3AB4B

Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
157
Chain Sequence
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of concerted inhibition of {alpha}2{beta}2-type heterooligomeric aspartate kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
molecule keywords Aspartokinase
total genus 35
structure length 157
sequence length 160
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01842 ACT ACT domain
B PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ab4B01
2RQMA 3OFFA 1PSDA 2DTJA 5IS2A 3MWBA 3MAHA 2QMXA 2QSWA 3IXQA 2J0WA 2RQKA 4IO1A 3TUJC 1KS2A 3ENVA 2CDQA 3NRBA 4GO7X 3LUYA 2FGCA 3CEDA 3K5PA 3AB4B 1YBAA 3IBWA 2H9ZA 2RE1A 1UJ4A 2LQJA 3DDNA 1XTZA 2DT9A 3OFGA 2P9CA 1Y7PA 4GO5X 2P9EA 3KWMA 3ENWA 1LKZA 1UJ5A 4LUBA 1M0SA 2NYIA 3MTJA 3OBIA 4PWUA 1YGYA 3AAWB 2I9SA 3DC2A 2J0XA 3S1TA 3DHXA 3UW1A 2JOQA 1LK5A 1O8BA 2QMWA 2F8MA 3OFHA 2PA3A 3LOUA 3N0VA 3OFEA 2KO1A 2LVWA 5IT4A 2PC6A 5FIIA 3W7BA 4X84A 3TUIC 4M8LA 2MDAA 5IT0A 3TUZC 3AB2B 1RWUA 3HHEA 4GMKA 2QRRA 1U8SA 5JJBA 3DHWC 1ZPVA 1LK7A 5T41A 1SC6A 2F1FA 2ZHOA 4NMLA 2P9GA 3O1LA 3L7OA 3P96A 3ENQA 1UJ6A 2JHEA 3U7JA
chains in the Genus database with same CATH superfamily
3CCJS 3ILOA 4DOZA 1PYSB 5CYMA 5A8WB 5D3GA 4XDCA 2A6OA 4NPOA 1RKIA 7AT1B 2EG2A 2MLZA 3Q86A 3KTQA 1IKWB 3N6LA 3MM5A 3AFGA 2WBRA 2FUG9 3VWSA 2QSWA 1KQFB 4V19J 3IXQA 4RNMA 1RTHA 1R31A 1YSJA 2ASYA 2XG8A 3DMJA 3IC1A 3J81U 4LF8J 4KHPJ 1S1XA 5BJRA 1L3UA 1DQ9A 2XMJA 3JYTB 1EAYC 3JTOA 4KFBA 3TZWA 1KS2A 5M2UA 2BJ8A 4LRDA 4G6VB 3RB3A 4N41A 4WP3A 3RG6A 1BQNB 1SB6A 4GVLA 2YNIA 2HHVA 3G82A 2N7CA 1CS4B 5J2NA 1XR7A 2CAJA 3IWLA 4P7VA 1JLQB 5A8RB 3AY0A 1GTHA 5J2PB 4ECUA 5T7LA 3M8ZA 1R0BG 1P6TA 2N4DA 3HFZB 3D9BA 1NB2A 3FEXB 3VAMA 1MMLA 5J1NA 3KHGA 2BKPA 4KGMA 2AYMA 4IH6A 2AKWB 3LP1B 4KB7A 2ZUAA 3OW2R 4JI8J 1APSA 3MMAA 4ES2A 1B99A 4X4QA 2C3MA 3BSOA 2ADCA 1N54B 2YKNA 4NI2B 3ENAA 5KOXA 3BO4A 4TY8A 2RB7A 3NBPA 3QWUA 4G1QA 3MI7X 1WD6A 2ZOGA 1ZA1B 4PWWA 4EGLA 4JI3J 2NZCA 1R7IA 4HHHA 4CO0A 4U67Q 4X4PA 3PIPQ 4CO4A 4HLBA 5CXTA 1RTJA 2QN6B 3SCIE 1N32F 5CCMA 1ACMB 1YWXA 1KR4A 3ENWA 3MZIA 3S7RA 7FD1A 4WP9A 2ZH7A 2CVEA 3VAFA 3SZ2A 3LO3A 4ED2A 1VQPS 2BR0A 1S0OA 4JI0J 3F0NA 3PNIA 5J2QA 3ADAC 1R6VA 4FF1A 1IM4A 3K57A 3T1AA 4TLQA 4I2QB 2WW8A 3GCWP 1FJGF 4ZVSB 1WI6A 1UA1A 2ADBA 4B3RJ 2YKMA 1GXTA 1WG1A 3FEZA 4XK8C 5HMXA 4UUWA 2I9SA 1RT2B 4R5PA 3J7A1 4OFZA 2CZ9A 3I5BA 3DGPB 4MK7A 1HL6A 4QW9A 4QYZJ 1HNVB 2AP6A 4Y6IA 4ZVPB 3QGHA 3CC7S 2QMWA 4ED0A 1VK3A 4DQQA 5IT9Y 2F8MA 2GIRA 2KRRA 2IPOB 1RT6A 5CYMB 4RUCA 2DH7A 2GJIA 5B08A 3T41A 3OUYA 1IR2A 1NKBA 2VA2A 3HHNB 5HP1B 1FO1A 1P8GA 3R5GA 3SYZA 3PACA 1NM2A 4F36A 4XPCA 1L3TA 4DV7J 4C8ZA 2HYIB 4LF2A 4LSLA 4EUVA 4GKKF 2MEWA 1ZAWA 3DGVA 2FC8A 4QIFA 4J9UE 1V3RA 1HQUB 5HI7A 4DSFA 4PXCA 2IM0A 3D3BJ 3D54A 3R7BB 4HEA9 4ED7A 3ZZTA 4RX6A 1H2VZ 2HLUA 4WFNQ 5DQIA 5ETQA 4LR8A 3FZBA 1ZPWX 3BR8A 3MMBB 3G96A 3W66A 1VQLS 4F2SA 3DI6A 3C19A 4OLPA 2J9CA 4I2PB 1HNIA 4ZHRA 1E6VB 2E1RA 1IQTA 5CAAA 3SFUA 1RAHB 2VFTA 2V8DA 4CO2A 2GS8A 1J5OB 2IBKA 1E6YB 1RABB 2P9GA 1B3TA 4Q0BA 2ASJA 1X0FA 1C0UB 3IA0A 1H7XA 3LANA 1RACB 3DOKB 4RJVA 3DLEA 4J90A 2HFUA 4D3GA 3C15B 2K1RB 3T9ZA 3M7VA 1BQXA 5KAKA 3UWTA 4TY8B 3JTNA 3ELHA 1H72C 4CO1A 1NK9A 2D3O1 1OYDA 4HHJA 2NYHA 4I2PA 4PG5A 3MM7B 2N3LA 2CPEA 1R89A 2E7VA 3TQ1A 1SJ4P 1R8BA 4DG1A 5EHHA 1XMOJ 2CPJA 1S1UA 3L09A 5KFBA 1AUSL 4RW7A 4R8UA 4FF2A 1RI7A 2AU0A 1UL3A 2KH9A 3M30B 4CLFA 2ZBIA 3M6XA 3ZTQA 3G82B 2MZRA 5C7PA 2IYGA 5HSPA 2N82B 4DLGA 2KTQA 2X7IA 4NEYA 4J91A 4K59A 5T7LB 4DV4F 1QDUB 1EQMA 3HVWA 2XSFA 3ENVA 4DEZA 1QUPA 5JMNA 1NK0A 1S57A 2XZWA 2EWHA 4CRJA 2AJ4A 4CYUA 4WFBQ 3VTIA 4DV0F 1VC5A 1X5PA 4MFBA 1KQKA 1A6LA 4M5JA 1V6HA 2JC1A 3THPA 2HWIA 1R0AB 2FGCA 3MFHA 3R5BA 4LBPA 4P6QA 4M5DB 3SCJE 1YBAA 3IBWA 2R7RA 1NJIT 1EP4B 3DDKA 3BBCA 4ZPVR 5CCLA 4LFCF 3J81j 3C16A 4DV3J 3VGTA 1KLNA 2LEPA 1CJVA 2DNMA 3FJ2A 3MR2A 4B17A 1T9YA 1DHMA 2PFFB 2ZM6J 1ZAVA 2BBEA 3RBZA 5GMEA 2Q3PA 2BXJA 1TQLA 3KK2A 5D78A 3HXMA 3H2LA 3UR3C 1D0EA 2LXIA 2RD5C 1SJ1A 3DM2A 2G2ZA 3QQCD 2Q43A 5KFFA 1X60A 2VB6A 1JJ4A 2BJEA 2PEHA 3AJ1A 1TMJA 1VRQC 2F7VA 5CHCB 3PHTA 2YKNB 4NLOA 3CCQS 2G1HA 2QFJA 1SUQA 1SV5A 2QA4G 4E98A 1G7CB 3M6UA 4ES1A 2OFGX 2QT7A 2W2MP 4Q2LA 4J37A 1IQZA 5HQMA 2ABYA 2IVMA 2K3KA 5E5NA 3VR1A 4YY3J 5F8HA 4Q45A 1GH8A 2DH8A 3L3CA 4PCQA 1YJWS 5IQ6A 3HCXA 1FXDA 2O01C 2YY3A 1VBKA 5ETLA 5KFXA 2BX6A 5KFCA 3PX0A 5H9FK 3PM9A 2DCLA 3DRPA 1HBNB 2FC9A 3KMSA 3QATA 1D8YA 2DIVA 4FZVA 1O8BA 4USTA 3R6GB 2VPWB 3PYDA 4OX8A 4WFXA 4FYXB 3VVUA 4TQSA 5L1KA 3UVJB 2AZ3A 4A8OA 1CQMA 1WKLA 1S48A 2EVZA 4LQ9A 5C25B 3A12A 3SDEA 4X66J 4GVBB 2J5AA 4OI0A 1RHRB 2B9YA 4I67A 2E1PA 3AD7C 3KJVB 4WYLA 3V5RA 2APOA 2ILYA 3LPYA 3M1VA 3OXGA 4UY8T 2LECA 2DGTA 3BPSP 1VOMA 1SJQA 5KFVA 3HULA 4LRBA 2LXUA 2EFNA 1HLWA 3DLGA 2UUAF 1S1VB 2F40A 1VHIA 3HHEA 4FS1A 1MSWD 4M5KA 1RAIB 1XIQA 2B7BB 5JJBA 2ZNZA 3JTPA 2K1RA 4KSEB 3TRGA 3MM6A 3K59A 3HKZD 3S6EA 1JB0C 2AGPA 1NH7A 1FKPA 2GGPA 3SDEB 4ZPTR 1N5SA 1WOSA 3KG1A 5C2CA 2H4WB 2BE7D 2AJQA 1BWVA 3Q0AA 2R2TA 3AQPA 1D09B 