4TLQA

Crystal structure of c-terminal rna recognition motif of human elav type rna binding protein-3 at 2.5 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
EGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords CUGBP Elav-like family member 2
publication title Crystal structure of C-terminal RNA recognition motif of human ELAV type RNA binding protein-3 at 2.5 Angstrom resolution
rcsb
source organism Homo sapiens
total genus 22
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tlqA00
4WFAQ 3DXBA 1X4BA 1H2UX 4YUDA 2F9JA 1PO6A 5IFMA 2N3LA 4A8XA 3UCGA 4IUFA 3CD6S 2PEHA 4EGLA 3VAMA 3MI7X 1BY9A 1YWXA 1WHVA 1L3KA 2LA4A 1H6KX 3B4DA 3P3DA 3K0JA 3FEXB 1VQ9S 1U6FA 2LCWA 4F26A 5CYJA 1Q86T 2KRBA 5LSOA 3SXLA 1FO1A 5GAHU 3BS9A 2DGOA 1U1NA 2UP1A 2EVZA 4F25A 4C0OC 2N7CA 3VALA 2XNRA 4TU9A 2MKIA 3N9UC 1JJ4A 3CUNA 1X4DA 3VAFA 2RNEA 2CQGA 3OW2R 1X4CA 3G4SS 1WF2A 3S8SA 2FPHX 2MJNA 4C4WA 3TP2A 2HZCA 2L08A 1HD0A 4U67Q 3CCUS 1WI8A 2F9DA 1U1LA 2E44A 1WF1A 1WG4A 1HD1A 2BOPA 1R8HA 1D9AA 1DBDA 4CH1A 2DNHA 3UD4P 1N54B 1ZZNA 3G8SA 2K3KA 2KN4A 3NNAA 1X4AA 1U1PA 3Q2SC 2JRSA 2I2YA 2KXHA 2N3OA 2RRAA 2MKCA 2PE8A 3U1MA 3S6EA 5D77A 3VAKA 1QVFR 1X4EA 1PGZA 2XB2D 2MMYA 5GADU 3VAGA 1M90T 5EN1A 1QM9A 1N88A 3MURP 1Q82T 1D8ZA 2D9PA 3EGZA 2KXNB 3CXCR 2VOOA 1G2EA 3LQVA 2AYGA 2XS7A 4WFBQ 2HGLA 1VQ4S 1S79A 5LXRA 2DGTA 2E5GA 2CQ3A 2LKZA 2CQDA 2LXUA 2MHNA 2DISA 2YH0A 1OPIA 2MZRA 4OZ1A 1RK8A 2DH7A 1YJWS 5ITHA 1SJQA 1N52B 4YB1P 2GHPA 5DM6Q 1ZZFA 2EK1A 2CPJA 1HL6A 4LIRA 2G0CA 2EK6A 2CPHA 1YJNS 1FJEB 1WG5A 2FY1A 1X4HA 2AYEA 1WEZA 2HGNA 2MB0B 2D9OA 1U1OA 4V19X 5HL7Q 3G71S 2KG0A 2MJUA 1U1RA 2DNPA 3G8TA 2MY7A 2M8DB 3I56S 3CCQS 2MZTA 1VQPS 1K9MT 2DNKA 2E5JA 1FXLA 3J7YU 4WFNQ 3P6YC 2DNLA 2ZJQQ 3THPA 2MSSA 2LECA 1VQ7S 4TU7A 2JVRA 2RU3A 4QQBA 1WHYA 2DHXA 5GMKa 4BS2A 2NZ4A 2KU7A 2LMIA 4CIOA 2MGZB 3CCES 4WCEQ 2QA4S 3VAHA 2CPXA 3HI9A 2MKKA 1SJRA 3CULA 1KQSR 4WKRA 2CQ4A 2CQ0A 5DM7Q 2E5IA 3BEGB 1U6BA 2MZ1A 2L41A 1YIJS 2DH8A 2YKAA 3TO8A 1OWXA 1VQOS 3SMZA 4ED5A 2LYVA 2RS8A 3HHNB 3VAJA 1NJIT 2ADCA 2M9KA 2DNOA 2DNQA 3CF5Q 2U2FA 4P6QA 2KH9A 3UCUP 5BJRA 2SXLA 1XN9A 2DNNA 2OTLS 1M5OC 2CPYA 4J5OA 2HYIB 1NU4A 3NNHA 2XNQA 1YHQS 1K73T 4CH0S 2ADBA 1WEXA 1O0PA 3VF0B 1UAWA 3TYTA 1M5PC 5D78A 4RU2A 2RVJA 3MUMP 5LJ5Y 2DHGA 2XS2A 1A7GE 2X1FA 1JMTA 4UY8T 2MQPA 2MQMA 3IRWP 1CVJA 2LEAA 3MDFA 1VBXA 2DGSA 1KOOA 1Q81T 3CCLS 2ZJPQ 2CQIA 1FT8A 2RT3A 1A9NB 2KG1A 3BO3A 2J76E 1X5TA 2E5HA 2VOPA 3CCVS 2M2BA 2ERRA 2CQ2A 2DNGA 2LQ5A 3IWNC 3CCJS 2M52A 2V94A 3UWTA 1YJ9S 1VQKS 4LMZA 4Z2XA 5HO4A 2M7SA 5LSLA 3NNCA 3I55S 3R27A 2CPFA 1WTBA 2LXIA 4PRFA 3PIOQ 1KD1T 2M4MA 1VQMS 3UCZP 2X1BA 3DLLQ 2M70A 1VC0A 2KHCA 1VQ8S 2MKHA 2M0GB 2MY8A 4QU7A 5MLCV 3UE2A 3G96A 2OSRA 2XSFA 3MXHP 2MKJA 2X1AA 3ZZYA 4C7QA 2G1DA 1WF0A 2OTJS 3P49B 2JX2A 1WEYA 2KYXA 3CTRA 3CMAS 1U1MA 3H2UB 1F9FA 1VC5A 4OZ0A 3P5TL 3FEYB 2Q79A 2DB1A 2JVOA 2KFYA 3LPYA 4W90B 2RS2A 1X5OA 4IO9Q 1M1KT 2MQNA 3BO2A 1ZH5A 1R8PA 2DNZA 4UQTA 4Y00A 1WHWA 5IQQA 1FJCA 2DO0A 1VQNS 1UW4A 2MQLA 1NO8A 1VQ6S 1FJ7A 4WIIA 2HVZA 5FJ4A 1DZ5A 1X0FA 2MKSA 2LEBA 3CCRS 2DNRA 1X4FA 2D3OR 2QEXS 2DO4A 2U1AA 4YOEA 4IOAQ 2RRBA 1YI2S 3MUVP 2L9WA 3RW7A 5H1SV 3EX7B 2FHOB 2G4BA 1OO0B 5IM0B 3CCMS 1URNA 3SDEB 1OIAA 2CQCA 2AYBA 2M88A 3CCSS 4ZKAA 3V4MA 1M5KC 2KI2A 2XS5A 3Q2TC 3ULHA 5LJ3Y 2DHAA 2FC9A 1RKJA 4FXWA 4PKDB 1KOHA 4QU6A 1U2FA 3PIPQ 3BO4A 1SJ4P 2ZJRQ 2KT5A 2KM8C 3MD3A 1DHMA 2VONA 2HGMA 2CJKA 1DRZA 3L3CA 4M5DB 4PR6A 1SXLA 3CPWR 2DGVA 2QFJA 1FHTA 2AYMA 1VQLS 3MOJB 2DIVA 2KXFA 4LJMA 3MUTP 3CMES 2NLWA 2RQCA 2CPDA 4Y0FA 1YTYA 3H2VE 3J7ZT 3CC4S 1UP1A 2MSTA 3UD3P 5GVQA 2CPZA 3R1LA 1H2TZ 2B0GA 1B7FA 1U1QA 5CXTA 5DDOC 1WHXA 2MGZA 1SJ3P 4ERDA 3B4MA 4TU8A 1K8AT 1QVGR 1IQTA 2MQOA 1VC6A 3S01A 2OSQA 2X1GA 3US5A 5GAGU 1M5VC 1FNXH 3NS6A 2BZ2A 2M8HA 2OIHA 2DH9A 3U1LA 2CQBA 2CPIA 2CQPA 5IM0A 3RW6A 1WWHA 3CC2S 2F3JA 3SDEA 2MQQA 5DDRC 2GO9A 2DNMA 2DNYA 2A3JA 2O3DA 2RQ4A 1SJFA 2J0QD 2FC8A 5LXYA 1X5SA 2YWKA 3VAIA 1JJ2R 3EGNA 2DGUA 2AD9A 2K8GA 2KVIA 4FXVA 2KM8B 1W2BR 2DK2A 2MXYA 4W92B 2DGWA 4TLQA 3CC7S 5JVGQ 2VODA 3G9CA 2MYFA 1X4GA 1HA1A 4QPTA 1JJHA 1VBYA 2I38A 2DGQA 3THTA 5CA5A 2JWNA 4CQ1A 2MZSA 2CQ1A 3R1HA 1S72S 2LA6A 2KRRA 2YTCA 1X5PA 1N8RT 2J8AA 2YH1A 2RUGA 5DDQC 1VBZA 2DHSA 1Q7YT 2J0SD 4WF9Q 4F02A 1VQ5S 2DGXA 1P1TA 1AUDA 2N82B 3D2WA 1UFWA 2CQHA 2MZQA 3NMRA 3G6ES 1KC8T 2WBRA 1P27B 2CPEA 4IOCQ 1U1KA 1H2VZ 2MZJA 2OJ3A 1WELA 1YITS 5GAEU 3S7RA 3NS5A 2MPUA 3MD1A 1WI6A 5JVHQ 2DIUA 3ZZZA 5DETA 2DITA 5DDPC 3JB9k 1WG1A
chains in the Genus database with same CATH superfamily
