2DKOB

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 19
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2dkoB00
5IC4B 1F9EB 3IBFB 2H54B 1RWWB 3P45B 3D6MB 3GJSB 3D6FB 3R7SB 2H5IB 3D6HB 2C2OB 2H51B 2HBYB 3GJQB 3P4UB 2H65B 1PYOB 2CDRB 3EDRB 2CJXB 1RHUB 2QL9B 2Y1LB 1SC3B 1BMQB 3SIPB 2CNOB 1RWMB 2P2CB 3QNWB 5IC6B 3GJTB 2HBZB 1SC4B 1RHRB 1GFWB 4LSZB 2Y0BB 3KJFB 2XYGB 4ZVOB 4DCJB 3R6LB 1SC1B 5K20B 1I3OB 2QL7B 2DKOB 2H4YB 2H4WB 3R7NB 2FQQB 1RWPB 1RHJB 4JB8B 1RWNB 1RE1B 4ZVQB 1RWXB 1IBCB 1RHQB 2QLBB 2XYHB 1PAUB 2HBRB 1RWVB 2QLJB 2QL5B 2C2KB 3EDQB 4ZVSB 3R5JB 1I51B 2C1EB 4ZVRB 3RJMB 2HBQB 1RHKB 3KJQB 2CNKB 3KJNB 4ZVUB 1RWKB 4ZVPB 2CNNB 2XZDB 2XZTB 1RHMB 1ICEB 3NS7B 3R7BB 4DCPB 1RWOB 2CJYB 1QDUB 3IBCB 2XYPB 3R6GB 1NMEB 4ZVTB 2C2MB 3GJRB 2QLFB 4DCOB 2C2ZB 2H5JB 1QTNB 2H48B 2CNLB
chains in the Genus database with same CATH superfamily
1Y3JA 5IC4B 1FA0A 2JWNA 2QRRA 3KLVA 3IRWP 2ZH2A 4DPYA 1T7PA 1LWFB 4DPTA 2DGQA 4LR9A 4WP3A 3TZYA 2AP6A 2KTQA 2IM2A 4B9MA 2O66A 2P5VA 1RP5A 2DHSA 4DX8H 4IFYB 3QBCA 4YR0A 5HMZA 1TK5A 3UI3A 1EKSA 2WSCC 2BE9B 1NHVA 3SCLE 1C1BB 2N7YA 3VTIA 1D8YA 2MKSA 5E33A 1TK0A 1UVIA 1PJ6A 1U02A 2G13A 2QSFA 1FJCA 4B9NA 4NLWA 4MK7A 2VBWA 4QR0A 3ZTRA 3ZTSA 2HNYA 1LV5A 1HBOB 4EI2A 1UETA 4CT9A 9RUBA 3G82A 2DD8S 4CLYA 3FCWA 5D0HA 1RT5A 4WFNQ 2HYIB 4DS4A 5E0OA 5IQ6A 1GMVA 4G6VB 3M8YA 1RAOA 4F3MA 1JIHA 2CNOB 4UQGA 2P2CB 3C14B 2GIQA 1WOOA 3W5ZA 5IC6B 1FKAF 1QTMA 2EEYA 2BRKA 5KFBA 2WAQD 3LP0B 1GFWB 1IKWA 2IYGA 5HK4A 2CVEA 1WDTA 5GMDA 4KPCA 5CYQB 2OI2A 1ZAVA 2XG8A 3MM5A 1KVJA 2YVSA 3AXMA 3MEKA 2K2PA 4RBTA 3DGPA 1DTQB 4CP5A 3I6PA 5HBMB 5LSLA 1VQSA 1FTCA 2XI3A 5KFIA 3MEEA 3QFHA 4OZ2A 1REVA 3FFIB 3M2RB 2NS1B 2EK6A 4CLTA 5AE1A 4B9SA 3OVBA 1A6LA 1RWXB 2RNEA 4DR6F 3MGJA 5FJ4A 3U1MA 5KFJA 4N5SA 3QWUA 5I3UA 3DRPA 4W4MA 2LECA 5DDRC 4IKAA 5ADZA 3QIPA 1VK8A 1VQ7S 4O3RA 2UVVA 2RQKA 2L9NA 2DK2A 2MY8A 2OSQA 2BJ9A 2VBZA 2VFVA 4U7UK 3WZ0A 5B7WA 2VFRA 3MTKA 1W25A 4OQJA 4ZVRB 4FN5A 4ANDA 1RHKB 2CWKA 3HSJA 3VAJA 3KJNB 3Q83A 2RDIA 3CO0P 1VMBA 2DXDA 2RRNA 1PBUA 2XO7A 4ECTA 3D0GE 1PSDA 1NDLA 4C8OA 3S8SA 2XZDB 4ECZA 1QM9A 3V6KA 1ICEB 2VONA 1FXRA 4O4GB 1X4DA 1QAYA 2JH3A 3CC7S 3KTQA 3C2PA 3PYEA 4L74A 1N5VA 2OO4A 3CO9A 2VUGA 4MT1A 3WC0A 2RRBA 4CO2A 2ZDOA 4TNOA 1P9QC 1CC7A 1FWLA 1NEEA 1F3VA 1B0TA 1U1LA 1O51A 2AGOA 3LF0A 4OFZA 1GEHA 3AH6A 5KFHA 4QYRA 3NBPB 5M2RA 5KT7A 1XNRJ 3GYXB 1EP4A 3HSZA 2LQ9A 3MPYA 2LQ8A 1I94F 3TA2A 3M1VB 2LEBA 3W66A 3DYAB 1QDUB 3MOZA 3AOAA 3EE3A 2IY5B 1UVJA 3M9OB 2V34A 3D2WA 4LF4J 1OYEA 2EG1A 1FVSA 3K5PA 1XR7A 5C42A 2DR8A 2HHTA 1TTHB 3MD1A 1HNXF 5G4DA 4NCGB 1CJUB 2YNIB 3VGVA 3VAIA 1APSA 3DFEA 5L38A 1MN9A 3ENAA 3D5MA 3EICA 4NLXA 2C22A 3NEKA 3NCRA 2KH9A 2VQFF 3O8WA 4EK2A 2KU7A 4RW4A 1R8BA 1NDPA 1RCOB 3CCVS 3PY8A 1YJWS 5B0EA 2ZWPA 4U6PA 3HVAA 4ZJLA 3ZTQA 4RNNA 2DNMA 3RRGA 2PFDA 2D1CA 4ZIWA 3CDWA 1OYDA 3LANA 3F73A 4Y0FA 3B4DA 1KLMB 2IVFB 1U09A 2ZC4A 3NP5A 4CTAB 2N4CA 1LXNA 1PJ7A 3AA8A 3PDNA 3RR7A 1Q5VA 3ZTOA 2NSCA 4LFCF 2DO0A 4LF7F 4Z2XA 2E5LJ 2QYGA 4BDPA 3TQEA 3W5YA 3ZZTA 1DHMA 4CDIA 1WC6A 1TFWA 4DV2J 1YHQS 4WFBQ 1EHWA 3JQMA 4DR6J 3THTA 4RJVA 2CDRB 2PMZD 4OHYA 2Y9HA 1LW0A 2O67A 4PXCA 4ETXA 2OD4A 4GMKA 3DYAA 1UFKA 1NLKL 4ED1A 2HNDB 4KAIA 1U48A 2J6SA 3UD5A 3TANA 2E1AA 3ISNC 3AA9A 2CQDA 3KNGA 3H5XA 2IM3A 1X8DA 4ANCA 3QJJA 2VQEF 4F4KA 5KFKA 5JVGQ 2WONA 5KT6A 2M88A 2VB6A 4M63A 2XHWA 2UXBF 1RZMA 1VQ8S 1BQXA 1VC0A 1NHUA 2UUTA 1U0SA 2CJQA 4YHHJ 2YNHA 1I3OB 3THPA 3KJVA 4E2FB 2BM0A 2JRSA 3C14A 1IWAA 3X3UA 4AD6A 3LPYA 4CH7A 4QWAA 3I87A 1K73T 4IR1A 1H2UX 3HJVA 4Q43A 3MR7A 3CJ5A 4DFPA 2OIHA 4QYZJ 2B51A 1NZAA 1N0VC 4KYZA 1SIZA 1TL4A 1PCAA 3GG0A 4JV2A 1VRTA 4X66F 4JB8B 5J2NB 3TJAA 4AE5A 1XC9A 3HFKA 3T5HA 3I4PA 1CBKA 2XMKA 1EJ7L 3B8HA 4OV1A 1S1UB 4CH1A 3H4BA 1N54B 2CFXA 1KQGB 2Z2LA 1UVKA 3PM9A 4UOFA 5KG0A 5KG7A 1T03B 5DZ6A 2VFSA 4NLYA 1R8HA 2KZMA 2CPEA 1UEVA 2ZOMA 3V6DB 1FXDA 3GFYA 2X1AA 2UUAJ 1I51B 2XMMA 1R8CA 1U7LA 1VLOA 1U1RA 1T9UA 2YTCA 1RWKB 3HVTB 5LT5A 1G4CA 2H1YA 1VFJA 4N77A 1YZ6A 4TY8B 3R9LA 3UVJA 1DTTA 1H72C 2C3MA 3L09A 3GYNA 1U6ZA 2XMAA 4JI3J 5CQGA 4MKYA 4JI8F 1K1SA 2MKJA 3ZTPA 4X4UA 1TKXB 3UNYA 5HROA 4Z37A 4PCQA 5J2MA 4M8LA 5E41A 2PSZA 3R7BB 5LMNF 5CCLA 2R8IA 8RUCA 1VQNS 5D8HB 5BJRA 1B99A 4NA3A 3DLLQ 3AY0A 3I31A 3VVUA 1T9YA 1OMSA 2GA7A 2FJEB 3QMQA 3LWLA 2ZDPA 3CD7A 2O01C 4ZITA 4F7VA 1LW0B 1RABB 1FE0A 2QLWA 1WG5A 2DB1A 2DNKA 2M2BA 4J9KA 3D1HA 3K8WA 4NA2A 1HBOA 4YDXA 5A8RA 4LFAF 4RUBA 3GP9A 2R7SA 1CJKB 2HFOA 2KXFA 4Y3CA 4C7QA 5HQ8A 3K57A 4FF1A 2EC0A 2XGPA 4N47A 4DUYJ 1C4CA 1KDNA 1CG2A 1GX5A 2GS8A 2BA9A 2M52A 1FRXA 1T9WA 2VBYA 4CWBA 3OQ2A 5JMNA 2XB2D 2RE1A 2E5GA 3GIMA 3G8TA 3AQOA 4DX7A 1RTHA 1TL7B 2BJ1A 2GIRA 2W01A 3KUGA 4JP8A 4PAAA 1RI7A 3N6MA 3V81A 1UJ5A 2DIUA 2J8SA 4JI1F 3JTNA 5EWGA 4EBCA 4K0KJ 1A9NB 1UFWA 1D0EA 2ROGA 1ELOA 1SI9A 1T9XA 2OPRA 2CWXA 3IBFB 4RNHA 5LXYA 3PIPQ 4KPYA 3POTB 4C8NA 3JQJA 3WIUA 3HI9A 4ES2A 1GMUA 2Z2MA 1AYEA 2GX8A 3LOUA 3D6FB 3TAMB 2UXDF 2DH8A 3IMQJ 3V4IB 4Q2MA 3N79A 3ZZRA 1SXLA 2YX1A 2BKPA 5D4PA 1PYSB 5HATA 1O5JA 3W2WA 1HARA 3DM2B 2VC1A 2P6TA 4HHHA 5HJYA 4DQIA 1L3SA 3UN2A 2G2ZA 5GADU 4PYDA 1HNVB 3SCIE 4DV7J 3AD9C 4EYHB 1RLDA 2HPUA 3DXBA 1IKVA 2QLXA 3NWRA 4DBQA 4PRFA 2X1FA 4GVLA 2X3GA 1IKYB 1LOUA 1IXKA 2A3JA 2AW0A 4PQAA 2DVIA 3DLBA 1FFWB 2LMIA 3HT3A 1MU2A 2QSWA 3M6VA 1HNWJ 3HD1A 4KH1B 4KFBA 5F8MA 2HIQA 1G7CB 3C16B 3IR5B 2Z2ZA 2KFNA 4EO6A 2BABA 4ZVOB 4IH6A 4RZRA 4M5MA 2BXJA 4J9UE 4B3RF 1X4BA 4DI6A 1MG7A 4OZ5A 4C11A 5BXIA 1S6UA 1BGXT 2V0NA 3FGVA 3S1TA 3TP2A 5KT4A 3H5YA 5ETKA 5I3PA 2W9AA 2B4PA 1S0VA 4KKOB 3FSXA 3H20A 2KXHA 1U49A 4LMZA 2BKOA 1NO8A 1WC3A 