3T1YJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3t1yJ00
1IBKJ 3JAMU 1N33J 4NEYA 4DV0J 5LMNJ 4X65J 2VQFJ 4B3RJ 1XMOJ 4JI8J 4JI6J 4V1Ak 4DR7J 5FLXU 4NXNJ 2UU9J 4LF8J 1HR0J 5A2QU 2MTLA 4JI3J 4LF9J 4JI0J 2ZM6J 4OX9J 4KHPJ 1N36J 4KY3A 1N34J 3OTOJ 1XNQJ 5IWAJ 3J80U 1N32J 2E5LJ 5BR8J 4X66J 4LF7J 2UXBJ 4DV7J 4B3MJ 4RJVA 4HHUA 4DR4J 4DV6J 4JI1J 4NXMJ 4DR5J 3D3CJ 5IT9U 3IMQJ 4X64J 3R2CJ 2MQ8A 4AQYJ 4JYAJ 4DV5J 4K0KJ 3T1HJ 4LFCJ 1HNWJ 4LF5J 4YY3J 4JI7J 4JV5J 4DR2J 1IBMJ 4GKKJ 2VQEJ 4NEZA 4DR6J 4LF4J 1I94J 2MEWA 2UUCJ 2HHHJ 4DR1J 4KYZA 2F4VJ 4JI5J 1XNRJ 3T1YJ 2UUAJ 3J7AN 5AJ3J 4DV1J 4JI2J 4DR3J 4PWWA 4JI4J 4B3SJ 2KVQE 3J81U 4LFAJ 2UXDJ 4DUYJ 4LF6J 2UXCJ 1IBLJ 4DV3J 4X62J 3W1YC 3D3BJ 1XMQJ 2KL8A 4LFBJ 1HNXJ 1HNZJ 4DV2J 1FJGJ 1J5EJ 5LM7E 4DUZJ 4B3TJ 5LMUJ 3R2DJ 4DV4J 4GKJJ 2UUBJ 4YHHJ
chains in the Genus database with same CATH superfamily
5EWFA 1IBMF 4WKRA 5HVGA 3OFGA 2DR7A 1RT4A 2W01A 3ZZ0A 3J81Y 4BC9A 3Q0AA 1S1WA 2VQFJ 5J1EB 3EJMA 1RHUB 5GVQA 4ZITA 1WC5A 2BKPA 4X4SA 2DD8S 3D0GE 2XLJA 3LW5C 3CCLS 2HNYA 4KSEB 1UWAA 3PTWA 1HARA 1S1UA 2RUGA 2RRBA 4ZN1A 1CJVB 4DPUA 1U7LA 1X31C 3I0RA 3BR8A 3CCRS 4Z2XA 3Q8VA 1NHUA 4ZJOA 1IKWB 3H90A 1SB6A 4PXBA 5KG1A 1XC9A 2DNQA 4JI0J 2KT5A 4OX9J 2BXJA 2JJ4D 3DYAA 3V4IB 3H2VE 3QLHB 4KY3A 2XHCA 3DXBA 3MM9A 5A0YB 1VRQC 3CD7A 1N34J 2RILA 2PGCA 1FA0A 3OXGA 2LQJA 2NPIA 4TU8A 4WK1A 2LLZA 5D6GA 1IKYB 2OSQA 4RPFA 2VG5B 2P6SA 2HFZA 4UZCA 5D4NA 4DPTA 3DLJA 1VIXA 2QEXS 1WWHA 1U02A 5D0HA 2XTJP 1M0SA 3TA2A 3AH6A 2FVSA 3WDOA 3TQ1A 2GO9A 2HQIA 3AOBA 3TAMA 4K4YA 1BE4A 5HP1B 2E5JA 4GVLA 5K8NA 1EB0A 4GC7A 4F8RA 3OVBA 4KJIA 1B64A 4FYWB 1NZAA 5HQLA 1S7HA 1HHTP 5LJ5Y 3N5BA 4NXMJ 3FC9A 3PYFA 1V3ZA 1SC3B 3BF4A 3LH2S 1MWZA 3OW2R 2P9EA 1T95A 2DR9A 3QGGA 1IQZA 4AFFA 4B3TF 3W2VB 2GC8A 4CO0A 4YP3A 2HS3A 4WCEQ 2JVOA 1SJ1A 2VB6A 2Q6CA 3UNYA 3BH6B 3ZNUA 1RWKB 2EK6A 1I5OB 3LO3A 1JLGB 5F3ZA 1XQIA 2BBEA 4FPIA 4DWIA 2MPUA 4L72B 4P75A 5CHCB 4QYRA 2BJEA 4LF4F 3NKYA 3J81j 3MR7A 4JI3F 1RBOB 4LF9F 4B02A 4DR6F 3M2RB 3EPGA 2WZ1A 3MR6A 1VBYA 3DOLB 4LVNP 3EWGA 3R7NB 2MMYA 4P7VA 2ACMA 2JC0A 3DXSX 5DJBA 3MAQA 2ZD1B 1NPRA 2AEMA 1R0CB 5K8MA 1X60A 3IM9A 3KDOA 1T3NA 5KT3A 4IRCA 1GNKA 1Y5NB 2JH3A 3FZBA 3SV4A 4DQSA 1XK8A 4V19J 1TV6B 2J9EA 3EXYA 3DI6A 4I2PA 2MZ1A 3M4XA 2OPQB 3HHLD 3GIMA 1LW0B 1JLEA 3O1LA 1GMVA 1SIWB 2RT3A 2RQCA 3LP0A 3QFWA 3EVMA 2AU0A 3TNVA 1Q79A 4BLGA 1JLAA 2DRBA 2HVEA 2ZVIA 5LT5A 2FJVA 1Y9OA 4CIOA 1YJVA 2HGLA 3W1YC 2MQMA 3CCJS 2HWIA 3FBBA 5E3RA 1BLUA 2WBMA 3Q86A 2B5JA 4LSLA 3DRXA 3EZOA 1SC6A 4FVCA 2HNYB 3UR0A 2PIIA 3T1AA 2NYHA 3NXZA 4DU7A 3AOCA 4L73A 2GFFA 2R3VA 2FLLA 3FFIB 4DPYA 4NLQA 3KXDA 2DK2A 3MCMA 4F0HA 2XQCA 3M8RA 3G8TA 4ECWA 3A8KA 4YHHF 4DL3A 2DNKA 3K0JA 2CUYA 3ILOA 1EP4B 2EKYA 1B3TA 4DV4J 1YJ7A 4UUWA 1TTHB 2KXNB 1WEXA 4CLFA 1KDNA 4F0MA 2XLIA 2ZFHA 1YHQS 1UVMA 2ZUAA 5D15A 4RUAA 2E1AA 2J6UA 2CPXA 3C6TB 2YKMB 2W7AA 2R8IA 2VG5A 3CIMA 1D09B 2QL5B 2CZ4A 2V63A 4OZ0A 2XMTA 4B9UA 4V1Ak 4MKAA 4B9LA 4IR1A 1KP6A 2BRLA 3FSXA 5E3QA 3DDNA 2ADBA 1S6QB 2V68A 4FF2A 2OPRB 4YDXA 5D0EA 4DV3F 5HP1A 4QOTA 4OI0A 1LXNA 1YRXA 4LJMA 1EETA 1G6BA 5KFPA 3KK3A 2R8HA 4OLOA 3VF0B 1WOPA 2MYFA 3NGSA 4KH1B 4PR6A 2VKRA 3DLKA 3PEHA 4ZPCA 1WF1A 4DI6A 3VAIA 3SSSA 3H4BA 1N32F 2GHWA 2DEIA 2RKIA 2XZTB 1KWMA 1RAFB 3PW7A 4IOBA 1D9DA 4WZMA 2AZ3A 3MCSA 4MK7A 3J80U 2M88A 1QDUB 2WONB 4OHWA 2DNHA 4ID5B 3MI7X 4OMFG 3K5LA 3BN4A 4URSA 2XC9A 4Q8FA 4C8MA 4LF7J 1X9MA 3BBFA 4H4MA 4B3MJ 5CD4H 3JSRA 1WD6A 2ZITA 3TJ8A 2BE2A 2F9DA 4I6YA 4C0HA 2UUTA 5J2QA 1RYSA 2R7TA 1LNQA 3RU0A 3PJXA 1VC6A 4ZHRA 1DY3A 2FC9A 3BV8A 3P5BP 4ZPTR 2MQQA 1TU0B 3TX8A 3OTEA 4RW6B 3W62A 4DV5F 2DHXA 4K0KJ 3UDLA 1TAQA 2L48A 1VJWA 2DH9A 3PW4A 3DNCA 5A6PA 1YQHA 4LF5J 2AEJA 2OPQA 2F7VA 2YNFA 3ZFVA 4IH7A 4TY9A 5IOLA 5EX0A 3PW5A 4EEYA 2NXNA 3CCMS 1IBMJ 4GKKJ 3ENWA 4KHPF 4YQWA 2E1MC 3RBZA 3HO1A 2VKZG 4LF7F 2J9DA 3CGIA 2MEWA 2WAQD 1RTIA 4OJ1A 4WFXA 3NGUA 3W9HA 2HHUA 4I1TA 4IOCQ 4ECSA 2PI4A 1D8ZA 2B5JB 2R7RA 1UA0A 3DC2A 1F5BA 2BE7D 3QWUA 5ETVA 4RNNA 3CCVS 3A3NB 7FD1A 2HFOA 5D8HB 3BYRA 1IUJA 5DRKA 5KT7A 2BANA 5LSLA 4F25A 3MXHP 3GFZA 1NMEB 1RXOB 1GT8A 3F0NA 4ALZA 4LFAJ 2YKQA 2C2ZB 1TK8A 4NLWA 4CYUB 5E5NA 1WC3A 2X1GA 2CDQA 3RBXA 3VGVA 3TVZA 3I5AA 4K5RA 3M2UA 5HL7Q 3CJ4A 1REVB 2D69A 3C16A 1HI1A 5B0AA 2C2RA 4I7FB 2W9BA 4X62J 1XWLA 4NLTA 3BB5A 4MAKA 1NK9A 3TI0A 2RDIA 5KG7A 2R2UA 4KAIA 1Q7YT 2RSQA 2VL1A 3OL8A 4WPAA 3GV8B 1LWCB 2XBPA 2POKA 3PHTA 5KFVA 1U1NA 2VPWB 3E51A 2RD5C 4J9VA 4CO1A 1DARA 1SV5B 4NZ7A 1EARA 5HVHA 5CCLA 2CJ9A 4QQBA 4CLWA 3S7RA 1KTQA 3MR2A 4PWDA 1OPZA 2DB1A 2GVDA 3GWCA 3I9ZA 5J1NA 5KG6A 4Q2LA 1QD1A 2Y0BB 4A48A 4JI0F 4DCOB 2G1HA 2KG1A 3NP5A 3ZNJ1 3JSBA 4O44A 4DL2A 4P2MA 2OPSB 3EGWB 4R5PB 4L3NA 4O23A 5KFSA 3ZTOA 4AXJA 1SKWA 4C8ZA 1N33J 2E66A 2H1YA 4ZOSA 4X65J 2CQHA 3GJTB 5B0GA 3A3PB 4EYHB 3D6HB 4QJVA 2B4OA 2Z57B 2EK1A 3WQPA 2ZH4A 1L5UA 1KEKA 1G3OA 4WP8A 4M94A 4EUVA 3D66A 4J9QA 4ETZA 2VFUA 1N6QA 1HKAA 2M4MA 5DLFA 2D41A 4B3RF 4MYTA 4O3SA 1QM9A 1UFKA 3VAGA 1CEZA 4ZP6A 3TZZA 2H5IB 2LEBA 1WI6A 5GADU 2MSTA 1VQ9S 1X5SA 2XI2A 1RT6B 4FVMA 4O3PA 2BV3A 1WOSA 2OEJA 1LK7A 5DO2A 1KVJA 3I0RB 4IH6A 2H51B 4ZHRB 1NZ8A 3VQSA 4R25A 2DGUA 3SIPB 3OFEA 1CS4B 2CJAA 2OI2A 1IR0A 4GKKF 4YB1P 4Q7AA 3PRVA 1W2BR 2E29A 1VBZA 4M63A 2OMLA 4I6AA 5LSOA 1ZYQA 1NJXA 1TK5A 3UCUP 1NSQA 2B43A 1I3OB 5F8JA 4DOZA 4LR7A 2LP4A 3P8BB 4XTTA 1FKPB 4MH8A 1YGYA 2DR6A 5EDWA 4UY85 1G1XA 1CPZA 2CQ2A 2O5DA 4FKXA 2PFFB 4I67A 4N41A 1S76D 4DR4F 1DTTA 2NUHA 4USHA 5EN1A 4DL6A 3NGKA 2DTJA 1FD8A 1EZZB 2BOAA 2G2ZA 3SV3A 1DLOA 5C25A 3R2CJ 4CNZA 2R4FA 1K44A 3VQTA 3MPYA 3NEKA 2VG7B 2ROGA 1R43A 4U95A 4ECXA 5HSPA 4DL7A 2IFXA 4RNFA 1VQ4S 3HHDA 2YBVA 4PG5A 4TLQA 2WHOA 1HYSA 2DT9A 1T3OA 1NK0A 1B70B 4WTYA 3TZYA 3BGLA 3FZ2A 4KO0B 5HJXA 1IKYA 1VI7A 4DFPA 2A2DA 5KFHA 1IR1A 2YX7A 4OI1A 2BUNA 3CIZA 3HULA 1T05A 3KLHB 3OSNA 3CMAS 2QMXA 3AD8C 5LOQA 3DGPB 5A8WA 1KQFB 2C2OB 7AT1B 3M8WA 1VQYA 4RWXA 1URRA 1ZAVA 2AKWB 3I0SB 4C97A 2ASJA 1U48A 1RCXB 4AL6A 5T7LB 3J7AN 3M2RA 2H4YB 4J9SA 3FMWA 5G4DA 3M6WA 4YUDA 3CD6S 1WACA 3QO9B 1IWGA 2FIUA 2EVZA 1APSA 1PO6A 3DLGB 3IWXA 3Q22A 4UOGA 3RB6A 2Y9HA 1JKHB 3PHEA 1Q95G 3HT0A 2O3DA 2AWZA 4OYBA 2HWHA 4B17A 1C4CA 2ZBQA 3PEJA 2W9CA 1FI4A 4Q8EA 3THVA 1S1UB 1VOMA 2VFTA 4NL5A 2FVQA 2RS8A 4R5PA 2H5JB 3K57A 2LU2A 1SXLA 2I1RA 2MY8A 3QMQA 4MYUA 2CJXB 3Q8UA 5C24B 3A12A 4M5KA 4LSZB 3VGTA 1RU1A 4UF4A 2KHCA 3DRRB 1UA1A 2KZMA 3GG0A 1TFYA 4DV2J 5M2UA 3R3TA 3UFCX 2HNDB 4ECQA 5J2NB 4K4WA 3W2WB 3H7HB 5L38A 4USIA 3ZO7A 3G6VA 3IWNC 1HWLA 1TK0A 1VIOA 1MG7A 2Z2LA 2CQ0A 3FRYA 4Q43A 3EYZA 1PSDA 2E9TA 1NKEA 3J7Z5 1SH2A 1B0VA 2YQ1A 4XIUA 1CJKA 1A0OB 2QA1A 1LFWA 1GK8A 2R7VA 1NPKA 5DZ7A 2V4QA 1TELA 1UZHA 2D74B 2COLA 3QFHA 4UQTA 4WWSA 4DFJA 3QAEA 1EP4A 3D54A 5ETPA 2L08A 3M2VA 4AXIA 2RF2A 4DL0C 1KVIA 2FJBB 2CPEA 1Y11A 2BJ8A 2XEXA 3HXMA 1XTZA 2J0SD 3HJFA 2ZDOA 3D1HA 4QYZK 4CCHA 3HHLA 4C8KA 1N56A 5AJ3F 3AXKA 1YX2A 2HGNA 3MM7A 3NBPB 2K7KA 2BE9B 3I31A 5K8OA 4U67Q 4X4QA 4HDHA 3KHHA 1REGX 4ANDA 2LA6A 2LDYA 2HKEA 4NA3A 1P9YA 5KFGA 5F8HA 4OLPA 3TR5A 2HAIA 4DX7A 5IS2A 2FZKB 1RAHB 2PMZD 5G0RB 5I3UA 4J9KA 4WP3A 4C8NA 2FY1A 3CCSS 5KFAA 2BANB 3DOLA 2R7SA 3IWLA 4OV1A 2CNNB 3RJMB 3J7A1 1RLCL 5AE1A 1HBMB 2WOMB 4C11A 2NXEA 3W2VA 5DQIA 2PI5A 2WVEA 3OTOF 1NSKL 4DQIA 5BJRA 2C22A 4K8RA 4DLEA 1T9XA 2QRRA 3GIRA 4W98A 2V2VA 4GO7X 1T9TA 4OJGA 2UXBJ 1UW4A 1HBOB 2H48B 3QGPA 4I64A 3AB2B 2V94A 4HHUA 3SDEA 1KOOA 2C28A 4MK9A 3CMQA 1RHMB 1RJJA 2MHEA 2YWHA 3UO0A 4IFVA 1RAEB 1YJWS 4ZVEA 3RZAA 3AODA 2R42A 3UQSA 3V6HA 3DN9A 4DUTA 4KGZB 1BQMB 2V9WA 3GR0A 3FK4A 4O3QA 4IRKA 4RBVA 1RWMB 1KVKA 1LWXA 3QBCA 3K59A 5KFMA 5KT5A 4EBEA 3FKBA 4HDGA 2KZZA 4MIWA 4M5MA 4LSLB 1FXRA 5K20B 2DH8A 2SXLA 5KT4A 4MKYA 2D3OR 4JV5J 4ZCLA 3GTYX 4PPZA 2V2ZA 4C6AA 5JMNA 3V81B 2UUCF 3B78A 3MEEB 4I2QA 3VWSA 2HVIA 1A9NB 1IM4A 1C1CB 1O51A 2D9PA 3K7RA 4QR1A 1HHQA 5HAOA 3GYXB 3TEHB 4ES3A 5HROA 2P9GA 4H4MB 2BZ2A 2D3UA 3RBDA 4ZN3A 1U1RA 2BYCA 1TKDA 2DGXA 4YOEA 3AA9A 4NZ0A 1WKJA 2UUAJ 1A7GE 4OHZA 1S4EA 4LFCF 5M2PA 3KG1A 2JX2A 5CXTA 3HSDA 2K8GA 2A1BA 3IC1A 1WF0A 2W8LA 4DR3F 3T5HA 1RYRA 2GMLA 3CJ8A 5ETTA 1HBUA 4QZVB 4DUYJ 3RAXA 2ZZTA 3M30B 4N7TA 4OI6A 2FPHX 3SFUA 1Q53A 4B9TA 2BM0A 3EDRB 4P74A 4USJC 3N0VA 1N33F 3CJTA 4IDKB 4P72A 1IBLF 3O44A 1GX5A 1HWIA 4F67A 4PXCA 3FEXB 1FK9A 4G1PA 5FDLB 4CZCA 5BR8F 1QAIA 1RZMA 1NXIA 4CLPA 2HPUA 1RWUA 1UZDA 1N5TA 3ISND 3BPSP 4PCQA 4JUZA 2KRBA 3HHLC 3J7YU 1G4CA 1U47A 1I6JA 2HHSA 1AYEA 3D6MB 3CJQA 4U7UK 4DV1F 4XK8C 3WIVA 2W4DA 3C6TA 4KHMA 1FKPA 4ELTA 1UTAA 3D5MA 4F26A 3ENVA 3OR1B 1P8GA 1PBUA 1UEKA 4KGXB 1O5JA 5LM7E 1XMBA 1JJ2R 4RW7B 2ZM6F 4OYXA 3U27A 3MMAB 2W9AA 3NCRA 1KSPA 4NCBA 1RKIA 3R2DJ 1JLBB 4YHHJ 1NKBA 5HVFA 5DQGA 3SQGA 2UP1A 3Q8YA 1IJEB 4TYAA 2I2YA 1WEZA 2OUGA 1RK8A 3QZ8A 2C3YA 2ZUGA 3CCWA 1PAEX 1P9QC 3FGVA 2YTCA 4ZPAA 1NBEB 3VV2B 2DXFA 3LTOA 3RB0A 2ATLA 1PGZA 1Y0HA 4OZ2A 3UD3P 1FEHA 4KQZA 4NX9A 1B99A 3O3LA 3L95X 4ZKAA 4CO4A 2HHVA 2ZC4A 4L3KA 1WC6A 2WONA 4ZLNA 2EC0A 5A8KB 1V3SA 3NOCA 2BR0A 4HR2A 5DETA 5FD1A 1SQGA 5A2QU 1BGXT 2KVIA 3I0SA 1HQ2A 4LQ9A 4OFZA 3WX8A 3PR4A 5L1IA 4F4WA 2ZM6J 1NRKA 2C2DA 3B82A 2NXJA 5JVHQ 2H54B 1OPIA 1C1BB 1KQGB 4M5JA 1MMDA 4R8UA 5KFBA 2KKHA 3BPDA 1RDRA 3PIPQ 4ED2A 3NNCA 1X4AA 1S6PA 4UTGA 2EW9A 2VHGA 2MQLA 2BJ9A 4GRSA 1JNZB 1U6ZA 3MEDB 3G9CA 1FVSA 3GIJA 2QMWA 3SCKE 3JB9k 1CSJA 2P5VA 2BEFA 4L6V3 3B8HA 3QLHA 4OX8A 4ZVUB 4NYOA 2NUUG 4FBTA 1FJCA 3FDSA 1CQNA 4YMEA 3MAHA 2Y1JA 3G6ES 3HKWA 4LR8A 3QRQA 1S1TB 1XN9A 2XS5A 5K14B 2QLFB 1KLNA 1UVNA 1O8BA 4A8KA 1NHVA 4CRJA 4XPCA 1FXLA 1RTIB 4QW9A 1NDLA 4CWBA 4Q0BA 3D9BA 4LFCJ 5RUBA 1PJ6A 1S59A 4FXDA 4OL8A 3NMAA 1H7WA 3T9NA 2HEKA 3R5CA 3HKZD 2IM2A 5E33A 2ZJQQ 3W64A 4C3KA 1OSCA 4OZJA 1EKRA 2HFVA 2HAFA 1UETA 1SV5A 3KFWX 4J37A 3RBEA 1SKSA 5GAHU 1DAXA 1FTCA 3FEYB 4NE9C 5L1JA 4NMLA 4ZP9A 1O0PA 3R5GA 3BQ0A 2CZ9A 1HW9A 2LQ9A 3DCAA 3IRXB 2HQDA 3NS5A 2W9BB 1TV6A 1K9MT 2OIHA 4LF5F 2OTJS 2Q66A 2YNIB 3AXMA 3IS9A 2ZHAA 5C2CA 1R8BA 3NCPA 2G1DA 4FYXB 5HBMB 1RE1B 2KH9A 1CULA 3BS9A 2XHWA 4K4UA 1RABB 3X1LB 1RGVA 1SIZA 2NCKL 3PVXA 5J2QB 4C8YA 1MWQA 1VDHA 3M32A 5B0DA 4X65F 4O3RA 1YSJA 1MN7A 2UXCJ 2VJVA 2EPIA 1D1UA 1OS5A 1UCNA 5I3UB 3OL6A 5FDLA 1Z2ZA 3I5BA 4EO6A 1HD1A 2VIHA 3TARA 1HIYA 2A18A 2CJQA 1KQKA 3DI6B 3GFYA 2DHHA 5F9NA 2P8IA 5KG0A 3L09A 3W5ZA 3OL9A 