2CPFA

Solution structure of the penultimate rna recognition motif of hypothetical rna-binding protein rbm19
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLFIKNLNFSTTEETLKGVFSKVGAIKSCTISKKKNKAGVLLSMGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRISERATKPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the penultimate RNA recognition motif of hypothetical RNA-binding protein RBM19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RNA binding motif protein 19
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpfA00
2CPXA 3UWTA 2ADCA 5GMKa 1HA1A 3MI7X 2XNQA 1U6BA 4WKRA 1U1OA 2RRBA 5GAEU 1YJWS 1U1RA 2VOOA 3PIOQ 2LYVA 2HVZA 2MZSA 1UW4A 2MKHA 2KG0A 2DNOA 2CQ4A 3DXBA 4F26A 3HI9A 2GO9A 2DNMA 4ZKAA 3BEGB 2KT5A 5CXTA 1VQ8S 3D2WA 5HL7Q 4PR6A 1FJCA 1YJ9S 2DNHA 4LJMA 5LXRA 3UCUP 2G4BA 3U1MA 2LQ5A 1HD1A 3BS9A 2YWKA 1U1LA 2KRRA 3P6YC 1U1QA 1X4BA 2DNGA 3SDEB 5CYJA 2G1DA 3N9UC 2M9KA 4A8XA 1VC6A 3K0JA 3MURP 1X5SA 1WELA 2F9DA 2JX2A 3LPYA 2E5GA 1YWXA 1VC5A 2KXFA 5IM0B 2JWNA 2M8DB 2M52A 1WEXA 3CUNA 1P27B 3EX7B 2EK6A 3R1HA 2JVRA 2MJUA 2CQGA 1K9MT 1NU4A 1KD1T 2MY8A 1YHQS 1D8ZA 3CXCR 3NS5A 3BO4A 2DITA 1W2BR 1WHYA 4TU7A 1U1NA 2MQMA 2AYMA 1FHTA 4RU2A 2VOPA 3P49B 1K73T 1X5TA 1X0FA 3R1LA 2CQ2A 2L41A 3ZZZA 2HGLA 2DISA 3G4SS 2MJNA 3MXHP 2DGOA 1FXLA 3Q2SC 2DGTA 3CPWR 2PE8A 2RS2A 1VBYA 2MPUA 2D3OR 3BO2A 5D77A 5LXYA 2FY1A 1DZ5A 2NZ4A 2VONA 2DHGA 2EK1A 2LEBA 3CCMS 1WG4A 3NS6A 2DHAA 3MD1A 3H2UB 3OW2R 2J0SD 2DH8A 1NO8A 2FHOB 4M5DB 1AUDA 2N3OA 1XN9A 2E5IA 2M88A 3PIPQ 1A7GE 1KOOA 2A3JA 2RUGA 1JJHA 3THTA 1U1PA 2DHSA 2KI2A 2CPEA 2M7SA 3MUMP 3S6EA 2F9JA 4WFAQ 2KG1A 4Y0FA 1CVJA 1DBDA 2LEAA 1KC8T 4IO9Q 3TO8A 2MZQA 3CCUS 1X4EA 5EN1A 3CCJS 2MQNA 3FEXB 1KQSR 1L3KA 1U2FA 2DGWA 1YJNS 2HGNA 1M5KC 2CQ3A 2MZ1A 2E44A 1FT8A 1YITS 2AYGA 2KH9A 2MQLA 4C4WA 1F9FA 2QA4S 2ZJPQ 1WG5A 2DNQA 1Q82T 3NMRA 3NNAA 1WEZA 5GADU 2DGSA 2XS7A 1WTBA 2MQQA 2CPFA 2KXNB 3NNCA 1H2UX 2CQCA 3UE2A 2ADBA 4YB1P 2YKAA 4IOCQ 2U2FA 2DNPA 4FXWA 2JVOA 3NNHA 3VALA 4CIOA 2MSSA 2KFYA 3MDFA 1SXLA 4U67Q 3G8TA 1D9AA 2CQIA 2MSTA 5LJ5Y 2LA4A 3THPA 2QEXS 3G9CA 1M90T 2DO0A 1M5PC 2MKKA 4IOAQ 1FJEB 3VAKA 1SJFA 3FEYB 4C0OC 5DDOC 2OTJS 4OZ0A 1SJRA 2DH7A 4F25A 4CH1A 3MOJB 3TP2A 2MKJA 3TYTA 2DGUA 3VF0B 3VAGA 3UD4P 5BJRA 1OO0B 4TU9A 1ZH5A 2RU3A 2J8AA 2DB1A 2M70A 3P3DA 2Q79A 2DIVA 2KM8C 3I55S 2BOPA 3ULHA 3HHNB 2DGXA 2MYFA 2MGZB 2LKZA 4TLQA 2XS5A 1HD0A 1UAWA 4C7QA 2LECA 1WHXA 4LIRA 1M5VC 4P6QA 2LXUA 1WI8A 1BY9A 3S8SA 4J5OA 5FJ4A 1UFWA 3P5TL 3US5A 5DDRC 1P1TA 2B0GA 1WHVA 2CQDA 3G8SA 3MD3A 2RQ4A 4EGLA 1Q81T 1M5OC 1H6KX 2VODA 2CPHA 5LSOA 2KXHA 5DETA 1VC0A 3VAHA 2CPJA 2MY7A 5DDPC 2XNRA 1FO1A 2DNRA 1R8PA 3H2VE 3G96A 5JVHQ 4UQTA 4WCEQ 1H2TZ 2OIHA 1WWHA 2OJ3A 1WF1A 3VAIA 2N82B 1SJQA 4UY8T 1URNA 1IQTA 2D9OA 1NJIT 4WFNQ 1VQMS 2MKCA 1ZZNA 2KHCA 3UCGA 2JRSA 2E5HA 2CPZA 1SJ3P 2M8HA 2V94A 5CA5A 1YTYA 1VQKS 2M0GB 2WBRA 1DHMA 2DNKA 1X4HA 2L08A 4WFBQ 2X1BA 1YI2S 2G0CA 1RKJA 1VBXA 2MXYA 1UP1A 2CPYA 4PKDB 3JB9k 1VQPS 3RW7A 3U1LA 3L3CA 3CF5Q 1JJ4A 1WEYA 4ED5A 1WHWA 5D78A 1VQ9S 3G6ES 2MB0B 2ZJQQ 2ERRA 2D9PA 2BZ2A 1M1KT 2MKIA 3CCQS 2DIUA 3CCES 3CMES 2N3LA 3UCZP 1S72S 5GAHU 1QVGR 1O0PA 2KM8B 2MQPA 2DNZA 2KVIA 2MZJA 2LMIA 1OIAA 3CCRS 2XSFA 4F02A 3SXLA 1Q7YT 5IM0A 3J7YU 3UD3P 4IUFA 3B4DA 2DGVA 3VAJA 4QQBA 3EGNA 2J0QD 1RK8A 1S79A 2CPDA 1N88A 2DNLA 2DO4A 2NLWA 1WG1A 2I38A 5GAGU 1YIJS 3SDEA 2YH1A 1KOHA 2HGMA 2CQBA 2FC8A 3I56S 2AYBA 2QFJA 2KN4A 2UP1A 2X1FA 3CULA 2MHNA 3EGZA 2XS2A 5H1SV 1VQ7S 2I2YA 4BS2A 4QU6A 1X5PA 2GHPA 3G71S 3RW6A 2K8GA 5LSLA 1X4DA 2HZCA 3V4MA 4CH0S 2EVZA 3CC2S 2U1AA 2YTCA 2YH0A 1Q86T 3S01A 1FJ7A 4TU8A 3SMZA 3CC4S 2M2BA 2LCWA 2AYEA 1FNXH 2CQ0A 3VAMA 1N54B 2LXIA 3S7RA 1HL6A 2DHXA 1PO6A 1OWXA 2MQOA 2MMYA 1VQLS 3BO3A 4W92B 2XB2D 4QU7A 1X4AA 2LA6A 4V19X 2OSQA 2X1GA 2RVJA 4OZ1A 3J7ZT 1VBZA 5DM7Q 1JJ2R 1JMTA 2F3JA 3MUTP 2AD9A 1ZZFA 2CQPA 1VQOS 1VQ4S 1A9NB 2K3KA 3DLLQ 4QPTA 2E5JA 5DDQC 2KYXA 2ZJRQ 2KU7A 2M4MA 4FXVA 2MGZA 1U1KA 2CJKA 1VQNS 1VQ6S 3LQVA 1QM9A 5MLCV 4Y00A 4YOEA 2CQ1A 2RQCA 3VAFA 3CC7S 1U1MA 2MZTA 2RRAA 3CD6S 5ITHA 1U6FA 4YUDA 2CQHA 2FC9A 4W90B 2DNNA 2MZRA 2J76E 1X4CA 2DNYA 3CCSS 5GVQA 4WF9Q 4CQ1A 1WF2A 1X4GA 3ZZYA 3B4MA 2RNEA 3CCLS 4WIIA 4Z2XA 4LMZA 3CTRA 5IQQA 2PEHA 5DM6Q 5JVGQ 2L9WA 1X4FA 1H2VZ 2DK2A 3CMAS 2O3DA 3R27A 2KRBA 2X1AA 2SXLA 4ERDA 1SJ4P 3CCVS 1X5OA 1N8RT 2MKSA 5HO4A 3MUVP 2RS8A 2FPHX 2DGQA 2CPIA 2OTLS 2OSRA 4PRFA 5IFMA 1N52B 2RT3A 1K8AT 5LJ3Y 2DH9A 2HYIB 1VQ5S 1PGZA 3IWNC 1R8HA 3IRWP 1QVFR 1B7FA 1WF0A 1DRZA 1OPIA 2N7CA 1WI6A 3Q2TC 1G2EA
chains in the Genus database with same CATH superfamily
