4TLQA

Crystal structure of c-terminal rna recognition motif of human elav type rna binding protein-3 at 2.5 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
EGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal RNA recognition motif of human ELAV type RNA binding protein-3 at 2.5 Angstrom resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords CUGBP Elav-like family member 2
total genus 22
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tlqA00
2M4MA 2XS7A 1X5OA 1U1RA 1JJ4A 2XS5A 2A3JA 1YJ9S 3G4SS 2DNMA 2LMIA 2KG0A 2MZJA 3MD1A 5IM0B 1M5OC 5FJ4A 2MQOA 1H2TZ 2CPHA 3RW7A 2E5HA 2YWKA 5JVHQ 4OZ0A 1PO6A 5LXRA 2DNLA 4F25A 1WTBA 2DITA 3J7ZT 1OPIA 2WBRA 1UP1A 5DDPC 2JVOA 1YJWS 3CTRA 4TLQA 1U1NA 2KN4A 1VQ8S 2OIHA 1UW4A 4IOAQ 2RQ4A 5LJ3Y 5GADU 1WF1A 5IQQA 5DM6Q 2MSSA 2RU3A 2DNQA 2CPYA 3V4MA 3VAJA 2K8GA 2CQ3A 2X1GA 2OTLS 2HZCA 1R8HA 4EGLA 1R8PA 3VAMA 1FJ7A 5DETA 1JMTA 3FEXB 2EK6A 1U1PA 2AYEA 1WHWA 2DIUA 3CMAS 1WF0A 3UD4P 2LA4A 1SJ4P 1WEYA 2CQPA 3DLLQ 3CUNA 2DIVA 1P27B 3CULA 2DNGA 2MQMA 2DHAA 2MYFA 1CVJA 2EK1A 2MKSA 2J76E 5GMKa 2D3OR 2M8DB 3CMES 2MKKA 1KD1T 2KM8C 2K3KA 1D8ZA 4PKDB 2DNZA 1WELA 3MURP 1NU4A 3HI9A 2CQDA 1SJ3P 1M1KT 1BY9A 4U67Q 2HGNA 2RS8A 1U1KA 1D9AA 1X5SA 3S7RA 3CC7S 3BEGB 2DGTA 4YOEA 2DO0A 3CCJS 2MGZA 1FJCA 2X1AA 2CQ0A 4CQ1A 2LXUA 2CPZA 1JJHA 2F3JA 2FPHX 2JVRA 2N82B 2RT3A 5GVQA 2I2YA 3NS5A 2M70A 3US5A 1SJQA 1SJRA 1FNXH 2DNPA 4IUFA 1W2BR 3OW2R 1N52B 2CQ2A 3R27A 1U2FA 3CCLS 1H6KX 3VALA 3SDEA 3VAKA 1VBZA 2QEXS 5GAGU 1YTYA 1S79A 1X5PA 1QM9A 1U6BA 2MZSA 3UCZP 3VAHA 3CPWR 3MDFA 4C7QA 2MJUA 3CCRS 3CD6S 2ERRA 3EGNA 1YJNS 2CPJA 2KG1A 3RW6A 2M8HA 5LXYA 2VONA 1KOOA 4PR6A 1U1MA 2I38A 1F9FA 2CQ4A 1WWHA 1WHXA 4TU8A 2CQGA 1X4GA 2CPXA 2KRRA 4WCEQ 2LCWA 4LIRA 4C0OC 1VQ9S 2M0GB 2LEBA 5IM0A 2XNRA 4UQTA 1AUDA 2XNQA 4F26A 2MKIA 3MUVP 3BO3A 4WF9Q 2MQQA 2N3LA 3CF5Q 4WIIA 3NS6A 4ERDA 2CPEA 5JVGQ 1WHYA 2PEHA 1VBXA 3CCSS 3G71S 3D2WA 2OJ3A 2KH9A 1X4DA 2CPDA 2M9KA 4QU6A 1YIJS 2DHXA 4W90B 3R1HA 1HA1A 2RS2A 1WI6A 2ZJPQ 3LPYA 1NJIT 2KXFA 1X4EA 1VQ4S 1VQ7S 2M52A 2DNHA 1VQMS 2LQ5A 1A7GE 3G6ES 3BO2A 2AYBA 1Q86T 2PE8A 1M5VC 3DXBA 3PIOQ 2DNRA 2D9OA 1RKJA 2U2FA 3PIPQ 2KFYA 1Q81T 2DGOA 2O3DA 5DDQC 5BJRA 2E5JA 3G96A 1X0FA 2J0SD 2DGVA 2HGLA 2RRBA 1X4BA 4TU9A 2DGWA 2DGXA 2MMYA 3VF0B 2MHNA 4LJMA 3TYTA 1XN9A 5LSOA 3K0JA 2DH8A 2YH0A 3MUTP 2CQ1A 5DDOC 5MLCV 2QA4S 1N54B 1FXLA 2CQIA 3LQVA 3H2VE 1OWXA 2ADCA 1URNA 4UY8T 2D9PA 2MZTA 3I56S 2LEAA 4QU7A 3CXCR 4CH1A 1UFWA 2MPUA 4BS2A 3G9CA 3IRWP 1NO8A 2L9WA 4Z2XA 4Y0FA 1P1TA 3SMZA 2KM8B 3G8SA 1Q82T 3J7YU 3BO4A 1VQKS 2Q79A 2KXHA 3THTA 1HD0A 3HHNB 1QVFR 2B0GA 3BS9A 1PGZA 2EVZA 2ZJRQ 3UD3P 2KRBA 4CH0S 1VQNS 1H2VZ 1ZH5A 1UAWA 4RU2A 2KYXA 1WHVA 3UWTA 3P49B 1VC5A 2NLWA 1VC0A 2JWNA 3SXLA 3S8SA 1L3KA 2DGSA 4C4WA 1K8AT 1WG4A 3NNAA 2KI2A 4V19X 1JJ2R 5CYJA 3VAIA 2HYIB 2J0QD 1M5KC 2L08A 3S6EA 4OZ1A 5HO4A 2DGQA 4IOCQ 2G1DA 1FJEB 2RRAA 1KOHA 1WG5A 1H2UX 3P6YC 1WI8A 5CA5A 3I55S 2LXIA 2FY1A 5CXTA 2MZQA 2AYMA 2MB0B 2DK2A 3CC4S 1ZZNA 2KXNB 2MZ1A 2CQHA 3CCQS 1OO0B 3THPA 3VAGA 5D77A 1X4HA 3MUMP 1VQLS 1IQTA 1YWXA 4PRFA 2XB2D 4ZKAA 2SXLA 3U1MA 5DDRC 2DB1A 1X4CA 1DZ5A 4W92B 2CPFA 1HD1A 2KHCA 3CCVS 5EN1A 2MZRA 1VQOS 2LYVA 5IFMA 2VOPA 2MSTA 2MQPA 1VQ5S 3B4DA 2CPIA 1N88A 1VBYA 2F9JA 3P5TL 4WFNQ 5GAHU 2MQNA 1U1LA 2QFJA 2DNKA 2HVZA 1K9MT 3JB9k 5HL7Q 2M7SA 4Y00A 3FEYB 2MQLA 1YI2S 2JX2A 3N9UC 4QQBA 1U1QA 5H1SV 2DHGA 3TO8A 2AD9A 3H2UB 1SXLA 2MKJA 2BZ2A 3CCES 4LMZA 3MI7X 2LA6A 1DBDA 2XS2A 2RNEA 5D78A 2G4BA 2FHOB 2FC8A 2MXYA 1Q7YT 4TU7A 3TP2A 1KQSR 3EX7B 1FT8A 2J8AA 4WKRA 1QVGR 1WF2A 3L3CA 3EGZA 1VC6A 2FC9A 2X1BA 3R1LA 2V94A 2BOPA 4QPTA 1G2EA 2GO9A 2DH7A 1HL6A 2HGMA 1YHQS 2MKCA 2OSQA 3ULHA 1FO1A 1X5TA 3G8TA 1O0PA 2YTCA 1VQPS 2M2BA 1A9NB 2DNYA 2LECA 2DO4A 4M5DB 2XSFA 2G0CA 1M90T 2N3OA 4FXVA 1WEXA 1VQ6S 3UCUP 3IWNC 5DM7Q 1N8RT 4J5OA 1KC8T 2DISA 2DNNA 2OTJS 2YH1A 3SDEB 1OIAA 5ITHA 2VODA 2DGUA 2MKHA 1K73T 1RK8A 1WG1A 1ZZFA 3MXHP 1U6FA 3UCGA 2DHSA 1B7FA 2E5GA 2KVIA 3NNHA 3U1LA 3ZZYA 5LSLA 4WFAQ 2YKAA 2AYGA 4A8XA 2MY7A 2F9DA 1U1OA 2KT5A 2RVJA 1FHTA 3Q2SC 2L41A 3NNCA 2MY8A 2U1AA 2MGZB 2E5IA 5LJ5Y 2UP1A 4FXWA 3B4MA 2DNOA 1M5PC 2OSRA 2RQCA 2CJKA 1S72S 2NZ4A 2GHPA 2M88A 2ADBA 3CCMS 3S01A 1WEZA 1X4FA 2CQBA 2ZJQQ 3VAFA 2VOOA 4IO9Q 1DHMA 4YUDA 1YITS 2E44A 1X4AA 2KU7A 2X1FA 4YB1P 3MOJB 2RUGA 2DH9A 2JRSA 5GAEU 3P3DA 4CIOA 1SJFA 1DRZA 3ZZZA 2MJNA 3CCUS 4F02A 3CC2S 3MD3A 3UE2A 3Q2TC 4WFBQ 3NMRA 4P6QA 2LKZA 2N7CA 2CQCA 4ED5A
chains in the Genus database with same CATH superfamily
