3AB4B

Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
157
Chain Sequence
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 35
structure length 157
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B01
2J0WA 5IT0A 2DT9A 3KWMA 2H9ZA 1PSDA 1UJ5A 3L7OA 3HHEA 2J0XA 3LOUA 1YGYA 3U7JA 3DC2A 4PWUA 4M8LA 2P9GA 2QRRA 3OFHA 2P9EA 3K5PA 3MAHA 2LQJA 3TUZC 2LVWA 1XTZA 3AAWB 3IBWA 2QMXA 5FIIA 2I9SA 3DHWC 3ENQA 3LUYA 3UW1A 2ZHOA 3O1LA 1U8SA 3TUIC 5T41A 1ZPVA 4IO1A 1UJ4A 1RWUA 2PC6A 3TUJC 2DTJA 3OBIA 3P96A 1LK7A 1KS2A 2RE1A 3S1TA 2FGCA 2RQKA 1O8BA 4LUBA 1UJ6A 3OFEA 2F8MA 3MTJA 3NRBA 2NYIA 2JHEA 3ENVA 3N0VA 1M0SA 1LK5A 3DHXA 1Y7PA 3IXQA 3CEDA 2P9CA 3MWBA 4GO5X 2QSWA 5IS2A 2KO1A 3DDNA 3OFGA 2MDAA 1LKZA 4GO7X 5IT4A 5JJBA 4NMLA 2F1FA 4X84A 1SC6A 2CDQA 2PA3A 3AB2B 3ENWA 4GMKA 3AB4B 3OFFA 1YBAA 2RQMA 2JOQA 3W7BA 2QMWA
chains in the Genus database with same CATH superfamily
1E6VA 1JLGA 3HHEA 4EO6A 3RB4A 2DNMA 2WB4A 3PW2A 4K7QA 2JEJA 1SB6A 1BQNA 1KQFB 5A6WA 3BZQA 1V9OA 3AAWB 2DNYA 4Q5VA 5D3GB 4B3RJ 2I8EA 3N28A 3DGPB 1ZPVA 2HZVA 4UQTA 4OJHA 2AWZA 3BO3A 1VK8A 3UD3P 3MM9A 2GC8A 5CCLA 2VKZG 3NGUA 4QPXA 2EFNA 2MZJA 1RQ0A 4X64J 4TU7A 3TAPA 4QQBA 2EXUA 3ONQA 4RKUC 5KAKA 3IR6B 3EPIA 1EAYC 1T95A 2OPPB 1SI9A 3F0NA 5LJ3Y 4PR6A 2OFHX 4HL9A 2JX2A 3J81U 2XZWA 4DDFA 5DDRC 4ZPVR 1M90T 1F9EB 2IBOA 5GVQA 4IUFA 1T8EA 4KH0B 1IKVA 2G2ZA 4HT7A 2QL5B 4NLQA 1S0VA 3SQGB 5A8KA 3RRKA 1HI1A 2IVYA 1RE1B 3GIJA 1RU1A 5HN0A 5KFUA 3MCMA 3JSMB 2BQ3A 1HLWA 1RWUA 2ASJA 4PG6A 3SDEA 3MM5A 2DTJA 5KG3A 3QRPA 1PIEA 2JH3A 4I64A 3CJTA 4RW9B 2XGPA 3UDCA 1XMOF 2QA1A 3HFZB 2VG7A 1KP6A 1VC5A 3IR5B 1PG5B 3T41A 3WX8A 1PJ5A 2BQRA 2ZWOA 2OFGX 2DRBA 2FHMA 1FFWB 1WOSA 9RUBA 2C2OB 4Q0BA 1NSAA 3D6TB 4BDPA 4ZP8A 1CLFA 3MCNA 2V9WA 2XG8A 1NDLA 1RBOB 4M63A 1SL0A 3PRDA 1K0TA 1N4LA 2W2NP 4QPTA 1UKUA 1N88A 2CDRB 3MR3A 1ZAWA 5D0GA 5KFDA 1XK8A 4DV0F 3OTOF 2DR6A 3M8QA 1JNRB 3L95X 4DU8A 3C3LA 1GMWA 3A8KA 3BO4A 2R7RA 1NK0A 5ETQA 3DU5A 3GB0A 2PE8A 3M9OB 3SCKE 5GAGI 5B0GA 4BCAA 4U7CA 4PZVA 3P96A 1LXNA 3K5OA 5L38A 3WC0A 2I0XA 3CCZA 4O23A 4ENOA 1UCNA 3R5JB 4NYOA 1EETB 4A8FA 4UZBA 3NBPB 2IDEA 4X66F 5IC6B 5D0EA 4Z7CA 4WP3A 2CJ9A 2GO8A 4DV5F 2HFZA 1B70B 3PKYA 1URNA 2MXYA 4DV1F 3MMBB 2DNNA 3Q2TC 1RWXB 5HL7Q 2C22A 1IBKF 3EGVA 3QT8A 4J9LA 4ED1A 1U25A 3W2VA 3WDOA 1LWCA 1SBRA 3EYZA 4DR1F 1U45A 1RKIA 3VTIA 3DLKA 1ZOTA 1UAWA 2QGFB 2W7AA 3L7UA 4QYZK 5F8MA 1BWEA 3Q0AA 5AE3A 4A8OA 1SKRA 3G71S 2MZRA 4L3KA 3QJJA 2ZBPA 1UWBA 3UVJB 4ZPAA 3U1LA 1HI8A 3CJRA 3O2IA 4A8WA 2PSZA 2ZVSA 3G6VA 3TP2A 1BC6A 3JQMA 4U96A 1JLCA 4NCBA 2VA2A 5DRKA 4L74A 3GV5B 2JC1A 1F3VA 4C98A 2D69A 4DLEA 1RBLA 4A8MP 1MN9A 4X84A 3O44A 2RHSB 2N7YA 2HHUA 4ZVTB 1L3VA 3UDVA 1NRKA 3RB3A 3V81A 1YGYA 2HIQA 1XEZA 1YDLA 1S1WB 2L9WA 1XMOJ 4USJC 2XLIA 4K2XA 3K5MA 2U2FA 4Z37A 1RT1A 2RJZA 2MPUA 2BW7A 3IWXA 3M9NB 2LQJA 2XB2D 5B08A 3NMRA 2Y1IA 1ZS6A 2HS0A 1U1QA 1N8RT 2ZOFA 3CD6S 2HNZB 3ZZRA 2YH1A 2GMLA 2J7WA 4Q2MA 1RU2A 2RE1A 1G1XA 3H0PA 1JKHA 1PYSB 5K14A 3KHHA 5LMUF 3W3SA 3HCXA 3OL7A 2OUGA 3PX6A 1Y4ZB 3C14B 2HVIA 4IRDA 3G6ES 2B3TB 3CEDA 1IVZA 3OTOJ 4TU8A 4DV0J 2DGTA 1WEZA 3DI6A 2E7WA 1VQ7S 4JV1A 3H5SA 5D77A 4MKBA 1U2CA 1BD6A 4RW4B 2MGZB 2VJVA 1H2VZ 3MMAB 4CNYA 1ZZNA 3HVTA 3J80Y 1N33F 2DEJA 2HBYB 2EG1A 1HL6A 2WVBA 2CVEA 2CNOB 3D1OA 1DQAA 3AOBA 2QL9B 1UFLA 4B08A 1F0XA 4J9MA 1J5OA 2KXFA 5EX3A 2ATCB 4Q45A 4X66J 2ZC3A 2B9EA 1XTZA 4J7CA 4DV5J 4DUTA 3OSPA 2MSTA 3D1QA 2H5EA 4ZLPA 4HI2A 5AJ3J 4DV1J 4KRWA 1PCAA 4KYZA 4ZITA 2HMIB 1IBKJ 3HSDA 3EWGA 1SL1A 3EVOA 2WSEC 2K8GA 3CJ4A 4N77A 3QSIA 1DTQB 2DEIA 4HHUA 3TQEA 1NDKA 3Q8QB 3DRPA 4HHHA 5SZTA 3QZ7A 2WAQD 1WC3A 1HKAA 2E7XA 2BA9A 3KXDA 4MJKA 2XMMA 2DCLA 2AW0A 2KN4A 1WKJA 5KG1A 2GJIA 3ENWA 3FRZA 2DRAA 3QGPA 3Q89A 4UY8T 4OHZA 3KK1A 4JV0A 2BANA 4F4YA 4FBTA 3MUTP 3N9UC 5EGYA 4NLOA 4RJVA 1VQPS 4LR7A 3OV7A 4DL6A 3S6EA 2MHNA 4NA1A 3WIUA 5EWGA 3VVTA 3RU0A 2A3JA 3AA8A 1FA0A 2CPYA 2XSJA 3ZTRA 5ADZA 5HVGA 1UVLA 3GSIA 4DPTA 5E33A 2W4PA 4K4TA 2V34A 4RW8A 4Y34A 2YPYA 3HHKA 2FZCB 3LP2B 3VAIA 2LLZA 3M8WA 2DGOA 2IA0A 4DPYA 5L1IA 2GMJA 4K50A 3PV8A 4DZ6A 3C6UA 2P9CA 2FC9A 1Y3KA 4C8LA 2AQ4A 4GO7X 1AUSL 3EE3A 4EBCA 1GMUA 1H2TZ 1X4FA 1OIAA 4AFFA 3C15A 1K73T 3HHDA 3MEGA 1SV5B 3D6FB 4ALZA 4I6YA 2CWXA 1MU2B 4PG8A 3FEXB 5LMUJ 5KOXA 2AJFE 4PXCA 4M5DB 2ZZMA 3BGUA 3KJVB 1LNQA 4WIQA 2LA4A 2DNOA 4H4OB 1RTHB 2PT0A 2IJRA 4RWXA 2MKIA 4FXWA 2KB2A 2IRUA 2ILYA 3N4WA 2VUGA 1RABB 3OHBA 5HP1B 1Q7YT 1N33J 2QLBB 4O3RA 2ZJRQ 2WBRA 2VBWA 2ZBQA 1PYTA 3GJQB 2J8SA 2HHSA 1P6TA 1H2UX 2CNNB 2I5JB 5K8MA 4W92B 1W2BR 3SQGA 3OW2R 2OMOA 3UN5A 2HFNA 2BVZA 4OZNA 3HVWA 4AL5A 2YKAA 4U8YA 1S7IA 3OL6A 1RT5B 5B7WA 3JSMA 8RUCA 3MHYA 4ZMMA 1LXJA 4ID8A 4NZ7A 2DR5A 3MR7A 3KJQB 2ADBA 4QBUA 4ZVOB 2W2PP 2Q1LA 4LSLA 4C9DA 1FXDA 4KBIA 3QIDA 5EN1A 5CH7B 1X60A 3H98A 2H54B 3I4PA 3E51A 3G4SS 1T03A 2V68A 3CDUA 3MF5A 1B3TA 2G0CA 2HQGA 1RAHB 1KOOA 3TJAA 5K8OA 2NPFA 1V6HA 2VPZB 4QYZJ 5KFMA 2ZC4A 1RI7A 2C1EB 3K7RA 4OV6A 4BHQA 1GMVA 1LK7A 5A8WB 2FGCA 3R7BB 4UOFA 3NAHA 1TL1B 