4RW4B

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 110
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4B03
3DI6B 1ZETA 3RAXA 4ZP8A 1EETA 1S1UA 3KK1A 5KFMA 2E9TA 3OL8A 2GIQA 3LANA 5T14A 1HPZA 3FSIA 3IRXA 4RW9B 1Z4UA 1S9GB 4MIBA 1S0NA 4ECTA 3OL9A 2AX1A 2BANA 2E9RX 3NMAA 4MFBA 2ATLA 4RW8A 3MF5A 4EBEA 2IA6A 4DL3A 1RT2A 3RB6A 5DQHA 1XR5A 2WCXA 3KLGB 2OPQA 3JSMB 2VA2A 4M95A 3DM2A 5J2MA 3T5HA 5HROA 4J9SA 4WXWA 4Y3CA 3ITHB 5J2NA 1HMVB 4PUOB 3BGRB 4YQWA 3MR2A 1I6JA 4KFBB 3OL6A 1RT7B 3I5BA 2YNGB 4I7FB 4IRDA 3PW2A 2FLNA 1S1XB 1TVRA 1TV6B 4IFYB 5HP1B 1RT5B 3M8PB 4U7CA 1S9EB 3CVKA 3QIDA 3IG1A 5DQGA 2XWYA 3MEGA 3OLAA 2HNYB 2HWIA 2ILYA 1FKOB 4O44A 3HHKA 4NLSA 5J2PA 1TL1B 3C6UA 2W9CA 4IOBA 2FVQA 4NLXA 4O3SA 1R0AA 2W7PA 1DTQA 1S6QB 2QE5A 1JLGA 2WHOA 5EDWA 4G3IA 2WK4A 4TYAA 4Q8FA 3V4IA 5KFNA 1DTTA 3TAMA 4WZQA 1UWBB 4J9NA 3NL0A 1HNVB 1QE1A 5J1EB 3KHGA 4LSNA 1JLFB 3CJ2A 2UVVA 3GIKA 4XPEA 2F8EX 3NGDA 1JLEA 5KFIA 5DLGA 1LWEB 5JUMA 3RBEA 4RZRA 4Y2AA 4R5PA 1EETB 4TN2A 4ED8A 4WFZA 1HYSA 3I5CA 4RNHA 4KAIA 3FQLA 1HQUA 4TYBA 1KLMB 4NLRA 4NRUA 2HNDB 3T19A 4EO8A 1HPZB 2DPJA 1RT1A 4O3PA 3IRXB 2JEIA 2ILZA 1TKXB 4ECSA 1S1WA 1N5YB 4PWDA 4MFBB 1C0UA 3H5UA 5D3GA 3GIMA 1REVA 1RT2B 1LWFA 2IMWP 3E01A 3HVAA 5F8NA 5C42A 5L1LA 4JV1A 4LQ9A 2OPQB 3MFHA 3DM2B 2OPRA 3RAQA 5J2NB 3CJ5A 3DDKA 4ED2A 4H4OA 1HQEA 5DQIA 2WOMB 2IM2A 4MKAA 4XO0A 3MEDA 3PZPA 4QWDA 4NLPA 1S97A 4ZPCA 3DRRA 2OPPA 1TVRB 2AGPA 5KFQA 5KFAA 5CYMA 4DG1B 3IG1B 4Y2CA 1VRTA 3MEGB 3PW0A 2XCAA 3LP0A 4O44B 1SV5A 5J2PB 2W8KA 3C6UB 2DPIA 1KHWA 3DOKB 2UVRA 2WONB 1JKHA 2OPSA 1R0AB 4RNOA 4QWAA 1DTQB 1N4LA 1JLGB 2R2RA 1ZTWA 3V6JA 3GQCA 3QGIA 1DLOA 3V4IB 2D3UA 1JLAA 3DMJA 1DTTB 3GV7B 3PR4A 5KFHA 4J9RA 5KFOA 1QE1B 2D41A 2FVPA 1TL3B 2VG6A 3ICLA 3NKYA 5CYQA 3BSNA 3QZ8A 2C28A 5DG8A 2WTFA 2J6UA 3KHHA 2V9WA 1RT4B 2WRMA 4JUZA 4FBUA 4DL4A 2C2DA 5HBMA 1C1CB 1HYSB 3QGGA 3KMQA 2R2UA 1HQUB 2W9AA 4O4RA 4TY8A 5EUHA 1JLCA 4NLTA 2BR0A 1SUQA 3DLEB 4WFXA 1S1VA 5KG3A 4K50A 2W8LA 2YKMA 4MIAA 1S1WB 5KFRA 4PWDB 2AX0A 1RTDB 2FLLA 3LAMA 4NZ0A 1C0UB 3MFIA 4ED3A 2ZE2A 1S6PA 3MTKA 4WYWA 1XR7A 1LWFB 4QWBA 4Q0BA 4JV0A 3E01B 2VG5A 3OHBA 4ECWA 3HVTA 1FKPA 1RT6A 4EYIB 2O5DA 3T5JA 3I0RA 4I2QA 2OPRB 2AU0A 4F4XA 2VA3A 3OSPA 3NBPB 4ZVHA 4H4OB 4DL7A 3LP1A 1HQEB 4O3OA 5KFJA 2V0NA 4MK9A 3MEDB 4TQSA 3H5XA 1WNEA 1RAJA 3M8QA 3Q8QB 1VRUB 3DRRB 5K14B 5KFVA 5DG7A 3C6TA 5KT6A 1VRTB 2YNFB 3M9OB 3JYTA 4K4SA 3DRSB 2GC8A 4ZPDA 2BRKA 1N6QA 3GV8B 3QGHA 4ZVEA 1RTJA 5I42A 1JKHB 2OPSB 4KV8B 2ASLA 4NLUA 1LW2A 1TP7A 4R8UA 3MEEA 5C24A 4MKBA 2I5JA 1N56A 1JLAB 2XC9A 2HNZA 4B3OA 2YNHA 4IH6A 3D28A 5KT7A 3DLKB 4IG3B 2WB4A 2VG6B 5CYQB 1MU2A 4WYLA 4O3NA 4J9PA 2HMIA 1ZTTA 1SH0A 4LQ3A 3M9NB 1JLQA 1C1BA 3G6XA 5HBMB 1K1QA 2ASDA 2YNIA 4TLRA 1BQNA 2RKIA 4KKOA 2R8IA 2IM0A 1JLCB 3PW7A 1SUQB 1S1VB 4O4GB 2BQUA 2B6AA 4KB7A 1RTHB 2IAJA 2ZKUA 4ZP6A 1IM4A 3MECA 2UVWA 5F9LA 3N6LA 2ZE2B 1S6PB 3T5LA 4Q0BB 2JC1A 4J9MA 3HVTB 4NLYA 1RYSA 4K4YA 1FKPB 1QAIA 3SFGA 3I0RB 4I2QB 4YR2A 1QUVA 3MR6A 3M9MB 1RYRA 1JIHA 3KLVA 4ED6A 2R8JA 3DOLA 4K4VA 2J6SA 1S1TA 3LP1B 4Q45A 1RT3A 5EWFA 3CIZA 5HLFA 2FVRA 3KOAA 5KFFA 2QV6A 3M8QB 3CWJA 5KFLA 1RDRA 4ECYA 4KE5A 1S1UB 3DRPA 3KK1B 3V81A 3RB4A 2GIRA 3C6TB 3CJ4A 3BR9A 1JXLA 3JYTB 2CKWA 2C2RA 3I0SA 2IM3A 3CJ3A 3Q8SB 1N6QB 4NCGA 3OL7A 2BANB 1RTJB 5I42B 2W9BA 1RTIA 1HARA 1LW2B 4RW8B 4R8UB 3MEEB 5C24B 5F8GA 2I5JB 5KT4A 4IDKA 1TKZA 4RNNA 1FK9A 2HNZB 4B3OB 2YNHB 3Q8PB 2E9ZA 4ZP9A 2B5JA 4NLOA 3SFUA 5J2MB 3KLHA 5HROB 3GILA 4RW7A 1MU2B 2UUWA 3PHEA 4PQUA 3G6YA 1C2PA 4KO0A 4RNFA 2HMIB 2C2EA 1SH3A 1C1BB 3QLHA 4IH5A 4IFVA 4Q43A 4IR1A 4QW9A 2YNIB 4MK7A 1S9FA 4KSEB 5KFUA 4KKOB 4WE1A 3EZUA 4R0EA 4Q8EA 2ZD1A 3KLIA 3NAHA 2C22A 1NHUA 3OHAA 2EC0A 4WXOA 2B6AB 4ZPBA 5DGAA 1HNIA 3MECB 4MK8A 2W9CB 3H2LA 4IKAA 3T1AA 5C25A 3DLGA 4RW6A 3LP2A 2V4RA 1D1UA 3TAMB 3DOLB 3KK3A 2D7SA 1S1TB 2BE2A 5KFZA 4LSNB 3H5SA 5F8IA 3RB3A 1JLEB 1K1SA 1EP4A 2OH2A 4NLWA 4J9KA 3RB0A 3KK2A 4R5PB 2FVSA 5KFTA 1IKXA 3BREA 1KHVA 5KFYA 4QPXA 1S0MA 4OL8A 4IH7A 4ICLA 1CSJA 2IC3A 4KBIA 4QW8A 4ED7A 3I5AA 3E51A 1RT1B 2RDJA 2AQ4A 4NCGB 4NRTA 5EWEA 4ZVGA 2W9BB 1RTIB 4WFYA 4ECQA 4M94A 3CDUA 5D3GB 5F8JA 1REVB 1S49A 4RW4A 3H4BA 4IDKB 3KLGA 3LAKA 5C42B 4URQU 4EBDA 3Q8RB 2B5JB 3CDEA 3ITHA 1NHVA 3KLHB 4RW7B 2JEFA 4G1QA 4F4WA 1RT7A 4J9QA 2ALZA 3QLHB 3EPIA 4IFVB 4O3QA 3GV5B 1S10A 1N48A 2FLPA 1W25A 2FJWA 4NLQA 2OPPB 3IN5A 3BSOA 4WE1B 5F8MA 3V6DA 4ECUA 3KLIB 5CYMB 5KG6A 4RU9A 3LP0B 4GC7A 3EPGA 1SV5B 4DL2A 5F9NA 4H4MA 5FDLA 4TQRA 5C25B 4URSA 2RDIA 5L1IA 1T94A 3DLGB 4RW6B 5L9XA 4J9OA 4IRKA 5KG5A 3LP2B 1DLOB 1UWBA 4ZVFA 3DMJB 5KT5A 1NNDA 3KK3B 1D0EA 4NLGA 3ISNC 2BE2B 2YKNA 4TXSA 1LWEA 1EP4B 4XPCA 1JLBA 3PJXA 4ED0A 1LWCA 5KFPA 4ECZA 3KK2B 1IKXB 1KLMA 4EBCA 2HNDA 2HAIA 4RNMA 4F50A 2AGOA 4ICLB 1IKYA 2IC3B 5KG0A 4TY8B 3LALA 1TKXA 3UDLA 4GC6A 4LSLA 1N5YA 2YKMB 2HWHA 3KLEA 5KFEA 2R8HA 1IKWA 3GIIA 2ASJA 1TQLA 3H4DA 2RF2A 4RW4B 1U09A 5C5JA 2VG5B 4K4XA 1J5OA 1RT6B 3QYYA 4KHMA 3UR0A 3BSCA 