4RW4B

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
424
structure length
405
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 110
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B03
1IKXB 3KK1B 1VRUA 3MECB 2OPSB 3ISNC 3HVTA 1RT7A 2VG6B 3CWJA 4TN2A 4FS1A 2HNYB 1S48A 2JEIA 4K4VA 4O3NA 4K50A 3RBDA 2RF2B 1CSJA 3RB0A 4PUOB 1N56A 1LWEA 3PW4A 4DL2A 4QWCA 2J6UA 2IM1A 4H4MB 4IFVA 1TKTB 2BQRA 4NRUA 1S1WB 3T1AA 1FK9B 5JUMA 4RUAA 5KFOA 3M9MB 2R8KA 3NL0A 5L1KA 2YNIB 5KFEA 1S1XA 4ECQA 1LW0B 3QLHB 5KT2A 3V6HA 3JSMA 1S9EA 4IR9A 4KHRA 4MK9A 4EO8A 3KLFB 2ZD1A 4FBTA 1HYSB 1S1TB 5KT3A 4WYLA 5HLFA 5D3GA 4TY8A 2JEJA 1HPZA 1W25A 3M9OB 2WOMA 1JLFA 1RTIB 4ED3A 4KSEB 5C25A 2R2RA 2FJXA 5F8IA 1HMVB 2UUTA 1HQUB 2B5JA 4Q0BA 2HNZA 5JXSA 1HNVB 3IS9A 4LSNB 1RA6A 1SH3A 5KT4A 5I42A 2RKIA 1JLAB 4ZVFA 3DMJB 3UDLA 3IG1A 5L9XA 3BSAA 4KHMA 4NYZA 1FKOB 3PHEA 2B43A 3H4DA 4HYKA 3NBPB 3I5BA 4YQWA 1S6QB 4IG3A 4RW9A 1TL1A 3FRZA 3CDUA 4LSLA 3Q8QB 1IKXA 3MECA 2D3ZA 4KAIA 4DL5A 4G3IA 2OPSA 2BQUA 4NLSA 5KFCA 1C0TB 4ZVGA 3OHAA 4J9KA 2VG6A 2IA6A 4J9NA 1U09A 3JYTB 4R8UB 4NLOA 2HNYA 2ZE2B 4KBIA 4J9SA 5F9LA 3RB4A 5KFFA 2FVQA 2W7OA 1BQNA 2VG7B 2RF2A 4PUOA 4EO6A 3OL9A 2QV6A 1JLGA 4RW6B 4ZP7A 2ILZA 3KLGB 1RT2B 4H4MA 1D1UA 1TKTA 3ITHA 1C2PA 3EZUA 5K14B 1S97A 1S1WA 3I5CA 2ATLA 4J9MA 5KFQA 4Q8EA 3KLEA 3D5MA 2ALZA 3KJVB 2OPRA 4URQU 2AWZA 1S0MA 2YNIA 4DEZA 3M8QB 4Q43A 1LW2A 4J9LA 3QLHA 2WK4A 1VRUB 3CDWA 2HAIA 2FVSA 3KLFA 2OPPB 4WFXA 1HYSA 4YMEA 1S1TA 3PZPA 1KHVA 5C42B 4EYHB 4NCGB 1YVFA 3BJYA 4NLRA 2FVRA 4B3OB 1QUVA 1RYRA 1BQMB 1RTIA 3CJ3A 3H5XA 1T94A 1HMVA 3DLGB 1HQUA 3I0SB 4NLDA 2WHOA 1HNVA 2WRMA 2AX1A 3KOAA 4MIBA 2FVPA 4ZPAA 5HROB 2UVUA 4F50A 3DMJA 5J2MB 3SFUA 1FKOA 3H5UA 5F9NA 3RBEA 3DLKB 2UVWA 3NBPA 4MK7A 1S49A 1S6QA 4Y3CA 3D28A 3I0RA 5KT6A 1T03A 2IJNA 4K4WA 3G6VA 4K4YA 4Y2CA 2IAJB 4IQXA 4ZHRB 1DTQB 5D3GB 5KFRA 2E9ZA 1C0TA 3E51A 3QGHA 1HQEB 3G86A 4ECVA 2R8GA 1OS5A 4EYIB 1HARA 3JYTA 3QYYA 5C25B 4R8UA 1S1VB 2XCAA 3DYAB 4Q0BB 4F4WA 3V6DB 4RW6A 1RT1B 5KFZA 3T5JA 3IG1B 3PW7A 5DQIA 3KLGA 1RT2A 2W8LA 4NLXA 5J2NA 5K14A 4ECZA 4F4XA 4ED8A 1LWFB 2W9CB 4EEYA 1JXLA 3OSNA 3DRRB 3CVKA 3QIPB 3KJVA 5DG9A 5KT7A 1QAJA 3M8QA 3N6NA 4O4RA 2CJQA 5F8JA 1TVRB 1QAIA 5DLFA 2D7SA 2OPPA 4O4GB 2I5JB 1NHVA 5C42A 3H5SA 4NCGA 2W8KA 3FFIB 4IH5A 4KO0B 2R8IA 1BQNB 2YKNB 3ISND 4B3OA 1BQMA 3ICLA 4O3SA 3FSIA 4RW4B 1TKZB 3DLGA 3I0SA 3GIKA 4Q8FA 1S1UB 2JEFA 1JLGB 3RAQA 5KFGA 2DPJA 3EPIA 3GQCA 4WZMA 5F8NA 5KFJA 3ITHB 2OPQB 5HROA 1MU2B 3T5KA 1LWCB 5J2MA 3NAHA 4ZP6A 2YKMB 5KFVA 3KLEB 3IN5A 5DG7A 2OPRB 3M8PB 1R0AA 5KFKA 5HBMA 1TP7A 2AGOA 3DLKA 1LW2B 3LP2B 4ID5B 4MKBA 4NLPA 5DQHA 4ZVHA 3C6TB 2VA3A 2IM3A 4O3RA 3HVWA 3T5LA 4IH6A 1T05B 3OLBA 2HWIA 3OSPA 4KFBB 2IAJA 4ZHRA 1DTQA 2GIRA 3OLAA 1N5YB 4J9RA 3LAMA 1HQEA 2WB4A 1SH0A 3M9NB 4LQ9A 2IM0A 4JV0A 3NKYA 1S1VA 4WFZA 4RU9A 3DYAA 3BGRB 2C2DA 4DL3A 4IRDA 4NLGA 5FDLB 1TQLA 3V6DA 1RT1A 2BRKA 5KT5A 3QZ8A 5KFWA 3CIZA 1S9FA 5EWFA 3KNAA 4IOBA 1LWFA 1KHWA 1RT3A 4QW9A 2W9CA 3GV5B 3DRRA 4ICLB 4IRKA 3QIPA 1XR5A 3MEEB 5F8LA 4K4UA 3I0RB 4O44B 1T03B 1RTDA 3H5YA 1TVRA 2R2TA 3GIMA 3LP0B 3OHBA 5DGAA 1TL3B 1JLBB 4O4GA 2I5JA 2XGQA 2V0NA 3HKWA 4Y34A 1IM4A 5KFBA 3FFIA 5KG4A 4KO0A 3GIIA 2YKNA 3DI6B 4RNNA 5C24B 3SI8A 1D0EA 2R8HA 4RW4A 3H40A 1TKZA 5I3UB 1S1UA 2BANB 3QZ7A 4FS2A 2YNGB 2ASLA 2IC3B 3LP1B 2ASDA 2XWYA 4KKOA 1S0OA 2OPQA 5J2NB 1MU2A 3BSCA 1LWCA 2JEGA 2D41A 2YKMA 1JIHA 1IKWB 4Q44A 3MFIA 3DOKA 1RTJB 3M8PA 2BR0A 4QWAA 3LP2A 4ID5A 4ZVEA 1RTHB 3LANA 3KHRA 3C6TA 3KLHB 4XPCA 1ZETA 5KFHA 4GC7A 4Y2AA 3PR5B 1T05A 2ASJA 4KFBA 4QWDA 2AQ4A 2JC0A 4NLQA 4XO0A 3I5AA 1T3NA 1XR7A 5DQGA 1N5YA 1ZTWA 1S6PA 4EBEA 3H2LA 4I2PB 3E01B 3CO9A 1DLOB 3PVXA 1S0NA 3BGRA 2ILYA 3CDEA 1NHUA 4R5PB 1QE1A 2AX0A 5FDLA 4MH8A 4NLYA 5KFYA 5KFDA 2QE5A 3FQLA 2IJFA 3N6LA 4U6PA 4RNHA 4YR0A 3HHKA 5CYMB 3H59A 1TV6B 4RW7A 4WXOA 3DM2A 5KFLA 1R0AB 5KFMA 4IFYB 5HBMB 1Z4UA 2WCXA 3PJXA 4RNFA 4HKQA 4ICLA 3CJ2A 3H4BA 3OL8A 2E9RX 4O3QA 3MEEA 1JLQB 2VG5B 3DRSB 4O44A 1SH2A 4KB7A 4TQRA 4WFYA 5KFUA 2HNDA 1SUQB 3LP0A 5KG0A 2AGPA 1TL3A 1JLBA 2FLLA 5F8HA 5J2PB 4LQ3A 2R2SA 1TKXB 1IKYB 4URGA 3GYNA 3DI6A 5KFXA 5C24A 2B6AA 1S4FA 4J9QA 5I3UA 4DL4A 2BANA 2UVRA 2YNGA 5DG8A 2IC3A 3LP1A 2FJVA 3BR9A 3GIJA 3BQ2A 3LAKA 2W7PA 1N48A 3KHGA 2YNFB 1RT3B 1IKWA 3MEDB 3TQ1A 2UVVA 1RTJA 3PJWA 4J9PA 1I6JA 5T14A 1HNIB 5C5JA 1RTDB 2GIQA 2ZKUA 1RTHA 4QWBA 5KG1A 4ED0A 2VA2A 1J5OB 3KLHA 4RNMA 2V9WA 4NRTA 4WXWA 5KFPA 2HMIB 3V6KA 3KK3B 1JLCB 3NGDA 1IKVB 1JKHB 1SV5B 3EPGA 2WONB 3MFHA 2R2UA 4I2PA 3E01A 3RB6A 1DLOA 3QIDA 5F8GA 2HWHA 4NLTA 4K4TA 4ED2A 5J1EB 4PQUB 3QGGA 2E9TA 2V4RA 4J9OA 4EBCA 4TYBA 4R5PA 3KHLA 3V4IB 1REVB 2R8JA 1RT5B 4KKOB 2BE2B 4ZP8A 2J6SA 3H98A 4KV8B 5EUHA 3GV7B 5CYMA 3SFGA 1TV6A 4YP3A 3MR6A 4RW8B 4MFBB 3DOKB 4O3OA 2C22A 4IFYA 2XI3A 1ZTTA 2AU0A 1FKPB 1C0UB 3DDKA 1VRTB 2XC9A 2DPIA 1EP4B 1JLQA 4M95A 4PWDB 3FDSA 3UPFA 1NNDA 1RT6B 2VG5A 3DRSA 3UQSA 4IR1A 3MR2A 2C2EA 4F4YA 1MMLA 1SUQA 1EETB 1S6PB 5J2PA 3KLVA 4URSA 