1M1GA 2DHSA 1RI7A 1HNZJ 2FLPA 2FY8A 1Y3JA 4WU2A 2XI3A 1SUQB 2FGCA 5DZ6A 3AQPA 2EFQA 3VZHA 3DLEA 2D1CA 3GV5B 1KNZA 1LWFA 4K4SA 1DJ0A 1NNDA 2GQ2A 2IAJA 1TMJA 2R2RA 3UCZP 4HHHA 1QJHA 5KFJA 5HK4A 4X62F 3B6BA 4PG4A 2IPOB 1NK4A 4ED3A 4GKJJ 1RAGB 5LMUF 5I42A 2B4VA 4QR2A 4FYVB 4RUHA 4O0IA 4I69A 1MMLA 3MUTP 2ZHBA 2ILYA 3N4WA 3CJ2A 4F7VA 1WTBA 4DSIA 9RUBA 2DHGA 3W5YA 2B3TB 2BVZA 3THTA 5CYQB 1H2VZ 3GJQB 3ZZTA 5M2RA 1R89A 4UT4A 1KD1T 4JI6J 2OEKA 3MEGA 3W63A 1NJZA 3NL0A 3ICLA 1WDTA 4Y2CA 1S12A 5J2MA 5FLXU 1TKXA 2J9DE 5BYSA 3FSYA 2L9DA 3R5BA 2J8AA 1L3UA 2R9LA 2XLKA 2KT2A 3CULA 3MD3A 5KFFA 3BGRB 2WB4A 3FQKA 3IXQA 3E2EA 1IQTA 2HRUA 1NU4A 3B4DA 3WZ0A 1QAYA 3DHXA 2CQ4A 3KJFB 3LWLA 1S6PB 3ET6A 1D9FA 1OIAA 1C0UA 4NI2A 3OR2A 4NCGB 2R7WA 3DRPA 2HBYB 4XAKA 2Z0GA 5ETRA 4DSEA 2RJZA 3FBEA 2NSBA 2HFNA 4OHVA 1Q16B 5T7LA 2XMAA 2X1AA 1QSYA 1M5KC 5KAKA 2BKNA 3KK2A 1RT5A 3MM5B 3PRBA 4DS4A 3JTNA 1OY9A 2V8GA 2R8GA 3BBBA 1S1XA 2V6AA 3DGVA 2J76E 1X4CA 3KDNA 2GHVC 4DV6J 1T05B 2DGVA 1HLWA 1FRLA 3NGTA 2HBQB 4YB7A 2R7OA 3IMQJ 1TMMA 2HQFA 3ENQA 3HSJA 3IRXA 5IC6B 5I3PA 5KFRA 3WX4A 2HIQA 3LALA 1ZH5A 4F02A 2B0GA 3IS9B 2MQ8A 3OLAA 4AQYJ 5CH7B 3QZ7A 4Y6IA 2IMWP 2QSWA 1HNWJ 4F2RA 4JV1A 3M8SA 1FCAA 2WK4A 1VC0A 1AUDA 3KTQA 2FJDB 3MM6A 5KT2A 4L76A 1Q8KA 2Z2YB 3KLEA 5H9FK 3VHQA 1UVLA 1FE4A 2W2OP 4DPXA 5L1LA 1DQ8A 2W8KA 1SH3A 1TP7A 1CBKA 3OTCA 1YKWA 3TUIC 4NZ6A 1PC4A 1NK6A 2KT3A 2F1FA 4OJ3A 2RRNA 1RT3A 2K06A 3CDAA 2CAJA 4ZLPA 3GJSB 4OZLA 2XG8A 2XCAA 3KLVA 2X1BA 1ZTWA 2F4VJ 1JLQB 3IAS9 5GAGI 5F8IA 2WTFA 4USTA 1URNA 1FNMA 1GXTA 1X4HA 3CJKA 4ENOA 1K73T 4JOUA 4Q44A 4PWWA 3G87A 3M2VB 2J6TA 3UN5A 4JI4J 4LQ3A 1E6VA 3M32B 2BW7A 3DOKB 1Z2LA 2MGZB 4EMDA 3PV8A 4DSJA 1Q5YA 4IG3A 1JJCB 1RTJB 1RWOB 4RX6A 1HNIB 1VQ7S 3TANA 2PMHA 1X4BA 4DV3J 3IM8A 2LMIA 1YJNS 3BYPA 4DV7F 3FNNA 1ZAXA 4RW4A 5D3GA 5E3PA 3K8VA 1V5VA 4Y65A 4DZ6A 5ITHA 1ZOTA 3BGOP 3LP2A 5HROB 4FKYA 3F56A 2FVRA 2DNNA 2W4CA 4A4JA 1FJGJ 2DO4A 3O6QA 4G1QA 4ITSA 2WRMA 1I1GA 2AYGA 4JI5F 2P6TA 3IGNA 2F4VF 1H74A 3EX7B 4ER8A 1M5OC 2DR5A 3BKUA 3Q8PB 1AFIA 2CNOB 4F0KA 2XSJA 3MM8A 2KM8B 4B3TJ 2KDOA 3UN3A 1H3DA 1RHKB 2BKOA 3H4DA 1EJ7L 1WHVA 3SXLA 2DGTA 4M1KA 1SC1B 6AT1B 3V6KA 2R8JA 2QLBB 3NGRA 1RT2A 4DHVA 3JS9A 5AXNA 2EBEA 4WFNQ 3JAMU 2ZJPQ 2V69A 4WIIA 5DDRC 2I5JB 4YFUA 2IMOA 5LMNJ 4DUYF 1UMJA 2IM0A 2KFZA 4Y28C 1XBWA 5AE2A 4C3MA 1C2PA 1RA7A 3SQGB 1F9EB 3OVSA 3TAQA 2RUSA 3PO4A 5HN0A 3V4IA 3GE9A 2IYIA 3T1YF 2DIUA 1S9GA 3QJJA 1TUWA 4FZVA 1S0OA 4CTAA 2B9YA 2FHKA 1JX4A 4LF8J 1VRUA 3A8EA 4EZ6A 1UPPA 1OYEA 4JI3J 4AUKA 4LF9J 1FHTA 4KGKA 3OD2A 2UVVA 4OI2A 4KHPJ 2ZH8A 1N36J 1JLBA 2IM3A 4ICLB 1SC4B 4DR2F 1YJUA 4O4GB 2BW2A 1I51B 3MURP 4ETXA 2ZOGA 1ZZNA 2V4JB 5GAEI 2YQ0A 4ZPWR 4LVOP 4HKQA 2WW4A 3LAMA 2OTLS 8AT1B 1PKUA 5B7WA 2PDAA 1RT5B 1N32J 3KLEB 9ATCB 4C8OA 4I4BA 1DTTB 3KNGA 3H98A 3LGMA 2QA4G 3WIUA 5MAOA 4IOAQ 2ZZMA 2F65A 3BM7A 1Q0NA 3JQKA 3KG4A 4X4TA 4YR3A 4OV6A 1YG0A 4RW9B 4CI0B 1TQLA 3QRRA 5AE3A 1PYTA 2A3JA 4MMOA 2C2EA 1YJRA 2RF2B 3IR6B 4B9VA 4LF8F 2K1RA 4E98A 1S72S 2CPHA 3PACA 4X64J 1Q4RA 2QYCA 3RAMA 5F41A 1CLFA 3GIKA 2DNPA 4ZVGA 2Y8YA 2WVDA 1FDNA 1S5ZA 3MMCB 4A8YA 4OIXA 4OYWA 1HI0P 4TKTA 5C5JA 2DYAA 4A8MP 4JI7J 3ZZUA 2AX0A 4RWWA 2I38A 2ZH3A 4DSKA 3CW2C 1N36F 4RZRA 4C48A 2CPFA 2RE1A 4Y2MA 3VVUA 2DBBA 3KMQA 5FLXY 5D77A 3D6FB 1SJQA 3KLFA 3M8PB 4ZVHA 1F9FA 3PR5B 1FK9B 2HVZA 3N5FA 1M1KT 2GJIA 2XZDB 3N28A 2XS2A 1GMUA 5CYMA 4CLUA 2QGFB 5HLFB 1RTDA 1FJGF 2KYXA 4USMA 2FJWA 2AJ0A 4B3OA 1TL5A 4N76A 2FHJD 2RHSB 2JHEA 5E41A 2NYIA 4NA1A 3U7JA 1TFWA 4C9DA 1AZSB 2EG2A 2WVFA 1CC7A 2WSFC 3MZIA 3IBFB 2K3IA 3N6NA 2ZOMA 3QO9A 4M5HA 3W66A 4WFAQ 5J2NA 4PWUA 4LBIA 1ZM4A 2IY5B 4LBPA 3RAQA 2W7OA 2VPYB 4R0EA 3BZQA 2ZOFA 4NYPA 1NJWA 5F8LA 1U49A 4K2XA 4D3HA 3NAHA 1DTQA 3GV7B 1XNRF 1GAOA 1TL7B 3DRSA 5C42B 1X8DA 3GQCA 4ZJLA 4DR1F 1UWBB 3EVWA 5L9XA 1P1LA 4I0WA 1YWXA 2XWXA 1FWLA 3MEDA 2QL9B 2GQQA 2VH7A 4KH0B 2YY3A 1BQNA 3M8YA 1R6YA 2QLWA 3GJRB 4HACA 3UE2A 1FFGB 3M6XA 5F9LA 2UUBJ 3ILLA 3SI8A 4J91A 1S4FA 2VQEF 1F3VA 4PYAA 4LF2A 4ZP7A 1NCLA 1TL1B 4F4YA 3Q24A 4DLGA 3MD1A 1KONA 1DURA 2JEGA 1FFSB 1CJVA 1C0TB 2GX8A 2MQNA 3H5UA 3QGIA 4UOCA 5FIIA 3U1NA 2ZJRQ 4AQYF 4MFBA 1OJ4A 2FHJA 2VBXA 4NOHA 4WYWA 4ZVQB 4X64F 1NK8A 2ZZNA 1SL2A 4C4WA 4QCLA 4DR5F 3P45B 3EE3A 3CCTA 1RT3B 2IA6A 2IVMA 2Y1IA 4GKJF 1IJFB 4QIEA 3RGIA 3D0HE 5J1EA 4O4GA 1HBMA 2KYZA 2WOMA 3ENAA 2X7IA 4M5IA 5IC4B 4OYOA 2G13A 4NRUA 5DG9A 2XO7A 2CYYA 2QLXA 4FPRA 2KFNA 4ZVSB 2KN4A 2C2NA 4OYAA 2JC1A 2CWKA 2HQCA 2BACA 5KFWA 3I5CA 2F9JA 4TNOA 2AD9A 1W7WA 2RH3A 2U2FA 3EDQB 3GCXP 3OR2B 4NCGA 3VCDA 4X4OA 3KJVB 3C46A 3DFEA 3KLGB 1BHNA 4HH0A 3ISZA 2RNEA 1FWPA 4A8QA 2XMVA 2VICA 2QZ8A 2M5YA 1JIHA 1HNVA 4Y34A 4KRWA 3KK2B 1FF2A 3T19A 3Q23A 1U2FA 2KJWA 4X4PA 5SZTA 4DR5J 4AYBD 5IT9U 4DV4F 1VBXA 1FXDA 4FYYB 1NH8A 2UXDF 3CJ3A 4G1QB 1OY6A 2UVRA 2HNZB 4N5SA 2M7SA 1NHKL 3GILA 2BJ7A 3JYTA 4JI4F 2GGPB 3DRYA 4JI8F 2EFGA 3QT6A 3G8QA 2ABYA 2CQGA 3C8YA 4N77A 2GVZA 3NAIA 1XNQF 3ZC4A 2JEJA 4ZPBA 3PFOA 1BMQB 2QTWA 1BC6A 1Q86T 1RWVB 3WHIA 3HVRA 4KIAA 3C14B 1BQMA 2YKOA 1QAJA 4DR6J 1SKRA 5LJ3Y 3OUYA 4LSNA 1ACMB 5D0GA 4KV8B 1TL3B 2O66A 4QWBA 1YRTA 1SI9A 5CYMB 4PG6A 5C25B 4JI5J 1HMVA 4QYZJ 1HQEA 4G3IA 4JV0A 2BRKA 4ED5A 2V34A 3UW1A 3W9IA 2M0GB 2XS7A 3R97A 4F3QA 2EWHA 3G82B 3PYEA 4K2JA 2CA9A 1RAAB 1JLQA 2CPYA 2CQIA 3LA0A 1JXVA 1ZM9A 4JP8A 3OPKA 1RT7A 2VC0A 4DX6A 2HWTA 5D0RA 5ETKA 2CPIA 5DG8A 1ZETA 1FESA 1PYSB 3EMTA 2D7SA 1YZ6A 2UUBF 2XMKA 3CO9A 2GHPA 2GIRA 3LGHA 3JSYA 4ZIWA 4B3MF 2H3EB 1MNEA 2JFKA 2DGQA 2V4JA 3ETMA 3POTA 2KRRA 3UVJA 2HZVA 3BSCA 5EWEA 2XMJA 1KFSA 2VOOA 3HZGA 3UD5A 5F8GA 2RB7A 1XERA 2VBYA 1U1PA 1RT1A 1KN6A 5B0BA 1Q8LA 2CVEA 3CWJA 4I2PB 1WNEA 5D4OA 5IT4A 1HNZF 2EC2A 2ZKUA 3ZXWA 4IYQA 2FVCA 5IT9Y 4FBUA 2IA0A 2OEMA 2DCLA 3PM9A 3D28A 3Q89A 4RNHA 2ZHOA 3ISNC 1N6QB 1NUEA 4DG1A 1U09A 2E5IA 2HURA 5L39A 2M52A 5ETQA 5IT0A 2JRSA 1TL1A 2VOPA 4NXNF 4F4XA 2HHQA 4ZS6A 1UAWA 4ZCKA 2OH2A 4PAAA 3TRGA 3A3OB 4ZK7M 1X0PA 3AAWB 1BY9A 3OXFA 5DLGA 3KOAA 1WI8A 2E1RA 4WFYA 3CEDA 3I32A 4FF3A 1X4EA 3ET6B 4O4RA 4C0OC 2EBGA 3VAFA 1SPBP 2CKWA 2HVHA 2MQOA 3R1HA 2B7CB 1EIYB 3KUGA 3Q8RB 3PJ9A 4FF1A 2KU7A 3T41A 4CQ1A 1RWWB 2ILZA 2IVYA 4DPOA 2IYGA 8RUCA 1IR2A 3KHGA 2XYPB 2AIRB 1WC0A 2X3DA 4BS2A 1ZPWX 3M8PA 1F9HA 1GTEA 2RQMA 4IQMA 1V9OA 2ZH5A 4IRDA 1F5CA 1RISA 2EKNA 1LFPA 2HGMA 3NS6A 2B4UA 1J5EF 3O2IA 2E1CA 5IV4A 2J7KA 1ULRA 3ADAC 1PC5A 3BKFA 4WFZA 1IVZA 2Y1LB 3SSRA 1HNXF 5FJ4A 4ZP8A 2UV8A 2DRDA 1YDLA 2MDAA 5IFMA 4HLBA 2CFXA 5KFNA 1H73A 1RWPB 1S1TA 2E7WA 2Z2MA 1GXLA 2ZKTA 2ZNZA 4HT5A 3Q8SB 4F2SA 4H4KC 1JLFA 2HRTA 3JXOA 1S9GB 2IBKA 3W60A 3OT9A 2E5GA 2EFNA 2C2MB 2HNZA 2HW3A 4PUOA 2P2CB 2VDIA 2OFGX 2B9XA 5F0UA 1EQ0A 4KT0C 4NLGA 2H65B 2KO1A 3HI9A 3LPYA 4KHRA 5J2MB 2C42A 1NSAA 5A0YA 3HD1A 3SSQA 2Z56B 1RWNB 2DJWA 4DFKA 1X9SA 4YY3J 2MZTA 1U0HA 2VBZA 1T7PA 1JNRB 1S57A 3BGRA 1IXKA 3CE8A 1FO1A 2RU9A 3F44A 4WE1B 3CJKB 4RNOA 3PIOQ 4DR2J 1RWXB 1R8AA 4RBTA 4C0BA 1UP1A 2NLWA 2R7QA 4YS2A 3GU0A 1CJUB 4TY8A 3TVYA 3VZIA 1N5QA 4H4OB 3TAMB 1X0FA 5KOWA 2X1FA 4U7UD 1N52B 2HHHJ 4YB5A 4RW9A 1S6OA 3M1VA 4IO9Q 4DQPA 2HQ3A 3I82A 2CXEA 4PEOA 4DSFA 2W1BA 1XNRJ 2LFVA 5CZXA 3MCOA 4TLRA 5D3GB 4JI2J 1RA6A 2FDNA 2MKHA 3OLBA 4ECYA 3Q8QB 3A13A 4WIQA 3BO2A 3H2UB 4K0KF 1RU2A 4Q2MA 2XYGB 1HPZB 2CADA 2VFRA 1S1XB 5HJYA 3MFHA 4CYUA 1NO8A 1S9EA 3K2YA 3J81U 1U6FA 2MKCA 3LUYA 3MMCA 1VHIA 4DF8A 5IQ6A 1E6YB 3RW6A 3UDVA 3CJ5A 2DEJA 3MUVP 2B56A 3CJRA 2G0CA 4QIVA 2RKIB 2XYHB 3ELHA 2QA2A 3FQLA 2ALYB 3ITHB 5HBMA 1WC1A 4CLKA 3MWBA 1FX4A 3T6JA 4QU7A 5E0OA 1NB7A 1HW8A 1RT2B 4BHQA 3A8JA 4ZLLA 3DU6A 5J2PB 3S01A 5A6WA 1R6VA 2ASDA 4ICLA 3OFHA 3UDCA 1G7CB 2V50A 2Y1RI 3KJNB 4LREA 2BQ3A 1EETB 4RU9A 3GG1A 4DV2F 3F73A 4QPXA 1QY7A 3NS7B 2BE2B 2IHR1 3TZWA 1RCOB 3P3DA 3ZZOA 3M30A 5H1SV 3CC4S 1TL7A 3SYZA 3CCES 1YJTA 3MOZA 1U25A 1V3RA 2UVWA 1VYAA 1WOOA 3HLUA 1IBKJ 5CYQA 2HHWA 4WF9Q 4LMZA 5LSRA 1SCJB 4JV5F 3MEGB 2Q6BA 4NLVA 2YKAA 2GIFA 4NRTA 2ZH1A 4O3OA 4J9UE 4LRBA 3E8OA 2W4PA 1MROB 3LP1A 2YWFA 3I56S 1RTZA 4JI6F 4P52A 4U8YA 2MGZA 1F5AA 1OY8A 1W2IA 1T9YA 2CPDA 2DH7A 2RMLA 3R6GB 4KC5A 5GMDA 4ZCIA 2KM8C 3D2WA 5L1KA 3SFGA 2U1AA 4LSNB 3TQEA 2OPPA 4QW8A 4TYBA 2C3UA 1FKAF 3DRPB 4RLEA 1H98A 4DU8A 1ITPA 4DN9A 1SL0A 4W90B 2XM3A 2AGPA 2GIQA 2KXHA 5ETMA 3DYAB 1PAUB 2B8QA 3F41A 3CCUS 2KTQA 4X4NA 3G82A 4WP9A 1QTNB 1DQ9A 1R0BG 2XSJB 5IWAJ 2QFJA 2MKJA 1GTHA 3EGNA 2EXUA 3MR5A 2XO6A 4HYKA 4GC6A 4P7TA 3MFIA 1QLNA 4XDDA 2NPFA 3E01B 4WK3A 3HVAA 2DNLA 1HBNB 1D9AA 3UWTA 1JLFB 4QWEA 5HLFA 2FD2A 1UJ5A 4ZPVR 2YVSA 2RDDA 4KBIA 3GYGA 3TVKA 4Y3CA 1L3VA 3DMJB 3BH7B 1S6QA 3U1LA 3CXCR 2CJYB 2L41A 2PO4A 1DLOB 1EX8A 3Q83A 3QSIA 2Y3YA 1NAQA 4DN0A 2B7BB 2FZCB 5HI7A 3MGJA 4ILLA 2G0IA 3PO5A 2MKSA 3OXLA 4A47A 2V4RA 2FC8A 3H40A 2K3KA 4DR7F 2HSEB 3W61A 2VFSA 5AXKA 2IVFB 1PIEA 3VAJA 5KFQA 3T1HJ 1B4SA 1X5PA 3EM1A 2G0JA 3O8WA 1XIQA 2BJ3A 5HO4A 3MPUB 1FERA 1NK5A 3TP2A 4UOFA 2NZ4A 1JLGA 1B0PA 1E6YA 3MAAA 4MKVA 4FS1A 1LXJA 3M6VA 3QIPB 3EUNA 4KKOB 4OZ5A 5DDOC 4LF4J 1RHRB 3TOQA 2W2MP 5KOXA 5CQGA 4DX8H 2L9NA 2AGQA 1KBRA 3K17A 1R0AA 3HK2A 1Y5IB 3US5A 4DL5A 4S0MA 4NXMF 3DOMA 2QT7A 3P6YC 2CQDA 3L7PA 3IR7B 4CNYA 4CH7A 2HS0A 1R8PA 3GFXA 4FNHA 4EO8A 3PY8A 3C66A 1X4DA 2GVDB 4IQXA 2V8HA 3CJ0A 5D4PA 1HNWF 1FRHA 1S77D 1FKOB 2JFDA 3R9LA 3KYLA 4NCAA 3KLIA 4V19X 1DTQB 2HVDA 3JQJA 1PCAA 3TYTA 4EI2A 3C19A 2DO0A 3FJ2A 5H9EK 4K50A 2UXDJ 2MXYA 1TR0A 4ID5A 2FHMA 3DGPA 4ZA1A 5A8WB 2LA4A 2QYGA 3B4MA 3W9JA 2I6WA 2PA3A 4C98A 5C24A 1NSPA 2J6SA 2QG9B 2CDRB 2OP5A 5T14A 2QJ3A 1PJ5A 2AMCB 1FRJA 2W7PA 3H25A 2FYXA 4X4VA 1FFWB 2OJ3A 3IR5B 4KV8A 1GXUA 2HRYA 3POTB 2DXEA 4ZVTB 4QWAA 3IAM9 3LPEA 1J5EJ 2MZRA 3V4MA 3CD0A 3KJQB 3UD4P 1Y5LB 4K7QA 2AT1B 4H54A 1LQ9A 3K89A 1D8YA 3FFIA 1I94F 2APOA 5GADI 2DPIA 2I5JA 4LF1A 2VD3A 3CTRA 3LQVA 1NJIT 3JSMA 3KLGA 2XB2D 1VQ8S 1ZA2B 2OAUA 3IBWA 2EEYA 2AZ1A 3NMRA 1NEEA 3QNWB 4OX6A 1U1KA 1WEYA 1R31A 2LECA 1G2EA 3DLKB 3ZTPA 4C7QA 3HVTB 1DHMA 1R3NA 2FZGB 3MM8B 3MPVA 4I7FA 4DXLA 1KLMA 4Z7CA 2AJ4A 4JI8J 3RB4A 2KG0A 4TU9A 2IM1A 3SZ2A 3JYTB 5B0EA 1S9FA 4OHYA 4MTPA 2VZ9A 3I4PA 1WSVA 2ZEJA 1FT8A 2YQ3A 2IRYA 1QSSA 2DISA 2HFSA 3TUJC 1S1WB 1Y00A 3OTDA 3UCGA 2AHOB 3HMJG 1Q5VA 4PRFA 3M1VB 4JYAF 5KFOA 1UL3A 1A6LA 4DG1B 3DLBA 4ZMMA 1M1HA 4DX5A 3BQ2A 2YKNA 2JLGA 4J9MA 4NWBA 4JV2A 5KFIA 3KHLA 2C2KB 4OYZA 