3OLBA 3FFIA 2WOMA 4F4ZA 3IGNA 3UQSA 4EEYA 4G1QB 3PVXA 2V4QA 2R2TA 2UUTA 1T05A 3PW4A 1GX6A 3CJ0A 1LW0A 5KG1A 2BQ3A 4IQXA 2JC0A 4YMEA 4Q44A 3SI8A 4DG1A 2FJXA 3DYAA 3V6DB 3H59A 3MR5A 5L1KA 3VQSA 3HKWA 3IS9A 5F8LA 3DOKA 4Y34A 1XR6A 2WONA 4H4MB 5FDLB 3KLFA 2B43A 4IG0A 3UPFA 3BQ2A 1IKVA 1GX5A 4U6PA 3TVKA 4DL6A 4QWEA 4ID5A 3D5MA 3CO9A 5I3UA 1TL3A 4I2PA 2XGQA 5KFGA 3H40A 2YKNB 2AGQA 1RT4A 4HKQA 3FRZA 5KFXA 3V6HA 4ZMMA 2R8GA 2UVUA 4K4UA 1JLBB 2XI2A 2BQRA 3HVWA 1JLQB 1JX4A 1LWCB 1C1CA 3CDWA 3T5KA 1QAJA 3MR3A 4IRCA 1BQNB 3QIPA 2RKIB 1IKYB 3DLEA 2D3ZA 4NYZA 4LSLB 3KJVA 5J2QA 1RTDA 4NLDA 2BRLA 2IAJB 3KLEB 5F8HA 4RUCA 3IGVA 4IR9A 1IKWB 1BQMA 4YR3A 3G6VA 1C0TA 1T03A 2FJVA 2RF2B 3QO9A 1TKTA 4ECRA 4ZP7A 2FVCA 1J5OB 3BJYA 3NBPA 2VG7A 5KFDA 3PW5A 4O3RA 1RA6A 4NLVA 3FFIB 4ZHRA 5DLFA 4QWCA 3PJWA 4MH8A 4TY9A 5KT2A 1T05B 4FS2A 1RT3B 3DI6A 1VRUA 5K14A 5HLFB 1LW0B 2CJQA 4K4TA 2YNFA 3N6NA 3DRPB 3DYAB 1MMLA 3DRSA 3V81B 3FDSA 3FQKA 4KHRA 3QZ7A 3OSNA 3IS9B 4K4WA 4RW9A 1S9GA 3I0SB 3H98A 4ZPAA 2W7OA 5JXSA 4KV8A 5KG2A 5KG4A 3KLFB 4DL5A 4IG0B 4ED1A 4X2BA 1IKVB 4YP3A 1S4FA 1T3NA 3GYNA 4ID5B 1TKZB 5KFKA 1FK9B 2IM1A 3JSMA 3DLKA 2JEJA 2R8KA 4IG3A 5I3UB 2I1RA 4I2PB 3H5YA 3BQ1A 5KFBA 1SH2A 4EO6A 1S0OA 5KFSA 5KFCA 1HMVA 1S48A 4PUOA 3BGRA 5DG9A 4H54A 4RUAA 2XGPA 3TQ1A 4PQUB 2JLEA 4KO0B 5DGBA 3KHLA 3GIJA 5L1JA 4EYHB 4KFBA 2YNGA 3BQ0A 4I7FA 4URGA 1S1XA 4JV2A 1TV6A 4IFYA 5HP1A 1RT5A 3KNAA 2IJFA 3QIPB 3M8PA 2IJNA 1S9EA 3G86A 3KHRA 4F4YA 2R2SA 4O4GA 3V6KA 2ZD1B 2AWZA 2HNYA 2JEGA 4K4ZA 4J9LA 1FKOA 3KJVB 1RTHA 5J2QB 3BSAA 5KG7A 1TL1A 2XCPA 2XI3A 5KT3A 1HNIB 2IBKA 4YR0A 4FBTA 1BQMB 4ECVA 1S6QA 4ECXA 5KFWA 1OS5A 1C0TB 1T03B 5EWGA 3QO9B 4HYKA 4WZMA 3N6MA 1TKTB 3RBDA 3NAIA 1YVFA 2VG7B 1RA7A 4DEZA 3PR5B 2J6TA 1HNVA 4ZHRB 5J1EA 1JLFA 3KMSA 3ISND 4FS1A
chains in the Genus database with same CATH superfamily
4F0MA 4ED5A 2GJFA 2OELA 4BCAA 4NEZA 1GTEA 4FVMA 3TWZA 1HW8A 1SQEA 2F65A 3S1TA 2HNYB 3THTA 4X4UA 3W2WB 1N88A 1VLOA 3AOCA 4J9NA 4WU2A 2UVVA 2OTLS 2F8EX 5CZVA 4JI8J 1HYSA 1KRPA 1KTVA 3GIMA 5D3GA 4DV1J 4DQIA 1N34F 3HVAA 2HBQB 3K2YA 3ZZZA 1Y9OA 4IOCQ 5CYJA 4XO0A 1RAOA 2OPPA 2RHSB 4WKYA 3Q23A 1WOOA 2UVRA 3EZOA 2OPSA 1U1RA 1ZTWA 3GYXB 2EBEA 2A2DA 1OMSA 1CJKA 4B17A 1F6TA 2KT5A 2MKKA 2WRMA 3GSDA 5GAHI 1HYSB 3NGKA 1S1VA 1RTDB 1YJVA 1MG7A 3MUVP 4LIWA 5LSOA 2YX1A 3H7HB 4R25A 3VAIA 1U1NA 3GTYX 4DFPA 5DG7A 2BDPA 1JJ4A 2MZJA 3OD2A 2BRKA 1RTJA 5I42A 2OPSB 2OSRA 2CPJA 5DRKA 1CJKB 3TJ9A 2A1BA 4DPOA 2CADA 1S1VB 1HNWJ 1LXNA 2MQOA 1N8RT 3MR6A 3MM8B 5E5NA 2QFIA 4L72B 2PE8A 2C3YA 5HLFA 4DPWA 2RILA 3SV4A 3I0SA 1RTJB 5I42B 4LF8J 2CXEA 1T0TV 4IDKA 3UO0A 1WI8A 2QEXS 1FNXH 4B08A 4MT1A 3AT1B 1W7WA 3OJUA 4ZPWR 1S79A 4Y00A 2E7VA 3FKBA 2ZZNA 2V2VA 2BE2A 4LSNB 1FRXA 4USUA 1K1SA 2OH2A 1PILA 2UU9F 2A6OA 1HI0P 1WC6A 3NS7B 4IDKB 1HNXJ 3ITHA 4O3QA 4PQAA 5CYMB 4LBPA 4MIWA 3W1YC 3FBFA 3MPYA 4TQRA 2B51A 4Z7YA 1MROA 2A18A 2KXHA 3R97A 2BE2B 1KOOA 4TXSA 5F0WA 3T1YF 1GH8A 5KFPA 3CD6S 2BA9A 4Q5VA 4F2SA 4ZLJA 4GC6A 1EQ0A 4E98A 3CJKA 1N5SA 3IP0A 2ACMA 3JB9k 4GO5X 2KT3A 3PVXA 4IQXA 2LECA 3IS9A 3GFYA 1IBMJ 2WONA 2KZZA 3D1OA 1PJ6A 3UPFA 1GX5A 1KVKA 4DS4A 3TI0A 5LOQA 4YN3B 3N0VA 2HFVA 4XTTA 2G9OA 3V6HA 4ZMMA 2DBBA 1VBXA 1AUDA 3HDSA 2HGNA 4OI6A 2HQIA 4C48A 4NYZA 3CJKB 2BRLA 5ETTA 3I96A 3VAJA 3NBPA 3V4MA 2XMKA 5KT2A 3BBCA 2GO8A 1WDTA 3RZAA 2DR7A 1IJEB 4DXLA 3IS9B 4RW9A 4JI5J 2V2ZA 4Y2MA 2IM1A 3C46A 2I1RA 3BQ1A 2F9DA 1IR2A 3H5YA 1S0OA 2I0XA 4B3RF 2HS4A 5DGBA 1FWLA 4IFYA 1T9XA 5DETA 1RAEB 4RBTA 5KT3A 2MZ1A 3MURP 5D77A 4ER8A 3QJLA 4ECXA 4RBVA 3D7SB 3J7AN 2XMAA 4JI2F 1YVFA 5DO2A 5CCMA 4ZLLA 5DM6Q 1WC5A 3R1HA 2GIQA 2KRBA 3OL9A 4RW9B 3DGVA 4JI3F 5ETOA 4RW8A 1U7LA 4HVZA 2UP1A 2WCXA 5J2MA 5B0GA 5E3PA 3J81U 3AOBA 4J9UE 1TVRA 3GSIA 4IFYB 5RUBA 5DQGA 1RQ0A 2HWIA 4X4PA 4O44A 1FTCA 3HHEA 2GVDB 2ZH9A 1F9EB 5DS7A 4CLWA 3GIKA 2FJBB 4RZRA 4LFAF 5AXNA 4NRUA 1B4SA 2ILZA 3HT0A 4XDDA 1S6OA 1KONA 1XQIA 5F0UA 1HQEA 3FBCA 4P75A 1TL7A 2CVIA 3M32B 1TVRB 1H6KX 4Y2CA 4LF9J 1RKIA 4KJIA 2XCAA 4O44B 1SV5A 2W8KA 1KHWA 2WBRA 4W4MA 2ZOGA 4QWAA 1ZZFA 2AF6A 5KFHA 4LVOP 4CH0S 4JV5F 4DL4A 1VFJA 2MZTA 5MLCV 3VAFA 4JP8A 3CJ8A 2ZE2A 4D3GA 4QWBA 3GR1A 4X66J 4F4XA 2KFZA 3BKUA 4CCHA 1HQEB 4J9VA 1TL7B 4QZVB 4ZJOA 2PO4A 1SC3B 2BACA 1RUSA 4Z37A 1U24A 2L9NA 1JLQA 4YY3F 2KT2A 1S99A 2PT0A 3J81j 2ADCA 5CXTA 1RTZA 2AHOB 4GO7X 2J8AA 2ZE2B 2NQPA 3K5NA 2DNPA 3D68A 4U67Q 4LF4J 2MHNA 1FD2A 2CQGA 1S1TA 5J1NA 3M6WA 4F3OA 1X4BA 4LR9A 3VZIA 3LO3A 4X65F 3K89A 1RBLA 4FYDA 2GIRA 3CJ4A 1JXLA 3QMQA 4L74A 2XTJP 2R7RA 2F4VF 3OPKA 4OX7A 4L6V3 3M8RA 3G96A 4NYOA 3QWUA 3SFUA 3OFGA 1DAXA 2QL9B 2YQ1A 4IO9Q 3PM9A 1WG1A 5DDRC 2RU3A 3C15A 2ZJPQ 3BV8A 4Y65A 3B4DA 3U1LA 1KSPA 1S1TB 2CWKA 5KFZA 1N36F 3BEGB 4DR1F 4L3KA 1SJ1A 4LR8A 3UCGA 2V69A 1NK4A 3J7YI 4IH7A 5CZXA 1NJZA 3E51A 4HL9A 2AQ4A 3NRBA 1AT1B 1X8DA 1GTHA 1YQHA 2V5HG 3EUNA 5F8JA 2NXJA 1CQNA 1WSVA 4OYZA 3OBIA 2ALZA 1NSKL 3GV5B 4DHVA 2CDRB 3LWMA 1BHNA 2FHOB 2YQ0A 3EPGA 3C15B 4DX7A 4OIXA 4DPTA 