3T1YJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3t1yJ00
1N33J 4NEYA 1HNWJ 4DR7J 4B3SJ 3R2CJ 4RJVA 2MQ8A 4LFAJ 4LF4J 2VQEJ 1HNZJ 5LMNJ 4JI1J 2E5LJ 1N34J 4YY3J 1XMOJ 4DUYJ 4JI2J 5LMUJ 4DV4J 4DV6J 4KYZA 4DV5J 1IBLJ 4B3TJ 3D3CJ 3R2DJ 3JAMU 5A2QU 2KL8A 1J5EJ 1IBKJ 4X62J 3J80U 4B3MJ 4JI6J 3T1HJ 1N36J 4YHHJ 4GKJJ 2UXCJ 2HHHJ 3W1YC 2ZM6J 4DV2J 4JYAJ 4LF7J 4DV1J 5IT9U 3J7AN 4DR3J 4NXNJ 4DR5J 4K0KJ 4LF6J 4LF5J 4PWWA 4HHUA 2UXDJ 4KHPJ 4B3RJ 1HNXJ 4DR2J 4JI7J 1I94J 1FJGJ 4DV3J 4GKKJ 1HR0J 4LFBJ 5AJ3J 4DV0J 3IMQJ 4JI4J 5FLXU 4DR4J 4DUZJ 4JI5J 1N32J 4DR1J 2UUAJ 4LF8J 4DV7J 2MEWA 3T1YJ 4JI3J 4JI8J 4X65J 2UU9J 5LM7E 5BR8J 2UUBJ 2MTLA 4LFCJ 4JV5J 2KVQE 4KY3A 2VQFJ 1XNQJ 1XNRJ 4X64J 4LF9J 3J81U 4NXMJ 3D3BJ 2F4VJ 4NEZA 1IBMJ 1XMQJ 4DR6J 4X66J 4OX9J 2UUCJ 4JI0J 4V1Ak 2UXBJ 3OTOJ 4AQYJ 5IWAJ
chains in the Genus database with same CATH superfamily
2P6SA 1VQ8S 3QIPA 1JLEB 2VQEJ 2K3KA 4IRKA 3CDEA 2DNOA 3R1HA 1SJQA 3BO2A 2PI5A 2G2OA 1KQFB 1MROA 1YX2A 1IBLJ 1KTQA 2BABA 1U2FA 3MPYA 2I2YA 1ZA1B 5DG9A 4AFFA 3KYLA 4YHHF 3GLJA 2W1BA 1T11A 4USHA 3R27A 2WRMA 4F2RA 5DDPC 3C6UA 1PO6A 2RRAA 4ZVTB 4B3OB 1FE0A 3MAAB 1FE4A 2ZOMA 3ZTSA 2XQCA 3CVKA 3OFEA 4X84A 2Z2ZA 3AOBA 2PFFB 4CO4A 4M5GA 3CMES 1PC4A 1R8HA 2UUBJ 1FERA 2I8EA 4HT7A 2HNZB 2ROPA 3S7RA 3MM5B 3K2YA 1FO1A 4YB7A 2A10A 3NMAA 2X1BA 1EIYB 2GS8A 4FPIA 2EBGA 4DR6J 4P7TA 4DQIA 1JNZB 2NUHA 3I0SA 1R8CA 3JTNA 3I5AA 3M8ZA 2OIHA 2VFTA 2MSSA 2JEJA 2MQ8A 5D6GA 3DXSX 2HIYA 2FY1A 2AU0A 3QPIA 1WC1A 1Q78A 2C2DA 1G7CB 3HHEA 1P8GA 1J5EJ 5DZ6A 1FEEA 1OJ4A 3V6DB 3ZTPA 4UZBA 3ZNUA 5F8LA 4C8LA 2CFXA 3AAWB 5KFRA 3LGHA 3GIIA 4DV3J 5IV3A 4P2FA 4PQUB 1NK9A 1FXDA 4I1TA 3RTVA 1WHVA 2Y8WA 3PFOA 1H72C 4KH1B 3MCSA 5KFOA 3QO9B 3CE8A 3HM9A 2FUG9 3G6VA 2UUCJ 3MAAA 1HIYA 2YBVA 4O0IA 3P49B 4RW6A 2CQDA 4DPOA 2HNZA 2J7UA 1QE1A 3MM9B 3MM5A 5A6PA 5HMWA 4KV8B 3OFGA 4DPUA 4HVZA 4ZPWR 5CCMA 2YPZA 2ZOGA 4DN0A 5D0RA 2HFVA 1RWWB 4JP8A 1Y4ZB 1F3VA 4ED7A 4DS5A 4N47A 2F3JA 2RE1A 4KAIA 1WI6A 1NCLA 1L3SA 3LOUA 4U7CA 1SL1A 4CZCA 4O3NA 1RYRA 2I6WA 2E5IA 3CSKA 2L9NA 5F8MA 4K8RA 2ASDA 3T6BA 2FY8A 2W4CA 3KLEB 3VAHA 4UQGA 3CJQA 2GAHC 4PWDB 2AEJA 4F0MA 1S10A 1IKYB 3AOCA 2NUUG 3KHRA 5DETA 3OJUA 5DDQC 4CLSA 5K9FA 2A2DA 4DPTA 4X4QA 3L09A 2FLOA 1JMTA 4ED8A 3BM7A 1DTTB 4FZVA 2YWEA 4GVLA 3R2CJ 3CWJA 3LQVA 1VIXA 1PAUB 1TELA 2DGQA 2VHGA 1D8YA 4JI2J 3IWNC 1VK8A 4LR8A 5LSRA 1NBEB 3GIJA 1H7WA 4LSLB 1YI2S 4OHZA 2V8DA 1UVLA 1HW9A 2ZM6J 2FTRA 5JXSA 2Z2YB 4PG4A 1CQMA 4JYAF 3MM9A 5DG7A 1H38A 1HBNB 4KV8A 5KFKA 2OEMA 3NNHA 3S1TA 2C2NA 1G3OA 4W90B 3D6MB 1AXQA 1RBLA 2ILZA 4Q0BB 2HHVA 2HGMA 2GGPB 4P7VA 2ZJPQ 2CVEA 1FTCA 1VDHA 3SCLE 5KFQA 5LJ5Y 3CJKB 3BPDA 2E1PA 1KVKA 3CCJS 2Q1LA 4OYAA 3HHDA 3O1LA 4F26A 3PR5B 5A0YB 5KAKA 5J1PA 3M8PB 3H2UB 3EZUA 1FD8A 1GTEA 2OKQA 3LAKA 4URQU 4QPTA 4ATNA 3HXMA 4CH0S 3KLEA 4PWDA 2R2RA 1KVJA 3EXYA 2HHSA 2HK2A 4JV1A 1ZM2A 1WHXA 3IM9A 3GJTB 3OVAA 3QRQA 1N56A 2R8IA 4NLRA 1DURA 4CDIA 2GHVC 3T1HJ 3NWRA 1KOOA 5I42A 3W1YC 1QAXA 4DFMA 3D9BA 4N8NA 2ZE2B 4AL6A 1XK8A 2D74B 4B3RJ 4WYLA 1PCAA 4RKUC 4CLLA 1LW2B 4L76A 2J0WA 4LIRA 4A4JA 1JX4A 3BH7B 4DR4J 5KFVA 2O01C 1A9NB 5DDRC 1VFJA 2PE8A 4ZLLA 1EQ0A 1SH3A 3KHLA 2WW4A 5T7LB 3KDNA 4DR3F 4D3HA 1HBNA 1G1XA 2CRLA 2O67A 1PC5A 1SL2A 4ECYA 5J2NB 3WIVA 1LXJA 1TUVA 2ATCB 4Q0BA 5H9FJ 4C4WA 3PYDA 4HI1A 3CUNA 2GGPA 3L95X 2CPFA 2W01A 2OPSB 3CJKA 1DFDA 1HLWA 4F3MA 4B3SF 4ETXA 2W2QP 2XI3A 5ETPA 1RT6B 2XHCA 4OI1A 2JLEA 2RDIA 1RT2A 2D41A 2XWYA 3JSMB 3BSNA 3DLEB 3GIKA 3M8PA 1BE4A 4G1IA 1ACMB 2HAIA 4ELUA 5ETSA 2KFZA 2LVWA 3V6KA 3FBCA 2K7JA 1MW7A 3LF0A 5B08A 2A6OA 2IFXA 2MZ1A 1VQLS 3E3XA 3PRVA 1WJ9A 2O1PA 4I0WA 3J7YU 1MG7A 3N6NA 1NPKA 2GAGC 2ZVSA 4GKJF 2EKYA 4P74A 3W8GA 5ETTA 1UAWA 4IQXA 4LF8J 2NYIA 4ZP9A 2I0XA 4FYDA 1Y5NB 4WZMA 5GADI 1GMWA 2NLWA 2ZE2A 1HI1A 2JX2A 1Q7LB 4NE9C 4CRJA 2DGVA 4Q7AA 2UV8G 3UQSA 2HFNA 1LW2A 3W2VB 2D3OR 3RR8A 1F1BB 2JFDA 2XMAA 3RW7A 1U26A 4F67A 4CWBA 2P9EA 1J5OB 1S9GA 2VQFF 1W2IA 3P4UB 2YTCA 1NNDA 4LFAF 3IBFB 1UZHA 3IFEA 5J2NA 3TARA 5KOWA 3KK3B 1HWJA 1A6LA 4DSIA 1RHKB 5H9EK 3KG0A 2VIHA 1TVRB 1SVDA 2CQHA 3N0VA 1XN9A 2WZ1A 1F0XA 3G8SA 2AJ2A 2UXCJ 2OPSA 4YMEA 1KSPA 2UUTA 4WCEQ 5J2PB 2YNFA 4C8MA 4ECVA 2WOMA 1KWMA 3RW6A 3JSMA 1C0UA 1NO8A 4AYBD 2HVHA 1MNEA 4DSLA 2AWZA 4OMFG 3DLEA 1F9FA 1FJGF 2YY3A 1H2UX 3NS7B 3W3SA 1EP4B 5ETLA 1YBTA 5LT5A 4DR1J 1C1CB 4ED6A 5F41A 1WKKA 2E1AA 1S1XB 3WX8A 3FRYA 1QAJA 4L3NA 4JV5J 3JSRA 1RAOA 2VV5A 2QO3A 3J81U 2BJ7A 2HBZB 3VGTA 2CPIA 2VKRA 1IBMJ 4X66J 2LU2A 4IOCQ 4ZPCA 4PCQA 1CJKB 4TYAA 1Z4UA 4WYWA 2BQRA 2E1RA 4F04B 3MMCB 3P5TL 2J5AA 5HK4A 3B6BA 3MEDB 4WE1A 4B9TA 1IM4A 3R6GB 3KLFB 3DLKA 2FZGB 4PKDB 1FRHA 3QGPA 3D3CJ 3W2VA 4TU8A 2J9DE 4C9DA 2EFQA 1KKHA 2H5EA 3BSAA 2R7XA 1J5OA 1RLCL 2G0CA 2XYPB 2ZWOA 1S6UA 1LW0B 4ZOSA 2YVSA 3KK3A 2HFOA 3CJTA 1FA0A 3MMJA 3W60A 3VAGA 3H5YA 1TVRA 4C3MA 2MGZB 2WHOA 5AXNA 2E9TA 4JI4J 4IO1A 3LALA 4R8UB 4RW9A 1YKWA 1VJWA 4TNOA 3FK4A 5J2PA 2HURA 5HLFA 2C42A 1JLFB 4Y65A 1YJWS 4B08A 3MEKA 2OFGX 2XLIA 4BHQA 3V6HA 1X5PA 4ZS6A 3QBCA 4UF4A 3RGIA 2XI2A 1C1CA 2DY1A 4NLUA 3HVAA 2BV3A 1MMDA 1S1XA 3CJ4A 4ZN3A 4LQ9A 4Q43A 2XNQA 5KFNA 5IQ6A 1X4CA 4Z7CA 1KRPA 4K7QA 5D15A 2FPHX 1CJKA 3NAHA 5E3QA 1SCJB 4M5NA 2IVMA 3MMCA 1UA0A 1H74A 2CG4A 4G65A 1NKEA 2GIRA 5KG6A 1HL6A 3I4PA 3DNCA 2E7WA 5KT5A 5DM6Q 2SXLA 4RW7B 3W62A 3R97A 3KLFA 3IN5A 3PYGA 3H2LA 1VISA 1SKWA 2Z8QA 4DN9A 4OJGA 3H8YA 4ZVQB 3FSYA 5AE1A 4N41A 2DIUA 3EWGA 3A8KA 4PEOA 3MR5A 4JI5J 1N32J 5DS7A 4NCGB 1Q16B 3TZWA 1GQEA 4W4MA 1R31A 1LW0A 1B4SA 1PJ7A 2B8QA 2GIFA 5D4NA 1JLQB 1BWVA 2IM3A 1FJCA 4R8UA 2V34A 3ENQA 3GWCA 4ILLA 3ZZZA 3CB4A 3IR6B 1NPPA 1QUVA 2QV6A 3FDSA 4FDFA 4ECRA 4NLYA 1JLFA 2E5LJ 3DRXA 2IRUA 3MEGB 3RB3A 2GHPA 5LMUF 4K5SA 2W9BB 3ICLA 2IMOA 2KJWA 1B3TA 1HHQA 3W9IA 2GFFA 3PW7A 2V8PA 3FBBA 4C0OC 2ZNZA 3IP0A 2ALZA 5FIIA 2Y9HA 5A6WA 4F4AA 5CD4A 2NSBA 2XB2D 4FXVA 2E5GA 3I56S 4YEAA 1PGZA 3IMQJ 4MKBA 5C2CA 3ET6B 3IG1A 3DRSB 4OFZA 1S76D 5HI7A 3QYYA 5BR8F 3BH6B 4RW7A 1UKUA 4PXEA 4K4XA 1WTBA 5RUBA 3MTKA 3VALA 4P72A 3UCGA 2XS2A 4W98A 3EJMA 2CZ4A 4J9UE 1K0TA 2GQCA 4KGZB 3OT9A 4E2FB 2Z2MA 3MR3A 3MAQA 3BBFA 4NCGA 2NXCA 1WKJA 2HWTA 1ZM3A 3E51A 3JB9k 2LA4A 3VVTA 3CCRS 3U02A 1JLQA 1SC3B 1ZBTA 5GVQA 4Y2IA 5K8OA 5KFMA 4Q5VA 5KFTA 2QX0A 1FEHA 1AROP 2ACMA 5ITHA 2IIHA 1TMMA 5HQ8A 4KO0A 2R7TA 2ZZTA 2KYXA 2VPWB 2W9BA 2PC6A 3S01A 2YKAA 2GW8A 1RTHB 4U8VA 5L39A 3WQPA 1VCTA 2J8AA 4ECWA 4X65J 3TZYA 3TEHB 3OL6A 2BE2B 2DR7A 4WIIA 2JC0A 4NEZA 4GKKF 3KJQB 4C98A 1HBOB 2DISA 3SSRA 1IUJA 2QL7B 1T9VA 3ET6A 1X4EA 1RABB 4PG7A 3Q86A 1RHQB 4NEYA 3DRSA 4DG1B 2KO1A 3HVWA 3NL0A 3QWPA 2FVRA 1CVJA 3CDAA 4B9MA 1NDCA 3BQ0A 1EJ7L 1FWPA 4P2SA 3AHPA 4YN3B 4DV6J 2XO7A 3W9HA 3TVZA 2PEBA 3G86A 3CIMA 2J6UA 2V9KA 2LDIA 3HSDA 5KFXA 1F2HA 1UWBB 1IKWB 5KFBA 4DR5J 3MURP 4C7QA 3D1HA 4HACA 2FGOA 2E9RX 3I9V9 2FJWA 3I9ZA 3VCDA 4BDPA 3Q2SC 4EBCA 1S0VA 1JLCB 1NXIA 3L7UA 1WG5A 5KT3A 2FVSA 2XY6A 1T03B 3CCWA 4ZN1A 3KNGA 4O3PA 3NNCA 3P5BP 2CUYA 1EETB 3EGVA 3CCES 2VG5B 3OJSA 4PXBA 1SJRA 1RTHA 2WVBA 1AT1B 5F9NA 1LKZA 5L1KA 1FNOA 2OJ3A 3PFEA 4C6AA 1NDKA 3I0RB 3CD0A 5H1SV 4G1PA 2ZBPA 2BE2A 4IRCA 4IFVB 4FF3A 2QFIA 3MZIA 3O8WA 3HJVA 1HBOA 3PR4A 3CULA 5KFPA 4YHHJ 2UUWA 4DG1A 3V4MA 1IWAA 3PTWA 4FYWB 4IG0A 3LP0B 2ERRA 1O0PA 2NS1B 2Q43A 4NXNJ 2B0GA 1VR6A 1X5SA 3NLCA 3Q22A 4QWBA 4CH1A 1F60B 3NGSA 1NK5A 3O44A 3PW5A 1CULB 3ETMA 1U2CA 2K1RB 3GE9A 3D5MA 1UWBA 5KFYA 3TYTA 3Q8QB 3R7BB 2P8IA 3R5DA 1RLDA 3A13A 2HS3A 4ZHRB 3HSJA 3QFHA 4XO0A 2AZ3A 3V81B 1JLCA 3OTOF 4ILMA 1P27B 4USMA 4UOGA 2FJVA 1T03A 2FHOB 4FVCA 1VRQC 2W24A 2R7OA 2KKHA 3H20A 5ETNA 3IWXA 4J9NA 1GMWD 3C19A 1OSCA 1EETA 3WBZA 1FJ7A 2FVPA 2VG5A 4NCBA 3CJ0A 2VONA 1IR0A 4B3TF 4H4KA 4MKYA 2HBQB 1LWFB 2XCPA 1LWCB 1VIOA 1U45A 4LVNP 4ZPTR 4MT1A 2HPUA 3M9NB 3OVSA 4M63A 3HVTB 2VC0A 3CMQA 1DQ8A 5GMEA 1NK4A 3GYGA 2ZDPA 2WONB 4WP3A 2CAJA 4A47A 3UCUP 4B9NA 2QA4G 3I5CA 4NA1A 2YWFA 1VJQA 1JIHA 5HSPA 2V6AA 5G4DA 4RLEA 4WFBQ 2DGUA 2OLWA 5CD4H 4FF4A 1T9WA 1WC0A 2RHQB 2KT5A 1CULA 1LEOA 3DFEA 3DGVA 4M5KA 1ZH5A 3LWLA 3M2UA 2EC0A 4XPCA 3EXCX 5LXYA 5KFCA 1YJUA 1EZZB 4UQTA 3CD5A 3MR7A 1Q86T 2BJDA 4F02A 3C15B 2ZD1B 3CT9A 4OYOA 3X3UA 3G6XA 5BYQA 2UXDJ 3W8PA 2H4YB 4F4WA 4UY85 4LR7A 2I9SA 3CCUS 2JVRA 3LA0A 1Z2ZA 3TWZA 4IOAQ 3W63A 4M5JA 3FQKA 4DSJA 2NREA 3M6UA 2YH1A 1K0VA 1LWCA 1HWUA 4FYXB 4KT0C 2AGQA 2HHUA 4MKVA 4J9OA 1KEKA 2RIJA 3HFZB 2Y1RI 3HVTA 1JXVA 4N7TA 1RHJB 2IBOA 2WONA 4NLOA 1RWNB 2N7YA 4EWTA 3PYFA 3HHLC 1XNQF 4CLKA 1I5OB 2HSEB 3QT6A 3G2XA 2E29A 2H5IB 4O4RA 2XZDB 3FZ2A 5CXTA 1X9WA 3TX0A 2E7XA 4UY8T 1X7VA 2NZCA 3GFHA 3L3CA 5H9FK 3M32B 2BZ2A 5IFMA 1FRKA 4JYAJ 2Z57B 1Y9OA 4DOZA 2ZH7A 4QR1A 2XYGB 5EDWA 1UTAA 2AEFA 4DPXA 2V94A 3JS9A 1SC4B 2GO9A 2XTJP 5DRKA 3VGVA 4KGKA 4A8XA 5F0WA 3WDOA 2ZD1A 5IC6B 3UD3P 3S8SA 3K7RA 4A8WA 5KT7A 2AJ4A 2K7KA 2MKJA 2XULA 3MECB 1S6PB 4ECXA 2BKOA 2APOA 4LQ3A 2B9YA 2FJEB 2GJ2A 4WTYA 1X9SA 1XMQF 3H59A 1Q53A 1C2PA 1VQSA 5SZTA 2HBRB 1L3VA 4DX8H 4I7FB 2J9CA 1DQAA 2CADA 2ZKTA 1AUDA 2M8DB 4IRDA 2B4VA 4ALZA 3D7SB 1OQ3A 1YDLA 1TKXA 5GAGU 4JI0F 2BX6A 2CNLB 3DC2A 3DMJB 1REVB 4TKTA 1UFWA 1RE1B 4ZDNA 3ZZ0A 3GIRA 2KT2A 4NLXA 1GEHA 4NYOA 3R7NB 5C42B 1WF0A 2AYGA 4PWWA 1Y10A 3T5LA 3G6ES 1NM2A 4OHYA 5IXUA 2AJ0A 4DZDA 2GO8A 3M32A 1RXOB 1NUEA 2V5HG 2WSFC 2DD8S 2KU7A 3E8OA 1AW0A 1SJ3P 3H5UA 4Z37A 1J2VA 3FVYA 2DHHA 3PY8A 4MTPA 4Y6IA 2C3YA 4I69A 1SL0A 3ZO7A 1Y5LB 3GONA 2OFHX 3SMZA 4A8QA 4QYZK 4A8OA 3LPEA 1HFEL 4B3SJ 2FHKA 2XLKA 2K2PA 4DCPB 1S79A 3MECA 1S6PA 2KVIA 3RU0A 3LH2S 4ID5B 4QIEA 4DLGA 3R3TA 4C3LA 2HVEA 4RUCA 5A2QU 3QJJA 2OELA 5EUHA 1BXNA 3HZEA 4ZK7M 5MLCV 4I67A 5LMNF 4MK7A 4P6QA 3NGTA 1X4AA 1H2TZ 2ZBQA 2OSRA 3MMBB 4PUOA 1NJYA 4DL2A 3NRBA 1X31C 1RTDA 2DHXA 1B0TA 2JVOA 4FN5A 4X62F 4CM0A 3CCTA 2CPJA 4B9VA 1WNEA 3DMJA 2AYBA 4LUBA 1REVA 2UUAF 4CYUB 1RZMA 2VDIA 4ZLNA 2V68A 4K4UA 5C42A 3HF5A 1ZAWA 3SV3A 1VC5A 3RBZA 2JH3A 1M5KC 1XIQA 3MD1A 4FS1A 2R7VA 3DM2B 1NKBA 3RZAA 1N5VA 2ZKUA 1U1RA 4JI8F 2QA2A 1TUWA 2A0FB 2HRUA 4M5HA 3SCIE 4LFAJ 5HBMB 2D69A 4GO5X 4AT1B 1WC3A 3KUEA 1OMSA 4ZIVA 3J81Y 1FK9B 2UZAA 4XTTA 5EGYA 2OD4A 3PEJA 3GSIA 3I82A 2B4PA 3OV7A 2XO6A 1Q79A 2BXJA 4JB8B 4Q2MA 2RRNA 2ZITA 1GMUA 4V19X 4ZJLA 4ID5A 1T02A 3QIDA 1R27B 1I94J 1FJGJ 3MM6B 3IAM9 4ZP8A 1ZTTA 3PKMA 3OR1B 3UFCX 1MWYA 2ZBCA 5B09A 3KNAA 1SKRA 3TZZA 3DI6A 1SXLA 