1X4BA 1HFEL 4CTAB 3TA1A 4EGLA 3BF4A 4Y6IA 1BY9A 1X7VA 4C11B 1IVZA 3LA0A 4NCGB 3A3NB 3P3DA 3FEXB 4FYWB 2J9CA 4AUKA 2J9EA 1UWAA 2DGOA 2C3OA 3IR5B 2CAJA 4N8NA 2V68A 1Q1KA 4CO4A 3R97A 1ZAVA 1U8WA 2QA2A 2IRUA 1U1LA 1XERA 4ECTA 3LP2B 2E5LF 4GKJJ 3BR9A 3SCLE 2KN4A 1U1PA 1C1BB 4YB5A 2KXHA 4X62F 2N3OA 3BGUA 3EXCX 4U7CA 2ZZTA 3IG1A 3RB3A 1NCLA 4DV2J 1MROA 3BJYA 2HFZA 4KRWA 4Y65A 3IMQJ 4RO0A 3TJ9A 1RBLA 2K7KA 4ZP9A 3P4UB 2HQ3A 1F2HA 3HSZA 2CPHA 3RJMB 1WG5A 2WVCA 4M5DA 4J9LA 2HGNA 5AXNA 3JTOA 1U1RA 3I0SB 3J7YU 3GMGA 4GKKF 2DNLA 4ZN1A 5KFJA 2LECA 4IYQA 4X4QA 2RU3A 2F5GA 1IWAA 1C2PA 4F4AA 1G4CA 1PJ7A 4JI8F 2QA4S 4HACB 2BA9A 1SL1A 1SJRA 3ISZA 2IVYA 2AZ3A 1T3NA 1PKUA 4DPYA 5GADI 3AD7C 3B54A 1N48A 2GW8A 4X4SA 3SSRA 4PXEA 4WFYA 3KKFA 5DQIA 5HMZA 3PG9A 3W9JA 4NOHA 4H54A 1U02A 4ZPCA 5K8NA 2RMLA 4QIVA 5A8WA 4JI2J 1FFGB 4BCAA 5LJ5Y 5M2UA 1H7XA 2BKNA 5J1EA 1A7GE 3OXLA 4NX9A 1FI4A 3RBDA 3C15A 2BX6A 3DLHA 2CQIA 1ROFA 2J76E 5HBMB 1HBOB 3ENAA 2VOPA 4ID8A 1RAIB 3CT9A 1UVNA 5CABA 4JI1J 3G6YA 2V94A 4PXBA 3CEDA 2M7SA 2CPFA 1W2IA 3SV4A 3TQ1A 2M4MA 5K8PA 1D9FA 2M0GB 2BMBA 2ZHOA 5K14A 2L48A 3BPSP 2AJ0A 3D4JA 3DLEA 4O23A 2AT1B 2BQUA 4A8OA 2B51A 1LK7A 4W90B 2AP6A 1NSPA 4IO9Q 5KFZA 1BQMA 3EZUA 2DO0A 4M8LA 1UW4A 4RW4A 2LEBA 2G2OA 4F2RA 1NSAA 2NS1B 3MPUB 5C25A 3HJFA 5H1SV 1RT4A 3I0RA 1VK8A 3IG1B 3KLIB 4CLYA 3V4MA 2KI2A 1S57A 4G65A 4OI0A 3T6JA 4ZLPA 1PIEA 4ED1A 1WKKA 4O4GA 2H4WB 3KUGA 1IR1A 5HMYA 4WP3A 4ZVPB 1IQZA 3ELHA 4M5DB 1V3SA 3HFZB 5KFRA 3QRRA 3NGTA 1HWUA 4LRAA 3P5BP 1VJQA 2EW9A 4KJIA 4DR6F 2KJVA 3J7ZT 2HNYA 3BBCA 1OYEA 5DDOC 5A8RA 1R8BA 1QVGR 1IQTA 4AXJA 4W98A 1YG0A 1TV6B 2VD3A 3PRBA 4OHWA 2YWWA 3SDEA 1TP7A 4FVMA 4J90A 5AE1A 1KN6A 4ZCIA 3N79A 2H51B 4DJBA 4JYAJ 5IOLA 1RJJA 3CE8A 1OS5A 4K0KJ 4J9MA 4RU9A 1RWMB 3D1QA 4IFVA 3QT5A 5A8WB 4DG1A 2OFGX 2D74B 4YN3B 2OEJA 4MK7A 4NWBA 3DHWC 3H5UA 5J1EB 1V3ZA 1WELA 4DUZJ 1WI6A 5AJ3F 3E8OA 3FSYA 1YX2A 3C15B 3OBIA 1VOMA 2F9JA 5IFMA 4H4MA 3GZ7A 4A8XA 4IUFA 3WQPA 5GAGI 1OY6A 2BE7D 3IAM9 2Q43A 3NAHA 1U6FA 2LCWA 2A18A 3EXYA 3EVOA 4KB7A 5K8MA 2JC0A 4XPCA 4B3SF 3VALA 1WC1A 2GGPA 1JJ4A 1T05B 1WNEA 5K14B 2ZKUA 3DLEB 2HZCA 1FRXA 3W62A 2P6SA 1HD1A 3MM6A 4CH1A 2W9AA 1BQMB 2HWTA 3NCPA 3Q2SC 4A4JA 2XYHB 1NDCA 1RHJB 3S6EA 2XMJA 5CD4H 4PG5A 3AQPA 3DU5A 2LVWA 2V6AA 2PT0A 3WHIA 3K5MA 1RT4B 2DGTA 1WSVA 4DQIA 2R7TA 5EWGA 4C8NA 2EC0A 3W66A 1VIOA 3IRXB 4I6AA 1N52B 4USMA 1VIXA 3A8EA 4O4GB 4NA1A 2HVDA 1RSCA 1KKHA 4DFPA 2NREA 1DURA 5AXKA 1EQ0A 2DNPA 1JLGA 4NLPA 5F8IA 3NOGA 1RTHA 3P6YC 3K17A 4TYBA 4USKA 2PMWA 2W8LA 4TU7A 4DR1F 3H90A 2UUCJ 4USHA 5SZTA 2XSJA 2B4OA 3VAHA 3A3PB 2FVRA 3W5ZA 1M5HA 3A8KA 2ZVIA 2E5IA 2FYXA 3V6KA 1SUQA 1N6QA 2NCKL 3I9ZA 5LT5A 3PVXA 2H3EB 3UW1A 2M9KA 5K5MA 4L72B 3OHBA 5SUHA 3M9NB 5KFOA 4MKYA 1P9QC 1K0VA 2PO4A 4BC9A 1S1UB 4J7CA 4PABA 3TAQA 4UUWA 2H4YB 4CLLA 3KLHA 2OHDA 5LM7E 4GC6A 1JXVA 4IFVB 5EHHA 2XS2A 1JMTA 2F40A 2BJ7A 1VHIA 4DG1B 1I5OB 3IA0A 4Q0BA 1PJ5A 3BQ1A 1RTJB 2GZOA 2IJNA 2AW0A 3MM9A 1J2VA 1XQIA 2RQKA 2ZBQA 3UDCA 4WPAA 4DV1J 4ZVSB 3IWNC 4K4SA 4M5NA 1V5VA 4H4MB 1N33F 2UVRA 1LNQA 4PRFA 3M9MB 3MMAA 1RUSA 3NCQA 2WSFC 3DFEA 1VC0A 1F5BA 4Y3CA 2J8SA 1VDHA 2DRBA 3MXHP 4CYUA 4DZDA 5LMNJ 3CJ2A 4UOGA 1WF0A 5HMXA 4DR3J 2IM2A 1T3OA 2HFOA 1NSQA 2GGPB 5T7LB 1F2GA 2JC1A 3R5JB 1X5OA 2C2KB 3PFOA 3FQLA 3OLBA 4ZCMA 3TUPA 1T9YA 3K59A 1FJCA 2H5JB 5CYMA 1NRKA 3DRPA 3MM6B 3TVYA 4C3LA 1LW0B 5DQGA 1YI2S 2P2CB 1Y4ZB 4JI5J 3KWMA 2D41A 1SB6A 4NXNF 2QX0A 3ULHA 2VIHA 1TL7B 2RSQA 4P52A 2ZH5A 4ECWA 2A6OA 4I4BA 2ILYA 3ZO7A 1O8BA 4MIWA 4KBIA 2KT5A 2KM8C 4Q45A 4KKOA 2VPYB 4KH0B 2DGVA 1VQLS 2JZ5A 2R8KA 1CULA 3CMES 2RQCA 2CDQA 4Q44A 3PW4A 1JB0C 1JLGB 1LEOA 2MQ8A 1RTHB 1N4LA 2R8IA 5I4MA 1NNDA 2ZVSA 3OL7A 4KC5A 4I7FA 3M7VA 2XSJB 1HI0P 3RU0A 2MQQA 1Q53A 1YSJA 2QTWA 3HHLC 4NASA 3NGKA 3VHQA 1BHNA 5D4PA 3D1HA 1SUQB 4NYOA 1W2BR 2DGWA 3TANA 1SC4B 3T9ZA 1S1VA 2XLJA 1X4GA 4OX7A 1RAAB 3GWCA 1S5ZA 4YEAA 5KFHA 4Y28C 2VICA 3HLUA 4G6VB 2WRMA 2C3PA 3LGNA 3A3OB 2IRXA 4DV6J 2MZQA 1UVIA 2IJFA 3KLHB 2M5YA 5HMWA 5HROA 4NLXA 3MM9B 4OFZA 4ECRA 4IRCA 3BN7A 4OJ3A 3DMJA 4K2JA 1R8AA 3MMAB 4F25A 3FKBA 3D0GE 3DHXA 1N0UA 2W4CA 2CDRB 4OYMA 1SIWB 3ZTPA 2DR8A 4CYUB 2FPHX 3AT1B 1HD0A 1LWFA 1XMQF 3RZAA 2F9DA 2E44A 4DLGA 4CLZA 1NM2A 1I94J 3J7Z5 2W2MP 4W4MA 4KAIA 5CYMB 1I51B 3OLAA 2QMXA 1X60A 3DRPB 3CJ0A 1H72C 1FKPA 5GADU 2ZOMA 2VG5B 3PZPA 1LWEA 4LSNA 3ILIA 4O0IA 1S79A 3IP0A 1TKTB 4B9MA 4OX9F 2AEJA 2XMTA 2DH7A 2XO6A 2EK1A 3D9BA 2HVEA 1WEZA 1GTHA 3H5SA 3AOBA 2CJXB 1JLQA 2HPUA 3WBZA 4LQ9A 3CCQS 2DKOB 4K4XA 1CULB 4P9SA 4NZ6A 3R8YA 1SC3B 5GMKa 2G1HA 1NB2A 2LMIA 3CCES 2OPSA 1KWMA 1TVRA 3C19A 2J9DE 3SQGA 4O3OA 3FBEA 4I7FB 3BN4A 4WJBA 1U6BA 3JQKA 1IKYA 4ED6A 1F1BB 4IO1A 1H73A 1VQOS 4P7VA 1N56A 3S1TA 4P2XA 2CJQA 3VQTA 1TL1B 1HNWJ 2DNQA 2PFFB 2KH9A 1U47A 1S1VB 1DFDA 2CG8A 2QZ8A 1NK9A 3QFHA 3MZIA 1EAYC 5I3QA 2AEMA 3VF0B 4TQSA 3MUMP 5E5NA 2H48B 5J2PB 4PAAA 4EZ6A 4KT0C 3ET6A 3FC9A 3ZXWA 3VCDA 5HROB 1FT8A 2LDIA 4MIAA 2CQ2A 2BDPA 4A47A 2UVWA 2IA6A 2VQFJ 4RBVA 1Y0HA 3B8HA 4OMFG 1S4EA 3KYLA 3QAEA 3MPWA 3JAMU 3BSCA 3DMJB 3Q8QB 2HHHJ 1NLKL 3ZFVA 1T8EA 2YVSA 2YWHA 1WEYA 1RQ0A 1NK4A 4CWBA 4C0BA 2WAQD 5F9NA 1GTEA 4R8UA 4FDFA 3N0VA 4MKAA 4EK2A 1AFIA 5FJ4A 1XC9A 2PFDA 2VHGA 4NLOA 2Z58B 4YOEA 4WU3A 3OT9A 4CP5A 3NS7B 1FKPB 1OO0B 1HNIA 3DOLA 5IC4B 4I6WA 4EUVA 1LWEB 1YDLA 4LSNB 4JI6F 4CRJA 2CWKA 3EICA 2AU0A 2YNHA 4LF8J 2ZH7A 2V8HA 4L75A 5F0UA 1KOHA 3QAUA 3ZZRA 1YVFA 4FYVB 3OV7A 2VONA 1UA0A 5KFQA 2CJKA 1FDNA 4ZPBA 2I6WA 1JLFB 4C8ZA 2AV5A 1JLQB 2CVEA 3T1HF 1REVB 4B3OA 4DR2F 