2VG6B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 90
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6B03
1Z4UA 2YNIA 4KV8B 3UQSA 4FS1A 1TL1B 4IG0A 5C25B 1HQEB 2IAJA 1NNDA 1FKPA 1LWCA 2YKNA 4NCGA 2HWIA 4ZVHA 3SFUA 3HVTB 2AWZA 3EZUA 1HNVA 5HROB 3H4DA 1IKXB 3MTKA 1BQMB 3KK1B 4IKAA 4EBDA 1FKOB 1RT5B 5L9XA 5KFNA 3PZPA 1HPZA 1C0UA 1RT6B 4ZP6A 5F8MA 5F8LA 4YQWA 4K4SA 3NBPA 2XGPA 4KHMA 3GIMA 2B5JA 4O3PA 4QWDA 3LP2B 3OHBA 4IG3B 2JEGA 4H4MA 3DMJB 1IM4A 4RW8A 4ED7A 2YNIB 1RTJA 4URQU 3I5CA 4QWBA 5KFWA 3M9MB 4ID5B 4ZMMA 3LP0A 2R8GA 3TVKA 3N6MA 1QE1B 5KFTA 2FLNA 1S1TB 3V4IB 5KG1A 4NLRA 1LW0A 1TKZA 4KKOA 5KFYA 3CJ5A 5F8IA 3G86A 2WOMA 1NHVA 2VA2A 2I5JB 2VG6B 4RUAA 1TL3B 1RTIA 1S1VB 4H4OB 5DLGA 1EETB 4EO6A 3G6VA 2YNFA 4LSNA 2UVRA 1SUQB 1DLOB 4RW7B 2B5JB 3IRXB 4IG3A 4K4TA 2XI2A 5C5JA 1SH2A 4YP3A 4KE5A 1JLFB 1T03B 4G1QA 5J2PA 2RDIA 3C6TA 3CO9A 4RUCA 1QAIA 1HMVA 1LWEB 4IQXA 3MEGB 5KFVA 3QLHB 1QE1A 5KG4A 2XCPA 1C0TB 4WE1A 4K4ZA 5K14B 4NLVA 4O3RA 3DI6B 4ED0A 4Y2AA 4WZQA 3KHGA 1EETA 3ISND 3V81A 3HKWA 4NRTA 2ATLA 5I3UB 2YNFB 3DLGA 4DG1B 5D3GA 4KSEB 2C22A 3FFIB 4RW7A 4KBIA 5I42A 3IRXA 4TLRA 2IM1A 4MK9A 4NRUA 2FLPA 1S1WB 3C6TB 4IFVA 1IKYB 2WB4A 3M8PA 1S49A 3CIZA 3I5BA 5KT5A 1ZETA 1EP4A 1N48A 1N5YB 4RW4B 4RW6A 3DI6A 3KOAA 2R2RA 4NLTA 4NLWA 2C2RA 3IG1A 1XR5A 2W9BA 3BQ2A 5J1EA 4LQ3A 4TYBA 5CYMA 4TXSA 4NLGA 3MF5A 3KLFB 2QV6A 1TKXB 4TY8A 2ASJA 3HVAA 5JXSA 5KG2A 3DM2A 3FRZA 3NGDA 3TQ1A 5L1JA 2WONA 2FVCA 4K4YA 3RBEA 3M8QB 1S1XB 5KFMA 3NAIA 3DRPB 3LP1A 4M94A 3DLKA 5F8GA 3NKYA 2FVPA 3I0RA 2UVWA 5DGBA 5KFRA 4IRDA 2R2SA 1C1CA 2J6SA 5KT3A 3UPFA 1RT1A 2J6UA 1DTTA 2BE2A 5F9LA 1FKPB 1LWCB 3KLGB 3JSMA 2HMIA 4ZPBA 3MR2A 4F4XA 3I0SA 3ITHB 4ZHRB 1S1UB 4PQUA 4DL4A 2VG7B 4I2QA 2XI3A 3KLVA 2AU0A 1HARA 1TKTB 2BRKA 4TQRA 4ZVGA 1YVFA 3D28A 5DGAA 4I2PA 1MU2B 2IMWP 1RA6A 3M8QA 5KFBA 4HKQA 1S97A 1ZTTA 4ECWA 1RT2A 4KB7A 2JEJA 3LP1B 3CDUA 4NLQA 4FS2A 3PW4A 1FK9A 4Q8EA 4O44A 5J2NB 3KJVB 3KK2A 4KAIA 1RT3B 4NLYA 1T05B 4URGA 3GILA 4QW8A 5L1KA 3RAQA 2D3ZA 4DL2A 1REVB 3RBDA 3ITHA 5F9NA 4IFYB 2IAJB 4WYWA 3MR5A 1S1TA 2YKNB 4NCGB 5HP1B 1ZTWA 1RTDA 3V6HA 3SI8A 2BQ3A 2RF2A 2D7SA 3DOKB 3KHRA 1IKXA 4I2PB 2EC0A 2VG5A 1RTIB 2XC9A 5KFUA 1N6QA 4PUOA 2XCAA 4NLSA 2IJNA 3V6KA 2C2EA 4IDKA 4WZMA 4IH5A 4B3OB 2IM3A 3NBPB 3HHKA 3I5AA 3RB4A 3KK2B 4O3NA 3LP2A 3V6DA 1HYSA 1IKVA 3T1AA 4ECXA 5KFZA 1LWEA 4RW8B 4ECSA 1QAJA 1RTJB 4DL6A 3QLHA 3FDSA 4JV1A 4IFYA 3Q8SB 5DG7A 3EPIA 3LP0B 1KLMB 4ZPAA 4O3QA 1S4FA 3OLBA 1BQNA 2YNHB 1RT7B 3E01A 3D5MA 2D41A 2WCXA 1JXLA 2WOMB 4TN2A 3QZ7A 3N6NA 5L1LA 3DLGB 4DG1A 5D3GB 2IM2A 2BQRA 3FFIA 2AX0A 2ILZA 3H2LA 3H59A 2R2TA 1XR6A 2UUWA 3VQSA 2C2DA 3GV7B 4R5PB 4ECTA 1S6QA 1JLAB 3V6DB 3PW0A 2R8JA 3BGRA 4ICLB 3DRRB 3RB3A 4RU9A 1JLFA 1T03A 4G1QB 5J2PB 3RB0A 3NL0A 2OPRA 1EP4B 1KHVA 4NLOA 4RNMA 1RDRA 1KLMA 3LANA 3BSAA 4J9SA 4ZPDA 2C28A 4IR1A 1S0MA 3OHAA 2OPQA 1RT7A 4YMEA 3M9NB 5HBMA 4LSLA 1T94A 5KG7A 4MIAA 3Q8RB 5KFXA 3DLEA 2E9TA 2YNGB 4ECVA 2W9BB 1DTQB 1GX6A 2V9WA 2JLEA 1JLBB 3JYTA 3IS9A 1C2PA 3Q8PB 3CDWA 4I7FB 5I3UA 1JLGA 2OPPB 5J2QA 1TP7A 3T5JA 4JUZA 4DL7A 5I42B 5KT6A 3BGRB 2WTFA 1LWFA 1I6JA 1HQUA 4RNFA 3H4BA 2E9ZA 4ED6A 1JKHA 2ZD1B 2UVVA 3I0RB 1D0EA 3G6YA 1IKYA 3CJ2A 2AQ4A 3M8PB 1VRTB 5KFKA 4YR3A 5EWGA 3TAMA 1TV6B 1SV5A 4J9LA 3FQLA 2OPQB 2W8LA 1R0AA 1S0NA 1RT1B 3DRSB 2FJVA 5DG9A 2HNZB 3OL6A 3PJXA 1J5OA 4NLPA 4WFXA 4RNNA 2W9AA 4ED8A 3C6UB 1JLBA 3JYTB 3PW2A 4NLXA 2JC0A 4QW9A 5J1EB 2ZKUA 1JLGB 3BR9A 5KFLA 2ALZA 4IG0B 4J9PA 1RAJA 1S9EB 1BQMA 1JLQA 5KT2A 4J9RA 1SH0A 1LWFB 1RYSA 1D1UA 3DYAA 5HROA 5T14A 3QIPB 3QGGA 4JV0A 3MEEA 2V4RA 2I1RA 4MKBA 1FKOA 1C1BB 3DLKB 4MH8A 2WHOA 3TAMB 3KJVA 5KFIA 5DG8A 1QUVA 4MIBA 4YR2A 1R0AB 4KO0B 5KFCA 3QO9A 5DQHA 4QWCA 4F4ZA 3DMJA 2UVUA 5J2MB 4H54A 4ZPCA 4KFBB 4ZP8A 4IRKA 1TQLA 3KMQA 2ASLA 4WXOA 3C6UA 2FJXA 4O3SA 4ID5A 4TYAA 1RTDB 1GX5A 4H4MB 5C24B 3OL8A 3M9OB 4NLUA 2IC3B 4ZHRA 4ED3A 1TKZB 4MK7A 1K1QA 2FVSA 3KLIB 5CYQB 3MFHA 2GIRA 1RTHA 4FBTA 4IDKB 4G3IA 1S1VA 3V4IA 4EBCA 1IKWB 3QIPA 3PHEA 4LSNB 3KLEB 2AX1A 3MR3A 2I5JA 2VG6A 4JV2A 3UDLA 3MR6A 4RNHA 4O44B 1S48A 3NMAA 5J2NA 4U7CA 2DPIA 5J2MA 4KFBA 1DLOA 4ZVFA 4ECUA 4IR9A 3IGNA 3BSNA 1BQNB 4Q0BA 4GC7A 3KLHB 2CJQA 4J9NA 3T5LA 2RF2B 3GV8B 3KLIA 5CYQA 4F50A 2IA6A 3QYYA 3BREA 1TVRB 2HNDA 2OPSB 3LALA 2V4QA 3OLAA 3OL9A 2WK4A 2R8KA 4NYZA 3GIIA 1LW2A 3OSNA 3EPGA 4PWDB 4R5PA 1XR7A 4MKAA 3RAXA 4ZVEA 5KFPA 2BQUA 3ICLA 2R8HA 1HNIB 5L1IA 4F4YA 4J9OA 1IKVB 2HNYB 5KFAA 5HLFB 5FDLA 2WRMA 4FBUA 1RT4A 3NAHA 4HYKA 4Q0BB 4DL3A 5HBMB 3BSOA 1N5YA 2V0NA 4RW6B 2YNHA 4RW4A 4X2BA 2YNGA 3E01B 5DLFA 3MECB 5KFJA 2RKIA 1TVRA 5KFHA 4Q45A 4QPXA 3DOLA 4RW9A 2B43A 3PJWA 3GIJA 2OPPA 3GQCA 1S10A 5CYMB 3BSCA 4KV8A 1UWBA 2XWYA 1LW2B 3IG1B 5C25A 4TQSA 5KG0A 4ECQA 3KK3A 4EYIB 1MMLA 2WONB 1HNIA 2W7OA 1HQUB 1JLAA 2JEFA 4J9KA 1HNVB 2HNYA 5KT4A 4ICLA 4M95A 3PR4A 5FDLB 3DM2B 1VRTA 4Y3CA 2OPRB 4WYLA 3BQ0A 1RT4B 1TV6A 2B6AA 1S9FA 1NHUA 4MK8A 4QWAA 4DEZA 4Q8FA 2YKMA 1C1CB 3DDKA 5C42A 2BANB 1OS5A 1DTTB 