2DKOB

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2dkoB00
2QL5B 3NS7B 1QTNB 3R6LB 4ZVUB 2XYPB 2CNNB 2H4YB 2FQQB 1RWWB 3R6GB 2C2KB 2CNKB 2CJXB 1I51B 5IC6B 1F9EB 2HBZB 1RWNB 1NMEB 4JB8B 2QLFB 4DCJB 4DCPB 4ZVPB 2CJYB 1IBCB 3R7SB 1QDUB 4DCOB 1RHRB 1RWKB 2H4WB 2H5JB 4ZVOB 1RHMB 3P45B 2HBYB 3KJNB 3EDQB 2H54B 2C2MB 1RHUB 3EDRB 1SC4B 1SC1B 2C2ZB 2QL7B 4ZVTB 1RHQB 2H51B 3GJSB 3KJFB 2QLJB 4ZVRB 5K20B 1BMQB 3P4UB 2XZTB 2QL9B 2HBRB 1RWOB 3SIPB 1ICEB 2CDRB 3D6MB 2XZDB 2HBQB 2CNLB 3QNWB 2H65B 4ZVSB 2Y1LB 3R7NB 1I3OB 2XYHB 2H48B 1PYOB 3D6HB 1RWPB 3R5JB 5IC4B 1RHKB 1RWXB 2QLBB 1GFWB 2XYGB 2CNOB 2H5IB 2P2CB 3KJQB 1RWMB 1RE1B 2C1EB 3D6FB 3GJQB 4LSZB 3GJRB 1RWVB 1SC3B 3GJTB 3RJMB 1PAUB 2DKOB 3IBCB 3R7BB 4ZVQB 2Y0BB 3IBFB 1RHJB 2C2OB
chains in the Genus database with same CATH superfamily
4HDHA 3R1LA 4OJHA 2LQ5A 3M6UA 1MMLA 1YRTA 4LR7A 5KFOA 4UOHA 5AXLA 4WXWA 2I6WA 3VGVA 4C0BA 3CULA 4AQYJ 4KGZB 3HJVA 4WXOA 4ELVA 1E6YA 1SIWB 2GVDB 2VPZB 3BH6B 4FN5A 1LWXA 2NXJA 4KKOA 5DDQC 2VL1A 1HR0J 2FLNA 3K8WA 2H51B 1MROB 2ASJA 1EP4B 3G82B 1NJWA 2IIHA 1W2IA 3NWGA 2V94A 2JFKA 4DQIA 2LXIA 3ILLA 2IM2A 3W7BA 1JKHA 3T1HF 1IXKA 2PMWA 3CDBA 4MK7A 3VZIA 2CQIA 1KVJA 5E3AA 2KT2A 2W4CA 2ACMA 1X9SA 2FB0A 5GAEU 4LSNA 2VC1A 4M95A 2BXJA 5B08A 2P9GA 3ULHA 4L3KA 5SZTA 1YG0A 3FBFA 3SBMA 3ENWA 1D8YA 1CSJA 2W2QP 4URGA 2W2MP 2FHOB 3C6UB 4AT1B 4XPCA 2QMWA 2J76E 1T9XA 3ZZPA 2M5YA 2EFVA 3UW1A 4S0MA 2DYAA 3BGLA 4I7FA 5BR8J 2NR0A 3A13A 2LVWA 4K4YA 1P1LA 3HP6A 2XO7A 3RB3A 2B0GA 1U4BA 3ZTRA 2GGPA 4RU9A 3SDEB 2UXBJ 4MKYA 4FYWB 2CQDA 1P1TA 2RU9A 3DLEA 1YJNS 3QJLA 4DSEA 3THPA 4HLBA 4RO0A 3V6JA 3EZ5A 2VKZG 1HHSA 5B0CA 1LWFB 3R27A 1VHFA 4HTJA 3UDVA 3NGKA 2RDIA 3LALA 3CD5A 2VHGA 4ZP9A 4F8RA 2DNPA 4KHMA 2BW7A 2E5HA 3HHLA 4DSIA 3HSGA 5LXYA 2UUCF 4UQTA 2CQ4A 2L41A 2FVRA 3QIDA 3MM6A 3W5XA 1YZ7A 4MIWA 5M2RA 2WW4A 3CCQS 4U6PA 1TKZB 4ZVPB 3OL9A 4USJC 5ETRA 3X3UA 1GNKA 3R5CA 1UEUA 2BANA 2BABA 4ZPDA 4FYDA 1TTHB 1WOOA 3W2VA 5D15A 2LYVA 2HRUA 2OAUA 2BKOA 2O1PA 1H6KX 2RIJA 3MEKA 2QE5A 2XMWA 3SFUA 3O2IA 3LPYA 1OJ4A 4PXCA 2IJNA 1YRUA 1WTFA 4AXIA 4P2FA 2VUGA 3W66A 2O3DA 4KGVB 2AP6A 2BVZA 1RT7B 2XNQA 4DR4F 5KFQA 1Y5NB 2ZH5A 2RB7A 5CYJA 3H2VE 3Q8UA 1WG4A 2E9ZA 2B9YA 3TYTA 3A4TA 4LRCA 4CDIA 2CZ4A 1WHVA 4NLOA 3RRHA 3NGUA 3FRZA 3DOLA 3PACA 2QJ3A 3MPUB 2FHMA 3DMJA 3D1QA 1H2UX 4OJ1A 3BS9A 4ZN3A 3GIJA 1R43A 2A6OA 1BXNA 4LFBF 4MIAA 3VGTA 2W25A 3MPVA 4Q5VA 4ZVOB 2W8LA 5A2QU 4ALZA 4QIFA 3TEGA 1QAJA 1Q53A 4GC7A 3IGVA 4OJGA 4LQ3A 1URNA 3SCIE 1TZ0A 3HVTA 4M5LA 4XAKA 4O44A 2AF6A 1A0OB 2MJNA 2B43A 3CNQP 1FRLA 1FVSA 3RBXA 3R5JB 2VQFJ 2AW0A 4Y28C 3K5MA 2VZ9A 1SJQA 1KQSR 3FCWA 3OHAA 3T5LA 1PILA 4CP5A 1RTDB 3GJTB 3EGNA 1XEZA 1EQMA 4DWIA 2XULA 1U2FA 3CO0P 1AROP 4A8QA 2ZE2A 5LMUF 4B17A 5FLXU 4QPTA 2R3VA 1FE0A 4P2MA 1ZM4A 1Z4UA 2YH1A 3JYTB 1F9FA 4QYZK 3ONQA 3PZPA 4IH5A 2XHWA 3GCXP 1U09A 4K4TA 3DI6B 3IFEA 3UD4P 2W1BA 2VFVA 1BQMB 5KFHA 4KT0C 1OO0B 2YQ0A 4DLEA 1SC4B 3ZNJ1 4GKJF 3HT0A 1IKWA 1G4CA 4HH1A 3BDPA 3D67A 4NRTA 3ZO7A 4B9NA 1Q5YA 4FF1A 3E3XA 1M5SA 1W26A 2RF2B 3I5CA 4AQYF 2LMIA 5GMDA 3GYNA 1H74A 1QE1B 3OT9A 2Q43A 3I0SB 3VGUA 1HR0F 2MZJA 5M2PA 4H4MB 1S6OA 2IJRA 2XHCA 3LAKA 1BLUA 4PQAA 4C3LA 5AXNA 2YWEA 3IAS9 3FUYA 2FDNA 3MDFA 2O67A 3M8QB 2GCFA 2BR0A 4FPIA 3RBDA 1Q7LB 4MIBA 2AX0A 2AZ1A 1QAYA 4IG0B 1FWKA 2HURA 4LR9A 1NU4A 2HGMA 4DCPB 4QWCA 1UVJA 2X3DA 2KTQA 1YI2S 5KFXA 4CZCA 3NWRA 3G86A 4O23A 3CIMA 4ICLA 3IMQJ 2YQ1A 2AJ4A 4DU8A 4LJMA 3TQEA 2OSRA 3DU5A 5HK4A 2RDDA 1WI6A 1FK9A 3PEHA 3M8ZA 4OZLA 5C2GA 1ITPA 2YKNA 1I3OB 3MUTP 4EU0A 2CPFA 3K2YA 1LOUA 4I6WA 2D3UA 1XERA 1MNEA 3V6HA 3UWTA 4NLUA 1FRHA 2EVZA 4OV1A 4NLGA 3DRPA 5IM0A 1UWBB 3VAHA 3R2DJ 4ZVHA 2RSQA 5BR8F 3H59A 1LKZA 1PSDA 2VJUA 1IWGA 4ZVQB 1NK5A 3UDEA 2XCAA 1LWEA 4F7VA 2HNDA 4USVA 3ZZOA 2VFRA 1YGYA 1EJ7L 1RTHB 4OMFG 4DR7J 1K1QA 1NKBA 1NSPA 1EQ0A 2FVPA 3JXOA 1GX5A 1WG1A 3AA8A 4ELUA 4E0DA 5IT9U 4OL8A 2DNZA 3EDRB 4CH7A 3AJ2A 4EMDA 4X65J 3T6BA 3L4BC 1WF1A 5J2QB 1B7FA 1RTIB 4EO8A 3U1MA 4IRKA 2MDAA 3MOJB 3GFXA 2FIUA 1RU2A 4CWBA 4JV1A 2ERRA 1E6VB 2DHXA 2OPSB 2I38A 2HRTA 2BOPA 5DM7Q 3GILA 1KFSA 1PBUA 2B9WA 3IBCB 4OHWA 4J9MA 2OPPB 4A8SA 4DR1J 1F3FA 3GQCA 2C3MA 3DXSX 5KG7A 5H1SV 2V6AA 5D4OA 4U96A 2BJ9A 3OJUA 4PWDB 2FJXA 4A48A 2FVSA 5BYRA 2QLFB 1SV5B 3KWMA 3T5JA 1X0FA 2CDQA 4XO0A 3HHNB 3OSPA 4ZP8A 2FD2A 1BHNA 2A10A 2HQDA 3SSSA 3ZC4A 4ZKAA 2AT1B 2ZJRQ 2DNRA 1B99A 2Y1RI 2HBQB 5KFIA 2VASA 2JL9A 2M9KA 3L7UA 2AYBA 2Q1LA 3OLBA 1XIQA 2PMZD 3MMAA 2XWYA 3L3CA 4DL7A 2ZHOA 3N4WA 4DX7A 4DUZF 2A2CA 3EJMA 1Q86T 5GAEI 3GJRB 3MMBB 3H5XA 2Z2ZA 5IWAJ 4E2FB 2VDHA 3MFHA 4LFCJ 1O8BA 3TW0A 2HEKA 1VC6A 1CJUB 3NGRA 1X0PA 2XY7A 2VQFF 3KTQA 4WTYA 2OTLS 1QJHA 1JLAA 5J2MA 3H2UB 2V8HA 3QGPA 2BX6A 3AODA 2JRSA 2YNIA 4DPWA 3L7OA 1CPZA 4X4QA 4PCQA 2RS8A 3IXQA 2UXDJ 3PCOB 2YY3A 1TKTB 3IP0A 3MAAA 2XLJA 3BGFA 3KK3A 1SC6A 3DRRA 3EYZA 5L1LA 3OVSA 4EGLA 5DQIA 2M70A 5DGBA 4KAIA 3CC2S 2HQGA 2YKQA 2ZUGA 1QSSA 2XMKA 1AB8A 3DDIA 4G3IA 4TY9A 1RE1B 1FDAA 3THTA 3ZZZA 1U0SA 3QSIA 3TA1A 1RP5A 3J7Z5 1RWVB 1UP1A 1FRMA 3BB5A 2PMHA 3IM9A 4QZVB 2JSXA 4ER8A 4QQBA 3D5MA 2RD5C 2HAIA 3R3TA 2NXNA 2G0IA 2CQ2A 4CQ1A 1AUDA 3QZ8A 4JI5J 3CMES 1NSQA 2BJ1A 3T9NA 2IFXA 4HI2A 2HGNA 4HACB 5B0EA 2CJYB 2LCWA 2RDJA 4DL0C 5DETA 4DL3A 2BJ3A 1YITS 1J5EJ 3CC4S 3VZHA 3QGIA 4MFBA 2Z56B 4O3PA 3H2LA 4LRDA 2RS2A 4FNHA 1IBMJ 2AYEA 4IR1A 1VQPS 4DR2J 2MLZA 3PM9A 2VG6B 5CA5A 1JLBB 5B0AA 4JBCA 5E7OB 2DNNA 1YJWS 5IC4B 2HIQA 3BGRB 2XYGB 4AL5A 1W7WA 2IY5B 3RB0A 4P2XA 2GO9A 2KJVA 2E1MC 1UMJA 2FHKA 3VQTA 5HMYA 3QAEA 4F2SA 3ELHA 1ZS6A 2PO4A 4WU3A 2M0GB 2GAHC 5KT3A 3JSMB 3C16A 4I2QB 2IC3B 3AD9C 2ZOGA 2UVRA 4ZOSA 1NEEA 2QZ8A 3NS6A 2GIRA 2NZCA 1HNIA 4KFBA 2IBOA 4TY8A 3IS9A 2BE9B 1I94J 4F4ZA 3HHEA 1X4EA 1FNMA 1HI8A 1Q95G 5HJYA 2MZTA 3C14B 2RVJA 2EFOA 3OD2A 2WHOA 1Q81T 1EETB 4MMOA 1KEKA 2AGOA 2MSTA 3LH2S 1RBLA 1AZSA 5ETPA 2KVIA 4NEYA 3B4MA 4Q7AA 3HVRA 3WQPA 2EBEA 3CT9A 2VB6A 4FBUA 1V3RA 3C19A 4DR7F 1URRA 2YKMB 4N56A 5A2QY 2OELA 4NYZA 5LXRA 2GVDA 2B51A 2Y8YA 1Z1ZA 4WPAA 2R2RA 3BSOA 3W9HA 1U1MA 1D3WA 4OQJA 4GMKA 4JI7J 2PC6A 1J2VA 2C1EB 1MROA 3GV8B 1EP4A 3M8SA 3G82A 2KU7A 2HWIA 4X65F 5A8WB 1M1KT 5GMEA 1WHWA 2D7SA 3KYLA 1K8AT 1TV6B 3LWMA 3VR1A 2GMHA 3J7A1 3LA0A 2KXFA 4C11B 3CCTA 3Q24A 2VA2A 2DO4A 1JJHA 1DHMA 2PEHA 1F2GA 1XMBA 3PFOA 1G7CB 3B54A 4WIQA 2ZJPQ 5IV4A 5J1NA 1DLOB 2A6MA 3FCVA 5FLXY 3M1VB 3KJNB 2XMUA 4YR3A 5EWFA 4DR1F 4QBUA 4BS2A 1KQKA 3GFZA 1S1XB 3ILJA 2ZJQQ 4Q44A 1B64A 3L7PA 2NSBA 4WFYA 4C0OC 5B7WA 3KG1A 4UUXA 3C6UA 5DGAA 3I6PA 2UZAA 3SSQA 5ETNA 2NUHA 1TAUA 3NCRA 3TZWA 4X4RA 1KHWA 4A8OA 1H2TZ 3MAHA 1SKRA 3NGTA 3RAQA 2F9JA 2YWGA 2NZ4A 4D3GA 3QBCA 1TL4A 1X4AA 3OHBA 3SDEA 4EFAC 3Q23A 2JC1A 2UV8A 1RTZA 4ZVUB 4OX6A 2ZZTA 3RYLA 3S6EA 2MQLA 5HN0A 5IC6B 4AFFA 1RAEB 5KTQA 2X51A 1NBEB 3BM7A 2HPUA 5HROB 3OVAA 4CLZA 5CD4A 2ILYA 3G6ES 1LWFA 5IWAF 2AIRB 1LXJA 1WEXA 1FJEB 2KRRA 3MCNA 4LFCF 3J80U 1JXVA 2VU5A 1OPIA 3EGZA 1PJ7A 3QWUA 1ICEB 4NA3A 1G3OA 3SYZA 2CA9A 1S9EB 3HD2A 3MTJA 3QNWB 3MURP 1TKZA 1V6HA 4HKQA 1S9FA 4IQMA 5ETOA 2ZZMA 3QO9B 4F2RA 2V9WA 4LVOP 4ZHRB 3B4DA 4EK2A 2UXDF 2EK6A 2HVDA 3TP2A 4F3OA 1JJCB 1FFSB 2U1AA 3LF0A 2E7WA 2LDIA 5T7LB 1NK7A 4F0MA 5HAOA 5KT2A 5KFRA 2GW8A 3DRYA 4MKBA 1Q8BA 4BBYA 3WIUA 2DRBA 1IKYB 5DLGA 1PYSB 4KQZA 2KVQE 4DUTA 2V8GA 4WE1A 2WVCA 1RT7A 4F25A 2R7XA 3X1LB 2WSEC 2VONA 3PVXA 1XNRJ 4HHUA 3BYPA 3RTVA 5CZVA 2H4WB 3EDQB 1YK9A 2XLKA 4DR5J 2MHEA 2N3LA 2EFNA 3R1HA 1GXUA 3N0VA 3ITHB 2GJIA 3R8YA 5B0DA 2OFGX 4LF5J 2VBYA 3FFIB 5L39A 3MI7X 3VV2B 1KC8T 5E33A 2V2QA 1GQEA 2CWKA 1KRPA 1YJTA 4LF9J 1XC9A 3D68A 1IBMF 2DB1A 3IN5A 1ZH5A 4DR2F 2AD9A 3KLEB 3M8WA 4F0KA 2BW2A 1OY9A 5B0FA 4CLYA 3BSAA 4DX8H 3CJQA 2XYPB 3M9MB 4F26A 1TQLA 2HHHJ 3D0GE 2W7AA 3W63A 1RTDA 1FESA 3F73A 1Q82T 5C24B 1FI4A 2J5AA 2DGQA 3FBEA 1S59A 3WHIA 5ETTA 2COLA 3VVTA 3BH7B 3FSYA 3NRBA 4KH0B 3JYTA 3NOCA 3MR7A 2FYXA 2Z4PA 3QRPA 3N6NA 3RBZA 3DI6A 4U7UK 1ZAXA 1I94F 4NLVA 3RG6A 3OFGA 1LNQA 4OLOA 2R9LA 1BQMA 4ID8A 1V3ZA 3NXZA 2VA3A 1CVJA 2C28A 3RB6A 1VRQC 2DPIA 4TLQA 3A3OB 3GJQB 2X7IA 4I67A 3J7YU 2HHXA 3Q8PB 3OUYB 4DX5A 1GAOA 3RW7A 1IUJA 3CJ4A 4G1QB 2RF2A 2MQ8A 2WSCC 4AD6A 2J9CA 5IT0A 1OMSA 3OJSA 2G0CA 1QE1A 2WOMB 4ZPAA 3I0SA 3TWZA 2CJ9A 3HVAA 1RWNB 5KG0A 4CYUB 4JI7F 4H4MA 4CLSA 1L3VA 2YPYA 3IWLA 3KLHB 2AJ1A 2YWWA 2C2NA 4I64A 4FF2A 3UR3C 3ZZTA 1T9YA 3RRKA 5KG2A 3M8QA 3PYDA 4DPXA 3CDAA 5ETVA 4CO2A 4H4OB 4DV5F 1QAIA 2FJWA 1BY9A 3J7ZT 4IG0A 2OI2A 1T3NA 2ZKUA 4FXVA 5GADU 4PG4A 1HL6A 4ZIWA 5F8IA 2Z58B 3EZUA 5HSPA 3AQOA 2J0SD 2WTFA 4IOBA 3KJQB 4Y3CA 1Q8KA 2BRKA 3VAJA 6FDRA 4UW2A 2KDOA 1NPKA 4PG5A 1TL1B 4B3RJ 5EWGA 2AYMA 1I6JA 2IDLA 3HT3A 4OX9J 2ZH1A 4JI8J 2BACA 4P72A 2JLGA 3ZTOA 1UWBA 1IJFB 1XN9A 3RAXA 2VBXA 1NAQA 1LW2B 2HRYA 2K3KA 2NXUA 2ALYB 2MQQA 2X3GA 2HWTA 2AJ0A 3BDEA 4DPYA 3D7SB 2HNZB 4RL1A 3G71S 3FBBA 4ECXA 3NGDA 1RHQB 1S76D 1RTHA 2HQ3A 4MYUA 1PAEX 3Q89A 5E2QA 2QEXS 3G9CA 2XY5A 1TFWA 1APSA 1G6BA 5E3RA 2CPYA 1MWZA 2BM1A 2MKCA 5HANA 3KMSA 1VQLS 3MMJA 1U1QA 4LIRA 3D6FB 1UTAA 4FVCA 1VGYA 4Y2AA 4LF4F 3D28A 1KD1T 5J2QA 4RBTA 1DFDA 1RTIA 2VF3A 4TVAB 3LAMA 1FFGB 4F4AA 3G8SA 5KFSA 2Y1IA 2KJWA 4FKXA 1H72C 3GE9A 2FJDB 4OZ2A 3W65A 3MUMP 2DHSA 3I5BA 2MTLA 2IRYA 4DL5A 1E6VA 3V4MA 2ZH2A 1MMNA 1D8ZA 2OPSA 2CPJA 3E2EA 4RZRA 2OPPA 2LKZA 1S4EA 5LJ5Y 1RAJA 1HHTP 3P45B 5KFFA 2V4JB 2V4RA 1UFLA 3KJFB 1H38A 1HARA 2J0QD 3ISNC 4PWDA 1U1NA 3ZFVA 1SV5A 1N0VC 1WELA 4ZPWR 3I4PA 3GG0A 4NX9A 5EWEA 3CCSS 2DEIA 2DNGA 1S1UB 3WZ0A 3QYYA 4P9SA 1ULRA 2QRRA 2OFHX 4DR5F 3TI0A 1KN6A 1KOOA 1VBKA 4FF4A 3DN9A 5KFCA 3ZXWA 2L3MA 3H0PA 3EVMA 3TVKA 3S1TA 2DGXA 2EFQA 4X2BA 1LW0B 5CABA 3MMBA 3D0IE 4ZCKA 3DRXA 4J9KA 5KG1A 3WDOA 4XK8C 2KI2A 4K2JA 7FD1A 4KSEB 4LF9F 3QJJA 4RWWA 3SFGA 4LRAA 3PV8A 4ED8A 1XMQJ 4KYZA 1CJUA 1C1CB 5HL7Q 3OL8A 4QW9A 5KFPA 2GJ2A 3B78A 1G2EA 3RGIA 1SJ1A 1WUUA 2ACYA 3JSYA 1H73A 3L9ZA 4NMXA 1SCJB 4IFYB 2V2ZA 2R7RA 1VK8A 2UUAJ 4AUKA 1TKTA 2DY9A 2C2EA 1XWLA 2W7PA 3HF5A 1EX8A 4F4XA 1FRJA 4WFXA 3UO0A 2WVFA 4ETXA 3PO5A 4DQRA 1FKOB 2OO4A 3MM7B 1JNZB 2ZFHA 2KXHA 4G1IA 3KK2B 1SJRA 4TKTA 4I6AA 1GT8A 2B8PA 2VPXB 1IBCB 2ZH7A 2G2ZA 2HBYB 1EAYC 4JI6J 2CQBA 1X31C 2ZH8A 5DG8A 3AHPA 3QLHB 2R2TA 2Z30B 1NK9A 1VHIA 1ROFA 1YVFA 8ATCB 4HACA 1PCAA 4LF1A 2RQMA 4DMZA 4K4WA 3EVWA 5J1EB 5E3PA 2ZBPA 