3AB4B

Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
157
Chain Sequence
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
molecule keywords Aspartokinase
total genus 35
structure length 157
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B01
3P96A 4IO1A 2LQJA 2PC6A 3ENQA 3KWMA 2CDQA 3OFEA 3IXQA 2MDAA 1UJ6A 1UJ5A 5IS2A 2P9GA 2F1FA 3UW1A 2ZHOA 3ENVA 4GO7X 3U7JA 3DDNA 2FGCA 1YBAA 2QMXA 3TUIC 3IBWA 2J0XA 2PA3A 2H9ZA 3ENWA 3DC2A 3OFFA 4M8LA 2LVWA 3AAWB 2RQKA 2QRRA 1PSDA 4GO5X 3OFHA 2DT9A 3K5PA 3TUZC 1U8SA 4LUBA 3CEDA 2P9EA 2J0WA 3MTJA 4GMKA 3LOUA 4PWUA 1LKZA 1O8BA 5FIIA 1RWUA 2P9CA 3W7BA 2QSWA 3L7OA 3TUJC 1XTZA 3DHWC 3DHXA 3MAHA 1KS2A 4NMLA 3NRBA 3MWBA 1Y7PA 2RE1A 2QMWA 3LUYA 5JJBA 3S1TA 1YGYA 3HHEA 2JHEA 5IT4A 3N0VA 3O1LA 5IT0A 1M0SA 2JOQA 1SC6A 3AB4B 1LK5A 3OFGA 5T41A 3OBIA 4X84A 3AB2B 2DTJA 2NYIA 2RQMA 2I9SA 1LK7A 1ZPVA 2F8MA 1UJ4A 2KO1A
chains in the Genus database with same CATH superfamily
2E5HA 2NYHA 1U26A 1T9YA 2K3IA 5K8MA 5IZHA 3U1MA 4F4WA 1T8EA 2V94A 2Y1JA 2E29A 3UN2A 6FD1A 4IQXA 3QRPA 4LVNP 1T95A 3PKYA 2GV1A 4RUBA 4ERDA 1HNVB 3OFEA 3PVXA 1PYSB 2GVZB 3FCHA 2HNDA 4IR1A 4MFBA 2MB0B 1U0HB 4N47A 3SFUA 3VQSA 1H6KX 1T11A 2FLOA 2CQGA 3CJ3A 3KK2A 4CYUA 1Q86T 3GYGA 3SFGA 2DNGA 4PAAA 5C2CA 1PAEX 3FSIA 2J0QD 3KK1A 4FXVA 1K1QA 4CTAA 3CCQS 5L1IA 1QUPA 3T41A 2UXCF 5J2PA 2CFXA 2ZD1B 1X4CA 3I6PA 3BREA 1XC9A 1SXLA 2AKWB 4MJKA 4PG7A 3BSNA 3DLHA 1R6YA 1DLOB 2XTJP 2KJVA 3L3CA 5BYQA 1HPZB 1GAOA 3CXCR 4OI4A 4ECYA 5K8PA 3JXOA 3W2WA 3AXMA 2EFPA 2PT0A 3EGWB 4BCAA 3T1HJ 3G2XA 1RI7A 3OW2R 3EDQB 4ES1A 4ZVPB 1JLAA 1QAYA 1Y3JA 4DX7A 2E1MC 4USUA 1NRKA 3NGTA 2C1EB 5AXNA 5B0GA 4DUZJ 4C8ZA 1KN6A 4DSKA 5T7LB 3R2DJ 1VR6A 3CWJA 3K57A 1U4BA 3BS9A 3RW6A 1B0PA 3RB0A 2R42A 3LF0A 2FUG9 4C11B 2VBZA 4URGA 1LFPA 2K7KA 3Q8UA 2XMWA 3KLGB 5HLFA 2BQ3A 2EKYA 1FJGJ 1UVJA 1DY3A 2RRNA 1FT8A 3P5TL 3W9JA 2CIMA 4H4OA 1YJNS 3DLKB 4DV2J 4DX8H 1U8WA 3G86A 4UT4A 3VAIA 3DXBA 4HH0A 2FY1A 4K0KJ 3UNGC 1NU4A 2W01A 3IM8A 2QLBB 3ZZPA 4MIBA 4NI2A 2XS5A 2PMHA 3VR1A 4PABA 3TUJC 2KH9A 3DHWC 3KLHB 4UOGA 5IWAJ 1WUUA 2PSZA 2VG6B 2WOMA 4LFAJ 5JMNA 2X1AA 2RAQA 1R8PA 3OXLA 1C1CA 1DRZA 2UVVA 3OR1A 4J9VA 1Q7YT 2QLWA 4NLXA 4BWJA 3K7RA 3DLEB 5KG1A 2R8KA 2LEBA 3C6UB 2KJWA 1I3OB 3M8YA 1ZAVA 4IFVA 2DHGA 3MEDA 4UOHA 4ED1A 4MIWA 4NPOA 4WFZA 4JI2F 2ZH8A 1N33J 2AGPA 3GE9A 1C4CA 5CYMA 1SKSA 2GMHA 3BF4A 4N8NA 3AXKA 4FKXA 4OI1A 5CA5A 3RAMA 4RW8A 2L48A 3THPA 1CC8A 3U1LA 3CJTA 5A8KA 5KFMA 4DFKA 2FHJD 3MECB 4OI3A 3VAJA 2FB0A 1SB6A 1TU0B 4ECRA 4IFYA 3MPDA 4QIWD 5JVHQ 2Q1LA 3IWNC 4DUTA 4NCGB 4QYRA 3HK2A 3D54A 2XM3A 4Y0FA 4IG0A 2XWYA 1DQ9A 4QR2A 1MN7A 3PYGA 2W9CA 4UF4A 3CUNA 2AX0A 1EZZB 5DGBA 1VQ6S 4ZK7M 3UNYA 1NJZA 1UVIA 3HHLA 2CNKB 3Q8VA 3D0GE 1HNIB 1UZDA 2U2FA 3M8ZA 2AYGA 2E1CA 4X84A 3PJ9A 4USVA 4FYDA 3MDFA 5HN0A 1HBMA 4DPTA 2YVSA 3H4DA 1NMEB 4NL5A 3TVKA 1RYSA 1JLGA 3BDPA 4URQU 4HI1A 4M5DA 3UCGA 3LGMA 4EK2A 3RBEA 1BQNB 1X8DA 4CLZA 4IO1A 5HMXA 3M4XA 1AFJA 2BANB 2BRLA 2EC2A 4X4PA 2QC3A 4OL8A 5FJ4A 1JLBA 1UW4A 1S12A 1X4EA 1YQHA 2MMYA 1B3TA 3M1VB 4JYAJ 3T1YF 3IXQA 1Q78A 1X9MA 1HWUA 1HQEA 1BQNA 2RUGA 1KFSA 1A9NB 5BXIA 3ZZRA 2RDJA 1RB0A 2D1CA 3QNWB 1LEOA 5GADI 2HVDA 3LP2A 4EO6A 2UUCJ 1NAQA 5IS2A 4EGLA 4WIIA 2NXUA 2F3JA 1RT2A 4X65J 1X4HA 3DDNA 4P73A 3UN5A 1HNXF 5HATA 3NNCA 1RDRA 3BKFA 3R6GB 4O44B 5F8GA 4CWBA 3KNAA 3FBCA 2X7IA 2OIHA 1FEEA 1FK9A 3FGVA 3IBWA 1U1LA 2QX0A 2PE8A 2NSCA 2QYGA 3T1YJ 3HT3A 3UVJB 3RUBL 1KVJA 2W7OA 5IT9U 3GCWP 3R5CA 3W8GA 5KOWA 1RT1A 2Z2YB 1FKPA 4ZVOB 5EX3A 4JV2A 1TKZA 7AT1B 4LMZA 2LVWA 4X66F 3OUYA 3SV3A 2QRRA 1W25A 4O0IA 1YZ6A 3RAXA 4DWIA 1S79A 4UTGA 4DU8A 2VG7B 3KFWX 4LVOP 1BC6A 2CYYA 5LSRA 1SH0A 1WG4A 1SJQA 2Y1RI 3NS5A 5C25B 3TAQA 2KM8C 4MK7A 3GV7B 1N6QA 1SL1A 3H8YA 2SXLA 5AXKA 4DFJA 1M1KT 2XI2A 3D4JA 2HFVA 2IM3A 3NGKA 4GMKA 3HKWA 1HPZA 3N5FA 4KBIA 4DMZA 4F4KA 3CTRA 3MAAB 1YTYA 2FJXA 2A6MA 3QAEA 1RWMB 1S1VB 2AV5A 3FSXA 2D69A 2WW8A 4LF5F 4WF9Q 2YWEA 4DFMA 2FJWA 4F3MA 5HMYA 3M2VB 3GV8B 2ZDOA 1Q81T 3H5XA 3IO1A 3KDNA 2H51B 2R7UA 1RT7A 2I2YA 4QWCA 1FDDA 1WF2A 2AHOB 2P6SA 2VBWA 3FZBA 4M63A 2IVFB 2Y1IA 4DR7J 4FXDA 2CQBA 2CG4A 1RACB 2HFZA 3NRBA 5DLGA 4EYIB 2RRAA 4IDKA 2UU9J 2PI5A 1IUJA 3AHPA 3RB6A 5DQIA 2E5LF 1NK0A 4K4ZA 1H0HB 1X9WA 2M7SA 4JV1A 4B3OB 2UVRA 2I8EA 3PV8A 1DTTB 3M2VA 3DYAA 2HW3A 3KJVB 5FLXY 5L1JA 1VIOA 2YWKA 1SC4B 4Y3CA 2ZBIA 3QSIA 1S97A 2FGOA 5CYQB 1WF1A 3I0RB 4QWDA 4KPCA 1RWOB 3CW2C 1BWEA 4PG4A 3QGHA 3ISND 2ZZMA 1VISA 2ROGA 5ETRA 2JX2A 2Q6CA 4OHZA 1HNZF 2CJAA 2BJ7A 3NBPB 1S9GA 3PJXA 3MAAA 1SV5B 3J7YU 4DQRA 2KYZA 1DTTA 1UPMB 2B0GA 2XHCA 4DR6F 2GAGC 3Q86A 3RZAA 5KT6A 4JI5J 2DISA 4USHA 9RUBA 1DURA 1U25A 1CVJA 1HYSA 2HLTA 2WB1D 4F3OA 2ZBRA 2FY8A 3W1YC 4C9DA 4JP8A 2LQ8A 2MKHA 4I6WA 1FRJA 4MK8A 3E2EA 2AEJA 2R3VA 3C16A 1YSJA 4DU7A 5KG0A 3C8YA 3T5HA 1BHNA 1QAJA 2NZ4A 2LKZA 3EMTA 1M1HA 3HSGA 2XMAA 1HFEL 5F8MA 1UFWA 3FZ2A 1ZAXA 2XLIA 1T05B 3WQPA 2YNHA 3DYAB 2ALYB 1O6XA 1U0HA 3OXFA 3RU0A 4ECQA 2ZC3A 4DL0C 2ATLA 2O66A 2CQDA 3GJSB 1NJYA 2GO8A 1N5VA 1H2TZ 