1X0FA 2PFFB 1TKZB 3I56S 4LQ3A 1C0UA 4YS2A 4DXLA 2BQUA 1CJKA 1RWNB 3CJ5A 5KFFA 3K8VA 1HBMB 2G1DA 2CPDA 3CT9A 1X8DA 3DM2A 3R2CJ 4L76A 5JMNA 3K89A 2GJFA 4JUZA 4AE5A 2HK2A 1OQ6A 3I0RB 1SC6A 3WX4A 4TY8B 1HQUA 4DFJA 5ETRA 2UXDF 4Q8FA 1OO0B 1CBKA 1QLNA 4ED7A 4LRBA 1D9AA 2RAQA 5F0WA 2J8AA 1VCTA 1NSKL 1EETA 4YUDA 4ILMA 2L3MA 3NBPA 2PGCA 3NXZA 3KK3B 3N79A 2C3YA 4WJBA 4LBPA 1DTTA 4OZ5A 3VAGA 4NI2B 4DV4F 3V4IB 3M2RB 5KFBA 2F4VF 1CQNA 4NEZA 5KFLA 2RIJA 4DX8H 4LFAF 1RUSA 2G0IA 4N56A 3KNAA 3D7SB 3PFEA 4UF4A 3RRHA 1KS2A 3PYFA 3CIZA 1RAJA 2R7OA 4DSLA 1WEYA 4KFBA 5C25A 2FLOA 5GAGU 2XQCA 1RTDB 3NG8A 4NLTA 1S72S 1JJ4A 1JLQA 4ED3A 2XTJP 2QE5A 5A8RB 2QA4S 1RDRA 3L9ZA 1FJ7A 2B6AB 4OFZA 1J27A 5C24B 3IS9B 5K5MA 4RW6B 1ZETA 1T02A 5ETPA 2MQOA 1CQMA 1NK6A 4EZ9A 1KQSR 4MH8A 1IM4A 5I42B 5KFZA 1HFEL 2XO7A 2O66A 2HVHA 3G6YA 2NZCA 4NLGA 3R5DA 1IN0A 3AJ2A 1KLMA 3M2VB 4Y28C 4NXNF 5IWAF 2C2KB 2DY1A 2QL7B 4Q7AA 4NCGA 1RT3B 2RQKA 4O4GA 1R8HA 3TW0A 2HHQA 2DXFA 1EQ0A 1NM2A 4YN3B 1S77D 3G8SA 4AL6A 4B02A 2AU0A 4GO5X 2QSWA 3KFWX 4ZVHA 2N4DA 1KFDA 4LREA 2HNZA 4Q2LA 4ANDA 3KOAA 2PMZD 5HROB 3ZZPA 2R2RA 4OJ3A 1NKBA 1RSCA 5I4MA 2E5GA 1M5HA 3UI3A 1KBRA 4DZDA 1F5BA 2OPSA 3CCRS 4ES1A 3H5UA 3JAMY 5KFRA 4MK7A 1VQSA 2LXUA 2JFDA 2QJ3A 5CZVA 1RYSA 5KT4A 4RW4A 4TU9A 2KVQE 3R5BA 5LXYA 3W5ZA 3KJFB 1PAUB 3MMAA 2Z2ZA 3MEKA 1QE1A 2ASYA 4ZDNA 4CNZA 2UXDJ 1R0BG 5KOWA 1QSYA 3BGRA 2YKQA 2B7BB 5IV4A 3BN7A 4KKOB 2CZ4A 3OXGA 5KFAA 2G2OA 4OYBA 1K47A 4MTPA 3BQ2A 3QAUA 4WK3A 1UPMB 1VK3A 4K8RA 1FNXH 1IJFB 4ZP9A 1D8YA 4DV4J 3EZ5A 3OLBA 2QLWA 2HGLA 1D8ZA 4LFAJ 2EWHA 2VC0A 2MMYA 3DMJB 2XY7A 5CYJA 2FYXA 5DG7A 2YX4A 1NHKL 1ITPA 3FKBA 2XY5A 4F4KA 1DJ0A 1RGVA 2Z2LA 3CD7A 2WOMB 2R3VA 3LP0B 4UOCA 3EM1A 2CQ2A 5J1EB 4C8KA 2LDYA 2AEMA 2MKKA 2HIYA 3C2PA 5K9FA 4EGLA 4OZ2A 2OPQB 1JJCB 1RACB 2CXEA 3MDFA 4ZVQB 3QNWB 1TFWA 3QPIA 2C3UA 5C42A 3KLHA 3T5HA 4YP3A 4WYLA 2B5JB 1RHUB 3W63A 4C11B 3TWZA 2CQ1A 3NRBA 3UN2A 1G4CA 3ZTQA 2ERRA 3R3TA 3VALA 3IA0A 4LRCA 1DBDA 5DDOC 3RB6A 4G1IA 1CJUA 5A2QU 2R2TA 1SJRA 4NXNJ 5IWAJ 2CPZA 4LF2A 2D3ZA 1NB7A 1R7IA 4CT9A 3LP2A 1TL5A 2JVOA 2IM3A 3KTQA 3HT0A 4HYKA 3NLCA 1VQ9S 4RNHA 1RAIB 3LPYA 3F73A 4Y65A 1OPZA 4PXEA 1U2RA 1WG4A 3DRRA 3F56A 3TZZA 3CJ0A 1S0MA 2YNHB 5IM0B 3T5LA 3BM7A 1FK9A 2OAUA 4CLUA 1RBAA 3DNCA 4EFAC 3CDBA 4X4VA 4C3KA 1XNRF 1MU2A 4ZVPB 1HBOB 1RYRA 4F67A 1YJNS 3H2VE 3EUNA 1VBXA 2VBXA 3IRWP 1RAFB 3ISZA 2Z0GA 1I1GA 3PEHA 2WSCC 1GXUA 4QYRA 3UCUP 2RF2B 1RTZA 1YZ7A 1LW0B 1FESA 1OQ3A 2V4JA 5KFIA 5HP1A 3MMJA 2HFVA 2BJ9A 4EBDA 1RT2B 3TVZA 4ED5A 4ICLB 2I5JA 3DGVA 3M8YA 2KL8A 2R42A 5MLCV 1QAYA 3BDEA 5DJBA 1RADB 4P2FA 3OSNA 4YB5A 1RT5A 2V8VA 1VLYA 3M32B 1H73A 2BKPA 4J9VA 4WTOB 3SZ2A 7AT1B 2G4BA 1U1PA 2EEYA 2OD4A 4YDDB 4P52A 2QLJB 4WFYA 3I0SA 5DM6Q 3DOKA 1SKUB 3PDNA 4MT1A 1W2IA 5CYMA 3DU6A 1DFDA 5E7OB 3JB9k 2CG4A 3T9NA 3M1VB 3ETOA 4FF2A 3VAJA 2JZ5A 1JB0C 3GZ7A 3MM7B 1B0VA 1LW2A 4DL2A 1LQ9A 3IRXB 3C46A 1UFWA 1YHQS 4FKXA 2MQQA 2VFUA 1S1UB 2I1RA 3C16B 2C2DA 4I2PB 2H51B 1EZZB 1JLFA 4DHVA 1QTNB 3ZTPA 2RKIA 3RAMA 1NU4A 2KH9A 1YZ6A 2FUG9 1UZHA 2YKNB 3R7NB 4UUXA 2A6OA 4JV5J 1N5VA 2IIHA 4MKAA 1Y9OA 1M5SA 1R43A 2VC1A 3GYXB 3FSXA 4YB6A 4M5KA 4WKRA 4URSA 2I9SA 3EICA 3IGNA 3PY8A 4NLXA 4NA2A 1JXLA 2KI2A 3IG1B 2V0NA 4ECUA 3GIRA 4OYIA 1K1QA 2ROGA 4RL1A 4FN5A 4AUKA 1X5PA 2LU2A 1QVFR 2WVCA 4IG3B 5H9FK 1VBKA 3M4XA 3NGTA 2DHAA 4I68A 2VQFF 3HD1A 1O51A 1OWXA 3MWBA 1DARA 2JFKA 3DN9A 1S1TA 2W4DA 2Q6BA 2E5LF 2GFFA 1P9QC 2FPHX 7FD1A 4I2QA 2LYVA 2B4VA 3FBEA 1KTQA 1XNRJ 4HLBA 4NWBA 3D1HA 3UQSA 4WIIA 1RTDA 5IC4B 2BOAA 2Z2YB 1YK9A 1NAQA 5A8RA 2QEXS 4DFMA 2DHHA 5DLGA 5J2NA 1A0OB 4H4MA 3O1LA 3W2WB 4DS5A 3IS9A 1SIZA 5KG5A 1UW9A 3HFKA 1B7FA 4P10A 4GC6A 2HHPA 3ENAA 1WC6A 2VFRA 1IBCB 2J9DE 1XR5A 7FDRA 4WE1B 4K4SA 3FDSA 3MTJA 3LANA 2QZ8A 3FZ2A 3SYZA 4ELTA 3CCVS 2IM0A 1HNVB 4PWWA 3B4DA 3POTB 3K5NA 3CMES 5FJ4A 3PW4A 1G2EA 3NGKA 2FZGB 4O4RA 3MM8B 1K0VA 3LW5C 1RT3A 5GMEA 3WZ0A 4DV7F 2C42A 2QX0A 5BYQA 4O3OA 2YKMB 1WOOA 3ILIA 2QA2A 4OQJA 1TMMA 5KG6A 3L7OA 4EO8A 5HBMB 1S76D 2JVRA 4CM0A 2QIFA 2V2KA 3VCDA 2UP1A 2XLJA 1GTEA 1PILA 4B3OA 1H74A 3FBCA 4KSEB 2CAJA 4CRJA 1N56A 1W25A 4B9SA 1UP1A 1Q4RA 3IFEA 2ROPA 3SI8A 5E2QA 4DJBA 5HROA 2C2MB 3WC2A 2UV8G 1HYSA 2LP4A 2M70A 4JI8F 2B51A 5KG4A 3HHLB 1SKWA 3G86A 4QIGA 4J9OA 5D6GA 5G0RB 3L09A 3QWUA 3W5XA 1LWEA 1XQIA 4F3MA 2IC3B 1EP4A 1IWGA 2ZHAA 2ZDOA 2CQBA 4U95A 4PYAA 5B0EA 1MMNA 2AZ1A 2C2RA 2OEKA 4C0OC 2QA4G 3I5AA 1DLOB 3HO1A 1KSPA 2YKPA 3ITHA 3U7JA 1VQMS 2YNIB 3MOZA 1L3KA 3JSYA 3MURP 4DL7A 5EWEA 2E5JA 2E44A 2AJ1A 2XEXA 2V63A 2VQFJ 3I6PA 2YQ3A 4Y6IA 3LWLA 1D1UA 3JQKA 4LF1A 2RHQB 3MD1A 3FQLA 3BO2A 2E5LJ 4RBTA 3KLFA 1RT7A 3DMJA 5EWFA 4MYUA 4MIWA 2CQHA 1FT8A 4RR5A 3OJSA 2UUAF 3QMQA 4IFYB 2WOMA 4BBYA 2UU9F 2XHCA 3N5BA 5J1EA 1AFJA 1SH2A 4M5NA 3BGFA 3M6XA 1SQGA 2NXNA 1YITS 2P6TA 4M5JA 3H90A 2B8QA 2DGXA 2B5JA 3OD2A 5HMWA 3GYNA 2AX0A 5E3QA 5C7PA 4IH6A 4YMEA 4X2BA 5F41A 5KTQA 2P9EA 3UCZP 1RT4B 4KTQA 3MAHA 1OS5A 1T0TV 2KHDA 4FF3A 2EI5A 3TUZC 3CCUS 1UWAA 2QMXA 4C7QA 