3T1YJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3t1yJ00
4B3TJ 4KYZA 4X66J 2UXBJ 3JAMU 4LFCJ 4X65J 4DR3J 4LF6J 1HR0J 2UXCJ 4JI0J 1IBLJ 4DR2J 5AJ3J 4DUZJ 2VQEJ 2UXDJ 2E5LJ 1XMOJ 4GKJJ 4LF8J 2MEWA 4DR1J 4DV0J 1HNWJ 3J80U 4YY3J 4JI4J 4DR6J 3T1YJ 1XNRJ 2KVQE 2MTLA 5IWAJ 4JI2J 2KL8A 4YHHJ 4LFBJ 1I94J 3R2CJ 4JI1J 1J5EJ 5A2QU 4JI7J 4NEYA 4B3MJ 4LF7J 4NEZA 3IMQJ 4RJVA 3D3BJ 2MQ8A 3D3CJ 1HNZJ 2F4VJ 4DR4J 5LM7E 4K0KJ 1IBKJ 2UUBJ 5BR8J 3R2DJ 1N36J 3J81U 1N32J 1XNQJ 1IBMJ 4JI5J 3W1YC 4JYAJ 1N34J 2UUCJ 4DV1J 4GKKJ 1N33J 1XMQJ 1FJGJ 4LF9J 2VQFJ 4DV4J 4KY3A 4DR5J 4OX9J 4DV6J 4B3SJ 4X62J 4NXNJ 4JV5J 4PWWA 4DV3J 5FLXU 4V1Ak 3J7AN 4DR7J 4B3RJ 4LFAJ 4JI8J 3OTOJ 4LF5J 4DV2J 4DV5J 2UU9J 4X64J 2UUAJ 4DUYJ 4LF4J 3T1HJ 2ZM6J 5LMUJ 5IT9U 5LMNJ 1HNXJ 4HHUA 4JI3J 4AQYJ 4KHPJ 2HHHJ 4DV7J 4JI6J 4NXMJ
chains in the Genus database with same CATH superfamily
4BDPA 2X3GA 4W98A 2NUHA 1ICEB 2MSTA 4NPOA 1FTRA 2FJXA 1HR0F 1VQ9S 4WFYA 1R6YA 4B9LA 1FRIA 3SV4A 3L9ZA 5HMWA 4U8YA 2MJUA 3WIUA 4CLZA 1WHWA 4D3HA 3LA0A 3ZTRA 1U6FA 1AA1B 1Q86T 4X65F 5IQ6A 8AT1B 2ZC3A 1UKUA 2H54B 2ZWOA 4DHVA 4B3MF 1FX2A 3P8BB 2ZITA 1N56A 2ZH9A 1F1BB 1R43A 3QWPA 4UOHA 5HLFA 2ILZA 2Q3PA 3HHLB 2JHEA 4F02A 3EZOA 4DV3J 1VQOS 1B99A 3T3FA 2QTWA 2HRTA 2VDHA 1XC9A 2R42A 4OYZA 4A8MP 1VC6A 2XMKA 3R5CA 4I69A 4ED1A 4ANEA 3F44A 4CLFA 2BMBA 3VGTA 2RS8A 1S1UA 3EWGA 1UFWA 4K50A 4UF4A 2J7WA 4OHVA 5HBMA 5I3QA 1WDTA 3HSDA 3KDOA 4ZPTR 2CJKA 4X64F 1S5ZA 1RT4A 2EVZA 1RP5A 3V4IB 4I1TA 2R7QA 1VQ8S 4RR5A 3I5CA 3H8YA 5K14B 4F2RA 3OFGA 3PZPA 2EBGA 1BWVA 5DRKA 3OSPA 2KT3A 2IY5B 1RT7A 2A18A 5A8WB 5IC6B 2ZEJA 5ETQA 4M5GA 3D54A 2DGQA 3SV3A 4KR0B 3QFHA 1S77D 2K06A 1WHYA 4Q5VA 3DLJA 2DY1A 1V5IB 1VQ6S 3LP2B 2QJ3A 2UU9J 4LF7F 4DS4A 1XIQA 1W2IA 2DNKA 2V0NA 4A8YA 1S48A 2B4OA 2BQRA 5A0YB 4JI3J 1UFLA 1MN9A 1FK9B 2E5IA 3KLIB 2DJWA 2I5JB 4WJBA 3G71S 1NNDA 3Q24A 4WWSA 3FFIA 4OJHA 1WC6A 2AD9A 2LQ5A 1I6JA 1KFSA 3HI9A 3SDEB 3KLHB 4NEZA 3JTOA 1H2UX 1OSCA 4M5KA 4DZDA 1ZZFA 1WG4A 1PBAA 4KO0A 4PYAA 2CPZA 2RQMA 2W8KA 2UZAA 3BGLA 3O5TB 4ICLB 4ZS6A 3GFYA 2QA4G 1WSVA 2K8GA 2MQMA 1EQ0A 2GMHA 4NLVA 3K5LA 1A6LA 9ATCB 4LF5J 3HZGA 5G0RA 2XWXA 4ZVTB 2HS0A 1GX5A 3PO5A 1UW4A 1LWFB 5ETTA 3MURP 4LFAF 1QAYA 1SKRA 3QQCD 3HHNB 2DBBA 3QGIA 4ZVGA 4DR2J 3M6UA 1VQYA 2KHCA 3UN3A 4LQ9A 4DR7F 5KFOA 2RDIA 5HQLA 3BDPA 4P73A 1CLFA 3CMQA 3CIMA 3JSRA 2XGPA 2CG8A 5E0OA 4I0WA 2CQ0A 3RU0A 3R7BB 1J5EJ 4GKJF 2MZRA 3PYDA 4O0IA 2FJAB 3NGTA 2IYIA 2BE9B 2WBRA 4C4WA 1LW2B 2PDAA 3P5BP 2VHGA 2DPIA 4CDIA 4EBEA 2YWGA 1NKCA 3BQ2A 2UVVA 3DLEB 4MK8A 3OVAA 2E7XA 3RGIA 4JI5J 2OI2A 4ID8A 4DEZA 2ZNZA 2CQ4A 4XIUA 5KFQA 3H98A 2ZH3A 2XTJP 1NJYA 4DUTA 3HKWA 1U02A 4OMFG 3M2UB 4J9NA 4LR8A 2CQPA 1DTQA 5I42A 1WTBA 2RVJA 1PYTA 1N33F 2LQBA 4U95A 3PR4A 2W2PP 5CHCB 2BW7A 2BE2B 1TKZB 2VFTA 4YB6A 3A8EA 3GIRA 1YVFA 1HYSB 2FJWA 1QSLA 5GVQA 4ZVSB 5L46A 4KJIA 4I64A 1U26A 3NGDA 4U9RA 2MPUA 2DGUA 2W9CB 5L1JA 1HBMA 1MMNA 5EWEA 2HZAA 2Q6BA 3R2CJ 3DLKA 2HVHA 3D6MB 3NP5A 3MD3A 2PI4A 4ZA1A 2Z2YB 3QGPA 2CPEA 4URQU 2PN6A 2BYCA 2W2OP 4LBIA 4LRAA 5D15A 3I96A 1BLUA 5F0WA 1RDRA 3W5ZA 5A8RB 1RK8A 2XSJA 3N6MA 4OFZA 3DHXA 3SFUA 2ZDPA 4NZ6A 1UVNA 1FX4A 2P9GA 1YJ7A 3CCMS 1VIXA 1NHKL 2AHOB 3GP9A 1FDDA 3LOUA 3IS9A 2ZUAA 3O6QA 3C16B 2CYYA 5ETLA 2BW2A 1VQKS 2HK3A 1FJGF 8ATCB 1NM2A 3JTNA 4CRJA 1RHMB 3CO0P 4DV2F 4J9QA 3POTA 2Q66A 1ZPWX 4M94A 3BH6B 2CJQA 1X0FA 4ILMA 1L3KA 5B0BA 3RBZA 1F9FA 3NXZA 1JLCB 4DDFA 3FSIA 1ITPA 1RT6A 4OL8A 2AEMA 2V69A 2J0XA 1R7IA 4RNFA 2AJ0A 1Z2ZA 1CBKA 3QJPA 1SI9A 3L3CA 1T03B 4R5PA 4LSNB 5LM7E 2WW8A 3ELHA 2ERRA 2JWNA 4ZPVR 3ZTQA 2LU1A 1IWGA 4K2JA 1M5PC 4C9DA 2XG8A 4Z37A 4DCPB 3LP0A 2IMWP 1I3OB 1TAQA 1YRXA 1QVFR 1XNQF 3UR0A 2HWIA 4IRKA 3V6HA 1X4FA 5BYQA 1Y7PA 2OEMA 1MWYA 1FI4A 5IQQA 3CJQA 1R8HA 3IAS9 3SEOA 1JJ2R 2ZE2A 3AFGA 4QWDA 1QAIA 1R8AA 2OIHA 4CM2A 1VRTB 5K8OA 4F0MA 1VBYA 5DETA 5B09A 3BKUA 3AT1B 2K1RA 3C6UB 4L75A 2W4PA 5BJRA 2Q79A 2GA7A 2W8LA 1RACB 3UPFA 1Y10A 4FVMA 4DXLA 4YS2A 1KVIA 4ELVA 1KONA 4IDKA 1VQSA 1VRUB 2VH7A 4KGMA 3PX4A 1PO6A 2M2BA 4ZPBA 3BF4A 3DRSA 3QRRA 4YB5A 2ZD1A 2CPIA 3D6FB 2ZH5A 1SH3A 2C2ZB 3VAHA 3KHGA 1AUDA 4M5JA 1GEHA 3D4JA 2NPFA 3ZTOA 3JQKA 4OYOA 4LF4J 4OYBA 4JV1A 2ZOGA 4HL9A 3H20A 3PG9A 1UP1A 4XO0A 4ZPAA 3TZXA 3MR7A 2HS4A 1RABB 2IVYA 4A8KA 3GYGA 1DBDA 3GV8B 1FVSA 1UVKA 3U27A 1L3VA 3AQPA 2VF3A 4PABA 3EX7B 1S57A 3PR5B 4DS5A 3KLVA 1HPZA 3BKFA 4OX6A 1Q81T 4OI6A 3KFWX 2NQPA 3MMAB 3MR6A 4NXMF 4YMEA 3M9MB 3QT6A 1Q5YA 2LECA 4ELTA 3THVA 4O3OA 4ED3A 2BA9A 3CJRA 4M1KA 5KT7A 2AYGA 5GAEU 1XMQJ 3X3UA 4WFAQ 1FRXA 1MMDA 1GTHA 3RRHA 2LCWA 2O66A 1XWLA 3R1HA 2R2UA 4JB8B 1N48A 3T6BA 5F8MA 4IO1A 4FVCA 1P1TA 2H5JB 4FXVA 1HHSA 2IJNA 2JEGA 1T9XA 3KLGA 4HHJA 1YTYA 4DUYF 3HJVA 3A3PB 5CCMA 1Q1KA 1O5JA 1H7XA 1HMVA 2HNZA 4TU8A 4W90B 5J2PB 4WYLA 1PIEA 4CO1A 4DR5F 2HNDB 1N88A 1UTAA 4NLXA 5KFUA 3QFWA 1LKZA 5EWFA 3SMZA 1YJWS 2W7AA 5HROB 4PKDB 3LP1A 2BBEA 1SVDA 4ZITA 5T7LA 3UNYA 3MM8A 4Z7CA 4YR0A 2GAGC 2HHHF 2V67A 7AT1B 1TL1B 3EPGA 1K44A 2FC8A 1F0XA 3J81U 2CUYA 4L72B 1TL7B 1IKWB 3U1MA 1X4GA 1JX4A 3N28A 2XMVA 5LT5A 4DV4J 1GH8A 1RWVB 5D3GA 1X4CA 2MDAA 3E01B 2V2ZA 2WHOA 3TAMB 2QLJB 2OSQA 4N76A 4DG1B 3CDBA 3MEGA 1NK8A 3GSIA 5B0DA 2LLZA 3KG4A 1WELA 3G4SS 5B0FA 4IFYA 3DOMB 4GC7A 1UCNA 2ABYA 4NL5A 1TUWA 2OPSB 2HQCA 2XO7A 2LMIA 3QYYA 2X1FA 3BPDA 1KQKA 2WVBA 5K5MA 3CCSS 1U1KA 5HJXA 1RKIA 2F3JA 1KSPA 3BO3A 4UY8T 2FIUA 3D3CJ 5B0CA 2IDEA 3W2WB 3MAQA 5DQGA 3KK2B 1RE1B 1S10A 1JQGA 1Z4UA 5GMKa 4LRCA 2OPPA 2DNNA 4I2PA 5KG3A 1TL4A 1VCTA 3RUBL 1Q16B 4KV8B 4EMDA 1WHXA 1CSJA 2BRKA 4CP5A 1NBEB 2J9DE 3DOKB 1T05B 1FJCA 1U0HA 2AYBA 3GR1A 1QD1A 4ALZA 1ACMB 1CQNA 4A48A 4A4JA 3OT9A 1IKXA 1GXLA 4Y2IA 2F9JA 2HQ3A 5J2NA 1QE1A 1X60A 4R25A 1QTMA 4C8MA 2YNHB 1DFDA 1UFKA 2GHWA 1B7YB 4C6AA 5KFXA 1RT2B 2Y8WA 2OFHX 1JLEA 3KJQB 1I94J 1RT3A 1PGZA 4JI1J 1J2VA 2N7CA 4DPWA 3MWBA 4KB7A 5GMEA 3QRQA 1RADB 3DYAA 3OL8A 1SIZA 4OI0A 1MU2B 4MJKA 2FUG9 3H25A 1QSYA 1LWEB 2GJ2A 3A4TA 4N56A 5KFHA 2UXDF 1WKLA 3IBCB 2LEAA 1C1BA 1VRQC 2P6TA 2DNMA 2RILA 4WIIA 3KMQA 1D0EA 1H3DA 1FXDA 1YITS 2KZMA 4O3SA 4PQAA 3K7RA 5ETOA 4M63A 2M5YA 5IZHA 2XMJA 4DV5J 1HARA 4NA3A 1PYSB 1HBOB 1KQFB 4ZVRB 3C14B 2RQ4A 3DHWC 1B7FA 3MCOA 4KPCA 4RW8A 2B51A 4GRSA 3MECB 5F8GA 3NCRA 4F0KA 1K47A 2F40A 2IM1A 1NUEA 3T5JA 3MMJA 3QIPA 1NSQA 5KG4A 1RWWB 1FRMA 2YWFA 4HTJA 5KFFA 1HWJA 1JKHA 2AJFE 2J76E 1WEXA 3GTYX 4TKTA 4EFAC 2EKNA 3AY0A 4F3QA 1CC8A 2EFNA 2XYGB 1U45A 2YX4A 1FVQA 2KB2A 2IMOA 3HXMA 1XJWB 2NSBA 1CG2A 1SXLA 3GR0A 1X8DA 2HW3A 3NS5A 2VBZA 1RHQB 4K5RA 3BEGB 1CJVB 2YKNB 2CPXA 3L4BC 1MW7A 2LKZA 5DDQC 3DRRB 7FD1A 2ZKTA 3S8SA 2N3LA 2G0IA 5J2QA 2VICA 1HIYA 4NASA 5DLFA 2NS1B 5H9FK 1LW0B 3VQSA 4NA2A 3UFCX 3HHLD 1WC0A 2KXNB 5LXYA 5J1NA 2W4DA 1U2RA 2HQFA 2CZ9A 1V5VA 2VKZG 1H2TZ 3FZBA 3PFOA 4DBQA 2ZVSA 4R0JA 2YKMA 1W2BR 2PSZA 5KG6A 2Z57B 4IOBA 2R7TA 1SH0A 1YJVA 3TVYA 4F4AA 3KTQA 5E2QA 4MKBA 3I0SA 1S6QB 2JZ5A 4H4OA 1JLFB 3HFZB 2FHOB 3V81B 1JNRB 2JSXA 4ZP7A 3ZNJ1 2V68A 1JMTA 5KFTA 3HZEA 4Q44A 5C24B 4EBDA 3PO4A 3HHEA 4G1QA 1EP4A 5FJ4A 4IDKB 3BPSP 4MFBA 2HQDA 3M32A 2CPHA 2HHQA 2MKSA 1XN9A 2JC1A 3MMBB 3KUGA 1AROP 2BANB 1FESA 3WZ0A 3ILIA 1R8PA 2YH0A 4EYHB 1JJHA 2B3TB 4GKKF 3OSNA 1RYSA 3ISND 4DX6A 4GO5X 1IVZA 1CVJA 2HHWA 4J37A 5F3ZA 2LQ8A 4IOCQ 1UW9A 4F36A 3HFKA 2YTCA 1EARA 1R0AB 2UXCJ 1S1XB 4IO9Q 4WXOA 1P9YA 2GHVC 5CYQA 1NSKL 2R7RA 2KL8A 4J91A 1MWQA 1YJNS 2H1YA 5AE1A 4ECYA 3BYRA 3N6LA 2YNFB 3QT8A 2A3JA 4S0MA 5E3PA 3GFZA 2ATLA 4WZMA 2WVFA 3Q0AA 2XS5A 4KKOA 3IC1A 5JXSA 1VJQA 2Y8YA 4Q2LA 1QUPA 2PA8D 1FKAF 4O3QA 1IQTA 1ZM2A 2D3OR 3PIPQ 2FVSA 1JXEA 2DIVA 1VFJA 2ZH1A 2HFNA 4X4TA 1EKSA 5SZTA 4Q43A 3CT9A 2ZOFA 4OHYA 2ZFHA 1FWLA 1C2PA 2C3UA 1HLWA 3CC4S 4YB1P 3EZ5A 5CCLA 1RZMA 1GTEA 2ZH4A 4RNNA 1OMSA 3FEZA 4WKRA 2KG1A 1LQ9A 3IN5A 5IM0B 2DCLA 2CVEA 4OYMA 1EHWA 1CJTA 1FNOA 3BN7A 4LRDA 2FHJD 4CZCA 1UZHA 4IQMA 4A8FA 2C3OA 4ED8A 5C25B 3RAXA 2BKPA 2W2NP 4QYZK 4OI1A 2E5JA 3UCZP 4R0EA 1FJEB 1H2VZ 2GQ2A 3HD2A 4R8UB 3ENVA 2C28A 2VC0A 4MMOA 2I9SA 3TA2A 2CA9A 1F60B 3UVJA 2Z8QA 2BJ8A 5CZVA 4DR1F 3TEHB 1JJ4A 4X4QA 1TQLA 3I9ZA 1CJKB 4RKUC 4JI2F 1PAEX 3OXGA 4NOHA 1SBRA 4RW9B 5I3UB 2MYFA 4C8NA 1TR0A 1IKVB 2HFVA 2J6TA 5EX0A 1HNIA 5L9XA 2KVIA 4NCGA 4DX8H 3LWMA 2NR0A 4CYUB 4X66J 2OPQB 2RAQA 4L3NA 3CCJS 1R27B 1X4DA 2BKNA 5AJ3J 4DUZJ 4FYXB 2XY6A 3MR3A 2GS8A 4I4BA 1CULB 3HSGA 4DSIA 3MAHA 4A8XA 3ADAC 3T1YJ 1TUGB 2HKEA 4H4KC 2N7YA 4W92B 4DI6A 1F2HA 1DURA 4TU7A 1TU0B 3K8WA 3EVMA 3GLJA 3CCZA 2R7OA 3M8QA 1S1VB 4ZPWR 1VK3A 4DMZA 4DR4J 2HPUA 2HVDA 1TL3B 2BUNA 2RH3A 3NG8A 2O01C 3VGSA 2DR9A 1S9GA 3QJLA 2V4JA 1VGYA 2OJ3A 4I68A 1N34J 1HNZF 4DV1J 4EEYA 4LFBF 2H65B 3OFFA 1SQFA 2MKYA 2HFZA 1S6OA 1U4BA 3LGHA 2MGZB 4BS2A 2E1AA 3TA1A 1W7WA 3CUNA 3DDNA 1RISA 1KC8T 3TARA 3DRYA 2EFVA 1BQMB 2PEHA 2XQCA 2V5HG 1UVIA 3OXFA 2E5HA 3GPAA 3K58A 1REVA 2KM8C 2LXIA 2XCPA 3ULHA 1DLOB 2OKQA 3O2IA 4ZHRB 2L3MA 2DD8S 4JOUA 3SQGB 3A8KA 3JS9A 1HWUA 1HW9A 2V4QA 1JLEB 1VYAA 1RSCA 1NB2A 2PO4A 5KFPA 4KH0B 3NCQA 2CQDA 2PIIA 3KHLA 3TANA 2C2RA 1U1RA 1DTTB 2LQ9A 3H90A 3UDCA 1EQMA 2WW4A 1BHNA 4RUBA 1RT1A 5GMDA 3KK3B 3AD7C 2EK1A 1S6PA 2EEYA 2R8JA 4OX9J 3CCWA 3I0RA 2RUGA 5KOXA 2UVWA 3HLUA 1A9NB 1RT5B 1U0SA 2YNGB 1RHKB 1Y0HA 1UWBA 5RUBA 2GGPB 4WP9A 1RTIB 4PPDA 1F3FA 4M5HA 2ASYA 2CNLB 2AJ2A 2KVQE 4WTYA 1I51B 1R8BA 1V6HA 3MOZA 2IC3B 2Y1LB 2KI2A 4DL5A 3MFIA 4DLGA 4NI2B 1G3OA 5CH7B 3PIOQ 1CEZA 3CD6S 4LT6A 1VQ4S 4WK3A 4DL6A 4JI4F 4OQJA 5E5NA 2IA6A 1S1TA 5HN0A 1OWXA 4F8RA 1RTDA 2BM0A 3GFXA 1ELOA 3VZIA 3CJTA 5HQ8A 4HEA9 1RWNB 1V3RA 5KG1A 1N36J 3MTJA 1TKDA 1FFGB 3OL6A 3EXCX 3ICLA 5HL7Q 2UUCJ 1UVJA 2ACMA 1QLNA 2YKPA 3L7PA 3UW1A 4YFUA 4ZPDA 2FZCB 3PACA 3EGVA 1FRHA 2V9WA 2XC9A 4G3IA 3CTRA 4RBUA 3VF0B 1YHQS 1WACA 5HATA 4KHMA 1WHVA 3G86A 3RW7A 3NS6A 4I56A 3W5XA 4C8KA 1QSSA 1Y5NB 3J7ZT 1N52B 2BEFA 2VPWB 1RHJB 1TMMA 1KS2A 1M5VC 3A8JA 2OELA 1NPKA 5L1KA 2IM0A 4LBHA 3DRXA 5GAEI 4CO4A 1NEEA 1T3OA 4P72A 2BABA 3MCSA 4DPXA 4BWMA 1QVGR 4O4GB 3RB3A 3OBIA 4WCEQ 3GIKA 3UD5A 3EVWA 3MM9B 4I6WA 5H9EK 3A8IA 2I0XA 2AJ4A 1VQLS 3ILLA 4O3RA 4CI0B 2P9CA 3FRZA 4LIWA 4E8UA 5KFCA 4OHZA 4BC9A 2YKOA 5DDPC 1HD0A 1H38A 2GCFA 2DR8A 1WEYA 2ALZA 3OTOJ 3D7SB 4NLTA 3W9HA 4WYWA 4GVBB 3M8PB 3C15A 4J9LA 3DI6A 3TRGA 1TVRB 3LPYA 2F8MA 2D1CA 2QMXA 1VQNS 3UDLA 5K9FA 1HR0J 4Y2MA 2ILYA 1P27B 3MR5A 1TL5A 4I7FA 