2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
2ILZA 3N6NA 3DM2B 4LSLB 2IBKA 5JUMA 2IM2A 4DL5A 1LWFA 1JLQA 3NAIA 3OL9A 3Q8RB 5J2PA 4ECVA 2HNYB 1TV6A 3UPFA 3KMQA 4ECTA 3NGDA 4NLSA 4TLRA 4ECRA 2BQRA 4RW8A 3IN5A 2WB4A 3I5CA 5KFKA 4MK8A 3HVTA 3DLGB 4URSA 4NRUA 3NBPA 3CDWA 5F8LA 3GV7B 2R8IA 1IKVA 2R2RA 2WHOA 2UVWA 4ICLB 5KG2A 1J5OA 4HYKA 2R8KA 5J2QA 2HWHA 1RTHB 3GQCA 1RTJA 4LQ3A 4IKAA 1JLAA 4NLDA 3BR9A 3EPGA 4ZPDA 2BE2B 4LSNB 4J9LA 2W7PA 4B3OB 3KHLA 3DI6B 3QLHB 5DGBA 3KLIB 4FS2A 1S10A 3IS9B 2FLPA 2I5JB 2GIRA 2HWIA 3LP0B 2IM3A 2IM0A 4O44B 4R0EA 2VG6A 4URQU 4EO6A 4J9SA 2FVCA 1EETA 3BQ1A 4KHRA 5EDWA 3LP1A 4RW6A 4R5PB 5F8GA 1T05B 1IKXB 1GX5A 5KFZA 5HROB 5KT5A 3Q8SB 3I0RA 1JLBA 2YNIA 1C0UA 4KV8A 3KLEA 3OL6A 2R8JA 4Y2AA 4I7FA 5EUHA 2B5JB 4IFYA 3UDLA 5DGAA 1S0OA 2DPIA 4PQUB 4WE1B 1SV5A 4O3RA 4JUZA 3KK3A 5I42A 4K4YA 1D0EA 4I2PA 4ZVHA 1FKPB 2B6AB 1RTIA 4IG3B 4DL2A 5DG7A 2I1RA 2YNGB 4KAIA 5DQHA 5KFNA 4F4XA 3JSMA 1HNIA 3MR5A 5EWGA 4IDKB 3PW4A 3V81B 3QGGA 3TAMA 1N5YA 3HVAA 3QZ7A 1JIHA 3GYNA 3MF5A 4Q0BA 2YKNA 3G6YA 2JC0A 2E9TA 3EPIA 2FVRA 4IH5A 2C2EA 5KG7A 2JC1A 4H4OB 1LWEB 4WYLA 4IFVA 1RT2B 1TL3A 4MFBA 3C6TA 5D3GB 4NLGA 1LW0A 5J1EB 4ZP9A 4KKOA 1XR6A 1S9EB 3LP2B 3FSIA 2C22A 2C28A 1OS5A 4ID5B 3DRRA 3KHHA 4PUOB 1S1XA 3N6LA 5F8HA 2V9WA 4KE5A 2JEJA 2WRMA 5I3UA 4EEYA 3KK1A 3PHEA 4X2BA 5C25B 4YR2A 3M8QA 1DTQB 5K14A 4EYHB 3RB0A 2FVQA 3RAQA 5KFOA 1C0TA 3MR6A 2BQUA 4WXWA 4JV0A 4RW8B 2RDIA 3KLGB 4WFYA 1VRTA 2E9ZA 1JLGA 3C6UA 3N6MA 5KFHA 1KHVA 5KFGA 2HNDA 2C2RA 4KO0B 1HMVA 4RW9B 3V6KA 4MK9A 2BRLA 5KFAA 2EC0A 1TKZB 3QGIA 4IRDA 1EP4A 4IFVB 2W9BB 4QWEA 2WOMB 2YNFA 5L1LA 4Q44A 4TYAA 3LALA 4ECSA 2V4QA 3M9NB 2WCXA 3IRXB 1HARA 3T5HA 4RW6B 3ISND 4DL7A 4KSEB 3KLHA 5I3UB 2FJVA 5KT6A 3DYAA 5CYQB 5FDLA 4ED1A 1RT6B 2XWYA 4K4ZA 1N6QB 3MEEA 2W9CA 4RNHA 3BREA 3IGVA 3M9OB 1JLFA 2RKIA 5J2QB 3GIIA 3M9MB 5JXSA 1UWBA 1BQNB 5EWFA 3FRZA 3GIJA 3V4IB 3QZ8A 4EYIB 3CO9A 1KLMB 4ECWA 4WZMA 5EWEA 3DLEA 3I5AA 5C42B 4NYZA 2XI2A 3E01B 4RNFA 3PW5A 4G3IA 1RT1A 4I2QB 1K1SA 1T03B 1SH0A 1DTTA 1XR5A 1EP4B 2VG6B 2B43A 4O3PA 1REVB 3PR5B 1VRUB 3PR4A 1C2PA 3FDSA 2GIQA 1MU2A 2YKMB 1JLQB 5KT7A 1C0UB 1S1WA 3V6DA 3RBEA 4U7CA 4QPXA 4J9KA 4H54A 1QE1A 2AX0A 3QIPB 1RTDA 4H4MA 4NLUA 2D7SA 1JLCB 1S6QA 4K4TA 4J9NA 2IJFA 1NNDA 1S1XB 1SUQB 3H59A 2YNGA 3T5LA 3JSMB 2E9RX 2JEFA 1TL1A 4NCGB 2OPRB 2FLNA 3FFIB 3D28A 2WONA 3MECB 3KJVB 1MMLA 2OPPA 4ZVEA 5KFWA 2XI3A 1J5OB 4RW4B 2HNDB 2AU0A 4R8UB 4KO0A 5HP1B 2BRKA 1LWEA 4NLWA 5CYMB 4WXOA 3G6XA 4MIBA 3OLAA 5J2NB 1T05A 3KNAA 3IS9A 2ASDA 1TKXA 2YKMA 3H5YA 4NZ0A 4QWAA 4TXSA 1LW2A 3M8PA 4EBDA 2VA3A 1BQMA 5KFYA 4K4XA 3DRRB 4ID5A 5KFMA 2VG7A 4XPEA 3PJWA 3CWJA 3KK3B 3BGRA 5J2MA 2HMIB 4M95A 2W9AA 1S1TA 4QWCA 1S6PB 1N48A 2R8GA 1U09A 5KFTA 1SUQA 2HNZB 2JLEA 1HQEB 1N56A 1SV5B 1VRTB 1IKYA 4IOBA 1C1CB 4O3OA 2IC3A 1ZTWA 5DG9A 1SH2A 5KFQA 1W25A 4NLTA 3CJ0A 1R0AB 4DL3A 2RKIB 4J9MA 2DPJA 5KT2A 3DRPB 3OL8A 2ILYA 2V4RA 2GC8A 3TAMB 1JLEB 3SFGA 4B3OA 1S4FA 5CYMA 4ECXA 5DG8A 4F50A 5KFRA 5HBMA 4EBCA 3RBDA 1S1UB 3LP2A 3DRSB 3CJ3A 4KFBA 3KLFA 4ZPBA 1BQMB 1JKHB 4G1QA 2ZD1A 3HVTB 2RDJA 5HROA 4K4UA 3QGHA 3NBPB 2YNIB 4KV8B 3DLGA 4IRCA 1T3NA 3H5SA 2BR0A 4J9OA 4YMEA 3H4DA 2WK4A 3DMJB 4O3SA 1JLGB 3C6UB 4ZPAA 3KK1B 3G86A 4ZP8A 1C1CA 1FKOB 3MEGA 3T19A 4RU9A 1S1VA 1JXLA 1RTIB 4IG3A 5KFPA 1S9GB 1C0TB 4ZP7A 3DI6A 3QLHA 3I0SA 3UR0A 4QW8A 3KLIA 1HPZA 3E01A 5F8IA 2OPRA 1NHUA 4I2QA 4K4SA 5DQGA 2IAJA 1T03A 5L1KA 4J9PA 4XPCA 2AWZA 2WOMA 5KG1A 3JYTB 5F8JA 2YNFB 3IGNA 2IM1A 4RW4A 1IKXA 3KLEB 2YNHA 1S9FA 1TKZA 1HQUA 3DRSA 4TYBA 5KFBA 3PW2A 4URGA 1LWCB 3V6JA 3C6TB 4ZVGA 4TY9A 4J9QA 3CDUA 4FBUA 4PQUA 5DQIA 4ED6A 5KT3A 3DYAB 3MEDB 2HNYA 1LWFB 1RA6A 4MK7A 4K4VA 4DL4A 2XC9A 1N6QA 1TV6B 3HVWA 1S6QB 2FVSA 2W9CB 4QWDA 3IRXA 4RNOA 4YQWA 2QE5A 4ED2A 2HAIA 1TVRA 2UVVA 3KLHB 5KFFA 3V81A 3LANA 1XR7A 2AGPA 1TL1B 3H5UA 2BQ3A 3MR2A 5F9LA 4ICLA 3MR3A 4QW9A 1RTJB 1HQEA 2OPQA 1RTHA 3DOKA 3H2LA 1S0MA 1T94A 4RUAA 4WZQA 2QV6A 3H98A 2R2TA 5KG0A 3OLBA 1RT2A 4MFBB 5KFIA 4IR1A 4NLOA 2YNHB 4IQXA 4EBEA 2J6TA 4FBTA 2V0NA 4HKQA 3KLVA 4MKBA 1DLOB 1EETB 2AGQA 1QUVA 3I0RB 4F4YA 3IG1A 4TQRA 1DTQA 2OPSB 3I5BA 1Z4UA 4EO8A 3RB6A 3M8QB 5K14B 3BSCA 4ED3A 3BJYA 2ALZA 4F4ZA 1RT7A 4IRKA 2ZD1B 3GIMA 4I2PB 1TP7A 3UQSA 1IKYB 4NCGA 1RA7A 4Y2CA 4LSNA 4Q8EA 2JEGA 3VQSA 2B6AA 3HKWA 2OPPB 1HMVB 1IKWA 4NLXA 3DOKB 1C1BB 3MFHA 4F4WA 3GILA 5HLFA 1S1VB 3HHKA 2W9BA 1JLEA 2YKNB 1KLMA 1I6JA 1NHVA 4NRTA 3LP1B 4R5PA 3H5XA 3CJ2A 4RNMA 1JX4A 4NLVA 1HPZB 4ECUA 1S1UA 4PWDA 3SI8A 3OSPA 5KG6A 3DOLB 4ZHRA 1D1UA 3CDEA 4QWBA 3KHRA 4ED7A 1DLOA 2ZE2B 3KHGA 2RF2B 3QO9B 4RZRA 4ECZA 2IMWP 3CIZA 3BSOA 1RYRA 2HMIA 5KG3A 5F8NA 5F9NA 1FKPA 1S1TB 5L9XA 2ZKUA 1HNVA 2FJXA 4YP3A 4ED0A 3PZPA 3ITHB 3PJXA 3OL7A 2VG5B 2J6UA 3KK2B 2VG7B 1JLAB 3OHBA 4K4WA 1GX6A 1RT4B 1UWBB 1JLCA 4O4GB 3BSAA 1BQNA 4KHMA 4DG1A 3KLGA 5KFLA 4IR9A 2IA6A 1HYSA 3BQ2A 1ZETA 2UVUA 1TKTB 1TVRB 3LP0A 3GV5B 2J6SA 3NMAA 3MTKA 4RW9A 4RNNA 2R2UA 1R0AA 1VRUA 2O5DA 2I5JA 