2DEJA 3LP1A 3EGWB 4IO9Q 3OJUA 2QJ3A 2PEBA 1GX6A 1FJGF 1S7IA 1B64A 1LWXA 1VBYA 3QFWA 3S7RA 5GMKa 4ZVQB 1IBCB 2XMUA 5DLGA 3BREA 4E98A 4TLRA 1RTJB 2EKYA 5HJXA 3W60A 5KT2A 1S4EA 4X4SA 2ZD1B 3ENVA 1FRJA 4KO0A 1J5EF 2J6TA 4WBFA 4JOUA 5LJ5Y 1KLNA 3SDEA 1FEHA 2W7OA 3QGPA 1KVIA 3O44A 3B54A 5HMWA 3RB4A 1T94A 2HBQB 3MEEB 4CLPA 5F8IA 3OSNA 1OY8A 4HLBA 4ZCKA 1VQMS 2ZBQA 3DLEA 3JAMU 2IBKA 3KHRA 1HBNA 1OO0B 1E6YB 5E2QA 2MHNA 1LWFA 2CNNB 2I5JA 3NLCA 2QMWA 2ZBPA 4LVNP 1KFDA 3EPGA 1TFYA 2LU1A 4JV0A 1S76D 3RB6A 5DRKA 4ZPDA 2JFDA 3GSDA 1QUPA 4LREA 2OPPB 4NLOA 3MMCA 3ETOA 2HHPA 1MWZA 4IFVA 5AJ3J 4N76A 2ZBIA 3OVAA 1FNMA 4K0KF 1T9VA 4IQMA 4PWWA 5BYRA 4ID8A 4PZVA 2BYCA 1XN9A 3V2UC 4CYUA 3MOJB 4L3NA 4G1PA 2ZVIA 4UZCA 2VA2A 1XIQA 2MPUA 5M2UA 1FFGB 2V50A 5CD4H 2HNZA 4F3QA 1MWYA 4DN0A 2UUBJ 2B5JB 2DHHA 1JX4A 4MJKA 2YQ3A 1FRMA 1ZM3A 2QV6A 2RUSA 3TO8A 2O3DA 5IM0A 3VGSA 4URQU 2ILZA 3QAEA 2EFNA 2FC8A 2KYXA 2RIJA 4TU8A 2H3EB 3CCWA 5B0AA 2FLPA 4WK1A 1DRZA 4WXOA 4ZN3A 3OLBA 3S6EA 1EZZB 4K4ZA 2AHOB 3A8KA 2OJ3A 2KRRA 2V4RA 3IRXB 1UEKA 2CNLB 1IWGA 4IR9A 2GO9A 5ETMA 4DV3F 4Y65A 1N33F 1NJIT 1OPIA 2AYGA 1K9MT 4A4JA 1BQMA 2VU5A 4OHVA 1UJ6A 2HK3A 3CDAA 3CJ2A 4F4XA 1L3UA 1LWCA 4IUFA 4J9NA 4OYWA 4LF7J 2OGUA 2XS2A 4LUBA 2XSJB 5KFYA 3MAQA 3P45B 1HPZA 1JLAB 1WKJA 2RVJA 2CADA 3LGMA 2OUGA 4ED6A 3QT7A 4FVCA 5D4LA 4F04B 3TI0A 5F0WA 2F3JA 4UUXA 5C24A 1DARA 5T7LA 2VG7A 3H0PA 4RL1A 2B9EA 4RW6B 4ZP6A 1SJ4P 1PYOB 4G3IA 2XC9A 4XPEA 4IFYA 2LQJA 4C3MA 3GV7B 2FHJD 1U4BA 1QSYA 4KQZA 2F8MA 2B4VA 2JFKA 2XWXA 4AXJA 2IPOB 2M7SA 4TVAB 2R2TA 2XY7A 1H38A 4NXNJ 4GO7X 4LR7A 5F9LA 1Q95G 3R8YA 2FJWA 2V63A 3TVYA 3PR5B 4K4SA 4UY85 1RWMB 3T6JA 1WNEA 1B7YB 5HP1B 4I69A 4RW8B 1LWEA 1RT4B 2BBEA 2LQBA 3FEZA 3K2YA 1TK8A 1HI1A 5HVHA 4DV1F 3OVSA 1M1HA 3RAMA 4DPUA 5KG6A 3GE9A 3NS5A 2BUNA 2Q6BA 4I7FB 2FY8A 2DKOB 5FIIA 3H42A 4AXIA 1G3OA 1NUEA 1Y10A 1MWQA 1JLCB 2RQMA 4M5KA 1I6JA 4C8MA 1UA1A 1IBMF 3GIKA 4ZVGA 3MECA 2N4DA 1WEYA 2HVZA 3KK3A 1OY9A 2GQCA 3TUIC 1RDRA 3NG8A 3VAKA 4X65J 1QAJA 4RW6A 5B08A 5CAAA 2KT2A 2APOA 1H3DA 3RG6A 2GCFA 3JYTB 2PMWA 1AW0A 4DG1B 2FDNA 2DEIA 2HBRB 1RWVB 2BVZA 2QLJB 2YQ0A 1C1BA 1LNQA 2ZH6A 4ECRA 3J80U 3T3FA 2WCXA 3ZZYA 2GVZB 3ZO7A 2QFJA 2COLA 1NH7A 3DU5A 5A8KB 4FXDA 5ETPA 2B8PA 3MCMA 3TW0A 3OHAA 4ZPWR 2OPRB 4DR4F 2AEJA 2DNLA 1OY6A 3MXHP 3I9ZA 1ZM4A 4NLDA 1J27A 1KHWA 1KC8T 4WFXA 2HGLA 3IG1B 2DGUA 1YJNS 2CYYA 3IP0A 2NCKL 5ETNA 2UU9F 1KONA 1S1TA 1GT8A 2YNGA 4HACA 2W2NP 2XS7A 3FMWA 3HSDA 2BV3A 2VG5B 3AHPA 2R2RA 2JEGA 3FEYB 4USTA 2EVZA 2MYFA 3KDNA 2EBGA 2UU9J 1KTQA 1XR5A 3GQCA 4JUZA 2WB1D 2DNGA 3OL8A 1UWBB 5B0CA 2BOPA 2B5JA 4ZP9A 2YKNB 3TZWA 3HHEA 1NNDA 4QBUA 4ZIVA 3BQ0A 2ATCB 3HHNB 1U2RA 5D3GB 3OV7A 3CD6S 3SFGA 4C97A 5JXSA 2EPIA 5HQMA 3EPIA 3CMES 2DGOA 2Y1RI 2YKMA 3CT9A 1X31C 3MM6B 4DV1J 2GMHA 4DL5A 1XMQJ 1VC6A 2JJ4D 1FD8A 3ET6B 3CJ4A 2L08A 5AXMA 3SQGB 4IG3B 2MGZA 1SIWB 3D1OA 4K4YA 2UV8A 2AJQA 4DUZF 1Q5YA 4HVZA 4A8WA 4JYAJ 2XY6A 4XK8C 3FKBA 1C2PA 4ECWA 1SV5B 1QLNA 3MR2A 3NGKA 1SC6A 4S0MA 3MPDA 4RW8A 2E9TA 5IT9Y 2DNPA 1RAHB 2DITA 2GAHC 1RTIA 3Q86A 1U6BA 3Q8PB 1PIEA 2F4FA 4NRTA 3OLAA 1UJ4A 2DGTA 2IMWP 3BDPA 3DMJB 1J5OA 1RADB 2HQDA 1MN7A 3ILIA 3MCNA 3MM8A 3PX4A 1I1GA 1HNVA 3FBEA 3Q24A 1KSPA 4KTQA 3PIOQ 2J0SD 3N01A 1KP6A 2IAJA 4A8MP 3G96A 2NREA 4I4BA 3HK2A 4F36A 1U8WA 2GJFA 5BR8J 1Y7PA 5L1JA 2VFUA 1WHVA 3OFEA 4KV8B 1FT8A 2WVCA 3MUVP 1WC5A 4NMLA 3PYGA 1S1UA 4PWDA 2H65B 4BS2A 1IM6A 1R27B 1ZA1B 2HVDA 2IRUA 4NOHA 4JI2F 4CLUA 3BJYA 3GFZA 3TUPA 3OHBA 1QSLA 1FDNA 3E01A 3AJ1A 2JEFA 2BACA 3CJTA 4NYPA 1SQGA 4FXVA 4KKOA 4R5PB 3JQKA 4CO5A 3KK1A 2KXNB 3F44A 4P74A 2JEJA 1U45A 3T19A 2FC9A 3OUYA 2CQCA 1S0NA 4V19X 2ZJQQ 2G0CA 1RXOB 4HI1A 1VRUA 4KB7A 4OHWA 2QT7A 2HHWA 3PR4A 1WF1A 1WC1A 1HMVA 1SVDA 3KJFB 1TKXA 1CS4A 1N0UA 1YK9A 2JLFA 2IA0A 3NKYA 4HI2A 3ZNJ1 2QL7B 4DN9A 1GK8A 4XAKA 2BANA 4Z7CA 4CH0S 4CIOA 4ED3A 3TAQA 4L73A 4OI0A 2Q1LA 4CLFA 1B3TA 4L76A 1VYAA 5KFOA 3RRHA 3N0VA 2BJ7A 5IV4A 1UVLA 2CG4A 3MAAA 2YKAA 3H5SA 3BSAA 4CO3A 2I0XA 4K2JA 4EUVA 1NM2A 4UOHA 4YN3B 1RA6A 1HHTP 2MHEA 3DM2A 4A47A 1X5TA 3BSOA 1NDKA 4Q0BA 2J0QD 4ZJQA 4DQSA 1FRLA 2MZQA 1NJXA 3CIZA 1UKUA 1HD0A 1MSWD 3MEDA 1Y9OA 3QO9A 3VVTA 4OX7A 2MQPA 4ED2A 1RT7A 4AL5A 2JLEA 3C6UA 1YBTA 5KFSA 5J2PB 2C1EB 2R4FA 4KGMA 5HROB 2BEFA 2J76E 4C3KA 5JUMA 2OD6A 2WK4A 4WIIA 2F4VJ 3P49B 3LP1B 5D0GA 4CCHA 2FHJA 5DGAA 3PVXA 1WORA 2ACMA 2R8GA 2BKNA 4CLZA 3UNGC 2CZ9A 2PE8A 2X1GA 2W4CA 3TVZA 4J9OA 2DR5A 1P8GA 3AOCA 1VBXA 1XMQF 4H4OB 2BM1A 5KFRA 3HVRA 1W2IA 1XNRF 3P5BP 5AE3A 1S79A 2C2DA 2B6AB 2CZ4A 1WF2A 2FJDB 3EVMA 2VIHA 3EMTA 3MEGB 3OXLA 5DDPC 1ZOTA 3GIIA 5IM0B 1X9MA 2UVRA 3VGTA 4YB7A 2CJYB 1QAXA 3S01A 3Q8UA 1Q1KA 5H1SV 4J9LA 3D68A 1VIOA 4IOBA 1HNIA 4BC9A 1YJ7A 3DRSA 2AYBA 3H4DA 5GADI 1CULA 4RO0A 1VRTB 3R3TA 3IWLA 4U95A 3BF4A 4F4WA 3PJWA 3R6GB 4I6WA 1XERA 5M2PA 1C0UB 1FERA 2HGNA 1VI7A 2P9CA 4GKJF 2CAJA 1U1NA 2W9CB 1LQ9A 2V2VA 2JHEA 3CDUA 4J9SA 1PC5A 5C7PA 2FY1A 2A2CA 2JL9A 2GZOA 2KHDA 3BO3A 4U7UD 4O0NA 3BH6B 3VAMA 1BQNB 2VOPA 2POKA 1Q16B 4LQ3A 2ROEA 3PW5A 1HA1A 1H98A 3ADAC 4HH1A 3OTEA 1DTTB 4NMXA 2DRBA 1UW4A 4JI2J 3I4HX 1FX2A 3DDNA 1TL3B 4ECQA 3ZNUA 1UL3A 1S7HA 3BPSP 4MIAA 4A8KA 3PX6A 4ANEA 1XMOJ 1FK9B 5KG5A 2E5IA 1CVJA 2RRAA 1FI4A 2CJBA 5E3CA 4LRFA 3UE2A 2BJ3A 2HHHJ 4B9VA 3NL0A 2UXCJ 1S9EA 1HQ2A 5KFZA 3UFCX 2J0XA 1L3TA 2IVYA 4WWSA 4UTGA 1WF0A 2DHAA 2BDPA 2FYXA 3BM7A 4RW7B 4R25A 1SKRA 4XIUA 2R7UA 4Q5VA 1F5BA 1AUSL 4LSLB 4WK3A 5HMYA 3EZ5A 3KDOA 2NZCA 3W61A 2MZRA 5D0RA 2HLUA 2R9LA 2UVWA 3NAHA 4HTJA 3W7BA 2CPFA 1SC3B 4UUWA 3ELHA 1T05B 2DNOA 2RU9A 2C42A 2VA3A 3RRKA 3NOCA 1RAJA 1RT2B 3B82A 1U1KA 3MM5B 2NXUA 