3TJ8A 3A3NB 2RQ4A 1S0OA 2DYAA 3MMBA 5B0BA 2QIFA 3FBEA 1EHWA 4OZJA 1BWEA 3TO8A 1NH8A 2CZVC 2DRAA 3FCHA 2LYVA 2BQUA 1D9FA 1FI4A 2BOPA 4NOHA 5E2QA 3D28A 3SV4A 1JLAA 3KK1A 3CO9A 3PW0A 1MWQA 3LAMA 2ASYA 3DM2A 2EK6A 2JEIA 3LTOA 5BYRA 4ED1A 3QGGA 5BYSA 1TAUA 1JJ2R 3CJ8A 2CVIA 5HBMA 3NOCA 2XC9A 5ETQA 2B7CB 4YDXA 4QCLA 3VZHA 1EKRA 1FK9A 2CQ2A 2V4JB 2Z0GA 5U47A 2V8GA 1RADB 2R7QA 1V3ZA 1Y3KA 3A3OB 3H0PA 1G4CA 1BC6A 3IRXB 2Y0BB 2XZWA 2FIUA 4GRSA 3FUYA 2MY7A 1RT5B 1PYOB 4L6V3 3MM6A 3DRYA 2B5JB 5LSOA 4V1Ak 1HW8A 2C3OA 2QG9B 2HFSA 4RWXA 2Y1JA 3OR1A 2C2KB 2XMWA 4AUKA 1HBUB 1VRTB 2POKA 1N5QA 4L75A 2VDHA 4UOHA 4J9QA 4TY8B 3PM9A 3IR5B 4CLTA 3QRRA 1RT3B 4NPOA 4HH1A 2V2KA 1EX8A 3TW0A 1SV5B 4HHUA 2PN6A 1FTRA 3B4MA 1SIWB 4Y2CA 3EVWA 5SUHA 1WOPA 3NXZA 4L73A 1N4LA 1VQPS 2HHTA 1JWWA 2V4JA 4ITSA 4I6YA 5D77A 2R8GA 1DLOB 3Q2TC 4GMKA 2R2UA 3IRXA 1AZSB 1R3NA 4MYUA 4BWMA 3LGMA 4DR7F 1MMLA 1KQGB 2B7BB 4NLPA 1U1KA 2M7SA 3MPWA 4DSKA 1MU2B 5LMUJ 1RT5A 3QSIA 2N7CA 2FLNA 2B5JA 2QLXA 3AQOA 5KFFA 4ANEA 2MHEA 3PG9A 3FNNA 3TVYA 3BSCA 3ZZPA 4RBVA 4J9KA 3TA2A 4PRFA 4N8OA 4OX8A 1HBUA 4DQSA 5K14B 2CQGA 1VRTA 2LP4A 2IJRA 5F3TA 2N3OA 4O44A 4TY8A 2CWKA 2EVZA 1CC7A 3K89A 2DH9A 4LRAA 4R0JA 1OY9A 2VH7A 1S99A 4DV7F 5BR8J 5ETMA 4DI6A 1SV5A 1X9MA 3DKDA 3K5PA 3DLLQ 4F4KA 1B70B 1ZTWA 1GNKA 4UOCA 3H25A 4ES1A 4DPWA 3Q89A 4OZ2A 3RB6A 5IOLA 2CPDA 4KRWA 2G9OA 2GV1A 3ZNJ1 1Q8IA 5KG4A 2L08A 2NPIA 3OL7A 4IQMA 2K06A 5J2QB 3PEHA 1TMJA 1DLOA 4FYYB 1FFWB 4ZVOB 4M95A 1U4BA 2L48A 2YQ1A 4OI4A 3MOJB 2XY7A 4WXOA 4EFAC 3FMBA 5F3ZA 3LGNA 1MU2A 1OY8A 1VLYA 2OEJA 3PCOB 1UW4A 3RG6A 1TK5A 3W5YA 4MK8A 4K4VA 2J7WA 2B8PA 2ZHBA 2DTJA 2Q6CA 2MZQA 2AX0A 2FLLA 5D8HB 2HIQA 4KPYA 4RR5A 5K14A 1RISA 2HS0A 2V69A 2FGCA 2RS8A 5F8IA 2CQ0A 2U1AA 4Q44A 3RAQA 3BBCA 3KLVA 1KHWA 3UE2A 3QGHA 1NDLA 3N9UC 2EFGA 2PD1A 2PMHA 3G71S 1UVJA 2FVQA 2HHQA 1ZM9A 5HO4A 4JBCA 1U6ZA 2MSTA 3D1QA 4K4TA 4QW9A 4A8FA 3O5TB 1GX6A 1UFKA 2BW7A 2LU1A 1WDDA 4K0KJ 2V2QA 3LUYA 5J2QA 2QZ8A 3OW2R 1HQUB 5AXLA 3GCWP 4OYIA 3HJFA 4OI3A 1PYTA 2BA9A 4DPYA 3RR7A 4LFCJ 1RU1A 2ZJRQ 1FD2A 3GYXB 5T41A 1ULRA 2LEBA 3L7PA 2C2OB 3MHYA 2YWGA 3M1VB 4DV0F 1UVNA 4F0HA 3QZ8A 1NSPA 1EQMA 3GV7B 3UVJA 3T5JA 3OXGA 5B0FA 2ZWPA 2MXYA 4KBIA 1F5AA 4MYTA 5FD1A 1N5YA 1N34J 3VAJA 3L4BC 2HQGA 3PW2A 1RTIB 2WVCA 1KOHA 4WK1A 5CYJA 3HDSA 3M2RA 2OTJS 2CJBA 2QGFB 2NSCA 1WHWA 1S1TB 1SQEA 1FESA 4F4ZA 2BOAA 1VQ5S 3BQ2A 5KFIA 4DDFA 1EAYC 1R0BG 2VG7B 3AB2B 3PVXA 1RWPB 3N01A 3GMGA 5HN0A 2KTQA 4O3OA 1D09B 2VJVA 1SQGA 3N28A 3WIUA 1HNVA 4Y2KA 2R7RA 2WBRA 1ZAVA 4J37A 1AB8A 5HJYA 5CA5A 4FBUA 2BDPA 5I3QA 3M8SA 2FHJD 5J1EB 4NXMF 2FJXA 1KNZA 1HQUA 4C8OA 4J9SA 5KG5A 5GAHU 2ZHAA 3OTOJ 2E7VA 3US5A 2YKOA 1LOUA 1DZ5A 3DOKB 1Y7PA 4CI0B 2Z2LA 1AFJA 5I3PA 4MIWA 3M4XA 2QA1A 3M9OB 2OGUA 2HWHA 4DHVA 3G8TA 2J9DA 5KFEA 2EEYA 1PJ5A 1R0CB 4B3TJ 3M1VA 2KXHA 2HRYA 5LOQA 1S1WB 1SIZA 4LBIA 3CPWR 4P2XA 4JI6J 1FXLA 4PABA 2GMLA 3PDNA 2AYMA 3OTDA 3TAQA 3TQ1A 4M5MA 4C2MA 1U6FA 3HX9A 1IBLF 3SZ2A 4DQRA 1QSLA 2QL9B 2DNLA 2AGPA 3RBEA 1HR0F 3QNWB 4CO2A 4C0HA 1YBAA 2H65B 4DFPA 1S1TA 4PWUA 1HYSB 3H40A 2D3UA 2VG7A 5KFJA 2YXLA 2IAJB 1U1OA 1M5HA 4BCAA 1MSWD 1K1SA 3MCOA 1NHUA 1WSRA 3PACA 5DGBA 2UUBF 2AV5A 1F9EB 3F0NA 5EWFA 1RGVA 3BF4A 1MMNA 5J1EA 2GJFA 2LXFA 4H4OB 1NJXA 4NZ6A 1HARA 4DEZA 3N4WA 4JUZA 4ED4A 4DU8A 2KM8C 5A8KB 4NI2B 4LREA 4HYKA 3DOKA 1C0TA 3JYTB 2DVIA 2AT1B 4OV6A 3IGNA 1IN0A 3IS9B 1F5BA 3G6YA 2J0XA 3EVMA 5KFGA 1LXNA 4LF6F 1NSQA 1RYSA 3GU0A 4ICLB 1J5EF 4CLYA 1S1WA 1UP1A 2KG0A 4YS2A 1N0VC 1K47A 2LXIA 2MKSA 1HI8A 1KR4A 2QL5B 3MGJA 1YZ7A 5F8JA 2RS2A 1NB2A 2MQMA 2WVDA 3AOAA 1IM6A 3SXLA 3VHQA 4LF9J 5C25A 2IM2A 1Q5YA 1HWLA 4DV3F 1YG0A 2EFOA 3SBMA 2UXBF 3RAMA 2RVJA 1RWOB 4X4RA 2BRLA 2B56A 1WOOA 4TQRA 3DRRB 2R2TA 1HMVB 1PYSB 3EYZA 4Y28C 4FPRA 1HYSA 2CQIA 4WFXA 1Y11A 1VK3A 2KB2A 2NZ4A 2IAJA 1S9FA 3ZZTA 4BS2A 1Q7YT 4YB1P 1T9XA 2KL8A 4G3IA 2UP1A 3G87A 4U7UK 1IBKF 2F63A 2V2ZA 3QLHB 2GVZB 4YFUA 1YSJA 1L5UA 3U1LA 1ROFA 2OD6A 1I3OB 3J7AN 2PSZA 4UTGA 2ZVIA 4Y0FA 4FF1A 3ZFVA 4H4OA 4NLVA 3ZZYA 3KTQA 2XBPA 2KFYA 2MB0B 2NYHA 5A8KA 4NI2A 2CPYA 3KOAA 2C2RA 2CA9A 3R5CA 1RAFB 3S6EA 1WG1A 1YJ9S 3HT0A 3IS9A 1YTYA 4P10A 1OPZA 1XNRF 3Q23A 5DM7Q 1XMQJ 2XYHB 5GAGI 4ICLA 1NJZA 3QRPA 1N6QB 2HRTA 2YNGB 2YX7A 2MKYA 3AJ2A 1NEEA 3NS5A 3CD7A 2C22A 2F8HA 2B9WA 2AZ1A 2JZ5A 5CCLA 1JLEA 3ADAC 8ATCB 2H5JB 3OHBA 4YY3F 2XGPA 4AXJA 3X1LB 4M5IA 3J80U 2DNKA 4FKXA 3ENWA 4TQSA 2RSQA 1YJNS 3DRRA 1HMVA 2F40A 2QRRA 3HKZD 3M8RA 2BMBA 2C2EA 4JI2F 1OIAA 4FNHA 2Q66A 1HNXJ 5E5NA 4M5DB 3TRGA 4ED3A 3HCXA 1T94A 5HAOA 1VBKA 2Y1IA 4EGLA 3PHTA 5A76A 4B3OA 4LBPA 5A2QY 2ZM6F 1CJUB 2RD5C 2GVZA 5J2MB 4A46A 4NLDA 5ETRA 3OR2B 3ZC4A 1CJTB 1Y00A 3J7Z5 5F9LA 1SKUB 2MJUA 1UFLA 1A7GE 3M6VA 1WD6A 3W66A 3SQGB 5HVHA 3CJSA 1S6QB 4TXSA 1HNZJ 3B82A 4ZKAA 5D4LA 5KG2A 2ZH5A 1RI7A 2OPRB 4ZP6A 2MJNA 2R7SA 3EZ5A 1L3UA 4UW2A 2Q3PA 1VHFA 5I3UB 1FRLA 2YNGA 3K8VA 4AD6A 1GXTA 1IKVB 4URSA 4BWJA 4PPDA 2X7IA 3BN4A 4G1QB 2KHCA 4Y00A 1TV6B 4ES3A 5KFWA 3V6DA 3IBWA 4DV1F 2G2YA 3UI3A 1ZETA 3OXLA 1U1LA 1XERA 2DH8A 1IJFB 1I51B 3TUIC 3T1HF 1X5OA 2CG8A 3JQJA 2UUAJ 4PQUA 4F4XA 4CT8A 1N5TA 2M9KA 3D68A 4DL5A 3H7HB 5B0GA 4B3RF 1GAOA 1WSVA 4ILRA 2XMUA 1X4FA 4M5DA 3K5MA 3QO9A 2O3DA 1Y5IB 3BYRA 1U1MA 2RDDA 2EI5A 4XDCA 2ZHOA 4F0KA 3PNIA 1CJUA 5J2MA 1NSKL 3OR2A 3QMQA 2WB4A 5AE3A 1NK7A 3IR7B 4NWBA 3CTRA 2CKWA 4I68A 2B9XA 3QAEA 1FWLA 3EUNA 4B02A 2DY9A 3WC2A 3UCZP 2HBYB 3JTPA 3IAS9 3N5FA 3SQGA 2ZFHA 5KT4A 4CO0A 1S6QA 1Q1KA 3B8HA 1D1UA 1WELA 2KYZA 2LXUA 2RQCA 1I1GA 1CEZA 3AT1B 2DEIA 2OPRA 4L72B 3OBIA 4PG5A 1UVMA 2VASA 5I3UA 2QSFA 1X4BA 4NA3A 3H5XA 2R3VA 1WI8A 5M2PA 1IKVA 5D0GA 4WFAQ 9ATCB 4TY9A 4IOBA 1UPPA 2DNYA 2MQPA 3NAIA 1TV6A 3NEKA 3AXKA 3GJQB 1UZDA 3Q8PB 2VL1A 4H4KC 5E3RA 2YNHB 4USJC 4KQZA 2NCKL 2XHWA 1X0FA 2HVZA 2DJWA 3FZBA 1IKYA 3R7SB 4CLPA 1VQMS 2BE9B 4ZPVR 1VS3A 4WTOB 4GO7X 3TX8A 2GCFA 2G1HA 3TZXA 4HHJA 4YUDA 1XR5A 3TUPA 2EG1A 2BW2A 1DTTA 2E66A 2N4CA 5D0EA 4ED2A 2CYYA 4OJHA 4RNNA 2RU3A 2KFNA 1R43A 1S0MA 2LECA 4DV4F 2G4BA 5JJBA 3F56A 1CJVB 4WF9Q 1UMJA 4LSLA 5GADU 1XMBA 3KHGA 3P6YC 2W4PA 1Y0HA 3H42A 3ZTQA 3QAUA 2M5YA 4C8YA 1KP6A 4JI7J 4LRCA 4FXWA 2M52A 5E7OB 3ENVA 2M70A 3MM8B 1Y3JA 1IXKA 2UXCF 2EFPA 3SSSA 5LM7E 4L74A 3MXHP 3VQSA 4OI6A 5HROB 1VQ4S 4C48A 3GV8B 1XJWB 5IQQA 1WEZA 3GG1A 5F8NA 4OI2A 2Y0SD 5A0YA 2CQCA 1FRIA 1SJ4P 3H90A 3M30B 5L1JA 3G82B 2VA2A 3GJRB 2YNHA 3MPDA 4ZVFA 2ZEJA 1WDTA 4LSNB 5D4OA 4NMXA 3KXDA 4X2BA 4RPFA 1UCNA 3THVA 1F2GA 3QT5A 4DCJB 2BQ3A 1M5VC 3FFIB 5IT9U 4ANCA 2NXJA 2DNHA 3IC1A 3OPKA 3D66A 3HHKA 4CLUA 1CJVA 4CM2A 3MDFA 1R7IA 2XNRA 4JI3J 3AODA 2LQ5A 1Q81T 2ZUAA 5T7LA 2W9CB 2BVZA 3BKTA 4IG3B 5JVGQ 1QY7A 3MM8A 4JI4F 4YOEA 4ZMMA 1TL1B 2IYGA 2XMVA 4NZ0A 1C4AA 4LF1A 2IMWP 1Z2LA 4DR7J 2ZH2A 4AL7A 3HMJG 1S6OA 5HROA 3D54A 5H9EJ 4ED5A 2JLFA 4K59A 1L3KA 3HSGA 3V2UC 4QWDA 1RT6A 2COLA 1F5CA 3PV8A 2HNYB 2EPIA 1M1HA 1YRUA 2OH2A 2WBMA 4OV1A 2VPZB 3HD2A 2W7OA 2ZOFA 3SDEB 1CLFA 1QM9A 3M30A 2AJFE 3G82A 5CYQB 3JQKA 1B99A 4DS4A 3HHLB 1H3DA 4LSNA 4CO3A 1VLOA 3A8JA 4H54A 4WZQA 2PIIA 3Q8RB 2ASLA 4Y2MA 2CPEA 4DV7J 3MWBA 2RDJA 2R42A 5KFZA 3FFIA 4XAKA 2UU9F 1UW9A 2EBEA 2CQ4A 2P9CA 9RUBA 5KFDA 4USTA 4S0MA 4JI5F 1N32F 2M3DA 1LWEB 2DNMA 2ABYA 1BUXA 5IWAF 1QAIA 2HWIA 4QJVA 2YQ0A 2YPYA 1B0VA 2V63A 2W9CA 2W2OP 2C1EB 1EKSA 3C6TB 4IG3A 2IVYA 1NJWA 4QZVB 3KK2B 4K4WA 1EARA 4OL8A 4KC5A 2YWHA 4B3MF 3CC2S 4MIAA 1S97A 3RYLA 4YR0A 2HVDA 3KUGA 1ICEB 3TVKA 2EC2A 2E5LF 2VZ9A 1MN7A 1P9YA 3DRPB 4FKYA 2BEFA 2M0GB 3T5KA 1NSAA 4HR2A 1TP7A 4NCAA 2VBYA 2CJYB 1OYEA 4USIA 2CJQA 3FRZA 4O4GB 3V4IB 2HNYA 1LK7A 1JXLA 5GMDA 2RB7A 2ATLA 3C3LA 2FHMA 1EP4A 3JQMA 3SDEA 3BDEA 4K2JA 5CYQA 3D1OA 3A4TA 3HHLA 4Q45A 4HLBA 4CLFA 7FD1A 1R0AB 5C2GA 5CAAA 2LLZA 2H1YA 4KKOB 1DJ0A 3QFWA 4MMOA 3M2VB 1FNXH 4LSZB 1DY3A 2OTLS 4IFYB 3MEDA 2IDEA 3T6JA 1JXEA 1SB6A 4X4VA 3TNVA 2DGWA 1S1VB 2IC3B 6AT1B 1LWEA 2BR0A 2PA3A 1H73A 2E5JA 2Y1LB 4QIVA 2F5GA 3GB0A 3T9NA 2CIMA 6FDRA 2HZVA 2AQ4A 2CDQA 3C6TA 1NKCA 1R8PA 1LNQA 2GIQA 5GMKa 1IKXB 4PYAA 4A8KA 4Q8FA 4AE5A 2RKIB 1FNMA 2MGZA 3FGVA 3V5RA 1KD1T 2QMUB 1VI7A 1P6TA 4EO6A 4DX6A 4MKAA 1DRZA 1JLGB 5F0UA 4CCHA 4N5SA 4WU2A 3M9MB 1DTQB 1S4FA 4O4GA 2OEKA 3V4IA 3ISNC 3QIPB 4D3GA 4X65F 1RT4B 4P9SA 1R89A 2RT3A 3NGUA 2CPHA 3TJAA 1V5IB 2RQKA 1R0AA 1WKLA 2HFZA 3CCZA 2RU9A 4KKOA 4XDDA 2VBZA 3M2VA 3A3PB 2AIRB 2E1MC 1N48A 4ER8A 3W65A 2EK1A 4YP3A 4U6PA 4ZLPA 5KFSA 4IFYA 3HKWA 3I31A 4J9MA 1CG2A 1X0PA 4DV6F 3BEGB 2HKEA 4IR1A 4DR2F 1S1UB 2IC3A 4RUAA 5GAHI 2HK3A 4DXLA 1D3WA 1H0HB 4Y3CA 1T0TV 3QWUA 1FDDA 1SI9A 1JQGA 3WX4A 1JJ4A 3RRHA 5A8WB 1U0SA 2ZH9A 4LIWA 1YJVA 4NXMJ 2MZJA 3OFHA 5AT1B 3KJVB 1TKZB 3M05A 4N56A 2C2ZB 1XC9A 1R8BA 4UT4A 1YITS 1LWXA 2YNIB 3BYPA 2UVWA 2KG1A 2RKIA 2ROEA 3HZGA 3MR6A 4J91A 3T5HA 1HNWF 4RJVA 3TOQA 4MH8A 4WIQA 1GMVA 2YKQA 4U95A 4OJ3A 2BE7D 2RUSA 4EMDA 1F3FA 4I64A 4CTAB 2CQ3A 1DTQA 3MEGA 1NH7A 3F41A 1RT4A 3PIPQ 1TL4A 2JEFA 3TI0A 2HHHF 2DCLA 3SCJE 3MD3A 3K5LA 2AYEA 4RX6A 2OPQB 4I2PB 1SH2A 2C3PA 5IM0B 4KHPF 2X1GA 1GK8A 4DCOB 1HR0J 1WEXA 2NXNA 3N5BA 3VF0B 4CLWA 3OTEA 3CIZA 4M5LA 2H3EB 2NXUA 4I6AA 1YWXA 4TYBA 4NXNF 1YZ6A 2MZTA 1HD0A 4FNIA 1VOMA 3IRWP 3AJ1A 3CO0P 4N76A 1S1UA 2L41A 3BV8A 2Z58B 4B9SA 1ZM4A 2PDAA 4RW6B 1QE1B 3SEOA 3MI7X 1A0OB 5A8WA 1RK8A 4RZRA 3I5BA 3KJVA 1TKZA 1N54B 2CZ9A 3IO1A 3PO4A 2YNIA 4RNOA 2DXFA 5IS2A 3AD8C 3R1LA 1U1QA 1IQZA 2HHPA 5KFAA 3OHAA 3QJLA 4HDHA 3DN9A 2AHOB 2CJKA 4HTJA 1S4EA 1GT8A 1NPRA 4LF6J 5E3CA 1EB0A 3N79A 2X51A 4CTAA 4FVMA 3RJMB 1OQ6A 3I6PA 3GFZA 4IH5A 3L9ZA 3ILJA 4YQWA 3O3LA 4QU7A 2KXFA 3CF5Q 2DPIA 2OO4A 1URNA 2OPQA 4I2PA 1FF2A 3ULHA 2MHNA 5IM0A 2UXBJ 1WORA 4PG6A 2OMLA 4TU7A 2AW0A 3GZ7A 2P6TA 1HHSA 2L9DA 3H4BA 2HNDB 2JC1A 5FJ4A 4PXDA 1OO0B 4A8MP 3LO3A 3FCWA 3G8QA 3QQCD 1CSJA 1HA1A 4LMZA 2LEAA 1IBKJ 1TR0A 3G4SS 2MKCA 2GMHA 2FC8A 2V67A 1VQKS 4QOTA 3PRBA 5JMNA 4E8UA 1KFSA 3GG0A 2ALYB 3BSOA 3KLHB 1P9QC 1RBOB 4NRTA 1IKWA 1VBYA 3PJXA 4ANDA 2IHR1 1AFIA 4LR9A 2JJ4D 2KZMA 2Q79A 4ZPDA 3CXCR 5D3GB 1NAQA 3J80Y 1YBUA 4DUZF 1N5SA 4Y34A 1WF1A 3GILA 3HPOA 3W5ZA 4G6VB 1XNRJ 1WEYA 2UXDF 3KG1A 2E1CA 3M8WA 2EFNA 3PHEA 3ISZA 1KQSR 1OWXA 4AQYF 1FKAF 4ED0A 2VFVA 2W2PP 2U2FA 1HQ2A 3DLGB 4OYMA 5CQGA 2MZSA 4OHXA 3I0RA 4YY3J 3VAIA 4IFVA 3JAMU 1YJTA 4UOFA 5I42B 4ECZA 4RBTA 3D4JA 1LFPA 3H5SA 1K44A 2HNDA 3DDIA 3LP0A 3U1NA 