1CC8A 2HVEA 1NJWA 4HHUA 4TLRA 2CA9A 2D74B 3MCOA 2BE2A 2Z56B 1M90T 2W24A 2ZBRA 4DR3F 5HAOA 1SQFA 4QW8A 2XQCA 3FCVA 5HVFA 3W3SA 2Q66A 1QTNB 4O0NA 4OV6A 3VGVA 2PMZD 1LWCB 4NLWA 3FK4A 1SH2A 2OD4A 2JC0A 2HFOA 2A1BA 2CPZA 2Z2ZA 3IS9A 3QSIA 4LIRA 4LFBJ 4Y2KA 2RS8A 5ETNA 2UVWA 1H98A 3SQOP 1WORA 4RLEA 4QZVB 2BM1A 3WIVA 4LF7J 2WRMA 3KG4A 3LTOA 2FLLA 1FRMA 3MD1A 1PCAA 2DGWA 4K0KJ 4KO0A 3Q8RB 2FZCB 2MLXA 1S6QA 4YS2A 1JLCA 4N8OA 5L1JA 1AA1B 2CNOB 4U7UD 2KVIA 2VG7A 4K5SA 1UPMB 2BJ9A 3BSAA 1VRTB 4WIIA 1VQ6S 5CZVA 4RW9B 1T8EA 4A8QA 4LF5F 2E7WA 1HBNA 2B4OA 1PKUA 3A3OB 3C14A 3DDIA 3JS9A 3NCPA 4GO7X 3DMJB 2NS1B 1UVMA 1S10A 2KXHA 5I3UA 3SSSA 4KGKA 4KTQA 1R3NA 1F9HA 1PIEA 4CLUA 4LRCA 1FXLA 4R5PB 1NK8A 3CB4A 5A6PA 2IBOA 1U7LA 4MK8A 2PDAA 1NMEB 2HQCA 2G4BA 4CCHA 1S4EA 5GAEU 4GC7A 4ANEA 5A8WA 1OO0B 1SI9A 4C0HA 1Q4RA 1C0TA 1U09A 1YLXA 2POKA 1IWGA 1CS4A 3MCMA 4PPDA 2C42A 4DV5J 4DL7A 3L9ZA 5D8HB 3H42A 1LV5A 2ROGA 3N6MA 1IBMF 1KLMB 1NPKA 3KLFA 5KT7A 3HSGA 1RYSA 1BLUA 1HI1A 1FVSA 3E01A 4MJKA 4EO8A 3CO9A 3NP5A 2XLJA 3BO3A 2VIHA 2R7TA 3NKYA 4C8NA 2K8GA 1UP1A 3DN9A 4M5GA 1JLEB 3CTRA 2KFNA 2VBZA 2XI3A 4RUHA 4LMZA 1IWAA 1B7FA 3K5NA 5F8NA 2XYPB 1VLYA 1D9AA 4B3MF 1H0HB 1Z2ZA 3RBXA 3WHIA 3ZC4A 4ED6A 4WTOB 1FE0A 1S1WB 2OPSA 3NS5A 4OYMA 4MKYA 3S1TA 2BRLA 2OIHA 2IMOA 1NZAA 2P6TA 2W9AA 4DFJA 4WCEQ 2U2FA 4FF4A 1X4CA 3CSKA 1Q7LB 1IJFB 3OT9A 1O0PA 2BKOA 4WU2A 1C0UA 3W9IA 4PPZA 1XQIA 3R8YA 3J80Y 5HLFB 2LU1A 2OPRA 2W4PA 3TARA 1M5PC 1BWEA 4PXBA 1WKJA 4K4WA 1FJGJ 1ZYQA 1N5VA 2UXCF 1NK6A 4K2XA 1QSSA 3Q2TC 3NMRA 2PT0A 2LLZA 2W4DA 3C8YA 4RW4B 3PEHA 5KG7A 4ZP8A 1KD1T 2R7XA 2YPZA 2RNEA 3LAKA 3PHEA 5J2MB 4KPYA 3GG1A 5DRKA 4DUZF 3QJLA 2CQCA 1M1HA 5IC4B 1RLCL 4DBQA 1GXLA 4J9OA 2UUCF 1DFDA 5IT0A 1YBUA 2DNLA 1JLBB 4USHA 4DDFA 3I55S 2UVVA 4WZMA 3AB2B 5HJYA 1S49A 1VRTA 3K7RA 3VF0B 3KLFB 2CG4A 3FRZA 3MFIA 4KAIA 3KHHA 3PX4A 1I94F 4YHHF 1NK5A 3I82A 2MY8A 3RW6A 2DJWA 5DQGA 2QEXS 1RK8A 2NSBA 5I42A 2FJVA 4UOFA 2DNQA 4NYZA 1GMWD 4C8MA 3HLUA 2OUGA 1OS5A 1RT6B 1NJZA 3SXLA 2HHSA 1RWVB 1VK8A 4YB1P 2VICA 3TAMA 3W5XA 2KG1A 2FHJD 4EWTA 2JVRA 4ETZA 2HNZB 2FZGB 2KJWA 3BGOP 3D4JA 4NWBA 4YB6A 5HK4A 3QJJA 2RH3A 1WACA 2FLPA 4C8OA 5GADI 3I56S 2M2BA 1N36J 5FLXU 4QWEA 1VYAA 2HHUA 2D7SA 2ZE2A 1UCNA 2XI2A 4A8YA 1WG5A 2ATCB 1MLAA 3G8QA 3S01A 5DG8A 1FJEB 2JJ4D 4HTIA 2OPQB 4USMA 3M8SA 3NNHA 5D6GA 1HW8A 1HNXJ 5B0AA 1U2FA 4JV0A 2K7JA 1HNWF 4ZJOA 1PAUB 1X5TA 1GMWA 5KG3A 1RHUB 3TZZA 5BR8J 2IY5B 2F4VF 4K4ZA 1IKXA 2BM0A 3FEYB 2P5VA 5D4LA 2GIFA 3NNCA 4J9SA 2I6WA 5BYQA 3ZTRA 3TJ8A 4U95A 5KFMA 3PJXA 4W92B 3NAHA 3CJKB 4FDFA 4ATNA 1XMBA 3Q8QB 4DUYF 4DQPA 4W98A 2VASA 2MKHA 2W7AA 2ZH9A 1UJ4A 2V94A 2Z0GA 4L72B 4UOCA 1AB8A 5D0RA 4B3MJ 4DL0C 5B09A 1Y0HA 2ZM6F 1YJRA 3DOKA 1JKHA 3UVJA 5KG6A 5E33A 3PKYA 1S9GA 3OFGA 5KFQA 4NXNJ 3GSDA 1LWEB 2IDLA 2HHQA 3D3CJ 2OPPB 1U1OA 2CPIA 2C2ZB 2MYFA 4YFUA 1HPZB 1M1GA 2V5HG 3D67A 4FXVA 3ILJA 4URSA 3U1LA 1ZETA 2H5EA 2B4UA 1WC5A 1HQ2A 3HHLB 4O0IA 1F5AA 2NXUA 1C2PA 1Q1KA 3GONA 3ZZOA 2C2EA 3VVTA 1U1LA 3A8EA 5U47A 3HVTB 3MTKA 3V4IA 2AYGA 2FJEB 1PC4A 3C14B 1YGYA 5GMDA 4EMDA 1K73T 2JSXA 3MOZA 3BKFA 2I8EA 4WWSA 4ECRA 3VQTA 2UXDF 2Y1JA 3G71S 3OTBA 3BYRA 1NPPA 5L1IA 4K8RA 1LWEA 2OSRA 4IO9Q 4Y2IA 1SC3B 2FZKB 4OZNA 1HD0A 2V8GA 3W9JA 4JV1A 1M1KT 3TQEA 2XY7A 1TUVA 1BC6A 4FVMA 2R7SA 3BQ1A 1C0TB 5ETOA 3N6NA 2I2YA 1M5KC 3JSMB 1MU2B 3JQKA 4RW6A 2VOPA 3MUTP 1JLBA 2QA2A 3MMCA 4OYZA 3A1YG 2YPYA 4LSNA 5G0RB 2LVWA 3C16B 4NEZA 4ZVUB 1HYSB 4ZCMA 2JLFA 3V4IB 5FIIA 4R8UB 5IM0B 1XEZA 1KVKA 1CJVB 1YJVA 1TK0A 4DV1J 3ISND 4X84A 2WK4A 3PEJA 3ITHB 3TUIC 1TAQA 4UZBA 1FNOA 4KH1B 4QWBA 1HIYA 3T5KA 2HFVA 2EW9A 4KGVB 5DDQC 3TANA 1HPZA 2V8PA 3GU0A 1NDKA 2KRBA 4BCAA 1QUVA 2C22A 2DR6A 4KHRA 2CZ4A 4IG0B 1EB0A 3PYFA 4DL3A 3QGIA 2H48B 4WXWA 4JP8A 4J9NA 4DSIA 4OYXA 1DTQA 2GAGC 4F0HA 3UR0A 1OPZA 4RW7B 3N4WA 3I5AA 1GFWB 1RAOA 2A3JA 3G6XA 2D1CA 3O1LA 1K0VA 3C3LA 1EHWA 3H59A 3P4UB 2V69A 4JBCA 4AT1B 2OO4A 3ZZYA 3MMAB 5HO4A 4PAAA 4U8YA 5EUHA 1QTMA 3H4DA 4JYAF 5IC6B 3DCAA 3KLEA 2DPIA 2HBZB 4MFBB 4WFZA 4DF4A 3BS9A 5LSRA 4CLKA 4JI8F 1FI4A 2MY7A 3G9CA 3MCNA 2DTJA 2C3OA 2GHPA 2VFRA 2E5JA 4J9MA 2BW7A 4MH8A 4QPXA 3MR3A 2ZZMA 3EVWA 2MQNA 1IBCB 1RWNB 3M8QB 1CJKA 3NOGA 3P3DA 4C3LA 1J5OA 4M5NA 4EZ6A 1T95A 2GQQA 3PJWA 2JLGA 4Q0BB 2WAQD 5B7WA 2QTWA 2W8LA 2RDJA 4TU8A 2W1BA 1OY6A 4ZDNA 3W65A 1HQEA 1RWPB 2KHDA 3DLLQ 1MN7A 2E5HA 3H0PA 1W7WA 2YQ1A 1WOOA 1WI8A 3TW0A 4QWAA 1ULRA 2IVYA 4ILLA 1N33F 4OI4A 3PX6A 4O4RA 4NLVA 5E3AA 1N32J 1Y3KA 5HMZA 3S8SA 2KYXA 1H2UX 2VF3A 2WONB 1AXQA 3UCZP 2DVIA 2Z2MA 4K7QA 2MTLA 2Z8QA 2XZTB 2CFXA 4Z7YA 4PXDA 1JXVA 2PMHA 2YX7A 4H4KC 5K8MA 3IAS9 3ETMA 4NA1A 2RHSB 2R9LA 1GT8A 2ZWPA 3VCDA 2AMCB 3DLKB 5IQQA 1LFPA 3L95X 2HHTA 2MHNA 2VDHA 4IDKA 4DL2A 1FX2A 2AGQA 2O5DA 1XC9A 3GIJA 1OJ4A 4HI1A 4C97A 2VQEJ 1MWYA 3DLGB 1KQSR 2YNFB 2KI2A 3RAXA 2UZAA 2COLA 1EJ7L 4HH0A 2PI4A 2HURA 3AA8A 1HI8A 2IAJA 4WF9Q 5L38A 1HBUA 1U26A 3EDRB 1P1TA 1BD6A 1DTQB 2W01A 4YR0A 5ETPA 1WC0A 2PFDA 1EKRA 3LP2A 2RF2A 3DOMA 4C11B 2ILZA 1HNZF 3I31A 1S5ZA 1FRKA 1YTYA 4K50A 