2CPXA 4M5MA 3W7BA 5F8HA 1K47A 4Q45A 4DR1J 3CO9A 1JLBB 4O3RA 4GMKA 2B6AA 2ZZTA 2IM2A 1NDKA 1FFWB 4P73A 2J0XA 4X62F 1KSPA 4EO6A 4WKRA 1G6BA 2RRBA 3ENWA 5F8MA 4B3TJ 4O4GA 2NS1B 2GMLA 1CULA 3DRXA 4KJIA 4UUXA 1UVMA 2HVZA 1FTCA 3UNYA 3R5CA 1HBNA 4J9UE 2WSEC 1FKPA 3JSRA 2VL1A 2MKHA 4ZLLA 3HI9A 1B70B 4U95A 4ZLJA 2E1AA 4MYTA 4LF5J 3UQSA 4C11B 2B51A 4UQGA 4PXCA 2KT5A 2NXCA 4FZVA 2BQRA 2VC1A 1WACA 3L9ZA 3KK2B 5CXTA 5B0FA 1VQ8S 1FJCA 2VV5A 3F44A 3G6VA 3T1YF 2R42A 1OYDA 1YJ9S 1AZSB 2HNYA 4WP8A 3KJVB 1UJ6A 1M5SA 2JSXA 1YK9A 2FB0A 2KRRA 2BJ3A 1U1LA 2F8HA 3MPVA 1U1QA 2GS8A 1YJVA 2B6AB 3SDEB 2XMUA 4J9SA 1FFSB 1LW0A 1RHKB 4EYIB 2ZM6J 4OZNA 3RRGA 4KHRA 4ZJOA 4A8XA 5HP1A 3MURP 1VC6A 1RLCL 4FKXA 4QR1A 5KFSA 2AJQA 3OTDA 2HIYA 4YB6A 3NG8A 2JLEA 1LFWA 2KKHA 3SQGA 3CJRA 4DG1B 4P71A 2ZH8A 2HNYB 3SI8A 2KXFA 4DV5F 3HD2A 2JWNA 1G1XA 2FDNA 3M8PA 2FHJD 1GMWA 2EFNA 1N33J 4ELTA 1UVKA 1T9VA 4LRCA 2EK6A 4C3LA 3R1HA 3VR1A 2PGCA 3G86A 2CZ4A 3W9HA 3D6HB 1FDBA 3MMAA 4C8ZA 4K2XA 4R8UB 2AKWB 4FDFA 2HVIA 3W8PA 1T0TV 4ZVGA 3DRRB 2AT1B 4ZVQB 3VZIA 2MDAA 2FVSA 2QJ3A 4ELVA 1DJ0A 2PMHA 1CBKA 2W4DA 1KVKA 3K5MA 4TQRA 2AX1A 2JEFA 5D0RA 3W62A 1N5TA 4HT7A 2R4FA 1BWVA 3GG0A 4GKJF 2DITA 3UDEA 1W2BR 3AOBA 4ZS6A 1WHYA 2B43A 1V5VA 4IQXA 2AYMA 2K7JA 1FHTA 1MW7A 2BE2B 3IFEA 4O23A 4PABA 2BANA 2XYHB 2K06A 2QIFA 1Q8IA 4PG7A 5CD4A 3M9MB 4RJVA 2FJBB 3VGVA 4EI2A 3K2YA 2XZDB 5F3TA 3TQ1A 2NPIA 4GO7X 3CCWA 2B7BB 2BE9B 4YHHJ 1NB7A 2HGLA 1XR6A 2RH3A 4B02A 3G4SS 2FJDB 2IC3B 5B0EA 4J7CA 2G2OA 1S1VA 4YR0A 1HNZF 1FXLA 3QZ8A 2VA3A 3TQEA 2CKWA 3JQJA 4NWBA 3DLHA 1VBYA 2MPUA 5L39A 1YG0A 3KK1B 5D77A 3GILA 3M9OB 1TKZA 2V50A 3DYAA 4DL3A 2H4YB 5GAGI 4P7TA 2PA8D 1WOSA 3TUIC 4A4JA 1HI1A 2YKQA 2R7RA 2NQPA 3LW5C 3AD7C 2UV8G 1UPMB 4ANDA 1TK0A 3MD1A 5EWEA 2YWWA 1REVB 2JFKA 3PW2A 2BE2A 3OW2R 1TFWA 4M8LA 2KTQA 2DR6A 5CAAA 3QJJA 2J0SD 2DH8A 1NO8A 4RBUA 4DUYF 3E51A 3OLAA 4OI0A 2N3OA 2LQBA 1QAYA 1XN9A 5HBMB 3QRPA 1PYTA 4DCJB 2Y1RI 3ZTPA 3PIPQ 1KQKA 1LW0B 1B0VA 1J2VA 1IWAA 1LWCB 1WC5A 2V8VA 2EW9A 1C0UA 1MWQA 1JKHA 3BR9A 1SKWA 1IBKF 3BPSP 2CFXA 3EXYA 3TX8A 4ZN1A 2UXDJ 2G9OA 1K0VA 1CJVB 3GCWP 3ZFVA 1RTJA 4WFAQ 2JNJA 2KT3A 2KG1A 4Q2LA 2HLUA 3OL9A 2FHJA 2QZ8A 1DBDA 1KC8T 2V8GA 2JEIA 3HMJG 4RR5A 1U25A 2ASYA 3DDKA 4ZVEA 4JYAF 3TARA 3MAQA 3KTQA 4LRDA 3B82A 4BWJA 5EGYA 3TZZA 4JV1A 1AW0A 1H7XA 4LVOP 3SSSA 1X4EA 3D6MB 4OX6A 5EN1A 2XI2A 3ITHB 1Q7LB 2VJUA 2IAJA 1NEEA 1REGX 1RUSA 2QLBB 3KLGA 2C42A 2RB7A 1U2FA 2AEMA 1GTHA 3BKFA 1TL1B 1T3NA 3FSYA 4O4RA 1CJUA 2P8IA 2UXBF 2UZAA 3UR3C 4NXNJ 3EZOA 1FWKA 1SC6A 2AYGA 2RKIB 4KIAA 2BJ8A 4ECYA 5J2QA 4C4WA 1S0MA 1F9FA 2MLZA 3MECA 4V1Ak 2OEMA 5KG0A 5SZTA 2LU1A 3R7BB 2ZJPQ 1QD1A 1ZAVA 5AE2A 3I32A 2DPJA 4LF4J 4CO5A 2LEPA 4DLGA 3NNAA 4XPEA 1RISA 3KDOA 2MQQA 3QO9A 3NY0A 1MU2B 2GW8A 1RT5A 1H2UX 2OPSA 1ZTTA 3QWPA 1F3FA 5K9FA 4BWMA 3V2UC 3JYTA 1HPZA 3F56A 2YKAA 3KMQA 1IR1A 3FQLA 5K8PA 1ITPA 1I5OB 2O67A 2ZKTA 2HHVA 2Y1LB 2GZOA 4NLDA 1M0SA 2DRAA 1FCAA 3HZGA 2RJZA 5K14B 1NK8A 4CIOA 4FF3A 5F9LA 5C42A 4TVAB 4BC9A 1F5AA 1N4LA 3MDFA 4K4VA 2BKOA 1O5JA 3EXCX 4U67Q 3GR1A 4G1QA 1D9AA 3C14A 2RD5C 1CS4A 2CQIA 2NXUA 4R25A 5E5NA 3EVOA 1YRUA 1TKTA 1SC4B 5A6WA 1YX2A 2LA4A 3CJKB 2XY6A 2XHCA 3CJ3A 2PDAA 3QBCA 2ASJA 2QEXS 3NMAA 4U7UK 2DO0A 4CCHA 2BJDA 1KKHA 3KLEA 3QJPA 4HACB 4RWWA 1UPPA 2JC1A 4BDPA 4ID8A 1FJEB 2H1YA 1ZM9A 2H5IB 1SJFA 3JSYA 3MM8B 4C0OC 2W9BB 2V69A 1JLCB 1IKXB 1SQFA 4WFYA 5F8LA 2R8GA 1HPZB 4LBIA 3KLFB 2OAUA 5CD4H 2IMOA 5C25B 1TL5A 4HH1A 3FCWA 2EPIA 4GO5X 5CCLA 2DY1A 4ANCA 2XWXA 2OFGX 3TYTA 1L3TA 2NXJA 1I94F 1J5OA 4DR6J 3VTIA 3GPAA 4G3IA 3ZNUA 4JI6J 3AT1B 1DLOB 3ZTSA 1EP4B 1QAXA 3BBFA 4QIVA 3NGSA 1YJUA 4ILRA 2V4RA 1SVDA 2HPUA 2WOMB 3MM7B 3BGUA 3T1AA 4CLFA 5H9EK 1NPRA 3MEGB 2HAFA 1FVQA 3KLGB 1EHWA 3FBEA 3KHGA 2BOPA 2WTFA 1JLAB 1YSJA 3KFWX 3UNGC 5FDLB 3D54A 1CG2A 2JH3A 2RU9A 4EU0A 2ASLA 2C28A 4TLQA 2FLLA 4LFCF 1HD0A 2W8KA 3R2DJ 1UAWA 1G3OA 1OMSA 4ZP8A 4C7QA 1MMNA 5CYQA 2JDJA 3SFUA 5KT3A 3RBDA 3DOLA 1RP5A 1RCXB 4M5LA 5KT4A 4TY8B 4LFAF 3MM7A 1YDLA 2RSQA 1HR0J 1RTIB 3LP2A 1UFWA 3ILLA 4KKOA 5FLXY 1FF2A 3IA0A 1HBNB 2HSEB 5KFFA 4I0WA 2QYCA 1AT1B 2B0GA 5AXKA 3NCPA 4X66J 1L3VA 3H5XA 3MD3A 4ES2A 4ALZA 3LTOA 2VODA 3D4JA 3KNAA 4PYDA 2XULA 4JI8F 2KXHA 2XMVA 4UT4A 3BGOP 4DPYA 1FRKA 2C2ZB 1ZA2B 2ROGA 3VVUA 1JLBA 3D6FB 3QYYA 5IT4A 2MY7A 3B6BA 1PJ6A 2XNRA 4NPOA 3BSAA 4A8OA 1JLAA 1X8DA 2FYXA 2LU2A 2OPRB 3H2VE 5JVHQ 4EZ9A 5A2QU 1RAHB 4J9LA 1R6VA 2D41A 1ROFA 4M63A 1Y7PA 3Q23A 3WC2A 2E9TA 8ATCB 4OHWA 2ZNZA 2D69A 1WORA 3QMQA 3HCXA 1WWHA 3ENVA 3T41A 2AGQA 3DC2A 2OJ3A 2VG7B 2JLFA 4FN5A 4NLVA 2YWFA 4ZVHA 1TKTB 3TUZC 4DV0J 2D9OA 1GH8A 3BGRA 4RL1A 3ELHA 3OXGA 4Q2MA 4C8NA 5C2GA 4CLTA 1OQ3A 1URRA 2XMJA 3D1HA 3LGHA 3MM5A 4PXEA 2Y1JA 3QSIA 3ZTQA 1I1GA 3LF0A 1FXDA 1TKXB 4DV1J 4F3MA 2CPZA 4RO0A 2ALYB 3X3UA 4ZLNA 1ZM3A 1WSVA 3SV3A 2ZWOA 2KYZA 1YTYA 1EX8A 2WBRA 4X65F 1B3TA 1TK5A 3LOUA 3DRPA 4DQQA 4KE5A 4NI2B 4WFBQ 1KFSA 4HACA 1JWWA 2CAJA 3QQCD 3MM5B 5DG8A 1YI2S 1HHTP 1RWPB 1LWFB 2HBYB 4XTTA 2OPRA 4Q5VA 3PDNA 1VBXA 1RT3A 1SKRA 2EC2A 4PKDB 4Q44A 1VQPS 2C1EB 4JI2J 2UXCF 4LREA 2EEYA 4HLBA 3GR0A 2IVYA 1VQ9S 3GU0A 5D0HA 5BYRA 6FDRA 1LEOA 5BR8F 2AQ4A 2HZVA 4N5SA 4PQUA 2HHQA 2Z8QA 2VFTA 5B08A 1NPPA 2CUYA 4ECSA 2WB1D 2MKIA 2BJ9A 3CCQS 3AA8A 3JTPA 5DZ7A 4K4SA 2P2CB 3S1TA 3UCZP 1CJKB 1S72S 4PUOB 2BE7D 2MQPA 2KVIA 4J37A 4TY8A 3JAMU 3IGVA 1KP6A 3OBIA 1TAQA 1C1BB 3JTNA 2XSFA 3ZTOA 4ZLPA 1IN0A 2HQIA 4C8LA 5KG2A 1RTZA 3UD3P 4CO4A 1KONA 4E8UA 2J7UA 4K4ZA 2GHVC 4KHPJ 1E6YA 1F2HA 2PSZA 4DR5F 2J0QD 1S79A 3MTKA 