4V1Ak 3WIUA 5GMDA 4RW6A 4QW8A 3R1LA 4A8XA 1IR1A 1YIJS 4K4XA 4F7VA 1S7HA 2J76E 3ITHB 3KG1A 5DM7Q 1F9HA 4AQYJ 3B82A 4P10A 2AMCB 1KOHA 1OPZA 3UVJA 3V6KA 4I1TA 1X9SA 4KGZB 1AB8A 3EXYA 3N5BA 2YXLA 4RNFA 3UW1A 4C0OC 2ZHOA 3GIKA 2XS2A 3GFHA 5B08A 1G3OA 3AQOA 1BXNA 1X5PA 1RT1B 2NLWA 1B0VA 1HW9A 1R3NA 1RJJA 4OYBA 4K7QA 3TA2A 5I4MA 2W2PP 2MZQA 4F67A 2BANA 3AJ2A 5J1PA 1HBMB 1TK8A 3CO9A 2IA6A 1TMMA 2K06A 4ITSA 2G0JA 2PA3A 2DR6A 1MMLA 3DU5A 4O44A 4Q7AA 3GIRA 1VHFA 2C3OA 4UZBA 3TAMB 4G3IA 1UL3A 2FJEB 2GVDB 1FWKA 2R7VA 1UKUA 4TYAA 3NGUA 4EZ6A 1O5JA 1S1WA 3MM6A 2HS0A 1SKWA 1I94J 1X0PA 3UO0A 3CJSA 4LFBF 1ZA1B 1HBNB 2XNRA 2HZAA 4DSEA 4NRTA 2D9PA 2V2QA 4ZLNA 2O1PA 1HNWJ 3ZTQA 2ATCB 4DR5F 1WHWA 2GIFA 3G71S 4ECXA 1PGZA 2GCFA 1FD8A 1GX6A 2HLUA 3QIPB 4PXCA 5DDQC 4NCBA 1RT2B 2MZ1A 1FFWB 1JLGB 2WVCA 5FIIA 3AOAA 1EARA 1RT5A 2Q43A 3D1QA 2W9CB 2Q6BA 5D15A 3C19A 4I6YA 2LU2A 3I4PA 2V4RA 3KMQA 3GIIA 2VFUA 1BD6A 1SBRA 2ACMA 3MEDB 3GIMA 4UZCA 4DV1J 2M52A 1XMQJ 2HQCA 4CP5A 4OX9F 2ZVSA 2MQOA 2XYPB 9ATCB 1BY9A 4WU3A 5JXSA 4PWDA 1JLQB 2XWXA 1OO0B 4J5OA 5CABA 2IRYA 3TRGA 1BMQB 3G82A 1VRQC 3QWUA 5KFHA 1S0MA 2HURA 4Y2IA 3I32A 4FYXB 1XR5A 1ICEB 1YRTA 3TVYA 2V9WA 2ZEJA 2HNYA 3E51A 1C1BB 3QO9B 2EFGA 3G6VA 3CCRS 4C0BA 1M1GA 4OV1A 5KG6A 2N3LA 4WE1B 1RTHB 1AROP 1RSCA 4TKTA 1OY8A 3X3UA 5LSOA 2HIQA 2CDRB 2LU1A 5HMWA 3D1HA 3R7SB 4TY8A 3OL6A 3G6XA 2KRRA 2YKOA 3BQ0A 3RG6A 2B51A 4KO0B 2R8JA 4CLFA 2ZKUA 2WVBA 2RMLA 3QFWA 4I7FB 4W98A 5C24B 4TU7A 2DR7A 2DNZA 3R8YA 3LP0A 3DRSB 3EZ5A 1WKKA 2DO4A 2DR5A 2PD1A 3D67A 3CJ5A 1RE1B 3NOCA 3MCOA 1LK5A 5DM6Q 3GJTB 1Q8IA 2Z2LA 5T41A 4ANDA 2KZZA 3QQCD 3SDEB 2CAJA 3BGOP 3T6BA 4N56A 3ZC4A 3OSNA 1VQ4S 2VBYA 1TL1B 4USIA 5A6WA 4KGVB 1ZZFA 2VFVA 1LNQA 5KT5A 2XGPA 2L9WA 4LFAF 2B9XA 4AL6A 1FJCA 3IFEA 2F9JA 2DTJA 3BGUA 2MLYA 3PCOB 4OYIA 4YB7A 3EVWA 5M2PA 3RRKA 2KB2A 4J9NA 5I3UB 3K2YA 2MKKA 3MOZA 3KJFB 2KHDA 4M5JA 2HAFA 2GW8A 5ETLA 5I3PA 4YP3A 2NREA 1RA6A 3DLKA 3ILIA 3T9ZA 4A46A 4ELUA 4DR6J 3V6HA 1UETA 2V8HA 2IAJA 2KFNA 2HWIA 2CPIA 1NDKA 5CYQA 2M88A 3FCWA 2M3DA 2ZC4A 4O3PA 2H5JB 1CJVB 1HWJA 3FSYA 3LWMA 3OTEA 2ZM6J 2C2DA 2LXFA 3EDRB 2P8IA 4CTAB 3HVWA 1ZTTA 3Q23A 4RL1A 4ILLA 1HIYA 1P27B 4B3RF 1FRKA 1SH2A 4P9SA 4K5RA 3PW7A 2FZCB 4DL4A 4C8LA 2BE2A 2W2OP 4D3GA 4DZ6A 2DJWA 2FHKA 2IM0A 1RAGB 1P9QC 5D4PA 3H5YA 3KHHA 1NKCA 2FDNA 3DLLQ 1LFWA 4M5IA 2DHSA 2NR0A 3G4SS 3KUHA 3WX8A 1ZM3A 4JI0J 5JUMA 4MTPA 1JKHB 3GPAA 1WJ9A 4AQYF 2UU9F 1CULB 2W2MP 4Y2AA 1FE4A 4BBYA 2OH2A 1RWNB 2EWHA 2H9ZA 3JSMA 2CPYA 1SH3A 2B4OA 3CGIA 3HMJG 3KK3B 2CJKA 2PGCA 4C3KA 3V6DA 2VKRA 3P45B 3HX9A 4GO5X 1VJWA 1YJWS 2DT9A 4OYPA 2E5LJ 2DGXA 5EWEA 4W4MA 1KQFB 4ZIVA 3OSPA 3GR0A 5DO2A 3G8TA 3PX4A 3O5TB 3CCTA 1DQAA 1WKJA 3HDSA 2VBXA 2DY1A 3FBEA 4C8NA 3MR2A 2AQ4A 1KVKA 1T3OA 2PA8D 4EUVA 1WORA 2ZH6A 1N36F 2CPHA 3CEDA 2DR8A 3TUPA 2MZJA 2B5JA 1Y4ZB 3EXCX 5A2QY 3TYTA 4CLUA 4JBCA 1EP4B 5H9FJ 5J2PB 3K5MA 4LIRA 3Q24A 3BGRA 4NLQA 2BOPA 3V6JA 1NDPA 4AD6A 1O0PA 4USJC 3HF5A 1FWPA 1RHRB 3E8OA 4ID5A 4LQ9A 2C28A 2EVZA 2D9OA 3TX0A 3US5A 1IN0A 2LA6A 2MZSA 2FVQA 4I2PB 2DNLA 2HGLA 4JI6F 1R27B 2J8SA 4N77A 2GVZA 2HQIA 4TN2A 4PPZA 4KHPJ 4MKBA 3ENAA 2RE1A 3DXSX 4BS2A 4XIUA 1IVZA 4RLEA 3M6WA 4HHUA 1NM2A 4WYWA 5LT5A 2PIIA 5H1SV 2CJXB 2MJNA 1Q5YA 5JJBA 5H9EK 1IBMJ 3G9CA 2FIUA 2OLWA 4UUWA 3NMAA 4DQIA 3HZGA 4NLWA 1L3UA 4JI6J 3MXHP 2IDEA 5DDOC 1IXKA 1WD6A 2QT7A 2HGMA 4QIGA 4RBTA 2F4VJ 4I67A 3MZIA 1FNOA 3FBFA 2QLFB 2JFDA 4KHRA 3O3LA 2HVIA 1RAOA 3OHBA 4B17A 3CO0P 1SJ3P 3OPKA 2UUAJ 4I69A 1CG2A 2E66A 4MK9A 3CMQA 2JDJA 2VPZB 4JI1F 5D4NA 2VJUA 3NWRA 3LANA 3K58A 2GHWA 1UVMA 4WK1A 4F0MA 1N5QA 3L7UA 1NJWA 1FX4A 2RIJA 1IKVA 3DOKA 5K20B 1JLFB 3HFKA 4K5SA 4MYTA 2XCAA 3ZZUA 2VQFF 1URNA 1NDCA 1X4FA 2AW0A 3ZTPA 2VPXB 3PW0A 3FVYA 2EBGA 1VMBA 2I9SA 1WTBA 4OI6A 1HI1A 2LEAA 1ZPVA 1JJHA 2RSQA 3AJDA 4HH1A 1KOOA 5DG9A 2V8GA 2WSCC 5IM0A 4F36A 1TKTB 5DQHA 2ZZNA 2PC6A 3UWTA 2W24A 1RU2A 2QN6B 4ECWA 3LAKA 2DIVA 2ZUGA 3BQ2A 5EDWA 1M5OC 2QV6A 2LA4A 2N3OA 3RBZA 3LP1A 5E3QA 2RU9A 1KHVA 2HSEB 4BC7A 3J7A1 2MQMA 4Q2MA 3C6UA 4HT7A 3CIZA 2ZZTA 4ZPAA 4DV4J 4AL5A 2WVFA 3MMAA 4G1IA 2F1FA 3IA0A 2Y9HA 1NK8A 1RT6B 5IQ6A 4DF8A 2JEIA 1S49A 1PO6A 1HMVA 1LW2A 4GO7X 3VQTA 1XR6A 5KFQA 1VRTA 3H2LA 4C0HA 2CPZA 4B3MJ 4R5PB 3SDEA 1YLXA 2C2KB 2O3DA 3GJRB 2MZRA 3MR7A 5HO4A 2WZ1A 3H7HB 2I38A 5FDLA 2CADA 3H5SA 3ZTRA 2LDIA 1E6YB 3TP2A 2JLEA 4DN0A 1BQXA 2GVDA 1LWCB 4XK8C 5HL7Q 2ZHAA 4W92B 1MSWD 4CNZA 3TR5A 3T5KA 4LR8A 2BKPA 3DRPA 4XPCA 2VD3A 3RJMB 2GJFA 2QA1A 3HHDA 3BN7A 1GTEA 4P6QA 4JI2J 2G1DA 3M32B 2JNJA 3NCRA 3ILOA 4FF3A 1UCNA 3H4BA 4C3LA 1PJ6A 4KY3A 8ATCB 2DO0A 5G4DA 3DOKB 4LRFA 3MM9B 1F3FA 3VHQA 4KHMA 3KJQB 5B0EA 3UD4P 1EHWA 2Y8YA 2XZWA 2H4YB 2YNFA 2E9ZA 4IH6A 3A3NB 1VLOA 5DZ7A 1ELOA 3F56A 5AXLA 1FKAF 2QYCA 4ZCIA 1TVRB 2L41A 5D8HB 2VG5B 2H48B 2DGVA 3FDSA 2WB4A 4R8UB 3JYTA 3W66A 1HI8A 1WC4A 2IVYA 4TQSA 1TKTA 5MLCV 2A0FB 4GC6A 3MAHA 2V6AA 1UPPA 2KT3A 4PRFA 3I5BA 4FDFA 1JX4A 3DLGA 2VOPA 3BDEA 2R4FA 3IGNA 1KQKA 2J8AA 2JC0A 1QY7A 2Z4PA 2QMWA 1S10A 1NHKL 