2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
4O3OA 5C25B 2QV6A 1HMVB 4R8UB 3Q8QB 3OL6A 3G6YA 3EPIA 4IR9A 2I5JA 1S6PA 5J1EA 1FKOB 1JLBA 1HNVA 1RT6B 1T05B 1RT2B 3QO9B 3FDSA 4NLYA 4NLVA 4RNOA 4K4VA 1C1BA 5C42A 3T5JA 2IBKA 3GV7B 2HNDA 3MF5A 3KLHA 2VA2A 1RYSA 3LP0A 3BSAA 1N6QB 5KG6A 4QPXA 4RW4A 4ZHRA 3I5AA 3BGRB 3DLEA 3RB6A 5KT5A 1S6QA 1HQEB 5K14A 1LWEA 5DLGA 1HPZA 2WONA 4KFBB 4JUZA 3GIKA 4I2QB 1SH3A 4EYHB 1S48A 2FVSA 4ECRA 2D3ZA 5KFMA 5KFPA 3CWJA 1JXLA 2C2DA 1LWCB 4KO0A 4MKAA 5L1KA 4LSLB 3LALA 2IA6A 4MIBA 4NLWA 2AU0A 4IG0A 3CDEA 2ZD1A 3QLHA 2IC3A 4Q0BA 1RTJB 4KE5A 4WZQA 2D7SA 4WE1A 4O3PA 5J2MB 5I42B 5J2QA 1XR7A 1EETB 4NLOA 1FKPA 1HNVB 4O44B 4ZP6A 4WYWA 4KBIA 2B5JB 3E01A 1R0AA 5KFFA 2YNIB 1SUQA 1ZTTA 3DMJB 2VG7B 1HYSA 1WNEA 4K4YA 3KLIA 4O4RA 1RT5A 2XI3A 1RT4B 3MEGA 4PQUB 5EWEA 1N5YA 4H4MB 4Y34A 3KMQA 2XC9A 3M9NB 2ZE2A 2WTFA 1TV6A 1S9GA 3HHKA 4YP3A 4RW9A 3CIZA 1RAJA 3PW5A 1QAIA 3V6JA 4IKAA 2D3UA 3H59A 3H2LA 3FQKA 3BJYA 4RW7B 4XPCA 3KK3B 1MU2A 3KLEB 1NNDA 1JLFA 1W25A 2F8EX 1S10A 2ASDA 3BSCA 4QW8A 3QZ7A 4LQ9A 5KG3A 2ILYA 4IG3A 5KG5A 2AGPA 1HNIB 2XI2A 4M95A 4URQU 3I5CA 5KG0A 4TY9A 5KFUA 4RW6B 3KLFB 1T03A 2OPPB 1JLQB 4DL5A 1S0MA 1S1VA 5CYQA 1N5YB 2BANA 2FLLA 1TL1A 1VRTB 1UWBA 2BQ3A 2BQRA 2ZE2B 2XGPA 5KFYA 2W9BB 4TQSA 2YKNB 3BSOA 3N6LA 3UR0A 4RW9B 3FRZA 3HVTB 1S1TA 4NLTA 5DG9A 4F4WA 2AWZA 4FS1A 4WFXA 3D28A 4QWEA 2YKMB 1SV5B 2XGQA 3ITHA 2DPIA 3IN5A 1MU2B 1NHUA 4ZPBA 3MEDB 1JX4A 4IG3B 1C2PA 3IG1B 4MFBA 4ID5B 4MK7A 3T5LA 2IAJB 4B3OB 1TVRB 2GIRA 3T19A 2VG6A 3CDUA 1NHVA 4O3QA 1TQLA 5KFHA 1BQMB 1LW2A 5CYMB 4PUOB 4YMEA 4IQXA 3QZ8A 4TXSA 5KT3A 1TKXA 3DYAA 4IFYA 5KFEA 4JV2A 4K4UA 4ED6A 4IR1A 4ED8A 4WYLA 4FBTA 1HARA 5J2PA 2WB4A 3LP2A 1IKYB 3NMAA 2R2UA 3HKWA 5KFIA 4Q8EA 3PHEA 5KFCA 4ED1A 2C28A 4KV8A 5F8NA 4KHMA 4LSNB 3EPGA 3DOLB 1S1WA 1GX6A 1RTHB 1RT3A 2W9AA 2XCPA 2R2RA 4NLQA 2JLEA 4ECVA 4XPEA 2FVCA 4MIAA 5EWFA 2HNZB 5C25A 1C0TB 1HMVA 1LWFB 4R8UA 2UVRA 2HNYB 1QUVA 3SI8A 1RT6A 1T05A 3NGDA 1RT2A 3QO9A 5F8IA 4ZP8A 3DYAB 1SH0A 5KFBA 2YNGB 1SH2A 4ZP7A 5KFRA 1S49A 2YNHB 3NL0A 4ECYA 1I6JA 1N6QA 4HKQA 3H5YA 2ASLA 4NRTA 3BGRA 4K4SA 4QWDA 1HQEA 4KFBA 4ECSA 2ILZA 1S1WB 2WOMB 4I2QA 3JYTB 2HWHA 5KFGA 3OLBA 2XCAA 4EYIB 4IRDA 3FQLA 1LWCA 4LSLA 3DDKA 4J9RA 2RKIB 2AX0A 3ICLA 3MR3A 1T94A 4G1QB 5DQIA 3V4IB 1RTJA 4RW8B 5L1JA 2VA3A 3NBPB 4KKOB 5KT4A 1S0NA 4NLGA 2E9RX 5J2MA 5I42A 1U09A 3QGGA 4KHRA 1EETA 2R8GA 4O44A 5DQHA 1RT7B 1TKTB 3PR5B 2B5JA 3CJ4A 3KOAA 4YR3A 2YNIA 4RNHA 4IH7A 3DMJA 1REVB 2VG7A 5KFTA 4RNFA 3M9MB 5KG7A 2JEGA 1DTTB 2JEIA 1RT4A 1IKWB 4PQUA 4FS2A 2OPSB 4RNNA 2C2EA 4H4MA 3OSNA 3DLKB 2J6SA 1K1QA 1JKHB 3H5UA 2FJXA 4NRUA 1QAJA 1K1SA 1JLCB 1Z4UA 5F8HA 2I1RA 1C0UA 4NLSA 3PW2A 4U7CA 3G6VA 4MKBA 4RW7A 3KK3A 4NLXA 3UDLA 3KLEA 4O3NA 3OHBA 4O3RA 4K50A 4QW9A 4ZPDA 2R2TA 5L1LA 4NYZA 5HBMB 1HNIA 1RT1B 3PJWA 2W8KA 4M94A 5KG4A 5D3GB 3RB3A 4MK9A 4DL6A 4RW6A 3KLFA 4IDKB 2OPPA 1JLQA 2HWIA 4DL3A 4ECZA 1YVFA 2AGOA 4J9SA 5C5JA 5EWGA 1VRTA 2UUWA 3CVKA 4ZVEA 3NAIA 4F50A 3OL9A 2UVUA 4O4GB 4MK8A 3CJ2A 2W9BA 3I0SB 2YKNA 3OL7A 2UVVA 2WK4A 3HVTA 3GIMA 1TL3B 1JLAA 1S9EB 4EBCA 4YQWA 1J5OB 5DGBA 1C0UB 2YKMA 4TYBA 1SV5A 2IM2A 3I5BA 1ZTWA 3DM2B 5F9NA 3MEDA 5JXSA 5KFZA 4EBEA 3KK2B 4K4ZA 3IG1A 5HP1B 3H5SA 4ID5A 2IJNA 3D5MA 3CDWA 1S1XB 2IAJA 1TVRA 4H4OB 4B3OA 4J9LA 1CSJA 4RZRA 5FDLB 4ECWA 3H5XA 2QE5A 4ECTA 1BQMA 3T1AA 5KFSA 5CYMA 3I0RB 4PUOA 4QWCA 2OPQB 3KHRA 4DL2A 3CO9A 4IRKA 3MEEA 2DPJA 1IKYA 4RNMA 1EP4B 1JLAB 2JEFA 5KFVA 4LSNA 3GV8B 1MMLA 4ICLB 2FJVA 3DOLA 3G86A 3V81B 3OHAA 5C24B 1RTHA 4WFZA 3IRXB 3M8QB 3T5KA 3LANA 3LP1B 3KK1B 2BRKA 1HQUB 2O5DA 3C6TB 3Q8SB 2HMIB 3PVXA 4URGA 3BREA 2R8KA 4ED0A 2HNZA 3PJXA 1C0TA 1LWFA 2B43A 4X2BA 2HNYA 3BQ1A 3PZPA 5KFDA 1KHVA 3MECB 4F4ZA 3MEEB 4Y3CA 1S1UB 2YNGA 4MH8A 3KHHA 2YNHA 1IM4A 4EBDA 3IS9B 3QIPB 2V0NA 3RBEA 4JV1A 4EO8A 1KHWA 4YR2A 1JLEB 1LW0A 2R8JA 2WOMA 3JYTA 1S9FA 4R5PA 2FJWA 2YNFB 2CJQA 4TY8B 5KFQA 3KLGB 2IMWP 5KFAA 3GILA 1XR6A 3CJ0A 5F8LA 1RTIB 5KFOA 2RKIA 2R8HA 3H4BA 1S97A 2FLNA 5KG1A 2W9CA 4U6PA 4Y2AA 4G1QA 4EO6A 3V4IA 4RW8A 3NBPA 1DLOB 4KKOA 1IKVB 5J2NB 2GC8A 3CJ3A 3NKYA 3UQSA 5F8GA 4IOBA 3Q8PB 3JSMB 2FVRA 3QIDA 4Q44A 4G3IA 4DG1B 4GC7A 1RT7A 1TKTA 3RAXA 5F8JA 4Y2CA 3SFGA 1RTDB 4DEZA 1REVA 4DL4A 2IM1A 3DRRB 5HLFB 4ECXA 1DTTA 1IKWA 1C1CB 2OPSA 5L9XA 3RBDA 1BQNB 4RUCA 3E51A 3DLKA 3MFHA 1LW0B 2W7PA 3IGNA 1JKHA 3KJVB 4R5PB 3QYYA 3FSIA 1TKZA 3FFIB 3BQ0A 1JLCA 4ZPCA 1RYRA 3GV5B 3GQCA 4H54A 5F9LA 4ECUA 2W9CB 3GIJA 4QWAA 4ZVFA 3TVKA 2R8IA 3N6NA 3PR4A 1XR5A 2R2SA 2WCXA 5HBMA 4Q8FA 1RT1A 3V6DB 1QE1B 5KFXA 5D3GA 3H98A 3DRPB 3DRSB 1ZETA 4IDKA 2C2RA 5T14A 4WZMA 1KLMB 2CKWA 4JV0A 5KFWA 3DI6B 2VG5B 2E9ZA 4ZPAA 4O4GA 2UUTA 5DG8A 3RB4A 3TAMB 3I0SA 1TKZB 2WHOA 1DTQB 3ISNC 4O3SA 2V4RA 1TL3A 2V9WA 1S9EA 2BQUA 4URSA 3GIIA 1J5OA 2JEJA 2C22A 3UPFA 3DLGA 4I7FB 3LAMA 3OLAA 2J6UA 3DM2A 5DQGA 3KK2A 3BQ2A 4NCGB 3DOKB 5HP1A 1JIHA 2IJFA 5KT6A 2ZKUA 1S1XA 5HROB 2IM3A 4H4OA 4WFYA 5FDLA 2V4QA 4I2PB 4PWDB 4J9KA 