5CD4A 3SCLE 4B9SA 4OZ3A 1CJUB 4TLRA 1YRUA 4LF8J 3JSBA 4TYBA 2EBEA 3DM2B 1NU4A 3B8HA 2PI5A 4ETZA 1NZ8A 3FUYA 2DRDA 4ZVQB 3LALA 2DO4A 2COLA 1UAWA 5KFYA 4B3MJ 1M0SA 2XLKA 2KN4A 3SCJE 4F67A 4X4UA 2XY5A 4NCBA 1XQIA 1B4SA 3LH2S 2BJ9A 3ZZTA 1UETA 2WZ1A 2DVIA 2HYIB 1WORA 5KAKA 2XWYA 3GIMA 1T9WA 4QWAA 4RUHA 3LO3A 2RDJA 3KJVB 3BQ1A 2PGCA 3H5YA 4Q7AA 1U1LA 1GMWA 1AFIA 2ZBPA 1DRZA 3DCAA 2QMUB 3FK4A 3PW2A 2ZM6J 3CCES 5EX3A 1H74A 2HURA 2W2MP 1HI8A 4AQYJ 1RBAA 1Y3KA 3FCHA 5IS2A 2Y0SD 2XB2D 4C98A 1JLGA 2ZOMA 3I9V9 2V8DA 2AIRB 4M5NA 3UO0A 4HHHA 3ENAA 4CLPA 1VOMA 1BE4A 1EAYC 4EI2A 4N5SA 2GVDA 5BXIA 4DL4A 3OHBA 2M52A 2XYHB 3CW2C 4LQ3A 1DJ0A 4OLPA 5CA5A 1C4AA 2WSCC 4RZRA 1WG5A 2DNYA 4ZJLA 3D2WA 2AMCB 4A8OA 1FDNA 2HZVA 1LOUA 4B9NA 4LF9J 4QIWD 2Y9HA 2J8AA 1NB7A 4BLGA 2W7OA 3IA0A 4TVAB 4O44B 2H4WB 1D09B 2QLXA 3MAAB 2XCAA 1YKWA 2QL7B 2DHXA 3ZZPA 3G6YA 1C0TB 2K3IA 1KN6A 4X4SA 4K4ZA 3TAPA 2RKIB 4USIA 1S72S 4KSEB 3OJUA 1NHVA 2DRBA 4ZLNA 3CULA 1M1GA 1BXNA 1GMUA 3JQMA 1HNXF 3N6NA 3NKYA 3TJAA 1RAIB 1T8EA 2DNLA 4RPFA 3OL7A 3G6XA 4JI0F 3HHLA 1U6BA 2RF2B 5LOQA 4TQRA 2QMWA 1ZOTA 3MM5B 3HVRA 2VJUA 4KGKA 4NLQA 4DQQA 4IYQA 3TA0A 4RNMA 1RAOA 4LF1A 2IRXA 2C1EB 4F04B 2BJEA 3PRDA 1ZAXA 4L76A 4LFAJ 1J5EF 2FVQA 2B7BB 1Y00A 3CEDA 3VHQA 4J9SA 2NYIA 5K8MA 3E51A 3VQTA 3V4IA 4IG0B 2OLWA 2JOQA 3MPWA 2FQQB 1GAOA 1F5AA 3OUYB 1NK9A 3VAJA 2YWEA 4JI5F 3ILOA 2IAJB 4QU6A 1RAGB 2BJ7A 5K14A 5KFAA 2VFSA 4YR2A 4GKJJ 4HT5A 4CIOA 3HVTB 4B9UA 3M30B 5A8WA 2MTLA 1G7CB 2V63A 1Q7YT 2W7PA 1S4EA 4UQTA 3LP2A 3I55S 4F3OA 2FJEB 2E9ZA 1FRLA 4YDXA 1Z2LA 2H9ZA 3FSXA 1IBKJ 3OV7A 5A0YA 1KRPA 2HHPA 3HHKA 2BX6A 2ZZTA 3JYTB 1FK9A 2GVZB 1KOOA 2DGSA 3KLIA 1H0HB 1P9QC 2I5JA 1N33J 2MHNA 5FLXY 2KRRA 4USVA 3V4MA 2NYHA 3MM6B 1BUXA 2IBKA 2MJNA 4AL5A 2LP4A 3H4BA 1S59A 2MSSA 2G1DA 4G1PA 2V2QA 2WVDA 2Z2ZA 3PW5A 2DXEA 2JNJA 4HHUA 3KJNB 3LAKA 1LWCB 3SDEA 3KLHA 2RMLA 2GHPA 3BSNA 3BO4A 3T1HF 1BQXA 3FCWA 3J80Y 4QPXA 2JLFA 1X4HA 2D74B 3PYEA 2VBWA 2W2QP 4WFZA 5BYSA 1S49A 4ICLA 4LMZA 3RBEA 2CNNB 2L9WA 2C42A 4Y28C 3D5MA 3Q8VA 1WI8A 3CMAS 2HBYB 4Y00A 3BGOP 3ZZ0A 3AOAA 2IRYA 2FHJA 1PG5B 1LWFA 5EUHA 5BR8J 4P2SA 3KLFB 2XYPB 3OFHA 4QW8A 1S97A 4RBVA 3KKFA 4CH1A 1RU2A 1ZBTA 3DMJB 3B82A 1FJGJ 1SB6A 2VQFJ 4C8YA 4FDFA 5FDLB 4RX6A 1JLAB 2HS3A 4DV2J 1LWXA 4J9VA 1AT1B 4NMLA 3HKZD 5DM6Q 3VV2B 2KO1A 3MM7B 3SCKE 4C8LA 4RW7B 2UV8G 3Q22A 4DSJA 2BXJA 2VFUA 2UUTA 4WZQA 3RB4A 1LW2A 2CAJA 4WPAA 4ES3A 3AJ2A 3DLEA 2KTQA 5C42B 1NK0A 3HK2A 1R8CA 3MI7X 2ZUGA 1NDCA 2WB1D 1FCAA 5G4DA 3M2UA 2C3MA 2YNIB 4P6QA 1IM4A 2KU7A 4QBUA 4F0HA 3QT5A 4PG5A 4OZ0A 3G9CA 3DXBA 2ASJA 3OLAA 1MG7A 4GMKA 2V8GA 2BE2A 1XNQJ 1TKZA 3QWUA 5HAOA 5FIIA 2QA4S 1KVJA 2VG6A 2OTLS 2KFNA 1KTQA 2E1RA 5KFLA 3GFHA 2JFDA 2Z58B 3EZUA 1YDLA 3GQCA 1Q8BA 2NZ4A 3M8RA 2W9CA 4J9KA 4Y2CA 1NJWA 2ZH6A 3D66A 2MKJA 2FB0A 3JXOA 2IVFB 3B78A 1E6YB 3PJXA 4CLKA 4CQ1A 3VR1A 4EK2A 1B70B 4DSFA 1YJUA 2HMIB 3MUVP 2FD2A 3ZTSA 2FJDB 4DV0J 4IOAQ 1M5SA 5A8RA 3CCQS 2ACYA 3NNHA 1SV5B 2QO3A 2VQEF 1N5QA 3M2RB 2XULA 1WUUA 2X1BA 4XTTA 4FKYA 4ECRA 1U1PA 2GMJA 5DZ6A 1XNRF 3C16A 3TQ1A 4X4RA 5JUMA 1X7VA 2KDOA 1GMVA 4OZ2A 4E2FB 1EETB 3AHPA 3I87A 1HFEL 1RHUB 2HIYA 1P1LA 1TP7A 3M2VB 2MQPA 2P2CB 1LNQA 3CCTA 3M7VA 2H3EB 3D1OA 3V6KA 2ZBIA 4ZJOA 1JLCA 4ECTA 1X4EA 4MYUA 3UD3P 5U47A 3RRKA 4CO2A 4H54A 5B0AA 2MKHA 2XMTA 4NYZA 4NA1A 2B5JB 4K2XA 4AXJA 3K5MA 1REGX 3NRBA 4C3KA 2JC0A 3W62A 1T03A 1XR5A 4LSNA 1XMQF 4P75A 2HBZB 4ID5B 2VG7B 4USHA 4PZVA 3VVTA 3GU0A 2ZZNA 1R3NA 1SJ3P 3PRVA 1NRKA 2WAQD 2ZKUA 1CC7A 1ZPVA 1OIAA 2DH9A 2GVDB 3BREA 3D1QA 4DZ6A 1NO8A 2NUUG 4WTOB 1FE0A 5KG2A 4WF9Q 3MCMA 1YZ7A 1FD8A 1OS5A 4OYAA 3RJMB 2CPYA 4XDCA 5CZXA 3AOBA 1VRTA 3I32A 3MPUB 3OTBA 2RRNA 1A7GE 3ZTPA 4B08A 3U7JA 1ZH5A 3C6UA 2EWHA 4DUYJ 2LEBA 2W25A 4NCAA 5HMXA 3MPVA 2FC9A 3D6HB 5H1SV 2ZZMA 2VBXA 2CWKA 1UEKA 3I56S 1VRUA 3EVOA 2RS2A 2K7KA 1G4CA 2ZNYA 2DH8A 2M4MA 1WJ9A 3DNCA 1WSRA 2V9KA 2GIQA 2YKAA 4B3TF 2MLZA 2A6OA 2RD5C 4FF1A 3G8SA 3MEKA 4FF2A 2Q43A 4QWCA 2WTFA 4ED6A 4EUVA 4YB7A 2GX8A 2PC6A 3Q86A 3QZ7A 1QY7A 1Q0NA 1RXOB 5KT6A 3WBZA 3LF0A 3IBWA 1ZAVA 2A1BA 1RAEB 1UMJA 5HSPA 2EC2A 2JVOA 2Z4PA 2MKIA 2HLTA 3R6LB 3LPEA 3O3LA 1HKAA 2EFPA 1UVLA 3Q8UA 1FXLA 4JI8J 1MNEA 4RLEA 1RI7A 3DLGB 3H2UB 1DAXA 2JL9A 3KUHA 3M8WA 3IGNA 3IR7B 2XBPA 2BDPA 2OP5A 1R31A 4KC5A 4ER8A 2G2YA 3HPOA 4DFJA 4ZLJA 4I67A 2Z2MA 3MMAA 2K2PA 1C1CB 2GQQA 5J1EB 3PHTA 1WC3A 3QNWB 2JLGA 2PE8A 4FS1A 3OQ2A 3U1NA 2QL9B 3H2LA 5FD1A 4C7QA 1E6VB 1L3SA 1MMLA 2CPJA 1RWXB 2PMHA 4DSKA 3P96A 2XLJA 3TUPA 2EG1A 4KAIA 4EZ6A 3VCDA 5DG7A 5B7WA 5IV3A 3GWCA 2M70A 4DL2A 1U7LA 1ZZNA 4IRCA 1TTHB 1R0CB 1C0UB 3KDNA 1M1HA 5J2PA 5HVGA 2LA6A 2Y1RI 4JI1F 2HNDA 3TAQA 3P49B 3EYZA 2BM1A 3FJ2A 4DN9A 2UUAJ 3WDOA 4OYXA 1FDBA 1D9FA 1Q78A 5HROA 4FNHA 1P8GA 2O67A 4PR6A 4YUDA 3H2VE 2FHMA 3CDEA 3GB0A 3Q8RB 4KQZA 4ZVHA 1TL1A 3CMES 4V19X 2CXEA 3RB0A 5DM7Q 1Q8LA 3IWXA 2ROEA 4DQPA 3F41A 4HH0A 3BBBA 4K59A 4XK8C 4MTPA 1TL7A 3PYGA 4DV5F 3NLCA 4HVZA 1IKWA 1FEHA 1F9EB 4C48A 4EO8A 5EGYA 3E01A 3TAMA 5HMZA 4MKAA 2MQ8A 2VA3A 2AX0A 4J9PA 1JLBB 4DG1A 3Q2TC 1N5TA 2D9OA 2MQOA 4IFVB 3KOAA 1OO0B 2F4VF 2MZQA 3DOMA 3CCRS 4OZ1A 4DV6J 1X31C 2OPSA 2FDNA 2KM8B 3OPKA 2O3DA 5ETKA 2RB7A 3T41A 3NWGA 4EYIB 3LWLA 1BD6A 2HFSA 2K7JA 4PAAA 5LMUF 1RB0A 4G6VB 1JLQB 3W2WA 1F9HA 4ZCLA 5LXRA 3KK2A 2HNYA 4ZOSA 3PRBA 3ZZRA 4UY85 2K3KA 1GNKA 4CLYA 1OPZA 1SCJB 3AQOA 3W9IA 3OLBA 1ZA2B 4KV8A 2WBMA 4I2QB 2M0GB 2UUWA 3DOKA 2VOPA 1KR4A 1T05A 3K2YA 5I4MA 1H98A 3C46A 1KHVA 2AV5A 4B3OB 2UV8A 5KOWA 2LDIA 4BBYA 5F41A 2R8GA 3EUNA 1HBNB 2YNHA 7FDRA 2R8IA 2DNHA 1F5CA 1O6XA 2VG6B 1RT2A 1TV6B 4JUZA 3OFEA 5A76A 3CIZA 1GQEA 3LQVA 3K0JA 3T5HA 3DC2A 4KHPJ 3H5UA 3PW4A 3DKDA 1S6UA 3ZZUA 2RRBA 5KFKA 1K8AT 4YOEA 1MU2A 2J0WA 1FNXH 4A47A 2DKOB 1LWEA 3UQSA 1K9MT 4NE9C 4C0BA 2XZWA 5C2GA 3RB6A 3HP6A 4BHQA 1S0NA 2DNGA 5HVHA 1NJIT 4MT1A 2I2YA 5DG9A 3KNAA 1HQ2A 1NAQA 2DT9A 3NWRA 4RO0A 2MMYA 4WE1B 1HBOA 1VC5A 3V6DB 3D28A 3C14A 4X84A 2EKYA 3JTPA 2UXCF 3RBDA 5MAOA 3A12A 3B4DA 1UJ4A 4D3GA 3FMWA 2MKKA 4DPUA 4DSLA 1KQGB 1TK0A 2QSWA 4GKKJ 2QYCA 3MECA 5E41A 3MPDA 5KFIA 4QJVA 1RTHB 5ETVA 2LA4A 3OL9A 3RG6A 2DXFA 1PSDA 1S4FA 4PWDB 3HJFA 3OR1B 4JV2A 3ZZYA 4QWEA 1WWHA 4LIRA 1TMJA 1AFJA 4DQRA 4QCLA 2JEJA 2MQNA 4ILRA 3FVYA 4PUOA 3LGNA 1X5TA 2E5GA 3MPYA 1BGXT 2IHR1 4TN2A 3UD4P 2HRUA 1PYOB 3IO1A 2MEWA 4J7CA 4DV7F 2OD4A 1D8ZA 1CJVA 3GG1A 3CO9A 2YKNA 1V3ZA 1Y5LB 4ECVA 1UA0A 3D1HA 4MK7A 3DRRA 3V2UC 4PG6A 2F8EX 3GIIA 2HHSA 2XNQA 3A3OB 3H0PA 4ZIWA 3KNGA 1LW0A 3CJ3A 3QBCA 2YKQA 4K0KJ 3N5FA 4Q2MA 1PCAA 1S7IA 5DS7A 2ROGA 1NK7A 1YSJA 2MZ1A 2F9DA 3PJ9A 4NXNJ 2J8SA 3IXQA 3H5SA 3UE2A 2ZBQA 2YVSA 1U1MA 2QSFA 3DOLB 4NLOA 1S6QA 2JVRA 1JLFA 2FZGB 3M6XA 3V81A 3KG0A 2ADCA 5ETNA 3TVZA 1T02A 4C11B 4LFCJ 2G0JA 4TYAA 5C24A 3TP2A 3SCIE 5K8PA 1U49A 1Y11A 4FKXA 4MH8A 1TFWA 3W3SA 3VZHA 3TJ9A 4DR3F 4PQUB 1VDHA 4PXDA 3MMBA 1S1WB 4YHHJ 4PPZA 2BANA 1EIYB 1X4AA 3BZQA 5A8KB 1SPBP 2D41A 2OSRA 3CC7S 2GC8A 4A8SA 1FFSB 4X66F 4WK1A 3N9UC 4NLDA 1S9EB 2HK2A 5THWA 5E33A 1T94A 4DUZF 4P71A 2VBYA 4Y3CA 4J5OA 1R0AA 4RNHA 3T1YF 1KQSR 2QGFB 4KY3A 1S1XA 3I5BA 2D69A 5DGBA 4PXBA 4EU0A 2WCXA 5K20B 2YPZA 1X5SA 1IBMF 3RZAA 5LSRA 5JJBA 4FZVA 1ZM4A 4NRUA 4N47A 2ALYB 2GZOA 3QMQA 4DR4F 2MB0B 2FZKB 2YNFA 1UEUA 3FC9A 1OQ6A 1SJ1A 2B9XA 1QUVA 1T7PA 4DV1F 5L1IA 2E1PA 2BE7D 4IKAA 4CT9A 3RBXA 1NDKA 4JI6F 1FDAA 4CLWA 1F3VA 2V8PA 4MK9A 2MQQA 3NS7B 1IXKA 3BH7B 3LGMA 4C3MA 3C66A 2RJZA 5MLCV 5CAAA 3BGRB 1HNWF 2B6AB 5IC4B 2AP6A 1B0TA 3M6WA 4ZVEA 5KT5A 1HNZJ 2B56A 4PYDA 3W2VB 4P2XA 3HT3A 5D0RA 3NMRA 5A6PA 2XHWA 3W61A 5D4OA 3EGNA 5IM0A 1Q8KA 1MROB 4K5SA 2VG5B 1RGVA 2HBQB 2E29A 1WKKA 2APOA 4B3RJ 4ZP9A 2R8HA 4PWUA 1X5PA 4HDGA 5C25A 3K8VA 3HSZA 3GE9A 1JK9B 2L48A 4K4VA 4R8UA 2KFYA 2LEPA 3CJKB 2F1FA 4HACA 5DQHA 2VA2A 3UDVA 4F50A 1XTZA 3KYLA 1BQNB 4ES1A 2DR5A 2PA3A 2CQCA 4OYPA 3FEYB 1XMOJ 2MQLA 4OX9F 2AQ4A 3BR8A 4YQWA 2MLYA 1IJFB 2KZZA 3OR2B 4F4WA 1CJKA 1QDUB 2QG9B 1Q53A 5HVFA 4RW9A 5I3UA 3PEJA 4HYKA 2ZH8A 1IKVA 4DLEA 4DR6F 2KHDA 1RTZA 4MKYA 3BSAA 2JDJA 1RBOB 3JQJA 2DHHA 4ECSA 1VS3A 3ITHB 4L3KA 4AE5A 1TUVA 2VUGA 1FWKA 4CYUA 4WU2A 2OPQA 4FS2A 4DU8A 1N5YB 1H7WA 1FNMA 2KXHA 2XZTB 5CYMB 5CD4H 4RW4B 4FYVB 5CYJA 1CULA 1FRKA 4P7TA 2DHAA 2QN6B 3B4MA 3UNGC 1WD6A 3OHAA 2KG0A 2B9EA 1HBUB 3PDNA 3TNVA 2F4FA 1J5OB 3SXLA 1KOHA 1OY6A 1N36F 1ZTTA 5KFJA 3JAMU 3E2EA 1S1VA 3OJSA 4K7QA 2OO4A 3PM9A 2UUCF 4U67Q 3K57A 1V9OA 1XERA 1TL3A 3IG1B 2AEFA 1ZAWA 4LF2A 1HQUB 4N8NA 5C2CA 4JI4J 3S6EA 3PXGa 2OFGX 3GZ7A 4U7CA 1S79A 1B0VA 2HNYB 4HDHA 1PJ6A 2G2OA 2HLUA 3FNNA 2IVMA 4I6YA 1VJWA 4JI7J 3TEGA 5KFNA 1G2EA 2MGZA 3IRWP 3R6GB 3CJ0A 4Q0BB 3J81Y 2X3DA 1VBXA 2PFFB 1BQMA 4AL7A 1RAAB 4K8RA 5EHHA 3PW7A 2CG4A 4H4MB 4ZLLA 2I1RA 1DLOA 4B02A 4ZHRA 3J7YI 5L9NA 3SQGA 1LXJA 2FYXA 3THPA 4B3SF 2DNRA 2BRLA 1IUJA 2QE5A 4ZCKA 2VFRA 3FCVA 5KFGA 1GMWD 3Q8PB 1DTTA 2E5LJ 1SIWB 4DFMA 1FFWB 5E3RA 3GYXB 3D0IE 4P52A 2UXBF 2Z56B 4YY3J 5J2MB 2NREA 3KK3A 3BN4A 4OX8A 2V6AA 4ED4A 4ELUA 4QR1A 2BJ3A 2F65A 1YIJS 1SJFA 3OVSA 3OD2A 4KGZB 1RA7A 2CPDA 1RT5A 3KWMA 4X4OA 2UVRA 3MOJB 2BJDA 1Y4ZB 2YNGA 2N3OA 2WOMB 4LF8F 3H5XA 3TW0A 2GGPA 1U47A 1RTIA 1KHWA 1IJEB 4KFBB 4E98A 2C2DA 2BOAA 1PBUA 2CQIA 1B64A 1U8SA 3AD9C 1TKXB 1EZZB 3A1YG 4DF8A 3VAFA 4KHRA 5ETRA 4G65A 4KGXB 1CQMA 2IIHA 1UWAA 2IC3A 5LMNJ 4NI2A 2KJVA 1U2FA 1OYEA 2H5IB 1FKPB 1FWPA 3HHDA 3EGZA 3D0HE 1QTNB 2J5AA 3BYPA 1HI0P 2PT0A 1TKTB 1XR6A 3HVWA 3R97A 2RQCA 1JWWA 1PC4A 2VONA 5GAGI 4PUOB 2XI2A 5AXKA 2VZ9A 2VASA 3N79A 1QAJA 5D4LA 2DGVA 4ZN3A 1VR6A 2ZM6F 5KFRA 3ZXWA 4QPTA 1RUSA 4DOZA 3CCLS 4ZIVA 2EXUA 4AQYF 4YEAA 3PX6A 1D9AA 2P8IA 3K5OA 3FGVA 1VQMS 1SUQB 5HK4A 2FY1A 4HI2A 2PMZD 5D0HA 3J7A1 4OIXA 2QT7A 2ZBRA 2AKWB 4KPYA 2RIJA 3EPIA 4X2BA 3CNQP 3IRXB 1UJ5A 2XS2A 3E8OA 1I1GA 1N32F 4W4MA 1UPPA 1M90T 4Y2AA 4X4PA 3KJFB 3J7Z5 3N5BA 1YBTA 3W8PA 3EJMA 1M1KT 3I6PA 4O4GA 2OHDA 3P45B 4UOCA 3QLHB 1PKUA 3R8YA 1APSA 3ILJA 3MM9A 2A10A 4LF9F 2ZDOA 3QO9B 3SSQA 1HWIA 4ECXA 3KHRA 5HP1B 4UT4A 5IWAJ 3R7NB 1N5VA 4ZP8A 1IBLF 3LTOA 3RRGA 1X0PA 5ADZA 2CWXA 4GVBA 3M8PA 4CLTA 4IR1A 2C3PA 2RDDA 2FVCA 2NXCA 2YPYA 1NJXA 1TVRA 1OY9A 3LW5C 2MLXA 5M2UA 2DITA 1U8WA 3WX4A 4GC6A 1CJUA 1LFPA 4X62J 2GV1A 3OW2R 3SI8A 4ZLPA 3UR3C 4IH6A 3DM2A 3VAIA 3EMTA 2VOOA 1CS4B 1HNXJ 3W8GA 1GX6A 4XDDA 1M5HA 1P6TA 3M1VB 1HNVB 4CTAB 4JI0J 5T14A 