1JX4A 2BE2B 2RKIB 4K4WA 1S9GA 3CJ0A 1S0OA 3H98A 3CVKA 3H5SA 4U6PA 4URSA 1S1UA 4PQUB 4ECZA 2D3UA 4EEYA 4I7FA 1RYRA 1S9EA 1JIHA 3QIDA 1TKTA 3T5KA 1JLQB 1TL1A 3BJYA 3I0SB 4WFZA 3KHHA 3CJ3A 1HQEA 3QGIA 3T5HA 4IH6A 3DYAB 4QWEA 3ISNC 5EWEA 4IRCA 4R0EA 3QZ8A 1CSJA 1N4LA 2UUTA 2GIQA 3T19A 1T3NA 1FK9B 2AGOA 1MU2A 2E9RX 3KK1A 5KFDA 3QO9B 1N56A 5EDWA 1RT2B 3IGVA 2FJWA 1RT3A 2BANA 1SUQA 5KFGA 1HPZB 5KFOA 3DRSA 4MFBA 2W7PA 2FLLA 1W25A 1S9GB 4K50A 2HNZA 1JLEB 4IH7A 4EBEA 4ZP7A 1REVA 4OL8A 4EO8A 1SH3A 3Q8QB 4RZRA 4NLDA 5KFFA 4Y2CA 1HMVB 4XPCA 1S6PB 3GYNA 2R8IA 2IBKA 3OL7A 2VG5B 1C0TA 4WE1B 1N6QB 4PUOB 5HP1A 1IKWA 3GV5B 5K14A 3FSIA 4J9QA 1JLCA 1RA7A 2DPJA 2VA3A 3KLEA 4ECRA 2BR0A 5KFQA 3DOKA 3G6XA 1LW0B 4KKOB 2IJFA 3MEEB 4B3OA 5KG3A 4WFYA 5EUHA 1C1BA 2OH2A 1TL3A 2J6TA 3OSPA 5KG5A 5KFEA 4ED1A 4KO0A 4H4OA 1HYSB 4F4WA 4MFBB 2R2UA 3IN5A 2XGQA 4GC6A 5DQIA 1JLEA 3V6JA 2W9CB 3CJ4A 4K4UA 1S1WA 4TY9A 5F8NA 3MEDB 5C24A 2HWHA 3N6LA 1S6PA 4O4GB 2IC3A 2CKWA 4ZP9A 5JUMA 4O3OA 4R8UA 3MEGA 5EWFA 2RDJA 3PW5A 2HNDB 2OPSA 1K1SA 2QE5A 4YR0A 3FQKA 1JLCB 3MFIA 1RTHB 2IM0A 4K4XA 4EYHB 4O4RA 3RB6A 4Q44A 4LQ9A 3GIKA 4Y34A 4RNOA 4XPEA 3E51A 1S6QB 4Q43A 5F8HA 2AGQA 3QGHA 2O5DA 3V81B 2AGPA 3KNAA 1TKXA 4TY8B 5HLFA 2ZE2A 4NZ0A 3H5YA 2BRLA 2ASDA 4XO0A 3BQ1A 2W9CA 1U09A 4KHRA 2JC1A 3KHLA 3H5UA 3MEDA 3H40A 3HVWA 3DRRA 2HAIA 2GC8A 4O4GA 3DRPA 2FVRA 3KLHA 4IOBA 4R8UB 4IFVB 3DLEB 2ILYA 1VRUB 3KMSA 3PVXA 3PW7A 2FVQA 1DTQA 3DOLB 4RW9B 5KT7A 4J9MA 1UWBB 4LSLB 4WXWA 4ED2A 3KK3B 3KLGA 3JSMB 2HMIB 4PWDA 1WNEA 3CDEA 3SFGA 4DL5A 3IS9B 2VG7A 4I2QB 3HVTA 2ZE2B 3CWJA 5J2QB 2W8KA 3KLFA 3LAKA 5KFSA 2B6AB 3H5XA 1RT5A 2YKMB 3LAMA 2JEIA 5C42B 5DQGA 1S1XA 1C0UB 1RT6A 1KHWA 1JKHB 2ZD1A 3UR0A 3PR5B 5KG6A 4K4VA 1VRUA 2F8EX 3MECA 1J5OB 1SV5B 4ECYA 1T05A 5F8JA
chains in the Genus database with same CATH superfamily
5LSOA 2XZDB 2KJVA 3BPSP 7AT1B 3UQSA 1FVSA 3HP6A 2DR5A 3N5BA 3VTIA 4F2SA 4C8LA 3FBBA 3FC9A 1I94F 3IBWA 2YKNA 4NCGA 4DN9A 3BBBA 3HVTB 4GMKA 2VC0A 3TJ9A 1HNVA 2R7TA 1SI9A 1XMOF 4MKVA 2J76E 1A6LA 3G2XA 4UTGA 4X62J 4EBDA 1FKOB 1RT5B 4FYYB 5KFNA 2R7QA 3VAGA 3SBMA 4DPWA 1RT6B 1YZ6A 4ZP6A 3PZPA 4ELTA 5F8LA 3A8JA 5JVHQ 3H25A 3THVA 4JV5J 3NBPA 3X1LB 2G9OA 4OV1A 1GQEA 1RLDA 4S0MA 1R8AA 2OP5A 3GIMA 2OO4A 4I6WA 5LMNJ 4H4MA 3CCSS 2DD8S 3M30B 5KFWA 1YQHA 3M9MB 4LF4F 4ZLNA 1SBRA 3LP0A 3N6MA 4UOHA 3MMBB 2DGVA 2GQ2A 3ISZA 3V4IB 1NK4A 4NLRA 1LW0A 4KKOA 3W62A 2AYEA 3CJ5A 4B17A 4F3QA 2WOMA 5A76A 1Q8BA 2VG6B 4XTTA 4RUAA 2XB2D 3GYGA 2MYFA 1TL3B 4I69A 3VR1A 4U95A 1NLKL 1S6UA 3QWUA 4FDFA 3ZNUA 4HI2A 4NPOA 1SUQB 4DV7J 1VBZA 5IT9Y 3DDIA 4RW7B 2QMWA 2B5JB 1Y10A 1N5VA 2YWFA 4P71A 4DS4A 2XI2A 5C5JA 1SH2A 1URRA 2AD9A 1JLFB 2RDIA 5CZXA 5IS2A 4A8MP 1WACA 1M1GA 2X7IA 2KG0A 2EPIA 2OMOA 2FY1A 4OHWA 1NJZA 4I0WA 2EG1A 5KG4A 2XCPA 1XNRF 2W4DA 1K0TA 1NPPA 2MKHA 4C0HA 5K14B 1PG5B 5DDOC 2UU9J 4O3RA 2ZC3A 2ABYA 1CJTA 1KLNA 2OTLS 5SZTA 3C2PA 3G8TA 4BDPA 1Q86T 1HHTP 1YITS 3V81A 4RUCA 3MM8A 2AT1B 1KONA 5I3UB 2YNFB 3DLGA 1R27B 2XMTA 3MPVA 1NB2A 3PFEA 3KUGA 4DR5J 2KZZA 4UF4A 5D4OA 3W5ZA 1X4EA 4ED8A 4JV5F 5D77A 2XO6A 1U02A 3A3NB 1DFDA 5A0YB 2E66A 4GRSA 1VOMA 3CW2C 3C6TB 3PYDA 4FVCA 1WC3A 4XDDA 3TJAA 1XNQF 4X4VA 1IKYB 1TZ0A 1GXTA 3J7YI 2HQIA 1HI1A 3CIZA 3OT9A 4HHHA 3LWMA 1NB7A 1N88A 1T95A 1WWHA 5H1SV 2VBYA 4K2JA 1QY7A 5B0EA 3GPAA 5K20B 2MZSA 2UUBJ 3NEKA 1PSDA 1WI6A 1H2VZ 3EICA 2EEYA 2GFFA 2GVDA 1GTEA 2V2QA 2XMWA 3JSYA 2MKYA 3M32B 4QPTA 3SCKE 3F41A 3P3DA 2L08A 1Q78A 3CB4A 2D69A 4TYBA 2G0IA 2GO9A 3W63A 2D9PA 3NP5A 1ROFA 4UOFA 2MHEA 4ZVOB 5JXSA 2ASJA 5KG2A 3DM2A 4RR5A 1U49A 2Y8YA 1N32J 3H8YA 4M5NA 4K4YA 4N8OA 4ALZA 4DSKA 1EX8A 1HNZJ 4GO5X 2DEIA 3CD0A 4CNYA 2NREA 3DRPB 4H4KC 1F9EB 1HW8A 2Q6CA 3T6BA 3NKYA 5AE1A 3I0RA 3VAJA 2DR6A 1QSLA 2YQ3A 4ZJOA 3D1HA 1EAYC 5DGBA 2HK3A 1Y5IB 3K17A 2W2NP 2H54B 1NCLA 2HQ3A 3UPFA 2DRBA 3SZ2A 1DTTA 2FGOA 4LF7F 3KLGB 2HMIA 3BDPA 2MHNA 2Y3YA 3I9V9 4LF9F 4BLGA 4ZHRB 1F6TA 4EWTA 1HNZF 4B9SA 2EBGA 4KGVB 2O3DA 2VJUA 1RWNB 5A8WB 3G71S 4KTQA 1NPKA 4KGMA 5DGAA 4I2PA 3IA0A 3UVJB 1TL7B 4HKQA 3R7NB 2RSQA 4ECWA 3ZZYA 2PD1A 3G4SS 4DU8A 2BKNA 1FK9A 3PTWA 1VGYA 4GKJJ 2V2KA 3R97A 3IP0A 3KK2A 1F5CA 4FN5A 4URGA 3JQMA 4QW8A 1GT8A 4RUBA 1IR2A 2GMHA 1X31C 1WKKA 1IN0A 3K5NA 4JI3F 2W2PP 4CLWA 1GXUA 3ITHA 5F9NA 1IQZA 1XIQA 2LCWA 1ZTWA 3V6HA 1AFJA 3PO4A 4DWIA 5F3ZA 2RF2A 3OTDA 5GAHI 2KO1A 2EWHA 1Y3KA 5DM7Q 1T9YA 1YJ9S 4DQSA 3M7VA 4P73A 2EC0A 2B56A 4FZVA 1NSQA 4PUOA 1ZA2B 4QIEA 1NH7A 4M5KA 2IJNA 3AJ2A 2C2EA 2VDHA 3PACA 1VQMS 2AJFE 3CXCR 1I1GA 4WZMA 4Y28C 2PA3A 3O5TB 3HHKA 3I5AA 2XSJB 2FUG9 1VQ5S 1FDDA 1R89A 4O3NA 3TZZA 2ZH2A 1BWEA 1ZA1B 4JI0F 4DZDA 4FXWA 3T1AA 4ECSA 3AB2B 1Y5LB 2MY8A 3DHWC 1IR1A 3DRXA 3TUPA 5DG7A 2WVCA 3ZZZA 4PXDA 2DH9A 2QMXA 1P6TA 1BQNA 1P1LA 3I82A 2L48A 2YNHB 1RGVA 1WOOA 2W2OP 3FEXB 3VGSA 2ZHAA 1CJTB 2WCXA 4PG6A 4TN2A 2QFJA 1L3SA 4RO0A 3N6NA 3WX8A 1DQ9A 3A8IA 2IDLA 1ACMB 3UR3C 3CCJS 3DLGB 4PCQA 1PJ7A 3M2VB 3MM9A 3H2LA 1N5SA 1H0HB 3H59A 3HZEA 4MYTA 3JQJA 5SUHA 2A6OA 2C2DA 