1KHWA 4TN2A 4WYWA 1QAIA 1MU2B 4PWDB 3TVKA 3DDKA 3DOLA 4XO0A 3FQLA 3LAMA 2IJNA 4RUCA 4IFYB 1LWCA 4KB7A 1FK9A 2W8LA 1TQLA 4WE1A 4PUOA 3H40A 3G6VA 1SH3A 4G1QB 3NAHA 1JLBB 5KFUA 3OSNA 1S49A 1LW2B 3M8PB 3GIKA 4H4MB 1HNVB 2B5JA 3D5MA 4KFBB 3KLFB 4J9RA 3ITHA 4LQ9A 2XCPA 2FLLA 2VG5A 1RT5B 2UUWA 3KK2A 4OL8A 3FQKA 5I42B 3IG1B 2BANB 4ZVFA 5T14A 3BGRB 5DLFA 3RB3A 4MIAA 4WFZA 5FDLB 2XCAA 1JLFB 3NL0A 1S9GA 1RT7B 3I0SB 4RW7B 5C24B 3DMJA 3OHAA 1TKTA 1ZTTA 3TQ1A 3RAXA 3CVKA 2BE2A 3KMSA 3DLKA 5HP1A 4Y34A 4IG0A 3H4BA 3QYYA 4R8UA 4Q0BB 2XGQA 4ECYA 5C42A 4ZPCA 2VA2A 3E51A 2WTFA 2ASJA 4Q43A 4NLQA 4M94A 2UUTA 4NLPA 3BSNA 1FK9B 4MKAA 1LW0B 5J1EA 3ICLA 3SFUA 4GC7A 2D3ZA 1IM4A 1YVFA 4KKOB 5KFVA 1S97A 3T5JA 3QIDA 2D3UA 5KT4A 3T1AA 1RT6A 1HQUB 1S1WB 5J2MB 3V6DB 4YR3A 1IKVB 3T5KA 2ZE2A 3CJ5A 4GC6A 2R8HA 3KOAA 1QE1B 1RDRA 3PVXA 4TY8B 2AQ4A 5L1JA 5KFEA 5C25A 3Q8PB 4FS1A 3RB4A 4Y3CA 3Q8QB 2XGPA 2ASLA 2FJWA 3MFIA 4IDKA 4RW7A 5C24A 1S0NA 1RT3A 1RT4A 5C5JA 3ISNC 4NLRA 4MH8A 1C1BA 1DTTB 4O4GA 2FVPA 3MECA 3KJVA 4NLYA 5F8MA 3FFIA 2WONB 3EZUA 1WNEA 1REVA 5HBMB 4O4RA 1HYSB 5KFSA 2W8KA 2AX1A 4ZP6A 3V6HA 2AGOA 4H4OA 1RYSA 2C2DA 1TL3B 5D3GA 5KG4A 4I7FB 3PW0A 4ZHRB 2F8EX 4ED8A 5DLGA 1JKHA 2W7OA 3DM2A 4LSLA 5J2NA 1TKXB 2RF2A 3QO9A 2JEIA 4O3NA 1CSJA 5J2PB 2OPSA 3QIPA 3MEEB 1RTDB 4ZMMA 4ECQA 3PW7A 4K50A 4TY8A 1HNIB 3BQ0A 2UVRA 5CYQA 3MEDA 1N5YB 1FKOA 1K1QA 1N4LA 5KFXA 5KFDA 4YR0A 3GV8B 1QAJA 4IH7A 3MEGB 5KFJA 1S6PA 2CJQA 2CKWA 4IH6A 4DG1B 2HNZA 1RT5A 5KG5A 3DLEB 4O3QA 4DEZA 4JV2A 2BANA 1RT1B 2R2SA 1RT3B 1RAJA 2IC3B 2ATLA 5HLFB 3CJ4A 3V4IA 4Q8FA 2IAJB 3LAKA 5L1IA 2D41A 4WFXA 4DL6A 4U6PA 2OPQB 1IKWB 4JV1A 3JYTA 1S48A 2OH2A 5KFCA 3DRPA 4TQSA 1S9EA 4O44A 3DLKB 4Q45A 4IG0B 3NKYA 4KBIA
chains in the Genus database with same CATH superfamily
1T9VA 3TUJC 5JUMA 2IM2A 1KN6A 3D54A 2HHXA 3NAIA 1JLQA 4IQMA 4X4OA 1TUVA 1L3KA 3KUEA 1TV6A 2P5VA 3DGPA 4ECVA 5C2CA 2VFSA 2E66A 5T41A 1AZSB 3O8WA 4LVOP 5CYJA 4NLSA 4TLRA 5K20B 3NGDA 4ECTA 4ECRA 3I5CA 2IVYA 3R5JB 4MK8A 2G0IA 3HVTA 3CDWA 5F8LA 3MM7A 2UXDF 3NMRA 1UPMB 4QIGA 2R2RA 2WHOA 2HBYB 2Q6CA 3ZTQA 1J5OA 2DY1A 2F4FA 4LF4J 3NNCA 2FGOA 1RTJA 2LEPA 1HWKA 2OEJA 4NLDA 4P7VA 5IT9Y 2VZ9A 4ZPDA 4FXVA 2BE2B 4DV4J 4CNYA 3DI6B 2J7UA 3LWMA 4C8OA 1LXNA 2LVWA 4LF7F 4OZLA 4USTA 2I5JB 1R31A 4DZDA 4CIOA 5DRKA 2XMAA 2DO4A 2BUNA 2EBGA 1H98A 2IM0A 1RWWB 3TRGA 2GMLA 3MEKA 4K0KF 2B3TB 4X4SA 4X62J 5CD4H 4KHRA 5A76A 4R5PB 3M8SA 3B54A 3N28A 2IRXA 1IKXB 2R8JA 2G0JA 4W90B 3W5ZA 3FZ2A 5EUHA 5JVHQ 4O3RA 2DPIA 4PQUB 1IBMJ 1U6BA 1YIJS 2KT2A 3LO3A 3UCZP 2QJ3A 2LXFA 1TKDA 4A48A 4PXBA 3W2VB 5I4MA 3QFWA 4JI2J 2B6AB 2QMUB 1R6YA 2V2KA 2HHPA 3ILOA 1M5PC 4KAIA 1A6LA 3KJQB 5DQHA 5KFNA 2R7TA 4OZ3A 4AD6A 2HQGA 2X1GA 4GKJJ 3TAMA 1NK7A 2NUHA 1KFSA 1V3RA 3HHLC 3IBCB 4JBCA 5B0GA 1Q0NA 2YKNA 1U0HB 2XG8A 3G8QA 2JC0A 1U47A 2E9TA 3KYLA 3F41A 2G9OA 4P71A 4MYTA 2ZH5A 2MHEA 4ATNA 5DDQC 3G96A 2HFUA 2EKNA 3KWMA 1EX8A 3HO1A 2VHGA 2RNEA 3AD8C 2N7CA 3A8JA 1FT8A 3FRYA 1V6HA 1UVLA 4RBTA 1IVZA 4JV5J 2QFIA 3DRRA 3CJKB 5KOWA 2VICA 2X51A 5F8HA 3RRGA 2NXCA 1F0XA 2WRMA 2MJUA 3CCRS 4QU7A 3KK1A 4LF2A 3CEDA 4JYAJ 3M8QA 2COLA 3IMQJ 2AKWB 3RAQA 2FVQA 4I68A 1MROB 4ZPWR 1C0TA 1YX2A 4GVLA 5KFOA 2DNZA 2QLBB 1Y5LB 2ZC4A 3B4MA 4WXWA 2RDIA 1M5HA 3CCUS 4F8RA 1ROFA 1NK9A 2OELA 1JLGA 1F60B 5KOXA 3IM8A 3N4WA 2C2RA 7AT1B 2ZZMA 3NNHA 2W2MP 1HMVA 1F3FA 1FEEA 2ZJQQ 1WC0A 4JI0F 1U48A 3MAHA 3TJAA 1M5SA 5ADZA 2EC0A 1SCJB 2XLJA 1TK5A 4LF6F 3R5DA 1HBMB 3SV4A 2YNFA 3W61A 4JI3F 2HVHA 4WFAQ 4NWBA 4QYZJ 1WF1A 4MTPA 3M9NB 1NH8A 1K44A 4PG5A 2VDHA 1HARA 3T5HA 1WDTA 3KLHA 3U1NA 4LRCA 2CIMA 4PG8A 2XWYA 1Q7LB 3W65A 3MEEA 4HHUA 2BJ3A 3BREA 2PIIA 3M9OB 3SCIE 5DDRC 2RKIA 1VFJA 4ES1A 3I82A 3R7NB 3PIOQ 1F5AA 4DV4F 1WOSA 4FF4A 5EWFA 3FRZA 4YS2A 1DBDA 1KTVA 2CZVC 2V5HG 2CWKA 4LF7J 4ZKAA 1O6XA 2XYPB 4Z7YA 3VGSA 1U1QA 1Y9OA 2L3MA 2VONA 3I5AA 4N77A 4OX6A 1HQ2A 3PW5A 1SL0A 3GIRA 1K1SA 4I2QB 2P9EA 1T03B 1WEZA 2CZ4A 1EP4B 2VG6B 1NZAA 1RWXB 2B43A 1TL4A 3R7SB 4NXMJ 3PR4A 2MQMA 4OYXA 3I4PA 2DNRA 2YVSA 1MU2A 2YKMB 3M05A 2H3EB 1WTFA 2R7VA 1R8AA 3ILJA 4QPXA 4J9KA 4H54A 2LQBA 3BR8A 1RWNB 2UV8A 4ZK7M 2CUYA 4XDCA 1TMMA 2QA4S 3POTB 4DR1F 3QIPB 2WSFC 1W2BR 2D7SA 4WKRA 1S6QA 4MAKA 1MG7A 4CH7A 3HVRA 1NNDA 2EKYA 1U6FA 2WZ1A 4V1Ak 5AJ3F 2BKOA 3RG6A 4CNZA 1HFEL 4GKKF 2Q3PA 2BW7A 4I56A 4ZLJA 4YB1P 2HURA 5ETLA 3FFIB 5HMWA 2VQFF 2PMZD 5GMKa 3EDRB 4M5MA 2OPPA 4ZVEA 4DPTA 5KTQA 4JI6F 3I9ZA 4KTQA 3BF4A 4FYXB 2DEJA 1L5UA 4E98A 2HNDB 3NY0A 4R8UB 4KO0A 2F1FA 4HL9A 1ZA1B 5CYMB 4ZOSA 4MIBA 5J2NB 2A6MA 1T05A 2JX2A 4K59A 1ZPWX 2YKMA 2DNPA 4NEZA 3HHLB 5EGYA 1IBCB 1B3TA 2QMXA 1LW2A 3M8PA 2HRTA 4KC5A 4EBDA 3PYEA 1RKJA 4DV7F 1R6VA 3NWRA 3MPWA 4GVBA 4NX9A 2AIRB 2VG7A 2C2MB 3S7RA 2EK6A 3U02A 3EWGA 3W63A 2HG4A 5J2MA 3I6PA 4LUBA 5IXUA 3EYZA 3C14A 2LEBA 3PYFA 4DQIA 2R8GA 1FJ7A 1U09A 2GVZA 3T1HF 3P6YC 5IV3A 1SV5B 1WOOA 4RWWA 4DX7A 2FGCA 1XJWB 2GQ2A 1X5TA 3NP5A 6AT1B 8ATCB 3CUNA 1OYDA 2RB7A 3MDFA 5LMUF 1SKWA 5KFQA 1KQFB 4CDIA 5ETSA 3OVAA 5HQLA 