2MLXA 3QSYB 1GTHA 4HTIA 2ASJA 2XG8A 1YQHA 3MMAB 5FLXU 4R5PB 1S48A 4PR6A 1TKTB 2CNKB 2RILA 1WC5A 3T19A 3RBDA 3T1YF 4J9LA 2K1RA 3KLHA 1JKHB 3MEEB 3O2IA 3QGIA 4NMLA 4BC7A 3BO3A 4DWIA 3BREA 1LV5A 3RAXA 3TJ9A 5D3GA 1KS2A 4ZHRA 2OPPB 2R7WA 3V81A 4DFJA 2F1FA 4NLSA 1RT2B 3DLJA 3KKFA 1OSDA 4LRFA 2D9OA 4DL6A 1RKIA 4OX6A 2RNEA 2KN4A 4TLQA 3VV2B 5THWA 4URGA 3R9LA 2NQPA 2WW8A 3BQ1A 4DV1J 2B43A 3DLGA 1U09A 4TLRA 1IR2A 1Q95G 1LWFA 3QT8A 1IQTA 1PG5B 4MJKA 1RQ0A 4HEA9 2ZZMA 2DCUB 1SJ1A 1G6BA 1E6YB 2CQ1A 1H6KX 4ID8A 1Q4RA 3MOZA 4QBUA 5AJ3F 4WK3A 3C8YA 2DIVA 5D0HA 4DX5A 2CDRB 2F7VA 4X64F 2PGCA 3IBCB 2WSCC 2O5DA 3CDUA 2R8HA 3MMAA 4DF8A 4R5PA 1S9GB 3PJ9A 1TKTA 4P2MA 3D6TB 5L8RC 5DQIA 1ZPWX 2J0SD 5CH7B 3K57A 2C3MA 2HZAA 1K8AT 1JKHA 3MEEA 1WUUA 3HHLD 1UJ4A 2OP5A 3NBPB 2HW3A 3VGSA 4EYHB 3KJNB 2V8HA 4IR9A 2YNFB 4M1KA 3LANA 4DZ6A 2OPPA 2MQQA 2WOMB 4K4YA 3C15A 1C0UB 1RACB 4CO1A 2C28A 1W7WA 5DQHA 4ETZA 3TUZC 3UN2A 4DMZA 5E3PA 1S59A 4I4BA 4OLOA 1SQFA 2P5VA 3BGRB 4KHMA 2XSFA 3ZZRA 2H9ZA 3C66A 2NR0A 2F8EX 1E6YA 3EGWB 1PJ6A 2BM1A 2VFSA 4OX9F 3DOLB 2F9DA 4K5RA 4U9RA 2HHXA 2R9LA 2H51B 3HLUA 4WE1B 4ZCLA 3DGPB 3SYZA 4PPZA 3FCVA 2F9JA 3DLKB 2RMLA 1OYDA 4DV4J 5HJXA 2XMJA 1RA7A 2Z56B 3K17A 4U67Q 2DR5A 1FKOB 4YR3A 4YB5A 4R25A 4DR3J 4FP9A 2H54B 2PO4A 3A12A 1Q8LA 3D0IE 1YIJS 3NBPA 2J76E 2WVFA 3JSYA 4RW9B 1IR1A 1FXRA 2CJAA 3BO4A 4OJ1A 4FS2A 5HLFB 1RJJA 1BQNB 1RCXB 8AT1B 2LMIA 3NGKA 2IM1A 3U7JA 1UPMB 3LP1B 1ZAXA 3MUTP 1F9HA 1TZ0A 5K8NA 1T95A 3Q8YA 1FWKA 1HWIA 3FSXA 5IT9Y 1Q8BA 1I94F 4QYZJ 3GJSB 2I38A 3CDWA 3MFIA 2W4DA 3DYAB 2XMMA 4FYVB 3OTBA 3J7YI 2WVEA 2W7AA 2RF2B 3BGRA 4DL7A 1U8WA 4WKYA 4I7FA 1YK9A 1HPZB 2GVDB 3RBXA 2Q6BA 3ZZUA 4KB7A 3QJPA 2IA0A 5JUMA 2KRRA 2HEKA 2VBXA 4OZ1A 4Y2AA 2YQ3A 2FHJA 3CDBA 3TANA 1HWKA 4MAKA 3DOLA 3FJ2A 2W25A 4DFKA 4GKJJ 3DGPA 2C3UA 3TA0A 2WK4A 1RHUB 2HAFA 5GAEU 3CC7S 3OD2A 2QTWA 2KZZA 1X4DA 3ONQA 1PBAA 2WSEC 1S57A 3PIOQ 3UD4P 2GJIA 1B0PA 2V4QA 1IVZA 5BXIA 2R7UA 3AD7C 4KGVB 3Q8SB 3THPA 4H4MB 2DRDA 3ILLA 3AXMA 2KM8B 3NCRA 1FKOA 1UEVA 2BKNA 2B4OA 3TP2A 2VQFJ 2GX8A 2DRBA 2XM3A 2OI2A 2HLUA 1NJIT 2G1DA 1RP5A 5DLFA 3MUVP 4MFBB 3OVBA 3PZPA 4ZVGA 3K58A 4OZ3A 2JWNA 2BACA 1BQNA 3T1AA 3LP1A 1TL3B 3K5NA 2CJXB 4DSFA 2CQPA 4WKRA 4LJMA 4J90A 2J7KA 3LP2B 4LVOP 2EG2A 3UR3C 4EUVA 3DYAA 4RO0A 2RF2A 2M2BA 2PT0A 2YKPA 4P71A 4EBDA 3JXOA 2QLBB 4CO5A 1HPZA 2GVDA 3POTB 5IV4A 1PAEX 4QYRA 2FDNA 1FVSA 5HMZA 5L9XA 2MQNA 4AL5A 3DHWC 1GFWB 2ZH4A 1XBWA 2JLGA 3IG1B 3KUHA 1N8RT 1RUSA 3UNGC 3ITHB 1RBAA 3Q8UA 2UU9J 3GR0A 2P9GA 2ZH3A 2R4FA 3KMSA 1RAAB 4CYUA 3UW1A 3N6MA 4DX7A 1FX2A 1BMQB 3TA1A 1ZYQA 3EICA 3M7VA 4OYBA 4CNYA 1NZAA 1K1QA 1QJHA 1URRA 8RUCA 1C4CA 1VC0A 2AEMA 5IWAJ 1Q82T 1UEKA 4H4MA 4BC9A 4K2XA 3L7OA 2R2SA 5ADZA 4OX7A 2DEJA 4IDKB 4NLWA 3SFGA 3SCKE 2K8GA 1FJEB 2W7PA 3EVOA 3OL9A 1I6JA 3SIPB 4MFBA 2FJBB 1QLNA 3UPFA 2LKZA 4B3MJ 1JK9B 2ZH8A 1QVGR 2A18A 4EZ9A 4Z7YA 2HZCA 4KO0B 1B7FA 1TL3A 7AT1B 1VGYA 1U24A 4NASA 3TAPA 4HH0A 1HHTP 4J9RA 5KT2A 3LP2A 2ADBA 4LF5F 2DNZA 4KE5A 4ZJQA 2HHWA 2LQJA 2FC9A 1PKUA 2CWXA 2L9WA 4J9VA 1QTNB 2M8HA 3POTA 4ENOA 2J6SA 1ZOTA 2LCWA 2VFRA 4ZVSB 3EGZA 4DUTA 4X4PA 5CYMB 2XMTA 1K9MT 4K50A 2VPXB 3MAHA 2E9ZA 4NYZA 1HI0P 2PEHA 4KGMA 5CZXA 4BBYA 3ITHA 1N33F 2ILYA 1U2RA 3DDNA 3SQOP 1RWKB 2JDJA 3GCXP 1BGXT 2DGXA 2NXEA 4ZIWA 1HNIB 3GQCA 4RW8B 3GIMA 3E01B 1N36F 1T9UA 4ZA1A 4ZVUB 4QU6A 3CCQS 1FRJA 2EWHA 4IDKA 4HACB 4O3QA 3UDEA 2DH7A 1QSYA 5M2RA 5HVFA 4KIAA 4AXIA 2A6MA 3DCAA 1GXLA 2FD2A 1F6TA 1ZZFA 5EWGA 2RAQA 3RB4A 5AXKA 1YRXA 1TUGB 3E2EA 1IJEB 1FHTA 4KGXB 4P52A 4WPAA 2D9PA 3HI9A 4Q8EA 1TK0A 4ZCIA 2MZRA 3NOGA 2FZKB 4V19J 1CPZA 2G0IA 3OLBA 3HHNB 5I4MA 5T14A 5HATA 4OZNA 3ELHA 1S5ZA 3W9JA 4PAAA 1IBCB 4WWSA 4RWWA 4OHWA 1XMOF 3KFWX 3MM7B 5CYMA 3ETOA 2ACYA 1HD1A 3J81j 1KN6A 3EM1A 1KFDA 4IG0B 3VR1A 4F4YA 2WAQD 4LF7F 1FDAA 1RT3A 1KC8T 4WJBA 5E0OA 2MQLA 2X3DA 3AH6A 4DR2J 1KQKA 2HQ3A 3ZXWA 2IVFB 3LPYA 4I56A 5KG7A 3U1MA 5DDOC 1HNIA 1U47A 4RW8A 3E01A 4CQ1A 3DU5A 2GQ2A 2VKZG 4K0KF 1M5OC 5B0EA 1VC6A 2GZOA 1HBMB 1O6XA 3MR2A 4X4SA 4C8KA 5L1LA 3HT3A 1HNWJ 3HP6A 3W5XA 4LFCF 2DB1A 2ZC4A 2DR6A 1AZSA 3MPVA 2JRSA 1SJFA 3KHHA 1FKPB 2MYFA 2Z4PA 3UN3A 5JVHQ 4DUYF 1FDBA 4OQJA 4J5OA 2ZBIA 2ZH6A 3TQEA 3BJYA 2AJ1A 2LEPA 5HMYA 3PYEA 3FEXB 4CT9A 2HHHJ 3FQLA 4PXCA 2W8KA 2DGSA 1M1KT 4KTQA 4OZLA 3RRKA 1T9TA 4ES2A 1BLUA 1N34F 4MIBA 4GC7A 4WFNQ 1T05B 1YHQS 1VQNS 1FVQA 4KHPJ 3MM7A 4GKKJ 1M90T 4K4ZA 4DL4A 4F36A 1VQOS 1SC6A 1W2BR 3GFXA 2BM0A 1X5TA 2PFDA 1XTZA 1U1NA 3OUYB 3R5GA 3HD1A 4ELTA 3K59A 4KR0B 2HQIA 3TEGA 4OYWA 2CNNB 4RU2A 1RA6A 3UN5A 2CPXA 4A8SA 1Q5VA 4ELVA 3AQPA 5F8GA 3QZ7A 4Q2LA 1S7IA 3M2UB 4ZVRB 2EXUA 2HGLA 3PJWA 2DR8A 1C1BB 4LF4F 2BJ3A 2QC3A 2X1AA 1HBMA 2QFJA 1UVIA 1KBRA 4HL9A 4ECQA 2RH3A 2EKNA 3EDRB 3VAMA 2OMOA 4ZPBA 4ZVHA 5KFHA 3UWTA 2H4WB 2LA6A 1RSCA 3AD9C 3P8BB 1FKPA 4LBHA 2V4RA 2YX4A 3LWMA 3BKUA 3B54A 4QW8A 3I87A 1JJHA 2MKHA 4OYXA 2V2VA 3KLGB 1KDNA 2VG6B 4JI6F 4X4UA 3GP9A 4C8ZA 2IBKA 2JHEA 2IY5B 3UDLA 5G0RB 1T05A 4OLPA 1D9AA 4F7VA 2AMCB 3T3FA 2DNGA 3AFGA 4KSEB 4OYZA 2F4VF 4LT6A 1R8AA 2OUGA 2VJUA 4DBQA 2CPZA 3HO1A 1OS5A 2GQQA 1RTZA 5DLGA 2QJ3A 1NU4A 3CJ5A 1PSDA 1Z1ZA 2DO4A 4RL1A 1WWHA 5FDLB 3OUYA 3PX0A 3R5AA 4JI1F 1PIEA 4A48A 1U8SA 1SKSA 3NGRA 1TL5A 2W9AA 3A8IA 4DV5F 1U1PA 3FEYB 1BY9A 1YJ7A 4KJIA 1UL3A 2F8MA 3A1YG 4HT5A 4E98A 3WC0A 3NP5A 1D8ZA 4DSEA 4DV2F 4A8YA 1DBDA 1TAQA 2PA8D 3IGVA 1C1BA 5MAOA 1N0UA 4HDGA 5HANA 4DU7A 2HQDA 4TVAB 2UV8A 4KFBB 3CD6S 2GA7A 2MLYA 5DZ7A 1RAJA 1DQ9A 2IDLA 3BB5A 3G96A 2YKMB 3JAMY 1BQXA 4DUZJ 4LFBF 2E5HA 1AYEA 1O8BA 2V9WA 4XPEA 3MCNA 3W61A 4X4OA 3R8YA 1E6VB 3PO5A 2RUGA 3EPGA 3EGNA 3M6WA 3KLGA 2VG6A 3SFUA 2B4UA 3CW2C 4AQYJ 2HLTA 4EO8A 2QN6B 3OQ2A 3SI8A 4RNFA 1VQ6S 5FLXY 1B7YB 5EN1A 2LQ9A 1TK8A 4LF9F 2B3TB 1TKXB 5G0RA 2VQEF 1V6HA 2D3O1 2YKNB 4WP9A 3W7BA 3V6JA 4CH7A 3KWMA 3IXQA 5K8MA 1RTIA 2JNJA 3EZOA 2O66A 4ECTA 1QAYA 3HSZA 2Y3YA 3I96A 1X8DA 2KRBA 3RB0A 1GH8A 1RAGB 1REGX 1UJ5A 5FDLA 4ZP7A 4ZVEA 1J27A 3DXBA 4F50A 1X4GA 5CABA 1SC1B 2XCAA 1P1LA 3T41A 3KJFB 5K20B 2AX1A 4QIGA 4U96A 3T1YJ 3DLHA 2ZH1A 5KOXA 4NLQA 4RU9A 2FZCB 2MTLA 3UD5A 1XR6A 4I2QB 3HK2A 3NWGA 2W2NP 1KHVA 2KT3A 2IPOB 1RCOB 2JSXA 4KFBA 2XEXA 4O3RA 3AA9A 4DR6F 4J9PA 2XGQA 2RHSB 2YKMA 4ECSA 3CJ3A 3I32A 3THTA 2OHDA 3FBFA 2JFKA 4XIUA 2BJ8A 4EYIB 1S7HA 1E6VA 1NDPA 2DR9A 3BGLA 2X1FA 4KHRA 2BUNA 3M8YA 2FVCA 5C5JA 1DHMA 3F44A 3CCMS 1NZ8A 1VYAA 2IA6A 3MUMP 2IJFA 2E44A 4UUWA 4ERDA 4ZCMA 2WTFA 3KDOA 1YGYA 3DLBA 4RUHA 5L46A 4PUOB 1RTDB 2YKNA 2J6TA 1W25A 1Q0NA 5KT6A 3CJRA 1T7PA 4FF2A 1WACA 1U25A 4RNHA 5AJ3J 4WFZA 3QT7A 3K5OA 3CJ2A 1XWLA 4HHHA 2VB6A 4OZ0A 2QE5A 4NLTA 4M94A 2HG4A 2AGOA 1XNQJ 3W64A 4X64J 4QR2A 1HNXF 2FJAB 5L1IA 2J0QD 2ZZNA 3VAKA 3GV5B 5BJRA 2VC1A 1SPBP 2FJDB 1XQIA 2DNQA 3BGOP 2GC8A 2UUCF 1GX5A 1T3OA 2YH0A 4WU3A 2Y8YA 3EDQB 3NGDA 4EBEA 4I2QA 4MK9A 3MTJA 2FYXA 3GR1A 2ROGA 2I5JB 1RWUA 2MKIA 1D9DA 4TN2A 1RT1B 3Q83A 3Q8VA 2BJEA 2QA4S 4DQPA 4WFYA 3OSNA 3JYTA 1HNZF 3AY0A 2VBWA 2QLFB 3BGUA 2A1BA 3DU6A 4R0EA 3TAMB 1L3TA 3OFFA 3HFKA 2CXEA 3G9CA 2MQOA 2YWWA 2HFUA 2MEWA 2OSQA 2KDOA 2LDYA 4F25A 4WP8A 3DI6B 3CGIA 3NKYA 2VF3A 5L9NA 3D6FB 4OX9J 3PW4A 1RU2A 2VU5A 3RRGA 4JI0J 2WCXA 2G2ZA 2AF6A 1CBKA 3MF5A 1S49A 2ZC3A 1JLAB 3KK1B 1KVIA 1RT7B 2GHWA 4PQAA 2G13A 3H2VE 4XK8C 4KYZA 3U27A 2FB0A 3FSIA 3R2DJ 1LFWA 4HI2A 2VICA 3NY0A 1OY6A 5ETOA 3IWLA 1U02A 1PBUA 3QLHA 2D7SA 4F8RA 4X4TA 2N82B 5KFUA 2HQFA 3NCPA 4QWEA 2G0JA 2I5JA 2PMWA 2KHDA 2VD3A 1DARA 1RT1A 5DGAA 1M0SA 3NG8A 3R5BA 2DGTA 4JV0A 5HP1B 3PRDA 2ZNYA 4M8LA 2MDAA 3GFYA 5LSLA 4RW4B 5HL7Q 3KG4A 1H98A 2DHSA 1CC8A 2C2MB 3TAMA 3FKBA 3DOMB 3K0JA 1JB0C 1N6QA 1RAHB 4USVA 3GYNA 2B51A 2ADCA 2DNNA 4OYPA 3A8EA 1UWAA 3VGUA 5GAEI 5F8HA 1UJ6A 1NK8A 5LMNJ 5B7WA 4C11B 1YLXA 3WZ0A 2HMIB 4RBUA 3VWSA 1SUQB 3ENAA 2MLZA 2M88A 3VTIA 4NRUA 3BDPA 4NYPA 4X62J 2QEXS 2XMKA 3J7ZT 4DL0C 3NCQA 2LQBA 3EMTA 4NX9A 3R5JB 2YWKA 4U7UD 2UVRA 3CC4S 1RT7A 3ZTOA 5C24B 1TU0B 1APSA 3QATA 1DAXA 1R6YA 3AA8A 3RUBL 4LF2A 3BBBA 4DR4F 4JI8J 1U0HB 2HYIB 4B17A 2XLJA 1CJTA 1NHKL 3CMAS 2Z30B 4NLGA 4JI7F 1TFYA 5DQGA 1QDUB 2DHGA 2JEGA 4IH7A 1U49A 4TU9A 1RKJA 4L3KA 4I6WA 5HP1A 4OHVA 3N6LA 4GC6A 5LXRA 1K73T 2QLJB 4RW4A 1QD1A 2BANB 7FDRA 2QLWA 3M6XA 1ELOA 1WC6A 3PXGa 4CLZA 1TL7B 2HVIA 1P1TA 3FMWA 5DG8A 3DOMA 4P75A 5HQMA 2XS5A 2RQMA 3TUJC 1NRKA 3HVRA 4G1QA 4C11A 4O44B 5K8PA 2W2MP 2KH9A 1FT8A 2VUGA 4YR2A 2K3IA 2HMIA 1RB0A 1SUQA 2KI2A 3NMRA 1VQ9S 5E3AA 1NB7A 2H48B 2UVVA 4LF8F 1U7LA 5IC4B 4ZVPB 1S77D 5C24A 2VFUA 2ZBRA 4UUXA 1RDRA 2DXDA 3DHXA 1YRTA 1CS4B 4USWA 1T9YA 4JI3F 4KH0B 1NMEB 1U0HA 1X60A 3LW5C 1V9OA 2VOPA 2M4MA 4PYDA 3NNAA 1MLAA 5AXMA 2R8KA 4LRBA 2PMZD 1H2VZ 1WF2A 1O51A 5B0DA 5L38A 5HVGA 3OTCA 2ZDOA 3BPSP 3WHIA 2DO0A 5D4PA 3GTYX 2BANA 2DHAA 3UDVA 4LF5J 3UDCA 3BGFA 2DKOB 1KLMB 1IWGA 1TL7A 2V50A 3GSDA 1RHMB 2OAUA 1VHIA 2DGOA 2QMXA 4B9LA 4DR1F 2JOQA 1JNRB 2CQBA 1ZS6A 2HQCA 2DT9A 4OIXA 1OPIA 1KLNA 4JV5F 2XSJB 3Q24A 2B9EA 4YDDB 4F3QA 1UEUA 1UA1A 2LFVA 1IBMF 1WC4A 4X66F 2N3LA 4FXDA 1H7XA 5A8RB 1NK0A 3C2PA 5KG3A 4YB6A 2ZJQQ 1N33J 5EX0A 2BBEA 3J7A1 2AP6A 4IYQA 1RTJB 2BYCA 2YX1A 2RRBA 1VMBA 5ETVA 3OSPA 1KONA 4ZCKA 4K4SA 3AB4B 6FD1A 1WHYA 1CS4A 4RNMA 2XY5A 1N36J 4DF4A 2KXNB 3KMQA 2LQ8A 2DITA 3C16B 2ZUGA 2IM0A 2DBBA 4ZJOA 1TFWA 1BQMB 2BJ1A 4C3KA 1M5PC 2AD9A 3C46A 4QWAA 2UVUA 2GNKA 3B4DA 1KTVA 3D0HE 2VA3A 1BD6A 1ITPA 1XR7A 1VQYA 2RJZA 1M1GA 3PX4A 4RUBA 5IT0A 5C7PA 5IT4A 1FX4A 1S72S 5B0AA 3BR8A 1AUSL 4ECUA 5LL6d 3UO0A 4OZ5A 3IA0A 1KLMA 3B78A 5K5MA 3FEZA 1T8EA 1D0EA 2CNOB 3UVJB 4O0NA 4EZ6A 2FLPA 2W8LA 1O5JA 1ZZNA 4CNZA 2HS4A 1N5YB 4DLEA 4IO9Q 2XSJA 3I4HX 3FC9A 1XMOJ 4ZPAA 1V3SA 3JTOA 3AJDA 2V0NA 1NLKL 3M2RB 5EX3A 5J1NA 3CNQP 5A8RA 4DJBA 1FDNA 2MMYA 3BKFA 5DO2A 4IH6A 2A2CA 4NL5A 1RTJA 4LF7J 2EW9A 4IKAA 2L3MA 5LJ3Y 2MPUA 5CHCB 5M2UA 3HULA 5KG0A 3PX6A 3P45B 1TQLA 1YJRA 1HNVB 4PG8A 3BS9A 4NA2A 1LK5A 5HMXA 1VBXA 1RWXB 2BKPA 3C16A 4KY3A 5KFLA 3UNYA 3O6QA 3D67A 3D3BJ 1BQMA 2AKWB 3Q0AA 1RAEB 3CCVS 3JSBA 5HQLA 2J8SA 3K8WA 4X4NA 4O23A 2X3GA 4ZITA 1QVFR 2QMWA 4FBTA 1TL1A 4QIFA 3NS6A 1CQNA 4B9UA 5KG1A 2PI4A 3BZQA 5AE2A 1BHNA 2WB1D 1MWZA 4DUYJ 2NPFA 2DNPA 4Z2XA 5B0CA 3MPUB 3W2WB 1SBRA 5ETKA 1S9EB 2VODA 1WOSA 1UVKA 1JLBB 2B6AB 5CZVA 3H98A 3BN7A 1GXUA 1R6VA 4C0BA 4P73A 4QR0A 1WG4A 3MCMA 2D1CA 1V3RA 5EWEA 2BRKA 4BLGA 4E0DA 1YVFA 2F4FA 3CCSS 3C14B 3ZZOA 2GMJA 1HQEB 4LRDA 4N77A 2QSWA 2HGNA 1SH0A 2F65A 4F3OA 4CP5A 1U6BA 4UZCA 1N88A 2KVQE 5EHHA 4EK2A 3M8QB 4CIOA 4PZVA 1QTMA 4QIWD 2R8JA 4OI0A 2XWXA 1HKAA 3CEDA 2XZTB 3IM8A 4USKA 4WXWA 2EFVA 3T9ZA 2IJNA 3R6LB 4GVBB 1G2EA 1AA1B 2MKKA 3EPIA 1V5VA 4HKQA 4LF4J 4QWCA 4JOUA 4KPCA 1U48A 2MY8A 1TTHB 4IUFA 2IYIA 2KJVA 2D3ZA 2CJ9A 3KLIB 1TKDA 1LQ9A 1C0TB 3OL8A 3I55S 3KK2A 3D6HB 4QPXA 4O3SA 3ILOA 2DNRA 3BR9A 3F73A 2DPJA 4U8YA 2JL9A 1VRUB 1B64A 1QSSA 3DRPA 2N4DA 1JJCB 5E41A 3W2WA 1RWMB 1ZPVA 1S9EA 4DV0J 1ZA2B 1NK6A 1VBZA 1JLBA 2B6AA 1NHVA 3UR0A 1UETA 1S0NA 5C25B 1W26A 2DXEA 3ZTRA 4C8NA 2P2CB 5DJBA 2I1RA 4USUA 2F4VJ 1MROB 1T3NA 2J9EA 2QT7A 2QYGA 4JV2A 3OLAA 1X4HA 3C14A 4EEYA 1FFGB 1FRMA 1HQEA 1VQ7S 3VAFA 5D78A 4DQQA 4F2SA 3DDKA 4DL3A 4J7CA 3ISND 4JI1J 3M8QA 5IZHA 2FQQB 3C6UB 4W92B 2IRXA 2XS7A 3TR5A 2BJ9A 1XEZA 4DV5J 1RAIB 5KTQA 4QQBA 2VOOA 2VPYB 1Q8KA 3VQTA 1RHRB 1S1VA 1MN9A 2V8VA 3SSQA 4GVBA 2A3JA 4EU0A 4DV2J 2AJQA 3GPAA 1S12A 3P96A 1QUPA 2DK2A 4NZ7A 4DR5F 1N52B 3EE3A 1WTFA 1FFSB 3OXFA 4WBFA 3KLIA 1FCAA 4LFBJ 3PKYA 1PILA 3I0SB 4EI2A 3EX7B 1IKXA 3H4DA 3MFHA 5E33A 2QYCA 3VVUA 1RWVB 3CCLS 1VRUA 3D2WA 4C97A 2IRYA 3D0GE 1JLGA 1M5SA 3ILIA 3VZIA 4ZLJA 3HFVA 1FRXA 3P3DA