5KFTA 2GGPA 1CJVB 1WWHA 5C2GA 2CUYA 2B6AA 2XI2A 2W4DA 1QUVA 2CPIA 3I5BA 3W9HA 4Q8EA 4JI5F 2DR7A 3CWJA 4F0HA 3OUYB 1NB2A 1KQKA 4QWDA 3UCZP 2VC0A 4A48A 1R0BG 1Q81T 2LP4A 4FKYA 2FHOB 1B0PA 1VS3A 4M5IA 3LWMA 2C3YA 3DI6B 3W9JA 1X9SA 3PRBA 2DTJA 1RK8A 2ZZMA 1T3OA 4NPOA 5KFPA 2ZOGA 3H7HB 3GPAA 2DRDA 2HGMA 1TL5A 4BCAA 4WTOB 4UY8T 3LTOA 3I0RB 3HP6A 2RF2A 3EDQB 4PKDB 4ECSA 4P72A 2HK2A 3FFIA 4CTAA 4KGXB 2J9CA 2FJXA 2A1BA 2B4OA 4Y28C 2JDJA 3CTRA 3MM8B 2DGVA 4NA1A 1AA1B 2GHVC 3GIJA 1HQUA 1FFSB 1RQ0A 1TL3A 4OI2A 1ZTWA 2G1DA 2B3TB 4E8UA 2LU2A 1FWPA 3FBCA 3HKZD 1Q8KA 3K59A 4KT0C 5LJ3Y 2YKQA 1RAGB 1TZ0A 4I2QB 5CYQA 5IOLA 4TQRA 1SJFA 2HKEA 4RW4B 2OELA 2DCLA 1XTZA 1TQLA 2WHOA 3GB0A 3D28A 5DDQC 3NS7B 3R27A 4OI3A 2E5HA 3CDEA 1WG4A 3UWTA 2DIVA 2W2PP 3J7YI 1M90T 4ELVA 3P8BB 1K0VA 4D3HA 2HAIA 2NYHA 3IR6B 5A0YA 3UR3C 3OFFA 2W9CA 4RU9A 1LKZA 2L48A 3H2UB 2RS2A 4C8KA 5HANA 2FGCA 4PPZA 5DG9A 2L9WA 3OR1A 5A8WB 1BUXA 2ZUGA 3CCZA 2EFQA 1WHXA 1H74A 2FTRA 2RHQB 4YP3A 2XCAA 1URNA 2IJRA 1N6QA 1Q8LA 3QT5A 1F9FA 2HQCA 2FJVA 4OYBA 3M1VA 1NPKA 3PYDA 5KT3A 2DHXA 3T1YF 2C2MB 4DU7A 2QLFB 4FZVA 3ULHA 3NGDA 2IFXA 4I64A 3Q0AA 4A8SA 3CUNA 3O1LA 4FF2A 1WDDA 1HW9A 3M32A 1M5KC 3ILOA 1SQEA 2V2QA 5FDLA 1RU1A 4H4OA 4NXNF 2DXFA 2ZNZA 1FK9A 4OX8A 3A12A 1FRHA 2HG4A 4ZHRA 4B3MF 2CPYA 3C66A 3JS9A 1U1PA 1KS2A 2O1PA 1RTIB 3UD3P 4O3SA 3Q2TC 4CZCA 3PYFA 1SH0A 2VFTA 3J7AN 2HZAA 2R7TA 4QR1A 5KFUA 3G82B 3GCXP 4QIWD 3JSBA 2KT3A 1IQZA 3GG1A 4ZPBA 4DZ6A 2VQEJ 4IOCQ 3W5XA 2J6UA 1WELA 1XJWB 2L3MA 3F41A 4N7TA 5E3PA 2XZWA 5FD1A 4TU7A 1K0TA 4DMZA 3L7OA 2R8HA 4Y00A 1RJJA 3MHYA 3JYTA 3IAS9 2KL8A 3HPOA 5ETRA 3OTCA 5C5JA 3VHQA 1KNZA 2ZNYA 3NY0A 3AQPA 3CSKA 5HLFB 2CQBA 1PG5B 1N48A 1KD1T 3PKYA 1QD1A 3DKDA 1XBWA 2QMXA 4O0IA 4QIFA 1NSAA 1S9GA 1E6VB 3HHLC 4USVA 4IDKB 3BKTA 3DDIA 4JI0F 5SUHA 2WRMA 3MMBB 1K44A 2NR0A 3CC2S 1Q7YT 2BQRA 1HNXJ 4KGZB 3LP0A 2GV1A 2UVUA 4ELTA 1F9HA 2HBZB 4PXEA 1PC4A 1T95A 1X60A 4IQXA 2OMOA 2HHQA 2HRTA 3T6BA 1YGYA 1RT2A 4O4GA 4URGA 5DM7Q 2DPJA 1WJ9A 1UZDA 3KLGB 4BHQA 1NJZA 3FJ2A 2KG1A 1FHTA 2V67A 3KUEA 4KR0B 3KHGA 5K14B 3CPWR 2YH1A 1VJWA 1RA7A 1Y11A 4X2BA 3E2EA 2C2NA 2HFNA 4ZLJA 3IWXA 2E44A 2I6WA 2YWKA 4J91A 3TA0A 3CCMS 5AJ3F 3FSYA 2BR0A 2XYHB 1D09B 3BN7A 1AUDA 1M1KT 2QTWA 3QYYA 4LF1A 4ES3A 1NKCA 3IS9A 3QRRA 4PQUA 1AZSA 1OIAA 3US5A 3RB3A 2M0GB 3N5BA 5T14A 3QT6A 1KLMA 2M4MA 2MMYA 1RT1A 2K3KA 5F8GA 3KLHA 3T1HF 3ILJA 3AT1B 2D41A 4ZVPB 3BB5A 1RAFB 2WTFA 2V6AA 4B3SJ 3KHLA 1IJFB 3LPEA 4CO4A 4V19J 5DO2A 3R2CJ 5D4NA 4B3MJ 3SSSA 1IR1A 1K47A 2ZBCA 2FVRA 1IKWB 2WB4A 5DETA 5B0BA 2CQ3A 3L7PA 4LJMA 5ETVA 5IZHA 4ERDA 1NPPA 1RT7B 4OLOA 1KTVA 1RT4A 4IH5A 2ZH7A 5RUBA 3ET6A 4F4ZA 4ZLPA 4IOAQ 4J9VA 1YSJA 3M2UA 2ZC3A 1N34J 4PABA 1JJCB 2PFFB 1BWVA 3CCUS 2WOMA 2N3OA 5KFVA 1FEEA 3L3CA 3D3CJ 3QGIA 3P96A 3MAHA 1CULB 1FNOA 4ZVTB 1N5QA 1RTDB 3ENWA 4QR2A 2F8HA 5AT1B 3VGUA 3HULA 1K8AT 3CC4S 4FVMA 1NK5A 1EP4B 2U1AA 1S12A 1F3FA 1SJQA 2D9OA 2MQLA 2RH3A 2PDAA 1AB8A 3I9V9 1UWBA 4TLQA 2HFUA 2QMUB 3Q8YA 3H98A 3BS9A 3MEGA 4F2SA 2ZITA 1HPZB 3CCES 2E1RA 1U6FA 3BO2A 1DZ5A 1GH8A 4J37A 1IBKJ 2VG5A 2HFZA 2V2KA 1N5TA 5H9FJ 1TV6A 4QW9A 1L5UA 4K8RA 5IS2A 3TYTA 2ZE2B 2VQFJ 3GFHA 3BSCA 3FDSA 2WVDA 3MR5A 3MZIA 1RTZA 4KBIA 4Y2KA 1S1VB 2RHSB 3BYPA 3DN9A 1L3VA 2CJ9A 2MQ8A 3V6HA 1J2VA 4FYYB 5ETQA 5J1EA 2K7KA 4U8VA 2AU0A 4F8RA 4I6YA 3C8YA 1Y3KA 2XGQA 1M5SA 2CPJA 3DOMA 1KEKA 2GVZA 3FUYA 2HWTA 4JI0J 2LFVA 2LXIA 1KVKA 1RGVA 2VPWB 4KO0B 3MEDB 2Z58B 2MZJA 2ZD1A 3TX0A 2HFVA 2W7PA 4X4PA 4USWA 1TKZB 3PJ9A 2YPZA 2ZBRA 3TZZA 1RUSA 3HFZB 3MI7X 1X7VA 4K5RA 3DLGA 2YWHA 3SBMA 4DV3J 1UW9A 2L9DA 4O3QA 3MR3A 2XMJA 1M0SA 4DV4F 1H2VZ 2ADBA 3BYRA 2N7CA 2YWFA 2YPYA 4CLSA 3M8ZA 4MYTA 3PV8A 4KGVB 4CYUB 4URSA 1BMQB 3SIPB 4HKQA 3J7YU 4DF4A 3DHXA 2KT5A 5CCMA 3NOGA 2HWHA 5IQQA 1JLEA 2V4JA 2AEMA 3T9NA 4ZK7M 2C2RA 2HHUA 1RLCL 1FE4A 2ZHOA 1FDAA 1FKPA 2OPPA 4ZLNA 4C4WA 1S48A 2IM1A 2XYGB 3EYZA 2IDEA 3PXGa 2HURA 1NJWA 1AFIA 2A18A 4KFBB 1JWWA 2MJNA 2K8GA 2I5JB 3BH7B 4DPXA 4MK8A 3EGZA 2YKMB 5K5MA 5IWAJ 4EZ9A 4LIRA 4C8LA 1JLBB 3R5BA 4EEYA 1VQ6S 2VG6A 1RWPB 2HNZB 5BR8F 2NZ4A 2ZH1A 2DR6A 3QZ8A 3D9BA 1BE4A 4F02A 1RE1B 3O2IA 8ATCB 4OMFG 1U1OA 4D3GA 4FS1A 1KRPA 1YIJS 1YKWA 2YKNA 3W2WB 3TRGA 2GJ2A 4MFBB 1HKAA 4X62J 1YJRA 1VQPS 2AD9A 4F25A 2SXLA 3HFVA 5HI7A 5KG2A 3RW6A 4OLPA 4QPTA 2XMWA 5CYMB 3MURP 1S0MA 3GR0A 3KLEB 2PI4A 2DNRA 2QA4G 3WDOA 4UZBA 3MWBA 2XM3A 4JI7F 2IC3B 1RKIA 2Y1JA 1BQMB 2WBRA 2VICA 4USUA 2MTLA 3OR2A 4USJC 2OLWA 2Z30B 1YWXA 2V8PA 3HLUA 2GHPA 3KWMA 1ZBTA 2MZ1A 4J9RA 2I38A 4WU3A 2R8JA 3BBCA 5F8NA 1FO1A 3M05A 1MW7A 3M4XA 4AL6A 4IG0B 1HHSA 4DSEA 1D9FA 1DBDA 4WFYA 2V4JB 1UCNA 1EKRA 4DQQA 3TWZA 1FJGJ 1HBUA 3V5RA 4AQYJ 4E0DA 1TELA 4EBEA 4P73A 1KKHA 1KFSA 2ZJPQ 3MM6A 4WFZA 3I0SB 1FKOA 1SB6A 3KG0A 2DCUB 3ISND 5H9EK 5KTQA 4UT4A 5U47A 1ITPA 2FHKA 2MKIA 2XQCA 4QPXA 4U8YA 3HO1A 2V8DA 4HHUA 5DM6Q 3GWCA 3M9NB 2C28A 3Q23A 5HN0A 4DUYF 3N9UC 3TEHB 3MF5A 4RUCA 4XDDA 5KOWA 4DV2F 2AX1A 3KUHA 1VISA 4QW8A 5A2QU 3CULA 2CQ1A 3CMQA 5T7LB 4F26A 1SL0A 4G65A 3T5LA 5DS7A 2OEMA 5GAHI 2EW9A 4GO5X 4OJ3A 5KFAA 4Q45A 4K2XA 5CA5A 2FLNA 3VQSA 3PTWA 1WC4A 3IFEA 1YZ7A 2AGQA 2E5JA 3M8PB 4M5LA 4MKVA 5I4MA 2Q6CA 4XO0A 4ECXA 3BEGB 1IR0A 2LXFA 3UN3A 1TAUA 1XK8A 3HD2A 4DR1F 2J9EA 2MDAA 5DGBA 2B43A 2KHCA 4DL7A 4C0HA 1HBNB 2MY7A 2ZEJA 4F0KA 3D0IE 3HM9A 3AJ2A 2ASDA 1YI2S 5IV3A 2WVEA 3EWGA 5HLFA 1U2FA 1BLUA 1BY9A 4FYVB 4KC5A 5KFCA 5GAEU 1NK4A 2PN6A 3A13A 3N6LA 5A76A 1ZPWX 4ED7A 4PQUB 3GV8B 3MD3A 3K5LA 2D74B 5B0DA 1OS5A 1T03A 2CPDA 2FVQA 2VPXB 3UDVA 2YWEA 3D6HB 4WTYA 2B9XA 3BGRB 2CDQA 2H51B 2OHDA 3RZAA 1WKKA 3HKWA 2KM8B 3BSNA 2UP1A 4HH0A 4LF4F 