2CXEA 2QGFB 3TO8A 1PIEA 2YX1A 4PG5A 4PZVA 5CYMA 2CQCA 2FHMA 1X4BA 1QE1B 3HF5A 3BR8A 1GX5A 3Q89A 1HBUB 3GYXB 4P52A 2BM1A 3OSNA 4DR1J 4O0IA 3BF4A 4RJVA 5GMEA 3LP1A 2R4FA 4DV5F 4ED3A 5AE3A 1SKRA 3R7BB 3OFFA 4AXJA 1A7GE 4JI6F 2Y8WA 1Q8BA 2O5DA 2B7CB 5IOLA 3GE9A 4C3MA 1Q8IA 1FFGB 3U1LA 4USWA 3ETOA 4Q45A 2HBRB 5J2NA 4CYUB 2DYAA 3CCWA 3V2UC 4RNMA 4OHXA 4F3MA 4CLYA 2RS8A 2XYGB 2IDEA 5C42B 3HO1A 2G1HA 4USIA 4AD6A 1RTZA 1IUJA 1UZHA 3F41A 5J2PB 1CS4B 3KK2B 3C19A 4X65J 5HQ8A 2FQQB 1FKPA 4G65A 4KFBA 2P9EA 3A3OB 2Y9HA 3D68A 2ZJPQ 3BQ0A 1KONA 5KFQA 4FNIA 4M8LA 5AE1A 3SYZA 3CIMA 1DLOB 1FTRA 4ED4A 2QL9B 2UUWA 5KT4A 1RHQB 2W2OP 4LRDA 1ZTWA 2DPIA 2RHSB 4KT0C 2AYMA 3G82A 1QUVA 3X3UA 1HQEB 3R9LA 3DNCA 4LF9F 2FJVA 2GC8A 3L95X 1ICEB 1KQFB 1RYRA 2ZBQA 3NEKA 2OMLA 3M8PB 5LXRA 4LF7F 4CM2A 1H3DA 2HAFA 1K8AT 1T11A 4WFNQ 2O66A 3PYDA 4QIFA 3L7OA 4LRCA 4R0EA 4PRFA 3EVOA 2BM0A 3ENQA 2KT3A 4B9TA 5M2PA 1KLNA 5ETTA 2IC3A 3US5A 5DLGA 2XG8A 4NI2B 3OR1B 1HBNA 3NGUA 2HMIB 2CIMA 2BE2A 4ED8A 3TZWA 3T5JA 2M8HA 3O8WA 1S6QA 2RUGA 3FRYA 2MKCA 4DSFA 4DF4A 3H42A 4ECYA 3TZZA 2HZVA 1S7HA 3AAWB 4ZN3A 2NZCA 2UUCJ 1WHYA 1TVRA 4C11B 1IBMJ 4O4RA 1OWXA 4OV6A 4DR5F 1QVGR 3OTEA 3PX6A 2AEMA 3BEGB 2B51A 4DR4J 3FSXA 3FMBA 4USVA 3RTVA 2VFVA 4JYAF 3D66A 2I6WA 1KC8T 3LF0A 1B7FA 2BX6A 5HP1B 2JHEA 3R2DJ 3VAKA 3TX8A 1B70B 4DV4J 3DLEB 4ZJLA 3KJVB 4KHRA 2PC6A 4Z2XA 3HK2A 5IM0A 3ZXWA 3M4XA 1F9HA 4K50A 3HD1A 3C8YA 5L1LA 1OSDA 3UCUP 3SEOA 3V6JA 3I87A 1LK5A 3TAQA 4OZJA 4B9MA 3KLEB 2H9ZA 2MY8A 1SQEA 3ULHA 5F8JA 2CNLB 3JTPA 2UUBF 2CQDA 3JQMA 3DRRA 2L9WA 2IYIA 1HQUA 2IMWP 5B0FA 3MAHA 1GAOA 2B8PA 5KG6A 3JQJA 2OPSA 3M9NB 3QIPB 3KLGA 4GC7A 3QGIA 4JI8J 1WG1A 2R7TA 2QSFA 3HLUA 2WK4A 5AE2A 3V4MA 3UD4P 4CWBA 1MW7A 1OQ6A 2X7IA 3C16A 3M1VA 5E3QA 1XR5A 1SXLA 2N3OA 2MYFA 2DBBA 2C3PA 5C5JA 1A9NB 2CQ4A 5AXMA 3HDSA 3IA0A 5D0RA 2B3TB 2MQNA 2C2MB 3SQGB 1J5EF 2FHOB 2DGTA 3W62A 1U8SA 1NK0A 4OX8A 3MR3A 2CQHA 1A6LA 3SCKE 2HNDA 1NK6A 1ZM4A 3MURP 3UNGC 4DFKA 4TXSA 2N7YA 1V3SA 1F9FA 1FRHA 