4ZP9A 4ECQA 3I0RA 3OSPA 2OPQA 2B6AB 4J9PA 4KSEB 2GIQA 3IGVA 1D0EA 1JLGB 3QGHA 1N56A 3SFUA 1IKXB 1OS5A 3VQSA 2BE2B 4ZMMA 5I3UB 2RF2B 1EP4A 1N4LA 2AQ4A 3HVWA 3H40A 1VRUA 3DLGB 4ICLA 2I5JB 1S6PB 5J1EB 5C24A 3V81A 1JLBB 1FK9A 3QGIA 2RDIA 5F8MA 3IRXA 3M8QA 2BRLA 2UVWA 3KK1A 3LP1A 3CJ5A 2BR0A 1C1BB 1HQUA 5C42B 3ISND 4KAIA 3C6TA 4HYKA 2ATLA 5DLFA 3PW4A 2HNDB 2HMIA 3KLHB 3LP0B 3MTKA 4K4XA 4RW4B 4ZHRB 3DLEB 3KMSA 1S6QB 5K14B 1LWEB 3Q8RB 1HPZB 2WONB 2JC1A 3MECA 1GX5A 2RDJA 1S1UA 2FLPA 4KO0B 5KT7A 4GC6A 4ED2A 3C6UA 2OH2A 3IS9A 4IG0B 2ZD1B 3QIPA 2IC3B 3QLHB 4Q0BB 4WE1B 1VRUB 2JC0A 1JLEA 4IH5A 5J2QB 4FBUA 5L1IA 1FKPB 5KFNA 1FK9B 2YNFA 4TY8A 5KFJA 1N48A 3KLGA 3BSNA 2EC0A 4WXOA 3E01B 1R0AB 1SUQB 2OPRA 3PW7A 1RTIA 1HYSB 2E9TA 3KLIB 4LQ3A 3N6MA 1RT5B 4Q45A 3MEGB 1DLOA 5KFKA 1IKVA 5J2NA 4NLPA 1D1UA 4NLRA 5EUHA 3KNAA 3GYNA 3JSMA 4DG1A 4J9QA 1TV6B 1RDRA 3MFIA 4ZVGA 1S9GB 4R0EA 1RTDA 2XWYA 4ZVHA 4K4WA 4WXWA 3DRRA 5HLFA 4NLUA 4XO0A 3C6UB 5KFLA 1TP7A 1S0OA 2J6TA 4RU9A 1C1CA 1T3NA 4Q43A 1BQNA 1RA6A 4QWBA 3M9OB 4IH6A 1JLFB 3EZUA 5DG7A 3KJVA 4OL8A 4F4YA 4J9OA 3FFIA 2WRMA 4KB7A 2OPRB 4YR0A 1T03B 4IFVA 3RB0A 1S1VB 5CYQB 1RA7A 1S4FA 2BANB 4TQRA 3MR6A 2W7OA 1TL1B 1UWBB 3V6DA 1QE1A 5JUMA 4J9MA 3M8PA 3KLVA 3DRPA 3DRSA 1S1TB 3V6KA 2AX1A 1KLMA 3PW0A 3MR5A 3DI6A 4TN2A 3TQ1A 2VG5A 3ITHB 5KT2A 4EEYA 4J9NA 3HVAA 2FVQA 4MFBB 3TAMA 2IM0A 1DTQA 2ASJA 2W8LA 2VG6B 2D41A 5DGAA 4IFVB 2HAIA 5KG2A 3LAKA 1LW2B 4IRCA 4I7FA 3H4DA 1FKOA 2AGQA 4NZ0A 1TKXB 4IFYB 3NAHA 4ED3A 4NCGA 3DOKA 5EDWA 5J2PB 4TLRA 3LP2B 5HROA 4K4TA 3KHGA 3M8PB 2FVPA 4I2PA 4PWDA 3G6XA 4KV8B 4DL7A 4NLDA 3KHLA 4RUAA 2B6AA 3RAQA 3OL8A 4TYAA 2ALZA 1RT3B 1JLGA 3BR9A 4F4XA 1IKXA 4ED7A 2BE2A 5I3UA 3V6HA 2RF2A 3T5HA 3MR2A
chains in the Genus database with same CATH superfamily
3Q8QB 1LNQA 2W2PP 3HVRA 1HNVA 1JXVA 4O23A 1RJJA 1RYSA 1N6QB 5KG6A 5K14A 5DLGA 4KFBB 4JUZA 1WKJA 4I2QB 4AL5A 2QL7B 2KT2A 1E6YB 3ELHA 2IC3A 1R7IA 2BACA 3W61A 1YGYA 1ZTTA 5GVQA 2MZQA 4DSKA 4ZVRB 2BABA 2JOQA 2PGCA 2J0XA 1J5EJ 3QNWB 5B08A 2DNGA 1YJ7A 5LM7E 4RW9A 1FRLA 5FLXY 1H7XA 2KHDA 1S0MA 1QY7A 3CCUS 1X8DA 3B78A 1U49A 3D28A 2AYBA 3MEDB 1NB7A 1F5BA 1KVIA 4MK7A 2WAQD 1DY3A 2DGWA 2OHDA 2DITA 3LP2A 1S79A 3P5BP 5A8RA 3EPGA 1HBOA 5LJ5Y 4DU8A 3JXOA 1BE4A 1WTBA 3N5FA 3J80U 3MUVP 4ZP8A 2O66A 3CDAA 3OR1A 3HO1A 2DHXA 1T94A 2LEBA 1HNZF 1IJEB 2EWHA 5KFTA 2R7RA 3VQTA 4D3GA 4ALZA 4RNNA 3OD2A 2MZJA 2Y8YA 3HHLD 4J90A 3TANA 1HNWJ 2CQCA 5ETLA 3KK3A 1QAYA 5I4MA 2MGZA 3FBEA 3A8EA 1MSWD 5HBMB 3KUHA 2KI2A 4MK9A 2HWIA 4XDCA 3VVUA 2CQ3A 1VRTA 5HQLA 5DM7Q 1YJWS 4JYAJ 4EBCA 4M5GA 4NXNJ 1V5IB 1VMBA 1UKUA 2PD1A 4I6WA 4JI3J 4X66J 1BY9A 4DV0F 3RW7A 5FDLB 2WW8A 1R8BA 4RWWA 1Q95G 2DPJA 3SCKE 3SDEB 1XN9A 4BWMA 4QR1A 2FJAB 1MMLA 1WACA 4RUHA 1NKEA 1X9MA 4CT9A 1IR2A 1FD2A 3BREA 4ILMA 2IYGA 2MQLA 1IJFB 1HD0A 2YNGA 3MM7B 5D15A 4C2MA 5IS2A 5IV4A 1I3OB 4FF2A 2RRNA 4YN3B 5KFQA 1RTIB 1UZDA 2W9CA 1HW9A 4RW8A 3BKUA 2RNEA 5J2NB 1Q8BA 2CWXA 4IOBA 4U96A 3JSYA 4K2XA 2M4MA 5HLFB 3R3TA 1DTTA 2OPSA 4N8OA 2QMUB 4LF7J 1OWXA 3ILOA 2KRRA 3W5XA 2GMHA 1YTYA 1JNZB 1ZS6A 3TVKA 5CA5A 1MNEA 4C48A 3E2EA 2PMZD 5KFXA 4DCJB 2ZWPA 3UCGA 1ZETA 3Q8UA 5KFWA 1CG2A 3BEGB 2BQUA 5ETVA 3D3BJ 3PJ9A 1IBKF 3OLAA 1SC6A 3DM2A 3BQ2A 2ZBRA 3MD1A 2G0JA 4PWDB 3HSZA 3EUNA 2YQ3A 1HWIA 2XEXA 3QJPA 5D0GA 1EP4A 1M5OC 4DV2J 1IBLF 2P5VA 3X1LB 3C6TA 2ATLA 1NXIA 4OJGA 2UUCF 3P96A 3PCOB 4CTAB 2DCUB 4OMFG 2CPYA 1SUQB 1S7IA 4Q45A 1D1UA 1F9EB 3CJ8A 4ZVGA 3I96A 1E6VA 4K4WA 4NLUA 1N34F 3C6UB 1T3NA 1C1CA 3OJSA 1JJHA 5EX0A 4C8YA 2QZ8A 2RJZA 2P9EA 1B4SA 4WPAA 3QT5A 2Q3PA 5A2QU 3CXCR 2QYCA 3Q83A 2FVQA 4P2XA 4ZCKA 2W8LA 4IFVB 1RCXB 3NAHA 2LCWA 3M6UA 1KOOA 3O1LA 5I3PA 3ZZRA 4CNYA 1OIAA 3OXFA 2RF2A 2ZBIA 4AD6A 2BM0A 2NXCA 4GO7X 4OYZA 3GV7B 2DNRA 3CCZA 2IFXA 2MHEA 4EYHB 4DR7F 3KDNA 3ILIA 4MKAA 3DXBA 2DTJA 1G2EA 5J2QA 1FKPA 5H1SV 3Q0AA 2JRSA 2HW3A 1N5YA 5LL6d 1GMUA 2ZE2A 3QSIA 1NK7A 1S9GA 2V2KA 5B0CA 3H59A 3T9ZA 4LRFA 1HNIB 3C3LA 1T03A 2UXDJ 1WF2A 4PWUA 2BANA 2YQ1A 4LR8A 3UR0A 4F4WA 1OSCA 3RTVA 4UY85 1XMQF 1CPZA 1VI7A 4UOHA 1NHUA 3K17A 3ZTOA 2XZTB 2IAJB 2B4OA 1LW2A 2XLIA 2QC3A 2OFGX 5HMXA 5KFIA 3GJQB 5HAOA 4P2SA 2KVQE 3D6HB 1SXLA 4XAKA 4MIAA 3CD6S 1X4DA 1S49A 2YNHB 3NL0A 3H5YA 2ASLA 1S1WB 2G2OA 2B7CB 3OLBA 2BOPA 4LSLA 3JQMA 4KY3A 2RAQA 1F60B 5KT4A 3ENAA 4TLQA 4JI2F 2PSZA 3T9NA 4RNFA 3GZ7A 2GJIA 1P8GA 1IWAA 2GAGC 1RLDA 1K1SA 2ZHAA 4USWA 3WX8A 1FHTA 3VR1A 3RW6A 4M94A 5KG4A 3DLBA 3PY8A 2DNYA 1FFSB 5IT0A 2A0FB 1UEUA 1YRXA 3HVTA 2NCKL 2A10A 4KR0B 4UOCA 4C97A 4PUOA 4J5OA 2AJQA 5HATA 1KC8T 2NZ4A 2ZUAA 1IKYA 4K2JA 2BJ9A 1P27B 5L38A 2KXNB 1WG4A 3V81B 2LYVA 2MY7A 4MJKA 3LANA 5LOQA 3D3CJ 1C0TA 1HI1A 2B43A 3MEEB 4Y3CA 3MZIA 1OYDA 3K8WA 3IS9B 3DDIA 3FCHA 3NXZA 4NA1A 2XMKA 2E1CA 1MMNA 3GILA 2KYXA 2HBZB 4ZIWA 2LFVA 2IVMA 5ETTA 2H5IB 3QRRA 1OY8A 2VASA 2W2NP 3UE2A 2WVEA 1NM2A 1L3UA 1X4AA 2ROPA 1K47A 2E7VA 1KSPA 4X4OA 2LDIA 1EQMA 4YDXA 1RT1A 5AXKA 2QA4G 3DRPB 4CO3A 4O4GA 1RHMB 2AF6A 1TL3A 2V9WA 3W7BA 1M1HA 3LAMA 