1FJ7A 2XMMA 2VDHA 4PWDB 1RQ0A 2NQPA 2F8HA 4IKAA 4RW6A 4Z37A 4UZBA 4Q5VA 1NH7A 2Z8QA 5C2GA 1GEHA 1U1OA 1IN0A 2RS2A 2K1RB 3MMBB 4P2SA 4RJVA 3PJWA 5U47A 3LWMA 1T03B 3TEGA 4BWJA 1IKXB 2HHTA 1RKJA 2F63A 1Q8BA 4HH1A 1NDPA 3P49B 4YN3B 3TW0A 5DGBA 3CDWA 2ASYA 2JLEA 3K58A 1IM6A 4B3SF 2XMWA 1YBAA 4OZ3A 4JYAJ 4MFBB 4RNMA 3T5KA 1N5YB 2WW8A 3S6EA 2IDEA 1ELOA 1VC5A 2RVJA 2HMIA 4HEA9 3MF5A 3AB4B 1VR6A 2IC3A 2V2QA 3HSZA 5EWGA 1RHJB 3V81A 2W2PP 1VHFA 2X51A 2YNIA 3MM5A 1FRKA 3N79A 4QWCA 4NEZA 4OQJA 2VA2A 3EVOA 2YWGA 5DG7A 1K8AT 3LF0A 4WJBA 2M9KA 4WE1A 5AT1B 5B0CA 2ROEA 2J7UA 2LXIA 4KGMA 1UKUA 3IBCB 3DLLQ 2LQ5A 5H9EJ 4KYZA 4U6PA 3L4BC 2FGOA 1PYOB 4LUBA 5JJBA 3OL7A 3T1YJ 1YTYA 1FKOA 3IN5A 2ALZA 2E1PA 4U96A 2R7XA 3JTPA 3JQMA 4DR3J 2W2QP 4Y2IA 1SJRA 2KVQE 3HPOA 4CDIA 3QSYB 1MWYA 1K47A 4E2FB 1XR6A 2ZE2A 2VUGA 4ED7A 1MW7A 5JUMA 2DITA 2MLXA 2W2NP 3HCXA 2ZBPA 1T8EA 5B09A 3JSMB 1FNXH 1IBLJ 3AQOA 3NGDA 3CUNA 1U2CA 3RG6A 1HA1A 2MZSA 2Z58B 4RKUC 2HBZB 1ZM3A 1SJ4P 3GLJA 3ZZYA 4RR5A 1Q81T 3C16B 4IG0B 4CO3A 3IRWP 2VA3A 4L75A 4OZNA 1QTMA 4B9SA 3C2PA 5KFCA 3L3CA 2KL8A 3GCWP 4UW2A 1FTRA 3OQ2A 4PG7A 4TVAB 4LFBJ 2RQ4A 1JLEB 4YB6A 2QE5A 1VRTA 4GVBB 4JI2F 3GMGA 3N9UC 4X84A 1VCTA 2MKYA 2FQQB 3OR1A 1HQUA 4WBFA 1CS4A 1HHSA 3GSDA 3QGHA 1AZSA 3BDEA 3KNAA 4RW7A 4DZDA 2JZ5A 2OFHX 3ZTRA 2KFYA 4J9PA 3U02A 2HHHF 3SDEB 2AYEA 4J9RA 2XULA 3NNAA 1EAYC 1HYSB 4AL5A 1KHWA 2MHNA 3BR9A 4KO0A 3GYNA 1HNIA 1Y3KA 3QYYA 2M8DB 1VQNS 3MECA 1YI2S 1QUVA 3SQOP 3ULHA 5ADZA 1TL4A 4HTIA 1C0TA 1CG2A 2CQBA 2LU1A 3AD7C 4CLSA 3TUZC 2H4WB 4E8UA 3PX0A 2DY9A 5I4MA 2V8VA 4HTJA 3HM9A 1UEUA 1N0VC 1UPMB 2GAHC 2K7JA 3TX0A 1FD2A 1XMQF 2LQBA 3NNHA 3AJ1A 3MMAA 2B9EA 2CWXA 3BJYA 3SBMA 3QIPA 5JXSA 4EU0A 2N7CA 3BO4A 2JOQA 2BX6A 3MMBA 2MB0B 3L7UA 4RO0A 4PQUA 1U2RA 1IKXA 1LW2A 4FNIA 5KTQA 3C6UB 1VS3A 1Y4ZB 2ASLA 2Z2ZA 3ZZPA 1EQMA 1KHVA 3M8ZA 1DRZA 2QL7B 3NWGA 4TY8B 3KUEA 3SMZA 1XJWB 3A1YG 4I56A 1YZ7A 3VVTA 3OTOJ 3CCQS 3ZZRA 3FEZA 5C7PA 2LXFA 4IFYA 5HMWA 3AA8A 4ZLJA 5HMXA 3V6DB 2DKOB 4PPDA 4FDFA 2DRAA 4NLRA 3MEEA 1DQAA 2QIFA 3KUHA 3LP1B 3I87A 4WXOA 5IXUA 2VODA 2HNDA 1FEEA 3MPWA 3DM2B 3EXCX 2HLTA 4IH5A 4ED4A 4KFBB 1N4LA 1TVRA 3RW7A 1U0SA 2OD4A 3MPDA 3MTKA 2FB0A 2GGPA 1VQ6S 2AF6A 4M95A 1VFJA 2ZBRA 2VV5A 1YLXA 1CJUA 4QIGA 2AGOA 2N3OA 2B4PA 1TKZB 4DEZA 3M9OB 2VONA 4CM2A 2CZVC 7FDRA 2OKQA 4FS2A 4W4MA 4LRDA 1S99A 1ICEB 1UEVA 2VPXB 2ZWOA 1AROP 2JEFA 1LWEA 2ZE2B 5LMNF 2AX1A 3OUYB 4EYIB 3MDFA 2W25A 2BA9A 1WHXA 4MK8A 3A8IA 3DLGA 2VQEJ 5HQ8A 1MLAA 3MTJA 2QV6A 2M8HA 2CQPA 4M5GA 2W9CB 5K14A 4C2MA 4CT9A 2VFVA 3DOKA 1I94J 3WC2A 1HWJA 2JLFA 3VAKA 2UUCJ 3G86A 4FXVA 2GVZB 4P2XA 3DU5A 2KHDA 3KWMA 2AP6A 4K4ZA 2EFOA 4OYMA 3BEGB 3FBFA 5DGAA 3TWZA 4ECTA 4IFVB 1V6HA 5AXLA 3OHAA 4QU6A 3DDKA 1F2GA 3NG8A 3OJSA 1VQ5S 2Q3PA 2GW8A 1T9VA 1KR4A 2N4DA 1VLOA 3DOMB 3IP0A 4RW4B 3TAPA 3MUMP 1QSLA 4QIFA 5CCMA 4RW8A 2H9ZA 3M8QB 3MMJA 2ZH7A 1T9WA 1S0VA 2CVIA 3GPAA 2DNGA 3RRKA 2WVBA 4EFAC 2J0QD 1T0TV 3BDPA 1JQGA 4ZDNA 3J80Y 2AYMA 2MLYA 1F0XA 1PJ7A 1Q1KA 2OO4A 4LRAA 1JLCB 2DNMA 3OSPA 4NLPA 3PG9A 1NPPA 1S1VB 1VBKA 2A0FB 2HIYA 1W26A 3IA0A 5IQQA 1AT1B 1CULB 1BD6A 1BXNA 2VG6B 3CB4A 2CQCA 4F3MA 6FD1A 4DL4A 1CJTB 1LV5A 5HMZA 4OZ1A 1HWUA 2IIHA 2GQCA 3IG1B 5BYQA 1REVA 1VQKS 1VK3A 3W2WA 3FCVA 4J7CA 4WU3A 5DS7A 3DKDA 3UVJB 1JMTA 4ANCA 1EKSA 1UVKA 3TZXA 1AXQA 3PCOB 3FRZA 3PX4A 2A2CA 2ZH9A 1WG5A 2DIVA 4HL9A 3ZTQA 1HBNA 4AT1B 4J5OA 1YVFA 2V8PA 2PA8D 4O0NA 4LF6F 1F2HA 1QUPA 2KB2A 4IDKA 6FDRA 4ECRA 1HPZA 1JK9B 5IZHA 1H6KX 1S7IA 5E3CA 4K4VA 4MT1A 3R7BB 4Z7YA 3AY0A 3W8PA 5KG2A 2J0WA 2CJKA 1ZBTA 4NYZA 1FWKA 4U9RA 5BYRA 1RACB 2B6AA 3I55S 2YPYA 5MLCV 4NXNJ 2FHOB 5KFTA 1KLMB 2Y0SD 5J1PA 1UWBA 1JXLA 5LXYA 2XMUA 4X4RA 2OGUA 2YWEA 2UU9J 4A8FA 1K1QA 2V2KA 1UFWA 2CNLB 2DNRA 3V5RA 1N0UA 4OX7A 3BQ1A 3RB3A 1Q78A 1OMSA 1PBAA 1WHYA 1LOUA 1ZAWA 3R5DA 4XO0A 2C3OA 2IRUA 4N8NA 2R8KA 2F3JA 4IUFA 1U4BA 3AT1B 4DPWA 2A6MA 5HMYA 1NDKA 1QVFR 1BUXA 2VASA 3G8SA 3N6LA 3KKFA 1XNQJ 3R6LB 2DNYA 1SVDA 1RT6A 1W25A 2NXUA 3X3UA 3KK1A 4ILRA 1LWEB 2OMOA 4A8OA 4K4TA 2BDPA 3UN2A 5BR8J 1DBDA 4G1IA 2G2OA 5EGYA 4F4ZA 1L3TA 2F8MA 4KR0B 1UJ6A 4DQRA 4OJHA 5D4LA 1LK5A 4I6WA 3HVWA 4DV0F 2KJVA 5IM0B 5KG5A 4IG0A 3LOUA 4DV6F 1HBOA 3R1LA 1D0EA 5EX3A 4I2QB 4LRFA 1MROA 4JI1J 3NLCA 2UU9F 3D3CJ 3M6UA 1C1CA 2HHXA 1WSRA 1T03A 3R5JB 1YJ9S 3BKTA 1F1BB 2MKKA 5EUHA 4A8WA 4QWDA 1WDDA 1XR7A 3MOJB 3D68A 3MEKA 1VK8A 3D7SB 4DSLA 4USVA 1GQEA 4J9NA 2PEHA 4ATNA 4ECZA 2PE8A 2FJEB 2YWKA 1T02A 1N5YA 4B9NA 3MHYA 2MZJA 3KLIB 1RAIB 1RTHA 2BJ1A 1U8SA 2YXLA 4P6QA 5B08A 2GCFA 2N82B 1AFJA 2HK2A 2MSSA 3UR3C 5A8RB 4NLUA 2IC3B 5A8KA 4OI4A 1MMNA 5CA5A 2E9RX 2EG1A 1S0NA 3AFGA 4HT7A 1LW0A 3FVYA 4DR1J 1U45A 1S97A 3GR1A 3CSKA 1R27B 1H72C 1WKLA 1Z4UA 1KQSR 4HI2A 4PYDA 2QX0A 3BREA 5AJ3J 4DV1J 2YH1A 2BQRA 1CVJA 2CIMA 3KLHA 4KPCA 3N6MA 5HQMA 1RHQB 1SJ3P 3G2XA 3AD9C 1KKHA 4QBUA 1RAJA 4ZVPB 2ZH6A 2AQ4A 1K1SA 1RUSA 1SKUB 1S48A 4O3NA 3W8GA 4Y00A 1VQOS 1N54B 4I68A 1ROFA 3SCLE 3R7SB 3M9NB 3D67A 4TU7A 2Z4PA 2UXBF 4XDCA 4M5DA 1ZPVA 5GMEA 3SCIE 1C4AA 1RB0A 2WVCA 5B0FA 5SUHA 2YNHB 2VG6A 3GZ7A 1U1MA 1BQNB 4NLYA 4A8SA 3IGVA 1RBAA 1UVJA 1J5OB 1GH8A 1J2VA 1MU2B 5KFXA 2NS1B 3QT8A 1HWKA 3ETOA 3MAAB 4C8LA 3GFHA 3VR1A 2M2BA 2ZNYA 4KKOA 4FP9A 3S1TA 2XNRA 1NDCA 2WBRA 3D4JA 4CP5A 4OX9F 2B8PA 1FRIA 5ETSA 3TJAA 1HQUB 1N88A 3DRRA 2UZAA 1S49A 1HR0F 1V5IB 2V9KA 4OYIA 3S8SA 3GP9A 1OWXA 1WJ9A 2XCPA 3H5XA 1B7FA 3K5PA 3LP2B 2J9CA 2BM1A 4NEYA 1OO0B 2E44A 2MY7A 5DDPC 1OYDA 3KK3B 4K59A 4B3RJ 4ZCMA 2AYBA 2QO3A 3KK1B 1C1BA 4NA2A 4R8UB 1RT1B 4DS5A 3P4UB 3T3FA 2AJ2A 1AW0A 3J7ZT 2B9WA 4R0JA 4RUCA 3CDUA 8ATCB 4CTAB 2YKPA 4W92B 4UQGA 1VRTB 2J8SA 4GVBA 4QPTA 2V8DA 2HZCA 2Q79A 4ZVOB 1Q8IA 3M7VA 5K5MA 3HFVA 3HT3A 1S10A 2CPJA 1M5HA 1Q7LB 3DLEB 4Y2AA 4AE5A 3OVAA 3G4SS 3QT7A 2R2TA 3Q2TC 2C1EB 2CNKB 2IAJB 1LKZA 4ZVRB 5KG4A 4Y0FA 1F3FA 4LFAF 1JXEA 4CO2A 2IJRA 2FTRA 3PNIA 2ERRA 1B7YB 1T11A 1TKTB 2HFUA 3GIIA 4DUZF 4ELUA 3NBPA 3UNGC 2Y8WA 5H9FJ 4LRCA 3CC7S 4YY3F 2HQGA 2W24A 3RTVA 3VAMA 3NOGA 4N8OA 1HL6A 2OPPB 3VGSA 3G6XA 2EI5A 2E5LJ 3G96A 2RHQB 1XR5A 1ZTTA 3K5NA 1X5TA 1H38A 1IKWA 4ZJQA 5HANA 3V2UC 4LT6A 1WG4A 4WFBQ 4DMZA 3AJDA 2HMIB 2XNQA 2VPZB 2GJFA 3CPWR 3HHKA 3RR8A 2BQUA 2GZOA 2JEIA 3QQCD 2F5GA 2DCUB 2NXCA 1PILA 2E7XA 2MZQA 3BN7A 3FUYA 3H2LA 5DDQC 4C11B 5F8NA 2ROPA 3LP0B 4N47A 3HDSA 1JLAB 2YPZA 2Z30B 4ES2A 1OQ6A 4ED6A 2DY1A 4DF4A 4DV5J 3RRGA 5DM7Q 4QIWD 1KRPA 4MIAA 2CG4A 5KFYA 5IWAF 3DMJA 2DGSA 1S0MA 3M05A 1AB8A 4FF4A 4OI3A 2MKIA 1FNOA 3QJPA 4TN2A 4FYDA 1H2UX 5KFKA 2XSFA 2XY7A 2IBOA 5DM6Q 3T5JA 1T94A 3O5TB 3D6TB 2QLJB 3GSIA 1U26A 2FLOA 4ZVFA 2V5HG 3KMSA 2UUWA 1Q82T 3FBCA 2RDJA 2CQ3A 4CH0S 3BO3A 4TXSA 1UFLA 2I8EA 1ZZFA 1RT7B 2YNHA 4JI7F 1H0HB 1IBCB 2E5HA 2PN6A 3HFKA 2CRLA 3T6BA 4PUOB 3FCWA 1TUGB 1IKVA 3CO0P 1L3KA 1VGYA 1N5SA 3LGNA 3OBIA 4RUBA 1R8HA 3THPA 3T1HF 4ZIVA 1JJ4A 4CLTA 3D0IE 4B3SJ 3V6JA 4KTQA 1VRUB 2C3MA 3HX9A 4P71A 4CT8A 3EICA 4B9MA 2VJUA 2WB1D 2VQFF 1N8RT 3ILJA 3CVKA 5L9NA 1CJKB 4ED8A 3OHBA 3ILIA 1XEZA 4USUA 2J0XA 1U6BA 1YBTA 1VJQA 1F6TA 1KS2A 3H5SA 4PXEA 2BJDA 2ZWPA 5LMUJ 5BXIA 2RIJA 4EGLA 3D3BJ 1QAXA 2FJAB 2GMHA 2HG4A 1HBUB 1WORA 1SBRA 1VLYA 2PC6A 3MCNA 2ATCB 1NM2A 4O44B 4P2FA 5GAGU 3UPFA 2LKZA 3PKMA 3EGVA 2RRAA 1GMWA 5EHHA 4UOHA 1TAUA 1ZA1B 5I3QA 1VQMS 4ILMA 1N34F 2A10A 3HD2A 5KFLA 2XY6A 2GJ2A 5CYJA 1NKCA 2NREA 3MM9B 2DNOA 2LEPA 4Y2KA 2BMBA 3DM2A 4E0DA 4F4KA 2PT0A 5DQHA 3CDEA 4IG3B 5E3AA 1M5VC 4EZ9A 5F8MA 2HS4A 1JB0C 2CQ1A 2GV1A 3AJ2A 2V67A 4WTOB 3TJ9A 4DV0J 1YBUA 4RU2A 1VISA 3E3XA 2FUG9 2HBRB 2YWWA 1N48A 1XMOJ 3PYGA 5GAEU 4X66F 4MJKA 3IO1A 3BGFA 4LR9A 1Z1ZA 2JNJA 3GB0A 4GMKA 4DR7J 4IFYB 1PG5B 3QAUA 3VALA 3BSNA 2AEFA 4BWMA 2QFIA 2GO8A 3CDBA 2LDIA 3W65A 1QVGR 4K5SA 3NY0A 2ACYA 1E6VB 1YK9A 4M5NA 2F4FA 2GS8A 4JI1F 3I9V9 2JL9A 4WXWA 1SH0A 4WYLA 2J7WA 4AL7A 4ED1A 2UXCF 2ZBIA 1K0TA 2ZDPA 3ZTSA 1RTJA 3PXGa 4DDFA 4G65A 4U7CA 3QT5A 4KGVB 5JVGQ 3BBCA 2XY5A 2PFDA 2FJXA 1KTVA 1N5VA 1R0AB 1U8WA 2WSEC 3QPIA 1FJEB 3T9ZA 4F04B 4URQU 3W3SA 1NLKL 2I9SA 4DCPB 5D78A 4CO5A 3A4TA 4X66J 2R2SA 3H20A 2JDJA 3P96A 4DBQA 3G6YA 2M70A 4DFMA 3MM6B 1BQXA 3R27A 2GA7A 2JWNA 2MQPA 3PDNA 3RYLA 2YKNB 1R7IA 4A8XA 1WELA 5L46A 2AJFE 4JBCA 4DR4J 3HSGA 2FVPA 1M5SA 4PQAA 4CM0A 4MIBA 2UV8G 1RTDB 4X4UA 2XZWA 5IM0A 2RQKA 3FSIA 1SJFA 2DR8A 2N7YA 2PD1A 3DRSB 3EPIA 1U24A 3CJSA 4NLOA 3CNQP 3TA0A 1ZM2A 1JLCA 2CJBA 5KT6A 4K4XA 4RL1A 3QATA 1HD0A 1S6UA 4HVZA 4NLDA 5T41A 4U8VA 1LW2B 4A46A 1UW9A 3E01A 3FCHA 1QE1B 3N01A 2FLNA 1FDDA 5E7OB 2DHAA 2YH0A 1X4GA 4USWA 1SQEA 3L9ZA 2L3MA 4RW8B 2Q43A 2WSCC 1K0VA 3CT9A 4Q0BB 2QA4S 1JKHA 2OHDA 2L9WA 3CF5Q 3H59A 2LQ8A 4H4KA 3CCZA 3EZUA 3CMES 3PW0A 2OPSA 2DNZA 4B08A 2EFPA 5CAAA 2JSXA 4G6VB 2AV5A 4F4AA 3JTOA 2VF3A 1FVQA 2P9CA 4DCJB 3PFEA 4TQRA 3NWRA 4GO5X 4DJBA 1TVRB 4XPEA 3FMBA 3TUPA 3AHPA 5GMKa 3RR7A 2KI2A 3PRDA 2X3GA 2AJ1A 1FX2A 4L74A 2RU3A 4UY8T 4LF6J 2BABA 5F0WA 5J2PA 1HFEL 1CQMA 3BGUA 3LANA 2OSRA 2DPJA 1OQ3A 1SL1A 1WC4A 2VU5A 3H0PA 1TKTA 1WKKA 3Q2SC 4ANEA 4QR0A 4BBYA 3EGZA 4ERDA 4PG8A 1DZ5A 4EWTA 2YKMA 5AXMA 5KFUA 1FRXA 3NRBA 4CLYA 2E5LF 2R7UA 1ZS6A 3C3LA 2PSZA 2YNGB 1HNXJ 3GONA 1XMOF 2QSFA 1D3WA 3KLFB 4FXWA 1KOHA 1RLDA 4J90A 2QMUB 3PX6A 4B3OB 3TO8A 3P5TL 1X4FA 4NLSA 1WTFA 3ZZZA 4CLLA 4EBCA 5LL6d 1KFDA 2IJNA 2LCWA 2IJFA 4JB8B 2H5EA 2B6AB 2OELA 3QIDA 1GFWB 3I6PA 3OFFA 3VAHA 1L3SA 1R8CA 4NPOA 4OYPA 1O6XA 1DFDA 4ED0A 3I4HX 2GAGC 3MM7B 4NASA 1M90T 4YR2A 3PYDA 3VTIA 4OHXA 2ZBCA 1UVIA 3HF5A 1LWFB 3C15A 3HJVA 3K8WA 1WG1A 1RT4B 2VBWA 3W5XA 4HI1A 2GNKA 3J7YI 4M5DB 3DLHA 4AD6A 1FE0A 1VQLS 3NCQA 3QJLA 4CLZA 1JWWA 1T9UA 5L8RC 2NSCA 2NZCA 5G0RA 5K8PA 4N56A 3BSOA 4LIWA 2M3DA 1U1LA 1M5PC 2YX1A 3MECB 5K9FA 2UUAF 2HHPA 1MU2A 2G2YA 3K5OA 4P73A 4MKBA 2OD6A 2HZAA 1CC8A 1BWEA 1BWVA 4ECVA 5C42A 2G9OA 2CG8A 4IR9A 1HR0J 2G4BA 5ETNA 1X7VA 2MTLA 4TQSA 4J9LA 5ETOA 4KB7A 2N3LA 1RTHB 4BC7A 1HMVB 4BCAA 1RAOA 3SCJE 1X5OA 4HACB 1CJTA 1FDBA 2F8EX 4LIRA 5A8RA 3PW2A 1TKXB 2HK3A 4YR0A 2BOPA 2C3PA 3IFEA 4DQQA 2AW0A 3HVTA 1YITS 3KG0A 4PQUB 1NB2A 2I0XA 2IRXA 2N4CA 3CD5A 4HHJA 2D3O1 3JAMY 3C14A 2NR0A 1VQSA 3C6UA 4NLXA 3VGUA 2EFVA 3PZPA 3L7OA 3R5AA 3QRPA 3DDIA 3I96A 4PXDA 1RADB 3KHRA 1OSDA 1EHWA 4DV7J 1C0UB 4NI2B 4WKYA 1TL3A 1TKZA 4M8LA 3D1OA 3HFZB 2XWYA 3WC0A 4P9SA 2WCXA 3OTBA 4LBHA 1HQEB 3M9MB 4EBDA 2HYIB 1GX6A 4YDDB 2XGPA 3K5MA 4ELVA 4PABA 3LAKA 1Y7PA 4UUXA 5LXRA 1JJHA 3T5LA 4WZQA 2F40A 4RBUA 1H7XA 1HI8A 4KFBA 4KPYA 2B51A 2AJQA 1U0HB 3H5YA 3W7BA 4PKDB 5HATA 1FRMA 2OLWA 1QE1A 5KFDA 4C3LA 1MSWD 4KE5A 1VMBA 3M2UB 2MJNA 1FDAA 3WBZA 3HHEA 4J9OA 3UDEA 1YIJS 1IBKF 2O67A 2MJUA 2LVWA 1U1QA 2OPRA 2D9OA 1TZ0A 3H8YA 4EK2A 1J27A 4F50A 4FN5A 5KFZA 4M5LA 1LWCA 3R8YA 3HP6A 1WHWA 3UI3A 2ZH2A 1NK7A 2VG7A 2DGWA 1F60B 1WUUA 2O01C 3B54A 4ECUA 2RAQA 2YNGA 2LXUA 3V6DA 1GMWD 4F3OA 2J5AA 5CABA 5CD4A 5A2QY 3EZ5A 2V0NA 4PZVA 1SUQA 1RSCA 1YRUA 3D1QA 5IV3A 2LYVA 1AUSL 4URGA 2K2PA 3RUBL 1VQPS 1MN9A 5A76A 2KXFA 4ID8A 2HLUA 1J5OA 4ZPDA 1WF2A 5THWA 3SEOA 2DGOA 4F36A 2D3ZA 4IO1A 2DVIA 3KJVA 1P27B 3HHLB 5GAHI 1P6TA 2DXDA 4H4OA 1H2TZ 4P10A 2O1PA 1TUVA 4YEAA 5I42B 4CH1A 3PKYA 2ADCA 1UJ4A 3ITHA 3QWPA 3CC2S 4NMXA 2CPZA 1SQFA 1S79A 2PEBA 2YX4A 2ZVSA 1HNVB 3C15B 3ONQA 4USKA 3OV7A 3TA1A 3RRHA 3IG1A 1XMQJ 2XGQA 3DHWC 1IWAA 2UVUA 2LEAA 3HHNB 3H42A 3M8QA 1RBLA 2E7VA 4X2BA 5E2QA 2QC3A 3HZEA 1RP5A 1S9EB 1LEOA 2GMJA 1AA1B 2Q1LA 2ZD1A 5KFEA 3U1MA 4Q45A 1KC8T 5F3TA 1IKVB 4ES1A 5KG3A 4LFBF 5ETLA 3OJUA 2E9ZA 2JVRA 2PMWA 4BDPA 2QN6B 2ZC3A 1Y10A 2VC1A 4D3GA 4DUZJ 2A6OA 5CZVA 2IDLA 1B0TA 3MR3A 1X9WA 1S1VA 2YNFB 3BSAA 1P1TA 2MLZA 3G71S 1NJYA 3AOAA