3BZQA 2E9RX 3QZ7A 3Q8VA 5KFNA 1S97A 1WOSA 2DO4A 2Y8YA 2VG6B 5BYQA 2R7VA 3NMRA 1FJEB 5EDWA 3D4JA 3QAUA 2GIFA 2IM0A 3HF5A 4P7TA 1S1WB 2JX2A 4KIAA 3LH2S 5E5NA 3PX0A 2HHHF 1F5AA 1YJ9S 1C0TB 3PO4A 3NGSA 2YNHB 3BGOP 4Y2CA 2ALYB 7AT1B 1WEZA 1X4AA 1YJTA 5F41A 1GQEA 4NXMF 2E1MC 2G9OA 1Y00A 4IRDA 5D0EA 4NLRA 1F60B 2H9ZA 4A46A 1MU2B 1MNEA 1XMBA 2Y0SD 1DY3A 1T02A 2J7UA 3C15B 4CLWA 4DLGA 2ZOFA 1OQ6A 1IKYA 4IYQA 4NASA 3R7NB 4JI7J 2HNDA 4F2RA 4NI2A 2Y3YA 2VZ9A 5GMEA 3DLGB 2HIYA 2AMCB 4PXBA 4C2MA 1P27B 4TXSA 2E9ZA 4IH7A 5FLXY 3V6DA 1UFLA 4DR3J 4RW7A 4FYDA 3G8QA 4A8OA 2EBEA 4I56A 4ZCIA 3OW2R 4MKBA 1KHVA 4LFCJ 4ZVSB 5J2NA 2MSTA 4LR8A 4TU9A 1U47A 5D15A 1YBAA 1B7FA 1S1XB 4DXLA 3KLFB 3RAQA 1T3NA 1SQFA 4M5NA 4ZVUB 4GRSA 5K14A 5C2CA 1HWJA 2HEKA 4WF9Q 4B02A 1RHMB 3FC9A 2ZE2A 2Y1IA 3FNNA 5EWFA 2HS3A 1VOMA 4LF5F 2PIIA 1ULRA 1DQ8A 4OJGA 1YDLA 5FDLB 4MAKA 3K5NA 2KJVA 1AROP 2OAUA 3BBFA 4DQRA 2WW8A 2Q79A 3LO3A 1K1QA 4I2PB 4DJBA 2OEKA 1RBLA 3J7A1 1V5VA 3EZOA 2BE7D 1U0HB 1HQEA 4DOZA 5I42B 3BGUA 1X5SA 3T1AA 5A8RB 3K89A 2AJ4A 2CJKA 2ZJRQ 2J5AA 3F0NA 3IBCB 1NK7A 4H54A 4LRAA 5K8PA 2CRLA 1UPMB 4QWEA 4G1QB 1QVFR 1UEUA 1YVFA 2DPIA 1OPZA 4WE1A 3AAWB 3BPDA 4DCOB 8AT1B 4AUKA 1UWAA 2C2ZB 4WYLA 4X66J 1RYSA 2UUCJ 5GAGI 3ZZPA 4ED5A 3DU6A 4C48A 2ATLA 3X1LB 3LAMA 1HWUA 2XHCA 4WJBA 4MIWA 4EMDA 5EHHA 2J8AA 5DG8A 2MXYA 3AODA 2W9BB 2D3UA 4CI0B 4CT8A 1V3RA 2GVDA 2YNFA 3H59A 4LSNB 2D3OR 4DR7F 2IVMA 1F9EB 3FSIA 3QLHB 5A6WA 4DUTA 4IDKA 1QY7A 1IN0A 5K8OA 1NHKL 4W90B 3J80Y 2QZ8A 2RD5C 3MTJA 4LSLA 4K4XA 4X4NA 4AT1B 2F40A 3RAXA 2F63A 2JC0A 1WEXA 1JKHB 4KGKA 2A0FB 1H2TZ 2OEJA 1UTAA 2MZSA 4GKKF 1HR0J 1YQHA 1GTEA 1Q79A 1ZM9A 2OPQB 3H2VE 4O4RA 4C8ZA 2DY9A 4P2XA 3O6QA 2V8VA 4ILRA 4WP9A 1NK6A 3HMJG 4L6V3 3W9IA 2HS0A 3E8OA 3I32A 5DQIA 3OR1B 2E29A 1HWIA 3AXKA 2A6MA 1S6OA 3QPIA 4USHA 3G6XA 7FDRA 2L41A 4C3LA 2EFGA 1SL1A 1NPRA 1VBKA 2OP5A 4ECYA 4RNOA 3D54A 5F8HA 2BW2A 3HVWA 2LEPA 4JV5J 2IDLA 3TEGA 3SEOA 1SC4B 3MM7B 3NXZA 2F9DA 2Y0BB 4LF6J 3HSGA 4EU0A 2MEWA 4FNIA 2M5YA 3RBDA 1SUQB 4R8UB 2UUAF 3GR1A 3CCJS 3KLIB 3N4WA 1G6BA 1X4HA 1T05A 2H4WB 4JI5J 2R7RA 3DGVA 3NS6A 4NLSA 2K1RB 1IKVB 2MQNA 4O3PA 4YY3F 5CH7B 2XCPA 3OT9A 3UW1A 4DV6J 4NCAA 2UXDJ 3PRVA 2HMIA 5H9FK 1A7GE 2AX0A 5EUHA 5L8RC 7FD1A 3JAMY 3GIRA 1T8EA 4TY9A 2UZAA 1OSDA 4OZLA 3V4IA 2XEXA 1TR0A 4K4WA 1PAUB 3ZXWA 4ED0A 5F3TA 1UA0A 2HQGA 2BMBA 4YUDA 5L1KA 3OSPA 1RAEB 1PKUA 2DGXA 3HXMA 1FNXH 4P71A 4RLEA 5CXTA 4HTIA 3QSIA 2VDIA 4PWDB 4I0WA 3DMJA 1J5OB 2AZ1A 3MUTP 4O23A 1HQUB 2LA6A 3LUYA 4PG4A 2UXCF 2NYIA 2IMOA 5LM7E 2C3OA 1S6QB 1SUQA 2DNZA 3BGLA 4R8UA 4ZHRB 2RSQA 1Q86T 3OL9A 4OJ1A 4GKKJ 1BQNA 5ETOA 4C0OC 1DLOA 2NXCA 3GSIA 4UQTA 4ZP7A 3SFUA 3W3SA 2NXEA 1UVNA 3CJ3A 2EC2A 4ZA1A 2VHGA 5T41A 4CNZA 2XSFA 3M30B 4DCPB 4DPOA 3R1HA 3WC2A 2CKWA 4RR5A 3ZZ0A 3SQGA 4R5PA 4TKTA 3T1HJ 4GC6A 5C42B 3B78A 4OJHA 4Q0BB 2P9GA 1F0XA 3E01B 1YLXA 2RKIA 3G86A 3MUMP 3A8EA 3FZ2A 4O44A 1Q78A 1TP7A 4RNMA 2BJEA 4ZVEA 5HBMA 2C3UA 2VJUA 1PJ5A 1HNIB 5KFLA 4JI8J 1N52B 2PEHA 3ILLA 4QWBA 3IC1A 4DV0J 3M7VA 1W7WA 5G0RA 2V68A 2DNHA 1JKHA 2YKPA 3AB4B 1GXLA 3QIDA 1CS4B 5BYSA 5C25A 1R89A 4X4RA 5LMNJ 3MM7A 4USIA 3M8QA 3V6JA 4B3OA 1FRIA 4F50A 3GCWP 3JB9k 3MFHA 2FZGB 2JZ5A 2KVQE 1S6QA 3NGRA 4B9TA 2ZKTA 5EX3A 1LK7A 2DYAA 4FPRA 3W2VB 2ZH8A 1LW2B 1WOPA 4TQSA 3IA0A 1EQ0A 2R7XA 5K9FA 3IGVA 2D7SA 5IXUA 3NNAA 2ROPA 3OL7A 2GVDB 2Z2YB 5E3RA 1SKWA 1NH8A 1B70B 2F65A 5J2PA 2A6OA 2CPZA 6FDRA 4JI1J 4QOTA 5KG4A 4KSEB 4Y2IA 3I5AA 4WXWA 5D77A 1TKDA 3AJDA 4WZQA 3W8GA 4DZDA 1M5HA 2QEXS 2M3DA 3I82A 2RUGA 5I3UB 3Q8QB 1LEOA 2J0WA 3D3BJ 3DRPB 4MFBA 4X84A 3TR5A 1N8RT 2W25A 5F8LA 3KMQA 1AT1B 2AGPA 4I67A 4NZ6A 5KFGA 2K06A 3FRYA 3PCOB 2V5HG 3U1NA 4C0BA 4N56A 3CJKA 2QN6B 3IGNA 3VAGA 1SKSA 3QJPA 2AJ1A 4LBIA 1R43A 4YS2A 2CPHA 2EFVA 3RB0A 2M9KA 1RU2A 3MDFA 3KJVB 3TZXA 4KHMA 4I2PA 3AOBA 3RU0A 4JI6F 5CABA 1U8SA 2CQIA 1YRXA 3FRZA 2FUG9 4HDGA 1NKEA 1JLFB 1WHYA 2E7VA 3DHWC 2LLZA 3EXYA 1TAQA 4I6AA 4EGLA 3NCQA 1X4FA 2RS8A 4L3KA 4HR2A 5B0FA 1NZ8A 1QE1B 1TKTA 2DY1A 2H5EA 3P3DA 5KAKA 2RDJA 2FVPA 2Z4PA 1WI8A 2LDYA 3FCHA 2C2EA 4PR6A 5A6PA 1T11A 2GQQA 4G1QA 1SJRA 1C0UA 4NL5A 3PHTA 1FD2A 3FK4A 3KLFA 2QIFA 1JQGA 3KLEA 1WSVA 4DR2F 4ICLB 1VBZA 2B7BB 2J7KA 4NCBA 3BBBA 4PG6A 1SJ1A 3CCRS 1XWLA 2OSRA 3KOAA 1G2EA 1C1CA 3EZUA 3ETMA 2ZZTA 2HHSA 2XMTA 1GMWA 2DGWA 2KYZA 1VJQA 5CZXA 2DGSA 4X4TA 2QA1A 2FZCB 3KG1A 3R5JB 2U2FA 4NLPA 3VQTA 4ETZA 2VBXA 4NI2B 4DU8A 2CNKB 1KQSR 4NWBA 1H6KX 1HYSA 2FJBB 1S1TB 2YNGB 2VDHA 4HACB 3RTVA 4KRWA 1PAEX 4LBHA 1JMTA 5HL7Q 1EIYB 4DUZJ 5L1LA 2PA3A 2EWHA 3GZ7A 2XLJA 1WKLA 3RGIA 4LRCA 1D8ZA 4CQ1A 2W2OP 1TU0B 3SMZA 5HSPA 2X7IA 2ZVSA 3ITHA 4RPFA 1YITS 3CJRA 4RNFA 4OZJA 3UD4P 2GQ2A 3Q89A 4PG8A 1U26A 4PYAA 3DDKA 1REGX 4X64F 3FQLA 1VGYA 4OZ3A 4LF6F 4Q2LA 2WZ1A 3D6TB 3ZZUA 1EETB 2G0IA 3CCLS 2IYIA 3QQCD 3HHLD 2B0GA 4DL6A 1RT5B 4QWCA 3FZBA 1ZZFA 2BQUA 1CC8A 2F5GA 2C3PA 2Z0GA 2IRYA 2Z8QA 4LIWA 5IT9U 3TAPA 1JLBA 4N8OA 1WG1A 1TKZA 2ZH5A 3DGPB 3MPWA 3THVA 3VV2B 2G1HA 1VK3A 2ACYA 1HNZF 2UV8G 3J81U 4OYMA 2BX6A 4PG7A 2H5JB 1QTNB 2HQIA 4Q8FA 3I96A 1R7IA 1V9OA 4LT6A 5ETSA 9ATCB 2HLTA 1LWEB 2DNQA 4X4VA 1SH2A 4CO1A 4ID5B 3VCDA 1PO6A 3H90A 1KN6A 4J5OA 2HVHA 1PYTA 3QRPA 5LL6d 1EX8A 2EXUA 1S1VA 1RT3A 1RT6A 1WTFA 6AT1B 1BWEA 1ZAXA 1YX2A 3GYGA 2QA2A 2V8HA 4YB5A 4WP8A 4DSLA 1NBEB 1BXNA 4Q44A 2UUBF 4NYOA 4PXDA 3F56A 1HL6A 1RISA 4LVOP 2J9DE 4JI3F 1TMMA 4QYZK 1SJ3P 4RUAA 3GJSB 3TUJC 2VG7B 2EKNA 2OPSA 3JTOA 3QIPB 2W2QP 4XDCA 1GXTA 2W4PA 4ZVFA 1RYRA 4FF3A 3T9ZA 4HEA9 4B3TJ 4FXWA 2Q66A 4WCEQ 3GJQB 4KHPJ 5DZ7A 2E5LF 2FIUA 2XLIA 4OI1A 3LAKA 4NEYA 2P9EA 1ZH5A 3GU0A 3WX8A 3K5MA 1LWCB 2FJAB 