3AB4B

Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
157
Chain Sequence
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 35
structure length 157
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B01
3OFFA 2JHEA 3DHXA 3O1LA 2RE1A 1RWUA 2RQMA 3ENVA 1KS2A 3LOUA 3AAWB 1LKZA 3OBIA 1YBAA 1SC6A 2P9EA 4PWUA 1LK5A 2P9GA 2KO1A 3NRBA 1U8SA 4NMLA 2F8MA 2NYIA 3ENQA 3MWBA 3ENWA 1PSDA 2MDAA 3DHWC 2DTJA 2H9ZA 4GO5X 2J0XA 2CDQA 2J0WA 3CEDA 2F1FA 1Y7PA 3DDNA 2PA3A 2QSWA 3HHEA 3W7BA 5IT0A 4M8LA 3MAHA 3L7OA 3TUZC 1UJ4A 2PC6A 1UJ6A 3K5PA 2P9CA 3DC2A 4X84A 3U7JA 2DT9A 5IT4A 2JOQA 1LK7A 2RQKA 3AB2B 3LUYA 3N0VA 2ZHOA 4GO7X 3IBWA 3OFGA 2QMWA 5FIIA 3TUIC 1O8BA 5T41A 2QRRA 1ZPVA 4LUBA 5IS2A 5JJBA 3AB4B 3MTJA 4IO1A 1YGYA 3OFEA 3S1TA 2QMXA 1UJ5A 1M0SA 3IXQA 3KWMA 2LVWA 3P96A 2I9SA 4GMKA 3TUJC 3OFHA 1XTZA 2LQJA 3UW1A 2FGCA
chains in the Genus database with same CATH superfamily
3FC9A 3VZHA 3AOBA 1R6VA 5DG7A 4ZVSB 3HJVA 3FBCA 2XBPA 1YBTA 5HAOA 2IVFB 3NCQA 5A2QU 1LEOA 5KFWA 4O4GA 4CI0B 2PDAA 3H4BA 4ECUA 4RUCA 3BO3A 2BANA 3MR2A 1JLBA 4A8YA 1FDBA 4HDHA 3CJTA 5D3GA 4OYWA 1X4DA 4PQAA 2QYGA 1UPPA 2DNKA 3H5XA 2ACMA 3J81j 2VFVA 3OLAA 2J9EA 1Y10A 2MY7A 2EFVA 4X64F 2EBGA 1OQ3A 4R8UB 2CZVC 3KYLA 1EHWA 2VUGA 4NEYA 4O3QA 2IRXA 3JB9k 2LECA 2VOOA 3TUIC 2RH3A 4ER8A 3KLHA 1J5OA 1FWPA 2AX0A 3E3XA 2OAUA 4Y3CA 4B3MF 3KLGB 4W4MA 3TZWA 4QZVB 4NLPA 1E6YB 3SBMA 1Q82T 2MB0B 5D4PA 2H51B 3CJSA 3TR5A 5F9LA 2VDHA 1TKXA 9RUBA 4ZN1A 3SEOA 2Q6CA 4OX9J 3MAAB 1KOOA 3FUYA 1BE4A 4LF9F 3QO9A 2V4QA 2P8IA 5CYQB 4P73A 2QO3A 5HO4A 5CYJA 2MYFA 2CWXA 2VG6A 5IM0B 3HSJA 4OX8A 3OUYA 4RL1A 2KZMA 2XGPA 4RU2A 3V6KA 1VQ4S 3T41A 3TVKA 1TMMA 1RWKB 4OZ3A 3CD5A 2H4WB 1T03B 1CC7A 2XEXA 1VCTA 1NHUA 2VBYA 1NK6A 5ADZA 2Q3PA 1S0OA 1I94F 2XMTA 3DGPB 3QGHA 4G1PA 1AT1B 4M5DA 3JTOA 1N32J 4K4UA 5FIIA 1FXRA 1WHYA 2FTRA 4O0IA 4V19X 4IG0A 1S9EA 4IG3A 5HQLA 2CJBA 2IC3A 4ID8A 3TRGA 4F4ZA 4JI7F 1DFDA 2DH8A 1LW2A 5DRKA 3V2UC 3FMBA 2RF2B 2NXEA 5HN0A 1JJ2R 4DFMA 1PIEA 4X62F 4HTIA 4CQ1A 3HDSA 3U1MA 1U0HA 2FJBB 1HNVB 1O0PA 4ECYA 4JV5J 2NR0A 5B7WA 3MWBA 5T14A 2HG4A 1S48A 1SKWA 2ROEA 2RRNA 6FD1A 2BE2B 5A8RB 4DL0C 2W4CA 2F4FA 1KSPA 5D0HA 2W2PP 5HROB 1WACA 1S9FA 3DRSA 3TVZA 2W9CA 1RJJA 4DV2J 4ZCLA 4GVBB 3PX4A 2C28A 3CC7S 1R8BA 3KJVB 3CD0A 2A10A 4QIEA 1WTFA 3KLIB 4I1TA 1UFLA 1WKLA 4TLQA 2RILA 4A8XA 1X9MA 1U26A 4C8OA 3WBZA 2VU5A 3HFZB 2CJAA 3KHRA 1PJ7A 4LBHA 2ASJA 1FCAA 3MM8B 2F8MA 3CCMS 3C14B 3PRDA 5E3QA 3BGUA 4DQSA 1RAGB 3LH2S 4Y2CA 1W2IA 4RNHA 5GMKa 1NO8A 4CH7A 1K47A 4UF4A 1IKYA 1VHIA 3KUEA 3T5KA 3VVTA 4ILMA 2C2NA 3Q83A 3BBFA 3HF5A 1MROA 1OO0B 1NK0A 2KB2A 1T9TA 1Q79A 2HNZA 4JI4J 3IGVA 1AFJA 4DG1A 2HHVA 1HQUB 3LGNA 2M3DA 2V4RA 4ANDA 2A2CA 1I51B 1D0EA 4DR6F 4Y2MA 3HK2A 4R0EA 2QMUB 1N33J 2RD5C 3OSNA 2AQ4A 1SC4B 3CCRS 1W26A 3QAUA 4OHWA 5CQGA 5HLFA 2I0XA 4P2MA 3OL7A 1KFDA 4U7CA 1PO6A 2RJZA 2JC1A 4DZDA 2D41A 3DLKA 1EETB 1K0VA 2DEIA 3T1AA 4Y2IA 2YNFB 3IGNA 5IWAJ 3W5XA 3BF4A 4M8LA 1OY8A 2H1YA 4LIWA 3D6FB 3NBPA 3CNQP 3HVWA 3Q8UA 2KXHA 2X7IA 3GB0A 3RR7A 3MFHA 2DH7A 2YX1A 1WDTA 4L73A 5EWGA 1HR0J 3OVBA 2CPJA 1MU2A 3IN5A 5AXMA 1TFWA 2V34A 2ZH4A 4ECSA 1U2CA 1U1RA 2BDPA 1JLAB 2DXDA 2HK2A 4DV7F 2XCPA 4BCAA 2QFJA 4OJ1A 4DX6A 3G6YA 1YIJS 2YWKA 1FE4A 4USWA 4C8KA 1VLYA 2BQRA 2YWFA 1GMWA 3OV7A 2K7KA 3VHQA 1D1UA 3JXOA 1DQ9A 5BYRA 3I9ZA 2ZH7A 4CLFA 2FIUA 2IPOB 4X4QA 3SFGA 3IA0A 4J9UE 4ZK7M 4V1Ak 3IM9A 4TYAA 3A8JA 2Y1RI 1XBWA 4A4JA 1RKJA 2VICA 1G4CA 5BXIA 2B6AB 2APOA 4PEOA 4Q0BA 2Q66A 2FHOB 5F0UA 4HEA9 2ZH3A 3WHIA 2HS4A 2E9TA 4KFBB 3PIPQ 3CCSS 4EU0A 1GMUA 3AD9C 2IM3A 3W9JA 1VQ6S 2OPSB 3R6GB 2KL8A 3D28A 3C6UA 5SZTA 3D68A 5E3PA 3BGLA 2JFDA 4RNMA 4YFUA 4WXWA 3QT8A 2Z2MA 3A8IA 4LSNB 2YNIB 2J8SA 4JV0A 2R7UA 2N4CA 2C1EB 1HWKA 1FKOB 3BGRB 1JJ4A 1X5OA 4O44A 4Y00A 4IH5A 1GX6A 5KT4A 4CM2A 2WBMA 2DR5A 4U7UD 1B64A 4JOUA 3D0GE 3NGSA 3QJJA 5EUHA 4C3KA 4K4ZA 1FTCA 1WEXA 2C2EA 3H98A 3ZZUA 1W7WA 2QFIA 2ZZTA 2JZ5A 2D3ZA 3H2UB 3MR3A 2NXJA 3FJ2A 1TUGB 1B7YB 4F26A 1ZM9A 2OMOA 1FVQA 3KNAA 1KOHA 1U2RA 1S1VA 2FZKB 5JJBA 2M4MA 4KGVB 1S1TB 4F7VA 4FBUA 4IQXA 3GQCA 4PR6A 2MQQA 3PEHA 4HL9A 1QSLA 4FF2A 3SCKE 2OSRA 2XSJA 3GCWP 4DR2F 3L7UA 2VFTA 5J2MB 4NLTA 5D0RA 2W7PA 3AT1B 4WPAA 2DHHA 5BJRA 1X7VA 3HFKA 1NPKA 5D4OA 1RA6A 3TVYA 2ZUGA 1JLEB 2CXEA 2DNLA 1Y9OA 3QZ7A 4W98A 3ENQA 1RTJA 2FJAB 3PNIA 1ACMB 1HHTP 4I7FA 3ILIA 3QJPA 1E6VA 3FNNA 3TYTA 2RMLA 1NJIT 4DX7A 3VAKA 5D77A 4NLYA 1D09B 1SL2A 1MMLA 1S1UA 4B9NA 3A3OB 2CJQA 3OR1A 4ZP8A 1WF0A 2BVZA 2F63A 5K8NA 3BZQA 2B56A 1SCJB 1KQFB 3DI6B 5AJ3J 4CO3A 4BHQA 4CLWA 2CNLB 3OVAA 1FE0A 2HAFA 3FGVA 1R31A 1HNXJ 1JX4A 1VQNS 4FXWA 4DUZJ 1RHJB 2YQ1A 1V6HA 3A3NB 2AIRB 2JEIA 1U8WA 3WIVA 1GK8A 4WCEQ 2C3OA 1WHXA 3DRPA 2VG7B 1TV6A 3D54A 4WBFA 2LEAA 3QBCA 1P8GA 3CO9A 4Z37A 5H9EJ 4KR0B 2FHJA 3D1QA 2E29A 2PA3A 5CYMA 3HZEA 3FFIB 3BSCA 2RRAA 1IKXB 3F0NA 3HD2A 3BBCA 2HSEB 2R2SA 2AYGA 3LAMA 3CIZA 5BR8F 3MHYA 2FJDB 2YNGB 2PMWA 4DSKA 1F0XA 4HR2A 1RA7A 3R1LA 1LWEA 3NLCA 2WOMA 4NCGA 2L9NA 2HMIA 5HATA 1CQMA 4YP3A 2VOPA 