3V6JA 1TKXA 4JV2A 3MTKA 4QW8A 1IKYA 5HP1B 1UWBA 3NMAA 3DOLB 3Q8RB 4K4ZA 4H4OB 4ECTA 1QE1B 1RT4B 4NLWA 3C6UB 4R0EA 3KK2B 2W9AA 3BQ1A 2XGPA 2JC1A 2FLNA 2AGQA 4EBDA 4JUZA 2IMWP 5J2QB 4RW7B 1GX6A 3RB3A 3DM2B 4I7FB 2FJWA 3KMQA 3MEGA 2YNFA 1KLMA 4NZ0A 3G6XA 3PW2A 2O5DA 4IH7A 3RAXA 3DRPB 3MEDA 4OL8A 4NLVA 3KHHA 5KFAA 1DTTB 2GC8A 3BREA 3T19A 4DL7A 4RUCA 1HNIA 4M94A 4ZP9A 2WTFA 3T5HA 1J5OA 2HNDB 4IDKA 3KMSA 5KG2A 3G6YA 1N6QB 1S9GB 2HMIA 2I1RA 3IGVA 4XPEA 3KK3A 1JLCA 3CJ5A 4TYAA 1RA7A 5EWGA 1RAJA 1IKVA 1JKHA 4ECXA 1SV5A 3VQSA 3OL7A 3BSOA 2FLPA 2WONA 3V81B 2B6AB 5EDWA 5J1EA 4PQUA 2FVCA 4QPXA 5L1LA 5L1JA 1C1BB 3V4IA 3Q8SB 1REVA 4G1QB 3N6MA 1RT5A 3TVKA 2BE2A 4GC6A 4ECWA 4IRCA 5CYQB 4KV8A 3FQKA 4MKAA 4ZPCA 5F8MA 3BSNA 3TAMB 1GX5A 4ED1A 4RW8A 4MFBA 3IGNA 3MF5A 3KK1A 5DGBA 3IRXB 1FKPA 1C0UA 1VRTA 2YNHB 4QWEA 1EP4A 4ZPDA 4PWDA 1RT6A 4H54A 3DLEB 1RDRA 4K4SA 2F8EX 4O3PA 3KLIB 3CJ4A 4U7CA 1EETA 1C1CB 4IG0B 5HP1A 5EWEA 4F4ZA 3DOLA 2EC0A 4KE5A 4MIAA 1JLEB 4H4OA 5KFNA 4I2QB 4ZPBA 4TQSA 2W9BB 1FK9A 1RT4A 3C6UA 2IBKA 3KK2A 4TLRA 1K1QA 2XI2A 3QO9B 4DG1B 2V4QA 4WE1B 5J2QA 5L1IA 4I7FA 1LW0A 3PW0A 3HVTB 1RT7B 3DRPA 4ECSA 2C28A 1DTTA 3UR0A 4JV1A 4X2BA 3LALA 2BQ3A 1K1SA 2IM2A 1N6QA 1S9GA 3Q8PB 2OH2A 5KG6A 2RDIA 5KG5A 1LWEB 1XR6A 4LSNA 2D3UA 1UWBB 4IFVB 3QGIA 3V81A 1JLAA 4WZQA 5DLGA 1N4LA 2CKWA 1WNEA 2RDJA 4ECYA 1C1BA 1S1XB 4G1QA 5KFIA 2UUWA 3MEGB 5CYQA 1S9EB 3JSMB 1KLMB 4IKAA 4MK8A 4DL6A 3TAMA 2ZD1B 4YR3A 4TXSA 1JX4A 3IRXA 5KFSA 5HLFB 4FBUA 3CJ0A 4TY8B 2YNHA 3GV8B 1HPZB 3MR5A 4IDKB 2WOMB 1JLFB 2ZE2A 3DLEA 3HVAA 4RZRA 2JLEA 2B5JB 2HNZB 2VG7A 3IS9B 3KLIA 5KFTA 5KG3A 4WYWA 1C1CA 4K4XA 5I42B 2RKIB 3NAIA 4NLUA 4IG0A 4ED7A 2C2RA 1S10A 4ED6A 3PW5A 2J6TA 1JLEA 3BQ0A 4I2QA 4Q45A 3MR3A 4ECUA 4ZMMA 2W9BA 2BRLA 4TY9A 1RYSA 3OL6A 3GILA 3QO9A 4RW9B 4IG3B 4DG1A 1TL1B 5KG7A 4YR2A 3PR4A 4RNOA 4WE1A 2XCPA 4ECRA 4LSLB
chains in the Genus database with same CATH superfamily
1FRMA 3KDOA 2E5HA 4FS1A 1T11A 3D0HE 1D09B 3NGSA 4RBTA 4LUBA 3K57A 1S1TB 2ROPA 1WSVA 5D8HB 1W25A 2GGPA 4Z2XA 1JLFA 1RTIB 2B5JA 4Q0BA 2JLFA 2HQFA 2W4PA 2ROGA 1SJQA 1N5TA 1Q16B 1WC6A 3H2VE 2UUAJ 2M3DA 2BYCA 1ZM3A 4ILLA 1T95A 2L9DA 2FC8A 1RKJA 1DQ9A 1OPIA 2C2OB 2QV6A 3R3TA 3UI3A 4CLPA 4NEZA 1PGZA 4YB5A 1BY9A 1JJHA 2AEFA 2GZOA 4DEZA 2Z0GA 2W2MP 1ZH5A 2OPPB 3D1OA 2FB0A 2IVMA 4M5DA 4F4AA 1F3FA 2V63A 4A8XA 4DV7J 2AEMA 4RWXA 2IDEA 3ZZPA 4OV6A 3UCUP 4N41A 2LXFA 3D28A 5KT6A 2IJNA 3C8YA 1DTQB 2C3MA 1NK4A 3BKTA 2WBRA 1LFWA 4FYXB 4WU3A 3J7A1 4ERDA 1R7IA 3R2DJ 2F7VA 1JXLA 4CO5A 3N6NA 4ZN3A 4ED5A 3AH6A 1EKRA 1Y10A 4B9LA 2DB1A 4KO0B 2XY5A 5CABA 1YJ9S 3GIKA 3PFOA 1S1UB 1JLGB 2DPJA 3OFHA 5GMDA 4OJGA 2QIFA 2ZBIA 3C6TB 2LMIA 2E5GA 3HVWA 4IH6A 2MY7A 3S7RA 4H4KC 5BXIA 3K5PA 2WB4A 4DS5A 2IM0A 1B0PA 2BKNA 5IWAF 1FWKA 2W9CA 2NCKL 1TVRA 1SPBP 2HHVA 4X4VA 4FS2A 3PIPQ 3MD3A 4WP3A 2UXDF 4HH1A 1KVJA 4DWIA 1EZZB 3SYZA 5IC6B 1OY9A 2QX0A 1TL7B 2WVCA 3CO9A 2J7KA 1S99A 3CDEA 2QE5A 1HA1A 5B0GA 1AUSL 2QJ3A 2YWFA 3LQVA 5KFMA 4IFYB 1F5CA 2QA1A 2HNDA 2ZDPA 5J2PB 3AY0A 2YX1A 3W61A 3K5MA 3G82B 3W3SA 2BANA 2UVRA 4USTA 4X84A 1AYEA 3MEDB 3K5LA 2LECA 2UVVA 1KQKA 2X51A 3KXDA 2BZ2A 3PKMA 2V9WA 1B7FA 2F4VF 3DKDA 1JKHB 1SV5B 2CQDA 4I2PA 4PQUB 4B3TF 1U6BA 2FGOA 2LLZA 1YDLA 4XDCA 2YXLA 1FKPB 4DZDA 4M95A 2C2EA 2X3GA 4N47A 4FF2A 3NMAA 1W7WA 4J90A 4WFAQ 1NPKA 2IMWP 3KMQA 2CQBA 4NLVA 3BZQA 4RUCA 4DR5F 2EI5A 3D6HB 3TVZA 4IDKA 2QO3A 1T7PA 3BSOA 5HVHA 3VR1A 4PXBA 1RHUB 5K8NA 4IYQA 4F8RA 2WSCC 2OEJA 5DETA 3FSXA 1OQ6A 1RBLA 4IG0B 3DCAA 1FK9A 1VC5A 5L1IA 1CC7A 2CFXA 3T3FA 3AOBA 1RHJB 2XS7A 2XBPA 5IWAJ 1Q8KA 1DARA 1RZMA 3HO1A 1WOSA 1SIZA 3DDNA 1EB0A 2N7YA 2ROEA 5ETSA 4LFBF 3DGVA 2UUWA 1ROFA 2IIHA 1JX4A 5KFSA 3GV8B 1BLUA 2FHJA 5A6WA 4ZVOB 2G1DA 4C6AA 3GILA 1VRUA 2ACMA 4NPOA 4TN2A 2ZH8A 4K4VA 3DLLQ 1D3WA 2RF2B 1H74A 4C0HA 4RPFA 4OZLA 1S1WB 3NL0A 5KT2A 3V6HA 2ZD1A 1RHKB 2GAHC 3W2VB 3SEOA 3M9OB 2UUTA 1VYAA 4PPZA 2RIJA 1EAYC 4LREA 4QU6A 3M30B 4NYZA 2W2QP 3H4DA 4QYRA 4RW9A 4C11B 2IVFB 2K2PA 4KAIA 2HVIA 2Z56B 4CLYA 2IA6A 1K44A 3MCSA 4U95A 4UF4A 5B0DA 1P1LA 3PHTA 2ILZA 1S97A 3ITHA 4DPUA 4Q8EA 5KFQA 1SKUB 1YHQS 3R5JB 2R7RA 2QSWA 1VR6A 1JK9B 1Q1KA 3ET6B 4EYHB 4OYZA 1QUVA 3IXQA 1N0VC 3I0SB 2MQQA 4JI3F 4GKKF 1RE1B 4DR5J 1CJTB 4M5HA 3S6EA 3ZZ0A 1ZM9A 2XMJA 3Q89A 3NBPA 3MMCA 2V2VA 4Y3CA 3E3XA 5JMNA 2HHPA 4YFUA 4K4YA 4Y2CA 2RQCA 5C25B 2V50A 4F4WA 4FDFA 1IBLF 4NZ7A 4S0MA 2HLTA 1NHVA 3V4MA 4OIXA 4WBFA 2MGZB 4ID5B 5DQHA 3CD6S 4X4NA 2NPIA 4LFBJ 4DV0F 1GTEA 3MD1A 2UUBF 3CCES 2NYHA 3MM6A 3G71S 4ZS6A 4RBUA 3QGPA 2CQHA 1LWFA 3KYLA 1Y4ZB 5A8RB 3OXLA 1Q81T 3AOCA 2D74B 3H8YA 3HK2A 3ZNJ1 2MMYA 3BH6B 3H40A 2ASLA 2XWYA 4KKOA 4JI1J 2BOPA 2YPZA 4HVZA 1XJWB 4WIQA 3KLHB 2ASJA 1UW4A 4QWDA 3EYZA 2BE9B 2H65B 1HBNA 2V4JA 2Z2YB 5F3ZA 3W66A 1VBKA 4USVA 3KKFA 3DRSB 4WFYA 1T02A 5F8HA 1B0TA 3H20A 4URGA 1AROP 3IAM9 8RUCA 1E6VA 2YY3A 1Y3JA 5T7LB 4KY3A 2KH9A 2YTCA 4ILMA 3M1VA 2ZH7A 1O6XA 4DR6F 3PX6A 2CDQA 5ETNA 1BUXA 2ERRA 1DLOA 3K2YA 1KD1T 2KKHA 3HFVA 4ZP8A 1XMOF 1HWIA 