3W3SA 1ZPWX 3BV8A 4NLXA 3FNNA 3O2IA 3BR8A 1F6TA 2UV8A 3NOGA 4RPFA 1I51B 5A0YB 4X4OA 3OTOJ 3V81A 2WSFC 1HWIA 5GAGU 2NSCA 3SDEA 1D0EA 3NKYA 1KOHA 3CJ5A 1EAYC 3MR2A 4NYZA 2HVEA 2VQEJ 2FC8A 2C2DA 2UP1A 1VJQA 2RE1A 4YS2A 5L8RC 4B9NA 4FVMA 1UKUA 2ACMA 3J7A1 1W26A 1RWXB 5A0YA 2ZH5A 1Q8LA 3AHPA 4DS5A 2BR0A 3EMTA 4BS2A 5A8WA 3HPOA 3W63A 3G71S 2JHEA 1HI0P 2G0IA 3TUPA 5BYSA 1BLUA 2YWGA 4J91A 3IWLA 5E3QA 4ED0A 2UU9J 3LH2S 4NXMF 1S12A 2U1AA 1IKXA 4ZJQA 5L1JA 2YH0A 1R8BA 2YTCA 3OSPA 5E2QA 3L7UA 4H4OB 3AXKA 1S1WB 3DLJA 1YBTA 3FK4A 1VQYA 4DPOA 3SIPB 3HXMA 2VICA 2QMUB 5AXLA 4BCAA 3BJYA 3PW5A 2A1BA 4DV7F 2FJWA 3A8JA 2P6TA 4F0MA 3CC4S 4K0KF 3CD5A 1YQHA 2AYEA 3FFIA 2ASDA 3C8YA 1TELA 2OO4A 2FD2A 4IO1A 5D4NA 5LT5A 4GKKF 1A6LA 4DMZA 1N54B 2I5JA 2V4JA 3OR2B 3RG6A 3GIJA 4KGZB 1PO6A 2LVWA 1OWXA 1FD2A 3OXLA 2HQGA 1TK8A 1JB0C 3BO3A 4ED6A 2W9CA 4QIWD 4JI7J 3GJSB 3HHKA 2HFVA 4C8MA 4ZVTB 2XB2D 3GIRA 1TL3B 4B3SF 2AJ2A 1MWZA 2O01C 2LA6A 4IH7A 1RWWB 1RHMB 3LP0B 4OQJA 4MKYA 4C3KA 1OY6A 3M2UB 4RWXA 2OSQA 1TL7B 1HBUA 3FBFA 3IAS9 3IG1A 4J9VA 4RNHA 4DPUA 1SUQA 3TR5A 1VBZA 2XZTB 5DM7Q 4TLRA 2DT9A 4RUAA 1JJ2R 3GTYX 3MUTP 2AD9A 4LQ9A 2FZGB 4WFXA 2ACYA 3ZNJ1 2XBPA 5HMYA 4CM0A 2ZHAA 5DGAA 1NSPA 2CQPA 1HW8A 2CG4A 2YX1A 3FQKA 4NA1A 2C2NA 3BGFA 4USWA 3SEOA 4OYXA 4CLYA 5KG5A 2R9LA 1HNIB 4QPTA 1RAFB 4ZPBA 1HQEA 5HLFA 2APOA 5KG4A 3MR3A 2DRBA 4ERDA 3HKZD 3MMBA 1QSSA 2DXEA 2VDIA 4JV5F 1JLFB 1U1KA 2YNFB 4ZVSB 3G8TA 2HFZA 4RNFA 1VQNS 3G8QA 3PVXA 4LF1A 3DRSB 1R31A 2XSJB 1LWEB 2G2YA 2CQ1A 1SH0A 3PYEA 2Y3YA 3M6XA 3MMCB 5L46A 4JI5F 2MQ8A 3CD6S 4PWWA 1JNRB 1U6FA 5D4OA 5ITHA 1Q95G 3CDBA 3QT8A 5EX0A 4C11A 2J76E 1GEHA 1VRTA 3VCDA 1OPZA 2WRMA 1N6QA 4DJBA 5D15A 5KOXA 1JLEA 3I9V9 4DS4A 1CJTB 1JNZB 2A0FB 4CQ1A 2IRYA 1X4GA 2J5AA 4OZJA 4TYAA 5LMUF 4LR7A 2IJFA 1C1CB 4RW4B 4ECQA 2DR7A 1DQAA 2RNEA 4CO3A 3CCLS 1D3WA 1H73A 1OYEA 2KZMA 3MAHA 5DG9A 3OFFA 2AIRB 2OHDA 3M2VB 2YKMB 3K8WA 2PEHA 4B9UA 3R2CJ 2HMIB 4AUKA 1CJKA 1HNWF 2E66A 1R8AA 2AF6A 5A6PA 4N8OA 4Y65A 1H98A 1EETA 1O51A 3R27A 2D3ZA 1VI7A 2Z4PA 4DDFA 3QNWB 1HNXJ 3FEZA 1B4SA 1U2CA 3HHLD 4NLPA 2E1PA 4N47A 1ULRA 1RZMA 2AW0A 1X5OA 2HKEA 4NZ7A 4OX8A 5HO4A 1SJ4P 1N8RT 4EO8A 1VQSA 2FPHX 3EE3A 4DV6F 1VLOA 1ZBTA 2IYIA 1LFPA 1NXIA 2NYIA 2XEXA 3N0VA 4OYBA 2OTLS 5IFMA 4LF7F 5D3GA 4IFYA 1IBLF 3GIMA 1SQEA 2DH9A 4YB7A 4DCOB 5LJ3Y 5J2NA 1PGZA 1D9DA 3KJNB 1QSYA 1TL7A 3CDEA 3IG1B 1RABB 1T9YA 3FRZA 3TA0A 1HWUA 3QO9B 5G0RA 1C0TA 1H7WA 3V6DB 1S6PB 1DRZA 4JOUA 4U9RA 3Q83A 1QE1B 1CULB 2B7CB 4ZITA 2VBZA 2F5GA 3Q2TC 2HWTA 1VIXA 4OX9F 4FF1A 3T9NA 2ATLA 3MPYA 2HVHA 3UWTA 4DR1F 4ITSA 1K1QA 2HWIA 2ZBIA 3FSXA 3H0PA 4KRWA 4DPWA 1HWJA 1X60A 3DOKB 1MWYA 1NAQA 1NRKA 1X7VA 2CVIA 2XNQA 2YY3A 3TZWA 3VZHA 4X62J 5HK4A 4M5NA 5L1IA 3ZXWA 1VOMA 1RT2A 2CXEA 2HLTA 3P45B 1YJWS 1QTNB 1XBWA 3NGTA 3UFCX 2Q43A 3RB0A 1U1RA 1EIYB 5ETQA 1RHUB 2LYVA 1SQGA 4NI2A 3GYXB 3RR8A 3AOAA 4F4XA 1Q79A 1FKOB 3Q89A 2Z2ZA 3OTEA 4PEOA 1YKWA 1OSDA 2CNOB 2P6SA 2QL9B 3DXBA 2C3PA 4AL6A 4B3OB 3ETMA 3OV7A 3CB4A 2GO9A 2V6AA 2VPXB 3ZZRA 4ZKAA 3M8SA 4B3RF 3KK3A 1JX4A 4DPTA 1WC1A 1XERA 3DDNA 4PR6A 3RBEA 4K4UA 3I0SB 3D9BA 1RWUA 2DNHA 4LJMA 1T94A 1DTTA 4F4AA 2P9GA 1VFJA 3U1MA 5LXRA 1RT4A 3UCUP 1FJGJ 2JOQA 1HD1A 2DNGA 3D7SB 5IXUA 4OI1A 2G1DA 3KUEA 1B99A 3OQ2A 1R8CA 3V6HA 3C3LA 4JUZA 2ZD1A 4C48A 3K0JA 2V8PA 4DSEA 4HDHA 4OYZA 2OPPA 2JX2A 3H7HB 3LPYA 3QFWA 4EEYA 2IIHA 3Q8YA 2QV6A 4AT1B 3PNIA 4P2FA 2B8PA 4RLEA 4DV5J 4KO0B 3CUNA 4KT0C 1ZM2A 2FIUA 1Q5VA 1L5UA 3OFEA 5G4DA 1X9MA 1GMVA 1HYSA 4QPXA 5IWAJ 1KQGB 2HURA 3Q86A 1SV5A 4ZOSA 1VRQC 3W9JA 5KFNA 2IM3A 3LP0A 3P8BB 3KK2A 3M1VB 4DFPA 2IHR1 4IFYB 3GV7B 2CJQA 2PO4A 3PFEA 2W2PP 1NH7A 2H65B 5IT9Y 1RT7B 4LR8A 2R8IA 2L9DA 3A1YG 2OUGA 3HFVA 3CXCR 3P96A 3BQ2A 1HARA 2HS4A 4GKJJ 2EWHA 3IM8A 3MAAA 1S9EA 1TUGB 1LKZA 4HTIA 1U1NA 2MQMA 5GAHI 1UJ4A 4RU2A 2GC8A 4LUBA 2K7KA 5KG3A 2XM3A 2W01A 2ILYA 5KG6A 3DU5A 5HQLA 2GO8A 2EFOA 3WBZA 1X0FA 1Y5LB 1B0TA 2BYCA 2OFHX 2HWHA 1SPBP 1JLFA 2BMBA 4XDDA 3FMWA 1KQFB 1FWLA 1TU0B 2B9EA 3LPEA 3ZZZA 2ATCB 2DISA 3PRDA 5CHCB 1F1BB 4NLSA 2MJNA 3HJFA 3MXHP 2IJNA 4LT6A 2QLXA 1T9WA 2ZBQA 3Q2SC 4ES1A 3MEKA 4EYHB 5DG7A 4JP8A 2X3GA 4OI6A 4WXWA 2H51B 4K4YA 4DSKA 1UW9A 2BJ1A 1ZOTA 1UVIA 1LK7A 4NLYA 2AU0A 1U47A 1WC0A 5HQ8A 2NZ4A 2BV3A 3OFHA 2DHGA 2DR8A 1GX6A 2DJWA 3FVYA 3VGUA 2MHEA 2EK1A 2IBKA 1S6QA 4DXLA 1RJJA 3KWMA 4ED3A 3JTOA 4UUWA 3NS6A 3SQGB 4RZRA 5EHHA 3HVAA 2ZC3A 1S7IA 2V67A 4C0BA 1F2GA 3H2UB 2F7VA 5KFBA 1FFGB 2V5HG 4F2RA 4ICLA 2F65A 3KKFA 3RAQA 2W9CB 1S4FA 2BQ3A 2AV5A 2D7SA 4OYOA 2E5IA 3QIPB 2G13A 3O1LA 2EFPA 3DMJB 3J7Z5 2RUGA 5H9EJ 1FK9B 3DLKA 1FXRA 3BKTA 4DL2A 1NDLA 2V4JB 4YP3A 1U1PA 2WW4A 2B5JB 3OJSA 2KI2A 1C2PA 2WW8A 2UXDF 1P6TA 4F4ZA 2HBRB 3RR7A 1S10A 2F9JA 3PKMA 1FTRA 3UI3A 4F36A 3DOMB 3I82A 1QLNA 4OHZA 2DBBA 4YDDB 5HSPA 3GQCA 3ITHA 1CVJA 1XNQF 4DX7A 1IJFB 2LEAA 2NZCA 5B0BA 1IKYB 3I87A 3NCQA 3RRKA 2GV1A 2BRLA 3O6QA 3ZO7A 2B5JA 2GCFA 1C1BA 4K50A 3V4IA 3I0RB 3R6GB 3Q22A 3CCUS 2FZKB 4ED2A 3MCSA 3HFKA 4RNMA 2AJ0A 3CCJS 3HFZB 5HP1B 2C2KB 3FEXB 4R5PB 2CWKA 3H20A 3M8WA 1X9SA 2N4CA 2CJ9A 