4NZ6A 2ZFHA 2E44A 3ISNC 2MB0B 4L75A 1W2BR 5CA5A 4N41A 4I6YA 3T1HJ 1V6HA 3SZ2A 1FNOA 4ZVSB 2KYXA 2QLWA 3UR0A 4DR2F 3DXBA 2V4QA 3PW4A 1VQ8S 2PFFB 5KG1A 4Q44A 1DBDA 3H59A 2E5JA 3VAMA 3RRGA 2QRRA 4I56A 3UD3P 2VD3A 4QWEA 3O2IA 5I3UA 1KQKA 2OSQA 4DV7F 1Q4RA 3PKMA 2CQ2A 2HRYA 2BQRA 1B7YB 5T41A 4DN9A 3TAQA 2D3ZA 2QT7A 4JI7F 1NPPA 4DPXA 1BQMA 1C0TA 4ANEA 4ZP7A 4AUKA 4FPRA 2VG7A 2M3DA 1XNRF 1QSLA 1WF0A 2PI4A 4KHRA 1PKUA 3FQKA 4FKYA 2UXBF 3ENQA 1PGZA 4TKTA 5I3UB 3TANA 4CH7A 3K5MA 1RU1A 3SCLE 4RUAA 1SKSA 1QDUB 3I4PA 4OJ1A 3KHRA 2XO7A 2HRUA 2AWZA 4J9LA 2DO0A 4OYPA 1H98A 2J76E 1BQMB 2ZVIA 1RHUB 1C0TB 4YFUA 3T3FA 5FIIA 2VG7B 2GIFA 2JX2A 3IBCB 3C14A 2ZC4A 5IXUA 2HVEA 5D0GA 2RQKA 4C11A 1UKUA 5GAGI 2ZDPA 2BXJA 2E9RX 3PEHA 1CPZA 4PG4A 4MFBA 2IA6A 3B78A 4HI2A 3I87A 4Y2KA 3DM2A 5LT5A 2P5VA 3OL6A 1RT7B 3I6PA 3U1NA 2NSCA 1WTBA 2IMOA 1NK8A 2JHEA 3C14B 3RBEA 4A8QA 1VS3A 2VF3A 2CG8A 4J5OA 2Q66A 4O0IA 1N33F 4B3SF 1AFIA 4ZDNA 4MFBB 3NGRA 2OIHA 4JV1A 1RWNB 3DM2B 1MWQA 4CLKA 2WOMB 4UF4A 2RS8A 1XMBA 2X1BA 5KFQA 2C3PA 4KTQA 3CULA 4NEYA 4DV4J 4EI2A 4RNOA 2B4PA 4X4SA 3D66A 4F0KA 5KFOA 6FD1A 5L39A 2KHCA 3OT9A 2JOQA 5IC6B 4W90B 4LF6F 3CF5Q 1CG2A 4TY8A 2HG4A 3CTRA 5DDOC 1Y5IB 3GG0A 2AU0A 2KXFA 4DV2J 2OEMA 4O3OA 5KFJA 1QM9A 2AMCB 2UUCJ 5K8OA 3DRSB 1N6QA 2E66A 1QY7A 3QGHA 4OX9F 2DXDA 2E7WA 2DNGA 1TP7A 4R8UA 2X51A 3DC2A 3R6LB 3D28A 4ITSA 4WK3A 3M9NB 5SZTA 4FF3A 2B6AA 1WC4A 1IM4A 3RW6A 3MECA 1H73A 4GVBA 4W98A 1HD0A 4K4YA 2JJ4D 4Q2MA 1QUVA 3SCJE 2W2OP 2FVRA 3KOAA 3DRPA 4GRSA 4CNZA 3TOQA 3EVMA 1N6QB 3B82A 3JTNA 3CDBA 4R8UB 5GMEA 4RNNA 3KUGA 5HROB 4RW7A 3THVA 3PHEA 2LXIA 3N28A 4DPYA 1GNKA 4R0EA 5GAHU 2PFDA 2QO3A 2B6AB 2Z2MA 3MECB 4GVBB 4IKAA 2DRDA 4OI2A 4V19J 5A2QU 3KK3A 3VAHA 4CRJA 1NK7A 3TJAA 4DS5A 1WHYA 3ZTPA 2DIVA 3FGVA 3M8YA 3RW7A 2IC3A 2BKOA 1SKWA 3BDPA 1SQFA 2FUG9 1HR0J 1REGX 3Q8RB 4RW7B 1SXLA 1N34J 2JEFA 4Y2IA 1RAAB 2FHMA 3NXZA 4HACA 3L3CA 2V8GA 3SQGA 3OFHA 3EMTA 4DR5F 3KK3B 3D3BJ 4WFAQ 1ACMB 2HZCA 2V8VA 3P49B 1U49A 2IC3B 5KG0A 3F73A 1RU2A 2BJ7A 4I0WA 4FYXB 2BMBA 4PZVA 4K4XA 3QYYA 4DUZF 4CO4A 4X64F 2BJ8A 4OZ5A 3CJ0A 3D6TB 1QVGR 2ZM6F 3WX4A 3SI8A 3W66A 2QLFB 2FC9A 2DNQA 1Q95G 4FNHA 2HRTA 4IG0A 3SQGB 1SJ3P 4JI1F 4WF9Q 4ZVUB 4ES3A 2R8GA 3EYZA 3EE3A 2IYGA 3KJQB 1FXRA 4WP3A 1QAJA 1KS2A 2CQPA 2HQ3A 2R7XA 1O51A 4DUYF 4A8SA 2VQEF 1B64A 3M1VA 4KIAA 1H7WA 2YPYA 1VQ6S 1NLKL 4Q7AA 3BH7B 4CYUB 2RDDA 4IG0B 4X2BA 5K9FA 4ES1A 3HF5A 3MOJB 1TV6A 4LF5F 1RT5A 3KNAA 2DR9A 3M8PA 1S9EA 2R2SA 4XIUA 4O4GA 5K8MA 1TL1A 2IBKA 3N5BA 4ECVA 5HANA 1Z2LA 3NAIA 4OYIA 4JI0F 3M1VB 2HBZB 5HL7Q 1G3OA 1M1GA 4U9RA 2E9TA 4WP9A 2Y0BB 1IJFB 1RADB 2HHSA 3OFEA 3LTOA 4KT0C 2AZ1A 4P71A 1TV6B 1RT5B 3M8PB 1S9EB 1ZPVA 2D9OA 1TL1B 1H72C 4O3SA 1YBAA 5GADI 5D78A 3NGDA 3TARA 5KFIA 5DLGA 3HSZA 2DCUB 3D54A 3T1YJ 2JEIA 3S8SA 4NWBA 3PRBA 3CCUS 2ZZTA 3B4MA 2N4DA 3P8BB 3MFHA 2OPRA 2E1PA 2QJ3A 1SB6A 2WB1D 4NLPA 1F3VA 1NK0A 1VRTA 1O5JA 2QSFA 4QR0A 3M30A 1NAQA 1FDDA 4U96A 1YDLA 2ERRA 2AYMA 2CPHA 1QJHA 2O67A 2WBMA 2DGTA 2BBEA 2VQFJ 5KG3A 3PX6A 4UOGA 4M5DA 1V5VA 2FLLA 4PCQA 1S6PA 1BGXT 3DRYA 2OPRB 4ATNA 2FZKB 3BGUA 4DL7A 3CCRS 8ATCB 2D3OR 3ISZA 1RAJA 5K14B 5KFVA 1L3VA 1VRTB 2KO1A 4ZPDA 3S7RA 1NSAA 1TK8A 2JH3A 3IFEA 3M30B 2VBYA 2HHHF 1Y5NB 1K1QA 1U6BA 4KKOA 2BQUA 3MPVA 2ZKUA 4M5DB 3KG4A 1S6PB 2JC1A 1F60B 1JIHA 4ED6A 4B3MJ 3PEJA 4JI2J 4NA1A 3RR8A 2X1AA 2FZCB 1HBOA 2QL7B 3GJRB 2Y8YA 1N54B 2CKWA 2C2RA 2GMLA 3Q8SB 2ZUGA 3HLUA 3X1LB 3DDIA 1Q78A 2NUHA 1H38A 3QLHA 4IR1A 1B0VA 4KKOB 1U02A 3CIMA 3EZUA 2ZD1A 3NAHA 2C22A 1NHUA 2PA8D 4NA2A 1S4EA 2BKPA 1NSQA 2ZBCA 2C42A 2KVQE 3CCJS 3FEYB 3TEHB 2EG1A 1CS4B 4J9KA 4QW8A 4DQRA 1D3WA 3EM1A 2EI5A 5A6WA 3LA0A 2RE1A 2EK6A 5H1SV 1RBOB 1ZM3A 4FYYB 5GMKa 4G1QA 2QLJB 3QLHB 2EFGA 3J7ZT 3IN5A 4ECUA 1D09B 4J7CA 2D3O1 1IWGA 2Y3YA 4USIA 5L9XA 3RR7A 1TL5A 5IM0A 2YKNA 1LWEA 3IAS9 1JLBA 2ZOFA 4OHZA 5CD4A 4JV5J 2HNDA 2ZH4A 2Z0GA 1MLAA 2NZCA 3MM6B 1O6XA 1IKWA 2ASJA 3SCKE 1CJVA 4PXDA 4DI6A 2VFVA 1Q0NA 1DZ5A 2MEWA 3CMQA 4G1QB 4NPOA 4OZJA 3CC2S 2DNYA 2R7TA 2RB7A 2IDLA 3C2PA 3TUJC 5GMDA 3LW5C 1RISA 2XGQA 5IM0B 2YKNB 1JLBB 1JX4A 4NXMJ 1H0HB 3TAPA 4YY3J 3J7YU 3FUYA 1FVQA 1T9YA 1IKWB 1CJVB 4ECRA 1RLCL 4OV1A 4OHVA 2R7QA 2BJDA 2HQDA 3FK4A 3N6NA 2QZ8A 4PXEA 1S9GA 4ZPAA 4X65J 5DZ6A 1FJGF 1PSDA 4DDFA 2LEPA 1TKZB 3IBFB 2CIMA 4IG3A 4X4QA 2F4VJ 3BGRA 1UWAA 3BQ0A 2RH3A 5L8RC 2XMTA 4UOHA 3GJSB 3V6KA 2WAQD 2L48A 4YR0A 4CTAA 4ZPVR 4F0HA 4CH1A 2N7CA 3IWXA 5LM7E 5HK4A 5LSRA 5J1PA 3OXFA 5CHCB 4P2MA 2N3OA 2XMVA 4MIBA 1S9GB 1R43A 4YB5A 3AQOA 1CC7A 3CCVS 4DQPA 3BGRB 2HVIA 1RHQB 1ULRA 2D9PA 5I3PA 1VQSA 2RHQB 2L9DA 1TFWA 4I69A 4I68A 5H9EK 5H9FK 1KFDA 2O3DA 4QIGA 2DNRA 1TKXB 4ECSA 2VIHA 1KVIA 3HPOA 2RUGA 1REVA 4C7QA 5C42A 1GEHA 4U7UD 4DR2J 2GX8A 1W26A 3BBBA 1L3SA 2K2PA 2GMHA 4DV5F 2LMIA 3QGIA 1DLOA 1NDLA 4HTJA 3KG0A 2D41A 2W7AA 4C0OC 3HZGA 3WC2A 3NNAA 4DV7J 1VR6A 5B09A 2R42A 3A3OB 5GAGU 2MXYA 2HBRB 2KM8B 4JI7J 1TL4A 1RT6A 1C4CA 2C3MA 1GXUA 1XNRJ 2WVCA 4USVA 4RKUC 4ZVQB 2B9EA 4F67A 