1GQEA 3GCXP 3KOAA 1RT2A 3U1LA 3CXCR 1ZS6A 2Z8QA 4YUDA 4FYWB 1RWUA 1FRIA 2CFXA 2VKRA 4TU7A 1N36J 2UXBJ 1N0VC 3EGNA 4DR4J 1VC0A 2K3KA 2OPRB 3NY0A 3MUMP 4CT9A 3KHLA 3SCIE 1ZM3A 3EM1A 3MPVA 2DGTA 2J6SA 2C3UA 2KG0A 1M1GA 3BH7B 4NA3A 4QWBA 2NZ4A 1HQEA 1VS3A 5A8WA 4J9LA 5C42A 3HVAA 2B4OA 2HBRB 4L75A 4QJVA 4DF4A 3FCWA 2DB1A 1MN9A 1KONA 1GTEA 4LSLB 4USKA 3DOKA 2C2ZB 2UUAJ 2FLPA 4TYBA 2KXFA 5HL7Q 2GQCA 4Q44A 2M7SA 2JEGA 4QWEA 3P49B 1BY9A 2LQJA 3W9IA 3UCGA 2X1GA 3O8WA 5K20B 4MIBA 4ES1A 2HHHJ 3W2WB 1VBYA 3FBBA 1G2EA 1CJKB 2HBYB 3KDOA 4YEAA 3R27A 2PI5A 1RT3B 3RB6A 2KO1A 5B0AA 1WF1A 2C3MA 3RB3A 1VJQA 2JC0A 4U8VA 1IQZA 5HK4A 3G82B 4A8SA 2B8QA 5DQHA 2DO0A 2CYYA 2Q1LA 1NZAA 2C22A 4G1QA 3PEJA 2KDOA 4I6AA 1EX8A 2IRUA 2ZKUA 5I3UA 2YKOA 4PG6A 4K4XA 1AZSA 4DV4F 1XJWB 3NGRA 1WNEA 4URSA 3K5OA 1F9HA 5T41A 2KG1A 2YQ0A 2J0SD 4DL4A 2DNGA 2KFNA 3GG1A 1HNZJ 1U1PA 5KG5A 4O3NA 3HSGA 1HYSA 2ZVIA 3CCES 3IXQA 2E7VA 4I2QA 4E8UA 1LXJA 3PVXA 3TUJC 2D9OA 1ULRA 1T0TV 4JP8A 1CVJA 3JSRA 3UDCA 3QPIA 1EP4A 1DQ8A 3PYDA 3MM6B 2LQBA 3W9HA 4CNZA 2VBXA 4K4YA 3CWJA 5LMNJ 5IC6B 2HQIA 3ILLA 4CLKA 2GCFA 2GO8A 1SC6A 2I1RA 1LK5A 2WB1D 1GMVA 3FSIA 2CQPA 2B7CB 1RQ0A 3DDIA 3HSZA 3D67A 3Q8QB 2HZCA 2Q79A 4Q2LA 4UQTA 3CTRA 3NS7B 1TTHB 1YJRA 4QWCA 3MR6A 4ZPBA 3BSOA 2LA6A 1RABB 5KT7A 3BDPA 1PBAA 5E3CA 2RQCA 4DX8H 4MFBA 5JVGQ 3DU6A 2C3PA 3TZYA 2XS7A 3PW4A 4ICLB 2LQ5A 3HHLA 3RR8A 1K73T 2UP1A 1VRUB 4LREA 4DV6J 4CNYA 4CLLA 3M1VA 3EPIA 4IFYA 4RR5A 4LJMA 1HD1A 4CZCA 2E1MC 2GJIA 2YH1A 2MSTA 3THTA 3ADAC 3D4JA 1IJEB 3ZNUA 5EN1A 1JK9B 1Y00A 4DSFA 1RLCL 4DLEA 1S7IA 1NDCA 5GAHI 2RNEA 4O4GB 2I38A 1IUJA 4ZPVR 2DNPA 3KUHA 4IYQA 1C0UA 2BANB 1KQGB 1JLBB 1UPMB 3P5BP 1IR1A 4ZVRB 1YQHA 3B4MA 3SQOP 5D3GB 3NGUA 2ZWPA 4WWSA 3BQ2A 5L1LA 4X4PA 2V67A 3T1YF 3PJXA 2NSCA 2BYCA 3N4WA 4RNOA 1QAYA 2DITA 2LCWA 2F1FA 5KFPA 4Y2KA 3CCWA 2FJVA 2HHUA 1RAHB 3CVKA 3GFXA 5F8HA 3KLHB 4J90A 2CKWA 1J5OB 1FJEB 3MEDA 2R8KA 5L1IA 4A8QA 1RT6A 4OHZA 3DU5A 4YDXA 1WG4A 4EO6A 3UD4P 3KJNB 1FJGJ 2YTCA 4IRCA 4PPZA 2HQFA 4DPUA 3DDKA 3UO0A 2BE7D 1J5EF 4DS4A 3ELHA 1TKXB 3N79A 2HPUA 4LF8F 1HBOA 5HVFA 5CZVA 4H4MA 2LU2A 3OFFA 1Y5NB 4ES2A 1JMTA 1UA1A 3ETOA 2CQ4A 1G7CB 2VG6B 2FVRA 3QAEA 1TFYA 1RCXB 2JNJA 3EE3A 1KLNA 3CDEA 3DOLA 4N76A 2FVPA 3GSDA 1RDRA 3HULA 3ZZOA 1WOPA 2J7WA 4MYTA 5F8LA 3G9CA 4C8YA 2RT3A 4WE1A 2ZH8A 3OR2A 4ELVA 4ZKAA 1WDDA 1SC3B 2UXCF 1UVIA 3QQCD 2DNQA 4M5DB 2QN6B 4JI6F 2R7SA 2B4PA 1RT7A 1HI8A 1ZZNA 3MEKA 1S9EB 5KFIA 1XQIA 2CAJA 1Y5IB 1TL7A 4X64J 3S01A 4IG3B 2HVDA 1OY6A 1Y5LB 5LT5A 2JL9A 2IC3B 2XCAA 1SUQA 3TUPA 5LMUJ 1TK0A 3LA0A 1NDKA 2KZZA 1LW2B 3GYNA 2W9BA 4ED2A 1DY3A 1V5VA 3OQ2A 3DMJA 4L3NA 3ZZRA 4PWDA 1XTZA 1F2GA 1U0HB 1SI9A 1YJWS 3MM5A 3ISZA 4RW4A 4M95A 3C6TA 2GVDB 4LF9J 4KBIA 1A9NB 4CT8A 4ZVUB 3MM7A 1RU2A 1B70B 2OP5A 2NXCA 4UUXA 4Y65A 1TUVA 5F3TA 2DTJA 4R0JA 3DGVA 4GO5X 1APSA 4UY85 3IR7B 3GG0A 2FJXA 1Y0HA 2MQLA 3ZTOA 3RAMA 3DRSB 3CMAS 4NYPA 1UJ4A 2DH9A 3UCUP 5KG0A 2W9CB 2NSBA 4LR8A 1FRHA 1I94J 3TA2A 2LMIA 1FWLA 2NLWA 2XMKA 4TN2A 3PHTA 4M5KA 3V4IB 1H6KX 1Q78A 1IKVA 1FKPA 3C2PA 2YBVA 1FWKA 5DS7A 1K9MT 2QLBB 2OGUA 3SMZA 2ZNYA 1CJUA 2L9DA 3NKYA 2OFHX 4JI7J 2GAGC 4Q45A 5JUMA 3OTOF 2CADA 3R5AA 4OYBA 1SKSA 2VFUA 5IQ6A 4ETZA 2CPYA 3CCTA 3GZ7A 1OJ4A 4OI2A 1YJ7A 3J81Y 4X62J 2ABYA 2BJ8A 4C6AA 3R97A 4KC5A 4ZS6A 1S6OA 2PE8A 2EKYA 3QIDA 4GKJF 1AFIA 1WOSA 5KFCA 1IKYB 3OXGA 4ZPCA 2XS2A 1VDHA 3LP2A 5HJYA 1NSQA 3W66A 1IJFB 3KJFB 4QYZJ 1TZ0A 1YG0A 1QVFR 1N52B 1U49A 3Q22A 2HNZB 3D5MA 3LUYA 4DG1B 3K8VA 1H2UX 2DY1A 2ZH2A 2IBKA 2OUGA 1KN6A 3SDEA 2YKMA 2ZM6F 1LOUA 1UA0A 4TQSA 2VZ9A 1T3OA 1TMJA 3RRHA 2NS1B 2EFQA 3A8KA 5IV3A 5KFGA 4L6V3 4PXCA 3CB4A 2CNKB 5HLFB 3PJ9A 2QLXA 3MOJB 1OS5A 3RG6A 4NLRA 2KRBA 3FCHA 2DGVA 3KLVA 1NHVA 2HHWA 3LPYA 2V94A 2Y0BB 3HX9A 3B8HA 1FERA 3M6XA 1D9FA 1EB0A 1T94A 4OJHA 5KT2A 3HZGA 3NOGA 4OYIA 1R89A 4IQMA 3DGPA 4OL8A 4ED8A 3NBPB 4NWBA 2HIYA 2EWHA 2VPYB 3B6BA 4RUHA 5KFJA 5KFZA 1P1TA 2AW0A 2JRSA 2DR8A 2CJYB 2OPPA 4YR0A 1SC1B 1MU2B 3O2IA 1UCNA 4L3KA 2GV1A 4NX9A 4LBPA 1R0AA 1XK8A 5A0YB 5GMEA 1LW0A 1H2VZ 2OD4A 4AL6A 1BHNA 2L41A 3KFWX 5K8OA 4M5MA 2DGQA 3RBXA 3UW1A 4ZVQB 1N5VA 2FVQA 3BO2A 3DLEB 4CIOA 2L08A 4DL7A 1Q86T 1DAXA 1CJTA 3SV3A 4CP5A 5ETSA 5MLCV 2XO7A 3Q8RB 4F25A 4LQ3A 4ZPAA 4WFYA 2AD9A 3O44A 3J81U 4ZLLA 1NK5A 1UMJA 1R8HA 3GMGA 2VASA 3LP0A 1H74A 2AKWB 5KG7A 1HKAA 1EKRA 2GGPA 2ZBCA 4K4SA 2JWNA 1G3OA 1YRUA 2EXUA 3GV5B 1ZH5A 4PKDB 3CJ4A 3FZBA 2HNYB 3AXMA 3T5HA 4IO9Q 2YY3A 2VQEJ 5AT1B 1K0TA 2X1AA 1RAIB 5L1KA 3C6UB 4KTQA 4ZMMA 4FXVA 2DCLA 1N34F 3EGVA 2BKPA 3I87A 3R1HA 2CJKA 3G86A 4O44B 4DV7J 1ZTWA 2B9XA 2KVIA 4FF4A 2HWIA 4ZCKA 4G65A 4OIXA 4JI0F 2GC8A 4CLYA 3MOZA 2RDDA 5DG8A 2AT1B 4QU7A 4XTTA 4C48A 2ZH9A 1I3OB 3DDNA 3IC1A 2Z56B 3KMQA 3KJQB 2YKPA 1L3VA 4ITSA 1S1WA 3U02A 4Y28C 4DR3J 1S1VB 1R3NA 2RS8A 2YNHA 2P2CB 1HI1A 4K0KF 5KOWA 2OPQA 4AQYF 5L9NA 4AUKA 2E44A 1ZPVA 4WP9A 4NCAA 1SKRA 1FJCA 2XYHB 4MKAA 1H0HB 2AJ4A 3VCDA 2AYMA 3NCRA 2RAQA 5M2UA 2OEKA 2CQBA 2AEJA 3IG1A 4HACB 4LF6F 5KFSA 4YB1P 4DUYF 