3I0SB 2OPRB 3GFHA 4USUA 1BQMB 4K4XA 2RKIB 2R8JA 1Y5NB 3KYLA 1Q0NA 5ETKA 2WSEC 4D3HA 1SC1B 2FHOB 3OVBA 1QD1A 2AT1B 5E3PA 2L9WA 1ZTWA 4QIVA 5JVHQ 1Q81T 1JLFB 3ZTSA 2VG5B 3ZO7A 4C0BA 2CWXA 3EICA 4DCPB 4FS2A 3V81B 3J7AN 1W2IA 2YQ0A 4CM0A 3LWLA 3QGGA 1U1NA 4R0EA 1QY7A 2V2ZA 3GP9A 1RU2A 2HBYB 1HI0P 4JV2A 1FWPA 4NOHA 1W26A 1ZBTA 1RLDA 4ZIVA 2ZBPA 2EBGA 3IRXA 5KT4A 1Q5VA 3SV3A 4AD6A 1YI2S 2Y0BB 1RHKB 2ZKTA 2ZH6A 4IDKB 1WKKA 3GZ7A 2AX1A 2YVSA 3Q2SC 1RWUA 4U9RA 2E5LF 2FVRA 1I51B 1B70B 1TP7A 2VU5A 4FYVB 5LT5A 2V2VA 5GAHI 3QZ7A 4DQRA 1AW0A 2VUGA 3HVRA 1VQNS 1RP5A 5KFGA 3DLHA 1M5HA 1MROB 3US5A 2VD3A 3PG9A 2VKRA 2GNKA 3FNNA 3KJNB 2OTLS 2JLEA 3OL7A 5T41A 1IVZA 3EX7B 4XTTA 3ZZRA 3CCUS 2OELA 3VAGA 3KOAA 1VLOA 1RDRA 2U1AA 1VQ5S 5ETTA 1XMQF 1HBOB 3HKWA 1MU2A 4RW6B 4TQRA 1S72S 4H4OB 4HT5A 3P45B 2QE5A 1TV6B 1UJ6A 4LSNB 4UTGA 2W2QP 5H1SV 2ZUGA 1UWBA 1N5YB 1QAIA 4KQZA 2IHR1 3VZHA 5C42B 4MYTA 2CUYA 1NUEA 1FTRA 3CDAA 5E3RA 3LP0B 5DDRC 2XTJP 4HYKA 2NR0A 2IJRA 3X1LB 2QLWA 3GFYA 3MM8A 1S1TA 2LEAA 2RQKA 1YKWA 3MR7A 4M5HA 4CO3A 1JLGB 2MJUA 2MQLA 3EDQB 3M2RB 4AQYJ 2ASLA 4NXNF 1XNRF 3M32B 3CJ5A 4NL5A 2HGMA 2KT2A 3DOLB 3QO9B 1KOOA 2YH0A 5D4PA 1CG2A 3T6BA 3WX8A 2J8AA 3KUGA 2C1EB 4DU8A 5KFKA 3ONQA 4IFVA 1QAXA 3ZZUA 4E2FB 3AJ2A 2W8KA 3QZ8A 3KXDA 3I32A 4UF4A 4PR6A 2Y3YA 1UEUA 4DX5A 5H9EK 2AV5A 1CQNA 1KBRA 3I4PA 5K5MA 4RUAA 3IRWP 2ZH5A 4DR3J 4AL6A 4MTPA 1UVIA 3PFOA 4WFYA 1BY9A 2X51A 3K5PA 2ERRA 1EIYB 3RTVA 3HHLD 2C2DA 2H9ZA 4QYZK 4I1TA 4F4KA 1O6XA 2AJ2A 2QLBB 1RT4B 3L4BC 3HX9A 3JQJA 4H54A 4QR1A 3GIKA 2FIUA 2EI5A 3ETOA 1FDBA 4PABA 4WE1B 3CXCR 1EQ0A 1FTCA 1XTZA 2DT9A 2DYAA 2DHHA 2W2OP 3QMQA 5HVGA 2BOPA 3IGVA 4HVZA 3CCZA 2D9PA 3CIMA 2DNPA 1S1UB 2Z2LA 5AE2A 3RRKA 2FVSA 3PO5A 4DFKA 2B0GA 3R27A 5KT5A 4WTYA 4BLGA 1T02A 3CW2C 2V4QA 3PRVA 3Q22A 2GVDB 2HNDB 4F26A 4LFBF 1UJ5A 2KM8C 2SXLA 3KKFA 1NSQA 4A46A 2YWGA 5F0UA 4XO0A 1JNRB 5KFOA 2YWHA 2JH3A 3RJMB 1YIJS 2XNRA 3M8WA 2UXDJ 2YNIB 2JEGA 5AE3A 1FRIA 1U2CA 1BHNA 5KT2A 3K0JA 2HFZA 2B5JA 4FNHA 3UDCA 2KVQE 2ZD1B 5KFNA 3UD3P 3GJQB 2WONA 3R7NB 4B02A 1RWMB 2ZH4A 4LBIA 5L1LA 3KHRA 3G6YA 4M94A 3UO0A 3CJ0A 1FA0A 1SKSA 2YKPA 5CD4A 1VIXA 3CJ8A 4PG7A 4BHQA 3K58A 3H20A 4LVNP 3PFEA 3CVKA 2MZTA 2X1GA 5KFDA 1BUXA 4DSEA 3FVYA 1G1XA 2LA4A 3BGLA 4I0WA 5KT6A 3BV8A 2PA8D 1QAYA 4X4VA 2DR7A 3G8TA 5F8JA 1S99A 2BA9A 2ALZA 2LFVA 2Y1LB 2CDRB 3CMQA 3UE2A 3VZIA 4ILMA 1S7IA 5F41A 2A10A 3GTYX 2WVFA 5HJXA 5K14A 1QJHA 3IBFB 4H4KA 3CDBA 1RT1A 1TZ0A 1SBRA 1U6BA 1SCJB 1B4SA 5HP1A 3I87A 1HD1A 3TUZC 2CJAA 4TVAB 2L48A 1N4LA 4UZCA 3BF4A 4JI1F 5CYQB 5H9EJ 1EKSA 4JI6F 5F3ZA 2ZEJA 2KXFA 3DOMB 4I4BA 4PXEA 3CPWR 2VQFJ 3M4XA 3F41A 3Q24A 3ITHA 3BJYA 1Q8IA 2Q1LA 4H4OA 4F7VA 1ZPVA 4PG8A 5LXRA 3CD0A 2J6TA 3CULA 4PQUA 1UFKA 1YX2A 1IBLF 4X4NA 2NQPA 1GMUA 2HRTA 4DR4F 3KLHB 4X4SA 5CABA 4NCGB 4RW4A 4YHHJ 3F73A 1TKXA 3MM7A 4KYZA 5I4MA 5J2MA 1YJ9S 4LF9F 2H1YA 4P2SA 4MKAA 3R97A 2CPDA 5KG0A 2LA6A 2CPHA 3TP2A 1MROA 1DTTA 1F6TA 1K1SA 1OWXA 3D28A 4IKAA 1KC8T 1BE4A 1RSCA 1VMBA 2G0JA 3HHKA 3KDOA 1ROFA 4RW9A 4JUZA 2B7CB 4ES3A 2RHQB 3BM7A 4DUZJ 2HZVA 2FYXA 4LF6J 1XNQF 3G4SS 2MPUA 4ECZA 4B9LA 5E0OA 5FD1A 3HT0A 4EYIB 1NCLA 1HARA 4ZITA 1V3ZA 3V6DA 2BQRA 1LQ9A 1F0XA 3DRRA 3VQSA 3G6ES 3EGZA 1GEHA 1TV6A 2FY8A 1X8DA 2VFSA 4WXOA 4F0MA 3G2XA 4XDDA 3H2UB 3KLHA 3D6HB 5HVHA 1JX4A 4IQXA 2MZQA 4MKBA 1TKXB 1UFWA 2WSCC 1REVA 5LM7E 4XIUA 4DSJA 3GG0A 3TUJC 4YY3F 3KFWX 1NHUA 3A3NB 1DARA 1OSDA 2HWTA 3D1QA 3P5TL 4PYAA 3TAMB 3KK3B 1LWXA 2WW4A 3GJSB 1L5UA 1JMTA 1SUQB 1ZM2A 1JNZB 3OL9A 4X64J 1HWKA 3PRBA 1S6OA 2WOMA 1HNXF 4W90B 2PN6A 3W8PA 1KQGB 4C4WA 1RA7A 1FRLA 4BWMA 1KLMA 2ZKUA 3D6MB 1H6KX 5AXMA 5F9LA 2KM8B 4BWJA 1Y11A 1Z1ZA 1YITS 3TAQA 2ZVIA 2BUNA 2CG8A 2R8KA 2B9EA 2DNKA 2EKNA 1TVRB 2KL8A 4PKDB 3A8KA 5H9FJ 1RB0A 1L3VA 3GE9A 1VR6A 1HBUB 1DZ5A 1Y7PA 1RHQB 2DNNA 2BZ2A 2P9EA 1UVLA 2NREA 3CWJA 1TMMA 4DCOB 3FDSA 2V2QA 4LFAF 1XERA 4TYAA 1U49A 5EDWA 3H5SA 4F0KA 3KLGB 3Q83A 2QG9B 3NGKA 1U45A 1HMVA 2EC2A 3CJTA 3FCHA 1AZSB 2B51A 4QIWD 5AJ3J 4DPYA 3QT5A 2RILA 4G1PA 5HANA 3RB0A 2XS5A 3M8QA 4K4VA 2HQIA 4DFMA 1FD8A 4FPRA 5A0YB 3H8YA 4YP3A 4B9VA 4LQ3A 3UCGA 4IG3B 3PDNA 4DL6A 2BOAA 3DC2A 2YQ3A 4G65A 4ECSA 3OJSA 3FSIA 3VALA 2WBMA 4G1QB 3SFGA 2M9KA 3T6JA 4Y00A 4J9RA 3RAMA 1HNIB 1YJNS 4RNFA 2HHHF 2VKZG 4OJ3A 1JWWA 3BSCA 5C5JA 2M4MA 4ECQA 2LQ5A 2CWKA 3ICLA 3GV5B 3DLBA 2BQUA 1KWMA 1F9EB 2QLXA 4USWA 1WC4A 4FYDA 2OMOA 4ZPDA 2V8HA 2UXCJ 5DS7A 2P8IA 4ZKAA 4P9SA 1S6PA 3WIUA 1JK9B 4PG6A 2JX2A 5IFMA 1HR0J 9ATCB 1U02A 2DPJA 3LP0A 1VJQA 1Z2LA 4DR1J 2GGPB 4DPOA 3Q8PB 1IBLJ 4KH0B 2DRBA 4B3TJ 1EETA 1TTHB 4ZP9A 4OHXA 1IN0A 3HHLC 2MQPA 2CQ1A 1N6QB 4OYIA 5IWAJ 2DK2A 2FVCA 3M32A 1KHVA 2XM3A 1RAEB 5KFUA 2EKYA 3VAJA 1FNMA 4O44B 1QVFR 2HQDA 2M88A 3MM5B 3CIZA 4NLXA 2AW0A 3GJRB 4NMXA 4OX7A 2LU2A 3R6LB 2HPUA 2ZHOA 1GNKA 3CJSA 5KOWA 3KLIB 4Q43A 2ZJRQ 1HYSA 3BSNA 2DXFA 2LKZA 4OI3A 2J7UA 3AXKA 3D5MA 3JSYA 3W9HA 2HBRB 2MXYA 2EFGA 4RWWA 1R8HA 2KDOA 3DRRB 3ZXWA 1M5SA 3HDSA 3W5ZA 3OR1A 5G4DA 2IA0A 5LMNJ 3PZPA 1BQNA 2CQ2A 4JYAJ 4Y3CA 1T9XA 1WEXA 4LF1A 4WKYA 