3G2XA 2FJEB 4DCPB 3A3OB 3GR1A 4R0JA 1QVFR 1VQ6S 2OPQA 3PM9A 4J9PA 1D0EA 2NXJA 1OS5A 4NXMJ 1H98A 3T1YJ 2VUGA 3BZQA 4N76A 2VPYB 1WC5A 2CNKB 3QRQA 2LP4A 2QRRA 1DQAA 3M8QA 1UJ5A 2HMIA 4DOZA 1NK0A 2XMWA 3MTKA 1OQ6A 1F2GA 1HKAA 3U02A 2IA0A 2EC0A 2X51A 3DLHA 1R8CA 2G0CA 3OT9A 4DV6F 4K0KJ 2LXUA 2RS2A 2L08A 1GTEA 5IOLA 1U6FA 4CLYA 5IT9Y 4WXWA 3DRRA 1KS2A 2H48B 4CO4A 2J6TA 4A8WA 4QWBA 2GS8A 4OL8A 1IWGA 1S4FA 5K8OA 1FA0A 3KLVA 3PW0A 3MR5A 5IWAF 3TQ1A 3AXMA 2NYHA 1MWQA 1IBMF 1UCNA 1SC3B 2W01A 2Y9HA 1YK9A 2J0SD 1VQYA 4OZLA 3HX9A 4TYAA 5HQMA 3PEHA 2F4VF 4TNOA 4NI2A 1ZH5A 4J37A 1U48A 3B8HA 3FDSA 3T5JA 1M1GA 2HNDA 3MF5A 3KLHA 3LP0A 4CIOA 4DR6J 1UFWA 5T41A 1LWEA 1SH3A 3ZXWA 2OAUA 1R0BG 4LF5F 2PA3A 4AXJA 3LALA 3F56A 1RWVB 4HL9A 2LLZA 4WZQA 2VU5A 4TU7A 3WX4A 2MEWA 4NLOA 5GAGU 2MB0B 3MEGA 1Z1ZA 4ZA1A 3C15B 2WTFA 2F9DA 3UD4P 2E1RA 2D3UA 2DO4A 1NH7A 3NS6A 1YRUA 5KG3A 4M95A 1S6UA 2ZNZA 1GK8A 1HBUA 2ATCB 5IV3A 3BSOA 2AWZA 1TR0A 4NEZA 2YKPA 2DPIA 2UV8G 3GG1A 2OD6A 3I4PA 3VZHA 3PDNA 1W2BR 3DYAA 4K4UA 4ED6A 3D67A 4P75A 2R2UA 3M6VA 3RBZA 2OIHA 3OJUA 4ES3A 3CT9A 4L73A 3OV7A 3G8SA 1OY9A 4LF4J 5E3CA 2FDNA 1I6JA 3G8QA 1F6TA 1VJWA 3FRYA 2H1YA 2KRBA 2P2CB 4LVOP 2R8GA 1KQGB 4O44A 3JTPA 2VQEF 5CHCB 1HL6A 2UUAF 2DNMA 1V5VA 3HHNB 2UXCF 2HHSA 4H4MA 3HKZD 4DCOB 1YWXA 2BKPA 1Z4UA 3NS7B 4L3NA 2QL9B 3GWCA 3VAFA 3D0IE 4ZPDA 2Y1IA 4ITSA 3NNAA 3D7SB 2W8KA 1DAXA 2XSJA 4HVZA 1U0HA 5EWGA 1S72S 2UVUA 3W63A 2UXBF 3R5BA 1JLAA 1S9EB 5B0EA 1O51A 4YQWA 2IM2A 3D5MA 1SC1B 1HR0J 3DHWC 4IRKA 2VPWB 4Z37A 1BLUA 2DKOB 3CJRA 1KWMA 2L3MA 4LSNA 2CJBA 2GFFA 5JJBA 3CULA 4S0MA 2WVDA 3EDRB 3TZZA 3W5YA 1KRPA 4M5NA 4JI8J 2CG8A 4KPCA 4RWXA 2P9GA 3MOZA 4JV1A 2FJWA 4AL7A 3G87A 1S97A 2RKIA 2R8HA 3GFXA 3CCWA 4HT5A 3UQSA 2E44A 1AXQA 2FZGB 5IQQA 5BR8J 3HZEA 2GJFA 2MQNA 1U1QA 4PPZA 2XNRA 2VBYA 3IGNA 2BMBA 3QAUA 3FFIB 4FN5A 1RB0A 2BJ7A 4OYXA 2ZUGA 1WC6A 3RU0A 3VGSA 1C4CA 4F02A 1DHMA 2C2RA 3HJFA 3I55S 2L9NA 4PXEA 5L39A 3CJKB 2DHGA 3NCPA 4O3SA 1DTQB 2CVEA 2CJKA 2C3OA 2W24A 5JMNA 1G1XA 5HP1A 1JIHA 3SYZA 1ULRA 2HFZA 3KNGA 3EXYA 2OSQA 3K89A 1XMOJ 2GZOA 2B6AB 3R5AA 4KSEB 2GIQA 4DSJA 2LA4A 2YKAA 1VQ4S 4ILRA 3E3XA 5LT5A 3FBBA 3ET6A 5J1EB 2KZMA 3GJSB 3IRXA 3AD8C 1YHQS 1ZAWA 1WORA 5CYJA 3HFKA 1X4EA 1R6YA 4ANEA 4YOEA 3N5BA 2AJ2A 1HIYA 3HK2A 4PG8A 4QIGA 1VRUB 4C0OC 3MPWA 3Q86A 4WXOA 2MHNA 1SB6A 2HFNA 3SSQA 2MKIA 3JSMA 3D2WA 2A1BA 3W3SA 3W62A 2V94A 3KJFB 2GGPB 3US5A 3VV2B 3MM5B 5LJ3Y 2LKZA 4CLKA 4DR1F 3NCRA 4E8UA 3ETOA 4JI0F 3RRKA 4TN2A 9RUBA 3V5RA 3PRDA 3B4MA 1Q4RA 3ONQA 2IBOA 3CO0P 2BJ3A 2FTRA 2PEBA 3NGUA 5DDRC 4Y0FA 1ZYQA 3HHLA 4CLTA 2FHOB 2AIRB 5M2UA 2BE2A 3AD9C 2C42A 1YJRA 3K58A 3VCDA 3IFEA 1FX2A 3MR2A 1S6PA 3EYZA 2O01C 4X62J 4QU7A 3BGRB 4DR3F 3CJTA 3S1TA 5KFMA 1BWVA 1LWCB 4PG6A 2AU0A 5H9FJ 4U8VA 3M8YA 3WIUA 2CQ4A 1R0CB 1HNVB 2DR8A 1VIXA 4DL0C 3DMJB 3HSGA 3G8TA 2LU1A 3LTOA 2XC9A 3GYXB 3VAJA 1BMQB 2H5EA 4DR5J 3SQOP 3V6JA 3GG0A 3SBMA 4LQ9A 1Q1KA 5SUHA 1S1VA 5CYQA 2NREA 1TL1A 2CZ9A 3IRWP 2F7VA 5IM0A 4RW9B 2Z4PA 4R25A 3VAGA 3C14B 4NWBA 4ZPBA 1JX4A 1C2PA 3CDUA 2Q6CA 3TRGA 1NHVA 1BQMB 1ZA2B 2O67A 1KVJA 4IR1A 1Y7PA 4Y00A 2OMOA 3DHXA 4I56A 4C8NA 3T1HJ 1S4EA 5LMUJ 2CQDA 1LWFB 2HZAA 1RK8A 1QUVA 4YY3F 1SH0A 1SH2A 2FGCA 4ZP7A 1GQEA 1HWLA 4FP9A 2CQBA 4P9SA 4E2FB 1UZHA 2E5GA 4DLEA 1PCAA 2MQOA 4OZ2A 1RT7B 4YR3A 4PYAA 1KR4A 1RT4A 4DR4F 5HI7A 3GU0A 1M0SA 2FJBB 3H5UA 3R5CA 3TJ8A 2VF3A 1QAJA 1TELA 4P2FA 2ZEJA 3ETMA 1AFIA 5GAEI 1K73T 3S7RA 1NH8A 3MWBA 2RIJA 5D3GB 2HAFA 1Y9OA 1GMVA 1FVSA 2CAJA 4Y2MA 3T41A 3M2RA 4EMDA 1LOUA 1UFLA 3I0SB 2Y8WA 3P4UB 3GIMA 3FJ2A 4JB8B 3QGPA 4KGVB 2C2KB 5F9NA 5JXSA 3KK2B 1S1XB 2CQGA 2OSRA 4CLSA 2GO9A 1FVQA 4ELUA 1GT8A 3TVZA 4IUFA 3OHAA 4TVAB 3LP1B 1HQUB 2A2CA 3PVXA 3FEYB 3IMQJ 5HMWA 2J9CA 1WEYA 2V69A 1G6BA 2YWWA 5KFAA 1N33J 3W2VA 3OR2B 4EO6A 4KKOA 2AZ1A 4B3RF 1TKTA 1WDDA 4Z7CA 1RTDB 5MLCV 4NL5A 3DLKA 3H8YA 3HT0A 1YSJA 2OJ3A 1JLCA 3O3LA 2W9CB 2HHWA 3ISZA 3N6NA 1M5SA 2R2SA 4K7QA 4DX6A 1NDKA 4ZK7M 5M2PA 2IVFB 1S57A 3MGJA 3DI6B 2ZC4A 1RWWB 4JI6J 1T9XA 2R7XA 1N5QA 2QLWA 2Z2LA 1M5VC 1NRKA 4J9KA 2FY8A 1BQXA 3LWLA 3M6XA 1RU2A 3NGSA 2OEMA 3GP9A 5J1PA 4KJIA 4B3MF 1IR0A 4ICLA 1P9QC 3D1OA 3C19A 1F2HA 1PJ6A 2ZVIA 2CJAA 1CULA 1TTHB 4MT1A 1B0PA 2GHPA 2BJ1A 3Q8RB 1TK8A 1L3VA 1HPZB 4OYWA 3MECA 4M1KA 4P2MA 2MPUA 1N36J 4PG4A 4F25A 1JLEA 4RBVA 5L1IA 2N4CA 5EUHA 1JJCB 3PX6A 2NXEA 4N56A 4ZVHA 5KFLA 1BQNA 2EKYA 3M9OB 1JLFB 4YR0A 3K7RA 1U7LA 2F1FA 3MCOA 4UZCA 4WWSA 1DJ0A 2OP5A 1TAUA 3MMCA 1E6VB 4X4NA 3CC2S 3ZTRA 2WSEC 2I6WA 3R7BB 4XIUA 3C8YA 2HHTA 3TAMA 1NDLA 2M2BA 2YKQA 1LWXA 1N0VC 2POKA 2L9WA 1TKXB 3W64A 3BO2A 4USMA 3BO3A 3KHLA 1B70B 1UVNA 1NK4A 3THTA 1FTRA 5THWA 4E0DA 2QV6A 4R8UB 3EPIA 2G9OA 1T05B 1U25A 4NLYA 3QO9B 4I64A 3BO4A 4C9DA 4MYTA 1T02A 1FRHA 5AE1A 2CZ4A 1U2RA 1CBKA 5IT4A 3MURP 1B64A 3QFWA 5D78A 2HLTA 1FDNA 3EZOA 4WYWA 3E01A 4OX7A 2YNIB 2XBPA 4N41A 2PFFB 4JI5J 3K0JA 1VQ8S 2XI3A 1UEVA 1LQ9A 3HHKA 3TUZC 1QAIA 4LR7A 3NOCA 4ZN3A 3CC4S 4OI1A 3FQKA 3M05A 1N5SA 3DN9A 1PJ5A 