3T1YJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3t1yJ00
2UU9J 4YY3J 5LMUJ 1N34J 4JI0J 4LF7J 4DR6J 4DV0J 3D3CJ 4NXMJ 1HNXJ 3D3BJ 1IBLJ 3J7AN 1XMOJ 4LF4J 4GKJJ 5BR8J 1FJGJ 4GKKJ 4B3RJ 1HNWJ 2KVQE 4PWWA 4JI1J 3JAMU 4KY3A 4JI8J 2UXCJ 3R2CJ 5IWAJ 3W1YC 5LM7E 4JI2J 4KHPJ 4DV3J 4X65J 2VQEJ 4JI5J 4B3TJ 2UUBJ 1XNQJ 4LF9J 4DR5J 1N33J 4NEYA 4X66J 2HHHJ 4K0KJ 4LFAJ 2UUAJ 3IMQJ 5IT9U 4LF6J 4DV1J 4AQYJ 1J5EJ 4OX9J 3J80U 4V1Ak 4LFBJ 4DV4J 4DR4J 1XMQJ 4DR7J 4DUYJ 4DR2J 4JI3J 4DV7J 2UXBJ 2MTLA 2UXDJ 3J81U 1IBMJ 4X62J 4DV2J 4LFCJ 4NXNJ 4B3SJ 1I94J 2UUCJ 1N36J 4DR3J 1XNRJ 1HNZJ 2ZM6J 3T1YJ 4RJVA 4B3MJ 4YHHJ 4JI6J 4LF5J 4LF8J 4JV5J 4KYZA 2F4VJ 4JYAJ 2MQ8A 2VQFJ 3T1HJ 2E5LJ 1HR0J 4HHUA 1IBKJ 1N32J 3R2DJ 5AJ3J 3OTOJ 4DV5J 4X64J 2MEWA 4NEZA 5LMNJ 2KL8A 4DV6J 4DUZJ 4DR1J 5FLXU 5A2QU 4JI7J 4JI4J
chains in the Genus database with same CATH superfamily
4EZ9A 4Q45A 5F8JA 4TVAB 2U2FA 4IKAA 3TA0A 2KJVA 2KH9A 4IG0B 4CM0A 4ZVOB 3VGVA 2XULA 4W92B 2AKWB 1TK0A 4QIFA 4QCLA 4NRTA 1X4CA 2R2UA 5J2QB 2BABA 3NCQA 4O3PA 3TEHB 2MGZA 3OT9A 2AEJA 4CNYA 4LT6A 5I3PA 5GAGI 3DMJA 2PA3A 2UXDJ 4H4KC 1UVMA 4O23A 3RR8A 1JQGA 4NL5A 3NMRA 1MSWD 3TZZA 3MHYA 4C3LA 4B9MA 5KG3A 1SIWB 3I31A 4DR1F 4LF5J 1AFIA 5J2NA 5KOXA 3R27A 1MMLA 2BBEA 1FVSA 4HLBA 2XLJA 2GV1A 5CH7B 2I0XA 2ACMA 2Z58B 2DCUB 5A2QY 3CPWR 1QY7A 2XYPB 2HVZA 2GJ2A 5HROA 5HMYA 2RIJA 4NA1A 2B4UA 3OJSA 3N6MA 1DQ8A 2MPUA 3LP1B 5L39A 1YSJA 1YK9A 1VISA 4DN9A 1VLOA 3MUVP 4DL7A 5CD4A 2K3KA 3AXKA 4XO0A 3V6DB 2V2QA 3HZEA 3R1HA 4LF9J 2HNYA 1OY9A 1JKHB 2DIVA 3QRPA 3KTQA 3GYGA 2PN6A 1FTRA 2BANA 4NLRA 1DTQA 2CWKA 2C3UA 1KOHA 2N82B 1D9FA 3M2RB 2E1PA 1NKCA 3MCSA 2XMJA 4ID5A 2AYBA 4N8NA 3QPIA 2FLOA 3PW2A 1YZ7A 3MECA 5CD4H 4DU7A 1I5OB 2ZH7A 1YITS 4H4KA 1ZH5A 2OJ3A 4RW8B 1OMSA 3TA1A 2BZ2A 3MWBA 4DLEA 4ZVRB 3VTIA 2NZ4A 2QYGA 1RT4B 1NK7A 5LL6d 3H4DA 1HL6A 5D77A 1U47A 2MKYA 4K4YA 3M2UA 2CNNB 2J76E 1H2TZ 3U27A 2AGOA 2UVRA 5GAGU 5LM7E 2AV5A 4Z2XA 2CQGA 4I6AA 4XDCA 1HLWA 6AT1B 4X62F 2ZKTA 2DT9A 3AT1B 4KR0B 3PIPQ 3LH2S 1SBRA 3OTDA 2DGUA 4DR7J 1YJNS 4DF4A 4ZCIA 2ZOFA 2AX0A 1HI1A 1TKXA 2ZFHA 2IHR1 1JLAA 1FNMA 1NKBA 1VQ9S 3PM9A 4GC6A 3MEGA 5KFHA 4RW4B 1H0HB 4C8LA 4PXCA 1LWEA 3TOQA 3MFIA 3M8PA 2CPIA 2GCFA 4J91A 2KG1A 2E5LF 4PZVA 2WB4A 1XMOF 1IBKF 1APSA 4LSLA 1N48A 1FRXA 2DJWA 4JI4F 1ITPA 4X65F 5C2CA 2B9WA 4BWJA 1S1VB 3KLHB 5F9NA 4X66F 3MAAA 3GWCA 3EWGA 2WONB 2HYIB 4DPWA 4WU2A 1QD1A 3PX0A 4PR6A 4Y2CA 2WAQD 2ZC4A 3UNYA 5C25B 4LFCF 3UFCX 4NCGA 3MEDB 4Y00A 1RWUA 4MKVA 2R7TA 3BPSP 3WQPA 4KJIA 4I7FB 2D9PA 1HW9A 1RT7A 2Z57B 4MAKA 3SCKE 1NCLA 4O4RA 3OHAA 3DOKA 4ZHRB 5K5MA 2K7JA 2CPXA 1VQ6S 1TL4A 2XO6A 2VUGA 1RWOB 3OXGA 1T9UA 2Z56B 1BWEA 3QWPA 3C46A 2XCAA 1S9EB 4CO4A 1SKWA 2QSFA 2DHHA 3VAKA 4ITSA 2M0GB 5EN1A 4OYMA 3HXMA 1M0SA 2E5GA 4J5OA 4RL1A 3P5TL 3S6EA 3SCLE 3CD5A 3EDRB 5D78A 2FLLA 2HGLA 3FBEA 4K0KJ 2L08A 1HNZF 2ZM6F 3FFIB 3DRPB 8AT1B 1S48A 2N3OA 1F9FA 1XMQJ 2FD2A 4NE9C 1UVIA 1UA1A 4B9VA 2OTJS 2EG1A 1VQ5S 3GONA 4PWDA 2RH3A 5AE2A 2F65A 2DXFA 2UVUA 1DFDA 1G1XA 2MQLA 4AYBD 1NK4A 4WKRA 4F25A 1F3VA 4ANEA 3HD2A 1WC0A 2ZH8A 3BGUA 3NNCA 4DL4A 3RUBL 2COLA 2GVZA 1F2HA 5KFNA 4PG6A 3IAS9 2ZVIA 4F4WA 1FWPA 3K58A 3NBPB 2JEGA 1Y00A 4DMZA 5MLCV 2CQ0A 4QIVA 1U1LA 3GFXA 4DR6F 3KK1B 4ILLA 1Q8KA 2YPZA 1MNEA 1Q1KA 2GVDB 1CPZA 1FO1A 3AD7C 4OJGA 4O3SA 3BKTA 4XK8C 1Z2LA 3A3NB 2CNLB 2R7WA 3KLIA 1FJ7A 2GGPA 2CJKA 4TLQA 2K2PA 1ULRA 1U1QA 3I6PA 2M70A 3J80U 4F4YA 1D8YA 2CDQA 4UZCA 3EXCX 2YX4A 4RW9B 1KONA 4C8OA 5IQ6A 1U1OA 3O2IA 2WK4A 4YQWA 3MM6A 2QLXA 4F36A 3OXFA 3ENQA 7FDRA 1M5SA 4QOTA 4YFUA 1HR0J 3IS9B 4PWUA 1NEEA 3E8OA 2R2RA 1NM2A 2IA6A 3H20A 1JLBA 1ZZFA 4USWA 2HQDA 4QW8A 2IY5B 2ZBIA 3OR2A 4QYZK 1NAQA 3D68A 1RT6A 3MUMP 3LOUA 3BH7B 4E2FB 1JJ2R 4DPUA 5HO4A 4G1PA 3IXQA 4B08A 3BREA 3TX0A 4E98A 2VBXA 2DNOA 4C11A 2QEXS 2QMUB 5IZHA 2RQCA 1YJTA 1KRPA 4LVNP 1QTNB 2C1EB 5B0FA 3R6GB 4LIRA 1S6OA 5C24A 1FKPB 3QT6A 1K9MT 4JYAJ 4ZDNA 3VAIA 4OZLA 1R8PA 1I6JA 3IG1A 5J2PA 4CO2A 1CJTB 4QQBA 3H2LA 5SZTA 2NS1B 4GKJF 4KBIA 2CAJA 4HKQA 2W4DA 4IRDA 3WHIA 3MAQA 3DLBA 2KYXA 4L73A 4KTQA 4WXOA 1RAJA 2G4BA 2HVDA 1KDNA 1R0CB 2O66A 2VG7A 1IKVA 1S99A 1U8WA 2CQDA 5F8NA 4M5LA 3SDEB 4ETZA 3CDAA 1H38A 3TAQA 3EZ5A 5DDPC 4OI1A 4LRBA 2WOMA 4IFVA 3PG9A 1L3KA 2EC2A 4UQTA 2YQ1A 2W8LA 2UUCF 2OTLS 3QT5A 3ENAA 3OTOF 3PYFA 4AL6A 1UA0A 2QO3A 4CYUB 3H40A 4P2XA 2ZH3A 3M9MB 3IWLA 3N28A 1WACA 1NO8A 3PYGA 2PMZD 2CPEA 2MEWA 1LWFA 2WCXA 1KR4A 3OSPA 4ED5A 1F5BA 2V8VA 5A2QU 3CW2C 1HWIA 1S97A 3EE3A 3KFWX 2RHSB 1IKYB 1RA6A 2YKPA 1X4FA 3GQCA 1HWLA 4RW6A 2DY9A 2HBRB 4KKOB 1YVFA 2PT0A 2FVSA 4UUXA 5BYRA 3TQEA 2BKNA 3TAPA 4DV3J 5CYMA 3D7SB 4IFYB 4PG5A 1OIAA 1REVA 4GVLA 2CPFA 5KT7A 3FSIA 2EVZA 1TP7A 4CWBA 3RU0A 4F3QA 5KFPA 4HT5A 2CNOB 2R3VA 5DQGA 1HWJA 1UWBB 2J0WA 1SVDA 3HO1A 1UVKA 4ED6A 1WG4A 3TVZA 3BSOA 2JH3A 4HACA 2G2YA 1FI4A 4MYTA 3BGRA 2RS8A 3T1HF 1RZMA 2HK3A 4TY8A 3R2DJ 4K2JA 4WTOB 1FKOA 2HFOA 3SCJE 4F50A 2HIQA 4MH8A 4DHVA 4U7CA 4GVBB 5HLFB 4NLPA 3EVWA 4B9LA 2B51A 1XR6A 1XQIA 3KDOA 1IM4A 1VHIA 3HHLC 4P10A 1MLAA 3L3CA 3LGNA 2BRKA 1RAGB 2MQMA 2V4JA 2ZH1A 1TZ0A 3RB6A 4ZP6A 4WFXA 1XIQA 4AQYJ 2DPJA 2L9DA 3BBCA 1EETA 1PKUA 2PI4A 5IQQA 1TU0B 2YKMB 1P8GA 4A8OA 4RKUC 4J9UE 1S0OA 2AW0A 3DOLB 2WRMA 4DX5A 1EB0A 3S8SA 1OY8A 4OYBA 1YGYA 2RHQB 2VICA 3MM9B 2AYEA 3D67A 2X1BA 3Q8VA 1N32J 1RQ0A 5KFFA 2MY8A 2OPSB 3AH6A 3OTBA 4RU9A 3V81A 1DRZA 1UAWA 1RAEB 2Q43A 4I69A 3T19A 4RUBA 2FB0A 1U49A 4ZVFA 1RUSA 3BBBA 1A7GE 4OLOA 3OVBA 3MD3A 1B7YB 1ICEB 1NLKL 1GXTA 5IWAJ 1UEUA 3D6FB 1UTAA 5T14A 4P71A 5L8RC 1C4CA 1U6FA 5A6PA 2NREA 2F8MA 2QN6B 5KG5A 1LNQA 4JB8B 4WP3A 3HHLA 3KNAA 5B0GA 1HBUB 3ETMA 5KAKA 4C4WA 1F9HA 3LA0A 4ANDA 1QAXA 2CJ9A 2XZWA 1RLCL 4KV8B 3C15B 5HP1B 1LWXA 2H5EA 3DGPB 3J81Y 3DOMA 3EYZA 2BR0A 3QGPA 5DJBA 1V5VA 2R42A 4CLPA 3KOAA 3FC9A 3VQTA 5LMNJ 4B3OA 1WHWA 3KK2A 1SKSA 3TZYA 1E6VA 2AJ2A 1NJZA 4IDKB 4LF4J 1T7PA 2HSEB 2FLPA 3VF0B 3KXDA 1VBYA 3CDEA 4KHPF 1D9DA 3CJ2A 1Y10A 2W01A 2RB7A 3LP0B 4CQ1A 2LQJA 1R6YA 5K14A 2DXEA 3PW0A 3IFEA 1UWAA 3VAJA 1BQMB 2OKQA 2M2BA 3BGFA 5D3GB 2HHSA 2P5VA 1SV5A 3QNWB 4DR3J 1V9OA 2XC9A 3KDNA 4A46A 4CH0S 1QAJA 2DNZA 1WOSA 3FKBA 1BY9A 3FGVA 2ZHBA 5C7PA 2WB1D 3GCXP 4PUOB 4FVCA 2GS8A 3PHEA 3UDCA 1M5VC 2RF2B 4WWSA 2HNDA 5HK4A 1BQNA 2MSTA 1V6HA 2C2NA 3V4MA 3SQGA 2YBVA 4IO1A 4IH5A 4Q2LA 4WKYA 2B43A 5LMUF 4ZVPB 2BMBA 1XC9A 1CSJA 4LFAF 2ZUGA 3M1VA 3HHNB 3OFHA 4ALZA 4ECZA 3FEXB 2FGCA 2Y1LB 2DY1A 4YDXA 1Y3KA 1TFWA 4DZDA 5CZXA 3JSBA 1X8DA 4J7CA 2EFOA 3PW7A 4WIIA 1FVQA 3QJJA 2GAGC 3ETOA 2ASJA 3H7HB 2MDAA 3C6TB 4PPDA 4FS1A 3R5GA 1D8ZA 1IBMJ 5THWA 4MK7A 5D0HA 2HQGA 4BC9A 3NOGA 1DTTB 2KHCA 1WOPA 2Q66A 1Q86T 2R7XA 2DXDA 2I5JA 1F3FA 2XYHB 3CJ5A 2V2ZA 3W2VB 1CQNA 1SIZA 1T03B 3UN2A 4Q2MA 1VRTB 3SMZA 2I2YA 3ITHB 1NSKL 1FJGF 1HNWF 2R8KA 3IRXA 3KJVB 1LW2B 2QYCA 3ENWA 4H4OB 3HI9A 1ZAWA 3D0IE 2W24A 3OUYB 4FKXA 2NZCA 5AXKA 4G3IA 2VJUA 2DGTA 3PTWA 4Q43A 4OZ0A 4DV4F 1KQKA 5A0YB 5KT6A 3MMAA 3M6WA 5HATA 3IA0A 2D7SA 1AZSB 3Q83A 3BGLA 1RTDB 1EIYB 4WTYA 2LXUA 1TL3B 2HEKA 2Q6CA 4IG0A 2IM3A 2BM0A 2IBKA 3NCRA 4AL5A 4OZ2A 1RT3B 3ZZ0A 2G2OA 1R3NA 1MW7A 3PW4A 1VC0A 5J2QA 3WZ0A 2FZCB 2FQQB 4M5IA 3FEYB 4MIWA 1EARA 2Y1JA 3M32B 2ZC3A 2JHEA 3EUNA 1LKZA 3O1LA 4NEZA 4ATNA 5F9LA 4NLVA 2UZAA 2EC0A 5KFGA 3CCVS 1YBAA 2OMLA 1D0EA 1H7WA 3DDIA 1CS4B 2RD5C 3ILIA 1V3SA 2M7SA 2HWIA 2MKCA 3UNGC 4RWXA 3VQSA 4HT7A 4YEAA 2UXCF 3P96A 1C1BB 2XM3A 3W64A 3GZ7A 4LR8A 3GV7B 3VZIA 4DV2F 1SC1B 1RSCA 5F3TA 4EO6A 5EWFA 5ETMA 3OQ2A 3LP1A 3CCUS 3UN5A 4DG1B 1OPIA 2OLWA 1J27A 2F8HA 2DHXA 3BB5A 3ZZUA 1RI7A 1Q81T 3V6DA 2RU9A 3AA9A 1BUXA 3DXSX 3GILA 1JKHA 3PJ9A 1CLFA 1YJVA 2MKIA 3BSAA 2HKEA 2XMWA 3M8WA 4Y0FA 5IM0B 5ETTA 4CT8A 1I1GA 2KDOA 3M2RA 3SXLA 1N8RT 3GSDA 3NNHA 4USVA 1T9WA 4WZMA 2EBEA 3PYDA 5LJ5Y 3PV8A 2UU9J 3UN3A 2ZUAA 3VAGA 3G6XA 2DEIA 3FCWA 3WIVA 1WEYA 2HRYA 2XMMA 4DQRA 4F3MA 4BHQA 4RW8A 3DRXA 4CO3A 5IV3A 3HDSA 4TYAA 2XWYA 2B3TB 3I5BA 3EXYA 1X4BA 1M5KC 1R8CA 3B4MA 2XHWA 2H48B 1RT4A 1KVIA 2V2KA 2QGFB 1KQFB 1LWCB 4U7UD 2HHTA 3NGSA 5EX0A 2HFVA 1RAOA 2Q79A 4QWCA 5DZ7A 3HSJA 2R8GA 2YH0A 4WJBA 2U1AA 1KC8T 4I0WA 2KRBA 1R0BG 1JNZB 3CUNA 2O5DA 4O3NA 1YJWS 4DBQA 3POTB 2F7VA 2KFYA 2PFFB 1SQEA 4QU7A 3PX6A 3W7BA 4RNOA 1YG0A 4KPCA 1WG1A 2EFQA 4F4AA 1V3RA 2LMIA 1N5VA 3HD1A 1T11A 1SC6A 2HWTA 4FNIA 4BBYA 3RGIA 4OJ3A 4M5GA 1W2IA 1FDBA 2QV6A 1N33F 4RW4A 2ALZA 1JXEA 2BW7A 3I96A 4IQMA 4ZCLA 3CJQA 1KEKA 3SCIE 1ZBTA 1UVNA 3L9ZA 2HLUA 1FXDA 2FGOA 4JI5F 5DRKA 2DPIA 2UUAJ 2R8IA 1PSDA 1X7VA 2BQUA 3JAMY 3Q86A 2FPHX 4LFBF 1S1VA 3DU6A 4FF4A 3S01A 4AUKA 2FHOB 3KLHA 2FJBB 3BQ2A 2MTLA 4ZVGA 1OO0B 1G3OA 2WONA 4DJBA 4CTAB 3AAWB 4GC7A 1FX4A 4CLLA 4DV6F 2DIUA 4JI7F 5C25A 2M3DA 1GXLA 1KLMB 2ZZNA 3MEDA 4YY3F 4JI0F 2LVWA 4HDGA 1UVJA 3T3FA 2IC3B 1RTZA 1X4HA 4AL7A 2WBMA 5IFMA 2FVCA 4I7FA 1Q7YT 1L3SA 3OV7A 3PDNA 2G0JA 2B7BB 5D8HB 4DR5F 3MGJA 3IWNC 2VFRA 4LJMA 1RT5B 3CF5Q 1N5SA 4JOUA 4USKA 4B3RF 4ZHRA 4FYWB 3R2CJ 5KFZA 4DR2F 3RBZA 2OEJA 1UJ6A 4URSA 1B64A 4ETXA 4ZLJA 1S9EA 2KRRA 4B3MF 2DTJA 4KGXB 1J5EJ 3H8YA 2JSXA 1GMWA 4RNHA 1VBZA 1GEHA 4K5SA 4F2SA 4EO8A 4RZRA 1N56A 1KD1T 1WSRA 4Y2MA 4JV5J 4EUVA 4CH1A 2XNRA 4CLSA 3FFIA 4IO9Q 5A6WA 3OLBA 4DV0F 2FJVA 3DRPA 4OJ1A 3G9CA 2VG6B 3FDSA 1UL3A 1S1WB 2Y1IA 1AYEA 2HBQB 5AJ3J 4ZPAA 1XEZA 3M9NB 1LOUA 5HN0A 1H98A 3ENVA 3GE9A 4ED2A 4K5RA 3OL6A 4NLWA 1HMVB 4K4WA 5L1KA 2XS5A 4YB7A 2IVMA 2JLFA 3HHDA 2OFHX 1DZ5A 1N54B 1P1TA 2CQBA 1IR1A 3IM9A 3CEDA 2DO4A 2QA2A 2MHEA 3NBPA 1T05B 2Z0GA 1EQ0A 1QLNA 3FQLA 3KK1A 1T8EA 5G4DA 5CCLA 3I5CA 4N76A 2GVDA 4RNNA 4L72B 2BKPA 1H2UX 3R7BB 2ZNZA 1SJQA 4BS2A 2ZWOA 5LXYA 5IV4A 3PACA 3U1LA 1IM6A 1F0XA 2L48A 4H4MB 4LF7F 3G87A 2MKKA 2QL5B 2GO8A 2HHPA 2OP5A 1RISA 3UW1A 2XNQA 1IBLF 2MMYA 3CCJS 1YLXA 2AWZA 3QFHA 4UOCA 4DR1J 2R7VA 4RW9A 2QT7A 4ES3A 3N6NA 4J9KA 1O51A 1X0FA 1CVJA 1IR0A 3E2EA 5HQ8A 3WBZA 3CWJA 2IDLA 3G82B 3KJNB 3TA2A 4AXJA 4BDPA 1S49A 4JUZA 4ZPVR 4KY3A 2WSCC 3ZZOA 3IS9A 4NLQA 3CC4S 4LRAA 4OJHA 1NK6A 2FHJD 3N9UC 1NH8A 3UDVA 1G4CA 1UFKA 2J8SA 5KFMA 4RW7B 4DPYA 1YHQS 2WTFA 3SFUA 1VC5A 3V4IB 2Z30B 5KFXA 2XBPA 3ZTOA 3TUZC 1SJ4P 4WU3A 5HQMA 2I8EA 1WD6A 3NAIA 4YUDA 2KZZA 2CQIA 4KHMA 2XO7A 2J7WA 1CG2A 3V6JA 3C14B 4OZJA 4CO5A 2I6WA 2JVOA 1S5ZA 4Q5VA 2POKA 2VBYA 1VJQA 4CLFA 1KN6A 2IM0A 2B6AB 4U7UK 4B3TF 3R97A 1FKPA 1X0PA 4USMA 1HNXJ 1HYSB 5KT4A 