4CYUB 5ETOA 2DHHA 5F8HA 2QL7B 1X5OA 2BUNA 4DLEA 1Q8KA 1WOSA 4FZVA 4DG1B 1YDLA 1VOMA 3FMWA 1GT8A 5DDRC 4NXNJ 1EJ7L 1EP4A 4PXDA 4F04B 1RU1A 4F2RA 1U1NA 1CJTA 1RT3A 2IC3A 2L08A 4A8QA 2FHOB 5GVQA 2ADBA 4OJHA 5KT7A 3DOMB 3TAMA 5I3QA 3QJLA 2P6TA 4P74A 1H2VZ 2C2EA 3ET6B 1N32J 3I96A 4CT9A 2E5GA 3ISNC 1D8ZA 4WP9A 4OX8A 1VC6A 1S1UB 3TW0A 4C98A 5CD4A 4OZ1A 3OL7A 4KC5A 5F41A 5LM7E 2YWGA 1KSPA 1RGVA 4NA2A 3AB4B 5HROA 3UDVA 1MROB 5D0GA 3M9MB 4NXNF 1JXLA 2Q3PA 4KH0B 3MGJA 1Q16B 4OYZA 2B7CB 4U7UK 3HKZD 5I3UA 1ROFA 1Q1KA 5F0WA 2IVMA 3EICA 4ECTA 1IBKJ 4QBUA 3DNCA 2EC0A 2IRUA 2CNOB 1RT3B 1RLDA 2IC3B 3ISZA 4X64J 3IWLA 5KFJA 4B3SJ 1J5EF 3OTCA 3RW7A 4O3OA 1VQ9S 3NCQA 2OPPB 3T1AA 5LXYA 2F8MA 1UJ4A 1HL6A 1TP7A 3AOCA 4HT5A 2DXDA 4OHXA 3WHIA 5GAEU 4A47A 2XLJA 3VAGA 1PCAA 2VH7A 1PBAA 5IQQA 1U2RA 1U7LA 1H73A 2MQPA 3JQKA 1IWGA 4RO0A 2BJEA 1NK4A 1QAIA 2CXEA 5THWA 4LBHA 1V3ZA 2IBOA 4X64F 4Q5VA 3KLIB 2ZHBA 1Q4RA 3D2WA 3VALA 1QM9A 1W7WA 4DCJB 4EI2A 3BKTA 2V2VA 4O4RA 1HHSA 4R0EA 3TA1A 1LWCA 3K0JA 3RR8A 1UJ6A 3PM9A 4UQTA 1B70B 3CJ2A 4UY8T 1X4DA 3IS9B 4B3TF 1CJKA 2GZOA 1C1BA 5GAEI 4ZCMA 2Y0SD 2VONA 3J81j 2C42A 3IN5A 2JEFA 2DCUB 4QIEA 1TL1A 4X4QA 3MAQA 4Y34A 1YBAA 2GAHC 2NUUG 4NYPA 2YH1A 1VJQA 1RT6A 8RUCA 1DZ5A 1U6ZA 2VG7A 2XNQA 3CDEA 4U96A 4HL9A 3MURP 1VQPS 1E6VB 4RUCA 3LH2S 4P71A 2MKJA 3ENWA 5J2QB 5BR8J 3R7BB 4FBUA 3HCXA 4URSA 4JI8J 3BZQA 5KFFA 2RQKA 1R8HA 4TY8B 1OJ4A 4HHHA 4ILMA 3OR2B 1RZMA 4MKAA 1FDBA 1FXDA 4OYXA 3C6TA 4PEOA 4HKQA 4C4WA 4DN9A 3NNAA 1GH8A 1RTIA 3JTNA 2V8PA 4DPUA 1B7FA 3VGTA 2DGQA 2ZOMA 3M8WA 2VOOA 2G1HA 2ERRA 4DX5A 3PRVA 4LF8J 1Z2ZA 2VQEF 5LL6d 2MLZA 1NKEA 2VV5A 4I7FA 2IJNA 3UR0A 3QPIA 4YHHJ 4LSNB 2HHTA 3JAMY 3R1HA 3JTOA 1FCAA 3M30B 3PRDA 2BRKA 4O23A 3WC0A 1HNZJ 1T3NA 1NNDA 2P9CA 4M1KA 1FHTA 1JMTA 1H2UX 3SMZA 4M95A 2BJ3A 4O4GB 3W63A 4LF4F 5KG7A 1YJTA 5K14B 2HIYA 3BBCA 4NMLA 2W8KA 2H1YA 4ZJQA 3RAQA 3BGFA 3RGIA 3H2UB 4OV6A 4QQBA 1LWFA 5KFLA 2MXYA 3GSIA 5L39A 1VC5A 1RT5B 2HS4A 2JVOA 1P1TA 3UD5A 5DG8A 1Y5LB 2HGNA 4J9KA 4FS1A 2DNHA 3LP2B 3NY0A 3W5XA 1X4GA 1AYEA 3DFEA 3W5ZA 2ZJQQ 2AEMA 5DGAA 2WSEC 4R0JA 5B7WA 2VZ9A 1KR4A 2KXHA 4EWTA 5B0DA 3IM9A 5A2QU 2M9KA 2HNZB 4DV5F 1D0EA 5IT0A 3LP0B 4ZJLA 4ED8A 3QIDA 1VBXA 2B4VA 1GXUA 1HBUB 4ZIWA 3B6BA 4YB5A 4KB7A 2YWFA 4OYMA 5DS7A 2KFZA 2QLJB 1WWHA 2CWXA 4KYZA 4RW6B 2ZH2A 5IC6B 4DV6J 1RTHA 3GIJA 1J5OB 4K4VA 3E01A 2VFTA 2HBQB 3GG1A 3I9V9 4L3NA 4BC9A 2ZOGA 2W4DA 4ZVTB 5IFMA 3FRZA 2DNNA 1RBAA 1XEZA 2YNHB 3A12A 3MMCA 3H40A 1S1TA 2OTLS 3GSDA 1U24A 2Y1LB 3DRXA 5KFXA 3THTA 3V4IA 1C4AA 3M05A 4HDGA 4ID8A 1XMOJ 3A4TA 2HQ3A 4PWDB 1VQKS 2BE9B 4YFUA 3S6EA 1S77D 3DLEA 2HHUA 3FJ2A 2JH3A 4LF1A 3VAKA 1KNZA 2BEFA 2RF2B 5KOXA 4JV5J 1T9TA 2YKQA 4NLRA 4AFFA 4ZVUB 3J7ZT 3NS7B 2XGQA 2NQPA 3VV2B 2YX1A 4N76A 4USMA 5EN1A 3IGVA 4A48A 4LREA 1HHTP 1UMJA 4PWWA 1LXJA 5DQGA 3THVA 1TK0A 4NI2B 2FPHX 3W62A 4C3MA 1I5OB 2GMJA 5T14A 3G6ES 1FKOA 1V3SA 2CQCA 2RNEA 4PXBA 2Q79A 4ALZA 2J9EA 1X7VA 1B99A 3HD1A 4PQAA 3D0IE 1HBOA 1ZOTA 2X1GA 1MW7A 1NHUA 1QVFR 5F8NA 4ILRA 2ZDPA 2RDDA 1R0CB 3IR5B 2QEXS 1RABB 4FP9A 1ZA2B 1PC5A 4WU2A 3U7JA 1WC5A 4I64A 1DTQB 2MSTA 3KNGA 5IV4A 2I0XA 2F5GA 2LEPA 2B3TB 2OELA 3FQLA 3IG1A 4LSNA 4CLLA 4DV7J 1T05A 1SQGA 2W8LA 1GMUA 1A7GE 4JI4J 3TX8A 2R7WA 2J6SA 3MM8B 1KVIA 1FE0A 4XDDA 5F3ZA 1HLWA 3GV5B 4CLKA 2BW2A 2HWTA 3HT0A 3KHRA 3LPEA 4ANEA 2OJ3A 1OY6A 1WOOA 3HJFA 2Y8WA 2EW9A 3N28A 2UZAA 1S9GB 2NXCA 3SEOA 1N5SA 4NMXA 4WKRA 3C15B 3DI6A 2JEGA 5ETNA 2BJ9A 2RJZA 4ES3A 4B3TJ 2E7WA 3EGVA 2ZKTA 1Z2LA 3TVZA 1JIHA 1S1VA 2BQRA 3HVTA 4DXLA 2YY3A 4ZPVR 4RW9B 3QLHA 1ZZNA 5ETKA 1K0TA 1G6BA 2RU3A 2J0WA 1PKUA 3KKFA 3PACA 4J91A 5A0YB 2HG4A 2JC1A 3VCDA 1PC4A 1YHQS 4DV4F 2DKOB 2ZVIA 5KFIA 2WHOA 1Z4UA 5BR8F 4M5MA 5KFVA 1O8BA 2ZM6F 2M8DB 3I9ZA 1RHKB 2XZTB 2AT1B 2D3O1 2LQBA 1DJ0A 4KTQA 1D3WA 3ELHA 3L7OA 3ETMA 1WF0A 3BKUA 3HPOA 3K8VA 5C24A 4G1QA 2ZNYA 4H4MA 4ZVFA 3ZZTA 3VVTA 1FFSB 3F0NA 4E2FB 1RWKB 1RTIB 1FI4A 7FD1A 5HVHA 2KXNB 4DPWA 3SV4A 1M5KC 4DR4J 4NXMJ 4K2XA 1KWMA 2EPIA 2GIQA 2JWNA 4IYQA 4EMDA 5HP1A 2O01C 4WE1A 1FJ7A 3R5AA 1X60A 4ZPCA 5GMKa 3D6MB 2AJ2A 3PEJA 4JI5F 1Y5NB 4RJVA 3W61A 3N01A 1XIQA 1GNKA 1EQ0A 2EXUA 1RAJA 2I5JA 4O3NA 1SI9A 1ZTWA 4LSLA 3JS9A 4OZ5A 1YJ9S 4NLYA 3NMRA 1JLQA 3O1LA 4ED7A 1RA7A 1RWWB 3MPVA 2EFVA 4IOAQ 1VBYA 1S48A 4Y28C 4DR7F 1CPZA 1DHMA 2OPQA 4RPFA 3PKMA 2LYVA 1GEHA 5D0RA 5KFTA 3VTIA 1WKLA 2J9CA 3HULA 5KFAA 2EK1A 4F26A 5DETA 2CNNB 5KFGA 3T3FA 5DJBA 3M8PB 2OSQA 1NLKL 4B9SA 2R9LA 3P5BP 3V5RA 3HVTB 1IKXA 2OGUA 4DR1J 3B54A 3NL0A 1H3DA 3UE2A 3W60A 4O3RA 3EJMA 1JNZB 4DEZA 1QUVA 3MHYA 4G1QB 3MM5B 2XQCA 2FHJA 2HHPA 2FJBB 5CHCB 4DPOA 1FK9B 3CCJS 5GAHU 3MM8A 2CJYB 4U8YA 1S0VA 3KG0A 1HBOB 2FTRA 2NS1B 3A8KA 4C48A 3IAM9 2WVDA 3I5CA 4RUHA 1ZETA 3OL9A 2RQ4A 1MU2B 3O8WA 3SCKE 2R2RA 3KUEA 2DH7A 2DK2A 4DQSA 1MWQA 2W9BB 2PI4A 3CVKA 5J1NA 3CSKA 3QZ8A 1SJ4P 3P3DA 1N32F 4ER8A 4M5KA 5EX0A 2YH0A 3K8WA 4RR5A 4KR0B 1IBMF 3UCUP 2XMVA 3ILLA 1Q5VA 3D6TB 3D9BA 1XR7A 1UVKA 2R8HA 2NZCA 3TO8A 4QR1A 1ZYQA 2JSXA 2UUWA 1HW8A 4V19X 