3FEZA 4OI6A 4CNZA 5ETPA 5A8WB 1N5YB 2X1FA 2V63A 3VALA 1FCAA 2ZE2B 4Y6IA 2GVZB 2XULA 1FEEA 4WFXA 2ZJRQ 3C16B 2XGQA 1IQZA 3A8KA 5BXIA 2VG6A 4IQXA 2RILA 3PTWA 3TUPA 4KTQA 3OW2R 1HNZJ 2DXFA 2P6TA 3A4TA 4USIA 4A8XA 2NPFA 1RTHB 4ENOA 1DBDA 1WG1A 3IBCB 1AW0A 1HHQA 1X5SA 2EFQA 2CPXA 4OHWA 5A6WA 1A9NB 4N7TA 3D1HA 3M2UA 1KTVA 2BYCA 5J2MA 1NLKL 3O8WA 2JLFA 2VG7A 2MYFA 2V6AA 3A13A 3ZZ0A 3CJQA 2XLKA 1Q79A 2XM3A 2J6SA 2G2ZA 4PQAA 4ZPTR 2EFPA 4LVNP 4B02A 3AJ1A 2PMHA 4RW7A 5FIIA 3BPSP 1NK5A 4RW6A 2OPPA 5BYRA 4C6AA 2GO8A 1T3OA 4A8YA 2YKNA 3AJ2A 3OL7A 2MDAA 4C8ZA 2VOOA 4BDPA 4TYBA 1SV5A 2IPOB 2PA8D 2OD4A 3P5TL 2MKHA 3H5XA 4HTIA 2KKHA 4C3LA 1HHTP 2U2FA 3UWTA 3BV8A 2FPHX 4WFZA 2MKKA 4F0HA 4QQBA 2R8KA 3PJXA 4DS5A 4LRDA 3UO0A 3JAMU 2QT7A 1S77D 3W9JA 3CC7S 4WFBQ 4R5PA 1WD6A 3KLGB 3CJ0A 2W4DA 4Y2AA 3NKYA 2FVRA 3KKFA 1REVA 3OTEA 2MTLA 3L3CA 4QIEA 1H3DA 1VQMS 4ZVQB 3GV5B 5F9LA 5IFMA 4DI6A 3GIJA 4RPFA 2RQKA 4WJBA 1U26A 1ZM3A 3H98A 1IBLJ 4JV0A 3TYTA 2HSEB 2UUTA 2ZITA 2VOPA 4E98A 1NSAA 3LUYA 2KH9A 2VL1A 1WOOA 3I0RA 4DPTA 3JAMY 3OPKA 1FE4A 1IKXB 1CS4A 1N4LA 3SV4A 3FEXB 2DIVA 1WHXA 2BRLA 3R1HA 2HBQB 3UD5A 1N34J 4HYKA 5AE3A 5DLFA 3QQCD 4L75A 2MKCA 4ZHRB 2WVCA 1RGVA 2QYGA 2OH2A 1Q5YA 3S8SA 3BR8A 4FBUA 2YNFA 1RT5B 3OFFA 3CCRS 5IC6B 2GA7A 3BB5A 1S0OA 4KC5A 4RU9A 4X4TA 3H7HB 1OJ4A 5LMNF 2FB0A 1YJNS 4LBHA 3P45B 1P1LA 2ZBQA 1YITS 4EI2A 2MKSA 1EARA 2AX1A 1KLMA 2CYYA 3Q23A 2VG5A 2PMWA 5KT2A 4J9NA 1EZZB 1FI4A 1U2CA 4QIFA 1L3TA 4ZN1A 5K8PA 4DR7J 4IRCA 4C0BA 3H4DA 4CLLA 1R8HA 2ZJQQ 2ZH2A 3C46A 5EDWA 4K4TA 1H72C 2LVWA 3DKDA 4KV8B 5A0YA 3RAQA 2RHSB 2VV5A 2DR6A 4NPOA 5CAAA 5G4DA 3OTBA 4Q2MA 5C25B 3G6YA 3NEKA 2VZ9A 2B7BB 1RT2B 1XIQA 5C42A 5J1NA 3THVA 1UVKA 3NS5A 3I5AA 2D3ZA 2EPIA 4IG0A 2ZD1A 1NHKL 4WE1A 1U0SA 3QT7A 2DBBA 3I9ZA 2OEKA 5KFFA 1FNMA 1XMQJ 3ZZPA 1ZAXA 3LF0A 3I4HX 4LIRA 2LMIA 2JDJA 2F8EX 3BSCA 3QZ7A 2PT0A 2IIHA 4ZKAA 4OX8A 2DNPA 2JWNA 3TO8A 1YG0A 3PNIA 4DZ6A 4YDDB 2DB1A 1MMDA 2KXHA 2R7WA 4ZVPB 1KQSR 3IG1B 4LFBJ 3H20A 3T19A 5C2CA 3MM8A 3KG4A 4YMEA 4X4QA 1RAFB 4ZJQA 2AP6A 3CGIA 4B9TA 5J2PA 3CEDA 1D9FA 3DOLB 2W9AA 2RUGA 4ECVA 3KG1A 2V8HA 4C8MA 1JNRB 3UR3C 3DYAB 4EWTA 1HQEA 3HFZB 1L3KA 2ZOMA 4IRDA 1RAAB 3FQLA 5DDOC 2KJWA 5B0GA 2AX0A 2SXLA 3B82A 3CCQS 3CJ4A 2B0GA 4WF9Q 3AT1B 3M9MB 2PIIA 1U2FA 3GCWP 3AJDA 2ZH9A 2H51B 1YZ7A 2XHCA 4NYOA 1CJVA 3G6VA 1Q0NA 3OHBA 1LXJA 4QW9A 3CDBA 3CCSS 3K57A 2OMLA 2D1CA 3RB3A 2JVRA 4Z7YA 1JLQA 2BVZA 5C5JA 2CJXB 4F04B 4KH1B 4DN9A 3IWNC 4CO2A 1VQLS 1ZTWA 2BKNA 5KFZA 1HBNA 4B3OA 1TVRA 1B0TA 3T1AA 2VJVA 4QWCA 4FF3A 1X31C 2D69A 2KN4A 1ZM4A 4WP3A 3ULHA 1JLAB 4K5SA 2JEFA 5KFVA 3AQOA 2DHHA 1J5EF 2EK6A 4DF4A 3KK1B 4ZCMA 2R7QA 3M30A 2HNZA 2HNYA 5G0RB 4PABA 2HQGA 4ZPVR 3TW0A 1KHVA 3G96A 2J0WA 1O5JA 3RBEA 4OV1A 3U1NA 3POTA 1VQ7S 3AOCA 2VFRA 2IMWP 2XYGB 2YWEA 3CCJS 2AD9A 4UZBA 3P49B 2K3KA 2BJDA 3HHEA 1S0VA 3PYFA 1JKHA 3KJVB 5D8HB 2AYMA 1QM9A 2YVSA 3BQ0A 2XMUA 4ZPCA 2RH3A 3HP6A 2R8IA 1CC7A 1D8YA 2RMLA 4ZPWR 3DRSB 2V9KA 2WSCC 5DRKA 2B9XA 2V4JB 3MM6A 2R9LA 1J5OA 1K44A 2RVJA 4IOCQ 2ZM6F 3DOKB 3OVSA 4H4OA 2MJNA 3OTCA 3TEGA 1FXLA 3I31A 4DV6J 4XTTA 3TA1A 4DX5A 2I5JB 2RDIA 3VAIA 1IR1A 4ERDA 3GONA 1ZM2A 1HNWF 4RW4B 1AZSA 2HVIA 3DLEB 1K0VA 1S6QB 1J27A 1P9YA 4QIVA 2RDJA 3M8ZA 4KO0B 2LQ5A 2IVYA 4F36A 2J9DE 3WHIA 5HQ8A 4Q0BB 1SC4B 2Y3YA 3ET6B 2GMLA 2VBZA 1VYAA 4JV5F 5IWAJ 3KLIB 2UP1A 1VHFA 2MSTA 1M1KT 4JYAF 3MAQA 1R31A 4NXNF 1SJ4P 4IQMA 1IBMJ 2FLOA 4DV1J 5AXLA 4JI3F 4X66F 1U6ZA 2YWFA 3LW5C 4CYUA 2E5LF 3IWXA 3W9HA 2HKEA 1H0HB 1AROP 1JK9B 4OHXA 3EMTA 2QL5B 1PBUA 3UN5A 1FDDA 3R9LA 1NJZA 4TU9A 4LREA 1YBAA 1Q16B 2LXIA 4C11A 3R27A 2NYIA 2AGQA 1RQ0A 3LH2S 3JQJA 3PRVA 5GADI 5HROA 3SQGB 4N47A 2O3DA 2CQHA 3JSRA 3R7SB 2K2PA 3NCQA 1T9TA 2KFZA 1HMVB 3OL6A 1YI2S 1C1BA 2FIUA 4LF7F 4HACA 5K8NA 1NSQA 5DDQC 2WONA 3PW2A 3HHLB 2PI5A 1PYTA 1GFWB 4QZVB 3FGVA 1RWMB 1R0AA 5AE2A 4A47A 4K4YA 4PQUB 4F7VA 1DFDA 3PO5A 4YB5A 2KZZA 3KJNB 2YWGA 1XEZA 4TY9A 2BBEA 1RACB 1Q7YT 1JB0C 3GR0A 3RYLA 5KFYA 2W9BB 1RAOA 3OVAA 3D4JA 3QFHA 3J7ZT 3GFYA 4P52A 4ID5B 3T5LA 2FLLA 1WOSA 4DFMA 1PYOB 4NX9A 3MAAB 1B0VA 3BGFA 3QZ8A 4TXSA 3FBCA 4FYYB 1HARA 3NMAA 2Z30B 3GMGA 3PHEA 2MQQA 2XCPA 4NLQA 1WC4A 1DZ5A 1FKAF 2UXCJ 1GXUA 4LIWA 5F8IA 3KWMA 1N6QA 3DCAA 4KFBA 2WOMB 4I2QA 3JYTB 3WDOA 2CPFA 1E6YA 5DQIA 3V4IB 1S0NA 1TL7B 4LFCJ 3SCLE 3HLUA 1FDBA 3ILJA 1IKWB 2C2EA 1SPBP 4AE5A 2RSQA 2GJ2A 2HS0A 2MQPA 4EFAC 4PXDA 3MI7X 4ES2A 4NA3A 4Y2KA 2KM8B 4DL6A 2DD8S 3AH6A 2UVVA 3W8GA 1YBTA 2CQPA 2GAHC 3MEDA 4LUBA 1PO6A 3DLLQ 3PYEA 1UJ6A 3GCXP 3DGPB 2I38A 3BH7B 2RQMA 4RNMA 3GV8B 5C24B 3T5KA 3G6ES 3M8RA 3Q8SB 4C4WA 2FGOA 4F3QA 1G4CA 2HVEA 4EBDA 3PFEA 2HHUA 3QIPB 4RBTA 4GVBB 2XO6A 4JI4J 4V19J 5EHHA 2A6MA 2COLA 4OZNA 4U6PA 4C0HA 5D6GA 2HGNA 5CXTA 3Q8PB 1FX4A 4EUVA 2N3OA 2HYIB 3PIOQ 1FJCA 3H2UB 3P8BB 2W7PA 1I94J 2B9YA 2D9PA 2DGVA 2YPYA 1O8BA 3K5LA 3PR4A 2L41A 4LBIA 1ZA1B 3UVJB 5HBMA 4DU7A 1FNXH 2EKNA 2DR7A 4Q7AA 2WB1D 2OFHX 3GSDA 4JBCA 4UTGA 1WDTA 2C22A 2I2YA 4OZJA 1FEHA 4NCGB 3H2VE 