3OL9A 3DI6B 2UV8A 3EGZA 2A18A 2C2MB 2W2NP 2UVWA 1UW4A 3F73A 3JQKA 5K8NA 5H9EJ 2MJNA 3RRGA 2EI5A 4WP8A 1JK9B 4I2PB 1UCNA 1XTZA 5E3RA 1IUJA 3PZPA 1CJTA 1ZPWX 4TU9A 1AROP 1RKJA 1FTCA 1OWXA 1RTJB 2JJ4D 1U09A 1Q95G 4X62J 3CGIA 1ZM2A 3DLGA 3KUEA 3Q22A 1NB2A 4YR0A 4ZVEA 2ZZMA 5EUHA 1R8HA 5KFYA 4PABA 3SV3A 4C2MA 2X1AA 5KFQA 3SDEA 4TQSA 3FCHA 3M8YA 4XTTA 1S57A 1GX6A 3VCDA 4I67A 2YQ0A 2K3IA 2M8HA 3Q8RB 1OYDA 3G4SS 2J0QD 1RAHB 4QR2A 3ISND 3LAMA 1VQLS 2DO0A 1XMOJ 3VZHA 4CYUA 7AT1B 4IG3B 4DL5A 3W61A 1LQ9A 2XCPA 1TAUA 2KFZA 4X65J 1JLQB 4U8VA 3U02A 3CO0P 1BLUA 3CCWA 2PGCA 2A6OA 4X66J 4O0IA 3GR0A 3RW7A 1JJHA 4W90B 1IKYA 3UD5A 2A0FB 3HP6A 3JSMB 3DLJA 3TJ9A 4YR3A 4LFCJ 4KKOA 3MTKA 3KHHA 4FPIA 3H25A 3QQCD 3EZUA 1AUSL 2QRRA 2LA6A 5ETPA 3T5JA 4ED7A 4IFYA 3JQMA 4C6AA 1U1MA 4ANCA 2BJ3A 3UWTA 3D6HB 4EBCA 2JC1A 1D09B 1S6UA 2BV3A 4OI4A 1SQGA 2ZD1B 3W2WB 1PBAA 4P9SA 2JLGA 3A8EA 4EI2A 1DURA 5CQGA 2AJ1A 1UWBA 4J9PA 1EKRA 5GAEI 3HF5A 4KAIA 2EK1A 4WXWA 1U1PA 3CC7S 3T5HA 2OI2A 3PR4A 2PO4A 4DZ6A 1Q4RA 4N7TA 2GA7A 4A8SA 2CJBA 3HJVA 4G1IA 4LQ3A 3LALA 3NWGA 2XG8A 1GQEA 1L3VA 1ZPVA 3N5BA 3U7JA 3T6BA 1H73A 1RHUB 1X5PA 2W8KA 3CCES 2ZJRQ 3BO2A 3R8YA 2BQRA 4Y34A 1MWQA 4NZ7A 5CABA 3HK2A 4F3OA 2K1RB 4FXWA 5U47A 3H5YA 2OPQB 3TQ1A 4RO0A 4ZVSB 4K4TA 1C1CB 3X3UA 1WI8A 2KXHA 3A8JA 3P8BB 4F0MA 2VPZB 4GVBA 5HLFA 2YKAA 3MR6A 2BRLA 2A10A 1HNZJ 2ZM6J 3D6TB 1W26A 2MZTA 5B09A 3AQPA 4F67A 1Z2ZA 2PIIA 3MOZA 2NXJA 1NDLA 4RUHA 2RDIA 5A8WB 5K9FA 4DSFA 4ED8A 3MPUB 2YKMA 4WBFA 4P75A 3CD7A 4EK2A 3I82A 2AGPA 2J7KA 3HX9A 2KVIA 3MM7B 2DNYA 3OL8A 4DFPA 5SUHA 3DOLA 3Q8YA 2XWXA 1RT2B 5IS2A 3BJYA 3H2UB 1XR5A 4E0DA 3GFHA 3MM9A 3C3LA 4WPAA 3BKFA 2OPSA 3W8PA 1Y5NB 2XTJP 3BN7A 3PRDA 2DISA 2LEPA 1TL7B 4OX6A 3CCSS 4QZVB 2LXIA 2XEXA 4YHHF 1FJEB 1XMQF 1IVZA 1QE1B 2LA4A 4P2MA 4QPTA 2YNGB 1URNA 2E1AA 4IOBA 1AUDA 3MPVA 4DN0A 1VQPS 3PYEA 2HAFA 2YKQA 1DAXA 2HHQA 2LDIA 3WC0A 2XSJB 3SSQA 2DHAA 3QIDA 4NLXA 5LSLA 4LUBA 1WHYA 3KNGA 1HBUA 2FHKA 2XLIA 3MXHP 2KB2A 2VF3A 1TUGB 3Q8PB 1B99A 3FZBA 4ED3A 4OHYA 3MI7X 1CBKA 3PXGa 2IVFB 4C8NA 3GYNA 4JV0A 4CZCA 4A8MP 4KV8A 1GAOA 3GJQB 4ER8A 2OPRB 3C15A 2GO9A 5HP1A 3AODA 1XR7A 3DGPA 2WVBA 3OFEA 1Q8BA 2P6TA 2IFXA 3JXOA 4GO7X 5D0GA 3RB3A 4ECYA 1DLOB 2HGMA 3OR1B 3SFGA 1K47A 2BVZA 4K50A 4NLUA 1U1KA 4OHXA 4ICLB 5B08A 3T41A 4IDKA 2P9EA 5AXLA 3OL7A 3U1NA 3Q23A 1JLGB 2W2OP 1N36J 2YNHB 2FLNA 4TKTA 4B02A 3GFYA 2Z2YB 4M5DB 1ROFA 5IT0A 2LQ5A 4NRUA 5GMKa 3LP0A 1CJUB 4XAKA 5GAHI 5B7WA 3ZNJ1 1TMJA 2DD8S 3P45B 4ILRA 1VRUB 1CJKB 1WDDA 3FVYA 4OFZA 3G96A 1BQMA 1HA1A 1U1RA 4LSNB 2PFDA 5D3GA 1FCAA 1Y4ZB 1T02A 3MEEB 4JV2A 3TARA 1D1UA 3B4DA 3HLUA 5G0RB 1Q82T 4BWMA 1TKTB 4DR4F 2ROPA 5DG7A 4UW2A 4PUOA 3R3TA 4QWDA 5HL7Q 1XN9A 3R7NB 2WVFA 3N4WA 4Y65A 4YDDB 3DC2A 1JNRB 2RF2A 1HFEL 2O01C 2QC3A 1MN9A 1RAFB 3AOCA 2LEBA 4PG8A 5D0EA 4ENOA 3FMBA 3L4BC 3OFGA 2DNGA 4W4MA 3IM8A 2HWHA 3LTOA 2M8DB 3HSDA 1MG7A 1R31A 4X64F 3NGRA 3G8TA 4DSIA 4Q8EA 1B0VA 2KXFA 2PDAA 4PRFA 3VGTA 2B7CB 2DHGA 3ZTSA 1ACMB 3EVOA 2P6SA 2CXEA 4OMFG 5HMWA 1NMEB 5DDQC 3C6TA 3OTOJ 4I64A 1C4AA 3BPDA 1Q8LA 4NYPA 1T9TA 4ECWA 1YZ6A 1WC5A 5A8RB 2OH2A 4EEYA 4FPRA 1H6KX 3UR3C 1DTTA 1KOOA 4MT1A 2HHHF 4P52A 3AHPA 3GIKA 3S1TA 3W2VA 1T03A 1QSLA 3VV2B 1VRTA 4ZJQA 1OS5A 1SC4B 2HAIA 3ITHA 5F41A 3T5LA 3D28A 5C2GA 3MCMA 3KJVA 4KPYA 1QTMA 4ID8A 3UR0A 3NKYA 1LW2A 4H4OA 1GH8A 1EKSA 1NJWA 4O3RA 1Y3JA 4IR9A 4ZLNA 3V6HA 1NU4A 2R7RA 5MAOA 3OUYA 2QE5A 1YKWA 3IC1A 4O0NA 3QZ8A 4Y2AA 1IKWB 5A0YA 1FRMA 1LK7A 3ELHA 2ZZTA 1KKHA 1XMBA 2MQPA 2WSEC 2AD9A 3LGMA 3R1LA 2QFJA 4G1QB 1SB6A 1PC4A 3G71S 1AZSA 1PJ5A 4O44B 2LLZA 1RTDA 1TL3A 4N41A 2DNHA 2BM1A 1NPPA 2VBWA 5IC4B 2J9CA 5LSRA 4J9NA 5K8PA 4JI2F 2F5GA 3HMJG 3OTEA 3QT7A 1RT3A 3P6YC 3QRRA 2BEFA 3BYRA 4K4SA 3IR6B 4F4ZA 2W9CB 4OYIA 2F9DA 3RBEA 3N5FA 3KG4A 3CJKB 2KT2A 1NDKA 1RBOB 3M32A 3J7YI 3CMES 1I51B 4DV3F 4AT1B 3TJ8A 3OVSA 1NK9A 4CH7A 4LMZA 4DV1J 5LSOA 4QIEA 5HBMB 1YJ9S 1WEZA 1AB8A 5JUMA 4DV7J 1CS4A 5KFVA 1ZTTA 3GPAA 1TK8A 5AE1A 3DM2B 3M4XA 1MROB 3I9V9 2KTQA 1H7XA 3AD9C 1C1BA 4P2SA 2B8QA 2XY6A 3NCPA 2ASLA 2MLZA 3GSIA 2XMAA 3QJPA 2O67A 1RYRA 3DNCA 4PQUB 1BD6A 2YTCA 5FDLB 5HQLA 1SL2A 2P2CB 1VGYA 4DG1A 1YJUA 1TTHB 1UVLA 1S6QB 2HK2A 4QYZJ 1R27B 1F5AA 1FWLA 2VPXB 2XQCA 5BJRA 4M63A 5DETA 1AW0A 1BE4A 2EEYA 2HFNA 5F0UA 1S1TB 2QL7B 1K0VA 1IKXB 2X7IA 1FFGB 4TY9A 4J9MA 2AJ4A 2KXNB 1URRA 3AD8C 2C3MA 4J9QA 4WYLA 5IM0A 1GT8A 1BXNA 2XS2A 2CZ9A 5KFWA 2GX8A 1WTFA 2ROEA 5DS7A 1ZOTA 1Q78A 2HQFA 1WNEA 5D15A 2QLJB 3HSZA 2OD6A 1VQ7S 2M88A 4NLOA 1RHQB 5GMEA 4LRDA 5ETQA 2C2RA 1ZAVA 2DRDA 3C16B 5K8MA 5T7LB 3IP0A 4EZ6A 2BX6A 1U2RA 2GQCA 1O0PA 4ED4A 3K8WA 1LWCA 3CJRA 3KLEB 1IJEB 4A4JA 3KUGA 3J7ZT 1AT1B 4IOAQ 4V19X 1SKUB 4DUTA 2GQQA 4LR7A 3KLGB 2VQEF 2J6UA 2HLTA 2JRSA 3POTA 1LK5A 4DXLA 4MIBA 1N5TA 3LUYA 4X4PA 2HFSA 2E5IA 2QL9B 5IWAF 1BHNA 3M8RA 3PEHA 1SPBP 1VIXA 1NKEA 1KVKA 1O5JA 4NPOA 4ZN1A 4R5PB 3IR5B 3GFZA 1NK8A 1FRJA 1AA1B 1U8SA 4KB7A 3TAMB 1HW8A 1NBEB 4N47A 2RQKA 2A6MA 1T9XA 2YWGA 4DQPA 1S12A 1VQMS 3CJSA 2VDHA 4USJC 5KG7A 1HBOB 2EFGA 2APOA 2CADA 1ZM9A 1S59A 4OQJA 1FT8A 2QA4G 2GMHA 1WC1A 3TNVA 3E51A 1H3DA 1M1GA 2BJ9A 2CZVC 4FYYB 3RG6A 5I4MA 2XI3A 2DGXA 4X4TA 4AD6A 1X4DA 4TU7A 1S0NA 1N5YB 5LMNF 4F8RA 2B5JB 4CTAA 4ZOSA 2KN4A 5KFDA 1R0AB 1BQXA 1ZM3A 3F41A 4KQZA 2AYGA 1FNXH 2ILZA 1YX2A 4LF4F 1KLMA 2Y8WA 2MKHA 2HFZA 4C0BA 3LF0A 3ZTPA 5H9FK 1JLEB 4LFAJ 4LRCA 2IC3A 3K5NA 1XNRF 2AZ3A 2VA3A 3QGIA 4NMXA 1FRIA 2XHCA 1RT5A 2B4OA 1NK5A 3VALA 3MM5B 4F2RA 4FVMA 1FFWB 4MK8A 2YNIB 1Q0NA 2E9TA 2BA9A 4TXSA 3NMAA 2V8HA 4FN5A 1SH0A 4MFBB 2EXUA 4KO0B 3ADAC 3BH6B 3ZZRA 4AFFA 1REGX 3I4HX 1XNQF 2DNQA 3UPFA 5H1SV 3VWSA 2H9ZA 1FJGJ 1HNWJ 1JJCB 4JI8J 2R7SA 1N5QA 1R89A 4YS2A 3M6UA 4CI0B 2VG6A 2XY7A 2VDIA 1S1WA 2OMOA 2GJFA 5E0OA 3DHWC 4C0HA 2PMWA 1LW0B 4OYZA 2NQPA 2ZH9A 4EYIB 3M30B 5BYSA 5KFKA 3JQJA 2ABYA 4ZVQB 4DV4J 2OO4A 3KLVA 2HFUA 1WG5A 1S76D 3J7Z5 1RACB 1GMWD 1S7IA 2N7CA 2B9YA 3CMAS 1IBMF 2B9EA 1HMVA 4E8UA 1RWXB 1UPPA 3KHRA 4CDIA 1WDTA 2EFNA 2C42A 2R2TA 3MM8B 2B4VA 4PEOA 2EFVA 4WP9A 1T05A 3RB4A 5DQHA 4ZPDA 1PILA 2B0GA 1CJVB 3GG1A 4USUA 2FHJA 2IJRA 2DH7A 1N88A 2AT1B 2AF6A 3ILOA 5ETKA 5GADI 5FD1A 3MCOA 3I0SB 3J7AN 9ATCB 4O3QA 3KG1A 1WWHA 4H4MA 3E01B 3KK3B 4DUYF 3NGDA 3EX7B 2E7WA 4IYQA 2XB2D 1U6BA 3MFHA 2AP6A 2CUYA 1FF2A 1U7LA 1Q16B 2R8HA 3R5DA 2FUG9 2WZ1A 3O8WA 3GB0A 4U96A 1UEKA 3CVKA 1T95A 1VLYA 4Y28C 3G82A 1O6XA 4OHZA 3RB0A 1FX2A 2QMWA 4DV2J 2W9AA 3A13A 3D0GE 4A8WA 3HVTB 2J7UA 3HZGA 5C42B 2LECA 1B4SA 2BQ3A 1VQ4S 2JZ5A 2FVPA 1R7IA 3BF4A 4RW7A 4LBPA 3V4IA 5E33A 3OD2A 4Y3CA 1WKLA 3K5MA 1NSPA 2X3GA 1F6TA 5ETRA 1T94A 3FSXA 2DRAA 2Y8YA 3UVJB 4C8MA 4NXMJ 3DLHA 4ZIVA 2GIFA 1VQNS 4P6QA 2CZ4A 3DRYA 2HHVA 1N52B 1MN7A 3C14A 2LYVA 4CLUA 3ULHA 2ROGA 3BM7A 2AJQA 1TFYA 1V3ZA 5IT9U 1RJJA 3ZNUA 3P3DA 2XMKA 3DLLQ 1SJRA 2B6AA 3Q89A 2ADBA 1CEZA 2KT3A 1U02A 1QDUB 4DX8H 2CIMA 1HYSA 4MTPA 5DG9A 3DI6A 4X84A 1WC6A 2CPDA 4H54A 2UV8G 3JB9k 5F8MA 2R9LA 3HSGA 3E3XA 1Q79A 3NP5A 3ZC4A 1QAYA 4I2PA 4MJKA 3CCTA 3DRRB 2PA8D 5CZVA 4ES1A 5JXSA 2HVIA 1S7HA 3EMTA 3DLGB 1RTJA 4K59A 3M8QB 2UUTA 5JMNA 1OYEA 2ZDPA 5DQIA 1SL0A 1IQTA 2YX7A 2DGWA 4PG4A 4QBUA 1IQZA 1V5IB 1HQUB 2DH8A 1RCXB 3H59A 5HVFA 4QWEA 4LQ9A 3Q8QB 4ZN3A 1FRLA 2J0XA 2IIHA 3CCLS 2YKNB 1N33J 2IM1A 4C7QA 3IMQJ 4O4GB 3KUHA 2RDDA 2IAJB 3MAHA 2UXBJ 3QIPB 2L3MA 2HZAA 3WIUA 4IRCA 4IG3A 2BXJA 4EWTA 2F8EX 1BGXT 3LQVA 2VHGA 4IH7A 1JLQA 1LXJA 4PAAA 2G1DA 3D54A 4Q0BB 4WFZA 3AOBA 4L75A 2F9JA 1RYSA 1Q53A 2H3EB 4ELUA 3TX8A 2F4FA 4M8LA 1U4BA 4U9RA 4DV6J 3JSMA 3MCNA 4PXBA 4JI7J 4OZNA 4YY3J 4JI0J 3UDEA 3NS7B 4HVZA 3D3CJ 4G6VB 3EDQB 5KT5A 2ZJQQ 1MMNA 4LF1A 1LV5A 2E1RA 4DFKA 1UJ5A 4PCQA 4IR1A 4X4OA 2ZVSA 3W1YC 1VQYA 3KJQB 2W9BB 2CYYA 2ZD1A 3W2WA 4DR5J 1QAIA 1FWKA 3RAQA 1EHWA 2JEJA 3MPDA 2JOQA 4V1Ak 2A2DA 4MK9A 5CXTA 4JI6F 2QIFA 2F4VF 1SUQA 2XZTB 1R8AA 3O6QA 4DR2J 2MYFA 1SKRA 3HPOA 4OLPA 3T5KA 5L38A 3U1MA 1CULB 2W1BA 2EG2A 3CULA 4B3MJ 5AXNA 4C8KA 2H4WB 4UTGA 1NUEA 1VQKS 3CE8A 2PEHA 1TL1B 4ZJOA 3VR1A 2UVVA 4XPCA 3UE2A 3ILJA 3BGOP 1NZAA 1ZETA 2OAUA 3EGNA 2H5IB 1FEEA 1OY6A 1HI0P 2K1RA 2CWXA 1WI6A 1RTIB 2OPQA 4X4QA 1C1CA 1VIOA 3H42A 1N34J 2V9WA 1MMDA 4ZIWA 3O44A 2ZBCA 4DV0J 2JFKA 4ES2A 2WVEA 1WELA 1U45A 1VOMA 3EJMA 3LPEA 2L9NA 4OV1A 4DCPB 5A8WA 1OPZA 2UUBJ 1OSCA 4R8UB 3PRBA 2CJAA 1I94F 4NASA 4IQXA 2FY8A 5EHHA 4F0KA 2HQIA 3AJDA 3K2YA 3MM7A 4N5SA 5M2PA 1RT2A 4TNOA 3T6JA 2VJVA 4Y2KA 4ILMA 3K5LA 4QW9A 3DU5A 1DQAA 4ED1A 1KLNA 3GR1A 1VDHA 1TL7A 1P9QC 3AQOA 4RBUA 4A8KA 5HJYA 3MMBB 3PVXA 2G1HA 1QE1A 4DUZJ 1FDDA 2UP1A 1S6PB 2YNGA 1KWMA 4LF7J 4YP3A 2P9CA 2JDJA 1RT1B 4ZLLA 1IBLJ 1KVJA 2VFVA 4LF6F 1Y5LB 2CJQA 3KMSA 4KRWA 1RDRA 2FJEB 2XSJA 2YKOA 1YI2S 3MR2A 1UPMB 2MQNA 2DK2A 4DPTA 2JLEA 2D3UA 4RWWA 3M8ZA 3VVUA 4URGA 1VC6A 2CJYB 2LQ9A 5L1LA 3HKZD 4FXDA 1ELOA 3OJUA 2DVIA 4R0JA 4Q8FA 4JI3J 4BLGA 2RRBA 2OPRA 2VKZG 3DGVA 3DYAB 3TYTA 5CYQB 4B3SJ 3MMJA 4OZ5A 1JLCB 2X1FA 3HFZB 4HDHA 2CQ2A 1DLOA 3OR1A 1VS3A 1KTQA 5KFSA 6FDRA 2VQFJ 4D3HA 4K8RA 3MMCB 3B78A 4DLGA 4OZ3A 1SC3B 3BBFA 5DLFA 4ICLA 3Q0AA 2DR9A 3CB4A 4CO1A 8ATCB 4WK1A 5KOWA 3W5YA 3CJ8A 1K8AT 1WHVA 2GC8A 4PKDB 2NXCA 5ADZA 4D3GA 3B6BA 1JLGA 2W7OA 2YNHA 4PYDA 4NA3A 5HVGA 2F40A 4C3MA 4LR9A 2E5JA 1KHWA 1HQEB 3I87A 3GJTB 2CQHA 4LSZB 4M5DA 4AE5A 4ECVA 1CJUA 2Z2ZA 5D4LA 1S4FA 4UF4A 2NYIA 3G6YA 1VRUA 2YNFB 4B3TJ 1CJKA 3J81j 4LSNA 3R5BA 2FIUA 4K2XA 1WJ9A 1K44A 4A8XA 3T1YF 1M5HA 2VOPA 2JX2A 2X51A 3MEEA 3NY0A 2H1YA 3R5CA 1Q8IA 2QSWA 2Y9HA 2IYIA 5E7OB 3IO1A 3DXBA 3LW5C 4U95A 2BJDA 1MWYA 3A8KA 5G0RA 1TKTA 3GP9A 2BE7D 3C6UB 2NCKL 2ZH5A 4ZPWR 2E7VA 3UQSA 1RK8A 1U0SA 3H5SA 4FXVA 1WTBA 3CT9A 3A4TA 2MHNA 1K0TA 1FXLA 2EFPA 5J1NA 1N0UA 4F4XA 3N6LA 1JXLA 3CJTA 3M7VA 1J5OB 3FNNA 1HNXF 2V5HG 4YR2A 1SQFA 4ZVTB 2KVQE 4DQSA 1S10A 2NPFA 4TN2A 4WFAQ 3KYLA 3CJ0A 2PI5A 2J9DE 2KG0A 1MU2B 1PBUA 4UQGA 1P9YA 4KGMA 5J2MB 5A8RA 1FE0A 2VC0A 1X4GA 4CLTA 5EWGA 1EQMA 1U0HB 2ZBPA 3PKYA 2YWHA 3J7A1 5L1IA 4C0OC 3FRZA 3D1HA 2HZVA 1DHMA 1RBAA 2QLFB 4FBUA 4OI0A 4FYXB 4KGVB 3T9NA 4C48A 3LWLA 2YQ3A 4GKKF 4FF1A 1A9NB 1TR0A 5RUBA 4FF3A 3C8YA 1IKWA 2DCLA 2RT3A 5CAAA 3D3BJ 4DPXA 1LFPA 2OFGX 3QGHA 4G1QA 5BYQA 3W60A 4O44A 3I4PA 2M4MA 1VCTA 3X1LB 5LT5A 5L1JA 2W7AA 4RBVA 3PHTA 3HHKA 3NNAA 3R5JB 4LF8F 3QFWA 1NNDA 2W9CA 1X60A 1YIJS 3H5XA 1GMVA 4LIWA 1UW9A 3I56S 4ZMMA 