1REVA 2FJVA 3R3TA 2U1AA 3QT8A 3MR5A 2KN4A 4NLPA 3CF5Q 3PW4A 2RS8A 1TUWA 2V8VA 2RF2A 3ULHA 3G8SA 2B8QA 5EWGA 4UW2A 1VQLS 1EETB 3MPYA 1DBDA 2CNLB 2AD9A 3GYXB 2W1BA 1OYEA 4Z7CA 1R43A 5KG3A 1YBTA 2ASLA 2WTFA 1F6TA 4DSJA 2EI5A 4CO2A 3IG1B 3W5YA 1TKXB 3CCVS 1U1KA 3DC2A 3PTWA 3BPSP 5KFYA 5K9FA 4RW7B 4QWAA 4EBCA 1Q79A 4C8YA 1IJEB 3PYEA 1QTNB 2B9WA 3GONA 2V34A 3M6UA 2MZTA 2E1AA 1RQ0A 3D68A 4NLDA 4ZP7A 3U27A 3EZOA 3ZNJ1 5KTQA 3IBFB 1ZAWA 5RUBA 4DS4A 3GMGA 1X5SA 2HRUA 2O67A 3W64A 4ZMMA 3TEGA 3VVUA 1Q8BA 2HFOA 2ZH5A 3C66A 1NK9A 2V4JB 1XMQF 3QJPA 5C2GA 1QJHA 2HRTA 1X5TA 2BJ8A 2PEHA 2UXDF 3MTJA 4K4UA 2Z58B 1FF2A 2A6OA 1TL7A 2XC9A 4X4NA 3QBCA 1ITPA 4LFCJ 1NSKL 2QTWA 3LGHA 3BEGB 2CQIA 3VZIA 2AF6A 5ETTA 1S4EA 3OVBA 2DNMA 3NXZA 1CLFA 3V4MA 2YNFB 3LALA 3M6XA 4M5GA 3KHGA 6FDRA 3D0HE 1BUXA 3QWPA 5B0BA 5A8RA 1VQ5S 2I5JB 4FS2A 1IBCB 3TI0A 4C8OA 2FJAB 1M5VC 4LF6J 5GMEA 3TWZA 3MMCB 1U1OA 5KFWA 3Q8SB 4LR7A 3OJUA 3MR6A 5M2UA 1BE4A 1SIWB 4DCPB 4YEAA 4PXEA 1R8AA 3H59A 2QG9B 3QMQA 4LT6A 3I0RA 3POTB 3HSDA 4F3QA 3S1TA 3KDOA 3KLEA 1Y5IB 4DBQA 5F0UA 1VI7A 1WELA 2EFNA 4HACA 4L6V3 4ICLB 4CO0A 3SI8A 2RB7A 4CM2A 4F25A 1CEZA 4B3OA 2Z2MA 3CCUS 2B43A 1W26A 4KFBB 1O51A 2B8PA 3TARA 4NZ6A 1S99A 3V81A 5F8JA 3KHLA 3AA8A 4HVZA 4ZDNA 4ECUA 5HJYA 3UQSA 3L95X 1HYSB 1PBUA 2H3EB 4LF9J 5DDPC 3DLBA 4LR9A 4CZCA 2D3UA 2CWKA 1JLAB 2YQ3A 3C2PA 5LJ3Y 4DV7F 4RW9A 1RAAB 4GKJJ 2CQ0A 3DGVA 3M2UA 1Q0NA 4HR2A 5D4OA 2V50A 3AFGA 5G0RA 1UA1A 5CH7B 1QTMA 1T9VA 2ILZA 2B4PA 3M8PA 1JXEA 2IM2A 4FKYA 2BQUA 5CXTA 1OSDA 2CPEA 4BWMA 3LWLA 3FEZA 3OT9A 4C6AA 3P4UB 1S1UA 3BO2A 2DVIA 2FLPA 2NXEA 2FC9A 1NO8A 4UUXA 2KZMA 4Y00A 2BYCA 1TR0A 2LXUA 3A8EA 1FVSA 4FVMA 4EO8A 5EWFA 2KM8B 3KK1B 4OYAA 2DHXA 4X4RA 4USWA 1VLYA 4LF5J 2PN6A 2ZBPA 3QT6A 1QE1A 5KT4A 3KMSA 1XN9A 5EUHA 2QL5B 3WBZA 4AXJA 2Z0GA 4WBFA 2CVEA 2G2YA 2JFKA 5E5NA 4YMEA 3D3CJ 1R31A 1S7IA 2QIFA 2W25A 3I0SB 4I4BA 2Z8QA 5KT3A 1UJ5A 1XERA 1Y9OA 2AJ0A 1RAIB 3D5MA 4PG6A 2BA9A 5AJ3J 2CZ4A 3OTOF 4RNHA 3MEEB 4QCLA 4P7VA 1NH7A 3U1NA 3BSOA 5HBMB 4RWXA 1QD1A 2MQLA 1I94F 3JSYA 4JI3F 2WCXA 4G65A 2ZJPQ 3CD5A 5DG7A 1AFIA 3TUIC 5HI7A 4YQWA 2YKNB 3KXDA 2HKEA 3C15A 4CCHA 2J0XA 3AT1B 4V19J 4WCEQ 1KEKA 3JTPA 3HZEA 3KG4A 3R5DA 5CZVA 2RRBA 4IOBA 2XCPA 2F65A 1OQ3A 1UEUA 3IRXA 3TQ1A 1ZM9A 2JLFA 1N5YB 3OFFA 1QSLA 4IO9Q 1SL0A 2UUBJ 2V2KA 1HNWF 1H7XA 1Q8LA 3D6FB 5HROB 1G1XA 3QLHB 1N34F 1ZBTA 2ASJA 3P49B 4OIXA 1XMBA 4OHVA 4J9MA 2AYBA 1UWBB 4U67Q 4YDDB 3K17A 3BPDA 2E44A 2IMOA 2NXNA 3AD7C 4CO3A 2R2TA 4RBUA 2F9DA 2HQDA 4I2QB 2UUCF 5LJ5Y 2VHGA 3DDIA 1WC3A 3J81U 1JQGA 2QLXA 2WRMA 3DOMA 4FBTA 3JB9k 3CJKA 2P9EA 1C0UB 4CDIA 2XZDB 3H98A 4WIQA 3W8PA 3DMJA 4HYKA 3LOUA 5HQMA 1PYOB 4XDCA 2K8GA 3CIMA 4L73A 2EFOA 3DKDA 1S6QA 4HTJA 1A0OB 3NGSA 1VCTA 3ZTSA 3PDNA 4XTTA 2F4VF 5FDLB 2A1BA 5GAGU 3F41A 5D6GA 1S6UA 3NS6A 2HMIB 3MPWA 3VGSA 4CLPA 1FO1A 2ASDA 3W2VB 1S59A 2KRBA 3EVOA 3PJWA 3TZWA 3MF5A 4P2FA 1RADB 3UR3C 4WFAQ 4KGMA 1U1MA 2BZ2A 2MPUA 4FVCA 2R7OA 5D0EA 1NUEA 4LFBJ 1S1TB 2V5HG 3DRYA 3HHEA 4Q0BB 3SCLE 4DSLA 2OFHX 2CQ1A 3IC1A 3M2RB 3SSRA 4YY3F 4B9VA 5L8RC 3M2UB 4KQZA 1HKAA 4IRCA 4YR3A 2V68A 2CPXA 2H4WB 4CH1A 1F9FA 2OPRB 3AODA 1YVFA 4KGKA 4K2JA 1JNRB 4HHJA 3CE8A 3DGPB 3HHLB 2E1PA 1D09B 2VG6A 1M5SA 3AD9C 3ONQA 2DXFA 2WBRA 5KG4A 3Q8PB 2DNPA 2IMWP 3R9LA 1RK8A 3V4IB 4PUOA 2W4CA 3FC9A 4OYWA 3OFGA 5I42B 4DV0J 1L3VA 1D1UA 2QO3A 4J9OA 1NPPA 2XULA 2XEXA 2FZKB 3HXMA 4IRDA 1HQUB 2VDIA 2OPRA 4NYZA 2MJUA 3MFIA 1J5OA 1JXVA 3EWGA 4F0HA 4M5LA 1GFWB 3R27A 5HLFB 2FLNA 2OD6A 5HJXA 3M9NB 3OQ2A 4X66J 2D3OR 1PIEA 1JJ2R 2HRYA 1KLMA 3GLJA 3QT5A 1NJIT 3HD2A 1XNQF 1LW0B 1XBWA 2AEFA 3PFOA 5L46A 1PG5B 2HHSA 4CRJA 1FESA 2CA9A 1HMVB 1HQ2A 1LW2B 1WSRA 3CJQA 2DNKA 4DCOB 5GAGI 2OPSA 3SXLA 1TQLA 2UV8G 4A8FA 1SQEA 2PDAA 4RBVA 2C2RA 1UZHA 1HQUA 1L5UA 1V3RA 1KBRA 4NWBA 5SZTA 1IKYA 4F4YA 4B9NA 1LW0A 3KLHA 3NAIA 2VQFJ 2AP6A 2F8HA 4G6VB 4KT0C 2OUGA 1QLNA 2E7XA 2DGOA 2HAIA 2WONA 4U8VA 2XS7A 4WYLA 2A3JA 2LCWA 1F2GA 1PYTA 4DI6A 1X0FA 4ZPDA 1PILA 5B0CA 3PYDA 5ITHA 1L3SA 3M2RA 2M70A 1ZPWX 1KD1T 3K59A 4OX9J 5AT1B 4FPRA 1IKVB 2KDOA 2W2QP 3UN3A 3VAHA 3PFEA 4K4YA 1YI2S 2QA4S 3B4MA 2BOAA 2HZCA 5E3PA 3W65A 3CJ4A 1WOPA 5L9NA 1U02A 2MYFA 1P1LA 2ZH1A 1TFWA 1UEVA 4ES2A 3PR5B 3UPFA 4A8KA 3CCZA 3GR1A 4P75A 4CO5A 2HNDB 1R8CA 3BYRA 4M8LA 4Y2MA 3RTVA 4LF7F 2XB2D 4PUOB 3I55S 4U7UD 2XMTA 4M5NA 5HANA 3QYYA 4JI0F 4K4SA 3Q83A 5B0FA 2NSBA 4OX6A 4IRKA 3Q22A 3N6LA 5B0AA 5E33A 4WZQA 4X4VA 2CRLA 4PG5A 1R7IA 2BE7D 1R6VA 4YN3B 3J7YI 2DGWA 3KOAA 4YR0A 2HFSA 2D7SA 2KI2A 3OR2A 4PZVA 3ZZ0A 2NPFA 4PQUB 2RHQB 3CULA 1DLOA 2RILA 4MH8A 5E3CA 4L72B 4X62F 4NLVA 3J7Z5 1SL2A 1S6PA 1GX5A 3M8RA 4FYYB 4LBIA 1GMVA 2VL1A 2YPZA 1TUVA 3G6YA 2AYMA 1H74A 3KLFA 3OTBA 1RCOB 2DRAA 3R5GA 1IQZA 1JKHA 4ZPBA 2IYGA 1RTDB 1XTZA 5BYRA 1GXLA 2I1RA 3AD8C 2BJDA 1RT4A 2KU7A 1XWLA 3BGRB 3QFHA 2GNKA 4X62J 2HVZA 1IM4A 2VA2A 2HBYB 4TU8A 3SYZA 1VQ8S 4DQPA 1HNVA 5K8NA 1WEXA 4J7CA 1SC3B 4WP3A 1WEYA 3DDKA 3BYPA 2C3YA 4TVAB 2CPFA 2K7JA 1N0VC 1PAUB 2ZWPA 4E8UA 2XY6A 2M4MA 3L9ZA 