2LCWA 2CZVC 1VQ5S 1KWMA 3B6BA 1VDHA 3BN4A 3C19A 3SI8A 4OZNA 1PILA 1QE1A 3W62A 4K7QA 5ITHA 3JTPA 3VWSA 3CDBA 4C11B 5GAHU 1X4CA 3JXOA 4LF2A 3IRXA 2VODA 1LK5A 4OV6A 1RKJA 3T1YJ 4RW9A 4OYIA 3ITHB 1Q7LB 1N32F 3MMCB 4UOGA 3PNIA 3I56S 3FBFA 3N28A 3W65A 3A3OB 3G4SS 3GFXA 3MMBA 5ETLA 2H4YB 1D9AA 4KHRA 1S1WA 4ZCLA 3M6UA 4ZDNA 4YHHF 2NUUG 1S49A 5JVHQ 3DLEB 4ZCMA 3TJ9A 2IC3A 2FQQB 1IKXB 2E66A 1R8AA 1WI6A 4NX9A 2KN4A 2AF6A 3PG9A 4M5DB 1RHJB 4OI4A 3RBEA 2RQCA 1S59A 1URRA 5CYMA 4DL3A 1ZYQA 4DWIA 2OTJS 4JYAF 2HSEB 2VH7A 3I0SA 3BGRA 3CNQP 1CEZA 2F9JA 2RILA 1O0PA 2OPSB 2CQ0A 3O5TB 2IA6A 1CJTA 4M5GA 2KKHA 3EGVA 3RJMB 1MLAA 3J81Y 2F4VF 3KNAA 3UCUP 3LGNA 4ER8A 1IKXA 4KJIA 5IWAF 3DOLA 1IBLF 3K0JA 4ZMMA 2QFIA 1RT3B 1RT6B 3DOKB 2CVIA 3PJXA 4RKUC 4MH8A 1IVZA 2XZTB 4I68A 3V81B 4R0JA 3RBZA 2EFOA 5D4OA 3W2VA 4QCLA 4ID5A 3PW7A 1NU4A 4A8XA 5DJBA 4AFFA 3KLHB 4DR4J 4OX9F 4OI6A 4EYIB 2A10A 2HAFA 2GW8A 4X4QA 2J9DA 1BD6A 3GLJA 3M8SA 3G6ES 4DSKA 1EQMA 2LYVA 3W63A 3SV3A 1JK9B 4DR2J 2MLYA 5EWEA 5B0GA 1X0PA 4QU6A 1G1XA 1Y0HA 1ROFA 3KFWX 4PG5A 2LKZA 2HVEA 4WIQA 2JNJA 3BR8A 1ZTTA 2CG8A 1X5PA 4UOCA 4DR5J 2LA4A 1NMEB 1A0OB 1B0VA 1OQ3A 1Q53A 4NYZA 2ZM6F 1VQLS 5AXKA 3D7SB 2EI5A 3UCGA 4MMOA 1JNZB 3M2UB 1VQYA 2X51A 1D1UA 1MROB 1HBUB 4RWXA 3MFIA 4LF9F 3PW4A 3SCJE 1YTYA 3NGTA 5ETTA 1D9DA 3HZEA 2R8KA 3GONA 1I94J 2H48B 4B9UA 4F0MA 1JLGA 2B4UA 3DCAA 2I2YA 1HD1A 5SZTA 3OTOF 2LDIA 2K7JA 1N5YA 1DAXA 1E6YA 1H7WA 3DOLB 1RACB 4U9RA 3MCOA 4M5JA 3J7Z5 1R0CB 4W98A 4DFJA 4ILLA 3MM9A 3J7ZT 2Q43A 1QVGR 3M32B 4C98A 5C25B 2AV5A 2CPXA 2M70A 1VRQC 3RW7A 5A2QY 1GNKA 5CHCB 3PW2A 1NK8A 2GO8A 1NK9A 3TVKA 4ZPCA 1HFEL 4DG1A 1QSSA 2YY3A 3MMAA 1RTJA 4LFBF 2HVIA 3M6WA 1C1CB 4ENOA 2KZZA 1JLAA 3P4UB 4OYXA 1C4AA 2JVOA 3C6TA 4OYZA 1JXVA 4WZMA 3DOMB 4ZJOA 4DFKA 2DNYA 1QAIA 2BRLA 3EDRB 4JBCA 1UZHA 3LP2B 1N5SA 4GVBA 1F1BB 1TVRA 2QL9B 1UP1A 4HT5A 4CNYA 5I3QA 1NKBA 1JLCA 3E3XA 2DJWA 3K17A 2E7XA 3UDCA 1N36J 4QQBA 1AFJA 1X4GA 3P5TL 2XNQA 4F4YA 2FVSA 4BLGA 4JI6J 5MLCV 5KFMA 3QJLA 2PA8D 2MKKA 1RTHB 1TL7A 1N33J 1TV6B 4F3OA 1VCTA 5HVFA 1IBLJ 4H4MB 1N36F 5HP1A 2XO6A 1RB0A 4DCJB 3KG4A 2ILYA 2J7WA 1JXEA 2MQMA 3CCQS 2WONB 5JJBA 1N56A 1DQAA 2KVIA 5F3ZA 3MPVA 4PWUA 4WYWA 1IJEB 1WACA 4A8YA 2ASLA 1RAIB 2OMLA 1S9GB 3ZZOA 3K58A 2EK1A 4G1IA 2GC8A 4ZP8A 1NRKA 4K5SA 4CLLA 1UMJA 4DR3F 3JSRA 1N6QB 1RTDA 1HYSB 1F2GA 2DISA 2YH0A 2KM8C 1HI0P 2W2MP 3PO5A 1XNQJ 1S10A 1JXLA 3M2VA 3NAIA 4DX5A 3G71S 3EGNA 3T41A 4NZ0A 2VPZB 1TL1B 2RB7A 3LQVA 2IHR1 1T9TA 4O3OA 4BBYA 2QLBB 4NLQA 2ZH3A 4FF4A 4CLKA 1KOOA 3TAMA 2DH9A 2XMVA 2C2KB 2FLLA 4OL8A 2QX0A 4OIXA 4WFAQ 3ZZZA 2ASYA 1U1MA 4LF9J 4QJVA 4RBVA 4DL4A 4M95A 2EFPA 4YR2A 1NSPA 4YY3J 5LSOA 4DV6F 2AJ2A 4ZS6A 5J1EB 3IXQA 3WIVA 3OXGA 3H25A 5DDOC 3UR0A 4DR5F 1GTHA 2OFHX 3RBXA 3FBBA 3M8RA 4M94A 1DQ9A 3A8IA 2CQ2A 2VF3A 3W64A 3NCPA 3PEHA 4QIEA 2DT9A 3DRRB 5B09A 1CLFA 2BW7A 3HZGA 3VF0B 4DLEA 1JJ4A 3M8QB 3GV5B 4ZLLA 1S57A 3IS9B 2PT0A 2I1RA 3C16A 4J90A 1YJUA 1T0TV 2UXBJ 1H0HB 3CXCR 1NK0A 4RU2A 1Y5NB 4K50A 1CJUA 2YNIA 3SSRA 1U2CA 3EVWA 3C46A 1CJKA 2PC6A 2G2YA 3UQSA 5HO4A 2HZVA 4EFAC 1S4FA 1NSKL 2P6SA 4UW2A 1R6YA 2YXLA 1ACMB 3KYLA 3BQ2A 5HQLA 2ASJA 4NLUA 3KLGA 2UUWA 2OPQA 1YRTA 3OTDA 1HQEB 5I42A 3BR9A 3R5CA 3G6YA 1JLQA 2P8IA 3R5GA 4L72B 1VR6A 3CE8A 1PBAA 3OBIA 4NLTA 1M5VC 4B3RJ 1UAWA 1DLOB 1ZA2B 3IM9A 3CCSS 1HR0F 3FVYA 4LFBJ 2GGPB 2B56A 4OX9J 2QGFB 2R42A 2BZ2A 2XULA 4WU2A 2JLGA 4RWWA 3SV4A 4TY8A 3HVTA 3HHLA 1Q4RA 5HMXA 5DQGA 4YQWA 3H8YA 1HIYA 5EGYA 2WVBA 1CSJA 3JSMB 3H40A 2QA4S 1RT1B 2CQHA 4MTPA 1FWKA 1MMLA 3SZ2A 1R3NA 1SKUB 2HS4A 4M5HA 4MKAA 1CQMA 3CEDA 4FBUA 3QRQA 3BKUA 4USMA 1FDBA 3LALA 4LF8J 2QO3A 2MLZA 3D67A 3I0RA 2YQ1A 2RF2B 3D6MB 3QGGA 4YB6A 4J9MA 4WKRA 4LBPA 1Z4UA 2V69A 3GMGA 2JSXA 3HDSA 3R7SB 5F9NA 5G0RB 1YJVA 3IO1A 3QO9B 2C2OB 4F4AA 3Q22A 3RR8A 2IIHA 2WVFA 1Y5LB 3OTBA 3FMBA 1QJHA 2MQOA 3PRDA 4W92B 2IRXA 2PD1A 3WHIA 5J2QA 1XNQF 4K4TA 3VZHA 1V3SA 2CJXB 3EVOA 2GMLA 1VLYA 5L1IA 2MKYA 3OPKA 2WSEC 3A8JA 3MAAB 1RAAB 3DRSB 1WHWA 1L3KA 2K1RA 2R2SA 4H4KA 4JV5F 3CW2C 2KFYA 4NEZA 4P2FA 4QIVA 2JVRA 1DTQA 4DDFA 5CD4A 4CM2A 3DLJA 1FRKA 3KLIA 3M30A 2NQPA 1NJYA 4MYUA 2DBBA 4ECVA 2AZ3A 4MIBA 2ALZA 4GC7A 2ADCA 1CJVA 2ERRA 2R7WA 3C3LA 1HHQA 2ZUAA 3L7UA 3MCSA 2N3LA 4DX6A 3IAM9 5CZVA 4DV5F 1EB0A 1Z2ZA 2MZTA 2O5DA 1AXQA 2XTJP 4P52A 4BWMA 3TJ8A 2AKWB 4OZ1A 3UPFA 2AQ4A 3E51A 1N88A 1Q0NA 3CGIA 3K7RA 1U1QA 3PKMA 1SBRA 1LXJA 2W1BA 2QYCA 3QWPA 2B9YA 5AXNA 1CQNA 2RKIB 4PUOA 1RBOB 2GHWA 5A8WA 2HRYA 3QT8A 4X4OA 4DSJA 5F8JA 2F7VA 2I9SA 4J9PA 4DL2A 4KE5A 1U0HA 2LXUA 2Y8WA 4DF8A 3MMAB 1ZPVA 4KV8A 5EX0A 2VV5A 4BC7A 5KG3A 5J2MB 2KI2A 2KO1A 3UO0A 4YOEA 1H73A 2G2OA 4Q7AA 2V9WA 3POTA 3M6XA 4DSIA 2XWYA 3HJFA 3KJQB 2HMIB 1UPPA 3N5FA 4IRCA 2OFGX 3JSYA 2N82B 1P1LA 4Y2MA 3UVJB 3HHLB 3CD0A 1NAQA 3QLHA 4AYBD 4ECUA 1V6HA 1LW2A 4F67A 2DRAA 4ES1A 5L9XA 1RWUA 1X9WA 1S77D 2ZWOA 2BOAA 4P75A 5GVQA 2AJ0A 4DR7J 3CJQA 4K4VA 1NCLA 4XPCA 2JEIA 2PMHA 2HRUA 1S1XA 3WX4A 2QG9B 5CYJA 2FGOA 2W9BA 3FEXB 1TMJA 2BJDA 4P7VA 3QSYB 2E1CA 1W2BR 1UVMA 4H4KC 3WQPA 3TQ1A 3G87A 4N41A 2NXNA 3OFGA 3TNVA 2CQPA 3V4MA 3KK2B 3VALA 1HNWF 5THWA 1P9YA 4AL7A 2JC1A 1XR6A 4NCGA 3RUBL 1Y4ZB 1TL1A 1NXIA 5LMUF 5D6GA 4NXMJ 3DRXA 5DQHA 2MB0B 4IO1A 4DFMA 2YBVA 5KG1A 1REVB 4NLGA 1Y5IB 3HCXA 3G8SA 4ILMA 1J5EJ 2FZKB 3R97A 5K8NA 3DI6A 4J7CA 3J81j 5J2QB 3K8VA 2B7CB 4NZ7A 4YMEA 2XY5A 1PGZA 5E3QA 3CB4A 4DSFA 2AWZA 2W24A 1WSRA 3AD8C 3C15A 1F5CA 3NBPA 2KJWA 4DHVA 5A0YB 2BANB 2MKCA 2KB2A 3KK2A 2G4BA 1TUVA 1O6XA 1Z1ZA 2QC3A 5KT5A 3BO4A 4PUOB 4YDDB 3FCVA 2Z57B 1N34F 2OTLS 4C9DA 3H5UA 4OX6A 1LFWA 1C0TA 3G9CA 2V2ZA 5FLXU 2W7AA 4NRUA 3MR6A 