4CLWA 3M05A 3CJKA 4RJVA 2F63A 2HNZB 4HR2A 4X4NA 4QU6A 2Z8QA 2MZRA 5JVHQ 2F1FA 4HL9A 4M94A 5HBMA 3GTYX 3NGUA 3VAMA 3MTJA 3M2VB 2BJ7A 4P73A 4DV5J 4YMEA 2OEKA 2Y0SD 4RX6A 2HHXA 3DM2A 1MROA 3K5PA 1ZA1B 5J1EB 2BW2A 4ERDA 2CG8A 3W66A 4WK3A 3IR7B 4B9SA 2QLBB 4J37A 4PQUA 2OPPB 3CCRS 1DQ9A 5FDLA 1NSQA 4X2BA 4U8YA 4UZBA 1FE4A 1S6QA 2MLYA 3GU0A 1HPZB 4C97A 3QLHB 4P2FA 3SIPB 3P4UB 1KS2A 3BR8A 1GK8A 1RHMB 1HNVB 5I3QA 5B0DA 5HVHA 4YN3B 1S1TA 3QSIA 2R4FA 3PFOA 3GIRA 1IKXA 4HEA9 3TUPA 1CQMA 3IWXA 4WE1B 2BE9B 3TVKA 4YHHJ 2IMWP 3SSSA 3FZ2A 2RJZA 1HNIB 3RRHA 5L9XA 2QFIA 4L6V3 3UCUP 4NLGA 2CQPA 2C3OA 3QT8A 4DFMA 3C16A 5T7LA 1KNZA 3D2WA 1YWXA 1S77D 3CDBA 2J9EA 1B0TA 2W2QP 1HKAA 2Y1RI 5BR8J 5DLGA 4JI1J 4CNZA 3KLEA 2ZKUA 1O8BA 4ED0A 5E2QA 3W63A 4CM2A 3A12A 4J9LA 3FRYA 4YB1P 2G0CA 2GMLA 2BJEA 2NSCA 1U24A 4L74A 1EP4B 4RBTA 2HQ3A 3KLGA 2ZH6A 4DF8A 5HI7A 4K4ZA 4V19J 3W8GA 3DKDA 4EBDA 1PAUB 1N0VC 1NPRA 1PCAA 2DGOA 3QATA 4NXNJ 4RNFA 1HD0A 2VG5B 1WC3A 2C28A 1A0OB 4WCEQ 4U6PA 2V67A 3GV5B 3NGKA 4I2QB 2DGVA 4R5PA 3TJAA 1UETA 3QZ7A 3BSNA 3CD6S 7FD1A 5GVQA 3TAMA 3TUIC 5A8KB 4TU8A 4Y2IA 1IJFB 1F1BB 3LGHA 1WOOA 3MR5A 5D4NA 2FZGB 2KFNA 2ZNYA 3PR5B 4OI6A 3MPYA 2FY1A 5L46A 2K7KA 3OPKA 1HBOA 3D5MA 3CMQA 1SXLA 3OVAA 2D69A 3SV4A 4PWWA 1DARA 1RBLA 3TR5A 1C0UB 2ZITA 2XMTA 4XIUA 3W5XA 1W25A 1GNKA 1N5YA 4WFYA 2AQ4A 1TKZB 2KU7A 2ASDA 1AXQA 2B5JA 1NXIA 3FBCA 1WKJA 4DR4J 4I6WA 2RRAA 1R0AA 2QZ8A 2DR6A 1RHKB 1TUVA 4FNHA 2IM2A 1RWNB 2AIRB 1N36F 4MKYA 1H2VZ 2V6AA 3IRWP 3LP2B 3GMGA 3K7RA 9RUBA 1F9EB 2KM8B 3JYTB 1JLEA 2C2EA 5FIIA 4KC5A 1KFDA 5D4PA 2CJXB 2IA0A 1FJCA 1RWMB 1Y7PA 4X64J 1KQSR 4WFNQ 2ZOGA 2CQ1A 3TZXA 2E9RX 2OIHA 3RRKA 4PQAA 1HHTP 3MM5A 2ZH2A 4ZLPA 3AB4B 4ZCKA 2RQMA 2YNIA 1RCOB 2I38A 3BO3A 2ZEJA 5DDOC 2AEFA 3PCOB 5KT2A 2FC8A 2FZKB 2AGQA 1KTVA 4QWAA 3I55S 4MFBA 5KG4A 5KFTA 4DCOB 4KO0A 3THPA 3DDNA 2HHHJ 1VQ8S 3R5AA 1HBNB 4A8YA 1VBXA 4C9DA 3MR3A 5DGBA 3MF5A 4DL3A 2HMIB 1FRKA 3VVTA 2QG9B 2OD4A 2BE2B 1FEHA 3J81U 8RUCA 2V4QA 1X4AA 1HBMA 4B9UA 2D1CA 3RW6A 1X4EA 1OQ6A 2VV5A 3HFKA 3NS5A 1T0TV 1RTHB 1DJ0A 1LW0A 2AEMA 1U48A 3M30A 2YX1A 3DDKA 2ASYA 2JWNA 2VH7A 3JSYA 2HRUA 1TV6B 4QR1A 2RKIB 3M8SA 4K7QA 2B8PA 4ECRA 1QJHA 3Q8UA 2DH9A 3C2PA 3VAHA 4HI1A 2EPIA 1BMQB 5KFLA 3MM8A 5HANA 3K57A 1QSYA 3D9BA 2EW9A 4OX9F 4JI2J 3QWUA 4CP5A 4P7VA 2WVDA 2NUUG 1CJVA 1RLDA 4I4BA 5KG1A 3TZWA 1S9GB 3LO3A 2OSQA 3AY0A 3GJRB 3W3SA 3QYYA 3NGTA 4NCAA 4WZQA 2ZE2B 3UDLA 2MKJA 3AFGA 3I0SA 2AYMA 2CNKB 1DBDA 4UUWA 2J8AA 3GIJA 4I6YA 3RAXA 2V8GA 2DKOB 3KLFB 3E01A 3ET6B 3KK3A 1RHJB 2GHWA 4TYBA 2DGQA 2D3OR 2ILYA 2O1PA 4JBCA 1WF2A 3IBCB 1N4LA 2XMVA 2VFTA 5E3AA 2W25A 1TVRB 2LQ8A 1M90T 2PMHA 2R8JA 2BJ1A 1WC4A 4QJVA 3HVTA 2VOOA 1MWZA 1NDCA 3CCZA 5C42A 2DB1A 1HQ2A 4I68A 2QLWA 3QO9B 3ZO7A 1VR6A 2FJDB 4M5KA 1N6QB 3CTRA 4ZP7A 4YB6A 3PNIA 2UXDF 1SJ3P 3HVWA 1RAIB 2DBBA 3DCAA 2HW3A 4DV1F 4ZKAA 4LF5F 3UVJA 4Q44A 4PXDA 3O5TB 4DV7F 4DQIA 4NMLA 2MZJA 4OYWA 5CHCB 1HHSA 4IOCQ 2LP4A 2ADCA 1B0PA 3TWZA 1SJ1A 2M5YA 2VD3A 3S7RA 1FNOA 2HVHA 1FDAA 2L9WA 2CQCA 3TP2A 2E1MC 4EMDA 1RHRB 1M5OC 3P5BP 2EBGA 3DLKB 4KHRA 4LF9F 4O3OA 1QM9A 3LAKA 2NLWA 3CJ4A 4USIA 4A48A 4OX7A 2GZOA 3DRRA 4CIOA 2NSBA 1WKKA 2VQEJ 3H0PA 1JIHA 2AX1A 4ECSA 2C2ZB 3M8QA 3NG8A 2H51B 1OJ4A 4FYVB 1IXKA 1EZZB 5BXIA 3ZTQA 2XSFA 4FKYA 3H2VE 5HJXA 3THTA 2RE1A 2GJIA 2D9OA 1HQUA 3UCGA 5B0EA 1NRKA 3CDWA 2V34A 2ZJPQ 4N56A 4PYAA 3FBBA 1TELA 4USTA 2YKNA 4J9VA 2W2MP 2AJ0A 2W7PA 3DLEB 2HBYB 2E7XA 1RE1B 4O4GA 1C0TB 4FS2A 2E5LJ 4OX8A 2IJNA 1FK9B 1IBKJ 1S1UB 2FC9A 1RWWB 5F8LA 1VJWA 2IAJA 4Y6IA 1GTHA 5K8OA 2RAQA 3QIPA 1NJYA 4JI4J 5K20B 2WSFC 5E3PA 3HHEA 4JV1A 1YDLA 2FJAB 5DGAA 1FDNA 2V94A 4Q0BA 1KSPA 3C66A 3BSCA 4DR7F 3FEZA 3OHBA 2DITA 3M6VA 2K8GA 1TAQA 3ZZZA 4DOZA 3CDUA 4EGLA 2WVCA 2OEMA 1B70B 1VHFA 1VRQC 3AOAA 3FSYA 1KFSA 3RR7A 3R6LB 5E5NA 5JVGQ 3MUTP 3TUJC 2OELA 1AFJA 1XNRJ 4NX9A 2VC1A 2N4CA 2W9BA 2B9XA 2KKHA 2B56A 2Z2LA 3DRSB 4MKBA 2PSZA 3B8HA 4DSKA 1TMMA 1KBRA 1SUQB 4TQRA 4ZVHA 1L3TA 2Z2MA 1U2CA 2F3JA 5F0WA 3TRGA 4DSJA 1I3OB 2DGSA 1S1XB 2XMUA 1PYTA 5FLXY 1UZDA 1NK0A 3PW5A 4FYDA 1CULA 3UD4P 3Q24A 4KT0C 2DR7A 4N77A 1Y0HA 5D6GA 1TL1A 5I42B 3EGVA 3RJMB 2QA4S 3IBWA 1GMUA 3A8IA 2ZOMA 1XNQJ 3ZZYA 1EX8A 1QVFR 4NI2B 1RTIA 4KH0B 1EAYC 2KZMA 1FERA 2RQ4A 4NA2A 3M6XA 4KFBB 3D6MB 3FJ2A 3GJSB 4CT9A 1E6YB 1YQHA 3I32A 4CO0A 2W2PP 2MZSA 3M9OB 2FTRA 2V0NA 5ITHA 4R8UA 3I0RB 2CVEA 2FVQA 4QR0A 2MQOA 3UCZP 2BYCA 4DWIA 2KYZA 2FVRA 2CVIA 5EGYA 2PD1A 4NYOA 3D66A 2RNEA 1JLFB 2HVEA 2RS2A 2IRYA 4M5HA 3ZXWA 2XYGB 2FHMA 4PPZA 4DR6J 2O3DA 3JTPA 1NB7A 3L7UA 4WFBQ 5I3UB 4K0KF 2HRTA 3I5AA 2GAHC 1TUWA 3JAMU 4JI8F 3GG0A 2Q3PA 3WDOA 3DFEA 4J9SA 2RMLA 4F4KA 2HG4A 3MMBA 2XGQA 3RAMA 2CPHA 3TO8A 1NDPA 1S6PA 4A8QA 5GAEU 3OFFA 3IAM9 4N8OA 1RT1A 4ECTA 4GO5X 3G2XA 4DUYJ 4F0HA 3V6KA 4WIQA 2JFDA 4DS4A 1U26A 1HWUA 2LDYA 1VI7A 2MJUA 2V4RA 2PE8A 1UMJA 2D3ZA 3HKWA 4XDDA 5KTQA 3OXLA 3L95X 2M52A 1U1NA 2ZH4A 1HIYA 1JX4A 1P6TA 4KGZB 4HI2A 2ZBRA 4OYXA 2LU1A 5KFEA 1NJIT 3QMQA 2MGZB 4F26A 5EDWA 3C19A 2P8IA 3DYAA 5CYQA 4KE5A 3T1AA 3BZQA 1JLCA 2NPIA 3DMJB 2E9ZA 3KKFA 4LBIA 1HHQA 3MMCA 1X9MA 4MIAA 4P7TA 4URQU 5F8IA 4DEZA 2VONA 3FQKA 3KJFB 3K59A 5C5JA 5J2NB 1FESA 2LKZA 5HMXA 2A2CA 4GRSA 4MKAA 3OTCA 5HSPA 1W2BR 3CO9A 4ZA1A 1PJ7A 2QX0A 2MLXA 1HQEA 1X5SA 3Q8SB 1U6ZA 1HR0F 5HROB 4LF2A 4K4UA 2V68A 2VODA 4NYZA 2IBOA 3PO5A 1BC6A 3HFVA 2YNFA 2VBZA 2OHDA 1IWGA 2NUHA 1IBCB 2CPYA 3WC2A 5L9NA 4NLDA 2E29A 2VA2A 2OGUA 1KHVA 1CC8A 1RABB 4MYUA 2LCWA 1W7WA 2HNYB 1RWKB 3B54A 4Z7CA 2KL8A 2XLKA 4M5MA 4DX6A 4ELVA 5CA5A 3PJXA 2VIHA 2CQ3A 3C6UA 2BANB 1DTQB 4FDFA 4NXMF 2VB6A 3V5RA 2ACYA 3VGUA 5H9FJ 4GKJJ 4MMOA 3EPGA 4ZS6A 4ID5B 2YXLA 1QUPA 2IJFA 4Q7AA 2WBRA 1RWPB 2LFVA 1IWAA 3MECB 4NEYA 2GFFA 3NL0A 3QBCA 3W9HA 3ONQA 2V63A 1RP5A 1UFLA 3RYLA 4JYAF 4YB5A 4RPFA 3BEGB 1J5OA 1JXVA 4ZCMA 1NH7A 2GIQA 2Z4PA 2C22A 2IVYA 5M2UA 5DO2A 4QIGA 2UUCJ 3HT3A 2J6SA 1R8BA 1X9SA 1S9FA 3M2UB 1P1LA 3ISZA 1S0MA 2HS3A 1S72S 2RUGA 1MU2A 3CIZA 5J2MA 3PRVA 3EPIA 2GHPA 3MOJB 4P74A 3JSRA 2B4PA 1R43A 1ZYQA 4UY8T 1U0HA 3ZZTA 1F60B 3PIOQ 3GV8B 2IPOB 5DG8A 4U67Q 4WF9Q 4RUCA 3RBDA 5KFJA 1TKXB 4B9TA 3V2UC 2KJWA 4CLKA 2GW8A 1HI8A 3B82A 3G8SA 1JLAB 5GAHU 3MEGB 4QPXA 5KFAA 1X9WA 4I1TA 1UJ4A 2C2KB 1LWEB 3HM9A 3BKUA 1K1SA 2LU2A 3M8PB 3QJLA 4F7VA 1XJWB 4RUAA 5J1PA 4TLRA 4LSLB 1YRUA 3CCMS 3NEKA 2AJFE 2UXBF 3HVAA 3KG0A 5B0AA 5CYJA 2BKOA 3ZFVA 5D0RA 1FXRA 3MAAB 4C98A 4JI6J 2Q6BA 1RKIA 2G9OA 2F4VJ 1FD2A 2HQCA 3T1HJ 2IRXA 3PKMA 5EX3A 3PY8A 4HHUA 4WYWA 3CNQP 3MDFA 1YBUA 3MD1A 1RU2A 4R0EA 2EWHA 1FRHA 4NCGB 1UZHA 1YJRA 5KFIA 2YY3A 2OSRA 2DRBA 3VAFA 2ZBQA 1L5UA 1NHUA 4PG7A 4X4UA 2XZDB 2HNZA 2BJ8A 1XK8A 1VQSA 5KFRA 1RT7B 3K0JA 5KG0A 3M2VA 3IBFB 4A47A 3NOCA 1WORA 5A76A 3DOKB 1LFWA 4DS5A 4X4VA 3SQOP 3OSNA 1UP1A 1WSVA 3PFEA 5J1EA 4ECQA 2GQ2A 1GX5A 1GFWB 5D4OA 2MB0B 5DZ6A 4UOGA 2K06A 1I94J 2JL9A 1SI9A 2OPPA 3FUYA 4OYAA 3CJ3A 1YRXA 3MURP 2CDRB 4OHVA 3SYZA 2H65B 2XI2A 1HPZA 2PEBA 1UEVA 3QLHA 2CPZA 4X4RA 1FD8A 4IRKA 4M5JA 5IC6B 2NXEA 3QGGA 1HNVA 3D1QA 2G0IA 4L3NA 4OYOA 2C2OB 1N34F 1ZM4A 2M9KA 2HS0A 4F04B 4WE1A 2R7UA 3CC2S 3N79A 1ZTWA 3Q2SC 3NLCA 4AQYF 2RDJA 3LANA 1HNIA 2NXUA 4PWDB 1S79A 1QUVA 4YOEA 1J2VA 4L3KA 2IDEA 4HYKA 3D1OA 4NZ0A 4FBTA 2UUBF 1F2GA 2KT5A 1ZA2B 4LF6J 1P27B 3ILLA 4CLZA 5ETSA 2LEAA 2GNKA 2GVZB 2QA1A 1LXNA 4UY85 3BDPA 3GYXB 2CKWA 2BOPA 4KGKA 1N32F 1FKAF 2OUGA 4NLTA 2V69A 4S0MA 3QAEA 1JWWA 4DL2A 5KT3A 3IGNA 3ZZPA 3J7YU 2YH1A 2DNNA 2WW8A 3D4JA 3R9LA 2MQ8A 1VK3A 2VZ9A 3G8QA 1Q7LB 1EP4A 1SCJB 2YPYA 3KMQA 3KLIB 3KHGA 1TQLA 4OIXA 2GGPB 2KM8C 1YTYA 5FLXU 1G2EA 1L3UA 4DUZF 1PYOB 1WUUA 4EU0A 2YWWA 4FZVA 3SSRA 3BN4A 2J5AA 2VG5A 2VKRA 3GCWP 1S0VA 2MY7A 2MZQA 1IR2A 4I2QA 2Y0BB 4KHPJ 5A8KA 2C3PA 2A3JA 4J9RA 4LVOP 2DNLA 3MM6B 5KG2A 2DNKA 4EFAC 4ZK7M 1D3WA 6FD1A 2ZHAA 4KIAA 3FMWA 1XERA 1RA7A 5ETVA 4JI3F 2RUSA 2FYXA 3KWMA 4B17A 2MZ1A 4ZPTR 4NWBA 1JLBB 3H98A 2A1BA 4B3SF 4L76A 3T1YJ 1C0UA 1NSAA 2NYHA 1ZS6A 3WX8A 1T3NA 2CA9A 3PO4A 1WF1A 3OR2B 4HTJA 1RT6B 1PYSB 2DYAA 2QMXA 2VQFF 1TKZA 2EKNA 1VK8A 4RNMA 1VQOS 3PX4A 4ZPCA 4ECUA 4ZPBA 2J6TA 2KI2A 2DEJA 3W9JA 2E1CA 4C11B 3UI3A 5LMUJ 4OL8A 4NLSA 3LP2A 5KFUA 5IT4A 2AHOB 1YJ7A 1TKDA 1H72C 2G2ZA 3JYTA 4J90A 3AXMA 1FHTA 1TK5A 4B9NA 3GLJA 4KH1B 5C24B 1OSDA 4FP9A 4P72A 3OBIA 2MXYA 3SZ2A 4C3KA 1T9VA 2LQBA 4DR3F 4DL6A 3EM1A 2CFXA 4FF2A 1WHXA 3K17A 2UUWA 3H90A 3L09A 3IG1B 5AE3A 5J2PB 2HIYA 4QYRA 1R6VA 4DSLA 1T9YA 3F56A 2XGPA 1FA0A 2W4CA 4KYZA 1PG5B 2AMCB 2KHDA 1HBNA 3BR9A 4X4SA 2ATCB 4DDFA 3PEJA 2HMIA 3IGVA 4LREA 3A3OB 1Y11A 2BE2A 1HBMB 2VG7B 1IKVB 4OV6A 1HD1A 3OW2R 2D41A 4BC7A 2AZ1A 1M1KT 1RU1A 4AXIA 4F02A 3H4BA 2WOMB 4IFVB 3BQ1A 1UKUA 1M5PC 2WW4A 4GKKJ 2FJWA 1RTHA 2N3LA 2VU5A 4EYHB 5B0BA 4LBHA 2E5HA 1RB0A 3US5A 1TV6A 4OZ1A 2RKIA 2PC6A 3HCXA 1NPKA 3GIMA 5HMZA 4HH1A 3K5OA 1EJ7L 3QSYB 4QWBA 1ZZNA 1X5OA 1LWFB 4JP8A 5F8GA 3BS9A 3W62A 4C8ZA 2DNRA 1D9AA 2ZHOA 1PIEA 4DSEA 3BO4A 4HHJA 2CPJA 2HHUA 3G6ES 1KP6A 4LF8J 3G6VA 4RW6B 3UO0A 2N4DA 2RILA 3N0VA 1S9GA 1PO6A 5CYMB 1K1QA 4NOHA 5M2RA 2ZE2A 5EWEA 4M1KA 1REVB 3D0HE 1Y9OA 1VFJA 4UOHA 5E3CA 5LXRA 3ZTRA 4PXEA 1GXUA 1JB0C 2EKYA 3KLFA 3JS9A 4K4VA 2BACA 3BDEA 3ET6A 2XY5A 3EGWB 4HH0A 4ECXA 3JTOA 4J9OA 2UXCJ 3ISNC 4IH6A 4HACB 2V8DA 3BQ0A 4HHHA 1TVRA 3BGRB 2D74B 2L41A 4ZJLA 1BWVA 1OQ3A 4RLEA 1GTEA 1ZAXA 4TY8B 2I1RA 3CIMA 2R7QA 1HARA 1VYAA 2E44A 1NZ8A 3QO9A 5KFOA 3EVMA 1FKOB 1K73T 1N6QA 4C8YA 3O3LA 3K8VA 4ZP8A 4DFJA 3GIIA 2I9SA 2FDNA 1C2PA 3MR7A 3FBFA 5GMDA 4R25A 1RGVA 1QVGR 4NZ6A 2AU0A 1VBKA 1U25A 1WEXA 2V4JB 1G6BA 4UOFA 3TW0A 4DL0C 4DV5F 3MEKA 3F0NA 4OI2A 4DQQA 1X5TA 4NCBA 1EETB 5DM6Q 2R7OA 3TEGA 4I56A 4DU8A 3AA8A 4UT4A 2RU3A 2HS4A 1YRTA 1TL5A 4OI3A 2V2VA 2VFSA 1S4EA 3JTNA 5LOQA 2BUNA 3CD0A 3AJ2A 3BV8A 5LJ3Y 4DCJB 2CRLA 5E41A 2JEFA 4BCAA 3CCQS 4A8FA 3DLKA 5KFCA 2H4YB 3HULA 2MSSA 5GADU 5ETLA 3V81B 1QSSA 1KQGB 1RWVB 4DPOA 2C3YA 2CQ4A 2ZWPA 1B3TA 2ATLA 3QRQA 3R7SB 3THVA 1B7FA 2R2SA 1DY3A 4Z7YA 2YWFA 2UU9F 3FK4A 2IYGA 2HBZB 5ETOA 2JVRA 1SL1A 2SXLA 3A3PB 3G86A 3HVRA 1H74A 3SI8A 3HJFA 3PJWA 2DNPA 1JJ4A 3AB2B 5F8HA 3HHLB 2JEIA 4G65A 3UD3P 3L7OA 3AJ1A 5DM7Q 4XPEA 5BR8F 3DLEA 5JJBA 4JI1F 1NHVA 2JC0A 1C0TA 4ZP9A 2DHSA 2YVSA 1WF0A 1FK9A 4JI5J 1S1UA 1RXOB 3CXCR 2D3O1 4IUFA 1CC7A 4M5NA 2RVJA 2G13A 3DOMB 4ZITA 2LXFA 1PAEX 2H5JB 5AT1B 3T9ZA 4LFBJ 1Q5VA 5E3QA 2XS7A 4M95A 2Y3YA 2H54B 3NRBA 4B3OB 3EZOA 3KK2B 4CCHA 4NXNF 1E6VB 1NHKL 1A6LA 1SJFA 2HHWA 1SH3A 3NXZA 2JNJA 3HHLD 3NAHA 4RR5A 3DHXA 3N01A 2QJ3A 1Y5IB 4NLYA 4OYPA 3H5UA 2GIRA 3LWMA 3W9IA 1XBWA 2HGNA 5K14B 2ZDOA 4CRJA 3RTVA 2YWKA 3F44A 1XWLA 5ETNA 2UUAF 5HAOA 5B0CA 3L7PA 2C2DA 1PC5A 3DRSA 4B3RJ 5T41A 1SV5B 2RSQA 2QTWA 4Z37A 2GMJA 1HWKA 1RAAB 3CSKA 3FCVA 1S1XA 5IOLA 3HT0A 1LEOA 5KG6A 4OHWA 4HTIA 2ERRA 3J80Y 4K4XA 2VASA 2HNDB 3TVYA 1BQNB 1UFWA 5H9EK 2YWEA 2VPWB 3NS6A 2BOAA 3SQGB 5I42A 2BDPA 3WX4A 3RZAA 3TI0A 4W98A 3IN5A 2Q1LA 3M1VB 1Z4UA 4NI2A 4ZVUB 5F3ZA 2VPYB 5IXUA 2J9DA 4DI6A 1U2FA 1PGZA 1M1HA 4QIWD 4KFBA 2RRNA 2VL1A 1YBTA 4CLYA 1FFSB 1E6YA 2HURA 2ALYB 1Z1ZA 3A1YG 1X31C 5FJ4A 1F5CA 2VFUA 2W4PA 3W5ZA 2P9GA 2IMOA 2X3DA 4KSEB 3DN9A 4EBEA 3LPYA 2NXNA 2HPUA 3ICLA 3EICA 3MZIA 3I0RA 1J5EF 3SEOA 2J0SD 2X1GA 5CCMA 1G7CB 3VGSA 2MKSA 2V50A 3SBMA 4USHA 3KHLA 2DR5A 3I9ZA 3VHQA 2I5JB 2E66A 2DNMA 1JMTA 4GMKA 1JLFA 4RU2A 3Q2TC 2CG4A 4DX7A 2N7YA 2GHVC 4OX9J 1IN0A 3NWRA 4JV5F 3MPWA 1T3OA 2V8PA 3IRXB 2MQQA 5I3UA 2FJXA 2V9KA 3TANA 2HZCA 1RADB 2NR0A 3BYPA 4ELTA 2WHOA 5IT9Y 5AXMA 5AJ3F 3W65A 3OLAA 1NJXA 3K89A 2IRUA 2DR8A 3MMAB 3P49B 5KFBA 2KO1A 1SH2A 3RBXA 5DDRC 1Q5YA 1PJ6A 3QAUA 1VMBA 4LRFA 2EK6A