4ED3A 2QA1A 4USTA 4V19J 3MEEB 1VLYA 3HSJA 2VG6A 2HYIB 1IKXB 4ED7A 3OPKA 4YR0A 2K8GA 5IXUA 1JLBA 3POTB 4USHA 3VVUA 1P9QC 3PG9A 3BPSP 1HNZJ 2A3JA 1OY8A 2MYFA 2ZZNA 2ROPA 3NS7B 3BGRA 2LA6A 1SQGA 3H4BA 2ZUAA 4DL6A 2QA4G 1XJWB 2EI5A 3KHRA 3WC2A 1Y11A 4HT7A 3JSMA 4I2QA 2IC3A 2F4VJ 1UA1A 3TZXA 4B3RF 2DCUB 2V0NA 5ETKA 3QT5A 4DPOA 3AA9A 1SJ3P 4H4KC 4ECWA 4ELTA 1MWYA 2XLIA 3IAM9 4OX9F 4JI8F 4XTTA 1KQFB 1HWJA 2V67A 2IA6A 4JUZA 2IYGA 4DV0J 3DRSB 3C14A 2AGPA 2MZ1A 1HFEL 1EETA 2V8DA 4Q0BB 1QUPA 1C1BB 2DISA 4IO9Q 1QAXA 3IR7B 4ED5A 2QG9B 5HQ8A 3QRQA 2XZWA 4OHYA 4KGXB 2EXUA 3FZBA 2HQCA 1FKPB 2JHEA 2YKMA 5I4MA 4RW6B 5HMXA 5KG6A 4M94A 1ZBTA 4O3RA 2R4FA 4RLEA 3UR0A 4UF4A 1CQMA 1NHVA 3W62A 2EKNA 3HHLC 1NMEB 4PG6A 5CQGA 3IR5B 4LREA 2BRLA 3DLGB 1L3UA 4Z2XA 5A8WA 1SBRA 3A8JA 2VIHA 5GVQA 4EBDA 3K17A 1FWPA 1H7XA 3D4JA 1TV6A 4WZMA 1IVZA 4C11A 2POKA 5KFKA 2KHCA 1NB2A 4ZVSB 3AFGA 4C8ZA 1P6TA 1DLOA 1PJ6A 2OPQB 4ED6A 3M1VA 2B7CB 3O3LA 2VG5B 4ZITA 3TZZA 4QU6A 3J7YI 2L08A 2YH0A 2VQEJ 1S1XA 3MUVP 4QIVA 2W2OP 4PABA 4DN0A 2MHNA 4IUFA 3U02A 4FXWA 5JVGQ 2AX1A 3M32B 1MG7A 4URSA 3IBFB 1KFDA 3OTOJ 4DFKA 2ZITA 4CLLA 4OYZA 3ILOA 4USUA 2HW3A 2G2OA 3MM5B 1X5SA 4MTPA 4UUWA 1DZ5A 2XMJA 4Q45A 1HKAA 4R5PB 3W60A 1IR2A 3QAUA 1KONA 3GJSB 5GADI 2R7TA 5HROA 3LANA 3UCGA 4KHPF 1UAWA 4WYWA 2C3UA 1MWQA 4Q2MA 1ZOTA 4OI4A 2GV1A 5KG3A 4GO5X 2IM3A 4CO3A 2FUG9 1TK8A 4TLRA 3ZZRA 1GK8A 1GX6A 1S9EA 4A8KA 5FD1A 3DCAA 4L6V3 4ZJOA 2VOPA 4ECRA 5A8KB 1I5OB 2E1RA 2E29A 5LJ3Y 3FZ2A 4OZ1A 5C2CA 4Y65A 3QO9A 3T3FA 1RT6B 4ZHRA 2QYGA 3LGNA 5KFJA 4RJVA 2XS2A 4DQSA 1HW8A 3K59A 1RCOB 5T7LA 1Z2ZA 1HWKA 1RQ0A 5DDPC 1IKYA 1SKSA 3KG4A 3B8HA 2QSWA 1KS2A 4M8LA 3VAIA 4IDKB 1WG5A 3LP0B 2Y1LB 3VAGA 3DOMB 2ADCA 1IQTA 4WCEQ 4BHQA 2KN4A 4TYAA 4USWA 2C3YA 3AOBA 3BN4A 4K4ZA 1T03B 3WC0A 3GSIA 2KG1A 4JI6F 1T8EA 3K8VA 2W9CB 2RNEA 3BO2A 3UVJB 1ACMB 2APOA 2HNYB 4PKDB 2HVHA 1A7GE 3DHWC 1T9WA 4I1TA 3FFIA 4E8UA 3ET6B 3P49B 3B82A 3R6GB 1Q5VA 1WOPA 1U8WA 3QRRA 5FIIA 1R0BG 3VAMA 4GRSA 5DM6Q 1TL3B 1IN0A 2CYYA 2DCLA 4BWMA 1F5CA 3KLEA 2J8AA 1HQUB 2A1BA 4OYWA 1VBYA 2BJ8A 1HBOB 3KXDA 3HXMA 3MR6A 2QL7B 1HNZF 5M2UA 4LVNP 2KB2A 1Q8LA 3OFEA 1UW9A 3M2UB 1B4SA 3OVBA 2CDRB 4FKYA 5DO2A 2DD8S 3R7NB 2PGCA 1UVLA 5C24A 1M1GA 3G8TA 2OHDA 4WFNQ 5HBMB 3OR2B 3E51A 2X1BA 2Z2LA 2F4VF 2YWHA 1UVMA 2HHWA 1X60A 2E5LJ 2HZCA 5CAAA 3PW0A 1QUVA 4ZJLA 2OLWA 4OHZA 4CLUA 2ATLA 1SUQB 1L3TA 1RAAB 3M8YA 1RHJB 5J2PB 3JTNA 2HFVA 5RUBA 4ZLNA 4NE9C 5AE2A 1BC6A 4BLGA 3HZEA 4LR8A 3MAQA 1S0VA 1HMVB 4ZDNA 3OTBA 4XPEA 3OUYA 5IZHA 2VJVA 4G1QA 1SXLA 5I3PA 4QCLA 2L9NA 5EHHA 5KFDA 5HMZA 1X8DA 1DQAA 3AB2B 4Q8FA 2F63A 4QIGA 4C48A 2WOMA 2E66A 4L74A 2NPIA 3JSRA 4QIEA 4CYUA 5HLFB 4M5DB 2K1RB 4XDDA 1N33J 1YIJS 2DR5A 2LEAA 4PXEA 4NWBA 3KLHA 3AXKA 2H9ZA 5A8RB 2K06A 2LQ8A 1Y10A 2Q6CA 3VGSA 1SPBP 2IRUA 2Q6BA 4H4OA 1ZETA 2FPHX 2CRLA 5KFTA 5AXKA 1LK5A 4Y34A 2WSFC 1JLGB 4A8YA 3J81j 3PJWA 4MAKA 3NCQA 4HI1A 1WEYA 4BC7A 2DNLA 4CH0S 4I4BA 2GQCA 2NXCA 3GV5B 3MCOA 2GIFA 3I0RB 1PC4A 2MKSA 1OQ3A 3TAPA 2DR9A 5ITHA 2VQEF 2EFGA 1X7VA 1TL1A 3UD3P 1UA0A 4OZNA 1JMTA 4NEZA 1YRXA 3KK1B 5K8NA 4PXBA 2ALZA 1TK5A 4DHVA 3OTOF 2FC8A 4U8VA 3HSDA 2HMIB 2W9BB 1LW2A 4WZQA 3O1LA 5F3ZA 4FS2A 1NDCA 3A8EA 4ETZA 5G4DA 3SCLE 2NSCA 1FHTA 3IC1A 4RNFA 3A8KA 1VYAA 4AXJA 2HNZA 3HFZB 3EVOA 2RAQA 2RHQB 1I1GA 1YX2A 3D66A 1BE4A 2NUUG 2UVWA 4EYHB 3E8OA 3UDCA 2RUGA 4FP9A 4G6VB 1WD6A 3OBIA 3DOKB 3PYFA 1VRTB 2JLEA 1UEVA 1HLWA 4LRBA 3VQSA 4YY3J 2XEXA 3FJ2A 1HBNB 5IS2A 2LXFA 2MZSA 1FVQA 4DR3J 1FJGF 4QYRA 3NAHA 3KUHA 1GXTA 4Q2LA 1QDUB 2CADA 3A3NB 3SSRA 2NYIA 1X5TA 1N48A 4I0WA 3LPEA 3T19A 3H5UA 1RYSA 5DZ7A 1OPZA 1RWUA 1WORA 4PAAA 4PG8A 4YEAA 1NDLA 4NLRA 4ZN1A 3DLLQ 4J9NA 1D9DA 1NKEA 2KFZA 2XYHB 2R7VA 1NK6A 3P6YC 4NXNF 1HI1A 1CJVB 4K7QA 2DR8A 1K44A 5CYQB 2V4JA 3QPIA 2YNGB 1JLFB 3OV7A 2EW9A 3G96A 4DG1B 2RH3A 4CRJA 4B3MJ 1NH8A 3IWNC 5DRKA 1VBZA 4LF6J 4KTQA 2SXLA 4OYXA 1OSCA 2D9OA 1S1UA 3ZTQA 1UZHA 2DNOA 2RRAA 2PI5A 2XB2D 4ERDA 2VV5A 2XGQA 1NDPA 3KLVA 2RILA 3EUNA 2CQ3A 3EWGA 3M8PB 1UL3A 2WZ1A 3A8IA 1WSVA 2M2BA 1VQKS 4ZPCA 1WC6A 4ECSA 1WDDA 2EG2A 3GLJA 4X66J 4ZCMA 3MR2A 1Y4ZB 1K1SA 5KAKA 3NMRA 1LW0A 1RYRA 1UFWA 2F9DA 2R7WA 2H65B 3FSIA 4C6AA 5I42B 4G1PA 2F40A 2GJFA 3TUIC 3KG0A 1C1CA 4ZMMA 1KLMB 3DGPB 2FJEB 1RAIB 3ENVA 3HCXA 5T14A 4F3MA 1U2CA 3PW4A 4N7TA 2OGUA 4U67Q 3BKTA 3UN2A 3GU0A 1VFJA 5LSOA 4IFYA 2I5JB 2IM0A 1GH8A 2F8EX 1F60B 1AA1B 3LUYA 3DC2A 1U2RA 4ED1A 5H9FJ 1Q4RA 2IPOB 4LSLB 2E1CA 2E5LF 3E01B 1ELOA 2C42A 2R2SA 1S7IA 2I2YA 4MK9A 3TANA 2HS4A 3PX4A 1FKOA 1X4DA 2D41A 3MM7A 4WE1B 2X1FA 1VQ6S 4U7CA 2GA7A 3KK2A 2XZDB 1XQIA 2GQ2A 3TUJC 2IYIA 5CCLA 2NREA 4K4UA 5HVHA 4LBIA 4RWXA 3KHLA 1RAHB 2F7VA 2E7XA 1NB7A 5KT4A 5F8MA 2CG4A 2VFTA 3R5DA 4EO6A 1JJ2R 3QLHA 1T11A 1VIOA 4PZVA 1YJ9S 4IRCA 3U1NA 1VQMS 2P6TA 3K5OA 2DRDA 1N33F 1TMMA 1JJ4A 2XNRA 4DUZJ 3B6BA 5J1EA 2GMLA 4HYKA 2GZOA 3MEEA 4DI6A 1IM6A 1JWWA 1IKXA 4B3TJ 4DV1F 3R7SB 3POTA 2C3PA 2MKHA 2R7UA 4DOZA 3FBCA 3EGVA 1P27B 3TVZA 4CT9A 3KNAA 1PG5B 3EMTA 4DU7A 4DFMA 2QGFB 3CCZA 2QLJB 4ZPTR 2B4OA 1WC0A 1RWOB 2FGCA 1Q0NA 5A0YB 5B0BA 1IM4A 4M5HA 2ZM6J 1UETA 1IQZA 2WBMA 1QSLA 4P10A 2WAQD 5E3CA 4DPUA 2J9DA 4IO1A 1N5YB 1TKXB 4BC9A 2VPYB 2GIQA 1B0PA 2E9RX 1QVGR 2HS0A 1SH2A 5EUHA 1IR1A 3IM8A 2AEJA 2F65A 2XY6A 2ZD1B 3FMBA 2CZVC 2CQHA 2XGPA 3DRSA 3F0NA 3QGGA 1NJXA 2C2OB 2YKAA 4Q0BA 2HG4A 5D0EA 1C1BA 3TJAA 2HHTA 1VI7A 5LSLA 2XSFA 2O01C 2FZGB 1WC3A 4DL4A 5B09A 4PYAA 1Q8IA 5GAGI 1FKPA 1T94A 4DV7J 5FDLB 1CULB 1HHQA 4RW6A 2PFDA 4Y2IA 2GHWA 1LWCB 1MMDA 2GQQA 4CO1A 1IBKJ 3R5AA 1IR0A 3DXBA 5JJBA 4MKVA 4WFBQ 4YY3F 4J9SA 3BBFA 5L9XA 3QZ7A 3DLGA 3JAMY 4PPDA 2H48B 4DR3F 4HHJA 3L95X 3CD7A 3T1YJ 2DHHA 4NCGB 3RAMA 4B08A 3TAQA 3BQ1A 3CJRA 1TAQA 5CYMB 1SL1A 1FD8A 1U8SA 3BREA 2ILZA 2NYHA 2IVMA 1RACB 2OPQA 1Q16B 4DV3J 3PFEA 4CI0B 2UUTA 2VG5A 4O3QA 3C15B 5AE1A 2CNKB 2ZC3A 3W9JA 1FEEA 1Y3KA 5KFUA 5D3GB 1HWLA 3PR4A 2W8KA 5H9EJ 4B3MF 4PUOB 3M32A 1VLOA 4OI2A 3CDWA 1RKJA 3ISND 4DL2A 4LF6F 2K3IA 5J2NB 2DGSA 4ECTA 1ZM3A 3M30B 1FKAF 5CCMA 1FA0A 3LGHA 1O0PA 1Y00A 3MM5A 3M7VA 2ADBA 2IMWP 2YWKA 4P75A 3CDEA 5F8JA 3NNHA 1BWVA 4R5PA 2JEIA 3UDLA 4KH1B 4RNOA 3GMGA 1YLXA 4NRUA 2W9AA 4WU2A 2MZQA 4FBTA 1RLDA 5THWA 1VQ7S 1JQGA 2NCKL 3FEYB 3FDSA 1LXNA 3DU6A 4WP8A 1MSWD 5D0HA 1DQ9A 4X66F 4QU7A 3R7BB 2XO6A 4F3QA 2DNHA 4DV4J 1D1UA 4M1KA 2Y1JA 3TAMB 4OX8A 1EB0A 1NUEA 2CNNB 3I55S 1N88A 1HQ2A 2WVDA 1SKUB 2RQCA 1PYTA 4LMZA 1S12A 2MGZB 5HQLA 2XTJP 4PR6A 1HD1A 5A8KA 2DVIA 3MF5A 4P2SA 1KNZA 5L46A 3LP2B 4NZ6A 4UOGA 4ZK7M 1RT6A 2M8HA 1UVKA 1FCAA 1RGVA 2CKWA 2HFZA 5MAOA 4CLFA 2XQCA 3AD8C 5DG9A 2B7BB 1SJFA 3PRDA 3GYGA 2MXYA 2CQ1A 5D77A 2AQ4A 4U95A 1JNRB 2FLLA 2E5GA 2QC3A 3G8QA 1JXLA 2BUNA 4W4MA 4P71A 2OP5A 3KLGB 3KJVB 2F8HA 2AEFA 4IDKA 3H90A 1SC3B 3LP0A 5A6WA 2FZKB 3AY0A 1PAUB 3CE8A 4UZCA 3FSXA 3LGMA 1NKCA 4HVZA 3TZYA 4YB7A 3DOMA 1RJJA 3OXLA 2YNFB 4N8NA 1J5OB 4FYVB 3M9NB 1CLFA 5GAHU 3HPOA 1QD1A 1NZAA 1SL0A 1X4GA 5DLFA 1T03A 1WF2A 3CCJS 5CZXA 4QOTA 3DDNA 2W9CA 3D3CJ 3P5TL 3UVJA 1RAGB 3LWLA 2R8KA 3BBCA 1K9MT 2HNYA 4X84A 3OL6A 1SQEA 5KFBA 1HNVB 3O8WA 3ET6A 3R5GA 1O6XA 1N5VA 1XNQJ 2LU1A 4ECYA 2YPZA 2IRXA 2M3DA 3PEJA 3BGOP 1RBOB 1UVIA 1CC8A 2JEGA 1HD0A 2MQNA 1PYOB 4Y2KA 3CCVS 1TL3A 1LV5A 1VISA 4QW8A 2HHPA 4B3TF 5DJBA 1HQUA 1X4BA 2R7SA 1HBOA 1HNWJ 1DBDA 3FKBA 4HT5A 5JUMA 1T7PA 4Y6IA 4CNYA 3JQMA 1WJ9A 1U26A 2EC0A 3M2UA 3Q8YA 4K59A 2UUBF 3G2XA 3M2RB 2MLXA 3PJXA 3N28A 1RABB 1UWAA 1S79A 2YKOA 1U47A 5HBMA 3LP1B 3OR2A 4RW4B 1N0UA 2ZM6F 4ZP6A 3MM8B 2OJ3A 4TN2A 2FJVA 4C8MA 2J7WA 3M2VB 3R2CJ 4ZVEA 3KKFA 2ZH6A 4KO0B 1FRKA 3C3LA 1SUQA 4RW8B 2CG8A 1V5VA 3WX8A 5J2PA 1VJQA 5LMNF 2XS7A 2B4UA 4GVBB 2GC8A 1HMVA 2LQ9A 3KDOA 2MY7A 4DUYJ 1X9WA 1V9OA 5AE3A 1NJZA 2R8JA 2CNOB 4O0IA 4DV7F 2XG8A 2JJ4D 3OXGA 7FDRA 4O3SA 2KFNA 4TNOA 1IBKF 1OYEA 1FT8A 5HLFA 4M5DA 2K1RA 2RQ4A 4XIUA 1U1LA 2PT0A 2WBRA 3HLUA 2I8EA 5A8RA 3T1YF 2YX4A 1U0HB 4X62J 4YQWA 1FDDA 1KQGB 3G6YA 1CS4A 1NPRA 1WKLA 1JLGA 1YHQS 1B0TA 1RHMB 2HZVA 3JTPA 4OI3A 3GCWP 3PW5A 4J9LA 1WKKA 4DV3F 4TQRA 3I0RA 1RK8A 3GB0A 5D0GA 1FD2A 3GONA 4O0NA 4ZLJA 1HWUA 3H4DA 1RCXB 2ZHBA 2DR6A 1EKRA 4UY85 5BYQA 2IM1A 4FZVA 5D0RA 3KK1A 3GIKA 3K7RA 2EK1A 5F8NA 3JTOA 1EARA 2J7KA 1RB0A 2KYZA 2BDPA 2HZAA 3AT1B 1WEZA 3TX8A 1RA7A 2HMIA 2DEJA 2W9BA 5C5JA 2JH3A 2J6UA 1TP7A 3CCLS 1S72S 1HYSB 3DM2B 3I96A 2ZVIA 4X4UA 2FGOA 2J0WA 3UCUP 1WF0A 1FWLA 4H54A 4UT4A 2DH8A 4MKAA 2H4YB 3QT6A 3LTOA 3CJKB 4TYBA 1DJ0A 3AOAA 4O4GB 3PIPQ 3W2WB 1HIYA 2CQ0A 5G0RB 3RBEA 2ZBQA 3CJTA 2UVUA 4IG3B 2LU2A 3DOKA 3HFKA 1VRTA 2F8MA 2Z2YB 4DV4F 5JMNA 4IOCQ 1KBRA 2W24A 5K20B 1HBNA 2AJ2A 4NI2B 4QR0A 3VHQA 1F2HA 1XK8A 1PKUA 4OYBA 1VQ4S 4YHHF 4IKAA 3UFCX 4OJ3A 1VOMA 2K2PA 1YJVA 4W90B 4DV5J 4EUVA 1AUSL 3P96A 3Q2TC 3ETMA 3QIPB 3V4IB 2J6TA 3H5YA 3CGIA 5GMKa 1CJVA 2FZCB 5CYQA 1VS3A 4NCAA 2YNGA 1JLFA 3D3BJ 3MCSA 3KLFB 5LL6d 4DG1A 2AEMA 3OR1B 3CD6S 4RNMA 4OZ5A 4CNZA 4KR0B 2H5JB 4J7CA 1S57A 2OSQA 1DARA 4JI2F 2MKYA 4QWDA 5HI7A 4M5IA 2CPHA 4DQPA 4WJBA 3EE3A 3KOAA 2LP4A 4WYLA 4A46A 3LW5C 3MD1A 3K5LA 2HS3A 1O5JA 3VAKA 3HKWA 3N6LA 2RQKA 3M8PA 4H4KA 1R8HA 2M88A 4FVMA 3PKYA 2P8IA 2VDIA 1DAXA 3CD0A 1S6UA 4ANCA 1EIYB 4UZBA 4CT8A 5CHCB 3K0JA 1KOHA 1LK7A 2ZOMA 2P6SA 3GYXB 2EBGA 5I3UB 4M5JA 1XNQF 4K0KF 1U7LA 3PY8A 3EPGA 5I42A 4DR6J 1VQ9S 1PGZA 4QPXA 1B3TA 4C2MA 2OPRB 6AT1B 2MQOA 1CJKB 4OI6A 1L3KA 3PHTA 4P7VA 4LF4J 1KLMA 3DLBA 2ZWPA 3DGPA 2DXFA 1REGX 1HNWF 3MR5A 3FCHA 3ZZYA 3K57A 5KG4A 5F41A 3FC9A 1FX2A 2H54B 9RUBA 2I5JA 2UU9J 1FXDA 2V5HG 1S6QB 2XC9A 1FXRA 4C97A 2H3EB 4ED4A 4JI4F 2N4DA 4LF7J 3OLAA 1TUVA 4LSLA 3E01A 7AT1B 1X4FA 1MLAA 5SUHA 2QN6B 1P8GA 5L38A 1QTMA 2D1CA 3M6WA 4CM2A 4ECQA 8RUCA 4CTAB 3N5BA 1VK3A 1WNEA 4A8WA 2JLFA 1S1VB 3I9V9 4C9DA 1HW9A 2XSJB 5U47A 4RUCA 3IO1A 3A12A 4DFPA 2L9DA 4CO0A 2HHQA 2EFPA 3P8BB 4DUYF 1JXEA 2O5DA 4XDCA 2W7OA 1NHKL 3LO3A 3S01A 1FERA 2RMLA 4JYAJ 2YWFA 3C2PA 2V50A 4NLWA 4J9QA 2MQPA 4L72B 2FTRA 3EX7B 1L3SA 1RA6A 5CXTA 4CH1A 5IT9Y 4M5NA 3OTCA 1WC5A 2C2ZB 4LRFA 3ILIA 3JQJA 4X62F 2O66A 2AJFE 5H9FK 3Q22A 2QFIA 3UCZP 4MJKA 3S7RA 3SCJE 3TUPA 3PO4A 3OTDA 1TUGB 4P74A 1DY3A 4DS4A 4YDXA 2RRBA 4E98A 3CSKA 4EZ9A 2KZZA 3PKMA 1H2VZ 1R8BA 3QWPA 3CF5Q 5A0YA 4RW9B 5ETLA 1VC5A 2CJBA 5GAHI 2HVZA 2DTJA 1N5YA 1RAOA 1TKXA 1IBLJ 3IWXA 3C66A 3W64A 