5GVQA 3NCQA 4DR3F 3EX7B 2XYHB 1L3UA 2C3UA 3Q8YA 3ET6A 2DNOA 2QMWA 3SFGA 3KLVA 3DOLA 4C8ZA 2XULA 4QIWD 1AB8A 3RB4A 1H74A 1RDRA 4PG8A 1S1UB 3MMCA 5F8GA 2I9SA 1R27B 4QYZJ 1F5AA 1RI7A 1SH3A 4IH5A 2V63A 2AJ4A 1KQFB 1Z1ZA 2XYPB 3FZBA 3ET6B 2VBXA 3MHYA 3G4SS 3C66A 4NMLA 2IVFB 2PD1A 2GJIA 3DOLB 3PIPQ 5F8IA 5K20B 1KLNA 3MMCB 3D6MB 2DISA 4QOTA 2QA2A 4G1PA 2VU5A 4M94A 3TQEA 1FE4A 2ZZMA 3KLGA 1N33J 1X9MA 5ETKA 3W8GA 3ZZ0A 4V1Ak 1ZS6A 2MY8A 4DZDA 4BWMA 2FJWA 2DXEA 3TZYA 3BDEA 4GC7A 4WKRA 4URSA 5D8HB 3D67A 1T94A 2F7VA 2HGMA 3DMJB 5C2GA 2IJRA 3QJPA 1WEYA 1JMTA 4PR6A 4XPCA 1LWCA 2MGZA 3L9ZA 1KLMA 2IDEA 3CO0P 1B0TA 5KFEA 4WIQA 4CLFA 4FN5A 3ILOA 4C97A 1NKBA 1XNQF 4M63A 2KVIA 2G2YA 4FZVA 3HKWA 1HHQA 2B43A 1IKVA 3R5JB 1UETA 1U8WA 5CABA 3NP5A 1BWVA 3HVWA 2FD2A 1LWCB 4DOZA 2MGZB 4EGLA 4F7VA 3FCHA 5A76A 1IM6A 4FVCA 4N8NA 4OYAA 4YR3A 2FJVA 1TKTA 3BJYA 4B3TF 2WZ1A 1MNEA 4OJHA 4FS2A 3CD5A 1N32F 5ETLA 4K4TA 1FRIA 3NGTA 4OYMA 3UI3A 1R6YA 4DL5A 1IKVB 3RBZA 4DV0F 1OPZA 2CZ4A 4EO6A 5KFCA 1RBAA 2ACYA 2DGXA 5B0BA 2QL5B 4RUHA 3GP9A 3OVBA 1M1HA 1SBRA 1TKTB 2CNOB 1RB0A 1X9SA 4ZPTR 1EQMA 1HPZA 3FSIA 2BANA 2G1DA 4QJVA 3CD0A 4EBEA 3GLJA 1A9NB 1WSRA 1U48A 2PMZD 3I5BA 3PW2A 1N0UA 5A8KB 1MW7A 4AQYF 4OFZA 4K2JA 3KJFB 3P45B 3M4XA 1FCAA 2H5IB 1UVJA 2R4FA 2OFHX 1RWXB 3BS9A 3PO4A 1HPZB 3MM7A 2QMXA 3AJDA 3EXYA 3A13A 2W25A 2N82B 4LQ9A 4P7VA 2IBOA 5B7WA 1OSDA 2N4CA 4A8YA 3A3PB 2J0XA 3AD7C 1U0HB 3BGLA 4X64J 3LP0A 5CAAA 3D6FB 2DPIA 3G8QA 2ZBPA 4EU0A 4C8OA 1LWXA 1DARA 2YY3A 3ZNJ1 5CYQA 4OZ3A 2ZWOA 3K57A 4JUZA 1MN7A 2FJAB 1C1CB 3JTOA 5ADZA 1GMUA 3MM7B 1OY8A 3J81Y 4WYWA 4ECWA 4UZCA 5D4NA 2XS5A 4FP9A 2LQ5A 3LP1A 2CDQA 5HMYA 5AE1A 1IUJA 4TQSA 1VQ5S 1BMQB 3M9OB 2VFTA 3P5BP 1HFEL 4R0JA 2HNZA 2GHVC 5GADU 5CYQB 2HIQA 2WSCC 3TA2A 5BYQA 2B4UA 4BC9A 3AJ2A 2XB2D 4NLYA 1RWOB 1KN6A 2FTRA 3LP1B 1HWIA 4P10A 5D0EA 3W8PA 3MUTP 1RT3A 3O5TB 4JI0J 4KE5A 1Q8KA 3KK1B 2DIUA 1TK0A 1SPBP 2DGVA 1VQNS 3Q24A 2HNZB 4MYTA 4QW9A 1S9FA 5KFUA 4WE1A 4PWUA 2ZBRA 2V8HA 4NE9C 3BGOP 1YGYA 1YLXA 5AJ3F 3C19A 1LK5A 2M8DB 3BO2A 2OP5A 2OAUA 3VGUA 4DSJA 1KOHA 5BR8J 1S0MA 1KHVA 5C7PA 1OSCA 1RT1B 4WFYA 3W65A 1P1TA 1NCLA 2QA4S 3PFOA 4EBDA 1FA0A 2XNRA 1RHMB 2LDIA 3SEOA 4J9QA 1S10A 4CLTA 4WE1B 1LKZA 4UUXA 4OYOA 1VRQC 2CZ9A 4IRKA 1X4AA 1G7CB 1AROP 1FDAA 1RAFB 2Z2YB 1S57A 2PMWA 2HFOA 1RJJA 4KY3A 2CJKA 3AJ1A 1TQLA 3GFXA 1XBWA 3OLBA 2V34A 5D0HA 1X4GA 2DGSA 3NGSA 1BUXA 3M6VA 5L1KA 2MMYA 1ROFA 4QU7A 3BQ2A 2G0CA 2NR0A 4ID5A 3MWBA 3OTDA 1TL3A 2VFRA 2X3GA 1TMMA 1F2HA 4B9TA 1YTYA 2DCLA 4KGZB 5KFXA 4CZCA 4C9DA 3R2CJ 3LOUA 3CDWA 1J5EJ 1VYAA 1BQNB 2NPFA 2RKIB 2OUGA 1IVZA 1IBLJ 4BLGA 4NYPA 3TX0A 1QTMA 2YWFA 3PW5A 4QWCA 1KFSA 1VRUA 3IR6B 2CJQA 3KYLA 4FF2A 1SIZA 1YJ7A 2AIRB 4PWWA 2UZAA 3QZ7A 5JXSA 4KHPF 2DH7A 3NNCA 1F9FA 4YP3A 4BS2A 4ID5B 1T9VA 4CM0A 1FJCA 2CJ9A 5KFSA 3LGHA 3GIJA 1U1LA 4YHHJ 3L09A 3DOMA 5LJ5Y 4C8LA 4DQQA 3LGMA 1WORA 4LFBF 1Y5LB 4OHXA 5B0DA 4KGVB 2ZHAA 4FBTA 3TZWA 1S6QA 1Y4ZB 4DLGA 3HHLB 3ISND 3QRQA 1ZETA 1EETA 2EVZA 2BVZA 3OL8A 5T14A 5KAKA 2HS0A 3HJVA 4O23A 3OTOF 3M2RA 4OZNA 1ITPA 2AW0A 1RABB 1WOSA 4J9SA 4WXWA 5BXIA 1PJ5A 1SCJB 1AFJA 4IRDA 3DOMB 4DCOB 3PX0A 1R0BG 2MQMA 3CVKA 4F2RA 3SV3A 1UZHA 5J2PA 2FVQA 2XSJA 4A4JA 2JL9A 1S6QB 2ROPA 1K9MT 1OY9A 1DTTA 3TAMA 4WZQA 1UWBB 2AJFE 3KHGA 3HCXA 3MXHP 5IQ6A 3N5FA 1EETB 1H2UX 1HQUA 2OGUA 2OMLA 5IT9Y 4FKXA 4LF2A 1N5YB 2B56A 2PEBA 2MPUA 4DV6J 2IMWP 4DR6F 2DHXA 5F8NA 1S59A 1RWPB 1L3KA 3M7VA 4M5GA 1TU0B 1W2IA 2HZAA 3DRRA 1IWAA 3HD1A 2AYGA 3BGFA 5J2PB 3R5AA 2XSJB 4LRAA 1Q1KA 1YJWS 1DTTB 3QFWA 3DGPB 2CJXB 1RT4B 4ZKAA 4DR7F 3AY0A 1BWEA 4USHA 1HQUB 2DGOA 2Z56B 3CJRA 3DLEB 1FESA 1RE1B 1V5IB 3MTKA 2G13A 4P72A 1JJHA 3J80Y 3HSGA 4Y28C 1RWVB 2NYIA 5EN1A 2ROEA 3DRRB 1UFKA 3U7JA 3W64A 2YNFB 2CPXA 3GIRA 1SL1A 4NLUA 3B8HA 2VKZG 1FJGJ 2YNHA 1FEEA 3HFKA 1UVNA 2J9DE 1WHXA 2UV8A 4LIRA 2IM0A 4GKJF 3PW7A 1HNZJ 4K2XA 3R2DJ 2UVWA 2AEJA 3N6LA 1ZM9A 3QNWB 1SKUB 2WW8A 5L38A 4X4NA 4M8LA 2RNEA 1VQOS 3F44A 3KNGA 4ZLPA 5KFLA 1YZ6A 4X4TA 2WVBA 3AD8C 4F04B 3OL7A 3U27A 3EVOA 2HLTA 1PC4A 3IR5B 4C8MA 5KT4A 3FVYA 3RRHA 2YNHB 1GMWD 3KLHA 4OHYA 4KO0A 3TZXA 5IWAF 3R1LA 3IRWP 4XAKA 1G2EA 3VV2B 3TYTA 3DDNA 5DGAA 1VQ7S 3EDRB 3IM9A 2AJQA 1D1UA 1HD1A 4ZIVA 2NXNA 1JLEB 1EHWA 3RB0A 3ZZYA 5KFYA 4OZ1A 1D9DA 3THPA 3H2VE 3SDEA 2HGLA 2M9KA 3MCOA 3KLHB 3KUEA 4ID8A 1HHTP 4WK1A 4DSIA 3EGWB 4HLBA 3DLHA 3AB2B 2BEFA 3V6DA 1YBTA 2F8MA 1YSJA 2X1GA 1ICEB 5KT5A 1NNDA 2LCWA 2I2YA 2HAIA 3W9HA 3UDLA 1XTZA 3L7PA 2NLWA 3SDEB 1Y11A 5C5JA 4WFBQ 4KHMA 2GCFA 2J5AA 3UQSA 4M5IA 4PEOA 3W5ZA 5D4LA 3O8WA 3PKYA 1LW0A 2FHKA 1T11A 3V6DB 3RU0A 5F8LA 3JSBA 3BH6B 3TVKA 2J9CA 3KFWX 2CJYB 1PJ7A 5KFGA 4DR3J 4OYBA 3T41A 4BBYA 3G6ES 5J2QA 2AJ1A 1YJ9S 1RTDA 2HURA 1X4DA 3W9IA 3ZNUA 4NI2A 2Y8WA 3G6VA 1RAIB 1AYEA 3HFZB 3BYPA 4O3RA 2W4PA 4MH8A 5THWA 2ZUAA 1KP6A 2CA9A 3MD1A 1LW0B 1HWUA 4P74A 1M5VC 2W7OA 2QG9B 5FD1A 3PXGa 4HT7A 2PGCA 5KFKA 4UOFA 1FK9B 3PDNA 4G65A 3GYGA 3OUYB 4PUOA 5DG9A 1VQPS 2VPWB 3UDEA 3M6UA 2XHWA 4URGA 