chains in the Genus database with same CATH topology
2UU9J 4YY3J 5LMUJ 1N34J 4JI0J 4LF7J 4DR6J 4DV0J 3D3CJ 4NXMJ 1HNXJ 3D3BJ 1IBLJ 3J7AN 1XMOJ 4LF4J 4GKJJ 5BR8J 1FJGJ 4GKKJ 4B3RJ 1HNWJ 2KVQE 4PWWA 4JI1J 3JAMU 4KY3A 4JI8J 2UXCJ 3R2CJ 5IWAJ 3W1YC 5LM7E 4JI2J 4KHPJ 4DV3J 4X65J 2VQEJ 4JI5J 4B3TJ 2UUBJ 1XNQJ 4LF9J 4DR5J 1N33J 4NEYA 4X66J 2HHHJ 4K0KJ 4LFAJ 2UUAJ 3IMQJ 5IT9U 4LF6J 4DV1J 4AQYJ 1J5EJ 4OX9J 3J80U 4V1Ak 4LFBJ 4DV4J 4DR4J 1XMQJ 4DR7J 4DUYJ 4DR2J 4JI3J 4DV7J 2UXBJ 2MTLA 2UXDJ 3J81U 1IBMJ 4X62J 4DV2J 4LFCJ 4NXNJ 4B3SJ 1I94J 2UUCJ 1N36J 4DR3J 1XNRJ 1HNZJ 2ZM6J 3T1YJ 4RJVA 4B3MJ 4YHHJ 4JI6J 4LF5J 4LF8J 4JV5J 4KYZA 2F4VJ 4JYAJ 2MQ8A 2VQFJ 3T1HJ 2E5LJ 1HR0J 4HHUA 1IBKJ 1N32J 3R2DJ 5AJ3J 3OTOJ 4DV5J 4X64J 2MEWA 4NEZA 5LMNJ 2KL8A 4DV6J 4DUZJ 4DR1J 5FLXU 5A2QU 4JI7J 4JI4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 J;  4YY3 J;  5LMU J;  1N34 J;  4JI0 J;  4LF7 J;  4DR6 J;  4DV0 J;  3D3C J;  4NXM J;  1HNX J;  3D3B J;  1IBL J;  3J7A N;  1XMO J;  4LF4 J;  4GKJ J;  5BR8 J;  1FJG J;  4GKK J;  4B3R J;  1HNW J;  2KVQ E;  4PWW A;  4JI1 J;  3JAM U;  4KY3 A;  4JI8 J;  2UXC J;  3R2C J;  5IWA J;  3W1Y C;  5LM7 E;  4JI2 J;  4KHP J;  4DV3 J;  4X65 J;  2VQE J;  4JI5 J;  4B3T J;  2UUB J;  1XNQ J;  4LF9 J;  4DR5 J;  1N33 J;  4NEY A;  4X66 J;  2HHH J;  4K0K J;  4LFA J;  2UUA J;  3IMQ J;  5IT9 U;  4LF6 J;  4DV1 J;  4AQY J;  1J5E J;  4OX9 J;  3J80 U;  4V1A k;  4LFB J;  4DV4 J;  4DR4 J;  1XMQ J;  4DR7 J;  4DUY J;  4DR2 J;  4JI3 J;  4DV7 J;  2UXB J;  2MTL A;  2UXD J;  3J81 U;  1IBM J;  4X62 J;  4DV2 J;  4LFC J;  4NXN J;  4B3S J;  1I94 J;  2UUC J;  1N36 J;  4DR3 J;  1XNR J;  1HNZ J;  2ZM6 J;  3T1Y J;  4RJV A;  4B3M J;  4YHH J;  4JI6 J;  4LF5 J;  4LF8 J;  4JV5 J;  4KYZ A;  2F4V J;  4JYA J;  2MQ8 A;  2VQF J;  3T1H J;  2E5L J;  1HR0 J;  4HHU A;  1IBK J;  1N32 J;  3R2D J;  5AJ3 J;  3OTO J;  4DV5 J;  4X64 J;  2MEW A;  4NEZ A;  5LMN J;  2KL8 A;  4DV6 J;  4DUZ J;  4DR1 J;  5FLX U;  5A2Q U;  4JI7 J;  4JI4 J; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  4Q45 A;  5F8J A;  4TVA B;  2U2F A;  4IKA A;  3TA0 A;  2KJV A;  2KH9 A;  4IG0 B;  4CM0 A;  4ZVO B;  3VGV A;  2XUL A;  4W92 B;  2AKW B;  1TK0 A;  4QIF A;  4QCL A;  4NRT A;  1X4C A;  2R2U A;  5J2Q B;  2BAB A;  3NCQ A;  4O3P A;  3TEH B;  2MGZ A;  3OT9 A;  2AEJ A;  4CNY A;  4LT6 A;  5I3P A;  5GAG I;  3DMJ A;  2PA3 A;  2UXD J;  4H4K C;  1UVM A;  4O23 A;  3RR8 A;  1JQG A;  4NL5 A;  3NMR A;  1MSW D;  3TZZ A;  3MHY A;  4C3L A;  4B9M A;  5KG3 A;  1SIW B;  3I31 A;  4DR1 F;  4LF5 J;  1AFI A;  5J2N A;  5KOX A;  3R27 A;  1MML A;  2BBE A;  1FVS A;  4HLB A;  2XLJ A;  2GV1 A;  5CH7 B;  2I0X A;  2ACM A;  2Z58 B;  2DCU B;  5A2Q Y;  3CPW R;  1QY7 A;  2XYP B;  2HVZ A;  2GJ2 A;  5HRO A;  5HMY A;  2RIJ A;  4NA1 A;  2B4U A;  3OJS A;  3N6M A;  1DQ8 A;  2MPU A;  3LP1 B;  5L39 A;  1YSJ A;  1YK9 A;  1VIS A;  4DN9 A;  1VLO A;  3MUV P;  4DL7 A;  5CD4 A;  2K3K A;  3AXK A;  4XO0 A;  3V6D B;  2V2Q A;  3HZE A;  3R1H A;  4LF9 J;  2HNY A;  1OY9 A;  1JKH B;  2DIV A;  3QRP A;  3KTQ A;  3GYG A;  2PN6 A;  1FTR A;  2BAN A;  4NLR A;  1DTQ A;  2CWK A;  2C3U A;  1KOH A;  2N82 B;  1D9F A;  3M2R B;  2E1P A;  1NKC A;  3MCS A;  2XMJ A;  4ID5 A;  2AYB A;  4N8N A;  3QPI A;  2FLO A;  3PW2 A;  1YZ7 A;  3MEC A;  5CD4 H;  4DU7 A;  1I5O B;  2ZH7 A;  1YIT S;  4H4K A;  1ZH5 A;  2OJ3 A;  4RW8 B;  1OMS A;  3TA1 A;  2BZ2 A;  3MWB A;  4DLE A;  4ZVR B;  3VTI A;  2NZ4 A;  2QYG A;  1RT4 B;  1NK7 A;  5LL6 d;  3H4D A;  1HL6 A;  5D77 A;  1U47 A;  2MKY A;  4K4Y A;  3M2U A;  2CNN B;  2J76 E;  1H2T Z;  3U27 A;  2AGO A;  2UVR A;  5GAG U;  5LM7 E;  2AV5 A;  4Z2X A;  2CQG A;  4I6A A;  4XDC A;  1HLW A;  6AT1 B;  4X62 F;  2ZKT A;  2DT9 A;  3AT1 B;  4KR0 B;  3PIP Q;  3LH2 S;  1SBR A;  3OTD A;  2DGU A;  4DR7 J;  1YJN S;  4DF4 A;  4ZCI A;  2ZOF A;  2AX0 A;  1HI1 A;  1TKX A;  2ZFH A;  2IHR 1;  1JLA A;  1FNM A;  1NKB A;  1VQ9 S;  3PM9 A;  4GC6 A;  3MEG A;  5KFH A;  4RW4 B;  1H0H B;  4C8L A;  4PXC A;  1LWE A;  3TOQ A;  3MFI A;  3M8P A;  2CPI A;  2GCF A;  4J91 A;  2KG1 A;  2E5L F;  4PZV A;  2WB4 A;  1XMO F;  1IBK F;  1APS A;  4LSL A;  1N48 A;  1FRX A;  2DJW A;  4JI4 F;  1ITP A;  4X65 F;  5C2C A;  2B9W A;  4BWJ A;  1S1V B;  3KLH B;  5F9N A;  4X66 F;  3MAA A;  3GWC A;  3EWG A;  2WON B;  2HYI B;  4DPW A;  4WU2 A;  1QD1 A;  3PX0 A;  4PR6 A;  4Y2C A;  2WAQ D;  2ZC4 A;  3UNY A;  5C25 B;  4LFC F;  3UFC X;  4NCG A;  3MED B;  4Y00 A;  1RWU A;  4MKV A;  2R7T A;  3BPS P;  3WQP A;  4KJI A;  4I7F B;  2D9P A;  1HW9 A;  1RT7 A;  2Z57 B;  4MAK A;  3SCK E;  1NCL A;  4O4R A;  3OHA A;  3DOK A;  4ZHR B;  5K5M A;  2K7J A;  2CPX A;  1VQ6 S;  1TL4 A;  2XO6 A;  2VUG A;  1RWO B;  3OXG A;  1T9U A;  2Z56 B;  1BWE A;  3QWP A;  3C46 A;  2XCA A;  1S9E B;  4CO4 A;  1SKW A;  2QSF A;  2DHH A;  3VAK A;  4ITS A;  2M0G B;  5EN1 A;  4OYM A;  3HXM A;  1M0S A;  2E5G A;  4J5O A;  4RL1 A;  3P5T L;  3S6E A;  3SCL E;  3CD5 A;  3EDR B;  5D78 A;  2FLL A;  2HGL A;  3FBE A;  4K0K J;  2L08 A;  1HNZ F;  2ZM6 F;  3FFI B;  3DRP B;  8AT1 B;  1S48 A;  2N3O A;  1F9F A;  1XMQ J;  2FD2 A;  4NE9 C;  1UVI A;  1UA1 A;  4B9V A;  2OTJ S;  2EG1 A;  1VQ5 S;  3GON A;  4PWD A;  2RH3 A;  5AE2 A;  2F65 A;  2DXF A;  2UVU A;  1DFD A;  1G1X A;  2MQL A;  4AYB D;  1NK4 A;  4WKR A;  4F25 A;  1F3V A;  4ANE A;  3HD2 A;  1WC0 A;  2ZH8 A;  3BGU A;  3NNC A;  4DL4 A;  3RUB L;  2COL A;  2GVZ A;  1F2H A;  5KFN A;  4PG6 A;  3IAS 9;  2ZVI A;  4F4W A;  1FWP A;  3K58 A;  3NBP B;  2JEG A;  1Y00 A;  4DMZ A;  5MLC V;  2CQ0 A;  4QIV A;  1U1L A;  3GFX A;  4DR6 F;  3KK1 B;  4ILL A;  1Q8K A;  2YPZ A;  1MNE A;  1Q1K A;  2GVD B;  1CPZ A;  1FO1 A;  3AD7 C;  4OJG A;  4O3S A;  3BKT A;  4XK8 C;  1Z2L A;  3A3N B;  2CNL B;  2R7W A;  3KLI A;  1FJ7 A;  2GGP A;  2CJK A;  4TLQ A;  2K2P A;  1ULR A;  1U1Q A;  3I6P A;  2M70 A;  3J80 U;  4F4Y A;  1D8Y A;  2CDQ A;  4UZC A;  3EXC X;  2YX4 A;  4RW9 B;  1KON A;  4C8O A;  5IQ6 A;  1U1O A;  3O2I A;  2WK4 A;  4YQW A;  3MM6 A;  2QLX A;  4F36 A;  3OXF A;  3ENQ A;  7FDR A;  1M5S A;  4QOT A;  4YFU A;  1HR0 J;  3IS9 B;  4PWU A;  1NEE A;  3E8O A;  2R2R A;  1NM2 A;  2IA6 A;  3H20 A;  1JLB A;  1ZZF A;  4USW A;  2HQD A;  4QW8 A;  2IY5 B;  2ZBI A;  3OR2 A;  4QYZ K;  1NAQ A;  3D68 A;  1RT6 A;  3MUM P;  3LOU A;  3BH7 B;  4E2F B;  1JJ2 R;  4DPU A;  5HO4 A;  4G1P A;  3IXQ A;  4B08 A;  3BRE A;  3TX0 A;  4E98 A;  2VBX A;  2DNO A;  4C11 A;  2QEX S;  2QMU B;  5IZH A;  2RQC A;  1YJT A;  1KRP A;  4LVN P;  1QTN B;  2C1E B;  5B0F A;  3R6G B;  4LIR A;  1S6O A;  5C24 A;  1FKP B;  3QT6 A;  1K9M T;  4JYA J;  4ZDN A;  3VAI A;  4OZL A;  1R8P A;  1I6J A;  3IG1 A;  5J2P A;  4CO2 A;  1CJT B;  4QQB A;  3H2L A;  5SZT A;  2NS1 B;  4GKJ F;  4KBI A;  2CAJ A;  4HKQ A;  2W4D A;  4IRD A;  3WHI A;  3MAQ A;  3DLB A;  2KYX A;  4L73 A;  4KTQ A;  4WXO A;  1RAJ A;  2G4B A;  2HVD A;  1KDN A;  1R0C B;  2O66 A;  2VG7 A;  1IKV A;  1S99 A;  1U8W A;  2CQD A;  5F8N A;  4M5L A;  3SDE B;  4ETZ A;  3CDA A;  1H38 A;  3TAQ A;  3EZ5 A;  5DDP C;  4OI1 A;  4LRB A;  2WOM A;  4IFV A;  3PG9 A;  1L3K A;  2EC2 A;  4UQT A;  2YQ1 A;  2W8L A;  2UUC F;  2OTL S;  3QT5 A;  3ENA A;  3OTO F;  3PYF A;  4AL6 A;  1UA0 A;  2QO3 A;  4CYU B;  3H40 A;  4P2X A;  2ZH3 A;  3M9M B;  3IWL A;  3N28 A;  1WAC A;  1NO8 A;  3PYG A;  2PMZ D;  2CPE A;  2MEW A;  1LWF A;  2WCX A;  1KR4 A;  3OSP A;  4ED5 A;  1F5B A;  2V8V A;  5A2Q U;  3CW2 C;  1HWI A;  1S97 A;  3EE3 A;  3KFW X;  2RHS B;  1IKY B;  1RA6 A;  2YKP A;  1X4F A;  3GQC A;  1HWL A;  4RW6 A;  2DY9 A;  2HBR B;  4KKO B;  1YVF A;  2PT0 A;  2FVS A;  4UUX A;  5BYR A;  3TQE A;  2BKN A;  3TAP A;  4DV3 J;  5CYM A;  3D7S B;  4IFY B;  4PG5 A;  1OIA A;  1REV A;  4GVL A;  2CPF A;  5KT7 A;  3FSI A;  2EVZ A;  1TP7 A;  4CWB A;  3RU0 A;  4F3Q A;  5KFP A;  4HT5 A;  2CNO B;  2R3V A;  5DQG A;  1HWJ A;  1UWB B;  2J0W A;  1SVD A;  3HO1 A;  1UVK A;  4ED6 A;  1WG4 A;  3TVZ A;  3BSO A;  2JH3 A;  4HAC A;  2G2Y A;  1FI4 A;  4MYT A;  3BGR A;  2RS8 A;  3T1H F;  1RZM A;  2HK3 A;  4TY8 A;  3R2D J;  4K2J A;  4WTO B;  1FKO A;  2HFO A;  3SCJ E;  4F50 A;  2HIQ A;  4MH8 A;  4DHV A;  4U7C A;  4GVB B;  5HLF B;  4NLP A;  3EVW A;  4B9L A;  2B51 A;  1XR6 A;  1XQI A;  3KDO A;  1IM4 A;  1VHI A;  3HHL C;  4P10 A;  1MLA A;  3L3C A;  3LGN A;  2BRK A;  1RAG B;  2MQM A;  2V4J A;  2ZH1 A;  1TZ0 A;  3RB6 A;  4ZP6 A;  4WFX A;  1XIQ A;  4AQY J;  2DPJ A;  2L9D A;  3BBC A;  1EET A;  1PKU A;  2PI4 A;  5IQQ A;  1TU0 B;  2YKM B;  1P8G A;  4A8O A;  4RKU C;  4J9U E;  1S0O A;  2AW0 A;  3DOL B;  2WRM A;  4DX5 A;  1EB0 A;  3S8S A;  1OY8 A;  4OYB A;  1YGY A;  2RHQ B;  2VIC A;  3MM9 B;  2AYE A;  3D67 A;  2X1B A;  3Q8V A;  1N32 J;  1RQ0 A;  5KFF A;  2MY8 A;  2OPS B;  3AH6 A;  3OTB A;  4RU9 A;  3V81 A;  1DRZ A;  1UAW A;  1RAE B;  2Q43 A;  4I69 A;  3T19 A;  4RUB A;  2FB0 A;  1U49 A;  4ZVF A;  1RUS A;  3BBB A;  1A7G E;  4OLO A;  3OVB A;  3MD3 A;  1B7Y B;  1ICE B;  1NLK L;  1GXT A;  5IWA J;  1UEU A;  3D6F B;  1UTA A;  5T14 A;  4P71 