2IM3A 5FDLA 1ELOA 4M5MA 4AL6A 4I2PB 4G6VB 4ZP9A 4AT1B 1ZZFA 3EVOA 3VQSA 4OI0A 2ZBCA 3VWSA 5JVHQ 3CJ5A 2ZH7A 4ZCIA 2M88A 2HIYA 3LGHA 2FLPA 3MM7A 4CO0A 4V1Ak 2XO7A 4DR1J 2BE7D 1NPPA 1EKSA 2BEFA 4JI0J 1R43A 3HHDA 3MM9B 1YBUA 4OX9F 1RTIA 4CO1A 1UP1A 4LFAJ 5J2NA 3HMJG 4U9RA 2FHJA 1TV6B 2XWYA 3GSIA 5HLFA 4ELVA 5LSOA 2UU9F 2B9WA 2DGUA 4LT6A 2QLXA 2DH8A 3L7PA 4XDDA 2DHAA 3V6KA 2DIUA 2QEXS 2B4PA 3G82B 3N79A 3ITHB 1XNQF 2W2OP 1HFEL 1N32J 3CTRA 2ZBPA 1PJ7A 3CF5Q 3LAKA 4DR3J 4WCEQ 1HD1A 1OSDA 1R3NA 2JVOA 5KOXA 3CW2C 5SZTA 4PWDA 2MJUA 4B9NA 2Z8QA 3IM8A 3R6GB 2V68A 4DN0A 3QPIA 3MTJA 1O6XA 2XMTA 4K59A 4IR9A 1YRTA 4FDFA 3TZXA 1Y00A 5HJXA 4RBUA 2IRUA 2VA2A 3BSAA 1VLOA 3K5NA 2HZCA 2CPHA 4DUYF 4CTAA 4W92B 2YTCA 3W60A 1EETB 3DOMB 4KBIA 4ZIVA 2B5JB 1UW4A 1SUQA 2Z56B 4O4RA 4CCHA 3KMQA 3M9NB 3LA0A 2BOAA 5ETNA 2CXEA 4CRJA 3KLEB 1M5KC 4HI1A 3MMJA 2K06A 2DH7A 2KG0A 1TL4A 3J80Y 2PI4A 3T1YF 3TJ9A 1GH8A 4V19X 2F5GA 5H9EK 1Y3JA 4YY3J 5A8KB 4IOAQ 2J0QD 3M32A 1DURA 2YH0A 3ZTSA 2V8GA 5KFEA 5D4OA 2WBMA 2D3O1 1KLNA 1VHIA 2DT9A 4HKQA 1FTCA 4PXBA 4A4JA 4QWDA 1UVIA 5KFGA 1KQKA 3MEKA 4G1QB 4FPRA 4KHRA 2QLJB 2ZZNA 2CDRB 3IC1A 4XK8C 2C2OB 3VAHA 5HVHA 1T11A 3E8OA 5E2QA 2I1RA 4U7CA 2KFYA 4NLXA 3UDLA 3F73A 2RRBA 4B9SA 1HNIA 1VQKS 4AQYF 3UDCA 3QBCA 4IDKB 5HK4A 2M3DA 4FYVB 3NAIA 2BJEA 2MQMA 2C2NA 1FO1A 3QSYB 4DR6F 4P7TA 4X4PA 3M2VB 3NP5A 2MLZA 1XC9A 5E3AA 2IAJA 1VK8A 3SCIE 5KAKA 1SL2A 3G86A 2FJVA 4B3RJ 3MMBB 5F0UA 1Q5VA 2EFOA 1WWHA 3PZPA 2CPEA 5IXUA 2DEJA 4CLPA 2YNHA 1UTAA 2VD3A 2V0NA 4MAKA 4J7CA 2WVFA 3U1MA 4TY8B 3CD7A 1X9SA 2AHOB 1IKVB 1UFKA 3TZWA 1H2TZ 4DG1B 2XNQA 2MZTA 3A8JA 5E0OA 1I51B 2ZVSA 4UY8T 3NGRA 4R5PB 3IP0A 4LMZA 1M5PC 5JVGQ 2B56A 1HW8A 2EG1A 5GMEA 1WTFA 4OX6A 1J2VA 3HSJA 3WC2A 4RL1A 2RHQB 4Q5VA 3FZBA 3UD3P 1N8RT 4LF9F 4H4KC 2R4FA 3BH6B 4C3KA 3W2WB 1RI7A 2HRTA 1U1OA 3ZO7A 4H4KA 4F26A 1NK9A 2QFJA 5CCLA 1D09B 3ZZZA 4C7QA 4GVLA 3IWLA 2GVDB 3V81A 3ENWA 1JLBB 1FK9A 2BR0A 5HVGA 3ZTQA 2FYXA 5A2QY 3DNCA 1VK3A 3IS9A 3QLHB 1X60A 4I69A 4IH5A 2HS4A 5KFNA 4AUKA 5KFJA 4WBFA 2KO1A 1S12A 3PW7A 1HYSB 4P73A 3TEHB 5KFKA 3MD3A 3TA0A 3W5ZA 4J9QA 5IZHA 4XO0A 4QBUA 3DU6A 3EZUA 4QCLA 2ADCA 1JJ4A 3X3UA 1LK7A 1UPMB 1WEXA 2WRMA 1EAYC 3FMBA 3RBXA 4DV3J 4ID8A 1UWBB 1NCLA 3DRPA 1YJTA 1VQNS 4L74A 4PAAA 4JI8F 2VJUA 2D41A 3P3DA 4DF8A 3R8YA 4NZ0A 4PG7A 1WJ9A 2CQIA 4DR2J 8ATCB 4P71A 2ALZA 2CPIA 1JJ2R 3BGOP 1QLNA 3V6HA 1T0TV 3ZZOA 3FCWA 5BR8F 1MN7A 4RNOA 3I32A 4K4VA 4MYUA 3HD2A 3IAS9 1D9AA 4MIBA 3EGVA 1RTJB 3HCXA 3GYGA 5I42B 3BDPA 4ZP6A 2KHCA 1WNEA 5EWEA 2YX4A 2AJ1A 1PC4A 4AXIA 1VBXA 1F3FA 1FJGF 2ZH3A 3CMAS 3ZNUA 1MU2A 4DQPA 3BN7A 4DDFA 3I5CA 3KLFB 1AA1B 3A12A 1W7WA 4K8RA 2AEJA 3N6LA 3IN5A 1RBAA 4J91A 2GHWA 2XY5A 3RZAA 5CYMB 1AUDA 2CA9A 3KUGA 5GAEU 4KHMA 4PPDA 2HIQA 1M90T 4YS2A 1BXNA 3RRHA 2JFDA 2E1PA 3UN2A 2ZH8A 3TA2A 1NJIT 2QLBB 7AT1B 1P6TA 3AOAA 5KFRA 3AHPA 1IN0A 4K4SA 2RU9A 4MKYA 2VFUA 3TARA 2XS5A 2MKJA 2ASYA 4U7UD 4WK1A 3NBPB 2MLYA 2PFDA 2YWHA 2ZOGA 5KG7A 3K5OA 1SJQA 4KHPJ 2FHKA 3C15A 5E5NA 3TVYA 1GXLA 5B0AA 2K1RB 3QWPA 4CDIA 6AT1B 1C0UA 2W7AA 3FSYA 2OTJS 1YDLA 4K50A 3CJSA 4NYZA 3LOUA 1X4CA 1ICEB 5T7LA 1I1GA 5IQ6A 1WHVA 4F50A 1PSDA 4MK8A 2G2YA 5K5MA 3VHQA 1MWYA 1K9MT 2H65B 3UDVA 4AFFA 1HBMB 2I9SA 4DZDA 4DQIA 4DL2A 2M8HA 2ZKTA 3ZFVA 2B8QA 2C3PA 2CZVC 1HWJA 4MTPA 2R42A 1V3SA 1M5HA 5D0EA 4ED0A 3QMQA 1UJ4A 3KHHA 3DGVA 4FXDA 2MQ8A 1KHWA 1MG7A 2H5JB 2CJQA 2C2ZB 3HM9A 1T9VA 2VDIA 3HJVA 1DLOB 2QG9B 3H25A 4GC7A 2CIMA 4DL4A 5B09A 1BGXT 3NMRA 1D9DA 3GQCA 2VQFJ 4DX8H 2HQ3A 1WKKA 2MSSA 3T1HF 4Q8FA 2Z57B 1QE1B 1WF0A 2ZDPA 3CCLS 5D77A 1WOPA 4ZPAA 1Q8LA 4OI2A 3ISNC 1VC0A 2IHR1 1S9EA 3AOBA 1NU4A 2KFNA 2CWKA 2LU2A 5CABA 3SMZA 3EXCX 2XY7A 3U27A 4X64J 2AW0A 3MPDA 4WIIA 4RO0A 1FT8A 2AQ4A 4B3TJ 3PX4A 8RUCA 5AXMA 3N9UC 1A0OB 3VF0B 2IDLA 2HHHJ 4ED5A 3QRPA 1CJUB 2AMCB 4HH1A 3K2YA 4JI7J 2ADBA 1IM6A 1UA1A 5GAHI 2MZRA 3M1VB 3MFIA 1ZPWX 4IH6A 3BYRA 5DO2A 4F4YA 3FFIA 1RHQB 4YB7A 2AKWB 2YKOA 2V50A 2DH9A 2VICA 1U4BA 1XERA 5JUMA 1S1TB 4GKKF 2HQFA 3W1YC 4KRWA 3CJKA 4MFBB 1DTQA 2ASJA 3R5GA 4A8FA 1FKOA 4DFJA 2R3VA 4IFYB 4TLRA 4DL7A 3TX0A 2B6AA 4USTA 1RT3B 4F4XA 4KIAA 3PRBA 2DGTA 2HGMA 1EJ7L 5J1EA 2HVDA 3K5MA 1RT6B 2YBVA 2R7OA 2IBKA 1Q8IA 4HDHA 1CJKB 2B3TB 2M8DB 4BBYA 4YHHJ 4DV7F 3J81U 3CDEA 4KE5A 2A2DA 2MKYA 4DSIA 3TOQA 2X1GA 4QYZK 3WQPA 2DXEA 1Q86T 2LXFA 3GFZA 2C3MA 3WBZA 4Z2XA 4ELTA 2RE1A 4ER8A 2KT5A 2N7CA 1V9OA 4OJ3A 1S5ZA 2KU7A 3HT3A 4NZ6A 5D4LA 2GGPA 1CVJA 5KG0A 3MM5A 4DL5A 1F3VA 4LRBA 1X4FA 4FS1A 2YKMB 4FVCA 4HDGA 1Y5NB 3MDFA 2XYPB 5KFHA 3AB2B 2Y0BB 1MROB 2V8DA 2YQ0A 1UETA 2M7SA 2QMWA 5KT3A 4OZ1A 4M5DA 4JV2A 2FZKB 4ED8A 4WYLA 4FBTA 2WB4A 3MMAA 2HK3A 2HHPA 3J81Y 1VCTA 1FD8A 2JLEA 2BKOA 4IO9Q 2XMAA 2VC0A 5KFBA 1Q53A 3BGRA 4X84A 1T9WA 4OHZA 1LWCA 3OUYB 1C4AA 4LBPA 3Q8YA 5L1JA 4HT7A 1YJUA 1X4BA 4PR6A 1SKWA 1U8WA 4CWBA 5F0WA 5DDPC 3FC9A 3DMJA 5RUBA 2I0XA 4ZJLA 4CZCA 2JEIA 1CJTA 2NUUG 2RQCA 1RHUB 2JFKA 3D66A 2DNNA 5F8HA 2QSWA 1FDAA 4NLSA 4MKBA 1NDPA 1QTNB 4DPWA 2RQ4A 