5DM7Q 1OSDA 4J9MA 4P52A 2V4RA 3DRPB 2UXDJ 2ILYA 1A9NB 1RHQB 3R97A 1W7WA 3AXMA 3UD4P 3R6LB 4YHHJ 2WVFA 1S4FA 2VJUA 5CYMA 2IBOA 4TVAB 4EMDA 2DXFA 1SC1B 4ELVA 1N88A 4OJGA 4XK8C 1VOMA 5D8HB 1S1UB 3HCXA 3J80Y 4AL7A 3LP2A 1SJRA 4LRDA 3DRSB 3IR5B 4NI2A 2AJ1A 4DFJA 2ADBA 4AXJA 1BQMB 3VR1A 2AJ2A 3GG1A 1JKHB 3BN4A 1XERA 3HVTB 1U2RA 4K4UA 1NCLA 4ZVTB 3MMJA 2MB0B 2XO6A 2YTCA 4IRCA 5AT1B 2BR0A 2HZCA 1SL2A 3W7BA 4J9OA 4DV0J 2D3OR 2XHCA 1T02A 4WIQA 2FYXA 1S79A 2KHCA 1NSQA 3KK1B 3G86A 2CPEA 1C1CA 1FKOB 2AJ0A 3T19A 2KVIA 4GMKA 2N4DA 4RU9A 2EK1A 1Y7PA 2O3DA 5GAEI 1C0TB 4W92B 3QLHA 3R8YA 3I0SA 1WC3A 3UR0A 1PIEA 2GCFA 3H42A 1VIOA 1YJVA 4OI1A 4U7UD 2WVBA 4A8KA 4B9TA 2VIHA 3E01A 1UCNA 2E7WA 4A47A 4BLGA 1P1LA 2DNKA 4JI8J 2IVMA 3PKYA 1N8RT 2A18A 2NR0A 5F8JA 3JYTB 1ZBTA 4L3NA 2XY5A 3IGNA 2IM1A 2KM8C 4EI2A 2RVJA 4KR0B 1SJ3P 1S9FA 3I96A 4ZJLA 5HVGA 1ZZNA 3A3NB 4HI2A 1WKJA 4FDFA 3A3OB 4PR6A 2HFVA 3OJUA 2CPHA 1JNRB 4PQUA 1TTHB 2ZBIA 2JNJA 1CJUB 4K4VA 3BO2A 3T1YF 1XMOJ 1BWEA 3AQPA 1UJ6A 4DI6A 4YUDA 1HWIA 4FKXA 1CJTA 3HVWA 2G2ZA 2PT0A 2W9CB 3IRXA 2NYHA 2O1PA 2VL1A 3F56A 4YQWA 1NAQA 2KTQA 3E8OA 2HAIA 3S01A 2LECA 2HW3A 3KLHB 2K1RA 2P8IA 5KFFA 1RWKB 3K89A 1Q95G 3IXQA 2KI2A 4X84A 4P6QA 4JI7F 4ICLA 1FTCA 1FJCA 1RTHA 3H7HB 5HL7Q 1DARA 4R0JA 1CQNA 1N54B 1FE0A 4PRFA 1V5IB 2H9ZA 3RBXA 4WZQA 3P8BB 1NKCA 2V67A 2R2TA 2H1YA 3LPEA 4LR7A 5F0WA 4DSLA 1K9MT 1UEVA 4UT4A 1ACMB 1ZAWA 5MAOA 1U24A 3V5RA 3G2XA 2DH8A 4HACB 2CG4A 3K8VA 3W2WB 2AYMA 4M5GA 2XQCA 2ZVIA 4DV7J 4IQXA 1F1BB 3KLVA 2X3GA 2CAJA 1WSVA 4RJVA 2AGQA 3TZZA 4CO1A 4F4YA 3IG1A 1KR4A 3CC7S 1FXLA 3Q22A 2WW4A 2OPSB 5LSLA 3CCZA 2ALZA 4X66J 4IUFA 1BC6A 1FESA 1RT7A 4IRKA 2DGUA 3M2VB 1HI1A 2DHXA 4I2PB 1TP7A 2HLTA 1RUSA 4LSNA 3HDSA 2E1MC 4A8YA 1VI7A 2GV1A 2YX7A 1L3VA 3PYDA 4A8OA 5EX0A 3GU0A 4YEAA 4DCOB 3J81Y 5HLFA 3ZFVA 1Y10A 2RDDA 1U1NA 1HIYA 1NHVA 4DZ6A 2CQGA 3SBMA 4A8WA 4X4NA 1HPZB 3R27A 4ECUA 3KTQA 1FDBA 4PWDA 2ZH1A 3SI8A 3RR8A 1GXLA 3CDEA 1D1UA 3KHRA 4ED7A 1GT8A 1UKUA 2P6TA 3QO9B 4LRBA 2R7XA 4ECZA 3P5BP 1RWOB 1R8CA 1H6KX 4DV1J 3GMGA 3LOUA 3BSOA 2HMIA 2PI4A 4AL6A 1U0SA 1S1TB 2B4UA 2FJXA 3PZPA 2CPFA 4ED0A 4ERDA 2FC8A 2HBZB 1VIXA 2J6UA 3HJVA 3M2VA 1UEKA 1JLAB 3OHBA 4YB7A 4J9UE 4M5DB 1GX6A 2ALYB 1RT4B 1UWBB 1AT1B 2KN4A 1PKUA 3MM7B 5H9FJ 3QATA 1X9WA 5D0HA 4O4GB 1HW8A 4X4UA 3L9ZA 2KXHA 3FVYA 4FNHA 4HTIA 4NL5A 1CQMA 4X64F 2CRLA 2LDYA 3BB5A 4RLEA 5LMNJ 1ZETA 2IA6A 4DSJA 3A12A 4DF4A 3LP0A 1FDAA 1B0TA 2ATCB 2QTWA 2YQ1A 4YY3J 2V8DA 2J6SA 5AE3A 3H90A 2PGCA 2AHOB 1VBZA 3GJRB 5B09A 4XIUA 2LXIA 3E3XA 2G1HA 3AT1B 2O5DA 3NOCA 2I5JA 3OQ2A 4HT7A 4ZVUB 1PCAA 1HD1A 3TVKA 1YJRA 4PWDB 4HVZA 2ZH4A 1M5OC 1ZYQA 3DOLA 2AQ4A 3LAMA 2W8LA 4IFYB 4OHVA 4ZVOB 5HMXA 3H40A 4WE1A 4CM0A 2LQJA 3G6VA 4DWIA 1N0VC 5KFUA 1YLXA 4UUXA 4QU6A 2BKNA 3POTA 4JYAF 1WC4A 1U1PA 2CYYA 2LXUA 1NJXA 4KFBB 3CSKA 1DURA 2UUWA 4F3MA 4W98A 1RAAB 4OL8A 3FQKA 4OJHA 4ZVFA 4OI0A 3BGRB 3DC2A 1FA0A 4ZPVR 2ZBRA 3NL0A 4L73A 1F2GA 1Q82T 2OP5A 4OX7A 2QX0A 4PXEA 3RAXA 4AUKA 2BE2A 5HP1A 3IFEA 4B3TJ 3CIMA 1VGYA 1QM9A 2XGQA 3U1LA 1LFPA 4EUVA 4UQGA 4ZPCA 1I94F 2XMKA 3QFHA 2BZ2A 1X5OA 5JVGQ 4P2MA 1OY8A 1YG0A 3GG0A 3L4BC 4KY3A 3G8SA 3MPUB 3PX4A 1TFWA 1DHMA 1NEEA 5J1EA 2CQ2A 2RT3A 3HZGA 2D3ZA 1IM4A 5IQQA 4KKOB 2DGXA 2HQDA 4DR1J 2HVZA 4DLEA 3NCPA 4X4VA 1PAEX 1O8BA 3ENQA 3V6DB 2BV3A 2LFVA 2CPDA 2NUUG 2RD5C 6FD1A 2ZE2A 4ZLPA 3PVXA 4KIAA 3K5NA 3GONA 1VK8A 1YQHA 1Z1ZA 4FS1A 4DS4A 3RB4A 1NK8A 5E3AA 1MROA 3Q8QB 2BJ7A 2XGPA 2R7QA 2DNYA 4JI6J 5C24A 4MJKA 3HT0A 1BQXA 3EZOA 1OWXA 3THPA 5C5JA 2BJ9A 1QSYA 1C1BA 1DTTB 4X4QA 3MECA 2HHSA 3BEGB 2ASYA 3BBFA 5F8MA 1HWLA 4DPOA 2WONB 3ISZA 4UW2A 4N5SA 1M90T 1Y11A 1RAGB 2DCUB 3TZWA 4ANCA 3V6HA 2H4YB 4ZHRB 2F8EX 3AAWB 5DLGA 1JKHA 1MN9A 4LSLA 4ZIVA 3DLHA 5IC6B 1TKXB 2RF2A 4DCJB 2JEIA 1FFSB 3H2VE 2CPYA 2LU2A 1OY6A 4NMLA 4ECQA 1Q7YT 2E5LJ 1QSLA 1UTAA 3OXGA 1SKSA 4HDHA 4K50A 3BQ0A 1N0UA 4W4MA 3TUPA 1I51B 3D6MB 5CYQA 4UOFA 2ZDOA 1FKOA 5KFXA 4YR0A 4F2RA 1FRLA 3CE8A 3N0VA 1QAJA 3OHAA 1F2HA 3TARA 4OHZA 2HZVA 3OFFA 1S6PA 1T9XA 2CJQA 2CKWA 2QC3A 2U2FA 2ZEJA 2Q1LA 3DOMB 1SIWB 4DEZA 5KG5A 5GADU 4JV2A 1W2IA 3GFHA 1EZZB 4OYPA 1RT1B 2R2SA 5A6PA 3BS9A 2IC3B 2UXCF 2CJYB 2DEIA 1RWPB 4Q8FA 4O0NA 1VC5A 1VQLS 3LAKA 5L1IA 3OPKA 1RBAA 4DR2F 3EDQB 5DO2A 5FD1A 4AQYF 4U6PA 4JV1A 3JYTA 2LP4A 5J1NA 2OH2A 1S9EA 2MYFA 3PFEA 4IYQA 3IBFB 5KFMA 1F9EB 1AFJA 2ILZA 4CLKA 3RZAA 3DM2B 1QY7A 5THWA 2ZJRQ 1RAOA 3QAEA 4N41A 4EGLA 3KUHA 2UUCF 1VQSA 2SXLA 4HACA 3Q8RB 2LLZA 2K3KA 2Z58B 1R8HA 1Y00A 1IJEB 1FEHA 1SC6A 4DV0F 3MMAA 2YQ3A 4QIEA 2BQRA 4RW8A 1HHTP 3OD2A 2C1EB 3GR0A 3NOGA 1B99A 4NRUA 1GMWA 2QT7A 2IRYA 4MMOA 1KFDA 4DQRA 2J8AA 1LEOA 4ICLB 5KG2A 4LF9J 2R8KA 1RTHB 2W9CA 4LQ3A 2XYGB 1JLAA 2K7JA 3BR9A 3A8KA 1T7PA 3FBBA 1WEXA 5B08A 1BGXT 3RU0A 4F67A 9ATCB 4B3OB 2EBEA 1RQ0A 1SIZA 1UEUA 3OT9A 4EU0A 3I4HX 2YXLA 3KHLA 1NJIT 3KLIB 1S10A 2XB2D 3IS9B 3UVJB 1NKEA 2GIRA 2RQKA 2CQHA 1CULB 2IM3A 1BXNA 4FYVB 2VG6A 4J9SA 2DR6A 1DAXA 1LXJA 1JNZB 2YH0A 4Y2KA 3TUIC 5IS2A 