1VYAA 2L48A 1S99A 2OLWA 3ZZOA 1N4LA 1DTQB 1Z1ZA 5I3UB 4NWBA 2AGQA 3IO1A 3ONQA 3PJWA 4Q8FA 2BE2B 3AHPA 4MMOA 4CTAB 3G4SS 2DNMA 3JAMU 1RT3B 1YVFA 1QAYA 3ENWA 4H4MB 2BW7A 2YKNA 4LF5J 4MIBA 1KNZA 3Q24A 2VKZG 1M1GA 1S0NA 1RT4A 2IMOA 1YBUA 2RD5C 1RTIB 3M2VB 4OZLA 5GMEA 1H2TZ 3PO4A 3CDUA 4GVBB 2E5HA 3KLGB 2PSZA 2RDIA 4I64A 2XY5A 2R7RA 1MWQA 3JQKA 4DPOA 4PXEA 1BGXT 2DNLA 2WHOA 1C4AA 1LW2B 2F65A 2F40A 3DN9A 4F25A 2GMLA 4RW9B 3OJSA 1WTBA 4URQU 3HVTB 4WKYA 1OPIA 2GQCA 4I68A 3UD5A 3KLVA 3GIKA 1RTZA 3I9V9 4PUOA 4ID5A 2VHGA 1WC5A 2JVOA 1H73A 4GMKA 2BOAA 1TUGB 2C3UA 2J0XA 3HHLC 4TLQA 1CS4A 1PBUA 3MWBA 4OYWA 2GS8A 4AYBD 4L76A 4ECSA 2GVZB 2W8LA 2Y1RI 4ED1A 3OVBA 1VQ8S 2HVHA 2OIHA 1Z2LA 1TUWA 2AX1A 2C3YA 5CCMA 4XPEA 5DZ6A 4DL3A 3CJTA 3PHTA 1UVJA 1WF1A 3OFEA 4HH0A 1N0UA 2XSJB 4CLKA 4CYUB 1R31A 1RDRA 2CPYA 3BSCA 3FFIB 3G86A 2MLYA 4KAIA 2K8GA 2ROEA 4NLRA 4ELUA 2X1GA 2OTLS 3BF4A 5B0AA 5IXUA 1NDLA 4NA3A 2K1RB 3PYFA 4WJBA 4EGLA 5HROA 4B3RF 2XMJA 2VBXA 1HI0P 4YS2A 4BHQA 3I87A 1W25A 5DETA 4NCGA 4C48A 2YWHA 2XY7A 4PG4A 3FDSA 2Z56B 5A0YB 3PW4A 2HAIA 4AE5A 2QC3A 1B70B 2ZUAA 1U1PA 2YKOA 1L3UA 1WHWA 2DIUA 2V2VA 3CMAS 2E1CA 2D3UA 2BJ8A 1SJ4P 3BDPA 1WEYA 1NCLA 2AV5A 3DLLQ 4A8MP 5D0HA 5CAAA 3CULA 2MQMA 1V6HA 3T41A 2FD2A 4CLSA 2MKSA 3A8JA 3CMES 1PYSB 1UFLA 3QFWA 2D3OR 1RGVA 4BWMA 4JI7F 4G65A 1YK9A 1S6QA 3UNGC 2BUNA 3K57A 2K3KA 1RYRA 2HIQA 1NPPA 3DLKB 3K5NA 3SV3A 2DNZA 2OPSA 3QAUA 4H4OB 4I0WA 3C6UB 5C42A 5F8GA 3AQOA 2HBRB 1VQYA 2BJ1A 3ISND 2ZH5A 1WKJA 2C2EA 2UUCJ 4OL8A 4JBCA 7AT1B 1KFDA 2DRAA 4OZ5A 4W98A 2BBEA 1U1KA 5D15A 4UUXA 3M1VB 1IKXA 4I2QA 3EYZA 1B3TA 4JI4F 4IH7A 4ZVHA 1JXVA 3UI3A 3CC7S 1OQ3A 2QA1A 2GHWA 2BJDA 4AD6A 3KK2A 4DL4A 4CCHA 1KP6A 2VG7A 3BN7A 2X1AA 4NLDA 4AQYJ 2EC2A 2CPZA 1D9FA 1JJHA 2HK2A 2RHQB 2RT3A 1RB0A 5J2PA 3MFIA 3NS5A 4X84A 2R7WA 3UDVA 4CI0B 2UXCJ 3MEEA 2VBWA 1NSKL 2ZZTA 1FXRA 1FEEA 4J91A 3OW2R 2AD9A 1W2BR 2W2QP 3C14B 3I82A 2O66A 3PYGA 4PPDA 3SDEA 3PR5B 3OLBA 2OI2A 2XQCA 3SFUA 3FMBA 3IG1B 2FVPA 2VU5A 1S79A 2IVFB 2V8VA 3HZEA 5CD4A 1X5PA 4ELTA 4RWWA 3M8WA 5K14B 4RW6B 4NLGA 3BQ2A 4AL5A 4JI4J 3Q89A 4KKOB 1XR6A 2AEJA 1N5TA 3JSBA 1OSDA 5LMNF 3ZC4A 3QT6A 3GV5B 3O6QA 3OSNA 4QIVA 2YPZA 3MM7B 4X64F 4OFZA 3R2CJ 2YQ0A 1T9UA 3FSYA 2VV5A 3EGNA 1YJNS 2WRMA 3UQSA 4AUKA 1KOOA 3THVA 4M5LA 2A6MA 1C2PA 4MK8A 4RPFA 2ZNZA 1SC6A 2CQ4A 4DV1J 2FJXA 3C6TA 1WHXA 5EWFA 2CQGA 4TU8A 1X4GA 2DVIA 3GONA 3X3UA 4UUWA 5KOXA 1UA1A 2CPXA 5HBMB 3R9LA 2DYAA 6FD1A 5D0RA 3MCSA 1FRMA 1FWLA 5HANA 3GIMA 1VQ9S 4NX9A 1HQEB 3ILOA 5B09A 4ICLA 1C4CA 2XNRA 1RI7A 1AZSA 3LGNA 4NLPA 2HRYA 3W65A 1LXJA 2H1YA 3NAHA 1QAIA 2IRXA 3EMTA 4O44A 3UNYA 2FYXA 2CNKB 2WBMA 4F26A 3BO3A 4JI6J 4Q5VA 4UOFA 1F1BB 1TKZA 2QN6B 1MWZA 1R7IA 2IYIA 1R27B 4K8RA 1YJ7A 3K8WA 4DX7A 5CCLA 1S0VA 1MROB 1WHYA 2BJEA 2F4VF 4K7QA 3GPAA 1K44A 2LP4A 3WX8A 3HK2A 5HVGA 1NK8A 1VBXA 1CC8A 2FJWA 3G71S 4ECTA 2FZKB 3I0SB 3MAHA 4X65J 3MR6A 1OMSA 2VUGA 2OJ3A 3M6UA 3KOAA 1X4DA 2CPDA 2ATLA 2PI4A 4O23A 3OTCA 1JKHB 4HDHA 3OHAA 2H9ZA 3I0RB 4OI1A 4X4RA 4P9SA 1Q7LB 1PAUB 3CDWA 2ZJPQ 3LPYA 3LH2S 3CMQA 1NK9A 1NJIT 2KXFA 5HMXA 1RA7A 1X4EA 2NS1B 2PO4A 3BB5A 3Q86A 4OYIA 3D0GE 3R3TA 3SCLE 1LK7A 2M52A 3KDOA 4ECXA 3R5JB 2LQ8A 2O01C 1VQ7S 2CNNB 1A7GE 2LQ5A 2PD1A 2QO3A 3M6WA 1NSQA 4CTAA 3TANA 2WVEA 4CNZA 1ZAWA 2HLTA 3R97A 2OPPA 3QO9A 3WQPA 2HK3A 2YKNB 3MEDB 1FEHA 3L95X 5AXKA 5KFNA 3DRYA 3PIOQ 1UWBA 4WK1A 1V5IB 2DNRA 2LDIA 3BREA 2U2FA 3PIPQ 4XDCA 2AKWB 4ZP8A 5KG4A 1Q81T 4CO1A 4L6V3 3IGNA 3PDNA 3Q8YA 5E41A 4DR1F 2VG5B 4CLFA 2JH3A 1EJ7L 5BJRA 5DQGA 1LW2A 1X60A 3VGTA 3G96A 1X0FA 3GIRA 3BH6B 3KJNB 2HGLA 5AJ3F 3FVYA 2RRBA 1HR0J 4DV6F 1AXQA 1S97A 1TKTA 5HQLA 3W61A 4A48A 3RBEA 3BBFA 3P4UB 4DN9A 1T9XA 3KUHA 2MHNA 4DSJA 2Z8QA 3CJSA 1NNDA 4PXBA 4JV2A 1RWUA 4PEOA 4FKYA 2RRNA 2V0NA 3G8QA 1GX5A 4UQGA 1ZPVA 2GCFA 3SCKE 3MUTP 2RDDA 5MLCV 1N54B 1FXLA 3LQVA 1IXKA 3V2UC 3KDNA 2FHKA 4HT7A 4DZ6A 1UTAA 4WZMA 1S5ZA 2A2DA 4KGKA 3Q23A 4JI8J 4PZVA 1S76D 1ITPA 1YQHA 4FYXB 1RU2A 4L3NA 2VQEF 4MKAA 4BS2A 4F2RA 3EDRB 4DR4F 1Z4UA 1GX6A 2LVWA 4XAKA 4ZCMA 4IOBA 5HROB 2HVEA 4GC6A 4ED2A 1P1TA 2WOMB 4M5DA 3ZXWA 4F7VA 1JLQB 5A0YA 3SMZA 3G8SA 4DR3F 3J7YU 1WC3A 2XCPA 3BO4A 3E51A 4TVAB 1FKPB 3W9JA 3THTA 3HHNB 3BS9A 3HFZB 5KFSA 1UA0A 2EVZA 4F50A 1S9EB 3UD3P 3HF5A 3MM9A 4CH0S 4FBTA 2HURA 4CH7A 3A13A 4YP3A 3W60A 2HHXA 3OFFA 2KYXA 1S59A 2BABA 5G4DA 1CEZA 5KAKA 2NLWA 2B4OA 3IM8A 3VVUA 1F9HA 5ETTA 3SXLA 2KO1A 2PEBA 2ZBIA 1A0OB 1L3KA 1U2RA 2WONB 4H4KA 3MPUB 3GU0A 2J8SA 4YY3F 4FNHA 2HW3A 3E2EA 5C42B 1U25A 2FVSA 4WIQA 5AXMA 2GV1A 1WOOA 5CYJA 4EBCA 1RT7A 5J2QA 2WVFA 2P5VA 5CH7B 3CJ4A 3PCOB 4DU8A 1PG5B 4J9PA 2YNHA 3BBCA 3MM8B 3L7OA 5D4OA 4HTIA 1D3WA 1L5UA 4JI2F 2OKQA 3M32B 2GO8A 2VG7B 3OTOJ 1TL1B 2G1DA 2R7OA 1GMWD 3MCNA 3LPEA 1WC0A 5JXSA 2RRAA 3O1LA 2VA3A 4BC9A 4X64J 2UXBJ 3P6YC 4HVZA 4ZPCA 2HWTA 1Q8KA 4MIWA 5IC4B 1TQLA 3T5HA 5CA5A 1EKRA 2LXIA 7FDRA 2CZ9A 3KLIB 2GC8A 5CXTA 2JNJA 2ZITA 3FSXA 1SC4B 1GMVA 2X3DA 2MB0B 1HWUA 4ZCKA 3WBZA 3FCVA 2AU0A 1ZZNA 3CC4S 2QSFA 1PILA 1J5EJ 2KXNB 4TNOA 3IG1A 3QQCD 3HJVA 1J2VA 4M63A 4USUA 1OY9A 2XMWA 2V50A 3K5MA 5E7OB 3BM7A 1GT8A 1FRXA 1OO0B 1RT1B 5D77A 3TQEA 2AEFA 3U1NA 1IQTA 2B43A 1B4SA 2SXLA 1HNZJ 1RQ0A 1OYEA 2PI5A 2B51A 1G3OA 2DB1A 3HVAA 3IA0A 2ZH6A 2HHTA 2KHCA 1S7IA 5EN1A 1OSCA 1AA1B 1UEKA 3EUNA 2MZRA 2P6SA 3D68A 3FEZA 1VQOS 2MHEA 1LFWA 2XMVA 1N6QA 4KH0B 3MMBB 4ETXA 2OPQA 2ZD1B 3V5RA 5F8IA 1T11A 2QJ3A 2V9KA 2CPIA 3QJJA 1LW0B 3MEKA 5SZTA 2GMHA 4U95A 1B64A 3CDAA 2MQNA 4FYWB 4PG6A 4ZP7A 4UOHA 1NAQA 3HP6A 3W7BA 1F6TA 3VV2B 5IV4A 2FHJD 1X7VA 3AFGA 4DF4A 