3D0GE 2DRAA 3CDAA 2D3UA 3CB4A 5F8HA 5CABA 1GFWB 1YBUA 3AXMA 3R5BA 3W9JA 3MMCB 4EBCA 3KJVA 1M5OC 3NMAA 3QPIA 3C8YA 1VMBA 4M5DB 2GNKA 1SC4B 5GAHI 1FHTA 1QM9A 2Z0GA 1JB0C 1RTJB 3N0VA 2FGOA 1U1OA 4ENOA 2KXFA 3US5A 1NPRA 4JYAJ 3D9BA 2MZJA 1UA1A 4ZKAA 3PYFA 2XZDB 4MIWA 5F8IA 6AT1B 2R7XA 2HVZA 3PEHA 2E44A 4O0NA 3HO1A 4KBIA 1HQEB 1AUSL 5F9LA 3QSIA 3W5YA 1IBKF 4IH5A 1WF2A 3RAQA 1Q95G 3DDKA 2WONB 4P2MA 1PC5A 3ISZA 3QRPA 4HACB 1S0VA 5M2PA 3FKBA 3G8TA 3D68A 4WIQA 3AOCA 1RWOB 2OEKA 3BB5A 1O8BA 3ZZZA 4PCQA 4O44A 1T9VA 3ET6A 4RJVA 2VODA 4C0HA 1NHUA 3MAAA 3GCWP 4RW6B 4KT0C 3HSJA 2FLOA 4RU9A 2QLWA 5KFZA 1C0TA 2UUBJ 2DCUB 2RKIA 2FVPA 1AZSB 2CDQA 1NSPA 2R2SA 4O3PA 3BS9A 3GJSB 1R0BG 3JSMB 2ZVIA 3LANA 1JXLA 4F26A 1MN7A 2A0FB 3T1HJ 4WXWA 2AWZA 2RF2A 3RW6A 3SQOP 2BZ2A 4USKA 5BR8F 1FKOB 2DH7A 2V4RA 1SC3B 1NDLA 3MM5A 2BACA 1RAJA 2PFDA 5HJYA 2VQFF 1UPMB 4LR9A 4USMA 3VAKA 2OH2A 3M8YA 3DRPB 3M8ZA 3TUJC 2B0GA 2CQ3A 3VTIA 4CH0S 1RA6A 2W9BB 2CJYB 3NBPB 2U2FA 2YX1A 3DGPB 3CD0A 1WF0A 5HMYA 1GXTA 2VPXB 3AODA 3FDSA 2VC1A 1SKSA 2A6MA 1RWPB 4CO3A 1YJRA 2QYGA 3HULA 4FF3A 4DQIA 1RWUA 4IG0A 4OI4A 5IT9Y 2B4UA 2XI3A 4TY8B 3OUYA 1X4BA 1RCOB 3R7SB 4FXWA 4ATNA 2IAJA 3QGHA 2J0SD 1KLMB 2MKCA 5D78A 4DX5A 5D8HB 4FN5A 2OPRB 4LSLB 3HVTA 1WOOA 2J9DA 1VHIA 3M30A 4NLUA 4P2FA 1ZA1B 3ZNUA 3KK1B 4AXIA 2J6UA 2F5GA 2R4FA 2DEIA 5IXUA 1KP6A 4DCOB 3BBCA 2QLFB 1S99A 2HAIA 5E3AA 3IM9A 3DU6A 5AXNA 1IKYB 3KLEB 3EICA 2ROPA 4UQGA 3JYTA 1IWAA 3HMJG 1N6QB 2GVZA 3PW0A 4IG3B 3CJSA 3M4XA 3MEEB 4F4YA 1W26A 3MM6A 4FPIA 2AJ1A 4A46A 4L74A 3NAIA 4CNZA 3NEKA 2CADA 4CH7A 4PXCA 4DL3A 2UP1A 1UZDA 4EWTA 4Q8FA 2M88A 2LXUA 2ZBCA 4FBUA 2G9OA 2HFUA 3TJ8A 3R2DJ 3H59A 1J27A 5B0GA 1LWCA 4DV0F 1A0OB 1U48A 1ROFA 2GO8A 1QAXA 3UN5A 2XMUA 3PVXA 3G6ES 2C2EA 2JLEA 4JV5F 3AB4B 2B43A 2R7VA 4CO0A 3L95X 5B0EA 2B8PA 1T9UA 2W4CA 1OSDA 2N82B 5HLFB 3OXLA 4NYPA 2AF6A 4CNYA 4RU2A 2Y1JA 5LL6d 2VQEJ 2YXLA 4N7TA 3G96A 1WOPA 2CRLA 1U2CA 2J7UA 1EKRA 1YI2S 3T9NA 3KLFA 4F2SA 4DL0C 5CQGA 3OTEA 1XNRJ 4DPOA 3DMJA 4LF6F 2RUSA 1S9FA 3CD7A 2VPZB 3V6JA 5FDLA 3HF5A 3VWSA 1X9MA 2CJBA 1JLAA 1FE4A 4DJBA 3DLBA 2CQHA 1S1UB 3MM7A 5KT4A 1NXIA 3TUZC 5HBMB 3TZWA 4RW7A 3CF5Q 3AH6A 1MSWD 2CIMA 1RT4B 3I82A 1NLKL 3CCUS 1WNEA 1N5SA 2UVUA 2YWKA 4V1Ak 3MEDA 3H7HB 5C42A 5DGAA 2XHCA 3MGJA 1U25A 3UCGA 5DG8A 1UEVA 2YNIA 3NY0A 2L08A 1RT7B 2KRBA 3FEXB 4KRWA 1HI1A 2VKRA 4ECUA 2YWHA 4DWIA 1URRA 2AEJA 1SQGA 2XLIA 2AGOA 2AU0A 4ED2A 1KNZA 2XM3A 2WVEA 2C3YA 3R5DA 2PMWA 2XSFA 4OYIA 2CPFA 2DHSA 2DGWA 2LQJA 3B54A 4J9OA 4B9VA 3F73A 3C19A 2GJIA 4K4WA 1S7HA 2E1CA 4FNIA 4M8LA 1YWXA 3FFIB 1E6YA 2YH1A 3SIPB 2MZSA 4DU7A 4A8QA 2HMIA 2B9YA 2DNPA 2QX0A 1FEEA 1C4CA 4OHXA 5KG0A 1OQ3A 4DPYA 3T9ZA 5KG7A 2F63A 4HI1A 1SV5A 4V19J 1HD1A 4KO0B 3M2RA 2RSQA 4DV3F 1ZTWA 2VFVA 4B3TJ 4ZCIA 2QZ8A 2CQBA 5GADU 1X9SA 4X65J 3BV8A 2AZ1A 4QOTA 4Y2KA 3TO8A 1EETA 1AB8A 2EK6A 4J9MA 2RNEA 3M2VA 4JI8F 5G0RB 4B9MA 2A2CA 4N8OA 1LXNA 2QIFA 4WFXA 4DF4A 4QIVA 2HQIA 1LV5A 3MF5A 2QL5B 3RAMA 4ED7A 2J9EA 3IWLA 3MDFA 2Y3YA 3DGVA 2W9AA 5L8RC 4WP3A 2B5JA 5L39A 3DLLQ 2EI5A 1AYEA 3BR9A 4NX9A 4WU3A 2X7IA 2CNKB 2QLBB 2HVIA 3BO2A 5IV4A 4DL7A 1F2GA 3IR5B 5DDRC 4DFPA 5L38A 2FLLA 4ID5A 4X64J 2VG7A 1XMBA 5JMNA 4LRFA 3GONA 5F8NA 1T0TV 4DN0A 2YQ0A 1FO1A 1RAHB 2UU9F 4TY9A 1B3TA 2QFJA 1S0OA 4U7UD 3HCXA 3BSOA 2DNQA 3IGVA 3K59A 4JI3F 1Q79A 1VHFA 3QSYB 1ZS6A 2DHGA 4AYBD 8RUCA 2BOPA 4IUFA 4ANCA 1DTQB 4QZVB 5I42B 3FBEA 1WDDA 1HL6A 2UUAF 4PEOA 2BV3A 1NH8A 3C6TA 4KGVB 2ZH7A 4LF7J 3IWNC 3W66A 1SKUB 5KFBA 1NSAA 3R27A 2IJFA 3THTA 3DFEA 2P6SA 3ET6B 3QIDA 2FVRA 2HIQA 4ILLA 1T95A 3T5LA 4DSEA 3SSRA 5IT0A 3Q8YA 1HBMB 2OMOA 2WRMA 1OJ4A 2KT2A 2YWWA 3H42A 4C3LA 3DLKB 1K0VA 2XY7A 4J9RA 5HANA 5ETSA 4J9UE 1U1NA 3AA9A 1JXVA 4UW2A 1AW0A 1YJTA 3EDQB 5F8LA 4LF5F 2XSJB 1GXUA 3MZIA 4K4XA 3WIVA 4ZVUB 3S7RA 4OZ5A 2DY9A 4ZDNA 2KYXA 4AUKA 3SZ2A 4CO5A 4Z7YA 4ECZA 1LK7A 4DV6F 3IS9B 3G87A 2RHSB 2XMMA 4J90A 4DR2F 2JH3A 5DDOC 4NZ7A 4WP8A 3KG1A 4NLWA 4NEYA 3DLGA 3POTB 4Q45A 1HW8A 2FHKA 2F4VJ 1URNA 3CSKA 2MXYA 3ETMA 4MAKA 1WEZA 5IOLA 3UN2A 3CJ2A 3BSCA 5I3PA 3U1LA 3LUYA 2QA1A 4NYOA 1C1CA 1RT6B 5J1EA 4XPEA 2EW9A 4DR7J 1H73A 3OTDA 2H51B 4FPRA 1KWMA 1E6VA 3TUIC 2EFOA 2I8EA 2DGTA 2ADBA 2N4CA 5LMUJ 4ECWA 4R5PB 4HR2A 4KTQA 1KD1T 3GJTB 3QAEA 2G13A 2DR7A 3PHEA 2V8HA 2L9NA 1VK8A 3A3NB 2O5DA 1FA0A 5A2QY 4EO6A 5SUHA 2JJ4D 4IRDA 4UTGA 6FDRA 3LP0B 1KEKA 4HKQA 4OX7A 4RWWA 3WHIA 4RNOA 3FBFA 5DO2A 2CJXB 1PILA 1C0UA 3MHYA 1LFWA 2G4BA 1SQEA 2XMWA 4O3NA 2ZE2B 1Q5VA 3P4UB 4KHPF 4K4SA 3ZO7A 2GIFA 2M8DB 1NKBA 2Q1LA 2K1RB 2WB4A 2HEKA 2HVEA 5DJBA 3DXSX 3PJWA 4H4KA 1SJRA 3M05A 1HHQA 2HHTA 4LBPA 1NKEA 2J0QD 4ZVOB 2HAFA 3RR8A 4LUBA 3IR6B 2SXLA 3O8WA 3IP0A 2ZJQQ 4Y65A 1RHRB 5E3QA 4OYWA 2OGUA 1YJ9S 3CE8A 5D4PA 3DRSB 5KT3A 3ONQA 1U1QA 2ZD1B 3ENWA 1JLBA 3G82A 4FF4A 2G0CA 2D3O1 5HI7A 3TZYA 3NAHA 2HSEB 4FYYB 3IM8A 4IFVA 3MFHA 3Q23A 4QIEA 3FMBA 4MIBA 1NCLA 2HQGA 3CJ8A 4DX7A 4ED5A 1SL1A 2QEXS 2GQCA 4JP8A 2AW0A 2YBVA 1VI7A 2I38A 2AX1A 4AD6A 4ZP6A 3RTVA 1X9WA 2KJWA 2B8QA 1YBAA 4RBTA 1U24A 1DQAA 4XAKA 3BGFA 2BVZA 2ZJRQ 2E66A 1SC6A 2CJ9A 4NLSA 3M9OB 1JLQA 4C0OC 3IBFB 1HPZB 3QZ8A 2DPJA 5L1LA 4QQBA 3CDWA 5KFMA 4M5IA 4O4RA 3Q83A 3HHLC 3MEDB 1F6TA 4GVLA 1LEOA 2EFQA 4I2QA 4K0KF 2O1PA 4DV7J 4PXEA 5LSLA 2FJVA 2XGQA 5CXTA 3R1LA 3U02A 1ZM3A 3LAMA 1OPIA 4NXNF 4B3OA 3OTCA 3EGWB 1NZAA 1FF2A 2JX2A 3BJYA 2R3VA 3ZC4A 1HBNA 2HZCA 3PNIA 5DLGA 4XPCA 1YQHA 1SL2A 3KLGB 4U96A 1WF1A 1MWZA 1TV6A 1PJ5A 2QRRA 2BR0A 1K0TA 4LFCF 1HMVB 2HNZB 4LR7A 4BCAA 4M5MA 4CWBA 1XBWA 2MZTA 2ZH2A 2QA2A 4OHWA 4WFBQ 2F7VA 3CGIA 4FYWB 1PJ7A 3X1LB 1H72C 4YHHF 2RE1A 3LP1B 1D9DA 5T7LB 4PRFA 3MM8B 2M3DA 2B4PA 2ZWPA 1KFDA 3ISNC 4C97A 4TXSA 5IT9U 3K5NA 1HA1A 3VGVA 2ASLA 3M8SA 2YQ3A 3NGUA 3CXCR 4WE1A 4LF4F 1KTVA 4DR3J 2DTJA 3V6DA 3VAGA 5D3GB 3TX8A 1JIHA 5EDWA 2FJBB 3MEGB 3NOCA 3IAM9 3R5AA 2KT5A 1RTHA 2LDYA 1XK8A 3NOGA 1DARA 4UOFA 5HQMA 5ITHA 3AD8C 3ETOA 1S0MA 4IFYB 4PWDA 3TQEA 2CFXA 4LVNP 5DZ7A 1KDNA 3OR1A 1K1QA 4YN3B 4K4UA 1IBMJ 1KVKA 2LVWA 2NXJA 3HX9A 1VQPS 4C2MA 1T9YA 4ZJQA 4RL1A 1LK5A 3TWZA 2X1GA 3WC0A 4OZLA 3AAWB 2W1BA 3J7YU 2ZJPQ 1BC6A 2GJFA 4JI6J 4NXMJ 2OPPB 4KH1B 4WFNQ 4ED0A 3GV7B 4F4ZA 4I2PB 2GO9A 3L7UA 1NK4A 4OZJA 3TR5A 2RU3A 1HNWJ 4FP9A 3RYLA 4B3RF 3GJRB 5ETPA 2OEJA 1UL3A 1U0HB 3Q8SB 2E1MC 3UI3A 1GT8A 1TAUA 3R9LA 3S01A 3PY8A 2E7VA 1IKXB 2VU5A 3Q8QB 1VC0A 3C6TB 5LJ3Y 3DOLA 3FQKA 2XO6A 5J2NB 1QE1B 3BM7A 2N4DA 2D3ZA 4OJ3A 1XMOF 4OV6A 3PCOB 2B7CB 4TQSA 2POKA 2IDLA 4C11A 1RT3B 1IR0A 4DR5J 5M2RA 2ZC4A 1ZETA 3L09A 4ZN1A 2AGPA 4F4XA 4DFKA 1HWKA 2YX7A 1VBKA 4PQUA 2OTJS 3DYAB 2EC0A 5F0UA 4DV4F 3PTWA 1S1WA 3VVUA 5A8KA 1EJ7L 4Q8EA 2RHQB 2HHHJ 1C1BB 2PEBA 1ULRA 4KYZA 1KBRA 2XMAA 2IFXA 4Y34A 4CCHA 3WQPA 4QWBA 4DCJB 1S9EA 4AFFA 4MIAA 2VIHA 1Y9OA 2GFFA 2NPIA 4UZBA 3FZ2A 4MYTA 2W01A 4DR6J 4KIAA 1NJZA 2DNZA 1T11A 1RBLA 4L6V3 1NPPA 2EG2A 3TYTA 5GAGU 3JSYA 3T19A 3IMQJ 3D3BJ 4RW8B 3O1LA 1HWLA 5LJ5Y 3W7BA 5AXMA 5H9FJ 1UVMA 1RWMB 4Z2XA 5HO4A 1UJ6A 2KYZA 3NGRA 3MUTP 3H40A 1TFYA 1TK8A 3QIPB 3BKTA 2GAHC 2V2VA 3ZFVA 1JKHB 2CVIA 1IQZA 4FXDA 2D9PA 3K17A 2P5VA 4JI7F 1WOSA 3GCXP 3MR2A 2DB1A 3CD5A 4QU7A 4ECQA 4F3MA 1VISA 4AT1B 4NWBA 4RUAA 4IH7A 2CQGA 3BGRA 2B6AA 1JNZB 2G1HA 1XEZA 1SC1B 3SFGA 3W2VA 5KFWA 1DY3A 3AB2B 2L41A 3QAUA 1B0PA 1FT8A 5J2QB 4I6AA 1AXQA 3WX8A 1MROA 1N54B 4K4TA 2HBRB 2VG5A 3NGKA 4F7VA 5F3TA 1IR1A 3F56A 2R7UA 4USJC 1L3UA 2ZHOA 5AE2A 2H4YB 2IA0A 4U7UK 1I94F 2YKMB 3DU5A 4B17A 2CZ4A 2IM2A 5F9NA 2YQ1A 4X4VA 2E5LF 3PFEA 1SJQA 4OJGA 2RQKA 1YZ6A 3CJKA 4CLUA 3I0SB 1GK8A 5KFVA 4YY3F 2IRUA 4H4OB 4ES2A 2M8HA 3NL0A 1BQNA 3GV5B 4B3SJ 2HHUA 4IQXA 4FYDA 4N41A 5D0GA 5D77A 2M9KA 2FLNA 2V2KA 3OR2A 2OAUA 2GW8A 2XNRA 3BDEA 4G1QB 2CKWA 1EP4B 2FGCA 2V94A 2BJ1A 9RUBA 3K89A 1FTCA 1U09A 4MFBB 3N4WA 3M32B 5EWGA 2UXBJ 4USTA 2NZCA 4ZMMA 2C2OB 4QR0A 2UXDJ 4YP3A 1S76D 4WKYA 3ITHA 4ZVPB 1YK9A 2NXUA 1N5YA 3G82B 1RYRA 4AL6A 1O0PA 4KE5A 5CYMA 4CT8A 5ETMA 4NRTA 4RW4A 1I5OB 3GILA 5LMNF 1RU1A 1VLOA 3F0NA 4HTIA 4EGLA 3FSYA 2IPOB 2VJVA 1HBUA 3E3XA 1Y3JA 3HM9A 1WTFA 2HFOA 1J5OA 2GMLA 5GADI 3T6JA 5GAHU 5CYQB 4X4NA 3TVKA 2A2DA 1FJ7A 2LU2A 3SSSA 2QV6A 1JJCB 3IG1A 4GO7X 1T3NA 4P7VA 1HQUA 1YRTA 1DZ5A 2RRAA 4C8OA 4KKOB 4URGA 4QYZJ 2E9TA 2C2MB 2FPHX 3KHHA 3TOQA 1RCXB 5KFSA 4PG8A 4HT7A 2M7SA 4M95A 5BYRA 5LSOA 4Q0BA 6FD1A 3KMSA 3BQ0A 1KLNA 3NNCA 2NXNA 3EDRB 3EE3A 2FLPA 3CVKA 3GMGA 3UDEA 2RU9A 1XR7A 3O44A 4QW9A 3V5RA 5D6GA 4H4MA 3NNAA 4YR3A 3RR7A 4EZ9A 2VD3A 3R5JB 4F4KA 3Q2SC 2HGNA 2MY7A 2CQ2A 2DIUA 3HFVA 1RQ0A 1CJTB 2V50A 1NDPA 1FERA 3W64A 1WI6A 4E0DA 2DISA 3B6BA 1N32J 3PKMA 4ETXA 3UWTA 3UCUP 2LXFA 3I31A 1Q82T 5D4NA 5AXLA 1L5UA 4NMXA 5IWAF 4QIFA 2WSFC 2WVCA 2IBOA 5J2MA 1WG1A 1DQ9A 3UVJB 4O23A 2AYMA 4BWJA 2E9RX 5KT2A 2AT1B 1IN0A 2HWTA 1Q4RA 5KG5A 2R2TA 4UUXA 3I5AA 1IBLJ 1FRJA 4B9TA 4X62F 5J1PA 5E3CA 2WOMA 3I4HX 1NK6A 1YLXA 2Y1IA 3QATA 2F8HA 4KFBA 1HNIB 1ZM9A 4NCGB 5A2QU 1RWKB 2DGOA 5K8NA 1TKXA 3H4DA 2BKOA 1HHTP 1SL0A 1TELA 1K1SA 1Y5IB 3J81j 1FKPA 3L7OA 1N0UA 1RLDA 4OV1A 1TKTA 2QC3A 2Z30B 2EFGA 1BY9A 4PWWA 5FLXU 4P74A 2BQUA 3ENQA 3M8QB 2AGQA 3JB9k 2HG4A 2J6SA 1PAUB 3GSDA 4DPTA 1S9GB 2V4JB 2ASDA 2R7WA 2CNOB 4JYAF 3CPWR 3EXYA 2CZVC 1SUQA 3W60A 1DQ8A 2MY8A 3J80U 3GG0A 1O51A 2CDRB 1EX8A 3HD1A 5KFDA 3T5KA 2FY8A 3QGGA 3W63A 3IRXA 3AJDA 4PG7A 2W24A 3C3LA 3BBFA 2IYGA 3MXHP 1N8RT 1REVB 1CPZA 2DO0A 1DHMA 1ZYQA 5A6WA 4HH1A 1WC5A 3CDUA 2J9CA 4QIGA 1WKJA 3R3TA 1N4LA 1W25A 5AT1B 2RT3A 4BC7A 4OJ1A 1VQ5S 2LFVA 3QLHA 1BMQB 1VIOA 1QJHA 3G6VA 3QO9A 3J7AN 4URSA 3P6YC 5HP1A 2HGLA 2NCKL 5KTQA 2R7SA 4C8ZA 1U6ZA 3QJJA 4ITSA 2FTRA 2HHXA 1T9TA 2UUBF 1F5BA 1RT1B 3C2PA 2L9DA 1S6PB 3KUEA 3BGUA 2DXDA 2E7WA 3I0RB 4NLRA 1YGYA 5T41A 3N01A 4DR1J 4YDDB 2ZHAA 2Y0BB 3HVAA 5DQIA 3CWJA 3R5GA 1H6KX 3OVBA 1SKWA 4ZPCA 1N0VC 2DEJA 4JI2J 5F8JA 2VB6A 1WC1A 3P5TL 3T1AA 5AJ3F 2AJQA 2DNOA 4A8WA 5JVGQ 2Q6CA 1UWBB 3D6TB 4JV0A 3A13A 4LJMA 4NLPA 2XEXA 3FBBA 2R9LA 1CS4A 2DK2A 1Q8IA 2IJRA 4JBCA 3PKYA 3M1VA 1HNVA 4CTAA 3FRYA 1OY8A 4CM0A 1WC4A 1KKHA 2IM3A 1N34F 5JVHQ 4ZVFA 2KKHA 4ZCMA 1S1TB 4N77A 3TX0A 1RTDB 4HLBA 3MMCA 4NLYA 1YG0A 3AJ1A 3M9NB 2X1AA 3K5PA 2NSCA 3CJ5A 4M5DA 4ZK7M 1FD2A 3DLHA 4LVOP 3MCNA 1RTJA 5H9EJ 2B4VA 4U8VA 1VBZA 3CJ4A 2NXEA 4OLOA 3MD1A 3IFEA 1OYDA 2R2RA 4LFBJ 2JFKA 4NLGA 2B9WA 4MKVA 4USUA 1EB0A 2JEIA 5AE3A 2KFZA 2YY3A 1HQEA 1G6BA 4FBTA 1MLAA 4ERDA 5KFEA 2HHVA 3GJQB 4OI2A 2KH9A 2JRSA 4TLQA 2DYAA 2WONA 3NGSA 1L3TA 4LREA 3NCPA 2AZ3A 4CLLA 2QFIA 1IM6A 3D67A 4NZ0A 4QR2A 3PV8A 3VAMA 1NK5A 3M6VA 3KXDA 1K73T 1VLYA 5D0EA 2C2NA 1HYSA 1M5KC 4UOGA 3SBMA 3HDSA 4RW6A 5C7PA 4RUCA 2HRYA 2G2ZA 2WSEC 2CJAA 5B08A 1D1UA 3TZZA 5EN1A 4TNOA 3W65A 2JEFA 3C15B 4P10A 1AZSA 3P3DA 2CQ1A 3DI6B 3G8QA 2EPIA 4G1IA 1D3WA 4K4YA 2AYEA 3JSMA 4P9SA 2X51A 1Z1ZA 4I7FB 4CLSA 2GIRA 1RKJA 4L73A 5C5JA 5E7OB 3S1TA 2V8VA 4QYRA 2R8KA 3QT7A 1FKOA 1TK5A 1RAFB 2HWHA 4LSZB 4OI3A 4U6PA 1FXRA 1NH7A 1TZ0A 2Z2LA 2ZHBA 1SH2A 4F25A 1IR2A 1R6VA 1SJ4P 4JV5J 3EM1A 3I4PA 1V3SA 1S12A 2HGMA 3DRPA 1Q7LB 3DDIA 3FBCA 4WBFA 3PX0A 3Q89A 3AXKA 4LRBA 2W9BA 3NBPA 3DGPA 3MTKA 2VDIA 1YX2A 2LYVA 2U1AA 1BWEA 4LF6J 4DQSA 4USWA 2DGXA 2DR6A 2ATCB 2C2KB 2VL1A 4Y0FA 3MUMP 3GYNA 4OZNA 1NMEB 4TY8A 2V34A 1IBCB 4Y6IA 1D8YA 3CCVS 1RLCL 2NLWA 2PD1A 4RWXA 1KLMA 4UUWA 3VGUA 1R89A 5IT4A 3DN9A 5IFMA 2OPRA 2OD6A 4LSLA 2C22A 3TI0A 3KK1A 3SYZA 2BQ3A 4ANDA 1JLGB 2WK4A 4TU9A 2XS7A 2VPYB 1VQ7S 3VALA 3W1YC 3HT0A 3G2XA 2J7KA 2P9EA 2D7SA 4PG4A 1IKYA 1RJJA 3KLEA 3FQLA 3GIJA 2MHEA 1X5OA 1N6QA 2I6WA 4UZCA 2H5EA 3ZZOA 1G1XA 4M5LA 4IG3A 2VV5A 3MEEA 2OUGA 3WC2A 4IR9A 3JAMY 2OMLA 3OTOF 2H48B 3AA8A 3CC2S