1S6OA 3BKFA 4LBPA 3NS7B 2C22A 4JI3J 1HI8A 2DNMA 8AT1B 2VFVA 4DR4F 2DGTA 4P6QA 1S6PB 1KRPA 3M2RA 5HP1B 1WEXA 5A2QU 2X7IA 3UCZP 1FT8A 5J2QB 2O67A 3DRPB 1IBLJ 3CCMS 3LGNA 2R9LA 2I1RA 2RDJA 2EFOA 2EXUA 1REVA 4UOHA 4ECWA 1U25A 4MFBA 4F25A 1WTFA 4PWDA 3DLEB 3D1QA 2H48B 4XTTA 1EX8A 4MIAA 1UVNA 1P9YA 1A9NB 1NK0A 4DV0J 2UUBJ 3QO9B 5D4OA 2C2NA 1FD8A 4RBVA 3VALA 2C28A 2MLZA 2W2NP 3VCDA 2GCFA 1OWXA 1UVMA 1UWBB 2G13A 1DURA 1SB6A 4OZ2A 1MROA 1DQAA 1OMSA 4LF6F 1G6BA 1FNMA 2CNLB 3NWRA 4FBUA 1HPZB 4F26A 3PX0A 2EKYA 3HULA 3O2IA 3OT9A 1KR4A 4JI4F 3MCOA 4OI2A 2Q1LA 3RAMA 4OJ3A 5A8WA 2C2RA 3ULHA 4X65F 4TY9A 1RTZA 4RNOA 1ZZFA 2JVOA 3SQGB 4J91A 1A0OB 4C8KA 2P6TA 3O8WA 1VBXA 2M5YA 1GNKA 2A2DA 3LA0A 4G1IA 1S1XA 2A2CA 2NXJA 4MTPA 1L3VA 1QLNA 4F36A 3CXCR 5KT3A 3LPYA 2WOMA 2EFVA 1HNVB 4PYDA 2DXDA 1RWVB 4DR6J 3VGVA 3A13A 3O44A 2CQ4A 1TL1A 4A8FA 4O0NA 3MECA 3U1LA 1YIJS 3WQPA 4FXVA 2HHHJ 1XMOJ 2RVJA 3WHIA 3RB4A 2UU9J 3CD7A 4PG7A 1R6VA 4M5JA 4ZLPA 1S0MA 2GMJA 7FD1A 1X4GA 3R7NB 1YVFA 3MGJA 3CJ3A 2POKA 3KOAA 1FEEA 3M6WA 1VQ4S 5LXRA 3DMJA 2PI4A 1UFLA 2OTLS 2KT2A 5AXLA 4UQTA 3DYAB 3MMAB 1IQZA 3MAAA 5KFZA 2Z4PA 5K8OA 2OI2A 1BD6A 2Y1RI 4D3HA 4J37A 3FFIB 2R8IA 4BWJA 2V94A 2M8HA 4ILRA 3EPIA 4WZMA 5HROA 5JVGQ 5IZHA 2BACA 1URRA 2P6SA 4LVNP 1U48A 4DLGA 2WB1D 3T5LA 1R43A 1MWYA 1S0VA 4ZHRA 3MEKA 4ELUA 1YRUA 4JV0A 1FRIA 2KO1A 1RT1A 4NE9C 5KFWA 4LFCF 1SKRA 1XN9A 1K9MT 4JI4J 4IOBA 4NEYA 2XMKA 3DRRA 3D2WA 3P6YC 4CT9A 1U45A 4X65J 2I5JA 3J81Y 5GADI 4KHPF 2Q6BA 2O66A 1MU2A 1H6KX 3NGTA 2Q3PA 1UVIA 1CLFA 3NMRA 1M5HA 2EW9A 1VK3A 3I5AA 2WW4A 4JYAF 2MY8A 3A3PB 1RHRB 2WAQD 4Y2MA 3W60A 3W8PA 1F2HA 1L3TA 1LK7A 1TV6B 3VZIA 3MEEA 3IBWA 5IT9Y 1SUQB 2HHTA 1TL3A 3AQPA 2GQ2A 5IT4A 5F0UA 4DPWA 5C24A 4NI2A 4DL4A 1NK5A 3GCWP 5IXUA 3UD3P 4HR2A 3KHGA 4TNOA 4OZ5A 5C5JA 1RTDB 4ED0A 2F5GA 1E6YA 1YJTA 1NJWA 3QIDA 5J1EB 2HLUA 4OI4A 2J6SA 1KS2A 4J9VA 1VRTB 2HG4A 3MPUB 1RT6B 4LF9J 4Q2LA 2QA2A 4HL9A 1VMBA 3AFGA 1IKYA 2QT7A 4Y0FA 4HT7A 1XBWA 1FO1A 1FJ7A 4R0EA 3RBZA 3SDEB 1YG0A 1HWKA 2FJWA 2NXUA 3OXFA 3GLJA 2LEPA 4KR0B 3T19A 3BH7B 2AKWB 4YB7A 2CDRB 2WONA 1RUSA 4QPXA 5L1JA 2J0XA 4N5SA 2IPOB 3M6UA 4MKAA 3T1HF 3HSDA 4H54A 2E7WA 5FLXY 2DHGA 2DY9A 2A6OA 1NB2A 4OYBA 2C2KB 1RWXB 4LFCJ 2V34A 2LQ8A 1MN7A 4PQAA 2M52A 3K5NA 5DLGA 1WNEA 4OQJA 4ZCLA 3T9ZA 4LFAJ 3MEGB 4KHPJ 4ZDNA 3IRXA 4ZLLA 2YNHA 2GGPB 4ZVRB 1JLFB 1UFWA 2B5JB 1QM9A 3A12A 2ATCB 3NAIA 1HR0F 9ATCB 5ITHA 1XNQF 4JYAJ 4U96A 3VAFA 2VD3A 1RHMB 1X8DA 5SUHA 1J2VA 1S48A 1YX2A 1SJRA 1LWEA 1YI2S 2H51B 3M9MB 3BGUA 3O3LA 3QT8A 1HIYA 4ECQA 2AZ3A 4PR6A 4ZA1A 3JQMA 3GFYA 4M5DB 1R0CB 4DX6A 3WC0A 2NYIA 2HNZA 2PGCA 1SH3A 2ZWPA 2CQ3A 1JLAB 2DH7A 2COLA 3HDSA 4K2XA 4YY3F 1XIQA 1BXNA 3WX8A 1P8GA 3G6ES 3G8SA 2MHNA 1R6YA 2W7OA 2OD6A 4N7TA 1LW2A 2K3IA 5KTQA 4ANEA 1HYSA 3BGOP 4DV6F 3HHNB 3SCJE 2ZH6A 3EGWB 3VAJA 2W1BA 2YKOA 1HQUA 4L3NA 3EGNA 2I6WA 4AE5A 5E2QA 4UZCA 6AT1B 3I0RA 3D4JA 5DO2A 1F6TA 1OS5A 2XCAA 3T1HJ 5K9FA 2UUCF 1VFJA 3M2VA 5K14A 2OD4A 2W9CB 2KI2A 2V6AA 4O4RA 4F0HA 2FZGB 1X5PA 1TVRB 5F8JA 1QJHA 4V1Ak 3FBCA 5C42A 1HFEL 2QLBB 2G0IA 4FKYA 2HHUA 2YKAA 3OR1A 1FDNA 2QA4G 1FHTA 2PFDA 1RGVA 2GIFA 5DG7A 2PMWA 4DV2J 3FCHA 2C2MB 2HWIA 1SC1B 4J9RA 2MZQA 3JSRA 2XZDB 2IYGA 3DRYA 1ACMB 4DSEA 1TL4A 1GXTA 2JOQA 3QIPA 2C2ZB 2DRAA 2A1BA 1HR0J 2R2TA 2HW3A 3GIMA 2LQ9A 1Z2LA 4Y34A 2IVYA 4LF7F 2YKNA 3H25A 1Y5IB 2BANB 3SSRA 3R5CA 2K7KA 1IUJA 2ZBQA 4LF8F 2YKMA 3DOKA 3M8PA 1KN6A 4DLEA 2MZSA 1FXRA 5AT1B 3MXHP 1V6HA 4NLQA 4XO0A 1T3NA 3IWLA 4P2MA 4I2PB 4QIGA 5HQLA 3LO3A 4NLYA 3BPSP 1NH7A 2QZ8A 1VK8A 1PBAA 4RW7A 3QJLA 4Y2IA 4XAKA 2LA6A 3HHLA 1FWPA 1SH2A 2CQ1A 4M5GA 2FLLA 4C7QA 4YY3J 3TUPA 4YS2A 2N7CA 2FHOB 1HBOA 4LVOP 3CCJS 1DAXA 1CVJA 4ZLJA 2LU1A 3U02A 4DUZF 3EXCX 4CRJA 5LJ3Y 4DV6J 2FC9A 2FHMA 3EGZA 2CADA 3O5TB 2XI3A 1TAQA 2YWHA 2UV8A 3DN9A 3CCQS 1I1GA 4URSA 4DSJA 4QW8A 2KYXA 4TVAB 4WFBQ 4DI6A 4Z7YA 2VICA 1HNIA 1YJVA 4M94A 3A4TA 2VDIA 3KUHA 3KK3A 3FSYA 4WK1A 3D6TB 2DRDA 2EG1A 4LF2A 2MYFA 1WG5A 2NQPA 2DCUB 4K4SA 4DSKA 5K20B 2IBKA 3TR5A 4J5OA 1Q78A 1NKCA 4DQIA 3KWMA 2LVWA 4ELTA 2CJAA 3A8KA 1EQ0A 3LUYA 4LF7J 4ZPWR 3TAMA 4KGVB 2ZD1B 5B0AA 3BO2A 3CJ0A 5BYRA 4LF8J 1XQIA 5M2PA 4JI0F 2PIIA 1RYSA 4RW9B 4DG1A 1X5SA 2EBGA 2GMHA 2W01A 1Q5YA 6FD1A 2JWNA 3AODA 2KL8A 1N56A 2AF6A 2LEAA 3TZZA 2VPWB 3T1AA 1LV5A 2ADCA 2VOOA 2DR5A 5E5NA 1UEKA 4MYUA 5L1KA 1VQSA 3PEJA 4IR9A 4LRAA 5I3QA 4MK9A 5B08A 2E7XA 3AHPA 3TX8A 5HLFA 4TY8A 3IM8A 1GTHA 1VLYA 2HHWA 1NH8A 2DITA 3NBPB 3MMCB 2G2OA 2XY6A 4DUZJ 4PG4A 4LSLA 3PYDA 2BJEA 4BBYA 1QTNB 2QL7B 2F9DA 1PCAA 4NLOA 2IRXA 4R25A 1JLGA 2LXIA 1CULA 1C2PA 4J9MA 2L3MA 2XTJP 2HK3A 4YOEA 3JAMU 1N34F 1XNRJ 2DGVA 4NLDA 2CA9A 5HAOA 2KJVA 1IN0A 1H72C 5FD1A 4C9DA 3G9CA 2BUNA 4K0KJ 5KFRA 2E9ZA 3C14A 1JNRB 3CCVS 3OFGA 5HANA 5HN0A 4F3OA 3UN5A 1RT2A 1TELA 1LWFB 2M2BA 3IR5B 3A8IA 4X4RA 2M0GB 2CJQA 1KDNA 4X62J 4NCGA 1KBRA 1GAOA 4AQYF 4OZNA 3CSKA 5BYSA 2HQCA 3ZTPA 1GXUA 3RRHA 4ZP6A 2VL1A 4KGXB 2CNNB 4O3RA 4Q5VA 3C15A 5HSPA 2CVEA 1VCTA 1M0SA 1WTBA 1RP5A 