3NGUA 2ZHBA 3H2LA 3A3NB 6FD1A 3BDEA 1OJ4A 2IJNA 4ZPAA 4LSNA 3EUNA 1TVRB 4P2SA 2V94A 3MPUB 1VQ4S 5A8KA 4OYOA 4USKA 2OKQA 2RMLA 4B17A 2XS5A 4U96A 1RWWB 3C6UB 2FHMA 3TOQA 2PI5A 1FX4A 3CD5A 3U02A 1FTRA 2GNKA 3EM1A 3PEJA 4TYAA 1KQFB 3AB2B 1S9FA 1X4EA 1IBMJ 4HHJA 1SL2A 4EZ6A 2MLXA 2HWIA 2YX4A 3M2VB 4ZPTR 3R2DJ 1DURA 4GKJJ 4OZ0A 1R31A 3M2RA 1ZM2A 4O3NA 4P6QA 1S0OA 1KOHA 1H7XA 3HHKA 1HNZJ 4M5DA 4QZVB 1RHUB 1XQIA 2AT1B 3DRYA 2HQFA 2Y1LB 1SCJB 4ZN1A 3EXCX 2MKHA 1U24A 1MMDA 4JI4F 2VOOA 2CXEA 5HAOA 1B4SA 4Y34A 3CMAS 1JLGB 5HVGA 1VQ9S 3CJ8A 4LRDA 2YNFB 5J1PA 3DLHA 4YEAA 4ED4A 3M8PA 3OL6A 2DHGA 1ZS6A 1VRUB 1CPZA 1M5OC 2LEAA 2VKZG 4DPWA 5E3AA 3DRRA 1SC1B 3IN5A 4QIGA 4B3OB 1P1TA 1I5OB 3U1LA 2XNRA 3DNCA 2W8LA 2MGZB 4RX6A 3R1LA 1R0AB 3I5CA 3CVKA 3KK1B 4EO8A 3PW0A 4OYPA 2CQGA 4KY3A 4FBTA 3OJSA 2CQ4A 5IT4A 4DS5A 4N8NA 1VC5A 3NRBA 5LMUJ 4WKYA 4YB1P 4AQYF 3P6YC 3IBWA 4I1TA 2WBMA 3C6TB 3KKFA 4M1KA 2ZKUA 4PPDA 1NSQA 1EAYC 1X5OA 4KHPF 2IBOA 2VKRA 3PFOA 2KFZA 5DLFA 1XMOF 3LGHA 1JJ2R 1N32J 1RHQB 4B9LA 4QU7A 4HL9A 4TN2A 5L46A 4LFAJ 4ATNA 1S9EB 2YWGA 4CM0A 1GAOA 4ZKAA 5AXLA 1R6VA 3IM8A 3NWGA 2IAJB 3U27A 1VHIA 2CA9A 4V1Ak 3SYZA 1NB7A 1R8PA 2NXJA 2QE5A 4FYWB 4ELUA 3LW5C 4EWTA 3JSMA 1HW8A 4YFUA 4B3TF 3M9MB 2XBPA 5H9EJ 3PFEA 4ZVHA 4LRBA 3W1YC 2ZH4A 2HHXA 2FD2A 3L9ZA 3M8WA 1N5YB 1BHNA 4OYAA 3Q8SB 3Q2SC 1VQOS 3TX8A 2HZCA 3AFGA 2OH2A 2V9KA 3R5AA 4PEOA 4L75A 1YBUA 4Y6IA 1U25A 1CJTB 4X62F 4HYKA 1FKPB 5LOQA 1XEZA 2XLKA 4C8YA 1HBMA 3DLKA 1RCXB 2BE2B 1JLQB 2D69A 1WTBA 4WE1B 3WBZA 5K8MA 1RWOB 4A8QA 5EN1A 2F1FA 2K3IA 3B4MA 1Q8IA 4ZPVR 4OHXA 3UN5A 4DV5J 3MECB 2NUHA 2FPHX 2RJZA 3UDLA 4B3SF 1WD6A 1ZAWA 1FKOB 3AD7C 3EJMA 4NE9C 2AEFA 2ZFHA 2LQ5A 2HHVA 4DV7F 1MMNA 1SPBP 5KOXA 1HMVB 2DH7A 5GAEI 4CRJA 1DFDA 4FDFA 3MM9B 5J1NA 4RW9B 2M8HA 4H4MA 1M1GA 3BGFA 3L4BC 4DEZA 4FS2A 2RDDA 1YG0A 1FDDA 3D1QA 3T5KA 2MJUA 2YX7A 3IG1A 3OR2B 2HFSA 2YKOA 2KG0A 4JV1A 3CIMA 3L95X 3A1YG 2E7WA 4ALZA 2VJVA 1ZETA 5MAOA 1N4LA 2KDOA 3KMSA 2H54B 4P2MA 1M5PC 1JJHA 2GJIA 3OD2A 2HNYB 1RSCA 1V5IB 4K59A 2FVCA 2RU3A 2DR9A 1VIXA 2E1PA 3CCTA 4P9SA 4WPAA 2MQQA 2WW4A 4FP9A 1IR2A 1MROA 2GFFA 2H5IB 3GTYX 3UDEA 1KR4A 5C24B 5KFEA 3CF5Q 1IBKF 2HBYB 3QATA 3W8PA 3CJSA 1S99A 2FB0A 1DJ0A 1S6PA 3IR7B 3QGHA 1FF2A 2AYMA 2NSBA 3TA1A 5GAGU 4ICLA 3SCKE 2B9WA 5D3GA 3ICLA 2ABYA 2CIMA 1GXUA 1VHFA 5IFMA 3BV8A 2ZHAA 2YWWA 1S72S 1IM4A 3FQKA 1Z2LA 2WOMB 3ENQA 4IRKA 1TUWA 4HDHA 4LF5J 1Q82T 2PO4A 5L39A 3ZC4A 2EG2A 2W8KA 1HLWA 4Z7YA 1O8BA 2RAQA 3OXFA 2I8EA 4A8FA 3SSQA 4U7CA 2F8EX 2R7OA 3QNWB 3PHEA 4NLVA 5KFXA 3GJTB 1SV5A 2G0JA 4TYBA 4Y2AA 4DV0F 1RHRB 4LSZB 1JLEB 3OFHA 2V8GA 3A3PB 3R6LB 5K20B 2M8DB 2V4QA 1KBRA 2D9PA 3ZFVA 1FCAA 2GMJA 2X3DA 3DXSX 3LA0A 1HI8A 2R7QA 5AE2A 5D78A 4UF4A 3VAFA 4DQPA 4FYXB 1HWLA 4YR3A 4DV4J 2HQ3A 3ONQA 4X64J 3LP2A 4GVBB 3ISZA 5F0UA 4U67Q 2DXEA 2D3ZA 1EARA 2VPYB 3HHDA 4BWJA 4RUHA 3OTOJ 1RWNB 4R0EA 1AZSB 1Q8BA 3K5OA 2NPFA 1S6PB 1WUUA 4KH0B 3SDEB 4DL0C 2R2UA 4J9QA 3HT0A 3VR1A 5KFFA 2ZH9A 2GAGC 3SQOP 1F2HA 1LFPA 3MMJA 4LQ9A 3O3LA 3EX7B 2A2DA 2QL5B 1V3ZA 4K4UA 2NLWA 2IJFA 4X65F 4XTTA 2XSJA 1P6TA 2JOQA 3N6NA 1TUGB 4IG0A 3Q8RB 3IWNC 1NDCA 2AJFE 2MSSA 5E7OB 5KFWA 3RYLA 5KFQA 4ITSA 1FJ7A 3NMAA 4B08A 1FXLA 2UUCF 1JB0C 2ZM6J 2X1BA 3KXDA 3DOKA 3TUZC 3PZPA 1R0AA 2VASA 3D0HE 4C6AA 2HW3A 5LXRA 4LF8F 1VQKS 4FPIA 3U7JA 5KFDA 4JI4J 3BKFA 2RT3A 1SH3A 3GILA 1JNRB 5L9NA 2VD3A 4ZOSA 2ZZNA 3R5DA 3I55S 4FNHA 4ED8A 4HT7A 1OSCA 3VZIA 4MK9A 4EBDA 4IG3A 2KRBA 1D3WA 5LSRA 2BQ3A 5IT0A 1HWKA 2BJ8A 1FVQA 3NNHA 1E6VA 1ZZNA 1S5ZA 1WC0A 2RQ4A 1X0FA 3CJKB 2NPIA 1BC6A 3KK3B 4O44B 2R3VA 1W26A 2XYPB 3PACA 2PGCA 2LVWA 2DNNA 2AIRB 2VL1A 3KHHA 2WSFC 3D66A 1RBAA 1EETA 1OWXA 2Q3PA 3A4TA 4FKXA 4CO0A 3DC2A 2CJAA 3GJRB 1TKTB 2B8QA 3CJ0A 3T5JA 1IQTA 2AYEA 3HX9A 4OHZA 2Z56B 1HBMB 1FESA 3DLKB 2BE2A 1JLFA 1YRUA 4I7FA 4DR1J 2D3O1 5DG7A 1GMWD 3G6VA 3TARA 4IFVB 3VAHA 2FLOA 4P10A 3SXLA 3NNCA 1F6TA 3G2XA 4RBUA 3BQ1A 4I2QA 1IUJA
chains in the Genus database with same CATH topology
5IC4B 1F9EB 3IBFB 2H54B 1RWWB 3P45B 3D6MB 3GJSB 3D6FB 3R7SB 2H5IB 3D6HB 2C2OB 2H51B 2HBYB 3GJQB 3P4UB 2H65B 1PYOB 2CDRB 3EDRB 2CJXB 1RHUB 2QL9B 2Y1LB 1SC3B 1BMQB 3SIPB 2CNOB 1RWMB 2P2CB 3QNWB 5IC6B 3GJTB 2HBZB 1SC4B 1RHRB 1GFWB 4LSZB 2Y0BB 3KJFB 2XYGB 4ZVOB 4DCJB 3R6LB 1SC1B 5K20B 1I3OB 2QL7B 2DKOB 2H4YB 2H4WB 3R7NB 2FQQB 1RWPB 1RHJB 4JB8B 1RWNB 1RE1B 4ZVQB 1RWXB 1IBCB 1RHQB 2QLBB 2XYHB 1PAUB 2HBRB 1RWVB 2QLJB 2QL5B 2C2KB 3EDQB 4ZVSB 3R5JB 1I51B 2C1EB 4ZVRB 3RJMB 2HBQB 1RHKB 3KJQB 2CNKB 3KJNB 4ZVUB 1RWKB 4ZVPB 2CNNB 2XZDB 2XZTB 1RHMB 1ICEB 3NS7B 3R7BB 4DCPB 1RWOB 2CJYB 1QDUB 3IBCB 2XYPB 3R6GB 1NMEB 4ZVTB 2C2MB 3GJRB 2QLFB 4DCOB 2C2ZB 2H5JB 1QTNB 2H48B 2CNLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IC4 B;  1F9E B;  3IBF B;  2H54 B;  1RWW B;  3P45 B;  3D6M B;  3GJS B;  3D6F B;  3R7S B;  2H5I B;  3D6H B;  2C2O B;  2H51 B;  2HBY B;  3GJQ B;  3P4U B;  2H65 B;  1PYO B;  2CDR B;  3EDR B;  2CJX B;  1RHU B;  2QL9 B;  2Y1L B;  1SC3 B;  1BMQ B;  3SIP B;  2CNO B;  1RWM B;  2P2C B;  3QNW B;  5IC6 B;  3GJT B;  2HBZ B;  1SC4 B;  1RHR B;  1GFW B;  4LSZ B;  2Y0B B;  3KJF B;  2XYG B;  4ZVO B;  4DCJ B;  3R6L B;  1SC1 B;  5K20 B;  1I3O B;  2QL7 B;  2DKO B;  2H4Y B;  2H4W B;  3R7N B;  2FQQ B;  1RWP B;  1RHJ B;  4JB8 B;  1RWN B;  1RE1 B;  4ZVQ B;  1RWX B;  1IBC B;  1RHQ B;  2QLB B;  2XYH B;  1PAU B;  2HBR B;  1RWV B;  2QLJ B;  2QL5 B;  2C2K B;  3EDQ B;  4ZVS B;  3R5J B;  1I51 B;  2C1E B;  4ZVR B;  3RJM B;  2HBQ B;  1RHK B;  3KJQ B;  2CNK B;  3KJN B;  4ZVU B;  1RWK B;  4ZVP B;  2CNN B;  2XZD B;  2XZT B;  1RHM B;  1ICE B;  3NS7 B;  3R7B B;  4DCP B;  1RWO B;  2CJY B;  1QDU B;  3IBC B;  2XYP B;  3R6G B;  1NME B;  4ZVT B;  2C2M B;  3GJR B;  2QLF B;  4DCO B;  2C2Z B;  2H5J B;  1QTN B;  2H48 B;  2CNL B; 
