2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
3PVXA 5HP1B 2AX1A 2JLEA 3CJ5A 2C2DA 3D28A 4YQWA 5F8JA 2UVVA 2OPPB 4MFBA 4H54A 4IDKB 1IKYB 5DGAA 2ASJA 3G6XA 1BQNA 1S1UA 1YVFA 1S1XA 4KV8B 4Q8FA 2YNHB 4ID5A 2YNFA 3H40A 4EYHB 2UUTA 2HAIA 5C5JA 2FLNA 1RT2A 5KT6A 2FJVA 5KFEA 3QZ8A 2YNIA 3LALA 2W9AA 3DOLB 5I3UA 4QW9A 1TKTA 2WTFA 3PW4A 2ILZA 5DLGA 2IM3A 4DL5A 3M8PB 1HQUB 4NCGB 3D5MA 3GV5B 2ZD1B 2XCAA 4IFVA 1S1WA 2YNGB 5HROA 2BE2A 4RUCA 1UWBB 3JYTA 2OPSA 4O4GB 3QGHA 3KK2A 5KFAA 3N6MA 2ILYA 1N6QB 5T14A 1JXLA 3LP0B 2AQ4A 2V4QA 1R0AA 4EBDA 2JC0A 2E9RX 2JC1A 2VG6B 4LQ9A 3MEGA 4HYKA 5K14B 1VRUB 1RT6A 4XO0A 1QAIA 5F8NA 4IG0A 5J2PB 1TKZB 3I5CA 4NLTA 2C2RA 3NL0A 4DL2A 3Q8RB 2J6SA 4J9RA 1MU2B 3EPIA 2IBKA 3DM2A 1RA6A 2HNZA 1RTIA 2I5JB 5HBMB 4R8UB 3HHKA 4ECRA 4WFYA 1C0TA 3CJ0A 3MEDB 2V0NA 2VG5B 4TY8B 2C22A 3HKWA 1RA7A 2IA6A 1C0UA 2HNYB 4IG3B 1JLQA 3MEEA 1NHVA 3FQKA 5F8LA 4RU9A 3Q8SB 4MFBB 2W7OA 1S10A 4K4ZA 2R2SA 1RDRA 2B5JA 3KJVA 4MK9A 3IGNA 1BQNB 1S1UB 5DG9A 1T3NA 3G6YA 2JEIA 1S0MA 1S1XB 5KFXA 4F50A 2YNFB 2AGPA 3DRRA 2JEFA 1RT2B 3OHAA 2W9BA 1JKHA 3QGGA 3V6KA 4O4RA 2YNIB 1GX6A 2RF2A 4ZVFA 3T5HA 1IKWA 1RYRA 4O3RA 1TKTB 1CSJA 5EUHA 5DG7A 1C1BA 3NGDA 4WZMA 4ZHRA 4G1QA 1RTHA 4IFVB 1S1WB 5HROB 2F8EX 2BE2B 3GIJA 3JYTB 2OPSB 3VQSA 2D3UA 5KG7A 3KK2B 2UVUA 3PJWA 5F9LA 5KG4A 3TQ1A 5KFYA 1N48A 1S0NA 1R0AB 4NLUA 2VA3A 3MEGB 1SV5A 1T05A 1RT6B 1SH0A 4IG0B 3MECB 1LWCA 1D0EA 3BSCA 2XWYA 1HNIA 4IH5A 3DM2B 3H59A 2AGOA 2HNZB 1RTIB 3LP2B 2WCXA 5KG3A 4F4WA 3DMJB 1C0TB 3QGIA 3N6NA 4WXOA 4IRKA 2YKNA 5EDWA 3V81A 4PUOA 1C0UB 2ALZA 5J2QA 1JLQB 3DRSA 4ED8A 3T5JA 3CO9A 3MEEB 3RB0A 2V4RA 3MR6A 2ATLA 5J2NA 3CJ4A 2B5JB 3KJVB 3CWJA 2FJXA 2R2RA 3OL9A 3PW0A 3IG1A 3GQCA 3BSAA 3CDUA 3MF5A 2IAJA 3I5BA 1U09A 4MIAA 3OL7A 2R8JA 3PR4A 4K4XA 1RAJA 3DYAA 3DRRB 2W9BB 1JKHB 4XPCA 1I6JA 4DEZA 1ZTWA 3H4DA 1RT5A 2RF2B 5F8HA 1IKWB 3C6TA 4NLXA 1S1VA 4Y2AA 5CYQA 5KFWA 1C1BB 1DLOA 3RB6A 3GV8B 4ZHRB 3H5YA 3H5XA 4G1QB 1RTHB 2BQRA 5KFTA 4M94A 1K1QA 3Q8PB 4J9NA 5KFDA 4JUZA 3JSMA 4QWCA 4ED3A 3PW5A 5L1LA 1SUQA 5HLFA 1NHUA 2FVCA 3QIDA 5DLFA 3DLEA 1IM4A 4KE5A 4I2QA 3KHLA 2IM1A 1SV5B 1T05B 3ITHA 4RW8A 1LW2A 4B3OA 5KFOA 3KLGA 1LWCB 4J9MA 3NBPA 2AWZA 1WNEA 1HQEA 4ICLA 2XI2A 3UQSA 1GX5A 4ECQA 1S6QA 3PZPA 5KG0A 3I5AA 4QWEA 5L1JA 4TQRA 1XR7A 2YKNB 4H4OA 3V81B 4PUOB 2VG7A 4ZPBA 5J2QB 3DRSB 2HWIA 2R8HA 2IC3A 5DGBA 5KT7A 5JUMA 4NLVA 5J2NB 2D41A 1DTTA 1S6PA 3OLAA 3IG1B 5J1EA 2UVWA 4WZQA 4TQSA 2ASLA 2IAJB 4IR9A 3SFUA 1RT1A 3OL8A 4U6PA 1S9FA 4IKAA 3DYAB 1EP4A 4FS2A 2BR0A 4FBUA 5KFJA 4JV1A 4ECSA 2WRMA 4TN2A 2FLLA 3I0RB 2FVRA 2O5DA 2FLPA 4K4SA 1RT5B 4RNFA 3C6TB 4IG3A 3KHHA 1S1VB 3FSIA 4ZVEA 5CYQB 5KFIA 4Q43A 4EBEA 1DLOB 4LSLA 4Y3CA 3H2LA 4G3IA 2DPIA 3DLGA 4KFBA 4ECZA 4NLDA 3JSMB 2R2TA 1LWFA 4U7CA 1SUQB 4ZPAA 2R8IA 3BSOA 2WHOA 4TY9A 2UUWA 3DLEB 1KHWA 4R0EA 3ISND 4I2QB 4QW8A 5KFPA 5KG5A 3RB4A 4F4XA 4ECUA 1Z4UA 4WFXA 4R5PA 3H5SA 3ITHB 4RW8B 4KAIA 4RW9A 1LW2B 4B3OB 4ZVGA 3KLGB 5F8IA 4IR1A 3NBPB 2OPQA 1HQEB 4H4MA 3GYNA 1HYSA 4ICLB 3M8QA 2WONA 3T1AA 4NZ0A 4O3NA 5KT5A 1S6QB 1K1SA 3M9MB 3M9OB 3IN5A 1S97A 4EO8A 3QYYA 4ID5B 5L9XA 1JLFA 5I42A 5KFQA 3HVAA 2W7PA 4H4OB 5C42A 4TYAA 3GIKA 3DI6A 2VG7B 3T19A 4KO0A 4O44A 3N6LA 2WK4A 4RNHA 1RT3A 2IC3B 3IS9A 1HARA 2XCPA 4TXSA 5I3UB 3UR0A 1KLMA 5KFMA 3G6VA 4F4YA 1DTTB 1S6PB 3GILA 4RNMA 3MR3A 3PW7A 3CJ2A 2R8KA 1JLAA 4PQUA 5J1EB 2IMWP 1JX4A 3V6DA 4GC6A 2RDIA 4IOBA 3LAMA 4DL6A 4IH6A 1FKPA 2C28A 1RT1B 4JV2A 1EP4B 1C1CA 3OHBA 3RAXA 3NMAA 4WFZA 4LQ3A 5KFNA 2RKIA 2XGQA 3FDSA 2WOMA 1SH2A 4LSLB 5F9NA 1QUVA 5KFCA 2J6UA 3MFHA 3UDLA 2ASDA 3DLGB 4KFBB 3BQ2A 4ECTA 3GV7B 1LWFB 2BQ3A 1EETA 3QIPA 4I7FA 2BRLA 4DL4A 2OH2A 3C6UA 1TKXA 4Q8EA 2WB4A 5KFLA 5CYMA 4R5PB 3KK1A 5KT3A 1REVA 2I1RA 4RW9B 4NLQA 4ZP6A 4JV0A 3HVTA 2OPQB 4H4MB 5HP1A 1HYSB 4K4TA 3IRXA 3KLEA 3M8QB 2WONB 5JXSA 3RAQA 4RW4A 2IJNA 1XR6A 3KLIA 5KT4A 5F8MA 4DL3A 2W8KA 3PHEA 1JLFB 3OSNA 4DL7A 5I42B 4Q44A 4J9OA 2XC9A 4ED2A 1LW0A 3QLHA 5C42B 4IRDA 3DI6B 4YMEA 4KO0B 4O44B 3KMSA 3DLKA 1RT3B 3IS9B 4KB7A 4EYIB 1KLMB 4IFYA 4RW6A 3G86A 4GC7A 4K4WA 4HKQA 5KT2A 5J2MA 1JLAB 3HVWA 4K4UA 1W25A 3V6DB 4F4ZA 3OLBA 4ED6A 1FKPB 2B43A 5KFFA 2C2EA 3BSNA 1C1CB 2V9WA 5KFZA 3QO9A 3CJ3A 2CKWA 3V4IA 1RTDA 2YKMA 3KHGA 5F8GA 3KMQA 4K4VA 2RKIB 5FDLA 2R2UA 2WOMB 4O3SA 2HMIA 1TL3A 2FJWA 4Y2CA 1S4FA 4ED7A 2CJQA 4K50A 1HNIB 1VRUA 2QE5A 4X2BA 1S9GA 4KBIA 4ZP8A 5EWEA 4ECVA 5EWFA 2DPJA 4ZPDA 1EETB 3QIPB 1S1TA 4I7FB 3PW2A 3C6UB 1TKXB 3LANA 4NRUA 1FKOA 4NLOA 1TV6A 3E01A 1QAJA 3OSPA 3KK1B 2BANA 1REVB 1S9EA 4LSNA 1OS5A 2IJFA 2IM2A 5KG6A 4EBCA 3HVTB 3BGRA 4ECWA 1ZTTA 3I0SA 3CDEA 2BQUA 4IRCA 1N4LA 3IRXB 1RT7A 3KLEB 1C2PA 2IM0A 3KLVA 4RW4B 4O3QA 3KLIB 1N5YA 2FVPA 3CVKA 3IGVA 2W8LA 3BQ1A 1IKXA 4ECXA 4KKOA 1J5OA 3NKYA 3MTKA 1LW0B 1VRTA 3QLHB 2R8GA 4FBTA 1TP7A 3DLKB 3MR2A 2OPRA 4IQXA 2BRKA 4IFYB 4RW6B 1JLBA 2D7SA 3CIZA 5C25A 4MKBA 1XR5A 5J2MB 4J9PA 4TLRA 1JLGA 4Q0BA 2AX0A 5D3GA 5HLFB 1RYSA 1BQMA 2XGPA 1HMVA 1QE1A 4ZPCA 4QWBA 3H5UA 