4DSKA 3GWCA 1D09B 2YX1A 2D9PA 4KBIA 2ZD1A 1Y0HA 4DCOB 2AKWB 2N82B 2X1GA 5ETSA 4U7UD 2BE2B 1K47A 2M4MA 1VMBA 4LBPA 1XMOF 3M8RA 1D9AA 4KIAA 1H0HB 1VQYA 3DLHA 2KYXA 3WX4A 4M5KA 2MB0B 1TELA 5JVHQ 4B9SA 4F4WA 2R8HA 3I9ZA 3S8SA 2J6SA 4ZCIA 5FDLA 1NJYA 3HJFA 1CULA 1YBTA 3G6XA 3ICLA 3T9ZA 4RPFA 4WFZA 5DS7A 1LWCA 1F3VA 1N36J 2R8IA 3CCRS 3T5HA 2A2DA 4RU2A 5F3TA 4IH7A 3W5YA 1ZTWA 3BO3A 3D1HA 3BR8A 2HLTA 2DGVA 5HVFA 4NCGA 2UV8G 3FEZA 2D74B 5IQQA 3NGSA 3ETOA 5CYMA 3UNGC 5T41A 1YTYA 2DIVA 3VWSA 4OIXA 2CVEA 4Z7CA 2Q79A 2E5JA 1KP6A 3QQCD 3NNAA 3C15A 4B9UA 1A9NB 1S77D 4Y00A 3P4UB 2HBRB 1WDTA 2G2YA 5D3GA 5D8HB 2D69A 4RUAA 2OD6A 4PUOA 2DNMA 1CQNA 4CLTA 4CIOA 3M9OB 4OI0A 1M90T 3RU0A 4C8YA 5J2NA 2RRNA 4TU9A 3M30A 4N47A 2IHR1 2YNHB 4OYPA 2HFNA 1U6BA 2J8SA 2V9KA 5E3QA 2JFDA 5K8MA 3H7HB 5D4LA 1HBMB 4OZ3A 4V1Ak 2N4CA 3EICA 1VDHA 3DFEA 1F9EB 4LT6A 1ZAWA 2W01A 3C8YA 4CLWA 1BQXA 1CJTB 1QY7A 1V5IB 1WI8A 4I56A 3BR9A 8AT1B 2H5EA 2FY1A 2ZEJA 1OSDA 4UY8T 3W8PA 2UXBF 3BQ0A 3TAMA 4G65A 2C2MB 1BQNB 2DH9A 1C0UB 4DR6F 3IR6B 2BQUA 1T05B 1HNXJ 2IAJB 3BSNA 3D6HB 3TA0A 2MGZA 2GS8A 1JIHA 2VPWB 3EPIA 5H9EK 2HIYA 4B3OB 4WIIA 3LP2A 4UOCA 1TL7B 4DLGA 3D1OA 3TUZC 2MJUA 4OFZA 4Y2MA 4MT1A 5LM7E 2UU9F 4NLSA 1M0SA 2HSEB 3NG8A 2XCPA 4MYTA 4LF7F 4HEA9 3ENAA 5AXMA 1MW7A 5A76A 3OSNA 2BZ2A 4A47A 4C8KA 2DGTA 4NLPA 3HVWA 1S1TB 1X5OA 2IA0A 2CQPA 1VCTA 3UE2A 3KLGA 3KJVA 3NOGA 4K4VA 4JV0A 2DIUA 3PDNA 1FDNA 1S0OA 4JV2A 4K4XA 2YNFA 1J5OA 1UCNA 4ILLA 3DYAB 4UTGA 3ENQA 3SQGB 4DSJA 1FJCA 2G13A 4B9LA 1S7HA 2ASYA 1MU2B 3AJDA 1R0AB 4JYAF 2DY1A 3J81U 1RWPB 5KFVA 2LEPA 3SV4A 2QLBB 3TOQA 4ILMA 3OQ2A 1HNVA 3UI3A 1RDRA 4CLPA 3SI8A 3SQOP 3NL0A 3EZOA 4KHPJ 4TU7A 2I0XA 3CJ2A 4WK1A 2KO1A 4L75A 5L9NA 4YUDA 1OIAA 3H98A 2C22A 2VG7B 2C3OA 3CJSA 2E9TA 4KE5A 3Q83A 4OI1A 2AWZA 2KT3A 4X64J 3AD7C 1Q7YT 4HHHA 1RWKB 3M2RA 4TXSA 2UXCJ 3VTIA 3BO4A 3J7AN 3NS5A 2I9SA 2FJBB 3LP1A 2N7YA 4RW4A 1R6VA 3PW7A 1ZZNA 2JNJA 2LEBA 3MM8A 1T9VA 1BMQB 1PC5A 4J9OA 1S1WB 4NMLA 3IRWP 1ZPWX 3A3PB 1IBLF 3SEOA 4ZP7A 1N6QB 3NMAA 3M2VA 4KO0A 1W2BR 2GX8A 1NO8A 2Y9HA 4RW8A 1VQSA 4M5MA 3MM9B 1R0CB 1FNOA 3DKDA 1XR6A 2NXEA 1NSKL 2LDYA 4GVBA 2K7JA 3U1LA 1HA1A 2KT5A 2FLPA 4DEZA 3P5BP 1BWEA 3V6DB 2PI4A 2Y3YA 3MECB 2JEJA 2RE1A 1RWWB 1GXLA 2WB1D 5HATA 1X9MA 1NNDA 1N36F 5HO4A 3HSZA 1ZAVA 4ANDA 2HHVA 3C46A 3J80Y 1KTVA 1UJ6A 1FDBA 4KPYA 2BOAA 1U0HA 4CM0A 4N41A 2QL9B 1GMWD 1O51A 1R31A 3FQLA 1RKIA 4YS2A 1JX4A 3MWBA 3QMQA 2AU0A 2IVYA 3R9LA 3OW2R 3IGNA 4KV8B 4K50A 3THVA 3GFHA 3NBPB 5KFGA 2MKKA 1YJ7A 4FF3A 3CCMS 1TR0A 1MN9A 4WFAQ 3HO1A 4LSZB 1GTEA 3HMJG 3MXHP 1HPZB 4LF2A 1UPPA 3D2WA 1FRIA 2XWXA 4KB7A 4OHVA 4QWAA 4EYIB 1ZM9A 4DF8A 2BKPA 3VCDA 2C2RA 3AOCA 2J9DE 4DZ6A 4I2PB 4LUBA 3FQKA 3TJ8A 2QYCA 4IOAQ 2YKPA 3W9IA 4R8UB 3AXMA 2A18A 2CPZA 4J37A 1M5KC 2A0FB 4RBUA 4JV5J 1PIEA 1TUWA 2XI3A 4FYYB 4WP3A 1TVRB 2V68A 1HYSA 3DM2A 4ID5B 2E5IA 5B0GA 2WONB 2ZHAA 3CMAS 3TVYA 2GHVC 1U1RA 1RBAA 1T0TV 2J9EA 4X4SA 3CJKA 1R8AA 3H25A 4HL9A 4O4GA 3W2WA 3NCPA 5IOLA 5G0RA 4Z7YA 2X1AA 2R7QA 2R2UA 4QWEA 2NPFA 3W1YC 1RT5B 1R3NA 4IG3A 2V63A 2GFFA 4R0EA 3G6VA 1UKUA 1SI9A 3D6TB 1RI7A 1AXQA 3M6VA 2F3JA 4NI2A 4PG7A 4ILRA 4V19X 1DRZA 3I82A 1HNXF 3QJPA 3V81B 1RTJB 3TARA 3KUGA 1S9GB 3GR1A 3CCUS 4R0JA 3R6LB 1MN7A 3I5AA 4OZJA 2NLWA 1YZ6A 1RT1B 3TR5A 5DDOC 4AL6A 2HBZB 4C7QA 2B9XA 3HI9A 4OYIA 4J90A 2Z2MA 2YBVA 4ZPBA 5HP1B 2QIFA 3CXCR 3QIPA 3NP5A 3V4IA 1NH7A 2QTWA 3FEXB 1K0VA 1RHUB 3NLCA 5E0OA 4ZVTB 1RT3B 3Q86A 4JOUA 4GVLA 5I3QA 2IMOA 2NQPA 3KLFA 5C7PA 1NK8A 3OR1A 4ES1A 4C3KA 2DBBA 3PX6A 3BKUA 2QO3A 1IKVB 2QMXA 5EX0A 1VBXA 2P9EA 4NLXA 5HMWA 4KGMA 1RAFB 1ZA2B 4PPZA 3FRYA 1D9FA 3IG1B 4DBQA 5L8RC 5C42B 5KFAA 2J7UA 2CUYA 1FF2A 2Y0BB 3QT7A 1B70B 1R8CA 3IRXB 2WRMA 4DN9A 4QJVA 3LQVA 2PA8D 5J1PA 5DQHA 3SV3A 2XS5A 3ZTPA 4B9MA 1NRKA 1XTZA 2JVRA 2ZDPA 1FO1A 5I3UA 2R8GA 3O44A 2I1RA 5K5MA 4DV2J 1BD6A 2OUGA 4NA2A 2OPRA 1CJKA 1FJGJ 4C8LA 5F0UA 2WVEA 2CZ9A 1F6TA 4OHXA 4PEOA 4J91A 4B3SJ 1K0TA 4X64F 3BGUA 4N76A 2CJQA 3RZAA 2XBPA 3GIMA 4L3NA 2AZ3A 4GO7X 2E44A 2FVCA 3MR3A 2UXCF 5LSRA 3AH6A 2RT3A 2Y0SD 2D3O1 4CO5A 5KG5A 1GMWA 1S6QA 3EM1A 2OH2A 4LFAJ 5F8HA 3H40A 3HX9A 3CCES 5K8OA 1LEOA 5F9LA 1CC7A 2Z8QA 4C3MA 4NXNJ 2KFYA 2CQCA 4ZJQA 4RW7B 4FYXB 3V2UC 3BQ2A 4DJBA 5K14B 1DQ8A 1WKJA 4YFUA 1DTQB 4CTAA 2QMUB 1KLNA 2BQ3A 1S1VA 4PQUB 1RT4B 1HBUB 2M7SA 2QFJA 4DCJB 4WBFA 1NSAA 2OTJS 1M5PC 1QLNA 3I87A 5D78A 2XSJA 3MEDB 1H98A 5KT5A 3JQKA 2GVZB 3R5BA 1XR5A 3UQSA 4P7TA 4F50A 1UVNA 1HQEB 1FFWB 4FPRA 3BZQA 2R42A 6FD1A 1D0EA 3C6TB 4NOHA 3GIIA 1S49A 1UPMB 1KVIA 3BYRA 4ES2A 1GMVA 2HVIA 4B02A 5IV3A 5KFNA 3GTYX 3HD1A 4JI5F 3P3DA 3DLKB 4UOFA 2VBZA 2IDEA 3G87A 3DGVA 5HVGA 1X4CA 3D54A 2GAGC 3KUEA 3H5SA 2QV6A 3CMQA 2BJDA 5LT5A 3RW6A 2LFVA 3PNIA 1G1XA 1J5EF 2JWNA 3QT8A 4LF8J 1L5UA 3AB4B 4DF4A 4B9TA 3N9UC 2DT9A 4CO4A 5GAGU 4YMEA 2V8PA 5FJ4A 2V8VA 3NNCA 4F36A 4FXDA 3F41A 3I32A 1UJ5A 2HWHA 1JLEB 3G4SS 4K5SA 3OTEA 3T5KA 2UUWA 4RW9A 1JLCB 2DO0A 2L48A 3US5A 3BN7A 1DTTB 1UEKA 2NS1B 1KTQA 5DDRC 1VC0A 1EHWA 2JX2A 4EI2A 3AQPA 2ZKTA 2PEBA 1T02A 2AV5A 2AYGA 3KLIB 5L1JA 4WKRA 5D4PA 1Q78A 1N34J 1N32J 4JV5F 4ECZA 2OEMA 3KDNA 2QA2A 1S6PB 2BV3A 4RX6A 1NHUA 2BE2A 3MFIA 1REVB 2HK2A 3MEGB 3QGHA 2HHSA 3J81Y 3K89A 2QA4S 4KPCA 2DKOB 4ENOA 2AGQA 1FEHA 2P9CA 4OLPA 1U25A 3MCMA 5KOWA 3F56A 1C0TB 1CEZA 2CPDA 4U9RA 3HHKA 4K5RA 2HKEA 4WKYA 1SJ4P 1VRUB 4ED0A 2DH7A 4ZLLA 3F44A 2WB4A 4F0HA 4J9RA 1M5VC 5C25B 1VQNS 2ZWOA 4ECUA 2MKIA 3RB4A 1LFPA 2HHUA 2JVOA 2EG1A 2G4BA 1WHYA 4PRFA 2EPIA 2BM0A 4W98A 1YJRA 4EEYA 3T1AA 4DV1J 1CS4B 4KGKA 1S4FA 2YX7A 3MMCB 4IFVB 1S99A 1JLQB 3TX0A 1NDKA 4NYPA 1XBWA 2CJKA 4BWJA 4C98A 2ZNZA 2XMAA 2HFOA 1IWAA 4RBVA 3CTRA 4M5GA 1RWMB 1JB0C 2WCXA 3OL7A 1FTRA 1M5HA 1SKWA 1Q1KA 3I4HX 3BPDA 1HI0P 2F5GA 3O6QA 1A6LA 1PO6A 3WBZA 2RJZA 5D6GA 1R7IA 5KFEA 2KM8C 3Q8RB 3PW2A 4P52A 2VKRA 4DV6J 2YQ3A 1N5QA 1CBKA 3GFYA 3NEKA 2XI2A 2DR7A 1FX4A 3N79A 2ZVSA 3CEDA 3GR0A 2ZBIA 2B5JB 2YNHA 3GPAA 5CH7B 2MLYA 4WF9Q 4WTOB 2EC2A 2HQIA 1R89A 3AAWB 3QFWA 2BBEA 1X5PA 4GKKJ 1HBMA 2RKIB 5L1IA 2B6AB 4MK8A 3UPFA 4I68A 3HK2A 1YQHA 2VICA 4C8OA 4O3NA 3K5NA 1QM9A 1CJTA 3CJ8A 2ZH9A 1ZPVA 2JOQA 2K7KA 5A6PA 1RT2B 4OX7A 1BQNA 3RUBL 4X4VA 2CQGA 1C0UA 1N56A 1WSRA 4DV2F 3FGVA 4KC5A 1WWHA 4A8FA 4DPTA 1T05A 3Q8QB 4AL7A 1E6YB 2E1PA 2IAJA 1J27A 4YDDB 3V6KA 4KKOB 2JC0A 2Y8WA 1XR7A 5KFYA 4B3SF 4Y0FA 2GHPA 4RUBA 2DHAA 5KFWA 2B4PA 3HKZD 4NYOA 4ECVA 4B3OA 1W25A 1TL7A 2YXLA 1AYEA 4JI3J 2N3OA 4I69A 1SH3A 2B8QA 1YJUA 5IQ6A 4LFAF 1OY6A 2MMYA 2G0JA 4TU8A 2BJ7A 1JKHB 1Y5LB 1WOSA 3IA0A 1T3OA 2ATCB 1S0MA 1ZTTA 1F5AA 3ZNUA 4KHRA 4ZVRB 1TL5A 1WACA 3ZZ0A 1S1TA 1WC4A 2ZC4A 2PIIA 2AHOB 3HFVA 2MQMA 1UFKA 2B9EA 1QSYA 4LSNB 5HJXA 3UN5A 2Q66A 1Y9OA 5EN1A 4O4RA 1GFWB 3PRVA 3BF4A 2HFUA 4L76A 2WW8A 3DYAA 1H7WA 1WC1A 3SQGA 2EWHA 4YOEA 2W2PP 2G1HA 3MD3A 4NLDA 2IVFB 1U49A 2FHJD 4D3HA 5HQMA 4B9VA 4DFJA 1MU2A 3RJMB 3KHGA 2OIHA 4M63A 2BA9A 5DZ6A 1SIZA 1XNRF 1R0AA 4TQSA 3O5TB 3FK4A 4I7FB 4URQU 4R25A 4O3OA 2BMBA 1NPPA 2CJXB 4NL5A 4FNIA 3K58A 1AW0A 2KL8A 3JSBA 4QR1A 1F9HA 4F4YA 3SMZA 2GGPB 3CWJA 3GG1A 1OWXA 1UZDA 4LF5F 2HVEA 4Q8EA 4OZ0A 1YBAA 3DLEB 2QX0A 4K2XA 1KKHA 4PXDA 3RR7A 3SZ2A 1WHXA 4LQ9A 3KNGA 1B7YB 2F1FA 2VG7A 4W92B 2QLXA 2PA3A 1U45A 4DX6A 3SIPB 4C8NA 4EWTA 4LF8F 1KWMA 5EDWA 2CNLB 4ZCLA 1UJ4A 2M8DB 2GMJA 4ES3A 2EKYA 2CPXA 1M1HA 2MEWA 2PSZA 4YB1P 2H5IB 3HHLB 3CDUA 3CIZA 5E41A 3MM6B 2HHHF 2B56A 1S1WA 1KR4A 4YB6A 3VAFA 3PYGA 3TA2A 1N6QA 2OMLA 3W61A 3VALA 2BANB 1S48A 2HFSA 4RR5A 1U1KA 1N34F 3W2VB 1N32F 1IJEB 3MM9A 2W4DA 2ASLA 2VODA 3R97A 4KRWA 1R6YA 2VFSA 2BJEA 1TK0A 2UVVA 3UD5A 2E1AA 4DQQA 3CO9A 2DGWA 2OMOA 5E5NA 1U48A 1PJ5A 3V6DA 3QATA 4FS1A 3N6MA 3CUNA 4N77A 1SC1B 3MECA 3SCKE 1U1OA 4BDPA 1M5OC 2OKQA 3UNYA 2D3OR 1C4CA 4ZS6A 3MZIA 4ZLPA 1KHVA 1GEHA 4F4KA 3CB4A 3GSDA 3KFWX 4NXMJ 3EGWB 2HK3A 4A8XA 2OEJA 2V69A 1RHKB 1RWXB 2RHSB 3PTWA 4QYZJ 3DOLB 3ADAC 3DMJB 2R7OA 1T9UA 4Q43A 4NLYA 2XMVA 1Y5IB 1N5SA 2ABYA 3JS9A 4NLTA 4AYBD 4JP8A 4UQGA 2MY8A 3JB9k 4C4WA 5KFLA 4ED2A 4MH8A 4KV8A 4ANEA 4FDFA 2Q3PA 4JI0J 3NBPA 1SVDA 2C2KB 3W5ZA 3HVTB 4PWWA 4O44B 3Q2SC 2UUBJ 1HPZA 2F4FA 2DRAA 2WK4A 2FC9A 1Y7PA 4NZ0A 5DG7A 1U24A 3LOUA 1AFIA 4I2PA 1RISA 1YWXA 4DV6F 3BSCA 4USMA 2CWXA 2XMTA 2MZRA 4R8UA 5CD4H 2XMMA 2DJWA 4I6YA 4U8YA 1BUXA 3CPWR 2RUSA 1YBUA 3UN3A 2JZ5A 1U6ZA 1TVRA 2ZE2B 2YTCA 3ZZUA 4ID5A 5JXSA 5LMNJ 2WONA 3K5PA 1NK4A 2BKNA 4GKKF 3QFHA 1N5TA 2L9WA 1VR6A 3NY0A 4QR2A 3MPWA 3QSYB 2FLOA 5F8GA 5AJ3J 2VD3A 5K9FA 1RT2A 1IKWB 1RT5A 1ZYQA 2CVIA 4WWSA 4WK3A 2FHJA 4C0HA 2CAJA 1I51B 3HULA 3TEHB 1T9TA 2ZBRA 2DXEA 4J9VA 3DHXA 3DNCA 3TRGA 1HWIA 2MSSA 4Z37A 4NZ7A 2U2FA 3V81A 1RTJA 1S9GA 3H20A 2B3TB 1RT1A 2V34A 4JI1J 1S5ZA 5LOQA 1SQFA 1U1PA 2XZTB 4DSFA 1V3SA 2V4QA 2FJAB 1CG2A 1RUSA 4BCAA 2MPUA 3A1YG 1VIXA 5HP1A 3DDKA 4JI3F 3I56S 4NASA 3PIOQ 1B0VA 1NXIA 3OXFA 3FMWA 3V5RA 3ZTSA 4OYAA 2GNKA 3RRGA 1U6FA 2EEYA 3EXYA 1F0XA 4NLQA 3CC7S 4ZA1A 2KZMA 1TMJA 2ASDA 1RT3A 4USIA 3BJYA 4RUHA 3CVKA 3HM9A 4F67A 4OYOA 3GV7B 1IKVA 4KJIA 1PBAA 4ICLB 1R27B 1EZZB 1QTNB 2QSFA 3CJ5A 3BKFA 5D4NA 3H8YA 1Q79A 4HTIA 3T41A 1FK9B 1S0NA 9ATCB 5L1KA 3M05A 1SB6A 2VFUA 3IG1A 2YKNB 4YB5A 3OFFA 4P6QA 1F5BA 5C42A 3CJ3A 4EBCA 3HDSA 1N4LA 3IRXA 4A4JA 5IFMA 2DGUA 2LA4A 5KFMA 2G1DA 3DRPB 5IM0B 5DQGA 3N01A 4WP9A 2J0XA 3ISZA 2DNQA 4IR9A 4YR2A 4P73A 2DHGA 4J5OA 5EX3A 3Q0AA 1LWEB 3H42A 2VC0A 2HNDB 3CCWA 4F02A 4HR2A 1YDLA 5KOXA 4RNNA 1NZ8A 4NPOA 4J9PA 3TO8A 4DS5A 5F8LA 5BYSA 1RXOB 3GZ7A 2DNKA 2V2KA 2GO8A 2CPEA 2HGLA 4YHHJ 1JK9B 2PD1A 2Z57B 5MLCV 5BXIA 2LQJA 3EXCX 5ETMA 2QL5B 4LIWA 1XMQF 1NJIT 1FE4A 2CXEA 4ITSA 2DK2A 4OV6A 4NA1A 2B4VA 4X4NA 2LLZA 4N5SA 1EKSA 1H3DA 1RHRB 3T1HJ 1SH0A 3D0HE 2H1YA 3PX0A 5BJRA 2DGOA 4RW7A 4CLKA 1Z2LA 5K14A 2HQFA 2D3ZA 2ZNYA 2KRBA 4ATNA 2UUAF 1DTQA 2KH9A 3MTKA 3D6MB 4PQUA 1RT4A 2AJQA 1HBUA 1WTBA 2LXUA 4IYQA 4ZPVR 3KMQA 5KFZA 1SL2A 2ZH3A 4X4OA 3MEDA 2ZH4A 1T95A 4JI2J 4IH6A 2GVZA 3PYEA 1NM2A 2FVQA 2VOOA 2KM8B 1HQEA 1GMUA 2PN6A 3C6TA 4K8RA 2MKJA 3BBBA 3MHYA 4AE5A 5KT7A 1RADB 3D9BA 4NXMF 1FTCA 3N5FA 3DLJA 4K4SA 1VQ5S 2FQQB 3FNNA 1YKWA 1ZA1B 3ITHA 2LECA 2ZOFA 1OS5A 1R8PA 3DLKA 4EZ6A 2ROGA 4K0KJ 2XM3A 3TNVA 2BYCA 1UW4A 2HLUA 3MMAB 2PFFB 1FNXH 3BEGB 1OQ6A 2CJAA 3VF0B 2BEFA 2PE8A 4OYMA 2VBWA 3M4XA 2V2VA 2P5VA 2KHDA 4JI0F 2Z0GA 3L09A 1JLEA 3PR5B 2ZDOA 1C4AA 5ADZA 1KDNA 5F0WA 1BGXT 3JAMU 2DPJA 2YVSA 3PXGa 1JLCA 4N8OA 1N8RT 2UUCJ 1DTTA 1OYDA 2QT7A 4F04B 2ROEA 2JEFA 1JLAB 5J2MB 4GC6A 4Y2CA 2ZBCA 3SXLA 4JI4J 1RU1A 1FJ7A 3PRBA 4HH0A 3KLIA 2LQBA 2YNIB 4J9UE 2W4PA 5KT6A 1QVFR 3U7JA 1S6PA 1NK0A 4ZIVA 1ZM2A 4DDFA 3MAAB 2BE7D 1TKDA 3KK3B 4EBEA 1REVA 2OEKA 2KKHA 3DRRB 3MEGA 1TFYA 1VQOS 2CIMA 4ZVFA 2AMCB 4JB8B 4LBHA 4IRDA 5ETQA 1N54B 3IBWA 3BV8A 3Q8VA 1FXLA 5EGYA 4L73A 4X4TA 4DV0F 3AJ1A 3CW2C 1AFJA 3KHHA 4DR4J 1C0TA 4RKUC 2JDJA 3NKYA 5AJ3F 2IBKA 3PHEA 4PWUA 1AT1B 2KG0A 3U27A 1C2PA 4DZDA 1VRUA 1K73T 1FRXA 2FY8A 1S10A 4HDGA 5K8PA 5C25A 3MPYA 4YP3A 4A8MP 1X4HA 4RNHA 3GIRA 2QLWA 5IT4A 4PYDA 1RSCA 3TQ1A 3HHLD 1RLCL 1VQ8S 1KSPA 4LFBJ 4DXLA 4NCBA 1ZZFA 2W2NP 1RZMA 1YSJA 4JI1F 3M6XA 4QWBA 2HAFA 2IJFA 3Q8SB 3MMCA 3PJ9A 4IFVA 1JLQA 2CFXA 4MFBB 1NLKL 4ZVGA 2PDAA 2DXDA 2M52A 1U02A 2N7CA 1S97A 2KXNB 1F1BB 2VH7A 1LQ9A 4X4PA 2G9OA 1N52B 2WVBA 1VJWA 2OD4A 3T6JA 2UP1A 1NCLA 3WIVA 3MPDA 5AT1B 2BQRA 3W8GA 2C2DA 3OFHA 3RR8A 3MGJA 1LFWA 3MOZA 3TJ9A 3W3SA 2CPIA 3CJ0A 4DSLA 5LMUJ 2B5JA 3HHDA 3C16B 4KY3A 3FVYA 4CCHA 1TU0B 1Y3JA 2E7VA 4IQXA 1XMOJ 1KVKA 1HNIB 2P2CB 2RKIA 4KFBB 4USKA 4YN3B 2B6AA 4TY8B 3IS9B 1P9YA 3I31A 2DITA 5F9NA 4QIWD 3HZGA 1GTHA 2RU3A 2DNYA 3GP9A 4GKJJ 3NAIA 1AZSB 1DURA