5KOXA 1HBNB 1Q8BA 1S5ZA 2AEJA 2V4JB 2IBOA 2XLJA 5EWFA 1X4CA 4WTOB 1Y3KA 2CIMA 5DGAA 4JI0J 1TK8A 2Z30B 3IM9A 2JSXA 4CO1A 5K8PA 1NM2A 3I9V9 4RW4A 2FJDB 2W4DA 2WVEA 5HMYA 1E6VB 2E1MC 5D4LA 3VV2B 1LWCA 2N4DA 3W8GA 2QC3A 2R4FA 1WKJA 4PXDA 4ZVEA 4DR3F 3M1VB 4DV1F 3V5RA 2XM3A 2B9YA 1T05A 4I1TA 1MWZA 4KC5A 3OUYA 2KG1A 1WKKA 4C8LA 1N5YA 1DLOB 3UNYA 3NNCA 3A3OB 4RNHA 4WXOA 3J7YU 4PCQA 1NUEA 2VC1A 1RAAB 5KG0A 2BA9A 1KTQA 1JLBA 3AJDA 4FPRA 2P9EA 1D8ZA 1UEVA 5I3UA 2BKPA 4GO7X 1KKHA 3JTOA 5DG8A 3P49B 1N48A 2B7BB 3RTVA 1FWLA 5T14A 4GVLA 7FDRA 1FRJA 5HMWA 2LEBA 4F2RA 3EPGA 4DXLA 4NLTA 1HI0P 4ED2A 2E9TA 2L9WA 1REVB 1N34J 4WK3A 1S79A 3SFGA 4MFBB 1ZTTA 2XC9A 4LR7A 2GNKA 4PWDB 4IR1A 1XWLA 1RI7A 5D4NA 2UXBF 1U8WA 2XLIA 5D0RA 3JSBA 1I51B 4ANCA 1PO6A 3N28A 3Q8RB 1M5KC 4NLWA 1MG7A 3TA1A 1S76D 4I67A 3V2UC 3DM2B 1JB0C 4A8QA 3EX7B 3G6XA 1WOOA 1NDPA 2BX6A 3BS9A 2X3DA 2RRBA 1WACA 4NMXA 4FXDA 1MROB 1N33F 2LDIA 4ZIWA 4KV8A 4OX6A 4ZPCA 3TEGA 3TJAA 4AQYJ 1NK8A 1P6TA 2VASA 2AJ1A 4ES3A 2HQIA 4A8SA 2BM1A 2I9SA 3FNNA 3CJ4A 1KQFB 5A8WB 5EWEA 2HK2A 3TARA 4YUDA 1FJGF 3BBCA 2OAUA 3CO0P 1I5OB 1XTZA 2FZKB 1P1TA 4GKJF 3HHLD 2RUGA 3R9LA 2VQEF 5KG5A 3N79A 1ITPA 3QGIA 3OVBA 1M90T 3RR8A 1TUGB 1N4LA 2R42A 2HS0A 1S1XB 3VQTA 4ETZA 2WOMB 1VQLS 4OFZA 3EVMA 3S1TA 5IS2A 2HURA 4DR3J 2MJUA 1FVSA 4QZVB 1S10A 3BQ0A 1QVFR 1FA0A 1TL1B 4JI8J 4U8YA 4ES2A 3MECB 2HIYA 4M5IA 1WOPA 3CWJA 1VQNS 2KRRA 2C42A 1YQHA 1CJTA 2MSTA 2HVDA 2ZVSA 1U6FA 3RW6A 2JEJA 4JI6F 5C25A 4B9MA 3WIVA 1CJVB 3W64A 3IS9A 3M32A 4PXCA 3DMJB 2VHGA 2YWEA 3NY0A 4DL5A 1FX4A 2HFNA 1Q7YT 1U09A 5IOLA 2P8IA 2XYPB 4EO6A 2HBZB 3MAAB 4E0DA 4H4MA 3X3UA 2ATLA 2ALZA 4J9LA 4ITSA 1ZM4A 2ZC4A 3ENAA 2FVSA 3OTBA 4WIIA 4DX7A 2X1FA 4CZCA 5HROB 1RBAA 3MR7A 2BJDA 4ELVA 3CD0A 1NKEA 5D78A 2ASYA 2BBEA 1V5VA 1RXOB 5AXNA 1N33J 4ZHRB 3E51A 3GJSB 3JYTA 2GA7A 4UOCA 3M2UA 2HRYA 3RJMB 1RT1B 1C4AA 5ETTA 4F4XA 1VJWA 1I3OB 3DRRB 4W90B 4OI1A 2RQMA 3PJ9A 4UQGA 3EZ5A 2I5JB 1RU2A 1BQNB 1BQMA 1TFYA 1F60B 2K3KA 5KFGA 4GKJJ 2VQEJ 1MU2B 1UFKA 1TP7A 4MYTA 1T8EA 2V8HA 4B9TA 4C4WA 3WBZA 2D69A 4ZVUB 4WFZA 2AV5A 4DL3A 1XK8A 3U27A 1LFPA 1NMEB 1IM6A 1CEZA 3MEEB 3EWGA 5AE3A 1TL3B 2CNOB 3CGIA 5KG4A 5C24B 4NI2B 1U4BA 1TKZA 1SJ4P 4WPAA 4I0WA 1PC4A 2A0FB 2OPQA 2VBWA 4HEA9 2BR0A 1UVLA 4DPXA 3LP2A 4B9UA 3KHRA 2HIQA 4XPCA 3EE3A 5KFHA 2CPZA 4U7UD 1E6YB 5A2QY 1NJZA 1S6PA 2KRBA 4ZCMA 1S0NA 4CM2A 1IBKJ 4P7TA 2VFSA 5FDLA 4MH8A 2RH3A 4JI6J 3H59A 1K0VA 3OL8A 1GH8A 1RWPB 4KB7A 2F40A 2PEBA 3F44A 1VHFA 3BF4A 1VQ5S 1IKYB 3HHEA 3OVSA 3LP1A 5CXTA 2HEKA 1RT3B 4X4QA 3TVYA 3CJKA 2GIQA 3FRYA 2WSFC 2J9CA 5HQ8A 2WONB 5HMXA 5LJ5Y 4DZ6A 3F0NA 3TQEA 3H98A 2JFKA 2RMLA 5CYMA 2C3PA 3DDKA 1J27A 4P7VA 3UQSA 1HBUA 2QL5B 3KLVA 3V6JA 1UWBA 4TLQA 4A8MP 3LWLA 1PKUA 4EBDA 4JUZA 2CPEA 2CPXA 3PW2A 1RAFB 3KHHA 1XMBA 3QT5A 1OYEA 1X9SA 1X4DA 2RAQA 4IOAQ 5LSRA 2FLPA 1YK9A 2CQCA 3KFWX 4ANDA 1UTAA 5L1LA 3QT7A 5L9NA 3R7SB 3AQOA 1OJ4A 3FQKA 3J81j 1GEHA 2WW8A 3E2EA 3IRXB 2YNHB 4FPIA 3TI0A 2MKHA 4U7CA 1EETA 5B7WA 1J5EJ 4H4OA 2M88A 3NOCA 4I64A 4IOCQ 2NR0A 2JJ4D 3G2XA 1DTTA 1AA1B 3UR0A 1WUUA 3BEGB 5D77A 2CPDA 2IM2A 2KXNB 1VDHA 1LWEB 1RU1A 1XR6A 1VGYA 4QR0A 4NASA 4G1QA 3FK4A 3D9BA 3CB4A 1KLNA 2HGMA 4EFAC 5A76A 3MDFA 3PNIA 3VVUA 1JNZB 2HNZB 1MMDA 3TEHB 1HQ2A 1X4EA 4NLUA 3MWBA 1Q4RA 2J6TA 3R5AA 2DNKA 2MPUA 2HFVA 4NWBA 5GAGI 2NUUG 3OPKA 4NOHA 1ZM2A 4PZVA 3NRBA 2OFGX 1CSJA 2RUSA 2N3LA 3US5A 3G8TA 2W25A 3KJFB 4B3MF 1LW0B 4ALZA 4ZVQB 1HYSB 1FRLA 1CG2A 2L9NA 1R8BA 1HQUB 3R6LB 1R8AA 4LSNB 4AL7A 4RL1A 4USJC 2J9DA 3KG0A 3MURP 3D3CJ 3CJSA 4I6WA 3I5BA 4OX9J 1V3SA 1UAWA 2MQLA 5LMNF 5LMUF 4I4BA 2VG6A 3BN7A 1VQ8S 2HNYA 1YRTA 2DNHA 4J9SA 1O5JA 2AZ1A 4DSIA 2CVIA 3FC9A 3M2VB 5K14B 1QTMA 2ZC3A 3PYEA 2CQGA 2AW0A 5IM0A 2HHQA 3KLFA 1DBDA 5C42B 4A4JA 2FVRA 1HHTP 3J7ZT 3OR1B 1FDBA 1T9YA 2QMXA 3U1MA 2UVWA 1PJ7A 3G8QA 3IP0A 5DM7Q 2DH9A 2D9PA 4HLBA 2KHDA 1KONA 1UKUA 2XWXA 3OFEA 1H98A 3OSNA 3QIPB 3QATA 3CMAS 3M8QA 5CH7B 3L09A 5DLFA 2XLKA 5DJBA 1W2IA 3MMBA 1OO0B 2YKNB 3KTQA 2RDDA 1R89A 2IYIA 2I2YA 2FDNA 5J2MA 2YKMB 5J1NA 3M8PB 3U7JA 4DQPA 4KYZA 2Z2MA 4ZJQA 4OX8A 1HQEA 4GRSA 1U2CA 1KFDA 5ETVA 1ZOTA 1BQXA 2IFXA 5E3AA 1M5SA 2F65A 3HHLB 3BYPA 4K4UA 4ZPTR 1RTDA 2U1AA 4C98A 1FRHA 2VU5A 2R8HA 2M8DB 4J7CA 2OJ3A 1S0OA 3BSCA 1FRKA 4Q44A 1YJUA 2WSEC 3LANA 1HBOB 3PR5B 1NJIT 4B3MJ 1WHVA 2LQ5A 2ILYA 4USUA 3DLHA 3FQLA 2NZCA 2ZH3A 2Z58B 1RB0A 3ONQA 4C8NA 2WCXA 4RNFA 2CNKB 1QVGR 5L38A 3I56S 4O44A 1T9WA 4UY8T 1UCNA 1KC8T 4LR9A 4U9RA 3QPIA 5LMNJ 5LMUJ 3TAPA 1WF1A 2RD5C 1Y9OA 2ZDOA 2MKYA 3BQ2A 5M2UA 3BGLA 2GJFA 1HNIB 1VQ9S 5CCLA 3KK3B 4IO1A 3DLJA 4DFMA 2RE1A 3E01A 4J9OA 3WX4A 5E33A 3Q8UA 3C3LA 2DPIA 3OBIA 4OZ3A 2OSRA 3UPFA 3MAHA 2ZEJA 1MMLA 3IWNC 3D68A 3IC1A 4F2SA 3IFEA 2LCWA 1Q86T 3MEGA 4P2FA 1HNXF 2LKZA 3M6XA 2F3JA 4CDIA 3CCRS 1B0VA 1QAYA 1K47A 2WVDA 1H2TZ 3TW0A 2VDHA 3CNQP 2FVCA 2N3OA 1RACB 1RT5A 2MTLA 3TAMB 3B78A 2YBVA 5IQ6A 3DNCA 1EP4A 1G3OA 4DBQA 1KFSA 2B4UA 3O1LA 1Q8IA 1H0HB 2YH1A 2AD9A 1UL3A 1YRXA 4B9NA 1S72S 4ZPBA 1RT4A 