3FFIA 2XI3A 5KFHA 4YR0A 3Q8QB 2JEGA 3QO9B 3BR9A 3V4IB 1RTDB 2YKMB 3FRZA 4MH8A 4WXWA 4NRTA 5FDLB 4NLRA 3GIIA 4NLPA 3EPGA 4KHRA 2HMIB 1S48A 4RUAA 4OL8A 1TL3B 4KSEB 1T03A 1FK9A 1S9GB 3MECA 1SH3A 3KHRA 2FVQA 3RBDA 1S1TB 4MK8A 4MK7A 1HPZA 3LP1A 1FKOB 1TVRA 1TV6B 1JLEA 3E01B 2ZE2A 3LP2A 4NYZA 2GC8A 3EZUA 3OL6A 4ED1A 4DG1A 3DMJA 2BANB 3PJXA 4NLWA 1S9EB 4LSNB 2ZKUA 5KG1A 4O3PA 1S0OA 3BGRB 4KHMA 1RT4A 3I0SB 1D1UA 3FQLA 4EEYA 1RT7B 2EC0A 2HNDA 3PR5B 1N5YB 5EWGA 1T94A 1IKXB 1TQLA 3BQ0A 4J9SA 4J9LA 1LWEA 4KKOB 1J5OB 1DTQA 1VRTB 4ZVHA 5KG2A 1TL1A 3BREA 2VA2A 2RDJA 1JIHA 4RZRA 3BJYA 2OPRB 3KLHA 3M9NB 4PWDA 2D3ZA 3V6HA 1JLBB 3LAKA 3KOAA 1HNVA 5C25B 1MMLA 3KLFA 3KNAA 1JLCA 1JLGB 1RTJA 4RW7A 5C24A 3KK3A 5D3GB 4Q0BB 4WE1A 3RB3A 5L1KA 4MKAA 3H4BA 1BQMB 2W9CA 3UPFA 3DRPA 1HMVB 1IKVA 1QE1B 3TAMA 4QWDA 3FFIB 4I2PA 5DQGA 5KFBA 2B6AA 3DOKA 2QV6A 4XPEA 3GIMA 4WYWA 4ZP7A 2AU0A 2AGQA 3QZ7A 2HWHA 4IH7A 4YR3A 3CDWA 1S49A 3ICLA 1T03B 1FK9B 2OPPA 3NAHA 5KFGA 4QWAA 4TYBA 4ZP9A 4IDKA 1IKYA 2JEJA 4J9QA 3LP1B 1HPZB 1TVRB 3NAIA 4URSA 1JLEB 3TVKA 2ZE2B 3ISNC 5KFRA 4KV8A 5L1IA 2YNHA 4DG1B 4QPXA 4ECYA 4URQU 3V6JA 5KFUA 1KHVA 5DG8A 1RT4B 3H98A 4PQUB 3DOLA 2HNDB 2UVRA 4NLYA 2J6TA 3SI8A 4J9KA 3M8PA 1HQUA 4NCGA 4Y34A 4O3OA 2ZD1A 1LWEB 5KFSA 5DQIA 1DTQB 2YNGA 2E9ZA 4Q45A 1UWBA 4O4GA 1TL1B 4RNNA 3T5KA 4YR2A 3T5LA 5DQHA 4WYLA 3KLHB 3MFIA 1N56A 4PWDB 1N6QA 4ZMMA 3LP0A 4ED0A 1HNVB 1NNDA 4MIBA 3I0RA 3KLFB 4RNOA 2VG6A 4YP3A 2GIQA 1JLCB 5K14A 3DDKA 1RTJB 4RW7B 5C24B 3KK3B 5J2PA 1TKZA 2GIRA 4WE1B 5KFVA 5KFKA 3MR5A 3SFGA 2W9CB 3DRPB 1MU2A 1IKVB 3TAMB 4I2PB 3E51A 4M95A 4NLGA 2I5JA 5HBMA 2B6AB 3DOKB 4NLSA 5CYMB 4R8UA 4FS1A 2E9TA 4K4YA 3MEDA 2VG5A 4TY8A 4EO6A 4URGA 1ZETA 2FVSA 2HNYA 3RBEA
chains in the Genus database with same CATH superfamily
5HMWA 1SC3B 1U0HA 4IDKB 2A6OA 5B0AA 1FFSB 5ETRA 4Q8FA 2HAIA 2EFQA 4Y00A 4X66F 3QZ8A 5I3UA 2F1FA 4K2JA 5IQQA 3J80U 1TUVA 2GVZA 2HZCA 3GJSB 1WF1A 3RGIA 2G13A 4B9NA 2E9RX 1VRUB 4CO4A 3ILOA 4LF9J 3J7YI 4TY8B 4JYAF 1G1XA 2AJQA 1YJ7A 3Q8SB 4MFBB 2B5JA 2YXLA 5DG9A 4WP9A 2KRRA 2R7XA 2HGLA 2X1AA 1JKHA 4ZVFA 4O3RA 1V9OA 2CPDA 4N8OA 2OPSB 2UVUA 1NK4A 2I9SA 1N48A 2OEJA 5LMUF 4RX6A 3DLJA 2ZBPA 3DFEA 2GZOA 3T6JA 4WCEQ 1V5IB 4ZVPB 2HNZB 3M7VA 2HHWA 1JLQB 4ES2A 3CO9A 2MLXA 3RB0A 3C66A 2FJXA 2DR6A 1UAWA 1R8BA 1RAJA 4XPCA 2KU7A 2W24A 4FDFA 2VDHA 3LW5C 1VBKA 3QAUA 4ZVSB 2MPUA 1NHUA 1IBKJ 2N3LA 3M4XA 2CQ2A 3ZXWA 3I9V9 4FYWB 1DBDA 5GAHI 2RD5C 2W4PA 4C7QA 2YKNB 3MR7A 5KOXA 2CQGA 2DNZA 4C8MA 5DGBA 2P9CA 2D41A 2MMYA 4ES3A 4LVNP 3T1YF 4OQJA 1PBUA 1B64A 3NXZA 3ILLA 1S1VB 2YH0A 5T7LA 5L39A 2YX4A 2Q6CA 4ZPAA 1NJWA 4ZCMA 2WHOA 2ZZMA 3DLEB 3IBCB 4ECUA 3KUHA 4IR1A 4B3OB 3GR1A 2KM8C 4Y28C 2UV8A 1T9TA 2WONA 4QR2A 5KT5A 1OY6A 2XY7A 1KD1T 4O44A 3UN5A 3IS9A 3UR0A 2P6TA 1DTTB 5CD4A 2VKRA 5J1PA 4IH6A 2BE9B 2FIUA 8ATCB 2MLYA 3I96A 1KQKA 5KFCA 4DPUA 3CMES 4M5JA 3C6UA 1TKXA 4Q8EA 5ETQA 1GAOA 4PYAA 1EX8A 1HYSB 3TNVA 4DV7J 4V19J 3I31A 4TU8A 2W8KA 2BJ3A 3ZZZA 4YDDB 4PG5A 1NH8A 1F1BB 4IFYA 4FNHA 4I69A 2P9EA 1U1MA 3Q83A 3PO4A 2UZAA 1NPPA 2CKWA 1SIWB 2AP6A 1ZH5A 2DH9A 1M90T 1S4FA 2XSJB 4DSFA 2DRAA 2QL9B 1NRKA 1EETB 2UXBJ 1S1TA 2VKZG 5EX3A 3VAKA 3GONA 3NMRA 4F7VA 2PMZD 1OS5A 1RJJA 3HVTB 1FNOA 2HFUA 4DSKA 3PKYA 2IRUA 2JDJA 1X9SA 4RL1A 2PMHA 4LVOP 1S7IA 3DRYA 2DGTA 3FFIA 1NK7A 1OPIA 2RRNA 2XQCA 3EPGA 3OT9A 1MWYA 4B3MF 2C3OA 3RU0A 1FNXH 2ZDPA 4AL5A 2NSCA 1FKOB 1TV6B 4DSJA 3DC2A 1WTBA 3NCRA 3C19A 4LJMA 1FA0A 3BGRB 2UU9J 1RT4A 1CJUB 3JSYA 4J9LA 3W2VB 3MPYA 3Q2SC 3CCZA 4NE9C 2LXIA 3RYLA 4I2PA 3DOKA 1ACMB 1VR6A 4JI6J 4YR3A 2OHDA 3HHLD 4F4AA 2A2DA 2OPPA 4QWAA 3W7BA 2CXEA 2V4JB 1UZHA 1F5AA 3L95X 1H72C 2DEIA 2YBVA 2VFUA 1X0FA 3T5KA 3Q89A 2UV8G 2FHKA 2RJZA 4LFBJ 5DJBA 2E9TA 4URGA 2W2PP 4YQWA 2V69A 2XS2A 2ASJA 5KFEA 1M5OC 2QA1A 4B9LA 3OVBA 3PRVA 2OJ3A 2JLFA 1O0PA 4WK1A 1UWBB 4QJVA 3J7YU 3N6MA 1SJ4P 1U4BA 5JVHQ 3JAMU 2RE1A 5HBMB 2UXCJ 2C22A 4N76A 3AA9A 3X3UA 1RDRA 1O5JA 2VPYB 1EARA 3HHLA 4F50A 1CJTA 1FTRA 5E2QA 4OZ0A 2M0GB 4C0HA 3RRGA 3AH6A 3IWLA 2P6SA 5AE2A 3HSGA 4DFPA 4LFAF 2V8GA 2KHDA 3HP6A 1F2GA 3M6VA 4ZLJA 3GR0A 3MAAB 3MECB 1H7XA 3PIOQ 4A8KA 1YJNS 1R89A 3OTBA 1WHXA 2I0XA 4KGXB 4K0KJ 2GO8A 4CZCA 3BBFA 3QFWA 1C0UB 3R5GA 1WEXA 3AJ1A 3OL9A 2EG2A 2QX0A 3Q24A 3H5XA 3O3LA 1YDLA 4C0BA 2COLA 3T9NA 5GAHU 4DQSA 3MM8B 2Y1LB 4DPTA 5KFOA 2VFRA 2AD9A 1YJTA 2IVFB 4QWEA 4ZPWR 5LT5A 3V81B 1OYEA 1B7FA 2FTRA 5D4NA 5IT0A 3QFHA 1A9NB 4CRJA 2V2KA 2BOAA 2CFXA 2FLPA 3QJLA 5KFIA 2VL1A 1VQSA 3NS5A 1FNMA 3MPDA 2DPIA 4ECZA 2HHHF 4U7CA 1RWNB 2XLKA 4F4XA 2B9WA 2KO1A 4Y2MA 3GYNA 3D1QA 4DX5A 3M8QA 4DLEA 3BYPA 4JI7J 1R0CB 3GIKA 3T19A 2WK4A 1CG2A 1F5CA 1N5SA 4IOBA 3LAMA 1S79A 2GV1A 4M8LA 4I6YA 2VFTA 1NEEA 3OTDA 1YGYA 3AAWB 1R31A 4R5PB 4JV0A 2DGSA 2HRUA 2LU2A 4L6V3 2W4DA 4BBYA 1JLFB 1SJ3P 2DNNA 3KMSA 3DLKA 4P6QA 3WIUA 4RW6A 1X4FA 3JXOA 1B99A 1JLAB 4JI3J 4K4UA 4OV1A 4JB8B 5A0YB 3P5TL 4DPOA 2OIHA 3NOCA 4F3QA 1HNIB 2F9DA 1QLNA 1YG0A 3EGWB 2KL8A 2CG8A 4HT7A 3KK1B 2ZH1A 3FSXA 3OBIA 