chains in the Genus database with same CATH topology
4B3TJ 4KYZA 4X66J 2UXBJ 3JAMU 4LFCJ 4X65J 4DR3J 4LF6J 1HR0J 2UXCJ 4JI0J 1IBLJ 4DR2J 5AJ3J 4DUZJ 2VQEJ 2UXDJ 2E5LJ 1XMOJ 4GKJJ 4LF8J 2MEWA 4DR1J 4DV0J 1HNWJ 3J80U 4YY3J 4JI4J 4DR6J 3T1YJ 1XNRJ 2KVQE 2MTLA 5IWAJ 4JI2J 2KL8A 4YHHJ 4LFBJ 1I94J 3R2CJ 4JI1J 1J5EJ 5A2QU 4JI7J 4NEYA 4B3MJ 4LF7J 4NEZA 3IMQJ 4RJVA 3D3BJ 2MQ8A 3D3CJ 1HNZJ 2F4VJ 4DR4J 5LM7E 4K0KJ 1IBKJ 2UUBJ 5BR8J 3R2DJ 1N36J 3J81U 1N32J 1XNQJ 1IBMJ 4JI5J 3W1YC 4JYAJ 1N34J 2UUCJ 4DV1J 4GKKJ 1N33J 1XMQJ 1FJGJ 4LF9J 2VQFJ 4DV4J 4KY3A 4DR5J 4OX9J 4DV6J 4B3SJ 4X62J 4NXNJ 4JV5J 4PWWA 4DV3J 5FLXU 4V1Ak 3J7AN 4DR7J 4B3RJ 4LFAJ 4JI8J 3OTOJ 4LF5J 4DV2J 4DV5J 2UU9J 4X64J 2UUAJ 4DUYJ 4LF4J 3T1HJ 2ZM6J 5LMUJ 5IT9U 5LMNJ 1HNXJ 4HHUA 4JI3J 4AQYJ 4KHPJ 2HHHJ 4DV7J 4JI6J 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T J;  4KYZ A;  4X66 J;  2UXB J;  3JAM U;  4LFC J;  4X65 J;  4DR3 J;  4LF6 J;  1HR0 J;  2UXC J;  4JI0 J;  1IBL J;  4DR2 J;  5AJ3 J;  4DUZ J;  2VQE J;  2UXD J;  2E5L J;  1XMO J;  4GKJ J;  4LF8 J;  2MEW A;  4DR1 J;  4DV0 J;  1HNW J;  3J80 U;  4YY3 J;  4JI4 J;  4DR6 J;  3T1Y J;  1XNR J;  2KVQ E;  2MTL A;  5IWA J;  4JI2 J;  2KL8 A;  4YHH J;  4LFB J;  1I94 J;  3R2C J;  4JI1 J;  1J5E J;  5A2Q U;  4JI7 J;  4NEY A;  4B3M J;  4LF7 J;  4NEZ A;  3IMQ J;  4RJV A;  3D3B J;  2MQ8 A;  3D3C J;  1HNZ J;  2F4V J;  4DR4 J;  5LM7 E;  4K0K J;  1IBK J;  2UUB J;  5BR8 J;  3R2D J;  1N36 J;  3J81 U;  1N32 J;  1XNQ J;  1IBM J;  4JI5 J;  3W1Y C;  4JYA J;  1N34 J;  2UUC J;  4DV1 J;  4GKK J;  1N33 J;  1XMQ J;  1FJG J;  4LF9 J;  2VQF J;  4DV4 J;  4KY3 A;  4DR5 J;  4OX9 J;  4DV6 J;  4B3S J;  4X62 J;  4NXN J;  4JV5 J;  4PWW A;  4DV3 J;  5FLX U;  4V1A k;  3J7A N;  4DR7 J;  4B3R J;  4LFA J;  4JI8 J;  3OTO J;  4LF5 J;  4DV2 J;  4DV5 J;  2UU9 J;  4X64 J;  2UUA J;  4DUY J;  4LF4 J;  3T1H J;  2ZM6 J;  5LMU J;  5IT9 U;  5LMN J;  1HNX J;  4HHU A;  4JI3 J;  4AQY J;  4KHP J;  2HHH J;  4DV7 J;  4JI6 J;  4NXM J; 
#chains in the Genus database with same CATH topology
 4BDP A;  2X3G A;  4W98 A;  2NUH A;  1ICE B;  2MST A;  4NPO A;  1FTR A;  2FJX A;  1HR0 F;  1VQ9 S;  4WFY A;  1R6Y A;  4B9L A;  1FRI A;  3SV4 A;  3L9Z A;  5HMW A;  4U8Y A;  2MJU A;  3WIU A;  4CLZ A;  1WHW A;  4D3H A;  3LA0 A;  3ZTR A;  1U6F A;  1AA1 B;  1Q86 T;  4X65 F;  5IQ6 A;  8AT1 B;  2ZC3 A;  1UKU A;  2H54 B;  2ZWO A;  4DHV A;  4B3M F;  1FX2 A;  3P8B B;  2ZIT A;  1N56 A;  2ZH9 A;  1F1B B;  1R43 A;  3QWP A;  4UOH A;  5HLF A;  2ILZ A;  2Q3P A;  3HHL B;  2JHE A;  4F02 A;  3EZO A;  4DV3 J;  1VQO S;  1B99 A;  3T3F A;  2QTW A;  2HRT A;  2VDH A;  1XC9 A;  2R42 A;  4OYZ A;  4A8M P;  1VC6 A;  2XMK A;  3R5C A;  4I69 A;  4ED1 A;  4ANE A;  3F44 A;  4CLF A;  2BMB A;  3VGT A;  2RS8 A;  1S1U A;  3EWG A;  1UFW A;  4K50 A;  4UF4 A;  2J7W A;  4OHV A;  5HBM A;  5I3Q A;  1WDT A;  3HSD A;  3KDO A;  4ZPT R;  2CJK A;  4X64 F;  1S5Z A;  1RT4 A;  2EVZ A;  1RP5 A;  3V4I B;  4I1T A;  2R7Q A;  1VQ8 S;  4RR5 A;  3I5C A;  3H8Y A;  5K14 B;  4F2R A;  3OFG A;  3PZP A;  2EBG A;  1BWV A;  5DRK A;  3OSP A;  2KT3 A;  2IY5 B;  1RT7 A;  2A18 A;  5A8W B;  5IC6 B;  2ZEJ A;  5ETQ A;  4M5G A;  3D54 A;  2DGQ A;  3SV3 A;  4KR0 B;  3QFH A;  1S77 D;  2K06 A;  1WHY A;  4Q5V A;  3DLJ A;  2DY1 A;  1V5I B;  1VQ6 S;  3LP2 B;  2QJ3 A;  2UU9 J;  4LF7 F;  4DS4 A;  1XIQ A;  1W2I A;  2DNK A;  2V0N A;  4A8Y A;  1S48 A;  2B4O A;  2BQR A;  5A0Y B;  4JI3 J;  1UFL A;  1MN9 A;  1FK9 B;  2E5I A;  3KLI B;  2DJW A;  2I5J B;  4WJB A;  3G71 S;  1NND A;  3Q24 A;  4WWS A;  3FFI A;  4OJH A;  1WC6 A;  2AD9 A;  2LQ5 A;  1I6J A;  1KFS A;  3HI9 A;  3SDE B;  3KLH B;  4NEZ A;  3JTO A;  1H2U X;  1OSC A;  4M5K A;  4DZD A;  1ZZF A;  1WG4 A;  1PBA A;  4KO0 A;  4PYA A;  2CPZ A;  2RQM A;  2W8K A;  2UZA A;  3BGL A;  3O5T B;  4ICL B;  4ZS6 A;  3GFY A;  2QA4 G;  1WSV A;  2K8G A;  2MQM A;  1EQ0 A;  2GMH A;  4NLV A;  3K5L A;  1A6L A;  9ATC B;  4LF5 J;  3HZG A;  5G0R A;  2XWX A;  4ZVT B;  2HS0 A;  1GX5 A;  3PO5 A;  1UW4 A;  1LWF B;  5ETT A;  3MUR P;  4LFA F;  1QAY A;  1SKR A;  3QQC D;  3HHN B;  2DBB A;  3QGI A;  4ZVG A;  4DR2 J;  3M6U A;  1VQY A;  2KHC A;  3UN3 A;  4LQ9 A;  4DR7 F;  5KFO A;  2RDI A;  5HQL A;  3BDP A;  4P73 A;  1CLF A;  3CMQ A;  3CIM A;  3JSR A;  2XGP A;  2CG8 A;  5E0O A;  4I0W A;  2CQ0 A;  3RU0 A;  3R7B B;  1J5E J;  4GKJ F;  2MZR A;  3PYD A;  4O0I A;  2FJA B;  3NGT A;  2IYI A;  2BE9 B;  2WBR A;  4C4W A;  1LW2 B;  2PDA A;  3P5B P;  2VHG A;  2DPI A;  4CDI A;  4EBE A;  2YWG A;  1NKC A;  3BQ2 A;  2UVV A;  3DLE B;  4MK8 A;  3OVA A;  2E7X A;  3RGI A;  4JI5 J;  2OI2 A;  4ID8 A;  4DEZ A;  2ZNZ A;  2CQ4 A;  4XIU A;  5KFQ A;  3H98 A;  2ZH3 A;  2XTJ P;  1NJY A;  4DUT A;  3HKW A;  1U02 A;  4OMF G;  3M2U B;  4J9N A;  4LR8 A;  2CQP A;  1DTQ A;  5I42 A;  1WTB A;  2RVJ A;  1PYT A;  1N33 F;  2LQB A;  4U95 A;  3PR4 A;  2W2P P;  5CHC B;  2BW7 A;  2BE2 B;  1TKZ B;  2VFT A;  4YB6 A;  3A8E A;  3GIR A;  1YVF A;  1HYS B;  2FJW A;  1QSL A;  5GVQ A;  4ZVS B;  5L46 A;  4KJI A;  4I64 A;  1U26 A;  3NGD A;  4U9R A;  2MPU A;  2DGU A;  2W9C B;  5L1J A;  1HBM A;  1MMN A;  5EWE A;  2HZA A;  2Q6B A;  3R2C J;  3DLK A;  2HVH A;  3D6M B;  3NP5 A;  3MD3 A;  2PI4 A;  4ZA1 A;  2Z2Y B;  3QGP A;  2CPE A;  4URQ U;  2PN6 A;  2BYC A;  2W2O P;  4LBI A;  4LRA A;  5D15 A;  3I96 A;  1BLU A;  5F0W A;  1RDR A;  3W5Z A;  5A8R B;  1RK8 A;  2XSJ A;  3N6M A;  4OFZ A;  3DHX A;  3SFU A;  2ZDP A;  4NZ6 A;  1UVN A;  1FX4 A;  2P9G A;  1YJ7 A;  3CCM S;  1VIX A;  1NHK L;  2AHO B;  3GP9 A;  1FDD A;  3LOU A;  3IS9 A;  2ZUA A;  3O6Q A;  3C16 B;  2CYY A;  5ETL A;  2BW2 A;  1VQK S;  2HK3 A;  1FJG F;  8ATC B;  1NM2 A;  3JTN A;  4CRJ A;  1RHM B;  3CO0 P;  4DV2 F;  4J9Q A;  3POT A;  2Q66 A;  1ZPW X;  4M94 A;  3BH6 B;  2CJQ A;  1X0F A;  4ILM A;  1L3K A;  5B0B A;  3RBZ A;  1F9F A;  3NXZ A;  1JLC B;  4DDF A;  3FSI A;  1ITP A;  1RT6 A;  4OL8 A;  2AEM A;  2V69 A;  2J0X A;  1R7I A;  4RNF A;  2AJ0 A;  1Z2Z A;  1CBK A;  3QJP A;  1SI9 A;  3L3C A;  1T03 B;  4R5P A;  4LSN B;  5LM7 E;  2WW8 A;  3ELH A;  2ERR A;  2JWN A;  4ZPV R;  3ZTQ A;  2LU1 A;  1IWG A;  4K2J A;  1M5P C;  4C9D A;  2XG8 A;  4Z37 A;  4DCP B;  3LP0 A;  2IMW P;  1I3O B;  1TAQ A;  1YRX A;  1QVF R;  1XNQ F;  3UR0 A;  2HWI A;  4IRK A;  3V6H A;  1X4F A;  5BYQ A;  1Y7P A;  2OEM A;  1MWY A;  1FI4 A;  5IQQ A;  3CJQ A;  1R8H A;  3IAS 9;  3SEO A;  1JJ2 R;  2ZE2 A;  3AFG A;  4QWD A;  1QAI A;  1R8A A;  2OIH A;  4CM2 A;  1VRT B;  5K8O A;  4F0M A;  1VBY A;  5DET A;  5B09 A;  3BKU A;  3AT1 B;  2K1R A;  3C6U B;  4L75 A;  2W4P A;  5BJR A;  2Q79 A;  2GA7 A;  2W8L A;  1RAC B;  3UPF A;  1Y10 A;  4FVM A;  4DXL A;  4YS2 A;  1KVI A;  4ELV A;  1KON A;  4IDK A;  1VQS A;  1VRU B;  2VH7 A;  4KGM A;  3PX4 A;  1PO6 A;  2M2B A;  4ZPB A;  3BF4 A;  3DRS A;  3QRR A;  4YB5 A;  2ZD1 A;  2CPI A;  3D6F B;  2ZH5 A;  1SH3 A;  2C2Z B;  3VAH A;  3KHG A;  1AUD A;  4M5J A;  1GEH A;  3D4J A;  2NPF A;  3ZTO A;  3JQK A;  4OYO A;  4LF4 J;  4OYB A;  4JV1 A;  2ZOG A;  4HL9 A;  3H20 A;  3PG9 A;  1UP1 A;  4XO0 A;  4ZPA A;  3TZX A;  3MR7 A;  2HS4 A;  1RAB B;  2IVY A;  4A8K A;  3GYG A;  1DBD A;  3GV8 B;  1FVS A;  1UVK A;  3U27 A;  1L3V A;  3AQP A;  2VF3 A;  4PAB A;  3EX7 B;  1S57 A;  3PR5 B;  4DS5 A;  3KLV A;  1HPZ A;  3BKF A;  4OX6 A;  1Q81 T;  4OI6 A;  3KFW X;  2NQP A;  3MMA B;  3MR6 A;  4NXM F;  4YME A;  3M9M B;  3QT6 A;  1Q5Y A;  2LEC A;  4ELT A;  3THV A;  4O3O A;  4ED3 A;  2BA9 A;  3CJR A;  4M1K A;  5KT7 A;  2AYG A;  5GAE U;  1XMQ J;  3X3U A;  4WFA Q;  1FRX A;  1MMD A;  1GTH A;  3RRH A;  2LCW A;  2O66 A;  1XWL A;  3R1H A;  2R2U A;  4JB8 B;  1N48 A;  3T6B A;  5F8M A;  4IO1 A;  4FVC A;  1P1T A;  2H5J B;  4FXV A;  1HHS A;  2IJN A;  2JEG A;  1T9X A;  3KLG A;  4HHJ A;  1YTY A;  4DUY F;  3HJV A;  3A3P B;  5CCM A;  1Q1K A;  1O5J A;  1H7X A;  1HMV A;  2HNZ A;  4TU8 A;  4W90 B;  5J2P B;  4WYL A;  1PIE A;  4CO1 A;  4DR5 F;  2HND B;  1N88 A;  1UTA A;  4NLX A;  5KFU A;  3QFW A;  1LKZ A;  5EWF A;  3SMZ A;  1YJW S;  2W7A A;  5HRO B;  4PKD B;  3LP1 A;  2BBE A;  1SVD A;  4ZIT A;  5T7L A;  3UNY A;  3MM8 A;  4Z7C A;  4YR0 A;  2GAG C;  2HHH F;  2V67 A;  7AT1 B;  1TL1 B;  3EPG A;  1K44 A;  2FC8 A;  1F0X A;  3J81 U;  2CUY A;  4L72 B;  1TL7 B;  1IKW B;  3U1M A;  1X4G A;  1JX4 A;  3N28 A;  2XMV A;  5LT5 A;  4DV4 J;  1GH8 A;  1RWV B;  5D3G A;  1X4C A;  2MDA A;  3E01 B;  2V2Z A;  2WHO A;  3TAM B;  2QLJ B;  2OSQ A;  4N76 A;  4DG1 B;  3CDB A;  3MEG A;  1NK8 A;  3GSI A;  5B0D A;  2LLZ A;  3KG4 A;  1WEL A;  3G4S S;  5B0F A;  4IFY A;  3DOM B;  4GC7 A;  1UCN A;  2ABY A;  4NL5 A;  1TUW A;  2OPS B;  2HQC A;  2XO7 A;  2LMI A;  3QYY A;  2X1F A;  3BPD A;  1KQK A;  2WVB A;  5K5M A;  3CCS S;  1U1K A;  5HJX A;  1RKI A;  2F3J A;  1KSP A;  3BO3 A;  4UY8 T;  2FIU A;  3D3C J;  5B0C A;  2IDE A;  3W2W B;  3MAQ A;  5DQG A;  3KK2 B;  1RE1 B;  1S10 A;  1JQG A;  1Z4U A;  5GMK a;  4LRC A;  2OPP A;  2DNN A;  4I2P A;  5KG3 A;  1TL4 A;  1VCT A;  3RUB L;  1Q16 B;  4KV8 