1HR0F 4RW4A 2ZH3A 1R8BA 3MM5A 1FWLA 2ZE2A 3BM7A 3I5AA 4ZVHA 5AE2A 4ED0A 2AJQA 1DFDA 1S6PB 1VK3A 1RTDA 3MEEA 1CSJA 2HQFA 4K50A 1HWKA 3WIVA 2H54B 4F4AA 2VODA 2R7XA 2ZBQA 4NX9A 1N88A 4MIAA 3PYFA 2IDLA 2LFVA 5F9LA 3C16B 4RNOA 2DH9A 3PO5A 2G9OA 4BHQA 2ABYA 3PG9A 1M0SA 1RT4B 1TVRA 2VFRA 1L3TA 1SKRA 4RX6A 4ETZA 2KTQA 1EKRA 4QR0A 2VC0A 3LAMA 4P7TA 1U48A 5H9EJ 5LMNF 1I6JA 4ECZA 5AE1A 3CDWA 1GQEA 3G87A 3HSZA 5CCMA 3T19A 1RHMB 1SV5A 4C7QA 3OBIA 1U1QA 3O2IA 5CCLA 5IT9Y 3MFHA 1FVQA 3ITHA 3VGVA 1G4CA 4Q8FA 3M9OB 5KFCA 4ZVGA 3R5JB 4MT1A 4WXWA 5LMNJ 1RAEB 2HFUA 3HP6A 2VF3A 2BBEA 1VQ7S 1T9XA 1U09A 2W7AA 2G13A 2R7SA 2XY5A 1U6BA 2GMLA 1Y3KA 4QIVA 5DZ6A 2DPIA 5H9FK 1B0TA 3D6HB 2J9DE 3I0SA 2R8GA 2HYIB 4QYZJ 2CDQA 3A13A 5HMZA 4NLTA 2Z57B 4IDKB 4E0DA 4CIOA 1KFDA 1UAWA 2RH3A 4NYOA 5L1LA 5IOLA 1TAQA 2BVZA 5A6PA 2C2MB 3I87A 3DM2A 3OD2A 4JUZA 3MI7X 5A0YA 2P9GA 3EM1A 3Q0AA 2RT3A 3H90A 3O44A 1Y0HA 3NP5A 4JV0A 2XSJA 3MUMP 3OJSA 2IJRA 4QPTA 2FVRA 2HHQA 4LRBA 1NZ8A 1TL5A 3MUVP 1KLMB 1NPKA 4ZN1A 2WSFC 2KYXA 3GJQB 3PIPQ 2NCKL 1RKJA 3HJVA 1S9FA 4OZLA 5D77A 2K3KA 3D28A 1IM6A 2BACA 2Z30B 2HFNA 4OZ2A 2OEKA 1YX2A 2DGSA 1DARA 2HPUA 2MY7A 2QMUB 5E3RA 1FJGF 4ZITA 3TZZA 1FFGB 4U9RA 2J9DA 3D3BJ 2A2DA 2DXEA 3MMJA 4ZCKA 3GQCA 1YJ7A 2GQ2A 3PX6A 1EAYC 3AY0A 4U95A 5C5JA 5A76A 3R7NB 3ZZYA 2DH8A 2GQCA 3D66A 2R2UA 4DFPA 4CT8A 3W9IA 3PEHA 1RTJA 2PO4A 1FNMA 3MMAB 5GAHI 1GMWD 3H2VE 4R25A 2KFYA 2C3MA 1LQ9A 1VK8A 3EYZA 5HQ8A 2IIHA 1UFKA 2HNYB 3AA9A 2IM1A 3BO3A 2F8EX 1VRUB 3SSSA 4OJGA 1V6HA 4LF7J 3G82B 2JVRA 1F1BB 2YNGB 2YWHA 3W7BA 5CYJA 1F5AA 1CJUB 5IM0B 3SQGB 4QJVA 1H38A 4F4ZA 3CDBA 4B9UA 1S9EA 1T02A 1TKXA 1C0TA 1URRA 3B8HA 4C97A 3F44A 3BQ1A 3AOBA 3A8IA 2C2ZB 1Y7PA 2EK6A 3U02A 1VFJA 3CDAA 5ADZA 3M8SA 1VGYA 3GTYX 1HNXJ 2HK3A 3GCXP 1K8AT 2A18A 3FCVA 1FXRA 2JJ4D 4YUDA 3KYLA 3HHNB 4F8RA 5BYSA 1N34J 4KO0A 1NSAA 2JHEA 3HFZB 4AXIA 4F50A 3R97A 4ZP8A 1RAHB 2OAUA 1HWLA 2V8DA 3A3OB 4IH5A 5L9XA 1RHUB 2WK4A 3N0VA 3ETOA 1UW9A 2CG8A 1C2PA 1FD2A 3CJKB 3EPIA 4QU7A 1EETA 4RNNA 1EX8A 1SQFA 1TFYA 1IJFB 2CQPA 4NZ0A 2N7YA 3BBBA 2FD2A 4RW7A 2VKZG 5J1EB 4JV5F 1VIXA 3IWXA 1FXLA 3PNIA 3RB4A 4J9PA 2W4PA 2ZUAA 4F02A 2XSFA 4NEYA 2N82B 5KFRA 2JZ5A 2HHWA 2G2OA 4EEYA 5HQLA 1RBOB 2C22A 1HI0P 2ZH7A 5KG2A 1IWAA 1S1WB 3MM6B 4ZHRA 1WG5A 3GYNA 4J9UE 2UXCJ 2UXBJ 1IR2A 4A8YA 2GGPB 1R89A 4HDHA 3HM9A 1YJVA 2EBEA 1REVB 8AT1B 4GVLA 4OZNA 4N8OA 4DV0F 1OY9A 4E98A 1FRXA 1S6QB 3IRXB 1SVDA 2BR0A 1RWVB 4DR1F 1VS3A 5IC4B 4YS2A 1N48A 2RDIA 3P96A 1XQIA 5E2QA 2AGOA 1RISA 2YKNA 2OHDA 2MHNA 4KIAA 1CULA 1BLUA 5JVGQ 1CC7A 1CS4A 4JI4F 1Y11A 5D3GA 4Y2CA 1NSQA 3CC2S 4FN5A 2H65B 2ROPA 3OR1B 5KG5A 4I2QA 1TV6B 3MEGA 3W3SA 2M0GB 4H4MB 5HAOA 3T5LA 3J80U 3MMBB 2IHR1 2B5JB 1UP1A 1YG0A 1FRHA 2DNOA 3GFYA 1T9WA 4NA3A 4PPDA 3MR3A 4ATNA 1HD0A 4DUZF 2CQ4A 1RHQB 1GK8A 3HHKA 4LRDA 2BM1A 2W9BA 2UXDJ 4N7TA 4DL6A 2UVWA 3L09A 1RBLA 1QE1B 5EHHA 2RQCA 3MECA 2QMXA 4Z2XA 2HBRB 2H5IB 2HEKA 2PFDA 3MCNA 3SIPB 1T03B 4NLOA 4Y65A 4UY85 1XNQJ 3BB5A 1S1XA 3CD0A 1WHVA 1FX2A 1YWXA 2BABA 2DGUA 4USTA 5EGYA 1R0AB 1JJ4A 2ZFHA 3QGPA 5CQGA 4BLGA 2UV8A 4M5HA 4QWBA 2WVEA 1PSDA 4GRSA 4O3QA 1A6LA 2AYEA 4LRAA 2ZWOA 3C14A 1UTAA 3GP9A 3PRBA 5AE3A 4QZVB 4HEA9 4ZOSA 2BM0A 1XJWB 2V0NA 3PW2A 4B02A 4O3SA 1N33F 1OIAA 2VDHA 4RWWA 4CLYA 2RHSB 1S57A 4CH0S 4KFBA 4ANCA 1BGXT 3KK3A 1R0AA 2B7BB 2IFXA 4KAIA 4B9LA 3NWGA 3NBPA 2IA0A 5HBMA 4JI8F 2VA3A 1KHWA 4AL7A 2KHCA 1EQMA 1NB2A 3QZ7A 4BDPA 4JI1J 3DCAA 3BN4A 3SBMA 3KLIA 1N0UA 1IKWB 1LWEA 4W90B 2QSWA 5HP1B 2EKNA 2B4UA 3BSAA 5F9NA 4L3KA 3DI6B 4FNIA 5KFDA 4ICLA 2O5DA 1WTFA 2VASA 2XMUA 3QO9A 1OWXA 1HA1A 1KQGB 4C11A 3KLGA 4A8WA 1HHQA 2J7KA 2YKMA 1N52B 2FQQB 2OFGX 3CCSS 4MFBB 1WHXA 2XO6A 1NSPA 5D4LA 2HHHF 4KRWA 1VQSA 4A8MP 1RT7B 4U7CA 2J7WA 4ZCLA 4QU6A 3FKBA 4WFYA 1FRIA 3ZO7A 4G1PA 3EUNA 5A8WA 3IR6B 4QYZK 2R7QA 3LQVA 1S72S 1U47A 3FMBA 3GU0A 2KG0A 4YDXA 3R5BA 3W2WB 1EB0A 1F0XA 1N5TA 4Q43A 1D9FA 4P2XA 3VAMA 4I6AA 2L3MA 3OUYB 2CZ9A 1SIZA 3T6JA 1VBZA 5SUHA 2POKA 3DRRB 1FKOB 2X1BA 3N4WA 4A4JA 4DZDA 3DOLB 2V9KA 3HHLD 3QIPA 4ENOA 4ZLLA 5B09A 3PZPA 3N79A 4OX7A 3CCMS 3CCWA 3UDLA 1YBUA 2XLKA 2VIHA 4ZLPA 3GILA 2CZVC 3QJJA 4J90A 1N56A 4ZVQB 4DR2J 1CJTB 5KFNA 3KK2B 2IRXA 3S7RA 2W7PA 4H4KC 1V5VA 3MD3A 1F5BA 1LWXA 5KT2A 2L9DA 2PEBA 3PIOQ 2OTJS 1L3KA 3Q2SC 1YJRA 4Z37A 1N4LA 1X4AA 2DPJA 4NASA 4B08A 2FVCA 4DDFA 2KXFA 4X4OA 4DL3A 1FNXH 2CJQA 1JLEB 2LQ5A 4NCGA 1FKPB 2MEWA 4FNHA 1SC1B 2XI3A 3TNVA 4PG8A 1TV6A 2RUSA 4WFXA 3KLEB 5C42B 4WTOB 3P8BB 5HK4A 4DV6F 4MKVA 3LO3A 4M94A 2Z2ZA 3WX4A 4IH7A 4I56A 5DRKA 1CQNA 1V9OA 3FK4A 4YHHF 2ZITA 1D9AA 1LWFB 2YNGA 5J2MB 4WTYA 4NE9C 1HBUA 2YX7A 5C42A 1GTHA 3OV7A 4MAKA 3MCMA 3NAHA 1LV5A 5K14A 1NCLA 5DLFA 1J5EJ 1JLBB 4YY3J 1Q53A 1VQYA 1SUQB 3M6VA 3NEKA 2Z56B 3LW5C 3R6LB 5LSLA 2J5AA 3ENVA 4DLGA 4DQQA 2N4DA 1N36J 3MM9A 2DR9A 3BO4A 1MWYA 3VGUA 2F40A 3PXGa 1SKUB 2GHVC 2CKWA 3BR8A 4F4XA 3OLAA 2VJVA 4O0NA 3M32A 5HSPA 3IRWP 4QOTA 4HI2A 2KL8A 4JYAF 3MCSA 4OMFG 2F7VA 5KAKA 2V4QA 2YKMB 3FUYA 1T7PA 2Y0BB 4FF4A 3DRRA 3AAWB 