3DKDA 4KO0B 2W01A 2CQ0A 3FCWA 1N88A 2MQ8A 4RNHA 2V8DA 3QO9A 5DG8A 3V4IB 3PXGa 1NK7A 2B9YA 3L4BC 4K4SA 2XM3A 4J9LA 5LSRA 3T5KA 2VOOA 3VQSA 4KIAA 4LMZA 3GV7B 4L74A 3TX0A 5J2QB 3OUYA 2QLFB 3P96A 2ZH7A 1CULB 4O23A 1SKWA 3GJRB 4ZPCA 1S6PA 3T9ZA 4KV8A 1N5QA 3RB6A 4F4AA 4LFCF 2JSXA 5E2QA 5J1PA 1TV6A 1UFWA 2ZFHA 1ELOA 1QM9A 1K0VA 1H38A 3GWCA 2KG0A 1T0TV 2JX2A 2EC2A 5IFMA 1NSAA 3AODA 3PFOA 2GGPB 3CVKA 4FYWB 2E5LF 4KGZB 2PN6A 4J7CA 5D78A 2FZGB 1HNIB 1RWUA 2Q43A 3WX4A 2RAQA 4BHQA 2XYPB 2F8MA 2FJDB 3QT6A 4K4VA 3SCJE 3DMJA 3GV8B 3JTNA 2OGUA 1RTJA 2MKHA 3K59A 1U1RA 3TANA 1X9WA 3FBEA 4LR8A 4O3RA 4ICLB 1IJEB 1UL3A 1UPMB 1W26A 4K7QA 3SDEB 2OELA 3PJ9A 3EXYA 1X31C 1OY6A 5IC4B 3CCTA 2WOMB 2BEFA 1JLFA 2WBRA 3H20A 2W1BA 4ECUA 2V4JB 2QLWA 3R1HA 4IFYA 5KG0A 2NUHA 1WF0A 5KFXA 4M63A 1T3NA 1QUPA 1C0UA 3U1MA 3CCSS 3CJSA 4UTGA 4LQ3A 4IG3B 3CF5Q 2CWXA 2XZTB 2V68A 3LA0A 2EKYA 2V2VA 1NNDA 4M5NA 2GIRA 2LFVA 4MJKA 4LF8F 2HVDA 1XTZA 3W5ZA 3NNCA 1PYTA 3BGOP 4A46A 4C8OA 2J6TA 2DGXA 2HFVA 4MTPA 3C14A 1JLGA 2DIVA 3HFKA 1Y3JA 2K3IA 3CD6S 8RUCA 3UN2A 5DQHA 3P6YC 3KHHA 4KPYA 3ZZOA 4ZVHA 2ZUAA 2W8KA 1SJFA 1MN9A 4ECZA 2UVVA 5BYRA 4LUBA 5LXYA 2ZH5A 2N7CA 2DHGA 3RB4A 1SC4B 4D3GA 2YKNB 2GHWA 3T1YJ 1HL6A 3PKMA 4B3TF 4O3QA 2A1BA 5ITHA 3FBBA 2HHXA 4OI2A 4ZP7A 3TA2A 1IR2A 2RIJA 4RW6B 1XR6A 3KHRA 2AJ1A 4LSNB 3NAHA 2X3DA 3DRPA 3U27A 3EGWB 4DR7F 3N6LA 4UT4A 5E41A 3UCGA 2QT7A 3LOUA 5LT5A 1Y00A 4M5DB 4KB7A 4EBCA 4QW9A 4CP5A 4LVNP 4WFBQ 1RB0A 3QJLA 2QZ8A 3BREA 3GCWP 3JSBA 3MHYA 3KNGA 2GV1A 3WHIA 3CCUS 4ZP9A 5M2RA 4X62F 1WSRA 4K4WA 4O44A 5KFEA 2F8HA 3M8WA 1S6UA 4X2BA 1FVSA 4WYWA 5LSLA 1E6YB 1AYEA 4B3SJ 2Z2ZA 1ITPA 1N56A 4CIOA 1TKTB 4MIBA 2F65A 4JI7J 3SSRA 3OLAA 4OMFG 1VQLS 1B3TA 3MMCA 4J37A 5KFSA 2B5JB 1NXIA 2XZWA 2KM8B 3W9IA 3NKYA 3OQ2A 5CYMB 3CSKA 3LP0B 4NLOA 2CQ2A 3PZPA 1T94A 2R7RA 5LL6d 5KFWA 1JMTA 1VCTA 2PSZA 5ETMA 4NCBA 3GIMA 2CFXA 3MFHA 5HMXA 3MPDA 3NOGA 2RS2A 1NM2A 3DRSA 4J9SA 1UVIA 1GXUA 4YOEA 1FCAA 3GQCA 3H5UA 4ILLA 2WVDA 3LP1B 2HIYA 2Z56B 4CLKA 3ZTOA