2UU9J 4ENOA 4RW6A 3H2UB 3PNIA 5KFZA 4J91A 3MAQA 4DHVA 1JLBA 2ZNZA 1LOUA 2YWKA 2MSTA 1FNOA 4Y2AA 3FJ2A 2RS2A 4I7FA 1S77D 1HLWA 4P7TA 1U4BA 4IFYA 2AJ4A 1S0OA 4IOAQ 1J5EF 4JUZA 4ZCIA 1VHIA 5I42A 8AT1B 1SBRA 4C6AA 3MURP 2RU3A 3G71S 4K4YA 3HHNB 4WZMA 2HGMA 2KM8B 1FKPB 3GFYA 1Y5NB 3NGTA 5DG7A 2I1RA 4JI7J 2HQCA 2AYEA 1YHQS 2OIHA 5EWGA 4UOCA 2GVDB 4NEYA 3QZ7A 1UJ5A 3P5TL 1VC6A 3VZIA 1RXOB 1DQ8A 3M2UB 4Q0BA 3MF5A 2HVIA 3HD1A 1RSCA 1AUDA 2KFNA 3BBCA 1RWVB 4IH5A 2C2EA 4NCBA 5KG7A 4UY85 2JC1A 4OMFG 5I3QA 3FBCA 4OYIA 4IFVA 1RT2B 4MFBA 2P2CB 3C6TA 4ES3A 3ILIA 5LOQA 4LF8F 2GO9A 4ZP9A 2DCLA 2WBRA 2DGSA 3LP2B 4NI2B 1F5CA 1MWZA 4Z2XA 4HHJA 3FSIA 4Y2IA 2C22A 2CA9A 3HZEA 4GVBB 1L3UA 3KHHA 4ZCKA 3J7A1 4PUOB 3N6LA 4DR4F 3BPDA 4KE5A 2VUGA 4FKYA 5FLXY 1ZAVA 2MGZA 4EEYA 1D09B 5C25B 1S5ZA 3BBBA 1DTQB 3PJ9A 4YR2A 2DXDA 2B4VA 4CLZA 2F5GA 3BGFA 2H54B 1IBKF 1CBKA 2BQUA 1KVJA 1GH8A 3JS9A 4IO9Q 3KLGB 1AROP 1YJ7A 1VRTA 4WFYA 3NNAA 1AB8A 2ZOMA 4O0IA 4OI6A 5KFHA 5KFGA 1Y0HA 5A2QY 2A2DA 5ETVA 4KO0B 4DR2J 4AQYJ 2DISA 3N9UC 1IBLF 4FPRA 4FN5A 1R0BG 2L9DA 4CM2A 1YGYA 2MY8A 4QBUA 3HXMA 2Y0SD 1KSPA 1G6BA 1TKZB 3NWGA 3QGIA 4CLUA 3NS6A 5LJ3Y 5ETKA 1RCOB 1HNZJ 4IFVB 2NXJA 4LBHA 4QPTA 5LXYA 2KXFA 5HO4A 2EG1A 4ELTA 1UVMA 4Q44A 2L41A 4TYAA 4LMZA 3LALA 2EW9A 4ITSA 4ECSA 3RR7A 3E2EA 4XTTA 2B9XA 5CCLA 3OTOJ 3Q8UA 4RPFA 1OQ6A 2HGNA 4ILLA 4KSEB 5CQGA 1DY3A 1EJ7L 5I3UB 2FJVA 2BEFA 2GMJA 3WIUA 5KT6A 1Z2LA 2JFDA 3CD5A 1PYSB 2M70A 4X4TA 4ED1A 1T8EA 1PO6A 2UUBJ 2CQCA 2GNKA 2E5GA 3J7YI 1G1XA 5ETRA 4DR3J 1FWLA 5HAOA 4ZCLA 2XY6A 3OTDA 3GE9A 5D4NA 3M6XA 4DUTA 4Y00A 5F3ZA 1OMSA 2IPOB 5LXRA 1SKUB 3W2VA 5M2UA 2CWXA 2DIVA 3GIJA 2XMJA 2DR5A 4ETXA 4K0KJ 3CO9A 3QSIA 3IAS9 3UN3A 1FI4A 3VV2B 3T3FA 3FSXA 3O44A 4OZJA 1M5VC 3DOMA 4KH1B 3J81j 3QRRA 4LT6A 4YDXA 4RNFA 5L9NA 2ZUAA 2EPIA 1RT1A 5F0UA 3TANA 1WWHA 1R89A 1DTTA 4DQSA 1MSWD 4ZLLA 5L46A 2VOPA 3VAIA 1ZPVA 4KT0C 4M1KA 1VRUB 2BABA 1VQMS 2VBZA 1MWQA 1U7LA 1WHWA 2D9PA 2GIQA 1JLQB 3B78A 4DXLA 2Y1IA 2VFRA 1JJHA 4PXDA 5BYQA 1RHKB 3V6DA 1KEKA 4NZ7A 3BZQA 5ETMA 3RBEA 1SL1A 1T3OA 2V2VA 3PACA 4K2JA 5HN0A 3D2WA 2VQEF 1U8SA 3OJSA 3ZTOA 2Y1LB 4NLUA 5A6WA 4J9NA 1CS4B 4WTYA 1JLCB 3D67A 3UWTA 3NLCA 3H59A 1SUQB 4P74A 2CXEA 4USHA 3T5LA 4A8MP 4F4KA 1TU0B 3JSMB 3BYRA 4RBUA 5BYSA 1VBYA 2FZKB 1TL1A 4YOEA 1VQYA 2B0GA 3D28A 1FFGB 2WONA 3D7SB 1H74A 1MMLA 3FEZA 2QL5B 2RQ4A 2XI3A 4L76A 3HF5A 1P8GA 4B08A 3CCQS 1Q81T 3K5PA 4RW4B 1UJ4A 1FD2A 2DNQA 2UXBJ 3M8WA 4NLWA 2V4JA 2XNQA 4A46A 2HFZA 3G6XA 1M1GA 4I64A 3M30B 3Q8VA 1X4HA 3BGUA 3JAMU 3ULHA 3IS9A 1TKXA 3MZIA 4QWAA 4RX6A 1TR0A 3FSYA 4ID8A 4TXSA 3CCLS 1N34J 3NGKA 1HNWF 1AW0A 5KFYA 3DRRB 3CJKA 3D1OA 1RBOB 2V6AA 4DPWA 4TKTA 2KVQE 1MW7A 5D0EA 1KWMA 3L7PA 4USWA 2HMIB 4FZVA 3M1VA 2W9AA 4ZN3A 1S1TA 2DVIA 2I2YA 1S6PB 1WACA 3GJQB 4GO7X 1NSKL 5K8PA 3W8PA 1N56A 1HQEB 2QSWA 4F3OA 1IKYA 4PYDA 1UWAA 2ZH7A 1IBLJ 2IC3A 4DUYF 4A8SA 4J90A 5DG9A 2ZH3A 1IM6A 1W25A 3SDEA 4NLTA 3NCQA 1R0AB 4DL3A 3NXZA 1XNQF 4P72A 2GC8A 2NPFA 3QWPA 1A7GE 2HHHF 3SFGA 3HSDA 5KFRA 2A6OA 5B0CA 5HBMA 3RBDA 2KB2A 3AJ1A 4N8NA 2FHJA 3HMJG 4C7QA 3CJ3A 1Z2ZA 2I38A 2APOA 3KLFA 2HVDA 1RACB 4YB5A 1S59A 2DXEA 2ZOGA 5IT9U 2RDJA 3UDCA 3J7ZT 1SVDA 1WSRA 3FUYA 4CH0S 4UQTA 4JOUA 3NGSA 1T3NA 1N32F 4M5NA 1HNXF 1RAHB 2ACYA 2WK4A 3MM9A 2M0GB 1U1MA 4HT5A 3C6UB 4ZPAA 1YJWS 1FDNA 4NE9C 1TL5A 1QD1A 3MEGA 3AJ2A 3B4DA 4NA1A 4C3MA 1JXLA 3TAPA 3DHWC 5IQ6A 5KFPA 4DV2J 4ZP7A 2QL7B 2HHTA 4QW8A 3W5YA 3N79A 4BBYA 2E44A 4I0WA 1HPZA 4RUHA 5F8IA 2OPRA 2DHGA 2F8MA 4KRWA 4J9PA 2AWZA 4E0DA 1S76D 2OSQA 3CCJS 4C3LA 2UUCJ 3KLEB 2XLKA 4FPIA 1HQUA 4TYBA 1IQZA 4URGA 2OHDA 4ZPTR 2KL8A 1FNMA 2I8EA 3X3UA 4C3KA 4ZVGA 3QRPA 2IHR1 4J9QA 2V34A 1Q1KA 5DQIA 4ED6A 5KT3A 3DYAB 2HNYA 4MK7A 2NCKL 2Q66A 1HHQA 2OGUA 4DL4A 2XC9A 1N6QA 2OFGX 5D77A 1TV6B 2ERRA 1JJ2R 2FVSA 3OVSA 2F9JA 1UW4A 3UN5A 2QE5A 4WCEQ 3CJTA 4LF9F 1BY9A 2CVEA 3C66A 2J76E 2AGPA 3CJSA 5CCMA 3M2UA 1QVFR 3HKZD 3QAUA 4GO5X 3MR3A 1NK0A 4QW9A 4B3RF 1RTJB 1VDHA 2OPQA 3SV3A 2VBYA 3PTWA 4RUAA 1LV5A 3MM8A 2UXBF 3DLBA 2GW8A 2QV6A 2CFXA 2RUGA 3H98A 2FJBB 2RIJA 3M2RB 4N8OA 2CZ9A 5KG0A 4ILRA 5KFIA 2JFKA 2QZ8A 3EXYA 2V8VA 1ZOTA 4HI1A 4PWWA 5F41A 4MKVA 2MKKA 4CO5A 2XEXA 2CQ0A 4EBEA 1KQSR 2HFNA 1PBUA 3PO5A 4PPZA 1UFKA 2CQ4A 4DV6F 1TAQA 3SIPB 1EETB 3NGUA 2KJVA 2XZDB 1QUVA 2Z2ZA 3KJFB 2MGZB 2Y1JA 1RHRB 1FF2A 3RW6A 1Z4UA 2FUG9 4EO8A 3ZZYA 2XHWA 1NH7A 3BJYA 3ILLA 4B9UA 4QOTA 3WC0A 2CPXA 1IR0A 4JI4F 3UQSA 2BOPA 1JQGA 3M6UA 3MPYA 4JI5F 1RA7A 2B7BB 4XAKA 4Y2CA 3VGUA 3CTRA 4FF1A 2HHUA 2B6AA 3HKWA 4USUA 1GK8A 2KT5A 4A8XA 3NS7B 4NLXA 1FJEB 1VHFA 2Y3YA 3MAAB 2V69A 5HK4A 3WHIA 2KFYA 3UO0A 3SMZA 5H1SV 2GQCA 3MM8B 1HD0A 3HHKA 2FHOB 4TNOA 4DR6J 2MQOA 1D3WA 4R5PA 1HKAA 3VZHA 8RUCA 3MCNA 2K3IA 2QA2A 3LGMA 4QYRA 3UCGA 4RNMA 3HULA 4FYDA 1S1UA 3CC4S 4DJBA 3OSPA 2IIHA 4QR0A 4ZHRA 1AZSA 1G2EA 3TUZC 4BC9A 2ZE2B 2HIQA 2W25A 3EVWA 1NM2A 1RGVA 5K9FA 4LF6J 3A3PB 2MSSA 4WP9A 3VGTA 4DMZA 5E41A 4B3MF 2FHKA 2XMVA 3CIZA 2JHEA 4QZVB 5F9NA 2MY7A 2ZKUA 1IBKJ 