4WIIA 4C3MA 2GFFA 3GILA 1NB7A 3L09A 1OPIA 1NDLA 4L76A 3OBIA 3ITHA 1RHRB 2XWYA 5DQGA 2AV5A 5GMDA 1GX5A 3IRWP 2BE9B 1GMWD 5EHHA 4I7FB 2E5LF 2DVIA 4YDDB 3VQSA 3NMAA 3NNCA 1E6VB 2R7XA 1UAWA 2IIHA 4JV1A 2BQUA 4WTOB 4ZJQA 2VBZA 2HQ3A 2XMJA 1S1UB 2ZZNA 1TELA 1D3WA 4HT7A 3QSYB 2YQ3A 3OR1B 2HK3A 1RU1A 1T11A 4B3TF 4DFKA 1YKWA 4C9DA 1N56A 5J2QA 4RBUA 1TK5A 2K8GA 3CDBA 4BS2A 3NAHA 2FGOA 2K1RA 3VAHA 3H0PA 1JLAA 3Q8VA 2RU3A 3UFCX 2VC1A 4B9LA 4LF2A 1JKHB 2B3TB 4DOZA 3QATA 5LOQA 4RU9A 3OXLA 2J7KA 1FDDA 2V9KA 4JI2J 5KG6A 4DL5A 4ES3A 4AXJA 4DR2J 1RT5A 3H5UA 4C8ZA 3KG1A 4J37A 3EXYA 4PWUA 1TV6B 4ED4A 4LFAJ 1BQNB 4CO4A 2CNNB 5DLGA 3VALA 1XMQJ 4NA2A 2XI3A 5KFQA 5CYMB 1REGX 1BQXA 2XLJA 4UUWA 2QTWA 2QJ3A 4QR1A 2B6AA 3UI3A 1LWCB 4M5LA 4B3RF 1NBEB 2PFDA 4BC9A 4DQRA 3IP0A 1S57A 4OFZA 4LRFA 1LWEB 1T7PA 2G2OA 2WOMB 3H25A 3W2VA 3R5JB 1DBDA 2OPSA 4ALZA 4A48A 1JLCA 1M5KC 4LRCA 1RT2B 1TAQA 2YNIA 4DDFA 5KFLA 4DI6A 3H2LA 1FKOA 1HNIA 3M30B 4MK8A 4XDCA 3M32B 1NEEA 5H9EK 2V8GA 1X4FA 3M2UA 2A1BA 2DNHA 3DCAA 2LA4A 4BC7A 2GMJA 4CLSA 3NNHA 4AL5A 3R5CA 4ECWA 1HQEB 3QWPA 2XY6A 5A8WB 4X4TA 5K14A 2J0WA 5C42B 1XMBA 2OO4A 3CJ5A 4RJVA 5AE2A 4MH8A 1GAOA 2OHDA 5LJ3Y 3GIKA 1MWZA 4ILLA 2HW3A 4ZVTB 3GJRB 1DTQB 1BD6A 4ZJLA 4OYMA 3DOKB 2QG9B 3HT0A 1N88A 3RBEA 4J91A 2V8DA 1NSAA 2YPYA 1S0VA 3G8QA 3FK4A 4M1KA 3RGIA 5BR8J 3H59A 2CVEA 1YGYA 1KHWA 5J2MA 4R5PA 3Q23A 3T6JA 2E7XA 2DK2A 4L72B 3IR6B 2V63A 3LO3A 1TU0B 2HS3A 4F4XA 4ECRA 1LWFB 2YWWA 5E33A 2DYAA 1RZMA 1NJZA 1GT8A 4F4YA 3UE2A 3UN3A 2Y8WA 2XLIA 1BWEA 2XNRA 3BB5A 4LRDA 4FYYB 1NKBA 4G1QB 1GXTA 4NXMF 4KGKA 2C2KB 1TK8A 2LQ8A 5I3UB 2E9ZA 5IXUA 1AZSB 3I32A 3MD1A 2FHJD 2O5DA 2EFNA 4OI1A 2HFVA 2L48A 3MF5A 4MKYA 3EVOA 1YWXA 3JSYA 1UEUA 4OZ5A 3DI6A 2W25A 1QTMA 5K8MA 3BQ1A 4I2QB 3QLHA 1TL1A 3ILJA 1YX2A 2QE5A 1B7FA 5KFHA 1FKAF 2QMXA 1EP4B 1NSPA 2BJ9A 1CJVA 1LV5A 2IMOA 1T9UA 1V3ZA 4WU2A 2F40A 5LL6d 1TAUA 2HNDA 2AU0A 4F36A 1BWVA 3MXHP 1FEEA 8AT1B 3BYPA 2HQCA 2IM0A 2EI5A 1NHKL 2BJDA 1CLFA 2OELA 2QLJB 4B3OB 2VD3A 2RS2A 3MM9B 2RU9A 3FFIA 3VQTA 4WZQA 5FD1A 2DNMA 1FRLA 1T8EA 2BW2A 5AXNA 1Q7LB 1V3RA 3RRGA 2HWTA 5D0GA 4MFBB 5EX0A 4J9OA 3THPA 3X1LB 3EWGA 3RRKA 4LBIA 2MKKA 3GU0A 2W2MP 2WZ1A 4JI8F 4C0HA 3HHLB 1NJXA 2LFVA 4DV4J 1AXQA 3M1VB 4IFYB 1FRXA 2G0CA 3OTBA 4GKKF 3BPSP 1TUWA 2WSCC 1ELOA 4ED1A 1JQGA 2W2QP 3GSIA 4DV5F 3CJKA 3K2YA 1IBMF 1YBUA 1C0UB 3MMCA 3RAXA 3R7SB 3JTNA 4KYZA 4IRKA 2GX8A 5KFOA 4RW7A 4F4KA 1VRTA 2MQMA 1S59A 4JI1F 1UEVA 1WTBA 1NKEA 5U47A 1YJUA 2B0GA 1ZAWA 1T95A 2N3OA 2DCUB 4M5NA 3QT5A 3OW2R 5ETNA 3GONA 3MEDB 2VV5A 1RT6B 3JAMY 3NS5A 3ZZZA 3EYZA 4DCOB 2MZQA 3IM8A 2MTLA 4B08A 4LSLA 2XZWA 5GAGI 4EBDA 5C2GA 3CW2C 2CPHA 3E2EA 4QPTA 3MFIA 1SIZA 1GEHA 1X0FA 1HBOB 2R2UA 1LXNA 4H4MB 1YJNS 4NRUA 1AUSL 2MKYA 3OFEA 2BW7A 3OJSA 1XMOF 3TQEA 3A12A 1IR2A 4XPCA 2C2RA 2OKQA 3ZC4A 4PCQA 2R8JA 3UR3C 3GIIA 2GVZB 3VAGA 2QA1A 3DOLB 4YB6A 1RT3A 5DM7Q 3GE9A 3PW0A 2AX1A 3QFWA 4EO8A 2N7YA 1SPBP 1WC5A 4ED7A 2J8AA 2AJ2A 3V81B 3J7YU 2CG8A 2H5JB 4CO5A 3KHHA 3M8ZA 1F3FA 2HFNA 1JIHA 4WE1B 4WF9Q 3SFUA 3G82A 3LW5C 3ZZTA 3OR2B 4FN5A 4PYAA 2PA8D 3RU0A 5A8KB 2J7UA 3TA1A 3CJQA 3I96A 4DEZA 2BR0A 2YWGA 4GC7A 4C8LA 2Z2YB 2I8EA 2HEKA 3RBZA 1RT7B 3CULA 3T1YJ 3TEGA 1TL7B 1H72C 2N4DA 2UV8A 2W4DA 1S4EA 3U7JA 1HBUA 4F3QA 2W2NP 3QFHA 1SUQB 2GMLA 3JS9A 3OTCA 2VONA 4UZBA 1UTAA 3CIMA 4LF4J 4J9VA 4A8KA 1XNRF 2BEFA 3PKYA 2DIVA 4DR5F 4DQIA 5HJXA 2GQQA 4PWDB 3TOQA 3AQPA 3HHLD 3MM5B 1Q8IA 2WRMA 4RW4B 1BC6A 1NKCA 4EMDA 3C6TB 4LF8J 4OYPA 5IOLA 3BM7A 4EFAC 1L3KA 2KM8B 1AW0A 3WX8A 3MM7B 4LFCJ 3FZ2A 3LOUA 4NXNJ 4FYVB 3CJ3A 2UUCJ 3DRYA 2D3O1 1Z2ZA 5EWFA 5KT5A 3M7VA 2CPFA 1PG5B 3L4BC 1X0PA 1JLGB 1FNOA 2DGSA 5K5MA 5J1EB 1PILA 4USMA 2NQPA 1M5HA 4USUA 1R6YA 5IT0A 5KFTA 3O6QA 2DXEA 3NNAA 2MZ1A 4P7TA 4RO0A 3ZNJ1 2JOQA 4ZLPA 3G71S 1SH0A 4ICLA 4DPWA 3JAMU 1UFWA 4Y2AA 2AGQA 1URRA 1ZAXA 4KHMA 2LEBA 3RB4A 3QRPA 1IKVB 1FKPB 2HFOA 4N56A 2WONA 2CPDA 1KVIA 1WKJA 1FNMA 2VH7A 1VBZA 1CJUB 1M5OC 1VBKA 3SQGB 2UVUA 3MEEB 3WX4A 2Y1JA 2FZCB 3PHEA 3VGSA 3M6WA 2MZJA 1T9VA 4KY3A 2W8KA 1TL4A 4HHUA 2FHMA 2P9EA 4ANCA 2O01C 4LR7A 2IM1A 3LQVA 1S79A 1P9YA 5EGYA 4U96A 3U27A 3LP2B 3PW5A 2JLEA 1F5AA 3S8SA 1R8AA 4CLZA 3VAJA 2HAIA 4UY8T 2A3JA 2DNOA 7FDRA 1S5ZA 2AEMA 2HHTA 2W9AA 3OD2A 1SJRA 3G96A 1VBXA 3M4XA 1MWQA 3MTKA 1RB0A 4ZPWR 1ZYQA 1S99A 3KMSA 3L7PA 2ZDPA 4OJGA 3V5RA 1XC9A 3TO8A 2KT5A 1RYRA 3SDEB 2G1HA 2YKMB 2GIFA 4X4RA 2CQ1A 5L38A 3D6TB 3LGMA 4DFPA 4OX7A 4UT4A 3C66A 2CPEA 2XY7A 2MGZA 3I82A 3T1HF 4TQRA 1REVA 3ILOA 2HHXA 3H5YA 4KIAA 1XIQA 4IH6A 3IRXA 4F3OA 3W60A 1M5SA 3PX6A 2IRYA 2V8VA 1RTDB 4DL3A 3W65A 3FVYA 2HGNA 1RBLA 3BH6B 3G8SA 4GKJJ 1WF2A 5J2NA 1UVNA 2OPPB 3TANA 1JNZB 1RAEB 1GH8A 3K7RA 1RACB 3PTWA 1R0AB 4AT1B 5IWAF 3K59A 2I6WA 1LW0B 3N9UC 2VA3A 2DBBA 1L5UA 2EKNA 1QAIA 4J9SA 2LKZA 1UZDA 4USVA 1X4AA 2WB4A 2A2DA 4IKAA 2LVWA 1MMDA 4MKVA 3TNVA 1RWPB 3FMWA 2D3OR 2UV8G 4F8RA 2GVDA 1CJTB 2ZM6J 3MMJA 4ZJOA 4UZCA 2V2QA 4CLPA 1U6ZA 4QU6A 5LM7E 1SJFA 2WVDA 1X9SA 1YBAA 2LXIA 4RW8A 3C46A 1FFGB 4ID5A 