4F0HA 3BSAA 1S49A 1TTHB 1X4DA 3TEHB 1BMQB 4DL0C 4ER8A 5L1KA 2U1AA 1SH0A 2HLTA 1OY9A 4MFBB 1YBUA 4IG0A 2PEHA 4WF9Q 4DV7J 2AJQA 4GKKJ 1T9XA 1VS3A 2HHWA 4A4JA 1Q81T 1N0UA 3BSCA 4I1TA 2W1BA 5ETNA 1EARA 1HW8A 3FFIA 1M5KC 4EMDA 3MECB 1P1LA 1N6QB 1WHVA 1P27B 1RK8A 3UN3A 3CJKA 2QTWA 4IOCQ 1OMSA 2HHXA 2AEFA 3NOCA 3LQVA 4G65A 2AX1A 3J80U 5IM0A 2YNHA 2DH7A 2HNYB 5E5NA 4CH0S 3GCXP 3T1YF 1PBUA 4MKYA 4HACA 1XN9A 4JI8J 2EVZA 3EDQB 1HBOA 3DLEA 4PUOB 2R7VA 1NJYA 2RNEA 2Z2MA 5M2RA 1VBYA 3VZHA 4ED4A 4CO0A 3B82A 1YRXA 2FHJA 5FIIA 4QIVA 4B9MA 3ENQA 3I96A 3UW1A 1HHTP 5LJ5Y 5J2QB 1PJ7A 1IR1A 3ADAC 2EFVA 3PX0A 2PMHA 4NZ6A 2HVEA 3LO3A 1FNOA 3NCQA 3SSRA 4DUZF 3MEEB 1Z2LA 4S0MA 3IMQJ 4DN0A 4YY3F 4LR9A 4ZK7M 1YIJS 1OSCA 4X4TA 4HTJA 1N5SA 1CVJA 2CYYA 3ELHA 4LBIA 3PRVA 1M0SA 2UXCF 1HBNA 4OJGA 5H9FJ 3UWTA 4JYAF 1SIWB 1PC5A 3CB4A 1X4BA 3M32A 1KNZA 3OFGA 4RNFA 2HSEB 5E41A 3MOJB 4LF5J 3W9HA 1F1BB 2VJUA 3CIMA 4XTTA 4GKJJ 3A3NB 5HSPA 1FTCA 1REVB 4WWSA 1LEOA 5D4PA 4XPEA 2NUUG 2HW3A 1ICEB 2GQ2A 3G87A 2FJXA 2HHHF 4WFAQ 2UUAJ 1P9YA 3M1VA 5C2CA 3ET6A 2JDJA 4OYMA 2UU9J 1U02A 1GT8A 2MZQA 1T9YA 3FZBA 4RUCA 2WW8A 1FHTA 1SJ1A 4ZLJA 4NXMF 4ETZA 1JQGA 3MR2A 4F25A 4RWWA 3C16A 2G2YA 4BC9A 2OO4A 4I2PA 3CDEA 4USVA 1U1NA 3PJXA 1S48A 2EBEA 5CYQB 3FNNA 4LF8F 3LP1A 1MROA 3CF5Q 1NDPA 2B9WA 2E5IA 1ZH5A 5F3TA 4Q8EA 2PI5A 2WVFA 2YNGA 2ZD1B 4YDXA 5ETLA 3SCIE 3O8WA 4IRCA 5FLXY 1GXTA 4QIWD 1WACA 3A8IA 4LIWA 4LRDA 2HBZB 1LKZA 3KLGB 4OX6A 1J5EF 3VQSA 3VQTA 1IKWA 3MZIA 1FWPA 2NQPA 2WSFC 2RDDA 1DAXA 3Q8PB 5I3QA 3T19A 2DY9A 4IQMA 4IG3A 3THPA 2L48A 5BR8F 4EUVA 1U6FA 4DSIA 4N47A 3UNYA 3VWSA 1SPBP 3VHQA 2FZKB 4OMFG 1RHQB 1UMJA 3EVWA 3MAQA 3HSGA 1JLEB 3B8HA 2XS7A 1IXKA 1KVIA 4GVBB 5J1NA 3EXYA 3T1YJ 3GWCA 4DMZA 4C97A 1YI2S 3HHNB 3GFZA 3KUEA 4ILLA 2D3UA 5F8JA 2V67A 4ZOSA 4ED2A 1VI7A 2W9BB 2GVDB 4RZRA 3DHXA 4XDCA 4RX6A 4JI1F 2QFJA 2V50A 4ZPTR 5DO2A 1Y5LB 2MTLA 4UY85 4E0DA 2M8HA 1UVNA 1U1LA 2R7TA 3KUHA 1SKSA 3E01B 2R7UA 2BJ1A 2DCUB 1YWXA 2AZ3A 1NPPA 2B4OA 2EFGA 4LSNB 3IAS9 3US5A 1WF1A 3VAKA 2ALZA 3H2LA 3G2XA 3PR5B 4RO0A 4YY3J 4WE1A 3ZZYA 2QFIA 3CCWA 5D8HB 3IM8A 3PIOQ 5B09A 1SVDA 2UXCJ 2XZTB 3J81Y 2W8KA 1HNVA 4JYAJ 3POTA 4F8RA 4AD6A 3GJRB 4JI6J 4FVMA 2V69A 3G6XA 3HMJG 1QY7A 2HK3A 1UJ4A 2V8DA 3DDIA 1RWMB 1HPZA 1WC5A 1YQHA 1VHIA 3VR1A 4Y2AA 2IBKA 2HZCA 2W01A 3TJ9A 4ZCKA 2HHHJ 2VPYB 1VFJA 2KVIA 1XR6A 1RWPB 1WG5A 5I3PA 3UR0A 1T94A 4KY3A 4ZCIA 1U09A 4C8MA 3D28A 3M30B 4NXMJ 3AQOA 3CUNA 1R0CB 2PA3A 1N5YB 2ZNYA 4HT5A 5HATA 3HHLA 4RNMA 5IV3A 3RAXA 3RR7A 4LF8J 4WP9A 1PKUA 5G0RA 3E2EA 4O44A 3GIIA 5L1LA 2A1BA 2RH3A 4FNHA 3OVSA 3HHLC 3EGNA 2BE7D 2DRDA 4BWJA 1A6LA 5JVHQ 4PRFA 4M94A 2LKZA 4ID5B 2YBVA 2ZWPA 1J5EJ 1IQZA 2AMCB 4IFVB 3PVXA 1S1XA 3M7VA 3CNQP 3UPFA 4RPFA 1FKPB 3EX7B 2YWHA 3HJVA 1UZDA 1CJVB 1R8PA 2BMBA 2CPEA 3LAKA 4NLRA 3S1TA 5FDLB 1R6VA 2GV1A 1EKRA 4ZPDA 3ENVA 3CCES 1S12A 3DLBA 2MKJA 1WC4A 1I6JA 3BYPA 2MSSA 4ZHRB 3ICLA 1KVJA 2EC2A 5IT4A 1QM9A 1X5TA 2VQEF 1CULB 2BE9B 3UNGC 1FO1A 2OTJS 8AT1B 3AD7C 3AOAA 4OZJA 4YB7A 4IFYA 1WF2A 1RTJB 5G4DA 3BH6B 1NJIT 2AT1B 2VKRA 5CZXA 2AV5A 1X4AA 2I38A 2CJKA 2EPIA 4Y2KA 2XBPA 2K1RB 1FJCA 1U0HB 1QUPA 2CJAA 4JI1J 1QD1A 4QR2A 2HYIB 4CH7A 2J0QD 3NCPA 4DLGA 1YJ7A 1AFIA 2UVVA 4J9UE 3TEGA 1M1HA 2W4CA 1QJHA 3TANA 3HKZD 1TMJA 5J2MA 2CQ4A 2EBGA 4LIRA 2RRBA 3VGTA 2MKYA 1NEEA 1LWFB 4WKYA 1H38A 3PYDA 3B6BA 2F1FA 4LF9F 3FCWA 4MFBA 1IM6A 2F4FA 3V6HA 2AYBA 3MR6A 1UW4A 1HNIA 1SQEA 1Q8IA 1D0EA 1E6YA 2HVZA 5CHCB 2Z57B 4OZ1A 1TK8A 1CJTB 3GJSB 4P2XA 2DKOB 4WFXA 3PYEA 3CCJS 3THVA 3BH7B 3MECA 1QAXA 1OPIA 2GHVC 5KFHA 2H48B 1L5UA 1MMLA 3DHWC 1RHMB 4FXDA 3D3CJ 1RCXB 4NX9A 4Y2CA 1C0TA 4IR1A 2CUYA 4PUOA 4N8OA 2LDIA 2BE2B 4ZVRB 1JXVA 4B9VA 2IM1A 1B99A 2WRMA 4X4OA 1TL4A 4USMA 5DM7Q 4N41A 5HLFB 1S79A 1YX2A 4KO0B 1NH7A 4F2SA 2F9DA 5IS2A 2E1CA 1SC1B 2GMHA 5J2QA 1ZYQA 1PO6A 2R8JA 4LR8A 3OPKA 4R5PB 5F3ZA 4OLOA 3J7YI 3FEYB 2M52A 2GX8A 4X4NA 4KGMA 3MEEA 4CI0B 1KFSA 4LRAA 1FX2A 2ZZNA 2B9YA 4WK1A 3DRXA 3DRYA 3SMZA 1VISA 3PCOB 1BUXA 1DHMA 1NK8A 4O3PA 3KHGA 1I51B 4EWTA 3IWNC 2VH7A 2H4YB 1S99A 3TX0A 5K8NA 1M5PC 1Y3JA 4NA3A 2VQEJ 2J7KA 5F0UA 4I6AA 2E1MC 3WHIA 4IQXA 4MYTA 4DSKA 3O5TB 5M2UA 1M1KT 1IR2A 2J6UA 2A18A 2H5JB 1AXQA 2AP6A 2OGUA 1U7LA 3DYAB 5E3AA 2M0GB 1MG7A 3NNCA 3JYTB 2DGSA 5KFCA 2BJEA 5C5JA 5CCMA 3DXSX 2FHOB 1LFPA 2HHTA 2KXNB 4F3QA 3C19A 2X1BA 4KPCA 4DUYF 4ECTA 1TAUA 2J0XA 4J9PA 4IDKB 1ELOA 3MMCA 4WTYA 2FJVA 2ZD1A 1B64A 2W7OA 3R97A 4EZ6A 4V1Ak 1KKHA 3SXLA 3A3PB 1QVGR 2ZFHA 3CCLS 4ATNA 1U2FA 4AQYF 2W24A 3KLGA 1URRA 4C0BA 2FJWA 2YWEA 2CQ3A 4JP8A 1U8SA 4KIAA 4LF9J 2LQ8A 3D5MA 1WHXA 1F9HA 4DI6A 1S9EB 5T7LA 1TVRB 4OYPA 3BN4A 1FE4A 5HANA 1CPZA 4H4KA 1VQKS 3PW7A 4Y0FA 1JLBB 3R5CA 1QAIA 2M8DB 2VDHA 3R1LA 3OR1B 4H4KC 3PJWA 2MEWA 4X4QA 4GVBA 5HQLA 1N32F 3K8WA 3QT6A 3G82A 4CWBA 4URQU 1TKTB 3L3CA 1U1KA 3H59A 4J90A 3NP5A 1NJWA 2YKOA 2HZAA 1F2HA 4DQIA 4ZLLA 4JI3F 1V3ZA 2KJWA 4WBFA 4WU2A 4USKA 3Q23A 2W9BA 2XMJA 2GVDA 5KT7A 2ATLA 4C0HA 4KGZB 4ZVEA 2CPXA 1Y5IB 2XM3A 2N7CA 4K4YA 1H7WA 