chains in the Genus database with same CATH topology
2QL5B 3NS7B 1QTNB 3R6LB 4ZVUB 2XYPB 2CNNB 2H4YB 2FQQB 1RWWB 3R6GB 2C2KB 2CNKB 2CJXB 1I51B 5IC6B 1F9EB 2HBZB 1RWNB 1NMEB 4JB8B 2QLFB 4DCJB 4DCPB 4ZVPB 2CJYB 1IBCB 3R7SB 1QDUB 4DCOB 1RHRB 1RWKB 2H4WB 2H5JB 4ZVOB 1RHMB 3P45B 2HBYB 3KJNB 3EDQB 2H54B 2C2MB 1RHUB 3EDRB 1SC4B 1SC1B 2C2ZB 2QL7B 4ZVTB 1RHQB 2H51B 3GJSB 3KJFB 2QLJB 4ZVRB 5K20B 1BMQB 3P4UB 2XZTB 2QL9B 2HBRB 1RWOB 3SIPB 1ICEB 2CDRB 3D6MB 2XZDB 2HBQB 2CNLB 3QNWB 2H65B 4ZVSB 2Y1LB 3R7NB 1I3OB 2XYHB 2H48B 1PYOB 3D6HB 1RWPB 3R5JB 5IC4B 1RHKB 1RWXB 2QLBB 1GFWB 2XYGB 2CNOB 2H5IB 2P2CB 3KJQB 1RWMB 1RE1B 2C1EB 3D6FB 3GJQB 4LSZB 3GJRB 1RWVB 1SC3B 3GJTB 3RJMB 1PAUB 2DKOB 3IBCB 3R7BB 4ZVQB 2Y0BB 3IBFB 1RHJB 2C2OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QL5 B;  3NS7 B;  1QTN B;  3R6L B;  4ZVU B;  2XYP B;  2CNN B;  2H4Y B;  2FQQ B;  1RWW B;  3R6G B;  2C2K B;  2CNK B;  2CJX B;  1I51 B;  5IC6 B;  1F9E B;  2HBZ B;  1RWN B;  1NME B;  4JB8 B;  2QLF B;  4DCJ B;  4DCP B;  4ZVP B;  2CJY B;  1IBC B;  3R7S B;  1QDU B;  4DCO B;  1RHR B;  1RWK B;  2H4W B;  2H5J B;  4ZVO B;  1RHM B;  3P45 B;  2HBY B;  3KJN B;  3EDQ B;  2H54 B;  2C2M B;  1RHU B;  3EDR B;  1SC4 B;  1SC1 B;  2C2Z B;  2QL7 B;  4ZVT B;  1RHQ B;  2H51 B;  3GJS B;  3KJF B;  2QLJ B;  4ZVR B;  5K20 B;  1BMQ B;  3P4U B;  2XZT B;  2QL9 B;  2HBR B;  1RWO B;  3SIP B;  1ICE B;  2CDR B;  3D6M B;  2XZD B;  2HBQ B;  2CNL B;  3QNW B;  2H65 B;  4ZVS B;  2Y1L B;  3R7N B;  1I3O B;  2XYH B;  2H48 B;  1PYO B;  3D6H B;  1RWP B;  3R5J B;  5IC4 B;  1RHK B;  1RWX B;  2QLB B;  1GFW B;  2XYG B;  2CNO B;  2H5I B;  2P2C B;  3KJQ B;  1RWM B;  1RE1 B;  2C1E B;  3D6F B;  3GJQ B;  4LSZ B;  3GJR B;  1RWV B;  1SC3 B;  3GJT B;  3RJM B;  1PAU B;  2DKO B;  3IBC B;  3R7B B;  4ZVQ B;  2Y0B B;  3IBF B;  1RHJ B;  2C2O B; 
#chains in the Genus database with same CATH topology
 4HDH A;  3R1L A;  4OJH A;  2LQ5 A;  3M6U A;  1MML A;  1YRT A;  4LR7 A;  5KFO A;  4UOH A;  5AXL A;  4WXW A;  2I6W A;  3VGV A;  4C0B A;  3CUL A;  4AQY J;  4KGZ B;  3HJV A;  4WXO A;  4ELV A;  1E6Y A;  1SIW B;  2GVD B;  2VPZ B;  3BH6 B;  4FN5 A;  1LWX A;  2NXJ A;  4KKO A;  5DDQ C;  2VL1 A;  1HR0 J;  2FLN A;  3K8W A;  2H51 B;  1MRO B;  2ASJ A;  1EP4 B;  3G82 B;  1NJW A;  2IIH A;  1W2I A;  3NWG A;  2V94 A;  2JFK A;  4DQI A;  2LXI A;  3ILL A;  2IM2 A;  3W7B A;  1JKH A;  3T1H F;  1IXK A;  2PMW A;  3CDB A;  4MK7 A;  3VZI A;  2CQI A;  1KVJ A;  5E3A A;  2KT2 A;  2W4C A;  2ACM A;  1X9S A;  2FB0 A;  5GAE U;  4LSN A;  2VC1 A;  4M95 A;  2BXJ A;  5B08 A;  2P9G A;  3ULH A;  4L3K A;  5SZT A;  1YG0 A;  3FBF A;  3SBM A;  3ENW A;  1D8Y A;  1CSJ A;  2W2Q P;  4URG A;  2W2M P;  2FHO B;  3C6U B;  4AT1 B;  4XPC A;  2QMW A;  2J76 E;  1T9X A;  3ZZP A;  2M5Y A;  2EFV A;  3UW1 A;  4S0M A;  2DYA A;  3BGL A;  4I7F A;  5BR8 J;  2NR0 A;  3A13 A;  2LVW A;  4K4Y A;  1P1L A;  3HP6 A;  2XO7 A;  3RB3 A;  2B0G A;  1U4B A;  3ZTR A;  2GGP A;  4RU9 A;  3SDE B;  2UXB J;  4MKY A;  4FYW B;  2CQD A;  1P1T A;  2RU9 A;  3DLE A;  1YJN S;  3QJL A;  4DSE A;  3THP A;  4HLB A;  4RO0 A;  3V6J A;  3EZ5 A;  2VKZ G;  1HHS A;  5B0C A;  1LWF B;  3R27 A;  1VHF A;  4HTJ A;  3UDV A;  3NGK A;  2RDI A;  3LAL A;  3CD5 A;  2VHG A;  4ZP9 A;  4F8R A;  2DNP A;  4KHM A;  2BW7 A;  2E5H A;  3HHL A;  4DSI A;  3HSG A;  5LXY A;  2UUC F;  4UQT A;  2CQ4 A;  2L41 A;  2FVR A;  3QID A;  3MM6 A;  3W5X A;  1YZ7 A;  4MIW A;  5M2R A;  2WW4 A;  3CCQ S;  4U6P A;  1TKZ B;  4ZVP B;  3OL9 A;  4USJ C;  5ETR A;  3X3U A;  1GNK A;  3R5C A;  1UEU A;  2BAN A;  2BAB A;  4ZPD A;  4FYD A;  1TTH B;  1WOO A;  3W2V A;  5D15 A;  2LYV A;  2HRU A;  2OAU A;  2BKO A;  2O1P A;  1H6K X;  2RIJ A;  3MEK A;  2QE5 A;  2XMW A;  3SFU A;  3O2I A;  3LPY A;  1OJ4 A;  4PXC A;  2IJN A;  1YRU A;  1WTF A;  4AXI A;  4P2F A;  2VUG A;  3W66 A;  2O3D A;  4KGV B;  2AP6 A;  2BVZ A;  1RT7 B;  2XNQ A;  4DR4 F;  5KFQ A;  1Y5N B;  2ZH5 A;  2RB7 A;  5CYJ A;  3H2V E;  3Q8U A;  1WG4 A;  2E9Z A;  2B9Y A;  3TYT A;  3A4T A;  4LRC A;  4CDI A;  2CZ4 A;  1WHV A;  4NLO A;  3RRH A;  3NGU A;  3FRZ A;  3DOL A;  3PAC A;  2QJ3 A;  3MPU B;  2FHM A;  3DMJ A;  3D1Q A;  1H2U X;  4OJ1 A;  3BS9 A;  4ZN3 A;  3GIJ A;  1R43 A;  2A6O A;  1BXN A;  4LFB F;  4MIA A;  3VGT A;  2W25 A;  3MPV A;  4Q5V A;  4ZVO B;  2W8L A;  5A2Q U;  4ALZ A;  4QIF A;  3TEG A;  1QAJ A;  1Q53 A;  4GC7 A;  3IGV A;  4OJG A;  4LQ3 A;  1URN A;  3SCI E;  1TZ0 A;  3HVT A;  4M5L A;  4XAK A;  4O44 A;  2AF6 A;  1A0O B;  2MJN A;  2B43 A;  3CNQ P;  1FRL A;  1FVS A;  3RBX A;  3R5J B;  2VQF J;  2AW0 A;  4Y28 C;  3K5M A;  2VZ9 A;  1SJQ A;  1KQS R;  3FCW A;  3OHA A;  3T5L A;  1PIL A;  4CP5 A;  1RTD B;  3GJT B;  3EGN A;  1XEZ A;  1EQM A;  4DWI A;  2XUL A;  1U2F A;  3CO0 P;  1ARO P;  4A8Q A;  2ZE2 A;  5LMU F;  4B17 A;  5FLX U;  4QPT A;  2R3V A;  1FE0 A;  4P2M A;  1ZM4 A;  1Z4U A;  2YH1 A;  3JYT B;  1F9F A;  4QYZ K;  3ONQ A;  3PZP A;  4IH5 A;  2XHW A;  3GCX P;  1U09 A;  4K4T A;  3DI6 B;  3IFE A;  3UD4 P;  2W1B A;  2VFV A;  1BQM B;  5KFH A;  4KT0 C;  1OO0 B;  2YQ0 A;  4DLE A;  1SC4 B;  3ZNJ 1;  4GKJ F;  3HT0 A;  1IKW A;  1G4C A;  4HH1 A;  3BDP A;  3D67 A;  4NRT A;  3ZO7 A;  4B9N A;  1Q5Y A;  4FF1 A;  3E3X A;  1M5S A;  1W26 A;  2RF2 B;  3I5C A;  4AQY F;  2LMI A;  5GMD A;  3GYN A;  1H74 A;  1QE1 B;  3OT9 A;  2Q43 A;  3I0S B;  3VGU A;  1HR0 F;  2MZJ A;  5M2P A;  4H4M B;  1S6O A;  2IJR A;  2XHC A;  3LAK A;  1BLU A;  4PQA A;  4C3L A;  5AXN A;  2YWE A;  3IAS 9;  3FUY A;  2FDN A;  3MDF A;  2O67 A;  3M8Q B;  2GCF A;  2BR0 A;  4FPI A;  3RBD A;  1Q7L B;  4MIB A;  2AX0 A;  2AZ1 A;  1QAY A;  4IG0 B;  1FWK A;  2HUR A;  4LR9 A;  1NU4 A;  2HGM A;  4DCP B;  4QWC A;  1UVJ A;  2X3D A;  2KTQ A;  1YI2 S;  5KFX A;  4CZC A;  3NWR A;  3G86 A;  4O23 A;  3CIM A;  4ICL A;  3IMQ J;  2YQ1 A;  2AJ4 A;  4DU8 A;  4LJM A;  3TQE A;  2OSR A;  3DU5 A;  5HK4 A;  2RDD A;  1WI6 A;  1FK9 A;  3PEH A;  3M8Z A;  4OZL A;  5C2G A;  1ITP A;  2YKN A;  1I3O B;  3MUT P;  4EU0 A;  2CPF A;  3K2Y A;  1LOU A;  4I6W A;  2D3U A;  1XER A;  1MNE A;  3V6H A;  3UWT A;  4NLU A;  1FRH A;  2EVZ A;  4OV1 A;  4NLG A;  3DRP A;  5IM0 A;  1UWB B;  3VAH A;  3R2D J;  4ZVH A;  2RSQ A;  5BR8 F;  3H59 A;  1LKZ A;  1PSD A;  2VJU A;  1IWG A;  4ZVQ B;  1NK5 A;  3UDE A;  2XCA A;  1LWE A;  4F7V A;  2HND A;  4USV A;  3ZZO A;  2VFR A;  1YGY A;  1EJ7 L;  1RTH B;  4OMF G;  4DR7 J;  1K1Q A;  1NKB A;  1NSP A;  1EQ0 A;  2FVP A;  3JXO A;  1GX5 A;  1WG1 A;  3AA8 A;  4ELU A;  4E0D A;  5IT9 U;  4OL8 A;  2DNZ A;  3EDR B;  4CH7 A;  3AJ2 A;  4EMD A;  4X65 J;  3T6B A;  3L4B C;  1WF1 A;  5J2Q B;  1B7F A;  1RTI B;  4EO8 A;  3U1M A;  4IRK A;  2MDA A;  3MOJ B;  3GFX A;  2FIU A;  1RU2 A;  4CWB A;  4JV1 A;  2ERR A;  1E6V B;  2DHX A;  2OPS B;  2I38 A;  2HRT A;  2BOP A;  5DM7 Q;  3GIL A;  1KFS A;  1PBU A;  2B9W A;  3IBC B;  4OHW A;  4J9M A;  2OPP B;  4A8S A;  4DR1 J;  1F3F A;  3GQC A;  2C3M A;  3DXS X;  5KG7 A;  5H1S V;  2V6A A;  5D4O A;  4U96 A;  2BJ9 A;  3OJU A;  4PWD B;  2FJX A;  4A48 A;  2FVS A;  5BYR A;  2QLF B;  1SV5 B;  3KWM A;  3T5J A;  1X0F A;  2CDQ A;  4XO0 A;  3HHN B;  3OSP A;  4ZP8 A;  2FD2 A;  1BHN A;  2A10 A;  2HQD A;  3SSS A;  3ZC4 A;  4ZKA A;  2AT1 B;  2ZJR Q;  2DNR A;  1B99 A;  2Y1R I;  2HBQ B;  5KFI A;  2VAS A;  2JL9 A;  2M9K A;  3L7U A;  2AYB A;  2Q1L A;  3OLB A;  1XIQ A;  2PMZ D;  3MMA A;  2XWY A;  3L3C A;  4DL7 A;  2ZHO A;  3N4W A;  4DX7 A;  4DUZ F;  2A2C A;  3EJM A;  1Q86 T;  5GAE I;  3GJR B;  3MMB B;  3H5X A;  2Z2Z A;  5IWA J;  4E2F B;  2VDH A;  3MFH A;  4LFC J;  1O8B A;  3TW0 A;  2HEK A;  1VC6 A;  1CJU B;  3NGR A;  1X0P A;  2XY7 A;  2VQF F;  3KTQ A;  4WTY A;  2OTL S;  1QJH A;  1JLA A;  5J2M A;  3H2U B;  2V8H A;  3QGP A;  2BX6 A;  3AOD A;  2JRS A;  2YNI A;  4DPW A;  3L7O A;  1CPZ A;  4X4Q A;  4PCQ A;  2RS8 A;  3IXQ A;  2UXD J;  3PCO B;  2YY3 A;  1TKT B;  3IP0 A;  3MAA A;  2XLJ A;  3BGF A;  3KK3 A;  1SC6 A;  3DRR A;  3EYZ A;  5L1L A;  3OVS A;  4EGL A;  5DQI A;  2M70 A;  5DGB A;  4KAI A;  3CC2 S;  2HQG A;  2YKQ A;  2ZUG A;  1QSS A;  2XMK A;  1AB8 A;  3DDI A;  4G3I A;  4TY9 A;  1RE1 B;  1FDA A;  3THT A;  3ZZZ A;  1U0S A;  3QSI A;  3TA1 A;  1RP5 A;  3J7Z 5;  1RWV B;  1UP1 A;  1FRM A;  3BB5 A;  2PMH A;  3IM9 A;  4QZV B;  2JSX A;  4ER8 A;  4QQB A;  3D5M A;  2RD5 C;  2HAI A;  3R3T A;  2NXN A;  2G0I A;  2CQ2 A;  4CQ1 A;  1AUD A;  3QZ8 A;  4JI5 J;  3CME S;  1NSQ A;  2BJ1 A;  3T9N A;  2IFX A;  4HI2 A;  2HGN A;  4HAC B;  5B0E A;  2CJY B;  2LCW A;  2RDJ A;  4DL0 C;  5DET A;  4DL3 A;  2BJ3 A;  1YIT S;  1J5E J;  3CC4 S;  3VZH A;  3QGI A;  4MFB A;  2Z56 B;  4O3P A;  3H2L A;  4LRD A;  2RS2 A;  4FNH A;  1IBM J;  2AYE A;  4IR1 A;  1VQP S;  4DR2 J;  2MLZ A;  3PM9 A;  2VG6 B;  5CA5 A;  1JLB B;  5B0A A;  4JBC A;  5E7O B;  2DNN A;  1YJW S;  5IC4 B;  2HIQ A;  3BGR B;  2XYG B;  4AL5 A;  1W7W A;  2IY5 B;  3RB0 A;  4P2X A;  2GO9 A;  2KJV A;  