4DBQA 3BBBA 1NDCA 4BCAA 2ZHOA 3IRXB 1BY9A 1NKEA 4RW4B 4ED5A 3SCJE 1VC0A 3NKYA 4FPRA 1NDPA 2OPRA 2MYFA 5J2MB 2XMVA 4QR1A 1DQ9A 2HG4A 3PACA 4QWBA 4A8OA 4PWUA 3VV2B 1T8EA 2YKMB 1SBRA 4NLPA 4B3SF 1S48A 1X4GA 2K1RB 3HHDA 1CVJA 5AXLA 3KHRA 1QUPA 1SJRA 2YWKA 3E01B 2GQ2A 3EVOA 2ZKUA 1F9EB 5HL7Q 2G1DA 3I0SB 4LRCA 2ADCA 4PG7A 1LWEA 3SQOP 3TRGA 3CJQA 2SXLA 2E5JA 4RUHA 4ZIWA 1U45A 2MZJA 4QCLA 4P9SA 3ICLA 2ZHBA 2PFFB 4C8KA 4TYBA 2KJVA 3NAIA 1T9XA 3SSQA 3MZIA 2KXHA 3DOLA 4X4OA 5MAOA 1RE1B 2RVJA 4PR6A 3ILJA 3FUYA 4NEYA 1SJQA 2VG6A 5IZHA 4YP3A 1EZZB 2GIRA 1Q1KA 3DRPB 2BM0A 2R7SA 3HF5A 3AODA 2DTJA 3RRKA 1K9MT 2HVDA 3D28A 3OUYA 1F2HA 4ZK7M 5B0GA 5DGAA 1BQNA 1KOOA 1VS3A 4RBUA 4QU7A 1B4SA 3M8PB 5HROA 3QGHA 4PWWA 5JMNA 2DH8A 2XYGB 2UXBF 3HDSA 5E3RA 2G2OA 2J6SA 1FFWB 2EFGA 3MM6A 4UT4A 2D69A 4QU6A 4FXDA 2HNYB 4K8RA 1U0HB 4BC9A 2GHPA 1RKJA 4QIWD 4ELVA 3VGUA 4F0MA 2GVZB 2DKOB 4FKXA 4C8LA 4DCJB 4JI8F 4N77A 1HQ2A 5AXMA 3O5TB 1QY7A 2FYXA 1LWCA 3HVRA 3I6PA 5K5MA 3VZHA 1B70B 2WCXA 2UU9F 5KG3A 2XY5A 4PUOA 1VI7A 1HLWA 2V4RA 2B5JB 5F41A 2IAJA 2C3UA 1Q5YA 6FDRA 1JKHB 1S7HA 3M2RA 4YS2A 4Y2AA 1DURA 3P8BB 5KFWA 1F3VA 3G8QA 4X65F 4DV2F 1HBUA 2BQRA 4B9SA 4YN3B 4JI6F 3PXGa 2XS7A 4I2QA 4HH0A 1U2RA 3GPAA 2IRXA 1HQEA 4ICLA 5DZ7A 3PZPA 5CXTA 1T7PA 5K8OA 3VAGA 4ZPBA 1P9QC 5GAGI 3FBEA 4M5MA 5IT9U 1LXNA 2V94A 4B9MA 2N4CA 4TN2A 5CH7B 4LFBF 3Q86A 3TAQA 1SPBP 3CCQS 2E7VA 1WI8A 4GVLA 1LXJA 1X60A 3VGVA 3D66A 3EVWA 4ZVGA 4DR7F 2HQFA 4Y6IA 4H4MA 3M9OB 3FEZA 1U8SA 1OO0B 4MYTA 2CQ1A 3EZOA 2ZWOA 5KFMA 3G6VA 2YQ0A 2VC1A 3A8JA 5ITHA 5D8HB 5D0GA 1NU4A 4X4UA 4JI4F 3HSJA 2QLBB 3VR1A 2GQCA 4A4JA 4DV5F 5T7LB 2UXCF 1UW4A 2DR7A 3GV7B 3MM5A 4I7FA 3ZTPA 2LU1A 3CXCR 1X0PA 1RAHB 4DQRA 2EKNA 1UW9A 2HVHA 2WONB 3AHPA 3ZZPA 3R9LA 4DL7A 4O44B 3IS9B 1NLKL 2BA9A 3A4TA 3PYFA 3WX4A 4DZDA 5KT2A 4DV4F 3PYGA 1RWWB 3BR8A 2R2UA 2IVYA 3C14A 4K0KF 3CD0A 1VK8A 2KTQA 5EWEA 4DJBA 3C6UB 1TKXB 2CQDA 3W64A 2GS8A 3R2DJ 3O2IA 3R27A 4A8SA 4EBCA 1IXKA 1FWLA 3UN2A 3CPWR 1QM9A 3BQ1A 4ECXA 3EM1A 4ANDA 4JV5J 2EKYA 1WACA 2QFIA 4IFYB 4KJIA 1NCLA 4XIUA 4DOZA 1RYSA 1HMVA 1QE1A 3H5UA 2G1HA 3MXHP 2XNRA 2XZWA 4P7TA 1KWMA 1RAGB 3R5CA 2FVQA 2M9KA 1S1TB 4MK7A 3L3CA 3CF5Q 3EZUA 3VQTA 1KQGB 4EU0A 1D1UA 2EC0A 3T6BA 2HK3A 3D9BA 3BQ0A 3BREA 3ZNUA 1JNZB 4CH1A 1HNVA 3UCUP 3KNAA 2KFYA 5JJBA 3TAMA 3FFIB 3MEKA 1R43A 2ZOFA 1WOOA 1MW7A 4FKYA 4JI1F 1WI6A 1Y3KA 1RT4B 3TZZA 2J6TA 1NXIA 5I3QA 4J9KA 4Y34A 8AT1B 2GQQA 4CLYA 4PAAA 2L41A 4ZMMA 5ETPA 1JXVA 4DS4A 3BGOP 3H25A 1HBOA 4I2PB 4R8UA 1V6HA 3DOKB 4NLSA 4K4YA 1IVZA 2X1BA 2B4UA 1KNZA 3CJ5A 5K8MA 2OPPB 2YVSA 2PSZA 2CQCA 1Z2LA 5D0HA 2GMLA 1U1RA 2FLNA 2L9NA 2FJVA 3BDEA 2W9AA 3LGHA 2F4VF 5DLGA 3KK2A 5A2QU 1FI4A 1R0AA 3MCNA 1FJCA 2XMJA 5CZXA 1TMJA 2P2CB 2LECA 3GSDA 4PABA 3M8SA 3PEJA 2R2SA 1G3OA 1R0BG 3AD7C 2BW2A 2JEFA 1UFKA 4LREA 3V6KA 4OI6A 4DPYA 3MCOA 1GX6A 1YQHA 4WZMA 4ZHRA 1RAAB 4XAKA 3CNQP 2E7XA 3VQSA 2CQIA 3NS7B 3LQVA 1T05A 4KPCA 1RBLA 2CPIA 2CPJA 5BR8J 1MROA 1NSPA 2BMBA 4LF8J 4EWTA 4A8YA 2HURA 1UZDA 2JWNA 3MF5A 3HHLB 3W60A 1CJTB 4ER8A 1TK8A 2F4FA 2VASA 1DLOA 4QYZK 3GV8B 5KFDA 4BWMA 1SUQA 3JQJA 3W9IA 1SI9A 2W2OP 5D78A 1K0VA 1BHNA 2G9OA 4ECQA 3QATA 1IWGA 2MY8A 1B0PA 2RRAA 2KVQE 3W8PA 1S9FA 3R3TA 4EBEA 2B56A 4LSLA 2A2CA 2ZH8A 2CADA 1UL3A 1QVFR 4CO1A 1A7GE 2E5IA 4X4SA 2K2PA 2VFSA 1Z4UA 4YY3J 2EFPA 2UUBF 4CM0A 3ZNJ1 1YZ7A 4ID5B 3IFEA 1REGX 2EBEA 1XBWA 1HHTP 2ZDOA 4GC6A 4JV2A 2F5GA 4ZN1A 1HNZF 3BKFA 3FCHA 3ENQA 3GE9A 1MWQA 2J8SA 4GKKJ 3QIPA 4DL4A 5G4DA 3KLEA 3M8QB 4J9OA 4ED2A 4IRDA 3K7RA 3QLHA 4WK3A 2CRLA 2OEKA 2HQGA 2CYYA 2AEJA 3VAMA 2L9WA 3GTYX 3SYZA 3V2UC 4ES1A 4F2RA 1M1KT 2QA2A 1RACB 3IWXA 1XWLA 1S6UA 4ZPDA 3M2UA 1UVKA 3H7HB 1SKSA 2DNGA 4A8QA 2IJFA 3FJ2A 4O3QA 4U8YA 3DLKB 4IQXA 4RW6B 4USWA 1XR5A 4FZVA 1HWJA 4U8VA 4J9PA 2C2OB 5FJ4A 5HLFB 3C15A 5KFHA 2YH1A 2GMHA 2V68A 4NXNJ 1IBLF 3SIPB 3THTA 4NRTA 3VGSA 2UUAF 4KHRA 4RUAA 2C3MA 3MUTP 1VGYA 3RBDA 2KT5A 1IN0A 3PJXA 4USKA 2OD6A 1WKLA 4BDPA 4DZ6A 4OHZA 5EWGA 3G96A 3PIPQ 2OPRB 3KLHA 3K59A 3KOAA 3KTQA 4E2FB 2AT1B 1HNXJ 1OJ4A 3CDWA 4DR4F 4DLGA 4Q5VA 2M2BA 4C97A 2HVIA 4GVBB 2Q66A 3QWPA 1FJ7A 1D09B 3CCWA 2MQQA 2P5VA 1YJWS 1RAOA 3A1YG 2DGQA 2HZVA 3TO8A 3AB2B 2LQ8A 2ZD1A 1LWEB 2E44A 1WORA 3F44A 3LP0A 5BYQA 4RNOA 2QMWA 3P45B 5J2PA 2QT7A 1TKZA 3DGVA 3M6XA 4UOGA 4OYPA 1ELOA 5HQMA 1X8DA 3PVXA 5HP1B 3K57A 4LUBA 3H40A 1BQXA 5M2PA 2AYBA 3LALA 3DOLB 4QW9A 2VHGA 1U6BA 2JHEA 4OJ3A 7FD1A 4P52A 2CAJA 3CTRA 1N52B 4EBDA 1Q8KA 2JC0A 2VG6B 5CABA 4FF2A 1GMVA 3IRWP 3I82A 1T3OA 3QMQA 4LSZB 2DB1A 1G2EA 3MOJB 1HWKA 2IA6A 1P27B 4FPIA 1XEZA 1NHVA 3OUYB 4RBTA 5CCMA 1BQNB 4CO5A 4PPDA 2ZH2A 2RF2A 4RWXA 5EUHA 1C1BA 3UWTA 5HROB 5IOLA 2Z30B 4DSLA 4DPWA 3QT5A 5F9LA 5ETOA 2C2NA 4MMOA 4C11A 2V34A 3CCRS 2WVFA 2CVIA 3W5ZA 2YWGA 4FYXB 3MM6B 3CCSS 4DL0C 4AFFA 4X4VA 4UY85 4ED8A 3OR1A 3VZIA 4E0DA 4B9TA 2C1EB 2FHOB 1X4DA 1IQTA 1RISA 4OYBA 3R5BA 1R6YA 1R6VA 4WP3A 3JSMA 3P3DA 3S6EA 1BGXT 1LW2A 1LWCB 1ZA2B 5HJYA 1NSAA 1F9HA 2VONA 4QYZJ 3I5AA 2FHMA 3TJAA 