1HD1A 1K1QA 4DG1B 3UCGA 1VQPS 3QWUA 3ILJA 4NXMF 4ECSA 1WHWA 1FVQA 3ZO7A 4DUTA 3SV3A 1FE4A 1S9GA 1U1PA 1OQ3A 5HL7Q 1JLAA 1NHKL 4CLTA 1VQ7S 4ZIVA 2R7XA 3JB9k 3ETOA 1FI4A 1RLCL 4RJVA 5HLFB 4UT4A 4TY8B 3MR5A 1Q7LB 5KG3A 1C1CA 2DR7A 3CJRA 5GAHU 4I2QA 4EI2A 1PAEX 2H1YA 2X1BA 3OL6A 2ZH5A 1G2EA 4X66J 4WE1A 4LSLB 3FCVA 1RAHB 3LWMA 2DD8S 1VISA 2HFOA 1CULB 2JDJA 2KZMA 2E5JA 1U0HA 3DDIA 3PRBA 4NA2A 1VJQA 2VH7A 1FDDA 4ZJOA 4FKXA 4PWUA 2CJBA 2OMOA 4ED3A 4GMKA 4HHJA 1X9WA 2G2ZA 3J7AN 4ZVTB 5H9EJ 4EZ9A 2R7OA 2BABA 5L8RC 3MM7A 3PHEA 4HYKA 4UUWA 3GG1A 1WC5A 1BHNA 2VFRA 4NLSA 3OHAA 2E29A 1Q5VA 4ZK7M 3C14B 5CCMA 4KPYA 2XZWA 3K8VA 3FEXB 3N5FA 4JV5F 4BWMA 1RT2B 4ZJLA 2KVIA 2VFTA 2WK4A 2HAIA 1IBCB 3PZPA 4NCGB 3CPWR 1HNXJ 2XYHB 3D0GE 1ZAWA 3RRKA 1FKOA 2PD1A 2BMBA 3C15B 2KXFA 5GMKa 4TU7A 4M5KA 3OTEA 4FVMA 3QSIA 3AJ2A 2LDYA 3B54A 3VF0B 2KTQA 3KLGA 3I4PA 4ED8A 1YJRA 3EMTA 3BR8A 2EBEA 4OHXA 3PYFA 1FFSB 5CYJA 3QAUA 3GR0A 3NS6A 4B3OA 1UJ4A 3ISND 4NXMJ 1REGX 4RW4B 2YWGA 1LWCB 3IN5A 1UA0A 1HNWJ 3DLKA 4OYAA 1T05B 3OUYB 1N5YB 2R7QA 3MPYA 1F2GA 4LQ9A 1F0XA 3EDQB 3HHDA 3QZ8A 2BEFA 3PO4A 2WZ1A 2NSCA 1XR5A 1TUVA 3PRVA 4PG8A 4X4OA 3Q0AA 1JLBB 1O8BA 2GV1A 3AD7C 2YQ0A 3DU5A 5I3UB 3TNVA 1VI7A 2EFNA 4CCHA 3O6QA 4OX7A 2R3VA 3MFIA 1VQKS 2AYMA 2XEXA 4GC7A 1DZ5A 2EG2A 4MAKA 3C16A 4K7QA 3BGRA 3FUYA 5KFYA 2DR9A 1PG5B 2ZH9A 1R0AB 4WKYA 3CJ2A 2GQQA 1TKDA 4TQRA 3OTOF 2RQ4A 4PYAA 4J9UE 2AGPA 3TP2A 1NK9A 1VHIA 3GYNA 4C2MA 5E3QA 3QSYB 4J9QA 4M1KA 3LAKA 2HZVA 4JV5J 2EC2A 4LF1A 2UZAA 3QFHA 1I6JA 2KFNA 4NRTA 4WXWA 4DMZA 1HWJA 1FFGB 2KN4A 2F8HA 1SXLA 5F8GA 4P74A 4IO9Q 3P8BB 2Q66A 3BO3A 4EBCA 3P45B 4KV8B 1QAXA 3CEDA 1U1KA 1X0PA 5D0EA 2VKRA 3FBBA 4JI1F 3CJ8A 3GIRA 2YX7A 1SQFA 2DK2A 1VBYA 4DR7F 1QE1B 1K73T 5AE2A 1SL2A 4LJMA 2EFPA 3RAXA 5HO4A 3QWPA 5KFAA 1KQSR 3BREA 2JRSA 3CT9A 2VBYA 2WTFA 3G6YA 1IWGA 2J0SD 4BC7A 4TYAA 3FKBA 3VQSA 3MM9A 1GMVA 4FNIA 2ACYA 4DQSA 4GC6A 1CJKA 1VC6A 5F8MA 2B4PA 2AJ2A 5LXYA 5DGBA 2XMTA 4OLPA 1U1MA 1Y5LB 1RLDA 2E66A 4QU7A 4CYUA 1UPPA 2CG8A 2DGQA 2ZHAA 2DR8A 5L39A 4KJIA 2GO8A 1TR0A 1JJCB 2VOPA 1N6QA 4ETXA 2ZJRQ 5G0RA 1DHMA 4WZQA 2VQFF 2BOAA 2M70A 2D9OA 3HFZB 1F5AA 1PC5A 2F8MA 5HI7A 3W9IA 5CYQA 1ICEB 2C3YA 1QUPA 2ZBRA 2EK6A 2LQJA 2JLEA 3IS9B 3DU6A 3KLIA 4K5RA 4WYWA 3M32B 4N77A 3PW5A 3LGMA 1RABB 4TU8A 4ECUA 1UZDA 3JAMY 3Q8YA 4ECRA 4YEAA 1RT7A 1L3KA 1NJXA 2JEIA 1HD0A 4O3NA 4DQRA 2DXEA 3UNGC 3OTOJ 4H4MB 4IFVA 3H42A 1S77D 1X4FA 2KM8B 4PG6A 3HT0A 2XMAA 5EX3A 2DIUA 5IV4A 2DISA 2FJEB 3MAQA 2BXJA 2Y0SD 4FVCA 3UVJA 1U47A 1FXLA 5JXSA 2RKIA 1TTHB 3BSAA 2B43A 1WJ9A 2P5VA 3FRZA 3RRGA 4C3LA 5M2RA 3I87A 3JYTB 3NLCA 2FVQA 3M2UB 2ZOFA 2H9ZA 1RBOB 2YX4A 4KH0B 4OHWA 4DS4A 3EZUA 3SQOP 1RJJA 3THVA 3QLHA 2ZUAA 2QGFB 4DR7J 3HD1A 2CG4A 2E5IA 1NSAA 1CS4A 1F5BA 1BQMB 3H5XA 4MIBA 3RBEA 3H5UA 2FYXA 3UO0A 3DXBA 3HSZA 5FIIA 6FDRA 1K0TA 2ZOMA 1FKAF 2LU2A 1M5VC 2Y9HA 1Q79A 3AB4B 3M8SA 2VONA 4NLXA 1GFWB 4Y6IA 5KT7A 1PAUB 3OTCA 2GO9A 3ELHA 1KQGB 3FZ2A 2MXYA 1TKZB 3W63A 1ZZNA 3EXYA 2HHHF 3VHQA 2OPQB 3Q83A 3N0VA 2UU9F 2BJ9A 3R5BA 1UETA 2BW2A 2AGOA 3LP2B 2ZNZA 3D1HA 5E3RA 2DBBA 2AMCB 3D3BJ 2QYCA 3R6GB 2VQFJ 1WI6A 2HRUA 3Q2TC 3R1LA 1A6LA 3WIUA 1S1VA 4RU9A 1Z1ZA 5FDLB 1APSA 3W2WA 1Y0HA 2E1CA 3VZHA 2HS3A 4UZBA 4OI6A 3M4XA 1S7IA 4DR1F 4U7UK 3I82A 3LP1B 2ASDA 2DNNA 1RWKB 1JIHA 1HW8A 3CJKB 2RT3A 1ZETA 2DHAA 2L41A 4KFBA 2MQNA 1B3TA 3B8HA 1TUWA 1RWWB 3AOAA 2AX0A 4OHZA 4HTJA 3HX9A 5CYMB 4EZ6A 3DM2A 5JVHQ 1WEZA 3HHLC 4UUXA 4O3QA 4DPOA 3CC4S 5ETPA 1HBUB 5GVQA 3LP0A 2R2SA 3ZNUA 2Z2ZA 1WEYA 3DI6A 3MZIA 2IC3A 1IJFB 2B4OA 2GHWA 2BV3A 2VUGA 2LQBA 1JMTA 1IKWA 2G2YA 3NNHA 4RO0A 2DGUA 1RAIB 2K8GA 2Y8WA 1B7YB 3EZOA 2XSFA 3AT1B 3RB6A 2PA3A 2H3EB 4K4TA 4TYBA 1G1XA 2R8JA 2B9WA 3BKUA 5EUHA 3L7OA 4KPCA 2AT1B 3HXMA 4ZPVR 2W2OP 3FEZA 3MCMA 1EETB 2DYAA 1KP6A 4K4ZA 4H4OB 3AA8A 2AHOB 4DFKA 5LOQA 1CJUA 2XGPA 1S6UA 2J9EA 3RUBL 4CH0S 4NCBA 1DTTB 2DNZA 2HMIA 3BGFA 2QLFB 1NRKA 1NSKL 1UW9A 1GT8A 3NXZA 3QT6A 4G1QB 3TVKA 1H38A 2BE7D 3W9JA 1B99A 2DHSA 4ZPDA 3FBEA 4Q2MA 5A0YA 5DM6Q 1WC1A 3HJFA 3DOLA 1FJEB 1H7WA 5KFNA 4CLLA 3VGUA 1R0BG 4G1PA 2B3TB 1NSQA 4WTYA 4CLUA 2P9GA 2CJXB 4HH0A 4ED4A 4JV1A 2PMHA 3LALA 1K1SA 4AYBD 1CJVA 2OH2A 3HZEA 3E8OA 4KH1B 1D8YA 2DGWA 4LF9F 2CKWA 1U1LA 2NREA 4DR1J 4DCPB 2OFHX 2D3O1 2KFZA 2BJ7A 2HQ3A 5H9FK 4M5LA 2UV8G 1FTRA 2J8SA 2FHJD 4NCAA 1JLEA 5L46A 1ZAVA 4RUHA 4EWTA 2RS8A 3LPEA 2A10A 3M8ZA 3HVTA 2VG6B 5HVFA 2HNYB 1OSDA 1NJYA 1NK6A 3NOGA 1EIYB 4WFNQ 3SV4A 4RUAA 2R8KA 4FYYB 3FVYA 2E5LJ 3CC7S 4K8RA 5IM0B 3PG9A 3KLFB 3SXLA 4PWWA 2MJNA 1RISA 2UXCF 2R2RA 1X7VA 5F8IA 1NAQA 1PYSB 2LYVA 1RA6A 5IC4B 2MDAA 1FERA 2MB0B 2HFZA 1EJ7L 2VKZG 4C8OA 4UOGA 3N5BA 4LFAF 2MLYA 2AJQA 4BDPA 4BCAA 1BQNA 2VG7B 3DHXA 2RJZA 4DU8A 2VPXB 2R7TA 3QRPA 2EPIA 3I5CA 1FJCA 3M8QB 4LIRA 4GO5X 3QJPA 3MMBB 2E44A 4AD6A 3B4DA 2DTJA 3BB5A 2AX1A 2DEJA 1UWAA 2IRYA 5J2MB 1HKAA 2VBZA 5CQGA 3GB0A 2XMMA 2NZ4A 2WVFA 2Y1LB 2G4BA 3Q86A 4A8KA 1HQEB 3TZYA 2QYGA 4EYIB 1HARA 2HFSA 4C8ZA 2PO4A 2M4MA 2YPYA 1U49A 3OW2R 4W4MA 