A;  5L8R C;  1C4C A;  1U6F A;  5A6P A;  2NRE A;  2F8M A;  2QN6 B;  5KG5 A;  1LNQ A;  4JB8 B;  4WP3 A;  3HHL A;  3KNA A;  5B0G A;  1HBU B;  3ETM A;  5KAK A;  4C4W A;  1F9H A;  3LA0 A;  4AND A;  1QAX A;  2CJ9 A;  2XZW A;  1RLC L;  4KV8 B;  3C15 B;  5HP1 B;  1LWX A;  2H5E A;  3DGP B;  3J81 Y;  3DOM A;  3EYZ A;  2BR0 A;  3QGP A;  5DJB A;  1V5V A;  2R42 A;  4CLP A;  3KOA A;  3FC9 A;  3VQT A;  5LMN J;  4B3O A;  1WHW A;  3KK2 A;  1SKS A;  3TZY A;  1E6V A;  2AJ2 A;  1NJZ A;  4IDK B;  4LF4 J;  1T7P A;  2HSE B;  2FLP A;  3VF0 B;  3KXD A;  1VBY A;  3CDE A;  4KHP F;  1D9D A;  3CJ2 A;  1Y10 A;  2W01 A;  2RB7 A;  3LP0 B;  4CQ1 A;  2LQJ A;  1R6Y A;  5K14 A;  2DXE A;  3PW0 A;  3IFE A;  1UWA A;  3VAJ A;  1BQM B;  2OKQ A;  2M2B A;  3BGF A;  5D3G B;  2HHS A;  2P5V A;  1SV5 A;  3QNW B;  4DR3 J;  1V9O A;  2XC9 A;  3KDN A;  4A46 A;  4CH0 S;  1QAJ A;  2DNZ A;  1WOS A;  3FKB A;  1BY9 A;  3FGV A;  2ZHB A;  5C7P A;  2WB1 D;  3GCX P;  4PUO B;  4FVC A;  2GS8 A;  3PHE A;  3UDC A;  1M5V C;  2RF2 B;  4WWS A;  2HND A;  5HK4 A;  1BQN A;  2MST A;  1V6H A;  2C2N A;  3V4M A;  3SQG A;  2YBV A;  4IO1 A;  4IH5 A;  4Q2L A;  4WKY A;  2B43 A;  5LMU F;  4ZVP B;  2BMB A;  1XC9 A;  1CSJ A;  4LFA F;  2ZUG A;  3M1V A;  3HHN B;  3OFH A;  4ALZ A;  4ECZ A;  3FEX B;  2FGC A;  2Y1L B;  2DY1 A;  4YDX A;  1Y3K A;  1TFW A;  4DZD A;  5CZX A;  3JSB A;  1X8D A;  4J7C A;  2EFO A;  3PW7 A;  4WII A;  1FVQ A;  3QJJ A;  2GAG C;  3ETO A;  2ASJ A;  3H7H B;  2MDA A;  3C6T B;  4PPD A;  4FS1 A;  3R5G A;  1D8Z A;  1IBM J;  5THW A;  4MK7 A;  5D0H A;  2HQG A;  4BC9 A;  3NOG A;  1DTT B;  2KHC A;  1WOP A;  2Q66 A;  1Q86 T;  2R7X A;  2DXD A;  2I5J A;  1F3F A;  2XYH B;  3CJ5 A;  2V2Z A;  3W2V B;  1CQN A;  1SIZ A;  1T03 B;  3UN2 A;  4Q2M A;  1VRT B;  3SMZ A;  2I2Y A;  3ITH B;  1NSK L;  1FJG F;  1HNW F;  2R8K A;  3IRX A;  3KJV B;  1LW2 B;  2QYC A;  3ENW A;  4H4O B;  3HI9 A;  1ZAW A;  3D0I E;  2W24 A;  3OUY B;  4FKX A;  2NZC A;  5AXK A;  4G3I A;  2VJU A;  2DGT A;  3PTW A;  4Q43 A;  4OZ0 A;  4DV4 F;  1KQK A;  5A0Y B;  5KT6 A;  3MMA A;  3M6W A;  5HAT A;  3IA0 A;  2D7S A;  1AZS B;  3Q83 A;  3BGL A;  1RTD B;  1EIY B;  4WTY A;  2LXU A;  1TL3 B;  2HEK A;  2Q6C A;  4IG0 A;  2IM3 A;  2BM0 A;  2IBK A;  3NCR A;  4AL5 A;  4OZ2 A;  1RT3 B;  3ZZ0 A;  2G2O A;  1R3N A;  1MW7 A;  3PW4 A;  1VC0 A;  5J2Q A;  3WZ0 A;  2FZC B;  2FQQ B;  4M5I A;  3FEY B;  4MIW A;  1EAR A;  2Y1J A;  3M32 B;  2ZC3 A;  2JHE A;  3EUN A;  1LKZ A;  3O1L A;  4NEZ A;  4ATN A;  5F9L A;  4NLV A;  2UZA A;  2EC0 A;  5KFG A;  3CCV S;  1YBA A;  2OML A;  1D0E A;  1H7W A;  3DDI A;  1CS4 B;  2RD5 C;  3ILI A;  1V3S A;  2M7S A;  2HWI A;  2MKC A;  3UNG C;  4RWX A;  3VQS A;  4HT7 A;  4YEA A;  2UXC F;  3P96 A;  1C1B B;  2XM3 A;  3W64 A;  3GZ7 A;  4LR8 A;  3GV7 B;  3VZI A;  4DV2 F;  1SC1 B;  1RSC A;  5F3T A;  4EO6 A;  5EWF A;  5ETM A;  3OQ2 A;  3LP1 A;  3CCU S;  3UN5 A;  4DG1 B;  1OPI A;  2OLW A;  1J27 A;  2F8H A;  2DHX A;  3BB5 A;  3ZZU A;  1RI7 A;  1Q81 T;  3V6D A;  2RU9 A;  3AA9 A;  1BUX A;  3DXS X;  3GIL A;  1JKH A;  3PJ9 A;  1CLF A;  1YJV A;  2MKI A;  3BSA A;  2HKE A;  2XMW A;  3M8W A;  4Y0F A;  5IM0 B;  5ETT A;  4CT8 A;  1I1G A;  2KDO A;  3M2R A;  3SXL A;  1N8R T;  3GSD A;  3NNH A;  4USV A;  1T9W A;  4WZM A;  2EBE A;  3PYD A;  5LJ5 Y;  3PV8 A;  2UU9 J;  3UN3 A;  2ZUA A;  3VAG A;  3G6X A;  2DEI A;  3FCW A;  3WIV A;  1WEY A;  2HRY A;  2XMM A;  4DQR A;  4F3M A;  4BHQ A;  4RW8 A;  3DRX A;  4CO3 A;  5IV3 A;  3HDS A;  4TYA A;  2XWY A;  2B3T B;  3I5B A;  3EXY A;  1X4B A;  1M5K C;  1R8C A;  3B4M A;  2XHW A;  2H48 B;  1RT4 A;  1KVI A;  2V2K A;  2QGF B;  1KQF B;  1LWC B;  4U7U D;  2HHT A;  3NGS A;  5EX0 A;  2HFV A;  1RAO A;  2Q79 A;  4QWC A;  5DZ7 A;  3HSJ A;  2R8G A;  2YH0 A;  4WJB A;  2U1A A;  1KC8 T;  4I0W A;  2KRB A;  1R0B G;  1JNZ B;  3CUN A;  2O5D A;  4O3N A;  1YJW S;  4DBQ A;  3POT B;  2F7V A;  2KFY A;  2PFF B;  1SQE A;  4QU7 A;  3PX6 A;  3W7B A;  4RNO A;  1YG0 A;  4KPC A;  1WG1 A;  2EFQ A;  4F4A A;  1V3R A;  2LMI A;  1N5V A;  3HD1 A;  1T11 A;  1SC6 A;  2HWT A;  4FNI A;  4BBY A;  3RGI A;  4OJ3 A;  4M5G A;  1W2I A;  1FDB A;  2QV6 A;  1N33 F;  4RW4 A;  2ALZ A;  1JXE A;  2BW7 A;  3I96 A;  4IQM A;  4ZCL A;  3CJQ A;  1KEK A;  3SCI E;  1ZBT A;  1UVN A;  3L9Z A;  2HLU A;  1FXD A;  2FGO A;  4JI5 F;  5DRK A;  2DPI A;  2UUA J;  2R8I A;  1PSD A;  1X7V A;  2BQU A;  3JAM Y;  3Q86 A;  2FPH X;  4LFB F;  1S1V A;  3DU6 A;  4FF4 A;  3S01 A;  4AUK A;  2FHO B;  3KLH A;  2FJB B;  3BQ2 A;  2MTL A;  4ZVG A;  1OO0 B;  1G3O A;  2WON A;  4DJB A;  4CTA B;  3AAW B;  4GC7 A;  1FX4 A;  4CLL A;  4DV6 F;  2DIU A;  4JI7 F;  5C25 A;  2M3D A;  1GXL A;  1KLM B;  2ZZN A;  3MED A;  4YY3 F;  4JI0 F;  2LVW A;  4HDG A;  1UVJ A;  3T3F A;  2IC3 B;  1RTZ A;  1X4H A;  4AL7 A;  2WBM A;  5IFM A;  2FVC A;  4I7F A;  1Q7Y T;  1L3S A;  3OV7 A;  3PDN A;  2G0J A;  2B7B B;  5D8H B;  4DR5 F;  3MGJ A;  3IWN C;  2VFR A;  4LJM A;  1RT5 B;  3CF5 Q;  1N5S A;  4JOU A;  4USK A;  4B3R F;  4ZHR A;  4FYW B;  3R2C J;  5KFZ A;  4DR2 F;  3RBZ A;  2OEJ A;  1UJ6 A;  4URS A;  1B64 A;  4ETX A;  4ZLJ A;  1S9E A;  2KRR A;  4B3M F;  2DTJ A;  4KGX B;  1J5E J;  3H8Y A;  2JSX A;  1GMW A;  4RNH A;  1VBZ A;  1GEH A;  4K5S A;  4F2S A;  4EO8 A;  4RZR A;  1N56 A;  1KD1 T;  1WSR A;  4Y2M A;  4JV5 J;  4EUV A;  4CH1 A;  2XNR A;  4CLS A;  3FFI A;  4IO9 Q;  5A6W A;  3OLB A;  4DV0 F;  2FJV A;  3DRP A;  4OJ1 A;  3G9C A;  2VG6 B;  3FDS A;  1UL3 A;  1S1W B;  2Y1I A;  1AYE A;  2HBQ B;  5AJ3 J;  4ZPA A;  1XEZ A;  3M9N B;  1LOU A;  5HN0 A;  1H98 A;  3ENV A;  3GE9 A;  4ED2 A;  4K5R A;  3OL6 A;  4NLW A;  1HMV B;  4K4W A;  5L1K A;  2XS5 A;  4YB7 A;  2IVM A;  2JLF A;  3HHD A;  2OFH X;  1DZ5 A;  1N54 B;  1P1T A;  2CQB A;  1IR1 A;  3IM9 A;  3CED A;  2DO4 A;  2QA2 A;  2MHE A;  3NBP A;  1T05 B;  2Z0G A;  1EQ0 A;  1QLN A;  3FQL A;  3KK1 A;  1T8E A;  5G4D A;  5CCL A;  3I5C A;  4N76 A;  2GVD A;  4RNN A;  4L72 B;  2BKP A;  1H2U X;  3R7B B;  2ZNZ A;  1SJQ A;  4BS2 A;  2ZWO A;  5LXY A;  5IV4 A;  3PAC A;  3U1L A;  1IM6 A;  1F0X A;  2L48 A;  4H4M B;  4LF7 F;  3G87 A;  2MKK A;  2QL5 B;  2GO8 A;  2HHP A;  2OP5 A;  1RIS A;  3UW1 A;  2XNQ A;  1IBL F;  2MMY A;  3CCJ S;  1YLX A;  2AWZ A;  3QFH A;  4UOC A;  4DR1 J;  2R7V A;  4RW9 A;  2QT7 A;  4ES3 A;  3N6N A;  4J9K A;  1O51 A;  1X0F A;  1CVJ A;  1IR0 A;  3E2E A;  5HQ8 A;  3WBZ A;  3CWJ A;  2IDL A;  3G82 B;  3KJN B;  3TA2 A;  4AXJ A;  4BDP A;  1S49 A;  4JUZ A;  4ZPV R;  4KY3 A;  2WSC C;  3ZZO A;  3IS9 A;  4NLQ A;  3CC4 S;  4LRA A;  4OJH A;  1NK6 A;  2FHJ D;  3N9U C;  1NH8 A;  3UDV A;  1G4C A;  1UFK A;  2J8S A;  5KFM A;  4RW7 B;  4DPY A;  1YHQ S;  2WTF A;  3SFU A;  1VC5 A;  3V4I B;  2Z30 B;  5KFX A;  2XBP A;  3ZTO A;  3TUZ C;  1SJ4 P;  4WU3 A;  5HQM A;  2I8E A;  1WD6 A;  3NAI A;  4YUD A;  2KZZ A;  2CQI A;  4KHM A;  2XO7 A;  2J7W A;  1CG2 A;  3V6J A;  3C14 B;  4OZJ A;  4CO5 A;  2I6W A;  2JVO A;  1S5Z A;  4Q5V A;  2POK A;  2VBY A;  1VJQ A;  4CLF A;  1KN6 A;  2IM0 A;  2B6A B;  4U7U K;  4B3T F;  3R97 A;  1FKP A;  1X0P A;  4USM A;  1HNX J;  1HYS B;  5KT4 A;  3OL9 A;  3DI6 B;  2UV8 A;  3EGZ A;  2A18 A;  2C2M B;  2W2N P;  2UVW A;  1UW4 A;  3F73 A;  3JQK A;  5K8N A;  5H9E J;  2MJN A;  3RRG A;  2EI5 A;  4WP8 A;  1JK9 B;  4I2P B;  1UCN A;  1XTZ A;  5E3R A;  1IUJ A;  3PZP A;  1CJT A;  1ZPW X;  4TU9 A;  1ARO P;  1RKJ A;  1FTC A;  1OWX A;  1RTJ B;  2JJ4 D;  1U09 A;  1Q95 G;  4X62 J;  3CGI A;  1ZM2 A;  3DLG A;  3KUE A;  3Q22 A;  1NB2 A;  4YR0 A;  4ZVE A;  2ZZM A;  5EUH A;  1R8H A;  5KFY A;  4PAB A;  3SV3 A;  4C2M A;  2X1A A;  5KFQ A;  3SDE A;  4TQS A;  3FCH A;  3M8Y A;  4XTT A;  1S57 A;  1GX6 A;  3VCD A;  4I67 A;  2YQ0 A;  2K3I A;  2M8H A;  3Q8R B;  1OYD A;  3G4S S;  2J0Q D;  1RAH B;  4QR2 A;  3ISN D;  3LAM A;  1VQL S;  2DO0 A;  1XMO J;  3VZH A;  4CYU A;  7AT1 B;  4IG3 B;  4DL5 A;  3W61 A;  1LQ9 A;  2XCP A;  1TAU A;  2KFZ A;  4X65 J;  1JLQ B;  4U8V A;  3U02 A;  3CO0 P;  1BLU A;  3CCW A;  2PGC A;  2A6O A;  4X66 J;  4O0I A;  3GR0 A;  3RW7 A;  1JJH A;  4W90 B;  1IKY A;  3UD5 A;  2A0F B;  3HP6 A;  3JSM B;  3DLJ A;  3TJ9 A;  4YR3 A;  4LFC J;  4KKO A;  3MTK A;  3KHH A;  4FPI A;  3H25 A;  3QQC D;  3EZU A;  1AUS L;  2QRR A;  2LA6 A;  5ETP A;  3T5J A;  4ED7 A;  4IFY A;  3JQM A;  4C6A A;  1U1M A;  4ANC A;  2BJ3 A;  3UWT A;  3D6H B;  4EBC A;  2JC1 A;  1D09 B;  1S6U A;  2BV3 A;  4OI4 A;  1SQG A;  2ZD1 B;  3W2W B;  1PBA A;  4P9S A;  2JLG A;  3A8E A;  4EI2 A;  1DUR A;  5CQG A;  2AJ1 A;  1UWB A;  4J9P A;  1EKR A;  5GAE I;  3HF5 A;  4KAI A;  2EK1 A;  4WXW A;  1U1P A;  3CC7 S;  3T5H A;  2OI2 A;  3PR4 A;  2PO4 A;  4DZ6 A;  1Q4R A;  4N7T A;  2GA7 A;  4A8S A;  2CJB A;  3HJV A;  4G1I A;  4LQ3 A;  3LAL A;  3NWG A;  2XG8 A;  1GQE A;  1L3V A;  1ZPV A;  3N5B A;  3U7J A;  3T6B A;  1H73 A;  1RHU B;  1X5P A;  2W8K A;  3CCE S;  2ZJR Q;  3BO2 A;  3R8Y A;  2BQR A;  4Y34 A;  1MWQ A;  4NZ7 A;  5CAB A;  3HK2 A;  4F3O A;  2K1R B;  4FXW A;  5U47 A;  3H5Y A;  2OPQ B;  3TQ1 A;  4RO0 A;  4ZVS B;  4K4T A;  1C1C B;  3X3U A;  1WI8 A;  2KXH A;  3A8J A;  3P8B B;  4F0M A;  2VPZ B;  4GVB A;  5HLF A;  2YKA A;  3MR6 A;  2BRL A;  2A10 A;  1HNZ J;  2ZM6 J;  3D6T B;  1W26 A;  2MZT A;  5B09 A;  3AQP A;  4F67 A;  1Z2Z A;  2PII A;  3MOZ A;  2NXJ A;  1NDL A;  4RUH A;  2RDI A;  5A8W B;  5K9F A;  4DSF A;  4ED8 A;  3MPU B;  2YKM A;  4WBF A;  4P75 A;  3CD7 A;  4EK2 A;  3I82 A;  2AGP A;  2J7K A;  3HX9 A;  2KVI A;  3MM7 B;  2DNY A;  3OL8 A;  4DFP A;  5SUH A;  3DOL A;  3Q8Y A;  2XWX A;  1RT2 B;  5IS2 A;  3BJY A;  3H2U B;  1XR5 A;  4E0D A;  3GFH A;  3MM9 A;  3C3L A;  4WPA A;  3BKF A;  2OPS A;  3W8P A;  1Y5N B;  2XTJ P;  3BN7 A;  3PRD A;  2DIS A;  2LEP A;  1TL7 B;  4OX6 A;  3CCS S;  4QZV B;  2LXI A;  2XEX A;  4YHH F;  1FJE B;  1XMQ F;  1IVZ A;  1QE1 B;  2LA4 A;  4P2M A;  4QPT A;  2YNG B;  1URN A;  2E1A A;  4IOB A;  1AUD A;  3MPV A;  4DN0 A;  1VQP S;  3PYE A;  2HAF A;  2YKQ A;  1DAX A;  2HHQ A;  2LDI A;  3WC0 A;  2XSJ B;  3SSQ A;  2DHA A;  3QID A;  4NLX A;  5LSL A;  4LUB A;  1WHY A;  3KNG A;  1HBU A;  2FHK A;  2XLI A;  3MXH P;  2KB2 A;  2VF3 A;  1TUG B;  3Q8P B;  1B99 A;  3FZB A;  4ED3 A;  4OHY A;  3MI7 X;  1CBK A;  3PXG a;  2IVF B;  4C8N A;  3GYN A;  4JV0 A;  4CZC A;  