chains in the Genus database with same CATH topology
1N33J 4NEYA 1HNWJ 4DR7J 4B3SJ 3R2CJ 4RJVA 2MQ8A 4LFAJ 4LF4J 2VQEJ 1HNZJ 5LMNJ 4JI1J 2E5LJ 1N34J 4YY3J 1XMOJ 4DUYJ 4JI2J 5LMUJ 4DV4J 4DV6J 4KYZA 4DV5J 1IBLJ 4B3TJ 3D3CJ 3R2DJ 3JAMU 5A2QU 2KL8A 1J5EJ 1IBKJ 4X62J 3J80U 4B3MJ 4JI6J 3T1HJ 1N36J 4YHHJ 4GKJJ 2UXCJ 2HHHJ 3W1YC 2ZM6J 4DV2J 4JYAJ 4LF7J 4DV1J 5IT9U 3J7AN 4DR3J 4NXNJ 4DR5J 4K0KJ 4LF6J 4LF5J 4PWWA 4HHUA 2UXDJ 4KHPJ 4B3RJ 1HNXJ 4DR2J 4JI7J 1I94J 1FJGJ 4DV3J 4GKKJ 1HR0J 4LFBJ 5AJ3J 4DV0J 3IMQJ 4JI4J 5FLXU 4DR4J 4DUZJ 4JI5J 1N32J 4DR1J 2UUAJ 4LF8J 4DV7J 2MEWA 3T1YJ 4JI3J 4JI8J 4X65J 2UU9J 5LM7E 5BR8J 2UUBJ 2MTLA 4LFCJ 4JV5J 2KVQE 4KY3A 2VQFJ 1XNQJ 1XNRJ 4X64J 4LF9J 3J81U 4NXMJ 3D3BJ 2F4VJ 4NEZA 1IBMJ 1XMQJ 4DR6J 4X66J 4OX9J 2UUCJ 4JI0J 4V1Ak 2UXBJ 3OTOJ 4AQYJ 5IWAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 J;  4NEY A;  1HNW J;  4DR7 J;  4B3S J;  3R2C J;  4RJV A;  2MQ8 A;  4LFA J;  4LF4 J;  2VQE J;  1HNZ J;  5LMN J;  4JI1 J;  2E5L J;  1N34 J;  4YY3 J;  1XMO J;  4DUY J;  4JI2 J;  5LMU J;  4DV4 J;  4DV6 J;  4KYZ A;  4DV5 J;  1IBL J;  4B3T J;  3D3C J;  3R2D J;  3JAM U;  5A2Q U;  2KL8 A;  1J5E J;  1IBK J;  4X62 J;  3J80 U;  4B3M J;  4JI6 J;  3T1H J;  1N36 J;  4YHH J;  4GKJ J;  2UXC J;  2HHH J;  3W1Y C;  2ZM6 J;  4DV2 J;  4JYA J;  4LF7 J;  4DV1 J;  5IT9 U;  3J7A N;  4DR3 J;  4NXN J;  4DR5 J;  4K0K J;  4LF6 J;  4LF5 J;  4PWW A;  4HHU A;  2UXD J;  4KHP J;  4B3R J;  1HNX J;  4DR2 J;  4JI7 J;  1I94 J;  1FJG J;  4DV3 J;  4GKK J;  1HR0 J;  4LFB J;  5AJ3 J;  4DV0 J;  3IMQ J;  4JI4 J;  5FLX U;  4DR4 J;  4DUZ J;  4JI5 J;  1N32 J;  4DR1 J;  2UUA J;  4LF8 J;  4DV7 J;  2MEW A;  3T1Y J;  4JI3 J;  4JI8 J;  4X65 J;  2UU9 J;  5LM7 E;  5BR8 J;  2UUB J;  2MTL A;  4LFC J;  4JV5 J;  2KVQ E;  4KY3 A;  2VQF J;  1XNQ J;  1XNR J;  4X64 J;  4LF9 J;  3J81 U;  4NXM J;  3D3B J;  2F4V J;  4NEZ A;  1IBM J;  1XMQ J;  4DR6 J;  4X66 J;  4OX9 J;  2UUC J;  4JI0 J;  4V1A k;  2UXB J;  3OTO J;  4AQY J;  5IWA J; 
#chains in the Genus database with same CATH topology
 2P6S A;  1VQ8 S;  3QIP A;  1JLE B;  2VQE J;  2K3K A;  4IRK A;  3CDE A;  2DNO A;  3R1H A;  1SJQ A;  3BO2 A;  2PI5 A;  2G2O A;  1KQF B;  1MRO A;  1YX2 A;  1IBL J;  1KTQ A;  2BAB A;  1U2F A;  3MPY A;  2I2Y A;  1ZA1 B;  5DG9 A;  4AFF A;  3KYL A;  4YHH F;  3GLJ A;  2W1B A;  1T11 A;  4USH A;  3R27 A;  2WRM A;  4F2R A;  5DDP C;  3C6U A;  1PO6 A;  2RRA A;  4ZVT B;  4B3O B;  1FE0 A;  3MAA B;  1FE4 A;  2ZOM A;  3ZTS A;  2XQC A;  3CVK A;  3OFE A;  4X84 A;  2Z2Z A;  3AOB A;  2PFF B;  4CO4 A;  4M5G A;  3CME S;  1PC4 A;  1R8H A;  2UUB J;  1FER A;  2I8E A;  4HT7 A;  2HNZ B;  2ROP A;  3S7R A;  3MM5 B;  3K2Y A;  1FO1 A;  4YB7 A;  2A10 A;  3NMA A;  2X1B A;  1EIY B;  2GS8 A;  4FPI A;  2EBG A;  4DR6 J;  4P7T A;  4DQI A;  1JNZ B;  2NUH A;  3I0S A;  1R8C A;  3JTN A;  3I5A A;  3M8Z A;  2OIH A;  2VFT A;  2MSS A;  2JEJ A;  2MQ8 A;  5D6G A;  3DXS X;  2HIY A;  2FY1 A;  2AU0 A;  3QPI A;  1WC1 A;  1Q78 A;  2C2D A;  1G7C B;  3HHE A;  1P8G A;  1J5E J;  5DZ6 A;  1FEE A;  1OJ4 A;  3V6D B;  3ZTP A;  4UZB A;  3ZNU A;  5F8L A;  4C8L A;  2CFX A;  3AAW B;  5KFR A;  3LGH A;  3GII A;  4DV3 J;  5IV3 A;  4P2F A;  4PQU B;  1NK9 A;  1FXD A;  4I1T A;  3RTV A;  1WHV A;  2Y8W A;  3PFO A;  1H72 C;  4KH1 B;  3MCS A;  5KFO A;  3QO9 B;  3CE8 A;  3HM9 A;  2FUG 9;  3G6V A;  2UUC J;  3MAA A;  1HIY A;  2YBV A;  4O0I A;  3P49 B;  4RW6 A;  2CQD A;  4DPO A;  2HNZ A;  2J7U A;  1QE1 A;  3MM9 B;  3MM5 A;  5A6P A;  5HMW A;  4KV8 B;  3OFG A;  4DPU A;  4HVZ A;  4ZPW R;  5CCM A;  2YPZ A;  2ZOG A;  4DN0 A;  5D0R A;  2HFV A;  1RWW B;  4JP8 A;  1Y4Z B;  1F3V A;  4ED7 A;  4DS5 A;  4N47 A;  2F3J A;  2RE1 A;  4KAI A;  1WI6 A;  1NCL A;  1L3S A;  3LOU A;  4U7C A;  1SL1 A;  4CZC A;  4O3N A;  1RYR A;  2I6W A;  2E5I A;  3CSK A;  2L9N A;  5F8M A;  4K8R A;  2ASD A;  3T6B A;  2FY8 A;  2W4C A;  3KLE B;  3VAH A;  4UQG A;  3CJQ A;  2GAH C;  4PWD B;  2AEJ A;  4F0M A;  1S10 A;  1IKY B;  3AOC A;  2NUU G;  3KHR A;  5DET A;  3OJU A;  5DDQ C;  4CLS A;  5K9F A;  2A2D A;  4DPT A;  4X4Q A;  3L09 A;  2FLO A;  1JMT A;  4ED8 A;  3BM7 A;  1DTT B;  4FZV A;  2YWE A;  4GVL A;  3R2C J;  3CWJ A;  3LQV A;  1VIX A;  1PAU B;  1TEL A;  2DGQ A;  2VHG A;  1D8Y A;  4JI2 J;  3IWN C;  1VK8 A;  4LR8 A;  5LSR A;  1NBE B;  3GIJ A;  1H7W A;  4LSL B;  1YI2 S;  4OHZ A;  2V8D A;  1UVL A;  1HW9 A;  2ZM6 J;  2FTR A;  5JXS A;  2Z2Y B;  4PG4 A;  1CQM A;  4JYA F;  3MM9 A;  5DG7 A;  1H38 A;  1HBN B;  4KV8 A;  5KFK A;  2OEM A;  3NNH A;  3S1T A;  2C2N A;  1G3O A;  4W90 B;  3D6M B;  1AXQ A;  1RBL A;  2ILZ A;  4Q0B B;  2HHV A;  2HGM A;  2GGP B;  4P7V A;  2ZJP Q;  2CVE A;  1FTC A;  1VDH A;  3SCL E;  5KFQ A;  5LJ5 Y;  3CJK B;  3BPD A;  2E1P A;  1KVK A;  3CCJ S;  2Q1L A;  4OYA A;  3HHD A;  3O1L A;  4F26 A;  3PR5 B;  5A0Y B;  5KAK A;  5J1P A;  3M8P B;  3H2U B;  3EZU A;  1FD8 A;  1GTE A;  2OKQ A;  3LAK A;  4URQ U;  4QPT A;  4ATN A;  3HXM A;  4CH0 S;  3KLE A;  4PWD A;  2R2R A;  1KVJ A;  3EXY A;  2HHS A;  2HK2 A;  4JV1 A;  1ZM2 A;  1WHX A;  3IM9 A;  3GJT B;  3OVA A;  3QRQ A;  1N56 A;  2R8I A;  4NLR A;  1DUR A;  4CDI A;  2GHV C;  3T1H J;  3NWR A;  1KOO A;  5I42 A;  3W1Y C;  1QAX A;  4DFM A;  3D9B A;  4N8N A;  2ZE2 B;  4AL6 A;  1XK8 A;  2D74 B;  4B3R J;  4WYL A;  1PCA A;  4RKU C;  4CLL A;  1LW2 B;  4L76 A;  2J0W A;  4LIR A;  4A4J A;  1JX4 A;  3BH7 B;  4DR4 J;  5KFV A;  2O01 C;  1A9N B;  5DDR C;  1VFJ A;  2PE8 A;  4ZLL A;  1EQ0 A;  1SH3 A;  3KHL A;  2WW4 A;  5T7L B;  3KDN A;  4DR3 F;  4D3H A;  1HBN A;  1G1X A;  2CRL A;  2O67 A;  1PC5 A;  1SL2 A;  4ECY A;  5J2N B;  3WIV A;  1LXJ A;  1TUV A;  2ATC B;  4Q0B A;  5H9F J;  4C4W A;  3PYD A;  4HI1 A;  3CUN A;  2GGP A;  3L95 X;  2CPF A;  2W01 A;  2OPS B;  3CJK A;  1DFD A;  1HLW A;  4F3M A;  4B3S F;  4ETX A;  2W2Q P;  2XI3 A;  5ETP A;  1RT6 B;  2XHC A;  4OI1 A;  2JLE A;  2RDI A;  1RT2 A;  2D41 A;  2XWY A;  3JSM B;  3BSN A;  3DLE B;  3GIK A;  3M8P A;  1BE4 A;  4G1I A;  1ACM B;  2HAI A;  4ELU A;  5ETS A;  2KFZ A;  2LVW A;  3V6K A;  3FBC A;  2K7J A;  1MW7 A;  3LF0 A;  5B08 A;  2A6O A;  2IFX A;  2MZ1 A;  1VQL S;  3E3X A;  3PRV A;  1WJ9 A;  2O1P A;  4I0W A;  3J7Y U;  1MG7 A;  3N6N A;  1NPK A;  2GAG C;  2ZVS A;  4GKJ F;  2EKY A;  4P74 A;  3W8G A;  5ETT A;  1UAW A;  4IQX A;  4LF8 J;  2NYI A;  4ZP9 A;  2I0X A;  4FYD A;  1Y5N B;  4WZM A;  5GAD I;  1GMW A;  2NLW A;  2ZE2 A;  1HI1 A;  2JX2 A;  1Q7L B;  4NE9 C;  4CRJ A;  2DGV A;  4Q7A A;  2UV8 G;  3UQS A;  2HFN A;  1LW2 A;  3W2V B;  2D3O R;  3RR8 A;  1F1B B;  2JFD A;  2XMA A;  3RW7 A;  1U26 A;  4F67 A;  4CWB A;  2P9E A;  1J5O B;  1S9G A;  2VQF F;  1W2I A;  3P4U B;  2YTC A;  1NND A;  4LFA F;  3IBF B;  1UZH A;  3IFE A;  5J2N A;  3TAR A;  5KOW A;  3KK3 B;  1HWJ A;  1A6L A;  4DSI A;  1RHK B;  5H9E K;  3KG0 A;  2VIH A;  1TVR B;  1SVD A;  2CQH A;  3N0V A;  1XN9 A;  2WZ1 A;  1F0X A;  3G8S A;  2AJ2 A;  2UXC J;  2OPS A;  4YME A;  1KSP A;  2UUT A;  4WCE Q;  5J2P B;  2YNF A;  4C8M A;  4ECV A;  2WOM A;  1KWM A;  3RW6 A;  3JSM A;  1C0U A;  1NO8 A;  4AYB D;  2HVH A;  1MNE A;  4DSL A;  2AWZ A;  4OMF G;  3DLE A;  1F9F A;  1FJG F;  2YY3 A;  1H2U X;  3NS7 B;  3W3S A;  1EP4 B;  5ETL A;  1YBT A;  5LT5 A;  4DR1 J;  1C1C B;  4ED6 A;  5F41 A;  1WKK A;  2E1A A;  1S1X B;  3WX8 A;  3FRY A;  1QAJ A;  4L3N A;  4JV5 J;  3JSR A;  1RAO A;  2VV5 A;  2QO3 A;  3J81 U;  2BJ7 A;  2HBZ B;  3VGT A;  2CPI A;  2VKR A;  1IBM J;  4X66 J;  2LU2 A;  4IOC Q;  4ZPC A;  4PCQ A;  1CJK B;  4TYA A;  1Z4U A;  4WYW A;  2BQR A;  2E1R A;  4F04 B;  3MMC B;  3P5T L;  2J5A A;  5HK4 A;  3B6B A;  3MED B;  4WE1 A;  4B9T A;  1IM4 A;  3R6G B;  3KLF B;  3DLK A;  2FZG B;  4PKD B;  1FRH A;  3QGP A;  3D3C J;  3W2V A;  4TU8 A;  2J9D E;  4C9D A;  2EFQ A;  1KKH A;  2H5E A;  3BSA A;  2R7X A;  1J5O A;  1RLC L;  2G0C A;  2XYP B;  2ZWO A;  1S6U A;  1LW0 B;  4ZOS A;  2YVS A;  3KK3 A;  2HFO A;  3CJT A;  1FA0 A;  3MMJ A;  3W60 A;  3VAG A;  3H5Y A;  1TVR A;  4C3M A;  2MGZ B;  2WHO A;  5AXN A;  2E9T A;  4JI4 J;  4IO1 A;  3LAL A;  4R8U B;  4RW9 A;  1YKW A;  1VJW A;  4TNO A;  3FK4 A;  5J2P A;  2HUR A;  5HLF A;  2C42 A;  1JLF B;  4Y65 A;  1YJW S;  4B08 A;  3MEK A;  2OFG X;  2XLI A;  4BHQ A;  3V6H A;  1X5P A;  4ZS6 A;  3QBC A;  4UF4 A;  3RGI A;  2XI2 A;  1C1C A;  2DY1 A;  4NLU A;  3HVA A;  2BV3 A;  1MMD A;  1S1X A;  3CJ4 A;  4ZN3 A;  4LQ9 A;  4Q43 A;  2XNQ A;  5KFN A;  5IQ6 A;  1X4C A;  4Z7C A;  1KRP A;  4K7Q A;  5D15 A;  2FPH X;  1CJK A;  3NAH A;  5E3Q A;  1SCJ B;  4M5N A;  2IVM A;  3MMC A;  1UA0 A;  1H74 A;  2CG4 A;  4G65 A;  1NKE A;  2GIR A;  5KG6 A;  1HL6 A;  3I4P A;  3DNC A;  2E7W A;  5KT5 A;  5DM6 Q;  2SXL A;  4RW7 B;  3W62 A;  3R97 A;  3KLF A;  3IN5 A;  3PYG A;  3H2L A;  1VIS A;  1SKW A;  2Z8Q A;  4DN9 A;  4OJG A;  3H8Y A;  4ZVQ B;  3FSY A;  5AE1 A;  4N41 A;  2DIU A;  3EWG A;  3A8K A;  4PEO A;  3MR5 A;  4JI5 J;  1N32 J;  5DS7 A;  4NCG B;  1Q16 B;  3TZW A;  1GQE A;  4W4M A;  1R31 A;  1LW0 A;  1B4S A;  1PJ7 A;  2B8Q A;  