3T5JA 3TX0A 2HVEA 1YJ7A 1O0PA 3U1NA 2VPYB 4A8WA 5HJYA 2Y1JA 1H2UX 4FP9A 2WVBA 1GK8A 3H5SA 1RWOB 4C8YA 4IH5A 4P10A 1AUDA 5CAAA 3FSIA 3DLGA 5EHHA 2HGLA 3C19A 5F8NA 1Q0NA 3KLEB 1I94F 4DN9A 4MKBA 4NLPA 1Y00A 4HDHA 4DPYA 3AA9A 2IAJA 1ZBTA 2GQCA 4AL5A 3CIMA 4NLGA 1SI9A 3HKZD 3B4MA 3PX4A 1N52B 2Y8YA 1KHWA 1RT3A 2HZAA 4IRKA 1NBEB 2ZJQQ 5F8LA 3JTNA 4O44B 2MZJA 3TJ9A 4AT1B 2J0QD 1RCOB 5LL6d 4O4GA 3I4HX 4LT6A 3VGSA 2FPHX 2ZHOA 5J2NB 1DRZA 3VGTA 3P3DA 1LXJA 3CJQA 3SSQA 4Y2AA 4A8OA 1QDUB 1M1HA 3Q22A 1ZTWA 4B9SA 3E01B 2MKCA 1QY7A 2B8QA 2MKSA 1WHXA 1U24A 2XB2D 3HHKA 2HYIB 2UXCJ 2AP6A 3EVOA 5KFLA 5HBMB 3PJXA 5K5MA 2ZH2A 1BWEA 3OTDA 2B9XA 2EFGA 1U02A 4AFFA 1U1OA 1RAOA 4DV2F 1HWUA 3ZXWA 3QMQA 4NYPA 4CO0A 3F41A 1RTJA 2K7JA 4F7VA 4QWBA 2ZJPQ 3V6KA 3OV7A 2BJ1A 1T9VA 4OYMA 5B0CA 3CE8A 4PKDB 1RWMB 3R5DA 1RT5B 1LKZA 4DV4F 1HNZF 3PEHA 1EP4B 3HF5A 4OYIA 2Q79A 3NS5A 2EK1A 3MTKA 1V3ZA 2DNPA 1RT4B 2ABYA 4EU0A 4N8NA 1RKIA 5B0FA 2YNFA 3QBCA 1NB7A 2HBYB 3EM1A 2OEKA 4E8UA 4USWA 3RBXA 3OJUA 1S9GB 1RAJA 1IKVA 4K59A 3HSGA 1XERA 4P72A 1CQNA 5BJRA 1PJ6A 1Q53A 1KNZA 4RW8A 4FF3A 5U47A 3D54A 2ZZMA 2N4CA 2MQOA 2OUGA 1RDRA 1I94J 1C1CB 4OZJA 2J8AA 3MUMP 4I2QB 3LH2S 4A47A 1HW9A 4WE1B 1LW0A 2QMWA 3GJQB 3VVTA 1WELA 3R2CJ 2D3UA 4LSNA 4E98A 2DNLA 1U0HB 2CJ9A 1MN9A 2ZZTA 1KLMB 4TXSA 1UEUA 3ZTQA 1WHYA 4RZRA 1G7CB 4QQBA 4B02A 4WP9A 3CULA 1WC3A 3MM7B 4CO2A 1NLKL 4WCEQ 4WKRA 4YR2A 2CQIA 2XCPA 4ZCIA 5CZVA 1CBKA 2KU7A 2VIHA 1FE0A 3RB0A 5E7OB 5B0EA 1Z2ZA 5JUMA 2O01C 1YGYA 2IDLA 1S9EA 4FYVB 4CH1A 5GMEA 4WYLA 3RR7A 4R0JA 1URNA 3C66A 2CPHA 2GHPA 3KJNB 2J0WA 4DSFA 1N5SA 1NCLA 2RSQA 1HBMA 1FKOB 2HQGA 5GAEU 3SCIE 4IG3A 2KG0A 3L7PA 3MPDA 3Q8QB 2BQUA 4OHYA 4DV4J 4KBIA 1LK5A 1HNZJ 4PUOA 5HATA 2RS2A 1NO8A 4DF4A 3LW5C 2KM8C 4ZITA 3KLGB 2FLOA 2C1EB 1IR0A 2ZITA 4LBIA 2MQMA 3CDWA 1VQMS 1O51A 4B3OB 2WHOA 1T9TA 3HFKA 3IWXA 3T1YF 2V2QA 4ZPAA 2UVUA 5DZ7A 2KB2A 2MZ1A 1YWXA 1YZ6A 3MPVA 3NG8A 2U2FA 2GAGC 3DLKB 2M7SA 4MK7A 1S49A 1S6QA 4YDDB 3SIPB 1IR2A 2UXDJ 1C0TA 3CDBA 2R8GA 3GP9A 3UN2A 3QYYA 4LRDA 5D6GA 4WF9Q 4RW6A 2JH3A 3VAGA 3HT3A 4LR8A 2KT5A 1YZ7A 5DG9A 4HACA 4I6AA 1QAIA 2ZHBA 3BM7A 3NCQA 4F04B 4Q8FA 2JEFA 3R1HA 1RCXB 4KT0C 3T5KA 4W92B 1UA1A 1X5TA 2OPRB 2BJ3A 1KOOA 1NK7A 4ZVHA 3OLBA 3C16B 5H9FJ 4RU2A 3CTRA 3BGRB 2Q43A 2BW7A 4K5SA 2DRBA 2F4VJ 5H1SV 2VJUA 1XNRF 4XDDA 4B3TJ 3W5XA 2DHXA 1FNOA 2OEMA 1Y7PA 2VPZB 2JLGA 4K0KF 2GW8A 1DJ0A 4I69A 2XQCA 4DV3F 4DPTA 4ER8A 1VOMA 3J7Z5 2GS8A 2IHR1 3UWTA 3ENQA 2JHEA 3THTA 1PIEA 4JI5F 4X62F 2V8PA 4CLFA 1M1GA 1Z4UA 2XHWA 1YSJA 4ICLA 2E9RX 4USIA 2QLJB 2JX2A 3TZWA 2HRTA 4AXJA 1RQ0A 4NA1A 5KFXA 1IQTA 3ENWA 2K06A 1IJEB 4L73A 2QL9B 3TQ1A 2XNQA 4ZVPB 1R27B 3CW2C 3W62A 4C3KA 4RNMA 5KFPA 2GVDA 3R5GA 4KGZB 5LT5A 1IR1A 3MM9B 3MFHA 4CT8A 1GMUA 1OY8A 3K0JA 2HWHA 3RYLA 1CJKB 4C97A 3NCPA 3IRWP 3T1YJ 3P4UB 2VG5A 4CYUB 2QEXS 1FNXH 4LF4F 3UE2A 3OXGA 1ULRA 2PN6A 1PYOB 2D1CA 2YQ1A 1J5OA 2CPIA 1N6QB 1D9DA 1RA7A 5G0RB 2B6AB 1HWLA 4M5NA 3FEYB 2BE2A 5CYQB 4Y00A 2R7WA 3PXGa 2C3UA 1C0UA 1N0UA 3KLIB 2BDPA 4CI0B 4RWWA 4Y28C 3KK2A 3CMES 3R7BB 4UY85 5GADU 1RT7B 5CA5A 1S57A 3THPA 1U26A 3GFZA 4YB6A 4DR2F 3CJTA 3BDPA 1KVKA 4C8MA 3Q8PB 2RDIA 4UTGA 1TMMA 4I6YA 4IFVB 2CZVC 3PFEA 1LEOA 3IBCB 3TA2A 1NSPA 1NDKA 4OYPA 4MIWA 4RLEA 2JFDA 5ETKA 3UVJB 2Y3YA 4X4TA 2RKIB 4DV3J 3VWSA 2HHXA 4Q45A 4M8LA 2BJ8A 3W1YC 3IBFB 4DSLA 4GKKJ 3RGIA 3ISNC 2Z57B 4JI5J 3PTWA 3CCTA 5GAEI 4ZOSA 4K50A 4BS2A 2XZTB 2YKPA 2P2CB 4QWCA 4LRBA 2ZBPA 5KFOA 4P71A 2KJWA 5KFEA 2XY7A 1U7LA 3QLHB 3JSMA 1R31A 4EO8A 1PILA 2EVZA 1CS4B 4W98A 2GFFA 3M7VA 2QTWA 4KHMA 3NGRA 3I6PA 3POTA 1JQGA 2RU3A 2QA4S 4G3IA 3T6JA 2AYBA 2M9KA 2ZE2B 3UR3C 3PM9A 5KFFA 3KG4A 4AUKA 5E41A 4F4KA 4L75A 4LF4J 3K89A 3D0IE 1R8CA 3BJYA 4U67Q 4JI8F 1T94A 1AXQA 1HMVA 4OZ1A 2FVPA 1FD2A 3TZXA 3DOMA 2QN6B 4FF1A 5D3GB 2K1RA 2RRNA 1S1VB 2DJWA 4Y2KA 1AW0A 3ENVA 3W2WB 3UDVA 4LIWA 3IG1B 2XYGB 4DU7A 2VFUA 2W4CA 1QAJA 5AXMA 3P5TL 3F56A 2RILA 4DR2J 5KFJA 2H5EA 1H2VZ 5KFKA 1R0AA 3BV8A 4KFBB 3PYGA 2OLWA 3HVRA 4P2XA 1VQYA 3NKYA 4H4KA 3V6DA 5KT5A 3TOQA 1LNQA 3A8EA 3JTPA 3ILLA 3GV5B 1T03B 1JXVA 3LP0B 4HHUA 2XGQA 9RUBA 2ALYB 2V0NA 2ZH1A 4IUFA 3GIIA 3DI6B 2QSFA 3ADAC 2IC3B 1Q82T 2D3OR 4DR4J 1IKWB 1H7XA 1AZSA 4CP5A 4PRFA 1XR7A 2GVZB 1WWHA 1SC6A 1QE1A 3N6LA 3H90A 4QYZK 3H0PA 5ADZA 3H4BA 1KEKA 2L08A 3QJJA 1H73A 2ZBCA 5KFUA 4CO3A 4DCOB 1M5OC 1F9EB 5ETOA 2IMOA 2PSZA 1CJUB 1B4SA 1IXKA 2YNGA 3A8JA 4M63A 4CTAA 2Z8QA 2DT9A 2FY8A 1Q95G 3EICA 2VA2A 3OR2A 3NEKA 2HMIB 4JI7F 2G0CA 2XHCA 3NGDA 3QNWB 2R2UA 3G96A 5LSOA 1N5QA 3X1LB 3MR6A 1QSYA 3J80U 4F02A 1JLQA 2XO6A 4WJBA 4F4YA 2GMLA 4LF6J 1TKXA 3H7HB 5A0YB 1SKSA 3DOLB 3BYRA 1IBKF 5ETQA 3L4BC 4DL7A 4ZP9A 1JLCA 2I0XA 4DFJA 3OL7A 4O0IA 2XSJA 3PACA 3SSSA 1OIAA 3N6MA 4IRCA 3IGNA 2CPJA 1AFJA 1SBRA 3UDEA 2HHSA 4USKA 4LBHA 3C46A 2EC0A 4KE5A 1JLEB 1ZA1B 3B6BA 4P9SA 4I7FA 1Q8LA 1NDCA 3W9HA 3RW7A 3HVTB 4OV1A 1SCJB 4QPTA 3SZ2A 3BDEA 2MQPA 5HJXA 2MEWA 3V81A 4Z37A 1G4CA 4ECYA 4KQZA 4M5MA 1UPMB 2MKIA 3TUIC 4K4XA 3VAHA 4ED7A 