chains in the Genus database with same CATH topology
1IBKJ 3JAMU 1N33J 4NEYA 4DV0J 5LMNJ 4X65J 2VQFJ 4B3RJ 1XMOJ 4JI8J 4JI6J 4V1Ak 4DR7J 5FLXU 4NXNJ 2UU9J 4LF8J 1HR0J 5A2QU 2MTLA 4JI3J 4LF9J 4JI0J 2ZM6J 4OX9J 4KHPJ 1N36J 4KY3A 1N34J 3OTOJ 1XNQJ 5IWAJ 3J80U 1N32J 2E5LJ 5BR8J 4X66J 4LF7J 2UXBJ 4DV7J 4B3MJ 4RJVA 4HHUA 4DR4J 4DV6J 4JI1J 4NXMJ 4DR5J 3D3CJ 5IT9U 3IMQJ 4X64J 3R2CJ 2MQ8A 4AQYJ 4JYAJ 4DV5J 4K0KJ 3T1HJ 4LFCJ 1HNWJ 4LF5J 4YY3J 4JI7J 4JV5J 4DR2J 1IBMJ 4GKKJ 2VQEJ 4NEZA 4DR6J 4LF4J 1I94J 2MEWA 2UUCJ 2HHHJ 4DR1J 4KYZA 2F4VJ 4JI5J 1XNRJ 3T1YJ 2UUAJ 3J7AN 5AJ3J 4DV1J 4JI2J 4DR3J 4PWWA 4JI4J 4B3SJ 2KVQE 3J81U 4LFAJ 2UXDJ 4DUYJ 4LF6J 2UXCJ 1IBLJ 4DV3J 4X62J 3W1YC 3D3BJ 1XMQJ 2KL8A 4LFBJ 1HNXJ 1HNZJ 4DV2J 1FJGJ 1J5EJ 5LM7E 4DUZJ 4B3TJ 5LMUJ 3R2DJ 4DV4J 4GKJJ 2UUBJ 4YHHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK J;  3JAM U;  1N33 J;  4NEY A;  4DV0 J;  5LMN J;  4X65 J;  2VQF J;  4B3R J;  1XMO J;  4JI8 J;  4JI6 J;  4V1A k;  4DR7 J;  5FLX U;  4NXN J;  2UU9 J;  4LF8 J;  1HR0 J;  5A2Q U;  2MTL A;  4JI3 J;  4LF9 J;  4JI0 J;  2ZM6 J;  4OX9 J;  4KHP J;  1N36 J;  4KY3 A;  1N34 J;  3OTO J;  1XNQ J;  5IWA J;  3J80 U;  1N32 J;  2E5L J;  5BR8 J;  4X66 J;  4LF7 J;  2UXB J;  4DV7 J;  4B3M J;  4RJV A;  4HHU A;  4DR4 J;  4DV6 J;  4JI1 J;  4NXM J;  4DR5 J;  3D3C J;  5IT9 U;  3IMQ J;  4X64 J;  3R2C J;  2MQ8 A;  4AQY J;  4JYA J;  4DV5 J;  4K0K J;  3T1H J;  4LFC J;  1HNW J;  4LF5 J;  4YY3 J;  4JI7 J;  4JV5 J;  4DR2 J;  1IBM J;  4GKK J;  2VQE J;  4NEZ A;  4DR6 J;  4LF4 J;  1I94 J;  2MEW A;  2UUC J;  2HHH J;  4DR1 J;  4KYZ A;  2F4V J;  4JI5 J;  1XNR J;  3T1Y J;  2UUA J;  3J7A N;  5AJ3 J;  4DV1 J;  4JI2 J;  4DR3 J;  4PWW A;  4JI4 J;  4B3S J;  2KVQ E;  3J81 U;  4LFA J;  2UXD J;  4DUY J;  4LF6 J;  2UXC J;  1IBL J;  4DV3 J;  4X62 J;  3W1Y C;  3D3B J;  1XMQ J;  2KL8 A;  4LFB J;  1HNX J;  1HNZ J;  4DV2 J;  1FJG J;  1J5E J;  5LM7 E;  4DUZ J;  4B3T J;  5LMU J;  3R2D J;  4DV4 J;  4GKJ J;  2UUB J;  4YHH J; 
#chains in the Genus database with same CATH topology
 5EWF A;  1IBM F;  4WKR A;  5HVG A;  3OFG A;  2DR7 A;  1RT4 A;  2W01 A;  3ZZ0 A;  3J81 Y;  4BC9 A;  3Q0A A;  1S1W A;  2VQF J;  5J1E B;  3EJM A;  1RHU B;  5GVQ A;  4ZIT A;  1WC5 A;  2BKP A;  4X4S A;  2DD8 S;  3D0G E;  2XLJ A;  3LW5 C;  3CCL S;  2HNY A;  4KSE B;  1UWA A;  3PTW A;  1HAR A;  1S1U A;  2RUG A;  2RRB A;  4ZN1 A;  1CJV B;  4DPU A;  1U7L A;  1X31 C;  3I0R A;  3BR8 A;  3CCR S;  4Z2X A;  3Q8V A;  1NHU A;  4ZJO A;  1IKW B;  3H90 A;  1SB6 A;  4PXB A;  5KG1 A;  1XC9 A;  2DNQ A;  4JI0 J;  2KT5 A;  4OX9 J;  2BXJ A;  2JJ4 D;  3DYA A;  3V4I B;  3H2V E;  3QLH B;  4KY3 A;  2XHC A;  3DXB A;  3MM9 A;  5A0Y B;  1VRQ C;  3CD7 A;  1N34 J;  2RIL A;  2PGC A;  1FA0 A;  3OXG A;  2LQJ A;  2NPI A;  4TU8 A;  4WK1 A;  2LLZ A;  5D6G A;  1IKY B;  2OSQ A;  4RPF A;  2VG5 B;  2P6S A;  2HFZ A;  4UZC A;  5D4N A;  4DPT A;  3DLJ A;  1VIX A;  2QEX S;  1WWH A;  1U02 A;  5D0H A;  2XTJ P;  1M0S A;  3TA2 A;  3AH6 A;  2FVS A;  3WDO A;  3TQ1 A;  2GO9 A;  2HQI A;  3AOB A;  3TAM A;  4K4Y A;  1BE4 A;  5HP1 B;  2E5J A;  4GVL A;  5K8N A;  1EB0 A;  4GC7 A;  4F8R A;  3OVB A;  4KJI A;  1B64 A;  4FYW B;  1NZA A;  5HQL A;  1S7H A;  1HHT P;  5LJ5 Y;  3N5B A;  4NXM J;  3FC9 A;  3PYF A;  1V3Z A;  1SC3 B;  3BF4 A;  3LH2 S;  1MWZ A;  3OW2 R;  2P9E A;  1T95 A;  2DR9 A;  3QGG A;  1IQZ A;  4AFF A;  4B3T F;  3W2V B;  2GC8 A;  4CO0 A;  4YP3 A;  2HS3 A;  4WCE Q;  2JVO A;  1SJ1 A;  2VB6 A;  2Q6C A;  3UNY A;  3BH6 B;  3ZNU A;  1RWK B;  2EK6 A;  1I5O B;  3LO3 A;  1JLG B;  5F3Z A;  1XQI A;  2BBE A;  4FPI A;  4DWI A;  2MPU A;  4L72 B;  4P75 A;  5CHC B;  4QYR A;  2BJE A;  4LF4 F;  3NKY A;  3J81 j;  3MR7 A;  4JI3 F;  1RBO B;  4LF9 F;  4B02 A;  4DR6 F;  3M2R B;  3EPG A;  2WZ1 A;  3MR6 A;  1VBY A;  3DOL B;  4LVN P;  3EWG A;  3R7N B;  2MMY A;  4P7V A;  2ACM A;  2JC0 A;  3DXS X;  5DJB A;  3MAQ A;  2ZD1 B;  1NPR A;  2AEM A;  1R0C B;  5K8M A;  1X60 A;  3IM9 A;  3KDO A;  1T3N A;  5KT3 A;  4IRC A;  1GNK A;  1Y5N B;  2JH3 A;  3FZB A;  3SV4 A;  4DQS A;  1XK8 A;  4V19 J;  1TV6 B;  2J9E A;  3EXY A;  3DI6 A;  4I2P A;  2MZ1 A;  3M4X A;  2OPQ B;  3HHL D;  3GIM A;  1LW0 B;  1JLE A;  3O1L A;  1GMV A;  1SIW B;  2RT3 A;  2RQC A;  3LP0 A;  3QFW A;  3EVM A;  2AU0 A;  3TNV A;  1Q79 A;  4BLG A;  1JLA A;  2DRB A;  2HVE A;  2ZVI A;  5LT5 A;  2FJV A;  1Y9O A;  4CIO A;  1YJV A;  2HGL A;  3W1Y C;  2MQM A;  3CCJ S;  2HWI A;  3FBB A;  5E3R A;  1BLU A;  2WBM A;  3Q86 A;  2B5J A;  4LSL A;  3DRX A;  3EZO A;  1SC6 A;  4FVC A;  2HNY B;  3UR0 A;  2PII A;  3T1A A;  2NYH A;  3NXZ A;  4DU7 A;  3AOC A;  4L73 A;  2GFF A;  2R3V A;  2FLL A;  3FFI B;  4DPY A;  4NLQ A;  3KXD A;  2DK2 A;  3MCM A;  4F0H A;  2XQC A;  3M8R A;  3G8T A;  4ECW A;  3A8K A;  4YHH F;  4DL3 A;  2DNK A;  3K0J A;  2CUY A;  3ILO A;  1EP4 B;  2EKY A;  1B3T A;  4DV4 J;  1YJ7 A;  4UUW A;  1TTH B;  2KXN B;  1WEX A;  4CLF A;  1KDN A;  4F0M A;  2XLI A;  2ZFH A;  1YHQ S;  1UVM A;  2ZUA A;  5D15 A;  4RUA A;  2E1A A;  2J6U A;  2CPX A;  3C6T B;  2YKM B;  2W7A A;  2R8I A;  2VG5 A;  3CIM A;  1D09 B;  2QL5 B;  2CZ4 A;  2V63 A;  4OZ0 A;  2XMT A;  4B9U A;  4V1A k;  4MKA A;  4B9L A;  4IR1 A;  1KP6 A;  2BRL A;  3FSX A;  5E3Q A;  3DDN A;  2ADB A;  1S6Q B;  2V68 A;  4FF2 A;  2OPR B;  4YDX A;  5D0E A;  4DV3 F;  5HP1 A;  4QOT A;  4OI0 A;  1LXN A;  1YRX A;  4LJM A;  1EET A;  1G6B A;  5KFP A;  3KK3 A;  2R8H A;  4OLO A;  3VF0 B;  1WOP A;  2MYF A;  3NGS A;  4KH1 B;  4PR6 A;  2VKR A;  3DLK A;  3PEH A;  4ZPC A;  1WF1 A;  4DI6 A;  3VAI A;  3SSS A;  3H4B A;  1N32 F;  2GHW A;  2DEI A;  2RKI A;  2XZT B;  1KWM A;  1RAF B;  3PW7 A;  4IOB A;  1D9D A;  4WZM A;  2AZ3 A;  3MCS A;  4MK7 A;  3J80 U;  2M88 A;  1QDU B;  2WON B;  4OHW A;  2DNH A;  4ID5 B;  3MI7 X;  4OMF G;  3K5L A;  3BN4 A;  4URS A;  2XC9 A;  4Q8F A;  4C8M A;  4LF7 J;  1X9M A;  3BBF A;  4H4M A;  4B3M J;  5CD4 H;  3JSR A;  1WD6 A;  2ZIT A;  3TJ8 A;  2BE2 A;  2F9D A;  4I6Y A;  4C0H A;  2UUT A;  5J2Q A;  1RYS A;  2R7T A;  1LNQ A;  3RU0 A;  3PJX A;  1VC6 A;  4ZHR A;  1DY3 A;  2FC9 A;  3BV8 A;  3P5B P;  4ZPT R;  2MQQ A;  1TU0 B;  3TX8 A;  3OTE A;  4RW6 B;  3W62 A;  4DV5 F;  2DHX A;  4K0K J;  3UDL A;  1TAQ A;  2L48 A;  1VJW A;  2DH9 A;  3PW4 A;  3DNC A;  5A6P A;  1YQH A;  4LF5 J;  2AEJ A;  2OPQ A;  2F7V A;  2YNF A;  3ZFV A;  4IH7 A;  4TY9 A;  5IOL A;  5EX0 A;  3PW5 A;  4EEY A;  2NXN A;  3CCM S;  1IBM J;  4GKK J;  3ENW A;  4KHP F;  4YQW A;  2E1M C;  3RBZ A;  3HO1 A;  2VKZ G;  4LF7 F;  2J9D A;  3CGI A;  2MEW A;  2WAQ D;  1RTI A;  4OJ1 A;  4WFX A;  3NGU A;  3W9H A;  2HHU A;  4I1T A;  4IOC Q;  4ECS A;  2PI4 A;  1D8Z A;  2B5J B;  2R7R A;  1UA0 A;  3DC2 A;  1F5B A;  2BE7 D;  3QWU A;  5ETV A;  4RNN A;  3CCV S;  3A3N B;  7FD1 A;  2HFO A;  5D8H B;  3BYR A;  1IUJ A;  5DRK A;  5KT7 A;  2BAN A;  5LSL A;  4F25 A;  3MXH P;  3GFZ A;  1NME B;  1RXO B;  1GT8 A;  3F0N A;  4ALZ A;  4LFA J;  2YKQ A;  2C2Z B;  1TK8 A;  4NLW A;  4CYU B;  5E5N A;  1WC3 A;  2X1G A;  2CDQ A;  3RBX A;  3VGV A;  3TVZ A;  3I5A A;  4K5R A;  3M2U A;  5HL7 Q;  3CJ4 A;  1REV B;  2D69 A;  3C16 A;  1HI1 A;  5B0A A;  2C2R A;  4I7F B;  2W9B A;  4X62 J;  1XWL A;  4NLT A;  3BB5 A;  4MAK A;  1NK9 A;  3TI0 A;  2RDI A;  5KG7 A;  2R2U A;  4KAI A;  1Q7Y T;  2RSQ A;  2VL1 A;  3OL8 A;  4WPA A;  3GV8 B;  1LWC B;  2XBP A;  2POK A;  3PHT A;  5KFV A;  1U1N A;  2VPW B;  3E51 A;  2RD5 C;  4J9V A;  4CO1 A;  1DAR A;  1SV5 B;  4NZ7 A;  1EAR A;  5HVH A;  5CCL A;  2CJ9 A;  4QQB A;  4CLW A;  3S7R A;  1KTQ A;  3MR2 A;  4PWD A;  1OPZ A;  2DB1 A;  2GVD A;  3GWC A;  3I9Z A;  5J1N A;  5KG6 A;  4Q2L A;  1QD1 A;  2Y0B B;  4A48 A;  4JI0 F;  4DCO B;  2G1H A;  2KG1 A;  3NP5 A;  3ZNJ 1;  3JSB A;  4O44 A;  4DL2 A;  4P2M A;  2OPS B;  3EGW B;  4R5P B;  4L3N A;  4O23 A;  5KFS A;  3ZTO A;  4AXJ A;  1SKW A;  4C8Z A;  1N33 J;  2E66 A;  2H1Y A;  4ZOS A;  4X65 J;  2CQH A;  3GJT B;  5B0G A;  3A3P B;  4EYH B;  3D6H B;  4QJV A;  2B4O A;  2Z57 B;  2EK1 A;  3WQP A;  2ZH4 A;  1L5U A;  1KEK A;  1G3O A;  4WP8 A;  4M94 A;  4EUV A;  3D66 A;  4J9Q A;  4ETZ A;  2VFU A;  1N6Q A;  1HKA A;  2M4M A;  5DLF A;  2D41 A;  4B3R F;  4MYT A;  4O3S A;  1QM9 A;  1UFK A;  3VAG A;  1CEZ A;  4ZP6 A;  3TZZ A;  2H5I B;  2LEB A;  1WI6 A;  5GAD U;  2MST A;  1VQ9 S;  1X5S A;  2XI2 A;  1RT6 B;  4FVM A;  4O3P A;  2BV3 A;  1WOS A;  2OEJ A;  1LK7 A;  5DO2 A;  1KVJ A;  3I0R B;  4IH6 A;  2H51 B;  4ZHR B;  1NZ8 A;  3VQS A;  4R25 A;  2DGU A;  3SIP B;  3OFE A;  1CS4 B;  2CJA A;  2OI2 A;  1IR0 A;  4GKK F;  4YB1 P;  4Q7A A;  3PRV A;  1W2B R;  2E29 A;  1VBZ A;  4M63 A;  2OML A;  4I6A A;  5LSO A;  1ZYQ A;  1NJX A;  1TK5 A;  3UCU P;  1NSQ A;  2B43 A;  1I3O B;  5F8J A;  4DOZ A;  4LR7 A;  2LP4 A;  3P8B B;  4XTT A;  1FKP B;  4MH8 A;  1YGY A;  2DR6 A;  5EDW A;  4UY8 5;  1G1X A;  1CPZ A;  2CQ2 A;  2O5D A;  4FKX A;  2PFF B;  4I67 A;  4N41 A;  1S76 D;  4DR4 F;  1DTT A;  2NUH A;  4USH A;  5EN1 A;  4DL6 A;  3NGK A;  2DTJ A;  1FD8 A;  1EZZ B;  2BOA