5K8OA 4KJIA 1IKXB 1VHIA 4HLBA 4O4GA 3UI3A 3TJ9A 2MKIA 3NKYA 3FFIA 1F60B 4C8MA 3OFHA 4NZ7A 2MQQA 2P2CB 4IG0B 4UOCA 1HNIA 2IJFA 1RHJB 4DPXA 3HHLC 2QZ8A 1TL4A 2LMIA 4A8OA 5A8WB 1YZ7A 1U8SA 3I31A 1E6VA 2AIRB 4DR4F 4ZKAA 5A8KB 1VC0A 4ZVRB 3JSBA 5KFZA 2MHEA 3UCZP 3LPYA 4KE5A 2WBMA 4DL5A 3GWCA 1LKZA 1WI6A 4PYDA 1FA0A 5C7PA 2IPOB 2GO9A 4NRUA 3BH7B 2E1RA 2PFFB 3RB3A 1AT1B 4OLOA 5CYMB 4DUYF 3RBDA 2HZVA 4USKA 3DHXA 1HD1A 2RD5C 1H72C 3TZXA 3CDUA 3GG0A 5KFUA 2XO7A 3KJVA 4H4OB 2XSJB 3MM7A 4TXSA 4FXWA 2MKSA 3WZ0A 4GKKJ 3FEYB 1I1GA 2F63A 4LSLB 2B6AA 5CZXA 4ED4A 3M30A 1AXQA 5GADU 3ADAC 2R8IA 4K59A 1DAXA 1YGYA 2KVIA 2WOMB 1MU2A 4IFYB 2AJ4A 1CQMA 3B4DA 4ZP9A 5KFSA 2OPQB 1EIYB 3D1OA 3EE3A 4N41A 4B9MA 1WC0A 4L75A 4H54A 2WAQD 4NXMF 4OZ3A 4LF4J 1HWIA 3B78A 3LGNA 2DRDA 1IKWA 1LWEB 1YK9A 4IG3A 1KONA 3NOGA 4YR2A 2E9TA 3MEGB 5CAAA 1S76D 3N6MA 3RR7A 3CC4S 2E5JA 4X4TA 4JB8B 4IFVB 4OHWA 3C6TB 5ETVA 2FZGB 5CD4H 3IS9A 2ZH4A 4J9LA 1WNEA 1JK9B 1P8GA 3BGLA 3MEKA 1U49A 4FPIA 4IR9A 1N6QB 4CH7A 2R2SA 1NZAA 2ZD1A 5IXUA 3ICLA 3A1YG 1P6TA 4CO4A 1S0OA 2OKQA 1WC1A 1G2EA 2DHAA 3EX7B 3PO4A 2YQ1A 1CJKB 2B9YA 1FEHA 2BMBA 1Y00A 2EFQA 3ZZZA 1VBKA 3HFVA 1FRLA 2LQ9A 3MD1A 4B9TA 3UDCA 5L38A 4PYAA 2PMWA 4AE5A 2LLZA 1LK7A 1Z1ZA 4DX6A 4LBPA 1Q7LB 4WJBA 3V81B 1F5CA 3RBXA 2QGFB 4DV5J 4I2PA 2D74B 2YQ0A 2UUTA 3SCIE 2JL9A 4WKYA 2C2OB 3MMBA 1RYRA 2YX4A 2DCLA 1JWWA 3T5JA 4FF2A 3Q89A 1OS5A 1WDDA 2C3UA 3QSYB 1JJCB 4OJ1A 4Y2KA 5J1EA 4NLUA 1SJFA 1AW0A 1QDUB 5KFEA 3POTA 1WACA 1SPBP 5D3GB 4J9QA 1UVLA 5HVGA 4GKJF 3TOQA 4RU9A 4RNMA 2XYHB 4NCAA 2DNYA 5C25A 4CO1A 1KLNA 3C3LA 1D8YA 3K89A 4A8SA 1HQEB 1TELA 4AUKA 2AZ1A 5U47A 3HLUA 3JQJA 4DG1A 3JYTB 2XMJA 2KVQE 2C3PA 3QAUA 5FD1A 3M1VA 3QATA 2LDYA 2DB1A 3S01A 2J7UA 4KGXB 4DOZA 5F8LA 2KKHA 4J9SA 1VQMS 3J7AN 3SSQA 3Q8QB 2HHVA 1S6OA 3TJAA 4CQ1A 4WWSA 1AZSB 2X51A 3V6DB 2FJDB 3EGZA 1G7CB 1VYAA 3TEHB 5ETQA 2AX1A 4M5DB 4QIFA 3QRQA 3Q8YA 3ET6A 1U2CA 1NKBA 1LXNA 2M2BA 4JI7J 1CJUA 2EEYA 1IBLJ 2VB6A 2V4JA 3O6QA 3IMQJ 3HO1A 4I0WA 3L7PA 4X65F 1MN9A 2GGPA 4Q45A 2FVPA 4LFCF 2RKIB 1YRXA 3VAFA 2DBBA 2VG5A 2YBVA 4R8UA 3TUZC 3OTDA 2I6WA 3DLJA 5L1KA 2CQHA 2YNIA 2IYIA 4OZJA 1JLEA 4OYOA 1QVGR 1Q95G 2APOA 2ACYA 1N8RT 4CLSA 2QFJA 3CD6S 2VU5A 1IR0A 2M8HA 2HS3A 4GVBB 4JOUA 2PMZD 1R0BG 1TKZB 3NLCA 1QSSA 1OSCA 1U0SA 2NPIA 1DTQA 3DN9A 5LMUF 4LIWA 4KHPF 4TU9A 1VRTB 1S9EB 2YKAA 2HNZA 4TY9A 4LF2A 3AH6A 4ECSA 1H7WA 2ZNZA 4LJMA 4ZVEA 3AJ1A 2HVHA 1FTRA 3QGGA 2OPSB 1RWPB 1FJEB 3EZUA 3FRYA 3SQOP 1XMOF 4NA1A 1KS2A 2OEMA 3M7VA 5MAOA 3RRGA 3MWBA 2E5IA 2XMKA 3HSJA 3K5LA 3WC2A 1J27A 2M5YA 3UFCX 1OYDA 7FDRA 3BBFA 2CPJA 4QPXA 2WONB 3BV8A 1VRUA 1YKWA 2K1RA 1WG1A 2VPYB 4ZHRB 1C1CB 2HVEA 1QSYA 2Q66A 4ED5A 3QGIA 1C0TB 2V67A 3GB0A 3CCES 4DL2A 2BXJA 1XNRF 2P5VA 3ZTOA 3SQGA 4DUYJ 1MMDA 1JLCA 1RTJB 1D9DA 2QJ3A 1AUSL 2MKYA 1EKSA 1TL3A 4AT1B 4LF6F 2HBZB 2QSFA 5KFKA 2KT5A 3OVSA 3E3XA 4CM0A 2MQNA 4Q2LA 3MTKA 3CJ8A 2FVSA 2QE5A 1UA0A 2DEJA 1APSA 1TK5A 1MWZA 1ULRA 1SC6A 4DSFA 2K2PA 2MLXA 2QA4G 4P52A 3DRPB 3HI9A 3DOLA 4NLGA 1NXIA 4EFAC 1P9YA 1HARA 2AZ3A 4S0MA 4R5PA 3CB4A 4WK3A 1V5IB 2MTLA 5T7LA 5E41A 2W9AA 5I42A 5ETPA 4ZLJA 3Q2TC 1MG7A 4D3HA 3GZ7A 3Q8RB 3PY8A 1JLCB 3VF0B 4Q8EA 4TLQA 3K5OA 4PKDB 2J0SD 3NGRA 3DM2B 2MGZA 1IKYB 1TKDA 1M5PC 2KO1A 1X4BA 3EVMA 1WDTA 3I4HX 1MNEA 3ZZOA 2LXIA 4OLPA 2BDPA 4J37A 1NDLA 3OL8A 1T0TV 3GFZA 4PR6A 3UDEA 1CBKA 1ZS6A 2GIRA 4IOCQ 3EPGA 1YRUA 2DNRA 5BJRA 1U2FA 3MPUB 4QW9A 4B3MF 1GXTA 4I68A 4CI0B 2DY9A 4DL7A 3A3PB 2G4BA 1Y10A 3F73A 3KJNB 2GQQA 2MDAA 4LRCA 4MYUA 1K47A 2AJFE 3N6NA 2N7CA 4DR2F 5E7OB 4DHVA 1C0UA 3G96A 1K1SA 1QAXA 2GJ2A 4C8KA 3PW5A 2JRSA 1HBNA 1FERA 2FGCA 3OXGA 5J2QA 3P6YC 1TAUA 4Y6IA 2VC1A 4ZA1A 3X1LB 4MKYA 4X2BA 3PR4A 2XYGB 2KG1A 5HVFA 1VDHA 4FF1A 1TL3B 3QRRA 1NPRA 2BV3A 2ILYA 1KDNA 1IQTA 1F9EB 2AJ1A 2OSRA 3CNQP 2ZH9A 3H20A 2HQGA 1F3VA 2N4CA 2QA2A 3C14B 1UVNA 2JLGA 4KKOA 1MROA 4JI3J 2FC8A 2JEJA 4LSZB 1CS4B 4DR5J 4KV8B 1MMNA 1ZM2A 4CNYA 1RKIA 3BSCA 2DYAA 3IR7B 2GHPA 2YKPA 1S1XB 4L76A 2OD4A 3M8QB 3PHTA 2H5EA 5E3AA 2CJBA 1UFLA 4UOFA 3FQKA 5AJ3F 1T03A 4B3RJ 1RAFB 1U1PA 4LUBA 1WEZA 1I51B 3OLBA 4KV8A 4RZRA 1REGX 3QT7A 2LP4A 4ELVA 2J6TA 2LECA 3I82A 4PWUA 1RTZA 4DV1F 4GC7A 2UUBF 3H0PA 4JI7F 3CT9A 3DU6A 3CJ0A 4OJ3A 4MMOA 1U45A 4XPEA 4YOEA 1KTVA 1TTHB 1NBEB 1M5HA 2G0CA 3NG8A 4ZP6A 4DPYA 2QFIA 2V63A 4DR3F 2OI2A 1S5ZA 2E9RX 1NEEA 2CVIA 2ZE2B 2OO4A 5KFOA 2RKIA 4FYWB 1GMWA 1KTQA 4OI0A 1NK6A 4ED2A 2UUAF 1WHYA 4HTIA 3W9HA 3MUTP 3NNHA 1K9MT 2OMLA 4PQUA 2MQ8A 2VFSA 3CJRA 5F3TA 3JAMU 4B3SF 2YTCA 2OPPA 2DEIA 2QL9B 3FNNA 5KFBA 4ZVSB 3VWSA 4X4SA 2DNQA 1AZSA 4TLRA 5ETMA 3BR9A 1SJ1A 5IT4A 5LXRA 1FDAA 4DJBA 2AGQA 1BQMA 3KLFB 4DR3J 2CJ9A 1VQOS 3NGDA 3OHAA 5LMUJ 3T9NA 1KQSR 4OHYA 5K5MA 2GC8A 4KPYA 2B9EA 4FYVB 3JSMB 1M90T 4DV2F 1FDNA 4Z7YA 1NHVA 2BE2B 3UD3P 3TANA 1OMSA 1H98A 3FBBA 1VQNS 2RVJA 1K73T 2D3ZA 1WI8A 2HWHA 2NUHA 2XBPA 4WZMA 1Q82T 1XNRJ 3G8QA 2OP5A 2XY7A 1U1RA 3DLGB 4CLTA 3CCLS 3PHEA 4RW4B 3ZFVA 3CMAS 4K4TA 1ACMB 1T94A 3D7SB 3JQMA 1CJVA 3ZXWA 1B4SA 3E01B 