2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
1FK9A 1S1UA 3MR6A 3DM2A 4QWEA 4DL3A 5D3GB 3NBPA 4ZVFA 4URQU 5I42B 1J5OA 3E51A 4KBIA 3DYAB 4HYKA 4Y3CA 4NCGA 5KG7A 1TKTA 5EDWA 3MFHA 3Q8SB 1IKVB 4Q0BA 1XR5A 1FKOB 1TL1A 1TQLA 4U7CA 4I2QB 3V6KA 2AGOA 4O44B 3CIZA 4RW8B 3LP1B 4NLOA 1RA7A 2W7OA 3M8QB 5F9NA 4FS2A 4ED8A 5DQHA 2OPPA 3DLKB 1JLBB 4LQ3A 4IFVA 3I0SA 2BANB 2IM2A 3IG1B 3RBEA 3LALA 5KFFA 4RW7B 5T14A 2OPRA 3QGHA 2C2EA 4NLGA 4G3IA 1HYSA 5C42B 2E9TA 1JLEB 3QZ8A 2YNGA 1RT5B 3CJ4A 5DG9A 3PW2A 4QW8A 4EO6A 4O3SA 1DTTB 1LW0B 3BSCA 4IR9A 1S97A 4G1QA 1SUQA 3H59A 4K4ZA 2BRLA 1LWFA 1JLFA 3IS9B 4XPCA 3OSNA 3ITHA 4LSNB 4QPXA 2ZE2B 1TV6B 1QAJA 4R8UB 2ZD1A 3SI8A 2OPQA 2CKWA 1S9EB 2JLEA 2C22A 3DI6B 3MEGB 4O4GB 2FVQA 4RU9A 2BQRA 4ED3A 1R0AB 1CSJA 4OL8A 4J9QA 5EWGA 1S49A 1RT6A 5J2MA 5KT2A 4IH6A 5K14A 3G6YA 3PJWA 1HNVB 1S10A 2E9RX 1TP7A 1HMVA 3G86A 3UPFA 2HMIA 3KHHA 4ZVEA 4WZQA 4ED6A 2HAIA 5KFUA 2IBKA 4B3OA 4IG0B 2UVUA 4KHRA 3JYTA 3LANA 5KFQA 3MEDA 4O3RA 3KHGA 2RF2B 2HNDA 1S6QA 3RB3A 5HLFB 5KFHA 2ATLA 4O3PA 5KFZA 1KLMB 2QE5A 5C24A 3TAMA 3RAXA 2R2UA 3DOLA 3H4BA 1QE1B 1KHVA 4KFBB 3KK3A 1RTDA 5KFOA 1TKZA 4KSEB 4TLRA 2AU0A 5DQGA 3IRXB 5KFAA 5KT5A 1RT7A 3DRSB 4ECZA 4MH8A 1S9GA 1HNIA 4O4RA 2B6AA 3T5LA 4MKAA 2YNHB 1S6PA 1MMLA 2BE2B 3N6MA 1MU2B 4PUOA 3MF5A 3KLGB 3QYYA 4WYLA 3KHLA 4WXWA 4ED7A 1ZETA 4I2PA 3V6DB 2XC9A 1LWEA 2IJFA 1S1WA 2JC1A 3N6LA 1WNEA 2D3ZA 3HVAA 4Q8EA 3MEEA 3IN5A 3TVKA 1N6QB 3SFUA 5KFNA 1RTIA 2WTFA 4Q45A 1XR6A 1RDRA 4IG3B 4RNFA 4KO0A 2W9BB 4RNHA 4J9KA 2J6SA 2VG6A 2D41A 4Q43A 3C6TA 4H4OB 1T05B 2BR0A 4EO8A 4TY9A 4F4ZA 1JLAA 2B5JA 3DLGA 5CYQB 4NLXA 3UDLA 3KMSA 2BQUA 1BQMB 5C25A 3QIDA 3CDEA 5F8LA 2ALZA 3H5XA 2R8JA 5KFRA 4WZMA 5HROA 2WB4A 5KFDA 5L1KA 3C6UB 2FVCA 3LP2B 1HQEA 1JIHA 2IJNA 4K4UA 4F50A 2WCXA 4IDKB 4ECRA 2FVRA 3H40A 5I3UB 1LW2B 4ID5A 1LWCA 4EYHB 3FRZA 4NLDA 1RT1A 2XGQA 4K50A 5F8NA 3NL0A 3QLHA 2YKMB 5J2NB 4NLQA 5KFTA 5C5JA 3MR2A 3PVXA 1FKPB 4LSLB 1FK9B 1S1XB 4IRDA 4MFBB 3LAMA 3V4IB 5DGBA 3GV8B 3QO9A 3LAKA 4F4WA 3DMJA 2VG5B 3KLHA 3T5JA 4ICLA 4J9RA 4QWAA 5KFCA 3BGRB 3LP0A 4XO0A 3GIMA 2V4RA 2IMWP 2IAJA 1W25A 4ZPDA 3CJ3A 1TL1B 3RB4A 2AX0A 4YMEA 3V81B 4RW8A 2IM0A 3BREA 4X2BA 4QWCA 4DG1A 3DRRB 1JXLA 4QWDA 4NYZA 2OPPB 1C0TA 4DL2A 2XI2A 1DLOB 1HPZB 4HKQA 3I0SB 5KFPA 4M94A 4NLVA 3M8PB 4NLUA 1IKWB 1D0EA 1VRUB 3GQCA 1T94A 4PWDB 4WFYA 3H5YA 3ISND 1HYSB 5C42A 1JLCA 5KFYA 1JLGB 3DOKA 1C0UB 1TVRB 3OL8A 3BQ0A 1TKXA 2OPSA 2W8KA 4ED1A 2WONA 1RTJB 3ITHB 4LSNA 4ECQA 1S1TA 4I7FB 4NLWA 2ZD1B 4ZHRB 4TN2A 1RYRA 1IKXA 2IM1A 5EWEA 4NLPA 4ECSA 3NAHA 3OSPA 4H4MA 2W9AA 4MKBA 5KFJA 3TQ1A 4Y34A 4Q8FA 4ZP6A 1RT6B 5J2MB 4J9OA 3T5KA 1S1VA 1HNVA 4IFYA 2YNIA 4K4VA 3H2LA 1RT4A 1NHUA 3NKYA 3RB6A 4WE1B 4ZPCA 3MECB 2R2TA 4RW9B 2XCPA 4NZ0A 4IG0A 2UVRA 1ZTWA 3MEDB 3I0RA 5DG7A 3QZ7A 1RTHB 3FFIB 1RT2A 1IM4A 1N56A 3OL6A 2ASDA 2RKIA 1KLMA 4RW4B 5C24B 5KFXA 4RNNA 1T03B 3DOLB 3CO9A 1TL3A 5HBMB 2WOMA 1SV5B 3JSMA 5J1EA 1QE1A 1GX6A 4YR0A 1JX4A 4KFBA 1JLQA 1RTDB 3NAIA 2AQ4A 1EETB 4RNMA 4JV2A 1BQNB 2AGQA 4O3QA 3KJVB 3OLAA 3FSIA 1HNIB 2R8KA 4WYWA 4RW6B 1C1CA 5FDLA 2BE2A 4YP3A 4TQSA 4JUZA 3N6NA 2UUWA 4IRCA 2I5JA 2ZKUA 3FQKA 4LQ9A 5KT7A 4R5PA 5KG0A 3H98A 3DM2B 4EYIB 2F8EX 1LWEB 3G6XA 3H5SA 4KV8A 1JKHA 2R2SA 2AWZA 2V9WA 5CYMB 3UR0A 2EC0A 5I42A 1J5OB 3BR9A 4K4XA 2VA2A 4TY8A 1DTQA 1N6QA 1TKTB 5EUHA 4DL5A 5F8JA 5KT3A 4Q44A 4IG3A 1FKOA 2VA3A 3KLEB 5L1JA 4O44A 4IOBA 3C6TB 3LP1A 3M8QA 4ECTA 4RUAA 2IC3A 2R2RA 3DRPA 3E01A 4IFVB 5HP1A 2GIQA 1EP4A 4WXOA 1C2PA 4TQRA 3IG1A 1IKYA 4RW7A 4GC6A 2OPRB 2J6UA 4O3OA 1HQEB 3LP2A 3SFGA 3KLFB 2HWIA 5DLFA 3PW7A 1RT5A 1N5YA 2OH2A 4ZMMA 1S48A 5D3GA 3KK2B 1RAJA 5I3UA 2HWHA 2DPIA 4IH5A 5KFMA 1SUQB 4KKOA 2FVSA 4NCGB 4PQUB 2FJVA 5KFEA 4YQWA 1TV6A 5DLGA 3T19A 2OPQB 4K4TA 3UQSA 3CWJA 3DI6A 4NLTA 2W9CA 1S1XA 2IM3A 2R8GA 3OHBA 3BSNA 1R0AA 4F4YA 2VG5A 3KLHB 3KLIA 3KK1B 1T3NA 2JEFA 5K14B 4M95A 5J2PB 3BGRA 3LP0B 3RBDA 2C2RA 3BSOA 3BQ2A 2HNZA 4EEYA 3IGVA 3T1AA 1UWBA 4K4SA 3VQSA 3V81A 4B3OB 1QUVA 1S4FA 3JYTB 5KFVA 4NLYA 5KFGA 3RAQA 2RF2A 3QIPB 1KHWA 1NHVA 1C0TB 5JXSA 4YR2A 4G1QB 4DEZA 1SH2A 3Q8PB 1LWFB 3IS9A 3CJ2A 5KFSA 4RUCA 2E9ZA 5J2QB 4ECUA 2CJQA 4ECYA 2YNFB 4ED2A 3KK3B 1RT3B 4O4GA 3BQ1A 2YKNB 1RT7B 3DOKB 3DRSA 1HARA 1K1SA 1SH3A 1TVRA 1S9GB 2RDIA 4TXSA 3OLBA 1HQUA 2HNYB 2ASJA 2B6AB 3KLVA 4FBTA 2VG7B 4JV1A 5L9XA 1MU2A 4PUOB 3Q8RB 1HMVB 1VRTA 3MFIA 1S1TB 4I7FA 4IRKA 1IKXB 5F8IA 4DL7A 4K4WA 5KFIA 1S0MA 4NRTA 2HNDB 1REVB 3QGIA 3GV7B 1C1BB 2AX1A 3PW5A 2GIRA 4NLRA 2UUTA 3FQLA 4MK9A 5F9LA 3TAMB 2FLPA 3CJ5A 2YNIB 3DLEB 1RT4B 2DPJA 3ICLA 2BQ3A 3MECA 2AGPA 1YVFA 4RW9A 3HHKA 2B43A 4QWBA 3KHRA 2JEIA 4ZPAA 3OHAA 4F4XA 2GC8A 3GIJA 2JEGA 4ZP7A 3PW4A 5KG5A 1S6PB 2XCAA 2RKIB 4KHMA 5F8MA 5L1IA 3KLGA 3D5MA 5HBMA 5HROB 1SV5A 3JSMB 4U6PA 4ECWA 4ZPBA 5DGAA 2RDJA 3PR4A 5KT4A 2WOMB 3HVTB 3I5AA 2XGPA 1S1UB 4I2PB 3V6DA 3EZUA 4K4YA 4IDKA 4ZVHA 3DDKA 4WFZA 3NBPB 4Y2AA 4J9MA 1LW2A 1S1WB 2XWYA 3DYAA 1C1CB 5FDLB 4NLSA 3KNAA 3ISNC 1RTIB 3NGDA 