2ZH3A 3HSDA 2IJFA 3FBBA 2MKJA 4PAAA 4K4ZA 1RCOB 2DVIA 5J2QB 3MMJA 2BABA 3K0JA 4NI2B 4KGXB 4AYBD 2F1FA 2IPOB 3ILLA 9ATCB 3MM8A 2WVFA 3A8EA 2LXFA 1FE0A 5JVGQ 5KFMA 2P6SA 1NMEB 2BM1A 2RU9A 4ECTA 4DV1F 1FD8A 2AX1A 3JQKA 1MWZA 1I1GA 1NJYA 3MF5A 2KKHA 4M95A 4DX6A 4PUOB 3JSYA 5HVGA 1WACA 4CLPA 4JB8B 1UCNA 1S76D 3NY0A 1N0VC 3WHIA 3J7A1 3PX4A 2WHOA 4DF8A 4RWWA 4LSNA 3MPDA 3MMBA 4JBCA 3BYRA 2Y1JA 2C2ZB 2HIYA 3D1HA 1U1PA 3AH6A 4KR0B 1F5BA 1U6ZA 3O44A 1XNQJ 5CYMA 4DG1B 2K3KA 4RX6A 2DH8A 1G4CA 4QBUA 4ANCA 3PR4A 5FLXU 2FVPA 3ICLA 3NKYA 1UVIA 5B0EA 3MMBB 2J6UA 2MYFA 1F0XA 4ZJQA 2ZNZA 4WFXA 2FJDB 2KFNA 2W8LA 4MIAA 1UA0A 1RACB 1GQEA 2KU7A 2IVYA 2YWHA 1TUVA 4I2QA 2FHJD 1KWMA 2EK1A 2HHQA 2XO6A 2DEIA 4B3TJ 4HTIA 1NPKA 1N32J 4LF8F 4CLSA 2AKWB 1LW2A 1PYOB 3FSYA 4MKBA 3O1LA 4IH6A 2XZTB 3DLKB 1VJWA 1YIJS 1EKSA 1YZ7A 4DV0J 3FMWA 5LMNJ 2RT3A 5KTQA 2CQHA 4I6AA 1RTHB 1HQ2A 3BO4A 1DQAA 1V3ZA 1URRA 5DZ7A 5M2PA 4I2QB 2XMMA 2DITA 2HSEB 4OHWA 1R8AA 3G8SA 3HULA 1X31C 4ECYA 7FD1A 2IM3A 4YDXA 5LJ3Y 1WJ9A 1LW2B 3HD2A 5ETMA 4DCJB 2NCKL 1EARA 1WELA 1X5SA 4U8YA 1WKKA 1SVDA 4MK7A 3PYEA 5HQ8A 1SJRA 3FMBA 2H3EB 4OMFG 1IQZA 3T6JA 3DLGA 2V4RA 3TW0A 1QUPA 3VGTA 2C2MB 3D6HB 3H5SA 4DX5A 3LUYA 3BREA 1HBUA 2NZ4A 2F4FA 1VHIA 4ECQA 1WEZA 3CB4A 2QSWA 1ZA1B 2Z2LA 2W2PP 4C8KA 4CQ1A 1VISA 2ZEJA 4ENOA 4HI1A 3EPIA 1I94J 1IQTA 2VC0A 5KG6A 2GVDA 2BOPA 3MCSA 2OD4A 1SL0A 3ZTRA 3CCMS 1S7IA 3DLGB 3W61A 3CXCR 1NJIT 4A8FA 2IRYA 4DV3J 4ED0A 3CCWA 1HBUB 1LV5A 2HFZA 4TNOA 2VJUA 1IN0A 2VG5B 2DRAA 3VGSA 3E2EA 1T05A 4F36A 3M32A 4HR2A 2VB6A 2U2FA 2VPZB 2GW8A 4N8OA 2KG1A 5HATA 3TO8A 3WX8A 2IIHA 3FRZA 3W9JA 2OJ3A 2DR8A 3L95X 1Q8IA 2IAJB 4CIOA 2R3VA 2BM0A 3OW2R 4TY9A 1T05B 2LQ9A 1Q7LB 4NMXA 3VAKA 3V81B 1R8BA 1RAGB 3H98A 2BJ3A 4TLQA 2L41A 5E3CA 1N5VA 4ELTA 2V4JA 5KFBA 4ZN3A 4I67A 1HMVA 2XGPA 3X3UA 3PYDA 3JXOA 4TU8A 3UVJA 2BKNA 1YX2A 3LWLA 4F4YA 3VGVA 4ZCIA 2XCPA 1HNIB 1OQ3A 2B9XA 4HYKA 2FJEB 1KVJA 2B9YA 1JLFA 3EXCX 2B0GA 5LMUF 3ZZUA 1E6YB 1DJ0A 2OMOA 1DHMA 1T9TA 3NLCA 3H0PA 3HX9A 3OTEA 3FNNA 2VA2A 2V4JB 1HMVB 3A1YG 3BKFA 1I6JA 4LF9F 3UVJB 2YWEA 3VHQA 3MEGA 3AHPA 4NLSA 3AFGA 3WIUA 1R0AA 3B54A 4TYAA 4Q8FA 5D4OA 3ULHA 1JLFB 1VQYA 1NUEA 2R7WA 3NWGA 3OR2A 1I51B 2XHCA 1EAYC 3AA9A 3CCTA 5ETRA 2KM8C 1BE4A 2VDIA 1UJ6A 1B0PA 1U1MA 3MEGB 3D1QA 2K3IA 3H20A 3DOKB 4PG7A 3O6QA 4OX8A 1R0AB 3GQCA 2VODA 2D3UA 1WWHA 2HZVA 3I56S 2DY1A 4JYAF 4FBUA 1B3TA 3D0IE 3OR2B 3QGGA 3ZZPA 1SUQA 3Q83A 1G1XA 2AX0A 2YH1A 4LVNP 4HDGA 3HVTA 5IFMA 3EGZA 4C4WA 4EYIB 3I0RA 3AXMA 2XMJA 2K8GA 4LJMA 5E2QA 3DLLQ 4USWA 2V0NA 4ZA1A 1ZYQA 3RBXA 3CCSS 3FJ2A 4K4SA 4KPYA 4X4RA 1VJQA 1CJUA 3N79A 1F3FA 3K7RA 4KHPJ 2VICA 4OZLA 3GFZA 1HI8A 1MMNA 2G2ZA 4WYLA 4J9PA 4UUWA 1SH0A 4CO3A 1C1BA 1KEKA 3M05A 2R8IA 1SUQB 2M5YA 4WU3A 2QLXA 4NXNF 2UXCJ 3H25A 2H54B 2LYVA 3H90A 5F9LA 4LFBJ 3QT6A 3HVTB 2LQBA 1HBMA 3QWPA 3CCQS 1LQ9A 3I0RB 3ZC4A 1NB7A 3ZZTA 1Y7PA 1NB2A 4IYQA 2V68A 4ELUA 3DHWC 4UZBA 3BR9A 3EGNA 2X3DA 4DQSA 2CQBA 1CJUB 4U95A 2MTLA 5ETSA 3OTOJ 3Q8PB 3W7BA 2H4YB 4ZP9A 8RUCA 4IOAQ 2C2EA 1C1BB 4A48A 3CC7S 5G0RA 3V2UC 3N4WA 1NH8A 2W9CB 5C25A 1HBMB 1M5OC 2OHDA 2KHDA 2Y1IA 1T3OA 1RHJB 4R5PB 1IKXA 3UFCX 4OL8A 3TA0A 1VI7A 1DQ9A 3MD3A 2RDJA 2DJWA 2LA4A 3H2UB 1J2VA 2MQNA 2W4DA 3H4BA 4RW4A 1UW9A 3NS6A 3FZ2A 3CDAA 3FEXB 2FB0A 1FVSA 1ZAXA 2BJEA 1RT7A 2UUBF 3UDVA 3ZTQA 2MJUA 3H8YA 5G0RB 2G0IA 1Y3KA 4ANDA 4RU9A 1Z2ZA 2VPXB 2ROGA 3BN7A 2DTJA 4LUBA 5C25B 3SMZA 2RDIA 4J9OA 1TELA 4LF7J 2OFGX 1X0PA 2ZH7A 1IKXB 1S6UA 4EBCA 2XZWA 1U8SA 1S12A 2J0SD 2RRAA 4NCAA 2YKMB 2NUUG 1OYDA 2UXDF 2QIFA 5AXKA 4RW4B 1ZM4A 2M0GB 2XS2A 4AD6A 2WOMA 4F4ZA 1V3SA 4TU7A 4EEYA 2E7XA 1HWJA 2UUTA 2XZDB 2QMUB 3W5XA 4DU8A 1TK5A 5C2CA 1Q86T 2Y9HA 2I6WA 3KXDA 3D5MA 1WHWA 2MQLA 2ABYA 3FCVA 3VVTA 2XY5A 4A8KA 2OEKA 2ZBIA 3MR3A 4IRCA 2NXEA 3NS5A 4UW2A 4B02A 4AL7A 1EKRA 4GKJJ 4IR9A 1XK8A 1VOMA 2R7SA 3G9CA 2F9JA 2FVCA 2I38A 2UUAJ 3PNIA 5HMXA 2LU2A 1WG5A 4WFNQ 3D3CJ 3DRSA 2WSFC 2GA7A 5KG4A 1FJ7A 1T3NA 1HIYA 2DXFA 1T9WA 1E6VB 4PQUB 5L1JA 2KFYA 2XY6A 2M70A 2YTCA 5E3QA 2GJ2A 1PG5B 1FF2A 2P2CB 3AXKA 5IWAJ 1FKOA 3KUHA 4DFJA 3LQVA 5ETVA 2JLFA 5KFWA 3I31A 4WZMA 1YJUA 3FC9A 3Q2SC 3D0HE 2V2QA 4X62F 1R89A 2GV1A 4N77A 2BJ1A 1Z4UA 4NL5A 1NKEA 1FFGB 1RT2A 2OPQA 1JB0C 5HROA 4CNYA 2ZJQQ 2HKEA 1R31A 2LLZA 4DV4F 3QSYB 1FKOB 4RLEA 2VHGA 3CMAS 2WVEA 5EDWA 5A0YA 3A8IA 4G3IA 3MEKA 1QE1A 3MUMP 2H65B 4XPEA 3CMES 1M5SA 1K73T 1Q7YT 4DSKA 4HDHA 2FGOA 2DR6A 4F4AA 2DO4A 1RT2B 3RGIA 5L1LA 2RQ4A 2OPQB 3IC1A 4F8RA 2IM2A 4AL6A 3HKZD 3MEDA 5I3QA 5KFAA 5F3TA 3G2XA 5GAEI 1O8BA 1YRUA 4JI4F 2DNZA 2QA1A 4GVLA 3V6JA 3AA8A 1M90T 5A0YB 1QE1B 3ELHA 1I5OB 2B8QA 2SXLA 2FLOA 4P7TA 3KMQA 4F25A 3BR8A 3MAAA 5ETQA 2ZNYA 1NU4A 1FKPA 3T5JA 1WKLA 3PG9A 5K8PA 4C6AA 4MK9A 3MEDB 4Z7CA 2YX7A 4B9UA 2MKSA 3BB5A 2ZHOA 3K5OA 1SQGA 3IXQA 2JDJA 3US5A 1TAQA 2KG0A 4QR1A 4KV8B 3C8YA 2XC9A 3HO1A 1P8GA 3IR7B 1FDNA 2ZBQA 1CJTA 2KTQA 1A7GE 1Q8BA 3GR0A 2P9EA 3MAAB 3I9ZA 1SJQA 4KB7A 2QFJA 1VGYA 3T5LA 1RYSA 3R7BB 1B7FA 1FKPB 1FXLA 