2D74B 2ZUGA 1WJ9A 3OL7A 2V94A 3PJXA 1K0VA 2VG5B 4HHHA 4CLYA 1Q53A 3GSIA 3KKFA 2YWEA 2YWGA 3JB9k 3L7OA 1VQKS 3BYPA 2GJ2A 1JLCA 4DV2F 3BSAA 4QYZK 2NQPA 4DG1A 4MIWA 2YX1A 1I5OB 2ZOFA 5KFLA 2UUAJ 4IR9A 1CJVA 4L75A 1TKTB 5IM0A 4ANEA 5GAHI 3P49B 3ET6B 4WWSA 3HLUA 3NMAA 4BWMA 4RW9A 4LFCJ 2AJFE 1C4AA 4RNNA 1R0AA 1VRUA 2E1CA 3CCTA 2HS4A 4KHPJ 3O5TB 2W2NP 2XSFA 1S7HA 5DJBA 1TL7B 3HD2A 3PW2A 1FK9A 1HBMA 2OI2A 3MMBB 3MI7X 2LEAA 4P9SA 1BE4A 2DGWA 2I9SA 5G0RA 4D3GA 4C8YA 1JLBB 4HLBA 3U7JA 1P1TA 4DSFA 2UUBF 3LA0A 4OHXA 1HNVB 4J9RA 3KLFB 2DTJA 5HATA 4LQ9A 2CNLB 2AV5A 3KK2A 5DLFA 1VC0A 4C4WA 3IP0A 2H51B 3M1VB 4F2SA 3JTNA 4OV1A 3G4SS 2X1BA 2ZH2A 1JLFB 1NSPA 1S9GA 3JSBA 3SYZA 1XIQA 1PILA 5CAAA 3I0SB 4RW7B 3DMJA 3CT9A 4LF4F 1TKTA 3R9LA 1SC4B 2GO8A 2QLJB 5HJXA 5AJ3J 3CVKA 3LGNA 3TQ1A 3ET6A 5D6GA 2VH7A 4Y34A 1YBTA 5A8RB 3H4BA 3QYYA 2D9OA 3KG0A 2VQFJ 4KPYA 4RL1A 2EI5A 3GZ7A 2G1DA 1WC6A 2V4JB 4X4RA 4M5HA 5EHHA 2Z2MA 4ECYA 3Q0AA 4LVNP 2GHPA 1KTQA 2J9CA 4Q43A 4DFMA 2FB0A 2RU9A 4M94A 2MZJA 3OR1B 1VQOS 1WHXA 2HS3A 1U1RA 3MMAB 1VRQC 5I3PA 1FJGF 3SFUA 1IR2A 3AY0A 3ICLA 1EKSA 2RHQB 3M4XA 4CLWA 4X62F 1S97A 3C2PA 2ZBQA 2IY5B 2JDJA 1Y4ZB 2DH7A 2M5YA 2HQ3A 2RUSA 4YR3A 4DSKA 2CJ9A 3BM7A 4BHQA 2WSEC 1S12A 2IYGA 1IBMF 3LH2S 2A0FB 5C25A 5A8KB 1NK6A 3IBWA 3Q8PB 3ZNUA 2O67A 3UD5A 2QA1A 2RS8A 1L3TA 1KVKA 1OPZA 3T1HJ 1YJNS 4RW7A 1SI9A 2GVDA 2PDAA 3VAGA 3IC1A 4DR7F 4DUZF 3CCWA 3TX8A 4NLRA 4MH8A 1NMEB 2QRRA 4NPOA 3RW7A 3KJVA 3PKMA 4PCQA 1UETA 3O2IA 5IC4B 4KH0B 1X7VA 3IWXA 4LBPA 1REVA 2P6SA 1DRZA 1HYSB 4B9NA 4FF2A 1HI0P 2VU5A 4OHWA 3K58A 2HHQA 1PYOB 3DXSX 3JXOA 4DFKA 1RYSA 1HNWJ 3OR1A 1TL3B 5D3GA 1VYAA 4I7FB 2IA0A 2LDIA 5KG4A 4UUWA 5K8MA 2W7OA 3HFKA 3VAKA 3ZZTA 4O3NA 2ZHAA 4P75A 5J2PB 4ZMMA 3QIPA 3MEEB 2KYZA 4NZ6A 1H0HB 4U67Q 1YTYA 4CO0A 2O66A 2RJZA 4F7VA 3QQCD 1YDLA 2HWTA 2W4PA 1H2UX 3GV8B 2VKRA 3CD7A 3MEGB 5KFJA 3K5OA 2UUAF 3C14B 3W5XA 4FF3A 1CEZA 1XK8A 1RT5A 4J7CA 4O3QA 1E6VA 2BANA 3AA9A 2MMYA 5E33A 1XNQJ 3KMQA 4WFNQ 3LPYA 3MPDA 1FRXA 3MMCB 2CDQA 3CJ4A 3VGVA 2DY9A 4V19J 9RUBA 5BR8J 4WFXA 1H73A 4F0KA 4DSEA 4DL6A 2C2NA 1IKWB 5JJBA 3DFEA 4HH0A 2C2KB 4TQSA 4B3SJ 1EAYC 5D4LA 3DLKB 2OUGA 2YPZA 3DNCA 3UW1A 3W60A 2X1AA 3FEYB 4ZN1A 5IT0A 3HK2A 2AJQA 2HQIA 1OYEA 3TVYA 2RRBA 2JLFA 4DL5A 1KD1T 4CRJA 1NDCA 4ELUA 1BLUA 4PWUA 1RZMA 5J2PA 1FRKA 2F65A 2HNYB 2Z30B 1EKRA 3QT5A 4CO2A 3SSRA 3ETOA 3IN5A 2HK3A 2WB4A 2HPUA 3FCWA 5KFKA 2JZ5A 4K5SA 3T1YJ 1XMOF 3KG1A 2R8IA 1LKZA 1F5BA 2B51A 1IKVA 2UVWA 4DX8H 4BS2A 2OMOA 2AZ3A 5ITHA 4U8VA 1B7YB 1CJKA 5J2QA 3GQCA 3HP6A 1UVJA 4LFAJ 3EPGA 1R8BA 2HLUA 4NYOA 3PY8A 2HGLA 3QLHB 3T9ZA 4QJVA 3EM1A 3AB4B 4LJMA 2JH3A 1ZA2B 2GGPB 1RHJB 2PSZA 3H25A 4EO6A 2H65B 2OJ3A 4R0EA 1FNXH 2DGQA 3NEKA 2C3YA 2FVCA 2M4MA 2NLWA 1EETA 3O6QA 5GVQA 3BQ1A 1ZS6A 5EDWA 3LP1A 5F8GA 4ANDA 4C0BA 4OZ5A 1WDDA 5D4PA 5HROB 5KT5A 4LBIA 3Q8SB 3I0RA 1X8DA 3OL6A 3MUVP 3BDEA 1VBXA 1VLOA 2EXUA 2I0XA 3CCES 3MPVA 1APSA 2FJEB 3DLJA 2GVZB 2HSEB 5ETTA 2KZZA 3UDLA 3M32A 3B8HA 3ZXWA 1SV5A 2HEKA 5IV4A 1KONA 4P2FA 3KK3A 3ZZZA 3OV7A 1JK9B 1QAXA 1YJTA 1VQ4S 1S57A 4DR7J 3AFGA 1VISA 2BM0A 4ZVHA 3PEHA 2ACMA 3RAMA 2ROEA 2PMHA 2QGFB 2R9LA 2YNGB 4DL2A 2WAQD 2J0SD 4B3RJ 3JSMA 3MR5A 3R5GA 1LWXA 4IDKB 1FE4A 3EVOA 3V81B 3WDOA 5IZHA 3PW4A 1WEYA 2PFDA 2GAGC 2HFSA 3CDAA 1JIHA 4K7QA 1R8PA 3GYNA 1NBEB 1FX2A 1X4BA 3TOQA 4L3KA 1WTBA 1VQ8S 3G6YA 3R3TA 3H8YA 2N4CA 3EJMA 2ZH9A 2LCWA 2FVRA 2HAFA 3EPIA 2MQLA 5IM0B 1SJ4P 4WTOB 1NJWA 2W24A 4V19X 2MPUA 3HSJA 4WYLA 4DSIA 3OFEA 5E5NA 2J5AA 3C3LA 1RU1A 2YKPA 1PC5A 2J9EA 5CHCB 5J1EB 2A3JA 2CNKB 1GTHA 3L09A 2RQCA 3CCSS 4KKOA 3NG8A 1R43A 1XR6A 1S9EB 2WW8A 3BKUA 3MM5B 1SPBP 1OSCA 2C28A 1G3OA 3WC2A 4ID5B 4NCAA 4FP9A 1FO1A 3MMBA 3OUYB 2POKA 2V9WA 2JEJA 5G0RB 3MM6A 4JI4J 2QLFB 3AD7C 2UU9F 4X2BA 3M6VA 4EYHB 3RB0A 3A4TA 1HBOB 3WIVA 4DF8A 1G7CB 4RW8B 3W66A 1GMUA 2EWHA 3R5BA 2CPZA 2EG2A 3C6UA 1T9TA 3N6MA 1KKHA 2FLPA 2FIUA 3TZXA 2W2PP 1FWKA 4DV3J 3AOCA 4RW9B 4M5LA 4C8NA 3TVZA 3M7VA 4FVCA 4MK9A 4EFAC 2MXYA 1QUPA 3A8EA 2CDRB 4USIA 3R5AA 5C2GA 2NXNA 3CJRA 4OLPA 2N7YA 2E5JA 4YY3F 1EP4A 1D9DA 2W9BB 3TYTA 4QWEA 2WOMB 2ZWOA 5E3RA 3LW5C 2C3UA 1FRIA 3WBZA 1NZ8A 4RKUC 2MZ1A 1X0FA 3BGOP 3GYGA 1L3SA 1Q16B 3IRXB 2XSJA 1WI8A 2BVZA 4RW6B 3ISND 2WSCC 2NSBA 2B9YA 3EGNA 2M8DB 1RTZA 3CD6S 4FXDA 3MM6B 5M2RA 3DYAA 5CYQB 2W7AA 5FDLA 2ROPA 1RT6B 3GCXP 3MOZA 4OFZA 4U9RA 1N6QB 2XO7A 1SQGA 2ZBCA 4OYBA 4DQQA 2VF3A 4OJ3A 4Q2MA 3DCAA 3SDEB 3ZTRA 4CI0B 3PIPQ 1JLFA 1GFWB 3PCOB 1RWMB 3N5FA 3ZZUA 3GIIA 1N52B 2ZNYA 3QT8A 5JXSA 1UWBA 1BQNB 3EX7B 3ONQA 4EYIB 2HBQB 1KLMB 4ILMA 4LFCF 3DLEA 1E6YB 5C42B 2LKZA 4NYZA 5J1PA 1E6VB 3I56S 4KHPF 2OD6A 1N33F 2BM1A 1SH0A 1XR5A 2JL9A 4JI8F 1QJHA 3B6BA 2W7PA 3HI9A 4O3PA 1REVB 4I69A 4F3QA 3BH7B 2RRAA 3K5LA 3TEGA 2ZJPQ 2Y8WA 2KHDA 4OLOA 1C0UB 2ZZTA 5D78A 3RYLA 4CYUA 1S1WA 1MWYA 4U7CA 2DT9A 2MKYA 4OYOA 2MQQA 3P4UB 3CJ8A 2E5IA 1XN9A 2AX0A 3SXLA 2GFFA 1URNA 1RTDA 2VOOA 2W2OP 4G1IA 2NYIA 4PABA 2MHNA 3DRYA 3CF5Q 1S1XB 1HBUB 3QGPA 1NSAA 1HWUA 