2HGNA 3V81B 5LM7E 4RW9A 4DN9A 1YJNS 2F4VJ 5HLFB 4HKQA 4OIXA 2MZ1A 4DL6A 2E44A 1FT8A 1HHSA 3QLHB 4CLKA 5KFKA 1EJ7L 1RHRB 3BQ0A 1RBAA 1A0OB 1RBOB 2QA2A 5HATA 3VGTA 1IUJA 2BACA 3SCKE 2NR0A 2HRYA 2IFXA 1G7CB 4LRAA 3IAM9 2ZKUA 1Q82T 2VD3A 3UVJB 1HLWA 1DQ8A 4J9RA 4LF4F 3HJVA 4C97A 1WEZA 2J9CA 4LBHA 4RUHA 4LF9F 3PACA 4CM2A 1WTBA 2Z2YB 4O44A 3NWGA 5CH7B 2CPFA 2KXNB 3NNCA 2CQCA 3ZZPA 5CZVA 3DN9A 4F0HA 2QFIA 1XC9A 3DFEA 4IOCQ 2U2FA 3Q8QB 2YWHA 1Q4RA 3GSIA 4QBUA 2DXFA 1BQXA 4KGVB 4W4MA 5B0GA 4DQIA 4OHYA 3NNHA 4DV2F 3W5XA 3ILOA 3B78A 2M3DA 3M8QA 3HHLC 4Y2KA 1RTDA 3T9ZA 5HN0A 5JMNA 1N36F 2IC3A 1T9TA 2IDLA 4WPAA 3NGRA 2C3UA 3THPA 2XY7A 1ZETA 4V19J 3MEDB 2W4CA 1RHQB 3HSGA 2CZ9A 1REVA 1S1XA 4X4PA 2ZH6A 5ETVA 5HQMA 1M5PC 1PG5B 3FSIA 5JXSA 4DV3J 4F3OA 5CYMA 2CJXB 1S6PA 1LXJA 2MKKA 1T95A 3I6PA 4IOAQ 4K4TA 5F8NA 4RW6A 4QR0A 3K5NA 4ZPVR 1JQGA 2Z2MA 2ZOFA 5F0UA 2OPSB 3IS9B 3VAKA 1VDHA 4KSEB 4OZ0A 5KG1A 4DUTA 2VG5B 3BGRB 1RCOB 1VS3A 5IV3A 2UUTA 3MOJB 5HVGA 2Q66A 4A8QA 1U09A 4DR6F 4A8WA 1TKXA 4PG8A 4X4UA 5IS2A 4JI6F 2HMIA 3VF0B 4Q0BA 2HBQB 2JFDA 3MOZA 2FHKA 3VAGA 4ZN3A 2RDIA 3U27A 2CADA 3DGVA 4NZ6A 1NSQA 1NSAA 2DB1A 2E9RX 2M70A 3N79A 1U4BA 3HHNB 1VQMS 3O5TB 2DGXA 2D74B 2MYFA 4KAIA 1RT6B 4CI0B 1RWVB 2KFNA 3Q0AA 4G1IA 5F8IA 4LFCJ 3G87A 2LECA 2CG8A 3ET6A 1SH2A 4HI1A 2LXUA 4LIRA 4WJBA 5KFWA 1BY9A 4LFAJ 2BW2A 4J5OA 1HR0F 5FJ4A 3ADAC 1RACB 2ILZA 2W2OP 4ECVA 3M9NB 2OD6A 1U45A 4FYDA 4X66F 1WHVA 4YN3B 2CQDA 2YNGB 2VH7A 2G2ZA 3G8SA 1Q81T 2F4FA 2GQ2A 1M5OC 1RQ0A 1S57A 2CPHA 3CNQP 3IO1A 2DPIA 4B3OA 5LSOA 1QDUB 1TL3A 3CJKA 4NYOA 1KTQA 2HAIA 1N0VC 1RAGB 3WZ0A 2ZH1A 2XGQA 3BDPA 2R2RA 3A13A 2BRKA 4MIBA 4OFZA 1NBEB 3JQMA 2YKNB 5EDWA 2DNRA 3TANA 4YR3A 2HQDA 2VKRA 4QW9A 2UUCJ 4UQTA 3J7YI 1MLAA 5DLFA 1YRXA 3IWXA 4ZHRB 1TV6B 4MK7A 3H4DA 1T03B 2KB2A 4EMDA 4Y2AA 5EWFA 3D6TB 3OT9A 4UY8T 3DKDA 3GJQB 4DV0F 4QZVB 4WFNQ 1UCNA 4J9NA 3R9LA 1S76D 1H0HB 1XMOF 3UW1A 4M5DA 2W1BA 3SBMA 5J2PB 3UCGA 2UVUA 4PXBA 5KFDA 4FVCA 4DV1F 4MMOA 4O3OA 1VJWA 1PCAA 6AT1B 1K0TA 4BBYA 2VHGA 1S9GA 3BB5A 2NCKL 1JJCB 1U24A 4HH0A 2OH2A 1FRIA 2H4WB 1DHMA 2L08A 2Q6CA 2IRUA 1MSWD 2ZBPA 4G6VB 4WBFA 1S0NA 1CLFA 1UVJA 1JXVA 3MPDA 4H4MB 3VQSA 2MXYA 2CPYA 3GONA 4XIUA 4B9LA 4HL9A 4JI2F 2K1RA 3RW7A 2FVRA 1T05B 2VA2A 1WEYA 4LSLB 1SH3A 1ELOA 1RBLA 3M7VA 1WHWA 3U7JA 4ID5A 1IR0A 1NHVA 1ZS6A 4FYWB 4DR4F 1RB0A 2YQ3A 2EI5A 1F5CA 1C1CA 4ZP6A 1KLNA 1CJUB 3HD1A 5BR8J 2D9PA 4U8YA 2HNZA 2BZ2A 3W1YC 3FFIB 4GRSA 5HROA 4I4BA 3RB4A 3M2VA 2DIUA 3CCES 3POTA 5GAHU 1QVGR 1O0PA 4QIFA 2MZJA 3L7OA 4PPDA 1IKYA 2LMIA 4I64A 1KWMA 1OIAA 4MH8A 4P2MA 4ETXA 3HVRA 1VISA 3H98A 2FZCB 1NDCA 3J7YU 4OI4A 2MTLA 4IUFA 1N0UA 3MECB 2DGVA 4PXDA 5BXIA 4MKBA 2V2VA 1LWCA 2O5DA 3BN4A 2ZVIA 3EGNA 3H42A 3IR6B 3AQPA 1CC8A 4QQBA 3VQTA 4DR5J 1UETA 3I31A 3RGIA 4ENOA 4NLWA 1RU1A 2NLWA 4FNHA 4DZDA 1KHVA 1RXOB 1FESA 2IVMA 1IBCB 3W8GA 2NYHA 3PR5B 1YIJS 1T9XA 1H38A 4IG0B 2YH1A 2LQ9A 2QLFB 4DFMA 2HGMA 4IR1A 2VQEF 2CQBA 2GA7A 2WVFA 3LGNA 2KN4A 2IYGA 3QAUA 2AYBA 2HS3A 3PW0A 1R3NA 1XIQA 2ZBRA 4QWBA 4DR3J 3EGZA 1HMVA 3M2RB 1TZ0A 4GVBA 1IWGA 2BQUA 2GX8A 4ES3A 2F40A 3KLHB 3V4IB 4IRCA 4M95A 5B0AA 5IQ6A 1LOUA 3DYAB 1SB6A 3K5OA 4HHHA 5KFYA 5KFJA 3K58A 3DLBA 4QU6A 2K8GA 5LSLA 1X4DA 1T3OA 2HZCA 2Y0SD 3TOQA 3HO1A 1HBOA 1Q1KA 4P7VA 1I6JA 4USVA 3DU6A 4QR2A 3ZZTA 2EVZA 4M5JA 3W64A 3CC2S 4NXMJ 2KFZA 3OR1A 5KFXA 3GCXP 5C25A 1FJ7A 1K1SA 4TU8A 2B9WA 1DTQB 2RKIA 3D66A 3UR0A 4ZCKA 1IKWB 1FNXH 1Y4ZB 4F2SA 3R7SB 1V3ZA 2RF2A 5ETPA 1DFDA 3HM9A 3GZ7A 3A3OB 2Y8WA 2WVBA 3Q8PB 3QRRA 3DRPB 2B4OA 3N6LA 2DHXA 2IJRA 5A8RA 4DPXA 3N5BA 2BDPA 3PYDA 5KFGA 1DTQA 1NK5A 5ETRA 1LWFA 2W24A 1JLGA 4JI7F 2K1RB 4QU7A 4B3SJ 1X4AA 3ISZA 3CJ8A 4M1KA 2QG9B 3MGJA 4NLTA 1RDRA 3EM1A 1TVRA 3TAMA 3HP6A 2UVRA 2R7SA 4I1TA 5F9NA 2X1GA 1YRTA 2RVJA 2VFVA 1FWPA 4RX6A 4WWSA 4Z37A 1NH8A 1RA7A 4C9DA 3PEHA 1XNRF 1ZZFA 3OXFA 4OZ2A 4QYZK 3T3FA 3WHIA 1B0PA 1TUVA 3M30B 9RUBA 2DKOB 3DLLQ 3H5SA 3KHLA 2HHHF 2ZOGA 3N4WA 2KYXA 4ZIWA 5ETNA 1RAAB 3RYLA 2J7WA 2JEJA 2M4MA 3PY8A 4NOHA 2PFDA 1HWLA 1WDTA 2Q6BA 3QT6A 1ZAXA 1VK8A 4FXVA 1NK7A 4M94A 1NB2A 2NSBA 5J2QB 2CJKA 4LBPA 1IKVB 3M8QB 4ZHRA 1U1OA 2HFUA 3M8ZA 3MEEB 1WTFA 3QJLA 4Z7CA 2HHPA 3M32B 3GFHA 2W2NP 5KFOA 4P2XA 4YOEA 1RWOB 3CC7S 3H25A 1HFEL 4KH0B 4E0DA 4JI1F 2YPYA 2BVZA 4L74A 1OSCA 4YUDA 2EBEA 2GIQA 1NJZA 3PCOB 4C8YA 1Q78A 2DNNA 4W90B 1X4CA 2FQQB 3A8KA 3MM8A 2W9BA 5I3UA 1JXEA 1YZ7A 3CCSS 4DQSA 4ZPAA 2AHOB 1N5SA 4B08A 1S48A 5LMUJ 4FF2A 2GAGC 4MFBA 3R5BA 1IM4A 4KC5A 3B4MA 1S0VA 1FKPB 3HK2A 2V8HA 2W2QP 3CJ4A 4Z2XA 2GVDA 3CTRA 2WZ1A 4NCGA 1EP4A 3HVWA 3MCMA 2L9WA 3TW0A 1FDNA 5DM6Q 2R2SA 4LRBA 2FHMA 3GFXA 3C14B 4DSJA 3AJ2A 1H2VZ 4YQWA 2FGCA 3MEDA 4LSLA 4ZP7A 2HG4A 3DRSA 4U7CA 3CMAS 1NK9A 2UUBJ 2HFOA 1VRUB 1AZSA 4WTOB 2R8JA 4OYWA 4LFBJ 4ZCLA 1UFLA 4KV8A 3IXQA 5JUMA 3BM7A 4F50A 5ETKA 1RT3B 5KOWA 2QRRA 3N28A 4ED4A 1WC6A 1QUVA 2EKYA 3OUYB 2OSRA 4DV4J 1B7YB 4DQPA 2LQJA 2Q3PA 4URGA 4Z7YA 4I7FB 2JJ4D 1QSLA 2DYAA 1K8AT 3T1HF 2DHHA 3I4HX 3IWNC 3KK1A 1R8HA 4AYBD 2J6TA 1TUWA 2ZUAA 4KV8B 3K5LA 1WJ9A 2WAQD 1AUSL 3M8PB 5CQGA 4ZCIA 2ZFHA 