3OSPA 5CXTA 4ZPTR 4ENOA 1AFJA 4IG0A 2EBEA 2HQDA 5GAGU 1RHUB 3MMBA 4I6YA 2OPSB 1TVRB 1JNRB 2JSXA 3HFVA 2BJDA 3FSIA 2ASYA 3SQGB 2FJXA 3G6XA 3KOAA 3EMTA 2Z30B 4OYOA 1XMOF 4NL5A 4K50A 1YGYA 3DCAA 2BV3A 3FRZA 2MXYA 2YQ3A 2B9XA 1XNRF 1T94A 1XWLA 3THTA 2C2NA 3LP0B 1FNOA 4X66F 3ZZOA 1N8RT 3W7BA 3G8QA 4KH1B 1HWIA 2J0SD 4OZLA 4HH1A 1TAQA 1NJXA 3NMRA 4B9VA 1F6TA 2WBRA 2CPEA 4OHXA 3HSDA 4LF1A 1NH7A 4FNIA 3ET6B 5HQ8A 4QR0A 5DDPC 4X4TA 5IV4A 2BUNA 4M63A 2CFXA 2QSFA 4ANDA 4LRCA 5G4DA 1K44A 4DI6A 3GFXA 4QWAA 1VI7A 1MN7A 1SKWA 3MAQA 4USUA 5HI7A 2HWIA 2HQGA 3GG1A 3LW5C 5KFAA 3N9UC 1FCAA 3W5XA 4YP3A 3MAAA 4PG7A 5H9FJ 2MJNA 3KJQB 1S0NA 1UA1A 4P71A 3M2UA 1Q78A 4NA2A 1FJGJ 2D69A 1RCOB 2JRSA 4JBCA 1OSDA 3VAKA 3CGIA 4LREA 2JJ4D 4MKBA 2BE2A 1S1TB 3OL6A 2MLZA 5I3UA 3CNQP 2HHSA 3DOLB 2E5GA 1I1GA 2L9DA 4FVCA 1AB8A 1S9EA 2IVMA 5KAKA 2HS0A 4HTJA 2GHPA 3JSRA 1PBAA 2ILZA 3H5YA 4NI2A 4Y2KA 3PW7A 5A76A 2M3DA 5G0RB 4OJ1A 3QWUA 2KG0A 3GB0A 4DL5A 1T95A 2M8DB 2F8EX 1FXLA 3POTA 2ZJQQ 3THPA 1NZ8A 1KONA 1JLBA 1F5AA 4LF6J 3OTBA 3ILOA 3KHHA 1FRHA 1JLEA 4CT8A 2Y0SD 3MMBB 1UFKA 1F5CA 3QLHB 1AYEA 1IN0A 2YKAA 5E3QA 2ZH8A 4IR9A 2GFFA 4X4UA 1GFWB 4KGKA 1XEZA 1CQNA 3HK2A 3W65A 2CPYA 2HRTA 4JV5F 4NLQA 1N5QA 3M32B 2RQMA 4HVZA 2ZOFA 1UAWA 4RL1A 3T19A 3H0PA 4ED0A 3OTEA 4IR1A 1S9FA 4NPOA 2MQMA 3FCVA 3NEKA 1C0UA 4H4KC 4DR5F 2I1RA 2KG1A 1S7HA 4QR1A 5L9NA 4JV1A 4FYYB 2K2PA 4CNZA 1MWYA 1LW2B 5AE2A 1KD1T 4XIUA 3WIVA 4DX7A 1VRTA 1U45A 2DEIA 2KYXA 3BBFA 5IWAF 3FEYB 1IKWB 2DB1A 3EDRB 1SL2A 2EFVA 3BO2A 4RWXA 4WKYA 3M30A 1YJUA 3T41A 3FGVA 4HL9A 4PWDA 3ZNJ1 3C66A 3M2UB 1S10A 2ROGA 2YKMA 1R6VA 1VS3A 4ZN3A 2V2QA 1TAUA 3F41A 1FWPA 2CQCA 4ECVA 5I3UB 1X31C 4QJVA 4QIGA 3GV8B 2WB1D 1RU2A 4QIFA 3TZYA 4ECXA 1RWXB 3PKMA 3VVUA 3RBZA 5HSPA 3I5CA 1D9DA 4DMZA 1H0HB 3M6UA 3ADAC 1GAOA 4NI2B 2HGMA 2IBKA 4AXIA 2V0NA 3CPWR 1CEZA 2GMHA 1O6XA 5ETSA 3UQSA 1K0TA 2KJWA 3AJ2A 3POTB 1CLFA 1DAXA 2XI3A 2YKQA 1K8AT 5IC6B 1JLBB 3C6TB 2V4RA 3ISND 3M6VA 1MN9A 3FZ2A 2YNGB 4BWMA 1TUVA 4S0MA 3KLFB 2APOA 5KFGA 1UFLA 3DU6A 4CLFA 2E5LJ 2UUAJ 2BRKA 2ZDPA 4CZCA 1HARA 1Q5YA 4AE5A 2IA0A 2V9WA 4X62J 3MCOA 2VODA 1HA1A 4QPTA 2DGQA 3FUYA 4PWUA 4QWDA 4ER8A 2JWNA 2K06A 4LF4F 1RE1B 1X5PA 2YH1A 1OJ4A 4U8VA 4UTGA 3MR3A 4R25A 3BH7B 3DGPA 2ASJA 2N82B 3DYAA 3R5AA 4EO8A 4R5PB 1YITS 4OIXA 3JSYA 3QFWA 1TKZA 5KT6A 4IQMA 2MLYA 1PILA 4GKKJ 2UP1A 2W8KA 5D0HA 2ZBIA 4TU9A 3BKUA 4OYPA 4JI8J 2GVZA 1WKLA 2QE5A 2R8JA 4J9QA 4RUAA 1D9AA 3CO0P 3M30B 4GMKA 2XHWA 4PWDB 2E7VA 2QLXA 2DY1A 3ZTQA 1B0VA 1PGZA 2XB2D 3HKZD 4HEA9 1Q82T 5DG7A 4UQGA 5HP1B 3WDOA 2MHEA 3LQVA 2HGLA 1Q0NA 1WC4A 4ZLNA 1TFWA 3M1VA 5IXUA 4CLPA 3KJFB 2B9EA 3LOUA 3QT7A 1BC6A 3EGWB 1ZPWX 5DM6Q 3N5BA 2WVEA 2UUCF 2EK6A 4MKVA 2HNDA 4A48A 5BXIA 3THVA 2AYEA 3HCXA 2RIJA 5B0DA 2KFNA 1Y00A 2XLKA 4G1PA 3D66A 2MY7A 2DY9A 3HSJA 3ZZPA 8RUCA 2Z2ZA 3R5DA 2XYGB 2HK3A 2XZTB 3BSNA 4A8SA 2VA3A 2PMHA 2FJEB 3OXGA 1NJYA 2XGPA 3CULA 1UZDA 3JQMA 3UDLA 3MOZA 2MZ1A 4ECZA 3GU0A 1RTDA 3O8WA 3AAWB 3JTNA 4HYKA 5D0RA 1C4AA 1U49A 2U2FA 1IM6A 1IKVA 4ZVEA 2SXLA 4J9SA 2DNNA 3N5FA 3HPOA 4TY9A 4K4YA 3NNHA 1K73T 4LVOP 4WU2A 2R8HA 1UEUA 2J5AA 1KQKA 5AXLA 1FA0A 2IM3A 1RBOB 4RUCA 1QAYA 3ONQA 2RDDA 3TVZA 5LMUJ 1VCTA 1DTTA 2JEFA 2E5HA 3CCVS 2OH2A 2YQ0A 2R7XA 2VFVA 3K7RA 3IBWA 1QUVA 4IRDA 1TMMA 1B70B 1VISA 2HHWA 2VG6B 4WXOA 3NGRA 3UE2A 3IGNA 4OJHA 2A0FB 2L9NA 1B3TA 1TL4A 2IBOA 1PYTA 1R31A 1VC5A 4JP8A 2GVZB 4KGVB 2RS2A 1ZH5A 4UQTA 1S6QA 1WHWA 4I2PA 4PQUA 4DSLA 5B0EA 3A8JA 1VQ6S 3W60A 2XI2A 1DZ5A 1CC8A 5A0YB 1T9TA 1H74A 2ACYA 5CHCB 2UU9F 2N4DA 3BPDA 1KVIA 5D4NA 4M5GA 2J6UA 1U2RA 2RILA 4DR4F 1RA6A 1XR7A 1HBNA 4EYHB 3WIUA 4QW8A 3M1VB 1ACMB 2EFPA 1ZM4A 3OFFA 5AJ3J 4DSJA 4P73A 1QLNA 3GSDA 3MUTP 1YJRA 4ZVOB 4OZ2A 3I5BA 2NYHA 1WDTA 2UZAA 1XBWA 4J9PA 1CQMA 4UW2A 2GV1A 4E98A 1F3VA 1VC6A 4B3SJ 2VB6A 3US5A 5KFDA 1FNXH 3W64A 4DL2A 1KFDA 2D3UA 3DRYA 4RNFA 3CB4A 2UUTA 3N6LA 1U0HB 2W1BA 5LXYA 4NLVA 4X64F 3H98A 3FCHA 2K8GA 1R3NA 4F4ZA 1RTDB 2MYFA 1CJTA 4YR0A 2I38A 3OQ2A 2MZSA 1GMWA 1SH2A 2KRRA 1IKVB 3MR5A 5A6PA 2RUGA 2Z4PA 5DDQC 3IBFB 3OR2A 5HLFA 4CLWA 4WF9Q 3GFYA 3QO9B 2ATLA 4ZVQB 4OI1A 3G6ES 4NZ7A 2H54B 4GO7X 1YK9A 1HMVA 4JV2A 5GAEU 2AF6A 5B08A 3BSOA 1FVSA 1DTTB 1WOSA 1NHVA 3UCGA 2LQ8A 2XCPA 1VJWA 4X4NA 2BQ3A 1VLOA 1SV5B 1I94F 5CYJA 1QE1A 4PPZA 2FB0A 1U1NA 4U7UK 5B7WA 2V8GA 3AOCA 1S97A 4ZCKA 2CQGA 2GJFA 5D0EA 5J1NA 5EWEA 5THWA 2KTQA 1R89A 1S6QB 4CCHA 4I2PB 1FX2A 2AJ1A 2W2OP 1FWLA 4MTPA 2ZUGA 4X4RA 2LKZA 4U6PA 3BBBA 3GSIA 2NXEA 3O2IA 2ASDA 2MZRA 4OZ1A 1RK8A 4GVBB 5DLFA 1HBNB 1PJ6A 2VJUA 2VPWB 4YS2A 4DV0F 4EO6A 1YJNS 2VG7A 2VC0A 3SCKE 1IBKJ 2AHOB 1K9MT 4USJC 1UZHA 1N33J 1YZ6A 1RAGB 5EUHA 2C3UA 2NXJA 1R0AB 2UV8A 2VDHA 3D3CJ 2KO1A 4WCEQ 1RWPB 1R0BG 3CDEA 4DQQA 2ZH4A 1KQSR 4WKRA 3ICLA 2VUGA 2L41A 3OFEA 1LQ9A 3HZEA 3T6BA 1CPZA 3VAJA 2QYCA 2AX1A 4LFBF 2FVSA 3CSKA 2CYYA 5T14A 3MEDA 3GIJA 2HYIB 2W2NP 4OV1A 3NP5A 1JK9B 2Z8QA 1U25A 5JUMA 4NXNJ 4KE5A 2XO7A 1RAHB 1RTIA 2W2PP 3DLGA 5HLFB 4AL5A 1HI1A 3MDFA 2PD1A 3ILLA 2HHVA 4TQRA 1HMVB 1A9NB 3BO3A 4I2QA 1HNZJ 2GQCA 4DN9A 