4PUOB 2R8HA 5KAKA 1H38A 3M8ZA 3G8TA 3FBFA 1CPZA 2IAJB 2BW7A 2MQPA 4FYVB 3M2RB 3FSIA 3ADAC 3EJMA 1FRMA 2XYPB 2FY8A 1HBUB 3MAHA 4AXIA 4P73A 2KXFA 1D9FA 4LF7F 3RTVA 1T95A 4I2QB 2ZBCA 4ILLA 2IFXA 1A0OB 4UW2A 3AB4B 1N32J 1HQEB 3HX9A 4ICLB 4YB1P 3T1AA 2VQEF 4TU9A 2HEKA 1K1SA 3BBCA 5KFQA 4FF4A 3HFKA 4RNHA 1R8AA 2G0IA 1RHRB 3CJTA 3VHQA 2JX2A 2HHSA 1RU2A 2JLGA 4DUZJ 4WBFA 3H20A 4USMA 2RKIA 1UEKA 2VC0A 3U1NA 2EC2A 4ANCA 2CUYA 2ERRA 4P2MA 1Q8LA 4X62F 4UOFA 1REVA 4N5SA 4TNOA 4H4MB 3N01A 2F40A 4RWWA 2KDOA 5C2CA 4YMEA 3AQOA 3IWNC 1SVDA 1XNQJ 1C4CA 1U25A 2V5HG 1NKBA 2DITA 4F4ZA 2VDIA 4ED6A 4QR0A 1YK9A 2LLZA 3CJ3A 3GP9A 1Z2ZA 4ZCIA 4C48A 4PYDA 4AT1B 5D0RA 1DFDA 1VRUA 2PIIA 3M8YA 3MM5B 4I7FB 3D67A 4LR7A 3HHNB 4EGLA 2LEAA 2FVPA 1UEVA 2Z57B 4QBUA 4X4PA 1T9VA 1BD6A 4FBTA 4B3RJ 4I6AA 3BN7A 4JI5J 1LV5A 3BKTA 4Q0BA 1BWVA 3PO5A 2Z2ZA 3Q8QB 2AZ1A 1U6ZA 5DO2A 1RWVB 1SL1A 5KTQA 4UOHA 3AJDA 3C14B 1H2UX 3OTEA 3K8WA 5CAAA 2RIJA 3P96A 1VCTA 3CMAS 1I1GA 3HPOA 4NXMF 2LFVA 4ILMA 1DAXA 4DU7A 5LSOA 1VQPS 4CH7A 1U0SA 1WKKA 2YQ1A 3BGFA 1LK5A 3BJYA 2VZ9A 2VPZB 2J0WA 1OSCA 1N34J 1HMVB 1QE1B 2HVZA 2H5JB 4KIAA 5KFBA 3MD3A 5EN1A 1ZOTA 4NPOA 1RCOB 2I38A 3R5DA 3A8KA 1NZAA 1IKYA 3PTWA 4DUTA 4J9QA 3MCMA 3ISNC 4KV8A 2YNHA 2YY3A 3HT0A 1JQGA 3VAIA 3DCAA 4DV1J 2Y1JA 1XTZA 3K5PA 5ETSA 3FKBA 4RNNA 1T0TV 4AQYJ 1SCJB 3ZTRA 3M32A 4WYLA 1N6QA 2W2QP 1HNVB 3A8IA 5K14A 3TAMB 2I5JA 1FDDA 1YX2A 1VQYA 2O3DA 3B54A 1YBAA 3G6XA 2FJDB 5GMEA 3UFCX 3KYLA 2ZH3A 1TAQA 2ASYA 1V3ZA 4O23A 2ZNYA 3BKUA 4IG0A 2VODA 4R8UB 1WHVA 2GW8A 1S10A 4RU9A 1TZ0A 5H1SV 4CLWA 4CDIA 2QO3A 2DGWA 4GKJJ 2XSFA 2MQLA 3OHAA 2V9KA 3GU0A 1RYRA 4LBIA 3SSSA 2D3UA 3KK2B 3TA2A 3TQ1A 5KFYA 1R0AB 1M5KC 1FDNA 1FRHA 3DDNA 4IH5A 3H59A 2BOPA 3ILIA 1E6YB 2VPXB 4O0NA 3DXSX 2M52A 3AD8C 4ZLPA 3T5JA 3I4PA 1JJCB 3CJ4A 1ZM9A 3IG1A 3RJMB 1BLUA 1YRTA 4WPAA 5GAEU 4DEZA 4CLFA 3MAQA 1W7WA 4OZ1A 1SKWA 4KGZB 5DM7Q 4ZHRB 4ZDNA 3RG6A 3AXMA 4X66J 1VDHA 1X4HA 2DNPA 3UVJA 1T05B 3DOMA 1MROB 1QAYA 3DHXA 2YPYA 1VOMA 4ZITA 2IC3A 2C2KB 1FDAA 3ISZA 1NJIT 3DNCA 4NMXA 1L3SA 2HSEB 4FS2A 4QIFA 5SUHA 4HVZA 1DLOB 3V5RA 4KFBA 3AD9C 2P9GA 1SUQB 2AJ1A 2ZITA 3ISND 3HXMA 2X51A 1HI1A 2LKZA 1CEZA 3TZXA 4C2MA 4IOCQ 3DI6A 2BXJA 3DLLQ 3RUBL 1GH8A 3CJKA 4A46A 1TL4A 2ZHAA 2R7UA 1UJ6A 4WFZA 4LQ3A 5F9NA 4LSLB 2MEWA 4NA1A 2HRTA 1EHWA 3HT3A 2H9ZA 1ZA1B 2HLTA 4C8OA 5KFLA 2HVEA 2Z0GA 3TUIC 1SXLA 3PHEA 3OSNA 2Q1LA 3HI9A 3HVWA 4QZVB 2N4DA 3FMBA 3I4HX 3KHGA 2DNYA 4ETXA 3T1YJ 4K7QA 2HMIA 3GCWP 2RDDA 5GMKa 1TL3A 1RADB 4N7TA 1M0SA 3CCMS 3QIPB 4L75A 1WF2A 2J0SD 2XS5A 5U47A 2M8DB 5FIIA 2K3KA 1Q7YT 1S9EA 4C8YA 3HD2A 4FP9A 3KLEB 4B02A 2IM0A 1IKXA 3QLHB 1AFJA 1O8BA 4YB6A 5AE1A 9RUBA 2PO4A 5D3GA 1X9WA 2XI3A 1KC8T 2HBQB 4OL8A 3MECA 3M2UB 1WG1A 3OPKA 4DV6F 1NK6A 2XMKA 4YFUA 3D4JA 2V2ZA 2YKAA 1URNA 1Y7PA 5E33A 3C15B 3MMBA 3GIMA 4F26A 4WYWA 4OX7A 3QZ7A 4KYZA 2HIQA 5K8NA 2HYIB 4CO3A 1UVMA 4M5LA 5T41A 2M5YA 3TVKA 4ZJLA 2IYGA 1XNRJ 1KHVA 2KN4A 4XDDA 2GO9A 3H98A 4MKVA 4PQUB 4R0JA 5RUBA 3N4WA 3SV3A 4NCGA 5KFSA 1HW8A 3VAHA 3QRRA 3KLHB 3HSDA 4UF4A 3AJ2A 2AEFA 4L73A 3C2PA 4LF5F 5CYMB 1XERA 4J5OA 1CJVA 3GIJA 2NSBA 3W62A 4H54A 3WIVA 4L3KA 4G1PA 1JXEA 3DHWC 2A3JA 2IHR1 4B3MJ 5C5JA 1G7CB 2H48B 2WTFA 1T9UA 5D77A 3GV5B 2ZD1B 1KP6A 1YTYA 4IO9Q 1NAQA 3LP0B 3W3SA 4UQGA 1Y4ZB 5J2PB 1TKZB 3Q8RB 3NCPA 1BC6A 1U7LA 1OMSA 1J27A 1R8CA 4QYRA 2BX6A 5F8LA 4M1KA 1ZPWX 4B3RF 4LRFA 3SBMA 4RUBA 1FTCA 2ZOMA 2JEIA 1S0MA 2A18A 1VC5A 3HFZB 3Q23A 2E5LF 3DRRA 2HK2A 2CNNB 3QGGA 4PRFA 3A8EA 4ANEA 4YEAA 3LTOA 2F8EX 2PEHA 2ROPA 1DY3A 2JL9A 8RUCA 5KG4A 1S0NA 2LEPA 3JQMA 3VAFA 2FZKB 1N8RT 2G0CA 3IMQJ 4CLKA 3LUYA 1HNIA 2AZ3A 2AEMA 1WG5A 2H51B 1FRIA 1FVQA 4RKUC 5F0WA 2DIUA 5J2QA 2QFJA 3D0HE 2CPFA 1GXTA 2DY9A 3PW0A 4C3KA 2MLZA 1VLOA 3PX6A 1KN6A 1WSRA 4K4XA 2OUGA 2Y9HA 3EVMA 1D8YA 2RF2B 5HN0A 2E7WA 4CM2A 1C1BB 2JRSA 4KTQA 2LXFA 3EDRB 3SMZA 1EKSA 4C11B 3ITHA 2G2ZA 3TOQA 3QBCA 1OQ6A 1WNEA 1S4EA 2K1RA 5L1JA 4WU3A 1HWUA 1X4CA 1SC6A 3OR1B 5KT7A 1F9FA 1QSLA 4AQYF 3HJFA 2G2YA 4WZQA 1U1KA 1ZM2A 2QTWA 1KFSA 4IKAA 2YKQA 4ENOA 3TANA 4FN5A 1NZ8A 2MQ8A 3H2LA 2KG0A 3JSMB 3VVUA 3CIMA 2HLUA 4TY9A 4DSIA 2IDLA 4V1Ak 3UD4P 2F63A 1LW2B 3EDQB 4EUVA 3PJ9A 3MGJA 4LFAJ 1S97A 2AKWB 4DMZA 2W7PA 1RSCA 1HARA 4Q2MA 1KLMA 2HFVA 2R8KA 3BPDA 2ZOGA 1ZZFA 4F3MA 4U9RA 2BRLA 4OZ5A 3FVYA 1Y3JA 3CCJS 1U2CA 4GKJF 5LMNF 4DL3A 3D3BJ 3TA1A 2NR0A 3EGVA 2HHTA 1X4BA 4I1TA 2ZZTA 2BKPA 4MKYA 2LXUA 3PM9A 1YZ6A 3QO9A 4CI0B 3V4IA 1IR2A 5G0RA 3SQGA 5F8GA 2RKIB 5FDLA 1SKRA 1KTVA 4KGKA 2DPJA 3VF0B 3M30A 3JS9A 2I2YA 2DYAA 1Q53A 2ZUAA 2J7UA 2MJUA 2BANA 1U48A 1REVB 4LSNA 2HHHJ 2F7VA 5KG6A 5B08A 1ZTTA 1NDLA 4EK2A 3PHTA 3VGTA 1GK8A 2OSQA 5E41A 2WVBA 3D6TB 1VRTA 1EAYC 1Q8BA 1TP7A 1VRQC 3L4BC 5GADU 1M1GA 2ZH4A 1AUSL 1Y11A 1BQMA 5HVGA 2A6MA 3MPWA 3GIIA 3B82A 4W98A 2QSFA 3CJ8A 1B7YB 3UD3P 1WTFA 2X3GA 1N5VA 4WFAQ 5E3QA 4DG1A 3G8SA 3N5BA 2VIHA 3SSRA 3ZTOA 4EEYA 3LGMA 1T94A 4ZVHA 4WJBA 4Z2XA 4J9VA 4N47A 1CQNA 4RZRA 4PWDA 1OYDA 3OV7A 3BYRA 2L3MA 4X64F 