1NHKL 3OPKA 1OPIA 4ZDNA 2IVFB 2BABA 2AZ1A 1WI6A 3A3PB 3PTWA 1G2EA 3OR2A 1FERA 2VJVA 1EETB 4QIGA 4BLGA 1N48A 2JL9A 2LP4A 5J1EB 3UPFA 1V3RA 4DCPB 1HA1A 5GMKa 1WKLA 2YX7A 3TVKA 4DR7F 1OJ4A 4U8VA 2BUNA 1BWEA 1D09B 2RHSB 4USMA 2LLZA 1W2IA 3I0RA 1LW2A 5KFTA 1C4CA 3LAMA 3GSDA 3I9ZA 4TNOA 1RTDB 1RKIA 2VOOA 2NUUG 4R5PA 4RW4A 4OI3A 5M2RA 4DFKA 3C16A 5KFUA 4BHQA 1UW4A 2CRLA 1YJ7A 3U1NA 2VBXA 5F8GA 3AD8C 2HRUA 4YFUA 1EQMA 2PA3A 3VWSA 3QGPA 3L4BC 2DNMA 5K8OA 1LNQA 3GB0A 3BEGB 4FBTA 1BXNA 1ZM4A 4B3RJ 2WONA 4CT8A 2VQFF 1UVNA 5I42A 3D2WA 4MK9A 7AT1B 1UFKA 2Q1LA 4URQU 3BF4A 3HKWA 4ZP9A 4RNNA 3MM6A 1LQ9A 3CCTA 2LQ5A 4CO2A 1FJGF 3BZQA 2KDOA 1Y00A 4H54A 3C6UA 5HROB 5LMNF 1RHJB 4KO0A 3N6NA 3QIPA 1F5BA 1P1LA 2HS0A 1TV6A 4LSZB 2YNFA 4DU7A 1T03A 1KNZA 1FDDA 1V9OA 2N4DA 2M9KA 1H3DA 4OLPA 2XGPA 1WELA 2B56A 2GAHC 4XAKA 1JIHA 2C2OB 3EICA 3KYLA 3MEGA 4YDXA 2RDDA 4FKYA 1F3VA 3VGSA 4FS1A 2MKYA 4DHVA 2HQ3A 4OHXA 1WEXA 5HMZA 5MAOA 1P27B 1PYOB 3A3NB 3EX7B 3J81Y 2E5LF 3Q24A 3ENQA 4G65A 3EYZA 1Y11A 3SCJE 5IWAF 4IYQA 2AP6A 3GV8B 2GIFA 1IR2A 3POTB 1QTMA 2B9YA 1NU4A 4Y2IA 3AB4B 3NS7B 1KD1T 1T11A 1S5ZA 3M8YA 3RZAA 1C0UB 1BQMA 1T02A 2YVSA 3GJTB 2MY8A 3K7RA 5E7OB 5E3CA 5C2CA 5CYMB 5KFQA 2OGUA 2CNNB 1FNMA 2ZUGA 4ZVRB 2CJAA 4O4GB 3ZTRA 2R3VA 3NS5A 3BO4A 2HHSA 3W61A 4GC6A 3QGGA 5CYQB 4TU7A 3PZPA 2L9NA 3KUGA 1EARA 2VOPA 2YNHB 5J2MB 2RMLA 4KB7A 5K14A 2VIHA 1JLQB 1RADB 4ER8A 2OPQA 4DN0A 3MMBB 4PCQA 3PO5A 2A2CA 5K5MA 3R1LA 4PQUB 2J9DA 1C0TB 1UEKA 3JAMY 3V6DA 3W2VB 4GC7A 2AWZA 1EB0A 4KHMA 2E7WA 2CJYB 3TWZA 4NCAA 1S99A 1S6QB 2XMTA 1IBMF 4CP5A 1QAJA 4ZPDA 3R8YA 4KTQA 4C3MA 2JC0A 1DTTB 1YBUA 4AXIA 2RS2A 1RWKB 2FLPA 2ZOMA 1IJEB 3BO2A 2GVZA 5KG7A 1RYSA 2FY1A 1WSRA 1OS5A 2CNKB 1DQ9A 2V9KA 1R0AB 1DZ5A 1AROP 3IP0A 2VONA 3NL0A 3I5CA 2AEFA 3PG9A 4NLRA 4K4XA 4K8RA 2BXJA 3NAIA 1JLCA 4M5GA 4NX9A 5ETOA 1TMMA 1FRJA 3BBBA 1GTEA 3PJWA 1WG4A 3EDRB 3D0GE 5A8RB 5DQIA 3PO4A 5AXMA 3EPIA 1WDDA 2XY5A 4LIWA 1GMUA 2X51A 4NL5A 5IC4B 3OHBA 1YZ6A 1AUDA 1RAOA 2ZH2A 3GYGA 2YQ0A 4QWDA 2P9EA 1SKSA 1GMWD 5IC6B 3H5UA 3IN5A 4OHVA 1KOOA 3PFOA 2ZBCA 4OZ5A 4B17A 3V6KA 2DHSA 5HJYA 4U6PA 2CPEA 2M7SA 5KFHA 2OTJS 2YNIA 3S6EA 2W7OA 2FJXA 1HBOB 3BKUA 4DFJA 3C2PA 4Y0FA 1UA1A 1PIEA 2HNDA 2ZDPA 1BD6A 3BPDA 4CNYA 4X4TA 1XNQJ 2J6UA 1N6QB 4DX6A 2KT2A 3CGIA 4WU3A 3TJ8A 3QWUA 5E3RA 1FRLA 2IRXA 4IO9Q 4TKTA 3FJ2A 2I0XA 4A46A 2YWEA 2RRNA 5ETMA 2D1CA 2C3MA 2KL8A 1NKCA 3D3BJ 4UOHA 2LXFA 4EBDA 3F0NA 1L3KA 2XHWA 3F41A 5E33A 2R7VA 5T7LA 5K8MA 3DNCA 1DAXA 2F4VF 2GIRA 3FUYA 4QIEA 2DVIA 3W2WA 1NLKL 2P9CA 3DOKA 4Y3CA 2KH9A 2EXUA 4QWAA 1HHQA 3FBBA 3LA0A 1C4AA 2QA4S 2ZEJA 1WG5A 5AXNA 2WOMA 3EVMA 1E6YB 2XQCA 3JYTB 4P9SA 2YKPA 6FD1A 3K57A 4L3KA 4OYMA 3AD9C 3Q8RB 3C16B 4LF9J 2NXNA 3NBPA 3OVSA 3NGUA 2ZWPA 4ILLA 1M1HA 2XS7A 5KFLA 1S97A 1RE1B 2FVQA 4IRKA 1R0AA 3K5PA 2WSCC 3KG4A 4OYPA 3C15B 2QE5A 2ADBA 3HHLB 1UL3A 3CVKA 2BKPA 2V4QA 2DNPA 1L3SA 3JQKA 3J7AN 4Y2MA 2VBWA 3I4PA 1T9UA 2ABYA 4DV2J 3VALA 4IR9A 2MSSA 1XQIA 3KLEB 4J9QA 1Y3JA 3L7PA 1SXLA 2CIMA 4ELUA 4I69A 5L1KA 4LF6J 1X31C 1N36J 3G6XA 3NXZA 2MSTA 5LJ5Y 4TN2A 3G9CA 3D28A 3RAXA 5CABA 4DR2F 2GFFA 4CLLA 3CIMA 2QN6B 2GHWA 4USIA 2WVDA 1EKRA 3E3XA 3DHWC 3IBFB 5U47A 4J9OA 4DV3F 3PYGA 1WNEA 4RNOA 1BQNB 1VR6A 2CYYA 2AEJA 3CJ2A 1HW9A 4C8KA 3EGWB 3DM2A 3PR4A 3HHLA 1JLEB 3GJRB 1U0HA 1WUUA 2DH7A 2ZHOA 4I7FA 4F25A 3NCRA 1S6OA 3C6TA 3TEGA 1KEKA 3TP2A 4F4WA 2MKJA 1RI7A 3OL7A 2PEBA 3I5AA 3AODA 3WIVA 4CO0A 1PYSB 5KT5A 1U48A 2B4VA 4IG3B 1TKDA 1TAUA 4ZJLA 4DSLA 1SV5B 1XJWB 3UD4P 1ZH5A 2RU3A 3N5FA 3H59A 2R7OA 4ID5B 3WC0A 3IR7B 1V5IB 1VRUA 1FK9A 2Z0GA 1TL4A 5KT7A 1WC4A 3P3DA 4DG1A 3ICLA 4FPIA 2DD8S 4J9PA 5CCMA 1WKJA 4PQAA 3ULHA 1J5EF 3CD0A 1D9FA 2QC3A 2GQCA 1SC1B 1FA0A 2OPQB 2XLKA 1TMJA 3K8VA 4RW8B 2FJAB 2LKZA 2C22A 3KNGA 3QT5A 1BHNA 2CVEA 4NZ0A 4ZPTR 4TXSA 3TI0A 1WHXA 4Y2CA 1JXLA 1M5VC 4P6QA 2FLNA 4JI4F 1WI8A 2AMCB 4DU8A 5FLXU 4BC7A 4OL8A 4I56A 3CDWA 3ILJA 4A8MP 2WBMA 2ZE2A 4O3PA 2CA9A 3SFGA 3US5A 5DDRC 2C2RA 3KJFB 4X4QA 5THWA 1P1TA 3BN7A 1Q0NA 1YJRA 2ZDOA 4USHA 5K8NA 4EBCA 2PMZD 4ECTA 1H6KX 5L9XA 1U8SA 4Y6IA 1NZAA 2PFFB 1FDAA 3QT7A 4UOCA 5HVFA 3DLGA 4C2MA 5DETA 2CDRB 4EZ6A 2XMMA 4X4SA 2VU5A 5IT9U 3AAWB 5J1EA 2VZ9A 2CPJA 5AJ3F 1ICEB 3MMCA 1T7PA 1FO1A 3CJQA 4DF8A 1R8PA 4WYLA 3G96A 3VVTA 4O0NA 2X7IA 2GMJA 1YBAA 2UUCF 4PAAA 1MN9A 3MWBA 4WCEQ 2ZH9A 1NKEA 1H2TZ 1N32F 5DGBA 3J80Y 2OIHA 1KLMA 2Z30B 3D67A 1WF1A 3VAIA 2N82B 3OJUA 4AQYF 3EVWA 1R6YA 4CLUA 5HMWA 1NJIT 1AA1B 3DGPA 3IRXA 4OV1A 1RAJA 5I3QA 1ZZNA 4M5IA 2KHCA 1NSKL 2EG2A 1XMOJ 5KFIA 4Q0BB 2EFQA 2VBYA 4EK2A 2E5HA 2C2EA 1Y5NB 4H4KA 4DL5A 2GQQA 3PX6A 4WP3A 4N8NA 2RAQA 5J1PA 5I42B 3CT9A 4EUVA 2VUGA 3MPUB 3BH7B 2M8HA 1S49A 2V94A 2VDHA 3M1VA 5CA5A 3QSYB 4X84A 1VQKS 1DY3A 4CYUA 2DNKA 4QYRA 1X4HA 3K89A 1F0XA 3IMQJ 2Y1IA 3KLHA 2ZVSA 1YITS 1BUXA 2X1BA 5IOLA 1RKJA 5A8WB 4DUZF 1UP1A 3PHEA 3RB3A 3L3CA 1N5YA 3MAAB 4ED5A 1IXKA 4P52A 2UVWA 3O3LA 2AZ3A 2YXLA 2XI3A 4MIAA 5D78A 3KHHA 3WX8A 2EFGA 2AGPA 2UVVA 4DR4J 4LSNA 3G6ES 1RT1A 2ZJQQ 3KJVA 4K4WA 1IVZA 2NUHA 4CNZA 4ZPCA 4AE5A 4L3NA 1FEHA 4MTPA 2AX0A 