3SCKE 3MR3A 2DVIA 2CZ9A 2W9BA 2BRLA 2BVZA 1TZ0A 4F0MA 4DL0C 3KK1B 4OI0A 4DL2A 2A3JA 5F3TA 4NRUA 3GU0A 3AAWB 3K7RA 4KHRA 1J5EF 3TWZA 4EEYA 1HL6A 3DGPB 1RADB 4FN5A 5I42A 1QD1A 3L95X 2KZZA 1CPZA 4JI7J 1WG4A 3R97A 3KDNA 3MUTP 3PV8A 1IKXA 2D3ZA 2OPSA 1SC3B 5KFCA 2QLXA 4ZVGA 2FY1A 4J9KA 1BC6A 3J7YI 3WDOA 4X64F 4ZP7A 1D1UA 1TKTA 4L3KA 2Y0BB 2AWZA 2YNIA 4Q43A 3PCOB 4YMEA 1KHVA 3CCUS 2YWKA 3DLGB 3DXSX 3GYGA 5D0GA 3GJRB 1HHSA 3MM5A 4EK2A 3SFUA 4UW2A 4CLKA 1FEHA 3G6VA 2IAJB 3EVWA 3L3CA 3QGHA 3G86A 4USMA 3NGKA 4R8UA 3A3NB 4Q0BB 2B8PA 3EJMA 2YQ3A 3H2UB 3NGUA 1NPPA 2MHEA 3KJVA 3GSIA 3Q2SC 1D9FA 4BHQA 2HS4A 4N56A 4O4GB 2JNJA 5H9EK 4OX9F 2R7SA 5K8MA 2DY1A 3HM9A 2PT0A 1QSSA 4F3MA 1VQOS 5G4DA 2W2PP 2BKOA 4BLGA 1NKBA 2GIRA 3BBFA 4AL6A 3LAMA 1SH0A 2O1PA 1SKWA 3G4SS 1WF2A 2PFFB 1YITS 3NP5A 2VV5A 1WKLA 2DNYA 5A8KA 3KUGA 4NZ6A 4G6VB 5LM7E 1WI8A 2F9JA 5KFBA 1HI1A 1SIWB 2CYYA 3RZAA 1VIXA 1WF0A 2KFYA 4DV5F 1RTJB 1SJ3P 1XEZA 4HDGA 4JOUA 5DQGA 4NXNF 1H3DA 4N76A 1V9OA 4F3QA 3SMZA 4C3MA 4FF4A 2PMZD 1NZ8A 2QFIA 1T9XA 2H4WB 4DOZA 4LQ3A 2IA0A 5DS7A 2GHVC 1NZAA 1R8PA 2L48A 1M5PC 5E0OA 1T3OA 3OFFA 1YJWS 2FJVA 4BC9A 2W7PA 2ZH4A 4YDXA 2YNFB 1PSDA 2DNRA 4X64J 3FMWA 3PJWA 5E3PA 4QR2A 3Q8VA 2V2KA 1RTHA 5C2CA 5HMZA 3GMGA 3KJQB 1IKVB 4A46A 4X4SA 1WDDA 4K2JA 4ENOA 2V4RA 1CQMA 4R5PA 4CO4A 3GFHA 4RW8B 4DFPA 3NNAA 4V19X 3MR2A 4CQ1A 3DRXA 1Y5NB 4CLSA 2B9EA 4JV2A 4EMDA 4F67A 3I96A 2NS1B 3BQ1A 2W9AA 4QJVA 4C0OC 2OKQA 1UMJA 2J9DE 1FX2A 2HNDB 3NCRA 3KMSA 3IGVA 1XNQJ 4CNYA 5EN1A 1SQGA 4MJKA 5DDPC 3PY8A 4OHVA 3V4IA 3BSNA 1SL1A 3K5OA 3MF5A 3GR1A 3BN4A 4HTIA 4U8VA 3M05A 4CH7A 1BWVA 2X1AA 2B7CB 2XO7A 1ZS6A 4GVBA 2RHSB 2H5JB 4TQSA 1NPRA 3C6UA 4LRCA 3MM8A 4YHHF 2V4QA 3Q24A 1SJFA 3PW0A 3TRGA 4X2BA 2BQ3A 2AYGA 4CM0A 5CHCB 2VB6A 1C1BA 1EARA 2OSQA 3HD2A 2MQ8A 3CMQA 1S9EB 2CQ2A 4QR1A 4L6V3 4HHHA 4PABA 1XMQF 2CWXA 2DGXA 4IDKB 2OIHA 3HVAA 4DV5J 3IR7B 2VG7A 5KFTA 3DFEA 1HBMB 4NXNJ 4ZVSB 4IG3B 1FF2A 4P75A 5ETLA 4QYZJ 3FZBA 3MPWA 3UDCA 3HCXA 2DNOA 2F4FA 4PUOB 5DDRC 3PW4A 2J5AA 2J6UA 2IM1A 1N32F 2APOA 1FK9B 3VAKA 1QSLA 5DDQC 3ZZUA 3EGVA 3EUNA 4FBTA 2CPYA 2PEHA 2V8DA 2UUCJ 2W24A 1N5VA 1VS3A 2KVQE 4KSEB 1KSPA 5THWA 2Z2LA 1TMJA 3ZZRA 5D0HA 2NXNA 3T41A 1S6QB 2HPUA 5E3CA 2B4VA 4YN3B 2PE8A 3M6VA 3HPOA 1C0TB 4UOFA 4KIAA 5HK4A 5CD4A 3QRQA 2SXLA 3ZZOA 4LSZB 3ZTSA 4JB8B 2CJKA 3T6BA 4RW6B 3KUEA 5D15A 1TFWA 3KLEA 3CCZA 1JXEA 4URQU 2JVRA 4HACB 1MWQA 4QCLA 1VRUB 4WFXA 1S1TA 3GONA 4CWBA 4X66F 1RTIA 4DHVA 1KWMA 2WRMA 3QFWA 4OI3A 4O23A 3D67A 4NYOA 4N8OA 5F9NA 1N88A 4K4WA 1UZHA 1VRQC 4IQXA 3OVAA 2VF3A 2VODA 1VIOA 1ZYQA 4Y65A 2HKEA 2LFVA 5DQIA 3HI9A 2W8LA 3HSJA 5J2NA 2OGUA 2B0GA 2PA8D 4Q7AA 1FCAA 2C3OA 2XULA 2OPPA 4LMZA 4YHHJ 2ZUGA 3LGHA 5BR8F 4IQMA 5C7PA 4O3SA 2QFJA 3RAQA 4LF5F 1S59A 3IR6B 3ITHB 4ZKAA 5HBMA 2FQQB 1DTQA 3CCSS 2RQKA 3M9NB 1X5OA 2E1PA 1N36F 4HT5A 2I38A 1XMQJ 1TQLA 4KGMA 2FJBB 1FFWB 2HSEB 4YB1P 4NX9A 3FBFA 4ICLB 4DJBA 3ZZZA 1W2BR 4ZN1A 3TUJC 3QRRA 1B70B 4QBUA 3OHBA 2GJIA 4KO0A 4RNNA 1D0EA 1S1UA 1VC0A 2E7VA 1YTYA 4OYWA 5EX0A 2MZRA 1KOHA 3KG1A 4ZCKA 2CQPA 1N32J 3C6TA 2VBXA 2GVDB 3D6FB 2CJYB 3M8YA 4USHA 2IRUA 1F1BB 1EHWA 3F73A 3AXMA 2DHHA 4HKQA 2VG5B 4ES1A 3I9ZA 3PDNA 3CC2S 1HNWF 3MM6B 4QIEA 2ZOGA 3HZGA 1GMWA 4X4UA 3GIJA 5EGYA 5DRKA 2ZWOA 5KG1A 1J5OB 2E1AA 2G0JA 1OYDA 5FJ4A 1BE4A 1TL7A 2KDOA 1WD6A 3QGGA 1F3VA 3VTIA 4KKOB 2BE2B 2E1RA 1FXDA 3DC2A 4YP3A 4O3OA 4IFYA 4XIUA 1C0UB 1RWUA 4HI1A 3HP6A 4PG5A 2KHCA 2MKJA 3FMBA 2CPFA 3ILIA 1N8RT 4MMOA 5J2PA 3TANA 1PYTA 3ZFVA 2ZVIA 4ECTA 3G82A 3KK2B 2JC1A 1FTCA 2V8GA 1GX6A 3RB3A 3LTOA 5A6PA 1KLMA 4NZ0A 2O5DA 3MEDA 2CWKA 3T5HA 5KG2A 1ZPVA 4XPEA 2XMWA 3KNGA 1JKHA 1SV5A 4A8YA 5F0WA 3OQ2A 1MLAA 2ZZNA 1NDLA 2OTJS 4PQUA 5BR8J 1SJ1A 1EQMA 1FKPA 4LF5J 3P5BP 3BPDA 4WP8A 2CQ0A 2FIUA 2RRAA 3AD9C 4RR5A 1Y11A 2XI2A 2QG9B 1N36J 1K8AT 1U2RA 4CIOA 1NU4A 5IT0A 1BGXT 1RSCA 2EWHA 3P96A 2ZFHA 5IFMA 4MT1A 1MW7A 1WSRA 5RUBA 4X4PA 3M2RB 2EKNA 5B09A 1YBTA 3C2PA 4JI2F 4MK8A 3JSMB 4IKAA 4DL6A 2MSSA 3PIOQ 1P9QC 4C48A 3TAQA 3LOUA 4ATNA 4IG0A 3ZZTA 4FZVA 4RKUC 3PR4A 3R27A 3POTB 4QIVA 4CNZA 5J1PA 3ZZYA 3GE9A 3CCWA 2GX8A 3AJ1A 3RBDA 1UVKA 4NA3A 1MNEA 3K59A 4EUVA 3VAIA 1R8HA 2N82B 1X4HA 1HMVB 2AYEA 2AJ0A 1LWXA 4ZVFA 3T9NA 3W5ZA 3CD5A 4L76A 4TKTA 3AXKA 3JS9A 3DOMB 1S7HA 2K1RB 2KYZA 2Q6CA 3FCWA 5ETRA 4P2SA 2RF2A 3OL9A 2MLXA 4KGKA 2CUYA 3CCLS 4DCJB 1S1WA 1V3RA 5C2GA 2R7VA 1KTVA 5AXKA 3D5MA 5MAOA 2OPRA 3PKYA 3N9UC 2LP4A 2HBQB 4CLZA 3D7SB 4HI2A 2DKOB 3GWCA 2CXEA 3W2VA 4KTQA 3BBBA 3K8WA 3M30A 2DCLA 1F9HA 2LXUA 1NXIA 4C11A 2F1FA 5T41A 1LOUA 3R8YA 1L5UA 1YJNS 4ECVA 1X4BA 4PEOA 4B3RF 3M8RA 2W7AA 3V6DB 1WORA 4DV1J 3PW7A 2OO4A 3CVKA 3HMJG 3CF5Q 2OMLA 3FJ2A 1YBUA 2D7SA 3QAEA 4CLWA 1U1QA 1HLWA 3ET6A 2W8KA 3ICLA 1GQEA 2DGSA 4NL5A 3I0SA 2RNEA 3GQCA 1DQ8A 3SCLE 1P27B 2V67A 3NAHA 5KFVA 2CRLA 4I56A 1AZSB 2OHDA 4JI2J 3WZ0A 2LA4A 3OLAA 1TK0A 4FYDA 2CZ4A 5JJBA 1JJ4A 2BRKA 3GFXA 5GAGU 1S9FA 4QW9A 4QIWD 5MLCV 2J7UA 4F0KA 1UP1A 2YVSA 4I68A 1XC9A 3AB2B 2HGNA 1DY3A 3HKWA 5B0BA 