1ZTTA 4A46A 1Z1ZA 2FJWA 2MQOA 3GFYA 3E01A 4M5JA 1RTIB 2F8HA 3LP0B 1U7LA 2HFSA 1Q7YT 2GGPB 1Y11A 5C25A 4MJKA 5I3QA 3EJMA 4HH1A 2VIHA 4W90B 2OMLA 2FLOA 3ZTSA 1F5BA 2DKOB 5DDRC 1VIXA 2BRKA 1FESA 3V4IA 3MAQA 5D8HB 4KPCA 3IAS9 1NNDA 5GAHU 3MPDA 1K1QA 3T5LA 3JYTA 2W7OA 2HIQA 2BM0A 1T05A 2HBZB 4Z7CA 2W2OP 4LQ9A 4C98A 2MY8A 3CJ8A 3H90A 4KJIA 2HLUA 1RLDA 1WSRA 3ZZPA 4QQBA 2J5AA 2AP6A 3NEKA 4QR0A 5DDOC 2HRYA 1DTTB 2RDIA 2VQFJ 1V3SA 4O3RA 1FVSA 3UNYA 5BYQA 5ETRA 5B0GA 1BQMA 5AE3A 4BWJA 2QYCA 5ETMA 3LP1B 4IOCQ 1X5TA 2VPXB 3BGFA 3M8QA 4K4WA 5B0DA 1IWAA 4Q5VA 2CDQA 2X1FA 1S1WB 5LSRA 2ILYA 3WQPA 1SBRA 2YNHB 5M2RA 4EK2A 3CO0P 2RIJA 2OPQB 3OJUA 1RWNB 2QX0A 2EK1A 4PQUB 2AGOA 2YWEA 2G0JA 2KYZA 4OZJA 2DGUA 2JVOA 2H5EA 1T9YA 2H48B 2J6UA 5C2CA 1EAYC 1AROP 3I5CA 3Q0AA 2WK4A 2GMHA 3IG1B 4DL6A 5CD4A 4F67A 2HGMA 1IQTA 2QEXS 3GYXB 4OI4A 3MCNA 4YMEA 1DQAA 3C15A 1O5JA 1RAFB 1HA1A 1P1LA 4X2BA 4JBCA 2CIMA 2V8PA 3ITHB 5T7LA 1FI4A 4URQU 3DOMA 4YOEA 2DY9A 2EW9A 1HL6A 4TKTA 3IFEA 2MLZA 1U8SA 1PAEX 1NLKL 2F7VA 1BXNA 5I42B 3MUTP 2XULA 1YRTA 4CO0A 4JI0J 2FHKA 1Q4RA 3ZXWA 4NE9C 1Q5YA 5J2QB 1HMVB 4QIGA 4B9SA 2C42A 2RQ4A 2Q6BA 4GRSA 3G87A 2H65B 5ETTA 5GAEI 2YX7A 3EGWB 1U2FA 2K1RB 5SUHA 1A0OB 3UD5A 4ELTA 5A0YA 3VVUA 4LUBA 2CG4A 4K0KJ 3IWXA 2V4JB 4IR9A 3MPWA 1FHTA 3U1NA 4ENOA 1VQ9S 1F9FA 3CMQA 1NK7A 4U9RA 4ZP7A 2V0NA 3WC2A 3MUVP 3DLEA 1QJHA 1VK3A 3CJ2A 3W63A 1RT5B 4WKYA 4C3LA 4LF6J 2QA4G 4JV2A 1TVRA 2DNNA 3T3FA 1UVMA 2B43A 3A13A 2FVSA 1WD6A 1LQ9A 1UVLA 4PPDA 3QYYA 5F41A 1QSSA 3VTIA 4RW6B 1JJCB 1MNEA 4TY8B 4QWAA 4JI5J 3I0RA 4E98A 5HVHA 2JJ4D 2DNZA 2CNOB 5H9FK 2E5LJ 2Z4PA 3BSAA 3FDSA 3SSSA 3HHDA 3MAHA 3IS9B 1KDNA 4HLBA 2IA6A 3CCVS 3TI0A 2HNYA 2FZGB 3MCOA 5B08A 3V4MA 2FC8A 2QA4S 3K5LA 4B3TJ 2E66A 1X8DA 4P2SA 1KLMB 3W2VB 5E41A 4LFBF 3UN2A 5KFFA 3RW7A 1JLCB 3UD3P 1IVZA 4TXSA 1N4LA 1S10A 3PV8A 3M9MB 3QT7A 2BBEA 3D1HA 4C11A 1L3UA 2OFGX 4PG7A 4U8YA 1YRXA 3LALA 1HNIB 4OV6A 3CJRA 3PRBA 1VJWA 3TAQA 2DHXA 1RXOB 5HVGA 1S9GA 3M2UB 3UCZP 2UVVA 4X4VA 4OV1A 4H54A 1KNZA 4ZVFA 3AA8A 3AOCA 4C97A 2AMCB 4OI3A 4M5HA 5K14B 2OTJS 3BYRA 2OEJA 4GVLA 3SSQA 1NUEA 5KG2A 4F04B 1WG1A 3ICLA 5JVHQ 3UDEA 4FVCA 4Q2MA 2ZBPA 4ILRA 1UETA 4YR2A 3AD8C 3MMAA 1WC3A 4B9VA 8RUCA 4B3RJ 4NLXA 3O5TB 2QRRA 3GLJA 2EC0A 5B0CA 4R5PB 2K2PA 2IY5B 4HACA 2ROPA 1YJTA 2UXDJ 2ALYB 4TLRA 4OLPA 3WDOA 2ADBA 2DR7A 3ZTQA 4OZ0A 3L3CA 4DCPB 1FX2A 4F2RA 5DQIA 4KV8A 3R8YA 1S6QA 3ISND 4O23A 4B3SF 3KK1A 1L3SA 5IT9Y 1H73A 5DZ6A 3P5TL 2NYIA 1FXDA 2R7OA 3TAPA 4P7VA 5HANA 2YKNA 1QSYA 1PBUA 1KP6A 3QJLA 1ZOTA 1NJYA 3KHGA 1WSVA 1S4FA 2XYPB 3CEDA 1PYTA 5F0WA 4WK3A 1C0TA 2RDJA 2LQ9A 1VR6A 4M94A 1FD2A 4EZ9A 2CJXB 1BLUA 2IVYA 1U0SA 2KJVA 4YY3F 3R9LA 3UN5A 1SL1A 2ZUAA 2CA9A 4QW8A 2ZH5A 3QLHB 1TL1B 2CPXA 1C1BA 4CLTA 3GV8B 2ZJQQ 1RTZA 5HQMA 3BR8A 1JKHA 3CMES 1Y4ZB 1IBLF 5CA5A 1CJVB 5GADI 4FNIA 2HNDB 4PAAA 2W4PA 3HFVA 4EGLA 1JXLA 4LF5F 3M2VA 1BQNA 1KQKA 2ASLA 2IFXA 4NL5A 2Q43A 2RHSB 3R3TA 5M2PA 2HVEA 1OQ6A 1D8YA 4P2FA 2CQCA 2DPIA 4IRDA 4KO0A 3HHKA 2DJWA 1EZZB 3TEHB 1R8PA 2H9ZA 5KFEA 1LWCA 2W7AA 3I31A 3BPDA 4NLDA 1YITS 3G2XA 2Z2LA 1IBKF 2LXFA 2KT3A 1XNQF 3GTYX 4NXMJ 3HKWA 1L3TA 3N01A 3K89A 2QZ8A 2DR9A 4K2JA 2KFZA 4FKYA 1B0VA 5L39A 1YHQS 1SJ1A 3VWSA 4EEYA 1LFWA 5KT3A 2G1DA 2K3IA 2OJ3A 2OSQA 2V6AA 5KFUA 3PJWA 1JLQA 1WHWA 3EZOA 2AGPA 2CQIA 1PJ6A 1B0TA 3BSNA 3SCJE 3GR1A 2GHVC 4FPRA 4DXLA 1JB0C 3CJKB 2G13A 2MKCA 1HARA 3MMCB 3CT9A 3FSYA 2J76E 4MT1A 1M1KT 2IYGA 3M30A 4RW7B 1VOMA 3M32A 1VRTB 2V2ZA 3W3SA 1PYOB 2C2MB 4ED0A 5DGAA 1TKZA 3OL6A 1DURA 3UR0A 4IR1A 2NXUA 3DRXA 4NEZA 1HWLA 1CULA 1FJ7A 4ECTA 5FLXY 1N5YA 5IT9U 2BKNA 4QW9A 3DFEA 4NPOA 2RSQA 4JB8B 1B3TA 3ZZYA 2FVCA 2IJRA 2OIHA 2M8HA 1S6UA 4HVZA 1DTQA 2VC0A 1SH3A 1RT4B 2D3UA 2PGCA 3I4PA 4P9SA 1S7HA 1AB8A 4NMXA 1M5VC 4Q8EA 2XQCA 3X3UA 4U67Q 4J9MA 1RYSA 4PYDA 2QL7B 4B9TA 3M6UA 3LWMA 4NZ7A 3SYZA 3B82A 1X4GA 3G6ES 1XEZA 3PYGA 4OHVA 2Y8YA 2MSSA 3P96A 1JXEA 2DGXA 4HHHA 4J9QA 2I9SA 2X3DA 2ALZA 1LWFA 3K5NA 4GKKJ 2FGCA 1RCOB 5L46A 4I4BA 4QIVA 1VIOA 4URGA 2MPUA 4DU8A 4NCBA 1IBMJ 2B51A 3TJ8A 4AL7A 3TAMA 2CQ0A 3CJ0A 2QV6A 3CUNA 4JI1J 3LGHA 2FDNA 1YJ9S 4I56A 2IAJA 2ZWOA 4P6QA 1Q0NA 2BUNA 1HBUB 3GJQB 3HM9A 3BR9A 2Z2ZA 4Z2XA 4CH0S 3R5DA 3GJTB 1U1LA 3KK2A 3NL0A 2QLFB 4ATNA 5A6PA 4NRTA 2BJ7A 5KT6A 3RW6A 4WTYA 3FEXB 4IH7A 2RRBA 1AYEA 4FPIA 4N8NA 4EYIB 5D4NA 3IBCB 2N82B 2VJVA 1FF2A 2GJ2A 5LMUF 3D1OA 1XMOJ 4WKRA 1RTHA 1NPRA 1TKDA 1SIWB 3L9ZA 1WELA 1S76D 3GJSB 1QTNB 1F5CA 2M52A 2BACA 4ELUA 2ZE2A 4ECVA 2VA2A 4B3OA 2ZBIA 3F56A 1X4CA 1YTYA 4ZITA 4DUTA 2ZHAA 3MM9A 3I55S 4H4OB 1RWWB 2MXYA 1S0NA 1KKHA 1D8ZA 4WFBQ 3R2CJ 5FLXU 2SXLA 3LPEA 3QSIA 4QYRA 2OTLS 4W92B 2UUBF 3K58A 2R7WA 4V19J 3DYAA 2HVIA 2Z57B 2F8EX 2X3GA 3K0JA 2WONB 3QGIA 2IMWP 1OSCA 3OFGA 4K8RA 4LT6A 2KHCA 5K8PA 3J7A1 3NWGA 1O8BA 3MPYA 4X66F 3DM2B 4HI2A 3POTA 1C4AA 2B5JB 1XNRJ 4DR5J 4WYLA 4MTPA 5F8MA 2G2ZA 4KSEB 2V9WA 4WP3A 2O67A 2ZOGA 4F02A 2B4VA 5GVQA 4QIFA 3UPFA 4MK9A 3KG0A 2MQPA 2D69A 2D7SA 2XMUA 3EXCX 1PAUB 2XTJP 5L9XA 2C2DA 2WVFA 