1IR0A 5L46A 2OP5A 3CCLS 3T1HJ 5BR8F 5A6WA 3OFFA 5K14B 5EWEA 4Q8FA 1LNQA 4LF9J 3HSZA 2OJ3A 3D68A 6FDRA 1ZZNA 2FHKA 4CQ1A 1UMJA 1UW9A 1V3SA 5EX3A 2XULA 2XS2A 3HSDA 5IT9U 4P2XA 1I3OB 3JSRA 4USKA 4WJBA 1UWAA 4K4YA 1RA6A 2AEMA 5LXYA 3NWRA 2KZMA 2WB1D 3V6KA 2K06A 1NAQA 1SC4B 2PD1A 3CJ2A 2NXNA 3HZEA 3MEKA 3W2VA 1CULB 4BBYA 4ICLB 4C8LA 5J1PA 1I5OB 4IG0A 5M2RA 3R2DJ 2XO7A 1QLNA 3K5OA 3CJRA 2VBWA 2B5JB 2V2KA 2XWYA 4P74A 4YR3A 1CBKA 5HBMA 2XC9A 4F3QA 1RHMB 2A2CA 2RU3A 4IFYA 4ZVOB 1GXUA 4LR9A 2R8HA 4X65J 1UA0A 1S59A 3B82A 4L74A 3DDNA 2M7SA 3NEKA 2OAUA 2ACMA 1HBOA 2GCFA 3SV4A 3CCES 5I3UB 4AL5A 2R4FA 3OXFA 2A6MA 3TEGA 3QWPA 2BACA 4F4YA 4M95A 4PG4A 2KXNB 4DPXA 3T5HA 4K4TA 3V81A 4Y0FA 2CQGA 2DEIA 5HATA 4WK3A 2F9JA 5KTQA 5J2NB 2X1AA 2Y1IA 4KO0B 4DQIA 2RT3A 4YDXA 4ZPWR 3R1LA 2NUHA 1WHXA 5DM7Q 3NOCA 2BJ3A 1T05B 1T7PA 2NYIA 1TKTA 3TJ9A 1FRHA 2ZC4A 2FLOA 3UI3A 4EO6A 5A8KA 4KKOA 1RCOB 4EEYA 2VODA 4ENOA 1N34J 3B78A 3NXZA 4ZPBA 3T3FA 2D9OA 4QBUA 5IV3A 1ELOA 4HACB 1TFYA 1FFWB 2DGOA 3CJKA 4PWDA 3TYTA 2V8VA 3DYAA 4NZ6A 4CLSA 1MWQA 2B8QA 4O4GB 4ZVGA 2C28A 4ZHRB 2DRAA 2MKSA 4UT4A 1TVRA 4RU2A 1Q53A 4I7FA 2VQEF 1RJJA 4I68A 4BS2A 2BJ7A 2UU9J 2R7UA 4KC5A 1WWHA 2MKIA 2NXEA 4NLGA 3MAAA 2C3UA 1RT4A 2G0CA 4RWXA 2XMAA 3C2PA 4FYYB 1CJKB 2XY6A 4NZ0A 1SJ3P 1TL3B 3FUYA 5SZTA 4OZ3A 4ITSA 3MGJA 1NO8A 4Z37A 2IYIA 3I0SA 3K2YA 5JXSA 4I6AA 2HIQA 1WC6A 2CPXA 2QMUB 4LFCJ 4LFAJ 4UOGA 3FFIB 1PYOB 4IFVB 1SIWB 2WVCA 3HD2A 2HS3A 4ZOSA 5LL6d 4ZP7A 4ANCA 4EZ9A 1EARA 4X62J 4CO5A 3MXHP 2IDEA 3DHWC 3M8YA 2DB1A 2MQQA 4ELTA 2ASDA 2M5YA 4DUYJ 3BGFA 1N56A 7FDRA 2FLNA 1HA1A 3DXSX 3SIPB 4LREA 1GX6A 3P96A 1HQUA 5CA5A 5KG2A 1CVJA 4IOAQ 2J8SA 5J2PA 2VOOA 3DLKA 2VC0A 1ZAXA 4KT0C 1IBKJ 3HI9A 1U1KA 3IG1B 1MW7A 3BR9A 1R27B 3GYXB 4PEOA 2VJUA 1UFLA 3QT8A 4I7FB 2JEIA 2WVEA 3JYTA 3MMJA 3EXCX 2DO4A 3K5LA 3BQ0A 3RRGA 2E66A 3R5CA 3R3TA 2L9NA 4NI2A 1ZZFA 3HFVA 3OTOF 1UVJA 1WEYA 2DBBA 2QGFB 2BDPA 1NEEA 3MURP 2YBVA 5D4NA 1KSPA 3N5FA 2LP4A 2Y1RI 3M1VB 4CTAA 4L73A 3FKBA 2R2UA 1Y9OA 4ILRA 4NLYA 4EYHB 1NJYA 1IKVB 3B4MA 1S76D 5EN1A 2Z4PA 1GX5A 1YRTA 2ATLA 5FJ4A 4ETXA 3RAQA 2V50A 4DQSA 1X4AA 3AH6A 2PIIA 4RBTA 3ILLA 3RR7A 3GFZA 4CDIA 1XMOF 4AXIA 2GHWA 1TR0A 3H5UA 1HHSA 2CQ4A 2NXJA 3M2VB 3POTB 1JKHB 1UZHA 5E7OB 2BVZA 2YWWA 4DN0A 2HMIA 1RAGB 3OJUA 2WCXA 1RAFB 1RADB 2J9DE 5I3PA 3V2UC 4KFBB 4I6YA 2RE1A 4MMOA 3H40A 1NPRA 3BPDA 3O2IA 4ZCKA 3RRHA 3WQPA 2DXDA 1JLAB 4DR5F 3OD2A 1LXJA 1QE1B 1U4BA 1T94A 2EK6A 2GO9A 4OYPA 1JLQA 1X5OA 5A8RA 2RUSA 4CLWA 4DG1B 5BYRA 1C1CB 1VQYA 4BC7A 4P73A 4YMEA 4CYUB 3FSYA 4LSLB 4DMZA 3SQGB 4ID8A 3PW0A 3RBDA 1Q78A 1R8CA 1N88A 2XMWA 3GV8B 4TYBA 2RRAA 1S9GB 4ZVQB 1HWUA 3WC2A 3MM9A 1B0PA 2HNYA 3N5BA 5M2PA 1N52B 3WC0A 4TU9A 4NLQA 5KG4A 5IV4A 3VAHA 4OI6A 4ELVA 1FHTA 1F1BB 1X7VA 2FDNA 4B3OB 2F9DA 3CUNA 2LDYA 4ED4A 3THVA 1T0TV 1X9WA 4IRCA 3ZTOA 2FJAB 5GAGI 1PAEX 2R2SA 3C6UB 2YNHA 2ZNYA 4DR6J 4JI0F 3HVAA 1GQEA 2M8HA 2OFHX 4NLPA 4W4MA 4CT9A 1RWXB 5DG7A 1VQOS 5DJBA 1CC7A 2CNNB 3NMAA 5CYJA 3I4HX 2YNGB 3MUVP 2G1DA 1CJUB 3D2WA 3CCVS 3JB9k 1UVNA 2CXEA 1IM6A 4X4TA 4DV7F 2ZOMA 1WG4A 2GW8A 2YKOA 1W25A 3OR1B 4F25A 2KT5A 2PC6A 2FVQA 4A8MP 4ID5A 4ZVEA 5IWAF 4QOTA 3VAKA 4QCLA 1LW2B 4EU0A 1R8AA 2KN4A 2ZDOA 1N0VC 4I69A 4XAKA 4DPUA 4KBIA 2IRYA 2K2PA 2OEJA 2P2CB 4QPTA 4Y34A 3PR4A 2D3OR 5L9XA 1D9FA 1Q8LA 2B4VA 4C6AA 2E29A 2YKMB 3NGRA 3AT1B 1U0SA 3CC2S 3CJQA 3BBFA 2YTCA 2QYCA 3RUBL 3JAMY 2J7WA 1FRJA 4USJC 2HNYB 4OV1A 5K8NA 1WF2A 1FFGB 3CMAS 2DNGA 4OZ5A 4GVBA 1SC6A 4DZDA 1MG7A 2CPYA 4IOCQ 3L7OA 4DN9A 3HO1A 1RKJA 5AXLA 3IGNA 1PJ6A 1YJUA 4IYQA 5BXIA 2C3PA 1SL2A 4B3SJ 2BYCA 2VBYA 3OTOJ 1S9FA 2QO3A 3CGIA 1F2HA 1YRUA 3MEDA 1FWLA 4NXMF 2HHXA 2XY5A 2GV1A 2IJNA 5HMYA 1IKYB 5KFAA 1I1GA 5LJ3Y 1P9YA 1KNZA 4FPIA 4OHWA 3QPIA 4O3OA 2H5IB 2UUAJ 2CQDA 2IM1A 2FHMA 4JB8B 1Q8BA 3BBBA 3MAHA 1IR1A 1J2VA 1XK8A 3T1YF 2AEJA 4DUTA 2Q6CA 4OHZA 3M6VA 2MSTA 1SL0A 4CWBA 4CH7A 3A3PB 3IG1A 3K89A 3NL0A 1U24A 1RT5B 1LW0A 2M0GB 3FSXA 4OX9J 4DI6A 3MF5A 2MZSA 3GYGA 1VQ4S 2GMJA 4AUKA 1FKPB 5F8IA 2CDQA 3TVZA 2W7OA 4DS4A 4USVA 1S7HA 3KLVA 5AJ3F 5A2QY 1YK9A 3LP2B 4PZVA 4LF6F 1S4FA 3R9LA 1HWLA 2K3IA 1UETA 1S0NA 1RXOB 2ZBCA 3SBMA 3MUMP 4ZPAA 1SJFA 3CF5Q 2OGUA 1IKWA 1P1LA 3UD5A 1NZ8A 2ZOFA 1ZH5A 4NCGA 1TL5A 2YNFA 1RT3B 2O66A 3NCQA 2D69A 4RU9A 3PW4A 1C1BB 2H5JB 2HQFA 3NS6A 4DZ6A 2UUBF 4IUFA 1Y5LB 4DV0J 3QRQA 3BEGB 1IBKF 2ZJQQ 1RCXB 2RJZA 4FN5A 1U1QA 1NK4A 5AT1B 6FD1A 2PMWA 2QLJB 4S0MA 4YB5A 3UFCX 1N8RT 1YG0A 4MYUA 4RR5A 1U2RA 4OJ1A 5GAEI 1U47A 3I5CA 2UP1A 1AROP 1UAWA 1KDNA 4QIGA 4WK1A 2WSFC 1DY3A 2Q6BA 4OYWA 2NPFA 2HFNA 2KKHA 3DKDA 1X5SA 2HBQB 4H4MA 5LMUJ 1K0TA 2RSQA 1BXNA 1VJWA 5ETRA 1LEOA 1FE4A 1YZ6A 4DS5A 4DL5A 4MKVA 3MECA 3O8WA 2DR9A 1VDHA 3N28A 2G0IA 3I9ZA 4C3MA 3IR6B 1DRZA 4QQBA 5EWFA 4JI4J 8AT1B 3J7YU 1RAAB 2J0XA 5L39A 2GJFA 1TL1A 3AQOA 4EI2A 2OPPA 1IKXB 3MEDB 4KJIA 3VAIA 2R8GA 2ZDPA 2C3YA 1NDLA 2PO4A 3W8GA 1DJ0A 1TELA 1HKAA 1Q5YA 3KUEA 4LJMA 3LA0A 4DR6F 3N0VA 1NKCA 5D4OA 2DNZA 2IJFA 2MKCA 4LRFA 4TU7A 1Y00A 1QSYA 2Z30B 1PO6A 3KLIA 2Y9HA 1RTHB 1RT7B 