#chains in the Genus database with same CATH topology
 1Y3J A;  5IC4 B;  1FA0 A;  2JWN A;  2QRR A;  3KLV A;  3IRW P;  2ZH2 A;  4DPY A;  1T7P A;  1LWF B;  4DPT A;  2DGQ A;  4LR9 A;  4WP3 A;  3TZY A;  2AP6 A;  2KTQ A;  2IM2 A;  4B9M A;  2O66 A;  2P5V A;  1RP5 A;  2DHS A;  4DX8 H;  4IFY B;  3QBC A;  4YR0 A;  5HMZ A;  1TK5 A;  3UI3 A;  1EKS A;  2WSC C;  2BE9 B;  1NHV A;  3SCL E;  1C1B B;  2N7Y A;  3VTI A;  1D8Y A;  2MKS A;  5E33 A;  1TK0 A;  1UVI A;  1PJ6 A;  1U02 A;  2G13 A;  2QSF A;  1FJC A;  4B9N A;  4NLW A;  4MK7 A;  2VBW A;  4QR0 A;  3ZTR A;  3ZTS A;  2HNY A;  1LV5 A;  1HBO B;  4EI2 A;  1UET A;  4CT9 A;  9RUB A;  3G82 A;  2DD8 S;  4CLY A;  3FCW A;  5D0H A;  1RT5 A;  4WFN Q;  2HYI B;  4DS4 A;  5E0O A;  5IQ6 A;  1GMV A;  4G6V B;  3M8Y A;  1RAO A;  4F3M A;  1JIH A;  2CNO B;  4UQG A;  2P2C B;  3C14 B;  2GIQ A;  1WOO A;  3W5Z A;  5IC6 B;  1FKA F;  1QTM A;  2EEY A;  2BRK A;  5KFB A;  2WAQ D;  3LP0 B;  1GFW B;  1IKW A;  2IYG A;  5HK4 A;  2CVE A;  1WDT A;  5GMD A;  4KPC A;  5CYQ B;  2OI2 A;  1ZAV A;  2XG8 A;  3MM5 A;  1KVJ A;  2YVS A;  3AXM A;  3MEK A;  2K2P A;  4RBT A;  3DGP A;  1DTQ B;  4CP5 A;  3I6P A;  5HBM B;  5LSL A;  1VQS A;  1FTC A;  2XI3 A;  5KFI A;  3MEE A;  3QFH A;  4OZ2 A;  1REV A;  3FFI B;  3M2R B;  2NS1 B;  2EK6 A;  4CLT A;  5AE1 A;  4B9S A;  3OVB A;  1A6L A;  1RWX B;  2RNE A;  4DR6 F;  3MGJ A;  5FJ4 A;  3U1M A;  5KFJ A;  4N5S A;  3QWU A;  5I3U A;  3DRP A;  4W4M A;  2LEC A;  5DDR C;  4IKA A;  5ADZ A;  3QIP A;  1VK8 A;  1VQ7 S;  4O3R A;  2UVV A;  2RQK A;  2L9N A;  2DK2 A;  2MY8 A;  2OSQ A;  2BJ9 A;  2VBZ A;  2VFV A;  4U7U K;  3WZ0 A;  5B7W A;  2VFR A;  3MTK A;  1W25 A;  4OQJ A;  4ZVR B;  4FN5 A;  4AND A;  1RHK B;  2CWK A;  3HSJ A;  3VAJ A;  3KJN B;  3Q83 A;  2RDI A;  3CO0 P;  1VMB A;  2DXD A;  2RRN A;  1PBU A;  2XO7 A;  4ECT A;  3D0G E;  1PSD A;  1NDL A;  4C8O A;  3S8S A;  2XZD B;  4ECZ A;  1QM9 A;  3V6K A;  1ICE B;  2VON A;  1FXR A;  4O4G B;  1X4D A;  1QAY A;  2JH3 A;  3CC7 S;  3KTQ A;  3C2P A;  3PYE A;  4L74 A;  1N5V A;  2OO4 A;  3CO9 A;  2VUG A;  4MT1 A;  3WC0 A;  2RRB A;  4CO2 A;  2ZDO A;  4TNO A;  1P9Q C;  1CC7 A;  1FWL A;  1NEE A;  1F3V A;  1B0T A;  1U1L A;  1O51 A;  2AGO A;  3LF0 A;  4OFZ A;  1GEH A;  3AH6 A;  5KFH A;  4QYR A;  3NBP B;  5M2R A;  5KT7 A;  1XNR J;  3GYX B;  1EP4 A;  3HSZ A;  2LQ9 A;  3MPY A;  2LQ8 A;  1I94 F;  3TA2 A;  3M1V B;  2LEB A;  3W66 A;  3DYA B;  1QDU B;  3MOZ A;  3AOA A;  3EE3 A;  2IY5 B;  1UVJ A;  3M9O B;  2V34 A;  3D2W A;  4LF4 J;  1OYE A;  2EG1 A;  1FVS A;  3K5P A;  1XR7 A;  5C42 A;  2DR8 A;  2HHT A;  1TTH B;  3MD1 A;  1HNX F;  5G4D A;  4NCG B;  1CJU B;  2YNI B;  3VGV A;  3VAI A;  1APS A;  3DFE A;  5L38 A;  1MN9 A;  3ENA A;  3D5M A;  3EIC A;  4NLX A;  2C22 A;  3NEK A;  3NCR A;  2KH9 A;  2VQF F;  3O8W A;  4EK2 A;  2KU7 A;  4RW4 A;  1R8B A;  1NDP A;  1RCO B;  3CCV S;  3PY8 A;  1YJW S;  5B0E A;  2ZWP A;  4U6P A;  3HVA A;  4ZJL A;  3ZTQ A;  4RNN A;  2DNM A;  3RRG A;  2PFD A;  2D1C A;  4ZIW A;  3CDW A;  1OYD A;  3LAN A;  3F73 A;  4Y0F A;  3B4D A;  1KLM B;  2IVF B;  1U09 A;  2ZC4 A;  3NP5 A;  4CTA B;  2N4C A;  1LXN A;  1PJ7 A;  3AA8 A;  3PDN A;  3RR7 A;  1Q5V A;  3ZTO A;  2NSC A;  4LFC F;  2DO0 A;  4LF7 F;  4Z2X A;  2E5L J;  2QYG A;  4BDP A;  3TQE A;  3W5Y A;  3ZZT A;  1DHM A;  4CDI A;  1WC6 A;  1TFW A;  4DV2 J;  1YHQ S;  4WFB Q;  1EHW A;  3JQM A;  4DR6 J;  3THT A;  4RJV A;  2CDR B;  2PMZ D;  4OHY A;  2Y9H A;  1LW0 A;  2O67 A;  4PXC A;  4ETX A;  2OD4 A;  4GMK A;  3DYA A;  1UFK A;  1NLK L;  4ED1 A;  2HND B;  4KAI A;  1U48 A;  2J6S A;  3UD5 A;  3TAN A;  2E1A A;  3ISN C;  3AA9 A;  2CQD A;  3KNG A;  3H5X A;  2IM3 A;  1X8D A;  4ANC A;  3QJJ A;  2VQE F;  4F4K A;  5KFK A;  5JVG Q;  2WON A;  5KT6 A;  2M88 A;  2VB6 A;  4M63 A;  2XHW A;  2UXB F;  1RZM A;  1VQ8 S;  1BQX A;  1VC0 A;  1NHU A;  2UUT A;  1U0S A;  2CJQ A;  4YHH J;  2YNH A;  1I3O B;  3THP A;  3KJV A;  4E2F B;  2BM0 A;  2JRS A;  3C14 A;  1IWA A;  3X3U A;  4AD6 A;  3LPY A;  4CH7 A;  4QWA A;  3I87 A;  1K73 T;  4IR1 A;  1H2U X;  3HJV A;  4Q43 A;  3MR7 A;  3CJ5 A;  4DFP A;  2OIH A;  4QYZ J;  2B51 A;  1NZA A;  1N0V C;  4KYZ A;  1SIZ A;  1TL4 A;  1PCA A;  3GG0 A;  4JV2 A;  1VRT A;  4X66 F;  4JB8 B;  5J2N B;  3TJA A;  4AE5 A;  1XC9 A;  3HFK A;  3T5H A;  3I4P A;  1CBK A;  2XMK A;  1EJ7 L;  3B8H A;  4OV1 A;  1S1U B;  4CH1 A;  3H4B A;  1N54 B;  2CFX A;  1KQG B;  2Z2L A;  1UVK A;  3PM9 A;  4UOF A;  5KG0 A;  5KG7 A;  1T03 B;  5DZ6 A;  2VFS A;  4NLY A;  1R8H A;  2KZM A;  2CPE A;  1UEV A;  2ZOM A;  3V6D B;  1FXD A;  3GFY A;  2X1A A;  2UUA J;  1I51 B;  2XMM A;  1R8C A;  1U7L A;  1VLO A;  1U1R A;  1T9U A;  2YTC A;  1RWK B;  3HVT B;  5LT5 A;  1G4C A;  2H1Y A;  1VFJ A;  4N77 A;  1YZ6 A;  4TY8 B;  3R9L A;  3UVJ A;  1DTT A;  1H72 C;  2C3M A;  3L09 A;  3GYN A;  1U6Z A;  2XMA A;  4JI3 J;  5CQG A;  4MKY A;  4JI8 F;  1K1S A;  2MKJ A;  3ZTP A;  4X4U A;  1TKX B;  3UNY A;  5HRO A;  4Z37 A;  4PCQ A;  5J2M A;  4M8L A;  5E41 A;  2PSZ A;  3R7B B;  5LMN F;  5CCL A;  2R8I A;  8RUC A;  1VQN S;  5D8H B;  5BJR A;  1B99 A;  4NA3 A;  3DLL Q;  3AY0 A;  3I31 A;  3VVU A;  1T9Y A;  1OMS A;  2GA7 A;  2FJE B;  3QMQ A;  3LWL A;  2ZDP A;  3CD7 A;  2O01 C;  4ZIT A;  4F7V A;  1LW0 B;  1RAB B;  1FE0 A;  2QLW A;  1WG5 A;  2DB1 A;  2DNK A;  2M2B A;  4J9K A;  3D1H A;  3K8W A;  4NA2 A;  1HBO A;  4YDX A;  5A8R A;  4LFA F;  4RUB A;  3GP9 A;  2R7S A;  1CJK B;  2HFO A;  