1VQYA 4FZVA 4KHPF 2RQMA 3M6VA 4HI1A 4YHHJ 1KTVA 1DLOA 1NB2A 4EWTA 3CCJS 3FKBA 4NMLA 4XAKA 3OVSA 3EICA 3CSKA 1IWGA 5ETOA 1S1XB 4PG8A 3DLGA 1MN7A 4C7QA 4KGZB 3KLEA 4DSEA 1WI6A 4DPOA 1RISA 2ZNZA 4O3PA 2GJFA 4WP8A 2EG2A 1TP7A 2BKOA 1Q8BA 3MMBA 3BO4A 4OHYA 2QSWA 2X51A 1GXUA 1Z4UA 4KGXB 1YZ7A 3OL9A 2M2BA 4KPYA 4USJC 2COLA 4YQWA 3JQKA 3PDNA 2Z30B 1FRJA 2VG5A 2RVJA 1ZA2B 5CAAA 1DJ0A 2ZDOA 5HI7A 2ZITA 4WU3A 2MGZB 1HWJA 2O1PA 1YK9A 4DWIA 1REVB 1M0SA 5B09A 4A8FA 2GVZA 4NLVA 3TWZA 5EX3A 1FFWB 3IRXB 1HLWA 3ET6A 4QCLA 1WEYA 3V81A 1IM4A 1SL0A 4O4RA 2LXUA 4YR3A 2XO6A 1LFPA 2PN6A 3FQLA 4UTGA 1WHVA 5A8KA 1I1GA 1NPPA 3UDLA 3BGOP 2P9GA 3MZIA 2W24A 3R7NB 4KRWA 4X4UA 4HYKA 3T5JA 4FDFA 1X31C 2ZH6A 1H3DA 2HGLA 5J2NB 4FYDA 4X4NA 4FF1A 5E3RA 4DCJB 1U6FA 2ZFHA 2KT2A 3C19A 3OXFA 2EFOA 1OMSA 4RNFA 2GIRA 2J6TA 4OJ3A 5KFKA 1HNWF 4QR2A 2PC6A 3AA9A 3A1YG 5LXRA 3JQJA 2OH2A 4FBTA 2DT9A 1WI8A 4A8WA 3W1YC 4BDPA 4MKBA 4B3MJ 4Y6IA 4GO7X 1HBNA 1J2VA 1AUDA 4M5GA 3ZTRA 1SB6A 2WVBA 1Q81T 4I64A 3T9ZA 1TQLA 2ZJPQ 3EZ5A 3D3CJ 4F4WA 1WC6A 2BQ3A 3PIOQ 1NM2A 5AXKA 1MW7A 3PYEA 3KWMA 4DPXA 2HBQB 3J7Z5 3KTQA 3RBDA 2XMVA 3PY8A 2CPZA 4RW8B 3T1HJ 3ONQA 5KFNA 4ID5B 3TJAA 1N5TA 4O0NA 4OYZA 2J0QD 3AH6A 3E01B 1JNRB 3IR5B 3NMRA 1ZM2A 4ETXA 4PXDA 1HHSA 1SH2A 2V2VA 3J7AN 5C25B 2YWHA 5AXLA 1VQMS 3KKFA 1JLGA 1OYEA 5J1EA 2WSEC 5DM6Q 2CZ4A 3FBEA 4IUFA 3KG4A 2R4FA 3I56S 3FBFA 3FEZA 3I5AA 4P10A 3PACA 2VB6A 2MLYA 1KD1T 3JYTB 2PSZA 1S49A 1T05B 1R0BG 4LIRA 4HHJA 1KR4A 1UVKA 3SQGA 2O66A 2BXJA 3MEEA 2PIIA 3L95X 5ETKA 5AE1A 2M88A 1D9DA 2VQEF 4NZ6A 5IQQA 4CTAA 2MZTA 3ZZ0A 3SI8A 2JEFA 1HWIA 3W8PA 1BQMB 2H54B 4IOAQ 4QOTA 4YN3B 2ZJRQ 1GTHA 2QGFB 5J1NA 3M8QB 3G6VA 4N8OA 4RBVA 4RPFA 1JXVA 1KBRA 5DJBA 2W8LA 2WHOA 1HBMA 3ULHA 5GAGU 5CD4H 3AODA 3GFZA 4MIAA 3MPUB 1N48A 1P9QC 2HLTA 1VQ5S 3IWLA 2ZZMA 3W7BA 4M63A 4PZVA 4DSIA 4Y34A 2MZRA 1RE1B 1UZHA 2ZBRA 5I4MA 4NI2A 1RBOB 2NREA 1YVFA 2UU9F 1HHQA 5KFYA 3ZFVA 4DR3F 2HKEA 2VPWB 2IM2A 1H98A 2E1RA 3C15B 1FA0A 1Q8LA 5T7LB 4KE5A 3M8SA 3DOMB 2OLWA 3ISNC 3H8YA 1X4EA 1R43A 1G1XA 1RSCA 3UVJA 4DV3F 4PRFA 1PYSB 1RTDA 2NPIA 1Z2LA 3HVTA 2QT7A 3BN4A 4P2XA 4LF7F 1OPZA 2IDEA 3EZUA 1S97A 1HIYA 1K44A 1HD0A 2GW8A 2XG8A 1UP1A 3D0HE 4P74A 2B9WA 2CDRB 4CYUA 2E5GA 1H38A 1NZ8A 1RP5A 3HPOA 4OZ2A 3HO1A 1QY7A 1S6PA 1VQLS 3L7OA 5LSLA 2MMYA 3IWNC 3FSXA 2HFUA 1LK7A 1VRQC 3N0VA 1XN9A 1CEZA 1N5QA 3D66A 2VPZB 3O3LA 3LANA 3WC0A 1N54B 2IHR1 4DR6J 4NASA 2N3LA 3OSPA 1WC0A 3M9NB 4X4SA 2ZC4A 1KRPA 4CM0A 2XC9A 4LMZA 3EGZA 1B4SA 3P8BB 4I0WA 3QT6A 1TVRB 1D9AA 4ZIWA 4ZHRA 1V9OA 1CSJA 4PUOA 4EYHB 4UQGA 3IAM9 1Q95G 4N41A 4NLWA 2OI2A 4O3SA 2DD8S 3C16A 1RTIA 1LKZA 1VMBA 2XHWA 4MK7A 2JX2A 3I0RB 4IFVB 4JI2F 3HD1A 2MKJA 3QGPA 4EUVA 3H5SA 5E5NA 1RI7A 2HHSA 1QE1A 4LFAF 4HKQA 3HXMA 4OHXA 4DX5A 1N6QB 3DXBA 1YDLA 1SQFA 1XMQF 2YX4A 3BQ0A 1TL3A 2ZD1A 2LP4A 3CDWA 2VF3A 2PO4A 3N28A 3BKFA 3IBWA 4PXEA 2R3VA 3VF0B 4UOCA 2FYXA 2KRRA 1SQGA 4C11B 2F9JA 2Y1IA 1UL3A 4RZRA 5CXTA 1UWAA 3MECB 3J7YI 6AT1B 2FUG9 2V50A 2I5JB 1C1CA 4JYAF 2A6OA 1DTTA 3RTVA 1S12A 1A7GE 1S9GB 2BMBA 2MKSA 2R8IA 4OX6A 1VLOA 2J9DA 1RAAB 1UVJA 2JHEA 1PJ5A 4K59A 3LP1A 5G4DA 2RUSA 1O6XA 4KH0B 2RHQB 4KB7A 2ATCB 3KUGA 4HTJA 4WIQA 1FRKA 2CZ9A 1S72S 1URNA 2JEJA 4C0BA 2BOPA 4YB7A 1UW9A 4OZ1A 3MMAB 2W01A 2R9LA 2XM3A 5FDLA 4PQUA 1C2PA 1IR0A 2PMHA 1N0UA 1U24A 1LNQA 2FY8A 8ATCB 1VQKS 4ZVPB 1Q53A 1MMNA 1IKWA 1RT1A 3OHBA 2MLXA 5KFXA 3UWTA 1LWXA 4N7TA 3QWUA 2NXNA 1NRKA 3QNWB 4LFBJ 4RX6A 2V68A 2WBRA 5HMZA 1I5OB 3P3DA 2JFKA 4RUAA 2VODA 1AA1B 4KV8B 3C3LA 2OEMA 1S6QB 5KTQA 1Q1KA 3V6HA 3KK1B 4HDGA 4K2XA 4ZCMA 5B0BA 4DPTA 3KLFA 4HH0A 3D3BJ 2YXLA 5I42A 5D15A 4DV1F 2YKNB 3KK3A 1CC8A 3C8YA 4YB5A 3NRBA 4P75A 4NYZA 1VQPS 3KDNA 2WVEA 1RWMB 1C0TB 4DN0A 1YZ6A 3MI7X 1HMVA 1VQ7S 3JSBA 2AHOB 4N77A 2GO9A 4D3GA 2LU1A 4RKUC 3DLHA 4ZA1A 4E2FB 2H4YB 5F8IA 3TUZC 2DGWA 1C1BB 2V4JA 3OT9A 4QPXA 4NYOA 4TY9A 2GHWA 1T3NA 2KKHA 3T9NA 1ITPA 2DISA 5IV4A 5IS2A 2DRAA 1JWWA 2PT0A 3BKTA 3QIPB 1RKIA 4X4OA 5DLFA 2WVCA 4WYWA 3SV4A 3M2VB 4TU9A 2DRBA 2ZOFA 5DDPC 4AFFA 3F44A 1CS4A 3ENAA 4RW9B 1RK8A 4KO0B 2M8DB 4RW6A 3W8GA 4FP9A 4TY8A 3M8PA 4JI3F 1T9WA 4B3SJ 4IDKA 3TARA 1JLFA 3ZTPA 3PRVA 3PG9A 2AZ3A 1X5SA 3Q89A 2EBEA 3NGTA 1SV5A 4WFXA 3IS9A 3BEGB 1DZ5A 1XR6A 4C0OC 3SSRA 5ETVA 1JLQB 1VYAA 4KKOA 1SJQA 3K5PA 1KLMA 4H4KC 7FD1A 3V6DA 2ZOMA 3MEGA 4DQPA 4ERDA 4DR7F 1PCAA 5HBMA 1HPZA 1WWHA 3J80Y 4RNNA 4YY3J 4ZVEA 1F2HA 3KNGA 1J27A 1SKUB 3PR4A 2FY1A 1XERA 1YJVA 2QLWA 4LVNP 3MTJA 4TNOA 3PX0A 2GA7A 4RBTA 4NA1A 3VV2B 2F4VF 1IBLJ 3DRRA 3B4DA 1B99A 1ZAVA 5CHCB 1TKZB 1M5PC 3AJ1A 5LXYA 4FNHA 1QM9A 1CULB 3DHXA 2P6SA 2GHPA 4Q8FA 3ENVA 4LF5J 1N5YB 3G8TA 1VHFA 1KVJA 3Q8YA 3NCPA 2C3YA 2VKZG 1PSDA 3W62A 2QSFA 2HQDA 3Q8PB 2PD1A 4J5OA 4J9NA 1VK8A 3HHEA 1RAJA 3VGVA 1IBKJ 4X65F 1XNQJ 2M9KA 4OI6A 4OZNA 4I2PA 2HWHA 3S6EA 3F41A 2PEHA 2DRDA 2ZBQA 4K4VA 1X9WA 2Z0GA 1FTRA 5KFVA 5ETLA 3TX8A 3K17A 3D9BA 4HT5A 3M05A 2L9WA 2R7RA 4ZVHA 4JUZA 5CCLA 4K5SA 1NDPA 2NUHA 2RKIB 3N6LA 2XS5A 3EVWA 2H5IB 1U1NA 4RWWA 2XHCA 