1Q4RA 1VK3A 3GYXB 4HDHA 2PA3A 4LMZA 1KDNA 3KK3B 5AT1B 1WTBA 3SBMA 1HNVA 4C97A 5MLCV 1EETB 1QE1B 4F04B 4OI6A 2ALZA 2JX2A 4URGA 1MU2A 2KFYA 2JVOA 3Q89A 2D3O1 1R8PA 1RT5A 2AJ2A 2QL5B 3EUNA 2P9CA 3KLGB 2Y0BB 1WUUA 4NXMJ 2HVZA 1X0FA 2X7IA 1N36F 1JWWA 2D3OR 4LF8F 4DV3F 3GCWP 2LU2A 3IGVA 5B0BA 3V5RA 2L9WA 2M88A 4FN5A 2E1PA 2CKWA 4ILRA 3M8QA 3AB4B 2FC9A 2OKQA 4FXWA 1QJHA 2FQQB 2GCFA 3MM5B 1BXNA 3Q8SB 4A8QA 2AX0A 2Y8YA 2V9KA 1VQSA 3M2VB 1HQ2A 1UJ4A 5ETTA 4PR6A 4RUHA 2RU9A 3QZ7A 3CWJA 2DIVA 1UVKA 2Z57B 5ETKA 2W2QP 2HHUA 1X0PA 4PEOA 4ELVA 1WC6A 4YDDB 4ANEA 3TARA 2ZH2A 3ZTOA 3FFIB 3GV5B 2UV8G 1I3OB 3OFHA 3Q8UA 3NS6A 3D54A 1N5YA 1UPMB 1YJ7A 1EKRA 4L76A 2KKHA 1QAXA 4NRUA 3UD5A 1XMQJ 5KG1A 4C8YA 2DNYA 2XMVA 2FC8A 1JJ2R 2RKIA 4M5KA 2W4PA 4DU7A 4MT1A 4RW8A 2FDNA 2HQFA 2CQ1A 1HPZA 2I5JA 4L3KA 3HT0A 1APSA 3MEDB 4P10A 2B8PA 1P1TA 3P96A 1FDDA 4J91A 1RTIB 3DLGB 3KK2A 2JL9A 1TKDA 4F36A 1HWKA 4QPXA 3W2VB 3HX9A 2K7JA 1KHWA 3K5NA 4CLTA 2HQIA 4ETXA 4I2QB 5KG4A 2HFSA 3M8SA 2P6TA 4BBYA 4K4ZA 2FUG9 2QO3A 4JOUA 4YY3J 3K0JA 2ZZNA 1MMLA 4AL6A 4EBCA 5KT3A 3NGUA 2YKOA 2EVZA 1FKAF 1NPKA 4LR7A 1HNVB 4Z37A 4ZITA 1Q8BA 2CZ4A 1RA7A 2GO8A 2HRYA 3CMQA 3J80U 1RT5B 2YPZA 2DCUB 4LF5F 3UO0A 2KB2A 3OVAA 3PRDA 2PE8A 3SI8A 3U1MA 2V4JA 3DDIA 2R7WA 4R0JA 2KXNB 3DNCA 4WFBQ 4OYZA 4TVAB 1S49A 4FKXA 4C11A 4NCGA 2JNJA 3M8QB 4WK1A 1CJKA 2FZKB 4XPEA 2E66A 1JQGA 2GVDB 1VHFA 4IDKB 4WIQA 2CPJA 2C22A 1HL6A 3VWSA 1RT1B 5JXSA 4OZNA 1KSPA 3AFGA 4K4VA 2QGFB 4N8OA 1K1QA 3GR0A 1RHQB 1C1BA 1WHYA 3A1YG 2CPXA 2QLJB 2DEJA 3HULA 1S59A 4F3OA 3CIMA 1GNKA 1N5YB 4M5JA 3QBCA 5E3PA 6FD1A 4I1TA 2J6SA 1VGYA 3TWZA 1TK5A 3IWLA 1F9HA 4DV5F 4LBIA 1Y5IB 4XAKA 2YWFA 1S6PB 1ICEB 4FYDA 2RKIB 1C1CB 4K8RA 2OTLS 4UT4A 3K8VA 3R7NB 1HPZB 1SI9A 2AJ4A 4ZPWR 5E7OB 1SQEA 2V2ZA 3TYTA 1ZAWA 4JI6J 3CDWA 1JXEA 1CSJA 2X1FA 2MQPA 1KTVA 4NLTA 3I5AA 3V2UC 3IS9B 2QMWA 3I32A 4Y2MA 2AJQA 1Q79A 3GQCA 3KK2B 1Q81T 2ZJPQ 2XY7A 4YFUA 4HACA 1U7LA 4CNYA 4CLSA 1KLMA 3FZBA 4ILLA 4KSEB 4FF1A 3PEHA 3ITHA 1GT8A 2HURA 4PPDA 2YX4A 2Q1LA 2LXIA 2WW8A 3BQ0A 4DR2J 1EARA 2V34A 4DFJA 2KHCA 1IKXA 2OSRA 2FGOA 2XSFA 4LFCF 4ZS6A 3LALA 1MSWD 4WYWA 1U1MA 1HYSA 5I3PA 1S1WA 3QJPA 4M95A 1XMOJ 5LSRA 1P6TA 3I4PA 2ZEJA 2R7QA 2MKSA 1QAIA 4XDCA 4Y2IA 5CYQA 2EG2A 3RYLA 3J80Y 2E1AA 1XNRJ 2YXLA 3HVAA 2RRBA 4OHZA 3UFCX 3W3SA 1KNZA 5HBMA 1HBOA 4X66J 3T5KA 2AYBA 1BGXT 1U8SA 2RRNA 2XS5A 5J1PA 5LJ3Y 3CJ3A 4ETZA 4USWA 4MFBA 3M2RA 2Y1IA 1CJKB 3CD5A 5DG8A 5HQMA 3CJ5A 3IC1A 3PIPQ 3V4IA 5IQ6A 5HQLA 3DC2A 4I64A 1KFSA 2YY3A 3WC0A 2AYMA 4FNHA 3MEKA 2BYCA 1HHQA 2MSTA 2V2KA 1U1QA 2UUAF 4ERDA 1FRMA 4TU8A 1NH8A 4OYXA 3PX4A 1TFYA 2M8HA 3HHKA 2IAJA 2FY8A 2LQBA 2EI5A 3KLIA 3JYTB 3ZNUA 4DCPB 5EX0A 3IAS9 2ZITA 2RF2A 1HWLA 4O3NA 2A3JA 4WK3A 4X2BA 2OLWA 5L1KA 1RLCL 3DLKA 3NY0A 1SKRA 3WX8A 1X9SA 3VQSA 5IT9Y 3VGTA 2B43A 4LSLA 3RAMA 2RDIA 4EI2A 1QDUB 3AD8C 2EFGA 1RT2A 2LEPA 3ZZUA 1JXLA 2J9DA 3CCTA 3KLVA 2R2TA 5KFTA 1B64A 3QQCD 1KC8T 4KQZA 5AE3A 3GR1A 2OJ3A 1KBRA 3M05A 4DPUA 3DRSB 1SKSA 1TV6A 2RE1A 2R7UA 3M8PB 2CJBA 1KLMB 4ZJOA 1Q5VA 3VAMA 2NQPA 3AOAA 3ITHB 4ZCLA 3BM7A 1V9OA 1ZM9A 1VYAA 4F26A 4FS2A 2HIQA 3SXLA 4CO3A 4DBQA 3BYRA 2V67A 2F4FA 1G7CB 2J7KA 3H59A 2FHKA 5LOQA 4WP9A 2BBEA 1IKXB 1TR0A 2HRUA 5DS7A 1WF2A 3TUZC 4F4YA 3TP2A 3Q23A 3CCUS 1HYSB 1LWXA 2KT2A 1UVMA 4BC7A 1S1WB 2UUWA 5IV3A 2C2OB 3GPAA 2VH7A 3G82A 1FEHA 5CYQB 1R43A 3VAGA 2QIFA 5KFMA 2H1YA 1BQNA 2VBZA 2XS7A 4JV5J 5DGBA 2IY5B 3D6FB 1YBAA 3JSMA 1MWQA 1REGX 2XEXA 2FHJA 4MFBB 3M2RB 3W9IA 4N47A 4DR5J 1T05A 5HATA 3V4IB 3R3TA 5M2PA 1IXKA 1EJ7L 2PI5A 3ILJA 4ZIWA 4ZHRB 2E5JA 3EM1A 1U09A 4WFNQ 2OFHX 1FVQA 3VGVA 2OD4A 1S48A 2OEKA 2XZDB 3HHLB 3ENQA 3QSIA 3DXSX 1DQAA 1HWJA 3OR1B 3TOQA 5IWAJ 4NLSA 2IAJB 2DTJA 2A10A 2NPIA 4MYTA 2RF2B 3MM7A 5H9FK 3IRXA 2ADCA 5D4OA 3DLKB 5DZ6A 5LMUF 3TA0A 2Z0GA 1CJVB 4LSLB 3NBPA 1TK8A 4WBFA 1U48A 4RU2A 3LWMA 3NOCA 5HN0A 1RT2B 4Q5VA 3PHEA 3MPYA 3EYZA 3A4TA 4AYBD 3RAXA 2ABYA 3K89A 2XYPB 3EPGA 5D8HB 2VQEJ 2M2BA 4ECYA 3MGJA 3CCJS 1P9YA 5KG0A 2GMJA 1VQKS 5KFYA 2ROPA 4LF2A 2VDIA 3I55S 2I8EA 2EC2A 4K4WA 1S99A 2R2UA 3UCZP 4DPWA 1FERA 1VQ8S 4IG3A 2ZD1A 4ZJQA 1FTRA 1Y9OA 4RJVA 2Q79A 3LPYA 1ZA1B 5ETMA 1S1UA 3RR8A 4Y00A 4YHHF 2P9EA 5EWFA 5FDLA 1X9MA 2YX1A 3G86A 1WD6A 5DLGA 2NZCA 4RKUC 4XTTA 2R42A 1RTJA 3G82B 1IR0A 2F4VF 1D8YA 2G4BA 4LF4J 1OQ6A 1BQNB 3J7AN 3AXKA 2V69A 2B7BB 4ZP8A 1SVDA 5F3ZA 1KQGB 3OTOF 4DZ6A 3JSMB 4LSZB 5KFXA 2HEKA 4U8YA 1S9GB 4QU6A 1WORA 3KNGA 1U2FA 3MM8B 1N0VC 4OZ5A 2AGOA 1V5IB 2NSBA 4QOTA 5T7LA 1Q16B 4K59A 3MTJA 1YRXA 3J7YI 2K1RA 3QYYA 2B0GA 3CD7A 1RADB 1P8GA 4KYZA 2HNZB 2P8IA 4LF9J 1LW0A 2MQOA 3MEGA 2ACMA 2X1GA 4YQWA 2IPOB 5DJBA 1SL0A 3KG1A 3IR7B 5C24B 2WVFA 3N01A 2DJWA 1YBTA 4N77A 2GO9A 2RQ4A 1TL7A 3MR6A 1Z2ZA 4CO5A 1FTCA 2DK2A 3MMJA 2HQCA 3MM7B 4F0KA 2N4CA 1V3RA 1T9VA 4D3HA 4CQ1A 2UXCF 4AD6A 1S1XA 2DCLA 3F0NA 5E2QA 3R1HA 1KHVA 3D1OA 2LA6A 1RGVA 3FRYA 3Q83A 3ETMA 4RW9A 5L1LA 3NBPB 4DUYF 3DM2A 1UFWA 2CQHA 5A2QU 4C8KA 1Z1ZA 5ETRA 3WC2A 4V19J 3RRGA 2B7CB 3Q0AA 3TRGA 5CD4A 4QCLA 4DR7F 2DIUA 1NBEB 2FLLA 1KRPA 2EXUA 3TX0A 