1DY3A 1VJWA 2J6TA 3E01A 3KLEA 5GAEU 2A2CA 2P5VA 1X9WA 2ZOMA 2BW2A 3GQCA 2FTRA 1S9GA 1IKXA 5AJ3F 3BGLA 2BUNA 3CO9A 3QLHA 2XMVA 4F4XA 4TN2A 4A8YA 4IOAQ 1C4CA 3MEDB 2JHEA 2PFDA 3JXOA 3U1MA 1DRZA 1TL7B 3H40A 2BDPA 2CPFA 1FWKA 3KNGA 4TLQA 4NZ0A 3GCWP 4ITSA 2MDAA 1HMVB 3D4JA 1HBUB 2DH9A 1LWXA 4RUHA 3MPVA 2VG5A 1NK5A 2XMKA 3W66A 2IFXA 4DU7A 5J2PB 3IO1A 3KK2A 1J2VA 3RAQA 1APSA 3CWJA 1S0OA 2FLLA 2WTFA 4MKVA 3M2UB 4M8LA 2GIQA 4LT6A 2YH0A 2XULA 1QUVA 2DNPA 1SC4B 2X7IA 3QO9B 2RS8A 1SH3A 1VBZA 1R89A 1XMBA 2Z56B 1YBTA 4P73A 3M30A 3OR2A 4ED8A 3V6KA 1RT6A 1N5YA 2VOOA 1JNZB 1S1VA 5B0DA 4HI1A 3KDNA 1WKKA 1NBEB 4G1QB 1AT1B 4QW8A 2RD5C 4DUYJ 2CPJA 5DQGA 2ZVIA 3UR3C 2Y1JA 1GTHA 3P4UB 4RW7B 1FRKA 2IY5B 3OUYB 2XS5A 2A0FB 1Q16B 4OHVA 5E3PA 2HURA 4WXOA 2YNFA 3BQ0A 4KH1B 1SXLA 4AQYJ 2XC9A 1PGZA 4FDFA 3RZAA 2GIFA 2RQ4A 2E9ZA 1BQNB 2HFSA 4TVAB 3J7Z5 2BM0A 3K57A 2GVZA 3FMBA 2WK4A 4NLPA 2IPOB 4CLFA 1YVFA 1U48A 3KLIA 4CYUA 2HHVA 4M5HA 3V6JA 4PWUA 1MSWD 1TU0B 1Y5NB 3FCVA 4R8UB 2CJQA 1Q5VA 1MNEA 4XAKA 2ZBRA 3THTA 4ZHRA 2GAHC 4N76A 1W7WA 2UVRA 5KFYA 4NRUA 2AKWB 3MM9B 1HNXF 1F60B 4ZN3A 4K4VA 1NPRA 2DGQA 1MMDA 2ZNZA 4WYWA 4LBHA 5F8HA 1N32J 1FRIA 2XMTA 2CIMA 3BBCA 4O3QA 2VU5A 5C2GA 1TZ0A 1IKYA 1AW0A 1RTJA 4U9RA 3EGWB 4LSZB 4JI3J 1T05A 2O3DA 3N0VA 3NKYA 1GX6A 3QSYB 2K1RA 1U0HA 5LOQA 3X3UA 4USUA 1UVMA 4TYBA 4Y2MA 2L08A 3EGZA 3DCAA 3QFHA 1EQMA 1VHFA 4FYDA 2HQCA 5SUHA 1JIHA 1IKVB 3BPDA 5A8KB 3HSJA 1PSDA 2FVCA 3BR9A 1R8BA 3CJQA 4RU9A 4DCJB 4RLEA 4WFNQ 4C3LA 3PXGa 1VR6A 2GGPB 4IKAA 1OYEA 3LGNA 3KG4A 2RSQA 4FZVA 5AXLA 4KAIA 3MD3A 1VRUB 1FRLA 2WCXA 2PDAA 5AXKA 1C1BB 3GMGA 3KDOA 3LF0A 1HW9A 4ZVSB 4K0KF 1WI8A 1ZAVA 3L7PA 3H7HB 1FDDA 2DNZA 1JJ2R 1FWLA 3H4BA 2MKHA 3IR7B 2OIHA 2R8IA 5K20B 2DD8S 2FVQA 1U1MA 1KONA 2ZEJA 3C6TA 4C8YA 3HT3A 5KFOA 4ECWA 3I5BA 2VICA 2HBRB 2ASDA 3PTWA 3MI7X 3HSZA 5D0RA 1WD6A 5BYRA 2OKQA 1U47A 2MHEA 2HQDA 3CCMS 2NREA 3TA2A 5CAAA 2HQ3A 3GG1A 1NHVA 2BE2A 3NS7B 4CCHA 5GADU 5KT5A 2HNDA 3M8QB 2F65A 4FXVA 5HLFA 2M9KA 2KT3A 4UZCA 3KHLA 4QWCA 1NJXA 2C3PA 1F3FA 2X3GA 2NS1B 3PO5A 4R5PA 2B43A 4LF7J 1M5VC 4IO1A 1OY8A 1WI6A 3KUGA 4NASA 1WKLA 5D3GA 3IAM9 4DSFA 2ASLA 4LUBA 3VGUA 2YY3A 3DGPA 5KFSA 2F3JA 5GMDA 5HI7A 5K8PA 4DL3A 3NNHA 3PYGA 2E5HA 2BYCA 3BBBA 4OZLA 4OHWA 2KJVA 2EG2A 1NK4A 6AT1B 2AGQA 4C6AA 2L9NA 4ZN1A 1NKEA 1Z2ZA 1HNXJ 2K7KA 2MYFA 3OHAA 2CJYB 4D3GA 2OSRA 4A48A 2DO0A 3MCSA 2EFQA 2JOQA 2OPPA 3HLUA 1RAGB 4USIA 1NZAA 4DFPA 2YVSA 2F5GA 3DLKB 1T11A 2XNRA 3T3FA 2HS4A 2KG1A 3SFUA 3J7YU 2ROEA 4YR3A 3RRGA 4Z7YA 3W9IA 5E0OA 5LSLA 1WSRA 4EEYA 1H72C 4HVZA 3R9LA 4YEAA 2LVWA 1UWBB 1WHWA 2IM2A 5F8GA 3NWRA 4G1PA 4NLDA 3K2YA 4PXDA 4FS1A 1SCJB 4QU6A 2YQ1A 4TKTA 5L1JA 3JSBA 2C3OA 2HVDA 2NR0A 2GW8A 2CVIA 3OBIA 5U47A 4DR4F 5KT3A 1YRUA 4DEZA 3NNAA 5ETKA 2HRTA 2M2BA 4DF8A 4CZCA 3L4BC 4B9LA 3GONA 3BPSP 4DPUA 4CT8A 2DITA 1X4HA 4HDHA 3RR8A 3HXMA 1H6KX 2YWGA 4RW9A 3H4DA 5GAHU 3NS5A 1TK5A 4EU0A 2IYIA 1WG1A 2E7VA 2HPUA 4L3NA 2XYPB 2RT3A 4K0KJ 2UXBJ 4TLRA 4IYQA 1RT1B 2C2EA 1UJ5A 2OEMA 1HWUA 1RKJA 3MM6B 4QR1A 3HFVA 3ZNJ1 5T14A 3A3OB 4L6V3 4OYZA 3IP0A 3C66A 1S97A 5A2QY 4F4WA 1VQOS 4XPCA 1JLBA 3RBXA 3H5YA 4PG5A 4DFKA 4USWA 4RNOA 5K14B 3OR1A 3CC2S 2LEBA 2E1PA 2DH8A 4PEOA 2P2CB 2OLWA 4P6QA 3HM9A 3BSNA 2B8PA 4CM2A 1NPKA 4OI3A 3OLAA 2XO6A 3IBFB 3GYGA 2VFSA 4ECQA 1TR0A 3DI6B 5F8NA 1RA6A 3JTOA 1FEHA 3M05A 4FKYA 1Y7PA 3HVTB 1XJWB 1N48A 2YWFA 3ZZUA 1Q95G 1XERA 5KFNA 1HNZF 1ACMB 4USHA 3AB2B 1SQFA 4GMKA 2R7SA 1RISA 4A8QA 3MTKA 3I87A 3MMBA 3QRRA 3W8PA 2HRUA 3FVYA 1KN6A 3RTVA 5THWA 1WTFA 2JEIA 4UQGA 1TQLA 2FLNA 1KLNA 2W9AA 3KJNB 1IWAA 3FBFA 3CC7S 2MZSA 4X65J 4WPAA 3LWMA 1GX5A 1HBUA 3DRPB 8ATCB 4OV1A 5BYSA 3MPYA 3TUJC 3QIPB 4AL7A 4PQAA 2DHGA 5L8RC 1V5VA 2VV5A 4ECVA 4PYDA 3GILA 2P8IA 2ZUGA 1FF2A 3QATA 4DBQA 4CH1A 1VQYA 3QO9A 3VV2B 3KK1B 3UVJA 2BANB 4AXJA 1VRTB 3QGGA 3H20A 3R7SB 3DXBA 3M6VA 2V8PA 1XIQA 4DX5A 3EJMA 2O1PA 4FVCA 2CJXB 1HR0F 1R31A 2R2UA 2BX6A 2UV8A 2XSJB 4DR4J 2LMIA 1YTYA 4RBVA 4RW7A 2GNKA 4CTAB 3FMWA 1R27B 4JI2F 3E8OA 2DO4A 3P8BB 3GFHA 2HWIA 5JVGQ 4RW8B 1RWWB 2N4CA 1F5AA 4ZPWR 2V6AA 6FD1A 1S1WA 4FPRA 5HQMA 2OH2A 3RGIA 2BRKA 1IUJA 1RTIB 5I3UB 2UUBF 2ZH2A 2AJ4A 5DZ7A 1TAQA 2N82B 3R6GB 2V8GA 1GK8A 5ETTA 2RU9A 3C6UB 2DJWA 5ETOA 2Z4PA 4L73A 2BEFA 2HS3A 2VG6B 4NLYA 4R8UA 1X4CA 3GPAA 1Q78A 3SBMA 1VIOA 2QC3A 2R2SA 5CD4A 3C15B 3CJ8A 3MEGB 3GE9A 4CO5A 1LOUA 2CDQA 2J0SD 3C14A 2EFPA 4JBCA 3I82A 2KFNA 2R4FA 4DR6F 2X51A 2MGZA 4DL5A 1NMEB 2QYGA 1D9FA 2KYXA 3J81j 4OI2A 4HEA9 2FY8A 2RDJA 1SJ4P 2HLUA 3GFYA 4FNIA 1Y10A 3ISNC 2PO4A 4P2SA 1HNZJ 4KV8B 3LTOA 1MN7A 2NXJA 1KC8T 1S9FA 3P45B 4DF4A 4M5IA 4K5SA 1HHSA 1ZTTA 1AB8A 2MKSA 1U6ZA 5IT9U 2MJUA 4KT0C 5BXIA 4QCLA 1S6QB 2GGPA 1TV6B 2HMIA 1S7HA 3OTDA 2LECA 5B0FA 1ZM2A 1VRUA 2JC0A 1DTQA 1KHWA 3M8ZA 2MZTA 2A6MA 4LSLB 4NMLA 1C1BA 2GQCA 2R7XA 4DS4A 3LALA 1RWVB 1BGXT 2WHOA 5M2PA 3OFFA 3TA0A 1KTVA 2H1YA 2KYZA 2CNLB 3DLLQ 1U8WA 4MAKA 3ZZZA 2XI3A 1T03B 3RW6A 3DC2A 4ES2A 1CG2A 3AOCA 2D3OR 1OSDA 4LVOP 1Q1KA 3D0IE 2VPXB 3B54A 4QZVB 