B;  4EMD A;  1WHX A;  1CSJ A;  2BRK A;  4CP5 A;  1NBE B;  2J9D E;  3DOK B;  1T05 B;  1FJC A;  1U0H A;  2AYB A;  3GR1 A;  1QD1 A;  4ALZ A;  1ACM B;  1CQN A;  4A48 A;  4A4J A;  3OT9 A;  1IKX A;  1GXL A;  4Y2I A;  2F9J A;  2HQ3 A;  5J2N A;  1QE1 A;  1X60 A;  4R25 A;  1QTM A;  4C8M A;  2YNH B;  1DFD A;  1UFK A;  2GHW A;  1B7Y B;  4C6A A;  5KFX A;  1RT2 B;  2Y8W A;  2OFH X;  1JLE A;  3KJQ B;  1I94 J;  1RT3 A;  1PGZ A;  4JI1 J;  1J2V A;  2N7C A;  4DPW A;  3MWB A;  4KB7 A;  5GME A;  3QRQ A;  1RAD B;  3DYA A;  3OL8 A;  1SIZ A;  4OI0 A;  1MU2 B;  4MJK A;  2FUG 9;  3H25 A;  1QSY A;  1LWE B;  2GJ2 A;  3A4T A;  4N56 A;  5KFH A;  2UXD F;  1WKL A;  3IBC B;  2LEA A;  1C1B A;  1VRQ C;  2P6T A;  2DNM A;  2RIL A;  4WII A;  3KMQ A;  1D0E A;  1H3D A;  1FXD A;  1YIT S;  2KZM A;  4O3S A;  4PQA A;  3K7R A;  5ETO A;  4M63 A;  2M5Y A;  5IZH A;  2XMJ A;  4DV5 J;  1HAR A;  4NA3 A;  1PYS B;  1HBO B;  1KQF B;  4ZVR B;  3C14 B;  2RQ4 A;  3DHW C;  1B7F A;  3MCO A;  4KPC A;  4RW8 A;  2B51 A;  4GRS A;  3MEC B;  5F8G A;  3NCR A;  4F0K A;  1K47 A;  2F40 A;  2IM1 A;  1NUE A;  3T5J A;  3MMJ A;  3QIP A;  1NSQ A;  5KG4 A;  1RWW B;  1FRM A;  2YWF A;  4HTJ A;  5KFF A;  1HWJ A;  1JKH A;  2AJF E;  2J76 E;  1WEX A;  3GTY X;  4TKT A;  4EFA C;  2EKN A;  3AY0 A;  4F3Q A;  1CC8 A;  2EFN A;  2XYG B;  1U45 A;  2YX4 A;  1FVQ A;  2KB2 A;  2IMO A;  3HXM A;  1XJW B;  2NSB A;  1CG2 A;  1SXL A;  3GR0 A;  1X8D A;  2HW3 A;  3NS5 A;  2VBZ A;  1RHQ B;  4K5R A;  3BEG B;  1CJV B;  2YKN B;  2CPX A;  3L4B C;  1MW7 A;  2LKZ A;  5DDQ C;  3DRR B;  7FD1 A;  2ZKT A;  3S8S A;  2N3L A;  2G0I A;  5J2Q A;  2VIC A;  1HIY A;  4NAS A;  5DLF A;  2NS1 B;  5H9F K;  1LW0 B;  3VQS A;  4NA2 A;  3UFC X;  3HHL D;  1WC0 A;  2KXN B;  5LXY A;  5J1N A;  2W4D A;  1U2R A;  2HQF A;  2CZ9 A;  1V5V A;  2VKZ G;  1H2T Z;  3FZB A;  3PFO A;  4DBQ A;  2ZVS A;  4R0J A;  2YKM A;  1W2B R;  2PSZ A;  5KG6 A;  2Z57 B;  4IOB A;  2R7T A;  1SH0 A;  1YJV A;  3TVY A;  4F4A A;  3KTQ A;  5E2Q A;  4MKB A;  3I0S A;  1S6Q B;  2JZ5 A;  4H4O A;  1JLF B;  3HFZ B;  2FHO B;  3V81 B;  1JNR B;  2JSX A;  4ZP7 A;  3ZNJ 1;  2V68 A;  1JMT A;  5KFT A;  3HZE A;  4Q44 A;  5C24 B;  4EBD A;  3PO4 A;  3HHE A;  4G1Q A;  1EP4 A;  5FJ4 A;  4IDK B;  3BPS P;  4MFB A;  2HQD A;  3M32 A;  2CPH A;  2HHQ A;  2MKS A;  1XN9 A;  2JC1 A;  3MMB B;  3KUG A;  1ARO P;  2BAN B;  1FES A;  3WZ0 A;  3ILI A;  1R8P A;  2YH0 A;  4EYH B;  1JJH A;  2B3T B;  4GKK F;  3OSN A;  1RYS A;  3ISN D;  4DX6 A;  4GO5 X;  1IVZ A;  1CVJ A;  2HHW A;  4J37 A;  5F3Z A;  2LQ8 A;  4IOC Q;  1UW9 A;  4F36 A;  3HFK A;  2YTC A;  1EAR A;  1R0A B;  2UXC J;  1S1X B;  4IO9 Q;  4WXO A;  1P9Y A;  2GHV C;  5CYQ A;  1NSK L;  2R7R A;  2KL8 A;  4J91 A;  1MWQ A;  1YJN S;  2H1Y A;  5AE1 A;  4ECY A;  3BYR A;  3N6L A;  2YNF B;  3QT8 A;  2A3J A;  4S0M A;  5E3P A;  3GFZ A;  2ATL A;  4WZM A;  2WVF A;  3Q0A A;  2XS5 A;  4KKO A;  3IC1 A;  5JXS A;  1VJQ A;  2Y8Y A;  4Q2L A;  1QUP A;  2PA8 D;  1FKA F;  4O3Q A;  1IQT A;  1ZM2 A;  2D3O R;  3PIP Q;  2FVS A;  1JXE A;  2DIV A;  1VFJ A;  2ZH1 A;  2HFN A;  4X4T A;  1EKS A;  5SZT A;  4Q43 A;  3CT9 A;  2ZOF A;  4OHY A;  2ZFH A;  1FWL A;  1C2P A;  2C3U A;  1HLW A;  3CC4 S;  4YB1 P;  3EZ5 A;  5CCL A;  1RZM A;  1GTE A;  2ZH4 A;  4RNN A;  1OMS A;  3FEZ A;  4WKR A;  2KG1 A;  1LQ9 A;  3IN5 A;  5IM0 B;  2DCL A;  2CVE A;  4OYM A;  1EHW A;  1CJT A;  1FNO A;  3BN7 A;  4LRD A;  2FHJ D;  4CZC A;  1UZH A;  4IQM A;  4A8F A;  2C3O A;  4ED8 A;  5C25 B;  3RAX A;  2BKP A;  2W2N P;  4QYZ K;  4OI1 A;  2E5J A;  3UCZ P;  4R0E A;  1FJE B;  1H2V Z;  2GQ2 A;  3HD2 A;  4R8U B;  3ENV A;  2C28 A;  2VC0 A;  4MMO A;  2I9S A;  3TA2 A;  2CA9 A;  1F60 B;  3UVJ A;  2Z8Q A;  2BJ8 A;  5CZV A;  4DR1 F;  3TEH B;  1JJ4 A;  4X4Q A;  1TQL A;  3I9Z A;  1CJK B;  4RKU C;  4JI2 F;  1PAE X;  3OXG A;  4NOH A;  1SBR A;  4RW9 B;  5I3U B;  2MYF A;  4C8N A;  1TR0 A;  1IKV B;  2HFV A;  2J6T A;  5EX0 A;  1HNI A;  5L9X A;  2KVI A;  4NCG A;  4DX8 H;  3LWM A;  2NR0 A;  4CYU B;  4X66 J;  2OPQ B;  2RAQ A;  4L3N A;  3CCJ S;  1R27 B;  1X4D A;  2BKN A;  5AJ3 J;  4DUZ J;  4FYX B;  2XY6 A;  3MR3 A;  2GS8 A;  4I4B A;  1CUL B;  3HSG A;  4DSI A;  3MAH A;  4A8X A;  3ADA C;  3T1Y J;  1TUG B;  2HKE A;  4H4K C;  2N7Y A;  4W92 B;  4DI6 A;  1F2H A;  1DUR A;  4TU7 A;  1TU0 B;  3K8W A;  3EVM A;  3GLJ A;  3CCZ A;  2R7O A;  3M8Q A;  1S1V B;  4ZPW R;  1VK3 A;  4DMZ A;  4DR4 J;  2HPU A;  2HVD A;  1TL3 B;  2BUN A;  2RH3 A;  3NG8 A;  2O01 C;  3VGS A;  2DR9 A;  1S9G A;  3QJL A;  2V4J A;  1VGY A;  2OJ3 A;  4I68 A;  1N34 J;  1HNZ F;  4DV1 J;  4EEY A;  4LFB F;  2H65 B;  3OFF A;  1SQF A;  2MKY A;  2HFZ A;  1S6O A;  1U4B A;  3LGH A;  2MGZ B;  4BS2 A;  2E1A A;  3TA1 A;  1W7W A;  3CUN A;  3DDN A;  1RIS A;  1KC8 T;  3TAR A;  3DRY A;  2EFV A;  1BQM B;  2PEH A;  2XQC A;  2V5H G;  1UVI A;  3OXF A;  2E5H A;  3GPA A;  3K58 A;  1REV A;  2KM8 C;  2LXI A;  2XCP A;  3ULH A;  1DLO B;  2OKQ A;  3O2I A;  4ZHR B;  2L3M A;  2DD8 S;  4JOU A;  3SQG B;  3A8K A;  3JS9 A;  1HWU A;  1HW9 A;  2V4Q A;  1JLE B;  1VYA A;  1RSC A;  1NB2 A;  2PO4 A;  5KFP A;  4KH0 B;  3NCQ A;  2CQD A;  2PII A;  3KHL A;  3TAN A;  2C2R A;  1U1R A;  1DTT B;  2LQ9 A;  3H90 A;  3UDC A;  1EQM A;  2WW4 A;  1BHN A;  4RUB A;  1RT1 A;  5GMD A;  3KK3 B;  3AD7 C;  2EK1 A;  1S6P A;  2EEY A;  2R8J A;  4OX9 J;  3CCW A;  3I0R A;  2RUG A;  5KOX A;  2UVW A;  3HLU A;  1A9N B;  1RT5 B;  1U0S A;  2YNG B;  1RHK B;  1Y0H A;  1UWB A;  5RUB A;  2GGP B;  4WP9 A;  1RTI B;  4PPD A;  1F3F A;  4M5H A;  2ASY A;  2CNL B;  2AJ2 A;  2KVQ E;  4WTY A;  1I51 B;  1R8B A;  1V6H A;  3MOZ A;  2IC3 B;  2Y1L B;  2KI2 A;  4DL5 A;  3MFI A;  4DLG A;  4NI2 B;  1G3O A;  5CH7 B;  3PIO Q;  1CEZ A;  3CD6 S;  4LT6 A;  1VQ4 S;  4WK3 A;  4DL6 A;  4JI4 F;  4OQJ A;  5E5N A;  2IA6 A;  1S1T A;  5HN0 A;  1OWX A;  4F8R A;  1RTD A;  2BM0 A;  3GFX A;  1ELO A;  3VZI A;  3CJT A;  5HQ8 A;  4HEA 9;  1RWN B;  1V3R A;  5KG1 A;  1N36 J;  3MTJ A;  1TKD A;  1FFG B;  3OL6 A;  3EXC X;  3ICL A;  5HL7 Q;  2UUC J;  1UVJ A;  2ACM A;  1QLN A;  2YKP A;  3L7P A;  3UW1 A;  4YFU A;  4ZPD A;  2FZC B;  3PAC A;  3EGV A;  1FRH A;  2V9W A;  2XC9 A;  4G3I A;  3CTR A;  4RBU A;  3VF0 B;  1YHQ S;  1WAC A;  5HAT A;  4KHM A;  1WHV A;  3G86 A;  3RW7 A;  3NS6 A;  4I56 A;  3W5X A;  4C8K A;  1QSS A;  1Y5N B;  3J7Z T;  1N52 B;  2BEF A;  2VPW B;  1RHJ B;  1TMM A;  1KS2 A;  1M5V C;  3A8J A;  2OEL A;  1NPK A;  5L1K A;  2IM0 A;  4LBH A;  3DRX A;  5GAE I;  4CO4 A;  1NEE A;  1T3O A;  4P72 A;  2BAB A;  3MCS A;  4DPX A;  4BWM A;  1QVG R;  4O4G B;  3RB3 A;  3OBI A;  4WCE Q;  3GIK A;  3UD5 A;  3EVW A;  3MM9 B;  4I6W A;  5H9E K;  3A8I A;  2I0X A;  2AJ4 A;  1VQL S;  3ILL A;  4O3R A;  4CI0 B;  2P9C A;  3FRZ A;  4LIW A;  4E8U A;  5KFC A;  4OHZ A;  4BC9 A;  2YKO A;  5DDP C;  1HD0 A;  1H38 A;  2GCF A;  2DR8 A;  1WEY A;  2ALZ A;  3OTO J;  3D7S B;  4NLT A;  3W9H A;  4WYW A;  4GVB B;  3M8P B;  3C15 A;  4J9L A;  3DI6 A;  3TRG A;  1TVR B;  3LPY A;  2F8M A;  2D1C A;  2QMX A;  1VQN S;  3UDL A;  5K9F A;  1HR0 J;  4Y2M A;  2ILY A;  1P27 B;  3MR5 A;  1TL5 A;  4I7F A;  5CD4 A;  3SCL E;  4B9S A;  4OZ3 A;  1CJU B;  4TLR A;  1YRU A;  4LF8 J;  3JSB A;  4TYB A;  2EBE A;  3DM2 B;  1NU4 A;  3B8H A;  2PI5 A;  4ETZ A;  1NZ8 A;  3FUY A;  2DRD A;  4ZVQ B;  3LAL A;  2DO4 A;  2COL A;  1UAW A;  5KFY A;  4B3M J;  1M0S A;  2XLK A;  2KN4 A;  3SCJ E;  4F67 A;  4X4U A;  2XY5 A;  4NCB A;  1XQI A;  1B4S A;  3LH2 S;  2BJ9 A;  3ZZT A;  1UET A;  2WZ1 A;  2DVI A;  2HYI B;  1WOR A;  5KAK A;  2XWY A;  3GIM A;  1T9W A;  4QWA A;  4RUH A;  3LO3 A;  2RDJ A;  3KJV B;  3BQ1 A;  2PGC A;  3H5Y A;  4Q7A A;  1U1L A;  1GMW A;  1AFI A;  2ZBP A;  1DRZ A;  3DCA A;  2QMU B;  3FK4 A;  3PW2 A;  2ZM6 J;  3CCE S;  5EX3 A;  1H74 A;  2HUR A;  2W2M P;  1HI8 A;  4AQY J;  1RBA A;  1Y3K A;  3FCH A;  5IS2 A;  2Y0S D;  2XB2 D;  4C98 A;  1JLG A;  2ZOM A;  3I9V 9;  2V8D A;  2AIR B;  4M5N A;  3UO0 A;  4HHH A;  3ENA A;  4CLP A;  1VOM A;  1BE4 A;  1EAY C;  4EI2 A;  4N5S A;  2GVD A;  5BXI A;  4DL4 A;  3OHB A;  2M52 A;  2XYH B;  3CW2 C;  4LQ3 A;  1DJ0 A;  4OLP A;  5CA5 A;  1C4A A;  2WSC C;  4RZR A;  1WG5 A;  2DNY A;  4ZJL A;  3D2W A;  2AMC B;  4A8O A;  1FDN A;  2HZV A;  1LOU A;  4B9N A;  4LF9 J;  4QIW D;  2Y9H A;  2J8A A;  1NB7 A;  4BLG A;  2W7O A;  3IA0 A;  4TVA B;  4O44 B;  2H4W B;  1D09 B;  2QLX A;  3MAA B;  2XCA A;  1YKW A;  2QL7 B;  2DHX A;  3ZZP A;  3G6Y A;  1C0T B;  2K3I A;  1KN6 A;  4X4S A;  4K4Z A;  3TAP A;  2RKI B;  4USI A;  1S72 S;  4KSE B;  3OJU A;  1NHV A;  2DRB A;  4ZLN A;  3CUL A;  1M1G A;  1BXN A;  1GMU A;  3JQM A;  1HNX F;  3N6N A;  3NKY A;  3TJA A;  1RAI B;  1T8E A;  2DNL A;  4RPF A;  3OL7 A;  3G6X A;  4JI0 F;  3HHL A;  1U6B A;  2RF2 B;  5LOQ A;  4TQR A;  2QMW A;  1ZOT A;  3MM5 B;  3HVR A;  2VJU A;  4KGK A;  4NLQ A;  4DQQ A;  4IYQ A;  3TA0 A;  4RNM A;  1RAO A;  4LF1 A;  2IRX A;  2C1E B;  4F04 B;  2BJE A;  3PRD A;  1ZAX A;  4L76 A;  4LFA J;  1J5E F;  2FVQ A;  2B7B B;  1Y00 A;  3CED A;  3VHQ A;  4J9S A;  2NYI A;  5K8M A;  3E51 A;  3VQT A;  3V4I A;  4IG0 B;  2OLW A;  2JOQ A;  3MPW A;  2FQQ B;  1GAO A;  1F5A A;  3OUY B;  1NK9 A;  3VAJ A;  2YWE A;  4JI5 F;  3ILO A;  2IAJ B;  4QU6 A;  1RAG B;  2BJ7 A;  5K14 A;  5KFA A;  2VFS A;  4YR2 A;  4GKJ J;  4HT5 A;  4CIO A;  3HVT B;  4B9U A;  3M30 B;  5A8W A;  2MTL A;  1G7C B;  2V63 A;  1Q7Y T;  2W7P A;  1S4E A;  4UQT A;  3LP2 A;  3I55 S;  4F3O A;  2FJE B;  2E9Z A;  1FRL A;  4YDX A;  1Z2L A;  2H9Z A;  3FSX A;  1IBK J;  3OV7 A;  5A0Y A;  1KRP A;  2HHP A;  3HHK A;  2BX6 A;  2ZZT A;  3JYT B;  1FK9 A;  2GVZ B;  1KOO A;  2DGS A;  3KLI A;  1H0H B;  1P9Q C;  2I5J A;  1N33 J;  2MHN A;  5FLX Y;  2KRR A;  4USV A;  3V4M A;  2NYH A;  3MM6 B;  1BUX A;  2IBK A;  2MJN A;  4AL5 A;  2LP4 A;  3H4B A;  1S59 A;  2MSS A;  2G1D A;  4G1P A;  2V2Q A;  2WVD A;  2Z2Z A;  3PW5 A;  2DXE A;  2JNJ A;  4HHU A;  3KJN B;  3LAK A;  1LWC B;  3SDE A;  3KLH A;  2RML A;  2GHP A;  3BSN A;  3BO4 A;  3T1H F;  1BQX A;  3FCW A;  3J80 Y;  4QPX A;  2JLF A;  1X4H A;  2D74 B;  3PYE A;  2VBW A;  2W2Q P;  4WFZ A;  5BYS A;  1S49 A;  4ICL A;  4LMZ A;  3RBE A;  2CNN B;  2L9W A;  2C42 A;  4Y28 C;  3D5M A;  3Q8V A;  1WI8 A;  3CMA S;  2HBY B;  4Y00 A;  3BGO P;  3ZZ0 