4A8M P;  4KV8 A;  1GAO A;  3GJQ B;  4ER8 A;  2OPR B;  3C15 A;  2GO9 A;  5HP1 A;  3AOD A;  1XR7 A;  3DGP A;  2WVB A;  3OFE A;  1Q8B A;  2P6T A;  2IFX A;  3JXO A;  4GO7 X;  5D0G A;  3RB3 A;  4ECY A;  1DLO B;  2HGM A;  3OR1 B;  3SFG A;  1K47 A;  2BVZ A;  4K50 A;  4NLU A;  1U1K A;  4OHX A;  4ICL B;  5B08 A;  3T41 A;  4IDK A;  2P9E A;  5AXL A;  3OL7 A;  3U1N A;  3Q23 A;  1JLG B;  2W2O P;  1N36 J;  2YNH B;  2FLN A;  4TKT A;  4B02 A;  3GFY A;  2Z2Y B;  4M5D B;  1ROF A;  5IT0 A;  2LQ5 A;  4NRU A;  5GMK a;  3LP0 A;  1CJU B;  4XAK A;  5GAH I;  5B7W A;  3ZNJ 1;  1TMJ A;  2DD8 S;  3P45 B;  4ILR A;  1VRU B;  1CJK B;  1WDD A;  3FVY A;  4OFZ A;  3G96 A;  1BQM A;  1HA1 A;  1U1R A;  4LSN B;  2PFD A;  5D3G A;  1FCA A;  1Y4Z B;  1T02 A;  3MEE B;  4JV2 A;  3TAR A;  1D1U A;  3B4D A;  3HLU A;  5G0R B;  1Q82 T;  4BWM A;  1TKT B;  4DR4 F;  2ROP A;  5DG7 A;  4UW2 A;  4PUO A;  3R3T A;  4QWD A;  5HL7 Q;  1XN9 A;  3R7N B;  2WVF A;  3N4W A;  4Y65 A;  4YDD B;  3DC2 A;  1JNR B;  2RF2 A;  1HFE L;  2O01 C;  2QC3 A;  1MN9 A;  1RAF B;  3AOC A;  2LEB A;  4PG8 A;  5D0E A;  4ENO A;  3FMB A;  3L4B C;  3OFG A;  2DNG A;  4W4M A;  3IM8 A;  2HWH A;  3LTO A;  2M8D B;  3HSD A;  1MG7 A;  1R31 A;  4X64 F;  3NGR A;  3G8T A;  4DSI A;  4Q8E A;  1B0V A;  2KXF A;  2PDA A;  4PRF A;  3VGT A;  2B7C B;  2DHG A;  3ZTS A;  1ACM B;  3EVO A;  2P6S A;  2CXE A;  4OMF G;  5HMW A;  1NME B;  5DDQ C;  3C6T A;  3OTO J;  4I64 A;  1C4A A;  3BPD A;  1Q8L A;  4NYP A;  1T9T A;  4ECW A;  1YZ6 A;  1WC5 A;  5A8R B;  2OH2 A;  4EEY A;  4FPR A;  1H6K X;  3UR3 C;  1DTT A;  1KOO A;  4MT1 A;  2HHH F;  4P52 A;  3AHP A;  3GIK A;  3S1T A;  3W2V A;  1T03 A;  1QSL A;  3VV2 B;  1VRT A;  4ZJQ A;  1OS5 A;  1SC4 B;  2HAI A;  3ITH A;  5F41 A;  3T5L A;  3D28 A;  5C2G A;  3MCM A;  3KJV A;  4KPY A;  1QTM A;  4ID8 A;  3UR0 A;  3NKY A;  1LW2 A;  4H4O A;  1GH8 A;  1EKS A;  1NJW A;  4O3R A;  1Y3J A;  4IR9 A;  4ZLN A;  3V6H A;  1NU4 A;  2R7R A;  5MAO A;  3OUY A;  2QE5 A;  1YKW A;  3IC1 A;  4O0N A;  3QZ8 A;  4Y2A A;  1IKW B;  5A0Y A;  1FRM A;  1LK7 A;  3ELH A;  2ZZT A;  1KKH A;  1XMB A;  2MQP A;  2WSE C;  2AD9 A;  3LGM A;  3R1L A;  2QFJ A;  4G1Q B;  1SB6 A;  1PC4 A;  3G71 S;  1AZS A;  1PJ5 A;  4O44 B;  2LLZ A;  1RTD A;  1TL3 A;  4N41 A;  2DNH A;  2BM1 A;  1NPP A;  2VBW A;  5IC4 B;  2J9C A;  5LSR A;  4J9N A;  5K8P A;  4JI2 F;  2F5G A;  3HMJ G;  3OTE A;  3QT7 A;  1RT3 A;  3P6Y C;  3QRR A;  2BEF A;  3BYR A;  4K4S A;  3IR6 B;  4F4Z A;  2W9C B;  4OYI A;  2F9D A;  3RBE A;  3N5F A;  3KG4 A;  3CJK B;  2KT2 A;  1NDK A;  1RBO B;  3M32 A;  3J7Y I;  3CME S;  1I51 B;  4DV3 F;  4AT1 B;  3TJ8 A;  3OVS A;  1NK9 A;  4CH7 A;  4LMZ A;  4DV1 J;  5LSO A;  4QIE A;  5HBM B;  1YJ9 S;  1WEZ A;  1AB8 A;  5JUM A;  4DV7 J;  1CS4 A;  5KFV A;  1ZTT A;  3GPA A;  1TK8 A;  5AE1 A;  3DM2 B;  3M4X A;  1MRO B;  3I9V 9;  2KTQ A;  1H7X A;  3AD9 C;  1C1B A;  4P2S A;  2B8Q A;  2XY6 A;  3NCP A;  2ASL A;  2MLZ A;  3GSI A;  2XMA A;  3QJP A;  2O67 A;  1RYR A;  3DNC A;  4PQU B;  1BD6 A;  2YTC A;  5FDL B;  5HQL A;  1SL2 A;  2P2C B;  1VGY A;  4DG1 A;  1YJU A;  1TTH B;  1UVL A;  1S6Q B;  2HK2 A;  4QYZ J;  1R27 B;  1F5A A;  1FWL A;  2VPX B;  2XQC A;  5BJR A;  4M63 A;  5DET A;  1AW0 A;  1BE4 A;  2EEY A;  2HFN A;  5F0U A;  1S1T B;  2QL7 B;  1K0V A;  1IKX B;  2X7I A;  1FFG B;  4TY9 A;  4J9M A;  2AJ4 A;  2KXN B;  1URR A;  3AD8 C;  2C3M A;  4J9Q A;  4WYL A;  5IM0 A;  1GT8 A;  1BXN A;  2XS2 A;  2CZ9 A;  5KFW A;  2GX8 A;  1WTF A;  2ROE A;  5DS7 A;  1ZOT A;  1Q78 A;  2HQF A;  1WNE A;  5D15 A;  2QLJ B;  3HSZ A;  2OD6 A;  1VQ7 S;  2M88 A;  4NLO A;  1RHQ B;  5GME A;  4LRD A;  5ETQ A;  2C2R A;  1ZAV A;  2DRD A;  3C16 B;  5K8M A;  5T7L B;  3IP0 A;  4EZ6 A;  2BX6 A;  1U2R A;  2GQC A;  1O0P A;  4ED4 A;  3K8W A;  1LWC A;  3CJR A;  3KLE B;  1IJE B;  4A4J A;  3KUG A;  3J7Z T;  1AT1 B;  4IOA Q;  4V19 X;  1SKU B;  4DUT A;  2GQQ A;  4LR7 A;  3KLG B;  2VQE F;  2J6U A;  2HLT A;  2JRS A;  3POT A;  1LK5 A;  4DXL A;  4MIB A;  1N5T A;  3LUY A;  4X4P A;  2HFS A;  2E5I A;  2QL9 B;  5IWA F;  1BHN A;  3M8R A;  3PEH A;  1SPB P;  1VIX A;  1NKE A;  1KVK A;  1O5J A;  4NPO A;  4ZN1 A;  4R5P B;  3IR5 B;  3GFZ A;  1NK8 A;  1FRJ A;  1AA1 B;  1U8S A;  4KB7 A;  3TAM B;  1HW8 A;  1NBE B;  4N47 A;  2RQK A;  2A6M A;  1T9X A;  2YWG A;  4DQP A;  1S12 A;  1VQM S;  3CJS A;  2VDH A;  4USJ C;  5KG7 A;  1HBO B;  2EFG A;  2APO A;  2CAD A;  1ZM9 A;  1S59 A;  4OQJ A;  1FT8 A;  2QA4 G;  2GMH A;  1WC1 A;  3TNV A;  3E51 A;  1H3D A;  1M1G A;  2BJ9 A;  2CZV C;  4FYY B;  3RG6 A;  5I4M A;  2XI3 A;  2DGX A;  4X4T A;  4AD6 A;  1X4D A;  4TU7 A;  1S0N A;  1N5Y B;  5LMN F;  4F8R A;  2B5J B;  4CTA A;  4ZOS A;  2KN4 A;  5KFD A;  1R0A B;  1BQX A;  1ZM3 A;  3F41 A;  4KQZ A;  2AYG A;  1FNX H;  2ILZ A;  1YX2 A;  4LF4 F;  1KLM A;  2Y8W A;  2MKH A;  2HFZ A;  4C0B A;  3LF0 A;  3ZTP A;  5H9F K;  1JLE B;  4LFA J;  4LRC A;  2IC3 A;  3K5N A;  1XNR F;  2AZ3 A;  2VA3 A;  3QGI A;  4NMX A;  1FRI A;  2XHC A;  1RT5 A;  2B4O A;  1NK5 A;  3VAL A;  3MM5 B;  4F2R A;  4FVM A;  1FFW B;  4MK8 A;  2YNI B;  1Q0N A;  2E9T A;  2BA9 A;  4TXS A;  3NMA A;  2V8H A;  4FN5 A;  1SH0 A;  4MFB B;  2EXU A;  4KO0 B;  3ADA C;  3BH6 B;  3ZZR A;  4AFF A;  1REG X;  3I4H X;  1XNQ F;  2DNQ A;  3UPF A;  5H1S V;  3VWS A;  2H9Z A;  1FJG J;  1HNW J;  1JJC B;  4JI8 J;  2R7S A;  1N5Q A;  1R89 A;  4YS2 A;  3M6U A;  4CI0 B;  2VG6 A;  2XY7 A;  2VDI A;  1S1W A;  2OMO A;  2GJF A;  5E0O A;  3DHW C;  4C0H A;  2PMW A;  1LW0 B;  4OYZ A;  2NQP A;  2ZH9 A;  4EYI B;  3M30 B;  5BYS A;  5KFK A;  3JQJ A;  2ABY A;  4ZVQ B;  4DV4 J;  2OO4 A;  3KLV A;  2HFU A;  1WG5 A;  1S76 D;  3J7Z 5;  1RAC B;  1GMW D;  1S7I A;  2N7C A;  2B9Y A;  3CMA S;  1IBM F;  2B9E A;  1HMV A;  4E8U A;  1RWX B;  1UPP A;  3KHR A;  4CDI A;  1WDT A;  2EFN A;  2C42 A;  2R2T A;  3MM8 B;  2B4V A;  4PEO A;  2EFV A;  4WP9 A;  1T05 A;  3RB4 A;  5DQH A;  4ZPD A;  1PIL A;  2B0G A;  1CJV B;  3GG1 A;  4USU A;  2FHJ A;  2IJR A;  2DH7 A;  1N88 A;  2AT1 B;  2AF6 A;  3ILO A;  5ETK A;  5GAD I;  5FD1 A;  3MCO A;  3I0S B;  3J7A N;  9ATC B;  4O3Q A;  3KG1 A;  1WWH A;  4H4M A;  3E01 B;  3KK3 B;  4DUY F;  3NGD A;  3EX7 B;  2E7W A;  4IYQ A;  2XB2 D;  1U6B A;  3MFH A;  2AP6 A;  2CUY A;  1FF2 A;  1U7L A;  1Q16 B;  2R8H A;  3R5D A;  2FUG 9;  2WZ1 A;  3O8W A;  3GB0 A;  4U96 A;  1UEK A;  3CVK A;  1T95 A;  1VLY A;  4Y28 C;  3G82 A;  1O6X A;  4OHZ A;  3RB0 A;  1FX2 A;  2QMW A;  4DV2 J;  2W9A A;  3A13 A;  3D0G E;  4A8W A;  3HVT B;  2J7U A;  3HZG A;  5C42 B;  2LEC A;  1B4S A;  2BQ3 A;  1VQ4 S;  2JZ5 A;  2FVP A;  1R7I A;  3BF4 A;  4RW7 A;  4LBP A;  3V4I A;  5E33 A;  3OD2 A;  4Y3C A;  1WKL A;  3K5M A;  1NSP A;  2X3G A;  1F6T A;  5ETR A;  1T94 A;  3FSX A;  2DRA A;  2Y8Y A;  3UVJ B;  4C8M A;  4NXM J;  3DLH A;  4ZIV A;  2GIF A;  1VQN S;  4P6Q A;  2CZ4 A;  3DRY A;  2HHV A;  1N52 B;  1MN7 A;  3C14 A;  2LYV A;  4CLU A;  3ULH A;  2ROG A;  3BM7 A;  2AJQ A;  1TFY A;  1V3Z A;  5IT9 U;  1RJJ A;  3ZNU A;  3P3D A;  2XMK A;  3DLL Q;  1SJR A;  2B6A A;  3Q89 A;  2ADB A;  1CEZ A;  2KT3 A;  1U02 A;  1QDU B;  4DX8 H;  2CIM A;  1HYS A;  4MTP A;  5DG9 A;  3DI6 A;  4X84 A;  1WC6 A;  2CPD A;  4H54 A;  2UV8 G;  3JB9 k;  5F8M A;  2R9L A;  3HSG A;  3E3X A;  1Q79 A;  3NP5 A;  3ZC4 A;  1QAY A;  4I2P A;  4MJK A;  3CCT A;  3DRR B;  2PA8 D;  5CZV A;  4ES1 A;  5JXS A;  2HVI A;  1S7H A;  3EMT A;  3DLG B;  1RTJ A;  4K59 A;  3M8Q B;  2UUT A;  5JMN A;  1OYE A;  2ZDP A;  5DQI A;  1SL0 A;  1IQT A;  2YX7 A;  2DGW A;  4PG4 A;  4QBU A;  1IQZ A;  1V5I B;  1HQU B;  2DH8 A;  1RCX B;  3H59 A;  5HVF A;  4QWE A;  4LQ9 A;  3Q8Q B;  4ZN3 A;  1FRL A;  2J0X A;  2IIH A;  3CCL S;  2YKN B;  1N33 J;  2IM1 A;  4C7Q A;  3IMQ J;  4O4G B;  3KUH A;  2RDD A;  2IAJ B;  3MAH A;  2UXB J;  3QIP B;  2L3M A;  2HZA A;  3WIU A;  4IRC A;  4IG3 A;  2BXJ A;  4EWT A;  2F8E X;  1BGX T;  3LQV A;  2VHG A;  4IH7 A;  1JLQ A;  1LXJ A;  4PAA A;  2G1D A;  3D54 A;  4Q0B B;  4WFZ A;  3AOB A;  4L75 A;  2F9J A;  1RYS A;  1Q53 A;  2H3E B;  4ELU A;  3TX8 A;  2F4F A;  4M8L A;  1U4B A;  4U9R A;  4DV6 J;  3JSM A;  3MCN A;  4PXB A;  4JI7 J;  4OZN A;  4YY3 J;  4JI0 J;  3UDE A;  3NS7 B;  4HVZ A;  3D3C J;  4G6V B;  3EDQ B;  5KT5 A;  2ZJQ Q;  1MMN A;  4LF1 A;  1LV5 A;  2E1R A;  4DFK A;  1UJ5 A;  4PCQ A;  4IR1 A;  4X4O A;  2ZVS A;  3W1Y C;  1VQY A;  3KJQ B;  2W9B B;  2CYY A;  2ZD1 A;  3W2W A;  4DR5 J;  1QAI A;  1FWK A;  3RAQ A;  1EHW A;  2JEJ A;  3MPD A;  2JOQ A;  4V1A k;  2A2D A;  4MK9 A;  5CXT A;  4JI6 F;  2QIF A;  2F4V F;  1SUQ A;  2XZT B;  1R8A A;  3O6Q A;  4DR2 J;  2MYF A;  1SKR A;  3HPO A;  4OLP A;  3T5K A;  5L38 A;  3U1M A;  1CUL B;  2W1B A;  2EG2 A;  3CUL A;  4B3M J;  5AXN A;  4C8K A;  2H4W B;  4UTG A;  1NUE A;  1VQK S;  3CE8 A;  2PEH A;  1TL1 B;  4ZJO A;  3VR1 A;  2UVV A;  4XPC A;  3UE2 A;  3ILJ A;  3BGO P;  1NZA A;  1ZET A;  2OAU A;  3EGN A;  2H5I B;  1FEE A;  1OY6 A;  1HI0 P;  2K1R A;  2CWX A;  1WI6 A;  1RTI B;  2OPQ A;  4X4Q A;  1C1C A;  1VIO A;  3H42 A;  1N34 J;  2V9W A;  1MMD A;  4ZIW A;  3O44 A;  2ZBC A;  4DV0 J;  2JFK A;  4ES2 A;  2WVE A;  1WEL A;  1U45 A;  1VOM A;  3EJM A;  3LPE A;  2L9N A;  4OV1 A;  4DCP B;  5A8W A;  1OPZ A;  2UUB J;  1OSC A;  4R8U B;  3PRB A;  2CJA A;  1I94 F;  4NAS A;  4IQX A;  2FY8 A;  5EHH A;  4F0K A;  2HQI A;  3AJD A;  3K2Y A;  3MM7 A;  4N5S A;  5M2P A;  1RT2 A;  4TNO A;  3T6J A;  2VJV A;  4Y2K A;  4ILM A;  3K5L A;  4QW9 A;  3DU5 A;  1DQA A;  4ED1 A;  1KLN A;  3GR1 A;  1VDH A;  1TL7 A;  1P9Q C;  3AQO A;  4RBU A;  4A8K A;  5HJY A;  3MMB B;  3PVX A;  2G1H A;  1QE1 A;  4DUZ J;  1FDD A;  2UP1 A;  1S6P B;  2YNG A;  1KWM A;  4LF7 J;  4YP3 A;  2P9C A;  2JDJ A;  1RT1 B;  4ZLL A;  1IBL J;  1KVJ A;  2VFV A;  4LF6 F;  1Y5L B;  2CJQ A;  3KMS A;  4KRW A;  1RDR A;  2FJE B;  2XSJ A;  2YKO A;  1YI2 S;  3MR2 A;  1UPM B;  2MQN A;  2DK2 A;  4DPT A;  2JLE A;  2D3U A;  4RWW A;  3M8Z A;  3VVU A;  4URG A;  1VC6 A;  2CJY B;  2LQ9 A;  5L1L A;  3HKZ D;  4FXD A;  1ELO A;  3OJU A;  2DVI A;  4R0J A;  4Q8F A;  4JI3 J;  4BLG A;  2RRB A;  2OPR A;  2VKZ G;  3DGV A;  3DYA B;  3TYT A;  5CYQ B;  4B3S J;  3MMJ A;  4OZ5 A;  1JLC B;  2X1F A;  3HFZ B;  4HDH A;  2CQ2 A;  1DLO A;  3OR1 A;  1VS3 A;  1KTQ A;  5KFS A;  6FDR A;  2VQF J;  