4DL3A 2Y0SD 3LO3A 5CD4H 3CJ2A 5D0RA 5M2RA 3I5BA 3C14A 4DXLA 2VODA 4C98A 3KYLA 1R27B 3EM1A 1BQMA 3KUEA 3CO9A 4F4KA 4D3HA 4OYIA 5KOWA 4JI5F 4DPOA 2W1BA 4QR2A 4I0WA 4PZVA 1FESA 1FXDA 1LWFA 5HANA 4WFNQ 3TAPA 2DGSA 1S1UB 4NOHA 4LF1A 4N8NA 4K5RA 4PRFA 3RAMA 3AQPA 4Y2IA 1I5OB 3VAMA 3H4BA 2GW8A 3ILLA 1V6HA 3L95X 2GC8A 1YIJS 2DJWA 2FY1A 1N5VA 2OKQA 1RT7A 3CE8A 1ZOTA 1YQHA 4OYOA 4P6QA 3RG6A 3R7NB 2ZM6J 1TKZA 2PE8A 4QIWD 1KP6A 1RWOB 3V6DB 1ZPVA 5D3GA 2CKWA 3IA0A 3D9BA 4CO5A 4NA2A 2ZHBA 3RB4A 4X4RA 3I0SA 2JX2A 4OJHA 4I7FB 3KK2A 1S1XA 2VKZG 2OUGA 1JLGB 4JV5J 1X0FA 5I3UB 2BW2A 2JH3A 3ZZYA 5F8MA 3LP1A 1HQUA 4TKTA 5L8RC 2ZDOA 5FD1A 4B9VA 3VGVA 3KMSA 2E5LJ 5K14B 4JI1J 1GX5A 1FRXA 4GC6A 4ED2A 1RISA 2IC3B 1XNRF 3BGUA 3J7YU 3OR2A 4DSLA 4LQ3A 4GKJF 2QA1A 1KFDA 4A8MP 1QSLA 5EGYA 1RDRA 2R7UA 1RTDA 1RKIA 4Q2LA 2BX6A 2DNHA 4Q43A 5K9FA 3QT6A 2V5HG 5E41A 4TQRA 4L6V3 5DZ7A 4O0IA 3NNCA 4LJMA 4DHVA 4BWJA 3DI6A 2M5YA 2UUBF 4ZVOB 4EEYA 3Q2TC 3GFHA 3HVAA 1UWAA 2EG2A 1TZ0A 3DFEA 2P8IA 2M52A 2AZ3A 2CPZA 4ED3A 3LP2B 2FVPA 5A8RB 1RHJB 3K5PA 3OL8A 2NPIA 1HBOB 1VRQC 1LV5A 4FYXB 3G4SS 1EQ0A 2QIFA 1HWUA 2E1MC 4OQJA 5K8MA 2ERRA 3UNGC 2HEKA 1HPZA 4CLWA 4ECRA 3IR7B 3OR1B 2QGFB 3CWJA 2CPDA 5L1KA 1FJ7A 3MAHA 2QMXA 4UQGA 2DXDA 2MXYA 1IUJA 4OLOA 1EIYB 1LKZA 4FF1A 4M63A 3A8IA 4DS4A 1NSPA 2DNQA 1XTZA 2RS8A 2H4WB 1JQGA 4DBQA 1DQ9A 3H2LA 3BJYA 3KK3B 1GNKA 3PFOA 1NNDA 1JLFA 4LR9A 2MGZB 5AJ3F 1VRTB 2Q1LA 2O1PA 3NGKA 4TQSA 4OV6A 3LPEA 2J8SA 4P74A 3AFGA 1EB0A 5ETSA 3UI3A 3OQ2A 1TKXA 4PEOA 2HQIA 2NSBA 5KFCA 3TX8A 1QSSA 3PIPQ 2X3GA 2Q66A 2LQJA 3JTOA 4TU8A 2OI2A 1NJWA 3M32B 4R8UA 4DV5J 1T05A 3MPVA 3QO9A 1RWUA 1RWPB 3BS9A 2YNGB 3P6YC 4W4MA 4QPTA 3BF4A 1P1TA 1WI6A 4FYDA 2LA6A 1MN9A 5L9NA 3L09A 1QDUB 4CH7A 4EYIB 3R6LB 2HBRB 3EVWA 4RW8B 1NZ8A 2E9RX 3QGGA 4ZVSB 2YNIA 4IH7A 1X0PA 4USJC 4RR5A 1FWLA 1DTTB 2OPSB 1PBAA 3LGMA 3Q24A 3EGWB 2XMMA 4W90B 1VQOS 4C8LA 5A8WA 4OFZA 2XLJA 4ANDA 2UUWA 4WU3A 3PV8A 3OFGA 2GVZA 2G0IA 5GMDA 1UAWA 3D6MB 3RR8A 3C16A 2GCFA 3GJTB 2G13A 3DM2B 3MOJB 4K4ZA 4F2RA 4ECTA 2GIFA 3ZC4A 2HWTA 2MLXA 1RADB 1EP4B 4NCAA 2J8AA 1RTHA 1UVMA 2BRKA 2RUSA 3RRGA 4DQRA 3LGNA 3C6TB 1VDHA 3VGUA 1DRZA 3UCZP 4USKA 4OYMA 4U95A 2RDDA 4DV4J 1LK5A 1GAOA 1XR6A 4UT4A 1H38A 2DNZA 3CJ3A 5F8GA 4ZCLA 4PKDB 3AB4B 2EBGA 4DEZA 2KJVA 4LFBF 3D6TB 3JQKA 1C1CB 2H54B 1N52B 1AUSL 1TKDA 2F8MA 1FWPA 3NOGA 1EX8A 4ECUA 1V3ZA 1KONA 3MPYA 1SQGA 2NS1B 2C1EB 3CCTA 3HDSA 1MW7A 4IO1A 1G7CB 2EFVA 5ETOA 1LFPA 4CLUA 2ABYA 5DQGA 2V4QA 3OSPA 4ECQA 5E33A 1HNXF 4OX9J 2RF2B 3HVWA 2UVWA 2XMVA 3N0VA 4CLZA 3THPA 4Y28C 2WW4A 2GMJA 2UU9J 1VQPS 2DRDA 3GTYX 4YUDA 1LEOA 1GEHA 1XWLA 1WC1A 2K7JA 4BC9A 3O5TB 2XZWA 5J2QB 1FKPB 2FZCB 1FK9B 3KLGA 4WU2A 5GADU 1URNA 1XNQJ 3B4DA 5DM6Q 1UL3A 2MMYA 4OLPA 3CUNA 3BBFA 4DQQA 3HZGA 1S9GB 4X4UA 3G9CA 5MAOA 2Y1LB 1FRKA 5U47A 4L76A 3J7A1 3ENVA 3MPUB 3H42A 1T03B 2YY3A 1FRJA 2BANB 3MR6A 2FHJD 3FNNA 3ZZUA 4KQZA 2IM0A 4QU6A 3EVMA 2VKRA 5KG2A 4DUYJ 1LW2B 2XG8A 1YLXA 2CVIA 2X7IA 2RT3A 1F5AA 3L4BC 4RUBA 2V67A 1JXEA 3KHGA 2JLGA 2FQQB 2E5JA 5IT9U 4C8KA 4DWIA 1IKXA 4O3OA 2R7VA 2ACYA 3R97A 2LEAA 3MUTP 4J9UE 4KGKA 4B9UA 4ZHRA 2J7WA 5KT5A 1TK0A 1UEKA 2FVSA 4DV0J 2NQPA 1JXLA 2C2DA 3PACA 4FKYA 4LSLB 2APOA 1URRA 2OLWA 1NSKL 4NZ7A 1VQ9S 1RT5A 1T8EA 2EXUA 4YP3A 1WC0A 3F41A 2EFNA 1ZM9A 3RUBL 4XPCA 1W25A 2ZH1A 4IG3A 3FKBA 2BV3A 1SJFA 2E7XA 1BWEA 2XYHB 3HVTB 2HHXA 2V2ZA 4LF6F 1MU2B 3BPDA 5EN1A 3F44A 5CCMA 2GIRA 1XJWB 2CQ2A 4PUOB 3NGTA 1GMWD 3PO4A 1IKYB 4X4VA 3JTNA 2IRYA 3TP2A 4KV8A 1X5OA 4U7UK 1GX6A 3OXLA 4F4AA 4XPEA 4DV1F 4UUWA 2E66A 5C25A 2VB6A 3UFCX 1C0TB 3SI8A 3CIMA 5HMZA 3NGDA 1RT2A 1ZBTA 4FYWB 4ILLA 4WTOB 1IBKJ 4NRTA 2KL8A 2HWHA 4PCQA 4AQYJ 4FXWA 4P72A 3ICLA 3MR3A 5HL7Q 4NLGA 4LRCA 2VH7A 3L7UA 4DUTA 2GQQA 1KN6A 3CNQP 2EK1A 5BYQA 3PKMA 2UUCJ 4FZVA 2KVIA 5L1LA 2VPXB 1RT1B 3N28A 1TFWA 4NASA 2X1BA 4ZVEA 4O4GB 1A6LA 1WHWA 2XTJP 1TL3B 4HHUA 4U8YA 1C0UB 1UMJA 3R5JB 4RX6A 3IG1A 2Q6BA 4B3SF 1CSJA 4RZRA 3SZ2A 5T7LB 4M5IA 3N4WA 3OVBA 2OPQB 1XBWA 3BYPA 3OBIA 2QTWA 1QJHA 1U6BA 1KTQA 1FWKA 1VLYA 3DOLA 3O6QA 1S6OA 3M8QB 3OTDA 2X3DA 2HMIB 2KB2A 3IR6B 4YB1P 2NUHA 4F4ZA 1RAHB 1IM4A 4EO8A 3K59A 2JHEA 2OGUA 3I82A 2AEMA 4LF9J 3QIDA 1VGYA 3RAXA 1WHYA 3DRRB 4YEAA 4NE9C 4DPYA 4DFKA 2ZHOA 3MFHA 1T7PA 4I6AA 4DUZF 2H4YB 4WK3A 2H3EB 2HRUA 2J76E 5C2GA 4WZMA 2QSFA 1PILA 2QLFB 2WHOA 2HBYB 2V2QA 1FERA 4URSA 3GIIA 3UPFA 3DLGA 1D3WA 3ZZTA 5E3RA 3NLCA 2IJFA 4DSFA 3TQEA 4F0KA 4QOTA 1KD1T 2EI5A 3KDOA 4LF8F 4PYDA 5LXYA 1TAQA 4F3OA 2VFTA 4CP5A 1L3SA 4ZMMA 1AT1B 4NI2B 4LFCF 2H9ZA 3H40A 4L72B 2ALYB 4G1PA 3KK1A 1D8ZA 2HNDB 3KLHB 3LP0B 2KTQA 4X65F 4K4XA 1N88A 5G0RA 3BKFA 1LWEB 1Y5IB 1BC6A 2F40A 2LDYA 1FRMA 5DS7A 2BE9B 4M8LA 2AYEA 2N3LA 4RJVA 2NLWA 2OPRA 2KG1A 2E9TA 2EVZA 2GHVC 2WZ1A 3MEGB 4NLPA 1OQ3A 4OJ1A 2Z0GA 4R0EA 4B9MA 2NZCA 2V8VA 4WTYA 5DG7A 3KJVA 2DNLA 4MKVA 3V2UC 1NJYA 1HBUB 4CM0A 3CD0A 3GLJA 4ETXA 4J9MA 3IO1A 3DRSA 1SBRA 4ZLNA 2CPJA 4JI2J 2V4JA 5HVFA 1TFYA 4ATNA 3MR7A 1SKRA 2JZ5A 1U47A 2HFVA 4JI4F 