1W2IA 2ALZA 5LOQA 3BJYA 3TA0A 2ROEA 2IAJB 3AB2B 4WP8A 2FLLA 4DV3F 4ED6A 2RQMA 4IQMA 4OQJA 4CLWA 4X4UA 3LA0A 2AU0A 2NXJA 1PJ7A 1RP5A 2X3GA 5M2RA 2LQJA 2C2NA 3HVRA 1E6YA 2VUGA 1XK8A 5A8RB 3NCPA 1FTCA 3ENQA 1JB0C 5F8IA 2OMOA 3DRSA 3LTOA 2V69A 3KWMA 4TNOA 1FRMA 3J80Y 3MM7B 1B7YB 1F2HA 3DGPA 3M8QA 3IP0A 4RUAA 4XO0A 2YWWA 1NH8A 4AYBD 2ZJRQ 4DF4A 2K1RB 3KUGA 4NLSA 3VZHA 3BH6B 2GA7A 1S0NA 2BW7A 2R7TA 1TL7B 2FHMA 1RLCL 2G2ZA 2HK2A 4YB6A 4WFBQ 1J2VA 4K4WA 1YITS 4ZPWR 1NJXA 5E0OA 2UVUA 4F2SA 4KKOB 6AT1B 4ZPTR 2BKNA 2DITA 2CUYA 4TYBA 4XAKA 5G0RB 4U6PA 3TQEA 2ADCA 4DSIA 4GKKF 3SZ2A 2CQ3A 2ZBCA 4IG3B 3CPWR 4OFZA 1PJ5A 3AQPA 4C2MA 2UP1A 2COLA 3ILJA 4K8RA 5J2NB 3W2VA 4EBDA 4K0KF 1OQ6A 4UQGA 2BJ1A 2MGZB 1TMJA 3KLVA 1KRPA 1BWVA 2EG2A 5KFPA 2OEJA 2X3DA 2B6AB 1N54B 1ZH5A 1RCXB 3K5PA 4WFNQ 2MKCA 2F4FA 1JLFA 2BKOA 3J81Y 1KP6A 4HACB 5AXMA 4OI2A 3L4BC 3LP1B 4P72A 2VICA 2W2NP 3WDOA 2E7VA 2EG1A 1TUGB 4IKAA 3GFXA 3RRHA 1TZ0A 4LF9F 2FYXA 1SJRA 1U6FA 3PX0A 3T1HF 2DRBA 4IUFA 5J2NA 1RXOB 3H25A 5FLXU 2XHWA 2CQ2A 4ZJOA 3K5NA 2CPDA 2KT2A 1RWUA 3CC7S 3IBCB 3CMES 2YPYA 4TQRA 2J6UA 2VQEJ 2A2CA 3FEXB 2GX8A 1SCJB 1NB7A 2GJIA 4H4KA 2GS8A 4KSEB 3S8SA 2GFFA 4Q0BA 2B56A 3H5UA 3TZYA 4ELTA 4DS5A 3DMJB 2DIUA 2R7RA 1T9UA 5D0HA 4J9RA 3FFIB 3LUYA 4ID5B 2G0IA 1IBKF 1S4FA 4ZN3A 2MY8A 5ETSA 4RU2A 4RKUC 1NK7A 3KTQA 3MOJB 1B64A 2RS2A 1IBLF 4PCQA 3EGNA 4WPAA 5D78A 1W2BR 2UXBF 4OZ0A 4L74A 4P2SA 2V2ZA 2HMIA 3ZNUA 2AWZA 1KC8T 2HHHJ 1AA1B 1OPIA 1ZM4A 4EU0A 3TJ8A 4EZ9A 4LF8F 2ASYA 4GVBA 1YJUA 2BX6A 2VPWB 3RYLA 3IAS9 4ZS6A 3A8JA 4NOHA 5IWAF 4ECVA 3HVAA 3JSRA 4ED3A 5IV3A 2JOQA 4EYHB 1RUSA 2ZOFA 2IBKA 2HHXA 1UEKA 2Y3YA 3OVAA 2X1FA 1BQMB 1SUQA 2D41A 4YB1P 1LOUA 3H42A 4F0KA 4EBEA 1K0VA 4RW8B 2YNIB 4P2MA 3V2UC 2L9NA 4QWEA 2MSSA 1NK5A 1HR0J 1UWAA 2IY5B 3I56S 1K44A 3CD7A 3OTOJ 4N5SA 1DQ8A 1X31C 2DGTA 1WC6A 1UWBA 2XMMA 4ETXA 5J2MA 4NEZA 3TAPA 3R2CJ 1AUDA 3N9UC 1KKHA 3SCJE 2NYIA 2A10A 2XG8A 4DV3J 2WW4A 4Q44A 1WSVA 4KH1B 4LQ3A 4WXOA 1RWXB 1N5YA 1MLAA 2DD8S 3C46A
chains in the Genus database with same CATH topology
2E5HA 1U26A 2K3IA 5K8MA 5IZHA 3U1MA 4F4WA 1T8EA 2V94A 2Y1JA 2E29A 6FD1A 4IQXA 4ERDA 4LVNP 1T95A 3PKYA 2GV1A 1HNVB 3OFEA 3PVXA 3FCHA 2HNDA 4IR1A 4MFBA 2MB0B 4N47A 3SFUA 3VQSA 1H6KX 2FLOA 3CJ3A 2CQGA 3KK2A 1Q86T 3SFGA 2DNGA 3FSIA 2J0QD 3KK1A 4FXVA 1K1QA 4CTAA 3CCQS 5L1IA 1QUPA 2UXCF 5J2PA 2CFXA 2ZD1B 1X4CA 3I6PA 3BREA 1XC9A 1SXLA 4MJKA 4PG7A 3BSNA 3DLHA 1R6YA 1DLOB 2KJVA 3L3CA 5BYQA 1HPZB 1GAOA 3CXCR 4OI4A 4ECYA 5K8PA 3W2WA 2EFPA 2PT0A 3EGWB 4BCAA 3OW2R 1RI7A 4ES1A 1JLAA 1QAYA 1Y3JA 2E1MC 1NRKA 5AXNA 1KN6A 5B0GA 4DSKA 5T7LB 3CWJA 3K57A 3BS9A 3RW6A 1B0PA 3RB0A 3LF0A 2FUG9 4C11B 2VBZA 4URGA 1LFPA 2K7KA 3KLGB 2XMWA 5HLFA 2BQ3A 1UVJA 2EKYA 2RRNA 1FT8A 3P5TL 2CIMA 4H4OA 1YJNS 3DLKB 4DX8H 3G86A 3VAIA 3DXBA 4HH0A 2FY1A 3UNGC 1NU4A 3ZZPA 4MIBA 2XS5A 2PMHA 3VR1A 3TUJC 2KH9A 3DHWC 3KLHB 2X1AA 2VG6B 2PSZA 2WOMA 1R8PA 3OXLA 1C1CA 1DRZA 2UVVA 3OR1A 1Q7YT 2R8KA 2QLWA 4NLXA 4BWJA 3K7RA 3DLEB 5KG1A 2LEBA 3C6UB 2KJWA 1ZAVA 4IFVA 2DHGA 3MEDA 4ED1A 4MIWA 4NPOA 4WFZA 4JI2F 2ZH8A 2AGPA 3GE9A 1C4CA 5CYMA 1SKSA 2GMHA 3BF4A 4N8NA 4OI1A 5CA5A 3RAMA 4RW8A 2L48A 3THPA 1CC8A 3U1LA 5A8KA 5KFMA 4DFKA 2FHJD 3MECB 4OI3A 3VAJA 2FB0A 1SB6A 4ECRA 4IFYA 4QIWD 5JVHQ 2Q1LA 3IWNC 4NCGB 4QYRA 3HK2A 3D54A 4Y0FA 4IG0A 2XWYA 1DQ9A 4QR2A 2W9CA 3CUNA 2AX0A 5DGBA 4ZK7M 1NJZA 1UVIA 3HHLA 3D0GE 1HNIB 2U2FA 2AYGA 2E1CA 4X84A 4FYDA 3MDFA 5HN0A 1HBMA 2YVSA 3H4DA 4NL5A 3TVKA 1RYSA 1JLGA 3BDPA 4URQU 4HI1A 4M5DA 3UCGA 3LGMA 3RBEA 1BQNB 1X8DA 4IO1A 5HMXA 3M4XA 1AFJA 2BANB 2BRLA 4X4PA 4OL8A 5FJ4A 1JLBA 1UW4A 1YQHA 1X4EA 2MMYA 3M1VB 3T1YF 3IXQA 1Q78A 1X9MA 1HWUA 1HQEA 1BQNA 2RUGA 1KFSA 1A9NB 3ZZRA 2RDJA 2D1CA 5GADI 3LP2A 4EO6A 1NAQA 5IS2A 4EGLA 4WIIA 2NXUA 2F3JA 1RT2A 1X4HA 3DDNA 1HNXF 1RDRA 3KNAA 4O44B 5F8GA 2OIHA 1FEEA 1FK9A 3FGVA 3IBWA 1U1LA 2PE8A 2NSCA 3HT3A 1KVJA 2W7OA 3R5CA 5KOWA 1RT1A 1FKPA 4JV2A 5EX3A 1TKZA 4LMZA 2LVWA 4X66F 3OUYA 3SV3A 2QRRA 1W25A 4O0IA 4DWIA 1S79A 1BC6A 2VG7B 3KFWX 4LVOP 2CYYA 5LSRA 1SH0A 1WG4A 1SJQA 2Y1RI 3NS5A 5C25B 3TAQA 2KM8C 4MK7A 3GV7B 1N6QA 1SL1A 3H8YA 2SXLA 5AXKA 4DFJA 1M1KT 2XI2A 2IM3A 3NGKA 4GMKA 3HKWA 1HPZA 3N5FA 4KBIA 4DMZA 4F4KA 3CTRA 2FJXA 1YTYA 3QAEA 2AV5A 1S1VB 4LF5F 3FSXA 2WW8A 4WF9Q 2YWEA 4DFMA 2FJWA 4F3MA 5HMYA 3M2VB 3GV8B 2ZDOA 1Q81T 3H5XA 3IO1A 2R7UA 1RT7A 2I2YA 4QWCA 1FDDA 1WF2A 2P6SA 2VBWA 3FZBA 4M63A 2IVFB 2Y1IA 4FXDA 2CQBA 2CG4A 2HFZA 3NRBA 5DLGA 2RRAA 4EYIB 4IDKA 2PI5A 1IUJA 3AHPA 3RB6A 5DQIA 1NK0A 4K4ZA 1H0HB 1X9WA 2M7SA 4JV1A 4B3OB 2UVRA 2I8EA 3PV8A 1DTTB 3M2VA 3DYAA 2HW3A 3KJVB 5FLXY 5L1JA 1VIOA 2YWKA 4Y3CA 2ZBIA 1S97A 2FGOA 5CYQB 1WF1A 3I0RB 4QWDA 1BWEA 4PG4A 3QGHA 3ISND 2ZZMA 2ROGA 2JX2A 2Q6CA 4OHZA 1HNZF 2CJAA 3PJXA 3NBPB 1S9GA 1SV5B 3J7YU 4DQRA 2KYZA 1DTTA 2B0GA 4DR6F 3RZAA 5KT6A 2DISA 4USHA 1DURA 1U25A 1CVJA 1HYSA 2HLTA 2WB1D 4F3OA 4C9DA 4I6WA 2MKHA 4MK8A 1FRJA 3E2EA 1YSJA 1QAJA 5KG0A 3C8YA 3T5HA 2NZ4A 2LKZA 1HFEL 5F8MA 1UFWA 3FZ2A 1ZAXA 2XLIA 1T05B 