A;  2G2Z A;  3SV3 A;  1DLO A;  5C25 A;  3R2C J;  4CNZ A;  2R4F A;  1K44 A;  3VQT A;  3MPY A;  3NEK A;  2VG7 B;  2ROG A;  1R43 A;  4U95 A;  4ECX A;  5HSP A;  4DL7 A;  2IFX A;  4RNF A;  1VQ4 S;  3HHD A;  2YBV A;  4PG5 A;  4TLQ A;  2WHO A;  1HYS A;  2DT9 A;  1T3O A;  1NK0 A;  1B70 B;  4WTY A;  3TZY A;  3BGL A;  3FZ2 A;  4KO0 B;  5HJX A;  1IKY A;  1VI7 A;  4DFP A;  2A2D A;  5KFH A;  1IR1 A;  2YX7 A;  4OI1 A;  2BUN A;  3CIZ A;  3HUL A;  1T05 A;  3KLH B;  3OSN A;  3CMA S;  2QMX A;  3AD8 C;  5LOQ A;  3DGP B;  5A8W A;  1KQF B;  2C2O B;  7AT1 B;  3M8W A;  1VQY A;  4RWX A;  1URR A;  1ZAV A;  2AKW B;  3I0S B;  4C97 A;  2ASJ A;  1U48 A;  1RCX B;  4AL6 A;  5T7L B;  3J7A N;  3M2R A;  2H4Y B;  4J9S A;  3FMW A;  5G4D A;  3M6W A;  4YUD A;  3CD6 S;  1WAC A;  3QO9 B;  1IWG A;  2FIU A;  2EVZ A;  1APS A;  1PO6 A;  3DLG B;  3IWX A;  3Q22 A;  4UOG A;  3RB6 A;  2Y9H A;  1JKH B;  3PHE A;  1Q95 G;  3HT0 A;  2O3D A;  2AWZ A;  4OYB A;  2HWH A;  4B17 A;  1C4C A;  2ZBQ A;  3PEJ A;  2W9C A;  1FI4 A;  4Q8E A;  3THV A;  1S1U B;  1VOM A;  2VFT A;  4NL5 A;  2FVQ A;  2RS8 A;  4R5P A;  2H5J B;  3K57 A;  2LU2 A;  1SXL A;  2I1R A;  2MY8 A;  3QMQ A;  4MYU A;  2CJX B;  3Q8U A;  5C24 B;  3A12 A;  4M5K A;  4LSZ B;  3VGT A;  1RU1 A;  4UF4 A;  2KHC A;  3DRR B;  1UA1 A;  2KZM A;  3GG0 A;  1TFY A;  4DV2 J;  5M2U A;  3R3T A;  3UFC X;  2HND B;  4ECQ A;  5J2N B;  4K4W A;  3W2W B;  3H7H B;  5L38 A;  4USI A;  3ZO7 A;  3G6V A;  3IWN C;  1HWL A;  1TK0 A;  1VIO A;  1MG7 A;  2Z2L A;  2CQ0 A;  3FRY A;  4Q43 A;  3EYZ A;  1PSD A;  2E9T A;  1NKE A;  3J7Z 5;  1SH2 A;  1B0V A;  2YQ1 A;  4XIU A;  1CJK A;  1A0O B;  2QA1 A;  1LFW A;  1GK8 A;  2R7V A;  1NPK A;  5DZ7 A;  2V4Q A;  1TEL A;  1UZH A;  2D74 B;  2COL A;  3QFH A;  4UQT A;  4WWS A;  4DFJ A;  3QAE A;  1EP4 A;  3D54 A;  5ETP A;  2L08 A;  3M2V A;  4AXI A;  2RF2 A;  4DL0 C;  1KVI A;  2FJB B;  2CPE A;  1Y11 A;  2BJ8 A;  2XEX A;  3HXM A;  1XTZ A;  2J0S D;  3HJF A;  2ZDO A;  3D1H A;  4QYZ K;  4CCH A;  3HHL A;  4C8K A;  1N56 A;  5AJ3 F;  3AXK A;  1YX2 A;  2HGN A;  3MM7 A;  3NBP B;  2K7K A;  2BE9 B;  3I31 A;  5K8O A;  4U67 Q;  4X4Q A;  4HDH A;  3KHH A;  1REG X;  4AND A;  2LA6 A;  2LDY A;  2HKE A;  4NA3 A;  1P9Y A;  5KFG A;  5F8H A;  4OLP A;  3TR5 A;  2HAI A;  4DX7 A;  5IS2 A;  2FZK B;  1RAH B;  2PMZ D;  5G0R B;  5I3U A;  4J9K A;  4WP3 A;  4C8N A;  2FY1 A;  3CCS S;  5KFA A;  2BAN B;  3DOL A;  2R7S A;  3IWL A;  4OV1 A;  2CNN B;  3RJM B;  3J7A 1;  1RLC L;  5AE1 A;  1HBM B;  2WOM B;  4C11 A;  2NXE A;  3W2V A;  5DQI A;  2PI5 A;  2WVE A;  3OTO F;  1NSK L;  4DQI A;  5BJR A;  2C22 A;  4K8R A;  4DLE A;  1T9X A;  2QRR A;  3GIR A;  4W98 A;  2V2V A;  4GO7 X;  1T9T A;  4OJG A;  2UXB J;  1UW4 A;  1HBO B;  2H48 B;  3QGP A;  4I64 A;  3AB2 B;  2V94 A;  4HHU A;  3SDE A;  1KOO A;  2C28 A;  4MK9 A;  3CMQ A;  1RHM B;  1RJJ A;  2MHE A;  2YWH A;  3UO0 A;  4IFV A;  1RAE B;  1YJW S;  4ZVE A;  3RZA A;  3AOD A;  2R42 A;  3UQS A;  3V6H A;  3DN9 A;  4DUT A;  4KGZ B;  1BQM B;  2V9W A;  3GR0 A;  3FK4 A;  4O3Q A;  4IRK A;  4RBV A;  1RWM B;  1KVK A;  1LWX A;  3QBC A;  3K59 A;  5KFM A;  5KT5 A;  4EBE A;  3FKB A;  4HDG A;  2KZZ A;  4MIW A;  4M5M A;  4LSL B;  1FXR A;  5K20 B;  2DH8 A;  2SXL A;  5KT4 A;  4MKY A;  2D3O R;  4JV5 J;  4ZCL A;  3GTY X;  4PPZ A;  2V2Z A;  4C6A A;  5JMN A;  3V81 B;  2UUC F;  3B78 A;  3MEE B;  4I2Q A;  3VWS A;  2HVI A;  1A9N B;  1IM4 A;  1C1C B;  1O51 A;  2D9P A;  3K7R A;  4QR1 A;  1HHQ A;  5HAO A;  3GYX B;  3TEH B;  4ES3 A;  5HRO A;  2P9G A;  4H4M B;  2BZ2 A;  2D3U A;  3RBD A;  4ZN3 A;  1U1R A;  2BYC A;  1TKD A;  2DGX A;  4YOE A;  3AA9 A;  4NZ0 A;  1WKJ A;  2UUA J;  1A7G E;  4OHZ A;  1S4E A;  4LFC F;  5M2P A;  3KG1 A;  2JX2 A;  5CXT A;  3HSD A;  2K8G A;  2A1B A;  3IC1 A;  1WF0 A;  2W8L A;  4DR3 F;  3T5H A;  1RYR A;  2GML A;  3CJ8 A;  5ETT A;  1HBU A;  4QZV B;  4DUY J;  3RAX A;  2ZZT A;  3M30 B;  4N7T A;  4OI6 A;  2FPH X;  3SFU A;  1Q53 A;  4B9T A;  2BM0 A;  3EDR B;  4P74 A;  4USJ C;  3N0V A;  1N33 F;  3CJT A;  4IDK B;  4P72 A;  1IBL F;  3O44 A;  1GX5 A;  1HWI A;  4F67 A;  4PXC A;  3FEX B;  1FK9 A;  4G1P A;  5FDL B;  4CZC A;  5BR8 F;  1QAI A;  1RZM A;  1NXI A;  4CLP A;  2HPU A;  1RWU A;  1UZD A;  1N5T A;  3ISN D;  3BPS P;  4PCQ A;  4JUZ A;  2KRB A;  3HHL C;  3J7Y U;  1G4C A;  1U47 A;  1I6J A;  2HHS A;  1AYE A;  3D6M B;  3CJQ A;  4U7U K;  4DV1 F;  4XK8 C;  3WIV A;  2W4D A;  3C6T A;  4KHM A;  1FKP A;  4ELT A;  1UTA A;  3D5M A;  4F26 A;  3ENV A;  3OR1 B;  1P8G A;  1PBU A;  1UEK A;  4KGX B;  1O5J A;  5LM7 E;  1XMB A;  1JJ2 R;  4RW7 B;  2ZM6 F;  4OYX A;  3U27 A;  3MMA B;  2W9A A;  3NCR A;  1KSP A;  4NCB A;  1RKI A;  3R2D J;  1JLB B;  4YHH J;  1NKB A;  5HVF A;  5DQG A;  3SQG A;  2UP1 A;  3Q8Y A;  1IJE B;  4TYA A;  2I2Y A;  1WEZ A;  2OUG A;  1RK8 A;  3QZ8 A;  2C3Y A;  2ZUG A;  3CCW A;  1PAE X;  1P9Q C;  3FGV A;  2YTC A;  4ZPA A;  1NBE B;  3VV2 B;  2DXF A;  3LTO A;  3RB0 A;  2ATL A;  1PGZ A;  1Y0H A;  4OZ2 A;  3UD3 P;  1FEH A;  4KQZ A;  4NX9 A;  1B99 A;  3O3L A;  3L95 X;  4ZKA A;  4CO4 A;  2HHV A;  2ZC4 A;  4L3K A;  1WC6 A;  2WON A;  4ZLN A;  2EC0 A;  5A8K B;  1V3S A;  3NOC A;  2BR0 A;  4HR2 A;  5DET A;  5FD1 A;  1SQG A;  5A2Q U;  1BGX T;  2KVI A;  3I0S A;  1HQ2 A;  4LQ9 A;  4OFZ A;  3WX8 A;  3PR4 A;  5L1I A;  4F4W A;  2ZM6 J;  1NRK A;  2C2D A;  3B82 A;  2NXJ A;  5JVH Q;  2H54 B;  1OPI A;  1C1B B;  1KQG B;  4M5J A;  1MMD A;  4R8U A;  5KFB A;  2KKH A;  3BPD A;  1RDR A;  3PIP Q;  4ED2 A;  3NNC A;  1X4A A;  1S6P A;  4UTG A;  2EW9 A;  2VHG A;  2MQL A;  2BJ9 A;  4GRS A;  1JNZ B;  1U6Z A;  3MED B;  3G9C A;  1FVS A;  3GIJ A;  2QMW A;  3SCK E;  3JB9 k;  1CSJ A;  2P5V A;  2BEF A;  4L6V 3;  3B8H A;  3QLH A;  4OX8 A;  4ZVU B;  4NYO A;  2NUU G;  4FBT A;  1FJC A;  3FDS A;  1CQN A;  4YME A;  3MAH A;  2Y1J A;  3G6E S;  3HKW A;  4LR8 A;  3QRQ A;  1S1T B;  1XN9 A;  2XS5 A;  5K14 B;  2QLF B;  1KLN A;  1UVN A;  1O8B A;  4A8K A;  1NHV A;  4CRJ A;  4XPC A;  1FXL A;  1RTI B;  4QW9 A;  1NDL A;  4CWB A;  4Q0B A;  3D9B A;  4LFC J;  5RUB A;  1PJ6 A;  1S59 A;  4FXD A;  4OL8 A;  3NMA A;  1H7W A;  3T9N A;  2HEK A;  3R5C A;  3HKZ D;  2IM2 A;  5E33 A;  2ZJQ Q;  3W64 A;  4C3K A;  1OSC A;  4OZJ A;  1EKR A;  2HFV A;  2HAF A;  1UET A;  1SV5 A;  3KFW X;  4J37 A;  3RBE A;  1SKS A;  5GAH U;  1DAX A;  1FTC A;  3FEY B;  4NE9 C;  5L1J A;  4NML A;  4ZP9 A;  1O0P A;  3R5G A;  3BQ0 A;  2CZ9 A;  1HW9 A;  2LQ9 A;  3DCA A;  3IRX B;  2HQD A;  3NS5 A;  2W9B B;  1TV6 A;  1K9M T;  2OIH A;  4LF5 F;  2OTJ S;  2Q66 A;  2YNI B;  3AXM A;  3IS9 A;  2ZHA A;  5C2C A;  1R8B A;  3NCP A;  2G1D A;  4FYX B;  5HBM B;  1RE1 B;  2KH9 A;  1CUL A;  3BS9 A;  2XHW A;  4K4U A;  1RAB B;  3X1L B;  1RGV A;  1SIZ A;  2NCK L;  3PVX A;  5J2Q B;  4C8Y A;  1MWQ A;  1VDH A;  3M32 A;  5B0D A;  4X65 F;  4O3R A;  1YSJ A;  1MN7 A;  2UXC J;  2VJV A;  2EPI A;  1D1U A;  1OS5 A;  1UCN A;  5I3U B;  3OL6 A;  5FDL A;  1Z2Z A;  3I5B A;  4EO6 A;  1HD1 A;  2VIH A;  3TAR A;  1HIY A;  2A18 A;  2CJQ A;  1KQK A;  3DI6 B;  3GFY A;  2DHH A;  5F9N A;  2P8I A;  5KG0 A;  3L09 A;  3W5Z A;  3OL9 A;  1M1G A;  2DHS A;  1RI7 A;  1HNZ J;  2FLP A;  2FY8 A;  1Y3J A;  4WU2 A;  2XI3 A;  1SUQ B;  2FGC A;  5DZ6 A;  3AQP A;  2EFQ A;  3VZH A;  3DLE A;  2D1C A;  3GV5 B;  1KNZ A;  1LWF A;  4K4S A;  1DJ0 A;  1NND A;  2GQ2 A;  2IAJ A;  1TMJ A;  2R2R A;  3UCZ P;  4HHH A;  1QJH A;  5KFJ A;  5HK4 A;  4X62 F;  3B6B A;  4PG4 A;  2IPO B;  1NK4 A;  4ED3 A;  4GKJ J;  1RAG B;  5LMU F;  5I42 A;  2B4V A;  4QR2 A;  4FYV B;  4RUH A;  4O0I A;  4I69 A;  1MML A;  3MUT P;  2ZHB A;  2ILY A;  3N4W A;  3CJ2 A;  4F7V A;  1WTB A;  4DSI A;  9RUB A;  2DHG A;  3W5Y A;  2B3T B;  2BVZ A;  3THT A;  5CYQ B;  1H2V Z;  3GJQ B;  3ZZT A;  5M2R A;  1R89 A;  4UT4 A;  1KD1 T;  4JI6 J;  2OEK A;  3MEG A;  3W63 A;  1NJZ A;  3NL0 A;  3ICL A;  1WDT A;  4Y2C A;  1S12 A;  5J2M A;  5FLX U;  1TKX A;  2J9D E;  5BYS A;  3FSY A;  2L9D A;  3R5B A;  2J8A A;  1L3U A;  2R9L A;  2XLK A;  2KT2 A;  3CUL A;  3MD3 A;  5KFF A;  3BGR B;  2WB4 A;  3FQK A;  3IXQ A;  3E2E A;  1IQT A;  2HRU A;  1NU4 A;  3B4D A;  3WZ0 A;  1QAY A;  3DHX A;  2CQ4 A;  3KJF B;  3LWL A;  1S6P B;  3ET6 A;  1D9F A;  1OIA A;  1C0U A;  4NI2 A;  3OR2 A;  4NCG B;  2R7W A;  3DRP A;  2HBY B;  4XAK A;  2Z0G A;  5ETR A;  4DSE A;  2RJZ A;  3FBE A;  2NSB A;  2HFN A;  4OHV A;  1Q16 B;  5T7L A;  2XMA A;  2X1A A;  1QSY A;  1M5K C;  5KAK A;  2BKN A;  3KK2 A;  1RT5 A;  3MM5 B;  3PRB A;  4DS4 A;  3JTN A;  1OY9 A;  2V8G A;  2R8G A;  3BBB A;  1S1X A;  2V6A A;  3DGV A;  2J76 E;  1X4C A;  3KDN A;  2GHV C;  4DV6 J;  1T05 B;  2DGV A;  1HLW A;  1FRL A;  3NGT A;  2HBQ B;  4YB7 A;  2R7O A;  3IMQ J;  1TMM A;  2HQF A;  3ENQ A;  3HSJ A;  3IRX A;  5IC6 B;  5I3P A;  5KFR A;  3WX4 A;  2HIQ A;  3LAL A;  1ZH5 A;  4F02 A;  2B0G A;  3IS9 B;  2MQ8 A;  3OLA A;  4AQY J;  5CH7 B;  3QZ7 A;  4Y6I A;  2IMW P;  2QSW A;  1HNW J;  4F2R A;  4JV1 A;  3M8S A;  1FCA A;  2WK4 A;  1VC0 A;  1AUD A;  3KTQ A;  2FJD B;  3MM6 A;  5KT2 A;  4L76 A;  1Q8K A;  2Z2Y B;  3KLE A;  5H9F K;  3VHQ A;  1UVL A;  1FE4 A;  2W2O P;  4DPX A;  5L1L A;  1DQ8 A;  2W8K A;  1SH3 A;  1TP7 A;  1CBK A;  3OTC A;  1YKW A;  3TUI C;  4NZ6 A;  1PC4 A;  1NK6 A;  2KT3 A;  2F1F A;  4OJ3 A;  2RRN A;  1RT3 A;  2K06 A;  3CDA A;  2CAJ A;  4ZLP A;  3GJS B;  4OZL A;  2XG8 A;  2XCA A;  3KLV A;  2X1B A;  1ZTW A;  2F4V J;  1JLQ B;  3IAS 9;  5GAG I;  5F8I A;  2WTF A;  4UST A;  1URN A;  1FNM A;  1GXT A;  1X4H A;  3CJK A;  4ENO A;  1K73 T;  4JOU A;  4Q44 A;  4PWW A;  3G87 A;  3M2V B;  2J6T A;  3UN5 A;  4JI4 J;  4LQ3 A;  1E6V A;  3M32 B;  2BW7 A;  3DOK B;  1Z2L A;  2MGZ B;  4EMD A;  3PV8 A;  4DSJ A;  1Q5Y A;  4IG3 A;  1JJC B;  1RTJ B;  1RWO B;  4RX6 A;  1HNI B;  1VQ7 S;  3TAN A;  2PMH A;  1X4B A;  4DV3 J;  3IM8 A;  2LMI A;  1YJN S;  3BYP A;  4DV7 F;  3FNN A;  1ZAX A;  4RW4 A;  5D3G A;  5E3P A;  3K8V A;  1V5V A;  4Y65 A;  4DZ6 A;  5ITH A;  1ZOT A;  3BGO P;  3LP2 A;  5HRO B;  4FKY A;  3F56 A;  2FVR A;  2DNN A;  2W4C A;  4A4J A;  1FJG J;  2DO4 A;  3O6Q A;  4G1Q A;  4ITS A;  2WRM A;  1I1G A;  2AYG A;  4JI5 F;  2P6T A;  3IGN A;  2F4V F;  1H74 A;  3EX7 B;  4ER8 A;  1M5O C;  2DR5 A;  3BKU A;  3Q8P B;  1AFI A;  2CNO B;  4F0K A;  2XSJ A;  3MM8 