3AB4B

Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
157
Chain Sequence
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
molecule keywords Aspartokinase
total genus 35
structure length 157
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B01
4M8LA 3DC2A 1LK5A 2DTJA 5FIIA 3KWMA 3OFFA 3AAWB 5IS2A 3AB2B 4LUBA 2PA3A 2CDQA 2P9CA 1ZPVA 2ZHOA 4GMKA 3LOUA 2QMWA 2H9ZA 3OFGA 4IO1A 3O1LA 2DT9A 4GO7X 2PC6A 3HHEA 3DDNA 4PWUA 3TUZC 1YGYA 1RWUA 1UJ4A 2RQMA 3U7JA 3TUJC 3LUYA 2LVWA 1PSDA 1Y7PA 3MWBA 2F8MA 5T41A 3CEDA 3MAHA 3NRBA 1KS2A 2J0XA 1U8SA 1SC6A 3ENQA 1O8BA 1LK7A 4NMLA 3IXQA 5IT4A 1UJ6A 3W7BA 3S1TA 3OFHA 2NYIA 2P9EA 3DHXA 2F1FA 1M0SA 2MDAA 3TUIC 3N0VA 2RQKA 2QRRA 2J0WA 2JHEA 4GO5X 2I9SA 3ENVA 4X84A 2LQJA 3OBIA 3P96A 3K5PA 1LKZA 2P9GA 2QSWA 3L7OA 2QMXA 1XTZA 2FGCA 2JOQA 2RE1A 3IBWA 1YBAA 2KO1A 3ENWA 5JJBA 3OFEA 1UJ5A 5IT0A 3MTJA 3AB4B 3DHWC 3UW1A
chains in the Genus database with same CATH superfamily
3W1YC 4PYDA 2EBEA 3DC2A 1S6UA 3J80Y 3I9V9 3NP5A 4H4KA 5FIIA 5HMZA 1YJ9S 1L5UA 1HPZA 1S49A 2RKIA 1IBLF 3HVTB 4ZP9A 4J9KA 1FXLA 4FXVA 4NA2A 1T05B 3PJ9A 2BE9B 5KFDA 3JQJA 3Q89A 4CWBA 2FJEB 2F3JA 2AJQA 3BKTA 2E7XA 1I94F 4I7FB 4V1Ak 5AXLA 2BX6A 3GQCA 3D2WA 1R8PA 3OQ2A 5FLXY 3Q0AA 1QAIA 2HS4A 1EHWA 4CI0B 2EKNA 1VFJA 1K9MT 2Q66A 2WONB 3IRXA 4FF1A 1G6BA 4IG0A 5J2PB 1S1XA 4O4GB 4X62J 2FUG9 3THVA 3RB0A 1FJEB 4IRCA 1RZMA 3KJFB 5I3PA 2WBMA 5IWAF 1TP7A 2R7TA 2BM1A 4M1KA 1NH7A 1RCOB 4RW8A 5E0OA 3OR2B 2Z56B 3T9ZA 5ADZA 3SSSA 4WP8A 3VAGA 4V19J 4KPCA 1CJKB 2GHWA 3MM9A 3LWLA 5B0CA 3MR2A 5U47A 1RCXB 4RBVA 2PGCA 4ID5A 1IKXA 2FQQB 3LUYA 4MK8A 2W9CB 1YTYA 3QSIA 1X0FA 4YR2A 3MM6B 3PDNA 3SDEA 4JYAF 3KLFB 5T14A 3M05A 3LAMA 4ECXA 3MUTP 1H98A 3GMGA 3K57A 3OTCA 4AYBD 4LSLB 3A8KA 1VRUA 4DPWA 2ZH5A 4CP5A 3ZC4A 4ZOSA 2E5GA 3UVJA 2DGOA 2W2NP 3FFIB 3RZAA 2CUYA 3T19A 1KS2A 1YQHA 3QATA 4PG7A 6AT1B 2DO4A 5CA5A 3IFEA 1RI7A 3S6EA 1TKXB 5CYQB 3EWGA 1FD2A 2IA0A 2OD6A 2RRBA 1RKIA 4ZIWA 4LVOP 2O5DA 4ECRA 2ASLA 3UD3P 4DEZA 1XR5A 3QJJA 3NGUA 2UXDF 4GVLA 4YB1P 1S76D 1XNRJ 2XNQA 2NPFA 3OSNA 4KHPJ 4RKUC 1UA0A 5EX0A 3PM9A 3W62A 3V6KA 4K0KF 2GW8A 3POTB 2MQ8A 3PRDA 4DL7A 3RR7A 1GXUA 3RRHA 3D6MB 3L3CA 3H5SA 5FLXU 4DFKA 1R7IA 4FKXA 4M5NA 4DN0A 1RT3B 2ZKTA 3QIPB 1RLCL 4IRDA 2HVEA 3EICA 3T5LA 1AFJA 4M5IA 3TAMA 5M2RA 1F0XA 9RUBA 4M5HA 4URSA 2B8PA 3D4JA 2W9AA 2C2RA 2HBQB 1CJVA 4CLPA 4F4WA 2VG5A 3OW2R 3T1AA 1VQ8S 2I9SA 4W90B 4I0WA 4D3HA 5EWFA 1YZ7A 2CJXB 3BDEA 1AROP 2K06A 4UQTA 3QRPA 3PZPA 1RXOB 2GAGC 4OZLA 4CTAB 4ETXA 1QE1A 1HMVA 4P73A 4Y00A 3DXBA 1SB6A 4OHVA 4XDDA 2QSWA 2R2RA 1P9YA 3TAQA 4EWTA 4AFFA 2IBKA 1JLFB 3MEGA 3UN2A 1VLYA 3I56S 2ZHBA 2BYCA 3K5LA 2AZ1A 2YNFB 3FEZA 1N5YB 4HT7A 2M4MA 2EEYA 4B3RJ 4EO8A 5JJBA 1YIJS 4ICLB 1FRHA 2LXUA 4DLGA 2R8KA 2HHHJ 2AYEA 2RDIA 5J2NA 3ISNC 1PBUA 2QFIA 2ZBPA 3CJ2A 5F0UA 4ATNA 2ABYA 2HURA 3HI9A 2DXFA 3KWMA 4RNHA 5L1LA 1RHUB 2BJ1A 4G3IA 1H0HB 3NKYA 4WE1A 2CNKB 2KZZA 4HVZA 2CPZA 2ZDOA 3I0RB 4KHMA 2D3UA 1EP4A 1EETB 3C16A 4WBFA 3W2VB 2J9DE 4CNYA 2RRNA 3GE9A 2H5JB 2CZ9A 2ZH2A 4DPTA 3K59A 5IS2A 1KVKA 3CDWA 3CD5A 3F44A 4UTGA 1RT2B 1M90T 2CDQA 3CJKA 2MKKA 3X3UA 5KFXA 2ZEJA 4U8VA 2WTFA 3KOAA 2GGPA 4MKYA 3PXGa 1TZ0A 1RABB 2X1AA 4FYDA 1EQ0A 3C15A 4J9OA 4ZVFA 3TVKA 5HSPA 4DJBA 3R5DA 2VBZA 5GMEA 2LKZA 3GPAA 3H90A 4JBCA 4P75A 4DV2J 1S0VA 4C0OC 3CJ0A 2KRBA 5BXIA 2DR7A 4LJMA 4Y2KA 2GCFA 2VG6B 3P45B 4ID8A 3RR8A 2JFKA 2IVFB 4DR4F 3GJTB 1RTIA 1X0PA 3D9BA 3RAMA 1SC3B 2DIUA 1VJQA 2H3EB 3U1LA 3GTYX 2YNHA 3VR1A 4JV0A 3OD2A 2MGZB 1FRKA 2V6AA 4ZVRB 7FDRA 1PJ6A 1BWEA 1U24A 1FK9A 1TL1A 2DR6A 4X4SA 2N82B 2W7OA 1FDBA 4P74A 4WXWA 5B0GA 4F4YA 3NNAA 4I69A 3GU0A 2XS2A 3KUGA 4ZLNA 3SQGA 1SKUB 2YWKA 2J0XA 3F41A 3MEEA 2NREA 1BY9A 1T9VA 2AJ0A 3G9CA 1QAYA 1M5VC 1ACMB 4USMA 5C2GA 1HARA 3MPUB 3ILIA 4P10A 4Y6IA 2XM3A 4DR3F 1RTDA 2IA6A 2I38A 3O44A 4YHHF 5C24B 4OHZA 4F67A 4GVBA 5D4LA 4LMZA 2M2BA 3GLJA 1NEEA 1Y5NB 3E2EA 2ZUAA 3D67A 3MECB 3QLHB 3MPYA 1YSJA 3IGVA 4OYOA 1YVFA 3CCLS 2VA2A 2IJRA 4K4UA 2ROEA 2E5HA 4JOUA 2BJ9A 3HKZD 2XB2D 2LQBA 3EE3A 1U2RA 1FFGB 1RWOB 3AFGA 1MWZA 5ETSA 3UCUP 1CSJA 3RB4A 2E5LJ 4JI1J 3QNWB 3JYTB 3R97A 2DY1A 3HXMA 5E3RA 2BUNA 2AZ3A 4N7TA 1CJTA 2OEKA 2SXLA 5KG2A 1KTQA 2BW2A 3Q8YA 2CQCA 2G0JA 2W01A 3LP0A 4DG1A 4BLGA 4NWBA 2B6AB 1WEYA 1RYRA 2F9JA 2MDAA 2GVDB 5A8WA 2AJ2A 2O1PA 3QIDA 2KL8A 1AYEA 2XEXA 2DXEA 3BQ2A 1L3VA 2JHEA 2BKPA 3MGJA 1CEZA 2B7CB 3TX8A 3UD5A 1CPZA 2M88A 2HNZA 4WK3A 1RAFB 1CS4A 1D3WA 3W5YA 1SJ4P 1WTBA 1TKTB 2CWXA 5KFYA 4X66J 1K0VA 1IWGA 1N5SA 3CXCR 4DXLA 3CULA 4KGXB 3CC2S 4I2QA 4OLOA 3G8SA 3TVZA 4EZ6A 2XHCA 2VIHA 2YH1A 5E3PA 2GIRA 5G0RB 2HRUA 1VCTA 4RO0A 1XTZA 1ZM3A 1C2PA 5IM0A 1Z4UA 2NZCA 2HLUA 3PFEA 2AGQA 4HH0A 2Y3YA 3HZEA 2WONA 3V4MA 4ZVHA 5KT6A 4O4GA 2XZWA 2E9ZA 2NS1B 3MXHP 1T7PA 4IG3B 1FTCA 2I0XA 5CHCB 4X4UA 2R7XA 4RW8B 2YQ3A 4MYTA 1GTHA 4GKJJ 1NK9A 4ZVEA 1F3FA 1U0HB 2L08A 2BR0A 2UZAA 3O5TB 2QL9B 4PWWA 4DCPB 2WB4A 3C66A 2MSSA 3GFXA 1VMBA 2YY3A 2CDRB 3H0PA 4BDPA 2VPWB 1IKXB 1SJ1A 2BRLA 3CD7A 4Y2CA 4EGLA 3NWGA 4K4XA 