4WCEQ 4R5PB 4ECTA 1S6QA 3MURP 2VQFF 1VFJA 2R7XA 2MPUA 1MMNA 8RUCA 3EX7B 3SV3A 2YTCA 2Z0GA 3M05A 2HG4A 2LVWA 4JI7J 1GTHA 4J9SA 3JXOA 3LANA 2AZ1A 2WW4A 5HATA 2B8PA 1IJFB 1UJ6A 3E8OA 4YMEA 3OHAA 4KJIA 2OIHA 2GVDB 3HHLB 1KVKA 2FJEB 2YNGB 4ECVA 2F1FA 1GX6A 1U2RA 2JWNA 3C66A 4OZLA 2PN6A 3Q8PB 4DV3F 2Y8WA 1TL4A 1DJ0A 4LFCF 1JLGA 1G6BA 4F0HA 3T5JA 4DBQA 4B3SF 2ZBQA 4JUZA 1Q0NA 3U1MA 1SC1B 4Z7CA 2IVMA 1M1HA 1LWFA 4WP9A 4PYAA 5FIIA 1I6JA 1WC0A 4W4MA 1AZSB 4N47A 2KH9A 2V8DA 5ETLA 3I0RB 2POKA 3CJ2A 4UUWA 2AQ4A 3CEDA 1VRTB 1VCTA 1UEVA 5EWGA 4J9LA 2W8LA 3JS9A 2M3DA 5IQ6A 1RHRB 2FJVA 2HGLA 2XHWA 2CYYA 1SC6A 5DZ6A 5BR8F 1V3SA 2GVZA 4J9UE 5B09A 4TU9A 2MGZB 3JAMU 3PJXA 1J5OA 1PYTA 1UEKA 2M88A 1JLBA 3JYTB 1NDPA 1WC1A 1CJUB 2CQ0A 2EW9A 3HHDA 4KT0C 4NLXA 2V34A 3RU0A 3VGTA 3D0GE 1CVJA 1V9OA 3IAS9 3CGIA 3FRYA 4X4SA 4FVMA 3WIUA 4DR2J 1MN9A 1UEUA 4PYDA 2E1RA 1S9EB 1BQMA 1V6HA 2VJVA 1TL7A 1UPMB 1V5IB 2W4CA 3A1YG 5JMNA 4A8YA 2EK1A 1U1LA 2UUBF 1JXEA 1RTZA 2DHAA 3MEEA 2MEWA 3LTOA 4ELUA 1FKOA 4I4BA 5KFIA 3DLKB 2WHOA 5DG8A 2ZH1A 1P1TA 2AP6A 1R0AB 4KO0B 5KFCA 3QO9A 5DQHA 1SKUB 2YVSA 3HSJA 4AE5A 5LJ3Y 2UVUA 5J2MB 4K8RA 1IJEB 1EKSA 3GMGA 4USUA 3CE8A 5H9EJ 3NGTA 1N36J 3KMQA 1S97A 1BLUA 2QL7B 3KKFA 2ASLA 3DRYA 1MSWD 3TEHB 4F2RA 4H4MB 3B78A 4OHZA 3ZFVA 4JOUA 2DGQA 1X5SA 1ZM9A 3C15A 4QU6A 2I2YA 3AOBA 3KUEA 1JXVA 3S6EA 1K1QA 2FVSA 4I67A 2RHQB 1LKZA 4QYZJ 4HL9A 2GNKA 3V4IA 1IKWB 3H2VE 2VFRA 4LSNB 3KLEB 2VG6A 2P9EA 3R7BB 5BYQA 1RHMB 3CMQA 2RJZA 4YB6A 5HN0A 4DR3J 4U7CA 2DPIA 3BB5A 4OJ1A 4F3MA 4PWUA 3AD9C 3AH6A 4IR9A 3IGNA 5BR8J 2V9KA 3D4JA 3HPOA 1KDNA 3BSNA 3TQEA 3CCLS 1BQNB 2YX7A 3QSIA 2ZBCA 3MMAA 3EYZA 3K59A 1XMBA 3UFCX 4YY3F 1XJWB 2CJQA 2GZOA 3T5LA 3NRBA 2QZ8A 4NA2A 3GV8B 4JI5J 5CYQA 1FTRA 3QYYA 1TVRB 2HS4A 5B0GA 4Y0FA 2AJQA 3OL9A 4CLYA 2R8KA 2KHDA 1BUXA 2HWTA 1FD2A 3T3FA 3KG0A 1LW2A 2XM3A 2WSEC 4R5PA 1XR7A 4HTJA 3SCIE 3P96A 4K5SA 4ZPVR 4CTAA 3EZOA 4ES1A 5KFPA 5L1IA 4F4YA 3T1HF 1M5VC 1GMWA 1J5EJ 5KFAA 4A48A 4RX6A 2F63A 1QJHA 1TFYA 2HQCA 3JSBA 2HRYA 1SVDA 3M8YA 4HYKA 3UI3A 2MQLA 5BXIA 3HHLA 4X2BA 1ZOTA 2YNGA 2MSTA 2RMLA 2KT2A 3OR2B 3MCMA 3MECB 1VIOA 2HFVA 1UPPA 3ILOA 2LQ9A 3MDFA 3W7BA 1CJKB 1WKJA 2NXEA 3WC0A 4CLSA 1S76D 3S01A 4RW9A 3GFHA 2K7KA 4LFAJ 2HHSA 1HL6A 2W2QP 5CYMB 2DY1A 3BSCA 4KV8A 1UWBA 2M52A 4CH7A 4TQSA 1HLWA 1HD1A 4NASA 5KG0A 3HHLD 1MN7A 3KK3A 2N7YA 3MM6A 2PT0A 4FPIA 4DQPA 4HACA 4PAAA 2VF3A 5HO4A 4NXNF 2C2NA 1Y11A 1SB6A 1WDDA 3HSDA 5CXTA 4YOEA 2KKHA 4ICLA 4M95A 2GHPA 5C2GA 5FDLB 3DM2B 1VRTA 4LRAA 4Y3CA 3QJPA 5ETKA 1RT4B 3BQ0A 4IOCQ 1FJ7A 2GHWA 2F40A 4MK8A 1UA0A 3BO4A 4CLFA 4DV1F 5K5MA 3UNGC 1W26A 2DK2A 2BKPA 4DI6A 5B0DA 3TVYA 2RKIB 1NZAA 2VODA 1N33F 4OYOA 5JVGQ 1S0OA 3CVKA 1RHUB 2OI2A 4BCAA 3ZZOA 4LF9J 1H7XA 4PQUB 4ECZA 2CFXA 3MUMP 1RLCL 1ZH5A 1S9EA 2G2YA 3LGHA 1HWJA 2DIUA 2M4MA 5G4DA 3K58A 4WFZA 5IM0A 3M8ZA 2DR9A 3IMQJ 4IRCA 1LK5A 3T41A 3QZ8A 3T1HJ 2UUTA 3JQKA 3CCVS 3RYLA 3T19A 4KHPJ 1FHTA 4V1Ak 3BGUA 3QO9B 5KFDA 3ETMA 2NCKL 4USHA 4CDIA 1N56A 3IGVA 3UD4P 3UDCA 2FJWA 2MQOA 2BANA 5KFOA 1NAQA 1HPZB 2LQ8A 2MLYA 1W25A 1S9GB 2BJDA 4FF4A 2KT5A 2H5IB 4PXCA 4DOZA 2CADA 4ZP7A 1H2UX 4F7VA 2B4OA 4ANCA 1XMQF 4XPCA 4N7TA 2PFDA 3IWLA 4ZPTR 2C3OA 3AXMA 2RAQA 1C0TA 5JJBA 2AJ0A 1N6QB 2DYAA 1IKWA 2OLWA 3D54A 3FSIA 3GV5B 2KRRA 3R6LB 3CCES 2VA3A 3KLEA 2HRUA 2KRBA 4B3OA 4WFYA 1NBEB 5EUHA 1PYSB 4WF9Q 4ZCMA 2BR0A 4QQBA 4H4OA 3IN5A 4MTPA 2XGQA 1I5OB 1K0VA 2W9CB 1F5BA 1K73T 4C7QA 1Z1ZA 1S1WA 1OMSA 3O8WA 4KGKA 2YH1A 1UVKA 3NNAA 2LQBA 3LGNA 2PFFB 2JZ5A 4A4JA 4ATNA 5D15A 4O3OA 1VQLS 2RQMA 1UCNA 3IO1A 5ETRA 5CCMA 3I32A 1DY3A 1YRXA 2DNPA 4MJKA 3MUTP 2XY6A 3PW5A 3FQKA 2K1RA 1WC5A 1RAFB 4EYHB 2DXEA 2LQ5A 3GIKA 3UW1A 2QRRA 3VQTA 4B9MA 1T9TA 1UFKA 2OFHX 2PMHA 2HBQB 3E51A 4ILRA 4NCBA 3F44A 3HSGA 4TY8B 1A7GE 1SIZA 3M1VB 5LMUJ 2ASDA 2EC2A 3K5MA 4ZITA 2HBZB 3K7RA 4HVZA 1CBKA 3H5UA 3H40A 4PWWA 4EFAC 2RS2A 3IRWP 1RADB 2HFZA 3FMBA 2H5EA 4LMZA 2CDRB 2HLTA 3B82A 3D6HB 2D1CA 1H73A 3ENQA 3M6WA 3NGSA 1VRUB 3DU6A 4ZIWA 3W9JA 4LVNP 2FVQA 4WFNQ 1DTQA 5M2PA 4AL7A 4RW9B 1ZM2A 1GEHA 4CT8A 4TKTA 5KT7A 3MPWA 1U1QA 2XMUA 2VZ9A 1UWBB 3PHTA 2VBXA 3KK3B 3JSMB 2VD3A 1D8ZA 3MM6B 4Y2IA 2HS3A 3OW2R 3D3BJ 5BYRA 3EXCX 2VG7A 1YI2S 4OX8A 3CWJA 2ZE2B 1FJEB 5BYSA 3RW6A 5IC6B 5HQMA 4ETZA 2VASA 5IT4A 3H5XA 3QT7A 1CS4B 1WI8A 2LU2A 1KC8T 2Q6BA 2Z2MA 3LAMA 2KB2A 2HZAA 2YKOA 1S1XA 3UR0A 2PMZD 2XWXA 5AXKA 3OTOF 2CQGA 2FB0A 1IBKF 4DPUA 1NXIA 1RAAB 4FYVB 5F3TA 4E0DA 3SEOA 1RWMB 3DFEA 5ADZA 4ZJQA 3SCLE 4IG0A 5C25B 2QC3A 2IAJA 1NNDA 1LWCA 2GQCA 3UCZP 1TK0A 3SFUA 1PJ6A 3R5CA 2H65B 3EZUA 1U8SA 1XQIA 1A0OB 3R8YA 1NUEA 1IKXB 4Z7YA 4ZS6A 2VOOA 1HNXF 3MTKA 1BQMB 2HPUA 2W01A 2BM1A 1SPBP 2LXUA 4L76A 1B4SA 3M2UB 2MQ8A 1OSDA 1HPZA 3Q89A 1VQ7S 3J7AN 4YQWA 4K4SA 4CYUB 4F4KA 1EB0A 1PIEA 4WFAQ 4NXNJ 4NYOA 1CQMA 4NYPA 3OHBA 3PX4A 4LFCJ 2DGUA 1GAOA 1IM4A 4RW8A 1YKWA 4ED7A 3J7A1 2YNIB 1RTJA 2OHDA 1U1PA 2ZOMA 4QWBA 3C14B 4ES2A 1KFSA 3DKDA 3NOGA 3ETOA 3KTQA 1HNWF 4ELVA 3TVKA 2FLNA 1QE1B 4LRFA 4ZVUB 4DV2F 