A;  2KM8 B;  4B3T J;  2KDO A;  3UN3 A;  1H3D A;  1RHK B;  2BKO A;  3H4D A;  1EJ7 L;  1WHV A;  3SXL A;  2DGT A;  4M1K A;  1SC1 B;  6AT1 B;  3V6K A;  2R8J A;  2QLB B;  3NGR A;  1RT2 A;  4DHV A;  3JS9 A;  5AXN A;  2EBE A;  4WFN Q;  3JAM U;  2ZJP Q;  2V69 A;  4WII A;  5DDR C;  2I5J B;  4YFU A;  2IMO A;  5LMN J;  4DUY F;  1UMJ A;  2IM0 A;  2KFZ A;  4Y28 C;  1XBW A;  5AE2 A;  4C3M A;  1C2P A;  1RA7 A;  3SQG B;  1F9E B;  3OVS A;  3TAQ A;  2RUS A;  3PO4 A;  5HN0 A;  3V4I A;  3GE9 A;  2IYI A;  3T1Y F;  2DIU A;  1S9G A;  3QJJ A;  1TUW A;  4FZV A;  1S0O A;  4CTA A;  2B9Y A;  2FHK A;  1JX4 A;  4LF8 J;  1VRU A;  3A8E A;  4EZ6 A;  1UPP A;  1OYE A;  4JI3 J;  4AUK A;  4LF9 J;  1FHT A;  4KGK A;  3OD2 A;  2UVV A;  4OI2 A;  4KHP J;  2ZH8 A;  1N36 J;  1JLB A;  2IM3 A;  4ICL B;  1SC4 B;  4DR2 F;  1YJU A;  4O4G B;  2BW2 A;  1I51 B;  3MUR P;  4ETX A;  2ZOG A;  1ZZN A;  2V4J B;  5GAE I;  2YQ0 A;  4ZPW R;  4LVO P;  4HKQ A;  2WW4 A;  3LAM A;  2OTL S;  8AT1 B;  1PKU A;  5B7W A;  2PDA A;  1RT5 B;  1N32 J;  3KLE B;  9ATC B;  4C8O A;  4I4B A;  1DTT B;  3KNG A;  3H98 A;  3LGM A;  2QA4 G;  3WIU A;  5MAO A;  4IOA Q;  2ZZM A;  2F65 A;  3BM7 A;  1Q0N A;  3JQK A;  3KG4 A;  4X4T A;  4YR3 A;  4OV6 A;  1YG0 A;  4RW9 B;  4CI0 B;  1TQL A;  3QRR A;  5AE3 A;  1PYT A;  2A3J A;  4MMO A;  2C2E A;  1YJR A;  2RF2 B;  3IR6 B;  4B9V A;  4LF8 F;  2K1R A;  4E98 A;  1S72 S;  2CPH A;  3PAC A;  4X64 J;  1Q4R A;  2QYC A;  3RAM A;  5F41 A;  1CLF A;  3GIK A;  2DNP A;  4ZVG A;  2Y8Y A;  2WVD A;  1FDN A;  1S5Z A;  3MMC B;  4A8Y A;  4OIX A;  4OYW A;  1HI0 P;  4TKT A;  5C5J A;  2DYA A;  4A8M P;  4JI7 J;  3ZZU A;  2AX0 A;  4RWW A;  2I38 A;  2ZH3 A;  4DSK A;  3CW2 C;  1N36 F;  4RZR A;  4C48 A;  2CPF A;  2RE1 A;  4Y2M A;  3VVU A;  2DBB A;  3KMQ A;  5FLX Y;  5D77 A;  3D6F B;  1SJQ A;  3KLF A;  3M8P B;  4ZVH A;  1F9F A;  3PR5 B;  1FK9 B;  2HVZ A;  3N5F A;  1M1K T;  2GJI A;  2XZD B;  3N28 A;  2XS2 A;  1GMU A;  5CYM A;  4CLU A;  2QGF B;  5HLF B;  1RTD A;  1FJG F;  2KYX A;  4USM A;  2FJW A;  2AJ0 A;  4B3O A;  1TL5 A;  4N76 A;  2FHJ D;  2RHS B;  2JHE A;  5E41 A;  2NYI A;  4NA1 A;  3U7J A;  1TFW A;  4C9D A;  1AZS B;  2EG2 A;  2WVF A;  1CC7 A;  2WSF C;  3MZI A;  3IBF B;  2K3I A;  3N6N A;  2ZOM A;  3QO9 A;  4M5H A;  3W66 A;  4WFA Q;  5J2N A;  4PWU A;  4LBI A;  1ZM4 A;  2IY5 B;  4LBP A;  3RAQ A;  2W7O A;  2VPY B;  4R0E A;  3BZQ A;  2ZOF A;  4NYP A;  1NJW A;  5F8L A;  1U49 A;  4K2X A;  4D3H A;  3NAH A;  1DTQ A;  3GV7 B;  1XNR F;  1GAO A;  1TL7 B;  3DRS A;  5C42 B;  1X8D A;  3GQC A;  4ZJL A;  4DR1 F;  1UWB B;  3EVW A;  5L9X A;  1P1L A;  4I0W A;  1YWX A;  2XWX A;  1FWL A;  3MED A;  2QL9 B;  2GQQ A;  2VH7 A;  4KH0 B;  2YY3 A;  1BQN A;  3M8Y A;  1R6Y A;  2QLW A;  3GJR B;  4HAC A;  3UE2 A;  1FFG B;  3M6X A;  5F9L A;  2UUB J;  3ILL A;  3SI8 A;  4J91 A;  1S4F A;  2VQE F;  1F3V A;  4PYA A;  4LF2 A;  4ZP7 A;  1NCL A;  1TL1 B;  4F4Y A;  3Q24 A;  4DLG A;  3MD1 A;  1KON A;  1DUR A;  2JEG A;  1FFS B;  1CJV A;  1C0T B;  2GX8 A;  2MQN A;  3H5U A;  3QGI A;  4UOC A;  5FII A;  3U1N A;  2ZJR Q;  4AQY F;  4MFB A;  1OJ4 A;  2FHJ A;  2VBX A;  4NOH A;  4WYW A;  4ZVQ B;  4X64 F;  1NK8 A;  2ZZN A;  1SL2 A;  4C4W A;  4QCL A;  4DR5 F;  3P45 B;  3EE3 A;  3CCT A;  1RT3 B;  2IA6 A;  2IVM A;  2Y1I A;  4GKJ F;  1IJF B;  4QIE A;  3RGI A;  3D0H E;  5J1E A;  4O4G A;  1HBM A;  2KYZ A;  2WOM A;  3ENA A;  2X7I A;  4M5I A;  5IC4 B;  4OYO A;  2G13 A;  4NRU A;  5DG9 A;  2XO7 A;  2CYY A;  2QLX A;  4FPR A;  2KFN A;  4ZVS B;  2KN4 A;  2C2N A;  4OYA A;  2JC1 A;  2CWK A;  2HQC A;  2BAC A;  5KFW A;  3I5C A;  2F9J A;  4TNO A;  2AD9 A;  1W7W A;  2RH3 A;  2U2F A;  3EDQ B;  3GCX P;  3OR2 B;  4NCG A;  3VCD A;  4X4O A;  3KJV B;  3C46 A;  3DFE A;  3KLG B;  1BHN A;  4HH0 A;  3ISZ A;  2RNE A;  1FWP A;  4A8Q A;  2XMV A;  2VIC A;  2QZ8 A;  2M5Y A;  1JIH A;  1HNV A;  4Y34 A;  4KRW A;  3KK2 B;  1FF2 A;  3T19 A;  3Q23 A;  1U2F A;  2KJW A;  4X4P A;  5SZT A;  4DR5 J;  4AYB D;  5IT9 U;  4DV4 F;  1VBX A;  1FXD A;  4FYY B;  1NH8 A;  2UXD F;  3CJ3 A;  4G1Q B;  1OY6 A;  2UVR A;  2HNZ B;  4N5S A;  2M7S A;  1NHK L;  3GIL A;  2BJ7 A;  3JYT A;  4JI4 F;  2GGP B;  3DRY A;  4JI8 F;  2EFG A;  3QT6 A;  3G8Q A;  2ABY A;  2CQG A;  3C8Y A;  4N77 A;  2GVZ A;  3NAI A;  1XNQ F;  3ZC4 A;  2JEJ A;  4ZPB A;  3PFO A;  1BMQ B;  2QTW A;  1BC6 A;  1Q86 T;  1RWV B;  3WHI A;  3HVR A;  4KIA A;  3C14 B;  1BQM A;  2YKO A;  1QAJ A;  4DR6 J;  1SKR A;  5LJ3 Y;  3OUY A;  4LSN A;  1ACM B;  5D0G A;  4KV8 B;  1TL3 B;  2O66 A;  4QWB A;  1YRT A;  1SI9 A;  5CYM B;  4PG6 A;  5C25 B;  4JI5 J;  1HMV A;  4QYZ J;  1HQE A;  4G3I A;  4JV0 A;  2BRK A;  4ED5 A;  2V34 A;  3UW1 A;  3W9I A;  2M0G B;  2XS7 A;  3R97 A;  4F3Q A;  2EWH A;  3G82 B;  3PYE A;  4K2J A;  2CA9 A;  1RAA B;  1JLQ A;  2CPY A;  2CQI A;  3LA0 A;  1JXV A;  1ZM9 A;  4JP8 A;  3OPK A;  1RT7 A;  2VC0 A;  4DX6 A;  2HWT A;  5D0R A;  5ETK A;  2CPI A;  5DG8 A;  1ZET A;  1FES A;  1PYS B;  3EMT A;  2D7S A;  1YZ6 A;  2UUB F;  2XMK A;  3CO9 A;  2GHP A;  2GIR A;  3LGH A;  3JSY A;  4ZIW A;  4B3M F;  2H3E B;  1MNE A;  2JFK A;  2DGQ A;  2V4J A;  3ETM A;  3POT A;  2KRR A;  3UVJ A;  2HZV A;  3BSC A;  5EWE A;  2XMJ A;  1KFS A;  2VOO A;  3HZG A;  3UD5 A;  5F8G A;  2RB7 A;  1XER A;  2VBY A;  1U1P A;  1RT1 A;  1KN6 A;  5B0B A;  1Q8L A;  2CVE A;  3CWJ A;  4I2P B;  1WNE A;  5D4O A;  5IT4 A;  1HNZ F;  2EC2 A;  2ZKU A;  3ZXW A;  4IYQ A;  2FVC A;  5IT9 Y;  4FBU A;  2IA0 A;  2OEM A;  2DCL A;  3PM9 A;  3D28 A;  3Q89 A;  4RNH A;  2ZHO A;  3ISN C;  1N6Q B;  1NUE A;  4DG1 A;  1U09 A;  2E5I A;  2HUR A;  5L39 A;  2M52 A;  5ETQ A;  5IT0 A;  2JRS A;  1TL1 A;  2VOP A;  4NXN F;  4F4X A;  2HHQ A;  4ZS6 A;  1UAW A;  4ZCK A;  2OH2 A;  4PAA A;  3TRG A;  3A3O B;  4ZK7 M;  1X0P A;  3AAW B;  1BY9 A;  3OXF A;  5DLG A;  3KOA A;  1WI8 A;  2E1R A;  4WFY A;  3CED A;  3I32 A;  4FF3 A;  1X4E A;  3ET6 B;  4O4R A;  4C0O C;  2EBG A;  3VAF A;  1SPB P;  2CKW A;  2HVH A;  2MQO A;  3R1H A;  2B7C B;  1EIY B;  3KUG A;  3Q8R B;  3PJ9 A;  4FF1 A;  2KU7 A;  3T41 A;  4CQ1 A;  1RWW B;  2ILZ A;  2IVY A;  4DPO A;  2IYG A;  8RUC A;  1IR2 A;  3KHG A;  2XYP B;  2AIR B;  1WC0 A;  2X3D A;  4BS2 A;  1ZPW X;  3M8P A;  1F9H A;  1GTE A;  2RQM A;  4IQM A;  1V9O A;  2ZH5 A;  4IRD A;  1F5C A;  1RIS A;  2EKN A;  1LFP A;  2HGM A;  3NS6 A;  2B4U A;  1J5E F;  3O2I A;  2E1C A;  5IV4 A;  2J7K A;  1ULR A;  3ADA C;  1PC5 A;  3BKF A;  4WFZ A;  1IVZ A;  2Y1L B;  3SSR A;  1HNX F;  5FJ4 A;  4ZP8 A;  2UV8 A;  2DRD A;  1YDL A;  2MDA A;  5IFM A;  4HLB A;  2CFX A;  5KFN A;  1H73 A;  1RWP B;  1S1T A;  2E7W A;  2Z2M A;  1GXL A;  2ZKT A;  2ZNZ A;  4HT5 A;  3Q8S B;  4F2S A;  4H4K C;  1JLF A;  2HRT A;  3JXO A;  1S9G B;  2IBK A;  3W60 A;  3OT9 A;  2E5G A;  2EFN A;  2C2M B;  2HNZ A;  2HW3 A;  4PUO A;  2P2C B;  2VDI A;  2OFG X;  2B9X A;  5F0U A;  1EQ0 A;  4KT0 C;  4NLG A;  2H65 B;  2KO1 A;  3HI9 A;  3LPY A;  4KHR A;  5J2M B;  2C42 A;  1NSA A;  5A0Y A;  3HD1 A;  3SSQ A;  2Z56 B;  1RWN B;  2DJW A;  4DFK A;  1X9S A;  4YY3 J;  2MZT A;  1U0H A;  2VBZ A;  1T7P A;  1JNR B;  1S57 A;  3BGR A;  1IXK A;  3CE8 A;  1FO1 A;  2RU9 A;  3F44 A;  4WE1 B;  3CJK B;  4RNO A;  3PIO Q;  4DR2 J;  1RWX B;  1R8A A;  4RBT A;  4C0B A;  1UP1 A;  2NLW A;  2R7Q A;  4YS2 A;  3GU0 A;  1CJU B;  4TY8 A;  3TVY A;  3VZI A;  1N5Q A;  4H4O B;  3TAM B;  1X0F A;  5KOW A;  2X1F A;  4U7U D;  1N52 B;  2HHH J;  4YB5 A;  4RW9 A;  1S6O A;  3M1V A;  4IO9 Q;  4DQP A;  2HQ3 A;  3I82 A;  2CXE A;  4PEO A;  4DSF A;  2W1B A;  1XNR J;  2LFV A;  5CZX A;  3MCO A;  4TLR A;  5D3G B;  4JI2 J;  1RA6 A;  2FDN A;  2MKH A;  3OLB A;  4ECY A;  3Q8Q B;  3A13 A;  4WIQ A;  3BO2 A;  3H2U B;  4K0K F;  1RU2 A;  4Q2M A;  2XYG B;  1HPZ B;  2CAD A;  2VFR A;  1S1X B;  5HJY A;  3MFH A;  4CYU A;  1NO8 A;  1S9E A;  3K2Y A;  3J81 U;  1U6F A;  2MKC A;  3LUY A;  3MMC A;  1VHI A;  4DF8 A;  5IQ6 A;  1E6Y B;  3RW6 A;  3UDV A;  3CJ5 A;  2DEJ A;  3MUV P;  2B56 A;  3CJR A;  2G0C A;  4QIV A;  2RKI B;  2XYH B;  3ELH A;  2QA2 A;  3FQL A;  2ALY B;  3ITH B;  5HBM A;  1WC1 A;  4CLK A;  3MWB A;  1FX4 A;  3T6J A;  4QU7 A;  5E0O A;  1NB7 A;  1HW8 A;  1RT2 B;  4BHQ A;  3A8J A;  4ZLL A;  3DU6 A;  5J2P B;  3S01 A;  5A6W A;  1R6V A;  2ASD A;  4ICL A;  3OFH A;  3UDC A;  1G7C B;  2V50 A;  2Y1R I;  3KJN B;  4LRE A;  2BQ3 A;  1EET B;  4RU9 A;  3GG1 A;  4DV2 F;  3F73 A;  4QPX A;  1QY7 A;  3NS7 B;  2BE2 B;  2IHR 1;  3TZW A;  1RCO B;  3P3D A;  3ZZO A;  3M30 A;  5H1S V;  3CC4 S;  1TL7 A;  3SYZ A;  3CCE S;  1YJT A;  3MOZ A;  1U25 A;  1V3R A;  2UVW A;  1VYA A;  1WOO A;  3HLU A;  1IBK J;  5CYQ A;  2HHW A;  4WF9 Q;  4LMZ A;  5LSR A;  1SCJ B;  4JV5 F;  3MEG B;  2Q6B A;  4NLV A;  2YKA A;  2GIF A;  4NRT A;  2ZH1 A;  4O3O A;  4J9U E;  4LRB A;  3E8O A;  2W4P A;  1MRO B;  3LP1 A;  2YWF A;  3I56 S;  1RTZ A;  4JI6 F;  4P52 A;  4U8Y A;  2MGZ A;  1F5A A;  1OY8 A;  1W2I A;  1T9Y A;  2CPD A;  2DH7 A;  2RML A;  3R6G B;  4KC5 A;  5GMD A;  4ZCI A;  2KM8 C;  3D2W A;  5L1K A;  3SFG A;  2U1A A;  4LSN B;  3TQE A;  2OPP A;  4QW8 A;  4TYB A;  2C3U A;  1FKA F;  3DRP B;  4RLE A;  1H98 A;  4DU8 A;  1ITP A;  4DN9 A;  1SL0 A;  4W90 B;  2XM3 A;  2AGP A;  2GIQ A;  2KXH A;  5ETM A;  3DYA B;  1PAU B;  2B8Q A;  3F41 A;  3CCU S;  2KTQ A;  4X4N A;  3G82 A;  4WP9 A;  1QTN B;  1DQ9 A;  1R0B G;  2XSJ B;  5IWA J;  2QFJ A;  2MKJ A;  1GTH A;  3EGN A;  2EXU A;  3MR5 A;  2XO6 A;  4HYK A;  4GC6 A;  4P7T A;  3MFI A;  1QLN A;  4XDD A;  2NPF A;  3E01 B;  4WK3 A;  3HVA A;  2DNL A;  1HBN B;  1D9A A;  3UWT A;  1JLF B;  4QWE A;  5HLF A;  2FD2 A;  1UJ5 A;  4ZPV R;  2YVS A;  2RDD A;  4KBI A;  3GYG A;  3TVK A;  4Y3C A;  1L3V A;  3DMJ B;  3BH7 B;  1S6Q A;  3U1L A;  3CXC R;  2CJY B;  2L41 A;  2PO4 A;  1DLO B;  1EX8 A;  3Q83 A;  3QSI A;  2Y3Y A;  1NAQ A;  4DN0 A;  2B7B B;  2FZC B;  5HI7 A;  3MGJ A;  4ILL A;  2G0I A;  3PO5 A;  2MKS A;  3OXL A;  4A47 A;  2V4R A;  2FC8 A;  3H40 A;  2K3K A;  4DR7 F;  2HSE B;  3W61 A;  2VFS A;  5AXK A;  2IVF B;  1PIE A;  3VAJ A;  5KFQ A;  3T1H J;  1B4S A;  1X5P A;  3EM1 A;  2G0J A;  3O8W A;  1XIQ A;  2BJ3 A;  5HO4 A;  3MPU B;  1FER A;  1NK5 A;  3TP2 A;  4UOF A;  2NZ4 A;  1JLG A;  1B0P A;  1E6Y A;  3MAA A;  4MKV A;  4FS1 A;  1LXJ A;  3M6V A;  3QIP B;  3EUN