3TAMB 2JSXA 3N5BA 1RBAA 4KGMA 3PR5B 3B78A 3CF5Q 4UOHA 5C24A 2NYHA 5GAEU 4C2MA 5F8NA 3NWRA 2XMAA 2CQGA 2IAJB 5KG1A 3BREA 4G3IA 1ZM4A 3GIRA 1U6BA 4UOFA 3AXKA 3MGJA 5HSPA 1EARA 3TW0A 3PM9A 3Q24A 3KK2B 4RLEA 3AOAA 2HFZA 1WC4A 1U47A 2LEPA 2W1BA 1H7XA 3FRZA 3HP6A 2LDYA 1KHVA 4XPEA 3D6MB 3BKUA 3CE8A 2WTFA 5J2PA 5BYSA 4TU8A 2G2YA 3J80U 2LLZA 3TZXA 1B0PA 1YI2S 3S1TA 1RTHB 3DLBA 4LF4F 5HP1A 4DV0F 1FXLA 5F8JA 3QRRA 3UNGC 2ZE2B 1QDUB 1UW4A 1KC8T 2GIQA 1U02A 2KTQA 2MKHA 1A6LA 4XDDA 3I0SA 4Q43A 4USHA 3QO9B 1WEZA 2AZ1A 2ROGA 4B17A 3MD3A 1S77D 2YPZA 3D6HB 4LFCF 3AD7C 3CCZA 1R8CA 4NXNF 3N6NA 3DN9A 3EDQB 1OWXA 3DYAB 3R5GA 2HVHA 2UUCF 5FJ4A 3OUYB 4DHVA 2IJNA 3LWLA 3ZO7A 2ILZA 5L8RC 3R6LB 1NK9A 3TA0A 2KHDA 3H2VE 3GWCA 5KAKA 2AF6A 1Y3KA 3POTB 2L3MA 3G4SS 4CDIA 3H20A 5LSOA 4AD6A 2HHQA 4F4AA 1ROFA 3JTPA 3A3PB 2H3EB 1QUPA 3MR7A 4FS1A 2FLLA 2LYVA 2MZSA 3EUNA 4DR1F 2AYBA 4IG0B 2PFFB 1OSDA 3NP5A 2QIFA 2BV3A 3NGKA 1WOOA 2AJFE 1DLOB 4Y0FA 2WAQD 2DXFA 3THVA 2UUTA 2I2YA 1K8AT 3H7HB 4DBQA 3BN7A 3DLGB 4PG4A 3KLEB 2QC3A 4CH1A 2HZAA 5IZHA 5F3ZA 5I3PA 3BDEA 3VR1A 1MSWD 1TKTA 2ZH1A 3MMBB 2DR6A 2IJFA 2R2RA 1DARA 4CLUA 4USIA 1UKUA 1RT4A 1WG5A 1QD1A 4FXDA 2XZTB 1Y7PA 2K06A 2EVZA 3HMJG 3HJFA 4O3OA 1XR7A 2VG5B 2UUBJ 3K8WA 3DC2A 4ZP6A 3TZZA 1UWBA 2XSFA 2WW8A 3CCUS 2RUGA 4NLSA 3WZ0A 1GXLA 3SZ2A 3GIJA 3FRYA 3IBFB 6FDRA 3AHPA 3DKDA 5G0RA 2A6MA 1HW9A 4A8MP 2AYEA 4K4TA 4X66J 3M2RA 3JSMA 4RUBA 4DJBA 4K5RA 3ET6B 4OX9F 2UZAA 1IBCB 1Q5VA 4PWWA 1FK9A 1U1OA 5HMXA 2GZOA 1FEHA 1M1HA 3NGDA 2HRUA 4ZPTR 3HCXA 2DGOA 3RUBL 2XYGB 4KHPJ 3TP2A 1G6BA 3VZIA 5E7OB 4F3MA 5CH7B 1QAJA 3DHWC 1S0MA 4B9MA 1FFSB 2MJUA 2P6TA 5GADU 3Q2TC 1CG2A 1HBNB 4DF8A 1N32F 4DN9A 2XB2D 3AY0A 2B9EA 1HW8A 4IOBA 3A8EA 1ZPWX 2EFGA 2OD6A 4OYXA 1J5EJ 3GIMA 2EG1A 4NOHA 4RWXA 1GFWB 4R8UA 2CQDA 4EBCA 3HSDA 2ATLA 1MROB 2B9YA 4YS2A 3HLUA 5E3AA 3Q8SB 2KN4A 1HQ2A 1U1QA 2CUYA 2EK6A 1TR0A 3RB0A 2M70A 2KFYA 1R0CB 4KH1B 3KLGA 3R7BB 4F2SA 1E6YA 3NG8A 4ZOSA 5EWEA 3VAIA 3CCLS 1FX4A 2FLNA 3DLLQ 4WXOA 1HWUA 4I6YA 1UFKA 4JV5F 4H4OA 1T9XA 4NLUA 4ZVOB 3MAAA 2F65A 4ZLNA 1ZBTA 2XY5A 3HHNB 1EIYB 3E51A 2UXCJ 4WFAQ 5CYQA 4JI6J 4ECQA 5IM0A 2FQQB 5KFAA 4XIUA 2EEYA 5ITHA 2BJEA 2DNRA 3Q2SC 4N5SA 4DU7A 3DLKB 4ZP9A 2Y9HA 3HT3A 2BABA 3HKZD 1T03A 3DM2A 3PO4A 2XGQA 2RQKA 1WC1A 3N6MA 1HNWJ 1ZETA 2KVQE 1NJWA 2B5JA 2QMWA 4ZLJA 4ZVGA 4DV2F 3V6JA 5HQ8A 2RB7A 4OI0A 2DPJA 5L1JA 1V5IB 5K9FA 2CJ9A 2CRLA 4C8NA 4QWDA 4KHRA 4CTAB 2VDIA 3J7ZT 2IDLA 2V8HA 3SXLA 2POKA 3CDAA 1DRZA 5DGBA 4B9UA 2F9DA 2JVRA 3LF0A 2QL5B 5CZXA 1RUSA 1BMQB 3PW2A 2V69A 3TX0A 1HBMB 3PZPA 2RE1A 3EMTA 3SIPB 3F73A 1S1XA 2RF2A 4XK8C 2AEFA 4NZ0A 2VQFF 2E9RX 3D7SB 2AJQA 1HNVA 1QLNA 1Q16B 1U48A 2PI4A 1FDNA 2YKAA 3G6XA 1VFJA 1Y3JA 4ECZA 4NI2B 2U1AA 2F3JA 3IO1A 2B4UA 2BE2A 5A8RA 5THWA 1U1MA 3RAQA 1RADB 4JI4F 2E5IA 2WCXA 1KFSA 2XI2A 1IM6A 5HROA 5B0EA 1NH7A 4Q0BB 2FD2A 2E1AA 1CBKA 2JLGA 3OTOJ 2D74B 5DETA 4QYZK 3UVJB 4GVBA 5IFMA 2NUUG 1VISA 5KFRA 2R7TA 1W25A 1N33F 2UVRA 3HVTB 3KJVA 3M9OB 3KLIA 2V2KA 5E2QA 1RWVB 4OQJA 3CC2S 4FF3A 2G0IA 1NSKL 4CYUB 2E5HA 4U6PA 5D4LA 1WUUA 3MR5A 3ENWA 5DZ7A 1SJ4P 3BJYA 4N47A 3MM8A 4I69A 1PC5A 1S6PB 4DSJA 3C14A 1IXKA 3NAIA 1QVGR 4I67A 1R27B 1FT8A 1EQMA 2CVIA 5IT4A 2K7JA 2EFPA 2HRTA 4NLGA 5KFBA 2BM1A 3W5YA 2DHSA 2D9PA 3AFGA 1VQOS 1HR0F 2IVMA 4G1IA 1NH8A 1SVDA 2G9OA 1F9EB 2ZC3A 1K1SA 2UU9J 1SJ3P 2E1PA 2IA0A 3QRQA 3MURP 4ZHRB 1HQUA 4PUOB 2VHGA 2EPIA 2JH3A 4BLGA 3N5FA 3C16B 3LAKA 2FJEB 1WORA 1VQ8S 4ZCIA 2ACYA 3CGIA 2WSFC 3O1LA 5IC4B 2BRLA 1VGYA 2MHNA 3EX7B 2XSJB 4DV3J 2A0FB 2HURA 4A8OA 4AXIA 3W64A 1TL5A 1F6TA 3LTOA 1QE1B 3MDFA 4D3HA 4CO1A 1EJ7L 4PABA 4LF7J 4KT0C 1RHUB 1TL3B 2ZD1B 3RZAA 1RTJB 1RHQB 1U45A 1EETA 4XO0A 3I6PA 1XWLA 4JI5F 2R7VA 4FS2A 1M90T 3OPKA 2YNFA 4QIWD 5C7PA 2DNYA 4ED3A 2YKQA 2ZHOA 2ERRA 2XNQA 1RAOA 1C1CB 2NPFA 1F1BB 2VJUA 2MHEA 5F8GA 3CC4S 2KU7A 1KVKA 2NZCA 4BBYA 1OY9A 3VAMA 5H9FJ 1KWMA 4CCHA 4R25A 4K7QA 3T6BA 3UQSA 4MMOA 4OYOA 2G4BA 2NCKL 1GNKA 1BUXA 2R8HA 2VFRA 4UW2A 4ED5A 3P4UB 1RHMB 2M5YA 4CRJA 2MDAA 5FDLB 1U09A 3RYLA 4F0HA 4DQQA 4G6VB 4EBEA 4OZLA 3DRPB 3DXSX 3M8YA 3FQKA 1IKWB 1RT1B 2JLFA 4DS5A 4USTA 2B8PA 2DHAA 2JDJA 2KH9A 1RWOB 4BWMA 2KI2A 4EZ6A 2MQNA 3D0IE 4I6WA 5C5JA 3PKMA 4LRAA 1U4BA 1N34J 4NLOA 4C8MA 3KLFB 1EQ0A 4JYAJ 2UUWA 2E7WA 4KFBA 1HFEL 4DLGA 4MIWA 2AJ0A 3KK3B 4NCGB 2UXDF 4FYXB 4F50A 1ICEB 2HMIB 4OYAA 1KS2A 2ZVSA 4Z7YA 2AJ1A 5JXSA 2DIUA 2R7QA 1X5PA 1VC6A 4LSNA 4WJBA 4QBUA 4I68A 2VBWA 3EDRB 1P6TA 2HYIB 1KTQA 3BGRA 2HS0A 5KOXA 1MLAA 1NXIA 4WFZA 3GP9A 3PYFA 4DL2A 2ASYA 1PGZA 5KFMA 4AQYJ 4LR9A 1NK8A 2KYXA 2BJ3A 1MG7A 3UDVA 4F0KA 3CD6S 4IO1A 5AJ3F 2PEBA 5RUBA 4WFNQ 4DUYJ 1NK4A 5D78A 9ATCB 2R42A 1S1TA 3AJDA 1CS4B 3OLBA 2MKIA 1BGXT 2B7BB 2J9DE 1HNXF 3PFOA 3P45B 1N8RT 1I6JA 4IFVA 2DHGA 3M8PB 4DUZF 1FDAA 4IDKB 4OMFG 1JLFB 3AAWB 4ZIVA 2ZKTA 4WZMA 4AYBD 3H4DA 4DV1J 2XMMA 1SV5B 4ZDNA 1N6QA 1JLEA 1YSJA 1Q8KA 3PFEA 1CQNA 2IYIA 2J0XA 4B02A 4KKOB 2CQ3A 1KQSR 3V6DB 3MEGB 3I5BA 2EC2A 5ETQA 5HBMB 1P27B 4FVMA 1HPZB 2CQ2A 2Z58B 