2YWFA 7AT1B 4HHUA 3BPSP 5C24A 4Q0BB 3D6HB 5D4PA 2HKEA 2GFFA 2H4WB 4XPEA 2HQCA 3U1LA 2YKOA 1MLAA 2ALYB 4NA2A 4ECYA 4QPXA 2BACA 3EMTA 2HHPA 2C3PA 2IPOB 4Y2IA 2DNHA 1NNDA 3MWBA 3OXGA 1HIYA 3IC1A 5K8PA 3NY0A 3GZ7A 3TUPA 3FCWA 5HMYA 3E51A 2CNLB 4KH1B 3MEDA 3PFOA 4ILRA 4CLTA 3J7AN 2JLEA 1VQ6S 1PC4A 1FHTA 1IKYB 2VBYA 3IR5B 4ZS6A 2H4YB 4B3SJ 1S1XA 3G71S 4KV8B 5K9FA 2YNHB 4EYHB 4DR1F 1RT2A 3FEXB 1VIXA 2YNIA 3HHLC 4NMLA 3AOCA 3G6ES 1Q7LB 4IFVA 2RSQA 5IS2A 1XMOF 3IO1A 1GTEA 1D9AA 3M32B 4E98A 3R7SB 1N6QB 5T14A 2AQ4A 5F3ZA 3MEGA 5K14B 5F8NA 2MXYA 1RXOB 2V6AA 2DD8S 3NOGA 2XLIA 2I5JB 3HKWA 3S7RA 2WZ1A 2FUG9 3FQKA 3TJ8A 2DISA 2WB1D 4PXCA 2QL5B 2HIYA 4O4RA 4TVAB 2KZZA 2VB6A 3E8OA 5DZ6A 3PV8A 5B09A 3CCVS 3R6GB 4ELTA 3ZZUA 4P2FA 2PI5A 3FK4A 3PJWA 4CH0S 3R5AA 1SV5A 1HI0P 4IG0B 2XWYA 1LNQA 4F4WA 3QGIA 3N6NA 4IRKA 3W61A 2DY1A 2EI5A 1OSDA 2E5GA 5J2NA 2R2RA 1KDNA 2MB0B 3B78A 1Q86T 2VBXA 3PRDA 1RT5A 3DU5A 1RP5A 1UVJA 5J1NA 1K1QA 2FVCA 3VWSA 3SCKE 4KE5A 4N41A 1U02A 4FXVA 1YLXA 2AWZA 1XNRF 3UQSA 5GVQA 3IAM9 4BLGA 4HDHA 3IG1B 4ECSA 1VBXA 2ZNZA 2OTJS 3KHHA 1KONA 3N0VA 3DLGA 2Z8QA 1LWFA 3VALA 1VMBA 5KG5A 3RB4A 1C4AA 3I87A 2N7CA 3UVJB 1KVIA 3DOMB 1MNEA 1WDDA 1PAEX 4JI8J 3M9MB 3IN5A 1S77D 2DNKA 3V4MA 1S57A 4DN0A 3IM9A 2IC3B 1NSKL 2NQPA 2C28A 2FGOA 1UVLA 4HTJA 9ATCB 2KKHA 2EBGA 3EE3A 1WC1A 4A47A 5KFNA 4C4WA 3P6YC 2Q79A 2J6UA 3W9JA 2PA3A 4KFBB 2VUGA 2BQ3A 2W01A 2B0GA 1IUJA 3S8SA 1N36F 1DQ8A 1X7VA 4X65J 4DV2J 1FWPA 4NLQA 1M5VC 3DGPA 3B4DA 3FBCA 5I4MA 3WC0A 3DRXA 3IP0A 1U24A 5F8MA 2MJNA 3DI6B 2QLWA 4OX9F 5D0EA 1F3FA 2V8DA 3G86A 2OMOA 3CJKB 5BJRA 4M5IA 2ZH5A 1X9MA 1W25A 1LWXA 2GX8A 4Y2CA 3NEKA 1Q79A 4S0MA 4F36A 3TVZA 4NEZA 3GSIA 2V8HA 2MQMA 3GG1A 3KLVA 3MUVP 1PILA 2IJRA 4V19X 1Q95G 5LSLA 3TVYA 4DR7J 4F4KA 2WSCC 4DPXA 4C3MA 2D7SA 4UZCA 2RS8A 3HZGA 1S99A 4CO0A 3NNHA 3CT9A 5IV3A 3UCZP 3POTA 3OVAA 4OV6A 2ABYA 2HS3A 2HMIB 2V50A 1TL3B 4JI4J 1SKUB 2RMLA 4ALZA 3M2VA 4ECVA 4LF4F 4DV5J 3OL6A 1S9EB 2RUSA 1UVIA 5KG1A 2FLOA 4C0OC 3WX8A 1HHSA 1X4EA 3F0NA 4DDFA 1IKXB 1NJZA 4C9DA 4L74A 1H7WA 5CZVA 5CCLA 2VA2A 2CPYA 3M9NB 1FWKA 4DV0F 1MMLA 4ZJOA 1ZS6A 5D3GB 2W9CA 1IKVA 3J81U 1KR4A 2RUGA 3WZ0A 1MMDA 3W2WA 4DV4J 1YJRA 2ZJRQ 1SQGA 3I56S 3QJJA 4A8XA 4OYZA 3MDFA 3BF4A 1R8PA 4X4NA 2KRBA 4MT1A 2AJFE 1HNWF 3GYXB 4OYXA 1HQUA 4ZPTR 2ZKTA 2XEXA 4F2SA 1R27B 2OI2A 4MIWA 1UEUA 2MY7A 3WHIA 2XB2D 2KHCA 1EJ7L 3SFGA 2VOPA 4OZ3A 3MMBB 2FGCA 1HBMA 3MI7X 3TJ9A 2VG5A 4C98A 4USVA 1ZETA 2ZJQQ 2XZTB 3UNGC 5F8JA 1UJ5A 1T9YA 3MMJA 4ZVQB 1CJKA 4BC7A 4ID5A 2UUTA 2VQFF 1XMBA 1FO1A 3W63A 5D6GA 3U02A 3PW4A 3J80Y 2QJ3A 1F5BA 4NCGB 2BEFA 2PA8D 3JYTA 3D54A 2Z2YB 2ZUGA 1RLCL 4CLPA 2FD2A 2AHOB 4NLTA 1MSWD 2B9EA 2C2MB 3QGPA 3L9ZA 3RW7A 5B7WA 1C0TA 2C42A 5CHCB 3PRBA 1CJVB 1UFWA 1IQZA 4Z7YA 3KJVA 2NPIA 2B9YA 3L09A 4YB5A 1UA1A 5D4LA 5KFXA 2UUCF 3VTIA 1WC6A 5ADZA 1SQFA 2W9BA 1NB2A 1BUXA 4JI1J 5DG7A 2HAFA 4J90A 1FT8A 4OX6A 2VPWB 2ZM6J 1K0TA 1X5PA 3DMJB 2ALZA 4WFBQ 2ZC4A 3KUGA 2Z2MA 3RR7A 2J9DE 1ZBTA 4J7CA 4FYDA 1TL7A 2R8JA 3DRRB 3ZZYA 3G82A 2XO6A 1VQKS 1TELA 4RJVA 5L1LA 5HLFA 3QIDA 5DLFA 3TZYA 2EVZA 2F4VJ 1QSSA 1YI2S 3KLGA 2RT3A 2F9JA 3LPEA 2CG4A 2E1AA 2OTLS 1H3DA 1FCAA 4I68A 5K20B 5J2QB 2OD4A 4P7VA 4X4QA 2AJ4A 4X4RA 2ASLA 2XULA 1WD6A 3MOZA 3AOAA 1YHQS 1H2VZ 3SZ2A 4KQZA 4F3OA 1VYAA 4PXBA 1NB7A 3H5SA 3ITHB 2F65A 1PBAA 4DR5F 5L9NA 4EO8A 4GVBA 5C7PA 2F8MA 3N6LA 2KVIA 4F4YA 1FFGB 1FKPA 4LT6A 3CC4S 1C1CA 3OHBA 2ROGA 4DQIA 3JTPA 3FSYA 1SH2A 2FPHX 1S76D 4HTIA 2MKSA 4MYUA 3MMCA 4PPZA 1VQ9S 4HT5A 4KT0C 3IR6B 1DZ5A 5HP1A 1UETA 4GO5X 2MKYA 1Z1ZA 4EYIB 1KLMB 2PGCA 3EWGA 3GJRB 4K4WA 1VQNS 2HFOA 2ZBIA 6AT1B 3OLBA 2B43A 2C2EA 3CJRA 2U2FA 1MG7A 4ZOSA 4KHPF 1E6VA 3O8WA 4GRSA 3CCUS 1X31C 2POKA 3IBFB 3R1HA 3OSPA 3NNAA 5HSPA 3L7OA 1CS4A 3H2UB 1N5YA 1FX4A 3MTKA 4F8RA 2LMIA 1IJEB 2UUBJ 3EGZA 3THVA 1JLBA 2QG9B 5C25A 2KT3A 3K89A 3UDCA 5EGYA 1DRZA 1KFDA 3QO9B 3BR9A 3V4IB 1XMQF 5G0RB 2G4BA 3SQGB 4WXWA 4B08A 5FDLB 3X1LB 1Q0NA 3VCDA 4NYPA 3MCSA 3THPA 4UUWA 3M30B 2J9EA 4MK8A 1HNZJ 1ZAWA 2ZE2A 2BANB 2DT9A 4LSNB 2K7JA 5A8KA 2CJ9A 4IQMA 2LA4A 3GLJA 2HNDA 3PR5B 2KFZA 4JBCA 3TX8A 2HQDA 1QJHA 4DCOB 1DTQA 1VRTB 4DX7A 3K58A 6FD1A 3B8HA 1XQIA 3I32A 1WC5A 1KVJA 4WE1A 1BQMB 3UPFA 5DQGA 1FRJA 4AUKA 3HHEA 3AY0A 2M4MA 4URSA 2BJEA 4I6WA 1S72S 4DG1B 3S01A 2YWHA 1AT1B 4KGVB 3G9CA 2XHCA 4Q7AA 5KFUA 4LF2A 3Q8VA 5DQIA 2VBWA 4PWDB 1F60B 2E66A 2MHNA 2R7QA 5C24B 5L8RC 1P1TA 1EQ0A 3BN4A 1OPZA 1IBLJ 1JNRB 4OMFG 2IA0A 2UUAJ 1MMNA 2LDYA 1VQ5S 4M5NA 1S1WA 2RU9A 5KFAA 2V8PA 1KVKA 4LQ9A 5IV4A 2V67A 4DL2A 1FRKA 2XYHB 3JAMY 2IBKA 1WELA 3MUMP 4ECRA 3HHKA 3MEDB 1U47A 2KT2A 3OJUA 4MK9A 2F8HA 2VH7A 3QT7A 1S1XB 3J7A1 4DR4J 4A8FA 1RT2B 4RU2A 3BGLA 2YNIB 1JJ4A 4K59A 1UWAA 3TI0A 3ET6A 4IFVB 4DFKA 4DFMA 4DI6A 3QNWB 3MEGB 4LF6F 1HWLA 4UQTA 4W92B 1WUUA 2PEBA 4WIIA 3GQCA 4HR2A 3P5BP 3PYDA 3OL7A 3PCOB 2FY1A 1ZTWA 3GFZA 1AW0A 3KG4A 3RB6A 4OI2A 4F02A 4J9NA 3ZZ0A 2CQPA 2XMUA 2RAQA 1VC6A 3PDNA 1SV5B 1VQ7S 1SJFA 4J9MA 2FZCB 2DCUB 3RBZA 1NK9A 