A;  4KKO B;  4OZ5 A;  5DDO C;  4LF4 J;  1RHR B;  3TOQ A;  2W2M P;  5KOX A;  5CQG A;  4DX8 H;  2L9N A;  2AGQ A;  1KBR A;  3K17 A;  1R0A A;  3HK2 A;  1Y5I B;  3US5 A;  4DL5 A;  4S0M A;  4NXM F;  3DOM A;  2QT7 A;  3P6Y C;  2CQD A;  3L7P A;  3IR7 B;  4CNY A;  4CH7 A;  2HS0 A;  1R8P A;  3GFX A;  4FNH A;  4EO8 A;  3PY8 A;  3C66 A;  1X4D A;  2GVD B;  4IQX A;  2V8H A;  3CJ0 A;  5D4P A;  1HNW F;  1FRH A;  1S77 D;  1FKO B;  2JFD A;  3R9L A;  3KYL A;  4NCA A;  3KLI A;  4V19 X;  1DTQ B;  2HVD A;  3JQJ A;  1PCA A;  3TYT A;  4EI2 A;  3C19 A;  2DO0 A;  3FJ2 A;  5H9E K;  4K50 A;  2UXD J;  2MXY A;  1TR0 A;  4ID5 A;  2FHM A;  3DGP A;  4ZA1 A;  5A8W B;  2LA4 A;  2QYG A;  3B4M A;  3W9J A;  2I6W A;  2PA3 A;  4C98 A;  5C24 A;  1NSP A;  2J6S A;  2QG9 B;  2CDR B;  2OP5 A;  5T14 A;  2QJ3 A;  1PJ5 A;  2AMC B;  1FRJ A;  2W7P A;  3H25 A;  2FYX A;  4X4V A;  1FFW B;  2OJ3 A;  3IR5 B;  4KV8 A;  1GXU A;  2HRY A;  3POT B;  2DXE A;  4ZVT B;  4QWA A;  3IAM 9;  3LPE A;  1J5E J;  2MZR A;  3V4M A;  3CD0 A;  3KJQ B;  3UD4 P;  1Y5L B;  4K7Q A;  2AT1 B;  4H54 A;  1LQ9 A;  3K89 A;  1D8Y A;  3FFI A;  1I94 F;  2APO A;  5GAD I;  2DPI A;  2I5J A;  4LF1 A;  2VD3 A;  3CTR A;  3LQV A;  1NJI T;  3JSM A;  3KLG A;  2XB2 D;  1VQ8 S;  1ZA2 B;  2OAU A;  3IBW A;  2EEY A;  2AZ1 A;  3NMR A;  1NEE A;  3QNW B;  4OX6 A;  1U1K A;  1WEY A;  1R31 A;  2LEC A;  1G2E A;  3DLK B;  3ZTP A;  4C7Q A;  3HVT B;  1DHM A;  1R3N A;  2FZG B;  3MM8 B;  3MPV A;  4I7F A;  4DXL A;  1KLM A;  4Z7C A;  2AJ4 A;  4JI8 J;  3RB4 A;  2KG0 A;  4TU9 A;  2IM1 A;  3SZ2 A;  3JYT B;  5B0E A;  1S9F A;  4OHY A;  4MTP A;  2VZ9 A;  3I4P A;  1WSV A;  2ZEJ A;  1FT8 A;  2YQ3 A;  2IRY A;  1QSS A;  2DIS A;  2HFS A;  3TUJ C;  1S1W B;  1Y00 A;  3OTD A;  3UCG A;  2AHO B;  3HMJ G;  1Q5V A;  4PRF A;  3M1V B;  4JYA F;  5KFO A;  1UL3 A;  1A6L A;  4DG1 B;  3DLB A;  4ZMM A;  1M1H A;  4DX5 A;  3BQ2 A;  2YKN A;  2JLG A;  4J9M A;  4NWB A;  4JV2 A;  5KFI A;  3KHL A;  2C2K B;  4OYZ A;  1FJ7 A;  2XMM A;  2VDH A;  4PWD B;  1RQ0 A;  2NQP A;  2F8H A;  4IKA A;  4RW6 A;  4Z37 A;  4UZB A;  4Q5V A;  1NH7 A;  2Z8Q A;  5C2G A;  1GEH A;  1U1O A;  1IN0 A;  2RS2 A;  2K1R B;  3MMB B;  4P2S A;  4RJV A;  3PJW A;  5U47 A;  3LWM A;  1T03 B;  3TEG A;  4BWJ A;  1IKX B;  2HHT A;  1RKJ A;  2F63 A;  1Q8B A;  4HH1 A;  1NDP A;  3P49 B;  4YN3 B;  3TW0 A;  5DGB A;  3CDW A;  2ASY A;  2JLE A;  3K58 A;  1IM6 A;  4B3S F;  2XMW A;  1YBA A;  4OZ3 A;  4JYA J;  4MFB B;  4RNM A;  3T5K A;  1N5Y B;  2WW8 A;  3S6E A;  2IDE A;  1ELO A;  1VC5 A;  2RVJ A;  2HMI A;  4HEA 9;  3MF5 A;  3AB4 B;  1VR6 A;  2IC3 A;  2V2Q A;  3HSZ A;  5EWG A;  1RHJ B;  3V81 A;  2W2P P;  1VHF A;  2X51 A;  2YNI A;  3MM5 A;  1FRK A;  3N79 A;  4QWC A;  4NEZ A;  4OQJ A;  2VA2 A;  3EVO A;  2YWG A;  5DG7 A;  1K8A T;  3LF0 A;  4WJB A;  2M9K A;  4WE1 A;  5AT1 B;  5B0C A;  2ROE A;  2J7U A;  2LXI A;  4KGM A;  1UKU A;  3IBC B;  3DLL Q;  2LQ5 A;  5H9E J;  4KYZ A;  4U6P A;  3L4B C;  2FGO A;  1PYO B;  4LUB A;  5JJB A;  3OL7 A;  3T1Y J;  1YTY A;  1FKO A;  3IN5 A;  2ALZ A;  2E1P A;  4U96 A;  2R7X A;  3JTP A;  3JQM A;  4DR3 J;  2W2Q P;  4Y2I A;  1SJR A;  2KVQ E;  3HPO A;  4CDI A;  3QSY B;  1MWY A;  1K47 A;  4E2F B;  1XR6 A;  2ZE2 A;  2VUG A;  4ED7 A;  1MW7 A;  5JUM A;  2DIT A;  2MLX A;  2W2N P;  3HCX A;  2ZBP A;  1T8E A;  5B09 A;  3JSM B;  1FNX H;  1IBL J;  3AQO A;  3NGD A;  3CUN A;  1U2C A;  3RG6 A;  1HA1 A;  2MZS A;  2Z58 B;  4RKU C;  2HBZ B;  1ZM3 A;  1SJ4 P;  3GLJ A;  3ZZY A;  4RR5 A;  1Q81 T;  3C16 B;  4IG0 B;  4CO3 A;  3IRW P;  2VA3 A;  4L75 A;  4OZN A;  1QTM A;  4B9S A;  3C2P A;  5KFC A;  3L3C A;  2KL8 A;  3GCW P;  4UW2 A;  1FTR A;  3OQ2 A;  4PG7 A;  4TVA B;  4LFB J;  2RQ4 A;  1JLE B;  4YB6 A;  2QE5 A;  1VRT A;  4GVB B;  4JI2 F;  3GMG A;  3N9U C;  4X84 A;  1VCT A;  2MKY A;  2FQQ B;  3OR1 A;  1HQU A;  4WBF A;  1CS4 A;  1HHS A;  3GSD A;  3QGH A;  1AZS A;  3BDE A;  3KNA A;  4RW7 A;  4DZD A;  2JZ5 A;  2OFH X;  3ZTR A;  2KFY A;  4J9P A;  3U02 A;  2HHH F;  3SDE B;  2AYE A;  4J9R A;  2XUL A;  3NNA A;  1EAY C;  1HYS B;  4AL5 A;  1KHW A;  2MHN A;  3BR9 A;  4KO0 A;  3GYN A;  1HNI A;  1Y3K A;  3QYY A;  2M8D B;  1VQN S;  3MEC A;  1YI2 S;  1QUV A;  3SQO P;  3ULH A;  5ADZ A;  1TL4 A;  4HTI A;  1C0T A;  1CG2 A;  2CQB A;  2LU1 A;  3AD7 C;  4CLS A;  3TUZ C;  2H4W B;  4E8U A;  3PX0 A;  2DY9 A;  5I4M A;  2V8V A;  4HTJ A;  3HM9 A;  1UEU A;  1N0V C;  1UPM B;  2GAH C;  2K7J A;  3TX0 A;  1FD2 A;  1XMQ F;  2LQB A;  3NNH A;  3AJ1 A;  3MMA A;  2B9E A;  2CWX A;  3BJY A;  3SBM A;  3QIP A;  5JXS A;  4EU0 A;  2N7C A;  3BO4 A;  2JOQ A;  2BX6 A;  3MMB A;  2MB0 B;  3L7U A;  4RO0 A;  4PQU A;  1U2R A;  1IKX A;  1LW2 A;  4FNI A;  5KTQ A;  3C6U B;  1VS3 A;  1Y4Z B;  2ASL A;  2Z2Z A;  3ZZP A;  1EQM A;  1KHV A;  3M8Z A;  1DRZ A;  2QL7 B;  3NWG A;  4TY8 B;  3KUE A;  3SMZ A;  1XJW B;  3A1Y G;  4I56 A;  1YZ7 A;  3VVT A;  3OTO J;  3CCQ S;  3ZZR A;  3FEZ A;  5C7P A;  2LXF A;  4IFY A;  5HMW A;  3AA8 A;  4ZLJ A;  5HMX A;  3V6D B;  2DKO B;  4PPD A;  4FDF A;  2DRA A;  4NLR A;  3MEE A;  1DQA A;  2QIF A;  3KUH A;  3LP1 B;  3I87 A;  4WXO A;  5IXU A;  2VOD A;  2HND A;  1FEE A;  3MPW A;  3DM2 B;  3EXC X;  2HLT A;  4IH5 A;  4ED4 A;  4KFB B;  1N4L A;  1TVR A;  3RW7 A;  1U0S A;  2OD4 A;  3MPD A;  3MTK A;  2FB0 A;  2GGP A;  1VQ6 S;  2AF6 A;  4M95 A;  1VFJ A;  2ZBR A;  2VV5 A;  1YLX A;  1CJU A;  4QIG A;  2AGO A;  2N3O A;  2B4P A;  1TKZ B;  4DEZ A;  3M9O B;  2VON A;  4CM2 A;  2CZV C;  7FDR A;  2OKQ A;  4FS2 A;  4W4M A;  4LRD A;  1S99 A;  1ICE B;  1UEV A;  2VPX B;  2ZWO A;  1ARO P;  2JEF A;  1LWE A;  2ZE2 B;  5LMN F;  2AX1 A;  3OUY B;  4EYI B;  3MDF A;  2W25 A;  2BA9 A;  1WHX A;  4MK8 A;  3A8I A;  3DLG A;  2VQE J;  5HQ8 A;  1MLA A;  3MTJ A;  2QV6 A;  2M8H A;  2CQP A;  4M5G A;  2W9C B;  5K14 A;  4C2M A;  4CT9 A;  2VFV A;  3DOK A;  1I94 J;  3WC2 A;  1HWJ A;  2JLF A;  3VAK A;  2UUC J;  3G86 A;  4FXV A;  2GVZ B;  4P2X A;  3DU5 A;  2KHD A;  3KWM A;  2AP6 A;  4K4Z A;  2EFO A;  4OYM A;  3BEG B;  3FBF A;  5DGA A;  3TWZ A;  4ECT A;  4IFV B;  1V6H A;  5AXL A;  3OHA A;  4QU6 A;  3DDK A;  1F2G A;  3NG8 A;  3OJS A;  1VQ5 S;  2Q3P A;  2GW8 A;  1T9V A;  1KR4 A;  2N4D A;  1VLO A;  3DOM B;  3IP0 A;  4RW4 B;  3TAP A;  3MUM P;  1QSL A;  4QIF A;  5CCM A;  4RW8 A;  2H9Z A;  3M8Q B;  3MMJ A;  2ZH7 A;  1T9W A;  1S0V A;  2CVI A;  3GPA A;  2DNG A;  3RRK A;  2WVB A;  4EFA C;  2J0Q D;  1T0T V;  3BDP A;  1JQG A;  4ZDN A;  3J80 Y;  2AYM A;  2MLY A;  1F0X A;  1PJ7 A;  1Q1K A;  2OO4 A;  4LRA A;  1JLC B;  2DNM A;  3OSP A;  4NLP A;  3PG9 A;  1NPP A;  1S1V B;  1VBK A;  2A0F B;  2HIY A;  1W26 A;  3IA0 A;  5IQQ A;  1AT1 B;  1CUL B;  1BD6 A;  1BXN A;  2VG6 B;  3CB4 A;  2CQC A;  4F3M A;  6FD1 A;  4DL4 A;  1CJT B;  1LV5 A;  5HMZ A;  4OZ1 A;  1HWU A;  2IIH A;  2GQC A;  3IG1 B;  5BYQ A;  1REV A;  1VQK S;  1VK3 A;  3W2W A;  3FCV A;  4J7C A;  4WU3 A;  5DS7 A;  3DKD A;  3UVJ B;  1JMT A;  4ANC A;  1EKS A;  1UVK A;  3TZX A;  1AXQ A;  3PCO B;  3FRZ A;  3PX4 A;  2A2C A;  2ZH9 A;  1WG5 A;  2DIV A;  4HL9 A;  3ZTQ A;  1HBN A;  4AT1 B;  4J5O A;  1YVF A;  2V8P A;  2PA8 D;  4O0N A;  4LF6 F;  1F2H A;  1QUP A;  2KB2 A;  4IDK A;  6FDR A;  4ECR A;  1HPZ A;  1JK9 B;  5IZH A;  1H6K X;  1S7I A;  5E3C A;  4K4V A;  4MT1 A;  3R7B B;  4Z7Y A;  3AY0 A;  3W8P A;  5KG2 A;  2J0W A;  2CJK A;  1ZBT A;  4NYZ A;  1FWK A;  4U9R A;  5BYR A;  1RAC B;  2B6A A;  3I55 S;  2YPY A;  5MLC V;  4NXN J;  2FHO B;  5KFT A;  1KLM B;  2Y0S D;  5J1P A;  1UWB A;  1JXL A;  5LXY A;  2XMU A;  4X4R A;  2OGU A;  2YWE A;  2UU9 J;  4A8F A;  1K1Q A;  2V2K A;  1UFW A;  2CNL B;  2DNR A;  3V5R A;  1N0U A;  4OX7 A;  3BQ1 A;  3RB3 A;  1Q78 A;  1OMS A;  1PBA A;  1WHY A;  1LOU A;  1ZAW A;  3R5D A;  4XO0 A;  2C3O A;  2IRU A;  4N8N A;  2R8K A;  2F3J A;  4IUF A;  1U4B A;  3AT1 B;  4DPW A;  2A6M A;  5HMY A;  1NDK A;  1QVF R;  1BUX A;  2VAS A;  3G8S A;  3N6L A;  3KKF A;  1XNQ J;  3R6L B;  2DNY A;  1SVD A;  1RT6 A;  1W25 A;  2NXU A;  3X3U A;  3KK1 A;  4ILR A;  1LWE B;  2OMO A;  4A8O A;  4K4T A;  2BDP A;  3UN2 A;  5BR8 J;  1DBD A;  4G1I A;  2G2O A;  5EGY A;  4F4Z A;  1L3T A;  2F8M A;  4KR0 B;  1UJ6 A;  4DQR A;  4OJH A;  5D4L A;  1LK5 A;  4I6W A;  3HVW A;  4DV0 F;  2KJV A;  5IM0 B;  5KG5 A;  4IG0 A;  3LOU A;  4DV6 F;  1HBO A;  3R1L A;  1D0E A;  5EX3 A;  4I2Q B;  4LRF A;  1MRO A;  4JI1 J;  3NLC A;  2UU9 F;  3D3C J;  3M6U A;  1C1C A;  2HHX A;  1WSR A;  1T03 A;  3R5J B;  1YJ9 S;  3BKT A;  1F1B B;  2MKK A;  5EUH A;  4A8W A;  4QWD A;  1WDD A;  1XR7 A;  3MOJ B;  3D68 A;  3MEK A;  1VK8 A;  3D7S B;  4DSL A;  4USV A;  1GQE A;  4J9N A;  2PEH A;  4ATN A;  4ECZ A;  2PE8 A;  2FJE B;  2YWK A;  1T02 A;  1N5Y A;  4B9N A;  3MHY A;  2MZJ A;  3KLI B;  1RAI B;  1RTH A;  2BJ1 A;  1U8S A;  2YXL A;  4P6Q A;  5B08 A;  2GCF A;  2N82 B;  1AFJ A;  2HK2 A;  2MSS A;  3UR3 C;  5A8R B;  4NLU A;  2IC3 B;  5A8K A;  4OI4 A;  1MMN A;  5CA5 A;  2E9R X;  2EG1 A;  1S0N A;  3AFG A;  4HT7 A;  1LW0 A;  3FVY A;  4DR1 J;  1U45 A;  1S97 A;  3GR1 A;  3CSK A;  1R27 B;  1H72 C;  1WKL A;  1Z4U A;  1KQS R;  4HI2 A;  4PYD A;  2QX0 A;  3BRE A;  5AJ3 J;  4DV1 J;  2YH1 A;  2BQR A;  1CVJ A;  2CIM A;  3KLH A;  4KPC A;  3N6M A;  5HQM A;  1RHQ B;  1SJ3 P;  3G2X A;  3AD9 C;  1KKH A;  4QBU A;  1RAJ A;  4ZVP B;  2ZH6 A;  2AQ4 A;  1K1S A;  1RUS A;  1SKU B;  1S48 A;  4O3N A;  3W8G A;  4Y00 A;  1VQO S;  1N54 B;  4I68 A;  1ROF A;  3SCL E;  3R7S B;  3M9N B;  3D67 A;  4TU7 A;  2Z4P A;  2UXB F;  4XDC A;  4M5D A;  1ZPV A;  5GME A;  3SCI E;  1C4A A;  1RB0 A;  2WVC A;  5B0F A;  5SUH A;  2YNH B;  2VG6 A;  3GZ7 A;  1U1M A;  1BQN B;  4NLY A;  4A8S A;  3IGV A;  1RBA A;  1UVJ A;  1J5O B;  1GH8 A;  1J2V A;  1MU2 B;  5KFX A;  2NS1 B;  3QT8 A;  1HWK A;  3ETO A;  3MAA B;  4C8L A;  3GFH A;  3VR1 A;  2M2B A;  2ZNY A;  4KKO A;  4FP9 A;  3S1T A;  2XNR A;  1NDC A;  2WBR A;  3D4J A;  4CP5 A;  4OX9 F;  2B8P A;  1FRI A;  5ETS A;  3TJA A;  1HQU B;  1N88 A;  3DRR A;  2UZA A;  1S49 A;  1HR0 F;  1V5I B;  2V9K A;  4OYI A;  3S8S A;  3GP9 A;  1OWX A;  1WJ9 A;  2XCP A;  3H5X A;  1B7F A;  3K5P A;  3LP2 B;  2J9C A;  2BM1 A;  4NEY A;  1OO0 B;  2E44 A;  2MY7 A;  5DDP C;  1OYD A;  3KK3 B;  4K59 A;  4B3R J;  4ZCM A;  2AYB A;  2QO3 A;  3KK1 B;  1C1B A;  4NA2 