2OEKA 3LANA 4XK8C 3QYYA 5HL7Q 1FNMA 3IR6B 2HHHJ 4B3SF 3FEYB 2W7PA 1YI2S 2V8DA 4V1Ak 1KVIA 2QL5B 1AZSB 2F5GA 3OFHA 1UJ5A 4TYBA 1LFPA 4JI7J 3H0PA 2AJQA 3QT7A 2YQ3A 1ROFA 3EDQB 2A1BA 2BM1A 5U47A 3TJ8A 2CG4A 1TKZB 2F1FA 2I0XA 3RB6A 2ASJA 4RNNA 1E6YA 2X7IA 3CCES 4EUVA 1NJZA 1YG0A 4LMZA 4RW4A 2LA6A 2QYGA 2UV8A 5AT1B 3Q8UA 4NEYA 1NK6A 4DSIA 1WC6A 3R5BA 4WYWA 4FS1A 5BR8J 2E1RA 3GWCA 2JLGA 2FJVA 1RWWB 3OTOF 4F8RA 3AAWB 1GMUA 1HPZA 2W4DA 3DMJB 3DOLA 3RRGA 3FUYA 1IR2A 1HNIA 3ZTQA 3DDNA 4WP3A 4MK7A 3UVJB 1EETA 3TP2A 5HVHA 2B9EA 4JI3F 3C2PA 2XM3A 4ILRA 4OX9J 3N01A 4KGVB 5J1PA 3CCWA 2B3TB 2ALYB 1X0PA 1VC6A 2FC9A 3QZ7A 1UKUA 3R1LA 3TAMB 5A76A 4G1PA 1JWWA 2XO7A 2FLNA 2DH7A 4DHVA 1HL6A 5KFHA 2R2RA 1YHQS 1EIYB 3HSZA 1T9WA 5C24B 4ID8A 3S1TA 2GJFA 3QO9B 1N33F 3FBEA 2L9DA 3MEDA 3AH6A 3PRDA 5H9EK 1DLOB 4RZRA 1EP4B 3GZ7A 4DV3F 2LECA 1A9NB 1HIYA 2BE7D 2UU9F 1RYSA 2G0CA 1IR1A 2N3OA 4CZCA 4OX7A 1S9GB 4OYOA 2JEGA 4LF7F 3IWNC 5L1LA 1RJJA 4USJC 1JLAB 4NA1A 2DNNA 1KC8T 1KVJA 4DR6F 2B4UA 2VFVA 3R5GA 4Y2CA 5M2UA 2F4FA 3SCIE 4X62F 5GAHI 4LF9F 4DL7A 1G4CA 2UXDF 4G1IA 2DGUA 2DY1A 3MPWA 3M8SA 2E9RX 1RAAB 2XYPB 5EX3A 4DN0A 4JV1A 3Q8SB 4DV7J 2XHWA 4DR7J 2XWYA 4B9NA 1HNXJ 4Y28C 2DHSA 3QGHA 2B4VA 4ITSA 5T41A 2FVRA 4GVLA 4F67A 4I67A 3DCAA 2HHUA 1FCAA 2GJ2A 2KVIA 4EBDA 4B9TA 5KFLA 4ZN3A 1H7WA 5CD4H 3FQLA 3NNHA 4ER8A 1VRUA 1GXUA 2VC1A 3NKYA 4DL0C 3MMCA 3FMWA 3L7PA 5IT0A 3GJRB 4Y65A 3PVXA 4GKJF 2WK4A 3SQGA 2G2OA 2LLZA 1SQEA 2QLWA 3WIUA 1RA6A 2BKNA 3CEDA 4O3NA 2F9DA 4AFFA 4BWJA 5J1NA 3GIIA 1N0VC 1U1OA 3LUYA 3N5FA 3U27A 4CLUA 4GO7X 5CYMB 4DFMA 2UUAJ 2MGZB 3ZZRA 2E5IA 3Q22A 2WOMA 1KBRA 5KFXA 2FTRA 2UP1A 3K5OA 3NGRA 3W5YA 1JLQA 1M5PC 4KPCA 3VAKA 2UU9J 1FKPA 2CJKA 2XI2A 5K5MA 3W8GA 4UZCA 1BQNB 1IN0A 3ILLA 1D09B 3DHWC 3H5UA 4Q43A 6AT1B 3C15A 3S01A 1O8BA 5F3TA 2CQBA 4NLVA 5F9NA 1DHMA 3MECA 4KHPF 3V81B 2YWGA 4MKBA 4YUDA 4YHHJ 4ZJOA 2J5AA 1X4AA 2KU7A 2QMWA 3NWGA 3D5MA 4QIWD 2BXJA 1FKOB 5A8RB 2W9AA 3Q8QB 3B78A 2Q66A 4J9OA 2FDNA 3IBCB 1TK5A 5J1EA 4J9SA 3KHLA 3PW2A 1RT7B 2CXEA 4K5RA 4RJVA 4U8VA 2NPFA 4A8OA 2G9OA 3D6FB 4CIOA 4EEYA 3CC2S 3MD3A 1SUQA 1YZ6A 2QSWA 2FIUA 3BSAA 3MZIA 5DS7A 1NHKL 3E8OA 2W2OP 2C2KB 3KJVB 4KGMA 4X4UA 4CP5A 2VPYB 2C2MB 4TQRA 1GEHA 1SQGA 1QD1A 2LKZA 2YY3A 3KUEA 3GP9A 1KN6A 3RJMB 1GXTA 1FNOA 4C3LA 2H65B 1PKUA 5KFPA 1L3VA 1KWMA 3BPSP 2IPOB 2JFDA 1M0SA 1R43A 1RISA 2QGFB 2ZOMA 3OLAA 3OUYB 2FJEB 1JK9B 2UV8G 3EICA 4QIGA 1EKSA 2XS5A 4LBIA 2J6SA 1VLOA 3FBBA 5BYSA 1CULB 1Y7PA 1ZBTA 3KLIA 3AJDA 1QTMA 3VVTA 4WFZA 3RB3A 2LU1A 3MD1A 1TL7A 4PYDA 2MQOA 4MFBA 3CJ3A 1PYTA 1RWXB 2CPHA 2YKMB 4M5HA 4QJVA 2FZGB 2HS3A 3HPOA 3T5LA 2AQ4A 2IJNA 2KDOA 3CJ8A 1S57A 4J9QA 2C1EB 3QRPA 1DQ9A 3AOBA 2EEYA 1KTVA 3M8QA 2GW8A 2P9CA 4DV4J 2K7KA 2DITA 1U0SA 2BJ9A 4YB5A 4ZMMA 4ZITA 1B99A 1UP1A 2RKIA 2H5IB 4P2SA 3RR7A 1YRUA 4HACB 2GVDB 1UEUA 4EZ9A 4O3SA 2VFTA 4ZLNA 4F4KA 2ZEJA 3CTRA 1EHWA 3MR3A 3TVYA 2V4QA 2APOA 4N5SA 5MAOA 5FLXY 1T95A 3NWRA 5FIIA 5AE2A 5EUHA 4PAAA 1CC7A 5I4MA 4P2FA 2PN6A 2QFIA 2OEJA 3D1HA 3AD8C 5LJ3Y 3QRRA 1X9WA 4X4PA 2W2PP 1WORA 4LRCA 2MSSA 3JQMA 4LSLB 4Y6IA 3V4MA 2XO6A 5IWAF 1SIWB 1FD8A 2HZAA 2QTWA 3TEHB 2ZH1A 3OSPA 2CADA 3H5XA 2FGOA 1FX4A 2BE9B 1K1SA 2Q6CA 1CJTB 3CDEA 7FD1A 3G9CA 1Q8BA 3VAMA 1IKYA 1YX2A 4IG3B 1T05B 3CCZA 3FEXB 4RNMA 2HNDB 1HQUB 1S6UA 2IDLA 3PTWA 3OHBA 4A8WA 2ZOGA 1HI1A 4CT8A 4F4WA 4WFYA 2IHR1 3DI6B 2ZKTA 4R5PB 2UXDJ 3UD4P 2LA4A 4JI0F 4DXLA 1RKIA 4B02A 4O0NA 3HLUA 1P27B 2GX8A 1I5OB 3FZBA 2DNGA 1SBRA 2IA6A 4LQ3A 3R7NB 4DCJB 2MYFA 3N5BA 2CUYA 3UPFA 3KHGA 2HHSA 2J76E 3FBCA 5GMKa 1HNIB 5E3PA 4FF4A 4FBUA 4M5IA 1RUSA 5IV3A 1BWEA 2RILA 1VGYA 1Q79A 1Y3JA 3B8HA 1AYEA 2N7YA 2DJWA 2Y8WA 1S6OA 1DTTA 4LSNA 3GG0A 4TY9A 1O51A 1TVRB 3HI9A 1HHTP 4TXSA 5J2NA 3GQCA 2EC0A 2R8JA 3UDCA 4C8YA 1X8DA 1X5SA 4CRJA 2BRLA 1N6QB 3S7RA 2HNYB 5HATA 1OQ6A 3CE8A 2DGTA 4YOEA 1SQFA 2PMHA 3O2IA 2CNLB 2DO0A 3BPDA 1VLYA 1FRIA 4QYZJ 2HHQA 4OLPA 1FJCA 1O5JA 1U26A 4CQ1A 2DR6A 1P8GA 3F73A 3MPVA 2JVRA 1PIEA 2VKRA 2YNIA 3DFEA 5E3RA 3W2VB 1T03B 4LREA 2M70A 3W3SA 1ZA1B 2BQUA 1V3ZA 2DR5A 1ZOTA 2XLKA 2J9DE 4A46A 4JV5F 2BM0A 2J7WA 1IKWB 1FNXH 1B0VA 3F56A 1HBMA 3ENQA 3R8YA 2EXUA 4KGXB 2EBEA 4MJKA 1SC3B 4RUCA 3VALA 1CSJA 2R8HA 3HHKA 1VBZA 1VRQC 3K89A 5HMWA 4I1TA 4BCAA 4B3RJ 2XMUA 5GAGU 3W63A 4OJ1A 4WYLA 5KFMA 1IWAA 1RHKB 2V69A 2ZNYA 2MZSA 2YNFA 3UCZP 3CJ2A 4O3QA 3VAHA 3CIZA 2ZM6F 3RGIA 2BANB 3E01B 3D6HB 3QSIA 3DLEA 1VRUB 3SSRA 2XEXA 1GQEA 2HFOA 4LRDA 1MW7A 4RLEA 4A8KA 1RLCL 2OMLA 3OL7A 4LFAF 3CD6S 2KKHA 1SI9A 4DWIA 4DUZF 3RW6A 2M8HA 1RTJB 4J9VA 2VONA 2AGOA 4JV5J 1F9FA 4U7UD 3HX9A 1HFEL 3CT9A 4MH8A 5AXNA 1FDDA 1FE0A 2CJQA 1Q78A 3VGVA 1NPRA 4B17A 2HQGA 2PMZD 2AZ1A 1Y3KA 3TJAA 2KRRA 4USIA 2LCWA 1UMJA 2IM1A 2R2SA 4C0OC 4DV1F 3H5SA 4H4MA 1JLEB 1BQNA 3OVSA 4OHZA 1YRTA 3C15B 3H8YA 2XI3A 1VK3A 1ZAVA 1DQ8A 3W62A 4UQTA 4OZNA 5KG7A 4GVBA 2XLIA 1MMDA 2XNQA 1YRXA 4C11B 4N8OA 3MUVP 3OQ2A 1HYSB 1EQMA 4HDGA 3NCPA 2AIRB 4QIFA 3RRKA 2KT2A 1J5EF 1UVNA 3IC1A 2ZVIA 5A8RA 1RTHA 2CPEA 3D1QA 3HVTA 4IRCA 2BACA 1FK9A 2W7OA 5J1EB 2PEHA 4PUOB 