2PDAA 2X1GA 2DGOA 4DQQA 3CDAA 3QZ7A 2O3DA 2YNGB 5CZXA 2YKQA 4CTAB 2NUHA 2UXBJ 2UP1A 2PC6A 1YKWA 2NSBA 2MGZA 4ID5A 3OR2B 2V9KA 3M8WA 5KOWA 3DLBA 2XS5A 3TJ8A 2AQ4A 2RU9A 2JC0A 1LQ9A 4PPDA 4EBEA 3H2LA 3PVXA 3I55S 3JQKA 2DO0A 3MTJA 5DDOC 3DHWC 1TU0B 2IJFA 1X60A 4U6PA 2HVHA 1OY6A 2OP5A 4DDFA 2FZCB 1JLQB 5GAHI 4D3GA 3MCNA 5A8RA 1TKXB 2ZKTA 4V19J 2B6AA 1S4FA 1T0TV 3UD5A 2MKKA 2DNQA 3BR9A 3BO4A 7AT1B 1ELOA 4QOTA 1U8SA 2ZKUA 3K17A 3KLHA 2G1HA 1FJGJ 1JLCB 1SL0A 2XSJB 4L72B 3ILOA 3J81U 4E2FB 2H54B 2A18A 3JXOA 2AU0A 1YBAA 1U2FA 2DO4A 4A48A 1M1KT 3DRSA 1TAUA 4DUYF 3S01A 2RB7A 4TU9A 2J7WA 1SC4B 4I7FB 3SBMA 4KRWA 5T7LA 4B3RJ 4IH7A 4OL8A 1D9AA 1V5IB 3JSYA 2V8VA 1U6ZA 3N01A 2MZTA 3L9ZA 3N4WA 5EWGA 5IT9U 5ETMA 4MKVA 1X9MA 3V81B 2V2ZA 3GPAA 1RK8A 3TA0A 1CC8A 5KAKA 3D6MB 4JBCA 1SVDA 1GXLA 1RAGB 4DN0A 2XS2A 1U1NA 3TYTA 4Z7CA 1S4EA 2F8EX 4O3PA 2VC0A 3Q23A 1U0SA 5HP1A 3GJTB 2W9BB 2J76E 2HBRB 5J2QA 1AT1B 4DX8H 3K58A 2A6MA 1OSCA 2DNGA 3DRPA 1OPZA 2FTRA 2H5IB 4B17A 5KG6A 2JZ5A 4L74A 4OYXA 5F41A 2IY5B 2R7UA 5KFIA 1GMWD 2KXHA 4YR3A 3LF0A 3UW1A 4OLOA 2ZE2A 3DLEA 2QLWA 5I42B 2G9OA 4ED6A 1KVIA 1R3NA 1X4AA 3QO9A 2WBMA 1IKXB 2OPSB 3GYXB 3L7UA 3TO8A 3MUVP 4P52A 3WC2A 1TKTB 5FLXU 2BQRA 1WDTA 2YNIB 3RG6A 5DZ6A 3IAS9 5AJ3F 5D3GA 1HPZA 2FJXA 2DIVA 2HAFA 5KT4A 3MM5B 3ISZA 2KT3A 3UDLA 3IG1A 5L9XA 4XK8C 4YQWA 1IVZA 3CDUA 3OJSA 1WG1A 3SQGA 1FDAA 3W65A 3B82A 5HQMA 1W26A 4J9NA 3TUZC 4R8UB 2AIRB 5F9LA 1NEEA 1PJ5A 1SQEA 8ATCB 1LXNA 2V5HG 2DR6A 3QQCD 5I3PA 3KJVB 1PBUA 4DUYJ 1UVJA 3GTYX 2DEIA 2OELA 4NLRA 1RYRA 3HJVA 2HQDA 1HNVA 3ETMA 4ZLNA 2HZCA 4G65A 4F50A 2FHKA 4OZ0A 1T03A 3UN3A 1A7GE 1IBMF 2E5LF 2F63A 4B9VA 1RAEB 4ECZA 2FUG9 3G87A 5A8KB 5BYQA 4FXWA 4ID8A 2ZM6F 4RX6A 2B56A 4OJ1A 5HVGA 3VAMA 1UJ6A 4JP8A 2GVZA 2XMUA 2QMUB 2B51A 4P73A 5CD4H 1LW2B 2VA3A 2IM3A 3MI7X 3PRDA 3OSPA 3PO5A 2AJFE 1VQ6S 3DYAA 2C2DA 4IRDA 3MMAA 3MMJA 3MOZA 3CIZA 2XNRA 3KNAA 2IJRA 2VJVA 1DFDA 4FNHA 3OD2A 3I0RB 3H5YA 2V68A 4B3SF 1HHQA 3W5YA 1IM4A 1T9UA 3FFIA 2RHQB 3FGVA 3SI8A 4OYOA 3IMQJ 2DH8A 2PI5A 2DXFA 1AFIA 3J80Y 2HVZA 1RWNB 2D41A 2JEGA 2GJ2A 1AB8A 4QWAA 1RTHB 2QRRA 4RUBA 1ZPWX 4EGLA 2I8EA 1YLXA 3JQJA 4MKYA 5AJ3J 1NHUA 4R5PB 4OJHA 1VBZA 1IWAA 5KFDA 2XG8A 4B08A 4YR0A 3HLUA 2YH0A 3S8SA 3GZ7A 2HFUA 1ZAXA 4AXIA 4NMLA 1FRXA 3MHYA 1X0FA 1MSWD 4WU2A 4FYWB 3A1YG 4J9PA 1VLOA 2ZNYA 4PAAA 4OMFG 2UUAF 2CAJA 3I31A 3ZTOA 1FESA 1L3UA 4DX5A 4C0BA 3KHLA 3V4IB 3GSDA 3EDRB 3GV7B 1TV6A 3DOKB 2ADBA 1JJ2R 3FDSA 1NNDA 3I32A 2VZ9A 1ZA2B 1SUQA 4PXEA 4GVBB 4DF8A 3IO1A 3C6UB 3MM8B 1X31C 1WC4A 2FLNA 2AGQA 1IBMJ 4RW7B 3W7BA 3ZC4A 2NPFA 2V69A 2GC8A 2NXCA 2YWWA 4LRFA 1C4CA 1S12A 1F9FA 2H4YB 4DV7F 3CJ5A 4ECXA 4QIFA 5EDWA 2XMVA 3RU0A 5J1EA 1UJ5A 2ZM6J 5SZTA 3GG0A 1C1BB 5IV3A 3Q8SB 3AD8C 1GX5A 4ED1A 3KK1A 2NLWA 1VRTA 4QWEA 1RT6A 1B64A 3UFCX 2EFQA 5AE1A 2P9CA 4F4ZA 2FGCA 3GCXP 4TLRA 3IA0A 3SDEA 1U1RA 2EEYA 3UD4P 4WWSA 2AJ4A 5IQQA 3ZTRA 1TL5A 3DGPA 2HWTA 1RHQB 3MOJB 4B3SJ 1BMQB 1WC0A 2FD2A 3CUNA 2JL9A 2Y1IA 3D66A 5D4PA 1N54B 2FJAB 1L3SA 5I4MA 1JWWA 1TK5A 2BM0A 5LSLA 1MMNA 3NWGA 1EKSA 5KG7A 2NXEA 4ZMMA
chains in the Genus database with same CATH topology
3KK1B 2EBGA 1RT7A 1L3KA 1FRMA 2GMHA 1NJXA 2E5HA 6FD1A 4FS1A 2JEIA 1HD0A 4O3NA 2JWNA 4OI0A 4DQRA 1N56A 3D0HE 3UNGC 2AF6A 2LEAA 4DL2A 2VPWB 4H4MB 4IFVA 2A3JA 5F3TA 4NRUA 1S77D 3T1AA 1X4FA 2ADCA 1LV5A 2KM8B 4PG6A 2DR5A 2VOOA 5E5NA 4MYUA 4RBTA 5L1KA 5EX3A 2DIUA 1VQSA 3AAWB 3PEJA 3K7RA 4LUBA 4IR9A 5I3QA 4KHRA 4MK9A 2DISA 5B08A 3K57A 1J5EF 2E7XA 3AHPA 1S1TB 2ROPA 3TX8A 5D8HB 5HLFA 2FJEB 3MAQA 4TY8A 2BXJA 1W25A 2GGPA 4Z2XA 1JLFA 1RTIB 2Y0SD 1HL6A 4EEYA 4FVCA 1U47A 1FXLA 2B5JA 4Q0BA 2JLFA 5JXSA 2W4PA 2ROGA 1GTHA 1VLYA 4FN5A 5I42A 2RKIA 3L95X 1SJQA 1N5TA 1Q16B 2HHWA 2KZZA 1NH8A 3H2VE 1CPZA 2M3DA 3BSAA 1WG4A 2BYCA 2B43A 2DITA 1ZM3A 3NBPB 3MMCB 2P5VA 2XY6A 3FRZA 3MUTP 4PG4A 3PV8A 4ILLA 4LSLA 1IKXA 1T95A 2D3ZA 2L9DA 2FC8A 1RKJA 2OPSA 3RRGA 4C3LA 2BJEA 2QLXA 4BBYA 5KFCA 4ZVGA 2FY1A 4J9KA 5M2RA 1DQ9A 2F9DA 3I87A 3J7YI 1BC6A 3WDOA 3JYTB 4NLOA 3NLCA 2IRXA 2FVQA 1OPIA 3M2UB 4R25A 4X64F 2ZOFA 2QV6A 2H9ZA 1JLGA 3R3TA 2YX4A 4ZP7A 3UI3A 2LXIA 4OHWA 4DS4A 1D1UA 3EZUA 1TKTA 1C2PA 1PGZA 4YB5A 4J9MA 1BY9A 2L3MA 1JJHA 1RJJA 2AWZA 2YNIA 4DEZA 4Q43A 3THVA 3QLHA 2Z0GA 4YOEA 1ZH5A 2CG4A 2E5IA 2OPPB 4YMEA 3D1OA 1KHVA 1F5BA 3CCUS 2FB0A 2IVMA 4M5DA 1N34F 1BQMB 2DGVA 2YWKA 3H5XA 3DLGB 3DXSX 4NLDA 4MIBA 1HHSA 3MM5A 2KJVA 1IN0A 4A8XA 3SFUA 4RWXA 5FD1A 3H5UA 3RBEA 4C9DA 4UW2A 3ZZPA 3G9CA 3UCUP 4N41A 2LXFA 2BUNA 3D28A 1FEHA 2IJNA 3DXBA 5KT6A 3C8YA 5FIIA 3G6VA 6FDRA 2IAJB 1K0TA 2ZOMA 1DTQB 5KFRA 1FKAF 2C3MA 2LU2A 3L3CA 1NK4A 3QGHA 1M5VC 3G86A 2E9ZA 2WBRA 3NGKA 4R8UA 1JNRB 1LFWA 4Q0BB 3CCVS 4WU3A 3J7A1 3OFGA 4ERDA 2YQ3A 1Q79A 5HN0A 3H2UB 3AB4B 3M8SA 1R7IA 4F3OA 2F7VA 2MHEA 2VONA 1RT2A 4NLXA 1LWFB 1JXLA 4Y6IA 2M2BA 3KJVA 3Q2SC 3IR5B 4CO5A 5KT7A 1D9FA 4X4RA 3N6NA 2M0GB 2CJQA 4BHQA 3OTCA 2HS4A 4N56A 4ED5A 4O4GB 2GO9A 3AH6A 4NCGA 4B9LA 2DB1A 4KO0B 1GAOA 2XY5A 4OX9F 1YJ9S 1KQGB 3FZ2A