2R8JA 4IQMA 4JOUA 1HHSA 3CWJA 4HEA9 2CQ0A 3ILIA 4CYUA 3HVRA 1HR0F 1B99A 2NSBA 2C3OA 2JNJA 4P52A 1UA1A 1CJTB 5B0CA 4P2FA 4IUFA 2VBWA 4N56A 1Q5VA 1AW0A 4TVAB 3TR5A 1WF2A 3KWMA 5JMNA 3N9UC 3IM8A 1FWPA 2QGFB 4RU2A 1R8HA 2K7KA 4ED7A 2H48B 2VH7A 2DB1A 5D3GB 3PO5A 4OI0A 1P9YA 2A6MA 2KRRA 2PEHA 3W2VA 2OPPB 3PYFA 1U2CA 5F8MA 2VASA 3CE8A 1UVLA 3K8VA 1S5ZA 2M2BA 5KG5A 2GQQA 5E33A 4F3QA 2EKYA 4ZVTB 2GMJA 5DDPC 1VK8A 2MSTA 4OZ0A 4I64A 3R7NB 1Q8LA 2UU9J 1Q5YA 1VQ9S 4USTA 3OJSA 3H4DA 2QA4G 3JQJA 1UFLA 2R2TA 2HW3A 3W2VB 2VOPA 4M5HA 3KG1A 4NASA 4F3MA 2POKA 5LSLA 4JI6F 1PYSB 2CZVC 4C3KA 3MGJA 4U6PA 2J7UA 5HN0A 1BY9A 3NG8A 4K4UA 1YJNS 4BC7A 1CULA 2F40A 3KJVA 2DD8S 3WDOA 2K06A 2KN4A 1T03A 4PG5A 2ZH6A 3ZTSA 3HHLC 1UW4A 5K14A 5HLFB 3GE9A 1RWWB 3CCES 3I0SB 2HLUA 2IY5B 5HQLA 2IYIA 1S4FA 1DY3A 3GMGA 4FXDA 1TUGB 2JLEA 2YNGA 2G1HA 1CULB 2W24A 2J0QD 2J7KA 4Q2LA 1TKDA 3KJVB 5KG7A 2DHSA 1T03B 4DL0C 2CFXA 5HMWA 4DEZA 3LF0A 3UW1A 2BOAA 2RMLA 3KMSA 1BLUA 4DCPB 1F2GA 3RAXA 1PO6A 1JXEA 4YS2A 7AT1B 4K8RA 1S0NA 3FBEA 2UV8G 3VTIA 1XR5A 2IFXA 3ITHB 1L3TA 2MHEA 2YNGB 1JK9B 4B3RJ 3QIDA 4GKKF 3OR1A 2QE5A 2Q3PA 2DHGA 2J8SA 2N3LA 2WK4A 1MROB 5KFNA 4G1IA 2V2KA 3DU6A 2XLJA 3CJ2A 5EX0A 3K59A 2GHPA 3MMAA 1CS4A 2GQ2A 3N01A 4Y2AA 2VQFF 1K0VA 2RRBA 2LQJA 2PMHA 3FQLA 4TYBA 3T19A 2EWHA 5AE3A 1M0SA 2EBGA 3E01A 1UAWA 4JI3J 3R8YA 3UNYA 3RAQA 3UCUP 4PPDA 3POTA 2DNLA 3LPYA 5IC4B 3QT8A 2WONB 3OR1B 7FDRA 3KDOA 1ZBTA 2HHVA 3QQCD 3GV7B 4QQBA 1CLFA 3WQPA 2WTFA 5A8WA 3MMAB 5JJBA 1TAUA 2W9AA 2Q79A 1JLCA 1P1LA 2BR0A 4LFAJ 3I82A 1SL2A 3MM6A 1DQ8A 2AV5A 5IT0A 3E01B 4B3MF 2KI2A 1RGVA 3NBPB 1RAHB 2AD9A 1HA1A 3DHXA 4X84A 2YKQA 3POTB 4YOEA 4I4BA 5HVFA 1N56A 1WG4A 2HK3A 4U8VA 2LEBA 1GT8A 4K7QA 1NK5A 2HMIA 5A8WB 2GO9A 4C0HA 2CPFA 1YWXA 2H5EA 1JLCB 1FX4A 3GB0A 3A4TA 3HZEA 2C2OB 2FZGB 1RP5A 4EK2A 4M5KA 4J9MA 1QAIA 4ED4A 3A8JA 3CIZA 3QRRA 2QTWA 5LMUJ 3PJ9A 2Y1LB 2XY7A 2W9BA 1RTIA 5ITHA 4RW8B 1TKZA 2WW4A 1ZPWX 5J2MB 1UMJA 1C2PA 2HMIB 3UNGC 4KSEB 1U1OA 3UD4P 1NSPA 1FRJA 1FXDA 2ZITA 1M5HA 3Q2TC 2JVRA 2GVZA 4HT5A 1EP4A 1VMBA 3RUBL 3NEKA 4ZCKA 3GWCA 4NRTA 4PPZA 3NGUA 4BWJA 2W9BB 1RTIB 2Z58B 4ILMA 2CPZA 1HKAA 1UPPA 2RJZA 1NEEA 4F4WA 4I6WA 2CPYA 1ELOA 1FO1A 3U1MA 3BF4A 4RBUA 5I4MA 2AEFA 1SV5B 1FWKA 3ZZRA 2YKPA 3HM9A 1FNMA 1DURA 4NXMF 9RUBA 2GVZB 1EP4B 4JYAJ 1N36J 3P3DA 1VBYA 4DR1J 1IKYA 4C2MA 3LALA 1TKXA 3ENAA 1AUSL 4E0DA 2HWHA 1U1KA 3KLEA 1U09A 1S72S 3ADAC 3ZZOA 1RHKB 1CVJA 3IGNA 1WI6A 3WC0A 4ZOSA 3MR5A 3VQSA 2NYHA 2G4BA 4Y34A 1NZ8A 1U0SA 3KLFA 1XN9A 1H3DA 4I2PA 1TZ0A 1FEHA 1JLQB 2FGCA 4FXWA 3QIPA 1IKYB 4RUBA 2YWKA 5F3ZA 3SCIE 4W92B 3KLEB 1HLWA 1KQGB 4RUCA 5E41A 1Q16B 5HSPA 1QSYA 4NXNJ 3QO9A 1RLDA 1NZAA 1JNRB 1LNQA 3AD9C 2OO4A 4EUVA 3DI6A 1P6TA 1VBKA 4ED3A 1HWKA 2CPIA 2VV5A 3MR7A 3KLFB 2MZQA 4BHQA 4I2PB 1SH2A 3CT9A 4M5JA 4PRFA 1KD1T 2FDNA 5HP1A 3PV8A 3QIPB 3G86A 5KOWA 1PIEA 1FRMA 5IS2A 1V9OA 5EGYA 3KKFA 1QAXA 3QO9B 3D4JA 4C8YA 4USKA 2JFDA 3DN9A 2K7JA 2VFSA 1LFWA 4FS1A 3DI6B 2VJVA 1ZOTA 1S1UA 3K17A 2CJBA 5E7OB 4C3LA 1NO8A 4RR5A 2UXBJ 5J2NA 2AT1B 2CYYA 2P9GA 3K58A 2V67A 4EWTA 5HP1B 1O0PA 2Z2ZA 3OLAA 1RWKB 2UUBJ 2Z57B 4QYZK 4IOBA 4YEAA 2JFKA 2W7PA 1DTQA 1QTNB 2B8PA 2XS7A 3DLJA 1VQMS 1T8EA 2VPYB 3OXLA 4DN0A 3DNCA 4TN2A 4NLRA 1Y3JA 4O3PA 5L46A 3GFHA 2KZMA 3C3LA 4PWDA 1Q82T 2AZ3A 4V19X 1OO0B 2PI5A 4DPUA 2UXDJ 4NOHA 2NXCA 2RUSA 5J2NB 3CJ5A 4ED2A 5DQIA 1C4AA 2JVOA 5LXYA 3PZPA 4OQJA 4ZPCA 1GXTA 2AGPA 3MPUB 4OYXA 4FNIA 1YJRA 1KBRA 4HHJA 1SIWB 3AODA 3SXLA 1DTQB 5IT9U 1JLAA 3DMJA 4U7UK 5DM7Q 2LU1A 3BSNA 3QZ8A 5DG8A 2KDOA 5A8RA 1BQXA 2HHXA 2C2DA 3HK2A 4XK8C 4H4KA 2Q43A 1RHRB 4NLTA 4WTOB 4CDIA 3IBWA 4K50A 2RAQA 5SUHA 5KFRA 4PWDB 5E3RA 3M8WA 3A3NB 4B3SJ 1I3OB 1VLYA 2XG8A 3CCZA 4ZVHA 4L76A 2EKNA 2Z4PA 2VOOA 1UVKA 3SYZA 3C6TA 2GC8A 3R5CA 1FKAF 1T7PA 2J0WA 1H2TZ 1JQGA 1JLAB 2I8EA 1MU2A 5A8RB 4KYZA 3J80U 4LRCA 1RXOB 3CSKA 5EX3A 4LF6J 2RQMA 2DYAA 1MWYA 3I55S 4YR2A 3F0NA 2PSZA 1U1QA 3G71S 4AT1B 4N76A 3QAUA 2G2OA 1CBKA 5HJYA 4LFCF 5KFFA 4PYDA 2AYBA 4DWIA 4C11B 3C6TB 4X62J 5FLXY 5GAEU 1M1KT 2YVSA 1HL6A 4N7TA 4OX9J 4ERDA 2BUNA 2B5JA 4NLOA 1MU2B 1FRKA 5IT4A 3G6YA 1N5QA 4Q43A 2B4VA 3F56A 1LEOA 4XDCA 3CJTA 1JJ2R 5CCLA 2CQ1A 1NJWA 3H2LA 2WSEC 3PIOQ 2HHWA 3R27A 1RWMB 2U1AA 3L7OA 1S77D 3PCOB 1WDDA 1YITS 4NLWA 2BW7A 5AT1B 2FVSA 4ILLA 2JWNA 1FJEB 4ICLA 4KBIA 5E3AA 2FY8A 2RSQA 2CG4A 3RTVA 3GCWP 2B5JB 3TX8A 3NOGA 3GG1A 4NLQA 3BM7A 3BSOA 2QLBB 3E3XA 5A8KA 2ZH2A 3DCAA 1FI4A 2ADBA 4JI4J 4QU6A 4X4VA 2J9DA 3NNHA 2EFPA 3MM5A 2AGOA 4ICLB 2VDHA 4TY8B 1V3RA 2HHPA 4LR7A 4QIFA 5CD4H 5B0FA 2MZRA 3FRYA 2F8HA 2MKYA 5CQGA 1CEZA 3JAMU 3NCPA 1Y10A 3BSCA 4OV6A 3FFIA 1U0HA 2JC0A 1K47A 4CM2A 1NJXA 1XR6A 4B9NA 3PY8A 4QYRA 3OTCA 2V9KA 3H40A 4DR5J 3MM5B 3SSQA 1C1CA 3CC4S 4FDFA 5IV4A 1WUUA 2K1RA 2Y0SD 1RA6A 3FFIB 4ZHRA 4DUZJ 1SC4B 3DRPB 1FX2A 4K4WA 1VIXA 2ZM6J 4ED1A 4KRWA 5ETNA 1VDHA 4JI1J 3TUPA 2YXLA 2E1RA 1NRKA 1LOUA 3Q8UA 3UE2A 2QYGA 3Q22A 4ELVA 2V8DA 2L9WA 4USMA 3PFEA 2K1RB 4QR2A 1CQMA 4DUYJ 4AFFA 1VC5A 1F1BB 