4D3H A;  4K8R A;  3MMC B;  3B78 A;  4DLG A;  4OZ3 A;  1SC3 B;  3BBF A;  5DLF A;  4ICL A;  3Q0A A;  2DR9 A;  3CB4 A;  4CO1 A;  8ATC B;  4WK1 A;  5KOW A;  3W5Y A;  3CJ8 A;  1K8A T;  1WHV A;  2GC8 A;  4PKD B;  2NXC A;  5ADZ A;  4D3G A;  3B6B A;  1JLG A;  2W7O A;  2YNH A;  4PYD A;  4NA3 A;  5HVG A;  2F40 A;  4C3M A;  4LR9 A;  2E5J A;  1KHW A;  1HQE B;  3I87 A;  3GJT B;  2CQH A;  4LSZ B;  4M5D A;  4AE5 A;  4ECV A;  1CJU A;  2Z2Z A;  5D4L A;  1S4F A;  4UF4 A;  2NYI A;  3G6Y A;  1VRU A;  2YNF B;  4B3T J;  1CJK A;  3J81 j;  4LSN A;  3R5B A;  2FIU A;  4K2X A;  1WJ9 A;  1K44 A;  4A8X A;  3T1Y F;  1M5H A;  2VOP A;  2JX2 A;  2X51 A;  3MEE A;  3NY0 A;  2H1Y A;  3R5C A;  1Q8I A;  2QSW A;  2Y9H A;  2IYI A;  5E7O B;  3IO1 A;  3DXB A;  3LW5 C;  4U95 A;  2BJD A;  1MWY A;  3A8K A;  5G0R A;  1TKT A;  3GP9 A;  2BE7 D;  3C6U B;  2NCK L;  2ZH5 A;  4ZPW R;  2E7V A;  3UQS A;  1RK8 A;  1U0S A;  3H5S A;  4FXV A;  1WTB A;  3CT9 A;  3A4T A;  2MHN A;  1K0T A;  1FXL A;  2EFP A;  5J1N A;  1N0U A;  4F4X A;  3N6L A;  1JXL A;  3CJT A;  3M7V A;  1J5O B;  3FNN A;  1HNX F;  2V5H G;  4YR2 A;  1SQF A;  4ZVT B;  2KVQ E;  4DQS A;  1S10 A;  2NPF A;  4TN2 A;  4WFA Q;  3KYL A;  3CJ0 A;  2PI5 A;  2J9D E;  2KG0 A;  1MU2 B;  1PBU A;  4UQG A;  1P9Y A;  4KGM A;  5J2M B;  5A8R A;  1FE0 A;  2VC0 A;  1X4G A;  4CLT A;  5EWG A;  1EQM A;  1U0H B;  2ZBP A;  3PKY A;  2YWH A;  3J7A 1;  5L1I A;  4C0O C;  3FRZ A;  3D1H A;  2HZV A;  1DHM A;  1RBA A;  2QLF B;  4FBU A;  4OI0 A;  4FYX B;  4KGV B;  3T9N A;  4C48 A;  3LWL A;  2YQ3 A;  4GKK F;  4FF1 A;  1A9N B;  1TR0 A;  5RUB A;  4FF3 A;  3C8Y A;  1IKW A;  2DCL A;  2RT3 A;  5CAA A;  3D3B J;  4DPX A;  1LFP A;  2OFG X;  3QGH A;  4G1Q A;  5BYQ A;  3W60 A;  4O44 A;  3I4P A;  2M4M A;  1VCT A;  3X1L B;  5LT5 A;  5L1J A;  2W7A A;  4RBV A;  3PHT A;  3HHK A;  3NNA A;  3R5J B;  4LF8 F;  3QFW A;  1NND A;  2W9C A;  1X60 A;  1YIJ S;  3H5X A;  1GMV A;  4LIW A;  1UW9 A;  3I56 S;  4ZMM A;  4CLW A;  3M05 A;  3CJK A;  4RJV A;  2F63 A;  2HNZ B;  4HR2 A;  4X4N A;  4QU6 A;  2Z8Q A;  2MZR A;  5JVH Q;  2F1F A;  4HL9 A;  4M94 A;  5HBM A;  3GTY X;  3NGU A;  3VAM A;  3MTJ A;  3M2V B;  2BJ7 A;  4P73 A;  4DV5 J;  4YME A;  2OEK A;  2Y0S D;  4RX6 A;  2HHX A;  3DM2 A;  1MRO A;  3K5P A;  1ZA1 B;  5J1E B;  2BW2 A;  4ERD A;  2CG8 A;  3W66 A;  4WK3 A;  3IR7 B;  4B9S A;  2QLB B;  4J37 A;  4PQU A;  2OPP B;  3CCR S;  1DQ9 A;  5FDL A;  1NSQ A;  4X2B A;  4U8Y A;  4UZB A;  1FE4 A;  1S6Q A;  2MLY A;  3GU0 A;  1HPZ B;  4C97 A;  3QLH B;  4P2F A;  3SIP B;  3P4U B;  1KS2 A;  3BR8 A;  1GK8 A;  1RHM B;  1HNV B;  5I3Q A;  5B0D A;  5HVH A;  4YN3 B;  1S1T A;  3QSI A;  2R4F A;  3PFO A;  3GIR A;  1IKX A;  4HEA 9;  3TUP A;  1CQM A;  3IWX A;  4WE1 B;  2BE9 B;  3TVK A;  4YHH J;  2IMW P;  3SSS A;  3FZ2 A;  2RJZ A;  1HNI B;  3RRH A;  5L9X A;  2QFI A;  4L6V 3;  3UCU P;  4NLG A;  2CQP A;  2C3O A;  3QT8 A;  4DFM A;  3C16 A;  5T7L A;  1KNZ A;  3D2W A;  1YWX A;  1S77 D;  3CDB A;  2J9E A;  1B0T A;  2W2Q P;  1HKA A;  2Y1R I;  5BR8 J;  5DLG A;  4JI1 J;  4CNZ A;  3KLE A;  2ZKU A;  1O8B A;  4ED0 A;  5E2Q A;  3W63 A;  4CM2 A;  3A12 A;  4J9L A;  3FRY A;  4YB1 P;  2G0C A;  2GML A;  2BJE A;  2NSC A;  1U24 A;  4L74 A;  1EP4 B;  4RBT A;  2HQ3 A;  3KLG A;  2ZH6 A;  4DF8 A;  5HI7 A;  4K4Z A;  4V19 J;  3W8G A;  3DKD A;  4EBD A;  1PAU B;  1N0V C;  1NPR A;  1PCA A;  2DGO A;  3QAT A;  4NXN J;  4RNF A;  1HD0 A;  2VG5 B;  1WC3 A;  2C28 A;  1A0O B;  4WCE Q;  4U6P A;  2V67 A;  3GV5 B;  3NGK A;  4I2Q B;  2DGV A;  4R5P A;  3TJA A;  1UET A;  3QZ7 A;  3BSN A;  3CD6 S;  7FD1 A;  5GVQ A;  3TAM A;  3TUI C;  5A8K B;  4TU8 A;  4Y2I A;  1IJF B;  1F1B B;  3LGH A;  1WOO A;  3MR5 A;  5D4N A;  2FZG B;  2KFN A;  2ZNY A;  3PR5 B;  4OI6 A;  3MPY A;  2FY1 A;  5L46 A;  2K7K A;  3OPK A;  1HBO A;  3D5M A;  3CMQ A;  1SXL A;  3OVA A;  2D69 A;  3SV4 A;  4PWW A;  1DAR A;  1RBL A;  3TR5 A;  1C0U B;  2ZIT A;  2XMT A;  4XIU A;  3W5X A;  1W25 A;  1GNK A;  1N5Y A;  4WFY A;  2AQ4 A;  1TKZ B;  2KU7 A;  2ASD A;  1AXQ A;  2B5J A;  1NXI A;  3FBC A;  1WKJ A;  4DR4 J;  4I6W A;  2RRA A;  1R0A A;  2QZ8 A;  2DR6 A;  1RHK B;  1TUV A;  4FNH A;  2IM2 A;  1RWN B;  2AIR B;  1N36 F;  4MKY A;  1H2V Z;  2V6A A;  3IRW P;  3LP2 B;  3GMG A;  3K7R A;  9RUB A;  1F9E B;  2KM8 B;  3JYT B;  1JLE A;  2C2E A;  5FII A;  4KC5 A;  1KFD A;  5D4P A;  2CJX B;  2IA0 A;  1FJC A;  1RWM B;  1Y7P A;  4X64 J;  1KQS R;  4WFN Q;  2ZOG A;  2CQ1 A;  3TZX A;  2E9R X;  2OIH A;  3RRK A;  4PQA A;  1HHT P;  3MM5 A;  2ZH2 A;  4ZLP A;  3AB4 B;  4ZCK A;  2RQM A;  2YNI A;  1RCO B;  2I38 A;  3BO3 A;  2ZEJ A;  5DDO C;  2AEF A;  3PCO B;  5KT2 A;  2FC8 A;  2FZK B;  2AGQ A;  1KTV A;  4QWA A;  3I55 S;  4MFB A;  5KG4 A;  5KFT A;  4DCO B;  4KO0 A;  3THP A;  3DDN A;  2HHH J;  1VQ8 S;  3R5A A;  1HBN B;  4A8Y A;  1VBX A;  4C9D A;  3MR3 A;  5DGB A;  3MF5 A;  4DL3 A;  2HMI B;  1FRK A;  3VVT A;  2QG9 B;  2OD4 A;  2BE2 B;  1FEH A;  3J81 U;  8RUC A;  2V4Q A;  1X4A A;  1HBM A;  4B9U A;  2D1C A;  3RW6 A;  1X4E A;  1OQ6 A;  2VV5 A;  3HFK A;  3NS5 A;  1T0T V;  1RTH B;  1DJ0 A;  1LW0 A;  2AEM A;  1U48 A;  3M30 A;  2YX1 A;  3DDK A;  2ASY A;  2JWN A;  2VH7 A;  3JSY A;  2HRU A;  1TV6 B;  4QR1 A;  2RKI B;  3M8S A;  4K7Q A;  2B8P A;  4ECR A;  1QJH A;  3Q8U A;  2DH9 A;  3C2P A;  3VAH A;  4HI1 A;  2EPI A;  1BMQ B;  5KFL A;  3MM8 A;  5HAN A;  3K57 A;  1QSY A;  3D9B A;  2EW9 A;  4OX9 F;  4JI2 J;  3QWU A;  4CP5 A;  4P7V A;  2WVD A;  2NUU G;  1CJV A;  1RLD A;  4I4B A;  5KG1 A;  3TZW A;  1S9G B;  3LO3 A;  2OSQ A;  3AY0 A;  3GJR B;  3W3S A;  3QYY A;  3NGT A;  4NCA A;  4WZQ A;  2ZE2 B;  3UDL A;  2MKJ A;  3AFG A;  3I0S A;  2AYM A;  2CNK B;  1DBD A;  4UUW A;  2J8A A;  3GIJ A;  4I6Y A;  3RAX A;  2V8G A;  2DKO B;  3KLF B;  3E01 A;  3ET6 B;  3KK3 A;  1RHJ B;  2GHW A;  4TYB A;  2DGQ A;  2D3O R;  2ILY A;  2O1P A;  4JBC A;  1WF2 A;  3IBC B;  1N4L A;  2XMV A;  2VFT A;  5E3A A;  2W25 A;  1TVR B;  2LQ8 A;  1M90 T;  2PMH A;  2R8J A;  2BJ1 A;  1WC4 A;  4QJV A;  3HVT A;  2VOO A;  1MWZ A;  1NDC A;  3CCZ A;  5C42 A;  2DB1 A;  1HQ2 A;  4I68 A;  2QLW A;  3QO9 B;  3ZO7 A;  1VR6 A;  2FJD B;  4M5K A;  1N6Q B;  3CTR A;  4ZP7 A;  4YB6 A;  3PNI A;  2UXD F;  1SJ3 P;  3HVW A;  1RAI B;  2DBB A;  3DCA A;  2HW3 A;  4DV1 F;  4ZKA A;  4LF5 F;  3UVJ A;  4Q44 A;  4PXD A;  3O5T B;  4DV7 F;  4DQI A;  4NML A;  2MZJ A;  4OYW A;  5CHC B;  1HHS A;  4IOC Q;  2LP4 A;  2ADC A;  1B0P A;  3TWZ A;  1SJ1 A;  2M5Y A;  2VD3 A;  3S7R A;  1FNO A;  2HVH A;  1FDA A;  2L9W A;  2CQC A;  3TP2 A;  2E1M C;  4EMD A;  1RHR B;  1M5O C;  3P5B P;  2EBG A;  3DLK B;  4KHR A;  4LF9 F;  4O3O A;  1QM9 A;  3LAK A;  2NLW A;  3CJ4 A;  4USI A;  4A48 A;  4OX7 A;  2GZO A;  3DRR A;  4CIO A;  2NSB A;  1WKK A;  2VQE J;  3H0P A;  1JIH A;  2AX1 A;  4ECS A;  2C2Z B;  3M8Q A;  3NG8 A;  2H51 B;  1OJ4 A;  4FYV B;  1IXK A;  1EZZ B;  5BXI A;  3ZTQ A;  2XSF A;  4FKY A;  3H2V E;  5HJX A;  3THT A;  2RE1 A;  2GJI A;  2D9O A;  1HQU A;  3UCG A;  5B0E A;  1NRK A;  3CDW A;  2V34 A;  2ZJP Q;  4N56 A;  4PYA A;  3FBB A;  1TEL A;  4UST A;  2YKN A;  4J9V A;  2W2M P;  2AJ0 A;  2W7P A;  3DLE B;  2HBY B;  2E7X A;  1RE1 B;  4O4G A;  1C0T B;  4FS2 A;  2E5L J;  4OX8 A;  2IJN A;  1FK9 B;  1IBK J;  1S1U B;  2FC9 A;  1RWW B;  5F8L A;  1VJW A;  2IAJ A;  4Y6I A;  1GTH A;  5K8O A;  2RAQ A;  3QIP A;  1NJY A;  4JI4 J;  5K20 B;  2WSF C;  5E3P A;  3HHE A;  4JV1 A;  1YDL A;  2FJA B;  5DGA A;  1FDN A;  2V94 A;  4Q0B A;  1KSP A;  3C66 A;  3BSC A;  4DR7 F;  3FEZ A;  3OHB A;  2DIT A;  3M6V A;  2K8G A;  1TAQ A;  3ZZZ A;  4DOZ A;  3CDU A;  4EGL A;  2WVC A;  2OEM A;  1B70 B;  1VHF A;  1VRQ C;  3AOA A;  3FSY A;  1KFS A;  3RR7 A;  3R6L B;  5E5N A;  5JVG Q;  3MUT P;  3TUJ C;  2OEL A;  1AFJ A;  1XNR J;  4NX9 A;  2VC1 A;  2N4C A;  2W9B A;  2B9X A;  2KKH A;  2B56 A;  2Z2L A;  3DRS B;  4MKB A;  2PSZ A;  3B8H A;  4DSK A;  1TMM A;  1KBR A;  1SUQ B;  4TQR A;  4ZVH A;  1L3T A;  2Z2M A;  1U2C A;  2F3J A;  5F0W A;  3TRG A;  4DSJ A;  1I3O B;  2DGS A;  1S1X B;  2XMU A;  1PYT A;  5FLX Y;  1UZD A;  1NK0 A;  3PW5 A;  4FYD A;  1CUL A;  3UD4 P;  3Q24 A;  4KT0 C;  2DR7 A;  4N77 A;  1Y0H A;  5D6G A;  1TL1 A;  5I42 B;  3EGV A;  3RJM B;  2QA4 S;  3IBW A;  1GMU A;  3A8I A;  2ZOM A;  1XNQ J;  3ZZY A;  1EX8 A;  1QVF R;  4NI2 B;  1RTI A;  4KH0 B;  1EAY C;  2KZM A;  1FER A;  2RQ4 A;  4NA2 A;  3M6X A;  4KFB B;  3D6M B;  3FJ2 A;  3GJS B;  4CT9 A;  1E6Y B;  1YQH A;  3I32 A;  4CO0 A;  2W2P P;  2MZS A;  3M9O B;  2FTR A;  2V0N A;  5ITH A;  4R8U A;  3I0R B;  2CVE A;  2FVQ A;  4QR0 A;  2MQO A;  3UCZ P;  2BYC A;  4DWI A;  2KYZ A;  2FVR A;  2CVI A;  5EGY A;  2PD1 A;  4NYO A;  3D66 A;  2RNE A;  1JLF B;  2HVE A;  2RS2 A;  2IRY A;  4M5H A;  3ZXW A;  2XYG B;  2FHM A;  4PPZ A;  4DR6 J;  2O3D A;  3JTP A;  1NB7 A;  3L7U A;  4WFB Q;  5I3U B;  4K0K F;  2HRT A;  3I5A A;  2GAH C;  1TUW A;  3JAM U;  4JI8 F;  3GG0 A;  2Q3P A;  3WDO A;  3DFE A;  4J9S A;  2RML A;  4F4K A;  2HG4 A;  3MMB A;  2XGQ A;  3RAM A;  2CPH A;  3TO8 A;  1NDP A;  1S6P A;  4A8Q A;  5GAE U;  3OFF A;  3IAM 9;  4N8O A;  1RT1 A;  4ECT A;  4GO5 X;  3G2X A;  4DUY J;  4F0H A;  3V6K A;  4WIQ A;  2JFD A;  4DS4 A;  1U26 A;  1HWU A;  2LDY A;  1VI7 A;  2MJU A;  2V4R A;  2PE8 A;  1UMJ A;  2D3Z A;  3HKW A;  4XDD A;  5KTQ A;  3OXL A;  3L95 X;  2M52 A;  1U1N A;  2ZH4 A;  1HIY A;  1JX4 A;  1P6T A;  4KGZ B;  4HI2 A;  2ZBR A;  4OYX A;  2LU1 A;  5KFE A;  1NJI T;  3QMQ A;  2MGZ B;  4F26 A;  5EDW A;  3C19 A;  2P8I A;  3DYA A;  5CYQ A;  4KE5 A;  3T1A A;  3BZQ A;  1JLC A;  2NPI A;  3DMJ B;  2E9Z A;  3KKF A;  4LBI A;  1HHQ A;  3MMC A;  1X9M A;  4MIA A;  4P7T A;  4URQ U;  5F8I A;  4DEZ A;  2VON A;  3FQK A;  3KJF B;  3K59 A;  5C5J A;  5J2N B;  1FES A;  2LKZ A;  5HMX A;  2A2C A;  4GRS A;  4MKA A;  3OTC A;  5HSP A;  1W2B R;  3CO9 A;  4ZA1 A;  1PJ7 A;  2QX0 A;  2MLX A;  1HQE A;  1X5S A;  3Q8S B;  1U6Z A;  1HR0 F;  5HRO B;  4LF2 A;  4K4U A;  2V68 A;  2VOD A;  4NYZ A;  2IBO A;  3PO5 A;  1BC6 A;  3HFV A;  2YNF A;  2VBZ A;  2OHD A;  1IWG A;  2NUH A;  1IBC B;  2CPY A;  3WC2 A;  5L9N A;  4NLD A;  2E29 A;  2VA2 A;  2OGU A;  1KHV A;  1CC8 A;  1RAB B;  4MYU A;  2LCW A;  1W7W A;  2HNY B;  1RWK B;  3B54 A;  4Z7C A;  2KL8 A;  2XLK A;  4M5M A;  4DX6 A;  