A;  3AOA A;  2IRY A;  2FHJ A;  1PG5 B;  1LWF A;  5EUH A;  5BR8 J;  4P2S A;  3KLF B;  2XYP B;  3OFH A;  4QW8 A;  1S97 A;  4RBV A;  3KKF A;  4CH1 A;  1RU2 A;  1ZBT A;  3DMJ B;  3B82 A;  1FJG J;  1SB6 A;  2VQF J;  4C8Y A;  4FDF A;  5FDL B;  4RX6 A;  1JLA B;  2HS3 A;  4DV2 J;  1LWX A;  4J9V A;  1AT1 B;  4NML A;  3HKZ D;  5DM6 Q;  3VV2 B;  2KO1 A;  3MM7 B;  3SCK E;  4C8L A;  4RW7 B;  2UV8 G;  3Q22 A;  4DSJ A;  2BXJ A;  2VFU A;  2UUT A;  4WZQ A;  3RB4 A;  1LW2 A;  2CAJ A;  4WPA A;  4ES3 A;  3AJ2 A;  3DLE A;  2KTQ A;  5C42 B;  1NK0 A;  3HK2 A;  1R8C A;  3MI7 X;  2ZUG A;  1NDC A;  2WB1 D;  1FCA A;  5G4D A;  3M2U A;  2C3M A;  2YNI B;  4P6Q A;  1IM4 A;  2KU7 A;  4QBU A;  4F0H A;  3QT5 A;  4PG5 A;  4OZ0 A;  3G9C A;  3DXB A;  2ASJ A;  3OLA A;  1MG7 A;  4GMK A;  2V8G A;  2BE2 A;  1XNQ J;  1TKZ A;  3QWU A;  5HAO A;  5FII A;  2QA4 S;  1KVJ A;  2VG6 A;  2OTL S;  2KFN A;  1KTQ A;  2E1R A;  5KFL A;  3GFH A;  2JFD A;  2Z58 B;  3EZU A;  1YDL A;  3GQC A;  1Q8B A;  2NZ4 A;  3M8R A;  2W9C A;  4J9K A;  4Y2C A;  1NJW A;  2ZH6 A;  3D66 A;  2MKJ A;  2FB0 A;  3JXO A;  2IVF B;  3B78 A;  1E6Y B;  3PJX A;  4CLK A;  4CQ1 A;  3VR1 A;  4EK2 A;  1B70 B;  4DSF A;  1YJU A;  2HMI B;  3MUV P;  2FD2 A;  3ZTS A;  2FJD B;  4DV0 J;  4IOA Q;  1M5S A;  5A8R A;  3CCQ S;  2ACY A;  3NNH A;  1SV5 B;  2QO3 A;  2VQE F;  1N5Q A;  3M2R B;  2XUL A;  1WUU A;  2X1B A;  4XTT A;  4FKY A;  4ECR A;  1U1P A;  2GMJ A;  5DZ6 A;  1XNR F;  3C16 A;  3TQ1 A;  4X4R A;  5JUM A;  1X7V A;  2KDO A;  1GMV A;  4OZ2 A;  4E2F B;  1EET B;  3AHP A;  3I87 A;  1HFE L;  1RHU B;  2HIY A;  1P1L A;  1TP7 A;  3M2V B;  2MQP A;  2P2C B;  1LNQ A;  3CCT A;  3M7V A;  2H3E B;  3D1O A;  3V6K A;  2ZBI A;  4ZJO A;  1JLC A;  4ECT A;  1X4E A;  4MYU A;  3UD3 P;  5U47 A;  3RRK A;  4CO2 A;  4H54 A;  5B0A A;  2MKH A;  2XMT A;  4NYZ A;  4NA1 A;  2B5J B;  4K2X A;  4AXJ A;  3K5M A;  1REG X;  3NRB A;  4C3K A;  2JC0 A;  3W62 A;  1T03 A;  1XR5 A;  4LSN A;  1XMQ F;  4P75 A;  2HBZ B;  4ID5 B;  2VG7 B;  4USH A;  4PZV A;  3VVT A;  3GU0 A;  2ZZN A;  1R3N A;  1SJ3 P;  3PRV A;  1NRK A;  2WAQ D;  2ZKU A;  1CC7 A;  1ZPV A;  1OIA A;  2DH9 A;  2GVD B;  3BRE A;  3D1Q A;  4DZ6 A;  1NO8 A;  2NUU G;  4WTO B;  1FE0 A;  5KG2 A;  4WF9 Q;  3MCM A;  1YZ7 A;  1FD8 A;  1OS5 A;  4OYA A;  3RJM B;  2CPY A;  4XDC A;  5CZX A;  3AOB A;  1VRT A;  3I32 A;  3MPU B;  3OTB A;  2RRN A;  1A7G E;  3ZTP A;  4B08 A;  3U7J A;  1ZH5 A;  3C6U A;  2EWH A;  4DUY J;  2LEB A;  2W25 A;  4NCA A;  5HMX A;  3MPV A;  2FC9 A;  3D6H B;  5H1S V;  2ZZM A;  2VBX A;  2CWK A;  1UEK A;  3I56 S;  1VRU A;  3EVO A;  2RS2 A;  2K7K A;  1G4C A;  2ZNY A;  2DH8 A;  2M4M A;  1WJ9 A;  3DNC A;  1WSR A;  2V9K A;  2GIQ A;  2YKA A;  4B3T F;  2MLZ A;  2A6O A;  2RD5 C;  4FF1 A;  3G8S A;  3MEK A;  4FF2 A;  2Q43 A;  4QWC A;  2WTF A;  4ED6 A;  4EUV A;  4YB7 A;  2GX8 A;  2PC6 A;  3Q86 A;  3QZ7 A;  1QY7 A;  1Q0N A;  1RXO B;  5KT6 A;  3WBZ A;  3LF0 A;  3IBW A;  1ZAV A;  2A1B A;  1RAE B;  1UMJ A;  5HSP A;  2EC2 A;  2JVO A;  2Z4P A;  2MKI A;  2HLT A;  3R6L B;  3LPE A;  3O3L A;  1HKA A;  2EFP A;  1UVL A;  3Q8U A;  1FXL A;  4JI8 J;  1MNE A;  4RLE A;  1RI7 A;  3DLG B;  3H2U B;  1DAX A;  2JL9 A;  3KUH A;  3M8W A;  3IGN A;  3IR7 B;  2XBP A;  2BDP A;  2OP5 A;  1R31 A;  4KC5 A;  4ER8 A;  2G2Y A;  3HPO A;  4DFJ A;  4ZLJ A;  4I67 A;  2Z2M A;  3MMA A;  2K2P A;  1C1C B;  2GQQ A;  5J1E B;  3PHT A;  1WC3 A;  3QNW B;  2JLG A;  2PE8 A;  4FS1 A;  3OQ2 A;  3U1N A;  2QL9 B;  3H2L A;  5FD1 A;  4C7Q A;  1E6V B;  1L3S A;  1MML A;  2CPJ A;  1RWX B;  2PMH A;  4DSK A;  3P96 A;  2XLJ A;  3TUP A;  2EG1 A;  4KAI A;  4EZ6 A;  3VCD A;  5DG7 A;  5B7W A;  5IV3 A;  3GWC A;  2M70 A;  4DL2 A;  1U7L A;  1ZZN A;  4IRC A;  1TTH B;  1R0C B;  1C0U B;  3KDN A;  1M1H A;  5J2P A;  5HVG A;  2LA6 A;  2Y1R I;  4JI1 F;  2HND A;  3TAQ A;  3P49 B;  3EYZ A;  2BM1 A;  3FJ2 A;  4DN9 A;  2UUA J;  3WDO A;  4OYX A;  1FDB A;  1D9F A;  1Q78 A;  5HRO A;  4FNH A;  1P8G A;  2O67 A;  4PR6 A;  4YUD A;  3H2V E;  2FHM A;  3CDE A;  3GB0 A;  3Q8R B;  4KQZ A;  4ZVH A;  1TL1 A;  3CME S;  4V19 X;  2CXE A;  3RB0 A;  5DM7 Q;  1Q8L A;  3IWX A;  2ROE A;  4DQP A;  3F41 A;  4HH0 A;  3BBB A;  4K59 A;  4XK8 C;  4MTP A;  1TL7 A;  3PYG A;  4DV5 F;  3NLC A;  4HVZ A;  1IKW A;  1FEH A;  1F9E B;  4C48 A;  4EO8 A;  5EGY A;  3E01 A;  3TAM A;  5HMZ A;  4MKA A;  2MQ8 A;  2VA3 A;  2AX0 A;  4J9P A;  1JLB B;  4DG1 A;  3Q2T C;  1N5T A;  2D9O A;  2MQO A;  4IFV B;  3KOA A;  1OO0 B;  2F4V F;  2MZQ A;  3DOM A;  3CCR S;  4OZ1 A;  4DV6 J;  1X31 C;  2OPS A;  2FDN A;  2KM8 B;  3OPK A;  2O3D A;  5ETK A;  2RB7 A;  3T41 A;  3NWG A;  4EYI B;  3LWL A;  1BD6 A;  2HFS A;  2K7J A;  4PAA A;  5LMU F;  1RB0 A;  4G6V B;  1JLQ B;  3W2W A;  1F9H A;  4ZCL A;  5LXR A;  3KK2 A;  2HNY A;  4ZOS A;  3PRB A;  3ZZR A;  4UY8 5;  2K3K A;  1GNK A;  4CLY A;  1OPZ A;  1SCJ B;  3AQO A;  3W9I A;  3OLB A;  1ZA2 B;  4KV8 A;  2WBM A;  4I2Q B;  2M0G B;  2UUW A;  3DOK A;  2VOP A;  1KR4 A;  1T05 A;  3K2Y A;  5I4M A;  1H98 A;  3C46 A;  1KHV A;  2AV5 A;  4B3O B;  2UV8 A;  5KOW A;  2LDI A;  4BBY A;  5F41 A;  2R8G A;  3EUN A;  1HBN B;  2YNH A;  7FDR A;  2R8I A;  2DNH A;  1F5C A;  1O6X A;  2VG6 B;  1RT2 A;  1TV6 B;  4JUZ A;  3OFE A;  5A76 A;  3CIZ A;  1GQE A;  3LQV A;  3K0J A;  3T5H A;  3DC2 A;  4KHP J;  3H5U A;  3PW4 A;  3DKD A;  1S6U A;  3ZZU A;  2RRB A;  5KFK A;  1K8A T;  4YOE A;  1MU2 A;  2J0W A;  1FNX H;  4A47 A;  2DKO B;  1LWE A;  3UQS A;  1K9M T;  4NE9 C;  4C0B A;  2XZW A;  5C2G A;  3RB6 A;  3HP6 A;  4BHQ A;  1S0N A;  2DNG A;  5HVH A;  1NJI T;  4MT1 A;  2I2Y A;  5DG9 A;  3KNA A;  1HQ2 A;  1NAQ A;  2DT9 A;  3NWR A;  4RO0 A;  2MMY A;  4WE1 B;  1HBO A;  1VC5 A;  3V6D B;  3D28 A;  3C14 A;  4X84 A;  2EKY A;  3JTP A;  2UXC F;  3RBD A;  5MAO A;  3A12 A;  3B4D A;  1UJ4 A;  4D3G A;  3FMW A;  2MKK A;  4DPU A;  4DSL A;  1KQG B;  1TK0 A;  2QSW A;  4GKK J;  2QYC A;  3MEC A;  5E41 A;  3MPD A;  5KFI A;  4QJV A;  1RTH B;  5ETV A;  2LA4 A;  3OL9 A;  3RG6 A;  2DXF A;  1PSD A;  1S4F A;  4PWD B;  3HJF A;  3OR1 B;  4JV2 A;  3ZZY A;  4QWE A;  1WWH A;  4LIR A;  1TMJ A;  1AFJ A;  4DQR A;  4QCL A;  2JEJ A;  2MQN A;  4ILR A;  3FVY A;  4PUO A;  3LGN A;  1X5T A;  2E5G A;  3MPY A;  1BGX T;  2IHR 1;  4TN2 A;  3UD4 P;  2HRU A;  1PYO B;  3IO1 A;  2MEW A;  4J7C A;  4DV7 F;  2OD4 A;  1D8Z A;  1CJV A;  3GG1 A;  3CO9 A;  2YKN A;  1V3Z A;  1Y5L B;  4ECV A;  1UA0 A;  3D1H A;  4MK7 A;  3DRR A;  3V2U C;  4PG6 A;  2F8E X;  3GII A;  2HHS A;  2XNQ A;  3A3O B;  3H0P A;  4ZIW A;  3KNG A;  1LW0 A;  3CJ3 A;  3QBC A;  2YKQ A;  4K0K J;  3N5F A;  4Q2M A;  1PCA A;  1S7I A;  5DS7 A;  2ROG A;  1NK7 A;  1YSJ A;  2MZ1 A;  2F9D A;  3PJ9 A;  4NXN J;  2J8S A;  3IXQ A;  3H5S A;  3UE2 A;  2ZBQ A;  2YVS A;  1U1M A;  2QSF A;  3DOL B;  4NLO A;  1S6Q A;  2JVR A;  1JLF A;  2FZG B;  3M6X A;  3V81 A;  3KG0 A;  2ADC A;  5ETN A;  3TVZ A;  1T02 A;  4C11 B;  4LFC J;  2G0J A;  4TYA A;  5C24 A;  3TP2 A;  3SCI E;  5K8P A;  1U49 A;  1Y11 A;  4FKX A;  4MH8 A;  1TFW A;  3W3S A;  3VZH A;  3TJ9 A;  4DR3 F;  4PQU B;  1VDH A;  4PXD A;  3MMB A;  1S1W B;  4YHH J;  4PPZ A;  2BAN A;  1EIY B;  1X4A A;  3BZQ A;  5A8K B;  1SPB P;  2D41 A;  2OSR A;  3CC7 S;  2GC8 A;  4A8S A;  1FFS B;  4X66 F;  4WK1 A;  3N9U C;  4NLD A;  1S9E B;  2HK2 A;  5THW A;  5E33 A;  1T94 A;  4DUZ F;  4P71 A;  2VBY A;  4Y3C A;  4J5O A;  1R0A A;  4RNH A;  3T1Y F;  1KQS R;  2QGF B;  4KY3 A;  1S1X A;  3I5B A;  2D69 A;  5DGB A;  4PXB A;  4EU0 A;  2WCX A;  5K20 B;  2YPZ A;  1X5S A;  1IBM F;  3RZA A;  5LSR A;  5JJB A;  4FZV A;  1ZM4 A;  4NRU A;  4N47 A;  2ALY B;  2GZO A;  3QMQ A;  4DR4 F;  2MB0 B;  2FZK B;  2YNF A;  1UEU A;  3FC9 A;  1OQ6 A;  1SJ1 A;  2B9X A;  1QUV A;  1T7P A;  4DV1 F;  5L1I A;  2E1P A;  2BE7 D;  4IKA A;  4CT9 A;  3RBX A;  1NDK A;  4JI6 F;  1FDA A;  4CLW A;  1F3V A;  2V8P A;  4MK9 A;  2MQQ A;  3NS7 B;  1IXK A;  3BH7 B;  3LGM A;  4C3M A;  3C66 A;  2RJZ A;  5MLC V;  5CAA A;  3BGR B;  1HNW F;  2B6A B;  5IC4 B;  2AP6 A;  1B0T A;  3M6W A;  4ZVE A;  5KT5 A;  1HNZ J;  2B56 A;  4PYD A;  3W2V B;  4P2X A;  3HT3 A;  5D0R A;  3NMR A;  5A6P A;  2XHW A;  3W61 A;  5D4O A;  3EGN A;  5IM0 A;  1Q8K A;  1MRO B;  4K5S A;  2VG5 B;  1RGV A;  2HBQ B;  2E29 A;  1WKK A;  2APO A;  4B3R J;  4ZP9 A;  2R8H A;  4PWU A;  1X5P A;  4HDG A;  5C25 A;  3K8V A;  3HSZ A;  3GE9 A;  1JK9 B;  2L48 A;  4K4V A;  4R8U A;  2KFY A;  2LEP A;  3CJK B;  2F1F A;  4HAC A;  5DQH A;  2VA2 A;  3UDV A;  4F50 A;  1XTZ A;  3KYL A;  1BQN B;  4ES1 A;  2DR5 A;  2PA3 A;  2CQC A;  4OYP A;  3FEY B;  1XMO J;  2MQL A;  4OX9 F;  2AQ4 A;  3BR8 A;  4YQW A;  2MLY A;  1IJF B;  2KZZ A;  3OR2 B;  4F4W A;  1CJK A;  1QDU B;  2QG9 B;  1Q53 A;  5HVF A;  4RW9 A;  5I3U A;  3PEJ A;  4HYK A;  2ZH8 A;  1IKV A;  4DLE A;  4DR6 F;  2KHD A;  1RTZ A;  4MKY A;  3BSA A;  2JDJ A;  1RBO B;  3JQJ A;  2DHH A;  4ECS A;  1VS3 A;  3ITH B;  4L3K A;  4AE5 A;  1TUV A;  2VUG A;  1FWK A;  4CYU A;  4WU2 A;  2OPQ A;  4FS2 A;  4DU8 A;  1N5Y B;  1H7W A;  1FNM A;  2KXH A;  2XZT B;  5CYM B;  5CD4 H;  4RW4 B;  4FYV B;  5CYJ A;  1CUL A;  1FRK A;  4P7T A;  2DHA A;  2QN6 B;  3B4M A;  3UNG C;  1WD6 A;  3OHA A;  2KG0 A;  2B9E A;  1HBU B;  3PDN A;  3TNV A;  2F4F A;  1J5O B;  3SXL A;  1KOH A;  1OY6 A;  1N36 F;  1ZTT A;  5KFJ A;  3JAM U;  3E2E A;  1S1V A;  3OJS A;  4K7Q A;  2OO4 A;  3PM9 A;  2UUC F;  4U67 Q;  3K57 A;  1V9O A;  1XER A;  1TL3 A;  3IG1 B;  2AEF A;  1ZAW A;  4LF2 A;  1HQU B;  4N8N A;  5C2C A;  4JI4 J;  3S6E A;  3PXG a;  2OFG X;  3GZ7 A;  4U7C A;  1S79 A;  1B0V A;  2HNY B;  4HDH A;  1PJ6 A;  2G2O A;  2HLU A;  3FNN A;  2IVM A;  4I6Y A;  1VJW A;  4JI7 J;  3TEG A;  5KFN A;  1G2E A;  2MGZ A;  3IRW P;  3R6G B;  3CJ0 A;  4Q0B B;  3J81 Y;  2X3D A;  1VBX A;  2PFF B;  1BQM A;  4AL7 A;  1RAA B;  4K8R A;  5EHH A;  3PW7 A;  2CG4 A;  4H4M B;  4ZLL A;  2I1R A;  1DLO A;  4B02 A;  4ZHR A;  3J7Y I;  5L9N A;  3SQG A;  1LXJ A;  2FYX A;  3THP A;  4B3S F;  2DNR A;  2BRL A;  1IUJ A;  2QE5 A;  4ZCK A;  2VFR A;  3FCV A;  5KFG A;  1GMW D;  3Q8P B;  1DTT A;  2E5L J;  1SIW B;  4DFM A;  1FFW B;  5E3R A;  3GYX B;  3D0I E;  4P52 A;  2UXB F;  2Z56 B;  4YY3 J;  5J2M B;  2NRE A;  3KK3 A;  3BN4 A;  4OX8 A;  2V6A A;  4ED4 A;  4ELU A;  4QR1 A;  2BJ3 