1MN9A 1U48A 1VBYA 4FXDA 4NZ6A 3LP2A 3KLFA 4QU6A 1KTVA 1YRUA 2H48B 2O67A 3ZTRA 3TX0A 1FWKA 4O4RA 2HQDA 4LSLA 1ZH5A 4R25A 3FFIA 1VC0A 1QTMA 4DWIA 1FJ7A 3AXMA 3NOCA 2IRYA 2HFUA 3JXOA 2CNOB 4B3TJ 1PAUB 2QLBB 3VZIA 2R2TA 1U02A 4ALZA 3G6VA 4NCBA 2CWKA 2C28A 5LMUF 3PYEA 2PMHA 2W2PP 3QBCA 4C3LA 1Q53A 4WU2A 1YJRA 3NY0A 4EO6A 3D0HE 3SMZA 1OYDA 2ZOGA 3CMES 2B4PA 2AHOB 4FNHA 3E3XA 4I6WA 2VPYB 4MTPA 1SJQA 5HQLA 2AX1A 3KHRA 1TMMA 3HVWA 3CCJS 2MZSA 2RNEA 2DHHA 2B56A 4ZVPB 2CG4A 5DG8A 1U1KA 2UP1A 3HPOA 3ISND 1KLMB 2H4YB 2LU1A 3DM2A 2I6WA 3A4TA 3UDLA 4DMZA 3OL8A 4DUYJ 2HWIA 1XEZA 3KG1A 1OY8A 3NRBA 2GFFA 1GNKA 1ZZFA 2H51B 5KFTA 3ZNJ1 1JJ2R 1D9FA 3TJAA 2DISA 3KJQB 4ES2A 1RT3A 3QGGA 1S1TA 1U1NA 1H6KX 4X4VA 4B3OB 2MQLA 2KHDA 3VTIA 1N0VC 3NCQA 2ZDPA 4OZJA 2B51A 2BE7D 5K5MA 1OSCA 4NA1A 5CAAA 2GO9A 4PG4A 4USKA 2ZH9A 3OL9A 2KHCA 4OL8A 2LECA 1N5QA 1FA0A 1KHWA 2DNGA 3ZZZA 4ZMMA 1FO1A 1WJ9A 3BO3A 4IRKA 1S1VB 3VGTA 2EFQA 2V4JB 4MKVA 3MCSA 3T1YF 3BH7B 2DVIA 1WKLA 2D1CA 2QFJA 1JLFA 3MEGB 1YJUA 2AEFA 3PTWA 2OAUA 2F8HA 4NPOA 1NSQA 3P5BP 1N5YA 2XCAA 2HVZA 2CZ4A 1NK6A 5CQGA 2G2YA 2RUSA 3GIKA 1FNXH 2UVRA 3R27A 3G6ES 3NG8A 1NMEB 1TKZA 3T1YJ 1X31C 4HYKA 1LWXA 3MM8A 2LEBA 1VK3A 3PIPQ 3A3NB 1RAGB 2FDNA 1UETA 1ZM4A 1D09B 3QGHA 4I4BA 1FKAF 1WF1A 3QT6A 1VJWA 1WD6A 1X5PA 3CCRS 4DR2F 4N41A 1ROFA 4WE1B 3KNGA 4W4MA 2A2DA 1FD8A 1GK8A 3MFIA 5THWA 4EEYA 4IUFA 3HP6A 1EETA 1NAQA 4R0EA 1LKZA 2IM1A 2VKRA 2YWHA 2RD5C 5ETOA 5LL6d 3WX4A 2ASJA 4DR6F 2R9LA 2Y1RI 3DDIA 2J9EA 1REVA 1FNOA 3KLEB 5AXNA 1FEEA 1SI9A 3DLJA 1Q86T 5GVQA 4YR3A 2QN6B 2EVZA 3H25A 2VU5A 2N4DA 3Q8PB 2PE8A 2LEAA 2CJYB 5IT0A 2CPXA 2C3YA 4Q43A 1VIXA 3S8SA 2ZZMA 3C15B 1Z2LA 3UW1A 3SSRA 5A76A 1RT6A 2MB0B 3BS9A 2HFVA 3NS7B 5DLGA 3BM7A 3L95X 2D69A 2BANB 1LQ9A 2DNHA 2OH2A 1FF2A 4PAAA 4ANDA 5I42B 1T03B 3QPIA 1HI0P 3C2PA 2ZZNA 5I3UA 4CM0A 1WEZA 3DOKB 1C4CA 2G0IA 4LVNP 3ILLA 4M5LA 4KH1B 4NLXA 3J7YI 1T9WA 3W5ZA 3PHEA 2UUBJ 2O3DA 4ZVGA 2HQ3A 4NYOA 3HT3A 2UVVA 3G86A 4P72A 1KD1T 1VGYA 3MZIA 4KFBA 3M2VB 5B08A 4EYIB 4O3RA 2JC0A 2OPSB 1SH3A 4O3QA 4CO2A 4U7UD 2QGFB 4M5MA 1TL1B 2V8HA 1HNXF 4GMKA 4DPUA 4CLUA 1VI7A 2WHOA 4B3SF 3HD1A 1OWXA 1RT4A 2HS3A 3IO1A 3SQGB 3I87A 2WSEC 2WSFC 3MEEB 5E3AA 1FDNA 3G8TA 1UVLA 2L9DA 5F8NA 2WVFA 2DT9A 5F0WA 3CNQP 3ZO7A 4K4YA 1T3OA 3MCOA 3W66A 3V81B 3JTPA 4PQAA 3M9MB 2HAIA 1NDKA 1RU1A 2JZ5A 4GVBB 1S0OA 2WVCA 4LRCA 4C2MA 1RAIB 3QGIA 1N32F 1F9FA 2APOA 3HDSA 4OZ2A 2BKNA 2HFZA 3HJVA 2LEPA 3GFYA 1EB0A 3OXFA 1JLBA 3J7AN 1Y3JA 2E1PA 2F9DA 4TU9A 2VH7A 3H2LA 2AWZA 4J9LA 4U8YA 4JV2A 1VQNS 1S99A 3R7SB 2KG0A 4C98A 4RPFA 3ZFVA 3BGOP 3K2YA 5KT5A 3CEDA 3CD0A 4M94A 4PG8A 1YZ6A 3D5MA 4K4ZA 3PW7A 1JXLA 2CZVC 2FZCB 2IC3A 3GFHA 4DR3J 3QMQA 2DY9A 3NWRA 1X4CA 3DLGA 3CCTA 4DG1B 8ATCB 3KMQA 3ET6A 1YJVA 4QWBA 5HROA 2HNDB 1XIQA 1MMLA 4FYYB 1NRKA 1WF2A 1XK8A 4WP9A 2IBOA 2F5GA 5KG6A 5GAEU 3G82A 2DGVA 2WRMA 2GIQA 2NUHA 3IXQA 3NCPA 5E3QA 3RYLA 3V6DA 2FVPA 2HNZB 1BE4A 4B08A 3KG0A 2RVJA 3DLEB 2MTLA 4OQJA 4DPOA 4WZMA 5JMNA 4K4SA 5G4DA 1U1RA 3PW2A 5CYJA 2UU9F 1JLQB 2KT5A 4DF4A 2KYXA 4FPIA 4CDIA 2W2OP 4C11A 5GADU 2W25A 3OTBA 4J9RA 4U96A 2JL9A 1QTNB 3H5UA 3LPEA 4DQQA 2NXJA 4WXOA 2F8EX 2MY7A 1BQMA 3FGVA 4X65J 2XY5A 3K5NA 4IH6A 2OLWA 3H5YA 1CC8A 5IM0B 3M30A 2XSJA 3DRPA 3ULHA 2E1MC 1XJWB 4M5DA 1PILA 3VZHA 3BPSP 3CIZA 3DRRA 3DU6A 1RAJA 4B3MJ 2HHQA 2HFNA 5L8RC 4GC6A 2HG4A 5LJ3Y 1TUVA 4RNNA 4LFBF 4Y65A 4HHUA 4IFVA 4RW4B 5M2PA 4USTA 7FD1A 2V0NA 1RHJB 2AGOA 1ZYQA 3WZ0A 3NCRA 1RT5B 2M5YA 3SCKE 2OTJS 4QIWD 4Q7AA 2CPDA 2DHAA 2XMTA 3Q86A 5K8NA 4HDGA 1M1GA 4LFBJ 3TNVA 2X3GA 2HQFA 1MU2B 4P2MA 1UZDA 1FVQA 4B3RF 3PKYA 2LA6A 4K7QA 4YHHJ 2EFOA 4NYZA 3TR5A 3CCSS 1UPMB 1CULB 2EW9A 2FGCA 2F63A 3LP2B 3OXGA 2OMLA 5GAGI 5DS7A 1S6PB 3EM1A 4FS1A 4HI1A 2OP5A 2V8PA 5KAKA 2D7SA 3CCVS 4JI7F 2UUTA 3M1VA 3MTJA 3VGUA 1FKOA 3OV7A 1X9MA 2DRAA 1GMWA 5L1KA 4E2FB 1ZZNA 3KXDA 4EK2A 4M8LA 4CO5A 2G1DA 2HEKA 4K4WA 2BACA 4ECUA 1FXRA 2ALZA 1VLOA 4LFCF 1IVZA 3CCMS 3ADAC 2VDIA 3P5TL 1W2IA 4RW9A 1HNXJ 1V3RA 2HFOA 1FWLA 3W64A 5C42A 2W8KA 4KSEB 4DV4J 1RWMB 2YKNB 1T8EA 1WORA 1T0TV 2OHDA 2VL1A 2ILYA 1HI1A 5EUHA 4JUZA 4CT9A 3AB2B 2U1AA 1Y4ZB 3UNGC 3N79A 3C46A 4YB7A 4X2BA 1J2VA 3MM5B 3J7A1 3ZTPA 1RTJB 3PX4A 2QLFB 2OPPB 4E0DA 1S7IA 3E51A 2YKMB 1VBXA 1VQ4S 3TJ9A 3HD2A 1HKAA 3FKBA 1WTFA 4BS2A 2HK2A 1L3KA 1H2TZ 3PCOB 3VGSA 1MWYA 3KHHA 3GSDA 4KQZA 1Q78A 2ZZTA 1S48A 4IO1A 1VHIA 2F4FA 4NLQA 2D74B 4O23A 2C3MA 1KVIA 5FDLB 3R5GA 2RKIB 3MAAB 4O3OA 3HVTA 5KG4A 1PYSB 1YKWA 4ZCIA 2XY7A 3R6GB 3MF5A 4DQIA 2ERRA 2UUWA 4M5KA 3SCLE 1H2VZ 2J9CA 4CH0S 5HK4A 3LW5C 3M8RA 3GB0A 5K14A 3FSIA 2NQPA 4JP8A 5AXMA 2X3DA 1RACB 4I7FA 5EGYA 3V6HA 3UO0A 3LPYA 2PIIA 1ZAWA 4QW8A 4CZCA 1WOOA 1VHFA 3AXKA 2XCPA 1EX8A 2CPJA 3A3OB 2RDDA 4EBCA 1N52B 3CCES 4OZNA 3S7RA 5J2PA 2OUGA 4GKKJ 1ZPWX 1F9EB 4NOHA 1FWPA 4ZVOB 4BC9A 4DV1J 2UVUA 4HHJA 2JX2A 3LP1A 2MJUA 2QA1A 4ANCA 4A8KA 1TKZB 5B0FA 4WFXA 4P7TA 5LXYA 3J7Z5 1IUJA 2YQ0A 1KWMA 4ID5B 5CZVA 5K8PA 2W9CA 2A3JA 3K7RA 1N34J 2IFXA 3TJ8A 4HKQA 1TVRB 3MM6A 2HZVA 