6FDRA 2JEFA 1F9FA 4NCGB 2OPRB 1Q8KA 2HHVA 2RH3A 3DKDA 2IYIA 3P45B 5E7OB 1UVIA 3KJVB 5KFWA 2CQDA 4A8QA 4ER8A 1KDNA 1J5OB 2XMTA 4HR2A 5DZ7A 3RRHA 2DRAA 2MZQA 3THTA 1XEZA 3KFWX 4ZITA 4F04B 4LF1A 2AU0A 2BRKA 5HP1B 1LWEA 5CD4A 1N36J 4CLLA 3SQOP 2RHSB 2OO4A 4I6WA 1PJ5A 4NA2A 3KNAA 5B0FA 2DNMA 3H5YA 4NZ0A 3FBFA 3W9HA 1K8AT 2OKQA 3H0PA 1BQMA 2L9WA 1M1HA 2QLWA 3ZO7A 4L74A 3PJWA 3W1YC 1U1LA 3BGRA 4N7TA 4P73A 1SJ1A 4CP5A 1VLYA 4DX5A 1NK4A 2E5LF 4QWCA 1N48A 1FFWB 1WG1A 2KU7A 2KKHA 4UTGA 5BYRA 1B4SA 4CLPA 4ALZA 2Z8QA 2JLEA 2PE8A 3F0NA 2BJEA 1VRTB 5B0BA 1MMNA 5HSPA 4DUZJ 3C15B 4ZJQA 1C1CB 1GXUA 1ZTWA 1SH2A 2FY1A 4IO1A 4X65J 1X4AA 2AW0A 2OLWA 1MNEA 1IWGA 1NPKA 2H4WB 4UF4A 2B9WA 2QLXA 3ZTSA 4Y6IA 5KT2A 2E5HA 3R2CJ 4C9DA 3TAMB 5DS7A 3MXHP 3DDNA 1GEHA 1T9WA 4KYZA 2DRDA 5DG8A 4F50A 3S1TA 2VPXB 4EBCA 3SCJE 1RBLA 3AD9C 3JQKA 4MKYA 3D6HB 4KFBA 3D66A 4OYMA 5K8NA 1B0VA 4ZPBA 1U2FA 3JSYA 1S4EA 3D0IE 4G1QA 1CC8A 4Z37A 5HROA 2OD4A 3QGHA 3IRWP 2KXNB 1Y3KA 5IFMA 3DU5A 3EZ5A 3CC2S 4NMXA 3H5SA 4DV1F 2VJVA 1WC1A 2V50A 1NO8A 2FC9A 2CG8A 3FMWA 1JB0C 5GAGI 3L95X 2AEFA 3HSZA 4O3SA 4ZP8A 2DIUA 3C8YA 1S1VA 1RHUB 5HMYA 1SB6A 1S9GB 1YRXA 1LK7A 2GGPA 3DI6A 1RJJA 1P9YA 3MGJA 3OFGA 1AXQA 3VWSA 4IOCQ 1S6UA 1CPZA 3CPWR 1N33J 4RR5A 2MKSA 1PYTA 1EQMA 2ZH8A 4K8RA 5DQGA 2IAJA 1KP6A 2AT1B 2GX8A 2YWHA 2C3OA 5L1KA 4F4AA 4XPCA 2J7WA 3DLLQ 3TI0A 1HBNB 1UPPA 3HT3A 2E7VA 4RW4A 3A13A 2V68A 1IKXA 1IWAA 3A8IA 3G8TA 1VK3A 3GFXA 3DRSA 3PV8A 5KFBA 1FVQA 2DGVA 2Z56B 1LWCB 4M63A 2ZM6F 2H5IB 4AYBD 5DM6Q 1XMQJ 4TY9A 4G65A 2D1CA 3CDUA 1JWWA 4USMA 2H5JB 1EARA 3B82A 4PQAA 2WBMA 3MEDB 3RUBL 1LWFB 3TX0A 3VAHA 2L9NA 3UD3P 2GMHA 1DFDA 1JMTA 4I6YA 2ZKTA 3ZZPA 4QWDA 1FTRA 4N76A 1VQNS 3EE3A 4ED2A 3QJJA 3MHYA 1TVRA 2B4OA 4OZ2A 3TJ8A 2UVVA 3V81A 3LANA 2QMWA 4NYPA 5A8KA 1UVNA 1TL1B 2EFNA 3H5UA 3ZNJ1 5M2PA 2M88A 2ZVSA 5F9LA 2Z0GA 1HQEA 2CJBA 3DN9A 1R7IA 1BMQB 3QSYB 3W8GA 1DJ0A 3ZZRA 3C16A 2D3O1 1CVJA 3CW2C 3VTIA 3OLBA 2R7RA 4B3TF 2KRBA 2V8PA 3FEXB 2RILA 1ICEB 4CLSA 4USJC 3MM5A 1X31C 1TK8A 1E6YA 3ELHA 4CCHA 2MKCA 5LJ5Y 4DDFA 4FBTA 2V0NA 3D1HA 2J7KA 1DLOB 3PX6A 4OV6A 1BHNA 5A2QU 4HTJA 3EGVA 1KNZA 3BKTA 2QIFA 3QBCA 4TQRA 3N5BA 5H9FK 4FYYB 3M8QB 3LF0A 2GQQA 3BSCA 2BYCA 3Q8YA 2N3OA 5IWAJ 1N5VA 3CGIA 3O1LA 3MD1A 2ZD1B 1P27B 1M0SA 3DGVA 4GKJF 2JSXA 5DDPC 3K57A 2Y8YA 1IKYB 5LMUJ 4ED5A 1RCXB 4J9VA 1U8WA 3OBIA 5A0YB 4X65F 2JEGA 2DBBA 3GP9A 2LQ8A 2LU1A 3PFOA 2CNNB 3VQSA 1HMVB 1H7WA 2MKHA 2NPIA 3BDPA 3OVBA 3BPSP 2JJ4D 4YHHF 4F4WA 4DS5A 1NB2A 2JRSA 4TU8A 3MMCA 4L72B 2Y0BB 1JLEA 1VS3A 4NA3A 2W9BA 2DGOA 4QR1A 2MLYA 1KLMA 1YRUA 2HQFA 3CJ2A 1XBWA 4UY8T 1U25A 1XQIA 2VFUA 4WU3A 5KG6A 3VF0B 3DOLB 4JV5F 2KZMA 1EQ0A 4QR2A 4QWBA 1DLOA 1RK8A 3D3CJ 3G82A 4DR5F 4UZBA 3JSRA 1U02A 5AXMA 4J37A 1RYRA 2PMWA 4YP3A 1FKPA 3IA0A 2RQMA 5L9XA 3HPOA 3PRDA 2B8PA 2EFGA 3ITHB 4DCPB 4Y2MA 2HIYA 3S8SA 2VG7B 1NPPA 5D0GA 3HM9A 2CVIA 1FVSA 3IAM9 3MOJB 4OYZA 4OI3A 3UR3C 3VQTA 1BQNA 4K5RA 4DV3F 3BV8A 4ZJOA 3KLGA 2A1BA 2WVDA 3I32A 5ETNA 2DB1A 1HYSA 4PKDB 3BQ2A 1KLNA 2UVUA 1H72C 1VQ5S 2C3PA 3CMAS 3TW0A 1AA1B 3Q83A 2DNGA 2CJXB 2VDIA 3MTKA 1NJZA 1TMJA 1TUGB 5L38A 4C8LA 3GB0A 2R2UA 2MTLA 5FJ4A 3FCHA 1IJFB 1W26A 2VASA 4TN2A 3R6GB 4WYWA 1G4CA 1MU2B 1WG4A 2B4PA 2R3VA 4WBFA 4RUCA 4XO0A 1XMQF 2IJNA 2EVZA 2XMMA 4KB7A 2VC1A 1KQKA 4PUOA 1T9UA 3AHPA 3LWLA 3CULA 3HHLD 1IQTA 2QEXS 1PJ7A 3NAHA 3ENVA 4B9SA 4CT9A 3OSNA 3GIKA 1LW2B 3M8PB 2K8GA 1Q5VA 3D5MA 1MLAA 2VBXA 3HX9A 3OTEA 3ITHA 4AE5A 2MQ8A 2XCPA 2RE1A 1RT5B 2FLLA 3JQJA 2HBRB 4ZVRB 5T14A 2X1FA 2QG9B 2VQEJ 2BANB 2BJ8A 1WKLA 4YB6A 4WFZA 2PI5A 2KYXA 2MZTA 2PA8D 5C24B 2XY7A 1ZTTA 1TZ0A 2NZ4A 4ZVSB 3Q89A 3KG4A 3DLKA 1X4GA 2LQ5A 2RSQA 4IG0A 3D0GE 4OJ1A 4R8UA 3KMSA 5MLCV 2Y9HA 2Z2YB 5KAKA 2K7KA 4G6VB 3OR2A 1SKRA 2FQQB 3EVMA 2M2BA 4LREA 4DV5F 3D6TB 3QNWB 2UUTA 1T95A 1O0PA 3BSNA 2HS0A 4DN0A 4JI1F 1NDLA 2UZAA 5ETOA 1YJ9S 1F6TA 1NU4A 1KOOA 2HVEA 3VALA 3R7BB 2B8QA 3T5JA 5KT4A 5IWAF 3TAQA 1XNRJ 5J2MB 4Q7AA 2FPHX 1IKVB 3M32B 3T5KA 4GC6A 4EWTA 2R8HA 1QE1B 1EIYB 1NK5A 3N01A 2DR9A 1D8ZA 1J27A 1CS4A 4QIVA 1Y3JA 5KFEA 3J7Z5 2OTJS 3SQGB 1BWVA 1HBOA 1X4DA 2Y1RI 4PPDA 2VPYB 1ZM2A 2W4DA 3HFVA 3TEHB 3UCUP 2ASLA 1QLNA 4IDKA 1AYEA 3RBZA 1M1KT 4AFFA 1RT3A 3F44A 3GCWP 2J0XA 3RJMB 2EFOA 2FVPA 1WG5A 7FDRA 2R4FA 3CD0A 1N36F 3W9JA 3V2UC 1KVIA 1SXLA 1XC9A 5KFSA 2V8GA 2AX1A 2AZ1A 4KGZB 4OI4A 2OTLS 3GTYX 2HHHJ 2C2DA 2F40A 4DR5J 3MCOA 1Q8BA 2OFHX 1GAOA 3C16B 3EXCX 3G87A 4OZ1A 5LM7E 3PW0A 3DM2A 5AXKA 2QN6B 4LF8J 2XS7A 3M30A 5C7PA 2WVCA 2HK2A 1CSJA 2OSRA 1V3ZA 3DXBA 5H9EK 4WK3A 2XTJP 1KQGB 2ZDPA 2XLIA 2E29A 2KT3A 2XMUA 2AEJA 1YBAA 2M52A 4AXIA 5B0DA 5K5MA 4DR4J 1PSDA 3MEDA 1K1QA 2IMOA 2MZRA 1N4LA 5KFDA 1CLFA 2BKPA 3US5A 1WF0A 4X64J 3SSQA 4IH6A 3BGLA 4DG1B 2HNZA 4F02A 1T9YA 1CJVB 2JOQA 3GYXB 1RAJA 1X4FA 1RT3B 4OX9F 2ATLA 3I9V9 3UE2A 3VCDA 5B0AA 4JB8B 3TO8A 2IAJB 1HBNA 3IM9A 4MYUA 5B0EA 3U1MA 4KPCA 5AE2A 4DQPA 1S48A 2BMBA 2YKOA 3HSGA 5KFCA 1VMBA 2DR7A 4O44A 1NPRA 2IDEA 2FJDB 4RBVA 3NKYA 5K8OA 4Q5VA 2UP1A 