1RU1A 1WOPA 3MI7X 3QZ8A 2QA1A 5CQGA 3W63A 4JI4F 2W9CA 1XMBA 4ES2A 3BS9A 2G9OA 3MCMA 4C0OC 3GYNA 4IG3B 3OVSA 2BE9B 2ZD1B 3CUNA 1IBLF 1X4DA 3DOMB 3CJKA 3W2WA 2H9ZA 3G4SS 3FVYA 1FDAA 2HHQA 4ATNA 2CNKB 4UUXA 5FDLB 4RW7A 3KHGA 2DR6A 2I2YA 2FD2A 3BB5A 5D77A 2CJYB 4IOBA 4NCBA 4P2FA 1M90T 3LGMA 2BJ3A 2A6MA 1NDPA 2DR9A 4CO1A 4OHVA 4Q8FA 5KFPA 2XMAA 1IBKF 4ED2A 3M6WA 4B3RF 3UN5A 5ADZA 3BGOP 3BZQA 4TXSA 5B0CA 3BKFA 2JLEA 1RXOB 3FK4A 2JLFA 1CBKA 1NK0A 2G0CA 5HK4A 4CLKA 3I96A 1S0OA 1Y10A 2OP5A 5IT4A 5GMDA 2HSEB 1L5UA 2F8HA 3G8TA 1MW7A 2WTFA 2IVFB 4C9DA 2HLTA 1HQEB 2JVRA 1N5TA 2K1RB 1DLOB 1LKZA 5KG3A 1FKOA 4WTYA 3MEGB 2VG5A 3R2DJ 4QIEA 1LWCB 2YKPA 1TKTA 4ECUA 3TO8A 5KFVA 1OWXA 3QIDA 2ZNYA 4OI4A 3D68A 3TZWA 3B82A 3TA2A 3BGLA 1SJ1A 4NZ0A 2G2ZA 4ICLA 2V8PA 2HBRB 4QZVB 2UU9J 1S1XB 1HNZF 3LUYA 3FDSA 2C3YA 1UWBA 1IBMF 1A0OB 4RW9B 4DR4J 3CCWA 3GILA 4UY8T 5E33A 3DM2B 1ZYQA 2Q66A 1VBXA 3NAIA 2Z2YB 4F4WA 2BANA 2OMLA 4UF4A 5A2QY 2HZAA 2GNKA 2OGUA 2CWXA 3OD2A 1IJEB 4PQAA 3R2CJ 4KPYA 1RT3A 3FBCA 2LFVA 1BWVA 2WVBA 2R8GA 3K5PA 2MY8A 2W9CB 4NXMF 3PJXA 3GV7B 1TL1A 2H65B 2X1AA 2KHDA 3ZZYA 4DSKA 3CTRA 5F9LA 4OL8A 2VF3A 4DDFA 4QWEA 4J9UE 3CJKB 3W2WB 2DR5A 4ZIVA 1VRUB 2C2DA 2FLOA 5IQQA 1GEHA 5J2PA 1OQ3A 3OL9A 2FVPA 4X64J 4HLBA 4RW7B 3PFEA 2JFKA 1NZAA 3MUVP 3RBXA 1WKJA 1AXQA 1ZA2B 3QSYB 4DCOB 2DHAA 4OYBA 4E2FB 1S12A 2HK2A 1TUGB 3HFKA 3BO4A 1UTAA 3R7SB 4E8UA 5CH7B 3PNIA 1DRZA 5D3GB 3FNNA 4A8YA 4RNOA 5KFCA 2NLWA 2B6AB 2CPDA 3U7JA 1UP1A 3OJUA 3ETOA 3PRVA 1S7IA 2UXDF 3TAMB 3HZGA 1Q95G 3CDUA 3SV3A 2BZ2A 2CPIA 1FKOB 1FRKA 1NJWA 3AODA 4LFAF 3BGRB 2QC3A 4NLYA 1LXNA 4UOCA 2OEMA 1ZAXA 4FXVA 3M6XA 4TN2A 4D3GA 3CC7S 4GO5X 1VBYA 5GMEA 4ICLB 2E1MC 2W7AA 3KXDA 4XDDA 4K4UA 1JLFA 1PBUA 3OSNA 1Q7YT 4UZCA 1VMBA 2NXNA 2DGXA 3VZHA 3AHPA 1REVA 2POKA 3CDBA 4YY3F 1UWBB 4KFBB 5D0GA 2R7RA 1HR0F 4H4OB 4AQYF 1H3DA 2QRRA 3JQJA 4ZP7A 4DV0J 3BGFA 4F2SA 1U2CA 2BANB 2NXCA 2Q6CA 2ZDOA 2ZBPA 5CCLA 1H6KX 5KOWA 3EZ5A 1U26A 1RT3B 3CJ8A 3QATA 1W25A 2QLBB 4Y2AA 3DOKA 1HW8A 3PACA 2ZNZA 3LP0A 2VBWA 4WFXA 2QYGA 4ZPAA 4TY8B 3TR5A 2QA4G 2E9TA 2DNHA 1N54B 1WJ9A 3G8SA 1X4AA 1WC0A 3IN5A 1FE0A 5K9FA 1YRUA 3SQOP 4ZLLA 4LFBJ 2O67A 4X4VA 3UR0A 3FJ2A 1R27B 4IQXA 1KS2A 2A2CA 2LXUA 4O44A 4OLOA 1SJQA 1UEKA 2BVZA 1J5EF 3C2PA 2I0XA 3O5TB 1Q8KA 2ZM6J 1FJEB 2EKNA 1RHRB 4F50A 3TW0A 2AQ4A 1N32F 1GMUA 2JLGA 1RHMB 4EFAC 3QGHA 4BS2A 3PX6A 2B9YA 4J9KA 2NSCA 4F0MA 4NLDA 3RGIA 3HI9A 1S1TA 3CVKA 3V81B 5D15A 3NWRA 1URRA 2D3ZA 3FBBA 1Y11A 1GX6A 3Q22A 1R6YA 1NJIT 2R9LA 1N36J 4C8OA 5IS2A 4ZP6A 4DV3J 1NKBA 3NXZA 2HS4A 3EDQB 2EWHA 1M5OC 5G0RA 3T1YF 2F8MA 5EDWA 1JJCB 5HAOA 2XNQA 1KEKA 5A8KA 1JIHA 2HMIA 1M5PC 2R7VA 3MECA 3VZIA 2DHGA 3HF5A 4USIA 2O66A 2RT3A 4MK9A 4N56A 2AMCB 5J2MB 2OELA 8AT1B 2ZH3A 3QLHA 1FRLA 3GIMA 5HO4A 1NPRA 5F0WA 1HNXF 3PIOQ 4UZBA 2YNIA 2G13A 1ZETA 4ZDNA 2CJAA 2ZH6A 3DN9A 4Q7AA 3F56A 3DOKB 1Q8LA 4URQU 1M1KT 1TTHB 1W26A 4J9NA 2DD8S 3M32A 5L1IA 1VQNS 3N6NA 1SKUB 4ED4A 4YR3A 3KHLA 4HH0A 2VA2A 2DNRA 2NUUG 4NEZA 3D6TB 3TX8A 5KFSA 4JI3J 1S0MA 5KT4A 3EX7B 4J37A 5IM0B 2QL9B 3GJTB 2JFDA 4BHQA 1M5KC 1UETA 2VZ9A 2A1BA 1LW2A 1GXTA 1K1SA 4QWBA 2QT7A 4O44B 2Q6BA 4N76A 4RNMA 4OZJA 5B0GA 1QSLA 4B9SA 2UVUA 1Z2LA 4O0NA 2E9RX 3B78A 4G1QB 3X3UA 4X84A 4LF7J 1KVJA 2BRLA 1IKWA 2AZ1A 2QFJA 3AJDA 3DI6A 3UNYA 3J81j 2LDYA 3JAMY 2E7WA 3IM8A 4UY85 3ISNC 2WB4A 4N5SA 5JMNA 2AJFE 2D1CA 2P5VA 3GLJA 2B3TB 4CI0B 3D67A 3QIPA 4Y34A 2DH9A 4JUZA 3U1LA 3CC2S 2F3JA 5FIIA 3TJAA 3PR5B 2O1PA 1SJFA 1X5SA 4GVLA 2AD9A 4HI1A 4LF5J 1RBAA 1YZ7A 4DL4A 4B3MF 3PR4A 1JJHA 4KTQA 3MHYA 3QRPA 5DO2A 4QW9A 4F4XA 4JI7F 5A8KB 2HMIB 3LGHA 3MECB 1CG2A 3T3FA 2CNOB 3KG4A 3C6TA 4WFAQ 2Y1JA 1IM4A 1MROB 4ED7A 2RAQA 2YNGA 1GMWD 3KJVA 3KLFA 3NWGA 4DPTA 2KZZA 5KG6A 3G87A 4OI2A 4WE1A 2PI4A 9ATCB 3CO9A 2JH3A 2YNIB 2MKIA 1RWVB 4L3NA 3PM9A 4MK8A 1B0PA 3QT8A 4M5LA 2VPZB 3UNGC 2RJZA 2VASA 1UEVA 2DRAA 4NEYA 3M8ZA 1FWKA 3H4BA 4DV5J 2RRAA 2BR0A 4R5PA 1F60B 2UUBF 3MURP 2EFOA 1GK8A 5BYSA 2CQDA 3RG6A 2MHNA 2DHHA 5C42A 4QYZJ 4DL0C 4PCQA 3T9NA 3OTDA 1D0EA 2P9GA 4IH7A 2R2RA 4LIRA 3QT6A 1TU0B 1X4HA 1OSCA 2HHXA 1U1OA 4V19X 3G71S 4B3TF 3AA9A 4EU0A 3I56S 3OXFA 2DNKA 2YX7A 3CJTA 1T11A 3DI6B 3Q86A 3MPDA 5KFIA 2MSSA 4LRBA 3NGSA 1X8DA 1E6VA 1C0TA 4LFCJ 3MR2A 3GJQB 2RHSB 1FRJA 5HP1A 3I4HX 3QIPB 4IRKA 2CQ0A 3BEGB 1NHUA 4C8LA 4N7TA 1EIYB 2GIFA 2RS8A 2DXDA 3FEZA 1WC3A 4FF2A 3J7A1 3UCUP 4ZVHA 3HM9A 1RAOA 4J5OA 4ZOSA 2VQEF 3RRHA 2CZVC 5F8JA 4CH0S 4ECQA 5D78A 3GFZA 4HHUA 4RW4B 1XJWB 2Y8WA 4WXWA 2I9SA 2R3VA 2XLIA 2FGCA 4NLUA 2B5JA 4C98A 3CCLS 5C25B 2C2MB 3I0RB 3P45B 3Q8VA 4Z2XA 3LANA 2DYAA 3FMWA 2OPQA 3KJVB 1VQMS 1WDDA 4WE1B 3TJ8A 2EG1A 2G1DA 3CMAS 1KTQA 3H2UB 4P7TA 4OZ0A 3RBEA 3L7OA 2ROEA 2MQNA 4NLWA 3J81U 3H7HB 2DNZA 4X65J 3VTIA 4IH6A 1ITPA 3D0IE 2HNYB 2MQLA 5KT2A 2HG4A 3H5XA 3CCRS 1R0CB 5A8RB 2BM1A 2DO4A 2AKWB 4IOAQ 3QGGA 4RNHA 2ZOGA 1URNA 3SDEB 3CCSS 4ZKAA 3QGPA 1HKAA 4FYXB 4K4TA 3AH6A 2VG6A 2IHR1 5C42B 2CUYA 4ECSA 1SJ4P 4LF9F 3B6BA 4RNNA 1TMJA 2NUHA 1SC1B 4XK8C 4X4OA 4Y0FA 2HHPA 1YTYA 2FLNA 5F41A 1B7FA 1FESA 5A0YA 