3IBWA 1CJKA 4NZ6A 2LQ9A 4UW2A 3PJXA 1GK8A 3LO3A 3D2WA 4USTA 1SUQB 4F0KA 4UY85 2CVIA 3HKWA 1HMVB 4HLBA 2M9KA 4UZBA 3I31A 4FXDA 3KJVA 2GAHC 4PG5A 1YIJS 2DHXA 1P1LA 4W90B 3CD7A 2GVZA 1S1UB 2HS4A 2IA0A 3H98A 3EXYA 3I6PA 5KFZA 4YB7A 4YN3B 2EFVA 1NB2A 1XMBA 3GJSB 2XTJP 4P52A 4DSEA 2F8MA 3NBPA 2HQFA 4LRBA 3PEJA 5KT7A 2XSJA 4CYUA 4DPXA 3J7YI 3OUYA 5ETVA 3NLCA 3ZFVA 5T14A 1REGX 1VQMS 4O3RA 4X66J 3WHIA 4TY8B 3GR0A 4JUZA 2AYBA 4Q0BA 5KFUA 1CPZA 3DM2A 5HP1A 1KLNA 2HZVA 1I94F 2JL9A 3KFWX 2D9OA 3NXZA 5K20B 1GH8A 2Y0BB 3Q83A 4DS5A 3CJ5A 4AT1B 4PG8A 4EYHB 2YBVA 4TN2A 2E5JA 1S1XB 3JSYA 2BA9A 2X3GA 3ENAA 4IFYB 4ZVTB 3FCWA 1X4BA 1ZM9A 4EFAC 4JYAJ 4C2MA 3KMQA 2DT9A 2WVDA 4TU9A 2RHSB 2YNGB 2DGWA 2DGXA 3AOCA 3N6NA 2RMLA 4RW7A 1L3TA 1NH7A 2GZOA 2OPRB 2GVDA 4HACA 4QR2A 4LJMA 2IC3B 3G6YA 3AXKA 4K0KF 2ROPA 3TYTA 2EPIA 1Y4ZB 4DV4F 1GFWB 1VJQA 2NXEA 3R7SB 1HWIA 2BKOA 1R8BA 5LSOA 4LF6J 2DH8A 2YH0A 3LOUA 4HHHA 2IBOA 3TVKA 2CQIA 3I4HX 3M8YA 2Q43A 4ZVQB 5FDLB 2RU9A 1SC1B 3PR4A 2DTJA 2VL1A 4NLOA 4NXMF 1URNA 4TYAA 1F5CA 3ETMA 1IBCB 2E1PA 4ZCLA 4CO0A 1VK8A 2MZTA 1D8YA 4M94A 5GAEI 4LBHA 1IBKF 1Y5NB 4QU7A 4CH1A 3HSDA 2OP5A 2V5HG 3KK2B 2COLA 3ILJA 4YHHF 2L9WA 1S0MA 3B54A 4CLPA 5DGBA 2E5LF 4OJGA 5E3AA 2HNDA 2YVSA 2KM8B 2E1AA 5HVFA 2VQFF 1VQKS 4C8KA 1HD0A 1RXOB 1QVFR 3TZYA 5A6WA 4FYYB 1XJWB 2BRKA 1PGZA 3C14A 5IZHA 4DV6J 3AXMA 1JJCB 2KRBA 4ED0A 1VCTA 1VQNS 1MU2A 3M6VA 2AJ0A 4JP8A 4IRKA 3CD0A 4RU2A 4YR3A 2V6AA 5B0EA 1BWVA 3LGHA 1UWAA 4I7FB 4KSEB 3Q8PB 3PYEA 5A8WA 3DNCA 5EWGA 2O5DA 4MTPA 1WG4A 2WCXA 5CYQB 4ES1A 1PC5A 1TVRA 3GILA 2CJYB 1TMJA 1WACA 2O1PA 2CZ4A 5T7LB 5J2NB 3VAIA 2JZ5A 1NKCA 4IR9A 1NBEB 4C97A 3MOZA 3KUGA 1QAXA 1TZ0A 4NLYA 3GB0A 2WTFA 3Q0AA 2CWXA 2HBYB 2HNYA 4NXNJ 3R5CA 4QW9A 4J9LA 1ULRA 4ZPDA 2JLEA 3T1AA 2OFHX 3MM5B 5HO4A 2ZUGA 4OI2A 2WSCC 1WG5A 5ETPA 3W2VA 1PSDA 1WOPA 4XO0A 1HQEA 3CIMA 3CO0P 5C5JA 3TUPA 3D7SB 3N0VA 3W5ZA 2ZHBA 2FY1A 3AOAA 2AYMA 3R5AA 1N5VA 1SKUB 3N4WA 1YBTA 1HKAA 4LFBJ 1LWXA 2UUTA 4RUHA 4ZHRA 4Y34A 2CQHA 2HVDA 1RHJB 3IM9A 4DJBA 2XMTA 1UJ4A 2R7QA 4DQSA 2KYZA 1X4HA 1PJ7A 4CLTA 2HWHA 1WUUA 2YWWA 1YWXA 4U9RA 4OX6A 2YXLA 2Q1LA 1EARA 3BH7B 1S1VB 4DR5F 2HHWA 2HFSA 4KH1B 4G3IA 3GE9A 3DLEB 2CPFA 1IR0A 3I0SA 1HD1A 1TU0B 3PNIA 3A8EA 4BDPA 4I6AA 3AD7C 3PX6A 2IM3A 2JC1A 2FJDB 3MF5A 4EK2A 5IFMA 2HPUA 3RAXA 2DHHA 1NKEA 5IT4A 1VBYA 4R8UB 3KG4A 5KFRA 3P5TL 4WFNQ 1U1LA 2NXNA 1NLKL 3F44A 1N36F 2DPIA 4DSLA 3IFEA 2DNKA 4E98A 2HVZA 2BJ7A 2GNKA 3DOMA 3HD2A 5F8HA 3UN2A 2V2ZA 3WX4A 5KT3A 4DR5J 1LV5A 1SL0A 1SH0A 1VHFA 1IM6A 4IR1A 8ATCB 1P9YA 2DBBA 3M30B 1LK5A 2MQLA 4P72A 5AXLA 1LKZA 1MN9A 1NRKA 1UWBB 2QG9B 4R0EA 4ZJLA 4ECQA 1IBMF 4QQBA 4DS4A 1U1QA 3BZQA 2WVCA 1TK8A 1HHSA 4LFBF 3TO8A 1Q5YA 2CDRB 2V34A 3UDLA 1XTZA 4J7CA 1U6ZA 2VG5A 1LWCA 2YKPA 4P74A 5EDWA 3SV4A 4DV5J 4DMZA 2V68A 3LP2A 1Y11A 2W2MP 3GFYA 3ICLA 1RTHB 3OTBA 3VTIA 2OMOA 1DBDA 1M5SA 1OYDA 2EFNA 3MI7X 4Q8EA 4DL5A 2XS2A 2D41A 2C2DA 2QLBB 4PABA 3AJ2A 2FC8A 2NCKL 3ILIA 5FD1A 5L39A 2FLPA 3OR1A 4MYUA 5JMNA 3ZTRA 3DRRB 2FB0A 3T19A 1UVKA 3H90A 5L9NA 3SI8A 3EX7B 3EXCX 1SB6A 3J7A1 1JLGB 1S1UA 1MN7A 2Z58B 5HJYA 5HI7A 2ABYA 4DV2J 1S49A 4ZPWR 2X1BA 3NBPB 4B3MJ 4ES3A 5IWAJ 2EFGA 1D1UA 2B6AB 2GO9A 4FZVA 2L3MA 3QIDA 5D3GB 2F8EX 2HGMA 4UT4A 4L73A 1I3OB 3PM9A 5KG0A 2IJRA 4B08A 2R8KA 2HHHF 2IYGA 1AB8A 5A8KB 1KR4A 3G8TA 4Q0BB 3BKFA 4ECWA 4P7VA 3BJYA 1D0EA 5M2RA 2DO4A 2VZ9A 1P9QC 4U8YA 2NUUG 1Y00A 2CFXA 2DRDA 4M5DB 4DEZA 2AW0A 4LF8J 4B3MF 3K5LA 3ZNUA 1VQ6S 4NYPA 2IVMA 3UCUP 4D3GA 4RU9A 5I3QA 2VJUA 5DM7Q 3SQOP 5C25B 1SKSA 4J5OA 1S9EA 2DISA 4IFYA 2C2RA 4CNYA 1RAIB 2UXBF 2YH1A 1NSPA 1VQSA 1OIAA 2YNGA 4I2PB 3LP1B 4RW7B 4ZP9A 2E5LJ 2VODA 5AE1A 2OPRA 4HH1A 3VR1A 1VFJA 2F8HA 3C3LA 1F3FA 2RQMA 2WONA 3VZHA 3N28A 1FFGB 3M2UB 5K9FA 4DV5F 1CJUB 2ACYA 3IR7B 1UPMB 1GXLA 4OMFG 4DLEA 5B0BA 4OI6A 5FDLA 1GMWA 3U1LA 3W9IA 3CB4A 1T3OA 2V63A 3ZZYA 1XMOJ 2YKAA 1RT6B 4C0HA 1EQ0A 4K4UA 4F36A 4DOZA 2MY7A 1HNVA 2KT5A 3A8IA 1RU1A 1T7PA 2B56A 2RVJA 3M32A 4QPXA 2W1BA 4A8YA 1S77D 3Q2SC 1VJWA 4CO3A 2MY8A 2EFQA 4DCPB 4QWBA 4PWDA 4USKA 1HBNA 5LJ5Y 4LR8A 1A6LA 3LP0A 4C3KA 1N36J 3QLHA 4OYBA 4LFCF 4X4OA 2OSRA 1FF2A 2RQCA 1SJ1A 1TKXA 3ZTPA 1T94A 1Z2ZA 1F60B 2PFDA 2H5EA 3TNVA 3KG1A 3KJQB 1H98A 1NEEA 2ZBRA 2IDEA 2QLXA 3LAKA 2XC9A 3SBMA 2ALZA 5D8HB 1MU2B 3DU5A 1C1BA 1WEZA 3TJ9A 4N76A 3PRVA 3TVZA 5L38A 1RAHB 2RF2A 1RBOB 2FQQB 2JDJA 3CSKA 3EZUA 1XMQF 1QAJA 3POTB 2K7JA 1AFIA 2GIFA 2X1FA 3CJRA 4C6AA 3MOJB 3BKTA 4GO5X 1FDAA 4WXOA 4DU7A 5A8WB 5E3QA 4N77A 4QR1A 2B9WA 3GMGA 3FRZA 4OYXA 2QMXA 3M9MB 4DQIA 2KVQE 2RUGA 3FK4A 1JB0C 2F7VA 1RWMB 3K7RA 2JRSA 4KB7A 5CYQA 4JI5J 3P3DA 2DR7A 3DC2A 2HFZA 3BV8A 4UTGA 2AYGA 1PJ5A 2MJNA 1HI8A 4F02A 3BR9A 3JXOA 3D3BJ 3GR1A 4URGA 3MMBA 4RNHA 2RAQA 4DZDA 3T1HF 2CDQA 1MNEA 3F0NA 2J6UA 4WFBQ 5ETQA 4LF9J 3FZ2A 4P6QA 2N7CA 4C0BA 3IN5A 4E0DA 2R4FA 1FD2A 4DX6A 1VDHA 4X4NA 2XS7A 1EAYC 1X5OA 3HHEA 1U1RA 2UUBJ 4TKTA 1HR0F 2FHMA 1FFWB 4WFXA 5GAGI 4NXNF 4RWXA 2KG0A 1W26A 2MZJA 3LF0A 1HBUB 5IM0B 2EG2A 2HRUA 5KG5A 2ZH2A 1RAJA 5FJ4A 1FVSA 5ETMA 5H9FJ 2B5JA 