1ZTTA 3SDEB 1KP6A 5HJXA 2LA4A 3CSKA 3KJNB 4F36A 4DSKA 2QE5A 3W7BA 2C2ZB 1N34F 1U1QA 5DQHA 3CDBA 2CPEA 1K1QA 1VRUB 2IHR1 2JH3A 1SJRA 3MOZA 1UFLA 2XMKA 4ZPBA 5LMUJ 3BR8A 2BA9A 4AL7A 4TXSA 3K8VA 1YJWS 1DLOA 3KLEA 2AYMA 3H2VE 4J9MA 4DLEA 4ECYA 2JEJA 2LCWA 1TKXA 1TTHB 2V68A 3BN4A 2C2OB 2HKEA 2OSQA 2V2KA 2PFDA 3GJQB 4USIA 8RUCA 4QR1A 5KFLA 3IWNC 1DFDA 2OPQA 1Q0NA 2QRRA 4RW6A 2FVRA 3TAPA 1RT6B 1NDCA 2Z4PA 3B4DA 2H4WB 1HHSA 4DSFA 4Z7CA 5I42A 4J9SA 2XGPA 1JIHA 2Y0SD 2BJEA 5I3UB 4WJBA 1LV5A 4G1QB 1T95A 2LQ5A 3FSYA 4IR1A 2OJ3A 2MPUA 5F9NA 2DNKA 1LWFA 5B0BA 1K47A 1OQ3A 4U9RA 1U25A 3SXLA 2UUAJ 3JS9A 4YB6A 3MFHA 1KONA 2MZJA 3HX9A 4I6YA 5CCMA 1YBAA 2OPSA 3HSZA 2FJWA 4DL3A 4Z37A 1B99A 1PAEX 2DGQA 1FE4A 4JI1F 2NUUG 2UXBF 3TA0A 3T3FA 3TAMB 4OZ0A 3TEHB 5KFOA 5J2MB 4L74A 3AODA 2WVEA 2BW7A 2VG5B 4MK9A 1V3SA 1ZETA 2QC3A 3AD9C 3V81A 3RRGA 4B9SA 2V94A 3IAM9 1N4LA 2KN4A 1YG0A 2AYGA 3AAWB 5AXKA 3KDNA 5DG9A 3NS6A 1HBNA 4LIWA 3F56A 1CJUB 4CTAA 2CVIA 2MQPA 5EWEA 1HMVB 4RNOA 1WDTA 4N56A 1T9TA 2DBBA 4F3QA 4EI2A 3SCJE 4DL0C 3JTOA 3W8PA 4CRJA 5E5NA 3D6TB 3J7YU 1J5OB 1F2GA 3T6JA 4RU9A 1NUEA 1R89A 2ZH8A 2C2NA 4DR2J 1HWJA 2ZH6A 1RA6A 4JYAJ 4FP9A 3KTQA 4RWWA 4ZK7M 3SIPB 3ZZRA 1YX2A 1PIEA 2QL7B 3OFGA 4PABA 1R31A 3TZYA 4Q8FA 2IC3B 3OSPA 4KT0C 1SKSA 3HM9A 1S9EA 4ZITA 2XZTB 4WTOB 4PRFA 4FVCA 2E9RX 2DNYA 3ET6B 3J7ZT 1GMVA 1HA1A 1FERA 1RWUA 2DH7A 3CIMA 3I0RA 3T41A 4PZVA 4B3MF 1DTTB 2LLZA 2JVOA 2ZKUA 5L38A 4DV1F 3VAMA 1PSDA 1O51A 5ETPA 1RKJA 3KK1A 3TW0A 4DR7J 2FLLA 1Y7PA 2JRSA 1B0TA 2B4OA 2P5VA 4LRFA 2R2SA 4LF4F 3CJKB 2ZJRQ 5HP1B 1Q8KA 4C4WA 3IR7B 1IKWA 1BQMB 1IXKA 3N5BA 4KB7A 4LBIA 2GMLA 5IZHA 3HHKA 4MKAA 3MAQA 1NNDA 3CJ8A 2Q43A 3M30B 3DGPA 1QAXA 3N5FA 5DGBA 5GAHU 3IM8A 1C1BB 2PEBA 4QPXA 3TZZA 4QWDA 3DRRB 3KHLA 2ZH4A 1SC6A 5IC4B 3RG6A 1O8BA 2VC0A 2VODA 3QJLA 1KKHA 2HRTA 2VG6A 2JEIA 4HTIA 4IFVB 4RW4A 1TQLA 2RH3A 1RTIB 3EVMA 1FCAA 1LOUA 3DN9A 1X4GA 1RT5A 4MT1A 1M5KC 5KFGA 4EFAC 4B3SJ 2PD1A 2V5HG 3TOQA 2ZITA 1PC5A 2YNHB 4QIGA 1SUQA 4ED4A 3R2DJ 2J7KA 2ZH7A 1HL6A 2M70A 4MMOA 1FK9B 4DV3F 4OMFG 2DHGA 1AUDA 2WCXA 3M8SA 4ZN1A 3PYGA 5A6PA 1VC6A 5AE1A 2GO8A 1CULA 2MLXA 1VK8A 2F1FA 1S97A 2K2PA 2MKJA 4PUOB 1G3OA 1HQ2A 5D78A 1R8CA 3ICLA 3GCXP 2KTQA 4HR2A 1HNVB 4PQUA 1FKOB 2AIRB 4OHXA 4XK8C 5DDQC 1UW4A 3MURP 3QLHA 3QZ7A 2CJAA 3A8EA 4BWMA 4ZJQA 1VOMA 1AFIA 1SIWB 1A9NB 1GXTA 4P2FA 4DFMA 1RHMB 3HFZB 2E1AA 3W9JA 3FBEA 4OX9F 5C42B 4DL4A 2L9WA 4HHHA 2YKNA 1FDAA 1WSRA 2HQIA 2N7CA 4U95A 4DV0F 2VD3A 5DDOC 2VFUA 2VG7A 1V5IB 1TL3A 3B4MA 5JVHQ 4YB5A 2IM3A 2PDAA 4FYWB 4JV5F 4KBIA 2IMOA 3MEKA 1YI2S 3ZTSA 1HWIA 3TA2A 3PYDA 4CLKA 1C1CA 4KV8A 3S01A 4ZKAA 3T6BA 1Y3KA 2HVIA 1FJCA 5D4NA 3KMSA 1Z1ZA 5IV3A 4Y2MA 5FDLA 1VQOS 4QQBA 2X7IA 3V6JA 1PO6A 4PWDA 5D0GA 1S4FA 1X4AA 4K2XA 1YBUA 5AE2A 4X4RA 2KG1A 1BUXA 2M52A 4I2QB 2B5JA 2HZAA 1HNWJ 3U02A 2R7SA 4ZP6A 5K14B 2HHWA 4C3KA 1ZBTA 1NU4A 3I5CA 4LFAF 1S4EA 5G0RA 3AOBA 3H2UB 2I8EA 5B0EA 4QBUA 1T94A 4KTQA 2W7AA 1EARA 3FNNA 2IIHA 3NNCA 4DR1J 3U27A 1I51B 2PT0A 3FUYA 2YNGB 3CWJA 4OV6A 1NHUA 1QUPA 3A13A 4Q44A 4TU8A 4IFYB 1JNRB 5IV4A 1RU2A 1Y9OA 3GILA 4USJC 4UY85 4P71A 4F0HA 1IQTA 3SV4A 3HFKA 3D3BJ 2FLNA 1FESA 1TV6A 1YJTA 5CYMA 4L72B 2RS8A 7AT1B 2J8SA 5HVFA 3HHEA 1U0HA 2WK4A 3VAJA 1U0SA 2QLXA 2FHOB 2CQ3A 2FZGB 4OX7A 4JI5J 1WOSA 4QW9A 3W61A 1N33J 1ZAXA 2LQ8A 4P7VA 1RAHB 1Q4RA 4OYAA 2R3VA 2XI2A 5IC6B 3BPDA 4DU7A 1OS5A 1TVRA 1SBRA 2FJDB 1HHTP 4NZ0A 4XAKA 1X4DA 1XQIA 4UZCA 4YN3B 5DQIA 3AJ1A 2WW4A 3HSJA 1RJJA 5KFHA 3RBEA 5D4PA 3WIUA 1APSA 5KG1A 3CC4S 4C97A 3KNAA 5FJ4A 4DSJA 2YKQA 1YITS 3GR0A 3NGKA 2HBYB 2QZ8A 1RTZA 1Y5LB 2XQCA 2AMCB 2A1BA 1U8SA 2DD8S 2K8GA 5H1SV 5DLFA 3KDOA 4G65A 1W7WA 4RW7A 2FPHX 4E8UA 3PJXA 1K1SA 3R5AA 1U8WA 2A6MA 2L3MA 1FFSB 2RB7A 2IDLA 1M5OC 3FRYA 1UAWA 3J81U 2OPQB 2XMJA 2DEIA 2ZC4A 1XNRF 4RW6B 3H98A 3V2UC 3PFOA 2HW3A 1TK0A 1G2EA 3IC1A 2JFDA 1BHNA 4ED3A 4UUWA 4YY3J 5RUBA 4CH1A 4G1QA 4BHQA 1H72C 4LREA 1NM2A 5F8GA 5LMNJ 3I0SB 1KLMA 3OFHA 3NOGA 4XTTA 3CMAS 1W2BR 2NSBA 3X1LB 1WG5A 3SEOA 5DDPC 4QIFA 4J9QA 4RBUA 2A10A 2EXUA 2A18A 5CCLA 2VQFJ 3J81Y 2MKIA 4DUTA 2PEHA 4DPYA 4DV0J 4B9VA 2YWFA 2V8DA 1VC5A 3B78A 5JVGQ 2R7UA 3I4HX 3DU5A 4N77A 5DJBA 2RS2A 4B3OA 3I5AA 5J2MA 4BCAA 3GZ7A 1KDNA 2GHVC 3K5MA 1LFPA 3ENVA 3HJFA 1XMOJ 3M9NB 2FY8A 4EUVA 3EVOA 3QAUA 2J76E 4UUXA 2L9NA 1UPPA 3OBIA 3OT9A 1HBNB 1VQSA 2KRRA 1CJUA 4ZCLA 3RBXA 3W5XA 1CBKA 4HTJA 4KKOA 2V4JA 4DN9A 5IFMA 4F8RA 4EZ9A 4PXBA 2VBWA 4IQMA 2IM0A 2LDIA 2JEGA 3EXCX 1P1LA 1J5OA 4ILRA 5LM7E 3BBBA 2UU9J 2DGSA 3IR6B 4Q2LA 1RBAA 3B54A 3WHIA 1IKYB 1RWWB 3ENWA 2ZJQQ 4DFPA 1HNWF 3HFVA 3SYZA 4F3OA 4K4VA 3JQMA 2F4VJ 1R8HA 3MM8B 4YMEA 3DFEA 3HF5A 3M8QA 4Y0FA 2HMIB 1N5VA 4PG5A 3K0JA 2C1EB 3TARA 2IYIA 2DNZA 4DX6A 4FN5A 4C8LA 2C3PA 3IWXA 4FF3A 4NI2B 2DNQA 3SI8A 2XS5A 1UTAA 1AZSA 4C48A 2G13A 2ILZA 3BYPA 3AY0A 4LRAA 3OL7A 4AQYJ 1PGZA 4CNZA 4EMDA 3CD6S 1UFKA 2IAJA 1DTTA 2YVSA 1WKKA 3BYRA 1OY6A 1HD1A 4ZPTR 1ELOA 4ZLLA 4X65F 1U7LA 4GKJF 4BWJA 1REVB 2Z2MA 2NCKL 2VBYA 3ZZUA 1WC0A 1C0TB 4AQYF 1X9SA 