2FLLA 4J9NA 2D7SA 1RA6A 1IKVA 4Q0BB 4R5PB 1FKPA 4KO0B 2WRMA 4GC7A 4I2QA 4LSLA 2C28A 2UVWA 2VG6B 4IQXA 4MIBA 4EBEA 3RB0A 4H4OA 1T05A 1XR7A 2IA6A 3DMJB 1JKHB 1JLAB 2B5JB 3DLKA 1JLBA 4KV8B 5CYMA 5CYQA 1ZTTA 5KFWA 2W8LA 3H5UA 3FDSA 2BANA 4J9LA 4TY8B 1DTQB 3D28A 4Y2CA 3MR5A 3BJYA 4ZVGA 1K1QA 3IGNA 2WHOA 4TYBA 1N48A 1JLEA 2YNGB 4IKAA 1S0OA 3M9MB 3PR5B 1LW0A 1DTTA 2BRKA 1OS5A 4KAIA 1LWCB 5KT6A 5HP1B 4KB7A 3E01B 3Q8QB 1RT1B 1JLFB 1IKYB 3QLHB 5J2NA 2ZE2A 1IKWA 4R8UA 1VRUA 1S9EA 4EBCA 1JLCB 3MEGA 4XPEA 2O5DA 4ZP9A 4O3NA 4MFBA 3V4IA 1N5YB 1JLGA 3QO9B 4MIAA 3KK2A 3GYNA 2FLNA 4ICLB 3KOAA 3GV5B 2OPSB 4KKOB 4PQUA 2WONB 1RTJA 2ILYA 5DG8A 3V6JA 2IAJB 2HMIB 2V0NA 4J9SA 3I5BA 2FVPA 2I1RA 4RNOA 3PW0A 2W9CB 2ILZA 4H4MB 1QAIA 4DG1B 3DRRA 5KG6A 5F8GA 1S6QB 3KLIB 3KK1A 3G6VA 4EBDA 5HLFA 1DLOA 1HPZA 3I5CA 3PZPA 1D1UA 2WK4A 3CJ0A 4ZP8A 5J2PA 3M8PA 4RZRA 1SH0A 2HNZB 5KFLA 4PWDA 1N4LA 3CDWA 4MK7A 1TKZB 1UWBB 3QGGA 4MK8A 3MR3A 2V4QA 3GILA 4ECVA 4DL6A 1S0NA 3IRXA 3OL7A 3I0RB 4IH7A 2D3UA 1C0UA 3QIPA 1RTHA 1TKXB 3PJXA 3FFIA 1RT2B 2YNHA 2JEJA 3GIIA 4H54A 3EPIA 1T03A 3HVWA 2UVVA 5J2QA 1Z4UA 4ZHRA 4ECXA 4NRUA 2YNFA 3M9OB 1RT3A 5KG4A 3EPGA 4IR1A 1EETA 5EWFA 4URSA 2YKNA 1BQNA 1I6JA 4R0EA 4JV0A 4TYAA 3T5HA 1HQUB 2HNYA 2XI3A 2JC0A 2VG7A 5KG2A 4RW6A 1S1VB 3MEEB 5KFBA 3GIKA 5KG3A 3V6HA 4IFYB 1VRTB 2I5JB 3PHEA 3OL9A 4KE5A 5KFKA 4J9PA 2W9BA 4WE1A 4URGA 4QW9A 2J6TA 4DL4A 1GX5A 3DLGB 1REVA 3BSAA 5KG1A 1BQMA 1C1BA 5C25B 3MTKA 1RYSA 4RW4A 3CVKA 2R8IA 5L1LA 4ED0A 2FJWA 3KMQA 1TL3B 3DLEA 3NMAA 5J1EB 3C6UA 1NNDA 3KLEA 1JLQB 3CDUA 4FS1A 1S9FA 2W7PA 2C2DA 3H4DA 3KJVA 4ID5B 3HKWA 4FBUA 2IC3B 2FJXA 3DRPB 2ASLA 1EP4B 4WFXA 5DQIA 5F8HA 5JUMA 2R8HA 3M9NB 2YKMA 4YR3A 2QV6A 1U09A 3HVTA 3KLFA
chains in the Genus database with same CATH superfamily
4RBTA 4DR7J 1MROB 3DM2A 5E3AA 2MSTA 5G4DA 2XHCA 1WHVA 3E51A 4FNHA 4KBIA 4HACB 4Y3CA 4NCGA 3GB0A 1TKTA 4WCEQ 5EDWA 2QA4G 3MFHA 1F0XA 3FGVA 1UZDA 1TUWA 1IKVB 2CFXA 1FDDA 1TQLA 2C2OB 2W2MP 4YB5A 3EWGA 4U7CA 1QY7A 4O44B 1HD0A 5ETRA 3CIZA 4XTTA 3QJJA 4RW8B 4NLOA 5HQMA 1RU1A 1UP1A 2F65A 1IBMJ 5DQHA 3D7SB 1XMBA 4OMFG 2LKZA 1HNWJ 5HJXA 2R4FA 1VJQA 2E1PA 2G0CA 2VZ9A 2DVIA 4RW7B 2M52A 5T14A 2V8GA 4DXLA 4CT8A 2CYYA 3VAHA 4B3SF 3BEGB 1HYSA 5C42B 4NLGA 2E9TA 2X1BA 3CCMS 2YNGA 3CJ4A 5DG9A 1QVFR 2DJWA 2HG4A 2V67A 1DTTB 1RCXB 3BSCA 1UEKA 1ICEB 3DRXA 4IR9A 2GV1A 3X1LB 4UOFA 3K5NA 2GMJA 4TU9A 1IN0A 3OSNA 2C2ZB 3SI8A 1VQ6S 1GXUA 3S1TA 2JLEA 3THTA 2EFQA 5M2UA 3DI6B 2XHWA 4RU9A 4OYOA 3HT3A 2BQRA 4KR0B 1YZ6A 1R0AB 2YH0A 1CSJA 1RHJB 4OL8A 4LVOP 4FZVA 1KQFB 4P74A 3G6YA 1ZAVA 3GJTB 4OV6A 3U1MA 1S10A 2MQPA 3FCWA 2VV5A 3S7RA 4DV3F 2U2FA 3PV8A 1HNXF 2LU1A 4NCAA 4UY85 3QQCD 4LR9A 4ES2A 2UVUA 3JYTA 5G0RA 2GHWA 5ETLA 4A46A 1FXDA 1BLUA 5A2QY 1TK8A 4O3RA 4ZIWA 1NPPA 1CJKA 2RUGA 1EQMA 4ZK7M 5CD4H 3OW2R 3W61A 3DOLA 4MIWA 2POKA 3BS9A 3NGSA 4BCAA 4DPXA 5HMWA 3CE8A 1R8PA 2IIHA 4KFBB 1RTDA 1V5VA 1NH7A 3ENVA 4LBPA 4XK8C 3TR5A 1RTZA 4FPIA 3BKFA 1FEHA 4I6YA 4X4QA 3DLLQ 1RT7A 3C15A 2BACA 4BC9A 2VASA 1XNQF 1HNIA 1VCTA 4WKRA 3AB4B 1S6PA 1MMDA 2BE2B 1HW9A 2JX2A 3MF5A 1RUSA 5E7OB 1EAYC 1SC1B 2CQGA 3MM5B 3UVJB 1Z1ZA 5C7PA 1AUDA 1TZ0A 1R3NA 1YZ7A 1OY9A 2GHVC 1XNRF 2DNPA 2DEIA 1S1WA 1B99A 4N76A 3HVAA 2JLFA 3I82A 2HVEA 3SFUA 3MCMA 5E5NA 3IBWA 4RNFA 4KO0A 5HVGA 4RNHA 4J9KA 1R6VA 1U0HB 3AD8C 1SKUB 4FDFA 4M5DA 1NO8A 2EWHA 2GW8A 4PEOA 4H4OB 1T05B 2BJ3A 2EBEA 3DHWC 2FZCB 1L3UA 1M5OC 4ZCKA 2B5JA 4ZCIA 4F4ZA 2UVVA 3CCWA 3UDLA 4IUFA 3WC0A 1BQMB 3L7OA 3QIDA 3CDEA 4LRFA 4WTYA 4QBUA 2OD6A 2E5JA 2FC8A 2IPOB 1UJ5A 3W1YC 2C2KB 3PKYA 3P4UB 4DR7F 1LKZA 5HROA 5KFDA 5L1KA 3S8SA 4Y65A 3W5YA 5AE3A 5DM7Q 1HQEA 2KL8A 4OV1A 4UF4A 1JIHA 2AEFA 2DHAA 3M30B 4QR2A 1HI0P 4KC5A 2FVRA 4YUDA 1UA0A 1Y5NB 4DFMA 1SL1A 3J81U 1H7XA 2KN4A 3A12A 2DBBA 2MGZA 4IO9Q 3FRZA 2GGPA 2GQQA 4XDDA 1TFWA 3AQOA 4X4SA 5F8NA 4OYMA 3Q83A 2OJ3A 1U25A 3P6YC 1VDHA 2XMWA 2XQCA 4LSLB 5IFMA 1KP6A 1LFPA 5L39A 4IRDA 3R2CJ 3N01A 1RLCL 1SJRA 4A8MP 3GV8B 1YI2S 4F4WA 5DDRC 4F36A 1KRPA 3JXOA 2PA8D 2MZJA 2GZOA 3HLUA 1OIAA 1RJJA 3J7A1 5CH7B 2V4RA 4BWJA 2IMWP 4NYOA 3AJ1A 3TEHB 2MPUA 2VH7A 3QSYB 3CJ3A 3CULA 3CD6S 1R6YA 1YITS 4ZVQB 1FJCA 4Y2IA 1SC4B 2QRRA 4YMEA 3V81B 4RW8A 1NU4A 2IM0A 2XULA 3BREA 2FGOA 2FZGB 1YLXA 2ZBRA 3AOAA 9ATCB 4PPZA 1HA1A 4MKVA 2GVDA 1S7IA 4NA1A 5B0GA 4OHWA 3OR2A 3ETMA 4OZ2A 4M94A 2KB2A 5B08A 4NLUA 1GMVA 2V8DA 4R0JA 4DPUA 1IKWB 3DCAA 2BM1A 1FRLA 2GNKA 4WFYA 3H5YA 2CPDA 2YTCA 1HYSB 5C42A 4OIXA 1DQAA 4ZN1A 4ID8A 2KT3A 1TKXA 4J9VA 4Q2LA 5C2CA 1N34J 3D6MB 2KXHA 2YKQA 4USIA 5IT9Y 2PSZA 4ECQA 2HHTA 4NLWA 3HFVA 3RAMA 3VWSA 4A8FA 4CZCA 4NLPA 3OR1B 2VHGA 4JI7J 4DV7J 1NZ8A 2Z2LA 2DTJA 3NAHA 2D9OA 2P6TA 3R6GB 4TVAB 1M90T 2W9AA 5KFJA 4Q8FA 1HBUB 4Y34A 2DGOA 3ISZA 2XS7A 3HMJG 3I6PA 2PD1A 3L7UA 2LXIA 4DDFA 2BW7A 1PILA 3A3PB 1YBTA 3MMAA 4C3KA 2CQ4A 4ZVPB 4ZPCA 3MECB 2B4VA 2DO4A 2RILA 3TRGA 2QTWA 3QGPA 1V6HA 4NZ0A 4IG0A 2VDHA 1WG1A 2UVRA 1ZTWA 2DHXA 2CJYB 4B17A 5IT0A 4O0IA 1YJ9S 2I8EA 1V9OA 2WB1D 4ZKAA 3FFIB 