2NUUG 4KR0B 4N5SA 5LMNF 2MB0B 2IAJB 4RUBA 3TA0A 4I56A 4PUOB 4ZLLA 3UN2A 2HHPA 4M5MA 1XBWA 1JLEA 3OTEA 4LBHA 5D15A 5DETA 4JI7J 1S0VA 2QRRA 3TZXA 3KK1B 1JLGA 3M2RA 3QNWB 1F60B 3W60A 4B9MA 1HWJA 4URGA 3U1NA 2XMMA 1NBEB 2OLWA 1YBTA 2RDIA 2BJDA 2UUTA 3FBEA 1Q8KA 3P8BB 2VG7B 3R5JB 3PR5B 2KFYA 3ZTPA 2ZH2A 4B3SF 3EMTA 2QJ3A 4M5IA 1TUWA 3M05A 2GFFA 3E2EA 2HG4A 5C42A 2GVZA 4ED3A 5LOQA 4ZJLA 2WTFA 4A8SA 1CJUA 1LWCA 3FC9A 1WC3A 1SKWA 2OMLA 1Z4UA 4ERDA 4F2RA 1TK5A 3ENQA 3W64A 1EX8A 4FNIA 4OJGA 4ZN3A 2JHEA 2HVIA 1HNVA 4QYRA 4O4GA 2QX0A 4WPAA 2O67A 3HM9A 5F8GA 3DI6B 4A48A 2XGPA 1HBMA 4DV1F 1NJXA 4N8NA 4LSZB 3EGWB 3KK3A 4P10A 2CADA 2C2RA 1FERA 1NHKL 4DXLA 3LWMA 1VFJA 2ZH3A 1S97A 3MMCB 2UXBJ 5B0EA 3DRSA 4LF4J 3CD6S 3IAM9 3CDUA 5B0BA 1HW9A 1X4FA 1FCAA 3DNCA 1ZTTA 2LDIA 3K8VA 1T9TA 1TL3A 1VC0A 1A7GE 1K47A 3ZZZA 3BO2A 1L3SA 2E1CA 2B4PA 2PI5A 4C98A 4C3KA 2ZH8A 1A9NB 2BQ3A 4JI5J 3RYLA 5I42B 2JZ5A 1F3VA 1WDDA 4OI2A 3UDVA 2DY9A 1FJCA 2BE9B 4K5RA 3KK1A 2CJKA 1E6VA 2VFUA 2LEBA 2WZ1A 4KPCA 1FD2A 1OQ3A 4B9SA 4O44A 4JI7F 1YJTA 4Z7CA 1TK8A 4F4XA 1WJ9A 2VONA 2V67A 2A0FB 3BGRA 3HD1A 4KIAA 1LXNA 4DV6J 2KYZA 2BEFA 4QR0A 1N48A 3IWNC 4K2JA 3UDLA 3OHBA 1RAJA 4N77A 5C25A 1UW4A 3IR7B 2IRUA 1NKEA 2HGLA 3GV7B 4K4UA 3GIIA 1SQEA 3LPEA 4LF8F 1WHYA 3Q23A 1LW0B 4KHPF 4B9TA 1GMVA 2UV8A 3UQSA 2EFPA 4NRUA 1OIAA 4HH1A 5KFSA 2DGSA 3BB5A 2A2DA 5K20B 1J27A 3OBIA 1SXLA 3M2UB 5IM0A 3X3UA 4PWUA 3I0RB 2I38A 3MEEB 3PTWA 1AYEA 3G86A 1RYRA 2VBXA 4ECWA 3GMGA 3OXLA 3B8HA 3ILIA 1U1MA 2XZDB 3T19A 2E9ZA 2CQPA 3M8RA 1U48A 3EPIA 1I6JA 3CC4S 2W2PP 3LGNA 4ELUA 3Q89A 2DITA 1H2TZ 2HGNA 2DGVA 4NLSA 4MK9A 2CVIA 2HEKA 4AE5A 4B3RF 2QL7B 1G4CA 2HAIA 1RTIB 5FLXY 1G3OA 2AZ1A 2KHCA 3OFEA 3EGVA 3DRSB 1C1CA 4Y28C 5D77A 3UD4P 4BDPA 1VIOA 2DHXA 2B43A 2H54B 2ROPA 2YWKA 3LGMA 3MR6A 1H3DA 2W25A 3OR2A 4ZVRB 1X9SA 3MCSA 1N5TA 2GVDA 2HNDA 2YXLA 3E3XA 3CJ3A 2IMWP 3W5YA 1TL7A 4WYWA 4ANDA 3TA2A 4Y2MA 4HT7A 3SMZA 2EG1A 2QV6A 3KUHA 3LALA 3IMQJ 2QA4S 2GVZB 2GX8A 3DXBA 4F67A 3HZGA 3M2VA 5KFRA 3SI8A 1KRPA 2HIYA 4X2BA 1XR6A 2CYYA 3VGSA 1K1QA 3J80U 2H3EB 3T1YJ 2CRLA 2C2KB 3BH6B 4MIBA 5CZXA 3CT9A 3Q8YA 2RF2B 4C11A 5F8LA 5KG5A 2AYBA 1YRXA 4LIWA 3AOAA 2VC1A 2V4JA 2YNGA 3CJ4A 1SJRA 4NA3A 4UW2A 5L9NA 4QWCA 1X4EA 2DISA 5GAGU 1VQSA 2YKAA 3BZQA 3TNVA 2FD2A 3FBCA 2DCUB 3RU0A 2QA1A 3U7JA 1YHQS 1C4CA 3QFWA 3UN3A 3WDOA 1RT7A 4Y2AA 1KEKA 3W61A 4TKTA 1N34F 2XLIA 3WZ0A 4LVOP 4N7TA 3MWBA 4YR2A 5DG9A 1F2GA 2HHWA 4DV2J 1N0UA 3CD5A 4TNOA 3CDEA 3ZZPA 1Q16B 2L9DA 1SH3A 3MM9B 4HTJA 1TKTB 3FRYA 3QAEA 4L6V3 2RAQA 2XEXA 5F8MA 4DSLA 3G8SA 2KT3A 3LF0A 3N79A 3KJFB 2HAFA 3GWCA 1NK7A 5KFZA 4JV5F 2HFSA 2IFXA 4P75A 5GADU 1WTFA 4EFAC 4F3MA 3CCSS 4DX7A 5THWA 2P6SA 3EUNA 1H7WA 3DRPB 4ZS6A 3AD9C 1IUJA 2AJFE 3PKMA 1KVJA 3J7YI 3MECB 2HW3A 3NY0A 1UTAA 1U1PA 1NDPA 1REGX 1TKZA 2QC3A 2FJWA 4WKRA 1RT2A 3NGTA 5D0GA 4RBVA 2DNRA 2MMYA 3B4DA 2VZ9A 4J5OA 1WUUA 2IM2A 1GTEA 3QYYA 5DDPC 2Z2YB 3EVMA 2V4RA 4O3RA 1H74A 3KJQB 1HHQA 1HWIA 1T3OA 4EBEA 1XR5A 2HRYA 3N01A 3V6DB 2EFQA 2P9CA 1FEHA 1R0CB 4CH0S 4DF8A 2BANA 3QBCA 1QVGR 1T9VA 5B0GA 1FJ7A 3KWMA 1OMSA 3M8PA 4OZ0A 1FNXH 2XSJA 1S1VA 2ZFHA 4KV8A 4DV6F 5L8RC 2HK2A 4OYBA 3HF5A 3EPGA 1WTBA 2FTRA 1FF2A 3FCWA 2KFZA 1EP4A 2RRBA 3PCOB 4GRSA 3KMQA 1WOPA 2CIMA 2YX4A 1S1TB 4R25A 3EE3A 2RU9A 2W2NP 4J9LA 3HJVA 4DHVA 2UUWA 4F4AA 2UU9F 4C2MA 3MPWA 4A8KA 2G9OA 4U96A 4NX9A 2J76E 5KG1A 1ZM4A 4OJHA 5HN0A 1T11A 2KG0A 5D0HA 3JSMA 1VQ9S 2NCKL 5HBMB 2PSZA 3GFXA 2N7YA 4H4MB 5J2QB 3P6YC 3DLJA 4DX8H 1RQ0A 5EGYA 3CCWA 2MKKA 4RBUA 3MR5A 1S0MA 5HMWA 1RBLA 2HVDA 3RR8A 3QIPA 4WP8A 1YZ7A 4HR2A 2E9RX 3OFHA 3H5YA 1NB7A 2RIJA 1UVKA 1VGYA 2CJQA 5HROA 1NSAA 4RPFA 2MHEA 2V0NA 2WVBA 1FRXA 3NBPB 4N56A 3OSNA 3O5TB 5E41A 5IT4A 2F8HA 1PGZA 1UPPA 1CJTB 1JQGA 1QM9A 4F04B 2J6UA 4P72A 1DBDA 2B56A 2BMBA 2M52A 4QIEA 4FXDA 1FWKA 3AOCA 3QAUA 1HHTP 5F0WA 1M5OC 1FKOB 1NSKL 2CKWA 1RTDA 2XYHB 2M3DA 3M8PB 2MQ8A 3GCXP 3MD3A 1JLFA 4WU3A 5HLFA 1U1RA 4FKXA 4ALZA 1D9DA 3POTA 2M70A 3GJTB 2FB0A 2I5JB 4HDGA 3DLEB 3JQMA 4A8XA 5F3TA 2D41A 2X1BA 4G1IA 2ZBQA 4ZA1A 4CLLA 5CH7B 3NG8A 4F02A 3D0HE 2B9XA 3FBBA 2W9CB 5CD4H 2GMHA 2PE8A 2PGCA 1H38A 2FJDB 2E7XA 2V63A 1LWFA 3I96A 3I9V9 4FYWB 4OYOA 5B0FA 1X31C 3FBFA 2AJ1A 4AQYF 1RWKB 4ZVTB 4E0DA 3TUPA 4CP5A 1DAXA 4ZLJA 1QE1A 2IVFB 3TWZA 3PW2A 3DOLA 3QO9A 3OSPA 2BRKA 1T9UA 3UNYA 2BKNA 4IOBA 4CLPA 3JSBA 2FGOA 1U6ZA 1Q86T 4O3NA 1SIZA 1KFSA 1K8AT 1T03B 2RQ4A 2XSJB 1FX4A 2CJ9A 3D7SB 4KV8B 2CQHA 3NGUA 4NZ7A 2YH1A 2CZVC 4ZLNA 2E9TA 1G6BA 1PSDA 1CEZA 1BMQB 4WZQA 1B64A 3U27A 4P7TA 4YUDA 3BGUA 2ROEA 3C15A 2OI2A 5K9FA 3W1YC 4ED5A 4ID5B 2XMUA 1V9OA 1J5EF 2AEFA 3Q8UA 3HSJA 2J0WA 3IWXA 5KT3A 4LF7F 5LSLA 1HR0F 2F65A 5DLGA 3HK2A 1SKUB 3IFEA 2Y0SD 3O44A 4DV2F 1RISA 4RNOA 2AJ0A 3RGIA 3PYEA 1GAOA 4NLUA 5E3QA 4ED1A 2Z58B 2N4CA 2HZCA 4C8KA 1JXEA 1HNZJ 4FP9A 3NRBA 3H98A 4IQMA 1X0PA 2JDJA 4FBTA 3HHLA 2VG6A 3LUYA 3TZYA 2ZHBA 2NSCA 3GR1A 4RW8A 1SL1A 5GVQA 4ECVA 4CZCA 3DRYA 4ECXA 3FMWA 3PO4A 4DR7J 2XB2D 2Y8WA 4QU7A 2CQ0A 2MZJA 1FT8A 4JI4F 4ZCIA 2MQOA 2XNQA 4Q7AA 4ZIWA 3RB4A 