4ELV A;  5CA5 A;  3PJX A;  2VIH A;  2CQ3 A;  3C6U A;  2BAN B;  1DTQ B;  4FDF A;  4NXM F;  2VB6 A;  3V5R A;  2ACY A;  3VGU A;  5H9F J;  4GKJ J;  4MMO A;  3EPG A;  4ZS6 A;  4ID5 B;  2YXL A;  1QUP A;  2IJF A;  4Q7A A;  2WBR A;  1RWP B;  2LFV A;  1IWA A;  3MEC B;  4NEY A;  2GFF A;  3NL0 A;  3QBC A;  3W9H A;  3ONQ A;  2V63 A;  1RP5 A;  1UFL A;  3RYL A;  4JYA F;  4YB5 A;  4RPF A;  3BEG B;  1J5O A;  1JXV A;  4ZCM A;  1NH7 A;  2GIQ A;  2Z4P A;  2C22 A;  2IVY A;  5M2U A;  5DO2 A;  4QIG A;  2UUC J;  3HT3 A;  2J6S A;  1R8B A;  1X9S A;  1S9F A;  3M2U B;  1P1L A;  3ISZ A;  1S0M A;  2HS3 A;  1S72 S;  2RUG A;  1MU2 A;  3CIZ A;  5J2M A;  3PRV A;  3EPI A;  2GHP A;  3MOJ B;  4P74 A;  3JSR A;  2B4P A;  1R43 A;  1ZYQ A;  4UY8 T;  1U0H A;  3ZZT A;  1F60 B;  3PIO Q;  3GV8 B;  2IPO B;  5DG8 A;  4U67 Q;  4WF9 Q;  4RUC A;  3RBD A;  5KFJ A;  1TKX B;  4B9T A;  3V2U C;  2KJW A;  4CLK A;  2GW8 A;  1HI8 A;  3B82 A;  3G8S A;  1JLA B;  5GAH U;  3MEG B;  4QPX A;  5KFA A;  1X9W A;  4I1T A;  1UJ4 A;  2C2K B;  1LWE B;  3HM9 A;  3BKU A;  1K1S A;  2LU2 A;  3M8P B;  3QJL A;  4F7V A;  1XJW B;  4RUA A;  5J1P A;  4TLR A;  4LSL B;  1YRU A;  3CCM S;  3NEK A;  2AJF E;  2UXB F;  3HVA A;  3KG0 A;  5B0A A;  5CYJ A;  2BKO A;  3ZFV A;  5D0R A;  1FXR A;  3MAA B;  4C98 A;  4JI6 J;  2Q6B A;  1RKI A;  2G9O A;  2F4V J;  1FD2 A;  2HQC A;  3T1H J;  2IRX A;  3PKM A;  5EX3 A;  3PY8 A;  4HHU A;  4WYW A;  3CNQ P;  3MDF A;  1YBU A;  3MD1 A;  1RU2 A;  4R0E A;  2EWH A;  1FRH A;  4NCG B;  1UZH A;  1YJR A;  5KFI A;  2YY3 A;  2OSR A;  2DRB A;  3VAF A;  2ZBQ A;  1L5U A;  1NHU A;  4PG7 A;  4X4U A;  2XZD B;  2HNZ A;  2BJ8 A;  1XK8 A;  1VQS A;  5KFR A;  1RT7 B;  3K0J A;  5KG0 A;  3M2V A;  3IBF B;  4A47 A;  3NOC A;  1WOR A;  5A76 A;  3DOK B;  1LFW A;  4DS5 A;  4X4V A;  3SQO P;  3OSN A;  1UP1 A;  1WSV A;  3PFE A;  5J1E A;  4ECQ A;  2GQ2 A;  1GX5 A;  1GFW B;  5D4O A;  2MB0 B;  5DZ6 A;  4UOG A;  2K06 A;  1I94 J;  2JL9 A;  1SI9 A;  2OPP A;  3FUY A;  4OYA A;  3CJ3 A;  1YRX A;  3MUR P;  2CDR B;  4OHV A;  3SYZ A;  2H65 B;  2XI2 A;  1HPZ A;  2PEB A;  1UEV A;  3QLH A;  2CPZ A;  4X4R A;  1FD8 A;  4IRK A;  4M5J A;  5IC6 B;  2NXE A;  3QGG A;  1HNV A;  3D1Q A;  2G0I A;  4L3N A;  4OYO A;  2C2O B;  1N34 F;  1ZM4 A;  2M9K A;  2HS0 A;  4F04 B;  4WE1 A;  2R7U A;  3CC2 S;  3N79 A;  1ZTW A;  3Q2S C;  3NLC A;  4AQY F;  2RDJ A;  3LAN A;  1HNI A;  2NXU A;  4PWD B;  1S79 A;  1QUV A;  4YOE A;  1J2V A;  4L3K A;  2IDE A;  4HYK A;  3D1O A;  4NZ0 A;  4FBT A;  2UUB F;  1F2G A;  2KT5 A;  1ZA2 B;  4LF6 J;  1P27 B;  3ILL A;  4CLZ A;  5ETS A;  2LEA A;  2GNK A;  2GVZ B;  2QA1 A;  1LXN A;  4UY8 5;  3BDP A;  3GYX B;  2CKW A;  2BOP A;  4KGK A;  1N32 F;  1FKA F;  2OUG A;  4NLT A;  2V69 A;  4S0M A;  3QAE A;  1JWW A;  4DL2 A;  5KT3 A;  3IGN A;  3ZZP A;  3J7Y U;  2YH1 A;  2DNN A;  2WW8 A;  3D4J A;  3R9L A;  2MQ8 A;  1VK3 A;  2VZ9 A;  3G8Q A;  1Q7L B;  1EP4 A;  1SCJ B;  2YPY A;  3KMQ A;  3KLI B;  3KHG A;  1TQL A;  4OIX A;  2GGP B;  2KM8 C;  1YTY A;  5FLX U;  1G2E A;  1L3U A;  4DUZ F;  1PYO B;  1WUU A;  4EU0 A;  2YWW A;  4FZV A;  3SSR A;  3BN4 A;  2J5A A;  2VG5 A;  2VKR A;  3GCW P;  1S0V A;  2MY7 A;  2MZQ A;  1IR2 A;  4I2Q A;  2Y0B B;  4KHP J;  5A8K A;  2C3P A;  2A3J A;  4J9R A;  4LVO P;  2DNL A;  3MM6 B;  5KG2 A;  2DNK A;  4EFA C;  4ZK7 M;  1D3W A;  6FD1 A;  2ZHA A;  4KIA A;  3FMW A;  1XER A;  1RA7 A;  5ETV A;  4JI3 F;  2RUS A;  2FYX A;  3KWM A;  4B17 A;  2MZ1 A;  4ZPT R;  4NWB A;  1JLB B;  3H98 A;  2A1B A;  4B3S F;  4L76 A;  3T1Y J;  1C0U A;  1NSA A;  2NYH A;  1ZS6 A;  3WX8 A;  1T3N A;  2CA9 A;  3PO4 A;  1WF1 A;  3OR2 B;  4HTJ A;  1RT6 B;  1PYS B;  2DYA A;  2QMX A;  2VQF F;  1TKZ A;  2EKN A;  1VK8 A;  4RNM A;  1VQO S;  3PX4 A;  4ZPC A;  4ECU A;  4ZPB A;  2J6T A;  2KI2 A;  2DEJ A;  3W9J A;  2E1C A;  4C11 B;  3UI3 A;  5LMU J;  4OL8 A;  4NLS A;  3LP2 A;  5KFU A;  5IT4 A;  2AHO B;  1YJ7 A;  1TKD A;  1H72 C;  2G2Z A;  3JYT A;  4J90 A;  3AXM A;  1FHT A;  1TK5 A;  4B9N A;  3GLJ A;  4KH1 B;  5C24 B;  1OSD A;  4FP9 A;  4P72 A;  3OBI A;  2MXY A;  3SZ2 A;  4C3K A;  1T9V A;  2LQB A;  4DR3 F;  4DL6 A;  3EM1 A;  2CFX A;  4FF2 A;  1WHX A;  3K17 A;  2UUW A;  3H90 A;  3L09 A;  3IG1 B;  5AE3 A;  5J2P B;  2HIY A;  4QYR A;  1R6V A;  4DSL A;  1T9Y A;  3F56 A;  2XGP A;  1FA0 A;  2W4C A;  4KYZ A;  1PG5 B;  2AMC B;  2KHD A;  1HBN A;  3BR9 A;  4X4S A;  2ATC B;  4DDF A;  3PEJ A;  2HMI A;  3IGV A;  4LRE A;  3A3O B;  1Y11 A;  2BE2 A;  1HBM B;  2VG7 B;  1IKV B;  4OV6 A;  1HD1 A;  3OW2 R;  2D41 A;  4BC7 A;  2AZ1 A;  1M1K T;  1RU1 A;  4AXI A;  4F02 A;  3H4B A;  2WOM B;  4IFV B;  3BQ1 A;  1UKU A;  1M5P C;  2WW4 A;  4GKK J;  2FJW A;  1RTH A;  2N3L A;  2VU5 A;  4EYH B;  5B0B A;  4LBH A;  2E5H A;  1RB0 A;  3US5 A;  1TV6 A;  4OZ1 A;  2RKI A;  2PC6 A;  3HCX A;  1NPK A;  3GIM A;  5HMZ A;  4HH1 A;  3K5O A;  1EJ7 L;  3QSY B;  4QWB A;  1ZZN A;  1X5O A;  1LWF B;  4JP8 A;  5F8G A;  3BS9 A;  3W62 A;  4C8Z A;  2DNR A;  1D9A A;  2ZHO A;  1PIE A;  4DSE A;  3BO4 A;  4HHJ A;  2CPJ A;  2HHU A;  3G6E S;  1KP6 A;  4LF8 J;  3G6V A;  4RW6 B;  3UO0 A;  2N4D A;  2RIL A;  3N0V A;  1S9G A;  1PO6 A;  5CYM B;  1K1Q A;  4NOH A;  5M2R A;  2ZE2 A;  5EWE A;  4M1K A;  1REV B;  3D0H E;  1Y9O A;  1VFJ A;  4UOH A;  5E3C A;  5LXR A;  3ZTR A;  4PXE A;  1GXU A;  1JB0 C;  2EKY A;  3KLF A;  3JS9 A;  4K4V A;  2BAC A;  3BDE A;  3ET6 A;  2XY5 A;  3EGW B;  4HH0 A;  4ECX A;  3JTO A;  4J9O A;  2UXC J;  3ISN C;  4IH6 A;  4HAC B;  2V8D A;  3BQ0 A;  4HHH A;  1TVR A;  3BGR B;  2D74 B;  2L41 A;  4ZJL A;  1BWV A;  1OQ3 A;  4RLE A;  1GTE A;  1ZAX A;  4TY8 B;  2I1R A;  3CIM A;  2R7Q A;  1HAR A;  1VYA A;  2E44 A;  1NZ8 A;  3QO9 A;  5KFO A;  3EVM A;  1FKO B;  1K73 T;  1N6Q A;  4C8Y A;  3O3L A;  3K8V A;  4ZP8 A;  4DFJ A;  3GII A;  2I9S A;  2FDN A;  1C2P A;  3MR7 A;  3FBF A;  5GMD A;  4R25 A;  1RGV A;  1QVG R;  4NZ6 A;  2AU0 A;  1VBK A;  1U25 A;  1WEX A;  2V4J B;  1G6B A;  4UOF A;  3TW0 A;  4DL0 C;  4DV5 F;  3MEK A;  3F0N A;  4OI2 A;  4DQQ A;  1X5T A;  4NCB A;  1EET B;  5DM6 Q;  2R7O A;  3TEG A;  4I56 A;  4DU8 A;  3AA8 A;  4UT4 A;  2RU3 A;  2HS4 A;  1YRT A;  1TL5 A;  4OI3 A;  2V2V A;  2VFS A;  1S4E A;  3JTN A;  5LOQ A;  2BUN A;  3CD0 A;  3AJ2 A;  3BV8 A;  5LJ3 Y;  4DCJ B;  2CRL A;  5E41 A;  2JEF A;  4BCA A;  3CCQ S;  4A8F A;  3DLK A;  5KFC A;  2H4Y B;  3HUL A;  2MSS A;  5GAD U;  5ETL A;  3V81 B;  1QSS A;  1KQG B;  1RWV B;  4DPO A;  2C3Y A;  2CQ4 A;  2ZWP A;  1B3T A;  2ATL A;  3QRQ A;  3R7S B;  3THV A;  1B7F A;  2R2S A;  1DY3 A;  4Z7Y A;  2YWF A;  2UU9 F;  3FK4 A;  2IYG A;  2HBZ B;  5ETO A;  2JVR A;  1SL1 A;  2SXL A;  3A3P B;  3G86 A;  3HVR A;  1H74 A;  3SI8 A;  3HJF A;  3PJW A;  2DNP A;  1JJ4 A;  3AB2 B;  5F8H A;  3HHL B;  2JEI A;  4G65 A;  3UD3 P;  3L7O A;  3AJ1 A;  5DM7 Q;  4XPE A;  5BR8 F;  3DLE A;  5JJB A;  4JI1 F;  1NHV A;  2JC0 A;  1C0T A;  4ZP9 A;  2DHS A;  2YVS A;  1WF0 A;  1FK9 A;  4JI5 J;  1S1U A;  1RXO B;  3CXC R;  2D3O 1;  4IUF A;  1CC7 A;  4M5N A;  2RVJ A;  2G13 A;  3DOM B;  4ZIT A;  2LXF A;  1PAE X;  2H5J B;  5AT1 B;  3T9Z A;  4LFB J;  1Q5V A;  5E3Q A;  2XS7 A;  4M95 A;  2Y3Y A;  2H54 B;  3NRB A;  4B3O B;  3EZO A;  3KK2 B;  4CCH A;  4NXN F;  1E6V B;  1NHK L;  1A6L A;  1SJF A;  2HHW A;  1SH3 A;  3NXZ A;  2JNJ A;  3HHL D;  3NAH A;  4RR5 A;  3DHX A;  3N01 A;  2QJ3 A;  1Y5I B;  4NLY A;  4OYP A;  3H5U A;  2GIR A;  3LWM A;  3W9I A;  1XBW A;  2HGN A;  5K14 B;  2ZDO A;  4CRJ A;  3RTV A;  2YWK A;  3F44 A;  1XWL A;  5ETN A;  2UUA F;  5HAO A;  5B0C A;  3L7P A;  2C2D A;  1PC5 A;  3DRS A;  4B3R J;  5T41 A;  1SV5 B;  2RSQ A;  2QTW A;  4Z37 A;  2GMJ A;  1HWK A;  1RAA B;  3CSK A;  3FCV A;  1S1X A;  5IOL A;  3HT0 A;  1LEO A;  5KG6 A;  4OHW A;  4HTI A;  2ERR A;  3J80 Y;  4K4X A;  2VAS A;  2HND B;  3TVY A;  1BQN B;  1UFW A;  5H9E K;  2YWE A;  2VPW B;  3NS6 A;  2BOA A;  3SQG B;  5I42 A;  2BDP A;  3WX4 A;  3RZA A;  3TI0 A;  4W98 A;  3IN5 A;  2Q1L A;  3M1V B;  1Z4U A;  4NI2 A;  4ZVU B;  5F3Z A;  2VPY B;  5IXU A;  2J9D A;  4DI6 A;  1U2F A;  1PGZ A;  1M1H A;  4QIW D;  4KFB A;  2RRN A;  2VL1 A;  1YBT A;  4CLY A;  1FFS B;  1E6Y A;  2HUR A;  2ALY B;  1Z1Z A;  3A1Y G;  1X31 C;  5FJ4 A;  1F5C A;  2VFU A;  2W4P A;  3W5Z A;  2P9G A;  2IMO A;  2X3D A;  4KSE B;  3DN9 A;  4EBE A;  3LPY A;  2NXN A;  2HPU A;  3ICL A;  3EIC A;  3MZI A;  3I0R A;  1J5E F;  3SEO A;  2J0S D;  2X1G A;  5CCM A;  1G7C B;  3VGS A;  2MKS A;  2V50 A;  3SBM A;  4USH A;  3KHL A;  2DR5 A;  3I9Z A;  3VHQ A;  2I5J B;  2E66 A;  2DNM A;  1JMT A;  4GMK A;  1JLF A;  4RU2 A;  3Q2T C;  2CG4 A;  4DX7 A;  2N7Y A;  2GHV C;  4OX9 J;  1IN0 A;  3NWR A;  4JV5 F;  3MPW A;  1T3O A;  2V8P A;  3IRX B;  2MQQ A;  5I3U A;  2FJX A;  2V9K A;  3TAN A;  2HZC A;  1RAD B;  2NR0 A;  3BYP A;  4ELT A;  2WHO A;  5IT9 Y;  5AXM A;  5AJ3 F;  3W65 A;  3OLA A;  1NJX A;  3K89 A;  2IRU A;  2DR8 A;  3MMA B;  3P49 B;  5KFB A;  2KO1 A;  1SH2 A;  3RBX A;  5DDR C;  1Q5Y A;  1PJ6 A;  3QAU A;  1VMB A;  4LRF A;  2EK6 A; 
#chains in the Genus database with same CATH homology
 2UU9 J;  4YY3 J;  5LMU J;  1N34 J;  4JI0 J;  4LF7 J;  4DR6 J;  4DV0 J;  3D3C J;  4NXM J;  1HNX J;  3D3B J;  1IBL J;  3J7A N;  1XMO J;  4LF4 J;  4GKJ J;  5BR8 J;  1FJG J;  4GKK J;  4B3R J;  1HNW J;  2KVQ E;  4PWW A;  4JI1 J;  3JAM U;  4KY3 A;  4JI8 J;  2UXC J;  3R2C J;  5IWA J;  3W1Y C;  5LM7 E;  4JI2 J;  4KHP J;  4DV3 J;  4X65 J;  2VQE J;  4JI5 J;  4B3T J;  2UUB J;  1XNQ J;  4LF9 J;  4DR5 J;  1N33 J;  4NEY A;  4X66 J;  2HHH J;  4K0K J;  4LFA J;  2UUA J;  3IMQ J;  5IT9 U;  4LF6 J;  4DV1 J;  4AQY J;  1J5E J;  4OX9 J;  3J80 U;  4V1A k;  4LFB J;  4DV4 J;  4DR4 J;  1XMQ J;  4DR7 J;  4DUY J;  4DR2 J;  4JI3 J;  4DV7 J;  2UXB J;  2MTL A;  2UXD J;  3J81 U;  1IBM J;  4X62 J;  4DV2 J;  4LFC J;  4NXN J;  4B3S J;  1I94 J;  2UUC J;  1N36 J;  4DR3 J;  1XNR J;  1HNZ J;  2ZM6 J;  3T1Y J;  4RJV A;  4B3M J;  4YHH J;  4JI6 J;  4LF5 J;  4LF8 J;  4JV5 J;  4KYZ A;  2F4V J;  4JYA J;  2MQ8 A;  2VQF J;  3T1H J;  2E5L J;  1HR0 J;  4HHU A;  1IBK J;  1N32 J;  3R2D J;  5AJ3 J;  3OTO J;  4DV5 J;  4X64 J;  2MEW A;  4NEZ A;  5LMN J;  2KL8 A;  4DV6 J;  4DUZ J;  4DR1 J;  5FLX U;  5A2Q U;  4JI7 J;  4JI4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...