2E1M C;  1UMJ A;  2FHK A;  3VQT A;  5HMY A;  3QAE A;  4F2S A;  3ELH A;  1ZS6 A;  2PO4 A;  4WU3 A;  2M0G B;  2GAH C;  5KT3 A;  3JSM B;  3C16 A;  4I2Q B;  2IC3 B;  3AD9 C;  2ZOG A;  2UVR A;  4ZOS A;  1NEE A;  2QZ8 A;  3NS6 A;  2GIR A;  2NZC A;  1HNI A;  4KFB A;  2IBO A;  4TY8 A;  3IS9 A;  2BE9 B;  1I94 J;  4F4Z A;  3HHE A;  1X4E A;  1FNM A;  1HI8 A;  1Q95 G;  5HJY A;  2MZT A;  3C14 B;  2RVJ A;  2EFO A;  3OD2 A;  2WHO A;  1Q81 T;  1EET B;  4MMO A;  1KEK A;  2AGO A;  2MST A;  3LH2 S;  1RBL A;  1AZS A;  5ETP A;  2KVI A;  4NEY A;  3B4M A;  4Q7A A;  3HVR A;  3WQP A;  2EBE A;  3CT9 A;  2VB6 A;  4FBU A;  1V3R A;  3C19 A;  4DR7 F;  1URR A;  2YKM B;  4N56 A;  5A2Q Y;  2OEL A;  4NYZ A;  5LXR A;  2GVD A;  2B51 A;  2Y8Y A;  1Z1Z A;  4WPA A;  2R2R A;  3BSO A;  3W9H A;  1U1M A;  1D3W A;  4OQJ A;  4GMK A;  4JI7 J;  2PC6 A;  1J2V A;  2C1E B;  1MRO A;  3GV8 B;  1EP4 A;  3M8S A;  3G82 A;  2KU7 A;  2HWI A;  4X65 F;  5A8W B;  1M1K T;  5GME A;  1WHW A;  2D7S A;  3KYL A;  1K8A T;  1TV6 B;  3LWM A;  3VR1 A;  2GMH A;  3J7A 1;  3LA0 A;  2KXF A;  4C11 B;  3CCT A;  3Q24 A;  2VA2 A;  2DO4 A;  1JJH A;  1DHM A;  2PEH A;  1F2G A;  1XMB A;  3PFO A;  1G7C B;  3B54 A;  4WIQ A;  2ZJP Q;  5IV4 A;  5J1N A;  1DLO B;  2A6M A;  3FCV A;  5FLX Y;  3M1V B;  3KJN B;  2XMU A;  4YR3 A;  5EWF A;  4DR1 F;  4QBU A;  4BS2 A;  1KQK A;  3GFZ A;  1S1X B;  3ILJ A;  2ZJQ Q;  4Q44 A;  1B64 A;  3L7P A;  2NSB A;  4WFY A;  4C0O C;  5B7W A;  3KG1 A;  4UUX A;  3C6U A;  5DGA A;  3I6P A;  2UZA A;  3SSQ A;  5ETN A;  2NUH A;  1TAU A;  3NCR A;  3TZW A;  4X4R A;  1KHW A;  4A8O A;  1H2T Z;  3MAH A;  1SKR A;  3NGT A;  3RAQ A;  2F9J A;  2YWG A;  2NZ4 A;  4D3G A;  3QBC A;  1TL4 A;  1X4A A;  3OHB A;  3SDE A;  4EFA C;  3Q23 A;  2JC1 A;  2UV8 A;  1RTZ A;  4ZVU B;  4OX6 A;  2ZZT A;  3RYL A;  3S6E A;  2MQL A;  5HN0 A;  5IC6 B;  4AFF A;  1RAE B;  5KTQ A;  2X51 A;  1NBE B;  3BM7 A;  2HPU A;  5HRO B;  3OVA A;  4CLZ A;  5CD4 A;  2ILY A;  3G6E S;  1LWF A;  5IWA F;  2AIR B;  1LXJ A;  1WEX A;  1FJE B;  2KRR A;  3MCN A;  4LFC F;  3J80 U;  1JXV A;  2VU5 A;  1OPI A;  3EGZ A;  1PJ7 A;  3QWU A;  1ICE B;  4NA3 A;  1G3O A;  3SYZ A;  2CA9 A;  1S9E B;  3HD2 A;  3MTJ A;  3QNW B;  3MUR P;  1TKZ A;  1V6H A;  4HKQ A;  1S9F A;  4IQM A;  5ETO A;  2ZZM A;  3QO9 B;  4F2R A;  2V9W A;  4LVO P;  4ZHR B;  3B4D A;  4EK2 A;  2UXD F;  2EK6 A;  2HVD A;  3TP2 A;  4F3O A;  1JJC B;  1FFS B;  2U1A A;  3LF0 A;  2E7W A;  2LDI A;  5T7L B;  1NK7 A;  4F0M A;  5HAO A;  5KT2 A;  5KFR A;  2GW8 A;  3DRY A;  4MKB A;  1Q8B A;  4BBY A;  3WIU A;  2DRB A;  1IKY B;  5DLG A;  1PYS B;  4KQZ A;  2KVQ E;  4DUT A;  2V8G A;  4WE1 A;  2WVC A;  1RT7 A;  4F25 A;  2R7X A;  3X1L B;  2WSE C;  2VON A;  3PVX A;  1XNR J;  4HHU A;  3BYP A;  3RTV A;  5CZV A;  2H4W B;  3EDQ B;  1YK9 A;  2XLK A;  4DR5 J;  2MHE A;  2N3L A;  2EFN A;  3R1H A;  1GXU A;  3N0V A;  3ITH B;  2GJI A;  3R8Y A;  5B0D A;  2OFG X;  4LF5 J;  2VBY A;  3FFI B;  5L39 A;  3MI7 X;  3VV2 B;  1KC8 T;  5E33 A;  2V2Q A;  1GQE A;  2CWK A;  1KRP A;  1YJT A;  4LF9 J;  1XC9 A;  3D68 A;  1IBM F;  2DB1 A;  3IN5 A;  1ZH5 A;  4DR2 F;  2AD9 A;  3KLE B;  3M8W A;  4F0K A;  2BW2 A;  1OY9 A;  5B0F A;  4CLY A;  3BSA A;  4DX8 H;  3CJQ A;  2XYP B;  3M9M B;  4F26 A;  1TQL A;  2HHH J;  3D0G E;  2W7A A;  3W63 A;  1RTD A;  1FES A;  3F73 A;  1Q82 T;  5C24 B;  1FI4 A;  2J5A A;  2DGQ A;  3FBE A;  1S59 A;  3WHI A;  5ETT A;  2COL A;  3VVT A;  3BH7 B;  3FSY A;  3NRB A;  4KH0 B;  3JYT A;  3NOC A;  3MR7 A;  2FYX A;  2Z4P A;  3QRP A;  3N6N A;  3RBZ A;  3DI6 A;  4U7U K;  1ZAX A;  1I94 F;  4NLV A;  3RG6 A;  3OFG A;  1LNQ A;  4OLO A;  2R9L A;  1BQM A;  4ID8 A;  1V3Z A;  3NXZ A;  2VA3 A;  1CVJ A;  2C28 A;  3RB6 A;  1VRQ C;  2DPI A;  4TLQ A;  3A3O B;  3GJQ B;  2X7I A;  4I67 A;  3J7Y U;  2HHX A;  3Q8P B;  3OUY B;  4DX5 A;  1GAO A;  3RW7 A;  1IUJ A;  3CJ4 A;  4G1Q B;  2RF2 A;  2MQ8 A;  2WSC C;  4AD6 A;  2J9C A;  5IT0 A;  1OMS A;  3OJS A;  2G0C A;  1QE1 A;  2WOM B;  4ZPA A;  3I0S A;  3TWZ A;  2CJ9 A;  3HVA A;  1RWN B;  5KG0 A;  4CYU B;  4JI7 F;  4H4M A;  4CLS A;  1L3V A;  2YPY A;  3IWL A;  3KLH B;  2AJ1 A;  2YWW A;  2C2N A;  4I64 A;  4FF2 A;  3UR3 C;  3ZZT A;  1T9Y A;  3RRK A;  5KG2 A;  3M8Q A;  3PYD A;  4DPX A;  3CDA A;  5ETV A;  4CO2 A;  4H4O B;  4DV5 F;  1QAI A;  2FJW A;  1BY9 A;  3J7Z T;  4IG0 A;  2OI2 A;  1T3N A;  2ZKU A;  4FXV A;  5GAD U;  4PG4 A;  1HL6 A;  4ZIW A;  5F8I A;  2Z58 B;  3EZU A;  5HSP A;  3AQO A;  2J0S D;  2WTF A;  4IOB A;  3KJQ B;  4Y3C A;  1Q8K A;  2BRK A;  3VAJ A;  6FDR A;  4UW2 A;  2KDO A;  1NPK A;  4PG5 A;  1TL1 B;  4B3R J;  5EWG A;  2AYM A;  1I6J A;  2IDL A;  3HT3 A;  4OX9 J;  2ZH1 A;  4JI8 J;  2BAC A;  4P72 A;  2JLG A;  3ZTO A;  1UWB A;  1IJF B;  1XN9 A;  3RAX A;  2VBX A;  1NAQ A;  1LW2 B;  2HRY A;  2K3K A;  2NXU A;  2ALY B;  2MQQ A;  2X3G A;  2HWT A;  2AJ0 A;  3BDE A;  4DPY A;  3D7S B;  2HNZ B;  4RL1 A;  3G71 S;  3FBB A;  4ECX A;  3NGD A;  1RHQ B;  1S76 D;  1RTH A;  2HQ3 A;  4MYU A;  1PAE X;  3Q89 A;  5E2Q A;  2QEX S;  3G9C A;  2XY5 A;  1TFW A;  1APS A;  1G6B A;  5E3R A;  2CPY A;  1MWZ A;  2BM1 A;  2MKC A;  5HAN A;  3KMS A;  1VQL S;  3MMJ A;  1U1Q A;  4LIR A;  3D6F B;  1UTA A;  4FVC A;  1VGY A;  4Y2A A;  4LF4 F;  3D28 A;  1KD1 T;  5J2Q A;  4RBT A;  1DFD A;  1RTI A;  2VF3 A;  4TVA B;  3LAM A;  1FFG B;  4F4A A;  3G8S A;  5KFS A;  2Y1I A;  2KJW A;  4FKX A;  1H72 C;  3GE9 A;  2FJD B;  4OZ2 A;  3W65 A;  3MUM P;  2DHS A;  3I5B A;  2MTL A;  2IRY A;  4DL5 A;  1E6V A;  3V4M A;  2ZH2 A;  1MMN A;  1D8Z A;  2OPS A;  2CPJ A;  3E2E A;  4RZR A;  2OPP A;  2LKZ A;  1S4E A;  5LJ5 Y;  1RAJ A;  1HHT P;  3P45 B;  5KFF A;  2V4J B;  2V4R A;  1UFL A;  3KJF B;  1H38 A;  1HAR A;  2J0Q D;  3ISN C;  4PWD A;  1U1N A;  3ZFV A;  1SV5 A;  1N0V C;  1WEL A;  4ZPW R;  3I4P A;  3GG0 A;  4NX9 A;  5EWE A;  3CCS S;  2DEI A;  2DNG A;  1S1U B;  3WZ0 A;  3QYY A;  4P9S A;  1ULR A;  2QRR A;  2OFH X;  4DR5 F;  3TI0 A;  1KN6 A;  1KOO A;  1VBK A;  4FF4 A;  3DN9 A;  5KFC A;  3ZXW A;  2L3M A;  3H0P A;  3EVM A;  3TVK A;  3S1T A;  2DGX A;  2EFQ A;  4X2B A;  1LW0 B;  5CAB A;  3MMB A;  3D0I E;  4ZCK A;  3DRX A;  4J9K A;  5KG1 A;  3WDO A;  4XK8 C;  2KI2 A;  4K2J A;  7FD1 A;  4KSE B;  4LF9 F;  3QJJ A;  4RWW A;  3SFG A;  4LRA A;  3PV8 A;  4ED8 A;  1XMQ J;  4KYZ A;  1CJU A;  1C1C B;  5HL7 Q;  3OL8 A;  4QW9 A;  5KFP A;  2GJ2 A;  3B78 A;  1G2E A;  3RGI A;  1SJ1 A;  1WUU A;  2ACY A;  3JSY A;  1H73 A;  3L9Z A;  4NMX A;  1SCJ B;  4IFY B;  2V2Z A;  2R7R A;  1VK8 A;  2UUA J;  4AUK A;  1TKT A;  2DY9 A;  2C2E A;  1XWL A;  2W7P A;  3HF5 A;  1EX8 A;  4F4X A;  1FRJ A;  4WFX A;  3UO0 A;  2WVF A;  4ETX A;  3PO5 A;  4DQR A;  1FKO B;  2OO4 A;  3MM7 B;  1JNZ B;  2ZFH A;  2KXH A;  4G1I A;  3KK2 B;  1SJR A;  4TKT A;  4I6A A;  1GT8 A;  2B8P A;  2VPX B;  1IBC B;  2ZH7 A;  2G2Z A;  2HBY B;  1EAY C;  4JI6 J;  2CQB A;  1X31 C;  2ZH8 A;  5DG8 A;  3AHP A;  3QLH B;  2R2T A;  2Z30 B;  1NK9 A;  1VHI A;  1ROF A;  1YVF A;  8ATC B;  4HAC A;  1PCA A;  4LF1 A;  2RQM A;  4DMZ A;  4K4W A;  3EVW A;  5J1E B;  5E3P A;  2ZBP A;  4ED3 A;  2QA1 A;  4UST A;  4V19 J;  3MEE B;  1VLY A;  3HSJ A;  2VG6 A;  2HYI B;  1IKX B;  4ED7 A;  3OPK A;  4YR0 A;  2K8G A;  5IXU A;  1JLB A;  3POT B;  4USH A;  3VVU A;  1P9Q C;  3PG9 A;  3BPS P;  1HNZ J;  2A3J A;  1OY8 A;  2MYF A;  2ZZN A;  2ROP A;  3NS7 B;  3BGR A;  2LA6 A;  1SQG A;  3H4B A;  2ZUA A;  4DL6 A;  2QA4 G;  1XJW B;  2EI5 A;  3KHR A;  3WC2 A;  1Y11 A;  4HT7 A;  3JSM A;  4I2Q A;  2IC3 A;  2F4V J;  1UA1 A;  3TZX A;  4B3R F;  2DCU B;  2V0N A;  5ETK A;  3QT5 A;  4DPO A;  3AA9 A;  1SJ3 P;  4H4K C;  4ECW A;  4ELT A;  1MWY A;  2XLI A;  3IAM 9;  4OX9 F;  4JI8 F;  4XTT A;  1KQF B;  1HWJ A;  2V67 A;  2IA6 A;  4JUZ A;  2IYG A;  4DV0 J;  3DRS B;  3C14 A;  2AGP A;  2MZ1 A;  1HFE L;  1EET A;  2V8D A;  4Q0B B;  1QUP A;  1C1B B;  2DIS A;  4IO9 Q;  1QAX A;  3IR7 B;  4ED5 A;  2QG9 B;  5HQ8 A;  3QRQ A;  2XZW A;  4OHY A;  4KGX B;  2EXU A;  3FZB A;  2HQC A;  1FKP B;  2JHE A;  2YKM A;  5I4M A;  4RW6 B;  5HMX A;  5KG6 A;  4M94 A;  1ZBT A;  4O3R A;  2R4F A;  4RLE A;  3UR0 A;  4UF4 A;  1CQM A;  1NHV A;  3W62 A;  2EKN A;  3HHL C;  1NME B;  4PG6 A;  5CQG A;  3IR5 B;  4LRE A;  2BRL A;  3DLG B;  1L3U A;  4Z2X A;  5A8W A;  1SBR A;  3A8J A;  2VIH A;  5GVQ A;  4EBD A;  3K17 A;  1FWP A;  1H7X A;  3D4J A;  1TV6 A;  4WZM A;  1IVZ A;  4C11 A;  2POK A;  5KFK A;  2KHC A;  1NB2 A;  4ZVS B;  3AFG A;  4C8Z A;  1P6T A;  1DLO A;  1PJ6 A;  2OPQ B;  4ED6 A;  3M1V A;  2B7C B;  3O3L A;  2VG5 B;  4ZIT A;  3TZZ A;  4QU6 A;  3J7Y I;  2L08 A;  2YH0 A;  2VQE J;  1S1X A;  3MUV P;  4QIV A;  2W2O P;  4PAB A;  4DN0 A;  2MHN A;  4IUF A;  3U02 A;  4FXW A;  5JVG Q;  2AX1 A;  3M32 B;  1MG7 A;  4URS A;  3IBF B;  1KFD A;  3OTO J;  4DFK A;  2ZIT A;  4CLL A;  4OYZ A;  3ILO A;  4USU A;  2HW3 A;  2G2O A;  3MM5 B;  1X5S A;  4MTP A;  4UUW A;  1DZ5 A;  2XMJ A;  4Q45 A;  1HKA A;  4R5P B;  3W60 A;  1IR2 A;  3QAU A;  1KON A;  3GJS B;  5GAD I;  2R7T A;  5HRO A;  3LAN A;  3UCG A;  4KHP F;  1UAW A;  4WYW A;  2C3U A;  1MWQ A;  4Q2M A;  1ZOT A;  4OI4 A;  2GV1 A;  5KG3 A;  4GO5 X;  2IM3 A;  4CO3 A;  2FUG 9;  1TK8 A;  4TLR A;  3ZZR A;  1GK8 A;  1GX6 A;  1S9E A;  4A8K A;  5FD1 A;  3DCA A;  4L6V 3;  4ZJO A;  2VOP A;  4ECR A;  5A8K B;  1I5O B;  2E1R A;  2E29 A;  5LJ3 Y;  3FZ2 A;  4OZ1 A;  5C2C A;  4Y65 A;  3QO9 A;  3T3F A;  1RT6 B;  4ZHR A;  2QYG A;  3LGN A;  5KFJ A;  4RJV A;  2XS2 A;  4DQS A;  1HW8 A;  3K59 A;  1RCO B;  5T7L A;  1Z2Z A;  1HWK A;  1RQ0 A;  5DDP C;  1IKY A;  1SKS A;  3KG4 A;  3B8H A;  2QSW A;  1KS2 A;  4M8L A;  3VAI A;  4IDK B;  1WG5 A;  3LP0 B;  2Y1L B;  3VAG A;  3DOM B;  2ADC A;  1IQT A;  4WCE Q;  4BHQ A;  2KN4 A;  4TYA A;  4USW A;  2C3Y A;  3AOB A;  3BN4 A;  4K4Z A;  1T03 B;  3WC0 A;  3GSI A;  2KG1 A;  4JI6 F;  1T8E A;  3K8V A;  2W9C B;  2RNE A;  3BO2 A;  3UVJ B;  1ACM B;  2APO A;  2HNY B;  4PKD B;  2HVH A;  1A7G E;  3DHW C;  1T9W A;  4I1T A;  3FFI A;  4E8U A;  3ET6 B;  3P49 B;  3B82 A;  3R6G B;  1Q5V A;  1WOP A;  1U8W A;  3QRR A;  5FII A;  1R0B G;  3VAM A;  4GRS A;  5DM6 Q;  1TL3 B;  1IN0 A;  2CYY A;  2DCL A;  4BWM A;  1F5C A;  3KLE A;  2J8A A;  1HQU B;  2A1B A;  4OYW A;  