3O2IA 1CJKB 4USUA 4U7UD 1R31A 2EG2A 3BBFA 5CA5A 3OL6A 4KGVB 4UQTA 5D4PA 2ASDA 1OPIA 3I9ZA 3CO9A 5IQ6A 5BYQA 2LDYA 5J1EA 3UCGA 1X4AA 4N41A 4P73A 4KFBA 1RTDB 2XMAA 1H74A 1U1OA 4RLEA 1IBKJ 1NEEA 2HYIB 4KGZB 2M70A 1KD1T 1HNIB 2W2PP 1FT8A 2ZEJA 4C8ZA 3LPYA 5A8RA 1C1CA 3QRPA 2L41A 2UUWA 1TFYA 2QLXA 2G2OA 1HNZJ 4M5KA 4R5PA 3TA0A 4ZLPA 2LEPA 1IJFB 2QSFA 1RWXB 2BE9B 5KG0A 4DLEA 3DM2B 2VUGA 3CJSA 4AYBD 2F8EX 2LXUA 2OELA 3R7NB 3UCZP 5DRKA 1X0PA 4HT5A 1X5OA 3UR0A 5L9NA 3I55S 3PYEA 2RJZA 4TY8A 5EUHA 3IA0A 2FJEB 1HQ2A 2RE1A 5F8JA 1D9AA 2K3KA 3SCJE 1X4EA 2YKPA 2VC0A 1F6TA 3NCQA 1XBWA 3VAKA 4O44A 3CJ8A 3HFKA 4LR7A 2M3DA 1U1PA 3ZXWA 3LP1A 2VONA 1NJXA 1S76D 1CJVA 4FNIA 4QIFA 2IC3A 4PG6A 3DRPA 3E01A 5IT4A 5K8OA 2CQHA 1N33J 4J91A 2NS1B 5LMNJ 1Q79A 1VQYA 2P9CA 3GFXA 5GAEI 3HP6A 2CWKA 2HS3A 2ROGA 2DNMA 3HFZB 4O3OA 2J6UA 1HQEB 4LFCF 2HWIA 3L95X 2WVBA 1VLOA 3LPEA 4CLUA 5D3GA 3KK2B 1D09B 4DR4F 2DNKA 2DPIA 4M5MA 4IH5A 5BYRA 2YQ1A 2LLZA 3MZIA 3HX9A 2L9DA 2W2OP 3FZ2A 2CA9A 3AAWB 2IVMA 5CZXA 1T9TA 2RRBA 6AT1B 3BDEA 5ETKA 3P49B 3T19A 3IFEA 1GFWB 3DGVA 3CWJA 1GT8A 4NLTA 2P9EA 1S1XA 1CQNA 5DDQC 5GADU 4DMZA 2E7XA 1R0AA 2DIVA 2YX4A 2Z2ZA 4BC7A 4CP5A 3FSYA 4F4YA 3TARA 3KK1B 1S4EA 1CQMA 3HHLD 4CLYA 3D6FB 4QZVB 2W2QP 4F2SA 3G6ES 2HNZA 3BQ2A 2HIYA 3OXLA 5D0HA 3T1AA 3DHXA 1S4FA 4BWMA 4UOGA 4DN0A 3RAQA 4YN3B 5GMDA 4S0MA 3D6HB 4DEZA 2CQDA 1VQKS 1G3OA 1IQZA 1Y0HA 2RDDA 3Q8PB 3CJ2A 1QVGR 4JI3J 3VF0B 3LGHA 2DXEA 3RTVA 2CJQA 3QWPA 5K9FA 1QJHA 1LQ9A 4ECUA 3M6WA 1RT3B 2N7YA 3O44A 4P2MA 1RAIB 2DGTA 1OQ3A 1N32F 4GRSA 1VQNS 1M1GA 3LWMA 3DOKB 4DR2F 1M1KT 1XEZA 1NKEA 2HNYB 3SCIE 2E5LF 2KT5A 2Z58B 4NA2A 2C2NA 4P2SA 3ZZYA 4QOTA 3OVSA 3VGVA 2MKIA 4NMXA 3Q8RB 3PY8A 2W01A 2N3OA 1LNQA 3CPWR 4X64J 1UVMA 1IKXB 4RPFA 3HKZD 2CNLB 2XMVA 2ZOFA 3EICA 4RUBA 4K4WA 3NS5A 3VCDA 2B8QA 4YB7A 4YB6A 3K57A 4P52A 2M0GB 4PXBA 5B0CA 4WKYA 4IOCQ 2V9KA 1REVB 3QGIA 5GAHI 3CCRS 3T1YF 4WFAQ 2XZDB 1H3DA 3IBFB 2UUTA 4L6V3 5GMEA 5F9LA 4MK9A 4OJGA 3TAMB 1GTEA 2NLWA 2VBYA 4F4AA 2YNIB 4DLGA 3DLEB 1NK8A 2J0SD 2RQ4A 3ZTSA 2B4PA 1U6FA 3MECA 4WP9A 4LFBJ 2QJ3A 1Y00A 4DSEA 2XS2A 3HHKA 5IQQA 5F3ZA 1AZSB 4JOUA 2R3VA 1KFDA 2X3GA 2YBVA 1FNXH 4WBFA 4JI3F 3KHRA 1NJYA 2JEIA 3OHAA 2XSJA 4DQPA 5T41A 2JEGA 3PW4A 5KG5A 2PDAA 2CADA 2XCAA 5E2QA 1FTRA 2NZCA 5HROB 1UW9A 2RDJA 3PR4A 3MOZA 3D66A 4JI8J 3HVTB 5A0YA 1B0VA 4CNYA 3UD4P 3V6DA 2RT3A 4K4YA 4QR1A 5DDPC 3QNWB 5K8NA 2OSQA 4U8YA 3EZ5A 1UVIA 3NBPB 4Y2AA 4F25A 1YQHA 1FFSB 2MQOA 2NREA 4FF2A 3TEGA 3UWTA 3JQJA 3DYAA 2AJQA 1C1CB 3BKTA 1L3TA 4NYPA 1RTIB 2QL9B 3UR3C 3NGDA 4J9NA 2FLLA 2C3OA 1RA6A 4Q0BB 4R5PB 2HGLA 2XLIA 4LSLA 2LYVA 1TAQA 4ZA1A 3CCQS 2D69A 1XR7A 2Z57B 4ER8A 4ZIVA 4GKKJ 1RCOB 3HHDA 4EUVA 4PG7A 2AW0A 2PIIA 3OUYA 4C6AA 1Q95G 2CIMA 2BANA 4J9LA 4TY8B 3EM1A 5LT5A 4JYAJ 1BHNA 4EZ6A 1WI8A 2LP4A 1OYDA 1N48A 5D8HB 1HWIA 1YJVA 2B56A 1ZS6A 3M9MB 4OX9J 2MEWA 5ETQA 2VL1A 1LW0A 3K58A 2QA2A 2L48A 1OS5A 4FXWA 2J9DA 3PIPQ 3E01B 2UUCJ 3CT9A 5SZTA 1RT1B 1JLFB 2UV8A 1IKYB 5J2NA 2ZE2A 2B9XA 2CXEA 4USJC 4R8UA 2L9NA 2G0IA 2B9EA 1S9EA 1T0TV 4HDHA 5FD1A 1JLCB 3MEGA 2DRAA 2O5DA 1WACA 3HD2A 1YHQS 3V4IA 4O0NA 3GYNA 3MM9A 2J7WA 3OTCA 1APSA 2RHQB 2OPSB 1B64A 5LXYA 2WONB 4WIIA 1XMQJ 3BPDA 2QLFB 4UY8T 1YK9A 5HAOA 2WVDA 4J9SA 1SIWB 1WOPA 2IBOA 2P8IA 3O6QA 3OR1A 3CO0P 3E2EA 2J0XA 1H72C 4DQQA 5F8GA 1I94J 1DAXA 1U45A 3G6VA 3KK1A 4EBDA 5EX0A 2JDJA 3I5CA 1HPZA 2KH9A 3FEXB 3J80U 1CS4B 3NEKA 2RQMA 1SH0A 4F26A 3MUVP 2HNZB 5KFLA 4ZN3A 3NOCA 2XM3A 1AW0A 2FHJA 3BGOP 5KTQA 3AHPA 4DL6A 3D67A 4GVLA 5K5MA 5HMXA 1SKRA 3IRXA 1O5JA 1SPBP 3I0RB 1IBCB 3OL7A 2QC3A 2D3UA 3HPOA 3QIPA 5B0FA 2KVQE 1VHIA 3PJXA 4P10A 3CCJS 2I2YA 3FFIA 4OZNA 1U24A 2YNHA 4LREA 4A8XA 1MG7A 2OGUA 5J2QA 2BJ9A 4OZLA 4OZ1A 1SB6A 4NRUA 4ECXA 3CCUS 3SQGB 1RT3A 1UVLA 2IMOA 2R7UA 1UEVA 1EETA 3W64A 3PO4A 2YKNA 1YSJA 3RRGA 3CIMA 4TYAA 2HNYA 1WHWA 5KG2A 4RW6A 3MEEB 2GCFA 3GIKA 3FC9A 2IYGA 4XIUA 4KE5A 4J9PA 4WE1A 4FF4A 2KJVA 3MMBB 4AFFA 2VBZA 3J80Y 1GX5A 3KXDA 1Q8IA 4YS2A 2JLGA 3ZO7A 3BGFA 2A2CA 5KG1A 2Y1JA 3FKBA 3M05A 1SJFA 4CH0S 2MZ1A 2QLJB 1P8GA 2B3TB 4RW4A 2C1EB 1RYSA 3UN5A 2D3OR 3HK2A 1TL3B 3DLEA 3L9ZA 6FDRA 3NMAA 5I3PA 1ELOA 1FTCA 4B3RJ 1WEZA 4B9NA 1JLQB 1KTVA 1XIQA 3CDUA 4Z7YA 2YPYA 3K5LA 3PYDA 3RG6A 2C2DA 4YB1P 2UU9F 4IQMA 3KJVA 2QO3A 1NHKL 2XSJB 3HHLA 4QIGA 4ID5B 3HKWA 5DDOC 2IC3B 2FJXA 3GE9A 3AJ2A 3SIPB 2Z2MA 1Y5LB 4WFXA 1Q82T 3I4HX 3IXQA 4Y2MA 2R8HA 4MKYA 1N52B 4FKYA 1FCAA 1FRIA 4X4RA 3CB4A 1N0VC 1YBAA 1XR5A 2DHGA 4ZLJA 2HQ3A 3DKDA 3CD0A 2G1HA 4DL3A 1U6BA 5D3GB 2F9DA 3NS6A 7FDRA 4URQU 5I42B 1J5OA 5H9EK 3DYAB 1HWLA 4CO4A 3B82A 1RBLA 2H4WB 3I9V9 1NJWA 4OYIA 3SSRA 2KO1A 3MXHP 5IXUA 3N5FA 7FD1A 2F63A 2CJBA 4P7TA 2AGOA 2DRBA 2FIUA 3L3CA 2W7OA 4JV5F 3EDRB 3GCWP 4FS2A 3AOBA 3FCVA 1MWQA 2AJ2A 2OPPA 4ED8A 3DLKB 1Q8KA 3RR8A 3VHQA 4IFVA 3I0SA 2BANB 2IM2A 3LALA 2LXFA 1CULB 3IAS9 2OPRA 4ZJQA 5KFFA 1Q86T 3BYRA 3GFYA 2EK6A 2MZRA 3TQEA 1RKIA 1JLEB 1XWLA 3QZ8A 1X5TA 1JNRB 1RT5B 3PW2A 3IWLA 4QW8A 2CUYA 2ZHBA 4N56A 