1Y10A 4H4OA 2VG7A 2JFDA 3U1MA 4NLVA 4UUXA 5J2NB 1N33F 2DH7A 5J1EA 3F41A 1PYTA 3BH6B 2QGFB 1RT1A 3D1HA 1L3UA 4CNYA 1WG4A 4OHVA 4M63A 4K4SA 1RT5B 2GGPA 4OZ2A 2ZBRA 2R2TA 2XWXA 5IC4B 5HATA 2YPZA 3BS9A 3JQKA 3KFWX 3IA0A 2RQMA 4PQAA 4KAIA 5F8IA 2OPQA 1M5SA 4TLQA 4NCBA 5I42A 1Q82T 1RT3A 2C3YA 4KY3A 2IVMA 2GAHC 1U49A 3V6DA 2GJFA 2HHQA 2CA9A 2LVWA 1K44A 2AW0A 3FDSA 1V3RA 5IXUA 3DLGB 4F25A 1LWFB 2CPHA 3L7UA 3IBWA 1D9DA 2XHWA 2DXEA 5DDPC 3J7ZT 3M05A 4LRBA 2YWWA 4KB7A 1NPRA 2EK1A 2OELA 4LIWA 2ZM6F 2HHXA 4OYOA 2V9WA 5AE3A 3SEOA 2BABA 2R7WA 2FQQB 3K17A 3DXBA 4YUDA 4OI1A 3LGNA 1HI8A 5EWFA 1DHMA 4HHHA 3LF0A 4NRUA 4UTGA 3DGPB 1KEKA 4LMZA 2V2QA 4LF7J 2I6WA 2HBZB 2BE7D 1J5OA 3D1OA 2LQ5A 2R8GA 1GXLA 2VQEJ 2R7TA 3KDOA 4FVCA 2PMWA 2CJBA 3S1TA 5DDRC 1L5UA 4KR0B 2QRRA 4YR0A 2LQBA 2W25A 2H3EB 4NLRA 4X84A 3CD6S 2EFVA 2AYGA 2QMUB 3M8RA 2CZVC 2H1YA 5E7OB 1U1QA 2UXDF 2X7IA 1PYSB 1IBMF 3W5YA 3LP1A 4NYZA 4QQBA 1WOSA 2BJDA 3OD2A 4KRWA 1KBRA 1E6YA 4ED1A 5HVHA 2WBMA 4HI2A 3D2WA 4O3PA 1IWAA 2N7YA 5ETMA 1NSQA 5H9FK 4X62J 3FMWA 2D74B 3KDNA 2DNQA 3EZ5A 2RDJA 1JIHA 2HFSA 2HGMA 2D3ZA 3LAKA 2R4FA 2J5AA 1FDBA 1UJ4A 1JLCA 4LRAA 1NHKL 1P9YA 2O67A 2KYZA 1NK5A 1AA1B 5L1KA 5A6WA 3PY8A 2B6AA 3POTB 3JTNA 2BVZA 2HWHA 2ZH6A 3M2VB 1AB8A 2JH3A 1QAXA 4URQU 1KRPA 3AOBA 1RAIB 1JWWA 4UOCA 4Q45A 3HD1A 4XK8C 1U8WA 1VIOA 3FRYA 2W9CB 1IKVB 1YBUA 4PXEA 1ZAXA 4EO6A 3BV8A 5D15A 3RBEA 3W2WB 2C2DA 2UVVA 1Y5LB 5GAGU 4CLUA 2RS2A 1CBKA 1N5TA 2FHJD 2EPIA 1TKTA 1V3SA 2DBBA 2IM3A 1HQUB 1HR0F 1HKAA 4NXMJ 2JNJA 2ILYA 2WVEA 1RT6A 3J81j 2NZCA 1GTHA 5A8RA 2DNRA 3F73A 3SXLA 1NKCA 1HBMB 4WFYA 2OEMA 2VG5B 2PFDA 5LXYA 2UP1A 4K4ZA 4HEA9 2NREA 3IGNA 1T3NA 1CJKB 2K06A 2MSSA 2E1MC 3K8VA 1RHUB 4NYOA 4G1QA 3BB5A 2PN6A 3CD7A 2P8IA 3JYTB 3P49B 3T1HF 2KB2A 1UTAA 4DU8A 4OLOA 2IIHA 3CC7S 2EFOA 3A3PB 2Y0BB 2A0FB 1C0TB 4P71A 3NGTA 3KJVB 4F04B 2XMAA 1B0VA 4MIAA 2W9BB 1AXQA 2XO7A 3H4DA 3MM9A 4BS2A 2HFZA 3ULHA 3H5YA 5LL6d 2FHJA 4QWCA 3ZC4A 4LBHA 4DSEA 2BUNA 3KHLA 2LQ9A 1PCAA 1HL6A 2FC8A 5E5NA 2CPEA 4J37A 3U7JA 4YHHF 3UDVA 3SV4A 3NLCA 1FXLA 2WW8A 2KH9A 5IT9Y 4DHVA 4USUA 1GXUA 3SFUA 1TL7B 4FBUA 1MN7A 3T3FA 3I0RB 1Q5VA 2GHWA 3G82B 3OTCA 3O1LA 5HMXA 3PEHA 2Y1RI 1CC7A 2CJYB 4C3LA 1TK5A 1VBZA 2HBYB 2MZQA 5IFMA 3KLGB 3OTOF 4NZ0A 3BGUA 3R5JB 3R97A 2QZ8A 3HVAA 1X5TA 1HW9A 3D68A 2DJWA 2B4PA 3CJ2A 4PQUA 2YX7A 1JX4A 1YSJA 3RW6A 3Q2TC 2V63A 2X3DA 2XGQA 2D1CA 2WOMA 2EK6A 4DR3F 3H8YA 2Y3YA 2ASDA 5BYSA 1RLDA 3W5XA 4OI3A 3JSBA 2OH2A 4PZVA 4NCAA 4NASA 3A3OB 3T41A 2B8QA 5CYMA 2WBRA 2I1RA 3K2YA 2N82B 1ULRA 2W1BA 1RHKB 1NDKA 1L3VA 4PG8A 4NX9A 4Q44A 1LW0A 4EI2A 2M7SA 3AQPA 4WWSA 2M88A 2MGZA 2KXNB 1FKPB 5KFFA 2IYIA 1C1CB 4USJC 4K4VA 1ZM4A 4P2XA 4R25A 3MMCB 3PW2A 2OFGX 1D3WA 3CDEA 1C2PA 3HK2A 2L48A 3IGVA 3M6UA 4HACA 2KG1A 2Z2LA 2HRYA 2OGUA 4WP8A 4MKBA 1JLGA 3G2XA 4ZCLA 1OWXA 1M5HA 4ZPCA 3PX0A 2OFHX 1M5PC 3FRZA 4EFAC 3K5OA 1E6VB 4KSEB 5D4OA 3GFXA 4NWBA 1FK9A 2NUHA 5CQGA 3MPUB 4NLWA 4ZVTB 1CS4B 1NH7A 1N5YB 1VJWA 3RZAA 2FJAB 4LF9F 3TWZA 1JLBB 3FEYB 5C25B 3TZWA 1FJEB 4KC5A 2HGNA 5H9FJ 3EXYA 2VJVA 2AGQA 2HBRB 4OI4A 3KG1A 4DR6J 4DF4A 3FCVA 5ETTA 2JEJA 2ZE2B 3CD5A 5A8KB 2W2NP 2HNDB 2Z56B 2WSEC 1DTQB 2YNGA 4O4GA 3T5LA 4USTA 3B4MA 1H74A 4AD6A 2R42A 5KFVA 4WE1B 1MU2A 4FS1A 1LOUA 4ID8A 2ACYA 1HD1A 2AX1A 3BEGB 4N56A 2MSTA 3GFHA 2ZZNA 2YNFA 2ZVIA 1OIAA 1IBKF 3OXFA 3BO4A 2ACMA 2Q3PA 4DV6J 4A48A 2Q43A 2BE2A 3HKZD 3EICA 2VOOA 3WBZA 4PG4A 5A2QY 3BZQA 2EG1A 3N5FA 2MKIA 2MZRA 4I64A 5DDOC 4AYBD 4CCHA 4DR2J 4IOAQ 1WC4A 1GMUA 5E3PA 3EYZA 2BJ9A 2DGUA 2LEBA 2ZBQA 1HBNA 1IKWA 1AYEA 1U1NA 3NGDA 5A8WA 1RTHA 1S1WB 3W65A 2RRBA 4YOEA 4ZA1A 1Q78A 1XN9A 1RWOB 1O6XA 3GWCA 2MHEA 3LP2B 4WXOA 2FDNA 3ETOA 3GG0A 2FB0A 2AYMA 3IXQA 2ATLA 2D3O1 4NA3A 4LF5J 1O51A 2DHGA 2CZ4A 2DHXA 2YTCA 4I56A 2ZH7A 3HO1A 3BO2A 1UFLA 5F8HA 4HLBA 4NLXA 5CYQA 2BV3A 1KSPA 3ET6B 4DUYJ 4JUZA 1NBEB 1Y00A 4DV7F 1IM4A 3ZZTA 2WW4A 3ZTSA 4RW8A 3OXLA 2XG8A 3C46A 1S6QA 5KG0A 3DLHA 5HAOA 4YDXA 2W2MP 4JI2J 4IR9A 3N9UC 4U6PA 2BYCA 1EP4A 2NYHA 2PT0A 4ITSA 3AFGA 4P74A 1RKIA 4ZVEA 3JB9k 2QA4G 4Y3CA 2LYVA 4G3IA 2E5LJ 2R8IA 3PX4A 2JOQA 2MKCA 1I94J 1U1OA 1Q4RA 4QW8A 4WFXA 1B0TA 4RW9A 3LOUA 3HM9A 2FJBB 3NGSA 2CWKA 1ICEB 4H4OB 3C3LA 2VG7B 4KO0A 2XCPA 5I3UB 5HVFA 1IBCB 3A13A 5J1EB 1RT1B 1FRLA 2WVDA 1BWEA 3EX7B 3RAXA 2DR8A 1DJ0A 3UDEA 2GGPB 3UDLA 3N28A 3GB0A 3WDOA 2NCKL 4B3TJ 1FD2A 1VQLS 5KT3A 2FZGB 2WAQD 3RR8A 1MWZA 1W2IA 2OPQB 4I0WA 2EXUA 3RAQA 3KLIA 5I42B 2DVIA 1RT3B 5BXIA 1CC8A 1N0UA 4H4KC 1QDUB 1QVGR 2QIFA 4F0KA 1VQMS 3V6DB 2EEYA 2RHSB 1L3KA 5FD1A 2CJKA 2OMLA 2CQ3A 1NJYA 5SZTA 3CMQA 5A76A 3QQCD 1CQMA 1WEYA 4QIEA 1VLYA 2O66A 2CJQA 4X2BA 4OI0A 4ZP8A 1YRUA 4I67A 2YKPA 4M5DA 2HQ3A 1YITS 1FE4A 4IRCA 1N5QA 3CDAA 2E5HA 4G6VB 2DR9A 4UZBA 3CIZA 2O1PA 2AX0A 2XMTA 3CC2S 3P4UB 3ELHA 3FGVA 3R1LA 1NUEA 4AXJA 1HPZA 1J5EJ 1TVRA 1JLEA 2Y8WA 3CJSA 1S0OA 4OJ1A 2R7RA 1TQLA 1X5SA 2YWEA 4LBPA 1J5OB 1T11A 5KG2A 3OFEA 3D0IE 2ZFHA 1RI7A 5B0EA 5LMNJ 3ZTQA 5ETVA 4RW7A 2MZTA 1Q16B 1AFIA 4QWDA 4TU7A 