5JMNA 5E0OA 3CD7A 4X84A 5D0EA 1ZZFA 1CPZA 4PXBA 2HZVA 3MECA 4PG5A 1HI0P 3M8RA 1XR5A 1PC4A 2I5JA 3DRRB 3SCLE 5ETPA 1ZA1B 5A76A 3VGUA 4GMKA 1HYSB 3US5A 5CABA 1NMEB 4P52A 3FCVA 2DO4A 2KJWA 1RGVA 1FRMA 1O51A 1N36F 2LDIA 2UXBF 4DR4F 3TQ1A 2GS8A 4ED6A 1NU4A 4JI3J 3EPGA 2Y1LB 4J9RA 5LJ5Y 4P72A 3P6YC 2VG7A 4GC6A 3B54A 4I2PB 2DEJA 2M0GB 2E5JA 2FB0A 1UJ6A 2J9CA 4ZPDA 3PCOB 3AB2B 2CPIA 3I4HX 3K57A 4OLOA 1IKXA 1F3VA 4LF1A 4A47A 4DR7J 3D2WA 4AE5A 2UUAF 4F0MA 1VC5A 3BV8A 3GV7B 3GR0A 5HMYA 5F9NA 1IN0A 4K50A 5DG9A 2YNGA 5J1PA 3K5MA 3R5BA 3OFHA 2HHHF 3BS9A 2F4VJ 4DPYA 3OHAA 5C24B 1KEKA 2VL1A 5MAOA 2U2FA 3AJ2A 3RJMB 2YH0A 4KQZA 1WKKA 1DHMA 3OTEA 1OYDA 1T02A 4ANEA 2CQHA 2N7CA 4U95A 5H1SV 1C4CA 3M8WA 2OPRA 4U7UK 1FNXH 4M5IA 3CDUA 2HQGA 3HHLC 5J2PB 5DDQC 2KXNB 2P9CA 3QZ8A 4WK1A 4J9PA 2O3DA 1RWXB 3QIPA 2ADCA 1X60A 4X65J 1YLXA 2CWKA 1HNZF 4P71A 1X4HA 1U1KA 2PMZD 2QA2A 2GNKA 2E1CA 3AB4B 5HP1B 2YVSA 5D6GA 2Y3YA 5KG3A 1NCLA 2XLKA 3OL8A 4FKXA 5KFDA 1H2TZ 1VI7A 3GPAA 4H4KA 1VQSA 1UJ5A 2BX6A 3PW7A 2A18A 2IBOA 4RW9A 2GQ2A 3CCQS 3R2DJ 2BJ1A 5LMNF 3I0SB 4LVOP 4J7CA 3QMQA 1PKUA 5A2QY 3KXDA 1MWYA 2HHPA 2BA9A 2HVZA 1H7WA 2UVWA 3W2WA 3HI9A 4C4WA 1SXLA 3WIUA 4ECXA 1CJKA 2XWXA 3OTDA 3DNCA 1F60B 3NS6A 4DZ6A 1R7IA 3NXZA 3MCMA 3AQOA 3W61A 4E0DA 2R8GA 1JJHA 4TVAB 2XMWA 1FD8A 2ASDA 3EVMA 4CO2A 1U25A 4ZN3A 1W2BR 2ZEJA 2P5VA 3HVRA 3H40A 2D1CA 2QL9B 3T19A 1RHKB 3S7RA 3GFHA 5DO2A 1SQEA 4DV6F 2BZ2A 2MEWA 1QUVA 4DFJA 4J9KA 2AWZA 4S0MA 5KG4A 2R2TA 1NAQA 4CWBA 3PXGa 4DSLA 3W5ZA 4L74A 5HMWA 4DV0J 2W9BB 3E8OA 3DLJA 3CPWR 2XZDB 3DMJB 2V5HG 1UEKA 2FPHX 1N5SA 1TKTB 3H42A 3MM6A 7AT1B 2X1BA 3A4TA 2FC9A 4LRBA 5CCMA 4YHHF 3I9V9 3VAFA 4MYUA 5EDWA 3PO5A 3JQMA 3ETMA 3GYGA 4DMZA 4MAKA 3NOCA 5A6WA 4JI8J 1UWBB 3TJ9A 4LSZB 2VFSA 2MJNA 1WJ9A 2BOAA 2C2OB 5G0RB 1X4BA 3Q86A 2GAHC 3M2RB 4NLQA 1FJGF 3VGTA 3MCSA 3JSMB 1FO1A 4KAIA 4Q7AA 3IMQJ 4UOGA 2ZHBA 1QAXA 2Y0SD 2RKIA 1OIAA 2WW4A 4DV5J 1EKSA 2F5GA 1FK9B 2KM8C 3QGGA 4EI2A 4DR1J 3BBBA 3FEYB 2MQ8A 5B0FA 1VRUA
chains in the Genus database with same CATH topology
4WKYA 4C3LA 3VZHA 5LXYA 5KFGA 5DG7A 4L6V3 4PXCA 3CB4A 4FNHA 5HLFB 2QA4G 1QM9A 3DHXA 4JV2A 2QLXA 3MOJB 2P6SA 2GHPA 1OS5A 4NLRA 4Q8FA 2XBPA 1TVRA 3ENVA 2DNNA 2KRBA 3T3FA 3FCHA 1N5YB 3G8TA 2DGVA 3KLVA 1UVMA 2B43A 1VHFA 1NHVA 3NCQA 2IVFB 2FVSA 2HHWA 3LPYA 1KVJA 1WD6A 1LQ9A 2V94A 3NCPA 1UVLA 2C3YA 4PPDA 2VKZG 3QYYA 5KFWA 3HX9A 3B8HA 5F41A 1QSSA 4O4GA 3VTIA 4RW6B 4CI0B 2PDAA 1FERA 3H4BA 4ECUA 4RUCA 3M6XA 3BO3A 1PSDA 1D9FA 1MNEA 4TY8B 2BANA 4QWAA 3I0RA 3MR2A 2QSFA 1JLBA 4A8YA 4E98A 3Q8PB 2JJ4D 1FDBA 1T94A 4OJHA 2DNZA 4HDHA 2PD1A 5KT2A 5D3GA 3HZGA 1R89A 2Z4PA 4IQMA 4J5OA 1X4DA 3BSAA 3DGPA 4PQAA 3FDSA 4J9NA 2DNKA 3SSSA 3H5XA 4OL8A 4ED8A 1VK8A 3HHEA 2VFVA 3NBPB 3OLAA 2J9EA 1RAJA 3HHDA 2EWHA 2VPYB 3MAHA 4NWBA 4RUHA 5KFJA 3IS9B 2MY7A 2EFVA 4X65F 4X64F 2EBGA 4HLBA 2IA6A 3CCVS 3TI0A 2HNYA 5KFZA 1P1TA 2M9KA 4OI6A 4OZNA 2AW0A 1OQ3A 5B08A 2JRSA 4R8UB 2CZVC 4I2PA 2HWHA 3S6EA 3V4MA 2FC8A 2VUGA 3KYLA 2DR8A 3F41A 2OPPA 2PEHA 4O3QA 2IRXA 2QA4S 3JB9k 4YR0A 3K5LA 2LECA 4K4VA 1X9WA 2VOOA 2Z0GA 3TUIC 2E66A 1X8DA 4P2SA 1KLMB 1MU2B 3W2VB 2RH3A 5E41A 3O2IA 1FTRA 4LFBF 3KLHA 5KFVA 2GV1A 4NX9A 5KFFA 1J5OA 3TX8A 1R0AA 2AX0A 3RW7A 3E3XA 4HT5A 1JLCB 2OAUA 3M05A 4Y3CA 3UD3P 4TXSA 2L9WA 1XK8A 1N4LA 4B3MF 3KLGB 2R7RA 4ZVHA 1S10A 4QZVB 5A0YB 3PV8A 1LW0A 1E6YB 4NLPA 3M9MB 1H2VZ 2BBEA 2OD4A 3D1HA 4JUZA 4AL6A 5CCLA 4K5SA 1Q82T 2MB0B 4C11A 2L41A 3KFWX 5D4PA 1L3UA 5K8OA 2NUHA 2OFGX 4PG7A 2RKIB 3N6LA 2XS5A 2DGQA 1YRXA 3LALA 1HNIB 3TR5A 3UW1A 5F9LA 1TKXA 3SEOA 2Q6CA 1U1NA 3PRBA 1N5VA 2FVQA 3BO2A 1VJWA 3TAQA 1KOOA 4RWWA 3DLEB 4CIOA 2DHXA 4LF9F 3QO9A 3TAMB 2L08A 4DL7A 1S9GA 3M2UB 2JSXA 1Q86T 1DAXA 3N5BA 2V4QA 3UCZP 2UVVA 4KGMA 3PR5B 3B78A 4X4VA 3SV3A 4OV1A 3CF5Q 4H54A 1KNZA 5CYQB 4ZVFA 3AA8A 5MLCV 5C24A 2XO7A 3Q8RB 2QO3A 4C97A 5HO4A 4F25A 4C2MA 2MYFA 4ZPAA 5CYJA 5GAEU 4LQ3A 5F8NA 4WFYA 2VG6A 5IM0B 2AD9A 2CQGA 2IAJB 3O44A 4OI3A 4OX8A 5K14B 5KG1A 3OUYA 3BREA 2OTJS 2KZMA 4G3IA 1ZM4A 2XGPA 1NK5A 4RU2A 3V6KA 1U6BA 1UMJA 1VQ4S 1R8HA 3SSQA 3GMGA 3TVKA 1M5PC 3MGJA 5KG2A 2VASA 3CD5A 1T03B 1CC7A 1WG1A 3LP0A 3ICLA 5JVHQ 5KG7A 2XEXA 3TW0A 3PM9A 3Q24A 2GGPA 1NHUA 2VBYA 2ZBCA 4FVCA 4RLEA 3KK2B 1NK6A 4Q2MA 4ILRA 4K4SA 2HFZA 2Q3PA 5ADZA 1S0OA 1I94F 2JWNA 1UETA 1U47A 2LEPA 2XMTA 1H7XA 4YR2A 3FRZA 1G3OA 3QGHA 3MMAA 3HP6A 4G1PA 4M5DA 4B9VA 1YRUA 2LDYA 3JTOA 3GV5B 1ZH5A 1KHVA 4NLXA 4XPEA 3CE8A 2WTFA 4PKDB 5J2PA 5BYSA 4K4UA 3CJ4A 5FIIA 3FZBA 4TU8A 1FXRA 1WHYA 2HNYB 3O5TB 2FTRA 4O0IA 4V19X 2QRRA 4IG0A 3T5HA 1S9EA 2EC0A 5B0CA 2LLZA 4IO9Q 2YY3A 4IG3A 1K0TA 2X1AA 4R5PB 2K2PA 1B0PA 1YI2S 5L1KA 2CJBA 2IC3A 3S1TA 2ROPA 1RTHB 3DLBA 1YJTA 4ID8A 3C6UB 3TRGA 4LF4F 4F4ZA 5HP1A 4JI7F 4DV0F 1DFDA 4KTQA 4ZMMA 4TLRA 2DH8A 1FXLA 4OLPA 4FXVA 2DCLA 5F8JA 3WDOA 2ADBA 1LW2A 3UNGC 2ZE2B 5DRKA 2DR7A 3V2UC 4OZ0A 3L3CA 3FMBA 1N34F 4F2RA 1UW4A 5DQIA 2RF2B 4KV8A 5HN0A 1KC8T 2GIQA 1JJ2R 1S6QA 4DFMA 3I87A 3ISND 3R1HA 2CJKA 4X62F 4HTIA 3G86A 4O23A 4CQ1A 