2RUSA 1BQMB 3AHPA 2JJ4D 1NSPA 3TO8A 2OMLA 2D9OA 2ZHOA 2QO3A 4JV5F 5HJYA 2KKHA 3GV8B 1C0UB 2J5AA 1Y0HA 2AGPA 2FJDB 1CJKB 2E66A 1ZTWA 4LFBF 1MWQA 4DR3F 2V5HG 1HR0J 4A8KA 4CLTA 3M8SA 3DM2B 2F8MA 3OTCA 4NL5A 3P3DA 4UTGA 2X3DA 3CULA 2R7QA 1PC4A 3T1HF 4JI2J 1HQUB 4PPDA 3A4TA 3H2UB 3I31A 4RBUA 1IBMJ 1HD1A 2PA8D 4CLWA 3OL8A 3PACA 1S6OA 3GLJA 2APOA 3I55S 3Q8RB 4J9RA 2HWHA 3MGJA 3BREA 2J9CA 2UUBJ 4MK9A 2LU1A 5KFEA 4HH1A 1WJ9A 1OYDA 4F4AA 1DTTB 1S6PB 4ANEA 1ZZFA 4OIXA 2OEJA 1EJ7L 1RAAB 2QRRA 3OFHA 3EXCX 1B7YB 1FXRA 3Q2SC 1WTBA 4ELVA 4N7TA 2B9XA 4ECSA 1SV5A 3NWGA 3U02A 4M5DA 4FBUA 4QWDA 3KJVA 1Q82T 1RHKB 4DQPA 3TUIC 4KFBB 3SCLE 4NYZA 5C25B 2KFYA 2W2OP 4H4OA 5KFKA 3BYRA 1RTHA 2KXHA 4F7VA 5F8IA 2K2PA 1JLQB 4KHRA 2KZZA 3HD2A 4QW9A 4ZP6A 3LAMA 4DR6J 2YX7A 2QLXA 4N8NA 4JOUA 4OYOA 3TJ8A 4DOZA 4OI6A 1S4EA 1TL3B 4PQUB 1VJQA 5JXSA 3J7ZT 2B4UA 5F9NA 1UPPA 4IOBA 2E9TA 1KRPA 5DQIA 5L9NA 2XYGB 3TARA 5IT0A 2NSCA 3M8RA 1VQNS 4DR2F 3AJDA 1HNWF 1KLMB 2IMOA 2FHKA 1UEVA 3NMAA 4NCGB 3FQKA 5HVHA 3JTNA 2VA3A 3AH6A 3D67A 3QZ8A 1ULRA 4I67A 4O4GB 4ZCLA 1Y00A 3AD8C 4Z2XA 1GQEA 1N34F 1AA1B 1V3SA 1VRQC 2IDLA 4JI7F 1REGX 3D6HB 5ITHA 2NXEA 2XCAA 3PR4A 4ZIWA 4DQRA 2VBYA 1B0TA 3MM6A 3I9V9 5D15A 3BR8A 4EYHB 3HK2A 4L72B 2AJ2A 2LQ9A 4JI0F 4EBEA 3R5GA 5E3CA 2DVIA 4XDDA 4J5OA 5A8WA 4OI1A 1FDAA 1RXOB 1TL1A 4JB8B 2AYGA 2RRAA 3TA1A 1TKZA 4J91A 2EFOA 1YRTA 4YHHF 1NXIA 3BDPA 3NOGA 1HBMA 3QWPA 1UFKA 1RHJB 2OPSB 1X5SA 1X4EA 4Q43A 4LFBJ 1WDDA 4DR3J 1Q86T 3TR5A 4F02A 3G96A 4X4UA 3I0RA 2R9LA 4TY8A 4CQ1A 1D3WA 1QDUB 3PRBA 3T1HJ 3MPWA 2ZM6F 3N5FA 1QE1B 1KVKA 2J9EA 4L75A 1EB0A 3OJUA 2VASA 2DB1A 2GHPA 2ZOGA 1X5OA 3BGRB 5HMYA 3CMAS 1XR7A 3HF5A 4CO4A 3KK3A 3NAIA 1BY9A 1C2PA 4NI2A 3V4IA 2LXIA 3M2RA 2VD3A 2FHJD 1Q8BA 1GH8A 1VC6A 2ZH3A 1FKOB 1FXLA 3BGOP 3AODA 3GG0A 1G7CB 3T6BA 3RJMB 3DOLB 3W62A 4OYXA 2VFTA 5DZ6A 4NE9C 1TFYA 3KHRA 2LFVA 3D68A 1VIXA 3ZTSA 4ZVUB 1A7GE 1XNQF 1Q0NA 1CS4B 1A9NB 4BLGA 4NPOA 2X1GA 3QIPA 1ZM3A 2NYHA 3B4MA 3R1HA 4DR1J 2WONB 3TZWA 3GFXA 1LFWA 5L46A 2DT9A 3K59A 1AROP 1KDNA 2GS8A 4K4WA 1SUQB 2CNKB 1F9FA 1MWYA 2RS2A 2AF6A 4C8OA 3W5YA 4F4ZA 2B6AA 5IOLA 5C24A 4RW6A 2WVEA 4DPWA 5FD1A 1N0VC 1P8GA 2FD2A 5C42B 3HDSA 3KLHB 1VRTA 4OYWA 4DQQA 2FJEB 5AXMA 5DDPC 2WW4A 5I42A 4WZQA 2L41A 1K8AT 2MZ1A 5D4NA 3W8GA 2R8GA 4K4UA 4X4RA 4OZ0A 3T1AA 1O8BA 3M2VA 1I5OB 2RUGA 4CTAA 4DR2J 5HVFA 1HNWJ 4ECRA 3EPGA 1CJUB 1RCOB 3CCTA 3NL0A 2HEKA 2FY1A 4GKKF 1TUGB 2NPIA 2Q43A 2HRYA 2RRNA 1NZ8A 5CXTA 2CA9A 1UEKA 1RTIA 5I3UA 4EK2A 5DG9A 2XMAA 5D78A 1MW7A 3TAQA 1N34J 3AT1B 1HI0P 4DSJA 2YTCA 1WC0A 4I4BA 3PW5A 2ZHBA 2CQPA 4JI7J 2BRLA 4F3OA 2BJDA 1N5QA 3ZFVA 2E1AA 1KWMA 2VG6A 3D66A 4P9SA 4B17A 3DRRB 3CJ3A 2K3KA 4J9NA 1YKWA 2WZ1A 2V2QA 4JI0J 1JX4A 3OTEA 1FK9B 4CO3A 1YJ9S 2W2MP 2JLFA 3OVAA 4K5RA 2H4WB 4GVLA 5KFJA 2R8KA 1UL3A 4YHHJ 1D9DA 2OJ3A 3AXKA 3CO0P 2M7SA 1O6XA 2XY6A 1WEXA 1OJ4A 2QLFB 3D3BJ 3FUYA 4TQRA 2Y1RI 2AEJA 2DISA 3P49B 1G3OA 2ZM6J 2V4JB 2ZH9A 4PWDB 3RW7A 1VC0A 4KKOA 4KV8A 2BXJA 1L3UA 1UETA 2XCPA 3B78A 4V19J 2KHCA 3HPOA 2IRYA 1TKDA 2XWXA 4E98A 2RMLA 4DPOA 4A46A 4OYAA 4LF5F 3R27A 1S6QA 4C2MA 1TV6A 2HQFA 4GKJF 3PX4A 3MUVP 2IA6A 1T3OA 4M5GA 3WIVA 5F8LA 2D41A 3NEKA 5DETA 1WNEA 2CPHA 4ILRA 1YJRA 4U6PA 2M4MA 4FYVB 3U1NA 1S57A 2DNQA 5KFPA 3KLVA 1WORA 1CC8A 1R0AB 3I0SB 3DKDA 3CTRA 3DOKB 4LF6F 3RYLA 1XNQJ 1ZBTA 5CYMB 1EIYB 4D3HA 3LP0A 2GJ2A 1HD0A 5IXUA 3CD5A 2OPQA 1LW2B 4HH0A 1RZMA 2DNGA 2EKNA 3CJ2A 1F6TA 5KG7A 4A8SA 1TK0A 1WSVA 1S4FA 3JTPA 1BQMA 3VAHA 4F0KA 3A13A 3SQOP 1SJQA 4C11A 1JLFB 1YJUA 3KYLA 2RKIB 1C4AA 2AD9A 1XBWA 1SJFA 3T6JA 4FP9A 3QGHA 1RP5A 2C3MA 2VONA 1HWJA 1RWKB 4ED6A 2CJBA 4J9KA 3OVBA 2RVJA 1VGYA 4G3IA 1PJ6A 1MLAA 2DR7A 1SJ3P 2UVUA 3EZUA 3IGVA 2ILZA 1BHNA 3HHLD 2MJNA 4P71A 2OTLS 3BEGB 1GFWB 2JWNA 3IM9A 4O0IA 2B4PA 4M95A 3LA0A 3MR5A 1WHYA 3D0GE 1NUEA 6FDRA 4NLWA 2IMWP 2J6SA 3HVRA 2CQ0A 2AJ0A 1S6PA 2A2DA 3J7A1 4G6VB 3GIMA 1S1TB 2OHDA 3BF4A 5EUHA 2NYIA 3PNIA 2V2ZA 1VQ5S 4WP8A 4I2QB 1HQEB 2YWWA 2G13A 2BV3A 1NCLA 1MWZA 2UZAA 2DHSA 5JJBA 1JJHA 4YB1P 1UVKA 1JWWA 3M6UA 5J1PA 1YG0A 1X9SA 1F2GA 4X62F 4AT1B 4P2MA 2EC0A 3LOUA 2GCFA 2KRRA 2RF2A 1HWLA 2UUTA 4FF4A 1LW0A 5J2NB 1PAEX 2Q6CA 4H4MB 1TL3A 3IWLA 3TNVA 4PQUA 2W7PA 1RT2A 3O6QA 4ICLA 2N3LA 2ZZTA 2Q3PA 2HWTA 2M5YA 2FQQB 3PG9A 2XNQA 2DK2A 4J9QA 3TAMB 5HJXA 1T9TA 2LXFA 4HDGA 2OI2A 4ZLNA 2MLXA 4JI6F 2XZDB 5DQHA 3PM9A 3A12A 4V19X 1RHRB 4PXBA 2MLZA 2GAGC 2QN6B 1FJEB 5KT6A 3QT7A 5CABA 4C3MA 2CZVC 2YX1A 1VYAA 2VZ9A 3FCHA 1V3RA 4TYAA 2L9DA 1M5OC 4LF6J 5AE1A 2F9JA 4FYWB 3CPWR 2KU7A 1VLOA 1B4SA 4NMXA 3MM7A 1FFSB 4B3OB 3AXMA 1S6UA 3IRXA 4LQ9A 1S1UA 2BBEA 3GTYX 2DGUA 3QFWA 2PD1A 3CD0A 4CLKA 4ANCA 2EKYA 3AQPA 1HYSB 4KJIA 4DV3F 4QWBA 1DQ9A 4U67Q 1Q7LB 2PI4A 2YKNA 2CZ9A 2F63A 4I0WA 3UDLA 1DURA 1UEUA 3LGHA 2ABYA 4KPYA 1LWEB 4F2RA 2Y8WA 1EP4B 2RQCA 2DIUA 2LEAA 3OFEA 2DNLA 3IG1A 1DZ5A 4E2FB 2AYEA 2LCWA 4P7TA 4KGKA 1DQ8A 3PEJA 4OLPA 1S10A 2DNKA 4K2JA 5HK4A 3QJLA 4K59A 4KGVB 3QAEA 3ITHB 5CD4H 4QJVA 5GAEI 1T9VA 4DV2F 3N6NA 1YJWS 2RDIA 