2MGZA 5KFKA 1HLWA 3O6QA 5DG9A 3S01A 4KHRA 2OSQA 1E6VB 1C0TB 2CQPA 1EP4A 2XGQA 5DDRC 4MAKA 4DHVA 3UN2A 4EWTA 4FBUA 2J0QD 2E29A 1Y5LB 2KVIA 1L3UA 2B4PA 1HBMA 5KFFA 4OYAA 3V6HA 3MWBA 2IFXA 3PW0A 4DEZA 2XMUA 1NAQA 2PA8D 5HVGA 1S72S 2YTCA 4F4KA 1O5JA 1VBZA 2F1FA 1RKIA 3DRRA 1PSDA 1VQ5S 4YDXA 4KO0A 1V6HA 1TL5A 2MZJA 2XY6A 3PV8A 3PYDA 1ZM3A 4P2SA 1OPZA 2B5JB 4USVA 1H2UX 2IDEA 4EBDA 1PO6A 1SIZA 2C42A 2PEHA 4NYZA 1YWXA 1SH0A 1U0HA 1TQLA 3HVTA 2OPQB 3AJ1A 4QR2A 3HDSA 2F65A 3G6VA 2XWYA 1B0TA 2ZBRA 1LFWA 3S8SA 4JI0F 2IJRA 3H4DA 4NLGA 4LRDA 4U67Q 2HFNA 1HBUA 4P2MA 3QO9A 4ZVFA 2V8VA 3CJRA 5DRKA 3D7SB 3EJMA 4LUBA 4FXDA 3ENWA 1SQGA 4DV4F 3J81Y 3EVMA 4DCJB 3DDNA 3WX4A 2D9PA 2ZZMA 3CXCR 2V8DA 2FZGB 1N6QB 3W8PA 2C28A 5H9EJ 1SV5A 5T41A 3M4XA 5KT5A 2XM3A 4TYAA 4ZJLA 4DWIA 1WOOA 3LAKA 3TZXA 3E3XA 1RWUA 3CW2C 5GAHI 2MB0B 5B09A 3L7UA 4CO0A 1U6ZA 1BD6A 4C3KA 2BXJA 2IDLA 4TNOA 1T0TV 4ZPDA 1KVKA 2VC1A 4FF4A 4ED8A 3QPIA 2GJIA 1L3SA 3SZ2A 3MCNA 4M5HA 2DHXA 1JLAA 4Q0BB 2X3DA 4CIOA 2MGZB 2JHEA 2A2DA 2WVDA 4RX6A 1BE4A 4DXLA 2MKKA 2PSZA 3A13A 1FXRA 1G3OA 2KVQE 1MG7A 5AXMA 5MAOA 1EP4B 2DH8A 4YHHJ 3OVBA 2EFNA 2LYVA 4I0WA 2F7VA 4GVBA 2GA7A 4GC7A 5B0AA 3U02A 1RI7A 1IUJA 5L39A 6AT1B 1HBMB 2F4VJ 3AQOA 1L3VA 3PW2A 1YKWA 2JEJA 5B0FA 1FNMA 3DRRB 3OTOJ 3DKDA 1N34J 1D1UA 4KO0B 4DV7F 1R0AA 2DGSA 2D7SA 2W7OA 1KOOA 4B02A 2HZVA 2NPFA 4DPXA 4PXDA 2GC8A 4ITSA 1HI8A 3BKTA 1YJ9S 3HXMA 1TZ0A 3PO5A 1B7YB 4Q2MA 2PMZD 5BR8F 4ELUA 2LXFA 3NG8A 2BEFA 3HVTB 4WWSA 1QUPA 1PYOB 3HO1A 2X51A 4KKOB 1S4FA 3P5TL 3GJSB 3N28A 2DPIA 2CADA 5L1JA 1RWKB 5HVHA 2R2SA 3QRQA 1HBUB 1DQ9A 1X4FA 2GIRA 4K7QA 1LK5A 2EBGA 2C2EA 2UXCJ 2FHOB 3HMJG 2KZMA 3CCMS 2IM1A 4F67A 1H7WA 2PN6A 4DUYJ 3KK3A 1QY7A 1N5SA 2Y9HA 2CXEA 4Y2CA 1EETA 1FDBA 4HHHA 3VGUA 1UVJA 1QSYA 5I42A 4DR7J 1DHMA 3LWLA 1GXLA 2ZBCA 2DXFA 4HDGA 2VFTA 3JXOA 1JNZB 2PEBA 3H2VE 1F0XA 3KLGA 3PW5A 1VRQC 5KG5A 4JI4J 1H2TZ 5KFUA 1EQMA 1SQFA 3R5CA 4DSIA 4C48A 1JLAB 1RAJA 2BJ8A 4NLRA 3FQKA 1IBLJ 3R9LA 3OL8A 4C6AA 3K5LA 2FVQA 1RCXB 2YWEA 1YQHA 3M9OB 3HD1A 3QNWB 2YWKA 2HBZB 4ZPVR 3AB2B 2DGUA 2Y1LB 1BLUA 4A8MP 4B9TA 1JLCA 3MM5A 1UCNA 2HIYA 3HHLD 5CAAA 3IO1A 5CA5A 1XR6A 3M2VA 3U1NA 3RB4A 4EEYA 2FJVA 1MMNA 2QJ3A 4HR2A 4KGMA 5A6WA 1NKEA 1LWFB 3RTVA 2VPXB 2OO4A 1XIQA 2OD6A 4F02A 4B3RJ 3O3LA 1LFPA 1HIYA 4E0DA 4DQRA 1P27B 2FJWA 2BKPA 1DQ8A 3FFIA 1NSKL 3JB9k 4KR0B 1WG1A 3DXBA 4YUDA 5HVFA 3MMCA 4KY3A 4KHPF 3PJ9A 1L3KA 1HHTP 1VQ9S 3W8GA 4F7VA 4LBPA 2RH3A 3H2LA 4WTOB 3TEHB 2XNRA 3PO4A 1D09B 2RNEA 1Y7PA 3OW2R 1X4CA 1UMJA 1XR5A 2L08A 5J2QA 4O3SA 2JDJA 3BH6B 4HTIA 4Z7CA 1WG4A 3F44A 2HVHA 1DBDA 5K20B 3MR7A 3SIPB 2K3KA 3TNVA 5D4LA 5ETVA 3O44A 3KUHA 4DX5A 4J9VA 3D3BJ 1QVFR 1XNQJ 2HAIA 4ELTA 4DU8A 1B4SA 1QM9A 1LXJA 1N88A 3EGZA 2ZM6F 3W2VA 3GJRB 1VQ4S 2ZHBA 1B99A 1IKYB 1Y3JA 1RWWB 1IBMJ 1NJZA 2J0XA 1PCAA 4YB1P 1MMDA 3KMQA 4KIAA 3KNAA 2AIRB 2D9OA 4OX6A 3SFUA 2DRDA 5I42B 2MJUA 3BR8A 4FPRA 3TAPA 3C46A 4YR2A 5KFLA 4DQSA 1VQ7S 4IH5A 1YRTA 1RHKB 2FHJD 3BV8A 2IM0A 2BJ1A 2CQ4A 5JJBA 1YIJS 4GKJF 3SCJE 1EB0A 1RWOB 1DTQA 5C7PA 2GVDA 3E01A 4IDKA 2DNOA 2GX8A 4M1KA 1NXIA 3FSXA 4P6QA 1JLCB 1RT1A 1Q8IA 1U24A 1XN9A 4AFFA 1OYDA 4DV2F 1Y3KA 2R4FA 1NU4A 4R8UB 1UJ6A 2KFZA 4YB7A 3TQEA 4URSA 3I82A 1VFJA 3CJ4A 5RUBA 1T7PA 2BW2A 1S76D 2GMLA 2J7UA 2OUGA 2W24A 4IFYA 2HAFA 5GAEI 1JKHA 2WONA 4L73A 4NRTA 4NMXA 1HNIB 3QGIA 2WZ1A 4RBUA 5KG7A 2DNGA 2LQ5A 3L9ZA 2M52A 3UWTA 5KFEA 4M5IA 3MMCB 1S77D 4F8RA 1SC6A 2E1RA 4CLUA 2YNHB 3TVKA 2X1BA 3DLLQ 3QJLA 5HANA 3EE3A 2UXDJ 2LP4A 2MKJA 1S6PA 4U9RA 2FVCA 2BACA 5M2RA 8ATCB 2XBPA 1C1CA 3QWPA 4JI3F 1RACB 1RP5A 3IWXA 3C6UA 4LFAJ 5J2QB 2W4DA 4B3OB 2AWZA 4B9LA 1F3FA 4F3MA 4WIIA 2GJ2A 1YBUA 2KT3A 4DS5A 3R6GB 2OI2A 2EKYA 3IS9A 4IG0B 4ZVGA 2V2VA 1HHSA 2NXUA 3RW7A 2AEFA 4B08A 4ZVTB 4JI2F 1ULRA 4LF7F 2YPYA 1AT1B 4B17A 4EBEA 3Q2TC 4CT9A 1RKJA 4DFMA 4CDIA 2JEGA 4PKDB 4KPCA 2HWHA 4B9UA 3RR7A 1HR0J 4AQYJ 2ZKTA 3GCXP 2ZJRQ 4I69A 2ZWPA 2WW4A 5E0OA 3MEEA 4YB6A 4JI1F 1FHTA 3T5LA 2OPRA 2PIIA 3DGVA 1FX4A 3UD3P 1SJ3P 3B4MA 1XK8A 2VBYA 2N7YA 2W01A 2C1EB 1ZM2A 2ZH9A 1M5VC 2F63A 2FTRA 4O4RA 2XCAA 1YJVA 4CH7A 4ILMA 2CQBA 4C3MA 4DL6A 4U7UD 4V1Ak 3HHEA 3M8WA 4A46A 3HKWA 1G1XA 2O3DA 3VAIA 1NHKL 5FD1A 4KHMA 4MMOA 1AROP 1DTQB 4BLGA 2UXBJ 2YWGA 3E01B 2WSEC 3MAAB 9RUBA 3JTPA 2O01C 5HJXA 3UR3C 3KHRA 2WK4A 4Q43A 3D2WA 2ZE2A 4JV0A 4OYWA 1NB7A 1U1KA 3UVJA 1J5EJ 1CC7A 2H5EA 3NGDA 5JVHQ 4U95A 5DETA 2DITA 2B56A 1FXDA 4IFYB 2BE2B 1HW9A 4WFZA 3AXMA 3CJSA 1JKHB 2WONB 3IR6B 2N3LA 3JYTA 1N32J 3OUYA 3I31A 2XZWA 2LA4A 4DF4A 1S9EB 1FK9A 3GFHA 3M8YA 2XULA 1Q86T 2KRBA 2LLZA 3VGSA 5GAHU 2ZFHA 4KV8A 3GYGA 3D5MA 3DRXA 1GMVA 3K58A 4HHJA 3K8WA 4C4WA 1WI8A 4DS4A 3R7BB 1WF1A 5KG2A 1VBKA 3KJNB 3C6UB 1DJ0A 1RWNB 1EHWA 3NNAA 4MJKA 5F3TA 1HQUA 2XWXA 2MKCA 2H5IB 4JYAF 2OPPA 4OQJA 2X3GA 3DRSA 5KFNA 4DN0A 4RPFA 3EPIA 1JLEB 4K0KF 3IFEA 3T1YJ 3M8PA 1PAUB 2CQ3A 1YLXA 1RAEB 1JX4A 4BWJA 2DISA 3IM9A 1OPIA 3GONA 3D28A 4P75A 2LQJA 3A12A 4DUZF 4CO2A 4K5SA 4DSEA 2FY1A 1G6BA 2MEWA 2XHCA 2IYIA 1PC4A 2GHWA 3MEEB 2UVVA 3LF0A 1VQPS 2Q3PA 2OPRB 1GQEA 3BQ2A 