2GIF A;  5D4N A;  1JLQ B;  1BWV A;  2IM3 A;  1FJC A;  4R8U A;  2V34 A;  3ENQ A;  3GWC A;  4ILL A;  3ZZZ A;  3CB4 A;  3IR6 B;  1NPP A;  1QUV A;  2QV6 A;  3FDS A;  4FDF A;  4ECR A;  4NLY A;  1JLF A;  2E5L J;  3DRX A;  2IRU A;  3MEG B;  3RB3 A;  2GHP A;  5LMU F;  4K5S A;  2W9B B;  3ICL A;  2IMO A;  2KJW A;  1B3T A;  1HHQ A;  3W9I A;  2GFF A;  3PW7 A;  2V8P A;  3FBB A;  4C0O C;  2ZNZ A;  3IP0 A;  2ALZ A;  5FII A;  2Y9H A;  5A6W A;  4F4A A;  5CD4 A;  2NSB A;  2XB2 D;  4FXV A;  2E5G A;  3I56 S;  4YEA A;  1PGZ A;  3IMQ J;  4MKB A;  5C2C A;  3ET6 B;  3IG1 A;  3DRS B;  4OFZ A;  1S76 D;  5HI7 A;  3QYY A;  5BR8 F;  3BH6 B;  4RW7 A;  1UKU A;  4PXE A;  4K4X A;  1WTB A;  5RUB A;  3MTK A;  3VAL A;  4P72 A;  3UCG A;  2XS2 A;  4W98 A;  3EJM A;  2CZ4 A;  4J9U E;  1K0T A;  2GQC A;  4KGZ B;  3OT9 A;  4E2F B;  2Z2M A;  3MR3 A;  3MAQ A;  3BBF A;  4NCG A;  2NXC A;  1WKJ A;  2HWT A;  1ZM3 A;  3E51 A;  3JB9 k;  2LA4 A;  3VVT A;  3CCR S;  3U02 A;  1JLQ A;  1SC3 B;  1ZBT A;  5GVQ A;  4Y2I A;  5K8O A;  5KFM A;  4Q5V A;  5KFT A;  2QX0 A;  1FEH A;  1ARO P;  2ACM A;  5ITH A;  2IIH A;  1TMM A;  5HQ8 A;  4KO0 A;  2R7T A;  2ZZT A;  2KYX A;  2VPW B;  2W9B A;  2PC6 A;  3S01 A;  2YKA A;  2GW8 A;  1RTH B;  4U8V A;  5L39 A;  3WQP A;  1VCT A;  2J8A A;  4ECW A;  4X65 J;  3TZY A;  3TEH B;  3OL6 A;  2BE2 B;  2DR7 A;  4WII A;  2JC0 A;  4NEZ A;  4GKK F;  3KJQ B;  4C98 A;  1HBO B;  2DIS A;  3SSR A;  1IUJ A;  2QL7 B;  1T9V A;  3ET6 A;  1X4E A;  1RAB B;  4PG7 A;  3Q86 A;  1RHQ B;  4NEY A;  3DRS A;  4DG1 B;  2KO1 A;  3HVW A;  3NL0 A;  3QWP A;  2FVR A;  1CVJ A;  3CDA A;  4B9M A;  1NDC A;  3BQ0 A;  1EJ7 L;  1FWP A;  4P2S A;  3AHP A;  4YN3 B;  4DV6 J;  2XO7 A;  3W9H A;  3TVZ A;  2PEB A;  3G86 A;  3CIM A;  2J6U A;  2V9K A;  2LDI A;  3HSD A;  5KFX A;  1F2H A;  1UWB B;  1IKW B;  5KFB A;  4DR5 J;  3MUR P;  4C7Q A;  3D1H A;  4HAC A;  2FGO A;  2E9R X;  3I9V 9;  2FJW A;  3I9Z A;  3VCD A;  4BDP A;  3Q2S C;  4EBC A;  1S0V A;  1JLC B;  1NXI A;  3L7U A;  1WG5 A;  5KT3 A;  2FVS A;  2XY6 A;  1T03 B;  3CCW A;  4ZN1 A;  3KNG A;  4O3P A;  3NNC A;  3P5B P;  2CUY A;  1EET B;  3EGV A;  3CCE S;  2VG5 B;  3OJS A;  4PXB A;  1SJR A;  1RTH A;  2WVB A;  1AT1 B;  5F9N A;  1LKZ A;  5L1K A;  1FNO A;  2OJ3 A;  3PFE A;  4C6A A;  1NDK A;  3I0R B;  3CD0 A;  5H1S V;  4G1P A;  2ZBP A;  2BE2 A;  4IRC A;  4IFV B;  4FF3 A;  2QFI A;  3MZI A;  3O8W A;  3HJV A;  1HBO A;  3PR4 A;  3CUL A;  5KFP A;  4YHH J;  2UUW A;  4DG1 A;  3V4M A;  1IWA A;  3PTW A;  4FYW B;  4IG0 A;  3LP0 B;  2ERR A;  1O0P A;  2NS1 B;  2Q43 A;  4NXN J;  2B0G A;  1VR6 A;  1X5S A;  3NLC A;  3Q22 A;  4QWB A;  4CH1 A;  1F60 B;  3NGS A;  1NK5 A;  3O44 A;  3PW5 A;  1CUL B;  3ETM A;  1U2C A;  2K1R B;  3GE9 A;  3D5M A;  1UWB A;  5KFY A;  3TYT A;  3Q8Q B;  3R7B B;  2P8I A;  3R5D A;  1RLD A;  3A13 A;  2HS3 A;  4ZHR B;  3HSJ A;  3QFH A;  4XO0 A;  2AZ3 A;  3V81 B;  1JLC A;  3OTO F;  4ILM A;  1P27 B;  4USM A;  4UOG A;  2FJV A;  1T03 A;  2FHO B;  4FVC A;  1VRQ C;  2W24 A;  2R7O A;  2KKH A;  3H20 A;  5ETN A;  3IWX A;  4J9N A;  1GMW D;  3C19 A;  1OSC A;  1EET A;  3WBZ A;  1FJ7 A;  2FVP A;  2VG5 A;  4NCB A;  3CJ0 A;  2VON A;  1IR0 A;  4B3T F;  4H4K A;  4MKY A;  2HBQ B;  1LWF B;  2XCP A;  1LWC B;  1VIO A;  1U45 A;  4LVN P;  4ZPT R;  4MT1 A;  2HPU A;  3M9N B;  3OVS A;  4M63 A;  3HVT B;  2VC0 A;  3CMQ A;  1DQ8 A;  5GME A;  1NK4 A;  3GYG A;  2ZDP A;  2WON B;  4WP3 A;  2CAJ A;  4A47 A;  3UCU P;  4B9N A;  2QA4 G;  3I5C A;  4NA1 A;  2YWF A;  1VJQ A;  1JIH A;  5HSP A;  2V6A A;  5G4D A;  4RLE A;  4WFB Q;  2DGU A;  2OLW A;  5CD4 H;  4FF4 A;  1T9W A;  1WC0 A;  2RHQ B;  2KT5 A;  1CUL A;  1LEO A;  3DFE A;  3DGV A;  4M5K A;  1ZH5 A;  3LWL A;  3M2U A;  2EC0 A;  4XPC A;  3EXC X;  5LXY A;  5KFC A;  1YJU A;  1EZZ B;  4UQT A;  3CD5 A;  3MR7 A;  1Q86 T;  2BJD A;  4F02 A;  3C15 B;  2ZD1 B;  3CT9 A;  4OYO A;  3X3U A;  3G6X A;  5BYQ A;  2UXD J;  3W8P A;  2H4Y B;  4F4W A;  4UY8 5;  4LR7 A;  2I9S A;  3CCU S;  2JVR A;  3LA0 A;  1Z2Z A;  3TWZ A;  4IOA Q;  3W63 A;  4M5J A;  3FQK A;  4DSJ A;  2NRE A;  3M6U A;  2YH1 A;  1K0V A;  1LWC A;  1HWU A;  4FYX B;  4KT0 C;  2AGQ A;  2HHU A;  4MKV A;  4J9O A;  1KEK A;  2RIJ A;  3HFZ B;  2Y1R I;  3HVT A;  1JXV A;  4N7T A;  1RHJ B;  2IBO A;  2WON A;  4NLO A;  1RWN B;  2N7Y A;  4EWT A;  3PYF A;  3HHL C;  1XNQ F;  4CLK A;  1I5O B;  2HSE B;  3QT6 A;  3G2X A;  2E29 A;  2H5I B;  4O4R A;  2XZD B;  3FZ2 A;  5CXT A;  1X9W A;  3TX0 A;  2E7X A;  4UY8 T;  1X7V A;  2NZC A;  3GFH A;  3L3C A;  5H9F K;  3M32 B;  2BZ2 A;  5IFM A;  1FRK A;  4JYA J;  2Z57 B;  1Y9O A;  4DOZ A;  2ZH7 A;  4QR1 A;  2XYG B;  5EDW A;  1UTA A;  2AEF A;  4DPX A;  2V94 A;  3JS9 A;  1SC4 B;  2GO9 A;  2XTJ P;  5DRK A;  3VGV A;  4KGK A;  4A8X A;  5F0W A;  3WDO A;  2ZD1 A;  5IC6 B;  3UD3 P;  3S8S A;  3K7R A;  4A8W A;  5KT7 A;  2AJ4 A;  2K7K A;  2MKJ A;  2XUL A;  3MEC B;  1S6P B;  4ECX A;  2BKO A;  2APO A;  4LQ3 A;  2B9Y A;  2FJE B;  2GJ2 A;  4WTY A;  1X9S A;  1XMQ F;  3H59 A;  1Q53 A;  1C2P A;  1VQS A;  5SZT A;  2HBR B;  1L3V A;  4DX8 H;  4I7F B;  2J9C A;  1DQA A;  2CAD A;  2ZKT A;  1AUD A;  2M8D B;  4IRD A;  2B4V A;  4ALZ A;  3D7S B;  1OQ3 A;  1YDL A;  1TKX A;  5GAG U;  4JI0 F;  2BX6 A;  2CNL B;  3DC2 A;  3DMJ B;  1REV B;  4TKT A;  1UFW A;  1RE1 B;  4ZDN A;  3ZZ0 A;  3GIR A;  2KT2 A;  4NLX A;  1GEH A;  4NYO A;  3R7N B;  5C42 B;  1WF0 A;  2AYG A;  4PWW A;  1Y10 A;  3T5L A;  3G6E S;  1NM2 A;  4OHY A;  5IXU A;  2AJ0 A;  4DZD A;  2GO8 A;  3M32 A;  1RXO B;  1NUE A;  2V5H G;  2WSF C;  2DD8 S;  2KU7 A;  3E8O A;  1AW0 A;  1SJ3 P;  3H5U A;  4Z37 A;  1J2V A;  3FVY A;  2DHH A;  3PY8 A;  4MTP A;  4Y6I A;  2C3Y A;  4I69 A;  1SL0 A;  3ZO7 A;  1Y5L B;  3GON A;  2OFH X;  3SMZ A;  4A8Q A;  4QYZ K;  4A8O A;  3LPE A;  1HFE L;  4B3S J;  2FHK A;  2XLK A;  2K2P A;  4DCP B;  1S79 A;  3MEC A;  1S6P A;  2KVI A;  3RU0 A;  3LH2 S;  4ID5 B;  4QIE A;  4DLG A;  3R3T A;  4C3L A;  2HVE A;  4RUC A;  5A2Q U;  3QJJ A;  2OEL A;  5EUH A;  1BXN A;  3HZE A;  4ZK7 M;  5MLC V;  4I67 A;  5LMN F;  4MK7 A;  4P6Q A;  3NGT A;  1X4A A;  1H2T Z;  2ZBQ A;  2OSR A;  3MMB B;  4PUO A;  1NJY A;  4DL2 A;  3NRB A;  1X31 C;  1RTD A;  2DHX A;  1B0T A;  2JVO A;  4FN5 A;  4X62 F;  4CM0 A;  3CCT A;  2CPJ A;  4B9V A;  1WNE A;  3DMJ A;  2AYB A;  4LUB A;  1REV A;  2UUA F;  4CYU B;  1RZM A;  2VDI A;  4ZLN A;  2V68 A;  4K4U A;  5C42 A;  3HF5 A;  1ZAW A;  3SV3 A;  1VC5 A;  3RBZ A;  2JH3 A;  1M5K C;  1XIQ A;  3MD1 A;  4FS1 A;  2R7V A;  3DM2 B;  1NKB A;  3RZA A;  1N5V A;  2ZKU A;  1U1R A;  4JI8 F;  2QA2 A;  1TUW A;  2A0F B;  2HRU A;  4M5H A;  3SCI E;  4LFA J;  5HBM B;  2D69 A;  4GO5 X;  4AT1 B;  1WC3 A;  3KUE A;  1OMS A;  4ZIV A;  3J81 Y;  1FK9 B;  2UZA A;  4XTT A;  5EGY A;  2OD4 A;  3PEJ A;  3GSI A;  3I82 A;  2B4P A;  3OV7 A;  2XO6 A;  1Q79 A;  2BXJ A;  4JB8 B;  4Q2M A;  2RRN A;  2ZIT A;  1GMU A;  4V19 X;  4ZJL A;  4ID5 A;  1T02 A;  3QID A;  1R27 B;  1I94 J;  1FJG J;  3MM6 B;  3IAM 9;  4ZP8 A;  1ZTT A;  3PKM A;  3OR1 B;  3UFC X;  1MWY A;  2ZBC A;  5B09 A;  3KNA A;  1SKR A;  3TZZ A;  3DI6 A;  1SXL A;  3TJ8 A;  3A3N B;  2RQ4 A;  1S0O A;  2DYA A;  3MMB A;  5B0B A;  2QIF A;  3FBE A;  1EHW A;  4OZJ A;  1BWE A;  3TO8 A;  1NH8 A;  2CZV C;  2DRA A;  3FCH A;  2LYV A;  2BQU A;  1D9F A;  1FI4 A;  2BOP A;  4NOH A;  5E2Q A;  3D28 A;  3SV4 A;  1JLA A;  3KK1 A;  3CO9 A;  3PW0 A;  1MWQ A;  3LAM A;  2ASY A;  3DM2 A;  2EK6 A;  2JEI A;  3LTO A;  5BYR A;  4ED1 A;  3QGG A;  5BYS A;  1TAU A;  1JJ2 R;  3CJ8 A;  2CVI A;  5HBM A;  3NOC A;  2XC9 A;  5ETQ A;  2B7C B;  4YDX A;  4QCL A;  3VZH A;  1EKR A;  1FK9 A;  2CQ2 A;  2V4J B;  2Z0G A;  5U47 A;  2V8G A;  1RAD B;  2R7Q A;  1V3Z A;  1Y3K A;  3A3O B;  3H0P A;  1G4C A;  1BC6 A;  3IRX B;  2Y0B B;  2XZW A;  2FIU A;  4GRS A;  3FUY A;  2MY7 A;  1RT5 B;  1PYO B;  4L6V 3;  3MM6 A;  3DRY A;  2B5J B;  5LSO A;  4V1A k;  1HW8 A;  2C3O A;  2QG9 B;  2HFS A;  4RWX A;  2Y1J A;  3OR1 A;  2C2K B;  2XMW A;  4AUK A;  1HBU B;  1VRT B;  2POK A;  1N5Q A;  4L75 A;  2VDH A;  4UOH A;  4J9Q A;  4TY8 B;  3PM9 A;  3IR5 B;  4CLT A;  3QRR A;  1RT3 B;  4NPO A;  4HH1 A;  2V2K A;  1EX8 A;  3TW0 A;  1SV5 B;  4HHU A;  2PN6 A;  1FTR A;  3B4M A;  1SIW B;  4Y2C A;  3EVW A;  5SUH A;  1WOP A;  3NXZ A;  4L73 A;  1N4L A;  1VQP S;  2HHT A;  1JWW A;  2V4J A;  4ITS A;  4I6Y A;  5D77 A;  2R8G A;  1DLO B;  3Q2T C;  4GMK A;  2R2U A;  3IRX A;  1AZS B;  1R3N A;  4MYU A;  4BWM A;  3LGM A;  4DR7 F;  1MML A;  1KQG B;  2B7B B;  4NLP A;  1U1K A;  2M7S A;  3MPW A;  4DSK A;  1MU2 B;  5LMU J;  1RT5 A;  3QSI A;  2N7C A;  2FLN A;  2B5J A;  2QLX A;  3AQO A;  5KFF A;  4ANE A;  2MHE A;  3PG9 A;  3FNN A;  3TVY A;  3BSC A;  3ZZP A;  4RBV A;  4J9K A;  3TA2 A;  4PRF A;  4N8O A;  4OX8 A;  1HBU A;  4DQS A;  5K14 B;  2CQG A;  1VRT A;  2LP4 A;  2IJR A;  5F3T A;  2N3O A;  4O44 A;  4TY8 A;  2CWK A;  2EVZ A;  1CC7 A;  3K89 A;  2DH9 A;  4LRA A;  4R0J A;  1OY9 A;  2VH7 A;  1S99 A;  4DV7 F;  5BR8 J;  5ETM A;  4DI6 A;  1SV5 A;  1X9M A;  3DKD A;  3K5P A;  3DLL Q;  4F4K A;  1B70 B;  1ZTW A;  1GNK A;  4UOC A;  3H25 A;  4ES1 A;  4DPW A;  3Q89 A;  4OZ2 A;  3RB6 A;  5IOL A;  2CPD A;  4KRW A;  2G9O A;  2GV1 A;  3ZNJ 1;  1Q8I A;  5KG4 A;  2L08 A;  2NPI A;  3OL7 A;  4IQM A;  2K06 A;  5J2Q B;  3PEH A;  1TMJ A;  1DLO A;  4FYY B;  1FFW B;  4ZVO B;  4M95 A;  1U4B A;  2L48 A;  2YQ1 A;  4OI4 A;  3MOJ B;  2XY7 A;  4WXO A;  4EFA C;  3FMB A;  5F3Z A;  3LGN A;  1MU2 A;  1OY8 A;  1VLY A;  2OEJ A;  3PCO B;  1UW4 A;  3RG6 A;  1TK5 A;  3W5Y A;  4MK8 A;  4K4V A;  2J7W A;  2B8P A;  2ZHB A;  2DTJ A;  2Q6C A;  2MZQ A;  2AX0 A;  2FLL A;  5D8H B;  2HIQ A;  4KPY A;  4RR5 A;  5K14 A;  1RIS A;  2HS0 A;  2V69 A;  2FGC A;  2RS8 A;  5F8I A;  2CQ0 A;  2U1A A;  4Q44 A;  3RAQ A;  3BBC A;  3KLV A;  1KHW A;  3UE2 A;  3QGH A;  1NDL A;  3N9U C;  2EFG A;  2PD1 A;  2PMH A;  3G71 S;  1UVJ A;  2FVQ A;  2HHQ A;  1ZM9 A;  5HO4 A;  4JBC A;  1U6Z A;  2MST A;  3D1Q A;  4K4T A;  4QW9 A;  4A8F A;  3O5T B;  1GX6 A;  1UFK A;  2BW7 A;  2LU1 A;  1WDD A;  4K0K J;  2V2Q A;  3LUY A;  5J2Q A;  2QZ8 A;  3OW2 R;  1HQU B;  5AXL A;  3GCW P;  4OYI A;  3HJF A;  4OI3 A;  1PYT A;  2BA9 A;  4DPY A;  3RR7 A;  4LFC J;  1RU1 A;  2ZJR Q;  1FD2 A;  3GYX B;  5T41 A;  