3I31A 1Q8IA 2HIYA 1X5OA 3Q83A 1JJ4A 2HHSA 5HP1A 3DMJB 2YWWA 5KFAA 3A12A 1KFSA 4A8YA 3SSQA 1IKWB 1J5EF 2QMWA 4OI3A 4RL1A 4Q8EA 3QWPA 2DJWA 2GIFA 3KLGB 4TQSA 4MH8A 1I5OB 1PCAA 3DGPB 3NEKA 1TU0B 4J9VA 2YKOA 3FDSA 1MLAA 1OQ6A 2K3IA 4MJKA 5HN0A 1FRJA 1QJHA 2FVSA 3R3TA 2D3OR 2HVDA 1XWLA 2P6TA 4F4KA 3DOKA 4OZ3A 1WEXA 2HWTA 1RTHA 1YK9A 2DYAA 2G9OA 3M6WA 4NRUA 4P9SA 1Y0HA 3T5HA 4Z2XA 1I1GA 5GADI 3VAKA 2J6SA 4KPYA 2FHJD 2PA8D 4DFJA 2LVWA 2XWYA 1WWHA 1Q7LB 3SQOP 4KFBB 3RW7A 1SUQB 4QIEA 1SPBP 3MR3A 2NXCA 1WG4A 4HACB 3OUYA 1Q5VA 4NEYA 1WSVA 1HQUA 1OSDA 1PYOB 1WNEA 1U6FA 1KQGB 1FNMA 3D0GE 1R27B 4URGA 2AGPA 3QQCD 4FXWA 1HFEL 4S0MA 5EHHA 4WCEQ 1GAOA 2WOMA 5KFZA 2AX0A 4A8FA 1NKCA 2MKCA 1HNVA 3CE8A 1S6QB 3N01A 3T1HF 4PQUB 1AA1B 2CPFA 2I1RA 4N47A 1DAXA 1IQZA 1Q1KA 1SH0A 1JKHA 2CA9A 3NAIA 1HNZF 4OHYA 1O6XA 2QL5B 2R7RA 4LBHA 3SBMA 2VFTA 2C3OA 1JLEA 2D41A 1SQFA 3C14B 3FEYB 3T1HJ 1XR6A 2J9DA 1L3UA 3OTOJ 2UUCJ 5DZ6A 1HNZJ 4TY8B 5ETKA 2F65A 4IDKB 5ETNA 5EN1A 4QYZK 3FVYA 4R5PA 3DI6A 1KC8T 4KJIA 3GV8B 4DR6J 4LR8A 2XMMA 5FD1A 3OTOF 4EBDA 3LO3A 4TVAB 2HNDA 2B9YA 2FJBB 1X5TA 3CJ5A 3N6NA 2G1HA 4FPRA 1DQAA 1Y10A 4F4XA 1TMJA 2BBEA 4ZPAA 3G82B 1FKPB 2MQQA 3MM7B 1YLXA 2HRYA 3MPWA 2GJ2A 2M0GB 4A47A 1HBUA 2XLIA 3I6PA 1NO8A 1S5ZA 2Q6CA 1K73T 2PSZA 1QSSA 1TAUA 4QR2A 3OR1A 3VF0B 4J90A 3P6YC 1FHTA 1CC7A 4NCGB 2HQGA 5CZXA 2B5JB 3RUBL 1TK8A 1M5PC 3P96A 4I67A 1V3ZA 4JV5J 3PYFA 5HLFB 2P9GA 2MYFA 3LF0A 2JLGA 1S9FA 1NB2A 1JXEA 1RA7A 3M6XA 5J1NA 4CH7A 1IKVA 1Q95G 3HHLA 4MYUA 4RBTA 3J81j 5LXRA 3MMBB 2P6SA 5B0AA 2IM2A 3EYZA 2BQ3A 1KVJA 1NSPA 5DQGA 2MZ1A 2EBGA 3D66A 4NLDA 4W92B 2Q3PA 3G96A 1GFWB 2DIVA 3GYXB 2HBRB 2V67A 2X1FA 1FRIA 5C25A 4ED1A 4JI7J 2NYHA 4DBQA 3DRSB 2MKYA 4ZDNA 4AD6A 3ZTOA 2QT7A 3I32A 3PX0A 3VV2B 1MMNA 2GZOA 2YX7A 3KUEA 3LGHA 3PG9A 3KLHB 4U6PA 1GX5A 4DL6A 2K7JA 4ZVTB 1U6BA 1ITPA 2FC9A 2XMWA 2BZ2A 3CO9A 2V34A 4QWCA 2L48A 2VFVA 4LUBA 1S6PA 3BB5A 3NXZA 4DCOB 3ZNUA 3FCWA 3BZQA 2GQQA 5A0YB 4F02A 1SL2A 1WF0A 3M1VB 4OYXA 2ACYA 3HULA 3MEDB 4QPTA 2EFVA 2JVRA 1HBOB 4TU7A 2E7VA 1XN9A 4WU3A 3GG1A 5AE3A 2CAJA 1GXLA 1P27B 2JWNA 1YJNS 4GO7X 4DS5A 1U4BA 2J6TA 3R1LA 2YKAA 3BSCA 4PWUA 3OHBA 4RW9B 5KFNA 4LF6F 1KHVA 2D9OA 3IS9A 4FYVB 1WC3A 4K0KJ 3LA0A 1R3NA 3EZUA 4UOCA 2GVZB 3W63A 1JWWA 1W26A 1WC5A 4DPXA 2E1RA 1DRZA 4TQRA 4YEAA 2B4UA 2XMVA 5KT4A 2QMUB 1R43A 2WVBA 5AJ3F 4ECVA 4JI3J 3FZBA 2FB0A 3CCUS 4Y2IA 2ZH3A 1IBLJ 1RTJA 3TZXA 2VONA 5IT9U 1LWCA 1XMOF 2V2VA 1KOOA 2RHQB 2ALYB 3TO8A 5KFBA 4RZRA 2UXBJ 2W4PA 3DNCA 1PC4A 2MZTA 2FC8A 1WDDA 4K5SA 3EPGA 3G2XA 2B9WA 5IT9Y 1AB8A 1BMQB 2HGLA 3DXSX 4ZLPA 3GIIA 5E7OB 3MAAA 2VA3A 1NPKA 4DV4F 3IA0A 2FTRA 4KE5A 4QIVA 5KFWA 2HS0A 3H4DA 2E5LF 1RWKB 4FF4A 3P49B 3QJPA 3W2WA 1S12A 1WUUA 1TUWA 4BC7A 3JSMA 4HLBA 4ZIVA 1NK0A 4N8OA 3DOMB 1U1PA 1IM4A 2C2MB 5A6WA 2V9WA 3W9HA 1SJFA 3D54A 3IBFB 4I2PA 1TL7A 5BYRA 5LMNF 2BOAA 4MIAA 1C0UB 2ROPA 3I5BA 3LQVA 3AOAA 4OJ3A 5BR8F 1TUGB 3HT0A 4ZN3A 3PR4A 2O01C 3L4BC 1EIYB 2CIMA 3SFGA 3CPWR 1VQ5S 4CO3A 2MXYA 4LFAJ 1VQLS 4Q5VA 5HO4A 1TK5A 3R9LA 5EX3A 2UXDJ 4B17A 4LQ3A 3VAFA 1H7XA 2IPOB 4F3MA 3LP1B 4I6AA 2V4RA 2GJIA 3TI0A 2V69A 3KYLA 2G2ZA 3BO2A 2E1CA 2QJ3A 2XYHB 4LSNA 3KK3A 1NBEB 2J0WA 2HMIA 4C8NA 3MUVP 2AP6A 3D28A 1B0PA 2J6UA 5D8HB 5DG7A 4J9PA 4UOHA 1A0OB 4XPCA 2NXEA 2V2QA 3JSYA 4DL5A 1O0PA 4NMXA 4NI2A 4X84A 5DGAA 1D0EA 4QU7A 2VICA 4WFAQ 1G7CB 1HD0A 4ZPDA 2LMIA 2HGMA 1HWLA 1X4EA 2IAJB 4A48A 2IDEA 1E6VA 1HNIA 4OZ1A 3P3DA 5E33A 2HSEB 2ZBCA 4PXCA 1K8AT 1NXIA 2M7SA 2JSXA 3UFCX 1OJ4A 4WTYA 2RRAA 1DLOB 2IRXA 2VUGA 2PMWA 1N0UA 4ZLJA 1M5HA 4B9NA 3WQPA 1Q5YA 3GWCA 5H9EJ 3UI3A 3DMJA 4DV3J 4FVMA 2HVHA 3OFEA 1IR2A 4LIRA 2UV8G 1VRQC 2FHMA 4QZVB 2XYPB 4YY3F 2ZM6J 5HBMB 3Q23A 4DV7J 2A6OA 1P1TA 4TY9A 1HWKA 1LXJA 4AXIA 5B0DA 3KLGA 4FBTA 5F3TA 4ED2A 1NZAA 1HBMB 2Z8QA 2HPUA 3BSAA 3LALA 4MKBA 2AT1B 2V4QA 2UXCF 4ILLA 1KLNA 1DURA 1JK9B 3LGNA 5D0RA 1NSKL 3H8YA 3L7PA 2CYYA 1RTHB 1B4SA 1FE0A 3OLBA 2YH0A 1SV5A 1LWFB 5GMKa 4B3TF 4RX6A 3IRWP 4RUHA 4K59A 4CYUB 1N36J 2LXFA 2Y0BB 2YTCA 2IMWP 1WELA 2BE2B 1EJ7L 3GSIA 5J1EA 1RT1B 2XYGB 4CLWA 2PA3A 4WFZA 1KQKA 4HACA 1ZPVA 2VF3A 4ZVSB 2N7YA 3EGNA 5T7LA 1HQUB 1RK8A 5DRKA 3WX8A 5L9NA 5KT7A 4CIOA 2W8LA 3E01A 4ED6A 2A2CA 5HANA 1IBMJ 4ECQA 4Y3CA 4R8UA 1H7WA 4CCHA 4JI8J 2A0FB 4UF4A 2CQIA 2GX8A 4O0NA 4WFNQ 3H7HB 3CJRA 2Y1JA 2WOMB 3D6FB 4OYMA 1BD6A 3B82A 3PIOQ 2OSRA 5HROB 2YQ1A 2E7WA 4DZDA 2JLFA 1R6VA 3VHQA 4ITSA 5D0HA 4PXEA 5ETMA 2RQCA 1SKWA 2POKA 1JKHB 4FYXB 4KC5A 5A2QU 2W24A 3UNYA 3RAXA 2CG8A 2HHXA 3CDEA 4OYWA 1YDLA 3PRBA 5LOQA 3G6YA 2ADCA 1JLEB 3C14A 2CQ2A 2RQ4A 1XBWA 3BSNA 2XNRA 3MHYA 1KN6A 1KOHA 4DR7F 1F5BA 1DJ0A 4TY8A 3AJDA 1ZM9A 4X4TA 1OO0B 4A8XA 4R5PB 4DI6A 4MK7A 4UZBA 1S9EB 4ZCKA 3AA9A 4PR6A 5ETVA 4UY8T 3T5KA 1D1UA 2JJ4D 4LRDA 2YBVA 2ATLA 3L09A 3TZWA 4NXMJ 1BGXT 3HMJG 2HLTA 2XZDB 2ASYA 4WP3A 2PFFB 3DKDA 1HBUB 4CLFA 3KK1B 3C6UA 2C22A 1X4HA 2XHWA 3OR1B 3M32A 4OFZA 3ITHA 1XNQF 1NDPA 4CO1A 3IR5B 3PRVA 5F9LA 3PV8A 1TELA 5HLFA 1E6YB 1Q7YT 3PEJA 3ZZPA 3PO4A 4DR4J 1L3TA 5K9FA 