3SYZA 1ZM3A 1F3FA 2E7WA 2BRLA 2GVZB 1WORA 2IFXA 3IS9B 1K73T 3ITHA 4LSNB 1QAJA 5IV4A 2ZD1A 2ZBIA 3CXCR 1FRMA 2ZH5A 2DNQA 5JVHQ 1MWYA 2MLXA 2GO9A 2CQ3A 1UZHA 3T6JA 2EKNA 3PRDA 2MY8A 2RU9A 1ZBTA 2BUNA 5EWGA 3BO2A 2VKZG 4ZCLA 5J2MA 1A7GE 3H8YA 2Y0BB 4IH6A 3PJWA 1HNVB 4AXIA 4DR5J 5H9EJ 1TP7A 3JS9A 1WEXA 3NCPA 1HMVA 3CTRA 3N5BA 3UPFA 4X4TA 3KHHA 1SL0A 1RLDA 1MSWD 2HAIA 3GJRB 5KFUA 2HWTA 1GMWA 2ZKTA 1FFWB 5KFQA 3MEDA 3WIVA 5LJ3Y 2KU7A 2JSXA 4DQSA 2RF2B 4U9RA 2HNDA 2QYGA 1YBUA 1ZOTA 4PG8A 1HWUA 5HMZA 2FC9A 2OEMA 4HEA9 2K2PA 4OI3A 3S6EA 1CS4A 2ATCB 3G71S 2QE5A 5C24A 3HHNB 3TAMA 3A8IA 1HFEL 3RAXA 3KTQA 1S77D 4IYQA 1QE1B 4X65J 1KHVA 2KZZA 5HQ8A 3KK3A 3VTIA 1TKZA 5E3PA 1QM9A 4KSEB 2A1BA 4TLRA 5GAEU 2EI5A 1HNZF 2WSCC 3IRXB 1KQKA 4U67Q 4HT7A 4AE5A 4NA3A 4ZVOB 2UUCF 2LQBA 2B6AA 3T5LA 2HHXA 2V4JA 1WF1A 2HBRB 2MB0B 2HVIA 2HK3A 1RBAA 2O67A 4WYLA 4Y28C 4A48A 1NSPA 4OFZA 3TA1A 2V8PA 3Q8YA 3R5JB 3SQGA 4AQYJ 2KM8B 1ZETA 2PMWA 1D8ZA 4I2PA 1KBRA 2EFGA 3BBBA 1LWEA 2IJFA 1UPPA 1O6XA 2JC1A 3O5TB 2XO7A 3N6LA 2MZQA 4FVCA 3NRBA 2D3ZA 4RO0A 2NPFA 3CCVS 2FY1A 4NCBA 3TVKA 2AKWB 4NE9C 1DURA 2HHWA 1U02A 4AD6A 4RBVA 2QLBB 3FJ2A 4IG3B 1NDPA 2YXLA 3G82B 2W9BB 2EBGA 2VOOA 1B0TA 1DRZA 2R7OA 3LUYA 3KJQB 3OPKA 3G8TA 2NXUA 3G9CA 4CWBA 2QSWA 3OUYB 5CYQB 3KMSA 2DIUA 4JP8A 5C25A 1ZM2A 2ALZA 2ZM6J 2R8JA 2JRSA 3IO1A 1IJEB 1R0BG 1Y3KA 1WUUA 2MY7A 1WF0A 3AT1B 2WB4A 5FLXU 3OVAA 5ETOA 2LA6A 2FVCA 3EDQB 3Q0AA 2WCXA 4F50A 4JI1J 4IDKB 1KN6A 3ZZ0A 3H40A 3W5ZA 5I3UB 1LW2B 4ID5A 2ZVIA 3P5TL 3AODA 1SQFA 3TX0A 4NLDA 3V5RA 4PAAA 1RT1A 2WZ1A 4K50A 3M2UA 3NL0A 3QLHA 4ILLA 4DBQA 2MQMA 4DCJB 3OFHA 2B9WA 1FKPB 2ZJRQ 3PVXA 2QEXS 1WELA 1FJ7A 4K2XA 4JI6J 1JMTA 1OY8A 3T1HJ 3EGZA 4ZJOA 1TK5A 1NZAA 2WVCA 4L76A 1FA0A 3LAKA 3DMJA 2VG5B 3KLHA 2AT1B 3MM9B 3T5JA 1VC5A 3KJNB 1G6BA 4B3MF 3ZNJ1 3IM8A 3R5CA 1A6LA 3BGRB 4XO0A 2ROPA 3A1YG 3SDEB 3ZTOA 1RWVB 2W8LA 1U7LA 2QFJA 2RRAA 1M5PC 4OI0A 1EKSA 2B4UA 2K1RA 2X1FA 1CJTA 2AX0A 2UUBJ 4RWWA 1IQTA 4P72A 4X62F 4ITSA 4AT1B 4GMKA 3HHLC 4RUHA 1JXLA 4NYZA 4AXJA 2OPPB 1FRXA 2BKOA 4I0WA 1C0TA 4DL2A 1B70B 3K8WA 3PDNA 3RGIA 4DV4J 2QLWA 4CO5A 5KFPA 3CW2C 3M32A 1P1TA 2KXFA 4UUXA 2PN6A 3TP2A 4OI1A 3CMAS 1UVNA 3GQCA 2LFVA 1TR0A 3ISND 1RAEB 2CJAA 2MLZA 2V69A 2MKSA 3UDCA 4ERDA 4DV1J 1JLGB 1RWKB 4RBUA 5B0DA 1TVRB 1X4DA 4M5IA 3O3LA 2W8KA 2QA4S 2GVZA 4ED1A 1F3VA 2CQ1A 3TNVA 5HMYA 2YWKA 3M8SA 2A0FB 1RYRA 5J1PA 4UQGA 1N36F 2QMWA 4ILRA 4NL5A 4ECSA 3CD5A 4MJKA 1F60B 4OYXA 1DARA 3UCUP 2LEAA 2FHOB 3FUYA 2KRBA 1HI1A 3ZTRA 1K9MT 1GNKA 4RKUC 4ZP6A 2HHPA 5EX3A 4ZLLA 4HHHA 4WU2A 2HGMA 5BYSA 4LFBF 4JB8B 4IFYA 3N28A 4DR4J 3M6VA 3NMRA 4K4VA 3H2LA 1NHUA 4WE1B 1H2UX 1KOHA 3OBIA 4C7QA 3TWZA 1YRUA 3PJ9A 1AXQA 1YKWA 5A8KB 3MEDB 4U95A 2C2MB 1JJ2R 3TYTA 2V2ZA 2H5JB 1I51B 2DITA 2RKIA 4RW4B 4RNNA 5KFXA 1Y4ZB 2B8PA 3GSDA 2J0QD 1PBUA 3B54A 1TL3A 5HBMB 3JSMA 2CPHA 1SV5B 3JQMA 1QE1A 4WU3A 1WEYA 4JI0F 5IOLA 2QYCA 4QIVA 2YWEA 3AJDA 3OT9A 4JV2A 3P8BB 2AGQA 3TUJC 4O3QA 3OLAA 2ZZNA 3RUBL 2FZKB 3QRQA 4MYUA 2KKHA 3VVUA 2F40A 2GFFA 2B51A 1VI7A 3OD2A 2H5EA 4HHUA 4Q2MA 4JUZA 3BH7B 4LF1A 1U2FA 2BBEA 3FQKA 4C0OC 4JI2J 4ZJLA 2Q3PA 3CEDA 1QLNA 4X4OA 2VPZB 3R1LA 3DN9A 2C3YA 1U8SA 2W7AA 4PYAA 3H5SA 4KV8A 1TTHB 2AWZA 4CLKA 2HVHA 5CYMB 1T9YA 3ILLA 4USVA 3TZXA 8RUCA 3RW6A 4K4XA 2BZ2A 3ENAA 1FE0A 1DTQA 1N6QA 4A47A 4DL5A 1RHRB 1DZ5A 3IP0A 1W2BR 2CAJA 2YQ3A 1QSYA 5FIIA 3DOMB 4DV2J 4IG3A 3G82A 2VA3A 3KLEB 2H51B 4GKJF 1YJUA 3C6TB 3HJVA 5HVHA 4KHPF 2E1AA 3GSIA 4CTAA 3MM7A 2OI2A 4RJVA 4F0MA 3AB2B 4F4KA 5E3RA 3DRYA 2R2RA 3LOUA 2NXCA 3CGIA 3W9HA 4QR0A 3CCES 2VFVA 1PO6A 1AA1B 3BBCA 1HHTP 3NNAA 3K89A 1NKCA 1CULA 3NWRA 3T1HF 1K8AT 3QAEA 2Z4PA 4LJMA 3AOCA 2MHEA 3KLFB 1E6VB 3DNCA 3KUEA 4MT1A 5GAGU 2E1RA 1RT5A 4HTJA 4R25A 1HD1A 1N5YA 4ZMMA 3GLJA 1S48A 1RAJA 1FXLA 2RVJA 5I3UA 2HWHA 3DLBA 4MTPA 2NUUG 3GR1A 2COLA 1R7IA 3IMQJ 4NCGB 2IVYA 3N9UC 4U96A 3OQ2A 5GAGI 2GMHA 3I32A 3NGTA 2EVZA 1FJGF 1RBOB 8ATCB 2R9LA 2D9PA 4QQBA 2IM3A 4K5SA 2VFSA 3MR7A 3ADAC 3W65A 4F3OA 3BSNA 3HJFA 5JJBA 2YWHA 1JJCB 1VMBA 2OEJA 2YY3A 4OQJA 4A8YA 1U1NA 3KLIA 1Q16B 1QD1A 3ZTPA 4E98A 1S59A 1VQ4S 3BKUA 5J2PB 3J81Y 5K8MA 3SDEA 2W25A 3CC7S 3RBDA 3M6UA 3BSOA 3BGLA 5IM0B 3IWNC 5A76A 5AXLA 4EEYA 3IGVA 2J6SA 4DR1F 1TKDA 3GYXB 3VQSA 4B3OB 1QUVA 4I4BA 2AEJA 3AA8A 4C48A 3E8OA 1L5UA 2PFDA 1Z2LA 1G4CA 2G9OA 2RF2A 1KHWA 2KDOA 3R3TA 1C0TB 4NLYA 4QPTA 2MSSA 5JXSA 3W60A 4KT0C 4YR2A 3WHIA 3IRWP 2XS5A 2G0JA 2JVRA 3KFWX 3MCOA 2E9ZA 1S99A 4HR2A 3M7VA 2YNFB 1VLYA 4ED2A 3JAMY 1AUSL 3W8PA 3BO4A 4LF4J 1RHQB 8AT1B 3BQ1A 4MAKA 1PYSB 4TXSA 1FWLA 2CZ4A 2FJDB 3OLBA 1GEHA 1RE1B 2RDIA 1HQUA 3BB5A 1FO1A 4CO0A 3MM8B 4DSFA 1L3VA 2BOPA 4OX9F 3UW1A 2GIFA 4PUOB 1BUXA 1SJ3P 1VRTA 1S1TB 2UV8G 5F8IA 2DNHA 3R5AA 2XBPA 2W24A 3NS7B 4CI0B 2CPJA 1KR4A 2H65B 5D4OA 5FJ4A 4G1IA 2BJDA 1N88A 5M2PA 2N7CA 3W3SA 4CRJA 1OWXA 3PW5A 4ZITA 2F8HA 1Z2ZA 2CPFA 4C0HA 1X4HA 3EGVA 4YHHF 2FLPA 3PFEA 2V2QA 1D9DA 2F4FA 4JI7F 1RT4B 3NP5A 5DZ6A 1F9FA 5BR8F 2BQ3A 1SJ4P 3AH6A 2UUBF 3F56A 