3BN4A 3DOKA 2CRLA 3G6XA 3EE3A 3OTOF 3TJAA 4QYRA 2BXJA 2ZWOA 2I5JA 1FKOB 3U7JA 3SSRA 2XSFA 1FJGJ 2XHWA 1I94F 4QPXA 4RW4A 5A6PA 3DLEA 3RB6A 4A48A 2N7YA 1S6QA 4DX7A 4KO0A 4OHYA 3ZTPA 4Q0BA 2D7SA 4O44B 3JB9k 1VBZA 1L5UA 3KLIA 3O2IA 4H4MB 4Y34A 3VTIA 2FJDB 1RU1A 3PG9A 3QT8A 1RCOB 1S10A 2ASDA 2AGPA 2ILYA 5KG5A 2XI2A 2XSJB 1U0HB 3I56S 2XGPA 3GJRB 1U1NA 2YWKA 1HLWA 1KKHA 3D54A 1QSYA 1SL0A 1Z2LA 1TL5A 1NKCA 4OZ5A 4A46A 3B54A 3Q2SC 1K8AT 3UNYA 1OY6A 2E29A 2DHSA 3D0HE 1RLCL 3SQGA 4Q8EA 3FMWA 4ED1A 3PX0A 4LSNB 3IR5B 4LFAF 3AA8A 2R2RA 2AJFE 3Q89A 2FVCA 3LPYA 4FKXA 4I4BA 1HMVA 4EZ9A 1VBYA 4M5DB 3HHLC 4A8SA 3MMAB 4ZDNA 2ILZA 1SQEA 4EZ6A 1RWNB 4FNIA 2RKIB 4HLBA 1U09A 3AA9A 3KOAA 4PQUA 1N32F 1WG5A 2OELA 4HI2A 4LRAA 1H7WA 3OSNA 1VISA 2ZJPQ 3M8WA 2A18A 1BD6A 2DRAA 3R2CJ 4RKUC 3CCMS 2CQ1A 6FDRA 2D9OA 2AYGA 3PJWA 3EGNA 5HN0A 2AGOA 1T95A 1CJTB 1RTZA 2W9BA 1AFJA 3HF5A 1B3TA 2LQ8A 4EBEA 2VFSA 5HP1B 4ID5A 2IJNA 3CDWA 1WSRA 4BHQA 2D74B 1NKBA 3MAAA 3M6WA 3HD1A 1RWXB 4QJVA 4UUXA 3FK4A 1VQSA 1OO0B 5H9FK 1MLAA 1X9WA 3IRXB 4GMKA 1H73A 4DMZA 2E5IA 2GV1A 2DVIA 3R5DA 1NDCA 1TMJA 1Q82T 3M8SA 4PXCA 4YR2A 1PAUB 1LW0A 2R8JA 2WOMA 3JYTA 4P7VA 1S9FA 2F65A 3V4IA 1T9UA 1U02A 1TL7A 3JSMB 1LXNA 2F4VJ 2AT1B 2BW7A 5F8JA 2CADA 2KT3A 1TUGB 3EGZA 5I3QA 3EWGA 1IKWA 2CDQA 4RUCA 3S6EA 1RYRA 2KM8C 7FDRA 5CD4A 4LF5J 1FNOA 3TUIC 2WCXA 1PGZA 2ZZMA 3JS9A 2MY8A 1TKZB 2JEJA 2AJ4A 1KEKA 2DO0A 4WIQA 2J6UA 3PHTA 2QO3A 1PIEA 3SSSA 5KT6A 2Q79A 2RRAA 3IGVA 3DGPA 4UOGA 3SFUA 4B9LA 2BE2B 5ETQA 2N82B 2EW9A 2V34A 1YJVA 1S6PB 5C24A 4DQSA 3ISND 4KAIA 2KYZA 2A3JA 2BA9A 1X5TA 4HEA9 3DDNA 2JC1A 4JOUA 2UZAA 1HA1A 2YH1A 5KT7A 2RB7A 3QIPA 4GVBA 1B99A 2RD5C 2QFIA 5AT1B 4ZVUB 1FF2A 1SL1A 4GKKJ 4F3MA 3PYDA 3QWUA 3PYGA 1NMEB 4DV2F 5AXNA 4MIWA 2OTLS 4PWWA 2HZVA 2DRBA 1ITPA 1F1BB 3AXKA 1S1VB 5CYQB 7FD1A 3CCVS 1TL1B 1VQ5S 3UVJA 2P6SA 2B8PA 5IM0B 4F8RA 3M8PA 3H0PA 2F63A 1VS3A 1RAGB 1HI0P 2CFXA 2DNKA 2VQEJ 2UUAJ 4MMOA 2G1DA 2EBEA 5B0BA 1IVZA 2HRYA 2ZOFA 4DV7J 2DK2A 2W2QP 4NCGA 3TI0A 4I6YA 4I2PA 2LQ9A 2D3OR 3C66A 1VFJA 3RJMB 3LWMA 2K8GA 4CI0B 2UXBJ 1XK8A 3EZ5A 2HFOA 2DGXA 5F3ZA 2DR5A 2NSCA 2VBXA 1WUUA 3GIKA 4GO5X 1U8SA 1FRIA 5FJ4A 2KXFA 2IA6A 4NLWA 4O3PA 1XR7A 3Q22A 2F9JA 3CB4A 3MM9A 2HG4A 3KFWX 1G3OA 3V4MA 1EHWA 1RT4B 2F8HA 3TUJC 4EGLA 1TV6A 1S59A 4CLFA 2CUYA 3DXSX 4BCAA 3HULA 5K20B 3WIVA 4OHVA 4HHJA 1TU0B 4YFUA 4X4SA 3M2RB 3R2DJ 1DARA 1B7FA 2VC1A 3G82A 3ITHA 2PC6A 5B0FA 1W26A 3U1LA 5HSPA 1RKJA 1YJ9S 4B17A 1RSCA 5GAGI 1S76D 3HKWA 1F9FA 1PKUA 2UXDF 3TAQA 2G4BA 1YZ6A 2HQDA 4UF4A 1X4GA 2UVRA 4C8OA 2B9EA 1TMMA 2QA2A 5DJBA 3TZYA 2N4DA 1N54B 4ZLLA 2XCAA 4DV3F 3CMQA 3W2VB 2DR9A 3MXHP 4KKOB 2VBWA 2CG4A 1EETA 3DOMA 1TKTB 2B5JA 2C2MB 4RNHA 2YXLA 3DLKB 2W4PA 2HPUA 2VFVA 1JLCB 1HQ2A 4UW2A 3KLEA 4DR2F 4ZOSA 2IJRA 2ZH6A 1SCJB 1UPPA 3D6FB 3OL9A 3SDEA 1WI8A 5A8KA 3K8VA 3S01A 4J9LA 2QE5A 2NR0A 5KFSA 4OI3A 3NY0A 2IMOA 4OZ3A 5LSRA 4ICLB 4BLGA 4A8QA 2O5DA 3TWZA 1CULB 1OPIA 4URGA 3R1LA 2FUG9 4NCBA 3BQ1A 3MECB 1Y11A 6FD1A 2W25A 1RHKB 1JLEB 2QA4S 2KDOA 1EKRA 4OIXA 3UCUP 3VVTA 1RE1B 5KG1A 4G1QA 3DU5A 4G3IA 4O0NA 4Y2CA 1PYSB 1IXKA 5L9XA 1BQNB 3E51A 3QYYA 4FNHA 2QJ3A 4QWAA 3FSXA 2YX1A 3T6JA 3MMCB 4IDKA 2XQCA 2Y1JA 2E7WA 1NB2A 2EC2A 1FE0A 3TAMB 1XMBA 5GAHU 4P10A 3D0GE 2HHVA 3CD5A 3M2VA 2VIHA 1AYEA 5D0HA 2OO4A 1XNRJ 3AY0A 3HPOA 1N56A 5ETRA 5H9EJ 1ZZNA 4GKJJ 3T3FA 1HWKA 5BYSA 1IBCB 2MZ1A 4KHPF 3MMBA 1S99A 2U1AA 2HFSA 4KGZB 2E1AA 3EJMA 5LXRA 3C6UA 2XZDB 4CH0S 2JC0A 1N48A 4TY8A 3BSNA 3E01B 2ROGA 4NXMF 1IKVA 2UUBJ 4WP9A 1GMWA 4DG1A 3VZIA 1SKSA 1ACMB 1RAEB 1TP7A 2XS7A 1RA6A 1YX2A 2XWXA 3SCJE 1O0PA 2IDEA 3VGTA 4IFVA 3RB0A 1RXOB 3ENQA 1KVKA 4ED4A 2ACMA 1NUEA 4J9VA 1WELA 1APSA 2J7KA 1QD1A 4K0KF 1DQ8A 2Z58B 3W2WA 4DR4J 2VG6B 5DGAA 5HO4A 2W2MP 4JP8A 3MCMA 4OZ0A 2LEPA 1H6KX 4DPXA 4W98A 4A8OA 2DNOA 4ZJOA 4NMXA 3T5HA 2GVDA 4USVA 3H90A 1JLBA 4NLVA 4ZITA 4WKYA 3WZ0A 8AT1B 1UW9A 2VQFF 1RABB 4FXVA 4USHA 1S48A 5KFPA 3M2UB 1Y3KA 3QLHA 5AJ3J 5J2MB 1X5PA 3CPWR 3QATA 2VG7B 1HYSA 4HH0A 2DYAA 2EFGA 3QAEA 2FD2A 3PW5A 1KDNA 3WC0A 4G1IA 3FBFA 4RW7B 3DLJA 4BS2A 2VA3A 4RU2A 4QW8A 1FFGB 4URQU 5KFUA 4RW6B 2K3IA 2OPPB 4X64F 3OFEA 2CJYB 2FHMA 1R8AA 4B3TF 2CQ0A 4EU0A 1UWBA 3FZ2A 5CZXA 1GTHA 2YKNB 1VOMA 5BJRA 3FRZA 4NLTA 2VPZB 4QWEA 1UVJA 1SV5B 2HHHF 1NJXA 1KFSA 4IG3B 5HJYA 4O3QA 1TQLA 3GB0A 4CT8A 3PXGa 3I6PA 4OYAA 4JI7F 2PO4A 3J81j 2J5AA 5F8NA 3ZNJ1 1S1WA 2JSXA 4AYBD 1NO8A 4N77A 2FC9A 2ZNYA 2B4UA 2HVZA 3J7YI 2F4FA 2M9KA 2P9CA 1RBLA 4ECSA 5A76A 2XS2A 5DZ6A 1VC6A 1U1MA 1WKLA 5IC4B 1RTJA 2E5HA 5I42A 3BGLA 1NBEB 1REVB 1QUPA 4B3MJ 1R6VA 2JEGA 3NRBA 4DJBA 2DGOA 2AEFA 5D4PA 3EX7B 1K1QA 2FJXA 3KG0A 1U45A 4LF4F 3BKTA 3IBFB 1TK5A 5L46A 1QAXA 4HTJA 3KLFA 3RGIA 1KBRA 4ECZA 1HHSA 1YVFA 4J9SA 4RLEA 2NXNA 3NWRA 1XQIA 4DPUA 3UDEA 2JJ4D 3GPAA 4YHHF 2LECA 4ZS6A 1B7YB 3CMES 5CYMA 3I0RB 1ROFA 2IRXA 2IY5B 3MEEA 3BBCA 4A8KA 1CS4B 3KTQA 3W8PA 2AJ0A 1Q7LB 2F3JA 1Y0HA 2R7SA 1UVLA 2GX8A 1RWKB 2JNJA 5KFDA 2B51A 4MH8A 1RP5A 1HR0F 3MCNA 2YNFB 