A;  2F65 A;  1YIJ S;  1SJF A;  3OVS A;  3OD2 A;  4KGZ B;  1RA7 A;  2CPD A;  1RT5 A;  3KWM A;  4X4O A;  2UVR A;  3MOJ B;  2BJD A;  1Y4Z B;  2YNG A;  2N3O A;  2WOM B;  4LF8 F;  3H5X A;  3TW0 A;  2GGP A;  1U47 A;  1RTI A;  1KHW A;  1IJE B;  4KFB B;  4E98 A;  2C2D A;  2BOA A;  1PBU A;  2CQI A;  1B64 A;  1U8S A;  3AD9 C;  1TKX B;  1EZZ B;  3A1Y G;  4DF8 A;  3VAF A;  4KHR A;  5ETR A;  4G65 A;  4KGX B;  1CQM A;  2IIH A;  1UWA A;  2IC3 A;  5LMN J;  4NI2 A;  2KJV A;  1U2F A;  1OYE A;  2H5I B;  1FKP B;  1FWP A;  3HHD A;  3EGZ A;  3D0H E;  1QTN B;  2J5A A;  3BYP A;  1HI0 P;  2PT0 A;  1TKT B;  1XR6 A;  3HVW A;  3R97 A;  2RQC A;  1JWW A;  1PC4 A;  2VON A;  5GAG I;  4PUO B;  2XI2 A;  5AXK A;  2VZ9 A;  2VAS A;  3N79 A;  1QAJ A;  5D4L A;  2DGV A;  4ZN3 A;  1VR6 A;  2ZM6 F;  5KFR A;  3ZXW A;  4QPT A;  1RUS A;  4DOZ A;  3CCL S;  4ZIV A;  2EXU A;  4AQY F;  4YEA A;  3PX6 A;  1D9A A;  2P8I A;  3K5O A;  3FGV A;  1VQM S;  1SUQ B;  5HK4 A;  2FY1 A;  4HI2 A;  2PMZ D;  5D0H A;  3J7A 1;  4OIX A;  2QT7 A;  2ZBR A;  2AKW B;  4KPY A;  2RIJ A;  3EPI A;  4X2B A;  3CNQ P;  3IRX B;  1UJ5 A;  2XS2 A;  3E8O A;  1I1G A;  1N32 F;  4W4M A;  1UPP A;  1M90 T;  4Y2A A;  4X4P A;  3KJF B;  3J7Z 5;  3N5B A;  1YBT A;  3W8P A;  3EJM A;  1M1K T;  3I6P A;  4O4G A;  2OHD A;  3P45 B;  4UOC A;  3QLH B;  1PKU A;  3R8Y A;  1APS A;  3ILJ A;  3MM9 A;  2A10 A;  4LF9 F;  2ZDO A;  3QO9 B;  3SSQ A;  1HWI A;  4ECX A;  3KHR A;  5HP1 B;  4UT4 A;  5IWA J;  3R7N B;  1N5V A;  4ZP8 A;  1IBL F;  3LTO A;  3RRG A;  1X0P A;  5ADZ A;  2CWX A;  4GVB A;  3M8P A;  4CLT A;  4IR1 A;  2C3P A;  2RDD A;  2FVC A;  2NXC A;  2YPY A;  1NJX A;  1TVR A;  1OY9 A;  3LW5 C;  2MLX A;  5M2U A;  2DIT A;  1U8W A;  3WX4 A;  4GC6 A;  1CJU A;  1LFP A;  4X62 J;  2GV1 A;  3OW2 R;  3SI8 A;  4ZLP A;  3UR3 C;  4IH6 A;  3DM2 A;  3VAI A;  3EMT A;  2VOO A;  1CS4 B;  1HNX J;  3W8G A;  1GX6 A;  4XDD A;  1M5H A;  1P6T A;  3M1V B;  1HNV B;  4CTA B;  4JI0 J;  5T14 A;  3D0G E;  2DRA A;  3CDA A;  2D3U A;  3CB4 A;  5F8H A;  5CAB A;  1GFW B;  1YBU A;  3AXM A;  3R5B A;  3W9J A;  3MMC B;  4EBC A;  3KJV A;  1M5O C;  3NMA A;  3QPI A;  3C8Y A;  1VMB A;  4M5D B;  2GNK A;  1SC4 B;  5GAH I;  1FHT A;  1QM9 A;  2Z0G A;  1JB0 C;  1RTJ B;  3N0V A;  2FGO A;  1U1O A;  4ENO A;  2KXF A;  3US5 A;  1NPR A;  4JYA J;  3D9B A;  2MZJ A;  1UA1 A;  4ZKA A;  3PYF A;  2XZD B;  4MIW A;  5F8I A;  6AT1 B;  2R7X A;  2HVZ A;  3PEH A;  2E44 A;  4O0N A;  3HO1 A;  4KBI A;  1HQE B;  1AUS L;  5F9L A;  3QSI A;  3W5Y A;  1IBK F;  4IH5 A;  1WF2 A;  3RAQ A;  1Q95 G;  3DDK A;  2WON B;  4P2M A;  1PC5 A;  3ISZ A;  3QRP A;  4HAC B;  1S0V A;  5M2P A;  3FKB A;  3G8T A;  3D68 A;  4WIQ A;  3AOC A;  1RWO B;  2OEK A;  3BB5 A;  1O8B A;  3ZZZ A;  4PCQ A;  4O44 A;  1T9V A;  3ET6 A;  4RJV A;  2VOD A;  4C0H A;  1NHU A;  3MAA A;  3GCW P;  4RW6 B;  4KT0 C;  3HSJ A;  2FLO A;  4RU9 A;  2QLW A;  5KFZ A;  1C0T A;  2UUB J;  2DCU B;  2RKI A;  2FVP A;  1AZS B;  2CDQ A;  1NSP A;  2R2S A;  4O3P A;  3BS9 A;  3GJS B;  1R0B G;  3JSM B;  2ZVI A;  3LAN A;  1JXL A;  4F26 A;  1MN7 A;  2A0F B;  3T1H J;  4WXW A;  2AWZ A;  2RF2 A;  3RW6 A;  3SQO P;  2BZ2 A;  4USK A;  5BR8 F;  1FKO B;  2DH7 A;  2V4R A;  1SC3 B;  1NDL A;  3MM5 A;  2BAC A;  1RAJ A;  2PFD A;  5HJY A;  2VQF F;  1UPM B;  4LR9 A;  4USM A;  3VAK A;  2OH2 A;  3M8Y A;  3DRP B;  3M8Z A;  3TUJ C;  2B0G A;  2CQ3 A;  3VTI A;  4CH0 S;  1RA6 A;  2W9B B;  2CJY B;  3NBP B;  2U2F A;  2YX1 A;  3DGP B;  3CD0 A;  1WF0 A;  5HMY A;  1GXT A;  2VPX B;  3AOD A;  3FDS A;  2VC1 A;  1SKS A;  2A6M A;  1RWP B;  4CO3 A;  1YJR A;  2QYG A;  3HUL A;  4FF3 A;  4DQI A;  1RWU A;  4IG0 A;  4OI4 A;  5IT9 Y;  2B4U A;  2XI3 A;  4TY8 B;  3OUY A;  1X4B A;  1RCO B;  3R7S B;  4FXW A;  4ATN A;  2IAJ A;  3QGH A;  2J0S D;  1KLM B;  2MKC A;  5D78 A;  4DX5 A;  5D8H B;  4FN5 A;  2OPR B;  4LSL B;  3HVT A;  1WOO A;  2J9D A;  1VHI A;  3M30 A;  4NLU A;  4P2F A;  1ZA1 B;  3ZNU A;  3KK1 B;  4AXI A;  2J6U A;  2F5G A;  2R4F A;  2DEI A;  5IXU A;  1KP6 A;  4DCO B;  3BBC A;  2QLF B;  1S99 A;  2HAI A;  5E3A A;  3IM9 A;  3DU6 A;  5AXN A;  1IKY B;  3KLE B;  3EIC A;  2ROP A;  4UQG A;  3JYT A;  1IWA A;  3HMJ G;  1N6Q B;  2GVZ A;  3PW0 A;  4IG3 B;  3CJS A;  3M4X A;  3MEE B;  4F4Y A;  1W26 A;  3MM6 A;  4FPI A;  2AJ1 A;  4A46 A;  4L74 A;  3NAI A;  4CNZ A;  3NEK A;  2CAD A;  4CH7 A;  4PXC A;  4DL3 A;  2UP1 A;  1UZD A;  4EWT A;  4Q8F A;  2M88 A;  2LXU A;  2ZBC A;  4FBU A;  2G9O A;  2HFU A;  3TJ8 A;  3R2D J;  3H59 A;  1J27 A;  5B0G A;  1LWC A;  4DV0 F;  1A0O B;  1U48 A;  1ROF A;  2GO8 A;  1QAX A;  3UN5 A;  2XMU A;  3PVX A;  3G6E S;  2C2E A;  2JLE A;  4JV5 F;  3AB4 B;  2B43 A;  2R7V A;  4CO0 A;  3L95 X;  5B0E A;  2B8P A;  1T9U A;  2W4C A;  1OSD A;  2N82 B;  5HLF B;  3OXL A;  4NYP A;  2AF6 A;  4CNY A;  4RU2 A;  2Y1J A;  5LL6 d;  2VQE J;  2YXL A;  4N7T A;  3G96 A;  1WOP A;  2CRL A;  1U2C A;  2J7U A;  1EKR A;  1YI2 S;  3T9N A;  3KLF A;  4F2S A;  4DL0 C;  5CQG A;  3OTE A;  1XNR J;  4DPO A;  3DMJ A;  4LF6 F;  2RUS A;  1S9F A;  3CD7 A;  2VPZ B;  3V6J A;  5FDL A;  3HF5 A;  3VWS A;  1X9M A;  2CJB A;  1JLA A;  1FE4 A;  4DJB A;  3DLB A;  2CQH A;  1S1U B;  3MM7 A;  5KT4 A;  1NXI A;  3TUZ C;  5HBM B;  3TZW A;  4RW7 A;  3CF5 Q;  3AH6 A;  1MSW D;  2CIM A;  1RT4 B;  3I82 A;  1NLK L;  3CCU S;  1WNE A;  1N5S A;  2UVU A;  2YWK A;  4V1A k;  3MED A;  3H7H B;  5C42 A;  5DGA A;  2XHC A;  3MGJ A;  1U25 A;  3UCG A;  5DG8 A;  1UEV A;  2YNI A;  3NY0 A;  2L08 A;  1RT7 B;  2KRB A;  3FEX B;  4KRW A;  1HI1 A;  2VKR A;  4ECU A;  2YWH A;  4DWI A;  1URR A;  2AEJ A;  1SQG A;  2XLI A;  2AGO A;  2AU0 A;  4ED2 A;  1KNZ A;  2XM3 A;  2WVE A;  2C3Y A;  3R5D A;  2PMW A;  2XSF A;  4OYI A;  2CPF A;  2DHS A;  2DGW A;  2LQJ A;  3B54 A;  4J9O A;  4B9V A;  3F73 A;  3C19 A;  2GJI A;  4K4W A;  1S7H A;  2E1C A;  4FNI A;  4M8L A;  1YWX A;  3FFI B;  1E6Y A;  2YH1 A;  3SIP B;  2MZS A;  4DU7 A;  4A8Q A;  2HMI A;  2B9Y A;  2DNP A;  2QX0 A;  1FEE A;  1C4C A;  4OHX A;  5KG0 A;  1OQ3 A;  4DPY A;  3T9Z A;  5KG7 A;  2F63 A;  4HI1 A;  1SV5 A;  4V19 J;  1HD1 A;  4KO0 B;  3M2R A;  2RSQ A;  4DV3 F;  1ZTW A;  2VFV A;  4B3T J;  4ZCI A;  2QZ8 A;  2CQB A;  5GAD U;  1X9S A;  4X65 J;  3BV8 A;  2AZ1 A;  4QOT A;  4Y2K A;  3TO8 A;  1EET A;  1AB8 A;  2EK6 A;  4J9M A;  2RNE A;  3M2V A;  4JI8 F;  5G0R B;  4B9M A;  2A2C A;  4N8O A;  1LXN A;  2QIF A;  4WFX A;  4DF4 A;  4QIV A;  2HQI A;  1LV5 A;  3MF5 A;  2QL5 B;  3RAM A;  4ED7 A;  2J9E A;  3IWL A;  3MDF A;  2Y3Y A;  3DGV A;  2W9A A;  5L8R C;  4WP3 A;  2B5J A;  5L39 A;  3DLL Q;  2EI5 A;  1AYE A;  3BR9 A;  4NX9 A;  4WU3 A;  2X7I A;  2CNK B;  2QLB B;  2HVI A;  3BO2 A;  5IV4 A;  4DL7 A;  1F2G A;  3IR5 B;  5DDR C;  4DFP A;  5L38 A;  2FLL A;  4ID5 A;  4X64 J;  2VG7 A;  1XMB A;  5JMN A;  4LRF A;  3GON A;  5F8N A;  1T0T V;  4DN0 A;  2YQ0 A;  1FO1 A;  1RAH B;  2UU9 F;  4TY9 A;  1B3T A;  2QFJ A;  1S0O A;  4U7U D;  3HCX A;  3BSO A;  2DNQ A;  3IGV A;  3K59 A;  4JI3 F;  1Q79 A;  1VHF A;  3QSY B;  1ZS6 A;  2DHG A;  4AYB D;  8RUC A;  2BOP A;  4IUF A;  4ANC A;  1DTQ B;  4QZV B;  5I42 B;  3FBE A;  1WDD A;  1HL6 A;  2UUA F;  4PEO A;  2BV3 A;  1NH8 A;  3C6T A;  4KGV B;  2ZH7 A;  4LF7 J;  3IWN C;  3W66 A;  1SKU B;  5KFB A;  1NSA A;  3R27 A;  2IJF A;  3THT A;  3DFE A;  2P6S A;  3ET6 B;  3QID A;  2FVR A;  2HIQ A;  4ILL A;  1T95 A;  3T5L A;  4DSE A;  3SSR A;  5IT0 A;  3Q8Y A;  1HBM B;  2OMO A;  2WRM A;  1OJ4 A;  2KT2 A;  2YWW A;  3H42 A;  4C3L A;  3DLK B;  1K0V A;  2XY7 A;  4J9R A;  5HAN A;  5ETS A;  4J9U E;  1U1N A;  3AA9 A;  1JXV A;  4UW2 A;  1AW0 A;  1YJT A;  3EDQ B;  5F8L A;  4LF5 F;  2XSJ B;  1GXU A;  3MZI A;  4K4X A;  3WIV A;  4ZVU B;  3S7R A;  4OZ5 A;  2DY9 A;  4ZDN A;  2KYX A;  4AUK A;  3SZ2 A;  4CO5 A;  4Z7Y A;  4ECZ A;  1LK7 A;  4DV6 F;  3IS9 B;  3G87 A;  2RHS B;  2XMM A;  4J90 A;  4DR2 F;  2JH3 A;  5DDO C;  4NZ7 A;  4WP8 A;  3KG1 A;  4NLW A;  4NEY A;  3DLG A;  3POT B;  4Q45 A;  1HW8 A;  2FHK A;  2F4V J;  1URN A;  3CSK A;  2MXY A;  3ETM A;  4MAK A;  1WEZ A;  5IOL A;  3UN2 A;  3CJ2 A;  3BSC A;  5I3P A;  3U1L A;  3LUY A;  2QA1 A;  4NYO A;  1C1C A;  1RT6 B;  5J1E A;  4XPE A;  2EW9 A;  4DR7 J;  1H73 A;  3OTD A;  2H51 B;  4FPR A;  1KWM A;  1E6V A;  3TUI C;  2EFO A;  2I8E A;  2DGT A;  2ADB A;  2N4C A;  5LMU J;  4ECW A;  4R5P B;  4HR2 A;  4KTQ A;  1KD1 T;  3GJT B;  3QAE A;  2G13 A;  2DR7 A;  3PHE A;  2V8H A;  2L9N A;  1VK8 A;  3A3N B;  2O5D A;  1FA0 A;  5A2Q Y;  4EO6 A;  5SUH A;  2JJ4 D;  4IRD A;  4UTG A;  6FDR A;  3LP0 B;  1KEK A;  4HKQ A;  4OX7 A;  4RWW A;  3WHI A;  4RNO A;  3FBF A;  5DO2 A;  2CJX B;  1PIL A;  1C0U A;  3MHY A;  1LFW A;  2G4B A;  1SQE A;  2XMW A;  4O3N A;  2ZE2 B;  1Q5V A;  3P4U B;  4KHP F;  4K4S A;  3ZO7 A;  2GIF A;  2M8D B;  1NKB A;  2Q1L A;  2K1R B;  2WB4 A;  2HEK A;  2HVE A;  5DJB A;  3DXS X;  3PJW A;  4H4K A;  1SJR A;  3M05 A;  1HHQ A;  2HHT A;  4LBP A;  1NKE A;  2J0Q D;  4ZVO B;  2HAF A;  3RR8 A;  4LUB A;  3IR6 B;  2SXL A;  3O8W A;  3IP0 A;  2ZJQ Q;  4Y65 A;  1RHR B;  5E3Q A;  4OYW A;  2OGU A;  1YJ9 S;  3CE8 A;  5D4P A;  3DRS B;  5KT3 A;  3ONQ A;  1U1Q A;  2ZD1 B;  3ENW A;  1JLB A;  3G82 A;  4FF4 A;  2G0C A;  2D3O 1;  5HI7 A;  3TZY A;  3NAH A;  2HSE B;  4FYY B;  3IM8 A;  4IFV A;  3MFH A;  3Q23 A;  4QIE A;  3FMB A;  4MIB A;  1NCL A;  2HQG A;  3CJ8 A;  4DX7 A;  4ED5 A;  1SL1 A;  2QEX S;  2GQC A;  4JP8 A;  2AW0 A;  2YBV A;  1VI7 A;  2I38 A;  2AX1 A;  4AD6 A;  4ZP6 A;  3RTV A;  1X9W A;  2KJW A;  2B8Q A;  1YBA A;  4RBT A;  1U24 A;  1DQA A;  4XAK A;  3BGF A;  2BVZ A;  2ZJR Q;  2E66 A;  1SC6 A;  2CJ9 A;  4NLS A;  3M9O B;  1JLQ A;  4C0O C;  3IBF B;  1HPZ B;  3QZ8 A;  2DPJ A;  5L1L A;  4QQB A;  3CDW A;  5KFM A;  4M5I A;  4O4R A;  3Q83 A;  3HHL C;  3MED B;  1F6T A;  4GVL A;  1LEO A;  2EFQ A;  4I2Q A;  4K0K F;  2O1P A;  4DV7 J;  4PXE A;  5LSL A;  2FJV A;  2XGQ A;  5CXT A;  3R1L A;  3U02 A;  1ZM3 A;  3LAM A;  1OPI A;  4NXN F;  4B3O A;  3OTC A;  3EGW B;  1NZA A;  1FF2 A;  2JX2 A;  3BJY A;  2R3V A;  3ZC4 A;  1HBN A;  2HZC A;  3PNI A;  5DLG A;  4XPC A;  1YQH A;  1SL2 A;  3KLG B;  4U96 A;  1WF1 A;  1MWZ A;  1TV6 A;  1PJ5 A;  2QRR A;  2BR0 A;  1K0T A;  4LFC F;  1HMV B;  2HNZ B;  4LR7 A;  4BCA A;  4M5M A;  4CWB A;  1XBW A;  