2H3EB 3EVWA 3NCQA 2IM2A 5HSPA 3RW7A 2YWKA 8RUCA 3BGLA 1S10A 2AX0A 3J7Z5 1JXLA 4WPAA 3VQSA 2G0IA 3GFXA 4OZ0A 3BR8A 5LXRA 3M6XA 1PO6A 1FTRA 4RW4B 1OJ4A 4EYIB 4X62J 4K5SA 1S1VA 1RHMB 2KL8A 3PZPA 4OX9F 1HLWA 4O4GA 2WBRA 3P96A 3DMJA 1JJ4A 1CJVB 2CG8A 3DOLB 4LF7J 1H0HB 4Q7AA 4A47A 5BXIA 3UR0A 3UVJA 3QJLA 2NPIA 2V4JB 1TELA 2E9TA 3H4DA 1U7LA 3DKDA 2C2ZB 2VDHA 1SPBP 4DR1J 1U1NA 3U7JA 2KN4A 2EBGA 2EFOA 4RUAA 4QWAA 1C0UA 1YLXA 4G1QB 1WKKA 2QMUB 2ZE2B 3A8KA 1V9OA 2QT7A 1UW4A 3TAMA 2RQ4A 2VQFJ 2JC0A 4Z7YA 5GADU 3DLHA 2LDYA 2OO4A 4IOAQ 1K0VA 4J9UE 4I4BA 5IQQA 5DM6Q 1U02A 5DLFA 2RU3A 5C24A 2G0JA 3L9ZA 1J5OA 1QE1A 1PJ6A 3MCOA 2CZVC 1N56A 3M30A 3KNAA 4ZPBA 4DUTA 2FUG9 2WB4A 1EP4A 3JTNA 4JI6F 1R8HA 1HWKA 1R8PA 2E7WA 3RR8A 5L1IA 1FJ7A 3MTJA 3OBIA 3OXFA 5H9EJ 4NI2A 5A2QU 3IAS9 1GTEA 3JTOA 5HAOA 3OV7A 2X51A 3HCXA 2R7XA 5DGAA 3BYPA 3HSGA 3I5CA 1KSPA 1JNZB 2L9NA 4K0KJ 4ECVA 3KK1A 4IO1A 1IUJA 4QIEA 3K8VA 4PG7A 2E7VA 4EO6A 2EK1A 2DCUB 4ILMA 2PDAA 1S7HA 3OR1B 3T9NA 1R89A 4M5MA 3DRRA 1FX2A 2MKKA 3U02A 3EPGA 4J9MA 5HJXA 4LF8F 4JYAF 2KM8C 4DR3J 3KLEA 5E33A 1U2CA 4PKDB 5GMDA 1RT5A 2XGQA 5L1KA 4MKYA 3MURP 1KVKA 4ZVRB 2Y0SD 5RUBA 3MMCB 1NU4A 2CQDA 2XYGB 4G6VB 1ICEB 5LT5A 1SJ3P 4K50A 3SQGB 3ZZUA 2KFNA 1BY9A 4U67Q 2HGNA 1I94J 3M2RA 5KFEA 2J9DA 4FF1A 3VWSA 1RACB 1V5VA 1UVLA 3AJ1A 5A8KA 4OYPA 1HW8A 1M1HA 1N48A 2RUSA 3JYTB 3HVWA 4FYDA 3EVOA 3DU6A 5CYMA 1DURA 5KFYA 2MGZA 3CCJS 2CQ0A 1CLFA 2LXUA 3GYXB 3M8PA 4F0HA 2F3JA 2FPHX 1H74A 4J37A 2EI5A 3US5A 5HMZA 4LF1A 1SJQA 4CO2A 1SJRA 2B8QA 2HG4A 3OR2B 1L3SA 1IBLJ 1LXNA 1N52B 3QPIA 4I6WA 2Y1IA 2ZBCA 1XR5A 2VA2A 4RL1A 1UL3A 3CCLS 4NCAA 2NREA 1RWNB 1NM2A 3JTPA 3LP1A 4I2PA 3DXSX 3CCTA 3V81A 3D3CJ 4JI1J 1YTYA 2UVVA 4FVMA 2KTQA 3HDSA 1YKWA 4DFJA 1U6BA 1NDPA 1PCAA 2GIQA 1IQZA 2QE5A 4X2BA 4NMLA 2NSBA 3M2UA 3DGPB 1IBMJ 3FGVA 4MAKA 1CJUA 4UOGA 1NUEA 4NPOA 4KE5A 2IRYA 3QBCA 3QGIA 1RT2A 4C7QA 3GYGA 2A0FB 2MJUA 5B08A 3CCRS 4USWA 2GAGC 1WDTA 1N5YB 4OHWA 2CPJA 4OYZA 2KG1A 1VRTB 3V6DB 4JV0A 3MAAA 2BEFA 3HXMA 1RCXB 3MEGB 4PR6A 3W66A 1H38A 2XLJA 5KFCA 2YKQA 3TAPA 1WWHA 3KG0A 3PG9A 2FLLA 2XGPA 2B8PA 5DJBA 2R8GA 2ZZNA 2QL9B 1UZHA 4RBUA 5IC6B 3W1YC 2IMWP 4IRDA 1IKVA 1NZ8A 3QLHB 1JLBB 2VC0A 4QZVB 3MR5A 2DD8S 3HHLA 2HAFA 4WCEQ 2A2CA 3DLBA 3KTQA 4OYMA 3ELHA 4ZIVA 4QR0A 2LEBA 1AFJA 4QBUA 1NSAA 1HQ2A 1YBAA 5DO2A 4IDKB 3WC0A 1TL7B 1C1BB 1DFDA 4MFBB 2BX6A 5HN0A 5A2QY 2YKMA 2V9WA 3DRPB 2UUCF 3BDEA 3IS9A 2F63A 1RBLA 3OXGA 1IJFB 3G2XA 3POTA 3MR7A 3CF5Q 4C8LA 4DR2F 4LUBA 3CGIA 3NS6A 1TL3B 2R9LA 2B4PA 1ZA2B 3QJPA 5HQMA 5JVGQ 3HHLD 5G0RB 4DG1B 4U96A 2BKPA 2RKIB 4KTQA 4XPCA 4FF2A 2BDPA 3CCSS 1G1XA 1ZS6A 2ASLA 2HHVA 3KNGA 2KH9A 1YZ7A 2Z57B 3BGFA 1U4BA 4QU6A 1I1GA 2YWEA 4M5JA 3DRSA 1WOSA 3ZNJ1 1WSVA 2OEMA 1HA1A 3HJFA 2RS2A 1WI6A 1UJ6A 3RBXA 3MMAA 3W9HA 2HEKA 1BQMB 1FI4A 2JSXA 2XMKA 1NK5A 1UFKA 2HFVA 2OELA 4EMDA 1VQ4S 4PXDA 4O3PA 4WK3A 4F4ZA 1HNWJ 3BO2A 3MPYA 3D54A 1Q86T 1KRPA 2XULA 2GMJA 2AJ4A 2PE8A 3ZTSA 3K58A 1M5VC 4ZVEA 5K8PA 3HMJG 1F3VA 1IKYB 4IG3A 2VD3A 2I5JA 1HQUA 3KJFB 1FE4A 3N79A 2DGOA 2O3DA 3HVRA 5KT4A 1S12A 2VPWB 3O8WA 1BLUA 1Y9OA 4M5NA 2DGVA 3M4XA 2XY6A 3KKFA 4M8LA 3CVKA 1WKLA 3CO9A 3O3LA 3KLHA 1YJ9S 2R2TA 3CJ0A 4Q44A 4O4GB 2VF3A 3TRGA 4J9NA 2UUAF 2ROGA 2W9BB 2I9SA 4NYZA 2VFSA 4JOUA 1CG2A 3GV8B 4C9DA 1XN9A 4L3KA 1FDBA 3K0JA 2J7UA 2ZWOA 3V4IB 3BQ0A 2RJZA 2CQ1A 4G1QA 3DYAB 4RR5A 5DDOC 4QOTA 3J81Y 3MM6B 2QA4S 2BYCA 3TW0A 1IBKJ 1NXIA 3H2VE 3I32A 1FERA 2WAQD 3TZXA 2GJIA 5CQGA 4A8SA 2ADCA 1T02A 3D4JA 1TL5A 3ET6B 1J5OB 4E2FB 2UUBF 4UY8T 1QE1B 1REVA 4ED4A 3OFGA 4QWDA 4P75A 2V8GA 4KT0C 5ETLA 3CXCR 2MPUA 4DR7F 2W9CB 3FQKA 3TUIC 2CJ9A 2W7AA 3IRWP 4Z2XA 1TR0A 1HW9A 9RUBA 3RAQA 4Y0FA 1XMQJ 1TV6B 1JLFB 2YNIB 2HBZB 4F2SA 2XMMA 4ED3A 4DL6A 4DR6J 2QLJB 2XBPA 2KXHA 5KFFA 5KFKA 2B0GA 1HBMB 2HQ3A 3NOGA 4HI2A 5F0UA 4B9MA 2ZJRQ 2D3ZA 3SYZA 3KK1B 1FRJA 1H2VZ 1ZH5A 4ALZA 3OD2A 3NL0A 3W2WB 1NB7A 1NHVA 1WHVA 4M5KA 3UWTA 4DR2J 4WE1B 4KFBA 5C7PA 3P49B 1VC0A 2JWNA 4R25A 4Y2KA 1JLCB 3GFZA 2ZHAA 5ETRA 4ZVFA 2E1MC 1KHVA 4NL5A 2VB6A 4K4TA 2NZCA 3JSMB 1RT5B 2DGSA 2HHPA 3H20A 5LMNJ 3SSQA 4OYAA 3ITHA 1IVZA 3E01A 3NNAA 3NGKA 3GJQB 3TX8A 3EZ5A 1T9TA 2G2YA 4WTOB 1XBWA 4Q2MA 5D6GA 3PJ9A 2DCLA 2J0QD 1M5KC 3HT0A 3P45B 4ENOA 2YWFA 2AEMA 3CWJA 3UFCX 3UW1A 1BHNA 3N6MA 2HQIA 4DQPA 4CLZA 4OZ1A 1SKRA 4K4VA 3ZZPA 1FVQA 4KIAA 1YDLA 3CW2C 3M8PB 2MLXA 1GNKA 2A10A 5F0WA 1Q16B 1RZMA 1H2UX 2AJ1A 4WU3A 2NYIA 1UPPA 1WI8A 2OUGA 1G6BA 1JLEA 2C2NA 3OR2A 2DXFA 4P71A 4PWWA 1WC1A 4ZLLA 2IVYA 1KLMB 4LQ9A 1KDNA 2MZQA 4MYTA 3FCHA 3QWPA 1XIQA 1KHWA 3TWZA 1U0HB 3W8PA 5KFWA 4EBEA 5F8JA 4C11A 1RWVB 1SVDA 4MKVA 3CCQS 1HYSA 2NUHA 3R7BB 1ZM2A 4HHUA 1LEOA 1U8SA 2M5YA 3MUMP 2DRBA 2XYHB 4Y2MA 1NJYA 1ZM4A 4PRFA 2XB2D 4WU2A 1FK9B 4Q2LA 2KZZA 4CDIA 3RAMA 2OD4A 1QLNA 1CJKB 2P9EA 5LSRA 1RT2B 4LRFA 3EM1A 5D4NA 2RDJA 2E29A 4DFKA 1I51B 4F4YA 1DZ5A 3C46A 1XK8A 3CCVS 1PYOB 5C2CA 1HMVA 5J2MB 2CIMA 5JUMA 3V6DA 4B3OB 1LOUA 1R3NA 2BQ3A 1S1TA 1FRHA 1OY6A 4B9SA 2MSTA 2V2KA 2WW8A 3HD1A 1LWFA 3MEGA 1WJ9A 2PGCA 2MQPA 1NKBA 1VQ5S 4N41A 