4CT9A 1HNVA 4ZHRB 4F02A 3CCLS 2VQEJ 4AE5A 3KK1A 1WKJA 4L73A 2W2QP 1QLNA 4ES2A 1SJFA 4DR4F 2V6AA 4ILRA 5DQHA 1NK9A 4EMDA 2VC1A 2F3JA 4Y3CA 2ZHBA 1RZMA 2CQDA 3A8KA 2BV3A 2EW9A 1HWLA 3ZFVA 3NOCA 4A8OA 2FLNA 2BW2A 4HACB 4AXJA 2LP4A 2KH9A 4OLOA 5B08A 4LF5J 4DX8H 3I32A 3V4IA 1IR0A 1HNVB 3R7SB 3P5TL 3SIPB 5JUMA 1VQKS 3W60A 1L5UA 1RT1A 2LA6A 1X60A 3HMJG 2DY9A 2LVWA 2B3TB 4CI0B 4GMKA 2KYZA 2IA0A 3Q0AA 2CAJA 1UL3A 2ALYB 5HAOA 2DNKA 4ETXA 3BBFA 3QT5A 3TZZA 2QYCA 3V4IB 4JI6J 1ZAVA 3PHTA 1QSSA 5U47A 4A46A 5DDQC 2E1MC 1BC6A 3TA1A 1R0CB 4OYWA 4O4RA 5EUHA 3HXMA 1URNA 1PAEX 1YRXA 1TMJA 3LAMA 4YB7A 5HQMA 4Q0BA 3UD5A 3WZ0A 1FTRA 2O5DA 2PN6A 2MKIA 2Y1RI 3I4HX 2DEJA 1WNEA 1M5PC 3M8QA 3F41A 1KTQA 3R5DA 3R9LA 4LREA 5KT6A 1IR1A 1T95A 2P6TA 1FDBA 1P27B 1JWWA 1P9QC 3MEEA 5C24A 2HPUA 3TJ8A 3VR1A 3SBMA 1JXVA 1ZTTA 4PXCA 4LQ3A 4WCEQ 1BQNA 4ZCMA 2RKIA 2YKAA 4O4GB 3A12A 2GZOA 3MCNA 1SI9A 2C2KB 1BD6A 3W63A 4Q0BB 1PCAA 2KJWA 1R8CA 3W62A 3M9MB 2J6SA 2GFFA 5BR8F 5EWFA 3VCDA 3D9BA 3M8QB 3E8OA 3LPEA 4EZ6A 4OLPA 5B0AA 2JRSA 3C16A 2HBYB 2NXUA 4FYVB 3MEEB 5C24B 3KJNB 2UUWA 3VF0B 3BPSP 2HEKA 2HHHJ 4IFVA 3NMRA 5BJRA 2D1CA 4FF4A 4Z2XA 1D9FA 2EC0A 4ZPBA 3T6BA 1VQ4S 3VQTA 4GKKJ 1S7HA 4OJ3A 2GGPA 2D7SA 3AB4B 3HHLA 4ZCLA 4P73A 2W4CA 2YX4A 3G82A 5KFTA 2E29A 1CSJA 1RK8A 3BZQA 1OYEA 2L3MA 3C16B 5EWEA 2D69A 2NREA 3D2WA 5HJXA 1N48A 3GONA 4IFVB 4DLEA 2V50A 1AZSA 1RKJA 3DKDA 4KPCA 1YBUA 4B9LA 2V8PA 2YPZA 4DL2A 5F9NA 4H4MA 4I1TA 3PRDA 1UWBA 2GGPB 1J5EF 3PJXA 3G82B 1NHKL 1X4EA 4F50A 1IBLF 3T9ZA 4RWXA 1N5YA 2ZWPA 2EFNA 1YG0A 2DRBA 2RF2A 5IV3A 3CUNA 2HVZA 1J27A 1XMQF 4DZ6A 2A0FB 3BPDA 3Q86A 5M2UA 1AZSB 1U4BA 1R6VA 2CQ4A 1R8PA 4H4MB 4ZN1A 3PTWA 4KH0B 4DL6A 3W3SA 3PRVA 4CO0A 2V94A 3DGPA 4YHHF 2AGQA 1F9HA 1RT4A 4HKQA 4C8NA 2XI2A 1XIQA 1KQSR 2OI2A 1X9WA 3DLEA 2XSFA 3T9NA 4UQTA 4NZ7A 4FXVA 2RF2B 1XC9A 3GU0A 2RRNA 1ZZNA 5KFDA 1PYTA 4MKYA 4HHHA 4UY8T 5DLFA 1T9UA 2MKCA 2EEYA 2YNFA 1HBOB 1MMDA 2MJNA 2MQPA 2ZOMA 2GS8A 4A8WA 1FERA 2XQCA 2ZC3A 5D6GA 3KHLA 3IA0A 4KFBA 2OKQA 4I7FA 1U25A 2LFVA 1NXIA 4ZVRB 2B7BB 1VHFA 2ZD1B 1U2RA 2C2NA 1IBKF 4ZVOB 3V5RA 3UDCA 3IWLA 3N6MA 4DSLA 3BKTA 4S0MA 3ONQA 2EC2A 3MPWA 2CPEA 3ENVA 3IMQJ 3IRXA 1NPRA 4DV6F 2YH0A 1PBUA 1NDCA 2M7SA 3P96A 2H9ZA 1GMVA 4KFBB 2O1PA 3Q8VA 4I7FB 1JJCB 3DXSX 3O3LA 4U7CA 3W5YA 2AP6A 3C6UA 3OQ2A 3JQMA 2ZH8A 3MAHA 4KGMA 1WF1A 4ZLNA 1KKHA 2FYXA 3K5LA 1XMOF 2HYIB 2YWGA 5E0OA 1JLEA 4UTGA 1LWEB 4ED8A 4WFZA 3I5CA 4KAIA 3DFEA 2HNDB 1RCXB 3IRXB 3OXGA 4ALZA 2X7IA 2EXUA 4RPFA 4YDDB 4ETZA 4QWDA 1LXJA 3DRXA 1IBCB 5CH7B 3C6UB 2M88A 4K5RA 4QIEA 4J37A 4J9RA 4MMOA 2YBVA 5AE2A 2EG2A 1PBAA 2ZJRQ 1HNZF 1U47A 4CLUA 4P9SA 3HT3A 4DFMA 4NZ0A 3MFIA 4DMZA 3EJMA 1Y0HA 1Y00A 2MSSA 2VA3A 1SKRA 4E2FB 5D15A 1OQ6A 5HMZA 3TNVA 2XLIA 3QPIA 3ETOA 1YJTA 4DU7A 4LBHA 2ASLA 4K59A 3UN3A 2HWTA 4DV5J 1YK9A 2NS1B 1UZDA 4IG3B 1RSCA 4P6QA 3G6XA 4WTYA 2EFOA 1NH7A 2DHHA 3VALA 1SC1B 4ZP6A 3L4BC 2VBZA 4CTAB 4K5SA 1F5CA 4WWSA 3GZ7A 1K44A 2QV6A 4OJGA 3HP6A 4ZJLA 5A2QY 2KXNB 4OX6A 3MI7X 1FK9A 4WIIA 4CLZA 4RL1A 3GILA 4MJKA 3OUYA 4FF1A 4RNFA 2COLA 3EVWA 2E5LF 2ZVSA 4K0KF 2ZH5A 2MLYA 5IOLA 1FRLA 2MLZA 1UFWA 3T1AA 4OZ2A 5H9EJ 1WC3A 4RW6A 3LP2A 3MM9A 5H9FJ 2DGQA 2OEJA 3KK2A 4QPXA 2DK2A 2BYCA 2DNMA 3EICA 2H51B 2JLGA 3S01A 3CDUA 1REVB 1S49A 4PXBA 5C42B 4DSFA 3M2VA 2YKOA 1LK7A 1QAYA 2WVDA 1WD6A 1W25A 1OJ4A 1VQLS 1SJ4P 5FDLA 1OWXA 3OVSA 4MTPA 5L1IA 4RW6B 2ZKTA 4E8UA 3LP2B 1DLOB 3MM9B 1MN9A 3QRPA 4A8MP 4JI8F 4KC5A 1NDPA 2LXUA 5D4PA 3HHNB 3KK2B 3SQOP 1VCTA 4MYUA 4ZITA 1YKWA 4LSLA 2C1EB 3GIIA 3OTBA 1RT6B 2H1YA 3M2VB 2XNQA 1GX6A 2W01A 4DG1A 2FJXA 2RS2A 3DYAA 4CT8A 4UT4A 5FDLB 2JSXA 3OV7A 1HI1A 3VVUA 3S6EA 3DU5A 3Q89A 2B9WA 3U02A 1GAOA 2G0JA 4DJBA 2GAGC 2LQ8A 2HHTA 2A2CA 1NKCA 4NA3A 4LSLB 3QGPA 2QX0A 3H42A 1A6LA 4P2SA 2HFNA 2FIUA 1UTAA 3PJWA 2XYGB 4OI4A 3DYAB 3ZXWA 4LFCJ 5KG2A 1G6BA 3GYNA 3BN4A 3JSMA 3DLKA 2JEJA 2R8KA 4C0BA 4P2XA 4EYHB 3GPAA 3SSSA 1HNWF 3R6GB 1RTHA 2F63A 3QATA 2NPIA 2XI3A 2E5GA 1S0VA 5EWGA 3RJMB 4J90A 3PR5B 5J1EA 2CJAA 4CP5A 4ZP8A 1OIAA 3LANA 1OY6A 1KNZA 3M8SA 1X7VA 1EZZB 3RB6A 1H2VZ 4DF4A 3KLGB 3JSMB 3T5HA 1U45A 3UCZP 1M5KC 3UWTA 5HO4A 2VFUA 1X5TA 1DFDA 3P6YC 3B6BA 3IG1A 2XWYA 2ILYA 3HHKA 3HJFA 2XEXA 1Q53A 1GXLA 1JLGA 1APSA 1KR4A 3NL0A 1K0TA 5J1EB 3CPWR 1YHQS 2AEMA 1VK3A 3HFVA 1KLMB 2DPJA 2VKRA 2CWXA 4AXIA 3GJQB 2DR5A 3M8ZA 1HNXF 1C0UA 1XWLA 3IAM9 4UOCA 1LWFA 2ZH1A 5EHHA 1WOPA 3HHLD 4H4OA 1GMWA 4MKAA 2DNNA 3ETMA 5HVHA 3G87A 2GNKA 3IG1B 1U6FA 2DKOB 2DNHA 3ZO7A 1JKHA 1JLGB 2R2RA 4PKDB 5BYSA 5IQQA 4LF1A 2EFQA 2AYEA 4WBFA 4AQYJ 3LGNA 2VG6A 5LMNF 2V9WA 2MQQA 3KHHA 1Q81T 3QBCA 3OVAA 3KDNA 1Q79A 2R2UA 3VWSA 2L08A 1C0UB 2MLXA 3EWGA 2X1FA 1XR7A 1LWFB 2VG5A 1N5TA 1YRTA 2HK2A 3AAWB 4UY85 4H4OB 5HI7A 1BXNA 2M52A 1B70B 4WP8A 2Q1LA 1IBMF 1VBZA 1D8YA 4KH1B 3GV8B 3HI9A 1JKHB 3TP2A 2I5JA 3DLBA 4B9VA 2MDAA 2VG6B 1IXKA 3ILJA 4O3NA 1AA1B 3J7Z5 2ASDA 3IWNC 2YNIA 4TLRA 1GK8A 3KTQA 2ASYA 2AJ0A 4LSZB 5LL6d 2IAJA 4DSEA 1NBEB 2LEAA 1RYRA 2GHWA 4B9MA 5IZHA 