2EKYA 2LU2A 1ZAVA 1IKVB 3HHLB 2XMAA 4CLSA 1T9XA 3HHLC 1NLKL 2FHKA 1C1BA 1M0SA 2DCLA 2FIUA 3MMBA 2UUAF 3MMJA 4PCQA 3EJMA 3UN3A 3QT8A 4ZCMA 2QSFA 3PW0A 1G4CA 1RADB 2MMYA 4ANEA 3BSOA 1X8DA 1BQNA 4FZVA 2G0CA 2XLKA 1GMWD 3N6LA 1DQ9A 1MSWD 4KRWA 2V2ZA 1NJXA 3PKMA 4I68A 2ZWPA 2R42A 3MCMA 3UDVA 3UR3C 1DBDA 3IMQJ 3KLHA 3UN5A 2ZM6F 3K5PA 4DL2A 2NR0A 3O6QA 1A7GE 3LWMA 2BEFA 3IP0A 1M1HA 3O2IA 4X4NA 5BYSA 1W25A 4ED0A 3V4IA 1SVDA 5KOXA 4F04B 3QSYB 2BKOA 3DOLB 1NPPA 3IBWA 5DO2A 2H54B 2QEXS 1X5SA 4UT4A 4X4OA 3GIMA 4PUOA 3RB6A 4Z7YA 1HWUA 2CJBA 3QO9A 4KHPF 3PW5A 5C7PA 1QUVA 2KJVA 4J5OA 4J91A 1VQ7S 4IQXA 1NK5A 2BOPA 2QYCA 3MEDA 2MHEA 4UW2A 1OY9A 2N4CA 3DCAA 3CTRA 3H59A 3O3LA 3A8IA 5A8RA 4B9TA 5GMDA 2ZVSA 4G6VB 4WFYA 1D8YA 3DGVA 2L41A 4WYLA 2RAQA 2Z2ZA 3N4WA 2HYIB 2N3OA 2R4FA 2GVZA 3MMAB 3BQ1A 4K8RA 4NLWA 3MI7X 1P6TA 2AJ4A 2R7OA 1NHVA 1TAQA 4F4AA 2VG7B 4ZP7A 2Z30B 1TL3B 4ECWA 1X7VA 4WZQA 1Q82T 4GRSA 1H73A 3TUPA 3C6TA 3M2RB 1RBLA 1KNZA 4RLEA 2F7VA 2IVMA 2UUCF 5GAHI 2P9CA 3H42A 3LAKA 4QR0A 1IR0A 4F25A 2VQEF 3LANA 1LW0B 1C1CB 4KV8B 1IJEB 1RWPB 2CQDA 3EDRB 1U6ZA 4LF4J 5ETRA 3UCZP 4Y34A 1FX4A 2MZRA 1X9WA 3IG1A 2HHPA 3JAMU 2QLWA 4PPZA 5ETLA 1CQNA 5D3GA 2PC6A 1RWVB 3B6BA 2ZE2B 4LF1A 1RHRB 2DHSA 4OYIA 1SL0A 4JI4F 5SZTA 5C2CA 3TUZC 4PWDB 2EK6A 2RQMA 3W2WB 3T9NA 5HMWA 3US5A 3EZOA 4U7UK 2K1RA 2E66A 2VV5A 5KFMA 2B3TB 1TL7B 4RJVA 1FXDA 4X64J 4Q0BB 1C0UA 2DKOB 1N54B 3AHPA 2HAFA 3EGVA 4TN2A 4DSIA 1MG7A 2YNGA 4PXDA 4CLZA 3CJQA 5CD4A 2YX4A 3N9UC 4IFYA 2MY8A 1OPZA 2EI5A 2F4VF 2AU0A 1VBKA 3KJVA 2FJXA 1TV6B 2XMUA 1O5JA 5CYMB 1WHYA 4DSEA 3I96A 2KU7A 3ILJA 3PACA 1X60A 4KHRA 1LWEB 2XLJA 3AQOA 4KO0B 2D3ZA 3UDCA 2EWHA 4OIXA 2I2YA 3GIRA 2NXNA 5KFVA 1VDHA 3GV5B 1XC9A 1VQ9S 1VQKS 4USVA 3DLBA 3EX7B 2CPIA 4L3NA 4C8YA 3OTEA 1EZZB 3QFWA 4WWSA 2MLYA 2V9KA 2CRLA 4OJHA 1DTQA 1Y00A 3P4UB 3CJ4A 4N8NA 4Q2MA 2RF2A 2ZHAA 2I5JB 3D6HB 3CCWA 5F8JA 3VQSA 4ECSA 2YX1A 1S0NA 1F9HA 1HR0F 3ONQA 1JX4A 1MMDA 2RT3A 4OYPA 3K8WA 4P2SA 3BKUA 3W60A 2KM8C 4RW7B 4I56A 3CCQS 1KQSR 2RU3A 2DH8A 2O66A 2DR8A 3HO1A 1N8RT 2G4BA 5BJRA 4CQ1A 2KVQE 3ZZTA 5HBMA 2FZKB 3FZ2A 2LYVA 4GO5X 5DZ7A 4A8OA 3D0IE 2C2EA 3MMCA 1IM6A 4NRTA 3HHNB 2AD9A 2X1BA 4DUYF 3D1OA 1NJIT 4XIUA 2HIQA 4JI0J 4FDFA 2HBZB 5HATA 2DPIA 3K5OA 3EZ5A 3JB9k 2H1YA 2PO4A 1NZ8A 4Y28C 4D3GA 2V63A 2DGWA 4ZHRA 4USUA 3I0SA 5HI7A 3C19A 3QWUA 5GAEI 4QYZJ 3FSXA 3FMBA 4CYUA 2J7WA 3K17A 4WYWA 2KT2A 1VQMS 3NNHA 3TANA 4XO0A 4B9MA 1RT1A 3IM9A 2JNJA 4CO0A 3JSRA 2DPJA 5T7LB 1VQYA 3BGLA 3IGNA 1N6QA 2Q1LA 2R7QA 3GG0A 2PMZD 2CFXA 3AB4B 2CQBA 3WIVA 4YUDA 3RW6A 3CB4A 4R8UB 4KGKA 5F3ZA 3PX6A 4ED8A 2RMLA 4ZVUB 3TP2A 2DTJA 5KFIA 1RQ0A 1S1WA 2DNPA 3M6UA 2DGUA 1F2HA 1WHVA 2KXHA 5BYQA 1RLDA 4ZPCA 3RGIA 2HHTA 4LT6A 3AOCA 1URNA 2OELA 1DQ8A 2CQ4A 3MPVA 4KKOB 2KXFA 3M6VA 4DU8A 3R5CA 2RSQA 1S1UA 4M63A 3C8YA 1T02A 3D3CJ 1MROB 2XY6A 4JI4J 1FJGJ 1WC4A 3FQKA 2VOPA 1UCNA 4JI6J 5ETQA 1IKYA 2DH9A 2GJFA 6FDRA 3WC2A 2ACMA 5I4MA 4JI8F 3GJRB 1UVIA 4C0HA 1I3OB 3M4XA 4ED7A 2B4VA 5KFKA 3M8ZA 2KB2A 1UL3A 3M8QB 2E5JA 2MQNA 5MLCV 4LRBA 1JLGA 1X4FA 4F7VA 3K89A 4IOAQ 4NLRA 3NL0A 3KLIA 1JLAA 3DDNA 3MCNA 4FNIA 4PKDB 2HNYB 2FLPA 1AZSB 3HSDA 1FVSA 3EGZA 1ZA1B 3VAHA 1NKEA 3A3PB 1Q8BA 2FHJA 1R0AA 3CVKA 3SCIE 2MQOA 4MIBA 5DETA 4C8MA 3GR1A 4RUCA 2DITA 2XO6A 5L9XA 4LQ9A 1WOPA 2H65B 3L9ZA 3H4BA 3RAQA 4ELVA 3NMRA 3M32B 3VVTA 1C0TA 3BV8A 4X62F 5CD4H 3KG4A 2XBPA 4PEOA 4DDFA 4DV5J 1QVGR 4NLSA 4JI2J 5T41A 4FF2A 3FBCA 1SQGA 2BRKA 2DHXA 2DRBA 2HHVA 3RBZA 1F6TA 3MR5A 1UFWA 3KKFA 5DDRC 1VQ6S 4JI5F 2BV3A 1RHKB 2D3O1 4NXMF 4ED5A 4O3NA 1RAEB 1B7FA 4H54A 3NLCA 2GAHC 1QY7A 1JMTA 4LF5F 3FEXB 1U09A 2E29A 3ETMA 1BQNB 4Y2AA 5KOWA 2VHGA 2ZVIA 2DXDA 1L3SA 1RT7B 1WHWA 4U7CA 5IT4A 1R0BG 4J9NA 3BBCA 3IN5A 4LF8F 2B43A 2XWXA 3GP9A 5B09A 3M8PA 2EG2A 1WHXA 1UA1A 4NCAA 2Q79A 2QTWA 3OUYB 5J2QB 5C5JA 4ES3A 2R8GA 2FJAB 4C8ZA 1SJ3P 3ZZ0A 2P9EA 1N36F 4PYAA 4LF2A 5D0EA 2OD4A 3BKFA 3V4IB 2AYBA 1REGX 2HFSA 4UQGA 3K58A 2RIJA 1RWNB 5AT1B 3ELHA 1FEHA 1YJ7A 5KFCA 1I94J 1Q81T 2B9EA 1GT8A 3Q24A 1UWBB 2CPHA 3TUIC 4XPEA 5A8KB 2QA2A 1U2CA 2DGTA 1S6QA 3N0VA 4NX9A 5D77A 2DNRA 3QRRA 4QYRA 1FI4A 2B7BB 4WPAA 3FCVA 2W7PA 3G71S 2FVQA 1HPZB 3MDFA 1D8ZA 3SFUA 2FY1A 1CQMA 5EDWA 2Y8WA 4I1TA 3BN7A 3ENAA 4NXNF 4A8WA 1RDRA 4NLTA 5HVHA 4NLUA 2MSTA 3MMAA 1MW7A 1BXNA 3RJMB 2LDYA 5D6GA 4Q45A 1WC1A 5LJ5Y 3NMAA 2COLA 3CW2C 2MLZA 3MD1A 4IDKA 2R8HA 1S6OA 3UWTA 3C6TB 3M2RA 2JOQA 3DI6B 1SC4B 1UKUA 2RE1A 2NPIA 1ZOTA 2MJNA 3GCWP 3GFZA 2N3LA 4IG0B 4NYPA 1P9QC 5LSRA 1ICEB 3BGUA 2BMBA 2ZUGA 3I82A 1NJWA 2DRDA 1FKPA 5HMXA 3MM7A 5KFEA 4DV6J 1JLCA 4DQRA 3OR2A 4IH7A 2H5EA 3N6MA 3G6XA 1AUSL 3KFWX 5K8MA 1CJKA 3MM9B 1SH2A 4WK1A 3PY8A 4DR1F 3BDPA 4NCGA 2AEMA 4ETZA 2NSCA 1YHQS 1RUSA 2CKWA 4DF8A 1TFYA 1LFWA 2VPZB 4HL9A 4Q0BA 1FJGF 3CJ3A 1AW0A 4NEZA 3E8OA 3D1QA 3TQEA 3U1MA 5IQQA 1XNQJ 2HGNA 2GV1A 3NAHA 2ZHOA 2WW8A 5KG5A 2KZMA 3G4SS 2BDPA 5HAOA 3UVJB 1GMUA 2J7UA 3R5JB 3KJVB 2YNIB 1RHQB 5C25B 2RJZA 5LSOA 3UD4P 1UZHA 1B0VA 3DRSA 1KR4A 1XR7A 3LTOA 1FTRA 3R6LB 4TYAA 