1X4DA 3IP0A 2RS2A 2H51B 5CQGA 4F50A 3J7ZT 2B6AA 1KHWA 3D1OA 1ZM3A 1KP6A 4GO5X 3MEGA 1HFEL 5J1EB 1RE1B 2Y8YA 1RTZA 4NA2A 3TVKA 3LQVA 4MT1A 2MGZA 2EBEA 2UVRA 1HNWJ 5LMUF 1RTDB 3C46A 2UUBJ 9RUBA 3A8JA 5DO2A 1TKDA 1UEKA 2NPIA 3BH7B 3TAPA 1RU1A 3LP1A 4TY9A 3N9UC 1VBZA 3EYZA 4HACA 5ETVA 3SEOA 3KNAA 2XHCA 3GR0A 3LW5C 1LKZA 2QIFA 1RBOB 1XWLA 1VCTA 4DPWA 4PQUB 2D3UA 5K8OA 2B9WA 2VG5A 1DLOB 3A8IA 3BN4A 3KG0A 1LWFB 4WE1A 2AWZA 1C4AA 2H4YB 3CCMS 5DQHA 4FBUA 5E2QA 1JJCB 1T3NA 1TU0B 2ALYB 3LGHA 1T05A 2WHOA 1OPIA 2O3DA 2L08A 3MDFA 2MKJA 4MIWA 4NYPA 1WSRA 3GB0A 4OMFG 2C2MB 1ZOTA 2DHAA 2R3VA 1PJ5A 2R7QA 2ZC3A 4V19X 1D8ZA 2R7OA 2VJVA 4GKJF 1VS3A 2DNYA 4L3KA 4LT6A 3J7Z5 4DFPA 1FK9B 2KO1A 2GC8A 1Q82T 3H90A 3HVTA 2DNOA 4OX6A 4QWDA 1VQ8S 1Y4ZB 3CCTA 4DPTA 2DH9A 4Z2XA 3UCUP 3W7BA 3AHPA 3D0GE 2CQIA 3GIMA 2DO0A 4C9DA 4C7QA 4EK2A 1FKAF 3HT3A 3W2WA 3IO1A 5J1EA 4F4ZA 2IA6A 1NDCA 1RTIA 1VQKS 2W9CA 3DRXA 2F3JA 2XMVA 1T9WA 1S6UA 2VHGA 2IC3A 1PJ7A 1S12A 2L3MA 3PY8A 4GMKA 4YB7A 2ZJPQ 4ZMMA 4I64A 3UPFA 3E51A 4RZRA 1IKVA 1WSVA 2AQ4A 2RKIA 2R7VA 2B3TB 3PVXA 3PW7A 4NCBA 4UQTA 4ER8A 3VHQA 2ZZNA 2NXCA 1FKOA 1LK7A 1RHJB 5E3CA 4DX6A 3RW7A 2OHDA 2HS0A 2MZ1A 2UUCJ 2I1RA 3MEEA 2MQMA 4ZN1A 5HQ8A 1REVB 1NSPA 3OTCA 2QLFB 1URNA 3C6TA 1TKZB 1P27B 5HROB 4M5DA 2OEKA 2RVJA 1UEVA 4M5LA 4X64F 1YVFA 3EVOA 1ZA2B 2Q79A 2QSFA 2MGZB 4ZVHA 1SQGA 3D0IE 1TAUA 1EETB 3T1HF 5CYQA 1F9FA 1KVIA 2RQMA 3PRDA 5DDOC 3TVYA 3HP6A 1WC1A 1Y10A 2C2NA 2DEJA 3U02A 2XCAA 5IS2A 1TL4A 2DHGA 3M9NB 2VA3A 5D0EA 4IRKA 3R5DA 4JI1J 4QU6A 2DIUA 3I6PA 1U0HB 4JI2J 3MAQA 2AYEA 3IN5A 3PYGA 1C1BA 4IO1A 2GO8A 1VQ7S 2JEJA 3DFEA 2GQ2A 4F8RA 1MN9A 2EEYA 4FF3A 3EM1A 4NRTA 2HSEB 2IM3A 1ZS6A 5C24A 1VBYA 1D3WA 4IR9A 3CCRS 3D6FB 1S9EA 2FHJA 3ULHA 1G2EA 2FVPA 4B9UA 3CEDA 3QLHB 1PG5B 4B08A 2MLYA 5AXNA 3ISNC 2BANB 2CNLB 4IH5A 5AXKA 4DR4J 1IBMJ 3QT6A 5A8KB 2C2OB 5A0YA 8RUCA 3PV8A 1OY8A 4QR2A 3SQGA 4OL8A 4HI2A 2UV8G 2GZOA 2W9BB 3NLCA 3JAMU 2E5GA 4M63A 3MPUB 4TXSA 4JI6J 3H5XA 1MNEA 1H73A 2H65B 2VPZB 3R5AA 1ZM9A 3CDWA 4ZVFA 3DGPA 3W62A 3OVAA 3DYAB 4F4WA 4FVCA 5C24B 4Q2MA 4JI5F 3VGUA 1KTVA 3IM9A 1JLAA 1UZDA 3QSYB 2FJXA 4RNNA 4B3OA 3BKUA 1IXKA 4CIOA 1K9MT 5F9NA 4J9KA 3EZ5A 4P71A 1S79A 2VQFF 2G13A 3MEGB 4HKQA 3NGSA 1VRUB 3EZOA 1KKHA 2XHWA 5DLFA 3RB6A 4U7CA 1VC6A 5KFLA 1YDLA 3OV7A 3V4MA 5JUMA 5ADZA 3QFHA 1KONA 5ETMA 2J9EA 4C0OC 4K0KF 2GIQA 4L3NA 3OL6A 1B0VA 1Q95G 4USIA 4DU7A 2BV3A 1F3FA 3P5BP 8ATCB 4J9PA 2AHOB 2EPIA 2RMLA 3CD7A 4OI1A 3KK2B 2R8IA 5A76A 3SCKE 3DHXA 1JIHA 3UW1A 3W2VB 3KLEB 2UXBF 3OTDA 3QT7A 2DR8A 4UUXA 3HHDA 1FXRA 2CJBA 4OQJA 2PA3A 1VHFA 2V9WA 4Q5VA 1U6FA 3FMBA 1MWZA 4U8VA 4CNZA 2FPHX 2JFDA 5HQLA 2HVZA 4NASA 2FQQB 4KHMA 2BE2B 3K17A 2DHSA 5DZ6A 2GJ2A 4A8WA 2X1FA 3QRRA 1LFWA 4I2QA 2XGQA 1X4BA 1V5VA 1ICEB 1PBUA 2W9BA 2V4JB 4KRWA 2JVOA 4RNHA 3E01B 2M8DB 2XS7A 4KY3A 2Z57B 5KFPA 1N33J 3TR5A 1DQ8A 4DLEA 3O3LA 2DGQA 5I3QA 2D3ZA 1UWBB 1N5YA 4LR7A 3A4TA 5RUBA 1S1XB 2HQ3A 3DU6A 4AYBD 2GA7A 5IXUA 2CJXB 5MAOA 5LSOA 2HLTA 4U6PA 4DR5J 1S1WA 2OPSB 2B8PA 2YX1A 3IM8A 2ZWOA 3ZFVA 1P9QC 3J81Y 4O3PA 3WX4A 4J9VA 5MLCV 3PW5A 2J0SD 4JV5J 3I0RA 1FDAA 1F5BA 1LOUA 4AL7A 3E8OA 3F44A 3OR2B 3QJPA 3FGVA 3BREA 1WDTA 4Q8EA 2DR5A 4CLZA 2V6AA 3ZNJ1 3T5LA 2F8EX 4X66F 2XLKA 3K5MA 2HS4A 1L3KA 3AA9A 1CULA 4GC6A 2LQ9A 1S6PB 1NHVA 3DM2B 3EGNA 1RTJB 4OZJA 4V1Ak 3SCLE 3O6QA 4ZPCA 2R42A 4OZ2A 5GMKa 2O1PA 4NLDA 3H25A 1NNDA 1R8PA 2GHVC 2XBPA 3H2VE 4CNYA 2DRDA 1OQ6A 3RZAA 5DGAA 2E44A 1VRUA 2RRNA 1XJWB 4HL9A 4OZLA 3IRXB 1MMNA 3BGRB 3M2UA 4CI0B 1RWOB 4DWIA 2RUGA 3OPKA 1SPBP 1DURA 2VH7A 2JRSA 3GLJA 2UVUA 2X3DA 3JXOA 5AE1A 2R7WA 4PRFA 2AIRB 3C66A 4AFFA 2J6SA 3TOQA 4PYDA 4ZK7M 4NLTA 3FFIA 4U7UK 3V6JA 3GILA 5ITHA 2IRXA 2OD6A 1ITPA 2KZZA 3MPVA 1I94J 3R7SB 3QIPB 3BN7A 4NXMJ 2B6AB 4FXWA 4DV3F 1WEZA 2VDIA 2ZD1A 3AB4B 3Q8VA 3BDPA 4DR7F 1S6QB 4DSKA 1FDNA 2CNKB 3AOBA 5KFYA 4DL4A 4O3SA 3TEHB 1AFIA 3MAAB 1E6YA 2XWXA 3PJ9A 1WF1A 3KLGA 4TN2A 4CTAB 1SVDA 2XO6A 1AZSA 2VG6B 1X9MA 3Q8SB 2EXUA 1RUSA 3G87A 1TL7B 4IR1A 3D6TB 3BQ2A 1AT1B 3C6UA 1FK9A 3HPOA 2ZITA 4ECTA 3MMBA 3TX8A 3BDEA 1FVQA 3TX0A 1UKUA 4YQWA 1KFDA 1RZMA 1WHVA 4RKUC 4OIXA 2V68A 2XCPA 1FFSB 2DXEA 2HK3A 2J7KA 2LMIA 3ZNUA 5KFEA 3EWGA 4LUBA 3MPYA 1M0SA 3THTA 2VPYB 2OH2A 4A8FA 3G6VA 2OKQA 2G2YA 2AGOA 3ET6B 3L7UA 2EFOA 3AAWB 2CJYB 4ICLA 2LXFA 5K8PA 3OVSA 2PEBA 1HMVB 3D1HA 4Y65A 3VV2B 2JL9A 2MJNA 4CT8A 4RW8B 1JJHA 2F5GA 2HZAA 3OLAA 3PIOQ 5DZ7A 1WNEA 2G2OA 3BKTA 4CLTA 4YEAA 1RWWB 1NH8A 3P49B 1AUDA 2WB4A 4UY85 1NRKA 2VPXB 3LOUA 1NXIA 1VISA 3A13A 4O23A 4RO0A 1VQMS 1U8WA 5EWGA 1U25A 1PYTA 3FQLA 2K7KA 3EZUA 1NU4A 4KKOB 3ET6A 4G3IA 4MIAA 3NGDA 4AXJA 4DR2F 1W2BR 3SSQA 4X4OA 4M8LA 2HQGA 5IZHA 2MDAA 4O3QA 2ZE2B 1A0OB 5FDLA 4CH1A 1Y5IB 4KGXB 1AFJA 4KE5A 1T03A 1QAJA 1CPZA 2KB2A 3EXYA 2N3OA 1JXLA 4GKKJ 2E5IA 4JI3F 4LF5J 2QL9B 4IH7A 3M9OB 4ED8A 4PWDB 3FZ2A 1SV5B 1HQEB 4M1KA 4NLRA 4ZJQA 4LF4F 3MM8B 2F1FA 2EC0A 2OTJS 5KFJA 3IBCB 3R2CJ 3MPDA 5D3GB 3NNAA 3IR5B 4B3TF 1LW2A 3UNGC 4Q44A 2CPFA 3QIDA 4JI2F 1JLCB 3NAIA 5KFHA 2RDDA 2MKYA 2W4CA 2ZVSA 1OSCA 