3PVXA 3OTEA 5KFYA 3FSXA 2CNLB 3UCGA 2J0QD 1ZAXA 4NI2A 1QLNA 1M90T 2AYBA 2OGUA 4H4OB 4ITSA 1EETB 1HBUB 1OY9A 5DLGA 1Q81T 1R31A 3U1LA 3F0NA 4LSNA 2F65A 3K8WA 3U1NA 1U1MA 2UVRA 1DLOB 3SCJE 4DSJA 1HNWJ 1WHXA 3HZGA 3W65A 3IRXB 4IG3A 1HHQA 4K4TA 4WKRA 3Q8VA 3BYPA 2XMMA 2JDJA 1YJRA 4OX9F 3TJ8A 2LDIA 1HMVA 1I3OB 1N0UA 1N5QA 1G4CA 2VC1A 2W7AA 3C16A 2RU3A 4IQXA 1NDLA 4ANDA 4DDFA 1HBNB 2DITA 2EBEA 2GW8A 4WE1A 2CQ4A 3NXZA 1DURA 4U8VA 4O0IA 2IY5B 3G96A 3MUVP 1X9WA 2VKRA 1WSVA 2MKJA 3GFYA 5GVQA 1FD8A 3I4PA 4PG8A 3HCXA 4ENOA 1HNXJ 2MZ1A 4WZQA 3MI7X 2R7OA 3ISND 2FYXA 1CC7A 4DX6A 2C22A 1XC9A 5IOLA 3SXLA 2ZM6F 2BEFA 3AHPA 2DB1A 2I0XA 3DLJA 3QNWB 4KBIA 3PEJA 3TA1A 4TLRA 4OI0A 5L39A 4NRUA 4M63A 3WIVA 3LQVA 5L46A 2I38A 2HHXA 4DR2F 3I5BA 4WP3A 2F4VJ 3RRHA 1EP4A 2G13A 1ZETA 1Y9OA 2J7UA 2D9OA 1RXOB 3J7ZT 3GIRA 3K8VA 2HW3A 3DI6A 4HTIA 3J7YU 2R2RA 1SXLA 3Q8YA 4WWSA 5E2QA 1XR5A 1K9MT 2CPFA 2W9BA 2EG2A 1UMJA 3IC1A 5IWAJ 4DLGA 5J1EA 1AYEA 3T1YF 2YQ1A 2IRXA 4DSFA 5CYMA 1APSA 1XEZA 4NLGA 2C2ZB 2YBVA 2QV6A 1TKXB 1NRKA 2BE7D 3HVAA 2JFDA 1CS4A 4UOGA 5ETSA 2XS7A 1YK9A 4P75A 3TOQA 3W9HA 2Y1JA 2K3IA 2FVCA 1X5TA 2YQ0A 5HVFA 1S1XB 2FHKA 2LLZA 3HKZD 3CJ8A 5HSPA 2BJ9A 3NAIA 1OYEA 2BW7A 1UP1A 3LP1A 1M5OC 4NOHA 4KQZA 1NSKL 5E33A 2E5JA 2X51A 3QPIA 4CO4A 1RISA 1FT8A 4ID8A 3EM1A 3PNIA 5KFRA 3TUZC 2HHHJ 4IYQA 2J6SA 2WVFA 4D3GA 4ZK7M 5KT3A 1RT1A 1WELA 2NZ4A 5HQ8A 5E0OA 2XHCA 3TYTA 5H9FK 1LWCB 1VHIA 3PO5A 4F4XA 4IOAQ 4UY8T 1NK9A 2BJ8A 2ZH6A 2QO3A 4ZLPA 1Q8LA 2X1FA 2PIIA 4PQUA 4DL4A 2A6MA 4I2QA 2LDYA 4OX7A 4DR5F 3RR8A 3KLVA 1N54B 3I6PA 1D3WA 5D78A 4ZVGA 3JB9k 1YVFA 1RE1B 3UD5A 2IMWP 3KYLA 3M8QA 3HJVA 3EGVA 2GGPB 3M2UA 5HJXA 5KFBA 2XLJA 4LR9A 2E5LF 3EE3A 3CC4S 1VMBA 4KB7A 4K5RA 4O23A 1D9FA 2MQMA 5IV4A 4YY3J 4NLQA 1XNQJ 3HVRA 4K4UA 4Q8EA 4O44A 1CEZA 4RWWA 4DX8H 1K8AT 3W61A 3TZXA 2DHXA 4KAIA 3GILA 1ZPVA 1S99A 1U0HB 5IV3A 5L1KA 1S0VA 3OR1B 3RAQA 2BVZA 2EVZA 3FEYB 4EO6A 1KTQA 4IFYB 4WJBA 2MJNA 4WYWA 3MR5A 2YKNB 4NCGB 1RTDA 1WEZA 2E1AA 2YPYA 2Z30B 3PIOQ 2ATCB 1M0SA 1CG2A 2BQ3A 4FXDA 2D7SA 2RE1A 3KHRA 1TMMA 4OZNA 2B9EA 1T9VA 2BM0A 1RBLA 1KOOA 2ZHOA 1N6QA 5KFUA 2PI5A 1N32F 2QLWA 2XCAA 4OZ0A 1HWIA 4IDKA 2PDAA 1X0FA 4KYZA 1VDHA 2Z8QA 4E98A 1S77D 4B3OB 2K2PA 2IM3A 4WK3A 3NBPB 3RB4A 2MQNA 3BF4A 4QOTA 1IQTA 3MD1A 4ZCKA 2R4FA 3V6DA 1IKVA 1KWMA 2LEAA 3FEZA 4ECXA 3CTRA 1W7WA 2BBEA 5DDRC 3CCQS 3HD1A 3EVWA 3FDSA 2F5GA 2UXDJ 3Q8SB 4PXEA 3LP0B 4N41A 2OTJS 3OLBA 1RCXB 3MMBA 4B9LA 4NXMF 4USKA 3E01A 5HANA 4ZVPB 2WOMB 2ACMA 1W2BR 5L1LA 4NWBA 2ZH9A 4B3MF 1R7IA 1F1BB 4WBFA 2F9JA 3W5XA 4DJBA 3IBFB 3QT6A 2AX0A 2V5HG 2ILZA 4QYRA 4M5JA 4OMFG 5D0EA 1H3DA 3CDAA 4YUDA 2UUWA 3IM8A 4HHJA 4N56A 4FKXA 5A6WA 3GV7B 3PEHA 3PW0A 2UZAA 3BGRA 2ACYA 2QG9B 3DRRB 1JJCB 1JLFA 3UN5A 2ALYB 2N3LA 3CCZA 2N82B 1KRPA 1SQGA 1EP4B 1KHVA 4LFBJ 4NLOA 4ER8A 1SKSA 1BY9A 1KLMA 4OYIA 2C3UA 4DUYJ 4ZPDA 2C28A 1RT7A 3OXLA 3CCMS 2DNNA 1T94A 1WSRA 2RHSB 1TTHB 4L3KA 4DV5J 3CO0P 2W9BB 1DTQB 2IRYA 2PMWA 4ILLA 4X65F 4CZCA 4M5MA 1NK6A 2BMBA 3CDWA 3PYEA 4I7FB 5I3UA 3GE9A 2OPPB 2U2FA 3BO3A 4PZVA 5IFMA 2WSCC 4KGZB 4ZN3A 3A8EA 4CLUA 3VALA 1X4HA 4DL7A 3J7Z5 5KOWA 3MWBA 1HD0A 3ZTQA 4OI6A 2WTFA 3HT3A 4ZKAA 4GVBA 1HQUA 1BD6A 5J1NA 4RNFA 2E9ZA 2CIMA 4WP8A 1D0EA 1IKYA 2FDNA 1TR0A 4DV0J 2KN4A 1A9NB 3TAMA 2DJWA 1SV5A 2KVQE 1WF0A 2OPQB 1H7WA 2IIHA 2Z2LA 4LR7A 4TLQA 1RT1B 3DRSB 2JOQA 1HW9A 3FNNA 3SQGB 1REGX 4DFJA 1HI0P 3PDNA 2HNZB 3NMRA 3B6BA 1BHNA 2W9AA 4ZLJA 2CUYA 2CPDA 2DR8A 3C6UB 2DHHA 1FXDA 3PW2A 1FX4A 1TK8A 1OWXA 2JC0A 2LKZA 3GB0A 4RPFA 4AT1B 2ZKUA 3CD7A 3KG1A 2FC8A 3C46A 3MPDA 3RW7A 1N36F 4IG0B 3GONA 3GU0A 1XWLA 4L73A 3TI0A 1V3ZA 2GGPA 3Q86A 1JLQA 5KT2A 2R7WA 2IYGA 1IBMJ 4PXBA 1LEOA 5HMZA 1N0VC 3GFZA 1YTYA 1AW0A 5T14A 1F2HA 2QL9B 4R25A 2IYIA 3BBCA 3CJTA 3GSDA 4MKBA 3VVUA 3N0VA 1C1BB 3UWTA 3VGUA 2OSQA 2DTJA 4DUYF 2M9KA 4QWCA 4AFFA 2F9DA 3DMJA 3DGPB 3VWSA 2KYZA 1Y0HA 4IRKA 3PKMA 4ID5A 2LFVA 3S1TA 3BGFA 1RTDB 2FLOA 3DOMB 5C24B 3IR7B 4OYWA 2LEBA 2QGFB 4NLUA 1TKDA 4ZHRA 3RGIA 4ED3A 3C14A 5LL6d 4MK7A 2K06A 3MFHA 2YWEA 2ZBPA 1RTHA 4FBTA 4IDKB 1S1VA 3ILIA 1FNXH 3NCRA 4X4QA 3QIPA 3PHEA 2EFQA 2VIHA 3MR3A 4JV2A 2Q79A 2HS0A 4JI5F 3I9ZA 4NI2B 4OZ2A 1BE4A 3MR6A 5D8HB 3E2EA 1S48A 2IVFB 3EUNA 2PEBA 3C3LA 4JYAF 3L7OA 3R5AA 3BO2A 5AT1B 1VQ8S 4KFBA 1DLOA 2Y1RI 3EGNA 5D4NA 4ZVFA 2XNQA 4C8NA 1LFPA 4DQQA 2VB6A 2Y0BB 1Q53A 3J80Y 4UOCA 4GC7A 4W92B 6FD1A 3KLHB 1NKBA 4ES3A 3ILLA 4J9NA 1FVQA 2RF2B 1ELOA 2C3YA 3POTB 3KLIA 4CLLA 2A18A 3PCOB 3W8GA 4E2FB 3J81Y 3C19A 1SCJB 3QJLA 1Y00A 3QMQA 2CJBA 2M0GB 5ETNA 4OI1A 3OLAA 2KT3A 2KL8A 2V4QA 1E6YA 3GIIA 1H72C 3OSNA 1AUDA 4PWDB 1VQSA 2I9SA 4MKAA 5K8NA 4A8WA 3RAXA 2XSJA 1KOHA 3DLHA 3PG9A 5HK4A 3B54A 1HNIB 2DH8A 1RWWB 2KJWA 2OKQA 3W5YA 1YHQS 1VC6A 4YDXA 2ERRA 3ELHA 1QUPA 2VPZB 4LF8J 3R5JB 1LXJA 3F73A 2WRMA 4USWA 5HMWA 4FBUA 2Q3PA 3NAHA 2P6TA 4Q0BB 4DL3A 2NR0A 4DR6F 3BSOA 3Q2TC 1P27B 4W90B 4RW6B 2YNHA 4RW4A 2N4DA 4HEA9 5BJRA 5G0RA 1XTZA 4YHHJ 5KAKA 3ZTRA 4F4AA 3PJWA 2OPPA 3OQ2A 1UWAA 3TUIC 1VC0A 