3DLJA 3J80U 4FN5A 4V19J 3QIPB 1RTDB 2PA3A 1E6VA 4WP8A 4GKKF 1Q0NA 3UR3C 5KT2A 3QSYB 2QRRA 4EI2A 1IKVB 4DUZJ 4WBFA 1K9MT 4QCLA 4X4TA 1W7WA 3IRXB 3JB9k 4DDFA 1DTQA 3CNQP 4TY8A 4ETZA 5I3UA 3EE3A 4HEA9 3TARA 3DM2B 1RT3A 5HP1B 1YJVA 3RYLA 4IDKA 3VQTA 3N9UC 3QATA 5CABA 2VG6B 3KHHA 3DRPA 5H1SV 3L09A 2FGCA 2DHGA 3D0HE 3TX0A 2JJ4D 3H2UB 3NY0A 4LRAA 3FJ2A 3WDOA 5L46A 1C1CA 1SXLA 2RB7A 2MKJA 3BGOP 2VICA 1S1XA 2BZ2A 3A12A 4C8ZA 5DQHA 5IT9U 4TQSA 2QLFB 3KYLA 3NAIA 4RW9A 1N5QA 4OHYA 1RWOB 5G0RA 2GGPA 4DG1A 1WC4A 2AMCB 5D78A 4DV7F 2KT3A 2HBQB 3T6JA 2H54B 2IC3A 3LAMA 2W24A 4ID5B 4J9KA 4ZK7M 2ZBPA 2DY9A 4YR0A 4TU7A 3LGMA 5LM7E 1MMNA 5LMUJ 2ILYA 3HT3A 2J8AA 4RKUC 1WF2A 2LU2A 3H2LA 3NS7B 4F4AA 4ZN1A 3SZ2A 2NR0A 5D4LA 1DJ0A 3MMAB 1QSSA 4A8QA 2V8HA 2BOPA 4DV0F 2XCAA 2G1HA 4QPTA 3PYDA 4YY3J 5DQIA 4I69A 4DQQA 3RUBL 1XNRJ 1VS3A 5EWEA 2C22A 5E2QA 4BLGA 3ULHA 5B0FA 3RG6A 1TTHB 5DG8A 1X5TA 1O0PA 3ZZ0A 2YTCA 1RAGB 2I1RA 2M2BA 3NGUA 2K1RA 4OQJA 3VGUA 4Q45A 1VQPS 2DNYA 4HKQA 4PPZA 1QDUB 3MCMA 5KFBA 3TA0A 2RE1A 4F0MA 4PQUB 1LNQA 1BD6A 1Q53A 1U24A 1WEXA 3D28A 2Y1LB 3ISZA 3BBBA 4HTJA 2Y3YA 4K2XA 3UDEA 3M9OB 2OH2A 4WZQA 2W25A 3JS9A 4FPRA 2BMBA 1FESA 2YX4A 5K8MA 4OV1A 1R6VA 1FRLA 3KWMA 5ITHA 3I5BA 5KFJA 3O44A 3G6VA 4GKJJ 1ZAXA 1H7XA 1S4EA 2R3VA 2R42A 4I7FA 3VHQA 2HSEB 2J7KA 4NLWA 1U6FA 4NRTA 4PYAA 3UCGA 1LQ9A 3MXHP 2W2NP 4LVOP 1R0BG 1B7FA 4NE9C 3PFEA 4K4SA 2E5GA 3V4IA 4DBQA 3DLKA 1EX8A 2OPSB 4H4OA 5T7LA 3C6UA 1V3RA 1FTCA 2ZKUA 5ETOA 2HVIA 4ZVPB 5LSLA 1K47A 3VZIA 1U49A 1JNRB 2GQQA 4K4ZA 4BC7A 1REVB 3M1VA 4KO0A 3PW7A 1RAEB 1DY3A 3J80Y 4B3SJ 4ZLPA 1F9EB 2BW2A 1GAOA 2QL7B 3MM5A 3PO5A 1QUPA 2B7CB 2LFVA 3L7UA 4OZJA 4Y3CA 5IS2A 2L41A 4F3MA 2U1AA 2LQBA 2MEWA 1TV6A 2HFUA 2UUWA 4GKKJ 3TUJC 3BGRB 5J2PB 3D9BA 4KC5A 3IR5B 3UO0A 4ZIWA 3JQJA 2QYCA 1HWJA 4EWTA 4DQRA 5B0CA 1S72S 2GHPA 5IQ6A 1Y10A 4JI5F 1O6XA 2GIRA 2M88A 2NZ4A 2AJFE 4NEZA 4X4VA 3Q8VA 5CZVA 3PXGa 3W2WA 4L75A 4ZHRB 2ZJQQ 4K4YA 1RADB 1QY7A 4KFBB 3JAMY 4IO9Q 1XNRF 3KHRA 3L4BC 2E44A 4WTYA 3F41A 2VPXB 3AA9A 4ZPAA 1S48A 1R0CB 2VFRA 3T3FA 5K14A 3GTYX 1HNZF 2Z30B 3JSMA 5BYQA 1OPZA 2IJFA 3RB4A 4KKOA 2DH9A 4P10A 4CWBA 4DPUA 2V2QA 3AB2B 3GLJA 4Z7CA 3KMSA 4DFPA 3HKZD 2PT0A 3MM7A 4ES2A 5F8LA 2RIJA 1LWEB 5BR8F 3H5YA 4LF6F 2DEJA 3Q2TC 3IWXA 4DLGA 4CO4A 2KB2A 3NGTA 4L74A 4R8UA 5FLXU 4YDDB 1ZTWA 2JLFA 2CQCA 2AGPA 3PHEA 2IAJA 4BBYA 1KONA 4ED5A 3DOMB 2M4MA 4NLQA 4J9RA 3G87A 2EW9A 2B7BB 3W5XA 4HL9A 3QAEA 2BQRA 2A3JA 2CVEA 2LMIA 1NK7A 2ZH4A 1TMMA 1KQFB 1KLMA 2C3PA 4C8MA 1SCJB 4ICLB 4Y2AA 1AROP 2MTLA 1U0HA 1B7YB 4KQZA 3GV7B 1M5OC 2FLOA 1UETA 2CYYA 3M8RA 3PACA 1DAXA 1B0PA 2VPZB 4LF4F 2MDAA 1TP7A 4O44B 3T5JA 1LWCB 5JVHQ 4NASA 4ZVOB 4NZ7A 4P7TA 4ZP6A 2EWHA 3LP2B 4FKXA 4A8FA 2P9GA 3TZZA 1U47A 4QYZK 1QSYA 4AXJA 5L8RC 3J7ZT 2P6TA 4N8NA 3M8ZA 4ZPTR 5IOLA 4XIUA 3NP5A 3AT1B 4RUBA 1OY8A 3HSJA 4ZVUB 1Y0HA 3MFHA 4NCBA 5DDPC 2H4YB 5J2MA 3TUZC 2K06A 3BN4A 1OS5A 4ED7A 2OAUA 1RHUB 3QNWB 1YJWS 2CJAA 1JLGA 4S0MA 1VBKA 1NDCA 1FWPA 4N56A 2AWZA 3QIPA 4C98A 3T5KA 3I0RA 1FHTA 1TAQA 1U09A 2OD6A 1NK4A 2B6AA 2JEIA 1VR6A 5F8NA 5D3GA 3LW5C 1NH8A 2GQ2A 4CT9A 3V6JA 2DNQA 3VAJA 3IRXA 3ISNC 1T3NA 1VIXA 4DR4J 2CQ3A 2W01A 4A4JA 4C3MA 2HZCA 4X66F 5IT9Y 3BSOA 4ZS6A 2J9EA 1PC4A 2OPPB 4CO5A 2YPYA 4O3OA 1ZM3A 1KS2A 1R6YA 2Q6BA 2VG6A 3WC2A 1JMTA 2KJVA 3NG8A 2EK6A 2HFNA 1C1CB 5ETKA 4EZ6A 4FF3A 5C25A 4YB6A 4IFVA 2ASYA 3EPIA 4USHA 1V3SA 2AYEA 3IXQA 1XR7A 5KFOA 2UXCF 1WF0A 1RAFB 2CQPA 1NZAA 2JHEA 3WZ0A 1SKWA 4B9LA 3CUNA 3AA8A 2DIVA 2GGPB 3LTOA 4KHMA 5DZ7A 1TKTB 4NA2A 3CJQA 4B9VA 2DHAA 5HMYA 3OL6A 3D0IE 3QZ8A 4DUYJ 1CVJA 1T9YA 2V8PA 2M8DB 2G2ZA 2R7UA 4CLLA 2ILZA 1D9DA 2A6OA 1DQAA 2W8KA 1KD1T 2FJAB 2KJWA 1D8ZA 1NMEB 1Q8LA 2ACMA 1CQMA 3QT5A 4XTTA 5ETSA 2RSQA 4DV3J 1T8EA 2UVRA 4B9UA 1WELA 4AL6A 3PX4A 5JJBA 3HO1A 1TL4A 3KXDA 1TAUA 2AHOB 2ZFHA 1N32F 1M1KT 3TA2A 1RT6A 1FXDA 3PV8A 2RS8A 4IG0A 3T6BA 2CNOB 1D9AA 5CHCB 4DV0J 1HNVB 2Z4PA 4FS2A 5DLGA 1HBOB 3R6GB 3OXLA 3BEGB 1DARA 2QZ8A 3CJKB 1KFSA 1HNWF 2DKOB 1EZZB 2HWIA 2UVUA 4PWDB 3LWLA 3K59A 2R7VA 1HBNB 2UVWA 2VBYA 2Q3PA 3LP0B 1FA0A 4PCQA 4PQUA 2N82B 4DX5A 5D0EA 5GVQA 5L1JA 2I2YA 5KOWA 1JQGA 1TKXB 2J0WA 3K5PA 3UN5A 3A3PB 3GCXP 5KG2A 4HYKA 4OZ2A 3SFGA 2DNPA 4IUFA 2MLZA 4KV8A 1YJRA 2CQ2A 3UN3A 2WW4A 3R27A 4O4RA 2HMIB 1U2FA 1NK0A 1RHRB 1H6KX 4KYZA 3MM9B 5KFGA 3OL8A 2VQEJ 2H48B 1YJTA 4X65F 4LFAJ 1WDDA 2LQJA 2RF2B 2VASA 4NLUA 1VI7A 1S9FA 4I56A 1XC9A 1N34F 2QEXS 2ZM6J 4RNOA 2BVZA 3TQ1A 1QM9A 3PKYA 2E66A 4LSZB 1RWKB 4DL2A 3TA1A 3HFVA 4KY3A 2PA8D 2Z2LA 2H4WB 2NXCA 3CPWR 3MR2A 2P2CB 3EJMA 2HIYA 3MDFA 2FVQA 4J90A 3RRHA 2AF6A 5J2QB 1I6JA 2ERRA 1JJ2R 1Q4RA 5I3PA 3PY8A 4ECRA 4KO0B 1KKHA 1SH2A 3D67A 5BYRA 5LXYA 2YNHB 1U1MA 2I38A 3MM8A 5AJ3J 1WD6A 1R0AA 3I96A 3DLGB 2V4RA 4LBPA 4NZ0A 2Y8YA 4DUYF 4ZJQA 1ZYQA 2CJBA 1TL1A 2WZ1A 4PWUA 4FPIA 5KTQA 3BGRA 4KJIA 2HQCA 5THWA 2R2UA 1ZTTA 1H72C 2DXEA 4LIRA 1S1WA 4QWCA 3V6HA 3D6TB 2M0GB 4HHJA 1F2GA 1HBUA 4OI3A 5IM0A 1MMLA 3JSRA 4AXIA 2VIHA 1SL1A 2HS0A 4IYQA 5I42A 2B5JB 2XWXA 3PEHA 2IIHA 4FYVB 4YDXA 3VCDA 1AUDA 1N32J 