4A8FA 1TL7A 4QQBA 3Q2SC 1HNZF 1PC4A 3N6NA 4LSLB 2V63A 3CDBA 2FZCB 2ZWPA 5FIIA 2IBKA 4HEA9 1A0OB 4HDGA 2KG0A 1LWFA 1RI7A 2CQBA 1WHYA 3OL9A 2DNNA 2BACA 4F36A 2BJDA 3W9IA 1KRPA 3UPFA 2QYCA 3K17A 4LRAA 4DX6A 2G0CA 4EZ9A 2Z4PA 2VFVA 3AB2B 3MCSA 4DN9A 3D4JA 1WHVA 3QPIA 4ETZA 3DLGB 2DHHA 1WUUA 2MLXA 4URSA 3NBPA 2LA4A 3GV7B 3CCVS 2YKQA 1QTMA 5H9EJ 1ULRA 3J80U 4HYKA 2HWHA 2OMLA 3OFHA 1OIAA 4DR3F 1NB7A 2YKAA 1F3VA 4IKAA 4QIWD 2J9DE 4CZCA 3HFZB 3CXCR 1HWJA 1C4CA 1WC5A 1DQ9A 4LSNB 3MWBA 3PM9A 4ZIWA 4J9LA 1N5TA 5DGBA 2VD3A 2X3DA 4FS2A 4DV5J 5AXLA 3RGIA 3FZBA 3DU6A 4Y28C 3W2WA 2HWIA 3LP0B 3EGWB 4I4BA 4O44B 4DPXA 2PO4A 4URQU 3R1HA 4JI1J 3UI3A 4C98A 2R42A 2ZM6J 3HHDA 1REGX 2XSJB 5ETQA 4LIWA 3FK4A 1Q8IA 3CO0P 1T05B 1GX5A 2EFQA 3KNGA 5T7LB 1XNRF 2ZZNA 3K7RA 2M3DA 2YNIA 1C0UA 4KV8A 3KLEA 2L48A 1VJWA 1JXEA 2YBVA 4LFBF 4UZCA 2B5JB 2M8HA 3Q86A 3GLJA 4OIXA 4C48A 5DGAA 2QL9B 2UV8G 2Q79A 4WE1B 1QAYA 2R7OA 1HL6A 1RE1B 3FBEA 3TR5A 1Q86T 4WIIA 1D0EA 4I2PA 5CH7B 5A0YA 2Q43A 4OYWA 1T0TV 1WORA 1RTIA 4IG3B 3K8WA 5DZ6A 3TNVA 2KFZA 3K2YA 4F4XA 1HNIA 2F8HA 3IWNC 3QGGA 1VQ9S 2N3LA 1N5YA 3AJDA 3HVAA 4NXNJ 2J0QD 1WKKA 1KS2A 3EMTA 4HH1A 1VBKA 2BE9B 3D68A 4LR9A 4L6V3 2QA4G 1PJ6A 2GHWA 2PA3A 3PEJA 4RU2A 2ZFHA 3PX0A 5HVHA 1B70B 1M5KC 2M9KA 4H4OB 1LWEB 1FXDA 1YKWA 1TL3A 5D3GB 4JP8A 3IO1A 3M2RA 5SZTA 3PO4A 1LW0A 4LF5J 4M5IA 3OXFA 4M5KA 4DLGA 4NLGA 3AOAA 3OW2R 3CMES 4N47A 2CADA 4LR8A 2WVEA 3I31A 1N5SA 4H4KC 3M8ZA 4PG6A 1OS5A 4X66F 4NOHA 1N34F 1S1XA 1HBUA 5HQ8A 3FNNA 4M5DA 1B0PA 2GS8A 5I3UA 2OEMA 2XZWA 5CA5A 3PHEA 5RUBA 2KG1A 5LL6d 1NKBA 4B3MJ 5HVFA 5K14A 2HFOA 3DGPB 1NJYA 2QSFA 3RRKA 4PG7A 1XMBA 1X9MA 3MR6A 2EFPA 4JV0A 2GZOA 1T11A 2XYHB 4WK1A 5E3QA 1VJQA 5BXIA 1U1OA 4OX9J 4G1PA 2YWFA 3TJ9A 2E9ZA 1RKIA 1KHVA 2MQNA 2HNDA 1FRHA 1WOPA 2E1PA 5GAGU 2NXEA 3V6KA 2BRLA 1WI6A 2PEHA 2ZITA 5KFAA 1LNQA 5LSRA 1NHKL 1VQ7S 4IRDA 3NCRA 1OPIA 3AXKA 4RWXA 1FRMA 1RU2A 2B7CB 3AQOA 3G6ES 3OR2B 5U47A 3BO4A 2CNOB 3KUGA 2G13A 1YK9A 2N82B 1Q8LA 3EUNA 1NDKA 5L1LA 1TK0A 4KJIA 5A8WA 4OZ0A 4GRSA 1UVKA 1X60A 2W1BA 3P96A 4CTAA 2IFXA 2V4QA 2WCXA 1ZH5A 2K06A 4M8LA 4DL7A 3J81U 2GHVC 4K2XA 5CXTA 1YI2S 5GMEA 1CJUA 4PYAA 4DFPA 2YPYA 3ENAA 2F4VJ 4K4ZA 3VHQA 1U2CA 1CJTB 1Q79A 1Y5IB 2PD1A 3IGVA 4PG4A 4RNHA 3QT6A 1UFWA 1DQAA 5LMNF 5J2QB 4TU9A 2EFVA 3M9MB 1U49A 3P3DA 2DHAA 2W01A 3PYGA 1EHWA 3V4IB 3QZ8A 2VPZB 3SEOA 4QIFA 4ECWA 1H3DA 3J7YU 5EWEA 5AE1A 1U1KA 2GA7A 2XI2A 3E01B 1KBRA 5HI7A 4G3IA 1UFLA 2V2ZA 4WU2A 2ZBPA 1CC7A 1H38A 5F3TA 1IXKA 1P9QC 2VODA 3SCKE 1QDUB 3PR5B 1PAUB 1C2PA 1TELA 3FDSA 2FLOA 3W3SA 2AYGA 3IR7B 2OAUA 4OYAA 5KT7A 3BO3A 1TAUA 4ZLNA 4LFBJ 3VAFA 3SSSA 2RMLA 4E8UA 1J5EJ 2E1AA 2J8SA 1QE1A 3D9BA 1BUXA 1AUSL 1S72S 1SJQA 1KC8T 4ZVQB 4H4MA 3H20A 4KQZA 4PZVA 4I1TA 4K4TA 2IJFA 3OTCA 3PXGa 3WX4A 2LMIA 1DZ5A 4WF9Q 1CJKB 2YNGA 3MAAA 1EB0A 4DBQA 2MKIA 4B02A 2DRBA 4BDPA 4CH1A 2E9RX 3I87A 3T6BA 4B17A 2FLNA 1VCTA 2DK2A 3TQEA 2CQ3A 2DNLA 5HJYA 3MECB 4WP8A 2VFTA 1HHSA 1RABB 1F9HA 2MLZA 3CMQA 4ZS6A 3DDIA 3F73A 1I94J 1B7FA 3VAJA 2C2ZB 3D3BJ 4I6AA 1JJ4A 2FDNA 1OJ4A 2V9KA 3C46A 4ES2A 1FKAF 1IR1A 4USVA 3MTJA 4WXOA 2NSCA 4LF5F 2FJAB 3FCVA 3NGRA 4TLQA 3KXDA 3OLAA 3U27A 1SQEA 2NREA 1NRKA 1UA1A 2C2OB 1FRJA 4ZCMA 3ENWA 2ASDA 1CG2A 1K0TA 2H5EA 1CULA 5D0RA 2FTRA 4B9MA 2XS5A 2VA3A 2V8HA 2OEKA 4U95A 4K4XA 4DV6J 4M5JA 4ID5A 1S7IA 3QJLA 4XPEA 1BD6A 1NUEA 2H48B 3KK3B 3CWJA 1QTNB 2DR8A 1OQ3A 2B56A 4M95A 1K73T 3UDEA 4C11A 3CB4A 2XS2A 2BW2A 3G9CA 3UDVA 4MT1A 3VVUA 1OO0B 1GMVA 1X4CA 2BA9A 5KFTA 1SUQA 5D4OA 2HNZB 3GPAA 1GQEA 2MZSA 4IOBA 4O3OA 5A8RA 2LA6A 4YN3B 7FD1A 3M8RA 2GIFA 2PFFB 3AA8A 3J7AN 3CJ0A 2AYBA 2FD2A 2RKIB 1GTEA 3BH6B 2Q6BA 2DPJA 3OL8A 4OHYA 1UA0A 2ABYA 3S6EA 3PRVA 1JLEB 2IJRA 1VQPS 1RWUA 4B3OA 4ECXA 5IOLA 1UP1A 4O23A 1UL3A 2ZC3A 4QCLA 4B3SF 2CQ1A 3LGHA 1B64A 2CPJA 1ZM9A 2CJAA 2YQ0A 3OTOF 1YJUA 5CZVA 2IDLA 1X4EA 4LIRA 3D6FB 3OUYA 2ZD1A 2AD9A 3WZ0A 5E2QA 1JXVA 3NBPB 1LK5A 2YNIB 4KV8B 1RISA 3DLGA 2YY3A 2Z57B 1NLKL 3JTOA 1QVGR 4B9LA 3Q2TC 5SUHA 2G2OA 4J5OA 4OQJA 4C0HA 3H4DA 5LT5A 4EZ6A 3PDNA 3DMJB 2L08A 3DRXA 3AOBA 3W64A 1S6OA 2AP6A 2E1RA 3W62A 1UZHA 1JLGB 2UXCJ 2W2QP 1QSSA 4TU7A 3AODA 1RTIB 4IG3A 1Q5YA 1N5QA 1AFIA 2W4CA 2ZHBA 1FCAA 1WELA 3ADAC 2QO3A 3UVJA 3KLIA 2DYAA 1RAFB 2XNRA 1NHUA 4I2QA 4K4SA 1T03A 5GMDA 2ZHOA 4AT1B 1X9SA 2WOMA 5KG1A 2RRNA 4R25A 2YNFB 2BXJA 2PN6A 5JMNA 2YNHA 1HI8A 1TKZA 2Z2LA 4DPYA 3GJSB 4CO4A 1ZM4A 4FXWA 4BWJA 3V6JA 3C6TB 5E3PA 4PXCA 1UAWA 2KH9A 4FBUA 4WPAA 4DPUA 3OXLA 1RA6A 1YBUA 1ZM3A 2PC6A 4X4PA 3HJFA 3D1QA 3ETMA 3LUYA 2HKEA 1NDPA 1YZ6A 3T6JA 1VQ6S 1S6QB 1U26A 2LYVA 2DO0A 2G2YA 4RNOA 1S0VA 1D9FA 4CWBA 4KGXB 2HYIB 4RO0A 3K59A 1FERA 1FD8A 1XR7A 1ZAXA 5LSOA 3GWCA 4CT8A 2AMCB 3SQGA 2BQ3A 1RP5A 3QT7A 1GMWD 3MR2A 4BC7A 5ETPA 3RTVA 3MD3A 4Y65A 3DOKA 3H2LA 1RB0A 1UW9A 4D3HA 2ADCA 1S0MA 1MMDA 1T94A 1D8YA 1GXTA 1H2VZ 2HZAA 1RLCL 3KJNB 5B7WA 2ZH6A 1U6ZA 1YITS 3K0JA 4AL5A 3GFZA 3M6WA 1RT2A 4MFBB 3K5MA 4IR1A 1PG5B 4OX8A 2O01C 4DL0C 4C0OC 1VR6A 2XMWA 4NLOA 