2GVDB 3LANA 4NCGB 4O3SA 1UMJA 2DCUB 2N3LA 3WDOA 2W8LA 1OY9A 4LF8F 2IM0A 3MM9B 1YLXA 1QY7A 1SCJB 3LP1A 1GQEA 4R8UA 4DWIA 5HANA 2VG6B 3THVA 3BYRA 4CYUB 1PJ7A 3KG0A 4I2PB 2VPYB 1S4EA 2A10A 3HVTA 5IM0A 4F02A 2V2KA 4KGKA 2H5JB 1UTAA 1E6VA 4MKVA 3VAJA 4IG0A 4PG6A 3GLJA 1HBMA 4I6YA 1X0PA 2UUAJ 5FD1A 5KFAA 2R8HA 3VHQA 1RAEB 3HX9A 1N88A 2DNLA 4F67A 1GNKA 1LXNA 1RT4B 1W7WA 5FDLA 1MN7A 1RWMB 2HBZB 3TA1A 2DXDA 4DQRA 2BX6A 3CD7A 2I6WA 4F4YA 4QYZJ 2CWXA 3RJMB 3QFHA 1M5HA 5IT0A 3I56S 3AOCA 1HBMB 2E9ZA 4JI0F 3A12A 3QAEA 3UN3A 2QL5B 3JSBA 4DR3F 1D1UA 4CWBA 2XS2A 1H72C 5H1SV 2I2YA 4LRFA 4D3GA 4ZIVA 1N56A 2AJFE 3AQOA 4I2PA 2V2QA 5F3ZA 2GHPA 5T41A 1GK8A 4E98A 1BQNA 3K17A 1TP7A 4WKYA 3RW6A 3DOMA 3RUBL 3W9IA 3JSMA 3V4MA 1E6VB 5A8KB 3E01A 4CH0S 1NJWA 2Z56B 2V68A 3OVAA 1FVSA 2HQFA 1ZYQA 1KR4A 2VG5A 3S01A 3X1LB 1AB8A 1W25A 4X4RA 4JI3F 3MZIA 3SYZA 1CSJA 4FPRA 2LCWA 4UOGA 3KLVA 1XMQJ 1KHWA 2OP5A 3HSDA 2H48B 4K2JA 3RB6A 3VAMA 4B9SA 1WOPA 4L72B 1N5YB 4I2QB 2DEJA 2I1RA 2VG7A 2BANB 2W7PA 1N5VA 1UA0A 4K59A 3J81U 4MT1A 1X9WA 2VB6A 3TJAA 2MQOA 2MMYA 4OZLA 2AGOA 4O3QA 2Z58B 2Z57B 3FCVA 2H3EB 4LR9A 3EWGA 4WP9A 1V3SA 3FCHA 5F0WA 4FNIA 3L95X 2WVEA 4IQMA 4V19X 3BYPA 4DZ6A 5A8KA 4KPYA 3FZ2A 2F63A 2B9XA 3RTVA 3OR1B 5E3PA 4OZ1A 1JMTA 4NMLA 4FYYB 1PILA 4HHJA 1XNRJ 4M5KA 4NCBA 4IOBA 4X64J 2KHDA 3ISNC 4IFVA 4ECWA 1VQ4S 1KLMB 2KZZA 1IKVA 5BYQA 1WD6A 2VASA 5T7LB 2K3KA 4GVBB 1VHIA 3Q8UA 2E5JA 2XO6A 2HHHJ 4B3MF 2OEJA 2FY8A 2XYGB 2YBVA 1UZDA 3KJQB 4NE9C 1Y5IB 5DDQC 2ZJRQ 1RWNB 3KLIB 4IKAA 3OVBA 2OLWA 2POKA 2O66A 3Q8SB 2A6OA 1HNVB 2L48A 1L3UA 2ZD1B 1QM9A 3UN2A 1ZAWA 5MLCV 2R7UA 2FJEB 4Y00A 1AFIA 1MG7A 5DLGA 4CRJA 3V6JA 1ZTWA 2PC6A 2RUSA 3DRYA 3ILIA 2RQCA 2OEKA 3VAFA 4WZMA 4JI1J 2IPOB 2RRAA 4HDGA 4IH6A 1DARA 1R89A 4HI2A 2PN6A 3TX0A 4DEZA 3PX4A 1MNEA 2F8MA 4FP9A 2YNGA 4HVZA 2FC9A 4CZCA 1HYSB 1RT5B 4XK8C 2DNYA 2XSJA 3IS9A 4DBQA 4YY3J 5DO2A 2Y0BB 5GVQA 3KLFA 2V34A 1NJXA 4IDKA 4WF9Q 4NRUA 2CNLB 4OJ3A 5E0OA 3ZZYA 4C8OA 5D6GA 1PKUA 3MCNA 4NLQA 5ETSA 4CLWA 3OLBA 3GIKA 5AT1B 4WIIA 4LMZA 4CO1A 2DRDA 3OSNA 2EC0A 1H74A 1UJ5A 1NNDA 3I5BA 3QPIA 2UUBF 1Y0HA 2Y8YA 3HHDA 2OKQA 4U7UD 3CJTA 4B9TA 3I0SA 2NPFA 4B9MA 5SUHA 5M2PA 2HQCA 4I6WA 4KPCA 3MUVP 2MLYA 5HAOA 2RS8A 2X3DA 4KY3A 2EBGA 1Z4UA 4OX7A 3ENAA 4DV4F 2PI4A 4PRFA 1FEEA 5E41A 1RTHB 3OTBA 4PG4A 2RT3A 3EUNA 4PPZA 3T1HJ 1RSCA 1S77D 2V2ZA 1CC7A 2HHUA 1SIWB 3IRWP 1QVFR 3W66A 1EQ0A 1B7FA 1N34J 2ROEA 2BM1A 3R97A 2QGFB 3KG1A 4KR0B 3P4UB 2XG8A 4FYXB 2CZVC 2F1FA 2N7CA 3IGNA 1SL0A 3TAMB 4WXOA 1JK9B 1XR5A 2YNHA 5J2MA 1KVJA 2PD1A 2GJ2A 1P8GA 3C66A 1Z1ZA 1NCLA 2ADCA 2E7XA 3OFGA 3LAKA 4OJHA 4DR7J 3MI7X 2H9ZA 2EFVA 1U6BA 4NRTA 1RLDA 1NK4A 1CS4B 5GAEU 3H4BA 2LDYA 4P74A 4B3TF 1EZZB 2YX4A 3DHXA 1R0CB 2J0WA 3D68A 3PM9A 1CQNA 3C46A 3PIOQ 4MFBB 2MZSA 3D5MA 2G0JA 3QZ7A 4ZPWR 4HTJA 2BM0A 5KTQA 2KG0A 2DNOA 2CQ4A 4F26A 2RILA 4OMFG 3HVTB 4F4KA 4LF5F 4YMEA 3G82B 4WE1B 4WK3A 1O6XA 4KBIA 3JSMB 4X4VA 4TQSA 5JVGQ 2VQFJ 2D3UA 1HMVB 3M2RA 3CSKA 4USUA 2BBEA 5HL7Q 3T1YJ 2VF3A 5KAKA 2H5EA 2G4BA 4AL5A 3BS9A 2R2UA 3KUHA 4F7VA 2YWKA 5LMNJ 4N41A 4HHUA 4S0MA 1TFYA 1X4BA 1RTJB 5CYJA 3N9UC 2PT0A 2ZM6F 3HLUA 1T05A 2IAJB 5AE1A 1S1TB 1X5SA 2B4UA 3CJ0A 2F9DA 4NA2A 4M5HA 2E5GA 3TRGA 5A76A 1YWXA 3BH6B 2QLJB 4LQ3A 2A18A 2JLGA 3AY0A 4ICLB 1TTHB 5IM0B 3NGDA 4IRDA 3CJSA 3O44A 4ECRA 2M52A 5G0RB 2M8DB 3JS9A 1FRMA 5I3PA 1N33F 1MROA 2E5LJ 1ZPVA 2A6MA 3LGMA 2R8KA 2FLOA 2JVRA 2MJUA 4ETZA 2CQGA 1SL2A 5I3UB 1K9MT 5A2QY 2WONB 4MAKA 1CJTA 1PC4A 4ZVPB 1VIOA 2ZE2B 5D0GA 1UWAA 1FRHA 1SIZA 1KN6A 4J9MA 3SSRA 2UUWA 3A8EA 3FGVA 5GAEI 3A8IA 1D8ZA 1VHFA 4DL0C 5J1NA 1HNVA 1YJTA 2FVCA 1YHQS 4Q8EA 4X4NA 2RDJA 3RBZA 4LF2A 4HR2A 1R43A 1VCTA 3WX4A 2ZITA 4QWCA 1NHUA 4YHHF 3ET6B 3TUJC 3B8HA 3CCZA 1G4CA 4A8KA 3T5JA 4CTAA 1RT1B 4ZMMA 4XO0A 3GWCA 1K73T 5D0EA 1R27B 3KXDA 3P49B 1X5TA 3H90A 4RUBA 4RW7B 5C42B 1F9HA 1KDNA 5L9NA 5AE3A 2CQ2A 2L41A 1VGYA 3HT0A 2HK2A 3U02A 3ZZ0A 5F41A 4WU2A 4KGXB 5KFPA 3M30A 1HNZJ 2DGOA 3AXMA 3QATA 2DGTA 4IDKB 3OL8A 3CPWR 1IBMJ 2PE8A 4UY85 3MM6B 3LALA 4CT9A 2D3OR 3GFYA 5LXYA 1IKWA 3MR5A 2QYGA 5JJBA 3K59A 4F0KA 3EPGA 4NLUA 1LWXA 1QJHA 3D1QA 2LEBA 4CDIA 3TZXA 4HYKA 2JZ5A 3PRVA 3CCMS 4FBUA 2DHAA 1Q16B 4FS2A 1SKUB 1UVLA 4NLOA 2E1RA 2D3O1 3R5DA 2W2MP 3PRBA 3D3CJ 4F8RA 1JLQA 1KTVA 4DUYJ 2FHOB 4M5DB 3KLIA 4USKA 2ZH4A 2M88A 2W25A 1LW2B 1HI8A 3EGVA 1U7LA 4C98A 1S7HA 4DI6A 2R7WA 1KRPA 1AFJA 1A7GE 2R7QA 2A3JA 1GXLA 1JJHA 1FD8A 1ZA1B 3GMGA 5L1LA 2FVPA 3QGHA 3THTA 4ED7A 4I2QA 5KFMA 1IBKJ 4AFFA 3HSZA 3MUMP 1XWLA 4Y28C 2J9DE 5HJXA 1J5OB 2ROPA 2P5VA 1HWKA 4ZCMA 2C3YA 5M2UA 4N76A 4USTA 2FUG9 4MK8A 4YB5A 2YKOA 4DL4A 3DOLB 3BBCA 4TY9A 3FZBA 4UW2A 1U0HB 4WYWA 3GYNA 1BGXT 3G6YA 2BEFA 5DJBA 4JYAJ 3FDSA 2K2PA 1CJVA 2DY9A 1MROB 3TO8A 2MZQA 4AL7A 3SZ2A 1SBRA 2KJVA 1APSA 1NUEA 2KJWA 1MMLA 3M32A 4NEZA 4MJKA 2MQNA 4AD6A 1SC3B 1KQSR 1VK3A 2I5JB 4ZK7M 4FXDA 5C24B 2Y9HA 2DGWA 3CW2C 3DCAA 1UWBB 2CQ3A 4K5RA 3TVZA 5LSRA 1XMBA 1M5KC 2UXBJ 2C2MB 3MF5A 3R3TA 3F73A 4NXNF 4A47A 1FI4A 2WK4A 3AJ1A 2QMWA 3NOCA 2MQLA 3AH6A 5H9FJ 2HEKA 5DRKA 1PBUA 1DLOA 1U02A 