2MZT A;  2ZH2 A;  2QA2 A;  4OHW A;  4WFB Q;  2F7V A;  3CGI A;  4FYW B;  1PJ7 A;  3X1L B;  1H72 C;  4YHH F;  2RE1 A;  3LP1 B;  1D9D A;  5T7L B;  4PRF A;  3MM8 B;  2M3D A;  2B4P A;  2ZWP A;  1KFD A;  3ISN C;  4C97 A;  4TXS A;  5IT9 U;  3K5N A;  1HA1 A;  3VGV A;  2ASL A;  3M8S A;  2YQ3 A;  3NGU A;  3CXC R;  4WE1 A;  4LF4 F;  1KTV A;  4DR3 J;  2DTJ A;  3V6D A;  3VAG A;  5D3G B;  3TX8 A;  1JIH A;  5EDW A;  2FJB B;  3MEG B;  3NOC A;  3IAM 9;  3R5A A;  2KT5 A;  1RTH A;  2LDY A;  1XK8 A;  3NOG A;  1DAR A;  4UOF A;  5HQM A;  5ITH A;  3AD8 C;  3ETO A;  1S0M A;  4IFY B;  4PWD A;  3TQE A;  2CFX A;  4LVN P;  5DZ7 A;  1KDN A;  3OR1 A;  1K1Q A;  4YN3 B;  4K4U A;  1IBM J;  1KVK A;  2LVW A;  2NXJ A;  3HX9 A;  1VQP S;  4C2M A;  1T9Y A;  4ZJQ A;  4RL1 A;  1LK5 A;  3TWZ A;  2X1G A;  3WC0 A;  4OZL A;  3AAW B;  2W1B A;  3J7Y U;  2ZJP Q;  1BC6 A;  2GJF A;  4JI6 J;  4NXM J;  2OPP B;  4KH1 B;  4WFN Q;  4ED0 A;  3GV7 B;  4F4Z A;  4I2P B;  2GO9 A;  3L7U A;  1NK4 A;  4OZJ A;  3TR5 A;  2RU3 A;  1HNW J;  4FP9 A;  3RYL A;  4B3R F;  3GJR B;  5ETP A;  2OEJ A;  1UL3 A;  1U0H B;  3Q8S B;  2E1M C;  3UI3 A;  1GT8 A;  1TAU A;  3R9L A;  3S01 A;  3PY8 A;  2E7V A;  1IKX B;  2VU5 A;  3Q8Q B;  1VC0 A;  3C6T B;  5LJ3 Y;  3DOL A;  3FQK A;  2XO6 A;  5J2N B;  1QE1 B;  3BM7 A;  2N4D A;  2D3Z A;  4OJ3 A;  1XMO F;  4OV6 A;  3PCO B;  2B7C B;  4TQS A;  2POK A;  2IDL A;  4C11 A;  1RT3 B;  1IR0 A;  4DR5 J;  5M2R A;  2ZC4 A;  1ZET A;  3L09 A;  4ZN1 A;  2AGP A;  4F4X A;  4DFK A;  1HWK A;  2YX7 A;  1VBK A;  4PQU A;  2OTJ S;  3DYA B;  2EC0 A;  5F0U A;  4DV4 F;  3PTW A;  1S1W A;  3VVU A;  5A8K A;  1EJ7 L;  4Q8E A;  2RHQ B;  2HHH J;  1C1B B;  2PEB A;  1ULR A;  4KYZ A;  1KBR A;  2XMA A;  2IFX A;  4Y34 A;  4CCH A;  3WQP A;  4QWB A;  4DCJ B;  1S9E A;  4AFF A;  4MIA A;  2VIH A;  1Y9O A;  2GFF A;  2NPI A;  4UZB A;  3FZ2 A;  4MYT A;  2W01 A;  4DR6 J;  4KIA A;  1NJZ A;  2DNZ A;  1T11 A;  1RBL A;  4L6V 3;  1NPP A;  2EG2 A;  3TYT A;  5GAG U;  3JSY A;  3T19 A;  3IMQ J;  3D3B J;  4RW8 B;  3O1L A;  1HWL A;  5LJ5 Y;  3W7B A;  5AXM A;  5H9F J;  1UVM A;  1RWM B;  4Z2X A;  5HO4 A;  1UJ6 A;  2KYZ A;  3NGR A;  3MUT P;  3H40 A;  1TFY A;  1TK8 A;  3QIP B;  3BKT A;  2GAH C;  2V2V A;  3ZFV A;  1JKH B;  2CVI A;  1IQZ A;  4FXD A;  2D9P A;  3K17 A;  2P5V A;  4JI7 F;  1WOS A;  3GCX P;  3MR2 A;  2DB1 A;  3CD5 A;  4QU7 A;  4ECQ A;  4F3M A;  1VIS A;  4AT1 B;  4NWB A;  4RUA A;  4IH7 A;  2CQG A;  3BGR A;  2B6A A;  1JNZ B;  2G1H A;  1XEZ A;  1SC1 B;  3SFG A;  3W2V A;  5KFW A;  1DY3 A;  3AB2 B;  2L41 A;  3QAU A;  1B0P A;  1FT8 A;  5J2Q B;  4I6A A;  1AXQ A;  3WX8 A;  1MRO A;  1N54 B;  4K4T A;  2HBR B;  2VG5 A;  3NGK A;  4F7V A;  5F3T A;  1IR1 A;  3F56 A;  2R7U A;  4USJ C;  1L3U A;  2ZHO A;  5AE2 A;  2H4Y B;  2IA0 A;  4U7U K;  1I94 F;  2YKM B;  3DU5 A;  4B17 A;  2CZ4 A;  2IM2 A;  5F9N A;  2YQ1 A;  4X4V A;  2E5L F;  3PFE A;  1SJQ A;  4OJG A;  2RQK A;  1YZ6 A;  3CJK A;  4CLU A;  3I0S B;  1GK8 A;  5KFV A;  4YY3 F;  2IRU A;  4H4O B;  4ES2 A;  2M8H A;  3NL0 A;  1BQN A;  3GV5 B;  4B3S J;  2HHU A;  4IQX A;  4FYD A;  4N41 A;  5D0G A;  5D77 A;  2M9K A;  2FLN A;  2V2K A;  3OR2 A;  2OAU A;  2GW8 A;  2XNR A;  3BDE A;  4G1Q B;  2CKW A;  1EP4 B;  2FGC A;  2V94 A;  2BJ1 A;  9RUB A;  3K89 A;  1FTC A;  1U09 A;  4MFB B;  3N4W A;  3M32 B;  5EWG A;  2UXB J;  4UST A;  2NZC A;  4ZMM A;  2C2O B;  4QR0 A;  2UXD J;  4YP3 A;  1S76 D;  4WKY A;  3ITH A;  4ZVP B;  1YK9 A;  2NXU A;  1N5Y A;  3G82 B;  1RYR A;  4AL6 A;  1O0P A;  4KE5 A;  5CYM A;  4CT8 A;  5ETM A;  4NRT A;  4RW4 A;  1I5O B;  3GIL A;  5LMN F;  1RU1 A;  1VLO A;  3F0N A;  4HTI A;  4EGL A;  3FSY A;  2IPO B;  2VJV A;  1HBU A;  3E3X A;  1Y3J A;  3HM9 A;  1WTF A;  2HFO A;  1J5O A;  2GML A;  5GAD I;  3T6J A;  5GAH U;  5CYQ B;  4X4N A;  3TVK A;  2A2D A;  1FJ7 A;  2LU2 A;  3SSS A;  2QV6 A;  1JJC B;  3IG1 A;  4GO7 X;  1T3N A;  4P7V A;  1HQU A;  1YRT A;  1DZ5 A;  2RRA A;  4C8O A;  4KKO B;  4URG A;  4QYZ J;  2E9T A;  2C2M B;  2FPH X;  3KHH A;  3TOQ A;  1RCX B;  5KFS A;  4PG8 A;  4HT7 A;  2M7S A;  4M95 A;  5BYR A;  5LSO A;  4Q0B A;  6FD1 A;  3KMS A;  3BQ0 A;  1KLN A;  3NNC A;  2NXN A;  3EDR B;  3EE3 A;  2FLP A;  3CVK A;  3GMG A;  3UDE A;  2RU9 A;  1XR7 A;  3O44 A;  4QW9 A;  3V5R A;  5D6G A;  4H4M A;  3NNA A;  4YR3 A;  3RR7 A;  4EZ9 A;  2VD3 A;  3R5J B;  4F4K A;  3Q2S C;  2HGN A;  2MY7 A;  2CQ2 A;  2DIU A;  3HFV A;  1RQ0 A;  1CJT B;  2V50 A;  1NDP A;  1FER A;  3W64 A;  1WI6 A;  4E0D A;  2DIS A;  3B6B A;  1N32 J;  3PKM A;  4ETX A;  3UWT A;  3UCU P;  2LXF A;  3I31 A;  1Q82 T;  5D4N A;  5AXL A;  1L5U A;  4NMX A;  5IWA F;  4QIF A;  2WSF C;  2WVC A;  2IBO A;  5J2M A;  1WG1 A;  1DQ9 A;  3UVJ B;  4O23 A;  2AYM A;  4BWJ A;  2E9R X;  5KT2 A;  2AT1 B;  1IN0 A;  2HWT A;  1Q4R A;  5KG5 A;  2R2T A;  4UUX A;  3I5A A;  1IBL J;  1FRJ A;  4B9T A;  4X62 F;  5J1P A;  5E3C A;  2WOM A;  3I4H X;  1NK6 A;  1YLX A;  2Y1I A;  3QAT A;  2F8H A;  4KFB A;  1HNI B;  1ZM9 A;  4NCG B;  5A2Q U;  1RWK B;  2DGO A;  5K8N A;  1TKX A;  3H4D A;  2BKO A;  1HHT P;  1SL0 A;  1TEL A;  1K1S A;  1Y5I B;  3J81 j;  1FKP A;  3L7O A;  1N0U A;  1RLD A;  4OV1 A;  1TKT A;  2QC3 A;  2Z30 B;  2EFG A;  1BY9 A;  4PWW A;  5FLX U;  4P74 A;  2BQU A;  3ENQ A;  3M8Q B;  2AGQ A;  3JB9 k;  2HG4 A;  2J6S A;  1PAU B;  3GSD A;  4DPT A;  1S9G B;  2V4J B;  2ASD A;  2R7W A;  2CNO B;  4JYA F;  3CPW R;  3EXY A;  2CZV C;  1SUQ A;  3W60 A;  1DQ8 A;  2MY8 A;  3J80 U;  3GG0 A;  1O51 A;  2CDR B;  1EX8 A;  3HD1 A;  5KFD A;  3T5K A;  2FY8 A;  3QGG A;  3W63 A;  3IRX A;  3AJD A;  4PG7 A;  2W24 A;  3C3L A;  3BBF A;  2IYG A;  3MXH P;  1N8R T;  1REV B;  1CPZ A;  2DO0 A;  1DHM A;  1ZYQ A;  5A6W A;  4HH1 A;  1WC5 A;  3CDU A;  2J9C A;  4QIG A;  1WKJ A;  3R3T A;  1N4L A;  1W25 A;  5AT1 B;  2RT3 A;  4BC7 A;  4OJ1 A;  1VQ5 S;  2LFV A;  3QLH A;  1BMQ B;  1VIO A;  1QJH A;  3G6V A;  3QO9 A;  3J7A N;  4URS A;  3P6Y C;  5HP1 A;  2HGL A;  2NCK L;  5KTQ A;  2R7S A;  4C8Z A;  1U6Z A;  3QJJ A;  4ITS A;  2FTR A;  2HHX A;  1T9T A;  2UUB F;  1F5B A;  1RT1 B;  3C2P A;  2L9D A;  1S6P B;  3KUE A;  3BGU A;  2DXD A;  2E7W A;  3I0R B;  4NLR A;  1YGY A;  5T41 A;  3N01 A;  4DR1 J;  4YDD B;  2ZHA A;  2Y0B B;  3HVA A;  5DQI A;  3CWJ A;  3R5G A;  1H6K X;  3OVB A;  1SKW A;  4ZPC A;  1N0V C;  2DEJ A;  4JI2 J;  5F8J A;  2VB6 A;  1WC1 A;  3P5T L;  3T1A A;  5AJ3 F;  2AJQ A;  2DNO A;  4A8W A;  5JVG Q;  2Q6C A;  1UWB B;  3D6T B;  4JV0 A;  3A13 A;  4LJM A;  4NLP A;  2XEX A;  3FBB A;  2R9L A;  1CS4 A;  2DK2 A;  1Q8I A;  2IJR A;  4JBC A;  3PKY A;  3M1V A;  1HNV A;  4CTA A;  3FRY A;  1OY8 A;  4CM0 A;  1WC4 A;  1KKH A;  2IM3 A;  1N34 F;  5JVH Q;  4ZVF A;  2KKH A;  4ZCM A;  1S1T B;  4N77 A;  3TX0 A;  1RTD B;  4HLB A;  3MMC A;  4NLY A;  1YG0 A;  3AJ1 A;  3M9N B;  2X1A A;  3K5P A;  2NSC A;  3CJ5 A;  4M5D A;  4ZK7 M;  1FD2 A;  3DLH A;  4LVO P;  3MCN A;  1RTJ A;  5H9E J;  2B4V A;  4U8V A;  1VBZ A;  3CJ4 A;  2NXE A;  4OLO A;  3MD1 A;  3IFE A;  1OYD A;  2R2R A;  4LFB J;  2JFK A;  4NLG A;  2B9W A;  4MKV A;  4USU A;  1EB0 A;  2JEI A;  5AE3 A;  2KFZ A;  2YY3 A;  1HQE A;  1G6B A;  4FBT A;  1MLA A;  4ERD A;  5KFE A;  2HHV A;  3GJQ B;  4OI2 A;  2KH9 A;  2JRS A;  4TLQ A;  2DYA A;  2WON A;  3NGS A;  1L3T A;  4LRE A;  3NCP A;  2AZ3 A;  4CLL A;  2QFI A;  1IM6 A;  3D67 A;  4NZ0 A;  4QR2 A;  3PV8 A;  3VAM A;  1NK5 A;  3M6V A;  3KXD A;  1K73 T;  1VLY A;  5D0E A;  2C2N A;  1HYS A;  1M5K C;  4UOG A;  3SBM A;  3HDS A;  4RW6 A;  5C7P A;  4RUC A;  2HRY A;  2G2Z A;  2WSE C;  2CJA A;  5B08 A;  1D1U A;  3TZZ A;  5EN1 A;  4TNO A;  3W65 A;  2JEF A;  3C15 B;  4P10 A;  1AZS A;  3P3D A;  2CQ1 A;  3DI6 B;  3G8Q A;  2EPI A;  4G1I A;  1D3W A;  4K4Y A;  2AYE A;  3JSM A;  4P9S A;  2X51 A;  1Z1Z A;  4I7F B;  4CLS A;  2GIR A;  1RKJ A;  4L73 A;  5C5J A;  5E7O B;  3S1T A;  2V8V A;  4QYR A;  2R8K A;  3QT7 A;  1FKO A;  1TK5 A;  1RAF B;  2HWH A;  4LSZ B;  4OI3 A;  4U6P A;  1FXR A;  1NH7 A;  1TZ0 A;  2Z2L A;  2ZHB A;  1SH2 A;  4F25 A;  1IR2 A;  1R6V A;  1SJ4 P;  4JV5 J;  3EM1 A;  3I4P A;  1V3S A;  1S12 A;  2HGM A;  3DRP A;  1Q7L B;  3DDI A;  3FBC A;  4WBF A;  3PX0 A;  3Q89 A;  3AXK A;  4LRB A;  2W9B A;  3NBP A;  3DGP A;  3MTK A;  2VDI A;  1YX2 A;  2LYV A;  2U1A A;  1BWE A;  4LF6 J;  4DQS A;  4USW A;  2DGX A;  2DR6 A;  2ATC B;  2C2K B;  2VL1 A;  4Y0F A;  3MUM P;  3GYN A;  4OZN A;  1NME B;  4TY8 A;  2V34 A;  1IBC B;  4Y6I A;  1D8Y A;  3CCV S;  1RLC L;  2NLW A;  2PD1 A;  4RWX A;  1KLM A;  4UUW A;  3VGU A;  1R89 A;  5IT4 A;  3DN9 A;  5IFM A;  2OPR A;  2OD6 A;  4LSL A;  2C22 A;  3TI0 A;  3KK1 A;  3SYZ A;  2BQ3 A;  4AND A;  1JLG B;  2WK4 A;  4TU9 A;  2XS7 A;  2VPY B;  1VQ7 S;  3VAL A;  3W1Y C;  3HT0 A;  3G2X A;  2J7K A;  2P9E A;  2D7S A;  4PG4 A;  1IKY A;  1RJJ A;  3KLE A;  3FQL A;  3GIJ A;  2MHE A;  1X5O A;  1N6Q A;  2I6W A;  4UZC A;  2H5E A;  3ZZO A;  1G1X A;  4M5L A;  4IG3 A;  2VV5 A;  3MEE A;  2OUG A;  3WC2 A;  4IR9 A;  3JAM Y;  2OML A;  3OTO F;  2H48 B;  3AA8 A;  3CC2 S; 
#chains in the Genus database with same CATH homology
 4B3T J;  4KYZ A;  4X66 J;  2UXB J;  3JAM U;  4LFC J;  4X65 J;  4DR3 J;  4LF6 J;  1HR0 J;  2UXC J;  4JI0 J;  1IBL J;  4DR2 J;  5AJ3 J;  4DUZ J;  2VQE J;  2UXD J;  2E5L J;  1XMO J;  4GKJ J;  4LF8 J;  2MEW A;  4DR1 J;  4DV0 J;  1HNW J;  3J80 U;  4YY3 J;  4JI4 J;  4DR6 J;  3T1Y J;  1XNR J;  2KVQ E;  2MTL A;  5IWA J;  4JI2 J;  2KL8 A;  4YHH J;  4LFB J;  1I94 J;  3R2C J;  4JI1 J;  1J5E J;  5A2Q U;  4JI7 J;  4NEY A;  4B3M J;  4LF7 J;  4NEZ A;  3IMQ J;  4RJV A;  3D3B J;  2MQ8 A;  3D3C J;  1HNZ J;  2F4V J;  4DR4 J;  5LM7 E;  4K0K J;  1IBK J;  2UUB J;  5BR8 J;  3R2D J;  1N36 J;  3J81 U;  1N32 J;  1XNQ J;  1IBM J;  4JI5 J;  3W1Y C;  4JYA J;  1N34 J;  2UUC J;  4DV1 J;  4GKK J;  1N33 J;  1XMQ J;  1FJG J;  4LF9 J;  2VQF J;  4DV4 J;  4KY3 A;  4DR5 J;  4OX9 J;  4DV6 J;  4B3S J;  4X62 J;  4NXN J;  4JV5 J;  4PWW A;  4DV3 J;  5FLX U;  4V1A k;  3J7A N;  4DR7 J;  4B3R J;  4LFA J;  4JI8 J;  3OTO J;  4LF5 J;  4DV2 J;  4DV5 J;  2UU9 J;  4X64 J;  2UUA J;  4DUY J;  4LF4 J;  3T1H J;  2ZM6 J;  5LMU J;  5IT9 U;  5LMN J;  1HNX J;  4HHU A;  4JI3 J;  4AQY J;  4KHP J;  2HHH J;  4DV7 J;  4JI6 J;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...