2YNHB 4ZVPB 2J6TA 4KGVB 4HKQA 3L7UA 4MKBA 3T9NA 3TA1A 2P9CA 1FJGJ 3I0RB 1MN7A 3V4MA 5A8WB 1DTQA 3I5BA 2DITA 4P10A 4F0HA 5K14B 3RB6A 4ED3A 1K47A 2JVRA 1IUJA 1FWPA 2MDAA 1H2TZ 5GAEU 4CLTA 3GIMA 1HR0J 4NXNF 4DUYJ 3Q24A 1PBAA 3KDOA 3PHTA 2G4BA 4NCGA 2U1AA 4P2SA 4Q8EA 4CLFA 2OPPB 1JJCB 1URRA 1IKWA 2F7VA 2BDPA 3DOKB 3QWUA 1PGZA 1C1BB 3MFHA 3NS5A 2CPIA 2DD8S 4RUBA 4DOZA 4E2FB 1S1VB 5E3CA 3GILA 1FX4A 3GJTB 2I6WA 2YKNB 1V3SA 3UNYA 4NRTA 1I6JA 1IN0A 4C8ZA 3TP2A 3LP1B 2RAQA 1U0HA 2FZGB 3WQPA 3VAMA 3H5XA 5EN1A 1R0CB 4NLVA 2DJWA 5IT4A 4KGMA 2GJIA 2FHJD 1SJFA 1ITPA 2CQIA 4F26A 4OZNA 3KHGA 2VB6A 4FVMA 4JI3J 2RF2B 1RLDA 3D0HE 3O3LA 5HANA 4USKA 2BJ1A 4RZRA 2IMWP 1FHTA 2DNHA 2XBPA 4EK2A 5KG3A 1N32J 2YWWA 5F8NA 1XTZA 2J0WA 1HNXJ 1HNVA 2AEMA 1P6TA 3T41A 2HRYA 4CQ1A 4OI2A 2PEBA 2NXUA 3KK2B 3M8YA 3HHEA 4K4WA 3C19A 1YWXA 3KDNA 3ZZ0A 5DETA 1LFWA 3JQMA 2FY8A 1H7XA 4KHMA 2D69A 2VPWB 2R7UA 1ELOA 1O5JA 2IRUA 2HRUA 2F3JA 2EEYA 1TVRB 1SQFA 2JLGA 2K1RB 2IVFB 3GV5B 1I1GA 2QFJA 2DKOB 3GR1A 3AH6A 3ZC4A 4UOGA 5L39A 4FYWB 5FLXU 3Q23A 3FC9A 4YFUA 3PRBA 3R5CA 1OY9A 4BCAA 5BR8F 1RAEB 1KHWA 2C42A 4Y0FA 1O51A 3SCLE 1QAIA 3VVTA 1RADB 1UZDA 3DDKA 3FQLA 5CABA 1U45A 3IWLA 5HMZA 1LWCA 1TQLA 4NXMF 3LQVA 4B9VA 2KDOA 2C3MA 1SH3A 4G1QB 3BKFA 3QMQA 2LQ9A 1V5VA 2JWNA 2A2CA 4U8YA 2K2PA 2V2QA 4WKYA 2F4VF 5D15A 1JX4A 1S49A 3I55S 1I3OB 2A10A 4H4MB 2KJWA 2B5JA 3TZYA 4A4JA 2R7SA 2VG5A 4F0MA 2CJKA 2XWXA 1S99A 4I67A 5I42B 3IG1B 3TA0A 1WF2A 4YDDB 3RB3A 3UN2A 4MIAA 3CNQP 4N56A 5FDLB 4Q2LA 3GSDA 5GAHU 2XCAA 2HHWA 2MKJA 3MR7A 4KGKA 4S0MA 1RT7B 3IR6B 4H4KA 5GADI 2AF6A 2EC2A 3MM9B 2NS1B 3MCMA 2YX4A 3JTPA 4U7UK 4DU7A 1R27B 1HW9A 2VV5A 4XDDA 4GKKJ 2DGTA 1GNKA 1YSJA 4LFAF 3QJPA 4ZA1A 2VBWA 3ZZOA 2MJNA 4Q0BB 2P9GA 3MUTP 2J9DA 3QRQA 3TWZA 1WD6A 5C42A 3ZTPA 3X1LB 4CO3A 2MQPA 2VA2A 3E51A 1SC3B 2GJFA 4PAAA 1ZZFA 5CZXA 4ZDNA 2WTFA 3SZ2A 3FMBA 4NLQA 2ASJA 3A1YG 3LTOA 4NLPA 4DU8A 4C2MA 3NRBA 1FK9B 4MKAA 5T7LA 1LW0B 1Q78A 2BE7D 4GC7A 1XWLA 1YVFA 2NZCA 3FGVA 4C8MA 1UMJA 5KFVA 3QIDA 2D3UA 3TA2A 3T1AA 1RT6A 5EX3A 1HQUB 1S1WB 2XZTB 4C11B 1R3NA 4CYUB 3G82B 4LSZB 2F9DA 3CJ5A 3KOAA 1HR0F 1RDRA 4TY8B 2BOAA 4JI5J 4P2XA 4UOHA 5L1JA 2FHMA 4PEOA 3UFCX 4Y3CA 1YRTA 3EGZA 4F25A 2CQPA 1D9AA 1LQ9A 2BX6A 2FJWA 2B9EA 2JVOA 4JI2F 3MFIA 1S0NA 2KO1A 2YH1A 1RT4A 5AXNA 3ISNC 2XULA 4DR6F 4O4GA 1KOHA 1J2VA 4NLYA 3FFIA 4ED4A 3EZUA 1WNEA 1TFYA 4O4RA 5HBMB 3L3CA 4NASA 4C8KA 2W8KA 4ZP6A 4U96A 1X0PA 2AGOA 4H4OA 2MEWA 1TUWA 2DH9A 4C97A 2ROGA 4ED8A 2VC0A 4LRFA 3R2DJ 5J2NA 1X5SA 3QO9A 2QYGA 3FKBA 3HHLA 2R7WA 2OPSA 1RTDB 2GAHC 1V9OA 1X5PA 2VKZG 4FNIA 4CTAB 3PW7A 1Q4RA 3R1LA 2E7XA 2F63A 3UNGC 4WP3A 3EICA 5HQMA 4TY8A 1HNIB 3BN7A 4Z7CA 4WJBA 2UVRA 4F4ZA 2X7IA 1N5YB 3PG9A 1NXIA 1YZ7A 4IH7A 2BBEA 3WX8A 3JAMY 3CCMS 5E0OA 1FXRA 2KRRA 3DLEB 1FDDA 1RHMB 2WB1D 2XM3A 4WFBQ 3C15A 3DHXA 5HLFB 5DDOC 1HA1A 2M7SA 1RAIB 3V4IA 5G4DA 3OTBA 3THVA 5L8RC 2D41A 5BJRA 2OPQB 3CJQA 2DHSA 4JI0J 3DRPA 2DNOA 3MUMP 4Q45A 4IG0B 4YMEA 4KBIA
chains in the Genus database with same CATH topology
3TUJC 5JUMA 2IM2A 1KN6A 3D54A 2HHXA 3NAIA 1JLQA 4IQMA 4X4OA 1TUVA 1L3KA 4ECVA 1TV6A 2P5VA 3DGPA 4DFJA 2VFSA 2E66A 5T41A 5CYJA 3O8WA 4LVOP 3NGDA 4NLSA 4TLRA 4ECTA 4ECRA 3KMQA 3I5CA 2IVYA 4MK8A 3HVTA 3CDWA 5F8LA 3MM7A 2UXDF 3NMRA 4QIGA 2R2RA 2WHOA 2Q6CA 1J5OA 2FGOA 1RTJA 2LEPA 1HWKA 4NLDA 4P7VA 5IT9Y 2VZ9A 4ZPDA 4FXVA 2BE2B 4CNYA 3DI6B 2J7UA 3LWMA 4C8OA 1LXNA 2LVWA 4LF7F 4OZLA 4CIOA 2I5JB 1R31A 2FLPA 5DRKA 2DO4A 2BUNA 2EBGA 1H98A 2IM0A 3TRGA 2GMLA 3MEKA 4K0KF 2B3TB 4X4SA 5CD4H 4KHRA 4R5PB 3M8SA 3N28A 2IRXA 1IKXB 2R8JA 4W90B 3FZ2A 5EUHA 5JVHQ 4O3RA 2DPIA 4PQUB 1U6BA 2KT2A 3LO3A 3UCZP 2LXFA 1TKDA 4A48A 4PXBA 3W2VB 5I4MA 2B6AB 2V2KA 1R6YA 1M5PC 2HHPA 4KAIA 1A6LA 5DQHA 5KFNA 2R7TA 2X1GA 3TAMA 1NK7A 2NUHA 1KFSA 1V3RA 3HHLC 4JBCA 5B0GA 2YKNA 2XG8A 1U47A 3G8QA 2JC0A 2E9TA 3KYLA 3F41A 2G9OA 4MYTA 2ZH5A 2MHEA 4ATNA 5DDQC 3G96A 3KWMA 3HO1A 2RNEA 2N7CA 3FRYA 1FT8A 1V6HA 1UVLA 4RBTA 3DRRA 3CJKB 5KOWA 3RRGA 2X51A 5F8HA 1F0XA 2WRMA 2MJUA 3CCRS 4QU7A 3KK1A 3CEDA 3M8QA 2COLA 3RAQA 2FVQA 4I68A 1MROB 4ZPWR 1C0TA 5KFOA 2DNZA 1Y5LB 2ZC4A 3B4MA 4WXWA 2RDIA 1M5HA 3CCUS 4F8RA 1ROFA 1NK9A 1JLGA 1F60B 5KOXA 3N4WA 2C2RA 2ZZMA 3NNHA 1HMVA 1FEEA 2ZJQQ 4JI0F 1U48A 3MAHA 5ADZA 1M5SA 2EC0A 2XLJA 1TK5A 4LF6F 3R5DA 1HBMB 3SV4A 2YNFA 4JI3F 2HVHA 4WFAQ 4NWBA 4QYZJ 1WF1A 4MTPA 3M9NB 1NH8A 4PG5A 1HARA 3T5HA 3KLHA 3U1NA 2CIMA 4PG8A 2XWYA 1Q7LB 3MEEA 3BREA 2PIIA 3M9OB 3SCIE 5DDRC 2RKIA 1VFJA 4ES1A 3I82A 3PIOQ 4DV4F 1F5AA 4FF4A 5EWFA 3FRZA 1DBDA 1KTVA 2CZVC 2V5HG 2VONA 4ZKAA 1U1QA 1Y9OA 2L3MA 3I5AA 4N77A 4OX6A 3PW5A 1SL0A 1K1SA 4I2QB 2P9EA 1T03B 1WEZA 2CZ4A 1EP4B 2VG6B 1NZAA 2B43A 1TL4A 3PR4A 2MQMA 3I4PA 2DNRA 2YVSA 1MU2A 2YKMB 3M05A 1WTFA 2R7VA 1R8AA 4QPXA 4J9KA 4H54A 2LQBA 3BR8A 2UV8A 4ZK7M 2QA4S 4DR1F 4XDCA 3POTB 3QIPB 2WSFC 1W2BR 2D7SA 4WKRA 1S6QA 4MAKA 4CH7A 3HVRA 1NNDA 2EKYA 1U6FA 5AJ3F 4CNZA 1HFEL 4GKKF 2Q3PA 4YB1P 4I56A 3FFIB 5HMWA 2VQFF 2PMZD 5GMKa 5KTQA 2OPPA