2YWFA 3H4BA 4MAKA 2YKQA 1N5QA 4OLOA 4DV5F 1TFWA 5C2GA 4J9QA 2WOMB 3ZZ0A 2I0XA 2CQBA 1F5CA 2J9DA 2OSQA 4QJVA 4E8UA 2ZH1A 4DR2J 3BYPA 3TA1A 5B0CA 1O51A 3TO8A 3C6TB 1CLFA 6AT1B 4I6WA 1FDDA 2YWEA 2L41A 3GYNA 3GQCA 2FY1A 1D1UA 4IRDA 2QMXA 3T9NA 4DR1F 1Y3JA 2ZHAA 4C8YA 3LAMA 4XPEA 1CJTA 5LJ5Y 1RT3A 2KJVA 1R6YA 2V9KA 4OZ1A 4R0JA 3QRPA 4CM2A 1R0AA 2GMLA 1N6QA 3RBEA 4UQGA 1Q79A 2AX0A 4X4RA 2NZ4A 4PQAA 2QYGA 4IFYB 1TUGB 1DQAA 1BGXT 3NS7B 2IC3B 1U0HA 2A18A 2DD8S 3KDNA 2KU7A 1OYEA 3NCRA 3WBZA 4DCJB 3M9MB 1YJ7A 2BABA 4BC9A 2J0QD 3CMES 2QL5B 3HJFA 4ECYA 3QGPA 4L75A 1M5VC 1KTQA 1Q7YT 3W2WB 4ZLPA 4KGZB 1CSJA 3NWGA 1IJEB 1FESA 1RBAA 1WELA 2LQJA 1DLOA 2V34A 3GPAA 3U1MA 4WFAQ 2W7PA 2R2RA 1X4GA 2EFVA 4X4UA 4J7CA 2QZ8A 4OHVA 2EK1A 4K4SA 2E1AA 3EJMA 1XNRJ 2HNZA 2HVHA 3CNQP 5G0RA 4YDDB 2DY1A 2RQCA 5KFIA 2IIHA 2JEFA 4GKJJ 2HWHA 1IKYA 3F56A 3KJVA 2CQ3A 1XMQJ 1R43A 2XYGB 1V5IB 4YN3B 5B0DA 3R1HA 1BQMA 3DU5A 4WBFA 3B54A 1PILA 2LYVA 2JNJA 2WVDA 3KHLA 1B0TA 1URRA 4EBCA 3MTJA 3OLBA 4NYOA 2FJBB 4P52A 3AJDA 3D66A 3KNGA 1PC5A 5BYSA 3HMJG 2E1MC 2DGUA 1N36F 1S9EB 2JFKA 5SUHA 1RT5A 1S77D 2LQBA 4P2MA 4P2FA 3GSIA 3QLHA 3OL8A 2HHHJ 4CLYA 4B9NA 1OY9A 2E5LJ 2LCWA 3AODA 2XMKA 3LH2S 3V6HA 4PUOA 3M6WA 4NCAA 2HKEA 2AF6A 2JOQA 4OYAA 3H7HB 1LK5A 3CO0P 4ZCLA 3UN5A 4C48A 1O5JA 5DGBA 2VL1A 1JJ2R 3GIRA 3T5JA 3MHYA 2JWNA 4YOEA 5JVGQ 4WIQA 2VFVA 4Y2CA 5FDLB 3MOJB 2OEMA 1SH0A 2GQCA 1NLKL 1B7YB 1X4HA 5A2QU 3AD8C 5IOLA 2AD9A 4L76A 1XNQJ 2XMTA 5EX0A 4LRAA 2I5JA 1WF0A 2X3GA 5DM6Q 1KOHA 3CE8A 4HDHA 1GK8A 1DTTB 3OUYB 1K44A 2VV5A 3IS9B 2NLWA 5ETSA 1TL1B 2HRUA 1YQHA 2F63A 2DNHA 2YNHB 3L7PA 4FKYA 3FQKA 1PBAA 1MMDA 2DGXA 2GAHC 3SSRA 2BJ1A 3TI0A 1HBMB 1KN6A 1QSLA 1EZZB 1U8SA 1VI7A 1WHWA 4F3OA 1XN9A 3K8WA 5KFTA 4X62F 2ZZTA 2ACYA 1SKRA 4DJBA 4A4JA 3OHAA 2MSSA 3PXGa 3OQ2A 4A47A 5T14A 2DKOB 4DV4J 4NMLA 3UDEA 2LQ8A 4OX9F 3AXMA 4IG3A 5HL7Q 2OPQA 4URQU 3ISZA 4X65F 4OHYA 1RGVA 1J5EJ 2HMIB 4UOHA 2BW2A 4ZP6A 1VBXA 5KFWA 3W63A 1RT1B 4NE9C 3MM6B 4RL1A 5GAHU 1FEEA 2QFIA 4EBDA 4N76A 2F4VJ 4JOUA 3HFKA 3TJAA 3M30A 3B6BA 4N47A 2F4FA
chains in the Genus database with same CATH topology
3CCJS 4DOZA 5CYMA 5A8WB 5D3GA 4XDCA 4NPOA 1RKIA 2EG2A 3KTQA 1IKWB 3N6LA 3MM5A 2WBRA 2FUG9 3VWSA 2QSWA 1KQFB 4V19J 3IXQA 4RNMA 1RTHA 1R31A 1YSJA 2ASYA 2XG8A 3DMJA 3IC1A 1S1XA 5BJRA 1L3UA 1DQ9A 2XMJA 3JYTB 3JTOA 4KFBA 1KS2A 5M2UA 4G6VB 3RB3A 4N41A 1BQNB 1SB6A 2YNIA 2HHVA 2N7CA 5J2NA 1XR7A 3IWLA 4P7VA 5J2PB 1JLQB 5A8RB 3AY0A 1GTHA 4ECUA 5T7LA 1P6TA 2N4DA 3FEXB 3VAMA 1MMLA 5J1NA 3KHGA 4KGMA 2AYMA 4IH6A 3LP1B 4KB7A 3OW2R 1APSA 3MMAA 4ES2A 4X4QA 2C3MA 3BSOA 2ADCA 1N54B 2YKNA 5KOXA 3BO4A 4TY8A 2RB7A 3NBPA 3QWUA 4G1QA 3MI7X 1WD6A 2ZOGA 4EGLA 4LQ3A 4X4PA 1R7IA 3PIPQ 4CO0A 4U67Q 4CO4A 4HLBA 5CXTA 1RTJA 3SCIE 1N32F 5CCMA 3ENWA 1YWXA 1KR4A 3MZIA 3S7RA 7FD1A 2ZH7A 3SZ2A 3VAFA 2CVEA 4ED2A 1S0OA 3LO3A 1VQPS 2BR0A 5J2QA 3PNIA 4FF1A 1IM4A 3K57A 3T1AA 4TLQA 4I2QB 2WW8A 1FJGF 1WI6A 1UA1A 2ADBA 2YKMA 1GXTA 1WG1A 3FEZA 4XK8C 5HMXA 4UUWA 2I9SA 1RT2B 4R5PA 3J7A1 4OFZA 3I5BA 4MK7A 1HL6A 4QW9A 4QYZJ 1HNVB 2AP6A 4Y6IA 3QGHA 3CC7S 2QMWA 4ED0A 1VK3A 4DQQA 5IT9Y 2F8MA 2GIRA 2KRRA 5CYMB 1RT6A 4RUCA 2DH7A 2GJIA 5B08A 3OUYA 1NKBA 2VA2A 3HHNB 5HP1B 1FO1A 1P8GA 3SYZA 3PACA 1L3TA 4XPCA 4C8ZA 2HYIB 4GKKF 4LSLA 4EUVA 1ZAWA 2FC8A 4QIFA 5HI7A 1V3RA 1HQUB 4DSFA 4PXCA 2IM0A 3D54A 4HEA9 4ED7A 3ZZTA 4RX6A 1H2VZ 2HLUA 4WFNQ 5DQIA 3G96A 3FZBA 1ZPWX 3BR8A 3MMBB 4F2SA 1VQLS 3DI6A 4OLPA 4ZHRA 2J9CA 4I2PB 1HNIA 1E6VB 2E1RA 1IQTA 3SFUA 2VFTA 2V8DA 4CO2A 1J5OB 2IBKA 1E6YB 2P9GA 4Q0BA 2ASJA 1X0FA 1C0UB 3IA0A 1H7XA 3LANA 3DOKB 4D3GA 3DLEA 2K1RB 3T9ZA 5KAKA 1BQXA 3UWTA 4TY8B 3JTNA 4CO1A 1NK9A 4HHJA 4I2PA 4PG5A 3MM7B 2N3LA 2CPEA 1R89A 3TQ1A 1R8BA 4DG1A 5EHHA 2CPJA 1S1UA 3L09A 5KFBA 4RW7A 4R8UA 4FF2A 1RI7A 2AU0A 1UL3A 2KH9A 3M30B 2ZBIA 3M6XA 2N82B 4DLGA 2MZRA 2IYGA 4K59A 5T7LB 4DV4F 3HVWA 2XSFA 3ENVA 4DEZA 1QUPA 1NK0A 2XZWA 2EWHA 2AJ4A 4WFBQ 3VTIA 4DV0F 1VC5A 1X5PA 4MFBA 1KQKA 1A6LA 1V6HA 2JC1A 3THPA 2HWIA 1R0AB 2FGCA 3MFHA 3R5BA 4P6QA 4M5DB 3SCJE 1YBAA 3IBWA 2R7RA 1NJIT 1EP4B 3DDKA 4ZPVR 5CCLA 4LFCF 1KLNA 2LEPA 2DNMA 3FJ2A 3MR2A 4B17A 1DHMA 2PFFB 1ZAVA 2BBEA 2Q3PA 2BXJA 1TQLA 3KK2A 5D78A 3HXMA 3H2LA 3UR3C 1D0EA 2LXIA 2RD5C 1SJ1A 3DM2A 5KFFA 2Q43A 2VB6A 1JJ4A 2BJEA 2PEHA 3AJ1A 5CHCB 5GVQA 2F7VA 3W2WB 2QFJA 2YKNB 4NLOA 3CCQS 1SUQA 1SV5A 2QA4G 4E98A 1G7CB 3M6UA 4ES1A 2OFGX 2QT7A 4Q2LA 5KT2A 4J37A 1IQZA 4Q45A 2ABYA 2IVMA 2K3KA 5E5NA 3VR1A 2E9ZA 5F8HA 1GH8A 2DH8A 3L3CA 1YJWS 5IQ6A 1FXDA 2O01C 2YY3A 5KFXA 5KFCA 3PX0A 3PM9A 2DCLA 3DRPA 1HBNB 2FC9A 3KMSA 1D8YA 2DIVA 4FZVA 1O8BA 1SJ4P 4OX8A 2VPWB 4WFXA 5L1KA 4TQSA 4A8OA 1CQMA 1S48A 2EVZA 4LQ9A 5C25B 3SDEA 2J5AA 4OI0A 2B9YA 4I67A 3KJVB 4WYLA 3V5RA 2APOA 2ILYA 3LPYA 3M1VA 3OXGA 4UY8T 2LECA 2DGTA 5KFVA 1VOMA 1SJQA 2LXUA 2EFNA 3DLGA 2UUAF 1S1VB 2F40A 3HHEA 4FS1A 1MSWD 2B7BB 5JJBA 2ZNZA 3JTPA 2K1RA 4KSEB 3TRGA 3MM6A 3K59A 3HKZD 3S6EA 1JB0C 2AGPA 1NH7A 1FKPA 2GGPA 3SDEB 4ZPTR 1N5SA 3KG1A 2AJQA 3Q0AA 2R2TA 3AQPA 1CC8A 1NJWA 4TLRA 2D74B 2BE2A 