1RABB 4F3QA 2MKIA 4ECZA 3ZO7A 1Q8IA 4U7CA 4LR7A 1VMBA 4WF9Q 1NDKA 2N3LA 4OHVA 3C19A 4WIIA 2MQQA 3J81j 2HRTA 3H40A 4ERDA 1RT1A 2ASDA 1ZETA 1WTFA 2BJ3A 1F5BA 1P6TA 2JOQA 1S6PA 2D1CA 1CJVA 3R6LB 3J7AN 1XEZA 1S4FA 2B9XA 2C42A 3FKBA 1FJGJ 3SSSA 2V4JA 2CA9A 2ATCB 1LWEA 2DR9A 4NLSA 1FWKA 2IRUA 4JI0J 2GHVC 3CD5A 3KK3A 3AODA 4MIAA 2F4VJ 4ZVSB 3R1HA 3T1HJ 2OPQB 2KHDA 2ZD1A 1JX4A 2KZMA 1C0UB 3OPKA 1XQIA 4TLRA 2ZE2A 1LW0A 5KG6A 2IAJB 5KFQA 1RWPB 2JEFA 3MTKA 1T9VA 4B3TF 4NXMJ 4V19X 3Q8RB 2XG8A 4RW8A 2XZTB 2DNHA 3G6ES 1H3DA 3HHDA 2N4DA 2NXUA 3DXBA 3MGJA 3CDBA 1NJXA 4YEAA 1Q95G 2NQPA 4N7TA 1XWLA 4FNIA 4W4MA 2POKA 4NI2B 1RKJA 2EKNA 3W64A 3B6BA 2FHJA 2BV3A 2KFYA 2Y9HA 2NXJA 4B3TJ 4RNFA 5DDQC 3D66A 5KG3A 2R8IA 1X9MA 1PBAA 3EVMA 2J0SD 4NLXA 1E6YB 3ENVA 3QGPA 5EHHA 1SV5B 3QWUA 5KT6A 3TI0A 2ZH3A 3GSDA 3ZZTA 2Z2ZA 4I6YA 1K0TA 3T9ZA 4ZA1A 3M9NB 2MMYA 2QIFA 3VF0B 1U8WA 1MG7A 4R0JA 2R7SA 3G82A 1HPZB 5ETNA 5K8OA 4K4XA 3KLEB 1J27A 1HWLA 2PMWA 3N6LA 1C0TA 1EETB 5HLFA 2CRLA 9ATCB 5EX0A 5SUHA 5HQ8A 5KFDA 3TEGA 4ANDA 4ATNA 4DF8A 4DX8H 4ZDNA 1XMOF 1CBKA 1SIZA 2XHCA 1HARA 4X4SA 3GSIA 1MLAA 3IBFB 4ZOSA 1OWXA 1URRA 1W2IA 4H54A 4H4KC 1MSWD 4OHXA 3M2RB 1HHQA 5LMUF 2D9PA 1ACMB 8AT1B 5ADZA 2LEAA 3I56S 3JYTA 3PX0A 1UFWA 2M3DA 3GJTB 2H5JB 2IBKA 2DXDA 2P8IA 4YFUA 3FSIA 2LEPA 1IBLF 1NO8A 1QUVA 1DLOA 3K2YA 1KEKA 1QTNB 4P2MA 4ZVGA 1XERA 1FFSB 1QSLA 3GYNA 1Q82T 1FJGF 1S9GA 1UZDA 2Q79A 3OTDA 4DI6A 4IFVB 3H4BA 4AQYF 1RCOB 3ZTOA 1M5HA 2N4CA 3SEOA 5H9FK 4OI0A 2VFUA 2V67A 3NGDA 4ECYA 2O67A 1TFWA 4OV6A 1JLAA 3PRBA 3DGVA 2ZDPA 1UAWA 1RBAA 2FY8A 4RO0A 4OJ3A 4ZPVR 2C3MA 4C8NA 4C8OA 5D0GA 1VC5A 4K2JA 3DOKB 4PXCA 3T1YF 2DPJA 4M95A 5A6PA 1WSRA 3PKMA 2HNZA 1BE4A 2JFKA 3M05A 4DSKA 2VH7A 4QW8A 3PW0A 3EGVA 2OGUA 2I8EA 2ZC3A 3DGPA 3S8SA 3FBFA 3MAQA 3C8YA 2ZH9A 3RZAA 4K4WA 1SL2A 2ZOFA 4C4WA 1K8AT 2KI2A 1RAOA 4LR9A 4KHPJ 3QMQA 3EWGA 1VIOA 4D3HA 4USVA 2HYIB 2FJBB 1N5YA 2PC6A 3C16B 4ECUA 2IY5B 2PIIA 3H59A 3OT9A 1VRTA 3A4TA 1SH3A 2AP6A 4IG0B 2IM0A 3MAAB 2Z2YB 4GRSA 2HLUA 3KLFA 1HBOA 2L08A 4LF5F 3J81U 1WNEA 5DRKA 5DG7A 4X4QA 3AD9C 3CJKA 1HNXF 5E0OA 3S6EA 3DDIA 3ADAC 2JEJA 4KPYA 4ANEA 4QWEA 4KGZB 2DGQA 1R8CA 3BSNA 4IOCQ 3B82A 1FJEB 5F3ZA 1KOHA 1JLBA 2G13A 3HHLB 3TZWA 3I9ZA 5DG9A 2KFZA 2EFPA 1N5SA 3GIJA 3LWMA 1GTHA 2Z2MA 4OLOA 4ZLJA 1QJHA 2HKEA 1R8AA 2BE2A 3I55S 4KBIA 1KTQA 5LOQA 4KV8B 1IWGA 2CKWA 4DPTA 5GADI 2ZH8A 2VJVA 4F4XA 3RTVA 4K59A 2HMIA 1XNQJ 2DK2A 1RT4B 3M2VA 4UF4A 1RTIA 3IS9B 4USMA 4B3OA 2D74B 4CLWA 2MZ1A 4NMXA 3KLGA 3MECB 3OL9A 1N34J 3NMAA 3THPA 1TL3A 4HI1A 3VAGA 1VQLS 4IQXA 1RP5A 4HR2A 5B0GA 5L9XA 4DCOB 4ZKAA 3U1MA 5DDRC 1FKOA 4OJHA 3QFHA 3NRBA 4JB8B 4RX6A 4OZ3A 6FDRA 2H51B 2YQ1A 1X4CA 3H42A 4W92B 3AB4B 1Q1KA 1Y5LB 2ZHOA 4MK9A 1G7CB 3SIPB 4WWSA 5B0DA 2LYVA 5KT5A 2GA7A 3K17A 4LIWA 2VOPA 3DRSB 4L72B 2QV6A 1CS4B 4LT6A 1BQXA 1AUSL 3B4DA 3A3OB 4URSA 2WVBA 4ED6A 1N88A 1R0AB 2F9JA 4JI3J 3DLGA 1YGYA 4M5GA 2D7SA 3GFHA 1BQMA 3RBZA 5GAHU 2QFJA 5HK4A 3WIVA 4IQMA 1KQKA 1TK0A 5KFIA 3D6MB 2CJXB 3H7HB 4PQAA 4RBVA 3FFIA 1VISA 1S1WB 2DEIA 3PW5A 1N33J 1CQNA 2M7SA 2B9YA 2EG1A 4Y00A 4LF2A 2JX2A 1CULA 1FDNA 2ZC4A 1F5AA 2CWKA 3SCJE 4FP9A 5I42B 1S0OA 2I5JB 1NJWA 2MQ8A 4KR0B 5F9LA 4LF4J 1KQGB 4LVNP 5CZXA 5C2GA 4JI1F 3QT8A 2I6WA 2E9ZA 4P73A 2R7TA 4WP9A 3R5DA 2QA2A 4KHRA 1U48A 3AY0A 3KLHB 1YJUA 1TKDA 4F3OA 4Y2IA 3M8QB 4U7UK 1S6PB 2NSCA 2RNEA 2OFGX 3HZGA 3DHXA 4ZCIA 1AW0A 2W9BA 2G4BA 2FHOB 1ZPWX 3MHYA 4DPWA 2MXYA 2XZWA 2YX1A 3I4PA 1Q7YT 3DDKA 4UOCA 1UVMA 3OVAA 3DRXA 3KK3B 1S6QB 1KQSR 1BC6A 1FT8A 4WKRA 1QVGR 1PAEX 5KG1A 3DYAA 3A1YG 5LL6d 2ZBQA 3L3CA 3MM6A 3EGZA 4Z37A 2K3IA 5F41A 1T0TV 1JXEA 2V94A 1UW9A 2YX7A 4P2XA 3G6XA 3ET6A 1G2EA 4RW8B 3EGWB 2HQDA 2EKYA 4FVCA 3V6KA 1BXNA 1IKXB 1NHUA 2MKCA 2OSQA 2ZDOA 3A3NB 3HFKA 3LALA 4I2QB 1FO1A 4LSLA 1VHIA 4OI4A 4F04B 2W9CA 4DSFA 4WXWA 3R2DJ 3BYRA 3BKUA 3MMJA 3QRQA 1T05A 3RBDA 2WB1D 1CJTA 3T1YJ 4XDDA 3OTEA 1JLFA 3P8BB 5KFTA 2XSFA 4YR2A 4LFCJ 1FKAF 4NCGB 1M90T 1TFYA 4FXVA 3I5AA 4CM0A 1BMQB 2NYHA 2RQKA 2C2OB 2W4PA 3FNNA 3LA0A 3VGSA 1VOMA 3AQPA 2J6TA 3X1LB 3MEEB 4ED8A 1N8RT 5KFAA 3DI6A 1SV5A 4R5PA 2OTJS 4IH5A 4NLTA 3SDEB 2K2PA 4WE1A 2AT1B 2MKHA 2ZWPA 4MT1A 5E3CA 4YMEA 1K73T 1RK8A 3TOQA 1WG1A 1JLCA 3G82B 2GFFA 1UCNA 3IP0A 5D4PA 1ZZFA 1RE1B 5AE3A 4IKAA 4JI2J 1TUVA 2W4CA 2ZZMA 1C0TB 5HLFB 4RW6A 3ITHB 1UEVA 4CM2A 3RB0A 3IWLA 2BR0A 2QX0A 3FRYA 4EO8A 4LSNB 1DTTB 4O0IA 2Y1JA 5M2PA 3O5TB 1RHQB 4ELVA 3NGSA 3BGUA 5K8NA 2ZH7A 2UZAA 4AL7A 2WSEC 1RSCA 4WFAQ 2WSFC 2XMAA 3QGGA 3GCWP 1X9SA 2J9CA 4KRWA 2LXFA 4A8XA 2PFFB 4RBTA 2Z0GA 4FDFA 5KFVA 1X31C 3C6TB 2RH3A 3IMQJ 3NOCA 3NEKA 4M1KA 4NRUA 4DPYA 4N47A 3BQ1A 3NNCA 4QYRA 4ILLA 2AZ3A 3NCRA 3IGVA 4FXWA 3B4MA 1IJEB 2CAJA 2DNOA 5HBMA 2ZVSA 1ELOA 3ETOA 4E8UA 5EGYA 1T03A 3M7VA 2C28A 2D69A 1IKWA 3GG1A 2ADBA 3CCMS 1MWYA 1EB0A 2C3OA 2XZDB 1UVIA 2FZCB 1X4FA 3VAFA 1FRKA 4YQWA 2VOOA 4OX8A 3DOKA 1F2HA 2HNZB 1YITS 2QA4G 4U6PA 4IH6A 4YB1P 2DR8A 4NOHA 2E7XA 5E5NA 2FVCA 4CLYA 1AT1B 3HULA 4EU0A 1F0XA 4DV2F 2VDIA 2YNFB 4JI8F 3TR5A 1MROA 4OIXA 3P5BP 3FC9A 3H25A 3TAQA 1U45A 1Q5VA 2BANA 5GAEU 1NPKA 3EZOA 2D3O1 1SJFA 3C16A 3ZZZA 1DRZA 1Y5IB 3OJUA 1BUXA 3CCUS 1RLDA 2OHDA 3C66A 3UE2A 4HT5A 4GC7A 1S1TB 1XNQF 2A18A 3KLFB 3E3XA 1LWFB 3PFOA 1RTJA 1K1QA 3HM9A 3MPDA 1JKHA 1B0TA 2AJ2A 2VBZA 5F8MA 3NMRA 1RTDA 1APSA 1E6VB 2IFXA 1IM4A 1JIHA 2MKYA 3D1OA 4NYOA 4ANCA 5B7WA 3RU0A 3IAM9 1YSJA