2BKNA 3H8YA 2XLIA 3PW4A 4Q43A 3CO0P 5EX3A 2DNQA 4D3HA 3NMRA 1TVRB 1F9EB 1NZ8A 2ZH7A 2ALZA 1U49A 1Z2LA 2BJ7A 5GADU 3J80U 1PAEX 2DGSA 4MYUA 5ETTA 1AYEA 3NAHA 4CLSA 2IA6A 3PJ9A 3UDCA 4DLEA 3QRQA 1RT2B 2C3OA 1T8EA 1KVIA 2IM1A 3UE2A 3R6LB 5KFEA 4PWUA 1XK8A 1P9YA 1KBRA 4YB1P 3J81j 3KHRA 2HYIB 4YR2A 1NDPA 2OMLA 3OD2A 3AA9A 3LP1B 1Q8BA 2JVOA 3M6WA 4FXWA 3H40A 3M2UA 3IR5B 1UWBA 1R0BG 4ECUA 3RRHA 1BE4A 2KFYA 4P2SA 4K7QA 2BJEA 1K44A 4USJC 4U96A 5HBMA 4LF6F 3NRBA 4UOFA 3MFIA 4N77A 1ACMB 4W98A 2QMXA 4DF4A 2V63A 1M90T 4DR2J 2G1HA 3HZEA 3PW7A 4ANEA 5IZHA 3EZ5A 2ZHBA 2ZNYA 4RBTA 3TEHB 4C0HA 4ED8A 3GP9A 2PI5A 3P6YC 1S59A 2B8QA 1VRTB 3DI6B 1BMQB 3EDQB 3FEYB 1GXUA 2VC0A 3HULA 5DDOC 3CWJA 1SJRA 3OHAA 3MFHA 2ZH3A 3W5ZA 3T5KA 3H5YA 1S1WA 4TYBA 3IC1A 2LDIA 3IRXB 4CH1A 3W2WB 4RUCA 1BQMB 5J2PA 4O3NA 3FMBA 5D8HB 3JXOA 1B64A 2DGUA 3QLHA 1IM6A 8AT1B 2QTWA 3HSJA 3MTJA 1JLGB 4C6AA 3B54A 5BJRA 1OO0B 1EKSA 4TU9A 2J6SA 3E2EA 3WQPA 2F8EX 2J8AA 4JV0A 4WFZA 1O8BA 4K5SA 4NYPA 2Q79A 1FX4A 2DIVA 2KM8C 3I55S 1Q8KA 1YVFA 5GMEA 2HIQA 1J5EJ 1QUPA 1SL1A 1LK5A 3C19A 3NGKA 2MGZB 3FC9A 2IDEA 3BSOA 3D0IE 5DZ6A 4ATNA 2GNKA 4DX8H 2DR9A 2XS5A 1I94J 4JB8B 1YGYA 4JI4J 2BA9A 2HNDB 1VBKA 1J27A 4I68A 3DLEB 3IM9A 3S8SA 2ZC4A 4N56A 3TZYA 2COLA 3PXGa 3DRRA 4R0JA 3LWMA 3P5TL 1FKOA 1GT8A 1XEZA 2VPWB 1SUQB 4UF4A 2VKZG 5D4LA 4P72A 3RU0A 2LQ8A 3C6TB 3TJ9A 5HVHA 2QSFA 2RQ4A 4EGLA 3H2LA 1XTZA 4NASA 2QA4G 2DTJA 4FF4A 3D0HE 3DDIA 4JI8J 2E7VA 3NEKA 1U8WA 3MEEA 4DSFA 1Q53A 1VC0A 5L38A 2PIIA 1S1XB 4XDCA 4NA3A 2VG6A 4KYZA 1LWEA 3EZUA 1HQEB 1TQLA 3VAHA 5AJ3J 4N7TA 1PAUB 5DDPC 1OY8A 2HHTA 4P75A 3MHYA 3SCLE 2QO3A 4OJGA 4RW8A 4QWEA 2KO1A 5GMDA 1N32J 5CZXA 1HKAA 2HFNA 2V0NA 2VFSA 4G1QB 4Q7AA 1U0SA 4QJVA 1NK0A 1FE0A 4QCLA 1SJQA 2RHQB 4AQYJ 1SI9A 2QX0A 4CLZA 4O0IA 1FNOA 3M6UA 1URNA 1IQTA 2MKCA 1TKZB 1IQZA 3PEJA 2GVZB 3AFGA 2JRSA 4IG3A 4LVNP 4R0EA 3R7NB 7FD1A 1SJ3P 5D3GB 1VLYA 5LOQA 2CJBA 3E01B 3IBCB 3RBXA 2DEIA 3T19A 3LO3A 2VFUA 3KK3B 3DI6A 4NEYA 2M0GB 5J2NB 4X65J 1BC6A 1RU2A 1R7IA 2W9AA 3MCOA 3LWLA 1XR7A 1NMEB 1PC5A 4OYAA 2JEGA 3D1OA 2G0CA 2AJ4A 2XZWA 4ECXA 4DSIA 4DUZJ 3FBCA 3P5BP 1S1TA 3JB9k 1U2RA 2AJ1A 3U1LA 3W60A 9ATCB 3CF5Q 1JJ4A 3OUYA 3KOAA 2E29A 3T6BA 1FX2A 2UXCJ 4ZVOB 5HI7A 1S1UA 2HZAA 3OL6A 2XMKA 4ILMA 5DQGA 5C24A 3T5HA 3M05A 2I9SA 1NPKA 4H4OA 2MB0B 2CDQA 3NLCA 2XCPA 1S9FA 2ERRA 1N5QA 3CE8A 4RW7A 2XC9A 1DURA 1SJ1A 1M1KT 3DLGB 3UO0A 2RF2B 3CMES 3MMAB 4OLOA 3UD5A 1UEUA 2KM8B 4LF8J 1QE1A 2DNZA 4UZCA 4JBCA 4F3QA 3DM2B 2HRTA 3DLEA 3DXSX 2XTJP 5EUHA 5ADZA 1NK6A 3CCRS 5B0CA 1RTIA 3LP2B 3R5AA 4CH7A 1V6HA 3CIZA 2MLXA 2E1MC 3NP5A 3QIDA 4MIWA 3SXLA 1Q7YT 2J8SA 3B4DA 2H54B 5FIIA 3N01A 1RAIB 4ED1A 1RYRA 4PUOA 4A48A 4KHPF 4URSA 4WK1A 2FGOA 2B4PA 4WTYA 2NXEA 3EJMA 3ETOA 4PZVA 1RK8A 1GX5A 2UUAF 1U26A 3FKBA 3MR6A 3T6JA 3ZZOA 1TL1A 2CPDA 1S1UB 3W5YA 2DO4A 1MMDA 2YNIB 2BW7A 1WG1A 3G2XA 4KFBB 3SCIE 5KFCA 3OTOF 4PWDB 4AXJA 2N7YA 1U6ZA 1RT6A 2I38A 5B09A 5C7PA 4DL7A 4YEAA 4A8YA 4OYIA 4QOTA 4EFAC 4J90A 2J7KA 3ZZUA 1NM2A 4L76A 1S0OA 2OPPB 2X1FA 3CULA 2QFJA 4JI0J 1M1GA 2HK3A 2MHNA 3O8WA 4B9VA 1S6UA 2R7TA 1HNIA 2GGPA 2QSWA 4ZVFA 1VQ7S 4KFBA 4LFBF 4HEA9 3MPWA 2R2TA 4H4MA 3M4XA 3HHEA 1X5PA 3M8RA 1VC5A 4A8FA 2GJFA 3GFZA 2XYPB 1GAOA 4KGMA 8RUCA 2FJVA 2UU9F 5EWGA 5KT6A 4P10A 5DS7A 1TR0A 3PHTA 1Y9OA 2IBOA 3W65A 1AXQA 4Y34A 5KFVA 5HMXA 1S1VB 1HBUB 4F04B 4I6AA 4LSNB 1Q86T 4L75A 2EKNA 2GMHA 1FE4A 1FRXA 1Y10A 2HNZB 3MMJA 4JI3J 4UTGA 3SMZA 3IBWA 4DV7J 2NREA 3AB2B 2E1CA 2M2BA 2W4PA 1RGVA 2ZZNA 1XMQF 4K0KJ 1RA6A 5DQHA 1WC3A 4GKKJ 3DMJA 2CQ0A 2DCLA 2IA0A 2LXIA 2Z2LA 4ZVUB 2XMAA 4XPCA 3I96A 1HL6A 3S7RA 2HHXA 3PKYA 3E8OA 1PJ5A 4H4KC 3CDAA 1VQLS 1LV5A 4WIQA 3R5GA 4W92B 3BQ1A 4UZBA 3C15A 1RT7A 3TVYA 5F8JA 3TNVA 3QGIA 2LFVA 2QT7A 3TAPA 2WVCA 5IV4A 4ZA1A 4J9KA 4IFVB 4L6V3 3PX0A 3TAQA 1NKBA 2V8DA 3UVJA 2A2DA 1S9EB 5KT2A 4DOZA 2WCXA 5ETLA 1HQUA 3SQOP 3NBPB 1I3OB 1D8YA 3R5JB 3GIIA 3L09A 3J7ZT 3UDLA 3HT3A 4O44B 2F3JA 4RKUC 3SSQA 3ISND 4E2FB 4FYVB 4ECZA 3HDSA 1VYAA 3OTCA 4X64F 1MU2A 5T14A 4NLGA 3W2VA 1GXTA 1Z2ZA 1VQOS 2RQKA 3MR7A 1RTHA 1GFWB 1P9QC 2K3IA 2WHOA 3FRYA 5GADI 1A9NB 3PJXA 4QW8A 4EWTA 1HQ2A 3CEDA 3GV5B 4B3MJ 3CDUA 2XMWA 2KU7A 3BGLA 3C6UB 4PG5A 3N6MA 2HFSA 2YKMA 7FDRA 4JV5J 4RBVA 2MGZA 1NJYA 1VMBA 2MEWA 3BSCA 5K20B 4CLPA 1VQ6S 2OI2A 3LQVA 5KFZA 3SV4A 2PMWA 4EBEA 1UZHA 2YQ1A 1UEVA 4OZ3A 5B0DA 4KKOB 2YKNA 3PV8A 1Y3KA 1U1MA 4RU9A 3T5LA 3LUYA 4JI5J 4Q8FA 4PWDA 2MZTA 4NMXA 3GG1A 2KVQE 1PBAA 3GE9A 3G82A 4WE1A 2CQHA 2L3MA 2MZRA 2QL7B 3KDNA 4YY3F 4HT5A 1CPZA 2IY5B 4X2BA 1CEZA 2QA1A 2XCAA 4WZQA 1WF2A 2OELA 3DLKB 2GGPB 1OQ6A 1KS2A 2OD4A 2M5YA 2OMOA 3CMQA 2VPZB 3PYFA 2RQMA 2VFRA 5IQQA 4IH5A 1HNWJ 3BSNA 4PYAA 5H9FK 2WB4A 1X4FA 2DK2A 2HHWA 1WKKA 4GVLA 2O3DA 1JKHB 2KRBA 4OV6A 4RW9B 4KH1B 5D4PA 3RAMA 5C5JA 1KFDA 2X1AA 2I8EA 3V5RA 1HNXF 2HVDA 3UN5A 2SXLA 1FKAF 1QAIA 2B3TB 5KFRA 1CQMA 2QLWA 5I4MA 3KMSA 2MKSA 2W7AA 2XLJA 3CCVS 1Q5YA 1WOOA 2DGQA 2CPIA 2RIJA 2YPZA 4L73A 5E3AA 4DV6J 3ZC4A 2J9EA 3VV2B 4DX5A 4A8SA 2V9WA 4LF7J 1S9GB 5RUBA 3HF5A 2DR5A 3BREA 1N52B 1IBLJ 2ZZMA 1VQ5S 4OJ1A 2FTRA 2O1PA 1F60B 3BDEA 3NWRA 1HQUB 3WIUA 1N34F 3TA2A 1PSDA 2BOAA 2EG1A 1HIYA 1WF0A 2GJIA 4G1PA 5LL6d 4KQZA 4MKAA 3AJDA 3UDVA 2XO7A 3Q8VA 3MM9A 4RW6B 2IMWP 4JV2A 2XWYA 3A4TA 3M6VA 5B7WA 2HW3A 3ONQA 4OI2A 4CTAB 2R7XA 3DGPB 4I67A 4OX9J