1EARA 3IWXA 2PEHA 4YDDB 3QPIA 3N0VA 5DETA 4DWIA 5A8KA 1PSDA 3Q23A 3ULHA 3BR8A 1GMUA 1NLKL 4ZP7A 1S6PB 1Q81T 1KDNA 2RKIB 5F8MA 1WTBA 3GG0A 5HBMA 3JSMB 5DGAA 1UW4A 2GQCA 2K7KA 5ETSA 5KT4A 5A8WB 2WSEC 2WOMB 2XGPA 3MTJA 3TANA 3EZUA 3QT5A 1MROA 2FTRA 1Q5VA 4IDKA 2MYFA 2R42A 4ZVHA 5E33A 4ED4A 4K0KJ 1HBNA 4DV4F 2XWYA 3WX4A 1N8RT 4P2XA 5FDLB 4NLSA 3VVTA 3KNGA 4C98A 1D8YA 1NDLA 1U1MA 3R7SB 3VGUA 2DR7A 5J1NA 3OFFA 3TUIC 3IC1A 4C11A 4GC7A 2CVIA 1C4CA 2WRMA 1FKPA 4KO0B 2HFUA 1HHSA 3FBCA 2XMJA 5B0EA 1NAQA 4M5DB 2CJ9A 4LFAJ 3K8VA 4IQXA 4F04B 2PO4A 1CPZA 1T05A 1Q7LB 2OMOA 2OMLA 3DMJB 1JKHB 2B5JB 2RSQA 3MAQA 5CYMA 3HULA 3H5UA 1DFDA 3AXMA 3Q24A 2APOA 1RP5A 1HI8A 2FLOA 4LT6A 3MR5A 3M8RA 1XMOJ 4K5RA 3MMJA 4ZVGA 1K1QA 1YRXA 3DOMA 2OUGA 3BZQA 3FK4A 4TYBA 1B7YB 2CPIA 5CZVA 5ETNA 3ZFVA 3TZYA 4FYYB 2Y9HA 2YNGB 5L8RC 4IKAA 1S0OA 5K20B 2LECA 4JYAF 4HH0A 3PR5B 2HLTA 2BRKA 5L38A 3SV3A 1LWCB 4G65A 5HP1B 5MLCV 4ELVA 3SSQA 3R2DJ 2F1FA 3Q8QB 2M8DB 4QCLA 1IR1A 1UL3A 2B9YA 1VRUA 2HHSA 2DH7A 1XTZA 4EU0A 5CYJA 4HI1A 1FRJA 4XPEA 4EBCA 3HCXA 4ZP9A 3BPSP 4MFBA 2DY1A 2RS8A 1JLGA 2CDRB 2FJAB 4K2JA 4OLOA 5ETVA 3ZZTA 2FLNA 2XYGB 3R5GA 5D77A 4DHVA 1QTNB 4PQUA 3PHTA 4ZVRB 3V6JA 4DF4A 2HMIB 5D15A 1URNA 1ZPVA 3HSJA 2AYGA 4KY3A 2MQLA 3I5BA 4LF6F 1WSVA 1RGVA 1LK5A 2HFZA 2I1RA 4RNOA 2ACMA 3PW0A 1TAUA 3W9JA 4JI5J 1F5CA 1MWZA 1WKLA 3KDOA 2I9SA 1SIZA 3FBBA 1S6QB 3C66A 2X3DA 3PZPA 4Z7CA 1DLOA 3CC2S 1D1UA 3OR2B 4ZP8A 5J2PA 3M8PA 1UMJA 2B4OA 1U6ZA 2CNNB 2VPWB 3U1NA 1UVKA 3UO0A 2ZH3A 1R8CA 1RKJA 4ECVA 2CQ2A 5C2GA 4DV3J 1HNXJ 4DZ6A 2SXLA 4C8KA 1U1RA 5D0GA 2VPXB 3EZOA 1Q53A 3RBZA 2AYMA 1GMWD 1RWMB 1C0UA 2UUAF 4NZ6A 4P9SA 2ZVSA 1TKXB 3IR7B 3LWLA 4A8KA 3P96A 1LOUA 1A9NB 5DM6Q 4WP8A 3M8YA 3MUTP 1VRQC 4ZS6A 1NMEB 1PYTA 2G2YA 3JQKA 2CQBA 3QT6A 2EKYA 2V8HA 4OYWA 3AQPA 2GX8A 1G2EA 3M9OB 2YNFA 3PYFA 1PKUA 4DI6A 1FVQA 3T3FA 2I0XA 2OP5A 1TK0A 4DPTA 2K06A 2ZBCA 4F7VA 2XTJP 2MKCA 2DYAA 4LF8J 3M6XA 2AEMA 3Q89A 4WFBQ 5U47A 3CUNA 2CQPA 2XI3A 3U1LA 4PABA 4FN5A 1YRTA 1V3ZA 2B7CB 2I5JB 3DU6A 4USMA 3J81j 5KFKA 4RL1A 2HPUA 2H4YB 2HQCA 3C19A 3VR1A 4TU8A 2HFOA 2ASYA 3OXGA 3VAFA 1TL5A 1PAEX 2EK1A 2FD2A 4ZVUB 3EX7B 5EGYA 2KHCA 2HBQB 2X1GA 3TZZA 4DL4A 3QRRA 2GHPA 3DLGB 2WVFA 4G1PA 4HHJA 4HVZA 2ZJQQ 4PXCA 3C3LA 1S5ZA 1XC9A 3MWBA 4D3HA 1IR0A 3CVKA 5GMKa 4NASA 3IAM9 1FD8A 3C6UA 4WIQA 4FVMA 1NK6A 4FPRA 1X7VA 2OTJS 2XMKA 1LK7A 3CMES 2A18A 3B6BA 2C3PA 3F73A 3KG4A 3OTEA 4O23A 3H4DA 2MGZB 5HANA 4P7VA 2ASLA 4DR6F 5A8RB 1YJTA 4BS2A 1EP4B 1BQXA 3MCSA 3BGUA 4M5JA 4Z2XA 5JUMA 2R7RA 3OFEA 3M9NB 2LU2A 1R43A 4PYDA 2F5GA 2QV6A 3OJSA 2BYCA 2H54B 2HHVA 3J7ZT 1X4CA 2WOMA 1NB2A 3FMWA 4WWSA 1FK9A 1J5EJ 2FHJD 3JSBA 4QWEA 2M5YA 3ZC4A 3RU0A 3HDSA 1HBNB 6FD1A 3HO1A 2E5HA 2VFTA 3A4TA 3K2YA 4X66F 4OYPA 4C8OA 4LRAA 2L9WA 4HYKA 1K47A 3R6LB 2KVIA 5IZHA 3FSXA 2FYXA 4JV5J 3HD1A 4C0BA 2BMBA 1N54B 3Q2TC 1FKOB 1WKKA 2IVFB 4I2QB 1GTHA 4ANDA 5AJ3J 1VBYA 4I6AA 3D1QA 3LP1B 4GVBB 4RWXA 4DX8H 4J5OA 2MQ8A 3PRBA 3VZHA 5F9NA 1M0SA 2QIFA 1Y5IB 1NRKA 2ZBQA 4LQ3A 2GVDB 1HBMB 3W7BA 3IG1B 1H73A 1T9XA 3MAAB 3RBEA 2GS8A 3B4DA 4KGKA 3G8SA 1T3OA 1UEUA 2C2EA 2OHDA 2NSCA 4TKTA 2FDNA 7AT1B 4O3SA 4EO6A 3BV8A 3G4SS 2R7SA 3I56S 4ZPTR 1S97A 4G1QA 1SUQA 2E5GA 4A8OA 2XB2D 2AV5A 4K4ZA 2F7VA 2OO4A 4W4MA 2I6WA 4TU7A 4XPCA 3UFCX 1TV6B 3QT8A 4OJ1A 3W66A 4DCOB 3TJAA 2NXEA 2V63A 2ZBPA 4LIRA 4DOZA 1RWWB 1T7PA 4L3NA 1BY9A 3GP9A 1FWKA 1VQSA 2E5LJ 1OJ4A 1S49A 1RT6A 1IR2A 3ILOA 5KT2A 5K14A 1IBLF 2E9RX 1VBKA 3HF5A 5D6GA 1X5PA 4CH1A 3G86A 3LO3A 2HMIA 2PMZD 1VIXA 4ZVEA 1SL2A 1F9HA 5T7LB 4ED6A 4WZQA 1HIYA 4IG0B 4XAKA 1U4BA 3Q8UA 3KJFB 3KHGA 3MPVA 3ZZUA 1S6QA 1AFJA 3R5DA 3RB3A 5KFHA 5IS2A 1VC6A 1N33F 4O3PA 5AXKA 2BDPA 1S6OA 1KLMB 2HAFA 3KG0A 2R2UA 5D0EA 2HS4A 1P27B 4EZ9A 2WAQD 1RWNB 3K5OA 4E2FB 3K5PA 2J9DE 2Y3YA 5HATA 5KFAA 4DUTA 5DQGA 4ECZA 4KQZA 2AU0A 4MH8A 2V6AA 2WW4A 2QL5B 2HIQA 3MGJA 2J7KA 1MMLA 3DDIA 3MEKA 1MU2B 2VJUA 3KLGB 3KHLA 3WDOA 5A8WA 2BM0A 2OAUA 3FEZA 4LRBA 2VQEF 1BWVA 1ZYQA 2NZ4A 1X31C 2LVWA 1SC3B 1X9SA 1PGZA 2D1CA 3GWCA 4Q8EA 3BN7A 3IN5A 1IVZA 4ES1A 2JWNA 5MAOA 4E8UA 1WKJA 1IWAA 1WI6A 2DGQA 4B9LA 2VG6A 2D41A 2BE7D 3A8JA 4JBCA 4OHVA 3VZIA 4WP3A 3DLGA 5JMNA 1HWKA 1BE4A 1ULRA 3ET6B 4CH7A 5F8LA 2DNZA 4DX6A 4TNOA 1JJHA 2N82B 1D9FA 3A13A 1L3KA 5KFRA 1J5EF 4BDPA 4C8LA 4WZMA 3DU5A 3C6UB 4OJHA 1BGXT 3LP2B 2PGCA 2DGWA 3FRYA 3BYPA 3Q8SB 4K4UA 4ECRA 1U47A 2CQIA 2KI2A 1CC7A 2XMMA 4D3GA 3EMTA 1VGYA 1LWCA 2K8GA 2M9KA 3PKMA 4AL5A 1WC0A 1T9VA 1VQMS 3T1YJ 3JSRA 2XGQA 2ZHAA 1E6YA 1SJQA 5CCLA 3K59A 1SVDA 2K3IA 3ZTQA 2KXNB 1FK9B 1S1XB 3OFGA 1RHUB 4MFBB 2MHNA 4LBHA 5BXIA 3R7BB 3QO9A 4B9MA 2BJEA 4OI4A 4PPDA 2ZH7A 4QWAA 2P9GA 4J90A 1B3TA 5KFCA 1DQ8A 4HACA 2DR9A 1X4GA 1M5VC 3LP0A 2ZUGA 1U2RA 2DT9A 2YWGA 5A6PA 3OV7A 2Y1IA 2DXDA 4B3TJ 2IAJA 1W25A 3D0IE 3L09A 4ZPDA 1Q78A 5LSLA 2GJ2A 4GVBA 4M5NA 4QWCA 4DG1A 2RS2A 3MHYA 4F0KA 4QWDA 1KVIA 1V3SA 5LJ5Y 3GFHA 2R7TA 1OQ6A 2HFSA 1DLOB 4HKQA 4N8NA 2J8SA 5F0UA 2E66A 4EI2A 3M8PB 3BM7A 1LEOA 3LW5C 3NWGA 