1T03A 2HHTA 1HNXJ 2ZUAA 7AT1B 1ZPVA 2YKNA 1AUSL 4C8MA 2W9BA 1FRIA 2NZ4A 3F73A 1C0UB 1GH8A 2KU7A 4LRFA 4O3RA 3AD9C 1NPPA 2VFRA 3GIIA 4QBUA 2HW3A 3Q8RB 1RAFB 5DM7Q 4OI3A 3LH2S 3KLEA 1U4BA 4PUOA 1O51A 5E3CA 1VRTB 4RBTA 3NKYA 4JB8B 1ZOTA 1KP6A 1R8CA 1C4CA 2DBBA 1UW9A 2FJBB 2QV6A 4LQ3A 1WEXA 2WOMA 4F0HA 4ZHRA 3U27A 1CVJA 2CJ9A 2OMOA 2ZE2B 3HHLA 3UVJB 3EVWA 2YKMB 3OR1A 2NYIA 1M5SA 2ERRA 1ZTWA 3V6DA 1M0SA 4OHYA 3K2YA 2C2RA 2B4UA 5LSLA 3NNCA 4PYAA 1FE4A 4X65F 3R27A 4TKTA 3OUYB 4DLEA 3L4BC 4AT1B 1FK9B 2XMKA 3G96A 1S0VA 2BJ9A 1T02A 4FS1A 2J0WA 4KV8B 1F9FA 1CJVA 4G1IA 1RYRA 5C2GA 4ES3A 3KK1A 1FJ7A 4EMDA 4C2MA 3R5BA 3X1LB 2Z2LA 2WBMA 4OV6A 3H42A 4B3MJ 2QEXS 2HLUA 3N6MA 2U1AA 3OTCA 1HQUB 5F8HA 4OJGA 2PDAA 2OPPB 3T5HA 2WCXA 5CCMA 1WACA 1PYSB 5U47A 3DLBA 4X4PA 2XG8A 2V50A 2YQ1A 4JI7J 4WP8A 3UDVA 1S6OA 3R6LB 3PX0A 5KFBA 4KGZB 2FJAB 3MD3A 2WSCC 2GQ2A 4LIWA 2JOQA 3W5YA 3L3CA 4DV1F 3MOJB 3LPEA 4B9NA 4M5MA 3JS9A 4RR5A 3DGPB 2E9ZA 1UPPA 1NEEA 3DYAB 1T03B 1WHXA 1RLDA 2YKNB 5LMNF 2W9BB 2ZHAA 4DR3F 4P72A 3PDNA 3H20A 1TKZB 3MPVA 2IMOA 4Z7YA 3RW6A 1WWHA 1Y5NB 3PJWA 4DR6J 1I6JA 7FD1A 5EGYA 2EPIA 5L9XA 3KLEB 2KM8B 3O1LA 2PGCA 1S9GA 4PUOB 3G9CA 1FFWB 3JSBA 3NRBA 3MM8A 5L8RC 4ALZA 4MH8A 4MIBA 2EEYA 4JI5F 4HT7A 1BMQB 2UUBJ 3SEOA 3H40A 3CCZA 2QG9B 3MCSA 1SPBP 2J8AA 5KT7A 3SFGA 5BYQA 2VJVA 1AUDA 2WOMB 3Q24A 1H2VZ 4I68A 2HNZA 3S7RA 3KDNA 3IXQA 1OMSA 5FLXU 3PXGa 1FFSB 2WHOA 3KUEA 3IBCB 6FDRA 5C24A 2BJEA 4B3TJ 1MNEA 4HT5A 2QMUB 4G3IA 3V6DB 1WHVA 4ID5A 5ETOA 3B4DA 3SSSA 1IBCB 3NMAA 1D3WA 3OFGA 3R5GA 1RISA 2ZC4A 3PCOB 2HNDB 2ZWOA 3H25A 1E6YA 2OAUA 2HFVA 4PXCA 2CZ9A 2V63A 4PWWA 3E2EA 4HKQA 2GAGC 1R8HA 2G0IA 1BWEA 2KYZA 2QSWA 3UD4P 2IMWP 2W25A 2IIHA 2PC6A 2VKZG 1ZS6A 3KK1B 2HFUA 2RB7A 2CRLA 2MMYA 2XMMA 4WZMA 1D8ZA 2DR7A 1G2EA 2AYGA 5LL6d 2V4QA 1U0SA 1NDLA 1WSRA 1WC5A 4DV6F 3ZZ0A 3UI3A 3GE9A 4U96A 4XO0A 1X9WA 5ITHA 4ZVRB 3W1YC 2B8QA 5KFWA 1GXUA 3UN3A 3DOMA 3OHAA 3CJQA 4ED3A 2MZTA 3Q8YA 2E1CA 1EX8A 1FF2A 2J6TA 5IT0A 5F8LA 2ASLA 4QQBA 3C16A 4OX8A 3HSGA 5HJYA 3CD0A 3FBFA 4DX6A 2BQRA 2W7PA 1CS4A 3QMQA 3SMZA 4DR1J 1RT7A 3WZ0A 4ED5A 3L95X 4YMEA 1LV5A 3HHNB 2RUSA 2MDAA 1N34F 3CF5Q 2BKOA 4DSFA 4NA3A 5C2CA 3GG0A 2LQ9A 3L7PA 2QL7B 1YHQS 1UVLA 3RUBL 1EKSA 4NYPA 2Y3YA 4PQUB 3ZTSA 2RVJA 1N5VA 3PYGA 4I67A 5ETPA 1HQEA 4L6V3 4OZ3A 3G2XA 1DLOA 4DX8H 2YBVA 3QJJA 4FP9A 2QLWA 3FCWA 1RT6A 1X5TA 4USTA 4RZRA 4QYZK 1MWZA 3T1AA 3PKYA 1LWCA 4RW6A 4KGXB 1RDRA 5L38A 3HD2A 3HP6A 1QTMA 5FLXY 4ID5B 1NK7A 1FEEA 1ZBTA 3V6JA 1FD8A 4OLPA 2MKHA 3KFWX 2MKYA 2XY5A 4AL7A 2OTJS 4WYLA 1RABB 1E6YB 5ETLA 4Q2LA 5KOXA 3DDKA 1PAEX 3HT3A 2VV5A 4FBTA 3SSQA 2MTLA 1HNWF 5KTQA 2AGPA 2L3MA 4TLRA 4ZMMA 1EZZB 1ZTTA 1OIAA 1KR4A 1NDKA 3CIZA 4A8FA 5CZVA 4P74A 2FJDB 3K57A 5DQHA 4UOFA 2C3MA 1CJTB 4DFKA 1AA1B 1J5OA 3KMSA 3PEJA 3PY8A 4PG6A 1R7IA 3BSAA 3TI0A 2HKEA 2VQFF 1VRUA 3OR2B 2KL8A 3BDPA 5DZ7A 3CC4S 5GVQA 2CPZA 3R1LA 2V5HG 3C14A 4O3QA 2HHHF 1H98A 3VR1A 3C16B 2HS3A 1CJUA 5BYRA 4LVNP 1T9UA 3KTQA 4JI0J 3ENVA 4PZVA 2DNMA 1CS4B 4N41A 2IC3A 4ZA1A 4DOZA 1M1HA 3GIRA 4DPOA 1DY3A 3EGNA 4DQPA 1RT7B 3T5JA 4W92B 3VVTA 3ZTRA 4TLQA 5JVGQ 4DV4J 4BDPA 3VV2B 4UOHA 2RDJA 3NL0A 2B4VA 1Z4UA 4RWWA 3L09A 1AZSA 2DHSA 5D3GA 2VFSA 3RAQA 2B6AA 1QSSA 1IWGA 2QFIA 1QAJA 1TL3A 5F8NA 1T9XA 3UDEA 3I87A 5D6GA 1PC5A 3TAMA 2B9WA 2MPUA 3ZZZA 1TELA 3NLCA 3BREA 3C8YA 4RUBA 1RT6B 2GQQA 3CD6S 2XTJP 2BOAA 3BGRA 4RW6B 4ANCA 1TKXA 4K2XA 5LSOA 2BM0A 4K5RA 1FO1A 2RD5C 4NCAA 1XTZA 2CG4A 4NMLA 2N7CA 3MTKA 3VAFA 2VG7B 1XNQF 2G2YA 3C3LA 4H4KA 2BOPA 1TUWA 3M8RA 2QN6B 1KQFB 1ZZNA 1BUXA 4QYRA 2GIQA 3GIKA 2AGQA 1PG5B 4KFBA 1SH3A 4H4OA 2ALYB 3TUIC 1NK5A 2Z56B 3E51A 1ELOA 2DVIA 1X4EA 5F8MA 4DF8A 4FPIA 5EN1A 2HVIA 2RHQB 3UPFA 2VOOA 3EGVA 4GRSA 5LXRA 1FD2A 4A8KA 3AY0A 1UKUA 3HVWA 2GHVC 4C0HA 4L74A 2YH0A 1YJTA 1YJWS 2R7OA 5EX3A 3MAHA 1ZZFA 2K3IA 2YNFA 4LBHA 4DV7J 3EWGA 1OY8A 3NCRA 3D6MB 2NR0A 2DT9A 1J5OB 5HL7Q 4FZVA 4A8WA 4ES1A 3SYZA 3LTOA 4OX9J 3KG0A 1Q7LB 4TY8A 3OJSA 2COLA 5DGAA 3W9HA 5BR8J 5J2NA 5L46A 3KDOA 3LP1A 3C14B 1J27A 5CZXA 2CNLB 2CVIA 2LU1A 4F3QA 4EZ9A 4DL3A 1CJUB 4PG4A 1GX5A 3SCIE 4ZLJA 2VU5A 4LT6A 3MFHA 1FJGF 2IC3B 3H8YA 4ZK7M 1M1GA 4Q8EA 1IJFB 2GS8A 3Q8PB 2JEIA 5BJRA 1MU2B 3I9V9 1VR6A 1VQYA 1A6LA 3D0HE 3HJVA 2EFQA 4ZVUB 4I56A 5IZHA 2ADBA 3P8BB 1O0PA 3BDEA 1AZSB 2IRYA 1P1LA 2DPJA 3RB6A 4FKYA 2KDOA 1TL3B 2HBQB 3IRWP 2LEAA 2VL1A 1IR2A 3MF5A 1AW0A 3RB0A 5H9EK 4CTAA 1TK0A 4IKAA 4OYIA 5E3AA 1H38A 1NKCA 2R7SA 3RRKA 3PYEA 4DUTA 3V81A 4PYDA 3MFIA 3K5OA 2M70A 1TKXB 4QU7A 4QIWD 2CIMA 4CM2A 1RYSA 4LF6F 4C7QA 4LR8A 3P49B 4RLEA 1DARA 3GTYX 2XC9A 2QLFB 3ZZTA 3LP2A 4J9OA 2FHMA 3FMBA 1RZMA 4NE9C 3N4WA 3TUJC 2MLXA 3AA8A 2IYGA 1NO8A 2CA9A 4O3PA 1QD1A 4FF3A 1NK6A 3HVRA 2E7XA 2ZH1A 2G0JA 3ZC4A 4MYUA 5E41A 4J9RA 3PHTA 2C2ZB 5IT9U 5J2MA 3CDAA 1UL3A 2HBYB 3W61A 5F8GA 5E3RA 1WTFA 5ETQA 4PG8A 3TZZA 4EYIB 3PYFA 1NMEB 3DLJA 4RW8B 2BW7A 2J7WA 2YNFB 2VFUA 2I5JB 3I0SA 2ZC3A 3GP9A 1SXLA 1NUEA 2KXFA 4LJMA 1SBRA 1OY9A 4KHPJ 1LOUA 3EZOA 3BYPA 4HI2A 4DL7A 1RTZA 1UJ5A 5J2NB 1SCJB 2Y1RI 3A8IA 3LO3A 1T9WA 4CM0A 2UXBF 3LP1B 2OIHA 1S6UA 5C5JA 2Z2MA 5IM0A 2GAHC 1RB0A 3T1HJ 4R0EA 1QTNB 2XQCA 1K47A 1MLAA 1NK8A 4QWCA 3D6HB 2FIUA 5K8OA 2XMWA 1W7WA 1L3TA 2BABA 1BQXA 1F9EB 2DXEA 2FZCB 3TEGA 4G1QA 3LAMA 3HHDA 4M94A 1KLNA 2FLPA 3PTWA 5ETNA 2ATCB 4WZQA 7FDRA 3OPKA 2CNNB 4LR9A 4IOCQ 2VKRA 1VLYA 3I6PA 2V4JB 2O5DA 3NS5A 3MD1A 2VBXA