1P8GA 5CYQA 2IJFA 3WBZA 2EPIA 1U26A 1YGYA 2Y8YA 1BWVA 2EG1A 4KO0A 3QZ8A 2HHUA 3D68A 3I55S 1UEVA 2OO4A 3L7UA 1JJCB 3R7NB 4LF6J 3KHGA 4X4PA 3JQKA 3HHDA 3OJUA 4A8QA 1G1XA 2YPZA 4DS4A 1S79A 2R8JA 1J5EJ 4LFCJ 4H4MA 4JI0F 4ES1A 2IYGA 2RF2B 4JV1A 3FJ2A 5A0YA 5F8IA 3VQTA 3U1NA 3AA8A 2PI5A 5J1PA 4DV7F 3M9OB 2BVZA 4ERDA 1HBOA 2WZ1A 2XULA 3CUNA 5L46A 2KI2A 5L1JA 2LXIA 3NS5A 4K5RA 5E41A 1S57A 1WKJA 1S59A 2CPYA 3ENQA 3CT9A 1QAJA 2K7KA 3IS9B 4OJ1A 1YRXA 1EKRA 1ZA2B 2VZ9A 4DX5A 1Z2ZA 5H9EK 4ZS6A 2GC8A 4URQU 4H4OA 2W2QP 1JJHA 1SCJB 3MMCB 4OHWA 2WB1D 3BJYA 1NDLA 4NASA 2E44A 3JAMY 1TR0A 3MPDA 4WF9Q 2VB6A 2OKQA 1LWCB 4M5JA 3CGIA 3MD3A 3V5RA 4CT8A 1QE1B 3FC9A 4ZHRB 3MOJB 3QFHA 4M5GA 3ZZOA 2EFGA 4LSZB 2DR9A 4FS2A 3W3SA 2GNKA 3DHXA 2Z0GA 4EYHB 2CJQA 2CQPA 2W1BA 2YNFA 3BH6B 3QT5A 5IQ6A 1RP5A 5F8HA 3GIJA 1RBOB 3A1YG 3RTVA 4C8OA 2PI4A 1N6QB 1BC6A 2EFNA 4ZA1A 2BQUA 2RQKA 3JSMB 2GHPA 4ECZA 4FBUA 4F0MA 1IN0A 3R2CJ 3DOMA 1Y5IB 3OVSA 3OL6A 2B0GA 2J0SD 4LF9J 2MZQA 4I2PB 1V9OA 1K44A 3F73A 5HQ8A 2KDOA 3B8HA 3W2VA 4L73A 1Q16B 2RHSB 1FX2A 4OX6A 2VDHA 3WDOA 2QLJB 3Q8VA 1S1UB 2OIHA 2OTLS 2XI3A 3HVAA 3L7OA 2ZH1A 1DHMA 2ZOFA 5ETTA 4F2SA 1UMJA 2HK3A 2Z58B 3QT7A 2VKZG 1T9UA 1FRXA 1U47A 1S0MA 3DYAB 3UQSA 3PVXA 2XSFA 1HQEA 4QWEA 1UJ5A 2AJFE 1S9GA 2ROGA 4ELUA 3BBFA 4C0BA 4I64A 4LSNB 3KK3B 3DHWC 4DV5F 4U67Q 1NK7A 4YOEA 1JLGB 4X66F 4CM2A 3H5XA 3VGVA 2XTJP 1IJFB 3OFFA 1JLAB 1F5CA 1XMBA 2XC9A 3CJTA 2HNYA 3NGTA 4ZVQB 1NCLA 4YDDB 2R2UA 2FVCA 2RU9A 2DNNA 4R0JA 5I3QA 1FRMA 1E6VB 1AT1B 1HNIB 4ZJOA 4C3MA 4C8KA 2QV6A 3AQPA 3Q8RB 1VRTB 1HIYA 2WBRA 3NBPA 3PHTA 2V8VA 1JNZB 3OLAA 3DLKA 3HSGA 2AEJA 4OI0A 2ZFHA 2C2DA 1LNQA 2YWEA 4F2RA 3IBCB 9ATCB 5KG7A 3OPKA 4JI3F 2ZWOA 3MR6A 4A8MP 4WKYA 3CJSA 1WG1A 3CDAA 3LOUA 4MIWA 1TKDA 5CXTA 4M95A 5GAGU 8AT1B 4WKRA 2V8GA 4JB8B 3AT1B 3VALA 4HH1A 1Q8LA 1HBMA 3RU0A 3TWZA 1QSYA 3PO5A 2OFGX 5F8LA 3Q2TC 1RTDB 1F3VA 4BBYA 1UJ4A 3CCZA 4FKYA 5HJYA 3RRKA 1SV5B 1JQGA 3MECA 1LW2A 2W9BB 5DM7Q 2AQ4A 1T3NA 4G1PA 4W98A 3OHAA 1RT7A 3TRGA 2BE2A 2ZOMA 2VPXB 5J1EB 1UEKA 3TA1A 4NL5A 2JEFA 2KFNA 3M8PB 1Y11A 2H5IB 4RNMA 3W9IA 4DCJB 5J2QA 1TL5A 2QX0A 3R5BA 4MFBA 4O44A 2M3DA 2F8MA 5BR8J 1KRPA 3E01B 3JYTA 1IBKF 2J0QD 1DZ5A 4LR9A 3NGDA 2FLOA 2IY5B 1HHQA 1U49A 4C6AA 3O8WA 3NGSA 1UWBA 2GVDA 3MR7A 3TVYA 5A8WB 1S10A 3QRQA 4A8SA 1OIAA 2CQGA 4F0KA 1RE1B 2V50A 2VJUA 1D9DA 4LF8J 1SC1B 3WC0A 5KTQA 3OTDA 2R7WA 4GKKF 1CS4B 1TKTA 3Q8SB 3FBFA 1VQPS 2KFYA 2VC1A 3EUNA 3S1TA 4DOZA 2QIFA 3M2UA 1ULRA 2FYXA 1A6LA 1GEHA 2DO0A 4NE9C 2CVEA 4RUBA 4ER8A 1M1KT 2QG9B 3AD8C 3UPFA 1KSPA 2KYZA 3KK2B 2DNMA 1X4BA 5HQMA 3BR9A 3HHLD 4C9DA 5LT5A 2XO7A 1XMQF 2P8IA 1YWXA 4TLRA 3IWLA 5EWGA 4ECTA 2Y9HA 3R1HA 3KLVA 2PN6A 1DY3A 4DHVA 4OV1A 2OEMA 4WFBQ 4IG3A 2CNLB 2EK1A 1UVNA 2VOOA 3HZGA 1JLCB 1NSAA 2AW0A 2KVIA 3PNIA 1NJZA 1F1BB 2F40A 3C6UB 4J37A 4AL6A 5L39A 3EVWA 2CJKA 4KR0B 3G87A 4RU2A 4NLGA 4AT1B 2GQ2A 1VYAA 2C3UA 3ISZA 3ITHB 5E2QA 4L76A 4YS2A 2QA4S 3FRZA 2CNNB 2ZC3A 4OI1A 1EKSA 4EBEA 2NLWA 1E6YA 4PPDA 4P6QA 4MAKA 2Z2LA 1OPIA 3GONA 1R8BA 2KKHA 2OI2A 2W2MP 4OYBA 2E5IA 2ZNZA 4QWAA 1U1MA 4V19X 2ASDA 1U1OA 1QM9A 1F60B 1PKUA 2B9XA 2QYGA 3QGPA 3QYYA 1H3DA 4P52A 1HI8A 1RAOA 4KIAA 4ZP8A 3F0NA 1N48A 4RWXA 1UVKA 5KT2A 1GQEA 1HW9A 2LP4A 2K3KA 1HLWA 2YNIA 4RNFA 3UR0A 2Y1IA 2HZCA 5F41A 4KGZB 1LK5A 3G8QA 3DLHA 1MN7A 4HI2A 1C4AA 1NPRA 4IYQA 3SV3A 5KFRA 4YP3A 4GC7A 1VISA 2ZD1B 2AJ1A 2Q6BA 2QO3A 1DARA 4CO4A 3PEHA 3J80U 2Z57B 4DQPA 2MEWA 5H9FJ 4B9LA 3SZ2A 3GV7B 3DOLA 3OXLA 2FD2A 4CLLA 1HYSB 4H4MB 2OPRA 3QO9B 3BGRB 3BEGB 3DM2B 1RWXB 6FD1A 4F4ZA 2B8QA 4YDXA 1NHKL 2VQEJ 1EAYC 2D9PA 2VJVA 2GQCA 2BXJA 1N88A 2GS8A 3O1LA 3UCGA 3PW4A 2CQ1A 4J9UE 2DEJA 4QOTA 5D4OA 5A8RB 1S1TB 4USHA 2XGQA 4IR9A 3D7SB 4KGMA 3IAS9 1T05A 3GJSB 3U7JA 2CXEA 4L3KA 3TUJC 3M8WA 2KJWA 4H4OB 1UVMA 4AUKA 1QD1A 1I6JA 1CLFA 4JI2F 1RYSA 1V6HA 3JSBA 5E3CA 2FGOA 1S77D 3H40A 2KFZA 5HMYA 5KFFA 1IBMF 5K8OA 2X51A 2LQ9A 1WI8A 3IRXB 1T9YA 3MWBA 1LW0A 1S1VA 2WSCC 1K0TA 1S1XB 2BJ3A 4LBPA 1SQEA 4DX7A 2ZNYA 3IG1B 2QA4G 4DR5J 4LF7J 5KFUA 4A4JA 1UP1A 3CF5Q 4AL5A 1WI6A 4OJGA 4O3PA 3R8YA 5D3GB 1QLNA 2ZE2A 1PJ7A 5SUHA 4ZJLA 4ENOA 1UVJA 3HLUA 2EFPA 5F8MA 4TKTA 4ILMA 2GMHA 1VBZA 4N76A 2WVDA 1XERA 3N28A 1LK7A 1LEOA 1PG5B 3FK4A 4P2XA 3A8JA 2K1RB 1VS3A 2LFVA 3DDKA 2UV8A 4KGVB 4LF5J 3W65A 3ZZYA 2G2OA 1ZS6A 2VBXA 4JI6F 2IJNA 2OMOA 2HHHF 2HWHA 4NA3A 5J2NB 1PJ5A 1H2UX 4AE5A 2R7VA 2MKHA 3EGWB 2DK2A 1N33F 1PYTA 2BM0A 2KM8B 2Y1LB 4KYZA 1KEKA 4CLTA 1FFWB 3VAIA 4DV2F 4HT5A 5KG3A 1R6YA 2IVYA 4DZ6A 1B70B 3HCXA 3DYAA 5L1IA 1EQMA 1LWEA 1HQEB 2MHNA 3AH6A 2RDJA 4E98A 1S9GB 3CMQA 3EXYA 1S72S 3M8YA 2M9KA 3HVRA 2M8DB 3I9ZA 2YXLA 3BO4A 3KUHA 3THPA 1FT8A 1H74A 3H20A 3LH2S 3BQ0A 4DQSA 1N56A 2E9TA 2BANA 2YKPA 5KFJA 3OJSA 2P2CB 2ZBRA 4OYZA 2BQRA 1T03A 4F50A 2KH9A 2VASA 3EDQB 1DTQB 3C3LA 3T5JA 2J8AA 2RILA 2EC0A 2I5JA 3ILOA 4USWA 3BGFA 3LGMA 1VRTA 1JB0C 3POTA 3NBPB 2GMJA 3FQLA 5IOLA 3M2VA 1ZM2A 3DLKB 4OZ5A 1ZTWA 4WIQA 1KBRA 2UXCJ 2XG8A 2GA7A 4EU0A 1FDDA 4IOCQ 3W8GA 3QIPA 3TYTA 1RAAB 