5EX0A 5LSOA 2HFOA 3F41A 2G1HA 1FKOA 2XI2A 4AXIA 1P1TA 3KG1A 2DXDA 2VPWB 2F4VJ 3D54A 1NLKL 1JLAB 1U1RA 3DOLA 5LMNF 3KLFB 1RT7B 3R6LB 1UVJA 2K06A 4ETXA 4ZPBA 3DFEA 4MMOA 4W98A 1NO8A 1CS4A 3TOQA 3Q86A 3O3LA 3J7AN 3VGSA 4QWEA 3ILLA 4ZPCA 3HULA 2JLEA 1N52B 2WONA 2CRLA 4X62J 4O3SA 5KFGA 3CC4S 2N3OA 4TXSA 2CWKA 1SUQA 4UUWA 4USTA 3LH2S 2D9PA 4QIFA 4PCQA 2KM8B 3I32A 3MUMP 5D0HA 3W2WA 1Z4UA 1L3SA 2V94A 5ETMA 2ZH5A 4XK8C 2GA7A 2MY7A 3HZGA 3N01A 3SEOA 3D2WA 1CC7A 2E29A 3Q24A 4W4MA 1NKCA 3AY0A 2AGOA 2FVPA 3FEZA 3Q8SB 3FK4A 2FJBB 3TX8A 2MLYA 1BLUA 3MM8A 2DPJA 1R8CA 4DQSA 2YKMA 3ILJA 2DGVA 1KD1T 2DGWA 3WQPA 5A0YB 4IG0B 4MIBA 1Y11A 2H3EB 1AZSB 2Y8YA 2XYHB 5HBMA 4CO1A 5AXNA 2QMUB 3DLJA 5IQQA 3FFIB 3FRYA 2CQGA 1VDHA 4JI4F 2PIIA 1U49A 3Q8YA 4A47A 1VOMA 3CJKB 2VOPA 3RBEA 1X31C 1HWKA 3S01A 4A8XA 1FE0A 4FYXB 4HACB 2KO1A 4LFCF 3UE2A 4DV3J 3DLEB 2KZMA 1S5ZA 1BXNA 3W65A 3TVKA 2IC3A 5H9EK 4OX9F 4NLVA 2QMWA 2VHGA 2CG8A 1T3NA 2YWKA 4RU2A 1WF0A 2F7VA 2MQPA 3V6DB 5E3RA 3N6MA 4PWDA 1DLOA 3RBZA 3P5TL 3K17A 2Z30B 2FLPA 2CKWA 1KOHA 2OD6A 2YNIA 1QSLA 4ZJOA 2MY8A 1GXLA 1GMWD 4DCOB 1TKXB 2YXLA 2D1CA 1KQKA 3MFIA 5LSRA 4DV2J 4I6WA 3AA9A 2EK6A 1HBNB 4U7UK 5EHHA 2ACMA 2DIVA 2O67A 2ACYA 4J9SA 3Q22A 2RILA 2FGOA 5LMNJ 3BKFA 3Q83A 2H5IB 4DR7F 3NS6A 2DR9A 1R0AA 1VQLS 4ZJLA 1OY6A 3SSSA 2B0GA 4NLSA 4PG7A 4AYBD 4RNNA 2LA6A 4OX7A 3ET6B 3ZO7A 4K4ZA 2F8HA 5B0BA 3JSRA 3A1YG 2XMUA 2BOPA 3CMQA 3HZEA 4KHMA 3BS9A 2JEGA 3LP1B 1T9UA 3H8YA 1MROB 3OTBA 4YFUA 4UOHA 1RT4A 4ZKAA 2EK1A 1WOPA 3CCQS 2YNGB 4Q44A 1X9MA 4DX6A 3W61A 2IHR1 2WBMA 2W9CB 5GADI 3G8TA 3R5AA 5HQ8A 3NGRA 1O5JA 4WU3A 4B3SF 1IKWB 5AE2A 1FDNA 4JV2A 4KB7A 3IBCB 1K44A 3DOMB 2VIHA 1PYOB 2CQIA 2O01C 3JAMU 4CIOA 1HARA 4IR9A 2KG0A 2NCKL 1N6QA 3H5XA 3UD5A 4OX8A 2XHWA 1Q8LA 2IAJB 4HR2A 4WFBQ 2G0JA 3K58A 4JI4J 2ZE2B 1VQ6S 2X1AA 4FYYB 5KFVA 2P9GA 1HIYA 4DN9A 2HNYA 1YJVA 1FTRA 4R0JA 2Z8QA 2ZH1A 1HQEA 1RA7A 3HP6A 4LFCJ 3UCGA 2MKCA 3FBBA 1UA0A 1ZM4A 4DR5F 1S59A 4LVNP 4OX9J 3G8QA 2COLA 2XSFA 3MPUB 2WVDA 3V5RA 3T5JA 3OL9A 4C48A 4MIAA 1FJGF 2VDIA 1RJJA 2YQ0A 1S0NA 2W25A 3HKWA 4C8NA 1GEHA 2JEFA 2IRXA 3DDKA 1IBLF 3RBDA 3AD9C 3NCRA 4QR0A 3DLGB 3QYYA 2MQLA 3CVKA 2Z58B 3TYTA 4XIUA 2C2ZB 4DG1B 3VF0B 5DGAA 4ZJQA 2VFVA 5CQGA 3TAMA 2KT5A 1NDCA 4N5SA 2J0WA 3P6YC 3QGIA 3HI9A 1LV5A 4I69A 3EVMA 2ZDPA 3GR0A 1Q79A 2FJAB 1REVA 3MXHP 1TELA 4KHPF 3S8SA 1HPZB 3JS9A 3BSOA 1AYEA 3DRSB 3BKTA 1W26A 4DR7J 1NHUA 3RG6A 4IO9Q 1Q8KA 3EZOA 3LUYA 5JUMA 2Q79A 1H98A 5GAHI 1NJZA 2ZJPQ 3R2DJ 4NYPA 3LPEA 2PC6A 3NGDA 5IZHA 2OPRB 1R3NA 3QRQA 4XO0A 2V4RA 3TRGA 3MAAB 4I7FB 2WB1D 5AT1B 2V9KA 4C4WA 5MAOA 3IN5A 4KE5A 1U24A 1U1OA 2FDNA 4P74A 2IVMA 5H1SV 2M88A 3ZTOA 5LM7E 4E8UA 3PKMA 5CYQA 1FRMA 3IXQA 4F04B 4BWMA 3W1YC 3MFHA 4Y2IA 4DX7A 3CW2C 4IH7A 5B0AA 3VZIA 2POKA 3GR1A 3AB4B 4O44B 2CFXA 3VAMA 2RQMA 3T9ZA 1FKAF 1NB2A 4WCEQ 3ULHA 2BACA 5GMKa 3PIPQ 3SV3A 1T7PA 1FEEA 3UFCX 3C8YA 2V8HA 2BKOA 3FSYA 1S1XB 2FVSA 4B3SJ 4RUAA 1C1CB 2JRSA 3BB5A 3I4HX 2LQBA 5L39A 2CPIA 1NSQA 3KMSA 3ZC4A 3QQCD 4PPZA 1NK7A 2W8LA 1WELA 2DNRA 1Q53A 3SCJE 1UVIA 3BBFA 4W90B 5KG2A 2B56A 1JLEA 4BC7A 1JLAA 4OL8A 3GIKA 3V4MA 2M3DA 2NZ4A 4GC7A 1FNMA 1JMTA 3GP9A 4ZCMA 4F26A 2OELA 3DDNA 1RAOA 1EX8A 4YR2A 1UTAA 4O0NA 2QYCA 3MCOA 3JQJA 4DR5J 3ZZ0A 1NH8A 4PG4A 4CLLA 1U0SA 5H9EJ 2DYAA 3KKFA 4O3NA 1CEZA 1R6YA 1FJGJ 4QIEA 4R0EA 4LSNA 4B3TF 2SXLA 2ZBCA 3W64A 2LQ5A 1IBLJ 3Q8VA 2I6WA 4DL4A 3OQ2A 3IBWA 3RB0A 3M8PB 2NLWA 2KM8C 3H42A 1L3TA 5IFMA 3HJFA 2P6SA 2A10A 5T41A 2KT2A 1WC1A 3PHEA 2HKEA 5J2MB 3S7RA 2JSXA 1FRXA 2E1RA 1NK9A 4NRTA 2PN6A 4OI4A 3D6MB 1GNKA 1T9WA 3SFGA 3EMTA 4OHXA 4PAAA 1KHVA 2Y0BB 3PZPA 2R8HA 2Y1LB 3MPDA 4KHPJ 5A0YA 1AZSA 3CSKA 1HNIB 1E6YB 3A8JA 2ALYB 3FSIA 4FS2A 4CLPA 2IJFA 3W60A 1H7XA 3SSQA 1LK5A 2Y0SD 3K5LA 3FGVA 3KWMA 1U6BA 4ELUA 2DNHA 1QSSA 5CA5A 1TUVA 1I94F 4JI5F 4KC5A 4X4SA 4H54A 3VGVA 3WBZA 2DPIA 4PKDB 2AIRB 2ZJQQ 1I3OB 2W2QP 3OT9A 1PBAA 9ATCB 2KFZA 1WDTA 1K1SA 2ZBIA 1C0TB 4UT4A 4BS2A 5KFTA 3TQ1A 1ZM9A 4M5MA 2XGQA 2PMWA 2FIUA 1VQ8S 4R25A 2J7UA 4CLYA 4ID5A 1Q5YA 1E6VB 1JLGB 4LF7F 1UJ6A 4IFVA 1FKPA 3V6DA 1CJVA 5EDWA 1FD8A 4IRKA 1RB0A 5FDLA 2BJ8A 1FVQA 5DGBA 1BQXA 1H3DA 3SIPB 3X1LB 2GZOA 4DCPB 1TKXA 2JLGA 1N5TA 4KQZA 4OHYA 1CULA 3LGMA 4YQWA 1QTMA 4M1KA 1ROFA 4NLUA 1HQ2A 5D4OA 4GRSA 2UUCF 2ZUAA 2JL9A 1FD2A 2FB0A 3I9ZA 4YR0A 4DSEA 2K7JA 4Y3CA 4ZVFA 2BABA 2Q66A 1FCAA 3FJ2A 2GIRA 4F50A 5HO4A 2RB7A 1FX4A 2VL1A 1SC3B 3QJPA 5ETVA 3Q8UA 4LJMA 3HX9A 3V2UC 1F5CA 1IJEB 3EDRB 2KTQA 1R8AA 1N54B 1YLXA 2HFUA 1XMQF 2OP5A 5KFXA 3SV4A 4B3TJ 2MQMA 3D0HE 3VVUA 2MQNA 3ETMA 1HA1A 3FC9A 3A8EA 4CP5A 3MMCB 2XMWA 2VF3A 3SDEB 1KR4A 3MM5B 3UO0A 1LWFA 4UOGA 2H9ZA 4DPXA 2BJ3A 2W9CA 3IC1A 3CCSS 2ADCA 4B9UA 1KQGB 2UXBF 1VQ4S 3AFGA 2G9OA 4PABA 4FF1A 2VG7B 3F44A 4C8ZA 2X1FA 2JNJA 4HTIA 5T7LB 1WUUA 3DOMA 1CJTA 2ZKTA 2V2VA 1FDBA 4CLSA 3CXCR 4YOEA 2V4QA 3DLHA 4Q0BB 2GQQA 3KG0A 1AUDA 1FI4A 2R7WA 3PO4A 2IAJA 2VB6A 2ZE2A 5DS7A 2HAIA 3ILOA 2XLKA 1I94J 4JI5J 5HAOA 3P5BP 4B3MF 3R8YA 5LL6d 4CDIA 5RUBA 2QV6A 1O0PA 