2KTQA 3HDSA 4O44B 3U1MA 2MKHA 2FJBB 1ZTWA 4B3SF 3KK1A 1A6LA 2B9XA 4XDDA 2KVIA 1HNVB 1O0PA 4FF4A 3I0SA 4Q43A 4ECYA 4USHA 1L3SA 5IT9Y 2HWIA 3QO9B 1WEZA 4ZCKA 3P5TL 2ROGA 4B17A 3MD3A 2NR0A 2NYIA 5B7WA 1FXDA 2R7OA 1S77D 4LFCF 3TAPA 3MWBA 4OIXA 4P7VA 2YKNA 3CCZA 4JI0F 1R8CA 5T14A 2HG4A 1QSYA 4NXNF 3QJLA 1ZOTA 1S48A 2GC8A 3N6NA 3DN9A 1OWXA 3DYAB 3MOZA 1SKWA 1NJYA 2HVHA 5DG8A 3KHGA 2ROEA 2RRNA 6FD1A 2UUCF 5FJ4A 1S4FA 3OUYB 3CEDA 2IJNA 5F0WA 4DHVA 2BE2B 3LWLA 4QU7A 5A8RB 2ILZA 5L8RC 4WK3A 2ZH9A 4DL0C 1NK9A 3DDNA 3TA0A 3IC1A 1C0TA 2RDJA 2KHDA 2LQ9A 3H2VE 4M94A 1FD2A 3GWCA 2W4CA 5KAKA 4EZ9A 3KMQA 2YKPA 1BLUA 1L3VA 2IVYA 4ITSA 1S1WA 1KSPA 2KJVA 3U02A 4YY3F 2AF6A 4Y28C 1SL1A 1S1VB 4QW8A 1R3NA 2RS8A 1Y3KA 2YNHA 2ZH5A 5HROB 3POTB 1HI1A 4K0KF 1WACA 2L3MA 3QLHB 5KOWA 3G4SS 1S9FA 2OPQA 1TL1B 3DRSA 3TVZA 3H20A 2CPXA 4AQYF 5LSOA 5L9NA 4AUKA 2E44A 2HHQA 1C1BA 1ZPVA 3GV8B 2ZJQQ 1ROFA 2W9CA 3JTPA 3BR8A 1RJJA 1QUPA 4NCAA 1JKHA 1SKRA 3CMES 1FJCA 1Y4ZB 4ZCLA 1IBLF 4FS1A 4MKAA 5CA5A 1H0HB 3PX4A 2C28A 2FLLA 3CC7S 2LYVA 2MZSA 3EUNA 2AJ4A 4DR1F 2AYBA 4IG0B 3VCDA 2PFFB 5GADI 1OSDA 2AYMA 3NCRA 1R8BA 3NP5A 5M2UA 3KJVB 2QIFA 4FNIA 2HNDB 3CD0A 2BV3A 2A10A 2CQBA 3NGKA 4QIEA 1WTFA 3IG1A 3KLIB 2W4PA 4LF6F 4I1TA 1UFLA 5KFSA 4YB1P 4DUYF 2AJFE 4WIIA 4EGLA 4C3MA 1DLOB 4Y0FA 1JXLA 2WAQD 2GFFA 3M2VA 4TLQA 4LF5F 2RILA 1BQNA 4A8XA 1U26A 1KQKA 2UUTA 3THVA 1X9MA 4C8OA 3GILA 2ASLA 2IFXA 3WBZA 4NL5A 1NB7A 2Q43A 1OPIA 3L09A 2CJAA 2I2YA 1K8AT 3KHRA 3OBIA 3R3TA 5M2PA 4DBQA 3BN7A 3DLGB 1OQ6A 2ASJA 3ITHA 4PG4A 2XWYA 3KLEB 1D8YA 5DQGA 2AV5A 2CQCA 2DPIA 1FCAA 1GX5A 3MM8B 4CH1A 4IRDA 2F8MA 3IRWP 3CCMS 4KO0A 5IZHA 5EHHA 3PRDA 4I7FB 3HHKA 5E3QA 5F3ZA 2DJWA 3BDEA 5I3PA 3VR1A 1TKTA 1MSWD 2E5LF 2ZH1A 3MMBB 3BGUA 4DQSA 4YDDB 2DVIA 1R8PA 2IJFA 3VQSA 3NMAA 2R2RA 3LH2S 1DARA 3NNCA 2H9ZA 5KFEA 1E6VB 4Y2CA 2R7XA 1UAWA 1W2IA 1LWCA 2W7AA 3I31A 1UKUA 1RT4A 4NLDA 4RNHA 4USIA 1YITS 4JV1A 5GMKa 1WG5A 2Z2LA 1NO8A 4FXDA 2BQUA 1IBKF 2LXFA 2KT3A 1XNQF 1Y7PA 2VBZA 2HQ3A 3HKWA 1L3TA 2XMJA 3N01A 1S1UB 2QZ8A 2DR9A 2ZZNA 4CH7A 2EVZA 2KFZA 1B0VA 1D3WA 5L39A 3HMJG 4HT7A 1IKYA 1YHQS 1SJ1A 4O3OA 3VWSA 3HJFA 2YQ3A 3OR1B 3T5KA 1XR7A 4EEYA 2VG5B 3K8WA 3DC2A 1LFWA 4B3TF 4ILMA 5KT3A 4DFKA 4ZP6A 2G1DA 2K3IA 2OJ3A 2OSQA 4C9DA 1UWBA 2XSFA 1N56A 5KFUA 2WW8A 3HF5A 5J2QA 1MROA 3PJWA 1JLQA 1OO0B 1WHWA 3CCUS 2AGPA 2RUGA 1NK0A 2KB2A 2CQIA 4NLSA 3WZ0A 1GXLA 4RBUA 1TK5A 1Q79A 1B0TA 3SZ2A 3GIJA 2K8GA 2HNZA 3CDBA 3FRYA 3BSNA 6FDRA 3IGVA 3AHPA 1AFJA 5G0RA 4DG1A 4BS2A 2HHVA 1HW9A 3NAHA 2FGOA 2K1RA 1HQUB 3SCJE 2AYEA 4A8MP 3VAHA 4K4TA 3M2RA 3GR1A 3JSMA 4DJBA 1JLAA 2RU3A 2GHVC 3LGNA 4K5RA 3UFCX 2VC1A 4B9LA 2M3DA 4FPRA 2V4RA 1JB0C 3CJKB 2G13A 1JKHB 2B3TB 4DOZA 2MKCA 1HARA 2A2CA 4OX9F 2UZAA 3MMCB 3CT9A 3FSYA 2J76E 1D0EA 4DR6F 1M1KT 4RU9A 2IYGA 3M30A 3OXLA 4RW7B 1FK9A 1U1OA 4Y2MA 3HK2A 1VOMA 3M32A 2J7KA 1VRTB 5HMXA 1FDDA 2V9KA 3W3SA 5KG6A 4DL5A 4ES3A 4AXJA 1FEHA 4ED0A 4R0EA 5DGAA 1TKZA 3NGDA 1RT5A 2HRUA 3H5UA 4ZPTR 4C8ZA 2RD5C 3OSNA 2DGOA 3OL6A 1DURA 3KG1A 4J37A 2AQ4A 3EXYA 3UR0A 4PWUA 4IR1A 1TV6B 2NXUA 3DRXA 3QAUA 4OHWA 5CQGA 3CCRS 5HLFA 2I0XA 1HWLA 1BQNB 3OL7A 3TP2A 4CO4A 1G6BA 1FJ7A 1KFDA 3VZIA 4U7CA 5E7OB 5DLGA 1PO6A 3VALA 2RJZA 2JC1A 5FLXY 4ECTA 1N5YA 4F3MA 4QW9A 2D41A 3DFEA 4NPOA 4NA2A 2XI3A 3DLKA 5CH7B 1EETB 1K0VA 2RSQA 1QAJA 5KFQA 5CYMB 3T1AA 3DHWC 3ZZYA 1S0MA 2FVCA 1BQXA 2XLJA 2OIHA 4Y2IA 4B9MA 2YNFB 3IGNA 4UUWA 2M8HA 2MJUA 2P6TA 1S6UA 4HVZA 5GADU 3Q2TC 1CG2A 1DTQA 1HBNB 2VC0A 3BF4A 4M8LA 4QR1A 2B6AA 3UI3A 1LWCB 4DF8A 1SH3A 4B3RF 1N32F 1RT4B 4DN9A 2XB2D 4BC9A 4DQRA 3AY0A 2D3UA 2PGCA 3I4PA 1HW8A 1S7HA 4IOBA 4LIWA 3A8EA 1M5VC 3NBPA 4Q8EA 1ZPWX 2EFGA 3X3UA 2OD6A 3HVWA 4OFZA 2KXHA 4U67Q 4J9MA 3GIMA 2EG1A 4NOHA 4RWXA 1RYSA 3GB0A 3RR7A 4R8UA 2CQDA 3MFHA 2DH7A 1LWEB 2YX1A 4EBCA 1T7PA 2ATLA 4B9TA 1MROB 2WOMB 5EWGA 2B9YA 3HLUA 3H25A 3M6UA 5E3AA 3LWMA 4NZ7A 3OVBA 2CPJA 1MU2A 3W2VA 3B82A 3Q8SB 1X4GA 3SYZA 2KN4A 3IN5A 3G6ES 1DBDA 1XEZA 2OPSA 5AXMA 2EK6A 1U1QA 1TFWA 1TR0A 3RB0A 4ALZA 2ZH4A 4A48A 2M70A 4OHVA 2KFYA 4ECSA 1U1RA 1JLCA 1M5KC 2MSSA 3P96A 1JXEA 2DGXA 4J9QA 1RT2B 2I9SA 3KLGA 2ALZA 4F2SA 1LWFA 3K5NA 2BDPA 1E6YA 1JLAB 3NG8A 2FGCA 4ZOSA 5EWEA 1TAQA 3VAIA 2YNIA 3CCLS 4I4BA 4DDFA 2FLNA 4QIVA 5KFLA 4DV7F 2XCPA 3DLLQ 4WXOA 1HWUA 4I6YA 1VIOA 4BCAA 4URGA 3H2LA 2QFJA 4OJ1A 1FKOA 2MPUA 1HNIA 3M30B 4MK8A 3G6YA 4NCBA 1YIJS 4JV5F 2YWKA 4H4OA 4XDCA 2B51A 1FE4A 4C8KA 3M32B 4NLUA 1VLYA 1NEEA 2BQRA 1ZBTA 2XY5A 3HHNB 2YWFA 3E51A 4AL7A 3TAMA 2V8GA 1X4FA 3M2UA 3OV7A 2K7KA 2A1BA 2DNHA 3DCAA 2CQ0A 2LA4A 4WFAQ 4BC7A 3CJ0A 5CYQA 1D1UA 2GMJA 2QV6A 3CUNA 1DQ9A 5BYRA 3I9ZA 3NNHA 2ZH7A 2FDNA 4AL5A 4ECQA 3R5CA 4ECWA 1HQEB 5IM0A 5KFAA 2FIUA 3QWPA 4XIUA 1YJ9S 5ITHA 4I56A 2BJEA 2XY6A 2IAJA 5A8WB 4X4TA 2DNRA 4P6QA 5K14A 4X4QA 3SFGA 2BUNA 2J0WA 3IA0A 3Q2SC 5C42B 4N5SA 1XMBA 2OO4A 3DLKB 3CJ5A 1HBUB 4ZK7M 4ZP9A 4MH8A 5AE2A 3HM9A 3BR9A 3HT3A 2BABA 1GAOA 4Z2XA 4CH0S 5LJ3Y 4TYAA 2Y1RI 3R5DA 1XBWA 4A4JA 3GIKA 3HKZD 1RKJA 1T03A 1MWZA