chains in the Genus database with same CATH topology
2CPXA 3W7BA 5F8HA 4Q45A 3CO9A 1JLBB 4O3RA 4GMKA 2B6AA 2IM2A 1KSPA 2J0XA 4X62F 4EO6A 4WKRA 1G6BA 2RRBA 3ENWA 5F8MA 4O4GA 2NS1B 2GMLA 3DRXA 4KJIA 4UUXA 1UVMA 2HVZA 1FTCA 3R5CA 1HBNA 2WSEC 1FKPA 3JSRA 2VL1A 2MKHA 3HI9A 2E1AA 4MYTA 3UQSA 4C11B 2B51A 4UQGA 4PXCA 2KT5A 4FZVA 2BQRA 2VC1A 1WACA 3KK2B 5CXTA 5B0FA 1VQ8S 1FJCA 2VV5A 3F44A 3G6VA 3T1YF 1YJ9S 2HNYA 3KJVB 1UJ6A 1M5SA 2JSXA 2FB0A 2KRRA 1U1LA 2F8HA 3MPVA 1U1QA 3SDEB 1YJVA 2B6AB 2XMUA 4J9SA 1LW0A 3RRGA 4EYIB 4OZNA 4BDPA 4KHRA 4A8XA 5HP1A 1VC6A 3MURP 2AJQA 4QR1A 5KFSA 3OTDA 4YB6A 3NG8A 2JLEA 1LFWA 2KKHA 3SQGA 4DG1B 2ZH8A 1VC5A 3SI8A 2HNYB 3PY8A 2KXFA 4DV5F 4IRKA 2JWNA 1G1XA 2FDNA 3M8PA 2FHJD 2EFNA 4ELTA 1UVKA 2EK6A 4C3LA 3R1HA 3VR1A 2PGCA 3G86A 2CZ4A 3MMAA 1FDBA 4C8ZA 4K2XA 4R8UB 2HVIA 4ZVGA 3DRRB 2FVSA 3VZIA 2MDAA 4ELVA 1DJ0A 2PMHA 2W4DA 3K5MA 4TQRA 2AX1A 2JEFA 1N5TA 4HT7A 2R4FA 3GG0A 4GKJF 2DITA 1W2BR 4ZS6A 1WHYA 2B43A 4IQXA 2AYMA 2K7JA 1FHTA 1MW7A 2BE2B 3IFEA 4O23A 2BANA 2QIFA 1Q8IA 4PG7A 3M9MB 2FJBB 3K2YA 5F3TA 3TQ1A 2NPIA 4GO7X 3CCWA 2B7BB 1QTMA 1NB7A 2HGLA 1XR6A 2RH3A 4B02A 3G4SS 2FJDB 2IC3B 5B0EA 1S1VA 4YR0A 1HNZF 1FXLA 3QZ8A 2VA3A 2CKWA 3DLHA 4NWBA 1VBYA 2MPUA 5L39A 1YG0A 3KK1B 5D77A 3GILA 3M9OB 1TKZA 3DYAA 4DL3A 5GAGI 4P7TA 2PA8D 3TUIC 4A4JA 1HI1A 2YKQA 2R7RA 2NQPA 3LW5C 2UV8G 1TK0A 3MD1A 5EWEA 1REVB 2JFKA 3PW2A 2BE2A 3OW2R 1TFWA 4M8LA 2KTQA 3QJJA 2J0SD 2DH8A 1NO8A 4RBUA 4DUYF 3E51A 3OLAA 4OI0A 2N3OA 2LQBA 1QAYA 1XN9A 5HBMB 2Y1RI 3PIPQ 1KQKA 1LW0B 1B0VA 1J2VA 1LWCB 2V8VA 2EW9A 1C0UA 3BR9A 1JKHA 1SKWA 1IBKF 2CFXA 3EXYA 3TX8A 2G9OA 1K0VA 3ZFVA 1RTJA 4WFAQ 2KT3A 2KG1A 4Q2LA 2HLUA 3OL9A 2FHJA 2QZ8A 1DBDA 1KC8T 2V8GA 2JEIA 3HMJG 1U25A 2ASYA 3DDKA 4ZVEA 4JYAF 3TARA 3MAQA 3KTQA 4JV1A 3B82A 4BWJA 5EGYA 1AW0A 1H7XA 4LVOP 3SSSA 1X4EA 4OX6A 5EN1A 2XI2A 3ITHB 1Q7LB 2IAJA 1NEEA 3KLGA 2C42A 2RB7A 1U2FA 1GTHA 1TL1B 1T3NA 3FSYA 4O4RA 2UXBF 2UZAA 3UR3C 1SC6A 2AYGA 2RKIB 4KIAA 4ECYA 5J2QA 4C4WA 1S0MA 1F9FA 3MECA 5SZTA 2ZJPQ 5KG0A 2LU1A 1ZAVA 5AE2A 3I32A 2DPJA 4CO5A 2LEPA 3NNAA 4XPEA 1RISA 2MQQA 3QO9A 1MU2B 2GW8A 1RT5A 1H2UX 2OPSA 1ZTTA 3QWPA 5K9FA 4BWMA 3JYTA 3V2UC 1HPZA 3F56A 2YKAA 3KMQA 3FQLA 5K8PA 2O67A 2ZKTA 2HHVA 4NLDA 1M0SA 2DRAA 1FCAA 3HZGA 2RJZA 5K14B 1NK8A 4CIOA 4FF3A 5F9LA 5C42A 4K4VA 4BC9A 1F5AA 1N4LA 3MDFA 1O5JA 3EXCX 4U67Q 3GR1A 4G1QA 1D9AA 5E5NA 2RD5C 3VQSA 2CQIA 2NXUA 4R25A 3G8TA 5A6WA 1YRUA 1TKTA 2UVWA 2ASJA 2LA4A 3CJKB 2XY6A 2QEXS 3CJ3A 2PDAA 3NMAA 4U7UK 2DO0A 4CCHA 2BJDA 3QJPA 3KLEA 4RWWA 2JC1A 4ID8A 1FJEB 1ZM9A 1SJFA 3JSYA 3MM8B 4C0OC 2W9BB 1JLCB 1IKXB 4WFYA 5F8LA 2R8GA 1HPZB 3KLFB 2OAUA 5CD4H 2IMOA 5C25B 1TL5A 4HH1A 2EPIA 4GO5X 5CCLA 1L3TA 2XWXA 2OFGX 3TYTA 1I94F 1J5OA 3VTIA 4G3IA 1DLOB 1EP4B 1QAXA 4QIVA 1YJUA 4ILRA 2V4RA 2HPUA 2WOMB 3MM7B 3T1AA 3BGUA 3MEGB 1FVQA 3KLGB 3KHGA 2BOPA 2WTFA 1JLAB 1YSJA 3KFWX 3UNGC 5FDLB 3D54A 1CG2A 2JH3A 2RU9A 4EU0A 2ASLA 2C28A 4TLQA 2FLLA 4LFCF 1HD0A 2W8KA 1UAWA 1G3OA 4C7QA 4ZP8A 3RBDA 1MMNA 5CYQA 2JDJA 3SFUA 5KT3A 3DOLA 1RP5A 5KT4A 4LFAF 4TY8B 3MM7A 2RSQA 1RTIB 3LP2A 1UFWA 4KKOA 1FF2A 3IA0A 1HBNB 5KFFA 4I0WA 2QYCA 2B0GA 5AXKA 3NCPA 1L3VA 3H5XA 3MD3A 4ES2A 4ALZA 2VODA 3KNAA 2XULA 4JI8F 2KXHA 2XMVA 1FRKA 2ROGA 1JLBA 3QYYA 5IT4A 2MY7A 2XNRA 4NPOA 3BSAA 4A8OA 1JLAA 1X8DA 2LU2A 2OPRB 3H2VE 5JVHQ 4EZ9A 4J9LA 3WC2A 2E9TA 3Q23A 2D41A 1ROFA 4M63A 1Y7PA 4OHWA 2ZNZA 3QMQA 2AGQA 1WWHA 3ENVA 2OJ3A 3DC2A 2VG7B 2JLFA 4FN5A 4NLVA 2YWFA 4ZVHA 1TKTB 3TUZC 2D9OA 1GH8A 3BGRA 3OXGA 4Q2MA 4C8NA 1VQMS 1OQ3A 1URRA 2XMJA 3D1HA 4PXEA 3MM5A 2Y1JA 1I1GA 3LF0A 1FXDA 1TKXB 4F3MA 2CPZA 3X3UA 1ZM3A 3SV3A 2KYZA 1YTYA 2WBRA 4X65F 1TK5A 3LOUA 3DRPA 4DQQA 4KE5A 4WFBQ 1KFSA 1JWWA 5DG8A 3MM5B 1YI2S 1HHTP 1LWFB 4Q5VA 1VBXA 2OPRA 3PDNA 1RT3A 1SKRA 4PKDB 4Q44A 1VQPS 2UXCF 4HLBA 3GR0A 2IVYA 1VQ9S 5BYRA 6FDRA 2AQ4A 5BR8F 4N5SA 4PQUA 2Z8QA 2VFTA 5B08A 4ECSA 2WB1D 2MKIA 3CCQS 3AA8A 3JTPA 3S1TA 3UCZP 1S72S 4PUOB 2MQPA 2KVIA 4J37A 4TY8A 3IGVA 3OBIA 1TAQA 1C1BB 3JTNA 2XSFA 4ZLPA 1IN0A 2HQIA 4C8LA 5KG2A 3UD3P 4CO4A 1KONA 4E8UA 2J7UA 4K4ZA 2GHVC 1E6YA 2PSZA 4DR5F 2J0QD 1S79A 3MTKA 3W3SA 1ZPWX 4NLXA 3FNNA 3O2IA 3BR8A 2UV8A 3V81A 4X4OA 5A0YB 2WSFC 1HWIA 5GAGU 2NSCA 3SDEA 1D0EA 3NKYA 1KOHA 3CJ5A 3MR2A 4NYZA 2FC8A 2C2DA 2UP1A 2RE1A 5L8RC 4B9NA 4FVMA 1UKUA 3J7A1 4DS5A 5A0YA 2ZH5A 1Q8LA 3AHPA 2BR0A 4BS2A 5A8WA 3HPOA 3G71S 2JHEA 1HI0P 5BYSA 1BLUA 2YWGA 5E3QA 3IWLA 4ED0A 3LH2S 4NXMF 2U1AA 1IKXA 5L1JA 2YH0A 1R8BA 2YTCA 3OSPA 5E2QA 4H4OB 1S1WB 3DLJA 1VQYA 4DPOA 1NK5A 3HXMA 3HK2A 3BJYA 5AXLA 4BCAA 3PW5A 2FJWA 2A1BA 4DV7F 3CC4S 2P6TA 4K0KF 3CD5A 1YQHA 2AYEA 3FFIA 3C8YA 2OO4A 5D4NA 2FD2A 4IO1A 5LT5A 4GKKF 1A6LA 4DMZA 1N54B 2I5JA 2V4JA 3OR2B 3GIJA 1PO6A 2LVWA 1OWXA 1FD2A 3OXLA 1TK8A 1JB0C 3BO3A 4ED6A 2W9CA 4QIWD 2XB2D 3HHKA 4C8MA 4B3SF