1JXEA 3G82B 3QBCA 3GV7B 4LMZA 4NCAA 1K9MT 2HGMA 3UD4P 3NGSA 5DG8A 3TVYA 4EI2A 4KO0A 2D3O1 1D09B 1V5IB 1BE4A 3N6LA 4ED0A 2DHXA 2UVWA 4DWIA 1FVSA 4ES3A 1HWIA 4QOTA 1B0PA 1ZA1B 5L9XA 1VMBA 2J76E 2K3IA 3KLEB 2MQ8A 3CE8A 1IQTA 4X4PA 4DUZJ 4OJ1A 4ZS6A 3DLGA 3ISND 4HKQA 3GSDA 1S9GB 1IKXB 4DG1A 3H25A 3QLHB 3CDWA 4LF4F 5ETSA 5KFQA 3ZZOA 4P7VA 2FC8A 4KGXB 4X65F 2BR0A 2HGNA 3W2VB 4Y00A 2BZ2A 1N36F 3PHTA 1M1GA 2Y9HA 4ECZA 1LWCB 2VG5B 2ZH8A 2C28A 3GU0A 2UUCJ 1RAEB 4OZ3A 3DRSA 2KRBA 3CJSA 3KK2B 4DV6F 5B0CA 3HVAA 2H65B 4P75A 5IT9Y 4I56A 1Z1ZA 3PW0A 2OPRA 3M6WA 1ZA2B 3DYAA 3BJYA 4B9TA 3OXLA 2CADA 4WXWA 3MAAA 3QT5A 5HMZA 4I7FA 1FERA 3JYTA 2DR8A 5DLFA 1NNDA 1ZPWX 3I5CA 3CGIA 2IJNA 3OR2B 1U26A 1RT6B 3U27A 3K5PA 1XMQJ 3KMQA 4LRFA 1S1VB 5LT5A 1JLCB 4QWAA 2D74B 3G9CA 2EW9A 2D7SA 3K0JA 4ECXA 4IDKA 4TQSA 2QG9B 1X4GA 5KG0A 2F8EX 5KT2A 1KEKA 2HQIA 4ZIVA 2HAFA 5F9LA 5A6PA 1FFGB 4UW2A 2YNFB 5IQ6A 3V81B 2GO9A 2XS2A 4U8VA 2F40A 2VBZA 4K4XA 5HMXA 2FVRA 1HHQA 1S9EA 5BJRA 4NOHA 1EHWA 1TVRA 1C1CA 1RLDA 2ZH7A 3BKUA 2GVZB 1IR0A 4B3RF 2ZITA 3VAFA 2Y3YA 1ZAXA 1RWOB 3KLIB 4CYUB 3CDAA 4KR0B 3UDEA 2QSFA 1BWVA 3TUPA 5KFWA 1YBAA 5BR8J 4NEYA 2BM1A 5D4LA 4TNOA 2E9RX 3W9JA 5DDQC 3T5KA 2RU3A 1GAOA 1JKHB 4ZP7A 2NSBA 4J37A 4X64F 4B3MJ 2B7CB 3TZYA 2GHWA 4URGA 3ZXWA 2ZH4A 3GJTB 2I2YA 2BKNA 2QT7A 4RUBA 3PJ9A 1TKTA 4CLZA 1IKYB 4CO2A 1T05B 1RLCL 4WFZA 1FRHA 4TY9A 1H0HB 1YSJA 2ZKUA 2HG4A 4F0MA 2UUWA 1J5OB 3PFOA 3NY0A 1FRJA 5A76A 2HBQB 3M8PA 2KDOA 1U4BA 3D9BA 1WWHA 3E3XA 4OI0A 4M5LA 3MEDA 1TL7A 2IVFB 4LF4J 3ZNUA 3M9MB 1UA1A 2C2NA 1HMVA 4HHJA 1N36J 1XWLA 1EKSA 3ZZTA 1YJTA 2CQCA 5J2PA 4WZMA 3TZXA 2XWYA 2VODA 2DBBA 3M2UA 2CQDA 4DV6J 1X0PA 2OSQA 5FLXU 1CSJA 3AJ1A 4ZA1A 5LXRA 2AHOB 3OXFA 3C6TB 4MK8A 4ECYA 1XC9A 3BV8A 2NXUA 2O5DA 1X7VA 4P72A 2PEBA 4B9NA 3RUBL 2BJ7A 1TP7A 2YPZA 3BQ1A 4ERDA 2ZH6A 4U7UD 4G1QA 1JK9B 2IYGA 1QAJA 4EYIB 2LEPA 2NUHA 1SL2A 2NXCA 2J9DA 4F36A 3TI0A 2MB0B 4QU7A 2AYMA 2HNDB 3OUYA 4IH5A 1TUWA 2DXEA 4ZVGA 1IBMF 1G6BA 4FPIA 3W7BA
chains in the Genus database with same CATH topology
2B4VA 3MM7A 1E6VA 1PSDA 2FVCA 3BR9A 4B3OB 1R8BA 4RU9A 1JLGA 1S6UA 1KTQA 3HHEA 3IRXA 4EO6A 3RB4A 2DNMA 2WB4A 4RLEA 4LQ9A 4HLBA 3PW2A 4WFNQ 4NWBA 4C3LA 2JEJA 1S1UA 2BBEA 3D1HA 3PXGa 3UQSA 1SB6A 1BQNA 2GGPB 4WIIA 1KQFB 2DGUA 1RTDA 4IKAA 3LGNA 3KG4A 2PD1A 2RSQA 4FZVA 3CD0A 5A6WA 3BZQA 1NAQA 1V9OA 5AXLA 2EKYA 3AQPA 4KAIA 5A8RA 4DFMA 2QEXS 3AAWB 1HYSB 2DNYA 3MD3A 1VRUB 4KJIA 1FRLA 2WCXA 4Q5VA 4QWBA 1DQ9A 4DV3F 5D3GB 4U67Q 1Q7LB 5DLGA 2PI4A 2PDAA 5J2NA 2YKNA 4H4MA 5AXKA 2I8EA 3O1LA 1C1BB 3GMGA 3N28A 4I0WA 3LF0A 3W2WB 4DS5A 3UDLA 1ZPVA 1DURA 1UEUA 4UQTA 4OJHA 2AWZA 2ABYA 1SIZA 3IS9A 5KG5A 3HFKA 1B7FA 1HW9A 3BO3A 1VK8A 4KPYA 4K0KF 4GC6A 1LWEB 2HHPA 4F2RA 1WI8A 1ZAVA 3UD3P 1EP4B 3L7PA 2UP1A 1FDDA 2DNZA 1JJ2R 2RQCA 3MM9A 3H4BA 2GC8A 5CCLA 2VKZG 2DIUA 2LEAA 2MKHA 2VFRA 3IR7B 4QPXA 2OIHA 2J9DE 1XR5A 2EFNA 7FDRA 3OFEA 2DNLA 3FDSA 3IG1A 4WE1B 1DZ5A 4K4SA 2MZJA 2R8IA 2DD8S 3MTJA 2AYEA 2LCWA 2FVQA 4P7TA 1RQ0A 4KGKA 1DQ8A 4TU7A 1U1MA 1KONA 3PEJA 3C6TA 4C8YA 4OLPA 3LANA 2QZ8A 1S10A 3TAPA 3HT3A 4QQBA 3ONQA 5KFOA 4RKUC 2DNKA 5KAKA 3FZ2A 3IR6B 3EPIA 4ECWA 3I5BA 1T95A 3SYZA 4ELTA 3CCVS 2IM0A 2OPPB 1HNVB 2ASDA 1SI9A 3B4DA 3MI7X 3POTB 3QJLA 4K59A 3K5NA 3CMES 3QAEA 5LJ3Y 5FJ4A 4PR6A 1WD6A 3ITHB 5BYRA 3PW4A 1G2EA 3NGKA 2OFHX 4HL9A 2JX2A 5CD4H 4O4RA 2OKQA 1U47A 2MHEA 3MM8B 2XZWA 1K0VA 3LW5C 1RT3A 3WZ0A 4DDFA 5DDRC 3CCMS 2NREA 4QJVA 5GAEI 4DV7F 2C42A 4ZPVR 5BYQA 3TA2A 4O3OA 2YKMB 4DV2F 1M90T 3N6NA 1YJWS 2HQ3A 3GG1A 1NHVA 2IBOA 2QA2A 2BE2A 2RDIA 5GVQA 4OQJA 5EX0A 5LSOA 4CCHA 4IUFA 5KG6A 3L7OA 5GADU 1T8EA 2HFOA 4EO8A 3F41A 5HBMB 1FKOA 5KT5A 2XI2A 2HNDA 4AXIA 1P1TA 3KG1A 3M8QB 2VPWB 1S76D 1IKVA 2JVRA 3D54A 4HT7A 2QIFA 1JLAB 1U1RA 4NLQA 1S0VA 4FXVA 2V2KA 3SQGB 3VCDA 3DOLA 5A8KA 3RRKA 1GTEA 2XLJA 3KLFB 5LMNF 2M9KA 5HLFA 1RT7B 1HI1A 2IVYA 2KT3A 1UVJA 1PILA 4ETXA 4B3OA 4ZPBA 3DFEA 3GIJA 4QWCA 3KHLA 1NJXA 2C3PA 4KSEB 4MMOA 5HN0A 1N56A 1W25A 5KFUA 2X3GA 2NS1B 3PO5A 4B9SA 1UP1A 4R5PA 1NO8A 1Q4RA 2B43A 3IFEA 2ROPA 3JSMB 3TOQA 3O3LA 3SI8A 5E2QA 4DJBA 4QWEA 2BQ3A 1M5VC 4IO1A 5HROA 4ZPCA 1RWUA 2ASJA 2JLEA 3WC2A 4PG6A 3SDEA 1N52B 2WONA 2UV8G 1WI6A 3MM5A 2CRLA 2DTJA 1HYSA 4O3SA 2M70A 5KG3A 5KFGA 4JI8F 2B51A 3CC4S 2JH3A 5KG4A 3HHLB 1SKWA 5D3GA 4I64A 3IAM9 4TXSA 4UUWA 1SUQA 2N3OA 4DSFA 2ASLA 3LH2S 2D9PA 4LUBA 3G86A 4QIFA 4PCQA 2YY3A 4QIGA 2KM8B 3I32A 3DGPA 3MUMP 3W2WA 4RW9B 4J9OA 2XGPA 1Z4UA 5D6GA 5G0RB 3UDCA 1XMOF 3L09A 5KFSA 2F3JA 1L3SA 2V94A 3QWUA 5K8PA 5HI7A 4DL3A 1LWEA 3NNHA 2QA1A 2E5HA 2BYCA 4OZLA 4F3MA 2VG7A 2IC3B 4OHWA 1EP4A 2KJVA 2ZHAA 2EG2A 1NK4A 2ZH5A 2ZDOA 4XK8C 2AGQA 2GA7A 1VC5A 2MY7A 3HZGA 3IR5B 3N01A 2CQBA 2L9NA 3SEOA 3D2WA 2BQRA 1CC7A 1NKEA 1Z2ZA 5B0EA 1MMNA 2OFGX 2DRBA 2K7KA 2E29A 2MYFA 2FHMA 3OHAA 3Q24A 4D3GA 2OSRA 4Q0BA 4A48A 1NKCA 4BDPA 2DO0A 2C2RA 3AY0A 2EFQA 3MCSA 4ZP8A 2AGOA 2FVPA 2JOQA 4C0OC 1CLFA 2OPPA 3FEZA 3HLUA 2QA4G 4USIA 2V9WA 3I5AA 3Q8SB 1DLOB 2XG8A 1NZAA 4M63A 4DFPA 3HO1A 