2V8PA 2DY9A 5F8LA 5KFOA 2FLNA 2X1AA 5ADZA 3NBPA 4Q44A 3VAKA 1VC5A 3SFGA 3QJJA 3EDQB 4ECXA 4ETZA 2A6OA 3RBDA 2HVHA 1OYEA 3O44A 1NEEA 2XB2D 3FSIA 3PEJA 3NNHA 1HNXJ 4H54A 1TUVA 2K1RA 1U1PA 3M7VA 3HFVA 1Q78A 1PG5B 2DCLA 1R8PA 1KLMB 5T14A 2VG5B 1VIOA 2E9ZA 5DG8A 2BJ8A 3UW1A 2V4RA 5DETA 2MZSA 3W66A 2JL9A 3IM9A 4WFYA 4HHHA 3W9IA 1HBMA 5A0YB 1OMSA 3DLGB 3QGIA 3AODA 1LFWA 5C42B 2HURA 1SQFA 3PW4A 4LF2A 4L3KA 4NYPA 2HK2A 5HMYA 4YB6A 4IG0B 4FF4A 2ZD1B 4OYBA 4WE1B 1XMOF 2B4VA 1U1LA 2Z2YB 3N6MA 1DLOA 2BZ2A 1NPKA 3TR5A 3KNAA 5D4NA 2ZZTA 3MCSA 5F41A 4HR2A 1MWZA 1RAIB 3IXQA 2AV5A 4J9OA 4KB7A 2OPRB 1RBOB 3OFHA 2HQCA 5KTQA 3CCES 1RA7A 2W7OA 1QE1A 2CNNB 3CSKA 1AB8A 5B7WA 3L7OA 4KGMA 4WFAQ 1SKUB 2VONA 1SIZA 1SJRA 3N01A 3FCVA 3Q8VA 1HI8A 3MM8B 1Q8KA 1U1RA 5J2PB 3T6BA 3B6BA 3JSBA 5GMKa 4NLDA 4OYPA 1QTMA 4RUAA 3DC2A 3BR9A 3MUMP 4USUA 2M70A 4NEYA 4FVMA 3KJQB 4ZLJA 3LQVA 5B0DA 2C3UA 2GQ2A 1IQTA 3UN3A 2GQCA 1HQEB 1H2UX 2HS3A 1CJUA 5CZVA 1QVGR 2EEYA 3C2PA 1CC8A 3BBBA 5E7OB 3AAWB 2J9EA 4CH1A 4Y65A 1PC5A 4LF6J 2J9DA 3HXMA 1Z2ZA 2ZH4A 3M1VA 3I87A 1X7VA 3CIZA 1RAJA 4X62F 3L9ZA 4FPIA 4IKAA 2QN6B 1CJVB 3EICA 1Q81T 1NK6A 1SJ1A 2DGQA 4BC7A 4ZLPA 1JLQB 2Z2ZA 2HLUA 3AD7C 5EX3A 1GXTA 2G1HA 3OXGA 2BQRA 2BQ3A 4ECYA 1S1TA 5DG9A 4ANCA 4MFBA 1BUXA 1HBNB 4JI1F 4B3OB 1TVRB 4DR5F 4KH0B 4B08A 1JWWA 1H2VZ 4IFYA 1SVDA 2OEJA 4QR0A 1NZAA 2BUNA 2UV8A 4M5HA 3F0NA 3TNVA 5F3TA 2C28A 4UOFA 3QJLA 1RT3A 2RU3A 3M30B 5EWFA 2HNZB 2Z2MA 1S7HA 2HNYB 1RT6A 5C7PA 1N0UA 3ADAC 1CJKA 3J7AN 1CLFA 3POTB 5LSLA 1CQMA 3SXLA 1WF1A 3DDKA 4J9RA 2DISA 2PEHA 2PDAA 1VBKA 2HFUA 4WKRA 5DQHA 4GRSA 3PR5B 2XY6A 3FVYA 4FS2A 2BM1A 5ITHA 5LMUF 4EK2A 4M5JA 1JKHB 4NRUA 4B3SJ 1TUWA 3FUYA 3GIRA 4O3NA 4O3RA 2Y1RI 2R2TA 4I67A 4F0MA 4DLGA 2IYIA 2L9DA 4IYQA 1T9YA 2I8EA 1H74A 2YX7A 3CVKA 4KYZA 2WK4A 3DRXA 3MM6B 2VHGA 1J5OB 5DGBA 2YKMA 1FJEB 1CQNA 1VR6A 5ETMA 3H5SA 3HSDA 1WC3A 4ECWA 4H4OB 1Y10A 9ATCB 1K0TA 5LMNJ 1MROA 3KHRA 4CQ1A 3RR7A 2ZC3A 1REGX 4I1TA 2YPZA 1F0XA 4KPYA 3SV3A 3A3NB 3BM7A 1AZSB 1SI9A 4X2BA 3HI9A 4DSEA 4NMLA 3SEOA 1NAQA 4M5KA 4CM2A 4DUZJ 2CJ9A 5E3PA 1WSVA 5CH7B 1PAEX 3OUYA 2PN6A 2BDPA 4ZVTB 1NK8A 1Y5LB 2FC8A 1BHNA 2IM1A 3I9V9 2W4CA 4CYUB 1LW0B 3NWGA 4LF8J 3G71S 4DFPA 1RHRB 4QYZJ 4ZVFA 1XR5A 4OI4A 4M5LA 1SIWB 1N33F 4I68A 2V2VA 4G65A 4DV5F 4X65J 4LSZB 4C11B 1X4HA 1ZAVA 1YKWA 2ZKUA 5HROB 2Q43A 2NXUA 2CNOB 1F9HA 3PKYA 4U67Q 3D1QA 1Y4ZB 2WVBA 2C3YA 1SJ3P 1F5CA 2LQBA 1NPRA 3QGHA 3NG8A 4F2SA 3J7Z5 3W65A 1VRUA 2GNKA 2WSFC 2M0GB 3MHYA 1C1BB 1KQFB 2J7UA 4HACB 4ES1A 1RUSA 4JI6F 2WONB 1W2IA 3SIPB 1U24A 5ETKA 1S1UA 2HHQA 1CEZA 3IBWA 4WP8A 3DRYA 1R0AB 4F67A 2XMJA 1JMTA 1VJQA 4NLRA 3GYNA 1OPZA 1KOHA 4KT0C 4PG5A 2QX0A 1WEZA 2R7TA 1KNZA 1V3RA 2HGLA 2L48A 3A3PB 5CQGA 1A7GE 1FFWB 2DEIA 1N5TA 3KXDA 1N36F 5E3QA 1R89A 4C3MA 3OTOJ 4KGXB 3V6DA 2DY1A 2ROEA 2ZH5A 3D68A 2ZFHA 1RZMA 1U1KA 5FLXU 2HAIA 3M4XA 4I7FA 3BDEA 4DV4F 2VDHA 4N5SA 2WBRA 3M8PB 2CNLB 2K7KA 3IAM9 1FXRA 1UA0A 3GE9A 1JLGA 4ED7A 5I3UA 3A1YG 4UQTA
chains in the Genus database with same CATH topology
3ZZOA 2QV6A 4R8UB 3Q8QB 3EPIA 5BR8F 3HVRA 2I5JA 2G9OA 1FKOB 1HNVA 1T05B 1U25A 3U7JA 3I32A 3QO9B 4I64A 4NLYA 3SSRA 4RNOA 3BO4A 4K4VA 4C9DA 4O23A 2XSFA 4MYTA 2XHWA 4MYUA 1RJJA 1RYSA 1T02A 1N6QB 1I94F 5KG6A 1FRHA 4QPXA 4RW4A 5A6PA 5AE1A 3DLEA 3RB6A 4A48A 2N7YA 1S6QA 2CZ4A 5K14A 5DLGA 4KFBB 4JUZA 3IAS9 4I2QB 1U2RA 4AL5A 5IT4A 3MURP 1B64A 4KO0A 2KT2A 1D9AA 1E6YB 4MIBA 5D78A 4OHYA 4Q0BA 2IC3A 1R7IA 1RTJB 2D7SA 2HLTA 5I42B 2BACA 3BDPA 1FDNA 1YGYA 4O44B 4ZP6A 4WYWA 3JB9k 3E01A 4OX7A 2YNIB 1ZTTA 2KHCA 2XBPA 5GVQA 1VBZA 1L5UA 4N41A 2PFFB 1WNEA 2MZQA 3KLIA 4DSKA 2BABA 2JOQA 2PGCA 2XI3A 1VQ8S 3K0JA 2J0XA 5EWEA 3O2IA 2YX4A 4H4MB 4Y34A 3VTIA 2FJDB 1UEVA 1LQ9A 2DNGA 5B08A 2AJ1A 1PC4A 3HHKA 4RW9A 3TUZC 4AXIA 1VBXA 1QAIA 1FJGF 2ZH3A 3CC4S 4OI1A 3FQKA 3CMAS 1FRLA 4E0DA 1MU2A 3M05A 1S10A 2ASDA 3BN7A 2AGPA 4DQPA 1N5SA 3DN9A 2ILYA 5KG5A 5FLXY 2XI2A 1H7XA 4DDFA 3I5CA 3FEZA 2KHDA 4OI6A 3KLFB 4CNZA 1S0MA 5A8WB 2XSJB 3UFCX 1N5YB 2X1FA 3I56S 3VALA 1FCAA 2ZE2B 4Y6IA 2XGPA 1QY7A 3CCUS 1X8DA 3N6LA 3B78A 1U1NA 2XULA 2YWKA 1U49A 1FEEA 4WFXA 3D28A 2ZJRQ 2XGQA 3IN5A 3D54A 2AYBA 1QSYA 3MEDB 1NB7A 1SL0A 1F5BA 1IQZA 1Z2LA 2GHWA 1KVIA 2XY5A 4MK7A 2VG6A 1TL5A 1NKCA 3RZAA 2WAQD 4OZ5A 4A46A 3Q2SC 1K8AT 5CYMB 1AUDA 2E29A 2RILA 4IQXA 2DHSA 2DGWA 4KTQA 2DITA 3LP2A 3OW2R 3D0HE 2P6TA 3SQGA 1S79A 5GAEU 3FMWA 4Q8EA 4ED1A 5A8RA 4KHMA 4LSNB 3PX0A 4USIA 3EPGA 4PPDA 3IR5B 2HIQA 4A8XA 2NPFA 1RTHB 1M90T 4LFAF 1HBOA 3RRHA 2JFDA 5LJ5Y 1DBDA 3AA8A 1WG1A 2R2RA 1AW0A 2ZH8A 2AJFE 1WTBA 1X5SA 3N5FA 3TA2A 2FVCA 3LPYA 4I4BA 1NJIT 1HMVA 4EZ9A 3MUVP 2EFQA 1VBYA 4ZP8A 1P6TA 4M5DB 2O66A 3HHLC 5KFRA 2CPXA 3AHPA 4OHWA 4A8SA 5A6WA 3MMAB 1A9NB 1IN0A 4K4SA 4ZDNA 2RU9A 2ILZA 4MKYA 1SQEA 2VFUA 3CDAA 3D1HA 3OR1A 3TARA 4EZ6A 2XS5A 2MKJA 2ASYA 3HO1A 3M2UA 4FNIA 2RKIB 1KTVA 2DHXA 1T94A 2LEBA 1HNZF 1IJEB 4WK1A 3NBPB 4HLBA 2BYCA 5J2MA 2EWHA 1U09A 3AA9A 3O8WA 2YWHA 2JLFA 3KOAA 2VG7A 2MYFA 2ZOGA 5KFTA