1M90T 2W24A 4DR3F 4QW8A 3W3SA 2Q66A 2PMZD 1LWCB 4NLWA 1SH2A 2OD4A 2JC0A 2A1BA 2HFOA 2CPZA 3IS9A 4LIRA 4Y2KA 2RS8A 2UVWA 1H98A 4RLEA 4QZVB 2BM1A 2WRMA 3KG4A 2FLLA 1FRMA 3MD1A 2DGWA 4KO0A 3Q8RB 4DSKA 1S6QA 1JLCA 4N8OA 2KVIA 2VG7A 4K5SA 3BSAA 1VRTB 4WIIA 1VQ6S 5CZVA 4RW9B 1T8EA 4A8QA 4LF5F 2E7WA 1HBNA 2B4OA 4GO7X 1UVMA 3NCPA 3DMJB 2NS1B 1S10A 2KXHA 5I3UA 3SSSA 4KGKA 4KTQA 1R3NA 1FXLA 4R5PB 1NK8A 3CB4A 5A6PA 2IBOA 1U7LA 4MK8A 2PDAA 4CCHA 5GAEU 4GC7A 5A8WA 1OO0B 1SI9A 4C0HA 1Q4RA 1C0TA 1U09A 2POKA 4PPDA 2C42A 4DL7A 5D8HB 1LV5A 2ROGA 3N6MA 1IBMF 1KLMB 3KLFA 5KT7A 1RYSA 1BLUA 1HI1A 1FVSA 3E01A 4MJKA 4EO8A 3CO9A 3NP5A 2XLJA 3BO3A 2R7TA 3NKYA 4C8NA 2K8GA 1UP1A 3DN9A 1JLEB 3CTRA 2KFNA 2VBZA 2XI3A 4RUHA 4LMZA 1B7FA 5F8NA 3K5NA 1VLYA 1D9AA 4B3MF 1H0HB 1Z2ZA 3ZC4A 4ED6A 1FE0A 1S1WB 2OPSA 3NS5A 4MKYA 3S1TA 2BRLA 2OIHA 2IMOA 1NZAA 2P6TA 4DFJA 4WCEQ 2U2FA 4FF4A 3CSKA 1X4CA 1Q7LB 1IJFB 5L1JA 1O0PA 4WU2A 3J80Y 1C0UA 4PPZA 1M5PC 2LU1A 2OPRA 2W4PA 3TARA 1BWEA 4PXBA 4K4WA 2UXCF 1ZYQA 1N5VA 1NK6A 4K2XA 1QSSA 3Q2TC 3NMRA 2PT0A 2LLZA 2W4DA 3C8YA 4RW4B 3PEHA 5KG7A 4ZP8A 1KD1T 2R7XA 3LAKA 2RNEA 3PHEA 5J2MB 4KPYA 3QJLA 3GG1A 5DRKA 4DUZF 2CQCA 4DBQA 1GXLA 4J9OA 2UUCF 1DFDA 5IT0A 2DNLA 4DDFA 1JLBB 4USHA 3I55S 2UVVA 4WZMA 3AB2B 1S49A 1VRTA 3K7RA 3VF0B 3KLFB 2CG4A 3FRZA 3MFIA 4KAIA 3KHHA 3PX4A 1I94F 4YHHF 1NK5A 3I82A 2MY8A 3RW6A 2DJWA 5DQGA 2QEXS 1RK8A 2NSBA 5I42A 2FJVA 2DNQA 4NYZA 4C8MA 3HLUA 1OS5A 1RT6B 1NJZA 3SXLA 2HHSA 1VK8A 4YB1P 3TAMA 2KG1A 2FHJD 4EWTA 2JVRA 4ETZA 2HNZB 2KJWA 4YB6A 4NWBA 3QJJA 2RH3A 1WACA 2FLPA 4C8OA 5GADI 3I56S 2M2BA 4QWEA 2HHUA 2D7SA 2ZE2A 2XI2A 4A8YA 1WG5A 3S01A 5DG8A 3G8QA 1FJEB 2JJ4D 4HTIA 2OPQB 3M8SA 3NNHA 5D6GA 1HW8A 5B0AA 1U2FA 4JV0A 2K7JA 1HNWF 1X5TA 5KG3A 2F4VF 4K4ZA 1IKXA 2BM0A 3FEYB 2P5VA 5D4LA 3NNCA 4J9SA 5BYQA 5KFMA 3PJXA 4W92B 3NAHA 3CJKB 4ATNA 1XMBA 3Q8QB 4DUYF 4DQPA 2W7AA 2MKHA 2VASA 2ZH9A 1UJ4A 2V94A 2Z0GA 4L72B 4UOCA 4DL0C 1Y0HA 2ZM6F 1YJRA 3DOKA 1JKHA 5KG6A 5E33A 3PKYA 1S9GA 3OFGA 5KFQA 3GSDA 1LWEB 2HHQA 1U1OA 2OPPB 2CPIA 4YFUA 2MYFA 1HPZB 2V5HG 4FXVA 4URSA 3U1LA 1ZETA 2H5EA 2B4UA 3HHLB 4O0IA 1F5AA 2NXUA 1C2PA 1Q1KA 3ZZOA 2C2EA 1U1LA 3A8EA 5U47A 3HVTB 3MTKA 3V4IA 2AYGA 2FJEB 1PC4A 1K73T 1YGYA 2JSXA 3MOZA 2I8EA 4ECRA 2UXDF 3VQTA 2Y1JA 3G71S 3OTBA 5L1IA 1LWEA 2OSRA 4IO9Q 4Y2IA 4OZNA 1HD0A 2V8GA 4JV1A 1M1KT 1BC6A 1TUVA 4FVMA 2R7SA 3BQ1A 1C0TB 3N6NA 2I2YA 1M5KC 3JSMB 1MU2B 4RW6A 2VOPA 3MUTP 1JLBA 2QA2A 3MMCA 3A1YG 5G0RB 4LSNA 2LVWA 1HYSB 4ZCMA 2JLFA 3V4IB 5FIIA 4R8UB 5IM0B 1XEZA 1YJVA 1TK0A 3ISND 4X84A 2WK4A 3PEJA 3ITHB 3TUIC 1TAQA 1FNOA 4QWBA 3T5KA 2EW9A 5DDQC 1HPZA 2KRBA 4BCAA 1QUVA 2C22A 4KHRA 2CZ4A 4IG0B 4DL3A 3QGIA 4WXWA 4J9NA 4DSIA 1DTQA 3UR0A 1OPZA 4RW7B 3N4WA 3I5AA 2A3JA 3G6XA 2D1CA 3O1LA 1K0VA 3C3LA 3H59A 4JBCA 2OO4A 3ZZYA 3MMAB 5HO4A 5EUHA 1QTMA 3H4DA 4JYAF 3DCAA 3KLEA 2DPIA 4DF4A 4MFBB 4WFZA 3BS9A 5LSRA 4JI8F 2MY7A 3G9CA 2DTJA 2C3OA 2GHPA 2VFRA 2E5JA 4J9MA 4MH8A 4QPXA 3MR3A 2ZZMA 2MQNA 1J5OA 3M8QB 4C3LA 3P3DA 4EZ6A 1T95A 2GQQA 3PJWA 2JLGA 4Q0BB 2WAQD 5B7WA 2W8LA 2RDJA 4TU8A 4ZDNA 1HQEA 2KHDA 3DLLQ 2E5HA 1WI8A 3TW0A 4QWAA 1ULRA 2IVYA 4ILLA 1N33F 4OI4A 3PX6A 4O4RA 4NLVA 5E3AA 1Y3KA 5HMZA 3S8SA 2KYXA 1H2UX 2WONB 3UCZP 1AXQA 2Z2MA 2Z8QA 2CFXA 4PXDA 2YX7A 2PMHA 4H4KC 5K8MA 3IAS9 2R9LA 4NA1A 1GT8A 3VCDA 3DLKB 5IQQA 1LFPA 3L95X 2HHTA 2MHNA 4IDKA 4DL2A 2AGQA 2O5DA 1XC9A 3GIJA 4HI1A 4C97A 1MWYA 3DLGB 1KQSR 2YNFB 2KI2A 3RAXA 2UZAA 2COLA 4HH0A 2PI4A 3AA8A 4WF9Q 1HI8A 2IAJA 5L38A 1HBUA 1U26A 1P1TA 1BD6A 1DTQB 4YR0A 3LP2A 2RF2A 3DOMA 4C11B 2ILZA 1HNZF 3I31A 4K50A 1FRKA 1YTYA 3I0SB 2OPRB 3GFHA 4K4XA 1BQMB 2RKIB 2R8JA 1Y5NB 3KYLA 2WSEC 4D3HA 3OVBA 2FHOB 5E3PA 2L9WA 1ZTWA 4QIVA 5JVHQ 1Q81T 1JLFB 4C0BA 2VG5B 4FS2A 5HLFB 3V81B 1W2IA 3LWLA 1U1NA 3QGGA 4R0EA 1QY7A 1HI0P 4JV2A 4NOHA 1ZBTA 2EBGA 3IRXA 5KT4A 3SV3A 1YI2S 2ZKTA 2ZH6A 4IDKB 3GZ7A 2AX1A 2YVSA 3Q2SC 1RWUA 4U9RA 2E5LF 2FVRA 3QZ7A 5LT5A 1TP7A 5GAHI 4DQRA 1AW0A 2VUGA 3HVRA 1VQNS 1RP5A 5KFGA 3DLHA 1M5HA 1MROB 3US5A 2VD3A 2VKRA 2GNKA 3FNNA 2OTLS 2JLEA 3OL7A 5T41A 3EX7B 3ZZRA 3CCUS 3VAGA 3KOAA 1RDRA 2U1AA 1VQ5S 1XMQF 1HBOB 3HKWA 1MU2A 4RW6B 4TQRA 1S72S 4H4OB 4HT5A 2QE5A 1TV6B 1UJ6A 4LSNB 5H1SV 2ZUGA 1UWBA 1N5YB 1QAIA 4KQZA 2IHR1 3VZHA 5C42B 4MYTA 5E3RA 1FTRA 3CDAA 5DDRC 3LP0B 4HYKA 2NR0A 3X1LB 2QLWA 3GFYA 3MM8A 1S1TA 2LEAA 2RQKA 4CO3A 4A8WA 1JLGB 2MJUA 2MQLA 3M2RB 2ASLA 4NXNF 1XNRF 3M32B 3CJ5A 4NL5A 2HGMA 2KT2A 3DOLB 3QO9B 1KOOA 2YH0A 5D4PA 1CG2A 3T6BA 5KFKA 2J8AA 3E2EA 3ONQA 4IFVA 1QAXA 3ZZUA 3AJ2A 2W8KA 3QZ8A 3I32A 4PR6A 1UEUA 2AV5A 1CQNA 4RUAA 3I4PA 5K5MA 3IRWP 2ZH5A 1UVIA 4AL6A 4MTPA 3PFOA 4WFYA 1BY9A 2X51A 3K5PA 2ERRA 3RTVA 3HHLD 2C2DA 2H9ZA 4I1TA 4F4KA 3GIKA 1RT4B 3HX9A 4H54A 4QR1A 2FIUA 2EI5A 3ETOA 1FDBA 4WE1B 3CXCR 1FTCA 1XTZA 2DT9A 3QMQA 2BOPA 3IGVA 4HVZA 3CCZA 2D9PA 3CIMA 2DNPA 1S1UB 2Z2LA 5AE2A 3RRKA 2FVSA 3PO5A 4DFKA 2B0GA 3R27A 5KT5A 4WTYA 1T02A 3Q22A 2V4QA 2HNDB 4F26A 4LFBF 1UJ5A 2KM8C 2SXLA 3KKFA 4A46A 4XO0A 2YWGA 5F0UA 2XS5A 1JNRB 5KFOA 2YWHA 2JH3A 1YIJS