1KSPA 1SL0A 2YVSA 3PRDA 2FJBB 2YKPA 3DLKB 3ITHA 3TX8A 3U7JA 2XNRA 1BLUA 1VQMS 3T3FA 1K0TA 2HS4A 2KG1A 1N4LA 3MM8A 3SFUA 2DPJA 2YNIB 3J7YU 1R8CA 1L3KA 3MOZA 2ROEA 4YR3A 3JSYA 4QPTA 3RRGA 1UKUA 4DQSA 5E0OA 2YKMA 3MURP 5LSLA 4DL7A 5EWEA 1N88A 4EEYA 2DGVA 2E5JA 2DGWA 2E44A 1KD1T 2AJ1A 3MR3A 1ZAWA 2XEXA 4HVZA 5A0YB 4IG0B 4MIBA 4YEAA 5KFDA 1XK8A 2LVWA 3OTOF 1UWBB 3I6PA 4DV0F 1WHWA 2YQ3A 2IM2A 4Y6IA 3LWLA 1D1UA 5HBMA 4CO1A 3M8QA 5AXNA 5F8GA 1JNRB 3L95X 3MD1A 3FQLA 4G1PA 3BO2A 3C3LA 4NLDA 3K2YA 4PXDA 3BO4A 2R7RA 4RBTA 4FS1A 1NK0A 3KLFA 3DU5A 4QU6A 3GB0A 1RT7A 4TKTA 5L1JA 3JSBA 2C3OA 2PE8A 3DMJA 3M9OB 5EWFA 3SCKE 5GAGI 5B0GA 3DLJA 4MYUA 5IQQA 4BCAA 2GW8A 4U7CA 2NR0A 2CVIA 3FFIB 3OBIA 3P96A 5U47A 4MIWA 2CQHA 1LXNA 3FRYA 2CQGA 4DR4F 3K5OA 2PIIA 5KT3A 1U49A 4JI4F 1YRUA 4A47A 1FT8A 4DEZA 3OJSA 5L38A 3NNAA 3WC0A 1VOMA 2UUAF 3CJKB 2VOPA 2I0XA 2M2BA 3CCZA 3QMQA 4O23A 4DF8A 4IFYB 3RBEA 4CZCA 2WOMA 4NYOA 1EETB 1HWKA 4A8FA 4B9LA 3NBPB 4X66F 4BBYA 2UU9F 4CT8A 3N5BA 2DITA 3S01A 5J1EA 4A8XA 1FE0A 1X4HA 2CJ9A 4HDHA 2GO8A 4DV5F 3HXMA 3RR8A 2HFZA 1H6KX 2KO1A 2YWGA 1AFJA 3PKYA 4LFCF 3UE2A 1SH2A 3BGFA 4RW9A 3H4DA 1URNA 2MXYA 4DV1F 3M6XA 3MMBB 5GAHU 3DLEB 3NS5A 1TK5A 2DNNA 2KZMA 3Q2TC 5HL7Q 4EU0A 2IYIA 1YITS 1WG1A 2P6TA 2HPUA 3TVKA 2IC3A 2C22A 4L3NA 1IBKF 2RT3A 4OX9F 4NLVA 4J9LA 2QMWA 4TLRA 2DGXA 4IYQA 4ED1A 2B5JA 1RT1B 5HMWA 2C2EA 1U25A 1UJ5A 1T3NA 3GYNA 3W2VA 2AX0A 2YWKA 5E3QA 1HWUA 1RKJA 4IH6A 3MM6B 4QR1A 4YMEA 3WDOA 4X2BA 5F41A 5T14A 4L6V3 5KTQA 4RU2A 1WF0A 2F7VA 1LWCA 2P9EA 3UCZP 1RT4B 2MQPA 4KTQA 3V6DB 1SBRA 3C66A 3MAHA 5E3RA 3EYZA 1S97A 4DR1F 1OS5A 5A2QY 3N6MA 4PWDA 1DLOA 2KHDA 1U45A 4FF3A 2EI5A 4F4WA 3TUZC 1RKIA 3CCUS 1VQOS 3VTIA 4XPCA 1JLBA 3DLKA 1ZOTA 2QMXA 1UAWA 3P5TL 4PG5A 4C7QA 2W7AA 3H5YA 4DFKA 2FLPA 4RNOA 3BSAA 2CKWA 1S49A 1KOHA 2OD6A 2YNIA 5K14B 5F8MA 1QSLA 1BWEA 3OR1A 1X4DA 3Q0AA 5AE3A 3CC2S 4A8OA 2MY8A 1GXLA 4DL0C 2LEBA 1SKRA 2DH8A 2OLWA 4P6QA 5L1KA 3G71S 2U1AA 1SH0A 2MZRA 3QJJA 1TKXB 2HLTA 4MFBB 2D1CA 4IG0A 2PEHA 1KQKA 4WF9Q 3HM9A 1UWBA 3MFIA 2AJQA 5LSRA 3BSNA 4I6WA 3AA9A 2EK6A 1HBNB 4U7UK 5EHHA 2DIVA 1VS3A 4OI3A 3OLAA 4ZPAA 3U1LA 2O67A 2ACYA 2HHWA 1HI8A 2VFSA 4J9SA 4ECQA 1TR0A 3DI6B 4A4JA 1Q81T 3O2IA 3Q22A 1N0UA 5F8NA 1RA6A 3BSCA 4A8WA 4I1TA 2PSZA 2ZVSA 3G6VA 3TP2A 1BC6A 3JTOA 1FEHA 1HW8A 2RILA 3M05A 1JLCA 3FFIA 2FGOA 1M5KC 4NCBA 2VA2A 5DRKA 3GV5B 1Y7PA 3HVTB 1P1LA 2JC1A 3MECB 1N6QB 1N48A 2YWFA 3NS6A 3ZZUA 4DR7F 1WHVA 1P27B 1RK8A 1XERA 4C98A 3CJKA 5KFNA 2DR9A 4DLEA 4IOCQ 1R0AA 1HNZF 2HHXA 4A8MP 3LQVA 4X84A 3O44A 2N7YA 2HHUA 1VQLS 2AX1A 4USHA 3AB2B 5IM0A 2YNHA 4GMKA 2DH7A 2HNYB 3SSSA 2B0GA 4NLSA 4PG7A 5E5NA 4AYBD 4CH0S 2R7SA 1RISA 4RNNA 1L3VA 4A8QA 2LA6A 3T1YF 4OX7A 1NRKA 4MKYA 1XN9A 3MTKA 2EVZA 4K4ZA 1HBOA 3RB3A 3V81A 3I87A 2F8HA 3MMBA 3DLEA 4PUOB 1YGYA 2HIQA 2R7VA 2HRUA 1NJYA 3FVYA 2RNEA 1KN6A 5B0BA 1XEZA 3JSRA 5THWA 3RTVA 1S1WB 2L9WA 4USJC 2Z2MA 1WTFA 3A1YG 2JEIA 4UQGA 5M2RA 1TQLA 2XMUA 2BOPA 1VBYA 2XLIA 3VZHA 4K2XA 2FLNA 3HZEA 4KHMA 3K5MA 2U2FA 1KLNA 4Z37A 2W9AA 4CO0A 1RT1A 2RJZA 2MPUA 3CC7S 3B82A 3IWXA 3M9NB 3BS9A 2LQJA 1YRXA 2FHJA 2MZSA 5B08A 2XB2D 3NMRA 2Y1IA 5FIIA 2HS0A 4QIVA 1U1QA 1N8RT 4B9MA 3ENQA 3I96A 2JEGA 3UW1A 3LWMA 1GX5A 1HHTP 1HBUA 2ZOFA 5LJ5Y 3LP1B 5J2QB 3CD6S 3H8YA 1MROB 3OTBA 4YFUA 1RT4A 2HNZB 3ZZRA 2YH1A 3DRPB 2GMLA 2J7WA 4ZKAA 4OV1A 2EFVA 4Q2MA 2PMHA 2EK1A 3MPYA 4NZ6A 5BYSA 3CCQS 3PX0A 3TUJC 3QIPB 2YNGB 3LO3A 4Q44A 4AL7A 1FNOA 3NCQA 3SSRA 4DUZF 4PQAA 1X9MA 2DHGA 2RE1A 5L8RC 3MEEB 2VV5A 1Z2LA 4ECVA 1G1XA 1JKHA 4DN0A 4YY3F 2IHR1 5K14A 2WBMA 2W9CB 5GADI 3KHHA 5LMUF 4ZK7M 3G8TA 1YIJS 3W3SA 3R5AA 1OSCA 4X4TA 3GILA 2ZUGA 4HTJA 1N5SA 1CVJA 1FF2A 5HQ8A 2CYYA 4DBQA 3OL7A 4CH1A 1O5JA 1VQYA 3QO9A 3PX6A 4WU3A 1M0SA 4B3SF 1Y4ZB 2UXCF 2HVIA 1HBNA 1IKWB 4OJGA 5H9FJ 5AE2A 3UWTA 4IRDA 4JYAF 3G6ES 2B3TB 3KK1B 3CEDA 1SIWB 1PC5A 4TU8A 3CB4A 2BANB 1FDNA 4AXJA 2DGTA 1VRTB 1WEZA 3DI6A 3QGGA 1X4BA 3M32A 2E7WA 4KB7A 3OFGA 4RNFA 1VQ7S 4JV1A 1KNZA 5E41A 3H20A 3MOJB 3H5SA 5D77A 4MKBA 3DXBA 2CQIA 2O01C 1BD6A 3M6VA 4RW4B 2MGZB 3CIMA 4CIOA 1HARA 4IR9A 2KG0A 1FTCA 1H2VZ 1REVB 3MMAB 4CNYA 1ZZNA 3HVTA 3J80Y 2O1PA 1N6QA 4FVCA 3H5XA 1N33F 2EG1A 1HR0F 1HL6A 5D4PA 1R31A 2CVEA 4OX8A 4XPEA 2NUUG 2R2UA 2XHWA 3D1OA 2HW3A 2UV8A 1Q8LA 2XSJB 1DQAA 2GQ2A 2IAJB 4WFBQ 3K58A 2LMIA 2ZE2B 4B08A 1UFLA 2FJXA 1YTYA 1VQ6S 2HHHF 4WFAQ 1F0XA 4RBVA 2X1AA 4RW7A 5KFVA 2GNKA 4CTAB 2P9GA 4DN9A 2HNYA 4J9MA 1J5OA 2KXFA 3FMWA 1R27B 1YJVA 3M1VA 4JI2F 1FTRA 3E8OA 2DO4A 4R0JA 5EX3A 3GFHA 4Q45A 2HWIA 2Z8QA 2JDJA 2ZC3A 5JVGQ 4RW8B 2ZH1A 1HQEA 1GT8A 1XTZA 2N4CA 1F5AA 2MZQA 3FZBA 4RUCA 2WW8A 1RA7A 3OSPA 1FHTA 4ZPWR 6FD1A 1SJ1A 2MSTA 1S1WA 3HP6A 4NXMF 4FPRA 3UCGA 3D1QA 2H5EA 4ZLPA 2MKCA 4HI2A 4KRWA 2OH2A 2BRKA 4ETZA 1UA0A 1IUJA 1ZM4A 1RTIB 5I3UB 3MR2A 4F25A 2UUBF 4RWWA 2ZH2A 4DR5F 4LVNP 2HMIB 2AJ4A 1TAQA 2N82B 4BC9A 2OO4A 4I2PA 3CDEA 3G8QA 1U1NA 2V8GA 1SL1A 2WSEC 2COLA 2XSFA 3PJXA 1S48A 2EBEA 2K8GA 3CJ4A 3V5RA 2RU9A 3C6UB 5CYQB 3T5JA 1S0MA 4N77A