1NKBA 2DR5A 4QCLA 2VFSA 4OI6A 3UDEA 4NLOA 3ZXWA 4UOGA 3EMTA 1RT4B 3I4PA 4J7CA 3THTA 2ADBA 2JLEA 3DLLQ 2OEJA 2ZBQA 4O0IA 1SXLA 5KFSA 1CJVB 3D1HA 5KT3A 2VFRA 2CQ0A 2OFHX 2FJVA 2EC2A 4B9UA 3BF4A 3CDUA 2AKWB 2U2FA 4OLPA 5D15A 3FBBA 4AXJA 4L75A 4PG6A 4RUAA 3MUMP 2UUBF 2VQFF 4KY3A 4IO9Q 1SL1A 2ATCB 1UEUA 1LW2B 2W9BA 2ZJPQ 2MKSA 3TEGA 2DNLA 4LR7A 1LXNA 1J27A 1JLBB 1SIZA 4K2JA 2OGUA 1B64A 3HK2A 4CLYA 5ITHA 4C7QA 4LF9F 3QAEA 2Z2YB 1RSCA 5CABA 4X64F 4OX9J 1RB0A 4ICLA 4MFBB 4O44B 1IWAA 5CH7B 1URRA 4OI2A 2C2KB 1D9AA 2H9ZA 4NLPA 1MWQA 4DUZJ 2WAQD 1OMSA 5AJ3J 3HKWA 2NZ4A 4NZ7A 4DSLA 1S1WB 2KT3A 3DLGB 4F26A 1AXQA 1N5TA 5IXUA 5A2QY 1N32J 4TLQA 1PBAA 3TQ1A 1V5VA 2YPYA 4NXNJ 1XMQJ 1EP4B 4DUZF 1QDUB 2MQMA 3C16B 4LF7F 5HVGA 4DR5F 3V6DB 4DX8H 2DCUB 2IRUA 4DV6F 4IKAA 3EPIA 1CVJA 4L6V3 1MROA 3DLEA 5IWAJ 1T11A 3CO0P 1SKRA 4O3SA 1RT2A 1WC6A 1JLQA 3Q22A 2JDJA 2XS7A 4HEA9 4C11B 1YBTA 2BJ8A 1BLUA 1U2FA 3DRXA 3M2UB 3Q8UA 2GGPB 4IH5A 4WIIA 1GTEA 3JTNA 4KH0B 4K4TA 1NK4A 1TFWA 2CJ9A 4QJVA 3MAHA 5KG0A 3FCHA 3KK2A 4OI4A 2BABA 2XSJB 3DRPB 3M7VA 4NLYA 1GH8A 4M5DB 3KLIB 2R8IA 4YQWA 1TL4A 3R7BB 4N5SA 1YRTA 3VCDA 2UVWA 4IOBA 3RBDA 1BQXA 2ZBIA 4XDCA 3ZTQA 4NMLA 3VVUA 1IBCB 1R0AB 4HDHA 3AJ2A 5M2UA 4YR0A 2HQCA 2BJ7A 1M5SA 1R8AA 2RUGA 1H38A 5H9FK 2DGXA 1KQFB 1QVFR 1UW9A 4B02A 1UJ6A 1IR1A 1NH8A 2MGZA 4NLVA 3AD7C 1MU2A 3MTKA 4X4QA 2NYIA 1VR6A 3RB3A 4K50A 5KFPA 1VIOA 1CG2A 2YWGA 3PR5B 4YFUA 3Q2SC 5B7WA 4ELTA 1JXVA 2NXUA 4KAIA 1MNEA 5MAOA 4H4KC 2X1GA 2M8HA 3BREA 2W4CA 3DRYA 5JUMA 1B7YB 5DM6Q 1Q79A 4G1IA 5C24A 5HL7Q 5JXSA 4UOFA 1HW8A 2DB1A 5K20B 3OVBA 3GYGA 4TYBA 2LQJA 4RR5A 3UE2A 2AF6A 1NJYA 3CC7S 2AV5A 2CADA 1UWAA 3OVAA 1GX6A 1U45A 1HR0J 1RGVA 2ZD1A 1OYEA 1R0CB 1KFDA 3FMWA 3VWSA 3Q8QB 1NK8A 3PJWA 2DNOA 3NGRA 1B3TA 1QSLA 2W4DA 2QMXA 2J5AA 2C42A 1CJTB 4ZPVR 2CQHA 2KXNB 2JC1A 2KO1A 3MM5A 3LP0B 1S7HA 1HYSA 2OPRB 2OPPA 3P8BB 5LSLA 1F5AA 1FRLA 2B6AA 2BJDA 1RISA 2YKMA 3BGRA 4TNOA 5A8KA 3GYNA 5KFQA 4OX8A 4A46A 1IBKJ 3ETOA 1U1LA 4ZPWR 1NB7A 1WACA
chains in the Genus database with same CATH topology
2EBEA 3DC2A 1S6UA 3J80Y 3I9V9 3NP5A 4H4KA 5FIIA 5HMZA 1YJ9S 1L5UA 1HPZA 1S49A 2RKIA 1IBLF 3HVTB 4ZP9A 4J9KA 1FXLA 4FXVA 4NA2A 1T05B 5KFDA 2FJEB 2F3JA 2AJQA 2E7XA 1I94F 4I7FB 5AXLA 3GQCA 3D2WA 1R8PA 3OQ2A 5FLXY 3Q0AA 1QAIA 2HS4A 4CI0B 1VFJA 1K9MT 2Q66A 2WONB 3IRXA 4FF1A 1G6BA 4IG0A 5J2PB 1S1XA 4O4GB 3THVA 2FUG9 3RB0A 1FJEB 4IRCA 5I3PA 2WBMA 5IWAF 1TP7A 2R7TA 2BM1A 4M1KA 1NH7A 4RW8A 5E0OA 3OR2B 3T9ZA 5ADZA 3VAGA 3SSSA 4V19J 2GHWA 3MM9A 3LWLA 5B0CA 3MR2A 5U47A 4RBVA 2PGCA 4ID5A 1IKXA 3LUYA 4MK8A 2W9CB 1YTYA 1X0FA 4YR2A 3MM6B 3PDNA 3SDEA 4JYAF 3KLFB 5T14A 3M05A 3LAMA 4ECXA 3MUTP 1H98A 3GMGA 3K57A 3OTCA 4AYBD 4LSLB 2ZH5A 1VRUA 5J2NA 3ZC4A 4ZOSA 2E5GA 2DGOA 3FFIB 3RZAA 3T19A 1KS2A 1YQHA 4PG7A 2DO4A 5CA5A 3IFEA 1RI7A 3S6EA 1TKXB 5CYQB 1FD2A 2IA0A 2OD6A 2RRBA 1RKIA 4LVOP 2O5DA 4ECRA 2ASLA 3UD3P 4DEZA 1XR5A 2UXDF 4YB1P 1S76D 2XNQA 2NPFA 3OSNA 4RKUC 1UA0A 5EX0A 3PM9A 4K0KF 3V6KA 2GW8A 3POTB 3PRDA 3RR7A 4DL7A 1GXUA 3RRHA 3L3CA 3H5SA 4DFKA 1R7IA 4DN0A 1RT3B 2ZKTA 3QIPB 4IRDA 3T5LA 1AFJA 3TAMA 5M2RA 1F0XA 4URSA 2W9AA 2C2RA 4F4WA 3OW2R 1VQ8S 2VG5A 4W90B 3T1AA 2I9SA 4I0WA 4D3HA 5EWFA 3BDEA 1AROP 4UQTA 3PZPA 4OZLA 4CTAB 4ETXA 1QE1A 1HMVA 4Y00A 3DXBA 1SB6A 4OHVA 4XDDA 2QSWA 2R2RA 3TAQA 4EWTA 4AFFA 2IBKA 1JLFB 3MEGA 1VLYA 3I56S 2ZHBA 2BYCA 3K5LA 3FEZA 2YNFB 1N5YB 4HT7A 2M4MA 4EO8A 5JJBA 1YIJS 4ICLB 1FRHA 2LXUA 4DLGA 2R8KA 2AYEA 2RDIA 3ISNC 3CJ2A 5F0UA 4ATNA 2ABYA 3HI9A 3KWMA 4RNHA 5L1LA 4G3IA 1H0HB 3NKYA 4WE1A 2KZZA 4HVZA 2CPZA 2ZDOA 3I0RB 4KHMA 2D3UA 1EP4A 1EETB 4CNYA 3W2VB 2J9DE 2RRNA 3GE9A 2ZH2A 3K59A 5IS2A 3CDWA 3CD5A 3F44A 1RT2B 1M90T 2CDQA 3CJKA 3X3UA 5KFXA 2WTFA 3KOAA 2GGPA 4MKYA 3PXGa 1TZ0A 2X1AA 4FYDA 4J9OA 4ZVFA 3TVKA 4DJBA 3R5DA 2VBZA 2LKZA 4JBCA 1S0VA 4C0OC 3CJ0A 2KRBA 2DR7A 4LJMA 4Y2KA 2GCFA 2VG6B 4ID8A 3RR8A 2JFKA 2IVFB 4DR4F 1RTIA 1X0PA 3RAMA 2DIUA 3U1LA 2YNHA 3VR1A 4JV0A 2MGZB 1FRKA 1BWEA 7FDRA 1U24A 1FK9A 1TL1A 4X4SA 2N82B 2W7OA 1FDBA 4F4YA 4WXWA 5B0GA 4I69A 2XS2A 3SQGA 2YWKA 3HHNB 2J0XA 3F41A 3MEEA 2NREA 1BY9A 2AJ0A 3G9CA 1QAYA 1M5VC 1HARA 4Y6IA 4DR3F 1RTDA 2IA6A 2I38A 3O44A 4YHHF 5C24B 4OHZA 4F67A 5D4LA 4LMZA 4WF9Q 2M2BA 1NEEA 1Y5NB 3E2EA 3MECB 3QLHB 3CCLS 4DUYF 3MPYA 1YSJA 3IGVA 2VA2A 1YVFA 4K4UA 2ROEA 2E5HA 4JOUA 3HKZD 2XB2D 2LQBA 1U2RA 1MWZA 3UCUP 3RB4A 1CSJA 3JYTB 3HXMA 5E3RA 2BUNA 2SXLA 5KG2A 1KTQA 2BW2A 2CQCA 3LP0A 4DG1A 4NWBA 2B6AB 1WEYA 1RYRA 2F9JA 2MDAA 5A8WA 2O1PA 3QIDA 2XEXA 3BQ2A 1L3VA 2JHEA 3MGJA 1CEZA 2B7CB 3TX8A 1CPZA 2M88A 2HNZA 4WK3A 1D3WA 1SJ4P 1K0VA 1WTBA 1TKTB 5KFYA 1N5SA 3CXCR 3CULA 3CC2S 4I2QA 4OLOA 3G8SA 3TVZA 4EZ6A 2YH1A 5E3PA 2GIRA 5G0RB 2HRUA 1XTZA 1ZM3A 1C2PA 5IM0A 1Z4UA 3PFEA 2HLUA 2AGQA 4HH0A 3HZEA 2WONA 3V4MA 4ZVHA 5KT6A 4O4GA 2XZWA 2E9ZA 2NS1B 3MXHP 1T7PA 4IG3B 1FTCA 2I0XA 5CHCB 4X4UA 2R7XA 4RW8B 2YQ3A 4MYTA 1GTHA 1NK9A 4ZVEA 2L08A 2BR0A 2UZAA 3O5TB 2WB4A 3C66A 2MSSA 3GFXA 1VMBA 2YY3A 4BDPA 2VPWB 1IKXB 1SJ1A 2BRLA 3CD7A 