3BDEA 4KPCA 4P7TA 2HKEA 1WG4A 2PE8A 2XWYA 1X4AA 3HFZB 1C4CA 4LVOP 4Q2MA 1RAIB 2ADBA 3RRGA 4GKKF 1OYDA 2P8IA 2WONB 5LMNF 1HQUB 2OEKA 2HNYA 5KT4A 3Q24A 2Y9HA 3D68A 1FRHA 3PR4A 1Y7PA 2UUCF 4B3MJ 3HFKA 1SL1A 4YHHF 1WOPA 4DMZA 4DEZA 1U1RA 2YKMA 1C1CB 3MCNA 3DDKA 3G9CA 3N79A 2BE2B 3HSZA 4UZBA 2RUSA 4C6AA 4K4WA 4GKKJ 1QAYA 2CNOB 3H98A 1PKUA 2HHHF 1X9MA 2CQ3A 4U6PA 3HM9A 3NGKA 4URSA 4CCHA 1RYRA 5EX3A 4YDDB 3TARA 1FEHA 1JLQB 1TL1A 3ONQA 3L4BC 4I56A 1XERA 3N9UC 3CJ3A 5I3PA 3KHHA 3NOCA 2XULA 2DNHA 1PAUB 1RHJB 4IH6A 3ISNC 5EWEA 2UXCJ 4R0EA 3Q0AA 1CSJA 5HMXA 4ZVSB 4U8YA 4L6V3 1T3NA 5EX0A 3KK1A 2DNGA 1X8DA 4GKJF 4OZ3A 3I96A 4DV3J 1QM9A 1RT3A 2V8VA 2MQPA 4ZPWR 4MFBA 2DR7A 2GJFA 1JLEB 1U1OA 3K5PA 1YBTA 1REVA 4OL8A 1DHMA 3Q8QB 2NYHA 2CWKA 1NKCA 2ZWPA 1KVJA 1S79A 3OR1A 3DC2A 3GYNA 1FKAF 2X1BA 3GCXP 2R8IA 1Q5YA 3M6VA 1UZDA 3OL7A 2IBKA 1FJGF 2VG5B 3WDOA 4CH1A 2KXNB 1SQFA 2VFUA 2GHVC 3JAMY 3D7SB 4J9QA 2Z2YB 1JLCA 1MG7A 1RA7A 3BN4A 1X5PA 2HVEA 3BS9A 3V2UC 5KFQA 2N7CA 1J2VA 2CQIA 4JP8A 3G6XA 4ECRA 3D6MB 3MEEB 2DY9A 5KG3A 5CA5A 4LF6J 3MOZA 2CJKA 2OH2A 3SYZA 2J6TA 4HDGA 3T9NA 4JI0J 4KO0A 2QN6B 1HYSB 3WQPA 2UXDF 3CNQP 1R8BA 2MZTA 3V6JA 1JNRB 1VQ6S 3GYXB 1NPRA 2BE9B 2RRBA 3FBEA 3MM7A 2DGXA 1VLYA 2VV5A 5U47A 5F8NA 4XAKA 5DDPC 3AOCA 2HWHA 4DCOB 4NXMJ 1S6PA 4O4GB 1CJVB 2CPHA 2CKWA 3SSQA 5JUMA 3MMCB 3VVTA 4IQMA 3MEGA 5ETVA 4J90A 1VQYA 1JB0C 1HIYA 4Q44A 3W2VB 4DQRA 1NJYA 1BC6A 4G1PA 1L3UA 2BJ7A 4B9TA 3OVBA 3FCHA 1Q4RA 3NY0A 1S7HA 5GADU 2HRTA 1KKHA 2WVDA 4Q43A 4RNOA 2J8AA 4CM2A 3KNAA 2CPIA 4EUVA 3H5YA 3OFEA 5E7OB 3HO1A 4XO0A 3NS5A 2CXEA 3QGPA 2PEHA 4BC7A 3BH6B 4DL0C 3BQ1A 4LF7J 3KHLA 1FWLA 3K5LA 1LNQA 5CABA 3MEDA 2QA4S 3D3CJ 4YB5A 3MGJA 3DRRA 2JNJA 1KQFB 2GC8A 1FFGB 4QIFA 2QX0A 4K0KJ 2FVRA 5G0RB 4IOBA 1H74A 2KFZA 4R8UB 3DLEB 1H2TZ 2DEJA 2C3MA 3PW7A 3EDQB 2HFOA 5A2QU 1QTNB 2DNMA 2AJ2A 3A8KA 4WXWA 5CH7B 1FERA 2P5VA 4ED2A 3VAKA 2HQDA 3G82B 8ATCB 2HIYA 1SL0A 4RBTA 4WK1A 1GMUA 3OTCA 3SFGA 2C1EB 2B0GA 1EHWA 4CTAB 1ZAVA 3HVTA 1RBAA 1WKLA 2FPHX 2HIQA 4LIRA 1L3VA 4OIXA 4EI2A 1PGZA 1SIWB 3TA2A 5B0CA 1RT5A 2QLFB 4ED4A 2YKMB 2RT3A 4C8YA 2E1PA 1EQMA 4GVBB 1KSPA 2BACA 1KHWA 1RT6A 5DQGA 1WTFA 1YBAA 1V3RA 4X84A 2VU5A 4PR6A 3MECA 2UUAJ 1TAUA 4HDHA 3W66A 1SV5B 3CD6S 1D9AA 4OJ3A 4DHVA 2FLPA 1T05A 4OX9J 3L09A 2GV1A 1RHQB 3SQGA 1H38A 5GMDA 2HSEB 1M1KT 3KJFB 1Z4UA 2G1HA 4KV8B 1F3FA 3Q83A 1TL1B 4FS1A 1MROB 4RU2A 5GMEA 3O44A 3ILJA 3KXDA 4HACB 2FZCB 4MAKA 1U1KA 2AWZA 4CQ1A 2VOPA 5HROB 2BYCA 2DGWA 3H4DA 1TUGB 4IKAA 3KK1B 1C4AA 5CQGA 2P2CB 4LR8A 4B02A 3BBFA 5D0GA 3RRKA 3OPKA 3QAEA 2M2BA 4P2MA 2HURA 5AE2A 1C0UA 2JHEA 2J8SA 2YWKA 2CPYA 4OHYA 4DX7A 4J37A 1SJFA 3FGVA 4YB7A 2AIRB 4EMDA 1KEKA 2B5JA 4O3PA 7FDRA 3LP2B 4QWDA 5THWA 2KFYA 2VONA 3HFVA 3DMJB 4YS2A 4PABA 4OFZA 1XMOJ 3MTJA 1T9WA 3HDSA 2FHMA 4ID5B 2R8GA 4FF1A 1NO8A 5B0FA 1EARA 2EK6A 3DOMA 4X4PA 2MKCA 5F8IA 5KG1A 2GCFA 3W8PA 4DXLA 3MM5B 5E3QA 1NHVA 1N33J 3Q23A 4OQJA 3IM9A 2V6AA 3BH7B 2AZ3A 1MWQA 3TWZA 3VGVA 1SJ1A 1S1VB 3G6VA 3AXKA 4HI1A 2YNFA 1R6YA 1Q5VA 4O0NA 3GJQB 4X66F 4ZJLA 4Y2KA 1OPZA 3SSSA 4L75A 4YP3A 4KE5A 3BKTA 1T03B 2AJ1A 4G1QA 5J2PA 4JB8B 3C6TA 2E5HA 3CO9A 1QAIA 4OZ5A 5M2UA 1LWEB 5D0RA 1LXNA 3R5DA 2N3OA 3MEGB 2R3VA 2YWWA 3R3TA 2MTLA 3EJMA 5KFVA 3HMJG 1FFSB 2ROEA 1C0TB 2DO4A 3W2VA 1PC4A 3AJDA 4NLVA 1CULB 4C3KA 2VL1A 3AA8A 3IAM9 2F4VF 3B8HA 4L72B 1SC3B 3WZ0A 3LWLA 2XYGB 2W1BA 1FF2A 1YDLA 3HKWA 3NWRA 4NRTA 3KHGA 4DLEA 2ATLA 5E3PA 4DG1B 5D3GA 4BWMA 4KSEB 1E6YB 2HFUA 1F3VA 2WVEA 4RW7A 2B3TB 3CJSA 2V50A 5I42A 2IM1A 5ITHA 1NH8A 2VHGA 1VBXA 4ED5A 2XO7A 1S1WB 5DRKA 4NL5A 3BKFA 5FLXY 3M8PA 2CQ1A 2DNRA 1PCAA 5LJ5Y 2XQCA 3AODA 1N48A 2V4JA 3EGWB 2KG1A 1IBMF 4B3RJ 2JVOA 3K89A 4G1IA 2A3JA 3I31A 4NA1A 2FJBB 3LOUA 4N77A 4RW4B 4RW6A 1JJHA 3H42A 3L3CA 4NLWA 1AA1B 3ZTPA 4MKYA 4C11A 1WF1A 2DO0A 1U2FA 1R8PA 3M6XA 4Y00A 1FJCA 3OUYB 4TXSA 4LQ3A 2XTJP 4WU2A 3D66A 1H6KX 4TY8A 3M1VA 3FRZA 3NGDA 3OJUA 3TQ1A 5L1JA 2WONA 1VIXA 4Q7AA 3S7RA 3V4MA 4DPXA 3UVJA 5FD1A 5IT9U 1VS3A 1RKIA 3CPWR 3L9ZA 3GZ7A 1HBOA 3TR5A 2XLIA 4IO9Q 2J0WA 4ZCIA 1HKAA 1LQ9A 1MWYA 2UVWA 2YX4A 2FZKB 1RACB 3T9ZA 6AT1B 1GH8A 1S72S 1U8WA 1X4FA 2ZC4A 2R2SA 3AQPA 4NZ6A 4DV1J 1C1CA 2BOPA 4IRDA 1UW4A 4C8ZA 1YJTA 2QSFA 2J6UA 2B7BB 3GJSB 1MROA 2BE2A 1B0VA 4A8XA 5F9LA 2FHOB 2MLXA 2XBPA 3MR2A 3JSMA 1ZZFA 4ZPBA 2UP1A 2D3O1 3ITHB 3FSYA 1DQAA 1FFWB 1MMDA 1YLXA 2ZOGA 2ZWOA 1URNA 2UXCF 1S5ZA 2NYIA 2VG7B 3EVOA 5A8RB 3MPYA 2AU0A 5J1PA 2BRKA 1R0BG 4TQRA 4RL1A 2HHQA 1QSSA 1MU2B 2FZGB 1RA6A 2V8GA 5K8OA 2E29A 1Q16B 3MAAA 3PFOA 2K3KA 4AYBD 2JEJA 2XEXA 4EZ9A 4FS2A 3AD7C 3KG4A 1SJRA 2HAFA 2AEMA 3I87A 3MOJB 2NPFA 1X4GA 1F9FA 1PYOB 5J2NB 3KJVB 1RT3B 3D0IE 4NLYA 1ZM3A 2J7WA 2LEPA 3PRBA 4ILMA 2L3MA 1WC4A 3MEKA 1TK5A 3D6TB 3M2RA 3MCSA 2D3ZA 2H48B 1REVB 2V2VA 2IAJB 1VLOA 5IZHA 3ZXWA 2CPJA 2YY3A 3MM5A 4OZ1A 4DV5F 1IBLF 2HFSA 2O67A 3DOKB 1OIAA 4NE9C 3EVMA 1IKXA 4CO3A 2QA1A 4I2PB 5B08A 2VG5A 3LF0A 2XC9A 4LF6F 1QD1A 2Y0SD 2EKYA 4IO1A 4UZCA 3ULHA 1AB8A 2L9WA 2NXUA 3GJRB 3FCVA 