chains in the Genus database with same CATH topology
5D77A 2IVYA 2Q79A 3N5FA 1SL0A 2W7PA 4QOTA 5KFBA 4CT8A 1KFDA 3IXQA 2Z2MA 4G1QB 4F26A 1UVMA 2K3KA 3DOLA 4AL5A 5KFGA 3OXGA 1YHQS 3D0GE 2PMZD 4B9VA 2UUCF 2XMUA 1TL1A 1WF1A 2PEHA 3UWTA 2OAUA 3R27A 3TAPA 1MROB 2LA4A 1S6OA 2V9KA 5J2NB 4DV3F 2YTCA 2EK6A 2IJFA 2LMIA 4JI4F 2IFXA 3CJ5A 2BACA 1S77D 4HDHA 1NO8A 1Q8LA 5K8MA 2AWZA 1MMLA 1C1CA 1CEZA 1DTTA 2LECA 2EI5A 3O6QA 1XC9A 4CH7A 4UW2A 4CO2A 3K5LA 4AL7A 1ZBTA 1FKAF 3S7RA 1VI7A 3KK3A 3RBEA 2IM3A 5J2PA 1GQEA 4Y2MA 1Y3KA 2BRLA 3KK2A 2ZKUA 3H59A 4W90B 2VQEF 3QJJA 1HMVB 3LAKA 4N56A 3MF5A 1R6YA 2DK2A 5DS7A 5CXTA 5EHHA 1S1WB 4OZ0A 5L9XA 2KH9A 2XS2A 1BQMB 2DNKA 4YDDB 1VRTA 4J9RA 2R7XA 3KG0A 2JLFA 1P9QC 3RRKA 3CJ0A 2B4OA 4CTAB 1QTMA 4DS5A 1R8BA 1H0HB 1U6BA 1Q7LB 5D4LA 5MLCV 3N5BA 4ZPBA 3FMWA 3R5CA 4RUCA 4ED7A 4LQ9A 4N41A 2UVRA 5I3QA 4J9QA 2E9RX 3Q8PB 4KFBB 4OV1A 1IN0A 3K2YA 1VC0A 1D9AA 4MKBA 2RU3A 3HVTA 4NZ0A 3C2PA 4Y6IA 2VG6A 3V6KA 4OI1A 2BR0A 2J7WA 5K9FA 1QSYA 2HW3A 1X4DA 4ED2A 3CC7S 3BDPA 5F3ZA 4IR1A 2IRYA 3MOJB 1DLOA 1V6HA 1FK9A 2L41A 1GXTA 2K8GA 3OBIA 4ES3A 3SV3A 2RQ4A 1D0EA 2UUTA 3IC1A 4ZHRA 4MKYA 4IG0B 3KLFB 1R89A 2FHKA 4ZCLA 2DHSA 3RAQA 2CPZA 1AW0A 3MECB 1HQEA 2V8HA 4K59A 1HWLA 3CCRS 2LKZA 3DRYA 2KYXA 2HGNA 2MY7A 3TARA 4ILMA 3T1HF 2XY7A 1TKZB 3ZZPA 4QCLA 2ZJQQ 1FKOA 4FZVA 1U47A 2ZHOA 1ZAXA 2IM2A 3BS9A 4I6YA 3HVRA 1DBDA 1YVFA 2E1MC 2PD1A 4JV0A 3SMZA 2PFFB 2MJNA 4I2PB 4RBTA 4PPZA 2MQOA 3C6UB 5KT5A 3NBPB 2XSFA 3M8PA 4NLGA 1MWZA 2OPPA 2VB6A 4LJMA 3X1LB 2JC0A 3MOZA 2W9BA 3D0IE 3C6TB 3B78A 3T5HA 1UWBA 1DZ5A 1OQ3A 5DQGA 2JDJA 4ETZA 2YX7A 4LSNA 2HGMA 3BM7A 2IBKA 4K5SA 1RT6B 1U4BA 2QA2A 2CQGA 1HD0A 1JLQB 4IUFA 4EBEA 2BQ3A 2KXFA 3VAIA 1HNZF 3M2RB 2AJFE 3CCMS 1RTIA 1ROFA 2ZD1A 2WW8A 2NPIA 2VOPA 1B0TA 5CZXA 4DUZF 2FVSA 2DNYA 4YMEA 1CLFA 3NCQA 1U49A 4TU7A 3V5RA 1WHVA 2VC1A 3I96A 4LF6F 5HROA 2MZQA 4I7FA 1TR0A 4Y2KA 4URGA 4X66F 2AGPA 4NLVA 4C0BA 5A8KA 1S1UB 3OR1A 3O5TB 2E44A 1BQXA 2KJVA 4X4PA 1KVIA