2YNHA 3DYAB 3RU0A 4ECQA 3OXFA 2ATLA 2ZC3A 4DL0C 2O66A 2CQDA 1NJYA 2GO8A 1N5VA 1H2TZ 1YIJS 4QW8A 4RW6A 3R1LA 4A8XA 4K4XA 1S7HA 2J76E 3ITHB 3KG1A 5DM7Q 3B82A 1KOHA 1OPZA 3V6KA 4I1TA 1X9SA 3EXYA 3N5BA 4RNFA 3UW1A 4C0OC 2ZHOA 3GIKA 2XS2A 3GFHA 5B08A 1G3OA 3AQOA 1X5PA 1RT1B 2NLWA 1B0VA 1HW9A 1R3NA 1RJJA 3TA2A 5I4MA 4F67A 2MZQA 2BANA 3AJ2A 5J1PA 1HBMB 1TK8A 3CO9A 2IA6A 4ITSA 2PA3A 3DU5A 4O44A 1MMLA 4Q7AA 1VHFA 2C3OA 3TAMB 4G3IA 1UL3A 2FJEB 2R7VA 1UKUA 4TYAA 4EZ6A 1O5JA 1S1WA 3MM6A 2HS0A 1SKWA 1X0PA 4LFBF 1HBNB 2XNRA 4DSEA 4NRTA 2D9PA 2O1PA 4DR5F 1WHWA 3G71S 4ECXA 1PGZA 2GCFA 1FD8A 1GX6A 2HLUA 3QIPB 4PXCA 5DDQC 4NCBA 1RT2B 2MZ1A 1JLGB 5FIIA 2Q43A 1RT5A 3D1QA 2W9CB 2Q6BA 4I6YA 2LU2A 3I4PA 2V4RA 3KMQA 3GIIA 2VFUA 1BD6A 1SBRA 3MEDB 3GIMA 2M52A 4OX9F 2ZVSA 2MQOA 1BY9A 4WU3A 5JXSA 4PWDA 1JLQB 2XWXA 1OO0B 4J5OA 2IRYA 3TRGA 3QWUA 5KFHA 1S0MA 2V9WA 4Y2IA 3I32A 2R7SA 1XR5A 1YRTA 3TVYA 2HNYA 3E51A 1C1BB 3QO9B 2EFGA 3G6VA 3CCRS 4C0BA 4OV1A 5KG6A 2N3LA 4WE1B 1RTHB 1AROP 4TKTA 3X3UA 5LSOA 2HIQA 3OL6A 2LU1A 5HMWA 3D1HA 3G6XA 4TY8A 2KRRA 2YKOA 3BQ0A 2B51A 4KO0B 2R8JA 2ZKUA 5C24B 2RMLA 4I7FB 4TU7A 2DR7A 2DNZA 3LP0A 3DRSB 3EZ5A 2DR5A 2DO4A 2PD1A 3CJ5A 5DM6Q 1LK5A 5T41A 1Q8IA 2Z2LA 2KZZA 3SDEB 3T6BA 4N56A 3OSNA 3ZC4A 1VQ4S 2VBYA 1TL1B 4USIA 5A6WA 1ZZFA 2VFVA 5KT5A 2XGPA 2L9WA 4LFAF 2B9XA 4AL6A 1FJCA 3IFEA 2F9JA 2DTJA 3BGUA 4YB7A 5M2PA 3RRKA 2KB2A 4J9NA 5I3UB 3K2YA 2MKKA 3MOZA 2KHDA 5I3PA 2GW8A 2NREA 4YP3A 1RA6A 3DLKA 4A46A 3T9ZA 4ELUA 3V6HA 1UETA 2V8HA 2IAJA 2KFNA 2HWIA 2CPIA 5CYQA 4O3PA 2M88A 2M3DA 2ZC4A 1HWJA 3FSYA 3LWMA 3OTEA 2C2DA 2LXFA 4CTAB 3HVWA 1ZTTA 3Q23A 4ILLA 1P27B 4B3RF 1FRKA 1SH2A 4K5RA 3PW7A 4DL4A 4C8LA 2BE2A 4D3GA 1NK5A 2DJWA 2FHKA 2IM0A 5D4PA 1P9QC 3H5YA 3KHHA 1NKCA 3DLLQ 2FDNA 1LFWA 2DHSA 2NR0A 3G4SS 1ZM3A 5JUMA 4MTPA 1JKHB 4AQYF 2UU9F 4Y2AA 4BBYA 1FE4A 2OH2A 2EWHA 2H9ZA 3JSMA 2CPYA 1SH3A 2B4OA 3CGIA 3HMJG 3KK3B 2CJKA 2PGCA 4C3KA 3V6DA 2VKRA 3HX9A 4GO5X 1VJWA 1YJWS 2DT9A 2DGXA 5EWEA 1KQFB 3OSPA 3GR0A 5DO2A 3G8TA 3PX4A 3O5TB 3CCTA 1DQAA 3HDSA 2VBXA 4C8NA 2AQ4A 3MR2A 1T3OA 2PA8D 4EUVA 2ZH6A 2CPHA 3CEDA 2DR8A 2MZJA 2B5JA 1Y4ZB 3EXCX 5A2QY 3TYTA 4JBCA 1EP4B 5H9FJ 5J2PB 3K5MA 4LIRA 3Q24A 3BGRA 4NLQA 2BOPA 3V6JA 1O0PA 4USJC 3HF5A 3E8OA 4LQ9A 4ID5A 2C28A 2EVZA 2D9OA 3US5A 1IN0A 2LA6A 2MZSA 2FVQA 4I2PB 2DNLA 2HGLA 4JI6F 1R27B 4N77A 2HQIA 4TN2A 4PPZA 4MKBA 4BS2A 2RE1A 3DXSX 4XIUA 4RLEA 3M6WA 2ZH2A 5LT5A 4WYWA 5H1SV 2PIIA 2MJNA 5JJBA 3G9CA 2FIUA 2OLWA 4UUWA 3NMAA 4DQIA 3HZGA 4NLWA 1L3UA 3MXHP 5DDOC 1IXKA 1WD6A 2QT7A 2HGMA 4QIGA 4RBTA 4I67A 3MZIA 1FNOA 2JFDA 4KHRA 3O3LA 2HVIA 3OHBA 4B17A 1SJ3P 3OPKA 4I69A 1CG2A 2E66A 4MK9A 2JDJA 2VPZB 4JI1F 5D4NA 3K58A 3LANA 2GHWA 1UVMA 4WK1A 1N5QA 1NJWA 2RIJA 1IKVA 3DOKA 1JLFB 3HFKA 4K5SA 4MYTA 2XCAA 3ZZUA 2VQFF 1URNA 1X4FA 2AW0A 2VPXB 3PW0A 3FVYA 2EBGA 1VMBA 2I9SA 1WTBA 4OI6A 1HI1A 2LEAA 1ZPVA 1JJHA 2RSQA 4HH1A 1KOOA 5DG9A 2V8GA 2WSCC 5IM0A 5DQHA 1TKTB 2ZZNA 2PC6A 3UWTA 2W24A 4ECWA 3LAKA 2DIVA 2ZUGA 3BQ2A 5EDWA 1M5OC 2QV6A 2LA4A 2N3OA 3LP1A 5E3QA 2RU9A 1KHVA 4BC7A 3J7A1 2MQMA 4Q2MA 3C6UA 4HT7A 3CIZA 4ZPAA 4AL5A 3MMAA 4G1IA 2F1FA 3IA0A 1NK8A 1RT6B 5IQ6A 4DF8A 2JEIA 1S49A 1PO6A 1HMVA 1LW2A 4GO7X 3VQTA 1XR6A 5KFQA 1VRTA 3H2LA 4C0HA 2CPZA 4R5PB 3SDEA 2O3DA 2MZRA 5HO4A 2I38A 5FDLA 3H5SA 2LDIA 1E6YB 3TP2A 2JLEA 4DN0A 1BQXA 4XK8C 1LWCB 5HL7Q 2ZHAA 4W92B 4CNZA 3TR5A 3T5KA 3DRPA 4XPCA 2VD3A 2QA1A 3HHDA 3BN7A 1GTEA 4P6QA 2G1DA 3M32B 3NCRA 4FF3A 3H4BA 4C3LA 2DO0A 5G4DA 3DOKB 3MM9B 4KHMA 5B0EA 3UD4P 2XZWA 2YNFA 2E9ZA 4IH6A 1FKAF 1ELOA 3F56A 5AXLA 2QYCA 4ZCIA 1TVRB 2L41A 5D8HB 2VG5B 4R8UB 2DGVA 3FDSA 2WB4A 3JYTA 1HI8A 2IVYA 4TQSA 1TKTA 5MLCV 4GC6A 3MAHA 2KT3A 4PRFA 3I5BA 1JX4A 3DLGA 2VOPA 3BDEA 2R4FA 3IGNA 1KQKA 2J8AA 2JC0A 1QY7A 2Z4PA 2QMWA 1S10A 5F8HA 1X5OA 2BUNA 4DLEA 4FZVA 4DG1B 1VOMA 3FMWA 1GT8A 5DDRC 1EP4A 4PXDA 4F2RA 1U1NA 1RT3A 2IC3A 2L08A 4A8QA 2FHOB 5GVQA 2ADBA 4OJHA 5KT7A 3TAMA 5I3QA 3QJLA 2P6TA 2C2EA 1H2VZ 3I96A 4CT9A 2E5GA 3ISNC 1D8ZA 4OX8A 1VC6A 1S1UB 3TW0A 4C98A 3OL7A 4OZ1A 4KC5A 5F41A 2YWGA 1KSPA 1RGVA 4NA2A 3AB4B 5HROA 3M9MB 1MROB 4NXNF 2Q3PA 3MGJA 1Q16B 2B7CB 4U7UK 3HKZD 5I3UA 1ROFA 1Q1KA 5F0WA 2IVMA 4ECTA 4QBUA 3DNCA 2EC0A 2IRUA 1RT3B 2IC3B 3ISZA 3IWLA 5KFJA 1J5EF 3OTCA 3RW7A 4O3OA 1VQ9S 3NCQA 2OPPB 3T1AA 5LXYA 2F8MA 1UJ4A 1HL6A 1TP7A 4HT5A 5GAEU 3VAGA 4OHXA 3HHNB 1JWWA 4A47A 2XLJA 2VH7A 5IQQA 1U2RA 1U7LA 2MQPA 1NK4A 2BJEA 1QAIA 4X64F 5THWA 2ZHBA 1V3ZA 2IBOA 4Q5VA 3KLIB 1Q4RA 3D2WA 3VALA 1QM9A 4O4RA 4R0EA 1HHSA 3TA1A 1LWCA 3K0JA 3RR8A 1UJ6A 3PM9A 4UQTA 3CJ2A 4UY8T 1X4DA 3IS9B 4B3TF 5GAEI 4ZCMA 1C1BA 2Y0SD 2VONA 3IN5A 2C42A 2JEFA 2DCUB 4QIEA 1TL1A 4X4QA 3MAQA 4Y34A 1YBAA 2NUUG 4NYPA 2YH1A 1RT6A 1DZ5A 1U6ZA 2VG7A 2XNQA 3CDEA 3MURP 4HL9A 1VQPS 1E6VB 4RUCA 3LH2S 2MKJA 3ENWA 5J2QB 4FBUA 4URSA 3BZQA 5KFFA 2RQKA 1R8HA 4TY8B 4ILMA 3OR2B 4MKAA 1FDBA 1FXDA 3C6TA 4HKQA 4C4WA 4DN9A 3NNAA 1GH8A 1RTIA 3JTNA 1B7FA 2DGQA 2ZOMA 2VOOA 2ERRA 1Z2ZA 2VQEF 5LL6d 1NKEA 2VV5A 4I7FA 2IJNA 3UR0A