3R8YA 1RAEB 3UN3A 3LP1B 2O01C 5L1IA 3V6JA 1GFWB 3CUNA 2GA7A 4NLYA 3SI8A 4O3OA 4YR2A 1X4AA 5DQHA 3M1VA 2AJ2A 2V2VA 2GIQA 1JLCB 3MTJA 2OLWA 4LR8A 4G65A 2OSRA 1APSA 4M95A 2B6AB 4DS5A 4JI0J 1UVNA 2D9PA 3QPIA 1S1UA 5IQ6A 1YWXA 1RZMA 4DX8H 2NXUA 5E0OA 1Q81T 1GQEA 4OJHA 3D5MA 3C16A 1W26A 2KFNA 4RUCA 4CIOA 3CGIA 1RTZA 4HYKA 1PSDA 4L76A 2U1AA 3SCIE 1SC4B 1PIEA 1JJHA 3LPYA 3CDBA 4NI2A 4RR5A 4X64J 3CJ0A 4K5RA 4W4MA 4PEOA 1SJ1A 3HLUA 1FKAF 3OQ2A 2XY6A 3K5LA 1SIZA 3QAEA 3BDPA 3T5HA 4Y65A 1TKTB 5ETKA 2HZAA 3KJQB 4JI7F 1RT6B 1SH0A 4OYAA 1D0EA 3BSCA 5A8RB 4OIXA 5JVGQ 3DRSA 2R7VA 3CWJA 2MKKA 1ZPVA 3BSAA 3CDUA 3QT8A 4OZJA 3KUEA 3Q8UA 4WU2A 2GAGC 2F3JA 3DYAA 3UCGA 4F67A 1IM6A 4DXLA 4G1QB 4ZVUB 4DR1J 4CQ1A 3LH2S 4DR6F 1U6FA 1KQFB 2DR5A 3GJTB 3U27A 5DM6Q 1XMOJ 3NBPA 1YJ9S 4JI3F 1XR7A 3AXKA 4LR9A 4CT9A 3Q8YA 3EUNA 3NGUA 2UVWA 3MM7A 3OL8A 2DXFA 4H4KA 2FLLA 2WSFC 4RNFA 4CO2A 3MM9B 2QEXS 4HH1A 4DCPB 2CZ9A 4NLDA 1PJ6A 3BSOA 2J9CA 4BHQA 1YBTA 2GVDA 1KHWA 4R0EA 1WEZA 3NGKA 5MLCV 1WKJA 1FEHA 1VISA 1KS2A 3OR2A 4O3NA 3QT6A 3MMAA 1IJFB 1RBOB 4ZLLA 1TK0A 2HQIA 5HQLA 2JFKA 3LO3A 5AJ3J 1YRXA 4AE5A 4QIGA 3TX0A 1RQ0A 3NMAA 4ELUA 4C8ZA 2CIMA 3CE8A 3O6QA 4DR2F 4ECTA 4I4BA 2KZMA 1P8GA 4OLPA 1SC1B 3HMJG 2ZH9A 1Y0HA 5JXSA 5KT4A 1N54B 1QTMA 5ETNA 1T9WA 3SDEA 2M8HA 2GJIA 4HKQA 2V8VA 3TEHB 3FBBA 3KWMA 2ZC3A 3QRQA 3EXCX 2NLWA 1S0VA 2WOMB 4O3SA 3H0PA 4K50A 2QE5A 2LP4A 5LM7E 1WOPA 3ZO7A 2KM8B 1QTNB 2EW9A 4DWIA 1WWHA 4ECWA 2Y0SD 1RT7A 2HS0A 4KKOA 1LW0B 3NCQA 4WKYA 4DUYF 2MGZB 1TAUA 3IR7B 1LQ9A 2XGPA 2JEGA 2N3OA 5A6PA 4IYQA 2LDIA 1RU1A 1T03A 2GC8A 4NZ7A 3DMJA 3OFHA 4JI2F 2L9DA 5IM0A 2FC9A 1K47A 1N36J 2ZWPA 4WTOB 5IT4A 1H73A 1SB6A 4HACB 1AROP 1TL1A 2M3DA 1IR0A 1VFJA 2XTJP 1YJUA 3A3NB 1I94F 1JLGB 1RTJA 3KK3A 2KYXA 2MKHA 3H2VE 3OFFA 4OX9J 1BXNA 2W7AA 2RQKA 2NXNA 5CD4H 1FK9B 4DN9A 3NAHA 1HHQA 5KFGA 4ZP9A 4ZVRB 4GMKA 5DG8A 4WKRA 2L08A 1NPKA 2UVRA 1JB0C 3ENVA 5HO4A 4B3TF 2J8AA 2NYIA 4BWJA 2DK2A 3MR5A 2B4VA 3CB4A 3PG9A 3TAPA 5LJ5Y 3OVSA 4P75A 4IG3A 1RWKB 4WF9Q 2CQHA 3GJQB 3RRHA 1D8ZA 1QD1A 4EZ6A 2OP5A 3PNIA 3QSYB 2DEJA 4LF4J 3VVTA 2HPUA 2YNGB 4QPTA 4O4GB 3W1YC 1BE4A 4OX8A 1JXLA 2JC1A 2X1GA 4Z37A 4XO0A 1QAIA 3I5CA 2C2RA 4J9RA 1MU2B 4OHYA 3DM2A 4DV0J 1RTIA 3HZEA 2BKNA 1LFPA 2V0NA 3ENWA 3W66A 3I55S 1R7IA 1KKHA 1WC0A 3MEEA 2J0QD 2W7OA 2JVRA 2HHVA 3TEGA 2HFNA 2YNFB 1PJ5A 1TKDA 3DKDA 1FF2A 3CCLS 2BE2B 5AXKA 1RB0A 3O44A 1HNWJ 4RLEA 2VA3A 4B9VA 5LSRA 2ATCB 4Y2KA 1J5EF 4WIQA 2HW3A 2J0XA 2J7WA 4HI1A 2DGOA 5HK4A 1HWIA 1UKUA 1FVSA 4DX6A 5EDWA 3B6BA 3WC2A 2RU3A 3KNGA 1KOHA 1XJWB 1U09A 2DNLA 1I3OB 1HBNB 3ZFVA 1IKWB 3C6TA 2JSXA 2H5IB 3TUZC 5A8WB 1RTHB 3HULA 2VQFJ 1WSVA 4NL5A 3TP2A 1CULA 3OJSA 1PJ7A 2MTLA 2GNKA 1GX5A 4EZ9A 1FJGJ 2QLXA 4TQRA 3GCXP 4AL7A 2HWIA 1S6PA 4PCQA 2M70A 3UW1A 3KKFA 4OJGA 2O5DA 1R3NA 5CYQB 2CPZA 3Q0AA 1FERA 2UUCJ 4JI0F 5DDQC 1TU0B 1VHIA 5KFPA 1HA1A 3CCES 4JV5F 1FX2A 1GT8A 4RW8B 2HHUA 5L38A 2GJ2A 1S6QB 2DHAA 4OFZA 4LFCJ 3QYYA 2GHVC 4ZJQA 3UD5A 2NXEA 5C42A 4TYAA 1VJQA 3R2CJ 2QYCA 2B4OA 4CLSA 1N88A 3HCXA 4DQPA 1L3TA 4RNMA 3PW7A 2IMWP 1RGVA 1R8HA 1TMMA 2VV5A 1EP4B 2VD3A 4RO0A 1QUVA 1X5OA 2HWTA 2BKOA 1RHMB 4KPYA 4CTAA 2WB4A 5FLXU 3WQPA 4RW9B 1RBAA 2IJNA 3E2EA 2VFVA 3MHYA 2DRBA 1RUSA 1WHYA 2XC9A 3HJVA 4KO0B 3GIRA 1AZSA 2BJ1A 4B9UA 4ZIVA 5GAEI 2ROEA 1RHJB 1RK8A 5KFZA 1RTDA 1H0HB 1PGZA 1RAFB 5H9EK 4ED7A 4MTPA 1YJVA 1S9GA 4L72B 4P10A 2XMMA 3G4SS 3LANA 1TFYA 2WVCA 3RBXA 3PYEA 2IM2A 1SQEA 2BQUA 3KLIB 2J76E 2NXCA 3CULA 2NS1B 4ZCKA 3DN9A 4DR5J 2JJ4D 3QSIA 2DRDA 4K5SA 5HJXA 4TLRA 1RWUA 4WTYA 1FE0A 3M6WA 2VICA 4JOUA 1JK9B 1ZM3A 3ONQA 1DQAA 1WF0A 3DDIA 4M5HA 1UA0A 4M5DB 2GCFA 1BMQB 1TR0A 4KHMA 1I51B 3VAJA 1F0XA 1U2FA 4QOTA 3MD1A 4CYUA 3KLFA 1S6OA 2CQ4A 1NK8A 3MPVA 3RB3A 5DRKA 2RB7A 3HSZA 2IMOA 5DS7A 4ZP7A 2ZJPQ 3KJFB 2K7KA 4ETZA 2RQCA 1NK0A 3CCTA 4IDKA 1HPZB 1TVRB 1WC3A 4KHPJ 1JLEB 5KFRA 2LQJA 5AJ3F 2H65B 1I5OB 4YB7A 3RAMA 3CW2C 2B9XA 4U7UK 1SL2A 3KG0A 1VHFA 2E9ZA 1TUWA 2E1RA 5BR8F 4WFNQ 4F0HA 3MFIA 2OKQA 4ED0A 4CLZA 4LF8F 1RHQB 4RW7B 1U1PA 3TYTA 5AT1B 4TY8A 2AIRB 5LJ3Y 4C8NA 4MFBA 5EHHA 2AV5A 1XMQJ 4USHA 1YVFA 2VBZA 5KT6A 4U95A 4L3NA 2JZ5A 2I8EA 2ILZA 1HD0A 4OHWA 4DL5A 3ENAA 4D3HA 2XCAA 1JJ2R 2OPSA 4PKDB 3M1VB 2V4QA 3NL0A 3EPIA 1RA6A 2HNZA 2AF6A 3PFEA 2PC6A 1JLQA 3ZZOA 5B0CA 2CNKB 2AMCB 2BJ7A 2H54B 4OHXA 5THWA 4PG6A 1S1UB 1GMWD 2BM1A 2AGPA 5HANA 3J7Z5 1NO8A 1CSJA 2G0JA 2D3OR 3C16B 4YY3F 3N79A 2IDEA 2PD1A 3GMGA 3AA8A 2D9OA 2CPXA 4DV3J 1EQMA 4C6AA 3FNNA 1PC5A 5BYRA 5KOWA 4J9UE 4X4TA 2R3VA 1EB0A 4NI2B 4GO7X 4B17A 2XM3A 2DGXA 2IY5B 1EKRA 2YKNA 2J7KA 3LA0A 2HS4A 4M5GA 3MR6A 1XK8A 2DNMA 3NWRA 3NS6A 1VQ4S 4N8NA 3I5BA 1OQ3A 3PR4A 4GKKF 1I6JA 1S1VA 3JSRA 1Y5IB 2QYGA 4P2SA 3UR3C 5KFTA 4M94A 3Q8PB 4DFJA 3QRPA 2B7CB 3DLEA 1NMEB 1YKWA 2IM1A 4PXDA 2VJUA 4B3OA 4KH0B 1URRA 3PKMA 2APOA 3DLBA 3DRSB 1K73T 2K3IA 2XBPA 4J91A 4A8MP 1DTTA 5IWAJ 4EMDA 3DYAB 2BR0A 1TTHB 2DCLA 1A6LA 2A1BA 1GMWA 4Q43A 1HBOB 3UI3A 2PDAA 3QWUA 1FEEA 3K5MA 2UUWA 2YX1A 4HHJA 2RNEA 