1VBY A;  2BJ8 A;  1HBO B;  3KXD A;  3HXM A;  3MR6 A;  2QL7 B;  1HNZ F;  5M2U A;  4LVN P;  2KB2 A;  1Q8L A;  3OFE A;  1UW9 A;  3M2U B;  1B4S A;  3OVB A;  2CDR B;  4FKY A;  5DO2 A;  2DD8 S;  3R7N B;  2PGC A;  1UVL A;  5C24 A;  1M1G A;  3G8T A;  2OHD A;  4WFN Q;  5HBM B;  3OR2 B;  3E51 A;  2X1B A;  2Z2L A;  2F4V F;  2YWH A;  1UVM A;  2HHW A;  1X60 A;  2E5L J;  2HZC A;  5CAA A;  3PW0 A;  1QUV A;  4ZJL A;  2OLW A;  4OHZ A;  4CLU A;  2ATL A;  1SUQ B;  1L3T A;  1RAA B;  3M8Y A;  1RHJ B;  5J2P B;  3JTN A;  2HFV A;  5RUB A;  4ZLN A;  4NE9 C;  5AE2 A;  1BC6 A;  4BLG A;  3HZE A;  4LR8 A;  3MAQ A;  1S0V A;  1HMV B;  4ZDN A;  3OTB A;  4XPE A;  3OUY A;  5IZH A;  2VJV A;  4G1Q A;  1SXL A;  5I3P A;  4QCL A;  2L9N A;  5EHH A;  5KFD A;  5HMZ A;  1X8D A;  1DQA A;  3AB2 B;  4Q8F A;  2F63 A;  4QIG A;  4C48 A;  2WOM A;  2E66 A;  4L74 A;  2NPI A;  3JSR A;  4QIE A;  4CYU A;  5HLF B;  4M5D B;  2K1R B;  4XDD A;  1N33 J;  1YIJ S;  2DR5 A;  2LEA A;  4PXE A;  4NWB A;  3KLH A;  3AXK A;  2H9Z A;  5A8R B;  2K06 A;  2LQ8 A;  1Y10 A;  2Q6C A;  3VGS A;  1SPB P;  2IRU A;  2Q6B A;  4H4O A;  1ZET A;  2FPH X;  2CRL A;  5KFT A;  5AXK A;  1LK5 A;  4Y34 A;  2WSF C;  1JLG B;  4A8Y A;  3J81 j;  3PJW A;  4MAK A;  3NCQ A;  4HI1 A;  1WEY A;  4BC7 A;  2DNL A;  4CH0 S;  4I4B A;  2GQC A;  2NXC A;  3GV5 B;  3MCO A;  2GIF A;  3I0R B;  1PC4 A;  2MKS A;  1OQ3 A;  3TAP A;  2DR9 A;  5ITH A;  2VQE F;  2EFG A;  1X7V A;  1TL1 A;  3UD3 P;  1UA0 A;  4OZN A;  1JMT A;  4NEZ A;  1YRX A;  3KK1 B;  5K8N A;  4PXB A;  2ALZ A;  1TK5 A;  4DHV A;  3OTO F;  2FC8 A;  4U8V A;  3HSD A;  2HMI B;  2W9B B;  1LW2 A;  4WZQ A;  3O1L A;  5F3Z A;  4FS2 A;  1NDC A;  3A8E A;  4ETZ A;  5G4D A;  3SCL E;  2NSC A;  1FHT A;  3IC1 A;  4RNF A;  3A8K A;  1VYA A;  4AXJ A;  2HNZ A;  3HFZ B;  3EVO A;  2RAQ A;  2RHQ B;  1I1G A;  1YX2 A;  3D66 A;  1BE4 A;  2NUU G;  2UVW A;  4EYH B;  3E8O A;  3UDC A;  2RUG A;  4FP9 A;  4G6V B;  1WD6 A;  3OBI A;  3DOK B;  3PYF A;  1VRT B;  2JLE A;  1UEV A;  1HLW A;  4LRB A;  3VQS A;  4YY3 J;  2XEX A;  3FJ2 A;  1HBN B;  5IS2 A;  2LXF A;  2MZS A;  1FVQ A;  4DR3 J;  1FJG F;  4QYR A;  3NAH A;  3KUH A;  1GXT A;  4Q2L A;  1QDU B;  2CAD A;  3A3N B;  3SSR A;  2NYI A;  1X5T A;  1N48 A;  4I0W A;  3LPE A;  3T19 A;  3H5U A;  1RYS A;  5DZ7 A;  1OPZ A;  1RWU A;  1WOR A;  4PAA A;  4PG8 A;  4YEA A;  1NDL A;  4NLR A;  4ZN1 A;  3DLL Q;  4J9N A;  1D9D A;  1NKE A;  2KFZ A;  2XYH B;  2R7V A;  1NK6 A;  3P6Y C;  4NXN F;  1HI1 A;  1CJV B;  4K7Q A;  2DR8 A;  1K44 A;  5CYQ B;  2V4J A;  3QPI A;  2YNG B;  1JLF B;  3OV7 A;  2EW9 A;  3G96 A;  4DG1 B;  2RH3 A;  4CRJ A;  4B3M J;  1NH8 A;  3IWN C;  5DRK A;  1VBZ A;  4LF6 J;  4KTQ A;  2SXL A;  4OYX A;  1OSC A;  2D9O A;  1S1U A;  3ZTQ A;  1UZH A;  2DNO A;  2RRA A;  2PI5 A;  2XB2 D;  4ERD A;  2VV5 A;  2XGQ A;  1NDP A;  3KLV A;  2RIL A;  3EUN A;  2CQ3 A;  3EWG A;  3M8P B;  1UL3 A;  2WZ1 A;  3A8I A;  1WSV A;  2M2B A;  1VQK S;  4ZPC A;  1WC6 A;  4ECS A;  1WDD A;  2EG2 A;  3GLJ A;  4X66 J;  4ZCM A;  3MR2 A;  1Y4Z B;  1K1S A;  5KAK A;  3NMR A;  1LW0 A;  1RYR A;  1UFW A;  2F9D A;  2R7W A;  2H65 B;  3FSI A;  4C6A A;  5I42 B;  4G1P A;  2F40 A;  2GJF A;  3TUI C;  3KG0 A;  1C1C A;  4ZMM A;  1KLM B;  3DGP B;  2FJE B;  1RAI B;  3ENV A;  3HCX A;  5T14 A;  4F3M A;  1U2C A;  3PW4 A;  4N7T A;  2OGU A;  4U67 Q;  3BKT A;  3UN2 A;  3GU0 A;  1VFJ A;  5LSO A;  4IFY A;  2I5J B;  2IM0 A;  1GH8 A;  2F8E X;  1F60 B;  1AA1 B;  3LUY A;  3DC2 A;  1U2R A;  4ED1 A;  5H9F J;  1Q4R A;  2IPO B;  4LSL B;  2E1C A;  2E5L F;  3E01 B;  1ELO A;  2C42 A;  2R2S A;  1S7I A;  2I2Y A;  4MK9 A;  3TAN A;  2HS4 A;  3PX4 A;  1FKO A;  1X4D A;  2D41 A;  3MM7 A;  4WE1 B;  2X1F A;  1VQ6 S;  4U7C A;  2GA7 A;  3KK2 A;  2XZD B;  1XQI A;  2GQ2 A;  3TUJ C;  2IYI A;  5CCL A;  2NRE A;  4K4U A;  5HVH A;  4LBI A;  4RWX A;  3KHL A;  1RAH B;  2F7V A;  2E7X A;  1NB7 A;  5KT4 A;  5F8M A;  2CG4 A;  2VFT A;  3R5D A;  4EO6 A;  1JJ2 R;  3QLH A;  1T11 A;  1VIO A;  4PZV A;  1YJ9 S;  4IRC A;  3U1N A;  1VQM S;  2P6T A;  3K5O A;  2DRD A;  1N33 F;  1TMM A;  1JJ4 A;  2XNR A;  4DUZ J;  3B6B A;  5J1E A;  2GML A;  4HYK A;  2GZO A;  3MEE A;  4DI6 A;  1IM6 A;  1JWW A;  1IKX A;  4B3T J;  4DV1 F;  3R7S B;  3POT A;  2C3P A;  2MKH A;  2R7U A;  4DOZ A;  3FBC A;  3EGV A;  1P27 B;  3TVZ A;  4CT9 A;  3KNA A;  1PG5 B;  3EMT A;  4DU7 A;  4DFM A;  2QGF B;  3CCZ A;  2QLJ B;  4ZPT R;  2B4O A;  1WC0 A;  1RWO B;  2FGC A;  1Q0N A;  5A0Y B;  5B0B A;  1IM4 A;  4M5H A;  2ZM6 J;  1UET A;  1IQZ A;  2WBM A;  1QSL A;  4P10 A;  2WAQ D;  5E3C A;  4DPU A;  2J9D A;  4IO1 A;  1N5Y B;  1TKX B;  4BC9 A;  2VPY B;  2GIQ A;  1B0P A;  2E9R X;  1QVG R;  2HS0 A;  1SH2 A;  5EUH A;  1IR1 A;  3IM8 A;  2AEJ A;  2F65 A;  2XY6 A;  2ZD1 B;  3FMB A;  2CZV C;  2CQH A;  2XGP A;  3DRS A;  3F0N A;  3QGG A;  1NJX A;  2C2O B;  2YKA A;  4Q0B A;  2HG4 A;  5D0E A;  1C1B A;  3TJA A;  2HHT A;  1VI7 A;  5LSL A;  2XSF A;  2O01 C;  2FZG B;  1WC3 A;  4DL4 A;  5B09 A;  4PYA A;  1Q8I A;  5GAG I;  1FKP A;  1T94 A;  4DV7 J;  5FDL B;  1CUL B;  1HHQ A;  4RW6 A;  2PFD A;  4Y2I A;  2GHW A;  1LWC B;  1MMD A;  2GQQ A;  4CO1 A;  1IBK J;  3R5A A;  1IR0 A;  3DXB A;  5JJB A;  4MKV A;  4WFB Q;  4YY3 F;  4J9S A;  3BBF A;  5L9X A;  3QZ7 A;  3DLG A;  3JAM Y;  4PPD A;  2H48 B;  4DR3 F;  4HHJ A;  3L95 X;  3CD7 A;  3T1Y J;  2DHH A;  4NCG B;  3RAM A;  4B08 A;  3TAQ A;  3BQ1 A;  3CJR A;  1TAQ A;  5CYM B;  1SL1 A;  1FD8 A;  1U8S A;  3BRE A;  2ILZ A;  2NYH A;  2IVM A;  1RAC B;  2OPQ A;  1Q16 B;  4DV3 J;  3PFE A;  4CI0 B;  2UUT A;  2VG5 A;  4O3Q A;  3C15 B;  5AE1 A;  2CNK B;  2ZC3 A;  3W9J A;  1FEE A;  1Y3K A;  5KFU A;  5D3G B;  1HWL A;  3PR4 A;  2W8K A;  5H9E J;  4B3M F;  4PUO B;  3M32 A;  1VLO A;  4OI2 A;  3CDW A;  1RKJ A;  3ISN D;  4DL2 A;  4LF6 F;  2K3I A;  5J2N B;  2DGS A;  4ECT A;  1ZM3 A;  3M30 B;  1FKA F;  5CCM A;  1FA0 A;  3LGH A;  1O0P A;  1Y00 A;  3MM5 A;  3M7V A;  2ADB A;  2IMW P;  2YWK A;  4P75 A;  3CDE A;  5F8J A;  3NNH A;  1BWV A;  4R5P A;  2JEI A;  3UDL A;  4KH1 B;  4RNO A;  3GMG A;  1YLX A;  4NRU A;  2W9A A;  4WU2 A;  2MZQ A;  4FBT A;  1RLD A;  5THW A;  1VQ7 S;  1JQG A;  2NCK L;  3FEY B;  3FDS A;  1LXN A;  3DU6 A;  4WP8 A;  1MSW D;  5D0H A;  1DQ9 A;  4X66 F;  4QU7 A;  3R7B B;  2XO6 A;  4F3Q A;  2DNH A;  4DV4 J;  1D1U A;  4M1K A;  2Y1J A;  3TAM B;  4OX8 A;  1EB0 A;  1NUE A;  2CNN B;  3I55 S;  1N88 A;  1HQ2 A;  2WVD A;  1SKU B;  2RQC A;  1PYT A;  4LMZ A;  1S12 A;  2MGZ B;  5HQL A;  2XTJ P;  4PR6 A;  1HD1 A;  5A8K A;  2DVI A;  3MF5 A;  4P2S A;  1KNZ A;  5L46 A;  3LP2 B;  4NZ6 A;  4UOG A;  4ZK7 M;  1RT6 A;  2M8H A;  1UVK A;  1FCA A;  1RGV A;  2CKW A;  2HFZ A;  5MAO A;  4CLF A;  2XQC A;  3AD8 C;  5DG9 A;  2B7B B;  1SJF A;  3PRD A;  3GYG A;  2MXY A;  2CQ1 A;  5D77 A;  2AQ4 A;  4U95 A;  1JNR B;  2FLL A;  2E5G A;  2QC3 A;  3G8Q A;  1JXL A;  2BUN A;  4W4M A;  4P71 A;  2OP5 A;  3KLG B;  3KJV B;  2F8H A;  2AEF A;  4IDK A;  3H90 A;  1SC3 B;  3LP0 A;  5A6W A;  2FZK B;  3AY0 A;  1PAU B;  3CE8 A;  4UZC A;  3FSX A;  3LGM A;  1NKC A;  4HVZ A;  3TZY A;  4YB7 A;  3DOM A;  1RJJ A;  3OXL A;  2YNF B;  4N8N A;  1J5O B;  4FYV B;  3M9N B;  1CLF A;  5GAH U;  3HPO A;  1QD1 A;  1NZA A;  1SL0 A;  1X4G A;  5DLF A;  1T03 A;  1WF2 A;  3CCJ S;  5CZX A;  4QOT A;  3DDN A;  2W9C A;  3D3C J;  3P5T L;  3UVJ A;  1RAG B;  3LWL A;  2R8K A;  3BBC A;  1K9M T;  2HNY A;  4X84 A;  3OL6 A;  1SQE A;  5KFB A;  1HNV B;  3O8W A;  3ET6 A;  3R5G A;  1O6X A;  1N5V A;  1XNQ J;  2LU1 A;  4ECY A;  2YPZ A;  2IRX A;  2M3D A;  3PEJ A;  3BGO P;  1RBO B;  1UVI A;  1CC8 A;  2JEG A;  1HD0 A;  2MQN A;  1PYO B;  4Y2K A;  3CCV S;  1TL3 A;  1LV5 A;  1VIS A;  4QW8 A;  2HHP A;  4B3T F;  5DJB A;  1HQU A;  1X4B A;  2R7S A;  1HBO A;  1HNW J;  1DBD A;  3FKB A;  4HT5 A;  5JUM A;  1T7P A;  4Y6I A;  4CNY A;  3JQM A;  1WJ9 A;  1U26 A;  2EC0 A;  3M2U A;  3Q8Y A;  4K59 A;  2UUB F;  3G2X A;  3M2R B;  2MLX A;  3PJX A;  3N28 A;  1RAB B;  1UWA A;  1S79 A;  2YKO A;  1U47 A;  5HBM A;  3LP1 B;  3OR2 A;  4RW4 B;  1N0U A;  2ZM6 F;  4ZP6 A;  3MM8 B;  2OJ3 A;  4TN2 A;  2FJV A;  4C8M A;  2J7W A;  3M2V B;  3R2C J;  4ZVE A;  3KKF A;  2ZH6 A;  4KO0 B;  1FRK A;  3C3L A;  1SUQ A;  4RW8 B;  2CG8 A;  1V5V A;  3WX8 A;  5J2P A;  1VJQ A;  5LMN F;  2XS7 A;  2B4U A;  4GVB B;  2GC8 A;  1HMV A;  2LQ9 A;  3KDO A;  2MY7 A;  4DUY J;  1X9W A;  1V9O A;  5AE3 A;  1NJZ A;  2R8J A;  2CNO B;  4O0I A;  4DV7 F;  2XG8 A;  2JJ4 D;  3OXG A;  7FDR A;  4O3S A;  2KFN A;  4TNO A;  1IBK F;  1OYE A;  1FT8 A;  5HLF A;  4M5D A;  2K1R A;  2RQ4 A;  4XIU A;  1U1L A;  2PT0 A;  2WBR A;  3HLU A;  2I8E A;  5A8R A;  3T1Y F;  2YX4 A;  1U0H B;  4X62 J;  4YQW A;  1FDD A;  1KQG B;  3G6Y A;  1CS4 A;  1NPR A;  1WKL A;  1JLG A;  1YHQ S;  1B0T A;  1RHM B;  2HZV A;  3JTP A;  4OI3 A;  3GCW P;  3PW5 A;  4J9L A;  1WKK A;  4DV3 F;  4TQR A;  3I0R A;  1RK8 A;  3GB0 A;  5D0G A;  1FD2 A;  3GON A;  4O0N A;  4ZLJ A;  1HWU A;  3H4D A;  1RCX B;  2ZHB A;  2DR6 A;  1EKR A;  4UY8 5;  5BYQ A;  2IM1 A;  4FZV A;  5D0R A;  3KK1 A;  3GIK A;  3K7R A;  2EK1 A;  5F8N A;  3JTO A;  1EAR A;  2J7K A;  1RB0 A;  2KYZ A;  2BDP A;  2HZA A;  3AT1 B;  1WEZ A;  3TX8 A;  1RA7 A;  2HMI A;  2DEJ A;  2W9B A;  5C5J A;  2JH3 A;  2J6U A;  1TP7 A;  3CCL S;  1S72 S;  1HYS B;  3DM2 B;  3I96 A;  2ZVI A;  4X4U A;  2FGO A;  2J0W A;  3UCU P;  1WF0 A;  1FWL A;  4H54 A;  4UT4 A;  2DH8 A;  4MKA A;  2H4Y B;  3QT6 A;  3LTO A;  3CJK B;  4TYB A;  1DJ0 A;  3AOA A;  4O4G B;  3PIP Q;  3W2W B;  1HIY A;  2CQ0 A;  5G0R B;  3RBE A;  2ZBQ A;  3CJT A;  2UVU A;  4IG3 B;  2LU2 A;  3DOK A;  3HFK A;  1VRT A;  2F8M A;  2Z2Y B;  4DV4 F;  5JMN A;  4IOC Q;  1KBR A;  2W24 A;  5K20 B;  1HBN A;  2AJ2 A;  4NI2 B;  4QR0 A;  3VHQ A;  1F2H A;  1XK8 A;  1PKU A;  4OYB A;  1VQ4 S;  4YHH F;  4IKA A;  3UFC X;  4OJ3 A;  1VOM A;  2K2P A;  1YJV A;  4W90 B;  4DV5 J;  4EUV A;  1AUS L;  3P96 A;  3Q2T C;  3ETM A;  3QIP B;  3V4I B;  2J6T A;  3H5Y A;  3CGI A;  5GMK a;  1CJV A;  2FZC B;  5CYQ A;  1VS3 A;  4NCA A;  2YNG A;  1JLF A;  3D3B J;  3MCS A;  3KLF B;  5LL6 d;  4DG1 A;  2AEM A;  3OR1 B;  3CD6 S;  4RNM A;  4OZ5 A;  4CNZ A;  4KR0 B;  2H5J B;  4J7C A;  1S57 A;  2OSQ A;  1DAR A;  4JI2 F;  