3JTPA 3OTBA 2X3DA 1NKEA 2DKOB 1I94J 2ZBRA 1NSAA 3R5GA 2JH3A 1HWKA 1NK7A 1T8EA 2HHVA 2F8HA 3KK2B 2KVIA 1WJ9A 1HYSA 4B9VA 2RD5C 3EGZA 1LWEA 4RW8B 4F0MA 1UVMA 4F02A 3THPA 1RTJB 4JBCA 5ETOA 4DL6A 2BDPA 2YX1A 4OV6A 1HHSA 4DSLA 4YEAA 2FJDB 2DCUB 4O3QA 3D9BA 1S4FA 4F26A 4V19J 3QFWA 3R9LA 4V19X 1JXLA 2FGCA 5A2QY 1T11A 3QZ7A 1P9QC 1S6OA 3PYFA 4IUFA 1T02A 4DG1A 5D3GB 4D3HA 2IM2A 2DXFA 4NMXA 2R42A 3M8SA 1KVIA 4X4UA 2MZRA 2PC6A 5AXLA 1RU1A 4DX5A 2XLKA 5FJ4A 1JLAB 2R9LA 4X65J 1RAHB 2ZH4A 3ZZRA 4XIUA 3SQOP 4KY3A 4RU9A 1AZSA 2BJEA 2XMVA 3EXYA 2OPRA 5E3CA 4AQYJ 2HVHA 4LT6A 1RDRA 4IR1A 3BSAA 4HR2A 1RWUA 4QR1A 2H51B 3M9NB 1S12A 3R7SB 4YB1P 5C7PA 3UCUP 1WEXA 4C11B 5LSRA 3DLEA 4LRDA 2E9TA 2MGZA 2V9WA 2DBBA 3ZO7A 4HLBA 2XYHB 3FMWA 3UDEA 2JLEA 3QT5A 1JLBB 3JYTA 3IS9A 1C2PA 2HQFA 5D6GA 3D2WA 4C8OA 2DRAA 1U25A 1QDUB 5J2QA 4BS2A 2RVJA 5FLXU 1UAWA 5RUBA 3R1HA 1CPZA 1X0PA 3VAHA 1ZZNA 3O2IA 2AV5A 2GMLA 3NGRA 3OFHA 1DARA 2ZH7A 1JKHA 2UVVA 3MR7A 4HH1A 4C48A 2ZH8A 5KFKA 4LSZB 3QATA 4Z2XA 4XDCA 3WHIA 1R0AA 4AUKA 1MLAA 1YG0A 5I4MA 2HYIB 3P45B 4G6VB 5CCLA 1KNZA 3P49B 1IXKA 1VC5A 4WFXA 4NLPA 2AJ4A 2UUAF 2X3GA 2XNRA 3ZC4A 2XY5A 1QAXA 4I6AA 5A8RA 5J1EB 1VJQA 1JLGB 4P74A 2J5AA 5D4LA 2DNZA 3C15B 1SQEA 3VHQA 4J9PA 1VYAA 4I64A 4DPTA 4JI4J 1HQ2A 1SH0A 1LWFB 4EU0A 3DYAA 2KI2A 2VH7A 5HROA 3UN2A 4A8OA 4JV0A 2V4RA 3MHYA 2GS8A 2R7SA 1B70B 3U7JA 1XK8A 1WD6A 2NLWA 5A8KA 3KJVA 4TU7A 4MIBA 4YR2A 4ZDNA 1MW7A 3CF5Q 4USVA 1E6VA 3F56A 3FBFA 3UD3P 2GA7A 3ET6A 2VKZG 1KS2A 2GVZB 4JI2F 3P5BP 4NEZA 3NG8A 1K47A 2ZOFA 4ZP8A 1TQLA 4ZPCA 4I68A 2GMJA 4ZA1A 1KTVA 2BW2A 2FJXA 2P9GA 4WXOA 3TX0A 1CJUA 4X4TA 2OEJA 3AOAA 2CJYB 3MMAB 2IC3B 1KBRA 1UW9A 2PSZA 1TKZB 2Q1LA 3CJQA 2CQBA 1Z2LA 3O3LA 3TNVA 1YJWS 4LF4J 1FRXA 5CYQB 2LP4A 3CMAS 2CG4A 4RLEA 1ICEB 4U67Q 3A3OB 4U7UK 3CC7S 1L3KA 1RSCA 2XS2A 2DGSA 1N34F 4GVLA 2WW8A 4DSEA 4O44B 1TL5A 3AQOA 4MMOA 5IT0A 3NMAA 1TMJA 2FC9A 3PRVA 4UQGA 5J2MA 4UY85 4CP5A 2U1AA 1UVLA 1VQOS 2OD4A 5DM6Q 1FRIA 1P8GA 2HZCA 2ZVSA 4A8KA 2BX6A 2KXFA 3NS6A 4K2XA 1RAEB 2ZHBA 2XZTB 4OLOA 3OR2A 4C8KA 3CT9A 4F50A 2IA6A 2J7KA 5E3RA 1FXLA 3BREA 1FWPA 1CJKA 2OMLA 3KJQB 2HNDA 2OPSB 1K44A 4CT9A 4A8SA 3FBCA 2YKAA 2WB1D 4NYZA 2LQJA 2QTWA 3V5RA 1SJQA 1SKRA 4ZVEA 2BQUA 4QU7A 3I56S 1IKVB 3OFGA 2H9ZA 2V8PA 4AL6A 2ASYA 5FDLA 1XBWA 3CSKA 1TUWA 4LREA 1UVJA 3P4UB 1RT4A 1NDCA 2EI5A 3ZZPA 3LGMA 4B9UA 3HJFA 4B3RF 4F3OA 3BPDA 2G2OA 1N5YA 2QMUB 2V0NA 2LA6A 3IR5B 3NS7B 2FD2A 3E01B 5DLFA 1IWAA 3G6ES 1RABB 3W9IA 4F67A 2RKIA 1T7PA 2V4JB 5LXRA 1TVRA 3R1LA 1SL2A 1NZ8A 1X4CA 5HMYA 3T1YJ 1OSCA 2B43A 4QPXA 1L3TA 3W3SA 5KOXA 1S10A 2EFNA 7FD1A 3SV4A 1HR0J 3LPYA 2C42A 1LW2B 2APOA 2COLA 2NXCA 2BV3A 3JTOA 3L7PA 3VZIA 4EYIB 4J7CA 5D0HA 4ECQA 2DGTA 1U4BA 2E5GA 1ZYQA 5IWAF 5IM0B 2X1GA 5K8PA 3OUYA 3QBCA 3CC2S 2JEFA 4J9KA 2M8DB 1HNVB 4DR6J 4C9DA 1T0TV 1VQ4S 2K7JA 1S9FA 4QJVA 2B6AA 3FZBA 4WU3A 4DFMA 1NHUA 2E7WA 4QWAA 2KZMA 1R8CA 1MNEA 5ETTA 1PAEX 5GAEU 1HBOB 2PI4A 5C42A 2BANB 4RJVA 4C0BA 4KIAA 2CRLA 1S9GA 2CG8A 2MY7A 3CJ0A 4LF5J 1YJNS 4LF1A 1S1UA 4EEYA 1UVIA 3VCDA 4I7FA 1YJVA 4X66J 1JIHA 3T5KA 1TKTA 1HBMA 2MZQA 3Q2SC 4L74A 3BJYA 4JI1F 1YGYA 2A0FB 1HQEA 3MPUB 5F0WA 2IVYA 2FY8A 3X3UA 3DYAB 3T5HA 4A47A 1UVNA 1F0XA 4CLPA 4DZ6A 1RWOB 4TVAB 1J5EF 1FDNA 2GIQA 2HFNA 3GG0A 3LO3A 2AGOA 4GO7X 1MU2A 1AXQA 4QR2A 1E6VB 2H4WB 2PA8D 2YWGA 1PJ5A 2QYCA 4OYPA 2XMAA 2NPIA 3DU5A 1SUQA 3M8RA 2W7PA 4DS5A 3DRSA 2KDOA 1QSYA 1ITPA 3IR6B 2B9WA 2EFOA 3W60A 5E5NA 3ZZTA 1R8HA 4JI3J 2HNZA 4IH7A 3QRRA 4F04B 2MKSA 4EO8A 3EDRB 4H4KA 3TZYA 1Q95G 3CMES 1N5TA 4LIWA 2B4UA 3RAMA 1JWWA 2OUGA 2HGNA 5L9NA 3Q8UA 3C8YA 4I1TA 3B4MA 5DO2A 4C98A 5IXUA 3W2WB 4JI8J 1RI7A 5K14A 3R6GB 4P7VA 2K1RB 1GXLA 3A3PB 3LUYA 2A10A 3DOKA 4PEOA 2BKOA 4CIOA 1NK0A 4P6QA 2YKPA 1KP6A 3IWNC 1C1BA 1PBAA 2M5YA 3MM8B 5KG5A 3HHEA 3M6UA 4F4WA 2R2UA 1YJ7A 3RZAA 4NCAA 4LUBA 3UE2A 3DGPA 5DQIA 2IMOA 3N5FA 3OBIA 2OFGX 4JI8F 4TY9A 2IPOB 5EGYA 1O5JA 1IR0A 2DHGA 2ADCA 1VHFA 5C24A 1UETA 3R5BA 5HI7A 1FRLA 4QIWD 4ZP9A 5HVHA 4USMA 2OAUA 4BBYA 2J0XA 2HNDB 2OPSA 1K1SA 2LA4A 2RS8A 3H7HB 5DS7A 2HZVA 1RTHB 3DLLQ 3GG1A 2C2KB 4O4RA 4WIQA 4ZIVA 3PXGa 3M32A 4FF2A 3OD2A 4Y34A 3CIMA 2ZNZA 4UUXA 1YIJS 2CQ2A 4XPEA 2R7RA 3VAFA 2AGQA 2QJ3A 1WG1A 2CQCA 3PIPQ 2KM8C 2ZE2A 4NZ0A 5GADI 2BRLA 3AT1B 3EMTA 4CLKA 3VAMA 4K4VA 1VK8A 4G65A 2W9CA 5DJBA 3CD5A 4AQYF 2DXDA 2J9CA 1N8RT 4KHRA 5GAGU 5F0UA 2ZVIA 5CHCB 2QLBB 3AJ1A 4LBPA 4F25A 4P72A 4WFBQ 3DRPA 3LW5C 5AJ3J 2XG8A 3KLHA 1MWZA 2E5IA 3BGLA 4FYDA 4IFVB 3KMSA 2ZJRQ 2UV8G 1DZ5A 1WUUA 3POTA 4XK8C 2NUUG 2C2OB 3U02A 2UV8A 3D67A 4DUZJ 3TVZA 3G8SA 2NSCA 1EJ7L 1RK8A 1PC5A 3GLJA 3KLGA 2HMIB 3QQCD 4Q5VA 4BHQA 4PWDA 3CDEA 3AAWB 5A6PA 3IS9B 4J9VA 4CLTA 4DL5A 1X4DA 1HA1A 1HI8A 1SC4B 5J2QB 3BM7A 1EIYB 4OJGA 4Y65A 1GNKA 3RBZA 4ZLLA 3KLFA 2ZNYA 2W8KA 1M5SA 2B6AB 5CD4H 1UJ4A 5C42B 3FZ2A 5IQQA 3TP2A 1YRUA 3PR5B 1JKHB 1PILA 2X1AA 5KG6A 1TFWA 1VI7A 1VRUA 1R6VA 2AW0A 2F8EX 4CYUA 2E1CA 1VQ9S 2F3JA 4DV0F 3G87A 3LA0A 5CYJA 2F4FA 4ECYA 1CQNA 3QFHA 5F8JA 2AYGA 