1ULR A;  2LEB A;  3L7P A;  2C2O B;  3MHY A;  2YWG A;  3M1V B;  4DV0 F;  1UVN A;  4F0H A;  3QZ8 A;  1NSP A;  1EQM A;  3GV7 B;  3UVJ A;  3T5J A;  3OXG A;  5B0F A;  2ZWP A;  2MXY A;  4KBI A;  1F5A A;  4MYT A;  5FD1 A;  1N5Y A;  1N34 J;  3VAJ A;  3L4B C;  2HQG A;  3PW2 A;  1RTI B;  2WVC A;  1KOH A;  4WK1 A;  5CYJ A;  3HDS A;  3M2R A;  2OTJ S;  2CJB A;  2QGF B;  2NSC A;  1WHW A;  1S1T B;  1SQE A;  1FES A;  4F4Z A;  2BOA A;  1VQ5 S;  3BQ2 A;  5KFI A;  4DDF A;  1EAY C;  1R0B G;  2VG7 B;  3AB2 B;  3PVX A;  1RWP B;  3N01 A;  3GMG A;  5HN0 A;  2KTQ A;  4O3O A;  1D09 B;  2VJV A;  1SQG A;  3N28 A;  3WIU A;  1HNV A;  4Y2K A;  2R7R A;  2WBR A;  1ZAV A;  4J37 A;  1AB8 A;  5HJY A;  5CA5 A;  4FBU A;  2BDP A;  5I3Q A;  3M8S A;  2FHJ D;  5J1E B;  4NXM F;  2FJX A;  1KNZ A;  1HQU A;  4C8O A;  4J9S A;  5KG5 A;  5GAH U;  2ZHA A;  3OTO J;  2E7V A;  3US5 A;  2YKO A;  1LOU A;  1DZ5 A;  3DOK B;  1Y7P A;  4CI0 B;  2Z2L A;  1AFJ A;  5I3P A;  4MIW A;  3M4X A;  2QA1 A;  3M9O B;  2OGU A;  2HWH A;  4DHV A;  3G8T A;  2J9D A;  5KFE A;  2EEY A;  1PJ5 A;  1R0C B;  4B3T J;  3M1V A;  2KXH A;  2HRY A;  5LOQ A;  1S1W B;  1SIZ A;  4LBI A;  3CPW R;  4P2X A;  4JI6 J;  1FXL A;  4PAB A;  2GML A;  3PDN A;  2AYM A;  3OTD A;  3TAQ A;  3TQ1 A;  4M5M A;  4C2M A;  1U6F A;  3HX9 A;  1IBL F;  3SZ2 A;  4DQR A;  1QSL A;  2QL9 B;  2DNL A;  2AGP A;  3RBE A;  1HR0 F;  3QNW B;  4CO2 A;  4C0H A;  1YBA A;  2H65 B;  4DFP A;  1S1T A;  4PWU A;  1HYS B;  3H40 A;  2D3U A;  2VG7 A;  5KFJ A;  2YXL A;  2IAJ B;  1U1O A;  1M5H A;  4BCA A;  1MSW D;  1K1S A;  3MCO A;  1NHU A;  1WSR A;  3PAC A;  5DGB A;  2UUB F;  2AV5 A;  1F9E B;  3F0N A;  5EWF A;  1RGV A;  3BF4 A;  1MMN A;  5J1E A;  2GJF A;  2LXF A;  4H4O B;  1NJX A;  4NZ6 A;  1HAR A;  4DEZ A;  3N4W A;  4JUZ A;  4ED4 A;  4DU8 A;  2KM8 C;  5A8K B;  4NI2 B;  4LRE A;  4HYK A;  3DOK A;  1C0T A;  3JYT B;  2DVI A;  2AT1 B;  4OV6 A;  3IGN A;  1IN0 A;  3IS9 B;  1F5B A;  3G6Y A;  2J0X A;  3EVM A;  5KFG A;  1LXN A;  4LF6 F;  1NSQ A;  1RYS A;  3GU0 A;  4ICL B;  1J5E F;  4CLY A;  1S1W A;  1UP1 A;  2KG0 A;  4YS2 A;  1N0V C;  1K47 A;  2LXI A;  2MKS A;  1HI8 A;  1KR4 A;  2QL5 B;  3MGJ A;  1YZ7 A;  5F8J A;  2RS2 A;  1NB2 A;  2MQM A;  2WVD A;  3AOA A;  1IM6 A;  3SXL A;  3VHQ A;  4LF9 J;  5C25 A;  2IM2 A;  1Q5Y A;  1HWL A;  4DV3 F;  1YG0 A;  2EFO A;  3SBM A;  2UXB F;  3RAM A;  2RVJ A;  1RWO B;  4X4R A;  2BRL A;  2B56 A;  1WOO A;  4TQR A;  3DRR B;  2R2T A;  1HMV B;  1PYS B;  3EYZ A;  4Y28 C;  4FPR A;  1HYS A;  2CQI A;  4WFX A;  1Y11 A;  1VK3 A;  2KB2 A;  2NZ4 A;  2IAJ A;  1S9F A;  3ZZT A;  4BS2 A;  1Q7Y T;  4YB1 P;  1T9X A;  2KL8 A;  4G3I A;  2UP1 A;  3G87 A;  4U7U K;  1IBK F;  2F63 A;  2V2Z A;  3QLH B;  2GVZ B;  4YFU A;  1YSJ A;  1L5U A;  3U1L A;  1ROF A;  2OD6 A;  1I3O B;  3J7A N;  2PSZ A;  4UTG A;  2ZVI A;  4Y0F A;  4FF1 A;  3ZFV A;  4H4O A;  4NLV A;  3ZZY A;  3KTQ A;  2XBP A;  2KFY A;  2MB0 B;  2NYH A;  5A8K A;  4NI2 A;  2CPY A;  3KOA A;  2C2R A;  2CA9 A;  3R5C A;  1RAF B;  3S6E A;  1WG1 A;  1YJ9 S;  3HT0 A;  3IS9 A;  1YTY A;  4P10 A;  1OPZ A;  1XNR F;  3Q23 A;  5DM7 Q;  1XMQ J;  2XYH B;  5GAG I;  4ICL A;  1NJZ A;  3QRP A;  1N6Q B;  2HRT A;  2YNG B;  2YX7 A;  2MKY A;  3AJ2 A;  1NEE A;  3NS5 A;  3CD7 A;  2C22 A;  2F8H A;  2B9W A;  2AZ1 A;  2JZ5 A;  5CCL A;  1JLE A;  3ADA C;  8ATC B;  2H5J B;  3OHB A;  4YY3 F;  2XGP A;  4AXJ A;  3X1L B;  4M5I A;  3J80 U;  2DNK A;  4FKX A;  3ENW A;  4TQS A;  2RSQ A;  1YJN S;  3DRR A;  1HMV A;  2F40 A;  2QRR A;  3HKZ D;  3M8R A;  2BMB A;  2C2E A;  4JI2 F;  1OIA A;  4FNH A;  2Q66 A;  1HNX J;  5E5N A;  4M5D B;  3TRG A;  4ED3 A;  3HCX A;  1T94 A;  5HAO A;  1VBK A;  2Y1I A;  4EGL A;  3PHT A;  5A76 A;  4B3O A;  4LBP A;  5A2Q Y;  2ZM6 F;  1CJU B;  2RD5 C;  2GVZ A;  5J2M B;  4A46 A;  4NLD A;  5ETR A;  3OR2 B;  3ZC4 A;  1CJT B;  1Y00 A;  3J7Z 5;  5F9L A;  1SKU B;  2MJU A;  1UFL A;  1A7G E;  3M6V A;  1WD6 A;  3W66 A;  3SQG B;  5HVH A;  3CJS A;  1S6Q B;  4TXS A;  1HNZ J;  3B82 A;  4ZKA A;  5D4L A;  5KG2 A;  2ZH5 A;  1RI7 A;  2OPR B;  4ZP6 A;  2MJN A;  2R7S A;  3EZ5 A;  1L3U A;  4UW2 A;  2Q3P A;  1VHF A;  5I3U B;  1FRL A;  2YNG A;  3K8V A;  4AD6 A;  1GXT A;  1IKV B;  4URS A;  4BWJ A;  4PPD A;  2X7I A;  3BN4 A;  4G1Q B;  2KHC A;  4Y00 A;  1TV6 B;  4ES3 A;  5KFW A;  3V6D A;  3IBW A;  4DV1 F;  2G2Y A;  3UI3 A;  1ZET A;  3OXL A;  1U1L A;  1XER A;  2DH8 A;  1IJF B;  1I51 B;  3TUI C;  3T1H F;  1X5O A;  2CG8 A;  3JQJ A;  2UUA J;  4PQU A;  4F4X A;  4CT8 A;  1N5T A;  2M9K A;  3D68 A;  4DL5 A;  3H7H B;  5B0G A;  4B3R F;  1GAO A;  1WSV A;  4ILR A;  2XMU A;  1X4F A;  4M5D A;  3K5M A;  3QO9 A;  2O3D A;  1Y5I B;  3BYR A;  1U1M A;  2RDD A;  2EI5 A;  4XDC A;  2ZHO A;  4F0K A;  3PNI A;  1CJU A;  5J2M A;  1NSK L;  3OR2 A;  3QMQ A;  2WB4 A;  5AE3 A;  1NK7 A;  3IR7 B;  4NWB A;  3CTR A;  2CKW A;  4I68 A;  2B9X A;  3QAE A;  1FWL A;  3EUN A;  4B02 A;  2DY9 A;  3WC2 A;  3UCZ P;  2HBY B;  3JTP A;  3IAS 9;  3N5F A;  3SQG A;  2ZFH A;  5KT4 A;  4CO0 A;  1S6Q A;  1Q1K A;  3B8H A;  1D1U A;  1WEL A;  2KYZ A;  2LXU A;  2RQC A;  1I1G A;  1CEZ A;  3AT1 B;  2DEI A;  2OPR A;  4L72 B;  3OBI A;  4PG5 A;  1UVM A;  2VAS A;  5I3U A;  2QSF A;  1X4B A;  4NA3 A;  3H5X A;  2R3V A;  1WI8 A;  5M2P A;  1IKV A;  5D0G A;  4WFA Q;  9ATC B;  4TY9 A;  4IOB A;  1UPP A;  2DNY A;  2MQP A;  3NAI A;  1TV6 A;  3NEK A;  3AXK A;  3GJQ B;  1UZD A;  3Q8P B;  2VL1 A;  4H4K C;  5E3R A;  2YNH B;  4USJ C;  4KQZ A;  2NCK L;  2XHW A;  1X0F A;  2HVZ A;  2DJW A;  3FZB A;  1IKY A;  3R7S B;  4CLP A;  1VQM S;  2BE9 B;  4ZPV R;  1VS3 A;  4WTO B;  4GO7 X;  3TX8 A;  2GCF A;  2G1H A;  3TZX A;  4HHJ A;  4YUD A;  1XR5 A;  3TUP A;  2EG1 A;  2BW2 A;  1DTT A;  2E66 A;  2N4C A;  5D0E A;  4ED2 A;  2CYY A;  4OJH A;  4RNN A;  2RU3 A;  2KFN A;  1R43 A;  1S0M A;  2LEC A;  4DV4 F;  2G4B A;  5JJB A;  3F56 A;  1CJV B;  4WF9 Q;  1UMJ A;  4LSL A;  5GAD U;  1XMB A;  3KHG A;  3P6Y C;  2W4P A;  1Y0H A;  3H42 A;  3ZTQ A;  3QAU A;  2M5Y A;  4C8Y A;  1KP6 A;  4JI7 J;  4LRC A;  4FXW A;  2M52 A;  5E7O B;  3ENV A;  2M70 A;  3MM8 B;  1Y3J A;  1IXK A;  2UXC F;  2EFP A;  3SSS A;  5LM7 E;  4L74 A;  3MXH P;  3VQS A;  4OI6 A;  5HRO B;  1VQ4 S;  4C48 A;  3GV8 B;  1XJW B;  5IQQ A;  1WEZ A;  3GG1 A;  5F8N A;  4OI2 A;  2Y0S D;  5A0Y A;  2CQC A;  1FRI A;  1SJ4 P;  3H90 A;  3M30 B;  5L1J A;  3G82 B;  2VA2 A;  3GJR B;  2YNH A;  3MPD A;  4ZVF A;  2ZEJ A;  1WDT A;  4LSN B;  5D4O A;  4NMX A;  3KXD A;  4X2B A;  4RPF A;  1UCN A;  3THV A;  1F2G A;  3QT5 A;  4DCJ B;  2BQ3 A;  1M5V C;  3FFI B;  5IT9 U;  4ANC A;  2NXJ A;  2DNH A;  3IC1 A;  3OPK A;  3D66 A;  3HHK A;  4CLU A;  1CJV A;  4CM2 A;  3MDF A;  1R7I A;  2XNR A;  4JI3 J;  3AOD A;  2LQ5 A;  1Q81 T;  2ZUA A;  5T7L A;  2W9C B;  2BVZ A;  3BKT A;  4IG3 B;  5JVG Q;  1QY7 A;  3MM8 A;  4JI4 F;  4YOE A;  4ZMM A;  1TL1 B;  2IYG A;  2XMV A;  4NZ0 A;  1C4A A;  4LF1 A;  2IMW P;  1Z2L A;  4DR7 J;  2ZH2 A;  4AL7 A;  3HMJ G;  1S6O A;  5HRO A;  3D54 A;  5H9E J;  4ED5 A;  2JLF A;  4K59 A;  1L3K A;  3HSG A;  3V2U C;  4QWD A;  1RT6 A;  2COL A;  1F5C A;  3PV8 A;  2HNY B;  2EPI A;  1M1H A;  1YRU A;  2OH2 A;  2WBM A;  4OV1 A;  2VPZ B;  3HD2 A;  2W7O A;  2ZOF A;  3SDE B;  1CLF A;  1QM9 A;  3M30 A;  2AJF E;  3G82 A;  5CYQ B;  3JQK A;  1B99 A;  4DS4 A;  3HHL B;  1H3D A;  4LSN A;  4CO3 A;  1VLO A;  3A8J A;  4H54 A;  4WZQ A;  2PII A;  3Q8R B;  2ASL A;  4Y2M A;  2CPE A;  4DV7 J;  3MWB A;  2RDJ A;  2R42 A;  5KFZ A;  3FFI A;  4XAK A;  2UU9 F;  1UW9 A;  2EBE A;  2CQ4 A;  2P9C A;  9RUB A;  5KFD A;  4UST A;  4S0M A;  4JI5 F;  1N32 F;  2M3D A;  1LWE B;  2DNM A;  2ABY A;  1BUX A;  5IWA F;  1QAI A;  2HWI A;  4QJV A;  2YQ0 A;  2YPY A;  1B0V A;  2V63 A;  2W9C A;  2W2O P;  2C1E B;  1EKS A;  3C6T B;  4IG3 A;  2IVY A;  1NJW A;  4QZV B;  3KK2 B;  4K4W A;  1EAR A;  4OL8 A;  4KC5 A;  2YWH A;  4B3M F;  3CC2 S;  4MIA A;  1S97 A;  3RYL A;  4YR0 A;  2HVD A;  3KUG A;  1ICE B;  3TVK A;  2EC2 A;  2E5L F;  2VZ9 A;  1MN7 A;  1P9Y A;  3DRP B;  4FKY A;  2BEF A;  2M0G B;  3T5K A;  1NSA A;  4HR2 A;  1TP7 A;  4NCA A;  2VBY A;  2CJY B;  1OYE A;  4USI A;  2CJQ A;  3FRZ A;  4O4G B;  3V4I B;  2HNY A;  1LK7 A;  1JXL A;  5GMD A;  2RB7 A;  2ATL A;  3C3L A;  2FHM A;  1EP4 A;  3JQM A;  3SDE A;  3BDE A;  4K2J A;  5CYQ A;  3D1O A;  3A4T A;  3HHL A;  4Q45 A;  4HLB A;  4CLF A;  7FD1 A;  1R0A B;  5C2G A;  5CAA A;  2LLZ A;  2H1Y A;  4KKO B;  1DJ0 A;  3QFW A;  4MMO A;  3M2V B;  1FNX H;  4LSZ B;  1DY3 A;  2OTL S;  4IFY B;  3MED A;  2IDE A;  3T6J A;  1JXE A;  1SB6 A;  4X4V A;  3TNV A;  2DGW A;  1S1V B;  2IC3 B;  6AT1 B;  1LWE A;  2BR0 A;  2PA3 A;  1H73 A;  2E5J A;  2Y1L B;  4QIV A;  2F5G A;  3GB0 A;  3T9N A;  2CIM A;  6FDR A;  2HZV A;  2AQ4 A;  2CDQ A;  3C6T A;  1NKC A;  1R8P A;  1LNQ A;  2GIQ A;  5GMK a;  1IKX B;  4PYA A;  4A8K A;  4Q8F A;  4AE5 A;  2RKI B;  1FNM A;  2MGZ A;  3FGV A;  3V5R A;  1KD1 T;  2QMU B;  1VI7 A;  1P6T A;  4EO6 A;  4DX6 A;  4MKA A;  1DRZ A;  1JLG B;  5F0U A;  4CCH A;  4N5S A;  4WU2 A;  3M9M B;  1DTQ B;  1S4F A;  4O4G A;  2OEK A;  3V4I A;  3ISN C;  3QIP B;  4D3G A;  4X65 F;  1RT4 B;  4P9S A;  1R89 A;  2RT3 A;  3NGU A;  2CPH A;  3TJA A;  1V5I B;  2RQK A;  1R0A A;  1WKL A;  2HFZ A;  3CCZ A;  2RU9 A;  4KKO A;  4XDD A;  2VBZ A;  3M2V A;  3A3P B;  2AIR B;  2E1M C;  1N48 A;  4ER8 A;  3W65 A;  2EK1 A;  4YP3 A;  4U6P A;  4ZLP A;  5KFS A;  4IFY A;  3HKW A;  3I31 A;  4J9M A;  1CG2 A;  1X0P A;  4DV6 F;  3BEG B;  2HKE A;  4IR1 A;  4DR2 F;  1S1U B;  2IC3 A;  4RUA A;  5GAH I;  2HK3 A;  4DXL A;  1D3W A;  1H0H B;  4Y3C A;  1T0T V;  3QWU A;  1FDD A;  1SI9 A;  1JQG A;  3WX4 A;  1JJ4 A;  3RRH A;  5A8W B;  1U0S A;  2ZH9 A;  4LIW A;  1YJV A;  4NXM J;  2MZJ A;  3OFH A;  5AT1 B;  3KJV B;  1TKZ B;  3M05 A;  4N56 A;  2C2Z B;  1XC9 A;  1R8B A;  4UT4 A;  1YIT S;  1LWX A;  2YNI B;  3BYP A;  2UVW A;  2KG1 A;  2RKI A;  2ROE A;  3HZG A;  3MR6 A;  4J91 A;  3T5H A;  1HNW F;  4RJV A;  3TOQ A;  4MH8 A;  4WIQ A;  1GMV A;  2YKQ A;  4U95 A;  4OJ3 A;  2BE7 D;  2RUS A;  4EMD A;  1F3F A;  4I64 A;  4CTA B;  2CQ3 A;  1DTQ A;  3MEG A;  1NH7 A;  3F41 A;  1RT4 A;  3PIP Q;  1TL4 A;  2JEF A;  3TI0 A;  2HHH F;  2DCL A;  3SCJ E;  3MD3 A;  3K5L A;  2AYE A;  4RX6 A;  2OPQ B;  4I2P B;  