4C3MA 4JI5F 3V81A 4WPAA 1WC1A 1N52B 1X5OA 1K8AT 2BANB 1HARA 1UJ4A 4ZIWA 2I5JB 4DR4J 2VONA 3RYLA 2E9ZA 2XMUA 1I94F 1UJ5A 2H5JB 2EFVA 2YNIB 1R7IA 4Q8EA 2DHAA 1RWUA 1SC6A 4WXOA 1HNIA 5BYRA 2CQIA 4OI1A 3MDFA 1T02A 4DV3F 5K8NA 2CUYA 4D3HA 1E6YA 3I5AA 3TVYA 4ZVGA 3G8TA 1FT8A 2HQGA 3LAKA 4URQU 3EZ5A 2DGUA 3UR3C 2E5IA 3HHDA 3CJQA 2GAHC 4M5MA 3HSJA 3FEZA 3LP0B 4G6VB 1ZAWA 2VUGA 4ZVFA 4Y0FA 1D0EA 2CQ3A 5AJ3J 2HFSA 4ECZA 2M4MA 2HFUA 2MY7A 1ZA2B 4NCBA 2HVHA 3RG6A 1WHVA 2E1AA 3QJJA 1CC8A 3EGVA 4LT6A 2PC6A 2P8IA 1X0FA 1FFSB 2IVMA 4F26A 2B7CB 3QT7A 3DOKA 3QAEA 5MAOA 2HAFA 3VZHA 4YB1P 2BJ9A 4CO2A 4EZ9A 1EX8A 3CGIA 5LXRA 2BZ2A 2CQCA 2UVUA 1WEXA 2CRLA 3FCWA 1X5PA 4X66F 4L3NA 2RIJA 5F8HA 3IGVA 2FPHX 6FDRA 2IHR1 2APOA 4AL5A 3BO3A 2Z8QA 5KOXA 2LDYA 3L7UA 1U2FA 4ZK7M 1RT3B 3NCRA 2CPDA 1EB0A 3FDSA 1MMLA 2KJVA 2Q6BA 3RAMA 2DT9A 4LBIA 2J7WA 4OI3A 2M8HA 1S48A 4F4KA 3MOZA 3TQ1A 4H54A 3M6XA 1S1XA 4JV2A 1TFYA 4IO1A 1UP1A 4LF4F 2QN6B 1OS5A 3RBDA 2J9EA 3CD7A 2PIIA 1RA7A 2J6TA 2FHJA 2OTJS 2HQFA 5DJBA 1UPMB 2B4OA 3CJSA 4CO1A 2CNKB 1KC8T 3NMAA 2ATLA 1JNZB 3TRGA 4DL3A 2LKZA 4YQWA 3MR2A 4LRFA 1S1XB 3I9V9 2W1BA 3RRKA 1QVFR 2W9CA 4NLXA 1NK6A 1UEVA 3P4UB 4DUTA 1HW9A 1WC0A 5G4DA 2FY1A 4R5PA 2MZSA 4RNHA 4EO8A 1S1WA 2RVJA 2F5GA 3H5UA 3QFHA 4O0NA 2W2NP 2P9CA 2HQCA 4PG6A 3DDKA 2BE9B 1S97A 1XMQJ 3CW2C 3PW0A 2HVDA 2Z30B 4J91A 2QC3A 2MKHA 4TU9A 1N4LA 4DBQA 1FHTA 5JVHQ 4BDPA 1TUWA 1TL3B 2XM3A 2C28A 2YQ3A 1OPIA 5HBMA 2RD5C 4H4KC 2OD6A 2UXCF 3T1HF 2YKMA 1S1WB 3OHBA 4JV0A 3M2UA 1XERA 2A10A 5M2RA 1NM2A 4DR6J 3OSPA 5K5MA 2R7OA 3TEGA 2EPIA 4LRDA 2HS3A 3H5XA 2D74B 3Q8QB 1VRUB 2CNNB 4HHUA 4B9SA 3JYTA 1ZH5A 4PABA 1NDKA 4N47A 4ZVEA 3JS9A 4B3OA 5KT7A 2WB4A 3R3TA 2H4WB 5HBMB 2DGWA 3MZIA 4N5SA 2MQ8A 1WTFA 4DR7J 2YWWA 3TVZA 1U26A 3EDQB 1IBKJ 2O66A 3M2UB 1DRZA 4K4VA 2R7VA 4Q45A 3CEDA 4USJC 2GQCA 3LH2S 3AOAA 3JYTB 1YI2S 2IRXA 3CJ3A 4NCGA 3JSRA 3TUZC 2ATCB 3M2RB 4PYAA 2CNLB 3IO1A 4A47A 1XJWB 4B3OB 1E6VA 4PQUA 2R9LA 2KB2A 3K5PA 4EFAC 1MSWD 5D0RA 3KLIA 2BE7D 4CWBA 4CLLA 3OHAA 4MK8A 2CVEA 1FRHA 4LF7F 2FQQB 3PYGA 3TAMB 1D9AA 2VZ9A 3NWRA 2IRUA 3MTJA 3RB3A 1XMOJ 4HH1A 3R5GA 1X4FA 3D0GE 5AXMA 4ZS6A 4WJBA 3ZTOA 4NCGB 4KQZA 2W2MP 3CDEA 1NHVA 4QPTA 1X4CA 3GJTB 4MAKA 2FLPA 4RJVA 2PDAA 4KGKA 2OLWA 4NX9A 3KLIB 2PA3A 3FSXA 4YUDA 2RQCA 1VC0A 4M5LA 5F41A 3WBZA 4RO0A 4NLGA 4QCLA 2O01C 1HBNA 1X4HA 5T7LA 1UEUA 6AT1B 1EJ7L 2VL1A 2N7YA 4Y6IA 4RNMA 2A3JA 2JZ5A 1KDNA 5L9NA 4UQGA 2AJ2A 2XMWA 4DFKA 2R8HA 4M1KA 3R5BA 1J5OA 3SSRA 2HHUA 2UUAF 1D8ZA 4X4OA 4LMZA 1FFWB 1EIYB 4YB6A 3CNQP 2BQ3A 3JTPA 4YMEA 4FPIA 2ZDOA 8AT1B 1PC5A 1QD1A 2KL8A 5AXLA 4CO5A 2BX6A 3CO9A 1XEZA 5A6PA 3UN2A 1HBNB 5T7LB 4LRBA 2Q6CA 4QIVA 3T5KA 2R7UA 4C98A 1R3NA 3GCXP 3MCMA 4NLDA 3ENWA 3K8WA 4DV2F 2E5HA 1J5OB 4NLVA 1UVMA 2UUCF 1TR0A 4M5NA 1VIOA 5FJ4A 3UN5A 1TTHB 4CLYA 3MAQA 3OSNA 2E1CA 3VAGA 1ZM2A 4KV8A 1VC6A 1GFWB 1LFPA 2XLKA 4ZVPB 1PAUB 1UEKA 4KO0B 2DH9A 4FYWB 4MKVA 2IJNA 3JAMY 1AXQA 2JEGA 2HNYA 3PACA 3BSAA 3TUIC 2E5LJ 4HH0A 2XBPA 3WIVA 3QSIA 4K0KJ 3W2WA 1A0OB 2FC8A 3AQPA 5ETPA 4A8XA 3OFFA 2XWXA 1H7XA
chains in the Genus database with same CATH topology
5J1PA 3CCLS 3OXFA 4AE5A 1E6YB 5CHCB 3KK1A 2N3OA 1DJ0A 2OMOA 1DHMA 4ED5A 1QLNA 3NLCA 2XMVA 4MIBA 1S9GB 4ES2A 1SJFA 4DR4F 3HX9A 1R43A 3OTEA 4BCAA 3FNNA 4YB5A 4ILRA 5DQHA 1NK9A 3AQOA 1CC7A 3CCVS 4DQPA 2VC1A 2VA2A 2F3JA 2V4JB 4Y3CA 1HMVB 2ZHBA 3BGRB 1GTEA 4FVMA 2CQDA 3A1YG 2BV3A 2EW9A 1I6JA 1HWLA 3ZFVA 4LF9F 4A8OA 2FLNA 1HW8A 1SQEA 3S1TA 2YWEA 2BW2A 2HVIA 4AXJA 3MEGA 2KH9A 2HNYB 4OLOA 1ULRA 5B08A 3AHPA 3THTA 4NLSA 4DX8H 4X4UA 2D9PA 5I3PA 1R0AA 3I32A 1VQSA 2L9DA 3W2WB 1N88A 4TYAA 4Q8FA 3V4IA 1IR0A 5D4OA 3ULHA 4J9NA 1HNVB 4WU2A 1TFWA 1JLFB 2UVVA 2OTLS 2F8EX 1VQYA 5CZVA 3P5TL 4I69A 5JUMA 4I68A 2R7WA 3NWGA 1HYSA 3OR2A 1KRPA 1KTVA 1VQKS 1L5UA 3AA9A 1RT1A 2LA6A 3CCTA 1KFDA 2O3DA 4QIGA 2DNRA 1TKXB 4ECSA 2KM8C 1KVIA 3HMJG 3HPOA 2LVWA 3GIMA 2RUGA 5D3GA 2B3TB 1REVA 4DQIA 4C7QA 4CI0B 1N34F 3HVAA 5C42A 4GMKA 2KYZA 3K2YA 2IA0A 3ZZZA 1Y9OA 4IOCQ 1UJ6A 5CYJA 1B0PA 4XO0A 1U1MA 3Q0AA 2GX8A 2OPPA 1UL3A 3MEGB 3D1QA 2K3IA 3H20A 4WKYA 3Q23A 1L3SA 2DNKA 4ETXA 2UVRA 3DOKB 2K2PA 4PG7A 2GMHA 3O6QA 2OPSA 1R0AB 4OX8A 4DV5F 1U1RA 1ZTWA 3GYXB 3GQCA 2LMIA 2QYCA 3QGIA 2VODA 1DLOA 3V4IB 2D3UA 1ZAVA 4HTJA 2EBEA 2A2DA 1WWHA 1QSSA 3KG0A 3I56S 2D41A 5U47A 4A46A 4JYAF 2W7AA 4B17A 5DDQC 2KT5A 4C0OC 2MKKA 3HZGA 3WC2A 2WRMA 3GSDA 4FBUA 2E1MC 3NNAA 1BC6A 3D0IE 5GAHI 1HYSB 3OR2B 3QGGA 3TA1A 3ZZPA 3NGKA 4O4RA 5EUHA 5B09A 3HXMA 1SUQA 1S1VA 1URNA 1YRXA 1G1XA 2AX0A 5GAGU 2MXYA 1RTDB 3LAMA 2KM8B 1YJVA 4YB7A 4LVNP 2YH1A 4Q0BA 4HDGA 1TL4A 3HVTA 5IFMA 3EGZA 4C4WA 3WZ0A 1RT6A 3MUVP 1FTRA 2O5DA 2PN6A 3I0RA 4EYIB 4LIWA 5LSOA 2MKIA 2XMJA 2YX1A 4R25A 2K8GA 4LJMA 5E2QA 3DLLQ 2V0NA 2Y1RI 3I4HX 4ZA1A 1C4CA 3VAIA 1ZYQA 1WNEA 1M5PC 3M8QA 2C3MA 1GXUA 1U1NA 3F41A 1KTQA 4DFPA 3R5DA 3CCSS 5DG7A 3FJ2A 2BDPA 5KT6A 1JJ4A 4K4SA 2MZJA 4KPYA 4X4RA 1T95A 2P6TA 2BRKA 4RKUC 1RTJA 5I42A 2OPSB 3N79A 4F67A 5GVQA 3K7RA