4I6YA 2XZWA 3J81U 1JJ4A 2YNIA 5HL7Q 2DNOA 1HQEB 3PJ9A 5LXYA 1FKPA 2HWIA 1U6ZA 1VRQC 4ZVHA 2RUGA 2RQCA 1RKJA 3KDNA 1G7CB 4QBUA 2VDIA 5HVGA 5GAHU 2KM8B 3HULA 2W2MP 2GO8A 4U7UD 2IA0A 5L9XA 1F2GA 4ERDA 4DV2J 1XNRJ 1UJ5A 4AD6A 1R3NA 5F8MA 1Q1KA 1IVZA 2EXUA 4M5IA 2JX2A 2XGPA 4KHMA 5A8KB 2ZH3A 3HK2A 1FDAA 4ZCLA 2JEGA 1B3TA 3P8BB 4IG3B 3BZQA 4TNOA 3SMZA 1QVGR 4CO1A 2CJ9A 2CPXA 4ETXA 2H1YA 4M5LA 3WBZA 1BXNA 4URQU 3I5CA 3ZZ0A 4B08A 3GP9A 4U96A 4X62F 2UUCJ 4X4OA 2JLGA 4ZMMA 2KHCA 1NDKA 5KFTA 3KUHA 4PQAA 1S1TB 4OX6A 4RBVA 1FE4A 1TKZA 2QA4G 1RJJA 3G86A 2VA2A 2GIFA 2I5JB 3J80U 1WTBA 1Z2ZA 3PYGA 4NMLA 3SIPB 1VBYA 1FRJA 1RTIA 2ZZTA 3K5OA 4OYMA 1JK9B 1RP5A 2OSRA 3M2VA 3MM9B 3RUBL 4L3NA 3T6JA 4JI6J 2AHOB 2MDAA 3SDEA 1KFDA 2M70A 2E44A 2RRAA 3NCPA 4OHVA 2DIVA 3N01A 2MXYA 1R0CB 2VICA 2BJ1A 3E3XA 3R27A 3W1YC 1NHKL 1VISA 2QIFA 3NLCA 3P5TL 3TZWA 3LPEA 5GAGI 3ENVA 3M4XA 4B3SJ 3QLHB 1QE1A 4K4ZA 1FWKA 2MJUA 3KNGA 2WAQD 3LH2S 4KH1B 3DI6B 1T9UA 2L9NA 4ED0A 4UQTA 4Y2AA 4LBIA 2B7CB 5M2RA 5CD4A 1EETA 4WTOB 2P6SA 4X64J 3FFIB 2LECA 3B4DA 1FJGJ 3IRXA 1FNMA 1WHWA 2VPYB 1W2IA 1RWXB 2XMJA 2V8HA 1X5OA 5T7LA 2IDEA 4MK9A 2NXJA 4AXIA 2B8QA 1GFWB 2Z56B 3A12A 2J9DA 1HWLA 3D1QA 1DQ8A 3PM9A 2XY7A 4IFVA 1UL3A 4PKDB 3PV8A 4LF8F 1TU0B 2WB4A 1FDBA 1S49A 1P9YA 1RUSA 1YZ7A 3C16B 5KT5A 1PBUA 1HBNA 1YJUA 2JFKA 3MMCA 1B99A 3TAQA 1WHYA 2HVDA 4DPOA 1N5YB 2LXIA 4USIA 5T41A 1HR0F 5K8MA 3KOAA 2CVIA 4NLTA 2CNNB 4N76A 1B7FA 3IG1A 1BGXT 2JSXA 2LU1A 1NSPA 5AE3A 3VAIA 2KFNA 3BQ2A 3H20A 3FKBA 5AXMA 3K2YA 1ZAWA 3KLFB 1BMQB 3H2UB 3MF5A 4JI6F 3TX8A 1S7IA 3GWCA 4CWBA 1U6FA 5E41A 3U27A 3AFGA 4JI2J 1RWPB 2QEXS 1HFEL 6FDRA 1IM6A 3RBEA 3M8QB 2V68A 1U48A 3ZZUA 5KFMA 1YX2A 5HAOA 5LOQA 4DCJB 2MKKA 4M94A 5F8GA 3DLKA 1F5AA 2VFVA 2FVPA 1X60A 3OXFA 2V69A 4J91A 4BWJA 1HWUA 3VF0B 4C4WA 2FHJD 1Y5NB 3MMJA 4ZVQB 5B0BA 3D0HE 2UU9F 4A8QA 1O6XA 1FKPB 1S4EA 1GMVA 3G82A 2CQHA 3TO8A 3I0SA 4MT1A 3BEGB 3ENWA 4LF5F 4DR3F 3NWGA 3CJKA 1S1UB 1ZBTA 2XI3A 3AB4B 1HARA 1TKTB 1HBMB 3HXMA 5L8RC 1AROP 1VR6A 3D28A 2I8EA 2XYPB 2VFSA 4FKYA 3CUNA 3DLBA 1Q79A 1ZTTA 1IUJA 4A46A 1RT2A 2L9DA 1IBLJ 3LP1B 3CDUA 4Y2MA 3THTA 1FXRA 4OJHA 3PW4A 4CO0A 2DGOA 3FVYA 3ADAC 1J27A 2J9DE 4C3LA 4KPYA 4KHPF 3L7UA 1QTMA 3FUYA 4F8RA 2V63A 1UA1A 1G2EA 1T05B 1JNZB 2FJAB 2HQGA 2RILA 1NMEB 3MZIA 3NCQA 4B3TF 2CWXA 3TW0A 4DL2A 3RBDA 1ZS6A 1KD1T 1S1TA 5C2CA 1D8YA 5HP1B 1JJ2R 3MAHA 2R7VA 3D6FB 3IBCB 3SI8A 3BN7A 4KRWA 5L38A 1EQ0A 3CJRA 3HHNB 1FRKA 2W24A 3RR7A 1RTIB 1WG5A 1WHVA 3W2WA 4CO5A 1IWGA 4NLSA 3UN3A 3V6KA 5E3AA 1LFWA 3SDEB 4P52A 4ZOSA 2GAGC 9RUBA 2HK2A 2G4BA 3UDVA 3QRQA 4IH5A 1YBUA 8AT1B 4RBUA 3AY0A 2WBRA 4DV6F 1SKWA 1KQSR 2XMKA 4KC5A 4PG5A 4E8UA 2J0SD 3LP2A 3MD3A 1U0HA 4LFAF 1Y3JA 2B4PA 3RJMB 5KFZA 2EKNA 2LXFA 1YRTA 4P2SA 4C97A 1QAJA 2HHWA 4MIWA 3QLHA 4K59A 3GR1A 4JV1A 4IFYA 1F9HA 4CH0S 1OQ3A 2EFGA 2MLZA 1KLMB 4ZPAA 4CLZA 3EPIA 1NJWA 1LV5A 2CVEA 2VPWB 1UFLA 2H3EB 1RT7B 1RBOB 1U7LA 3D5MA 2D41A 2B9YA 2G0CA 3EWGA 2FQQB 1U45A 2V2ZA 4OYXA 1TELA 3FJ2A 4FP9A 4LRBA 1RZMA 4DSIA 2BQRA 2HGMA 3FFIA 2OEMA 2GX8A 3H0PA 3BKUA 4FF3A 2R2TA 1XR6A 1YWXA 2KYXA 2VBZA 1RCOB 2WZ1A 3VQSA 4RUHA 2R8JA 4KGXB 3V6DB 3CCWA 2HHPA 2GQQA 4KR0B 4EK2A 3J81j 4ICLB 2C3PA 4QR0A 3RB3A 2ZDPA 1T03A 3NL0A 4G1QB 5J2PB 3BV8A 3RB0A 5LT5A 3MAQA 3US5A 2HEKA 4USJC 4FNHA 4RNMA 1T3OA 3GTYX 1S0MA 1WF2A 3MXHP 2OPQA 1N34J 4P9SA 5AJ3F 1VK3A 5HBMA 4LSLA 1UZHA 4NA3A 5KG7A 4MIAA 4UW2A 1B7YB 1CULA 5KFXA 4OI2A 3Q8RB 1BWVA 2R7UA 2RB7A 3BGOP 1O51A 1X9SA 2VQFJ 4M5HA 2MQQA 3TANA 3DXBA 2CPEA 3ZNJ1 1SJ4P 1TP7A 5I3QA 2RQKA 4CRJA 1VJWA 1X7VA 4FXVA 3AA9A 1NJXA 4JI1J 5I42B 2RRNA 4F0KA 5LSLA 5KT6A 3BGRB 1OO0B 4DV6J 1L5UA 4DU7A 3QJJA 1OQ6A 3H4BA 4QCLA 3TA0A 2F8MA 2ZD1B 4ED6A 3WX4A 3G6YA 1UTAA 3TAPA 2CZ4A 4OI3A 3NGUA 3M8PB 4USTA 4WTYA 1OPIA 4YR3A 1JQGA 2AYMA 1TV6B 3OV7A 2HBYB 1FA0A 2GJIA 3FQLA 3PRDA 2RH3A 2K8GA 1S0NA 2Z2ZA 4QIGA 4CI0B 2ZM6J 2CA9A 2WBMA 5DG9A 1NK8A 3OL6A 4RNNA 2OJ3A 4FPRA 3KFWX 4X4RA 1U1NA 1UKUA 4W98A 1O8BA 2ROPA 3VZHA 1OJ4A 4UT4A 2RIJA 4QW9A 1M5KC 4K7QA 3BR9A 3PX6A 5KFLA 4PPDA 3FCWA 2ALZA 2RQ4A 3TUJC 2ZDOA 4BC9A 1RAJA 2JL9A 2NSBA 4WIIA 4J9RA 1RYSA 4DQIA 3RG6A 1FEEA 1T9XA 4C3MA 2H4YB 1D1UA 5MAOA 2Y1IA 3QIPB 2CJXB 3QGGA 1VQPS 5CZVA 2CDQA 2I1RA 9ATCB 1NK5A 4MH8A 4FNIA 3TAMB 4OHXA 5ETMA 4NEYA 1QUVA 3DN9A 1D9DA 1FO1A 2DISA 4M8LA 4C0OC 2ZFHA 4OYAA 4F4ZA 3QRPA 4DF4A 2WVBA 2DVIA 4H54A 3K57A 4KFBB 1N52B 2W4PA 1X4BA 1NM2A 2ZUAA 4CO2A 5DZ7A 1WC6A 3MCOA 3C6UA 4CNZA 5KTQA 4O3SA 4AL5A 4TYAA 2HHTA 4JYAJ 2AEFA 1GX5A 2XSFA 3KJNB 3W64A 2PO4A 3ZTSA 3OL8A 3M9OB 4DR1J 1G3OA 2HBRB 2VUGA 2CZVC 1OY6A 3M8WA 1B64A 5D4PA 3KLIB 3DHXA 2GIRA 1M5PC 5HQLA 3VV2B 2NS1B 2AEJA 2BOAA 2EFVA 4C8MA 4EBCA 3MAAB 4G3IA 4DR4F 1U47A 2GJ2A 3JSRA 2AX1A 2Z58B 2I5JA 4PG7A 4Y6IA 4DR4J 2CQPA 2VFTA 2G0JA 2I6WA 3UDLA 4RNHA 3JTNA 5GMKa 3QT8A 2SXLA 5J2NA 4DV4F 2MSSA 2DH7A 1Q7LB 2DNLA 3KWMA 2C2RA 2Y1LB 2D3OR 4LF2A 2JVRA 2QLXA 1WDTA 2JJ4D 2QLJB 2QYGA 4M1KA 2E1MC 4ECUA 4DF8A 4EZ6A 1FTCA 3M2RB 3K0JA 1H98A 1NEEA 1RWKB 1FX2A 