2MKY A;  4QWD A;  5HI7 A;  4M5I A;  2CPH A;  4DQP A;  4WJB A;  3EE3 A;  3KOA A;  2LP4 A;  4WYL A;  4A46 A;  3LW5 C;  3MD1 A;  3K5L A;  2HS3 A;  1O5J A;  3VAK A;  3HKW A;  3N6L A;  2RQK A;  3M8P A;  4H4K A;  1R8H A;  2M88 A;  4FVM A;  3PKY A;  2P8I A;  2VDI A;  1DAX A;  3CD0 A;  1S6U A;  4ANC A;  1EIY B;  4UZB A;  4CT8 A;  5CHC B;  3K0J A;  1KOH A;  1LK7 A;  2ZOM A;  2P6S A;  3GYX B;  2EBG A;  5I3U B;  4M5J A;  1XNQ F;  4K0K F;  1U7L A;  3PY8 A;  3EPG A;  5I42 A;  4DR6 J;  1VQ9 S;  1PGZ A;  4QPX A;  1B3T A;  4C2M A;  2OPR B;  6AT1 B;  2MQO A;  1CJK B;  4OI6 A;  1L3K A;  3PHT A;  4P7V A;  4LF4 J;  1KLM A;  3DLB A;  2ZWP A;  3DGP A;  2DXF A;  1REG X;  1HNW F;  3MR5 A;  3FCH A;  3ZZY A;  3K57 A;  5KG4 A;  5F41 A;  3FC9 A;  1FX2 A;  2H54 B;  9RUB A;  2I5J A;  2UU9 J;  1FXD A;  2V5H G;  1S6Q B;  2XC9 A;  1FXR A;  4C97 A;  2H3E B;  4ED4 A;  4JI4 F;  2N4D A;  4LF7 J;  3OLA A;  1TUV A;  4LSL A;  3E01 A;  7AT1 B;  1X4F A;  1MLA A;  5SUH A;  2QN6 B;  1P8G A;  5L38 A;  1QTM A;  2D1C A;  3M6W A;  4CM2 A;  4ECQ A;  8RUC A;  4CTA B;  3N5B A;  1VK3 A;  1WNE A;  4A8W A;  2JLF A;  1S1V B;  3I9V 9;  4C9D A;  1HW9 A;  2XSJ B;  5U47 A;  4RUC A;  3IO1 A;  3A12 A;  4DFP A;  2L9D A;  4CO0 A;  2HHQ A;  2EFP A;  3P8B B;  4DUY F;  1JXE A;  2O5D A;  4XDC A;  2W7O A;  1NHK L;  3LO3 A;  3S01 A;  1FER A;  2RML A;  4JYA J;  2YWF A;  3C2P A;  2V50 A;  4NLW A;  4J9Q A;  2MQP A;  4L72 B;  2FTR A;  3EX7 B;  1L3S A;  1RA6 A;  5CXT A;  4CH1 A;  5IT9 Y;  4M5N A;  3OTC A;  1WC5 A;  2C2Z B;  4LRF A;  3ILI A;  3JQJ A;  4X62 F;  2O66 A;  2AJF E;  5H9F K;  3Q22 A;  2QFI A;  3UCZ P;  4MJK A;  3S7R A;  3SCJ E;  3TUP A;  3PO4 A;  3OTD A;  1TUG B;  4P74 A;  1DY3 A;  4DS4 A;  4YDX A;  2RRB A;  4E98 A;  3CSK A;  4EZ9 A;  2KZZ A;  3PKM A;  1H2V Z;  1R8B A;  3QWP A;  3CF5 Q;  5A0Y A;  4RW9 B;  5ETL A;  1VC5 A;  2CJB A;  5GAH I;  2HVZ A;  2DTJ A;  1N5Y A;  1RAO A;  1TKX A;  1IBL J;  3IWX A;  3C66 A;  3W64 A;  4DSK A;  3GWC A;  1D09 B;  2YX1 A;  2D9P A;  4KBI A;  2ZD1 A;  1Y0H A;  4DCO B;  2AKW B;  2N82 B;  2X1G A;  5ETS A;  4U7U D;  2BE2 B;  1K47 A;  2M4M A;  1VMB A;  4LBP A;  1XMO F;  3M8R A;  1D9A A;  4KIA A;  1H0H B;  1VQY A;  3DLH A;  2KYX A;  3WX4 A;  4M5K A;  2MB0 B;  1TEL A;  5JVH Q;  4B9S A;  4F4W A;  2R8H A;  3I9Z A;  3S8S A;  2J6S A;  4ZCI A;  5FDL A;  1NJY A;  3HJF A;  1CUL A;  1YBT A;  3G6X A;  3ICL A;  3T9Z A;  4RPF A;  4WFZ A;  5DS7 A;  1LWC A;  1F3V A;  1N36 J;  2R8I A;  3CCR S;  3T5H A;  2A2D A;  4RU2 A;  5F3T A;  4IH7 A;  3W5Y A;  1ZTW A;  3BO3 A;  3D1H A;  3BR8 A;  2HLT A;  2DGV A;  5HVF A;  4NCG A;  2UV8 G;  3FEZ A;  2D74 B;  5IQQ A;  3NGS A;  3ETO A;  5CYM A;  3UNG C;  5T41 A;  1YTY A;  2DIV A;  3VWS A;  4OIX A;  2CVE A;  4Z7C A;  2Q79 A;  2E5J A;  1KP6 A;  3QQC D;  3NNA A;  3C15 A;  4B9U A;  1A9N B;  1S77 D;  4Y00 A;  3P4U B;  2HBR B;  1WDT A;  2G2Y A;  5D3G A;  5D8H B;  2D69 A;  4RUA A;  2OD6 A;  4PUO A;  2DNM A;  1CQN A;  4CLT A;  4CIO A;  3M9O B;  4OI0 A;  1M90 T;  3RU0 A;  4C8Y A;  5J2N A;  2RRN A;  4TU9 A;  3M30 A;  4N47 A;  2IHR 1;  2YNH B;  4OYP A;  2HFN A;  1U6B A;  2J8S A;  2V9K A;  5E3Q A;  2JFD A;  5K8M A;  3H7H B;  5D4L A;  1HBM B;  4OZ3 A;  4V1A k;  2N4C A;  3EIC A;  1VDH A;  3DFE A;  1F9E B;  4LT6 A;  1ZAW A;  2W01 A;  3C8Y A;  4CLW A;  1BQX A;  1CJT B;  1QY7 A;  1V5I B;  1WI8 A;  4I56 A;  3BR9 A;  8AT1 B;  2H5E A;  2FY1 A;  2ZEJ A;  1OSD A;  4UY8 T;  3W8P A;  2UXB F;  3BQ0 A;  3TAM A;  4G65 A;  2C2M B;  1BQN B;  2DH9 A;  1C0U B;  4DR6 F;  3IR6 B;  2BQU A;  1T05 B;  1HNX J;  2IAJ B;  3BSN A;  3D6H B;  3TA0 A;  2MGZ A;  2GS8 A;  1JIH A;  2VPW B;  3EPI A;  5H9E K;  2HIY A;  4B3O B;  4WII A;  3LP2 A;  4UOC A;  1TL7 B;  4DLG A;  3D1O A;  3TUZ C;  2MJU A;  4OFZ A;  4Y2M A;  4MT1 A;  5LM7 E;  2UU9 F;  4NLS A;  1M0S A;  2HSE B;  3NG8 A;  2XCP A;  4MYT A;  4LF7 F;  4HEA 9;  3ENA A;  5AXM A;  1MW7 A;  5A76 A;  3OSN A;  2BZ2 A;  4A47 A;  4C8K A;  2DGT A;  4NLP A;  3HVW A;  1S1T B;  1X5O A;  2IA0 A;  2CQP A;  1VCT A;  3UE2 A;  3KLG A;  3KJV A;  3NOG A;  4K4V A;  4JV0 A;  2DIU A;  3PDN A;  1FDN A;  1S0O A;  4JV2 A;  4K4X A;  2YNF A;  1J5O A;  1UCN A;  4ILL A;  3DYA B;  4UTG A;  3ENQ A;  3SQG B;  4DSJ A;  1FJC A;  2G13 A;  4B9L A;  1S7H A;  2ASY A;  1MU2 B;  3AJD A;  1R0A B;  4JYA F;  2DY1 A;  3J81 U;  1RWP B;  5KFV A;  2LEP A;  3SV4 A;  2QLB B;  3TOQ A;  4ILM A;  3OQ2 A;  1HNV A;  3UI3 A;  1RDR A;  4CLP A;  3SI8 A;  3SQO P;  3NL0 A;  3EZO A;  4KHP J;  4TU7 A;  2I0X A;  3CJ2 A;  4WK1 A;  2KO1 A;  4L75 A;  5L9N A;  4YUD A;  1OIA A;  3H98 A;  2C22 A;  2VG7 B;  2C3O A;  3CJS A;  2E9T A;  4KE5 A;  3Q83 A;  4OI1 A;  2AWZ A;  2KT3 A;  4X64 J;  3AD7 C;  1Q7Y T;  4HHH A;  1RWK B;  3M2R A;  4TXS A;  2UXC J;  3VTI A;  3BO4 A;  3J7A N;  3NS5 A;  2I9S A;  2FJB B;  3LP1 A;  2N7Y A;  4RW4 A;  1R6V A;  3PW7 A;  1ZZN A;  2JNJ A;  2LEB A;  3MM8 A;  1T9V A;  1BMQ B;  1PC5 A;  4J9O A;  1S1W B;  4NML A;  3IRW P;  1ZPW X;  3A3P B;  1IBL F;  3SEO A;  4ZP7 A;  1N6Q B;  3NMA A;  3M2V A;  4KO0 A;  1W2B R;  2GX8 A;  1NO8 A;  2Y9H A;  4RW8 A;  1VQS A;  4M5M A;  3MM9 B;  1R0C B;  1FNO A;  3DKD A;  1XR6 A;  2NXE A;  1NSK L;  2LDY A;  4GVB A;  2K7J A;  3U1L A;  1HA1 A;  2KT5 A;  2FLP A;  4DEZ A;  3P5B P;  1BWE A;  3V6D B;  2PI4 A;  2Y3Y A;  3MEC B;  2JEJ A;  2RE1 A;  1RWW B;  1GXL A;  2WB1 D;  5HAT A;  1X9M A;  1NND A;  1N36 F;  5HO4 A;  3HSZ A;  1ZAV A;  4AND A;  2HHV A;  3C46 A;  3J80 Y;  1KTV A;  1UJ6 A;  1FDB A;  4KPY A;  2BOA A;  1U0H A;  4CM0 A;  4N41 A;  2QL9 B;  1GMW D;  1O51 A;  1R31 A;  3FQL A;  1RKI A;  4YS2 A;  1JX4 A;  3MWB A;  3QMQ A;  2AU0 A;  2IVY A;  3R9L A;  3OW2 R;  3IGN A;  4KV8 B;  4K50 A;  3THV A;  3GFH A;  3NBP B;  5KFG A;  2MKK A;  1YJ7 A;  4FF3 A;  3CCM S;  1TR0 A;  1MN9 A;  4WFA Q;  3HO1 A;  4LSZ B;  1GTE A;  3HMJ G;  3MXH P;  1HPZ B;  4LF2 A;  1UPP A;  3D2W A;  1FRI A;  2XWX A;  4KB7 A;  4OHV A;  4QWA A;  4EYI B;  1ZM9 A;  4DF8 A;  2BKP A;  3VCD A;  2C2R A;  3AOC A;  2J9D E;  4DZ6 A;  4I2P B;  4LUB A;  3FQK A;  3TJ8 A;  2QYC A;  4IOA Q;  2YKP A;  3W9I A;  4R8U B;  3AXM A;  2A18 A;  2CPZ A;  4J37 A;  1M5K C;  2A0F B;  4RBU A;  4JV5 J;  1PIE A;  1TUW A;  2XI3 A;  4FYY B;  4WP3 A;  1TVR B;  2V68 A;  1HYS A;  3DM2 A;  4ID5 B;  2E5I A;  5B0G A;  2WON B;  2ZHA A;  3CMA S;  3TVY A;  2GHV C;  1U1R A;  1RBA A;  1T0T V;  2J9E A;  4X4S A;  3CJK A;  1R8A A;  3H25 A;  4HL9 A;  4O4G A;  3W2W A;  3NCP A;  5IOL A;  5G0R A;  4Z7Y A;  2X1A A;  2R7Q A;  2R2U A;  4QWE A;  2NPF A;  3W1Y C;  1RT5 B;  1R3N A;  4IG3 A;  2V63 A;  2GFF A;  4R0E A;  3G6V A;  1UKU A;  1SI9 A;  3D6T B;  1RI7 A;  1AXQ A;  3M6V A;  2F3J A;  4NI2 A;  4PG7 A;  4ILR A;  4V19 X;  1DRZ A;  3I82 A;  1HNX F;  3QJP A;  3V81 B;  1RTJ B;  3TAR A;  3KUG A;  1S9G B;  3GR1 A;  3CCU S;  4R0J A;  3R6L B;  1MN7 A;  3I5A A;  4OZJ A;  2NLW A;  1YZ6 A;  1RT1 B;  3TR5 A;  5DDO C;  4AL6 A;  2HBZ B;  4C7Q A;  2B9X A;  3HI9 A;  4OYI A;  4J90 A;  2Z2M A;  2YBV A;  4ZPB A;  5HP1 B;  2QIF A;  3CXC R;  3QIP A;  3NP5 A;  3V4I A;  1NH7 A;  2QTW A;  3FEX B;  1K0V A;  1RHU B;  3NLC A;  5E0O A;  4ZVT B;  1RT3 B;  3Q86 A;  4JOU A;  4GVL A;  5I3Q A;  2IMO A;  2NQP A;  3KLF A;  5C7P A;  1NK8 A;  3OR1 A;  4ES1 A;  4C3K A;  2DBB A;  3PX6 A;  3BKU A;  2QO3 A;  1IKV B;  2QMX A;  5EX0 A;  1VBX A;  2P9E A;  4NLX A;  5HMW A;  4KGM A;  1RAF B;  1ZA2 B;  4PPZ A;  3FRY A;  1D9F A;  3IG1 B;  4DBQ A;  5L8R C;  5C42 B;  5KFA A;  2J7U A;  2CUY A;  1FF2 A;  2Y0B B;  3QT7 A;  1B70 B;  1R8C A;  3IRX B;  2WRM A;  4DN9 A;  4QJV A;  3LQV A;  2PA8 D;  5J1P A;  5DQH A;  3SV3 A;  2XS5 A;  3ZTP A;  4B9M A;  1NRK A;  1XTZ A;  2JVR A;  2ZDP A;  1FO1 A;  5I3U A;  2R8G A;  3O44 A;  2I1R A;  5K5M A;  4DV2 J;  1BD6 A;  2OUG A;  4NA2 A;  2OPR A;  1CJK A;  1FJG J;  4C8L A;  5F0U A;  2WVE A;  2CZ9 A;  1F6T A;  4OHX A;  4PEO A;  4J91 A;  4B3S J;  1K0T A;  4X64 F;  3BGU A;  4N76 A;  2CJQ A;  3RZA A;  2XBP A;  3GIM A;  4L3N A;  2AZ3 A;  4GO7 X;  2E44 A;  2FVC A;  3MR3 A;  2UXC F;  5LSR A;  3AH6 A;  2RT3 A;  2Y0S D;  2D3O 1;  4CO5 A;  5KG5 A;  1GMW A;  1S6Q A;  3EM1 A;  2OH2 A;  4LFA J;  5F8H A;  3H40 A;  3HX9 A;  3CCE S;  5K8O A;  1LEO A;  5F9L A;  1CC7 A;  2Z8Q A;  4C3M A;  4NXN J;  2KFY A;  2CQC A;  4ZJQ A;  4RW7 B;  4FYX B;  3V2U C;  3BQ2 A;  4DJB A;  5K14 B;  1DQ8 A;  1WKJ A;  4YFU A;  1DTQ B;  4CTA A;  2QMU B;  1KLN A;  2BQ3 A;  1S1V A;  4PQU B;  1RT4 B;  1HBU B;  2M7S A;  2QFJ A;  4DCJ B;  4WBF A;  1NSA A;  2OTJ S;  1M5P C;  1QLN A;  3I87 A;  5D78 A;  2XSJ A;  3MED B;  1H98 A;  5KT5 A;  3JQK A;  2GVZ B;  3R5B A;  1XR5 A;  3UQS A;  4P7T A;  4F50 A;  1UVN A;  1HQE B;  1FFW B;  4FPR A;  3BZQ A;  2R42 A;  6FD1 A;  1D0E A;  3C6T B;  4NOH A;  3GII A;  1S49 A;  1UPM B;  1KVI A;  3BYR A;  4ES2 A;  1GMV A;  2HVI A;  4B02 A;  5IV3 A;  5KFN A;  3GTY X;  3HD1 A;  4JI5 F;  3P3D A;  3DLK B;  4UOF A;  2VBZ A;  2IDE A;  3G87 A;  3DGV A;  5HVG A;  1X4C A;  3D54 A;  2GAG C;  3KUE A;  3H5S A;  2QV6 A;  3CMQ A;  2BJD A;  5LT5 A;  3RW6 A;  2LFV A;  3PNI A;  1G1X A;  1J5E F;  2JWN A;  3QT8 A;  4LF8 J;  1L5U A;  3AB4 B;  4DF4 A;  4B9T A;  3N9U C;  2DT9 A;  4CO4 A;  5GAG U;  4YME A;  2V8P A;  5FJ4 A;  2V8V A;  3NNC A;  4F36 A;  4FXD A;  3F41 A;  3I32 A;  1UJ5 A;  2HWH A;  1JLE B;  3G4S S;  4K5S A;  3OTE A;  3T5K A;  2UUW A;  4RW9 A;  1JLC B;  2DO0 A;  2L48 A;  3US5 A;  3BN7 A;  1DTT B;  1UEK A;  2NS1 B;  1KTQ A;  5DDR C;  1VC0 A;  1EHW A;  2JX2 A;  4EI2 A;  3AQP A;  2ZKT A;  2PEB A;  1T02 A;  2AV5 A;  2AYG A;  3KLI B;  5L1J A;  4WKR A;  5D4P A;  1Q78 A;  1N34 J;  1N32 J;  4JV5 F;  4ECZ A;  2OEM A;  3KDN A;  2QA2 A;  1S6P B;  2BV3 A;  4RX6 A;  1NHU A;  2BE2 A;  3MFI A;  1REV B;  2HK2 A;  3MEG B;  3QGH A;  2HHS A;  3J81 Y;  3K89 A;  2QA4 S;  4KPC A;  2DKO B;  4ENO A;  2AGQ A;  1FEH A;  2P9C A;  4OLP A;  1U25 A;  3MCM A;  5KOW A;  3F56 A;  1C0T B;  1CEZ A;  2CPD A;  4U9R A;  3HHK A;  4K5R A;  2HKE A;  4WKY A;  1SJ4 P;  1VRU B;  4ED0 A;  2DH7 A;  4ZLL A;  3F44 A;  2WB4 A;  4F0H A;  4J9R A;  1M5V C;  5C25 B;  1VQN S;  2ZWO A;  4ECU A;  2MKI A;  3RB4 A;  1LFP A;  2HHU A;  2JVO A;  2EG1 A;  2G4B A;  1WHY A;  4PRF A;  2EPI A;  2BM0 A;  