5LMUJ 1NH8A 2ZC4A 1T94A 1ZZNA 1JLCA 4JI8F 3R1HA 1ROFA 1BXNA 5AXNA 2AJ1A 1UPMB 5HI7A 1RU2A 2ZJPQ 3DOKA 1IWGA 2CPEA 3MOJB 1C0UB 3C14A 1NKBA 3BQ0A 1URRA 1T02A 1M5KC 4Q5VA 3JB9k 4BBYA 2OPSA 1WG4A 1NCLA 1WF2A 2WONA 2YWFA 3HVRA 4USKA 1RQ0A 3TJ9A 4I7FB 2I38A 4ZHRB 1IKXA 1KVKA 2IM1A 2MZTA 1Y11A 2DD8S 3OSPA 2ZOMA 3SEOA 2AJ4A 1B0PA 4H4MA 1Q4RA 2BV3A 1CJUB 3O1LA 3D9BA 4CLPA 4DPWA 3TQ1A 1LWXA 3FBEA 4MMOA 3FMBA 1RT6B 3T5KA 1S1VA 5HN0A 3VAIA 1MNEA 4ANEA 3UD3P 1SQGA 1QAYA 2EEYA 4CQ1A 2KG0A 1WC1A 2YNIA 3CJKA 4ELUA 3UI3A 4C8YA 3NKYA 4C3MA 2R2TA 3CDAA 5DJBA 1FHTA 3D1HA 2XCPA 1VOMA 4EMDA 3I0RA 1R8AA 3FCHA 2EFVA 2N3LA 3H25A 5DG7A 3QZ7A 3KDNA 3D4JA 1RT2A 1BWEA 1N56A 1MW7A 2J9EA 4DR3F 1KLMA 4FYXB 4A8WA 4V19J 3R97A 3DOLB 2HK2A 2ZH9A 1GX6A 2X51A 2Q6BA 2VPYB 3HZGA 4YR0A 2ZH6A 1JX4A 2EG1A 2LCWA 1CEZA 1WC4A 3NAIA 2J9CA 1EETB 3ENWA 4KH0B 3UN3A 1BQNB 3HI9A 3C15B 5IC4B 4NXMF 2VDIA 1FJEB 3UDEA 4KPCA 2G2ZA 2R8KA 4RW6B 3HM9A 2BE2A 1Y9OA 4AUKA 5L46A 1DBDA 2CPYA 2VC1A 2DGSA 4TQSA 3LA0A 4X62J 3C8YA 4J9UE 4LQ9A 3W8GA 2A6MA 4C8NA 2JNJA 4CO3A 2EPIA 2E29A 3D0GE 3BO3A 3OTOF 3G6XA 1RADB 3SQOP 2KFYA 1AFIA 5AE2A 3FBFA 3PEJA 4ES3A 5KAKA 3BN4A 1KEKA 2CG4A 3EVWA 3EGWB 3M2RB 4I67A 1TKTB 4M5LA 2D74B 1W2IA 2W1BA 5KT3A 4C8MA 1U1QA 4Q44A 3H0PA 1WC3A 3KLFA 1FKOA 2HHHF 3JTOA 5L1JA 2M2BA 1TU0B 4IOBA 2CJKA 4DV0J 2CVEA 1IBLJ 4ECTA 4N7TA 3CCSS 4RUAA 4WXOA 2MJNA 4OX7A 3OTDA 4PR6A 1C2PA 2DH8A 5LXRA 3IG1A 1FNOA 3TUZC 1IKYA 4TQRA 4RW7A 3J7YU 1NUEA 3PX0A 2KFNA 2BJ8A 1U1KA 1P9YA 2J0WA 4DV6F 2BKPA 1WC6A 3LP2A 1T95A 2XY5A 3M30A 1D3WA 3PW7A 4UT4A 3H7HB 2PI4A 4YOEA 2CQCA 2W4CA 2OH2A 2ZNYA 4B3MJ 2B7BB 3HT0A 2DK2A 2R7VA 5F41A 4NMLA 1SUQB 3GIRA 2BJ1A 3I4PA 3TA2A 1R0CB 2FJVA 3NOGA 5KFEA 3LH2S 4ZPWR 1CG2A 1TV6A 5DLGA 2VBWA 4TLQA 3OTOJ 2YKAA 3QBCA 3M2VA 4DN9A 5AJ3F 3DI6A 4HI2A 2W9CA 3VGSA 2J5AA 3QAUA 2KRRA 4EWTA 2QL7B 3TVZA 4X64F 1VISA 2VD3A 3CJQA 3QJLA 1RWUA 2JEFA 2HSEB 5LM7E 3SZ2A 5K14B 4M95A 5D4LA 2NSBA 1HNWF 1K0TA 3LP0B 2AJFE 4BHQA 4ENOA 2C2RA 5B7WA 5CAAA 4JI6F 4OHZA 2H9ZA 4DSKA 1JK9B 1YJNS 4AL7A 4OHYA 1NSQA 1WDTA 4ZOSA 4B3SJ 1LXNA 3V81A 3DDNA 1RAAB 1XMQF 3JYTB 1GXTA 4N8OA 5G0RB 1SC6A 3LF0A 5KFGA 5KFVA 1MMNA 5LMNF 3QIPB 3G8QA 5LSRA 3QWUA 3S01A 1WOSA 3UN2A 3VAMA 4DUYJ 1UA1A 3LQVA 1UCNA 1K0VA 1I94F 1LWFB 3IS9A 5KFSA 2Z8QA 4KIAA 3PCOB 5J2QB 1R89A 3RZAA 1NDCA 3N79A 1EJ7L 2R7QA 4O4GA 2BXJA 2YKNB 1RT7B 4DUZJ 4LF9F 1HARA 1JWWA 3C14B 4A8SA 2J76E 4FBTA 3KLVA 1HW8A 2BJ7A 1H6KX 2HFVA 3CNQP 2HEKA 4LF5J 1ZH5A 3QATA 1MU2A 1HMVB 2Z0GA 3EXCX 4I7FA 1U8WA 4RR5A 1H98A 2CZVC 4DL7A 4Q7AA 3TUPA 3MMBA 1IM6A 3JTPA 5H9FJ 4EGLA 3TJ8A 2A3JA 4CO2A 1CJUA 2NPIA 1X9WA 1FVSA 1T9UA 1S0MA 2HVDA 2HNDB 3GV7B 1KLNA 1C1BB 2AX1A 5F3TA 1FXRA 3FQLA 4W98A 4C2MA 3KG1A 4DPOA 2IRUA 4LF2A 3ICLA 1U0HA 4P75A 1KWMA 2J7UA 4ZCMA 1X0FA 1NK0A 1X5SA 4L75A 2RB7A 4QWBA 2OEKA 4USTA 1QUPA 2FGCA 2GC8A 2LQ8A 4FXVA 4UTGA 2FPHX 3GIJA 2AJ0A 1DHMA 2YQ0A 2Z30B 4NXNF 3D5MA 1RB0A 2IDLA 2YKOA 4U6PA 4DR2J 4ECWA 2VB6A 4ZPBA 2JH3A 1VQPS 3W62A 4CLSA 3I5AA 4JI1F 1N32J 1S1UB 4I2PB 2C3MA 2P6SA 4FP9A 4B3RF 4DX5A 4FKXA 2UXDF 4ETXA 5CABA 4J9MA 3PX4A 2HS0A 3B4MA 2XZWA 1VQ7S 3PXGa 1SKWA 2GGPB 2OLWA 2R7WA 2MKKA 3ISNC 3NG8A 3Q86A 4K0KF 1YGYA 3PIOQ 2D7SA 5LSOA 1UFKA 3NLCA 2BKNA 1HKAA 3HSDA 3U7JA 4MIBA 2CNKB 2KM8C 3RB0A 2HQIA 4LRCA 1VS3A 1N34F 1JLAB 3DLKA 5CYQA 1JLBA 3UDVA 1FDBA 1RISA 2DHSA 4CO1A 3FDSA 3M2RA 4V19X 4WK3A 2MDAA 2HHUA 3F0NA 4OI6A 3IGNA 4DV7F 3RYLA 2MJUA 4X65F 1JLEA 4W92B 2DKOB 2CZ9A 3V2UC 1CJVB 4J7CA 4P2FA 4FYWB 3TVYA 3ENQA 1QDUB 4H4KA 4KB7A 3CCTA 1CLFA 3C16A 2XYHB 4NEYA 1SKSA 4JI4F 1KFSA 3U27A 3QLHB 1IKWA 4CM0A 4GKJJ 4V1Ak 3TO8A 2UXDJ 3B78A 4DQRA 4WF9Q 3A3NB 4FF3A 4N5SA 3ELHA 4O3NA 1K44A 5GVQA 3I96A 3DXBA 3GMGA 1WDDA 3OTBA 4MIAA 3KK2A 4ANCA 4YHHJ 4ICLB 1NK4A 4DR3J 1TUGB 1T9WA 2M88A 3AA9A 1VQOS 2ZOGA 3GZ7A 1YJWS 1NSAA 4C4WA 3NGUA 4U8VA 1KKHA 2ILYA 3H42A 1QSSA 2V0NA 2WBRA 4DSIA 4QIEA 3M2VB 2MKYA 2K1RB 2PFFB 1CJTB 1RAHB 2ZNZA 2NXJA 1JXVA 3OJUA 2W9CB 2Y1RI 4H4MB 2DH9A 1QAIA 1VQ5S 3DRRA 1WJ9A 2F4VJ 2A10A 1X4FA 2BOAA 5HLFA 2MQQA 2HW3A 4K59A 4C3LA 2ZM6F 3P3DA 5HK4A 3UD5A 2EC2A 2IDEA 3MD1A 4RZRA 3CJKB 1TL7A 2C3UA 3MMAB 4PXDA 4PWDA 4KYZA 3PO5A 1N4LA 2YX7A 4MK7A 1TKZB 3QGGA 3GILA 4B9UA 4KRWA 2BX6A 4L73A 4MYTA 4IH7A 1HR0F 4QJVA 3LGNA 1Q1KA 1ZAWA 1R8BA 1KQGB 3WIUA 1WTFA 1RT2B 1S7HA 2N4CA 2V4JB 3GFZA 2G1DA 5GADI 2Q1LA 1UETA 2YH1A 2JEJA 3EPIA 2UU9J 3RR7A 3HVWA 2ZDOA 3D6TB 2AHOB 2B0GA 4X84A 2UP1A 4FF1A 3PM9A 1PG5B 4YFUA 3MUMP 4IRCA 2L08A 5KG4A 3EPGA 2VKRA 2KYXA 1SBRA 1VJWA 3D1OA 5EHHA 3NGKA 4URSA 5IWAJ 1BQNA 5EWFA 2ZWOA 4R0EA 5ITHA 3T5HA 5EN1A 1FDAA 2DNNA 3MCNA 1HHQA 5KG3A 3MURP 4IFYB 1P9QC 3ZNUA 3V6HA 2HFNA 4ZVTB 2DNOA 3PHEA 3OL9A 2V50A 2RIJA 1HBOB 5ETMA 2W9BA 4DFJA 1X4BA 1JXEA 1VYAA 1ZA1B 4QW9A 2XLKA 2X7IA 2VQFJ 4CYUB 1H38A 1Q5YA 1AROP 1REVA 3BSAA 5C25B 1C1BA 3MTKA 2ZHOA 1KC8T 2PA3A 2A2DA 1FESA 2JFKA 5CCMA 2R8IA 1RABB 2E1CA 2MTLA 3QJPA 1PYOB 3GJSB 1PJ5A 1HR0J 3IR6B 1NNDA 4WJBA 3P45B 1BMQB 1WD6A 1KNZA 4FS1A 1AZSA 1S9FA 5K8PA 