A;  4R8U B;  1RT1 B;  4DS5 A;  3P4U B;  3T3F A;  2AJ2 A;  1AW0 A;  3J7Z T;  2B9W A;  4R0J A;  4RUC A;  3CDU A;  8ATC B;  4CTA B;  2YKP A;  4W92 B;  4UQG A;  1VRT B;  2J8S A;  4GVB A;  4QPT A;  2V8D A;  2HZC A;  2Q79 A;  4ZVO B;  1Q8I A;  3M7V A;  5K5M A;  3HFV A;  3HT3 A;  1S10 A;  2CPJ A;  1M5H A;  1Q7L B;  3DLE B;  4Y2A A;  4AE5 A;  3OVA A;  3G4S S;  3QT7 A;  2R2T A;  3Q2T C;  2C1E B;  2CNK B;  2IAJ B;  1LKZ A;  4ZVR B;  5KG4 A;  4Y0F A;  1F3F A;  4LFA F;  1JXE A;  4CO2 A;  2IJR A;  2FTR A;  3PNI A;  2ERR A;  1B7Y B;  1T11 A;  1TKT B;  2HFU A;  3GII A;  4DUZ F;  4ELU A;  3NBP A;  3UNG C;  2Y8W A;  5H9F J;  4LRC A;  3CC7 S;  4YY3 F;  2HQG A;  2W24 A;  3RTV A;  3VAM A;  3NOG A;  4N8O A;  1HL6 A;  2OPP B;  3VGS A;  3G6X A;  2EI5 A;  2E5L J;  3G96 A;  2RHQ B;  1XR5 A;  1ZTT A;  3K5N A;  1X5T A;  1H38 A;  1IKW A;  4ZJQ A;  5HAN A;  3V2U C;  4LT6 A;  1WG4 A;  4WFB Q;  4DMZ A;  3AJD A;  2HMI B;  2XNQ A;  2VPZ B;  2GJF A;  3CPW R;  3HHK A;  3RR8 A;  2BQU A;  2GZO A;  2JEI A;  3QQC D;  2F5G A;  2DCU B;  2NXC A;  1PIL A;  2E7X A;  2MZQ A;  3BN7 A;  3FUY A;  3H2L A;  5DDQ C;  4C11 B;  5F8N A;  2ROP A;  3LP0 B;  4N47 A;  3HDS A;  1JLA B;  2YPZ A;  2Z30 B;  4ES2 A;  1OQ6 A;  4ED6 A;  2DY1 A;  4DF4 A;  4DV5 J;  3RRG A;  5DM7 Q;  4QIW D;  1KRP A;  4MIA A;  2CG4 A;  5KFY A;  5IWA F;  3DMJ A;  2DGS A;  1S0M A;  3M05 A;  1AB8 A;  4FF4 A;  4OI3 A;  2MKI A;  1FNO A;  3QJP A;  4TN2 A;  4FYD A;  1H2U X;  5KFK A;  2XSF A;  2XY7 A;  2IBO A;  5DM6 Q;  3T5J A;  1T94 A;  3O5T B;  3D6T B;  2QLJ B;  3GSI A;  1U26 A;  2FLO A;  4ZVF A;  2V5H G;  3KMS A;  2UUW A;  1Q82 T;  3FBC A;  2RDJ A;  2CQ3 A;  4CH0 S;  3BO3 A;  4TXS A;  1UFL A;  2I8E A;  1ZZF A;  1RT7 B;  2YNH A;  4JI7 F;  1H0H B;  1IBC B;  2E5H A;  2PN6 A;  3HFK A;  2CRL A;  3T6B A;  4PUO B;  3FCW A;  1TUG B;  1IKV A;  3CO0 P;  1L3K A;  1VGY A;  1N5S A;  3LGN A;  3OBI A;  4RUB A;  1R8H A;  3THP A;  3T1H F;  4ZIV A;  1JJ4 A;  4CLT A;  3D0I E;  4B3S J;  3V6J A;  4KTQ A;  1VRU B;  2C3M A;  3HX9 A;  4P71 A;  4CT8 A;  3EIC A;  4B9M A;  2VJU A;  2WB1 D;  2VQF F;  1N8R T;  3ILJ A;  3CVK A;  5L9N A;  1CJK B;  4ED8 A;  3OHB A;  3ILI A;  1XEZ A;  4USU A;  2J0X A;  1U6B A;  1YBT A;  1VJQ A;  1F6T A;  1KS2 A;  3H5S A;  4PXE A;  2BJD A;  2ZWP A;  5LMU J;  5BXI A;  2RIJ A;  4EGL A;  3D3B J;  1QAX A;  2FJA B;  2GMH A;  2HG4 A;  1HBU B;  1WOR A;  1SBR A;  1VLY A;  2PC6 A;  3MCN A;  2ATC B;  1NM2 A;  4O44 B;  4P2F A;  5GAG U;  3UPF A;  2LKZ A;  3PKM A;  3EGV A;  2RRA A;  1GMW A;  5EHH A;  4UOH A;  1TAU A;  1ZA1 B;  5I3Q A;  1VQM S;  4ILM A;  1N34 F;  2A10 A;  3HD2 A;  5KFL A;  2XY6 A;  2GJ2 A;  5CYJ A;  1NKC A;  2NRE A;  3MM9 B;  2DNO A;  2LEP A;  4Y2K A;  2BMB A;  3DM2 A;  4E0D A;  4F4K A;  2PT0 A;  5DQH A;  3CDE A;  4IG3 B;  5E3A A;  1M5V C;  4EZ9 A;  5F8M A;  2HS4 A;  1JB0 C;  2CQ1 A;  2GV1 A;  3AJ2 A;  2V67 A;  4WTO B;  3TJ9 A;  4DV0 J;  1YBU A;  4RU2 A;  1VIS A;  3E3X A;  2FUG 9;  2HBR B;  2YWW A;  1N48 A;  1XMO J;  3PYG A;  5GAE U;  4X66 F;  4MJK A;  3IO1 A;  3BGF A;  4LR9 A;  1Z1Z A;  2JNJ A;  3GB0 A;  4GMK A;  4DR7 J;  4IFY B;  1PG5 B;  3QAU A;  3VAL A;  3BSN A;  2AEF A;  4BWM A;  2QFI A;  2GO8 A;  3CDB A;  2LDI A;  3W65 A;  1QVG R;  4K5S A;  3NY0 A;  2ACY A;  1E6V B;  1YK9 A;  4M5N A;  2F4F A;  2GS8 A;  4JI1 F;  3I9V 9;  2JL9 A;  4WXW A;  1SH0 A;  4WYL A;  2J7W A;  4AL7 A;  4ED1 A;  2UXC F;  2ZBI A;  1K0T A;  2ZDP A;  3ZTS A;  1RTJ A;  3PXG a;  4DDF A;  4G65 A;  4U7C A;  3QT5 A;  4KGV B;  5JVG Q;  3BBC A;  2XY5 A;  2PFD A;  2FJX A;  1KTV A;  1N5V A;  1R0A B;  1U8W A;  2WSE C;  3QPI A;  1FJE B;  3T9Z A;  4F04 B;  4URQ U;  3W3S A;  1NLK L;  2I9S A;  4DCP B;  5D78 A;  4CO5 A;  3A4T A;  4X66 J;  2R2S A;  3H20 A;  2JDJ A;  3P96 A;  4DBQ A;  3G6Y A;  2M70 A;  4DFM A;  3MM6 B;  1BQX A;  3R27 A;  2GA7 A;  2JWN A;  2MQP A;  3PDN A;  3RYL A;  2YKN B;  1R7I A;  4A8X A;  1WEL A;  5L46 A;  2AJF E;  4JBC A;  4DR4 J;  3HSG A;  2FVP A;  1M5S A;  4PQA A;  4CM0 A;  4MIB A;  2UV8 G;  1RTD B;  4X4U A;  2XZW A;  5IM0 A;  2RQK A;  3FSI A;  1SJF A;  2DR8 A;  2N7Y A;  2PD1 A;  3DRS B;  3EPI A;  1U24 A;  3CJS A;  4NLO A;  3CNQ P;  3TA0 A;  1ZM2 A;  1JLC A;  2CJB A;  5KT6 A;  4K4X A;  4RL1 A;  3QAT A;  1HD0 A;  1S6U A;  4HVZ A;  4NLD A;  5T41 A;  4U8V A;  1LW2 B;  4A46 A;  1UW9 A;  3E01 A;  3FCH A;  1QE1 B;  3N01 A;  2FLN A;  1FDD A;  5E7O B;  2DHA A;  2YH0 A;  1X4G A;  4USW A;  1SQE A;  3L9Z A;  2L3M A;  4RW8 B;  2Q43 A;  2WSC C;  1K0V A;  3CT9 A;  4Q0B B;  2QA4 S;  1JKH A;  2OHD A;  2L9W A;  3CF5 Q;  3H59 A;  2LQ8 A;  4H4K A;  3CCZ A;  3EZU A;  3CME S;  3PW0 A;  2OPS A;  2DNZ A;  4B08 A;  2EFP A;  5CAA A;  2JSX A;  4G6V B;  2AV5 A;  4F4A A;  3JTO A;  2VF3 A;  1FVQ A;  2P9C A;  4DCJ B;  3PFE A;  4TQR A;  3NWR A;  4GO5 X;  4DJB A;  1TVR B;  4XPE A;  3FMB A;  3TUP A;  3AHP A;  5GMK a;  3RR7 A;  2KI2 A;  3PRD A;  2X3G A;  2AJ1 A;  1FX2 A;  4L74 A;  2RU3 A;  4UY8 T;  4LF6 J;  2BAB A;  5F0W A;  5J2P A;  1HFE L;  1CQM A;  3BGU A;  3LAN A;  2OSR A;  2DPJ A;  1OQ3 A;  1SL1 A;  1WC4 A;  2VU5 A;  3H0P A;  1TKT A;  1WKK A;  3Q2S C;  4ANE A;  4QR0 A;  4BBY A;  3EGZ A;  4ERD A;  4PG8 A;  1DZ5 A;  4EWT A;  2YKM A;  5AXM A;  5KFU A;  1FRX A;  3NRB A;  4CLY A;  2E5L F;  2R7U A;  1ZS6 A;  3C3L A;  2PSZ A;  2YNG B;  1HNX J;  3GON A;  1XMO F;  2QSF A;  1D3W A;  3KLF B;  4FXW A;  1KOH A;  1RLD A;  4J90 A;  2QMU B;  3PX6 A;  4B3O B;  3TO8 A;  3P5T L;  1X4F A;  4NLS A;  1WTF A;  3ZZZ A;  4CLL A;  4EBC A;  5LL6 d;  1KFD A;  2IJN A;  2LCW A;  2IJF A;  4JB8 B;  2H5E A;  2B6A B;  2OEL A;  3QID A;  1GFW B;  3I6P A;  3OFF A;  3VAH A;  1L3S A;  1R8C A;  4NPO A;  4OYP A;  1O6X A;  1DFD A;  4ED0 A;  3I4H X;  2GAG C;  3MM7 B;  4NAS A;  1M90 T;  4YR2 A;  3PYD A;  3VTI A;  4OHX A;  2ZBC A;  1UVI A;  3HF5 A;  1LWF B;  3C15 A;  3HJV A;  3K8W A;  1WG1 A;  1RT4 B;  2VBW A;  3W5X A;  4HI1 A;  2GNK A;  3J7Y I;  4M5D B;  3DLH A;  4AD6 A;  1FE0 A;  1VQL S;  3NCQ A;  3QJL A;  4CLZ A;  1JWW A;  1T9U A;  5L8R C;  2NSC A;  2NZC A;  5G0R A;  5K8P A;  4N56 A;  3BSO A;  4LIW A;  2M3D A;  1U1L A;  1M5P C;  2YX1 A;  3MEC B;  5K9F A;  2UUA F;  2HHP A;  1MU2 A;  2G2Y A;  3K5O A;  4P73 A;  4MKB A;  2OD6 A;  2HZA A;  1CC8 A;  1BWE A;  1BWV A;  4ECV A;  5C42 A;  2G9O A;  2CG8 A;  4IR9 A;  1HR0 J;  2G4B A;  5ETN A;  1X7V A;  2MTL A;  4TQS A;  4J9L A;  5ETO A;  4KB7 A;  2N3L A;  1RTH B;  4BC7 A;  1HMV B;  4BCA A;  1RAO A;  3SCJ E;  1X5O A;  4HAC B;  1CJT A;  1FDB A;  2F8E X;  4LIR A;  5A8R A;  3PW2 A;  1TKX B;  2HK3 A;  4YR0 A;  2BOP A;  2C3P A;  3IFE A;  4DQQ A;  2AW0 A;  3HVT A;  1YIT S;  3KG0 A;  4PQU B;  1NB2 A;  2I0X A;  2IRX A;  2N4C A;  3CD5 A;  4HHJ A;  2D3O 1;  3JAM Y;  3C14 A;  2NR0 A;  1VQS A;  3C6U A;  4NLX A;  3VGU A;  2EFV A;  3PZP A;  3L7O A;  3R5A A;  3QRP A;  3DDI A;  3I96 A;  4PXD A;  1RAD B;  3KHR A;  1OSD A;  1EHW A;  4DV7 J;  1C0U B;  4NI2 B;  4WKY A;  1TL3 A;  1TKZ A;  4M8L A;  3D1O A;  3HFZ B;  2XWY A;  3WC0 A;  4P9S A;  2WCX A;  3OTB A;  4LBH A;  1HQE B;  3M9M B;  4EBD A;  2HYI B;  1GX6 A;  4YDD B;  2XGP A;  3K5M A;  4ELV A;  4PAB A;  3LAK A;  1Y7P A;  4UUX A;  5LXR A;  1JJH A;  3T5L A;  4WZQ A;  2F40 A;  4RBU A;  1H7X A;  1HI8 A;  4KFB A;  4KPY A;  2B51 A;  2AJQ A;  1U0H B;  3H5Y A;  3W7B A;  4PKD B;  5HAT A;  1FRM A;  2OLW A;  1QE1 A;  5KFD A;  4C3L A;  1MSW D;  4KE5 A;  1VMB A;  3M2U B;  2MJN A;  1FDA A;  3WBZ A;  3HHE A;  4J9O A;  3UDE A;  1YIJ S;  1IBK F;  2O67 A;  2MJU A;  2LVW A;  1U1Q A;  2OPR A;  2D9O A;  1TZ0 A;  3H8Y A;  4EK2 A;  1J27 A;  4F50 A;  4FN5 A;  5KFZ A;  4M5L A;  1LWC A;  3R8Y A;  3HP6 A;  1WHW A;  3UI3 A;  2ZH2 A;  1NK7 A;  2VG7 A;  2DGW A;  1F60 B;  1WUU A;  2O01 C;  3B54 A;  4ECU A;  2RAQ A;  2YNG A;  2LXU A;  3V6D A;  1GMW D;  4F3O A;  2J5A A;  5CAB A;  5CD4 A;  5A2Q Y;  3EZ5 A;  2V0N A;  4PZV A;  1SUQ A;  1RSC A;  1YRU A;  3D1Q A;  5IV3 A;  2LYV A;  1AUS L;  4URG A;  2K2P A;  3RUB L;  1VQP S;  1MN9 A;  5A76 A;  2KXF A;  4ID8 A;  2HLU A;  1J5O A;  4ZPD A;  1WF2 A;  5THW A;  3SEO A;  2DGO A;  4F36 A;  2D3Z A;  4IO1 A;  2DVI A;  3KJV A;  1P27 B;  3HHL B;  5GAH I;  1P6T A;  2DXD A;  4H4O A;  1H2T Z;  4P10 A;  2O1P A;  1TUV A;  4YEA A;  5I42 B;  4CH1 A;  3PKY A;  2ADC A;  1UJ4 A;  3ITH A;  3QWP A;  3CC2 S;  4NMX A;  2CPZ A;  1SQF A;  1S79 A;  2PEB A;  2YX4 A;  2ZVS A;  1HNV B;  3C15 B;  3ONQ A;  4USK A;  3OV7 A;  3TA1 A;  3RRH A;  3IG1 A;  1XMQ J;  2XGQ A;  3DHW C;  1IWA A;  2UVU A;  2LEA A;  3HHN B;  3H42 A;  3M8Q A;  1RBL A;  2E7V A;  4X2B A;  5E2Q A;  2QC3 A;  3HZE A;  1RP5 A;  1S9E B;  1LEO A;  2GMJ A;  1AA1 B;  2Q1L A;  2ZD1 A;  5KFE A;  3U1M A;  4Q45 A;  1KC8 T;  5F3T A;  1IKV B;  4ES1 A;  5KG3 A;  4LFB F;  5ETL A;  3OJU A;  2E9Z A;  2JVR A;  2PMW A;  4BDP A;  2QN6 B;  2ZC3 A;  1Y10 A;  2VC1 A;  4D3G A;  4DUZ J;  2A6O A;  5CZV A;  2IDL A;  1B0T A;  3MR3 A;  1X9W A;  1S1V A;  2YNF B;  3BSA A;  1P1T A;  2MLZ A;  3G71 S;  1NJY A;  3AOA A; 
#chains in the Genus database with same CATH homology
 1IBK J;  3JAM U;  1N33 J;  4NEY A;  4DV0 J;  5LMN J;  4X65 J;  2VQF J;  4B3R J;  1XMO J;  4JI8 J;  4JI6 J;  4V1A k;  4DR7 J;  5FLX U;  4NXN J;  2UU9 J;  4LF8 J;  1HR0 J;  5A2Q U;  2MTL A;  4JI3 J;  4LF9 J;  4JI0 J;  2ZM6 J;  4OX9 J;  4KHP J;  1N36 J;  4KY3 A;  1N34 J;  3OTO J;  1XNQ J;  5IWA J;  3J80 U;  1N32 J;  2E5L J;  5BR8 J;  4X66 J;  4LF7 J;  2UXB J;  4DV7 J;  4B3M J;  4RJV A;  4HHU A;  4DR4 J;  4DV6 J;  4JI1 J;  4NXM J;  4DR5 J;  3D3C J;  5IT9 U;  3IMQ J;  4X64 J;  3R2C J;  2MQ8 A;  4AQY J;  4JYA J;  4DV5 J;  4K0K J;  3T1H J;  4LFC J;  1HNW J;  4LF5 J;  4YY3 J;  4JI7 J;  4JV5 J;  4DR2 J;  1IBM J;  4GKK J;  2VQE J;  4NEZ A;  4DR6 J;  4LF4 J;  1I94 J;  2MEW A;  2UUC J;  2HHH J;  4DR1 J;  4KYZ A;  2F4V J;  4JI5 J;  1XNR J;  3T1Y J;  2UUA J;  3J7A N;  5AJ3 J;  4DV1 J;  4JI2 J;  4DR3 J;  4PWW A;  4JI4 J;  4B3S J;  2KVQ E;  3J81 U;  4LFA J;  2UXD J;  4DUY J;  4LF6 J;  2UXC J;  1IBL J;  4DV3 J;  4X62 J;  3W1Y C;  3D3B J;  1XMQ J;  2KL8 A;  4LFB J;  1HNX J;  1HNZ J;  4DV2 J;  1FJG J;  1J5E J;  5LM7 E;  4DUZ J;  4B3T J;  5LMU J;  3R2D J;  4DV4 J;  4GKJ J;  2UUB J;  4YHH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...