4W98 A;  1YJR A;  4EEY A;  3T1A A;  4DV1 J;  1CS4 B;  4KGK A;  1S4F A;  2YX7 A;  3MMC B;  4IFV B;  1S99 A;  1JLQ B;  3TX0 A;  1NDK A;  4NYP A;  1XBW A;  2CJK A;  4BWJ A;  4C98 A;  2ZNZ A;  2XMA A;  2HFO A;  1IWA A;  4RBV A;  3CTR A;  4M5G A;  1RWM B;  1JB0 C;  2WCX A;  3OL7 A;  1FTR A;  1M5H A;  1SKW A;  1Q1K A;  3I4H X;  3BPD A;  1HI0 P;  2F5G A;  3O6Q A;  1A6L A;  1PO6 A;  3WBZ A;  2RJZ A;  5D6G A;  1R7I A;  5KFE A;  2KM8 C;  3Q8R B;  3PW2 A;  4P52 A;  2VKR A;  4DV6 J;  2YQ3 A;  1N5Q A;  1CBK A;  3GFY A;  3NEK A;  2XI2 A;  2DR7 A;  1FX4 A;  3N79 A;  2ZVS A;  3CED A;  3GR0 A;  2ZBI A;  2B5J B;  2YNH A;  3GPA A;  5CH7 B;  2MLY A;  4WF9 Q;  4WTO B;  2EC2 A;  2HQI A;  1R89 A;  3AAW B;  3QFW A;  2BBE A;  1X5P A;  4GKK J;  1HBM A;  2RKI B;  5L1I A;  2B6A B;  4MK8 A;  3UPF A;  4I68 A;  3HK2 A;  1YQH A;  2VIC A;  4C8O A;  4O3N A;  3K5N A;  1QM9 A;  1CJT A;  3CJ8 A;  2ZH9 A;  1ZPV A;  2JOQ A;  2K7K A;  5A6P A;  1RT2 B;  4OX7 A;  1BQN A;  3RUB L;  4X4V A;  2CQG A;  1C0U A;  1N56 A;  1WSR A;  4DV2 F;  3FGV A;  4KC5 A;  1WWH A;  4A8F A;  4DPT A;  1T05 A;  3Q8Q B;  4AL7 A;  1E6Y B;  2E1P A;  2IAJ A;  1J27 A;  4YDD B;  3V6K A;  4KKO B;  2JC0 A;  2Y8W A;  1XR7 A;  5KFY A;  4B3S F;  4Y0F A;  2GHP A;  4RUB A;  2DHA A;  5KFW A;  2B4P A;  3HKZ D;  4NYO A;  4ECV A;  4B3O A;  1W25 A;  1TL7 A;  2YXL A;  1AYE A;  4JI3 J;  2N3O A;  4I69 A;  1SH3 A;  2B8Q A;  1YJU A;  5IQ6 A;  4LFA F;  1OY6 A;  2MMY A;  2G0J A;  4TU8 A;  2BJ7 A;  1JKH B;  1Y5L B;  1WOS A;  3IA0 A;  1T3O A;  2ATC B;  1S0M A;  1ZTT A;  1F5A A;  3ZNU A;  4KHR A;  4ZVR B;  1TL5 A;  1WAC A;  3ZZ0 A;  1S1T A;  1WC4 A;  2ZC4 A;  2PII A;  2AHO B;  3HFV A;  2MQM A;  1UFK A;  2B9E A;  1QSY A;  4LSN B;  5HJX A;  3UN5 A;  2Q66 A;  1Y9O A;  5EN1 A;  4O4R A;  1GFW B;  3PRV A;  3BF4 A;  2HFU A;  4L76 A;  2WW8 A;  3DYA A;  1H7W A;  1WC1 A;  3SQG A;  2EWH A;  4YOE A;  2W2P P;  2G1H A;  3MD3 A;  4NLD A;  2IVF B;  1U49 A;  2FHJ D;  4D3H A;  5HQM A;  4B9V A;  4DFJ A;  1MU2 A;  3RJM B;  3KHG A;  2OIH A;  4M63 A;  2BA9 A;  5DZ6 A;  1SIZ A;  1XNR F;  1R0A A;  4TQS A;  3O5T B;  3FK4 A;  4I7F B;  4URQ U;  4R25 A;  4O3O A;  2BMB A;  1NPP A;  2CJX B;  4NL5 A;  4FNI A;  3K58 A;  1AW0 A;  2KL8 A;  3JSB A;  4QR1 A;  1F9H A;  4F4Y A;  3SMZ A;  2GGP B;  3CWJ A;  3GG1 A;  1OWX A;  1UZD A;  4LF5 F;  2HVE A;  4Q8E A;  4OZ0 A;  1YBA A;  3DLE B;  2QX0 A;  4K2X A;  1KKH A;  4PXD A;  3RR7 A;  3SZ2 A;  1WHX A;  4LQ9 A;  3KNG A;  1B7Y B;  2F1F A;  2VG7 A;  4W92 B;  2QLX A;  2PA3 A;  1U45 A;  4DX6 A;  3SIP B;  4C8N A;  4EWT A;  4LF8 F;  1KWM A;  5EDW A;  2CNL B;  4ZCL A;  1UJ4 A;  2M8D B;  2GMJ A;  4ES3 A;  2EKY A;  2CPX A;  1M1H A;  2MEW A;  2PSZ A;  4YB1 P;  2H5I B;  3HHL B;  3CDU A;  3CIZ A;  5E41 A;  3MM6 B;  2HHH F;  2B56 A;  1S1W A;  1KR4 A;  4YB6 A;  3VAF A;  3PYG A;  3TA2 A;  1N6Q A;  2OML A;  3W61 A;  3VAL A;  2BAN B;  1S48 A;  2HFS A;  4RR5 A;  1U1K A;  1N34 F;  3W2V B;  1N32 F;  1IJE B;  3MM9 A;  2W4D A;  2ASL A;  2VOD A;  3R97 A;  4KRW A;  1R6Y A;  2VFS A;  2BJE A;  1TK0 A;  2UVV A;  3UD5 A;  2E1A A;  4DQQ A;  3CO9 A;  2DGW A;  2OMO A;  5E5N A;  1U48 A;  1PJ5 A;  3V6D A;  3QAT A;  4FS1 A;  3N6M A;  3CUN A;  4N77 A;  1SC1 B;  3MEC A;  3SCK E;  1U1O A;  4BDP A;  1M5O C;  2OKQ A;  3UNY A;  2D3O R;  1C4C A;  4ZS6 A;  3MZI A;  4ZLP A;  1KHV A;  1GEH A;  4F4K A;  3CB4 A;  3GSD A;  3KFW X;  4NXM J;  3EGW B;  2HK3 A;  4A8X A;  2OEJ A;  2V69 A;  1RHK B;  1RWX B;  2RHS B;  3PTW A;  4QYZ J;  3DOL B;  3ADA C;  3DMJ B;  2R7O A;  1T9U A;  4Q43 A;  4NLY A;  2XMV A;  1Y5I B;  1N5S A;  2ABY A;  3JS9 A;  4NLT A;  4AYB D;  4JP8 A;  4UQG A;  2MY8 A;  3JB9 k;  4C4W A;  5KFL A;  4ED2 A;  4MH8 A;  4KV8 A;  4ANE A;  4FDF A;  2Q3P A;  4JI0 J;  3NBP A;  1SVD A;  2C2K B;  3W5Z A;  3HVT B;  4PWW A;  4O44 B;  3Q2S C;  2UUB J;  1HPZ A;  2F4F A;  2DRA A;  2WK4 A;  2FC9 A;  1Y7P A;  4NZ0 A;  5DG7 A;  1U24 A;  3LOU A;  1AFI A;  4I2P A;  1RIS A;  1YWX A;  4DV6 F;  3BSC A;  4USM A;  2CWX A;  2XMT A;  2MZR A;  4R8U A;  5CD4 H;  2XMM A;  2DJW A;  4I6Y A;  4U8Y A;  1BUX A;  3CPW R;  2RUS A;  1YBU A;  3UN3 A;  2JZ5 A;  1U6Z A;  1TVR A;  2ZE2 B;  2YTC A;  3ZZU A;  4ID5 A;  5JXS A;  5LMN J;  2WON A;  3K5P A;  1NK4 A;  2BKN A;  4GKK F;  3QFH A;  1N5T A;  2L9W A;  1VR6 A;  3NY0 A;  4QR2 A;  3MPW A;  3QSY B;  2FLO A;  5F8G A;  5AJ3 J;  2VD3 A;  5K9F A;  1RT2 A;  1IKW B;  1RT5 A;  1ZYQ A;  2CVI A;  4WWS A;  4WK3 A;  2FHJ A;  4C0H A;  2CAJ A;  1I51 B;  3HUL A;  3TEH B;  1T9T A;  2ZBR A;  2DXE A;  4J9V A;  3DHX A;  3DNC A;  3TRG A;  1HWI A;  2MSS A;  4Z37 A;  4NZ7 A;  2U2F A;  3V81 A;  1RTJ A;  1S9G A;  3H20 A;  2B3T B;  1RT1 A;  2V34 A;  4JI1 J;  1S5Z A;  5LOQ A;  1SQF A;  1U1P A;  2XZT B;  4DSF A;  1V3S A;  2V4Q A;  2FJA B;  1CG2 A;  1RUS A;  4BCA A;  2MPU A;  3A1Y G;  1VIX A;  5HP1 A;  3DDK A;  4JI3 F;  3I56 S;  4NAS A;  3PIO Q;  1B0V A;  1NXI A;  3OXF A;  3FMW A;  3V5R A;  3ZTS A;  4OYA A;  2GNK A;  3RRG A;  1U6F A;  2EEY A;  3EXY A;  1F0X A;  4NLQ A;  3CC7 S;  4ZA1 A;  2KZM A;  1TMJ A;  2ASD A;  1RT3 A;  4USI A;  3BJY A;  4RUH A;  3CVK A;  3HM9 A;  4F67 A;  4OYO A;  3GV7 B;  1IKV A;  4KJI A;  1PBA A;  4ICL B;  1R27 B;  1EZZ B;  1QTN B;  2QSF A;  3CJ5 A;  3BKF A;  5D4N A;  3H8Y A;  1Q79 A;  4HTI A;  3T41 A;  1FK9 B;  1S0N A;  9ATC B;  5L1K A;  3M05 A;  1SB6 A;  2VFU A;  3IG1 A;  2YKN B;  4YB5 A;  3OFF A;  4P6Q A;  1F5B A;  5C42 A;  3CJ3 A;  4EBC A;  3HDS A;  1N4L A;  3IRX A;  4A4J A;  5IFM A;  2DGU A;  2LA4 A;  5KFM A;  2G1D A;  3DRP B;  5IM0 B;  5DQG A;  3N01 A;  4WP9 A;  2J0X A;  3ISZ A;  2DNQ A;  4IR9 A;  4YR2 A;  4P73 A;  2DHG A;  4J5O A;  5EX3 A;  3Q0A A;  1LWE B;  3H42 A;  2VC0 A;  2HND B;  3CCW A;  4F02 A;  4HR2 A;  1YDL A;  5KOX A;  4RNN A;  1NZ8 A;  4NPO A;  4J9P A;  3TO8 A;  4DS5 A;  5F8L A;  5BYS A;  1RXO B;  3GZ7 A;  2DNK A;  2V2K A;  2GO8 A;  2CPE A;  2HGL A;  4YHH J;  1JK9 B;  2PD1 A;  2Z57 B;  5MLC V;  5BXI A;  2LQJ A;  3EXC X;  5ETM A;  2QL5 B;  4LIW A;  1XMQ F;  1NJI T;  1FE4 A;  2CXE A;  4ITS A;  2DK2 A;  4OV6 A;  4NA1 A;  2B4V A;  4X4N A;  2LLZ A;  4N5S A;  1EKS A;  1H3D A;  1RHR B;  3T1H J;  1SH0 A;  3D0H E;  2H1Y A;  3PX0 A;  5BJR A;  2DGO A;  4RW7 A;  4CLK A;  1Z2L A;  5K14 A;  2HQF A;  2D3Z A;  2ZNY A;  2KRB A;  4ATN A;  2UUA F;  1DTQ A;  2KH9 A;  3MTK A;  3D6M B;  4PQU A;  1RT4 A;  2AJQ A;  1HBU A;  1WTB A;  2LXU A;  4IYQ A;  4ZPV R;  3KMQ A;  5KFZ A;  1SL2 A;  2ZH3 A;  4X4O A;  3MED A;  2ZH4 A;  1T95 A;  4JI2 J;  4IH6 A;  2GVZ A;  3PYE A;  1NM2 A;  2FVQ A;  2VOO A;  2KM8 B;  1HQE A;  1GMU A;  2PN6 A;  3C6T A;  4K8R A;  2MKJ A;  3BBB A;  3MHY A;  4AE5 A;  5KT7 A;  1RAD B;  3D9B A;  4NXM F;  1FTC A;  3N5F A;  3DLJ A;  4K4S A;  1VQ5 S;  2FQQ B;  3FNN A;  1YKW A;  1ZA1 B;  3ITH A;  2LEC A;  2ZOF A;  1OS5 A;  1R8P A;  3DLK A;  4EZ6 A;  2ROG A;  4K0K J;  2XM3 A;  3TNV A;  2BYC A;  1UW4 A;  2HLU A;  3MMA B;  2PFF B;  1FNX H;  3BEG B;  1OQ6 A;  2CJA A;  3VF0 B;  2BEF A;  2PE8 A;  4OYM A;  2VBW A;  3M4X A;  2V2V A;  2P5V A;  2KHD A;  4JI0 F;  2Z0G A;  3L09 A;  1JLE A;  3PR5 B;  2ZDO A;  1C4A A;  5ADZ A;  1KDN A;  5F0W A;  1BGX T;  3JAM U;  2DPJ A;  2YVS A;  3PXG a;  1JLC A;  4N8O A;  1N8R T;  2UUC J;  1DTT A;  1OYD A;  2QT7 A;  4F04 B;  2ROE A;  2JEF A;  1JLA B;  5J2M B;  4GC6 A;  4Y2C A;  2ZBC A;  3SXL A;  4JI4 J;  1RU1 A;  1FJ7 A;  3PRB A;  4HH0 A;  3KLI A;  2LQB A;  2YNI B;  4J9U E;  2W4P A;  5KT6 A;  1QVF R;  3U7J A;  1S6P A;  1NK0 A;  4ZIV A;  1ZM2 A;  4DDF A;  3MAA B;  2BE7 D;  1TKD A;  3KK3 B;  4EBE A;  1REV A;  2OEK A;  2KKH A;  3DRR B;  3MEG A;  1TFY A;  1VQO S;  2CIM A;  4ZVF A;  2AMC B;  4JB8 B;  4LBH A;  4IRD A;  5ETQ A;  1N54 B;  3IBW A;  3BV8 A;  3Q8V A;  1FXL A;  5EGY A;  4L73 A;  4X4T A;  4DV0 F;  3AJ1 A;  3CW2 C;  1AFJ A;  3KHH A;  4DR4 J;  1C0T A;  4RKU C;  2JDJ A;  3NKY A;  5AJ3 F;  2IBK A;  3PHE A;  4PWU A;  1AT1 B;  2KG0 A;  3U27 A;  1C2P A;  4DZD A;  1VRU A;  1K73 T;  1FRX A;  2FY8 A;  1S10 A;  4HDG A;  5K8P A;  5C25 A;  3MPY A;  4YP3 A;  4A8M P;  1X4H A;  4RNH A;  3GIR A;  2QLW A;  5IT4 A;  4PYD A;  1RSC A;  3TQ1 A;  3HHL D;  1RLC L;  1VQ8 S;  1KSP A;  4LFB J;  4DXL A;  4NCB A;  1ZZF A;  2W2N P;  1RZM A;  1YSJ A;  4JI1 F;  3M6X A;  4QWB A;  2HAF A;  2IJF A;  3Q8S B;  3MMC A;  3PJ9 A;  4IFV A;  1JLQ A;  2CFX A;  4MFB B;  1NLK L;  4ZVG A;  2PDA A;  2DXD A;  2M52 A;  1U02 A;  2N7C A;  1S97 A;  2KXN B;  1F1B B;  2VH7 A;  1LQ9 A;  4X4P A;  2G9O A;  1N52 B;  2WVB A;  1VJW A;  2OD4 A;  3T6J A;  2UP1 A;  1NCL A;  3WIV A;  3MPD A;  5AT1 B;  2BQR A;  3W8G A;  2C2D A;  3OFH A;  3RR8 A;  3MGJ A;  1LFW A;  3MOZ A;  3TJ9 A;  3W3S A;  2CPI A;  3CJ0 A;  4DSL A;  5LMU J;  2B5J A;  3HHD A;  3C16 B;  4KY3 A;  3FVY A;  4CCH A;  1TU0 B;  1Y3J A;  2E7V A;  4IQX A;  1XMO J;  1KVK A;  1HNI B;  2P2C B;  2RKI A;  4KFB B;  4USK A;  4YN3 B;  2B6A A;  4TY8 B;  3IS9 B;  1P9Y A;  3I31 A;  2DIT A;  5F9N A;  4QIW D;  3HZG A;  1GTH A;  2RU3 A;  2DNY A;  3GP9 A;  4GKJ J;  3NAI A;  1AZS B;  1DUR A; 
#chains in the Genus database with same CATH homology
 2QL5 B;  3NS7 B;  1QTN B;  3R6L B;  4ZVU B;  2XYP B;  2CNN B;  2H4Y B;  2FQQ B;  1RWW B;  3R6G B;  2C2K B;  2CNK B;  2CJX B;  1I51 B;  5IC6 B;  1F9E B;  2HBZ B;  1RWN B;  1NME B;  4JB8 B;  2QLF B;  4DCJ B;  4DCP B;  4ZVP B;  2CJY B;  1IBC B;  3R7S B;  1QDU B;  4DCO B;  1RHR B;  1RWK B;  2H4W B;  2H5J B;  4ZVO B;  1RHM B;  3P45 B;  2HBY B;  3KJN B;  3EDQ B;  2H54 B;  2C2M B;  1RHU B;  3EDR B;  1SC4 B;  1SC1 B;  2C2Z B;  2QL7 B;  4ZVT B;  1RHQ B;  2H51 B;  3GJS B;  3KJF B;  2QLJ B;  4ZVR B;  5K20 B;  1BMQ B;  3P4U B;  2XZT B;  2QL9 B;  2HBR B;  1RWO B;  3SIP B;  1ICE B;  2CDR B;  3D6M B;  2XZD B;  2HBQ B;  2CNL B;  3QNW B;  2H65 B;  4ZVS B;  2Y1L B;  3R7N B;  1I3O B;  2XYH B;  2H48 B;  1PYO B;  3D6H B;  1RWP B;  3R5J B;  5IC4 B;  1RHK B;  1RWX B;  2QLB B;  1GFW B;  2XYG B;  2CNO B;  2H5I B;  2P2C B;  3KJQ B;  1RWM B;  1RE1 B;  2C1E B;  3D6F B;  3GJQ B;  4LSZ B;  3GJR B;  1RWV B;  1SC3 B;  3GJT B;  3RJM B;  1PAU B;  2DKO B;  3IBC B;  3R7B B;  4ZVQ B;  2Y0B B;  3IBF B;  1RHJ B;  2C2O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...