1SH2 A;  2C3P A;  5IM0 B;  4KHP F;  2X1G A;  1GK8 A;  4DCO B;  1HR0 J;  1WEX A;  2NXN A;  3N5B A;  3VF0 B;  4CLW A;  3OTE A;  3CIZ A;  4M5L A;  2H3E B;  2NXU A;  4I6A A;  1YWX A;  4TYB A;  4NXN F;  1YZ6 A;  2MZT A;  1HD0 A;  4FNI A;  1VOM A;  3IRW P;  3AJ1 A;  3CO0 P;  4N76 A;  1S1U A;  2L41 A;  3BV8 A;  2Z58 B;  4B9S A;  1ZM4 A;  2PDA A;  4RW6 B;  1QE1 B;  3SEO A;  3MI7 X;  1A0O B;  5A8W A;  1RK8 A;  4RZR A;  3I5B A;  3KJV A;  1TKZ A;  1N54 B;  2CZ9 A;  3IO1 A;  3PO4 A;  2YNI A;  4RNO A;  2DXF A;  5IS2 A;  3AD8 C;  3R1L A;  1U1Q A;  1IQZ A;  2HHP A;  5KFA A;  3OHA A;  3QJL A;  4HDH A;  3DN9 A;  2AHO B;  2CJK A;  4HTJ A;  1S4E A;  1GT8 A;  1NPR A;  4LF6 J;  5E3C A;  1EB0 A;  3N79 A;  2X51 A;  4CTA A;  4FVM A;  3RJM B;  1OQ6 A;  3I6P A;  3GFZ A;  4IH5 A;  3L9Z A;  3ILJ A;  4YQW A;  3O3L A;  4QU7 A;  2KXF A;  3CF5 Q;  2DPI A;  2OO4 A;  1URN A;  2OPQ A;  4I2P A;  1FF2 A;  3ULH A;  2MHN A;  5IM0 A;  2UXB J;  1WOR A;  4PG6 A;  2OML A;  4TU7 A;  2AW0 A;  3GZ7 A;  2P6T A;  1HHS A;  2L9D A;  3H4B A;  2HND B;  2JC1 A;  5FJ4 A;  4PXD A;  1OO0 B;  4A8M P;  3LO3 A;  3FCW A;  3G8Q A;  3QQC D;  1CSJ A;  1HA1 A;  4LMZ A;  2LEA A;  1IBK J;  1TR0 A;  3G4S S;  2MKC A;  2GMH A;  2FC8 A;  2V67 A;  1VQK S;  4QOT A;  3PRB A;  5JMN A;  4E8U A;  1KFS A;  3GG0 A;  2ALY B;  3BSO A;  3KLH B;  1P9Q C;  1RBO B;  4NRT A;  1IKW A;  1VBY A;  3PJX A;  4AND A;  2IHR 1;  1AFI A;  4LR9 A;  2JJ4 D;  2KZM A;  2Q79 A;  4ZPD A;  3CXC R;  5D3G B;  1NAQ A;  3J80 Y;  1YBU A;  4DUZ F;  1N5S A;  4Y34 A;  1WF1 A;  3GIL A;  3HPO A;  3W5Z A;  4G6V B;  1XNR J;  1WEY A;  2UXD F;  3KG1 A;  2E1C A;  3M8W A;  2EFN A;  3PHE A;  3ISZ A;  1KQS R;  1OWX A;  4AQY F;  1FKA F;  4ED0 A;  2VFV A;  2W2P P;  2U2F A;  1HQ2 A;  3DLG B;  4OYM A;  5CQG A;  2MZS A;  4OHX A;  3I0R A;  4YY3 J;  3VAI A;  4IFV A;  3JAM U;  1YJT A;  4UOF A;  5I42 B;  4ECZ A;  4RBT A;  3D4J A;  1LFP A;  3H5S A;  1K44 A;  2HND A;  3DDI A;  3LP0 A;  3U1N A;  2MLX A;  3QSY B;  1GTH A;  4HTI A;  2ASJ A;  2XG8 A;  1YQH A;  3MMA B;  5FLX U;  4R5P B;  1S48 A;  4PR6 A;  1TKT B;  2CNK B;  2RIL A;  1WC5 A;  3T19 A;  3RBD A;  3T1Y F;  4J9L A;  2K1R A;  3KLH A;  1JKH B;  3MEE B;  3O2I A;  3QGI A;  4NML A;  4BC7 A;  3BO3 A;  4DWI A;  3BRE A;  1LV5 A;  3RAX A;  3TJ9 A;  5D3G A;  1KS2 A;  4ZHR A;  2OPP B;  2R7W A;  3V81 A;  4DFJ A;  2F1F A;  4NLS A;  1RT2 B;  3DLJ A;  3KKF A;  1OSD A;  4LRF A;  2D9O A;  4DL6 A;  1RKI A;  4OX6 A;  2RNE A;  2KN4 A;  4TLQ A;  3VV2 B;  5THW A;  4URG A;  3R9L A;  2NQP A;  2WW8 A;  3BQ1 A;  4DV1 J;  2B43 A;  3DLG A;  1U09 A;  4TLR A;  1IR2 A;  1Q95 G;  1LWF A;  3QT8 A;  1IQT A;  1PG5 B;  4MJK A;  1RQ0 A;  4HEA 9;  2ZZM A;  2DCU B;  1SJ1 A;  1G6B A;  1E6Y B;  2CQ1 A;  1H6K X;  4ID8 A;  1Q4R A;  3MOZ A;  4QBU A;  5AJ3 F;  4WK3 A;  3C8Y A;  2DIV A;  5D0H A;  4DX5 A;  2CDR B;  2F7V A;  4X64 F;  2PGC A;  3IBC B;  2WSC C;  2O5D A;  3CDU A;  2R8H A;  3MMA A;  4DF8 A;  4R5P A;  1S9G B;  3PJ9 A;  1TKT A;  4P2M A;  3D6T B;  5L8R C;  5DQI A;  1ZPW X;  2J0S D;  5CH7 B;  3K57 A;  2C3M A;  2HZA A;  1K8A T;  1JKH A;  3MEE A;  1WUU A;  3HHL D;  1UJ4 A;  2OP5 A;  3NBP B;  2HW3 A;  3VGS A;  4EYH B;  3KJN B;  2V8H A;  4IR9 A;  2YNF B;  4M1K A;  3LAN A;  4DZ6 A;  2OPP A;  2MQQ A;  2WOM B;  4K4Y A;  3C15 A;  1C0U B;  1RAC B;  4CO1 A;  2C28 A;  1W7W A;  5DQH A;  4ETZ A;  3TUZ C;  3UN2 A;  4DMZ A;  5E3P A;  1S59 A;  4I4B A;  4OLO A;  1SQF A;  2P5V A;  3BGR B;  4KHM A;  2XSF A;  3ZZR A;  2H9Z A;  3C66 A;  2NR0 A;  2F8E X;  1E6Y A;  3EGW B;  1PJ6 A;  2BM1 A;  2VFS A;  4OX9 F;  3DOL B;  2F9D A;  4K5R A;  4U9R A;  2HHX A;  2R9L A;  2H51 B;  3HLU A;  4WE1 B;  4ZCL A;  3DGP B;  3SYZ A;  4PPZ A;  3FCV A;  2F9J A;  3DLK B;  2RML A;  1OYD A;  4DV4 J;  5HJX A;  2XMJ A;  1RA7 A;  2Z56 B;  3K17 A;  4U67 Q;  2DR5 A;  1FKO B;  4YR3 A;  4YB5 A;  4R25 A;  4DR3 J;  4FP9 A;  2H54 B;  2PO4 A;  3A12 A;  1Q8L A;  3D0I E;  1YIJ S;  3NBP A;  2J76 E;  2WVF A;  3JSY A;  4RW9 B;  1IR1 A;  1FXR A;  2CJA A;  3BO4 A;  4OJ1 A;  4FS2 A;  5HLF B;  1RJJ A;  1BQN B;  1RCX B;  8AT1 B;  2LMI A;  3NGK A;  2IM1 A;  3U7J A;  1UPM B;  3LP1 B;  1ZAX A;  3MUT P;  1F9H A;  1TZ0 A;  5K8N A;  1T95 A;  3Q8Y A;  1FWK A;  1HWI A;  3FSX A;  5IT9 Y;  1Q8B A;  1I94 F;  4QYZ J;  3GJS B;  2I38 A;  3CDW A;  3MFI A;  2W4D A;  3DYA B;  2XMM A;  4FYV B;  3OTB A;  3J7Y I;  2WVE A;  2W7A A;  2RF2 B;  3BGR A;  4DL7 A;  1U8W A;  4WKY A;  4I7F A;  1YK9 A;  1HPZ B;  2GVD B;  3RBX A;  2Q6B A;  3ZZU A;  4KB7 A;  3QJP A;  2IA0 A;  5JUM A;  2KRR A;  2HEK A;  2VBX A;  4OZ1 A;  4Y2A A;  2YQ3 A;  2FHJ A;  3CDB A;  3TAN A;  1HWK A;  4MAK A;  3DOL A;  3FJ2 A;  2W25 A;  4DFK A;  4GKJ J;  3DGP A;  2C3U A;  3TA0 A;  2WK4 A;  1RHU B;  2HAF A;  5GAE U;  3CC7 S;  3OD2 A;  2QTW A;  2KZZ A;  1X4D A;  3ONQ A;  1PBA A;  2WSE C;  1S57 A;  3PIO Q;  3UD4 P;  2GJI A;  1B0P A;  2V4Q A;  1IVZ A;  5BXI A;  2R7U A;  3AD7 C;  4KGV B;  3Q8S B;  3THP A;  4H4M B;  2DRD A;  3ILL A;  3AXM A;  2KM8 B;  3NCR A;  1FKO A;  1UEV A;  2BKN A;  2B4O A;  3TP2 A;  2VQF J;  2GX8 A;  2DRB A;  2XM3 A;  2OI2 A;  2HLU A;  1NJI T;  2G1D A;  1RP5 A;  5DLF A;  3MUV P;  4MFB B;  3OVB A;  3PZP A;  4ZVG A;  3K58 A;  4OZ3 A;  2JWN A;  2BAC A;  1BQN A;  3T1A A;  3LP1 A;  1TL3 B;  3K5N A;  2CJX B;  4DSF A;  2CQP A;  4WKR A;  4LJM A;  4J90 A;  2J7K A;  3LP2 B;  4LVO P;  2EG2 A;  3UR3 C;  4EUV A;  3DYA A;  4RO0 A;  2RF2 A;  2M2B A;  2PT0 A;  2YKP A;  4P71 A;  4EBD A;  3JXO A;  2QLB B;  4CO5 A;  1HPZ A;  2GVD A;  3POT B;  5IV4 A;  1PAE X;  4QYR A;  2FDN A;  1FVS A;  5HMZ A;  5L9X A;  2MQN A;  4AL5 A;  3DHW C;  1GFW B;  2ZH4 A;  1XBW A;  2JLG A;  3IG1 B;  3KUH A;  1N8R T;  1RUS A;  3UNG C;  3ITH B;  1RBA A;  3Q8U A;  2UU9 J;  3GR0 A;  2P9G A;  2ZH3 A;  2R4F A;  3KMS A;  1RAA B;  4CYU A;  3UW1 A;  3N6M A;  4DX7 A;  1FX2 A;  1BMQ B;  3TA1 A;  1ZYQ A;  3EIC A;  3M7V A;  4OYB A;  4CNY A;  1NZA A;  1K1Q A;  1QJH A;  1URR A;  8RUC A;  1C4C A;  1VC0 A;  2AEM A;  5IWA J;  1Q82 T;  1UEK A;  4H4M A;  4BC9 A;  4K2X A;  3L7O A;  2R2S A;  5ADZ A;  4OX7 A;  2DEJ A;  4IDK B;  4NLW A;  3SFG A;  3SCK E;  2K8G A;  1FJE B;  2W7P A;  3EVO A;  3OL9 A;  1I6J A;  3SIP B;  4MFB A;  2FJB B;  1QLN A;  3UPF A;  2LKZ A;  4B3M J;  1JK9 B;  2ZH8 A;  1QVG R;  2A18 A;  4EZ9 A;  4Z7Y A;  2HZC A;  4KO0 B;  1B7F A;  1TL3 A;  7AT1 B;  1VGY A;  1U24 A;  4NAS A;  3TAP A;  4HH0 A;  1HHT P;  4J9R A;  5KT2 A;  3LP2 A;  2ADB A;  4LF5 F;  2DNZ A;  4KE5 A;  4ZJQ A;  2HHW A;  2LQJ A;  2FC9 A;  1PKU A;  2CWX A;  2L9W A;  4J9V A;  1QTN B;  2M8H A;  3POT A;  4ENO A;  2J6S A;  1ZOT A;  2LCW A;  2VFR A;  4ZVS B;  3EGZ A;  4DUT A;  4X4P A;  5CYM B;  2XMT A;  1K9M T;  4K50 A;  2VPX B;  3MAH A;  2E9Z A;  4NYZ A;  1HI0 P;  2PEH A;  4KGM A;  5CZX A;  4BBY A;  3ITH A;  1N33 F;  2ILY A;  1U2R A;  3DDN A;  3SQO P;  1RWK B;  2JDJ A;  3GCX P;  1BGX T;  2DGX A;  2NXE A;  4ZIW A;  1HNI B;  3GQC A;  4RW8 B;  3GIM A;  3E01 B;  1N36 F;  1T9U A;  4ZA1 A;  4ZVU B;  4QU6 A;  3CCQ S;  1FRJ A;  2EWH A;  4IDK A;  4HAC B;  4O3Q A;  3UDE A;  2DH7 A;  1QSY A;  5M2R A;  5HVF A;  4KIA A;  4AXI A;  2A6M A;  3DCA A;  1GXL A;  2FD2 A;  1F6T A;  1ZZF A;  5EWG A;  2RAQ A;  3RB4 A;  5AXK A;  1YRX A;  1TUG B;  3E2E A;  1IJE B;  1FHT A;  4KGX B;  4P52 A;  4WPA A;  2D9P A;  3HI9 A;  4Q8E A;  1TK0 A;  4ZCI A;  2MZR A;  3NOG A;  2FZK B;  4V19 J;  1CPZ A;  2G0I A;  3OLB A;  3HHN B;  5I4M A;  5T14 A;  5HAT A;  4OZN A;  3ELH A;  1S5Z A;  3W9J A;  4PAA A;  1IBC B;  4WWS A;  4RWW A;  4OHW A;  1XMO F;  3KFW X;  3MM7 B;  5CYM A;  3ETO A;  2ACY A;  1HD1 A;  3J81 j;  1KN6 A;  3EM1 A;  1KFD A;  4IG0 B;  3VR1 A;  4F4Y A;  2WAQ D;  4LF7 F;  1FDA A;  1RT3 A;  1KC8 T;  4WJB A;  5E0O A;  2MQL A;  2X3D A;  3AH6 A;  4DR2 J;  1KQK A;  2HQ3 A;  3ZXW A;  2IVF B;  3LPY A;  4I56 A;  5KG7 A;  3U1M A;  5DDO C;  1HNI A;  1U47 A;  4RW8 A;  3E01 A;  4CQ1 A;  3DU5 A;  2GQ2 A;  2VKZ G;  4K0K F;  1M5O C;  5B0E A;  1VC6 A;  2GZO A;  1HBM B;  1O6X A;  3MR2 A;  4X4S A;  4C8K A;  5L1L A;  3HT3 A;  1HNW J;  3HP6 A;  3W5X A;  4LFC F;  2DB1 A;  2ZC4 A;  2DR6 A;  1AZS A;  3MPV A;  2JRS A;  1SJF A;  3KHH A;  1FKP B;  2MYF A;  2Z4P A;  3UN3 A;  5JVH Q;  4DUY F;  1FDB A;  4OQJ A;  4J5O A;  2ZBI A;  2ZH6 A;  3TQE A;  3BJY A;  2AJ1 A;  2LEP A;  5HMY A;  3PYE A;  3FEX B;  4CT9 A;  2HHH J;  3FQL A;  4PXC A;  2W8K A;  2DGS A;  1M1K T;  4KTQ A;  4OZL A;  3RRK A;  1T9T A;  4ES2 A;  1BLU A;  1N34 F;  4MIB A;  4GC7 A;  4WFN Q;  1T05 B;  1YHQ S;  1VQN S;  1FVQ A;  4KHP J;  3MM7 A;  4GKK J;  1M90 T;  4K4Z A;  4DL4 A;  4F36 A;  1VQO S;  1SC6 A;  1W2B R;  3GFX A;  2BM0 A;  1X5T A;  2PFD A;  1XTZ A;  1U1N A;  3OUY B;  3R5G A;  3HD1 A;  4ELT A;  3K59 A;  4KR0 B;  2HQI A;  3TEG A;  4OYW A;  2CNN B;  4RU2 A;  1RA6 A;  3UN5 A;  2CPX A;  4A8S A;  1Q5V A;  4ELV A;  3AQP A;  5F8G A;  3QZ7 A;  4Q2L A;  1S7I A;  3M2U B;  4ZVR B;  2EXU A;  2HGL A;  3PJW A;  2DR8 A;  1C1B B;  4LF4 F;  2BJ3 A;  2QC3 A;  2X1A A;  1HBM A;  2QFJ A;  1UVI A;  1KBR A;  4HL9 A;  4ECQ A;  2RH3 A;  2EKN A;  3EDR B;  3VAM A;  2OMO A;  4ZPB A;  4ZVH A;  5KFH A;  3UWT A;  2H4W B;  2LA6 A;  1RSC A;  3AD9 C;  3P8B B;  1FKP A;  4LBH A;  2V4R A;  2YX4 A;  3LWM A;  3BKU A;  3B54 A;  4QW8 A;  3I87 A;  1JJH A;  2MKH A;  4OYX A;  2V2V A;  3KLG B;  1KDN A;  2VG6 B;  4JI6 F;  4X4U A;  3GP9 A;  4C8Z A;  2IBK A;  2JHE A;  2IY5 B;  3UDL A;  5G0R B;  1T05 A;  4OLP A;  1D9A A;  4F7V A;  2AMC B;  3T3F A;  2DNG A;  3AFG A;  4KSE B;  4OYZ A;  2F4V F;  4LT6 A;  1R8A A;  2OUG A;  2VJU A;  4DBQ A;  2CPZ A;  3HO1 A;  1OS5 A;  2GQQ A;  1RTZ A;  5DLG A;  2QJ3 A;  1NU4 A;  3CJ5 A;  1PSD A;  1Z1Z A;  2DO4 A;  4RL1 A;  1WWH A;  5FDL B;  3OUY A;  3PX0 A;  3R5A A;  4JI1 F;  1PIE A;  4A48 A;  1U8S A;  1SKS A;  3NGR A;  1TL5 A;  2W9A A;  3A8I A;  4DV5 F;  1U1P A;  3FEY B;  1BY9 A;  1YJ7 A;  4KJI A;  1UL3 A;  2F8M A;  3A1Y G;  4HT5 A;  4E98 A;  3WC0 A;  3NP5 A;  1D8Z A;  4DSE A;  4DV2 F;  4A8Y A;  1DBD A;  1TAQ A;  2PA8 D;  3IGV A;  1C1B A;  5MAO A;  1N0U A;  4HDG A;  5HAN A;  4DU7 A;  2HQD A;  4TVA B;  2UV8 A;  4KFB B;  3CD6 S;  2GA7 A;  2MLY A;  5DZ7 A;  1RAJ A;  1DQ9 A;  2IDL A;  3BB5 A;  3G96 A;  2YKM B;  3JAM Y;  1BQX A;  