4Y2CA 4EGLA 3NWGA 4K4XA 1U48A 1VBYA 4FXDA 4NZ6A 3LP2A 3KLFA 4QU6A 1KTVA 1YRUA 2O67A 4O4RA 4LSLA 1ZH5A 4R25A 3FFIA 1VC0A 1QTMA 4DWIA 2IRYA 3VZIA 2R2TA 4ALZA 3G6VA 4NCBA 2C28A 5LMUF 4EO6A 2PMHA 4C3LA 1Q53A 4WU2A 1YJRA 3D0HE 3SMZA 2ZOGA 3CMES 2B4PA 4FNHA 3E3XA 4I6WA 2VPYB 4MTPA 1SJQA 2AX1A 3KHRA 3HVWA 3CCJS 2MZSA 2RNEA 2B56A 2CG4A 5DG8A 1U1KA 2UP1A 3HPOA 3ISND 1KLMB 3OL8A 2LU1A 3DM2A 3UDLA 4DMZA 2HWIA 1XEZA 3KG1A 3NRBA 2GFFA 1GNKA 1ZZFA 5KFTA 1JJ2R 1D9FA 2DISA 4ES2A 1RT3A 3QGGA 1S1TA 1U1NA 1H6KX 4X4VA 4B3OB 2MQLA 2KHDA 3VTIA 1N0VC 3NCQA 2ZDPA 4OZJA 2B51A 5K5MA 2ZH9A 1OSCA 4NA1A 2GO9A 4PG4A 3OL9A 2KHCA 4OL8A 2LECA 1N5QA 1FA0A 1KHWA 2DNGA 3ZZZA 4ZMMA 1FO1A 3BO3A 4IRKA 1S1VB 2EFQA 2V4JB 3MCSA 3T1YF 2DVIA 2D1CA 2QFJA 1JLFA 3MEGB 1YJUA 2OAUA 2F8HA 4NPOA 1N5YA 2XCAA 2HVZA 2CZ4A 1NK6A 5CQGA 1FNXH 2UVRA 3R27A 3G6ES 3NG8A 1TKZA 4HYKA 3MM8A 2LEBA 1VK3A 3PIPQ 2FDNA 1UETA 1ZM4A 3QGHA 4I4BA 1FKAF 1WF1A 4DR2F 1VJWA 1WD6A 1X5PA 3CCRS 4N41A 1ROFA 4WE1B 3KNGA 2A2DA 1FD8A 3MFIA 5THWA 4EEYA 4IUFA 3HP6A 1EETA 1NAQA 4R0EA 1LKZA 2IM1A 2VKRA 2YWHA 2RD5C 5LL6d 3WX4A 2ASJA 4DR6F 2R9LA 2Y1RI 2J9EA 1REVA 1FNOA 3KLEB 5AXNA 1FEEA 1SI9A 3DLJA 1Q86T 5GVQA 4YR3A 2EVZA 3H25A 2N4DA 3Q8PB 2PE8A 2LEAA 5IT0A 2CPXA 2C3YA 4Q43A 1VIXA 3S8SA 2ZZMA 1Z2LA 3UW1A 3SSRA 2MB0B 1RT6A 3BS9A 5DLGA 3BM7A 3L95X 2BANB 1LQ9A 2DNHA 2OH2A 1FF2A 5I42B 1HI0P 1T03B 3C2PA 3QPIA 2ZZNA 5I3UA 1WEZA 3DOKB 1C4CA 4NLXA 4LVNP 3J7YI 3PHEA 2O3DA 4ZVGA 2HQ3A 4NYOA 3HT3A 2UVVA 3G86A 1KD1T 1VGYA 3MZIA 4KFBA 3M2VB 5B08A 4EYIB 4O3RA 2JC0A 2OPSB 1SH3A 4O3QA 4CO2A 1HNXF 1TL1B 2V8HA 4GMKA 1VI7A 2WHOA 4B3SF 1OWXA 1RT4A 2HS3A 3IO1A 3SQGB 3I87A 2WSEC 2WSFC 3MEEB 5E3AA 1FDNA 3G8TA 1UVLA 2L9DA 5F8NA 2DT9A 5F0WA 1T3OA 3V81B 3JTPA 4PQAA 3M9MB 2HAIA 1S0OA 2JZ5A 4C2MA 3QGIA 1N32F 1F9FA 2APOA 3HDSA 2HFZA 2LEPA 3GFYA 3OXFA 1JLBA 1Y3JA 2F9DA 4TU9A 2VH7A 3H2LA 2AWZA 4J9LA 4JV2A 1VQNS 1S99A 2KG0A 4C98A 3ZFVA 3K2YA 5KT5A 3CEDA 3CD0A 4M94A 4PG8A 3D5MA 4K4ZA 3PW7A 1JXLA 2CZVC 2IC3A 3GFHA 3QMQA 1X4CA 3DLGA 3CCTA 4DG1B 3KMQA 1YJVA 4QWBA 2HNDB 1MMLA 1NRKA 1WF2A 1XK8A 2IBOA 5KG6A 5GAEU 3NCPA 2DGVA 2WRMA 2GIQA 2NUHA 3IXQA 5E3QA 3RYLA 3V6DA 2FVPA 2HNZB 4B08A 3KG0A 2RVJA 3DLEB 4OQJA 4DPOA 4WZMA 4K4SA 5G4DA 1U1RA 3PW2A 5CYJA 2UU9F 1JLQB 2KT5A 4DF4A 2KYXA 4DSKA 4C11A 5GADU 2W25A 3OTBA 4J9RA 4DQQA 2JL9A 3H5UA 4WXOA 2F8EX 2MY7A 1BQMA 3FGVA 2XY5A 3K5NA 4IH6A 2OLWA 3H5YA 1CC8A 5IM0B 3M30A 2XSJA 3DRPA 3ULHA 2E1MC 4M5DA 1PILA 3VZHA 2HHQA 3CIZA 3DRRA 3DU6A 1RAJA 2HFNA 5L8RC 4GC6A 2HG4A 5LJ3Y 1TUVA 4RNNA 4LFBF 4Y65A 4IFVA 4RW4B 5M2PA 7FD1A 2V0NA 2AGOA 1ZYQA 3WZ0A 3NCRA 1RT5B 2M5YA 3SCKE 2OTJS 4QIWD 4Q7AA 2CPDA 2DHAA 2XMTA 5K8NA 4HDGA 3TNVA 2X3GA 1MU2B 1FVQA 4B3RF 3PKYA 2LA6A 2EFOA 4NYZA 3TR5A 3CCSS 2EW9A 2FGCA 3LP2B 3OXGA 2OMLA 5GAGI 5DS7A 1S6PB 4FS1A 4HI1A 2OP5A 5KAKA 2D7SA 3CCVS 4JI7F 2UUTA 3M1VA 3MTJA 2DRAA 1FKOA 3OV7A 1X9MA 5L1KA 1ZZNA 4ECUA 2ALZA 4M8LA 4CO5A 2G1DA 4K4WA 2BACA 4LFCF 1FXRA 3CCMS 4RW9A 3P5TL 1W2IA 1V3RA 2HFOA 2W8KA 5C42A 4KSEB 2YKNB 1T8EA 2VL1A 3W3SA 4F25A 4JUZA 2ILYA 1HI1A 5EUHA 4CT9A 3AB2B 2U1AA 1Y4ZB 3UNGC 3N79A 3C46A 4YB7A 4X2BA 1J2VA 3MM5B 3J7A1 1RTJB 3PX4A 2OPPB 4E0DA 3E51A 2YKMB 1VBXA 1VQ4S 1WTFA 4BS2A 1L3KA 1H2TZ 3KHHA 1MWYA 3GSDA 4KQZA 1Q78A 4O23A 1S48A 4IO1A 4NLQA 1KVIA 2D74B 2C3MA 5FDLB 2RKIB 4O3OA 3HVTA 5KG4A 4ZCIA 2XY7A 3MF5A 4DQIA 2ERRA 2UUWA 3SCLE 1H2VZ 2J9CA 4CH0S 3LW5C 3M8RA 3GB0A 5K14A 3FSIA 2NQPA 5AXMA 4I7FA 5EGYA 3V6HA 3LPYA 2PIIA 1ZAWA 4QW8A 4CZCA 1VHFA 2XCPA 2CPJA 4EBCA 1N52B 3CCES 4OZNA 3S7RA 5J2PA 1ZPWX 4NOHA 4BC9A 2UVUA 4HHJA 2JX2A 3LP1A 2MJUA 2QA1A 4A8KA 1TKZB 5B0FA 4WFXA 4P7TA 5LXYA 3J7Z5 1IUJA 5K8PA 5CZVA 4ID5B 2W9CA 2A3JA 3K7RA 2IFXA 4HKQA 1TVRB 3MM6A 1ZTTA 3SDEB 2LA4A 3CSKA 2QE5A 3W7BA 1N34F 1U1QA 5DQHA 3CDBA 2CPEA 1K1QA 1VRUB 2IHR1 2JH3A 1SJRA 3MOZA 1UFLA 2XMKA 4ZPBA 4AL7A 3BR8A 2BA9A 4TXSA 3K8VA 1YJWS 1DLOA 3KLEA 2AYMA 3H2VE 4J9MA 4DLEA 4ECYA 2JEJA 2LCWA 1TKXA 4NLPA 5JUMA 3BN4A 2V2KA 3GIKA 2OSQA 4USIA 1FJ7A 3IWNC 1DFDA 4QR1A 5KFLA 2OPQA 2QRRA 4RW6A 2FVRA 3TAPA 1RT6B 2Z4PA 3B4DA 1HHSA 5I42A 4J9SA 2XGPA 1JIHA 2Y0SD 2BJEA 5I3UB 4WJBA 1LV5A 4G1QB 1T95A 2LQ5A 3FSYA 4IR1A 2OJ3A 2MPUA 5F9NA 2DNKA 1LWFA 5B0BA 1OQ3A 4U9RA 1U25A 3SXLA 4YB6A 3MFHA 1KONA 2MZJA 3HX9A 4I6YA 5CCMA 1YBAA 2OPSA 2FJWA 4DL3A 4Z37A 2DGQA 4JI1F 1FE4A 2NUUG 2UXBF 3TA0A 3T3FA 3TAMB 4OZ0A 5KFOA 5J2MB 2VG5B 4MK9A 1V3SA 1ZETA 3V81A 3RRGA 4B9SA 2V94A 3IAM9 1N4LA 2KN4A 1YG0A 2AYGA 3AAWB 5AXKA 5HROA 5DG9A 3NS6A 1HBNA 4LIWA 3F56A 4CTAA 2MQPA 2CVIA 5EWEA 4RNOA 1HMVB 4N56A 2DBBA 4F3QA 3SCJE 4DL0C 3JTOA 5E5NA 3J7YU 1F2GA 1J5OB 3T6JA 4RU9A 1R89A 2ZH8A 1HWJA 2ZH6A 1RA6A 4FP9A 3KTQA 4RWWA 4ZK7M 3ZZRA 3OFGA 1R31A 2IC3B 3OSPA 4KT0C 1SKSA 3HM9A 1S9EA 4PRFA 4FVCA 2E9RX 2DNYA 3J7ZT 1HA1A 1FERA 1RWUA 2DH7A 3CIMA 3I0RA 4B3MF 1DTTB 2LLZA 2JVOA 2ZKUA 5L38A 4DV1F 3VAMA 1PSDA 1O51A 1RKJA 3KK1A 3TW0A 2FLLA 1Y7PA 2JRSA 1B0TA 2B4OA 2P5VA 2R2SA 4LF4F 3CJKB 2ZJRQ 5HP1B 4C4WA 3IR7B 1IKWA 1BQMB 1IXKA 3N5BA 4KB7A 2GMLA 5IZHA