2W7PA 3NGRA 2ALYB 1RI7A 4L74A 2OD4A 3DC2A 4CCHA 2Z56B 3NXZA 3DRPB 4B9VA 1CVJA 1S79A 5DQIA 4B9TA 2D3O1 2YKMA 2HGNA 2MZSA 5GAHU 2Q66A 4GKKF 2ACYA 2XLJA 4U7UK 1XQIA 1U09A 3HVTA 1O0PA 1H7WA 2ZKUA 4I1TA 1S1UA 1FE4A 3IR5B 2E5IA 1RAGB 3CD7A 5M2RA 3MR6A 2HQDA 2M4MA 4LUBA 3JSYA 3NBPA 1FERA 4ZVFA 4F0HA 4DSJA 1RAOA 2HKEA 4Y2KA 1BD6A 4RX6A 3I87A 2O01C 4X4NA 1V5IB 3UNYA 5KG7A 4CIOA 2VQFF 3AD9C 4PCQA 4OX8A 3OVBA 3ZZZA 4Q0BA 3V6KA 3MAHA 1TL1A 2E44A 1S6UA 1VK3A 2JVOA 4DJBA 4LMZA 3U02A 4JI0J 2UVWA 1RA7A 4CTAB 2KZMA 3M8QB 2QMXA 1PBAA 1VBXA 3DGPB 2E7VA 1JLBB 3C46A 4AL6A 3F44A 1UTAA 1M5HA 4EFAC 2FB0A 1IUJA 2BA9A 1IBMF 3QGHA 3KUHA 1U49A 4G3IA 4K7QA 1KSPA 4QYZJ 5IT9U 4KPYA 3SCKE 3PTWA 3M4XA 2QT7A 3EE3A 4I69A 4QIWD 1YIJS 1LW0B 1YDLA 3H59A 3QMQA 2GAHC 4CLTA 3C16B 4UZBA 1LWFA 1JLFA 2HRTA 3PEHA 2QG9B 4UOCA 2OIHA 4QPXA 2ZE2B 4R8UB 4B9SA 2OPQA 2CKWA 1S9EB 4N77A 4ELTA 4NI2B 1ZPWX 2C22A 3MEGB 4O4GB 2FVQA 1U26A 2AIRB 3AD7C 3N4WA 4DV2F 2PMHA 4ED3A 3BDPA 4J9QA 9RUBA 2ERRA 1U1LA 1Q8LA 4DU8A 1FX2A 2BEFA 3CJRA 1Q7YT 4QYZK 2CDQA 5JVGQ 2KHDA 1FX4A 5B0BA 3O8WA 2CG8A 2ZH2A 2DISA 4ZLNA 1H0HB 4DV5J 1N36J 2IBKA 4B3OA 1Y10A 4FYVB 4KHRA 3LANA 2LQJA 4LVNP 1U2CA 2JOQA 3D0HE 3EJMA 5HLFB 5HVFA 3D3CJ 4DUYF 2ATLA 3AFGA 1X9MA 2DNYA 2M7SA 2ADCA 5KFZA 2BVZA 1NM2A 1UWAA 1VK8A 3MPYA 1PJ7A 3G96A 1TL7B 3H4BA 4E0DA 5BJRA 4LF6J 3W9IA 1PAUB 3US5A 2HLUA 4YY3J 5KT5A 3DRSB 4I64A 1S9GA 1H2TZ 4O4RA 2BW2A 2HURA 4MKAA 1ZZFA 2RH3A 2YNHB 2IRYA 4DFKA 4LF7J 5IC6B 3AY0A 3N6MA 4DCPB 4PUOA 4J37A 2VQEJ 3QYYA 3PACA 1XNQJ 1N5SA 1R27B 1LFWA 1B4SA 2V94A 3M1VB 4WXWA 2AZ3A 3CCZA 3G2XA 2JZ5A 4ED7A 2ROEA 3V6DB 2XC9A 2AYBA 2RAQA 4F02A 4DSLA 2NXNA 2YPZA 2DCLA 2OTLS 1VBZA 3LGMA 2XG8A 1WNEA 1PJ6A 2XEXA 5E3CA 2ZZMA 3MEEA 1AYEA 5KFNA 1N6QB 2WTFA 1VC0A 1RTIA 3JAMU 4Q45A 3EUNA 1XR6A 2PE8A 2V68A 3HXMA 3VV2B 4CT9A 1RDRA 3A3OB 2O66A 3GONA 4A4JA 4LF8F 2HQGA 4DR1J 4F3MA 1ZM9A 3C6TA 2PEBA 4N47A 4Q43A 4DS5A 2BR0A 4EO8A 4TY9A 4CYUA 2YVSA 5DS7A 1JLAA 4NLXA 2BQUA 3GPAA 2HRUA 4USHA 4ETZA 3H5XA 4PG5A 1FD2A 2KTQA 2FY8A 4WFNQ 2NQPA 1J27A 1FNMA 2Y1LB 2M8HA 2XNRA 3MPUB 2F3JA 4UUWA 5KOWA 3W63A 4LBIA 2IJNA 2HZCA 1F2HA 3I31A 1DQ9A 3NY0A 3QFWA 3HHLB 1EQ0A 1OPZA 1AB8A 4X4VA 1S72S 4EYHB 1XNRJ 2XYPB 3MM6B 3PYGA 2HBYB 1WC5A 5J2NB 2YKMB 1NSKL 1ZAXA 2RHSB 2IHR1 3KWMA 4NLQA 5KFTA 5C5JA 5KFOA 3MR2A 2VJVA 3THVA 2C28A 2FHMA 3CSKA 3CMQA 2UZAA 4WPAA 2ZC3A 2ADBA 2QMUB 2NR0A 1FRKA 5HSPA 3V4IB 3LAMA 5DGBA 4ILMA 3QT7A 2QGFB 4B3TF 1F5BA 1RZMA 1KVJA 1F2GA 4ICLA 3IBCB 4J9RA 1NK5A 2JFDA 1F1BB 3NCRA 3K5MA 5SUHA 4NXMJ 2ZZTA 3GIMA 2CJXB 2PC6A 1T11A 1F5AA 2DNLA 1TL1B 2OSRA 3VAGA 5IWAF 3RB4A 1H2VZ 2A6OA 2UXCF 1S57A 2C42A 4X2BA 3DLJA 1FJGJ 3CDBA 2RNEA 4OYBA 3DRRB 1Y3JA 2PT0A 4LIWA 1QAXA 5LMUF 3DGPA 2ZUAA 2XI2A 1HPZB 1OY6A 1TL4A 3E3XA 5FLXY 4IOAQ 3I0SB 3L7PA 5H9FK 1RACB 4NLVA 1GK8A 2L3MA 4A8QA 1D0EA 1VRUB 1ITPA 4PWDB 1JJ4A 2CPZA 1X60A 1I3OB 3Q2SC 2DCUB 4LRDA 4OZ3A 2MQNA 5KFYA 4LFAF 2Y8WA 1M5SA 3J7AN 4Y6IA 3MPDA 2V34A 3OL8A 3SV4A 1EHWA 3MM8A 3SBMA 1JNZB 2KG1A 1O8BA 4KTQA 1S0VA 2QFIA 3H20A 1YG0A 1RTJB 3ITHB 4LSNA 3A8EA 4BLGA 1S1TA 3QSIA 4TN2A 2ZD1B 2WW8A 2Y0SD 4PWUA 5EWEA 4X4PA 1SI9A 3CCLS 1DY3A 2MLYA 1YWXA 4P6QA 3MMCA 2FQQB 3MD3A 2W4PA 4DV6J 3GCXP 4JI2F 5HL7Q 4MKBA 3D68A 1RSCA 5J2MB 2DGUA 2H3EB 4J9OA 2VOPA 1HNVA 1NJIT 2VODA 1WWHA 1KONA 5CD4A 1P1LA 1UJ6A 2OKQA 2DR5A 1RT4A 4YY3F 1GAOA 3RB6A 1NK9A 1HBOA 4OYAA 2LEBA 1NK7A 2RD5C 2HZVA 4RW9B 4M63A 2RUSA 1YJ7A 4OLPA 4PXEA 5CHCB 4DF8A 3BH6B 1DJ0A 1RTHB 1FI4A 2CWXA 4I68A 1IM4A 2ZFHA 1TELA 1AT1B 5C24B 4OZJA 1T03B 5DO2A 4Y00A 3TZWA 4C97A 1A0OB 1VHFA 5DZ7A 4P71A 1EKRA 4KGXB 1JLQA 4NX9A 3FNNA 3G87A 2AQ4A 4RNMA 5BR8J 2ZH8A 1SCJB 4HLBA 2VICA 3KJVB 4YP3A 3FSIA 1P6TA 1Q8BA 3W2VB 2RU3A 5CXTA 4WYWA 1OMSA 5FDLA 2MMYA 2VBXA 2DB1A 2Q43A 3N6NA 3PG9A 3T6BA 4C11B 2I5JA 1MLAA 1XERA 1XJWB 1YX2A 3W2WB 5KT7A 3J7Z5 2PI5A 5E0OA 4PWWA 3H98A 2EFPA 4EYIB 1MN7A 1LWEB 4X4UA 2AP6A 1JKHA 2R2SA 2V2VA 3LTOA 2V9WA 2EC0A 5KOXA 5I42A 1J5OB 3T9NA 3BR9A 1NXIA 3R9LA 3X3UA 2VA2A 3FEYB 4F3QA 3H2VE 1RXOB 1WOOA 1CBKA 1MN9A 1UJ4A 2DR6A 3DXSX 2DXFA 4HL9A 3RRKA 4F67A 5I3QA 3M8QA 3WZ0A 5HO4A 2HHHJ 4ALZA 4DR5F 5F0WA 1EIYB 1B7FA 2IA0A 2EFOA 2QX0A 5HP1A 3ILIA 4IFVB 1QSLA 2GIQA 1EP4A 4ZPVR 2HHQA 4C9DA 4M1KA 5HQLA 2WSFC 4GC6A 4PG4A 2OPRB 1ZM4A 3JTNA 1UKUA 3D2WA 4DV5F 5THWA 4HDGA 3SFGA 2HBZB 5DLFA 3WQPA 1XMOF 3GJQB 1N5VA 3SMZA 2VFUA 1IXKA 4I56A 3WC2A 4CLLA 2ABYA 5LOQA 1N5QA 3IM9A 3R27A 1EB0A 5KFMA 5KFWA 4LF7F 2UXBF 2ZH1A 4KKOA 2FVSA 3M8WA 3RRHA 4PQUB 1KQSR 5AE1A 2DNGA 3B8HA 3M2UB 4YQWA 1XK8A 4F8RA 1HL6A 2Y8YA 4QU6A 1F9EB 1OSDA 2OPQB 4Z37A 3UQSA 3RBXA 4K4TA 4NI2A 4F2RA 4RU2A 1GQEA 1VFJA 2JHEA 2V5HG 2VFRA 3HSGA 3OHBA 1VQ8S 1YJRA 2R8GA 2VIHA 2VG5A 3KLHB 1S12A 2V8VA 1T3NA 1VQ9S 2MKJA 1HBMA 1RWPB 4FXDA 4GO5X 3ONQA 3BGRA 4QU7A 2FUG9 3ILJA 3MPWA 5AT1B 1WSRA 1SXLA 3CJTA 1FRHA 4G6VB 1RHKB 2IJRA 2QA1A 1UWBA 4K4SA 3NNHA 4OX6A 4B08A 3UE2A 3AXKA 5H1SV 1NPRA 1V3RA 1NHVA 3VQTA 1C4AA 3GG1A 4LR8A 3W5XA 4G1QB 3Q22A 2DR8A 2Q79A 3C2PA 