4DUZ J;  4LFB F;  2E5H A;  1AYE A;  1O8B A;  2V9W A;  4XPE A;  3MCN A;  3W61 A;  4X4O A;  3R8Y A;  1E6V B;  3PO5 A;  2RUG A;  3EPG A;  3EGN A;  3M6W A;  3KLG A;  2VG6 A;  3SFU A;  2B4U A;  3CW2 C;  4AQY J;  2HLT A;  4EO8 A;  2QN6 B;  3OQ2 A;  3SI8 A;  4RNF A;  1VQ6 S;  5FLX Y;  1B7Y B;  5EN1 A;  2LQ9 A;  1TK8 A;  4LF9 F;  2B3T B;  1TKX B;  5G0R A;  2VQE F;  1V6H A;  2D3O 1;  2YKN B;  4WP9 A;  3W7B A;  3V6J A;  4CH7 A;  3KWM A;  3IXQ A;  5K8M A;  1RTI A;  2JNJ A;  3EZO A;  2O66 A;  4ECT A;  1QAY A;  3HSZ A;  2Y3Y A;  3I96 A;  1X8D A;  2KRB A;  3RB0 A;  1GH8 A;  1RAG B;  1REG X;  1UJ5 A;  5FDL A;  4ZP7 A;  4ZVE A;  1J27 A;  3DXB A;  4F50 A;  1X4G A;  5CAB A;  1SC1 B;  2XCA A;  1P1L A;  3T41 A;  3KJF B;  5K20 B;  2AX1 A;  4QIG A;  4U96 A;  3T1Y J;  3DLH A;  2ZH1 A;  5KOX A;  4NLQ A;  4RU9 A;  2FZC B;  2MTL A;  3UD5 A;  1XR6 A;  4I2Q B;  3HK2 A;  3NWG A;  2W2N P;  1KHV A;  2KT3 A;  2IPO B;  1RCO B;  2JSX A;  4KFB A;  2XEX A;  4O3R A;  3AA9 A;  4DR6 F;  4J9P A;  2XGQ A;  2RHS B;  2YKM A;  4ECS A;  3CJ3 A;  3I32 A;  3THT A;  2OHD A;  3FBF A;  2JFK A;  4XIU A;  2BJ8 A;  4EYI B;  1S7H A;  1E6V A;  1NDP A;  2DR9 A;  3BGL A;  2X1F A;  4KHR A;  2BUN A;  3M8Y A;  2FVC A;  5C5J A;  1DHM A;  3F44 A;  3CCM S;  1NZ8 A;  1VYA A;  2IA6 A;  3MUM P;  2IJF A;  2E44 A;  4UUW A;  4ERD A;  4ZCM A;  2WTF A;  3KDO A;  1YGY A;  3DLB A;  4RUH A;  5L46 A;  4PUO B;  1RTD B;  2YKN A;  2J6T A;  1W25 A;  1Q0N A;  5KT6 A;  3CJR A;  1T7P A;  4FF2 A;  1WAC A;  1U25 A;  4RNH A;  5AJ3 J;  4WFZ A;  3QT7 A;  3K5O A;  3CJ2 A;  1XWL A;  4HHH A;  2VB6 A;  4OZ0 A;  2QE5 A;  4NLT A;  4M94 A;  2HG4 A;  2AGO A;  1XNQ J;  3W64 A;  4X64 J;  4QR2 A;  1HNX F;  2FJA B;  5L1I A;  2J0Q D;  2ZZN A;  3VAK A;  3GV5 B;  5BJR A;  2VC1 A;  1SPB P;  2FJD B;  1XQI A;  2DNQ A;  3BGO P;  2GC8 A;  2UUC F;  1GX5 A;  1T3O A;  2YH0 A;  4WU3 A;  2Y8Y A;  3EDQ B;  3NGD A;  4EBE A;  4I2Q A;  4MK9 A;  3MTJ A;  2FYX A;  3GR1 A;  2ROG A;  2I5J B;  1RWU A;  2MKI A;  1D9D A;  4TN2 A;  1RT1 B;  3Q83 A;  3Q8V A;  2BJE A;  2QA4 S;  4DQP A;  4WFY A;  3OSN A;  3JYT A;  1HNZ F;  3AY0 A;  2VBW A;  2QLF B;  3BGU A;  2A1B A;  3DU6 A;  4R0E A;  3TAM B;  1L3T A;  3OFF A;  3HFK A;  2CXE A;  3G9C A;  2MQO A;  2YWW A;  2HFU A;  2MEW A;  2OSQ A;  2KDO A;  2LDY A;  4F25 A;  4WP8 A;  3DI6 B;  3CGI A;  3NKY A;  2VF3 A;  5L9N A;  3D6F B;  4OX9 J;  3PW4 A;  1RU2 A;  2VU5 A;  3RRG A;  4JI0 J;  2WCX A;  2G2Z A;  2AF6 A;  1CBK A;  3MF5 A;  1S49 A;  2ZC3 A;  1JLA B;  3KK1 B;  1KVI A;  1RT7 B;  2GHW A;  4PQA A;  2G13 A;  3H2V E;  4XK8 C;  4KYZ A;  3U27 A;  2FB0 A;  3FSI A;  3R2D J;  1LFW A;  4HI2 A;  2VIC A;  3NY0 A;  1OY6 A;  5ETO A;  3IWL A;  1U02 A;  1PBU A;  3QLH A;  2D7S A;  4F8R A;  4X4T A;  2N82 B;  5KFU A;  2HQF A;  3NCP A;  4QWE A;  2G0J A;  2I5J A;  2PMW A;  2KHD A;  2VD3 A;  1DAR A;  1RT1 A;  5DGA A;  1M0S A;  3NG8 A;  3R5B A;  2DGT A;  4JV0 A;  5HP1 B;  3PRD A;  2ZNY A;  4M8L A;  2MDA A;  3GFY A;  5LSL A;  4RW4 B;  5HL7 Q;  3KG4 A;  1H98 A;  2DHS A;  1CC8 A;  2C2M B;  3TAM A;  3FKB A;  3DOM B;  3K0J A;  1JB0 C;  1N6Q A;  1RAH B;  4USV A;  3GYN A;  2B51 A;  2ADC A;  2DNN A;  4OYP A;  3A8E A;  1UWA A;  3VGU A;  5GAE I;  5F8H A;  1UJ6 A;  1NK8 A;  5LMN J;  5B7W A;  4C11 B;  1YLX A;  3WZ0 A;  2HMI B;  4RBU A;  3VWS A;  1SUQ B;  3ENA A;  2MLZ A;  2M88 A;  3VTI A;  4NRU A;  3BDP A;  4NYP A;  4X62 J;  2QEX S;  2XMK A;  3J7Z T;  4DL0 C;  3NCQ A;  2LQB A;  3EMT A;  4NX9 A;  3R5J B;  2YWK A;  4U7U D;  2UVR A;  3CC4 S;  1RT7 A;  3ZTO A;  5C24 B;  1TU0 B;  1APS A;  3QAT A;  1DAX A;  1R6Y A;  3AA8 A;  3RUB L;  4LF2 A;  3BBB A;  4DR4 F;  4JI8 J;  1U0H B;  2HYI B;  4B17 A;  2XLJ A;  1CJT A;  1NHK L;  3CMA S;  2Z30 B;  4NLG A;  4JI7 F;  1TFY A;  5DQG A;  1QDU B;  2DHG A;  2JEG A;  4IH7 A;  1U49 A;  4TU9 A;  1RKJ A;  4L3K A;  4I6W A;  5HP1 A;  4OHV A;  3N6L A;  4GC6 A;  5LXR A;  1K73 T;  2QLJ B;  4RW4 A;  1QD1 A;  2BAN B;  7FDR A;  2QLW A;  3M6X A;  1ELO A;  1WC6 A;  3PXG a;  4CLZ A;  1TL7 B;  2HVI A;  1P1T A;  3FMW A;  5DG8 A;  3DOM A;  4P75 A;  5HQM A;  2XS5 A;  2RQM A;  3TUJ C;  1NRK A;  3HVR A;  4G1Q A;  4C11 A;  4O44 B;  5K8P A;  2W2M P;  2KH9 A;  1FT8 A;  2VUG A;  4YR2 A;  2K3I A;  2HMI A;  1RB0 A;  1SUQ A;  2KI2 A;  3NMR A;  1VQ9 S;  5E3A A;  1NB7 A;  2H48 B;  2UVV A;  4LF8 F;  1U7L A;  5IC4 B;  4ZVP B;  1S77 D;  5C24 A;  2VFU A;  2ZBR A;  4UUX A;  1RDR A;  2DXD A;  3DHX A;  1YRT A;  1CS4 B;  4USW A;  1T9Y A;  4JI3 F;  4KH0 B;  1NME B;  1U0H A;  1X60 A;  3LW5 C;  1V9O A;  2VOP A;  2M4M A;  4PYD A;  3NNA A;  1MLA A;  5AXM A;  2R8K A;  4LRB A;  2PMZ D;  1H2V Z;  1WF2 A;  1O51 A;  5B0D A;  5L38 A;  5HVG A;  3OTC A;  2ZDO A;  3BPS P;  3WHI A;  2DO0 A;  5D4P A;  3GTY X;  2BAN A;  2DHA A;  3UDV A;  4LF5 J;  3UDC A;  3BGF A;  2DKO B;  1KLM B;  1IWG A;  1TL7 A;  2V50 A;  3GSD A;  1RHM B;  2OAU A;  1VHI A;  2DGO A;  2QMX A;  4B9L A;  4DR1 F;  2JOQ A;  1JNR B;  2CQB A;  1ZS6 A;  2HQC A;  2DT9 A;  4OIX A;  1OPI A;  1KLN A;  4JV5 F;  2XSJ B;  3Q24 A;  2B9E A;  4YDD B;  4F3Q A;  1UEU A;  1UA1 A;  2LFV A;  1IBM F;  1WC4 A;  4X66 F;  2N3L A;  4FXD A;  1H7X A;  5A8R B;  1NK0 A;  3C2P A;  5KG3 A;  4YB6 A;  2ZJQ Q;  1N33 J;  5EX0 A;  2BBE A;  3J7A 1;  2AP6 A;  4IYQ A;  1RTJ B;  2BYC A;  2YX1 A;  2RRB A;  1VMB A;  5ETV A;  3OSP A;  1KON A;  4ZCK A;  4K4S A;  3AB4 B;  6FD1 A;  1WHY A;  1CS4 A;  4RNM A;  2XY5 A;  1N36 J;  4DF4 A;  2KXN B;  3KMQ A;  2LQ8 A;  2DIT A;  3C16 B;  2ZUG A;  2IM0 A;  2DBB A;  4ZJO A;  1TFW A;  1BQM B;  2BJ1 A;  4C3K A;  1M5P C;  2AD9 A;  3C46 A;  4QWA A;  2UVU A;  2GNK A;  3B4D A;  1KTV A;  3D0H E;  2VA3 A;  1BD6 A;  1ITP A;  1XR7 A;  1VQY A;  2RJZ A;  1M1G A;  3PX4 A;  4RUB A;  5IT0 A;  5C7P A;  5IT4 A;  1FX4 A;  1S72 S;  5B0A A;  3BR8 A;  1AUS L;  4ECU A;  5LL6 d;  3UO0 A;  4OZ5 A;  3IA0 A;  1KLM A;  3B78 A;  5K5M A;  3FEZ A;  1T8E A;  1D0E A;  2CNO B;  3UVJ B;  4O0N A;  4EZ6 A;  2FLP A;  2W8L A;  1O5J A;  1ZZN A;  4CNZ A;  2HS4 A;  1N5Y B;  4DLE A;  4IO9 Q;  2XSJ A;  3I4H X;  3FC9 A;  1XMO J;  4ZPA A;  1V3S A;  3JTO A;  3AJD A;  2V0N A;  1NLK L;  3M2R B;  5EX3 A;  5J1N A;  3CNQ P;  5A8R A;  4DJB A;  1FDN A;  2MMY A;  3BKF A;  5DO2 A;  4IH6 A;  2A2C A;  4NL5 A;  1RTJ A;  4LF7 J;  2EW9 A;  4IKA A;  2L3M A;  5LJ3 Y;  2MPU A;  5CHC B;  5M2U A;  3HUL A;  5KG0 A;  3PX6 A;  3P45 B;  1TQL A;  1YJR A;  1HNV B;  4PG8 A;  3BS9 A;  4NA2 A;  1LK5 A;  5HMX A;  1VBX A;  1RWX B;  2BKP A;  3C16 A;  4KY3 A;  5KFL A;  3UNY A;  3O6Q A;  3D67 A;  3D3B J;  1BQM A;  2AKW B;  3Q0A A;  1RAE B;  3CCV S;  3JSB A;  5HQL A;  2J8S A;  3K8W A;  4X4N A;  4O23 A;  2X3G A;  4ZIT A;  1QVF R;  2QMW A;  4FBT A;  1TL1 A;  4QIF A;  3NS6 A;  1CQN A;  4B9U A;  5KG1 A;  2PI4 A;  3BZQ A;  5AE2 A;  1BHN A;  2WB1 D;  1MWZ A;  4DUY J;  2NPF A;  2DNP A;  4Z2X A;  5B0C A;  3MPU B;  3W2W B;  1SBR A;  5ETK A;  1S9E B;  2VOD A;  1WOS A;  1UVK A;  1JLB B;  2B6A B;  5CZV A;  3H98 A;  3BN7 A;  1GXU A;  1R6V A;  4C0B A;  4P73 A;  4QR0 A;  1WG4 A;  3MCM A;  2D1C A;  1V3R A;  5EWE A;  2BRK A;  4BLG A;  4E0D A;  1YVF A;  2F4F A;  3CCS S;  3C14 B;  3ZZO A;  2GMJ A;  1HQE B;  4LRD A;  4N77 A;  2QSW A;  2HGN A;  1SH0 A;  2F65 A;  4F3O A;  4CP5 A;  1U6B A;  4UZC A;  1N88 A;  2KVQ E;  5EHH A;  4EK2 A;  3M8Q B;  4CIO A;  4PZV A;  1QTM A;  4QIW D;  2R8J A;  4OI0 A;  2XWX A;  1HKA A;  3CED A;  2XZT B;  3IM8 A;  4USK A;  4WXW A;  2EFV A;  3T9Z A;  2IJN A;  3R6L B;  4GVB B;  1G2E A;  1AA1 B;  2MKK A;  3EPI A;  1V5V A;  4HKQ A;  4LF4 J;  4QWC A;  4JOU A;  4KPC A;  1U48 A;  2MY8 A;  1TTH B;  4IUF A;  2IYI A;  2KJV A;  2D3Z A;  2CJ9 A;  3KLI B;  1TKD A;  1LQ9 A;  1C0T B;  3OL8 A;  3I55 S;  3KK2 A;  3D6H B;  4QPX A;  4O3S A;  3ILO A;  2DNR A;  3BR9 A;  3F73 A;  2DPJ A;  4U8Y A;  2JL9 A;  1VRU B;  1B64 A;  1QSS A;  3DRP A;  2N4D A;  1JJC B;  5E41 A;  3W2W A;  1RWM B;  1ZPV A;  1S9E A;  4DV0 J;  1ZA2 B;  1NK6 A;  1VBZ A;  1JLB A;  2B6A A;  1NHV A;  3UR0 A;  1UET A;  1S0N A;  5C25 B;  1W26 A;  2DXE A;  3ZTR A;  4C8N A;  2P2C B;  5DJB A;  2I1R A;  4USU A;  2F4V J;  1MRO B;  1T3N A;  2J9E A;  2QT7 A;  2QYG A;  4JV2 A;  3OLA A;  1X4H A;  3C14 A;  4EEY A;  1FFG B;  1FRM A;  1HQE A;  1VQ7 S;  3VAF A;  5D78 A;  4DQQ A;  4F2S A;  3DDK A;  4DL3 A;  4J7C A;  3ISN D;  4JI1 J;  3M8Q A;  5IZH A;  2FQQ B;  3C6U B;  4W92 B;  2IRX A;  2XS7 A;  3TR5 A;  2BJ9 A;  1XEZ A;  4DV5 J;  1RAI B;  5KTQ A;  4QQB A;  2VOO A;  2VPY B;  1Q8K A;  3VQT A;  1RHR B;  1S1V A;  1MN9 A;  2V8V A;  3SSQ A;  4GVB A;  2A3J A;  4EU0 A;  4DV2 J;  2AJQ A;  3GPA A;  1S12 A;  3P96 A;  1QUP A;  2DK2 A;  4NZ7 A;  4DR5 F;  1N52 B;  3EE3 A;  1WTF A;  1FFS B;  3OXF A;  4WBF A;  3KLI A;  1FCA A;  4LFB J;  3PKY A;  1PIL A;  3I0S B;  4EI2 A;  3EX7 B;  1IKX A;  3H4D A;  3MFH A;  5E33 A;  2QYC A;  3VVU A;  1RWV B;  3CCL S;  1VRU A;  3D2W A;  4C97 A;  2IRY A;  3D0G E;  1JLG A;  1M5S A;  3ILI A;  3VZI A;  4ZLJ A;  3HFV A;  1FRX A;  3P3D A; 
#chains in the Genus database with same CATH homology
 1N33 J;  4NEY A;  1HNW J;  4DR7 J;  4B3S J;  3R2C J;  4RJV A;  2MQ8 A;  4LFA J;  4LF4 J;  2VQE J;  1HNZ J;  5LMN J;  4JI1 J;  2E5L J;  1N34 J;  4YY3 J;  1XMO J;  4DUY J;  4JI2 J;  5LMU J;  4DV4 J;  4DV6 J;  4KYZ A;  4DV5 J;  1IBL J;  4B3T J;  3D3C J;  3R2D J;  3JAM U;  5A2Q U;  2KL8 A;  1J5E J;  1IBK J;  4X62 J;  3J80 U;  4B3M J;  4JI6 J;  3T1H J;  1N36 J;  4YHH J;  4GKJ J;  2UXC J;  2HHH J;  3W1Y C;  2ZM6 J;  4DV2 J;  4JYA J;  4LF7 J;  4DV1 J;  5IT9 U;  3J7A N;  4DR3 J;  4NXN J;  4DR5 J;  4K0K J;  4LF6 J;  4LF5 J;  4PWW A;  4HHU A;  2UXD J;  4KHP J;  4B3R J;  1HNX J;  4DR2 J;  4JI7 J;  1I94 J;  1FJG J;  4DV3 J;  4GKK J;  1HR0 J;  4LFB J;  5AJ3 J;  4DV0 J;  3IMQ J;  4JI4 J;  5FLX U;  4DR4 J;  4DUZ J;  4JI5 J;  1N32 J;  4DR1 J;  2UUA J;  4LF8 J;  4DV7 J;  2MEW A;  3T1Y J;  4JI3 J;  4JI8 J;  4X65 J;  2UU9 J;  5LM7 E;  5BR8 J;  2UUB J;  2MTL A;  4LFC J;  4JV5 J;  2KVQ E;  4KY3 A;  2VQF J;  1XNQ J;  1XNR J;  4X64 J;  4LF9 J;  3J81 U;  4NXM J;  3D3B J;  2F4V J;  4NEZ A;  1IBM J;  1XMQ J;  4DR6 J;  4X66 J;  4OX9 J;  2UUC J;  4JI0 J;  4V1A k;  2UXB J;  3OTO J;  4AQY J;  5IWA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...