2A2DA 1YSJA 5B0AA 3OFFA 3QAUA 4Q0BA 5IC4B 4RWXA 3CULA 1FRMA 3IFEA 4FYXB 5K9FA 2CQDA 3ZTOA 1ULRA 2KU7A 2A2CA 2O1PA 2WSFC 3HI9A 3KDOA 3CDBA 2PGCA 2UXBJ 1WEYA 3LALA 4TU8A 1DAXA 1D09B 3D1OA 2WK4A 4X64F 3O1LA 1AFIA 2RNEA 3EPGA 1TUVA 4N8NA 3PKYA 2VBWA 2F7VA 2Q66A 3ICLA 4Q2LA 2R8HA 3SSRA 2EFPA 2A1BA 4OZJA 4J9OA 2HNYB 4LJMA 3GCWP 4DUTA 4ZN1A 5HLFB 2NQPA 3I55S 3HT0A 1RQ0A 5T7LB 4DPYA 4PPZA 1U24A 5HBMB 4X4NA 4OYBA 4P2XA 1S57A 1Q8KA 3A13A 4DR1F 1VQKS 3HX9A 5AXNA 3GSIA 5KFJA 2N4CA 1CLFA 2KXHA 1RWVB 2AF6A 2ROGA 3BYRA 3UO0A 4C2MA 5DETA 5KFHA 1FE0A 3FK4A 4QZVB 3DOLA 4Q45A 2BA9A 3GIJA 3GQCA 2DCLA 1CC8A 4LFBF 3IG1B 5C25A 2CNKB 3HHLC 3QSYB 1MMLA 3CCRS 1HNIA 2Q43A 2W7OA 2E7XA 1JLAA 5B7WA 1Q7YT 1RAGB 4DV4J 2D74B 1RB0A 4OI4A 1DBDA 1QVFR 1WOSA 2OPRB 1I51B 2IRUA 2ZITA 1TV6A 2W25A 3I4HX 4WYLA 2L41A 1SJ3P 1FI4A 1Q8IA 2DHSA 2YH0A 3HF5A 4MYUA 4Q8FA 4AXJA 4M5DB 5F41A 3OVSA 1EZZB 1AT1B 1OS5A 1DTTB 1JX4A 3P6YC 1NJIT 3GFXA 2CZ9A 2BZ2A 2ZBIA 3L95X 3DNCA 3DXSX 2UXBF 4YN3B 2B4VA 2LYVA 3H5SA 2D3UA 4HHUA 1BQXA 3AD8C 3QIDA 4DV7F 4Z37A 5A8WA 1IBCB 2IJRA 1RAOA 3I0SB 2RDDA 5LM7E 3QGIA 2LMIA 2M7SA 2ZZMA 4HT7A 3CJKB 4U9RA 2CJAA 2YXLA 4QWEA 3O6QA 1LWXA 4DCPB 1U0SA 1VQNS 1N4LA 1JMTA 1O0PA 1ZPWX 2ZH5A 2H5JB 2BUNA 1GMWD 1FK9B 2VQEJ 2Z4PA 5EHHA 2E9RX 1HBUA 4NZ7A 3S8SA 2OD6A 2V94A 1RT2B 4DN0A 5EDWA 1LK7A 2ZKTA 3HLUA 1KQKA 5KFGA 4P2FA 2FLLA 4KH0B 1RHKB 1B0TA 4B3TJ 4K50A 2AMCB 4EBEA 2DNQA 1PO6A 4ZVRB 1SH3A 2DNYA 3TEGA 2QA2A 3CCTA 4NLDA 5KFFA 4RZRA 2BXJA 4Y2CA 1HMVB 3R2CJ 4EGLA 2DNKA 1S6PB 2MZJA 4PG4A 3BR8A 3M30A 2VQEF 3CCUS 2YPZA 4WE1B 2QSWA 2O01C 2YKQA 4PUOB 4P10A 5HP1A 2CAJA 4LRCA 2DPJA 3IWXA 1OY8A 1LW0B 4KKOB 2IJFA 3N4WA 4FYWB 2XS5A 4PRFA 2G1DA 2HVZA 5HJYA 5EN1A 1Q82T 3GR0A 3PX0A 2HLUA 1TL3A 3RBXA 3UNYA 4WKYA 3GJTB 4ANEA 5KFEA 1XN9A 4ED1A 1NU4A 3OSPA 2ZZNA 4MFBB 4WPAA 1XMQJ 3ET6B 4GC6A 3DCAA 1JLEA 3DDNA 4CM0A 4JI4F 2IFXA 1KR4A 2B9XA 3CJ4A 2C2MB 1DRZA 1TAQA 3MEDB 2BABA 1VBKA 2BJ3A 2MKIA 4DFKA 3N6LA 3OTOJ 2IC3A 5ETQA 5H9FJ 4F36A 5LMUF 1F60B 4J5OA 2QT7A 2P9CA 2Z57B 3HD2A 2V67A 4QIVA 4R8UA 5EWFA 2RDJA 2QE5A 4YR0A 3MFIA 1U2CA 1JLCB 4K4XA 3RB6A 2IM0A 4NX9A 2DRDA 3EZ5A 1AUSL 1B0PA 2VPXB 3A4TA 4LQ9A 4HT5A 5MLCV 3NNCA 2JLFA 3OJSA 2ZJPQ 1S6QB 1FNOA 5F8HA 1FESA 2M8HA 3QGHA 2O5DA 3V81B 2AGPA 2HVIA 1TKXA 5HLFA 1V5VA 2E7VA 4M5GA 2JRSA 2FTRA 2ZUGA 1U09A 1ZM4A 5GAEI 4QYZK 3N28A 3MM7B 2DT9A 2JC1A 4DFPA 2CPZA 2IBOA 3IXQA 2IHR1 3HVWA 4R0JA 5H9EK 4A8FA 2HAIA 2OELA 5DDQC 5A0YA 4O4GA 1CJVA 2NZCA 3QWPA 2ILYA 3H90A 4JI7F 3OXGA 1KQGB 1R43A 3DOLB 2YWHA 3OVAA 3TRGA 4DR7J 2KTQA 1RU2A 2MMYA 1LOUA 4LSLB 4J9MA 2E5LJ 3G8QA 3PY8A 3WC2A 3DGVA 2QL5B 1WORA 1IBKJ 1U6BA 4HH0A 2GAHC 2O66A 4ZVTB 2AKWB 1WNEA 3R2DJ 4LBHA 3RTVA 2QFIA 4I2QB 1UFWA 2B51A 1EKRA 4K0KF 2HHUA 3LAKA 5KFSA 3NNHA 2G2ZA 4RKUC 1GK8A 4B9NA 2NUHA 3ENAA 2ZEJA 4DR7F 4DUZF 2FHJA 1S59A 2FIUA 2JEIA 4M5DA 2ZJQQ 4YFUA 1C0UB 3Q22A 2ZD1A 1G1XA 2RU9A 1KN6A 2J9EA 5ETPA 1M5HA 1Y4ZB 2MB0B 1J5OB 2NXNA 4OYZA 5CAAA 4OLPA 4N5SA 1U26A 1FCAA
chains in the Genus database with same CATH topology
5LSOA 2KJVA 3UQSA 1FVSA 3HP6A 2DR5A 3N5BA 3VTIA 4C8LA 1I94F 3IBWA 2YKNA 4NCGA 4DN9A 3HVTB 4GMKA 2VC0A 1HNVA 2R7TA 1SI9A 1XMOF 2J76E 1A6LA 4EBDA 1FKOB 1RT5B 5KFNA 2R7QA 3VAGA 3PZPA 1RT6B 4ZP6A 4ELTA 5F8LA 5JVHQ 3H25A 3THVA 3NBPA 3X1LB 2G9OA 4OV1A 1GQEA 1R8AA 2OP5A 3GIMA 2OO4A 4I6WA 4H4MA 3CCSS 2DD8S 3M30B 5KFWA 1YQHA 3M9MB 4LF4F 1SBRA 3LP0A 3N6MA 3MMBB 2DGVA 2GQ2A 3ISZA 3V4IB 1NK4A 4NLRA 1LW0A 4KKOA 4F3QA 2AYEA 3CJ5A 4B17A 2WOMA 1Q8BA 2VG6B 4RUAA 2XB2D 4I69A 2MYFA 1TL3B 3VR1A 1S6UA 3QWUA 4HI2A 4NPOA 1SUQB 1VBZA 5IT9Y 4RW7B 2QMWA 2B5JB 2YWFA 1N5VA 4DS4A 2XI2A 5C5JA 1SH2A 1URRA 2AD9A 1JLFB 2RDIA 5CZXA 5IS2A 4A8MP 1WACA 2KG0A 2EPIA 2OMOA 2FY1A 4OHWA 1NJZA 4I0WA 2EG1A 5KG4A 2XCPA 1XNRF 2W4DA 1K0TA 2MKHA 4C0HA 5K14B 5DDOC 4O3RA 2ZC3A 2ABYA 1KLNA 2OTLS 5SZTA 3C2PA 3G8TA 4BDPA 1Q86T 1HHTP 1YITS 3V81A 3MM8A 1KONA 5I3UB 2YNFB 1R27B 3DLGA 2XMTA 3MPVA 3PFEA 2KZZA 5D4OA 4JV5F 1X4EA 5D77A 1DFDA 5A0YB 2E66A 1XNQF 1VOMA 3C6TB 4FVCA 4XDDA 4X4VA 1IKYB 1TZ0A 1GXTA 3J7YI 2HQIA 1HI1A 3CIZA 3LWMA 1N88A 1T95A 1WWHA 5H1SV 2VBYA 1QY7A 5B0EA 2MZSA 1PSDA 1WI6A 1H2VZ 3M32B 4OHVA 2GFFA 3SCKE 1GTEA 3JSYA 2XMWA 4QPTA 2BOPA 3F41A 3P3DA 2L08A 1Q78A 3CB4A 4TYBA 2GO9A 2D9PA 3NP5A 1ROFA 2ASJA 2MHEA 5JXSA 5KG2A 3DM2A 1U49A 3H8YA 4K4YA 4N8OA 4ALZA 4DSKA 4GO5X 4CNYA 3CD0A 2NREA 3DRPB 4H4KC 3T6BA 1HW8A 2Q6CA 5AE1A 3NKYA 3VAJA 3I0RA 1QSLA 2YQ3A 3D1HA 5DGBA 1Y5IB 2HQ3A 2DRBA 3UPFA 3SZ2A 1DTTA 2FGOA 4LF7F 3KLGB 2HMIA 3BDPA 2MHNA 3I9V9 4LF9F 4B9SA 4ZHRB 4EWTA 1HNZF 2EBGA 2O3DA 5A8WB 3G71S 4KTQA 4KGMA 5DGAA 4I2PA 3IA0A 4HKQA 2RSQA 4ECWA 3ZZYA 2PD1A 3G4SS 1FK9A 1VGYA 2V2KA 3KK2A 1F5CA 4FN5A 4URGA 4QW8A 1GT8A 2GMHA 3K5NA 1IN0A 4JI3F 1GXUA 3ITHA 5F9NA 1IQZA 2LCWA 1ZTWA 3V6HA 1AFJA 3PO4A 4DWIA 5F3ZA 2RF2A 3OTDA 5GAHI 2KO1A 2EWHA 1Y3KA 5DM7Q 1YJ9S 4DQSA 2EC0A 2B56A 4FZVA 4PUOA 4QIEA 1NH7A 2IJNA 3AJ2A 2C2EA 3PACA 1VQMS 2AJFE 3CXCR 1I1GA 4WZMA 4Y28C 2PA3A 3O5TB 3HHKA 3I5AA 2XSJB