chains in the Genus database with same CATH topology
3DXBA 1X4BA 1TKZA 1KRPA 4YUDA 5KT6A 1HFEL 3MMCA 4CTAB 4IQMA 3TA1A 4EGLA 3BF4A 3MI7X 4Y6IA 4KHPF 1BY9A 1X7VA 4C11B 1L3KA 2QA1A 4NCGB 3QZ8A 1HHTP 5CQGA 3P3DA 3FEXB 1VQ9S 1PILA 4JI4F 2W9CA 2J9CA 4AUKA 1XMBA 2J9EA 4ES2A 2RH3A 3BS9A 2DGOA 2UP1A 3H2LA 2G9OA 2W8KA 4C0OC 2ZBIA 2XNRA 2C3OA 3GYNA 3PO4A 3IR5B 4IG3B 4TU9A 4N8NA 3OVSA 2ZD1B 3CUNA 1IBLF 1X4DA 2RNEA 2QE5A 1Q1KA 3CJKA 3W2WA 2H9ZA 1Y7PA 2R8JA 3OW2R 1X4CA 4CO4A 3G4SS 1UMJA 1XR5A 3FVYA 1ZAVA 2L08A 1FDAA 2HHQA 5J2QA 2QA2A 4J9QA 4O3SA 2IRUA 2JDJA 4HTIA 4ATNA 1U1LA 4RUAA 1XERA 1WG4A 4ECTA 3F44A 1D9AA 3LP2B 2HVHA 1DBDA 2E5LF 3BR9A 4UUXA 3M30B 3SCLE 2K3KA 2KN4A 5FDLB 4GMKA 3TNVA 4RW7A 1U1PA 2XHWA 1C1BB 5D4LA 3KHGA 4YB5A 4PWDB 2QLXA 3O44A 2KXHA 4X62F 2N3OA 2I2YA 2FD2A 3BB5A 3BGUA 5D77A 4IOBA 3EXCX 4NCBA 4U7CA 1QVFR 1B0VA 2HAIA 1PGZA 4ELTA 2XB2D 1M90T 3HKZD 4HEA9 1QM9A 3IG1A 1LXJA 1N88A 1Q82T 3RB3A 5DG7A 3EGZA 4UQGA 2ZM6F 5HP1B 3WDOA 3W2VA 3LGMA 1MROA 2MHEA 3LQVA 2DR9A 4CO1A 2HGLA 4OHVA 1VQ4S 2ZHBA 4Q8FA 5KFPA 3BJYA 1IKYB 2HFZA 4KRWA 1IBKF 4ED2A 4Y65A 3M6WA 1Y3JA 4B3RF 5ADZA 3BZQA 4TXSA 5B0CA 2JLEA 1NJZA 1TFWA 3M1VA 5IXUA 2J0XA 2K7KA 2JLFA 3LOUA 4YB1P 4ZP9A 1BC6A 3EGWB 1ZPWX 1MMDA 3N5BA 5DM6Q 3KMQA 4KIAA 1NK0A 2HQ3A 2G0CA 3KNAA 2UUCF 2EK6A 2HNDA 2CPHA 1WG5A 4A48A 3I96A 4M5DA 2AYEA 3THVA 4J9LA 2RIJA 2HGNA 5B0DA 2D9OA 5AXNA 1S0OA 2KFNA 1Y00A 3JTOA 4OX6A 3SFUA 2OP5A 5IT4A 4G1PA 5I42B 2XLKA 2MJUA 3BR8A 4FPRA 1U1RA 1L5UA 2F8HA 3I0SB 3G8TA 2MY7A 3TAPA 1MW7A 3C46A 4YR2A 5KFLA 2WTFA 3J7YU 3ZZPA 2IVFB 3GMGA 4C9DA 4GKKF 4DQSA 2DNLA 5KFJA 3R5DA 2LECA 4IYQA 1VQ7S 2HLTA 3BSNA 4X4QA 4A8SA 1HQEB 2JVRA 2RU3A 2VA3A 1N5TA 2PMHA 2FJEB 4IH5A 2K1RB 1DLOB 1C2PA 1YRTA 3OXGA 2Y1JA 2FHJD 1LKZA 5KG3A 1NJYA 4JI8F 2QA4S 1FKOA 2XGPA 2BA9A 4WTYA 1SL1A 3MEGB 2VG5A 2IM0A 1SJRA 3ISZA 3CULA 2IVYA 3UDLA 1T3NA 3MOZA 2CQ4A 4QIEA 1LWCB 5GADI 2MZ1A 2YKPA 5JJBA 1YIJS 1TKTA 4ECUA 1N48A 2GW8A 3SCJE 4X4SA 3TO8A 3SSRA 5KFVA 4GKJF 4PXEA 4WFYA 1OWXA 3QIDA 4ECZA 3KKFA 1DTQA 5DQIA 2ZNYA 4OI4A 5HMZA 1RTDA 3O8WA 3AAWB 3E01A 3B82A 4IDKA 3TA2A 2DNOA 3JTNA 4HYKA 2GX8A 1SJ1A 3BGLA 4M1KA 4NZ0A 1C4AA 3FSXA 1U49A 2U2FA 4ICLA 4P6QA 1JLCB 1RT1A 1Q8IA 1IKVA 1U24A 2SXLA 4ZVEA 1XN9A 4QZVB 4AFFA 2DNNA 4NOHA 4J9SA 3N5FA 4H54A 4DV2F 1Y3KA 4ZPCA 2R4FA 3HPOA 4TY9A 5K8NA 4K4YA 1S1XB 2RMLA 4QIVA 1NU4A 1HNZF 5A8WA 4R8UB 3NNHA 1UJ6A 3LUYA 2KFZA 1K73T 4YB7A 4LVOP 4WU2A 3FDSA 2R8HA 4URSA 4BCAA 1UEUA 3I82A 2C3YA 1VFJA 1UWBA 2J5AA 3CJ4A 1IBMF 5LJ5Y 4RW9B 5M2UA 1KQKA 1H7XA 3CCWA 5J1EA 3GILA 1A7GE 4UY8T 5E33A 3OXLA 4NX9A 1T7PA 2BW2A 5AXLA 1S76D 3DM2B 2GMLA 2J7UA 1ZYQA 2Q66A 1VBXA 1FA0A 2W24A 3RBDA 2IM3A 4RUCA 3NAIA 1QAYA 4IFYA 3ONQA 3TVZA 4F4WA 3DLHA 1DTTA 2CQIA 5GAEI 1JKHA 1ROFA 2WONA 4NRTA 2BANA 2J76E 2JEFA 5HBMB 1HNIB 1HBOB 2E5HA 2VOPA 3QGIA 2OMLA 3CCVS 4ID8A 4RBUA 5A2QY 5KG7A 2DNGA 2GNKA 2LQ5A 3CT9A 2OH2A 1UVNA 3G6YA 2M52A 2V94A 3UWTA 4PXBA 5KFEA 2VFVA 2R7XA 1IJEB 3CEDA 3K7RA 2M7SA 3IBWA 4PQAA 4KPYA 1QUVA 3MMCB 1RT3A 4IRDA 1S77D 4F8RA 1SC6A 2E1RA 2CPFA 1W2IA 2YNHB 3SV4A 3TQ1A 2M4MA 5K8PA 3TVKA 2HHWA 2VG6B 2X1BA 3DLLQ 3QJLA 1D9FA 4WXOA 2R8GA 3K5PA 2M0GB 2MY8A 2W9CB 4NXMF 2ZHOA 3IGNA 3UE2A 3PJXA 5K14A 3GV7B 1TL1A 2MKJA 1S6PA 4OJHA 2L48A 2X1AA 2KHDA 4U9RA 3ZZYA 2L9NA 2FVCA 2AJ0A 2BACA 5M2RA 3DLEA 4O23A 1TL4A 2BQUA 4DSKA 2IBOA 2XBPA 3CTRA 5F9LA 4A8OA 1C1CA 4OL8A 3QWPA 1R31A 2B51A 1LK7A 1VC5A 4DDFA 4JI3F 4QWEA 3CJKB 3W2WB 2RS2A 2AP6A 4IO9Q 2DR5A 4W90B 1RP5A 5KFZA 1VRUB 2C2DA 3IWXA 1ZH5A 3C6UA 2FLOA 4UQTA 1BQMA 1S6QA 1WHWA 4I2PA 5IQQA 5J2QB 4PQUA 2W4DA 3EZUA 2DO0A 4M8LA 5B0EA 4DSLA 2AWZA 4B3OB 4B9LA 1UW4A 5J2PA 4RW4A 1OQ3A 4F3MA 1VQ6S 4WIIA 3OL9A 2XI2A 1DZ5A 2GJ2A 2FVPA 2KT3A 2LEBA 1CC8A 5A0YB 4HLBA 4DS5A 2EKYA 4RW7B 3IS9A 4IG0B 4F2RA 3PFEA 2JFKA 4ZVGA 1HHSA 1NZAA 2ACYA 2NS1B 3MUVP 5CHCB 2UU9F 2NXUA 3RW7A 5C25A 3HJFA 5H1SV 1AXQA 1RT4A 2N4DA 3I0RA 4B08A 1VK8A 1KVIA 3IG1B 3KLIB 4JI2F 1ULRA 4LF7F 5D4NA 3V4MA 2J6UA 2KI2A 4B17A 4EBEA 3Q2TC 4CT9A 2DHAA 1RKJA 1U2RA 4DFMA 2RILA 4OI0A 3T6JA 4ZLPA 4DR4F 1RA6A 1XR7A 2JEGA 1HBNA 4PKDB 4ED1A 2HWHA 4B9UA 3RR7A 4EYHB 4O4GA 4QW8A 3HFKA 3M1VB 2ZKTA 5HMYA 3BO4A 2EFPA 2ZJRQ 4I69A 1ZM4A 3OFFA 5E0OA 4DSJA 4E8UA 5CH7B 3MEEA 4YB6A 3PNIA 1DRZA 1IQZA 4JI1F 4M5DB 1FHTA 3T5LA 1V3SA 2OPRA 5KFRA 1QLNA 3GSDA 5D3GB 1HWUA 3FNNA 3MUTP 2PIIA 2EW9A 4RNOA 4A8YA 5KFCA 2NLWA 4KJIA 1YJRA 2B6AB 2CPDA 4DR6F 2KJVA 3U7JA 3J7ZT 1UP1A 3UD3P 2HNYA 3I5BA 3OJUA 3ETOA 2UZAA 5DDOC 1SJ3P 2UXDF 3B4MA 1XBWA 3TAMB 1XK8A 3HZGA 5A8RA 1CQMA 4J9PA 4UW2A 2GV1A 4E98A 1R8BA 1QVGR 1IQTA 1VC6A 2VBYA 2N7YA 4AXJA 2VB6A 1ZM2A 3CDUA 1YG0A 3US5A 5KFDA 2ZH9A 1TV6B 3SV3A 1FNXH 2FTRA 1M5VC 4O4RA 2BZ2A 1YJVA 4CH7A 2XCAA 2VD3A