chains in the Genus database with same CATH topology
2L48A 1S99A 2OLWA 3ZZOA 1N4LA 1DTQB 1Z1ZA 5I3UB 4NWBA 2AGQA 3IO1A 3ONQA 3PJWA 4Q8FA 2BE2B 3AHPA 4MMOA 4CTAB 3G4SS 2DNMA 1YJ9S 1RT3B 1YVFA 1QAYA 3ENWA 4H4MB 2YKNA 4MIBA 3Q24A 2VKZG 1S0NA 2NREA 1RT4A 2IMOA 2RD5C 3M2VB 1RTIB 4OZLA 1H2TZ 3PO4A 3CDUA 2E5HA 3KLGB 2PSZA 2RDIA 4I64A 2XY5A 2R7RA 4DPOA 4PXEA 1BGXT 2DNLA 2WHOA 1C4AA 1LW2B 3OJSA 2F40A 3DN9A 4F25A 2GMLA 4RW9B 1WTBA 4URQU 3HVTB 4WKYA 1OPIA 2GQCA 4I68A 3KLVA 3GIKA 4PUOA 3I9V9 4ID5A 2JVOA 4GMKA 2C3UA 2J0XA 3HHLC 4TLQA 3MWBA 4AYBD 4ECSA 2W8LA 2Y1RI 4ED1A 3OVBA 1VQ8S 2HVHA 2OIHA 1Z2LA 2AX1A 2C3YA 5CCMA 4XPEA 4DL3A 1UVJA 1WF1A 3OFEA 4HH0A 1N0UA 2XSJB 1R31A 1RDRA 2CPYA 3BSCA 3FFIB 3G86A 4NLRA 4KAIA 2K8GA 2ROEA 5C5JA 4ELUA 2X1GA 2OTLS 3BF4A 5B0AA 5IXUA 4NA3A 2K1RB 4WJBA 4EGLA 5HROA 4B3RF 2XMJA 2VBXA 1HI0P 4BHQA 3I87A 1W25A 5DETA 4NCGA 2XY7A 2YWHA 4PG4A 3FDSA 5A0YB 3PW4A 2HAIA 4AE5A 1U1PA 1L3UA 2YKOA 2E1CA 1WHWA 2DIUA 3CMAS 3BDPA 2D3UA 1SJ4P 1WEYA 2AV5A 3DLLQ 4A8MP 3CULA 2MQMA 1V6HA 2FD2A 2MKSA 3CMES 1UFLA 2D3OR 1RGVA 4BWMA 4JI7F 3UNGC 1S6QA 3K57A 2BUNA 2K3KA 1RYRA 2HIQA 3DLKB 3K5NA 3SV3A 2DNZA 2OPSA 3QAUA 4H4OB 4I0WA 3C6UB 5C42A 5F8GA 3AQOA 3ISND 1VQYA 2ZH5A 4OL8A 2C2EA 4JBCA 1KFDA 2DRAA 4OZ5A 2BBEA 1U1KA 3EYZA 4UUXA 3M1VB 1IKXA 4I2QA 4JI4F 4IH7A 4ZVHA 3UI3A 3CC7S 1OQ3A 2QA1A 2GHWA 2BJDA 4CCHA 3KK2A 4DL4A 2VG7A 2X1AA 3BN7A 4NLDA 2CPZA 1D9FA 1JJHA 2RT3A 5J2PA 3MFIA 3NS5A 4X84A 2R7WA 4CI0B 3MEEA 2VBWA 1FXRA 1FEEA 3OW2R 1W2BR 3I82A 2O66A 3SDEA 4PPDA 3OLBA 3PR5B 3SFUA 3FMBA 3IG1B 2FVPA 1S79A 2IVFB 2V8VA 3HZEA 1X5PA 4ELTA 4RWWA 5K14B 4RW6B 4NLGA 3BQ2A 4AL5A 4KKOB 1XR6A 1N5TA 3JSBA 1OSDA 5LMNF 3ZC4A 3GV5B 3O6QA 3OSNA 4QIVA 3MM7B 4X64F 4OFZA 3FSYA 2VV5A 3EGNA 1YJNS 2WRMA 3UQSA 4AUKA 1KOOA 3THVA 4MK8A 1C2PA 2ZNZA 1SC6A 2CQ4A 2FJXA 3C6TA 1WHXA 5EWFA 2CQGA 4TU8A 1X4GA 2DVIA 1UA1A 3X3UA 4UUWA 5KOXA 2CPXA 5HBMB 6FD1A 3MCSA 1FRMA 3GIMA 1VQ9S 4NX9A 1HQEB 5B09A 4ICLA 1C4CA 2XNRA 1RI7A 3LGNA 1QAIA 4NLPA 2HRYA 1LXJA 3NAHA 2IRXA 4O44A 4F26A 2WBMA 3BO3A 4Q5VA 1TKZA 1MWZA 1R7IA 2IYIA 1R27B 3K8WA 5CCLA 1S0VA 1MROB 1WHYA 2BJEA 2F4VF 3HK2A 1NK8A 2FJWA 1VBXA 1CC8A 3G71S 4ECTA 3I0SB 3MAHA 3MR6A 2OJ3A 2VUGA 3KOAA 3M6UA 1X4DA 2CPDA 2ATLA 2PI4A 4O23A 3OTCA 1JKHB 4HDHA 3OHAA 2H9ZA 3I0RB 4OI1A 4X4RA 2ZJPQ 1Q7LB 3CDWA 3LPYA 3LH2S 1NK9A 1NJIT 2KXFA 5HMXA 1RA7A 1X4EA 2NS1B 2PO4A 3BB5A 3SCLE 4ECXA 3D0GE 3R3TA 1VQ7S 1LK7A 2M52A 1KNZA 2O01C 2LQ5A 1A7GE 2PD1A 2QO3A 3M6WA 4CTAA 3TANA 4CNZA 1ZAWA 2HLTA 2OPPA 3QO9A 2YKNB 3MEDB 1FEHA 3L95X 5AXKA 5KFNA 3DRYA 3PIOQ 1UWBA 4WK1A 2LDIA 2DNRA 3BREA 2U2FA 3PIPQ 4XDCA 5KG4A 4ZP8A 1Q81T 4CO1A 4L6V3 3IGNA 3PDNA 5E41A 4DR1F 2VG5B 2JH3A 5BJRA 5DQGA 3G96A 1LW2A 1X0FA 2HGLA 5AJ3F 3FVYA 2RRBA 4DV6F 1AXQA 1S97A 1TKTA 4A48A 3RBEA 4DN9A 2MHNA 4DSJA 2Z8QA 4PXBA 1NNDA 4JV2A 1RWUA 2RRNA 2V0NA 3G8QA 1GX5A 4UQGA 1ZPVA 2GCFA 3SCKE 3MUTP 5MLCV 1N54B 1FXLA 3LQVA 1IXKA 3V2UC 2FHKA 4HT7A 4WZMA 2A2DA 4KGKA 3Q23A 1S76D 1YQHA 4L3NA 2VQEF 4MKAA 4BS2A 4F2RA 4DR4F 1Z4UA 1GX6A 2LVWA 4XAKA 4ZCMA 4IOBA 5HROB 4GC6A 4ED2A 1P1TA 2WOMB 4M5DA 1JLQB 5A0YA 3SMZA 3G8SA 3J7YU 2XCPA 3BO4A 3E51A 1FKPB 3THTA 3HHNB 3BS9A 5KFSA 1UA0A 2EVZA 4F50A 1S9EB 3UD3P 3HF5A 3MM9A 4CH0S 4FBTA 4CH7A 4YP3A 2HHXA 3OFFA 2KYXA 2BABA 5G4DA 1CEZA 5KAKA 2NLWA 2B4OA 3SXLA 2KO1A 2ZBIA 1L3KA 1U2RA 2WONB 4H4KA 2HW3A 4YY3F 4FNHA 3E2EA 5C42B 1U25A 2FVSA 5AXMA 2GV1A 5CYJA 4EBCA 1RT7A 5J2QA 2P5VA 5CH7B 3CJ4A 4J9PA 2YNHA 3MM8B 3L7OA 5D4OA 4HTIA 1D3WA 1L5UA 4JI2F 2OKQA 3M32B 2GO8A 2VG7B 1TL1B 2G1DA 2R7OA 2RRAA 5JXSA 3O1LA 2VA3A 4BC9A 3P6YC 4HVZA 4ZPCA 2HWTA 4MIWA 1TQLA 3T5HA 5CA5A 2LXIA 7FDRA 3KLIB 2GC8A 5CXTA 3FSXA 2ZITA 2MB0B 3CC4S 1HWUA 4ZCKA 3WBZA 2AU0A 1ZZNA 2QSFA 1PILA 2KXNB 4TNOA 3IG1A 4M63A 1J2VA 2XMWA 3K5MA 5E7OB 3BM7A 1GT8A 1FRXA 1OO0B 1RT1B 5D77A 3U1NA 1IQTA 2B43A 2SXLA 1RQ0A 2PI5A 2B51A 1G3OA 2DB1A 3HVAA 3IA0A 2ZH6A 2HHTA 2KHCA 5EN1A 1OSCA 3EUNA 2MZRA 2P6SA 3FEZA 1VQOS 2MHEA 1LFWA 2XMVA 1N6QA 3MMBB 4ETXA 2OPQA 2ZD1B 3V5RA 5F8IA 2V9KA 2CPIA 3QJJA 1LW0B 3MEKA 5SZTA 2GMHA 1B64A 3CDAA 2MQNA 4PG6A 4ZP7A 3HP6A 1NAQA 3W7BA 2FHJD 1X7VA 4DF4A 3LANA 4XK8C 3QYYA 5HL7Q 1FNMA 3IR6B 4B3SF 3FEYB 2W7PA 1YI2S 2V8DA 1KVIA 3OFHA 1UJ5A 4TYBA 1LFPA 2AJQA 2YQ3A 1ROFA 2A1BA 2BM1A 5U47A 2CG4A 1TKZB 2F1FA 2I0XA 3RB6A 2ASJA 4RNNA 1E6YA 3CCES 4EUVA 1NJZA 1YG0A 4LMZA 4RW4A 2LA6A 2UV8A 1NK6A 4DSIA 3R5BA 4WYWA 4FS1A 2E1RA 3GWCA 2JLGA 2FJVA 3OTOF 4F8RA 3AAWB 3DMJB 1HPZA 2W4DA 3RRGA 3DOLA 1HNIA 3DDNA 4JI3F 4MK7A 1EETA 3TP2A 3C2PA 4ILRA 3N01A 5J1PA 3CCWA 2B3TB 1X0PA 1VC6A 2FC9A 3QZ7A 1UKUA 3R1LA 3TAMB 4G1PA 1JWWA 2XO7A 2FLNA 2DH7A 4DHVA 1HL6A 5KFHA 2R2RA 1YHQS 5C24B 4ID8A 3S1TA 3QO9B 1N33F 2L9DA 3MEDA 3AH6A 3PRDA