4DR6J 3VALA 1SH2A 3M32B 1G1XA 2WBMA 3EVMA 4WTOB 4RUCA 3TW0A 5E3QA 1PCAA 2LMIA 4ECYA 3KK3B 1HWJA 2VF3A 3HZEA 4UW2A 4IO1A 4DS4A 4OZ0A 3DRSA 1UFWA 4M8LA 4OJ3A 1SH3A 1K1SA 1TVRA 1S9GB 1JQGA 1W7WA 4DPYA 2ASJA 1I5OB 2QZ8A 2B6AB 1YTYA 4X66J 2VG7B 4JV1A 1QTMA 1GXLA 1RAFB 4OZ5A 5L9XA 3ZZOA 4DUZF 3MFIA 4NWBA 4LF9J 4IRKA 3M1VA 2P2CB 3TX8A 4CNZA 4DV0F 5T7LA 2NYIA 1BC6A 1WG5A 5KFIA 3VAJA 2GA7A 1NPKA 1PIEA 2AMCB 2DRDA 1ZA2B 3KKFA 1FFGB 4NRTA 5D4NA 5IV3A 3TI0A 1FKAF 2OFHX 2XNQA 2ZWPA 2GIRA 4NLRA 3ETOA 1M1HA 3EGNA 3ZZRA 2IY5B 3POTB 1I1GA 3CJ5A 1U0SA 5ETTA 5B0AA 3MDFA 2RQKA 1VR6A 2DPJA 5AXMA 2AGPA 1YVFA 2IYIA 3PNIA 2G13A 4RW9A 1RHMB 1NDKA 4USWA 2B43A 1FF2A 4WK1A 4NXNJ 1FEEA 1N0UA 4OHXA 4ZPAA 4F4XA 2H5IB 3EVOA 4YDXA 5D78A 1N5TA 2HRYA 4KHMA 2NUHA 3FVYA 3SSSA 5RUBA 5L1IA 2XWXA 2ZITA 3KLGA 3MM5A 3UVJA 1SV5A 2UXCJ 3F41A 2DY9A 2OFGX 1LXJA 2CPXA 2JL9A 4AQYF 3GR0A 2G4BA 1L3SA 2BABA 2FHKA 5B09A 2DEJA 1KS2A 1SJ1A 1SQEA 2EXUA 2Q6CA 3DDKA 4OI2A 4WFZA 3HSZA 1LW2A 1S1WB 4PQAA 3W2VA 2P5VA 2HQFA 5ADZA 3CC4S 3P5BP 3WX8A 3MM6A 1U48A 3R8YA 3WBZA 2NYHA 1FWPA 3KNAA 5HJYA 1IKVA 2RMLA 4KHPJ 4EK2A 4I2QA 3K17A 4DV1F 4W90B 2VG6B 3OXFA 3D54A 4EBEA 2AZ1A 2O3DA 4H4OA 2DO0A 2LA4A 2DNRA 2WVEA 1T8EA 2IA6A 4LSZB 4KV8B 3KYLA 1O51A 1X8DA 4UZCA 1ZTTA 4NOHA 1WHYA 1OO0B 2HVZA 3ET6A 5CQGA 3H2UB 5D0RA 1FDNA 1EX8A 3T41A 3PRVA 2YX1A 3J7YI 1DTQB 4JI5F 4H4KC 3TAQA 3MAAA 2LDIA 3D28A 4Y2CA 3BJYA 1OSCA 2W2NP 2LQ5A 2WHOA 3GYGA 3D3BJ 2AF6A 4B02A 3TAPA 2KJWA 1NBEB 4DL0C 2XY7A 1Q0NA 1RWOB 4KH1B 4L72B 3GTYX 4YEAA 4LF5F 1DTTA 1TMMA 4KAIA 5KT6A 1VIOA 1WHXA 2CNOB 2UUAJ 2E1MC 2H1YA 3A8KA 3SXLA 3V4MA 5A2QU 4HH1A 4ZDNA 3PFOA 2ZH4A 1KTQA 4M5GA 4KJIA 4M5HA 2XO6A 1N5YB 3QO9B 4CLZA 2GMLA 4I6WA 3KOAA 1TUVA 3GV5B 4KKOB 1Y7PA 2K7JA 1RTJA 1REGX 2CRLA 5DG8A 1GH8A 2CQ0A 2IAJB 4HTIA 1UAWA 1LV5A 2YWWA 2FVPA 3R5BA 1JB0C 3BF4A 3MMCB 3RJMB 2ILZA 2RRNA 4DQIA 2NCKL 4DG1B 1EZZB 5KG6A 3K7RA 3EYZA 2J8AA 3KLIB 5E41A 1ACMB 3L4BC 2AD9A 2WK4A 3RW7A 3CJ0A 2F4VF 4K8RA 1VQLS 3TOQA 5IM0A 3M8ZA 3GU0A 2DHHA 2GQ2A 2Z2YB 1UWBB 3CDWA 2XMUA 4MK8A 4XDCA 3MR3A 2V4QA 3K0JA 4Y0FA 2H48B 1S0NA 4PRFA 4OYZA 3H90A 3T9ZA 4ATNA 2KT2A 4DFPA 1RTHA 2FJBB 3Q8VA 2F9JA 4GO7X 2IRXA 4CLFA 4PZVA 3GIIA 1NJZA 4H54A 4UOHA 1T03A 3EXYA 1UFLA 5ETPA 1PC5A 4CM2A 2LQ9A 2XZTB 4FYDA 1Z4UA 4ZHRA 3KUGA 4QYRA 2KYZA 4NZ7A 4IR1A 2HZAA 1IBKF 2EW9A 1CC8A 2ZDPA 1I6JA 1KOOA 1R8HA 1HBUA 2F8MA 4JV0A 2GO8A 1HQUB 2JJ4D 2U1AA 2UXBJ 1W26A 2JC0A 2VG7A 5A6WA 3UNGC 2DGVA 1S1VB 5KFBA 4L3KA 4NEZA 2GAGC 1VRTB 2GJIA 2N4DA 3PX6A 3SCLE 3W2WA 3QFHA 1HLWA 2RQCA 2XY6A 4ED5A 3ZZPA 2R7XA 4URGA 4DZDA 1J2VA 2VU5A 2J6TA 2GJFA 3DFEA 4CLWA 4JI4J 4NPOA 2XMTA 3CF5Q 4DX7A 1BQMA 5I4MA 2W4DA 4KGMA 2MXYA 1NB7A 1XN9A 1UVJA 5L1LA 4ED0A 1TMJA 2FJWA 3POTA 3KMQA 1PC4A 2O1PA 2AYEA 1G7CB 3FZBA 5J1EB 3VGTA 4DU7A 5A0YB 3KLEA 2V2KA 2EFNA 2QN6B 2MKHA 3MM7B 4CDIA 4ZVSB 4FBUA 3NNCA 3THPA 5F8HA 3MI7X 5LL6d 1RK8A 1E6YB 2KFZA 3DLHA 4YR3A 2XSFA 2DGXA 1OYEA 2X1AA 4LFCJ 3HHEA 4LF4F 1E6VA 4PKDB
chains in the Genus database with same CATH topology
4RBTA 1MROB 3DM2A 5E3AA 2MSTA 5G4DA 1WHVA 3E51A 4FNHA 4KBIA 4Y3CA 4NCGA 3GB0A 1TKTA 4WCEQ 5EDWA 2QA4G 3MFHA 1F0XA 3FGVA 2CFXA 3Q8SB 1IKVB 4YB5A 1FDDA 1TQLA 4U7CA 3HPOA 1N32F 3QJJA 1QY7A 4O44B 1HD0A 3CIZA 4RW8B 4NLOA 1UP1A 5DQHA 1XMBA 4OMFG 2LKZA 2R4FA 2G0CA 2VZ9A 2DVIA 4RW7B 2M52A 5T14A 2V8GA 4CT8A 2CYYA 3VAHA 4B3SF 3BEGB 1HYSA 5C42B 4NLGA 2E9TA 2X1BA 3CCMS 2YNGA 3CJ4A 5DG9A 1QVFR 2DJWA 2HG4A 1DTTB 3BSCA 3X1LB 3DRXA 4IR9A 2GV1A 3K5NA 2GMJA 4TU9A 1IN0A 3OSNA 3SI8A 1VQ6S 1GXUA 3S1TA 2JLEA 3THTA 2EFQA 5M2UA 3DI6B 2XHWA 4RU9A 3HT3A 2BQRA 4KR0B 1R0AB 2YH0A 1CSJA 4OL8A 4LVOP 4FZVA 1KQFB 3G6YA 1ZAVA 3U1MA 1S10A 2MQPA 3S7RA 2VV5A 4DV3F 3PV8A 2U2FA 1HNXF 4NCAA 2LU1A 4UY85 4ES2A 2UVUA 3JYTA 5G0RA 2GHWA 4A46A 5A2QY 1FXDA 1BLUA 1TK8A 4O3RA 2RUGA 4ZK7M 5CD4H 3OW2R 3DOLA 4MIWA 2POKA 3BS9A 4BCAA 5HMWA 3CE8A 1R8PA 4LFBF 4KFBB 1RTDA 4XK8C 1NH7A 3ENVA 3TR5A 3VTIA 5KFOA 4X4QA 4I6YA 1FEHA 3DLLQ 1RT7A 2BACA 4BC9A 2VASA 1XNQF 1HNIA 4WKRA 3AB4B 1S6PA 1MMDA 2BE2B 1HW9A 2JX2A 3MF5A 5E7OB 2CQGA 3MM5B 1Z1ZA 1AUDA 1TZ0A 1R3NA 2GHVC 1XNRF 2DNPA 1S1WA 4N76A 3HVAA 2JLFA 3I82A 3SFUA 5E5NA 3IBWA 4RNFA 4KO0A 4J9KA 4RNHA 4NCBA 2J6SA 4M5DA 4F25A 1NO8A 2EWHA 2GW8A 4H4OB 1T05B 1M5OC 2EBEA 3DHWC 1L3UA 4ZCKA 2B5JA 4ZCIA 4F4ZA 2UVVA 3CCWA 3UDLA 4IUFA 3WC0A 1BQMB 3L7OA 3QIDA 3CDEA 4WTYA 4QBUA 2OD6A 2E5JA 2FC8A 3PKYA 1UJ5A 4DR7F 1LKZA 5HROA 5KFDA 5L1KA 3S8SA 4Y65A 5DM7Q 5AE3A 1HQEA 4OV1A 1JIHA 2DHAA 3M30B 4QR2A 1HI0P 4KC5A 2FVRA 4YUDA 1UA0A 1Y5NB 4DFMA 1SL1A 1H7XA 2KN4A 2DBBA 2MGZA 4IO9Q 3FRZA 2GGPA 2GQQA 4XDDA 1TFWA 3AQOA 4X4SA 5F8NA 2OJ3A 1U25A 3P6YC 2XMWA 4LSLB 5IFMA 1LFPA 4IRDA 5L39A 3N01A 1SJRA 4A8MP 1YI2S 3GV8B 4F4WA 5DDRC 1KRPA 2PA8D 2MZJA 3HLUA 1OIAA 1RJJA 3J7A1 5CH7B 2V4RA 4BWJA 2IMWP 4NYOA 3AJ1A 3CULA 2MPUA 2VH7A 3CD6S 3CJ3A 1R6YA 1YITS 1FJCA 4Y2IA 2QRRA 4YMEA 3V81B 4RW8A 1NU4A 2IM0A 2XULA 3BREA 2FGOA 4PPZA 1HA1A 4NA1A 5B0GA 4OHWA 3OR2A 4M94A 2KB2A 5B08A 4NLUA