3NBPB 3LWLA 1HYSA 4U67Q 3M8WA 2Z58B 5L9XA 1LFWA 4LF6J 4ED3A 4G1IA 1S12A 3R7BB 4NXNF 4HDGA 2XMWA 1S59A 3NP5A 3MM7B 3LWMA 5L46A 1ZYQA 3FZ2A 3MFHA 2XSJA 1OY9A 1EETA 3NGRA 2GVDB 1Y5NB 2DHHA 4ZP6A 3HVTA 2E1CA 2CQ0A 3OR2B 4IO1A 2JVOA 1XR6A 1XIQA 3MMAB 1H2TZ 1W2BR 3TW0A 1AUDA 2QC3A 2ZVSA 4GC7A 1ZAVA 1HNXF 5IC6B 2R9LA 3BSNA 4E8UA 3TARA 1N33J 2CVEA 3KMQA 1PYOB 3R7NB 4FVMA 2CDQA 3SCLE 4XDCA 3NNCA 3GYGA 1IR1A 2CDRB 4FF3A 1FKOA 4NLOA 1TV6A 2KI2A 5F0UA 1WDTA 1RWPB 5LOQA 3BGRA 4ZPVR 1N4LA 1CJUA 4JYAJ 2R7OA 5H9EJ 1YIJS 3W2VA 3HFVA 3MR2A 3SDEB 2H5EA 2QLJB 4CWBA 3TA0A 4P72A 3AT1B 2NPFA 3H42A 3CO0P 3G87A 1B3TA 1FRXA 5HQ8A 1FJGF 2GMJA 4ZLNA 5LMUJ 2V4JA 1GNKA 2MZ1A 1PO6A 3FQLA 1RT7B 2Z4PA 3CSKA 5ETLA 4J9SA 4KKOB 1RCXB 2NZ4A 2EWHA 4K2XA 3D6MB 2CQBA 5B0BA 3K5NA 3NRBA 3H4BA 1ITPA 2W4CA 2QV6A 4A8WA 2AU0A 5FLXY 2MKJA 2QL7B 4LFCF 1S49A 1T03B 1U1LA 3FZBA 2OO4A 5CA5A 1H6KX 1FXRA 1QSYA 4USIA 5IM0B 1LK7A 1P6TA 4FNIA 3MURP 1FD8A 1UWBA 1TL1B 1N56A 5GMDA 2A10A 3T9ZA 4ERDA 4MIBA 3I0RA 2LCWA 4OYWA 3DDKA 1RTJB 5KFKA 3KK3B 2BZ2A 2NUUG 5HBMA 2ADBA 2BJ8A 5DETA 1RWMB 4AL6A 3UNYA 3FC9A 2NXJA 2UXDJ 1IBMJ 4MAKA 2Q6BA 2CWXA 2XNQA 4JP8A 5GADI 3KJNB 4FXWA 3H90A 4ZKAA 5I3PA 1TUGB 3MAAA 3D0GE 4CT8A 3CEDA 1RA7A 5F3TA 3US5A 1C0UA 1PG5B 4IG3B 1GEHA 2CNOB 3A12A 1VQ8S 2Y1IA 3G6YA 3BO3A 1T02A 4CNZA 1V5VA 1FESA 1EIYB 5KG7A 4IUFA 1N32F 2DO0A 3MM8A 4NLUA 2BBEA 7FDRA 4OZLA 1JMTA 1K8AT 4Q2LA 2AGOA 3DM2B 3D6FB 4QIVA 1RTIB 4U96A 3OW2R 1F6TA 3V81A 2QSWA 5CYJA 2VU5A 3R6LB 3MEEB 4DUZF 5HMZA 1VBYA 2B7BB 4MJKA 2MQOA 4CLLA 1S5ZA 2C2ZB 5M2RA 3C8YA 2BDPA 4ED4A 3PW5A 1HR0J 4M5KA 2QLFB 2EFNA 2QA4S 2XI2A 1XNQF 2CJAA 5EX0A 3UE2A 5JUMA 4ATNA 3OLAA 2Y8YA 1TFWA 2DXDA 4TQSA 2ZEJA 3TUJC 5KFJA 4JV1A 2WRMA 2FVRA 2QN6B 1LEOA 4RBVA 3C6TB 4HL9A 1PAUB 3E3XA 1UCNA 1ZZNA 1UPPA 2DHSA 1VQOS 1Y9OA 4R5PA 3W9HA 1CULB 4RPFA 1H98A 4FYYB 3T1HJ 4LF1A 4JI5F 1JLFA 1WJ9A 3W8GA 2DNOA 2DO4A 2GIFA 1M1HA 4TXSA 5E3CA 1S6PB 2RQ4A 3GILA 3MR3A 1JLAA 1HFEL 2RDIA 4DL6A 3K0JA 2XZDB 1VK3A 1MN9A 2AYEA 5A0YA 2MDAA 3D3CJ 2DGVA 2PI4A 3NG8A 4KGMA 1SL0A 3BQ2A 3QJPA 4U7UD 2RHQB 3TR5A 5LXRA 3KK1A 4O0IA 4K4TA 3IRXA 4RW4A 2E1PA 2RH3A 5AXNA 5C42B 1U26A 1N34F 4YHHJ 5J2MA 3TQEA 4DV3F 1FXDA 3IM8A 4XTTA 2J9DA 2YKMA 1UPMB 2MQNA 3ZZRA 4UY8T 2OAUA 2FJWA 4DV1F 1DARA 4KBIA 2XLJA 2K8GA 3UO0A 4CTAB 3E01A 1QAJA 1KTQA 4NOHA 1OY8A 3OFGA 3I0SA 1WHWA 3CVKA 2W8LA 3OTOJ 1AZSB 2BRKA 1UP1A 2LA6A 2VF3A 2RILA 1PKUA 1CLFA 1G6BA 1NJXA 2YQ3A 1RTDB 4NZ6A 4MH8A 2B8PA 4FF1A 5C2GA 1S9GB 4LRDA 1SH3A 4OZNA 4W90B 4DF8A 1RWXB 5B0FA 4OYIA 1XC9A 2FJEB 2KJWA 3LP2A 5IWAF 4DR3J 2IRYA 3BH7B 2B51A 1P1LA 4D3GA 1NM2A 4Z7CA 5E3AA 1LKZA 3I9ZA 3V6HA 3Q22A 4Y0FA 4MKAA 3DRPA 1KQSR 1ROFA 4LIRA 3J81Y 2B3TB 3GFYA 2PE8A 4IH7A 4ZN3A 3DU6A 2AJ0A 3NWGA 4OYMA 3IAS9 1G4CA 3D7SB 3F56A 4DQQA 5HI7A 2QMXA 4CP5A 1N0VC 3JTOA 3M8PA 1J2VA 3ETMA 3L7PA 2CJXB 3BM7A 1Q8IA 2E29A 2IBOA 3EGNA 3KXDA 4CYUB 5M2UA 3KLFB 2MZSA 1UMJA 1RABB 4TKTA 5B0DA 2X1FA 4NLGA 4ZVOB 2DIVA 1KLNA 1TL5A 2FVSA 2HNYA
chains in the Genus database with same CATH topology
3PVXA 5HP1B 5F8JA 5HMWA 1UJ5A 4IDKB 1UVNA 5B0AA 3MMJA 2D9PA 3QPIA 3K57A 1S1UA 4LUBA 4BC7A 5IQ6A 4ID5A 3H40A 4Q8FA 2UUTA 2HAIA 1YWXA 2EFQA 4Y00A 1BQXA 2VQFF 1XMBA 5M2PA 1FO1A 4X66F 2AYBA 3QZ8A 3LALA 4DX8H 2NXUA 5E0OA 3DOLB 5D6GA 1Q81T 5I3UA 4QW9A 1GQEA 2F1FA 4OJHA 3U02A 5IQQA 3PW4A 1U6BA 2JHEA 1TUVA 3D5MA 1F5BA 4NCGB 4OJ3A 3J80Y 2PA8D 2HZCA 2KFNA 7FD1A 4RUCA 3JYTA 1WF1A 4CIOA 3CTRA 3D54A 2G13A 4B9NA 3CGIA 1N52B 2ZUGA 4EBDA 2JC0A 2E9RX 2VG6B 4HYKA 4FF2A 1VRUB 1PSDA 2FD2A 4CO4A 3IRWP 4NLTA 2U1AA 3SCIE 1MSWD 1JJHA 3I82A 3LPYA 3CDBA 3J7YI 1T3OA 3QMQA 3QGPA 3RW7A 5B7WA 1C0TA 3CJ0A 4K5RA 2C42A 2DB1A 4TY8B 4JYAF 1G2EA 5CHCB 3MOJB 1HWKA 3PRBA 2IA6A 1UFWA 1G1XA 1P27B 2AJQA 1XEZA 1IQZA 1NHVA 3Q8SB 3OUYB 4MFBB 4RBTA 1SJ1A 2B5JA 3KJVA 2NPIA 5CCMA 2B9YA 3HLUA 1FKAF 3OQ2A 3L09A 2XY6A 4YB5A 3K5LA 1BQNB 5DG9A 2KRRA 1SIZA 4CO5A 1UA1A 4PPDA 3QAEA 5D4LA 5KFXA 2ZH2A 3VTIA 2UUCF 2R7XA 5ADZA 2HGLA 2X1AA 2W9BA 1JKHA 3BDPA 2RF2A 4ZVFA 3T5HA 4Y65A 4RWXA 4O3RA 1TKTB 5EUHA 5DG7A 1C1BA 3UWTA 1FT8A 1V9OA 2CPDA 4OX6A 4N8OA 5HROB 2OPSB 4DSLA 2UVUA 2VPWB 5F9LA 1NK4A 2I9SA 1N48A 1K0TA 4MMOA 5LMUF 4RX6A 4C11A 4JI7F 1RT6B 1SH0A 3DLJA 3DFEA 3T6JA 3CCRS 1D0EA 3BSCA 4WCEQ 5A8RB 1X5PA 2CVIA 2HNZB 2YWGA 3MM6B 4OIXA 3CCSS 3DMJB 4DL0C 4AFFA 4X4VA 4UY85 5JVGQ 2ALZA 2HHWA 1JLQB 3DRSA 3OR1A 4ES2A 4ED8A 3CO9A 3VZIA 4WFBQ 4E0DA 2R7VA 3RB0A 4B9TA 2ZC4A 3CWJA 2MKKA 3C66A 2FJXA 2Z2MA 3RR7A 2FHOB 2J9DE 1ZPVA 1X4DA 3BSAA 3CDUA 4OZJA 1ZBTA 4FYDA 4WU2A 1UAWA 1R8BA 2R8JA 1RISA 2F3JA 1RAJA 3DYAA 3DRRB 1IQTA 3UCGA 4XPCA 2KU7A 2W24A 4F67A 3ZZYA 3LW5C 1VQKS 4G1QB 3R5BA 1R6YA 3QAUA 3JSMA 4CQ1A 2MPUA 5L1LA 5HLFA 3P3DA 1NHUA 3LH2S 4DR6F 1U6FA 3QIDA 1KQFB 2N3LA 3S6EA 5DLFA 2DR5A 3M4XA 2CQ2A 3I9V9 2EVZA 1QSSA 3U27A 1BGXT 5DM6Q 1LW2A 1YI2S 1DBDA 3KLGA 1LWCB 2RT3A 5GAHI 2RD5C 3NBPA 2F9JA 1YJ9S 2CG4A 2E1AA 2VONA 2W4PA 2OTLS 3I5AA 4QYZJ 1H3DA 4JI3F 1FCAA 4I68A 2FHMA 4C7QA 1XR7A 2YKNB 5KOXA