2KXF A;  4Y3C A;  4C7Q A;  5HQ8 A;  3K57 A;  4FF1 A;  2EC0 A;  2XGP A;  4N47 A;  4DUY J;  1C4C A;  1KDN A;  1CG2 A;  1GX5 A;  2GS8 A;  2BA9 A;  2M52 A;  1FRX A;  1T9W A;  2VBY A;  4CWB A;  3OQ2 A;  5JMN A;  2XB2 D;  2RE1 A;  2E5G A;  3GIM A;  3G8T A;  3AQO A;  4DX7 A;  1RTH A;  1TL7 B;  2BJ1 A;  2GIR A;  2W01 A;  3KUG A;  4JP8 A;  4PAA A;  1RI7 A;  3N6M A;  3V81 A;  1UJ5 A;  2DIU A;  2J8S A;  4JI1 F;  3JTN A;  5EWG A;  4EBC A;  4K0K J;  1A9N B;  1UFW A;  1D0E A;  2ROG A;  1ELO A;  1SI9 A;  1T9X A;  2OPR A;  2CWX A;  3IBF B;  4RNH A;  5LXY A;  3PIP Q;  4KPY A;  3POT B;  4C8N A;  3JQJ A;  3WIU A;  3HI9 A;  4ES2 A;  1GMU A;  2Z2M A;  1AYE A;  2GX8 A;  3LOU A;  3D6F B;  3TAM B;  2UXD F;  2DH8 A;  3IMQ J;  3V4I B;  4Q2M A;  3N79 A;  3ZZR A;  1SXL A;  2YX1 A;  2BKP A;  5D4P A;  1PYS B;  5HAT A;  1O5J A;  3W2W A;  1HAR A;  3DM2 B;  2VC1 A;  2P6T A;  4HHH A;  5HJY A;  4DQI A;  1L3S A;  3UN2 A;  2G2Z A;  5GAD U;  4PYD A;  1HNV B;  3SCI E;  4DV7 J;  3AD9 C;  4EYH B;  1RLD A;  2HPU A;  3DXB A;  1IKV A;  2QLX A;  3NWR A;  4DBQ A;  4PRF A;  2X1F A;  4GVL A;  2X3G A;  1IKY B;  1LOU A;  1IXK A;  2A3J A;  2AW0 A;  4PQA A;  2DVI A;  3DLB A;  1FFW B;  2LMI A;  3HT3 A;  1MU2 A;  2QSW A;  3M6V A;  1HNW J;  3HD1 A;  4KH1 B;  4KFB A;  5F8M A;  2HIQ A;  1G7C B;  3C16 B;  3IR5 B;  2Z2Z A;  2KFN A;  4EO6 A;  2BAB A;  4ZVO B;  4IH6 A;  4RZR A;  4M5M A;  2BXJ A;  4J9U E;  4B3R F;  1X4B A;  4DI6 A;  1MG7 A;  4OZ5 A;  4C11 A;  5BXI A;  1S6U A;  1BGX T;  2V0N A;  3FGV A;  3S1T A;  3TP2 A;  5KT4 A;  3H5Y A;  5ETK A;  5I3P A;  2W9A A;  2B4P A;  1S0V A;  4KKO B;  3FSX A;  3H20 A;  2KXH A;  1U49 A;  4LMZ A;  2BKO A;  1NO8 A;  1WC3 A;  2DEJ A;  3LP1 A;  3EGW B;  4IO9 Q;  3OJU A;  2QJ3 A;  2PEB A;  1GX6 A;  1FJG F;  1S7I A;  1B64 A;  1LWX A;  1VBY A;  3QFW A;  3S7R A;  5GMK a;  4ZVQ B;  1IBC B;  2XMU A;  5DLG A;  3BRE A;  4E98 A;  4TLR A;  1RTJ B;  2EKY A;  5HJX A;  3W60 A;  5KT2 A;  1S4E A;  4X4S A;  2ZD1 B;  3ENV A;  1FRJ A;  4KO0 A;  1J5E F;  2J6T A;  4WBF A;  4JOU A;  5LJ5 Y;  1KLN A;  3SDE A;  1FEH A;  2W7O A;  3QGP A;  1KVI A;  3O44 A;  3B54 A;  5HMW A;  3RB4 A;  1T94 A;  2HBQ B;  3MEE B;  4CLP A;  5F8I A;  3OSN A;  1OY8 A;  4HLB A;  4ZCK A;  1VQM S;  2ZBQ A;  3DLE A;  3JAM U;  2IBK A;  3KHR A;  1HBN A;  1OO0 B;  1E6Y B;  5E2Q A;  2MHN A;  1LWF A;  2CNN B;  2I5J A;  3NLC A;  2QMW A;  2ZBP A;  4LVN P;  1KFD A;  3EPG A;  1TFY A;  2LU1 A;  4JV0 A;  1S76 D;  3RB6 A;  5DRK A;  4ZPD A;  2JFD A;  3GSD A;  1QUP A;  4LRE A;  2OPP B;  4NLO A;  3MMC A;  3ETO A;  2HHP A;  1MWZ A;  4IFV A;  5AJ3 J;  4N76 A;  2ZBI A;  3OVA A;  1FNM A;  4K0K F;  1T9V A;  4IQM A;  4PWW A;  5BYR A;  4ID8 A;  4PZV A;  2BYC A;  1XN9 A;  3V2U C;  4CYU A;  3MOJ B;  4L3N A;  4G1P A;  2ZVI A;  4UZC A;  2VA2 A;  1XIQ A;  2MPU A;  5M2U A;  1FFG B;  2V50 A;  5CD4 H;  2HNZ A;  4F3Q A;  1MWY A;  4DN0 A;  2UUB J;  2B5J B;  2DHH A;  1JX4 A;  4MJK A;  2YQ3 A;  1FRM A;  1ZM3 A;  2QV6 A;  2RUS A;  3TO8 A;  2O3D A;  5IM0 A;  3VGS A;  4URQ U;  2ILZ A;  3QAE A;  2EFN A;  2FC8 A;  2KYX A;  2RIJ A;  4TU8 A;  2H3E B;  3CCW A;  5B0A A;  2FLP A;  4WK1 A;  1DRZ A;  4WXO A;  4ZN3 A;  3OLB A;  3S6E A;  1EZZ B;  4K4Z A;  2AHO B;  3A8K A;  2OJ3 A;  2KRR A;  2V4R A;  3IRX B;  1UEK A;  2CNL B;  1IWG A;  4IR9 A;  2GO9 A;  5ETM A;  4DV3 F;  4Y65 A;  1N33 F;  1NJI T;  1OPI A;  2AYG A;  1K9M T;  4A4J A;  1BQM A;  2VU5 A;  4OHV A;  1UJ6 A;  2HK3 A;  3CDA A;  3CJ2 A;  4F4X A;  1L3U A;  1LWC A;  4IUF A;  4J9N A;  4OYW A;  4LF7 J;  2OGU A;  2XS2 A;  4LUB A;  2XSJ B;  5KFY A;  3MAQ A;  3P45 B;  1HPZ A;  1JLA B;  1WKJ A;  2RVJ A;  2CAD A;  3LGM A;  2OUG A;  4ED6 A;  3QT7 A;  4FVC A;  5D4L A;  4F04 B;  3TI0 A;  5F0W A;  2F3J A;  4UUX A;  5C24 A;  1DAR A;  5T7L A;  2VG7 A;  3H0P A;  4RL1 A;  2B9E A;  4RW6 B;  4ZP6 A;  1SJ4 P;  1PYO B;  4G3I A;  2XC9 A;  4XPE A;  4IFY A;  2LQJ A;  4C3M A;  3GV7 B;  2FHJ D;  1U4B A;  1QSY A;  4KQZ A;  2F8M A;  2B4V A;  2JFK A;  2XWX A;  4AXJ A;  2IPO B;  2M7S A;  4TVA B;  2R2T A;  2XY7 A;  1H38 A;  4NXN J;  4GO7 X;  4LR7 A;  5F9L A;  1Q95 G;  3R8Y A;  2FJW A;  2V63 A;  3TVY A;  3PR5 B;  4K4S A;  4UY8 5;  1RWM B;  3T6J A;  1WNE A;  1B7Y B;  5HP1 B;  4I69 A;  4RW8 B;  1LWE A;  1RT4 B;  2BBE A;  2LQB A;  3FEZ A;  3K2Y A;  1TK8 A;  1HI1 A;  5HVH A;  4DV1 F;  3OVS A;  1M1H A;  3RAM A;  4DPU A;  5KG6 A;  3GE9 A;  3NS5 A;  2BUN A;  2Q6B A;  4I7F B;  2FY8 A;  2DKO B;  5FII A;  3H42 A;  4AXI A;  1G3O A;  1NUE A;  1Y10 A;  1MWQ A;  1JLC B;  2RQM A;  4M5K A;  1I6J A;  4C8M A;  1UA1 A;  1IBM F;  3GIK A;  4ZVG A;  3MEC A;  2N4D A;  1WEY A;  2HVZ A;  3KK3 A;  1OY9 A;  2GQC A;  3TUI C;  1RDR A;  3NG8 A;  3VAK A;  4X65 J;  1QAJ A;  4RW6 A;  5B08 A;  5CAA A;  2KT2 A;  2APO A;  1H3D A;  3RG6 A;  2GCF A;  3JYT B;  2PMW A;  1AW0 A;  4DG1 B;  2FDN A;  2DEI A;  2HBR B;  1RWV B;  2BVZ A;  2QLJ B;  2YQ0 A;  1C1B A;  1LNQ A;  2ZH6 A;  4ECR A;  3J80 U;  3T3F A;  2WCX A;  3ZZY A;  2GVZ B;  3ZO7 A;  2QFJ A;  2COL A;  1NH7 A;  3DU5 A;  5A8K B;  4FXD A;  5ETP A;  2B8P A;  3MCM A;  3TW0 A;  3OHA A;  4ZPW R;  2OPR B;  4DR4 F;  2AEJ A;  2DNL A;  1OY6 A;  3MXH P;  3I9Z A;  1ZM4 A;  4NLD A;  1J27 A;  1KHW A;  1KC8 T;  4WFX A;  2HGL A;  3IG1 B;  2DGU A;  1YJN S;  2CYY A;  3IP0 A;  2NCK L;  5ETN A;  2UU9 F;  1KON A;  1S1T A;  1GT8 A;  2YNG A;  4HAC A;  2W2N P;  2XS7 A;  3FMW A;  3HSD A;  2BV3 A;  2VG5 B;  3AHP A;  2R2R A;  2JEG A;  3FEY B;  4UST A;  2EVZ A;  2MYF A;  3KDN A;  2EBG A;  2UU9 J;  1KTQ A;  1XR5 A;  3GQC A;  4JUZ A;  2WB1 D;  2DNG A;  3OL8 A;  1UWB B;  5B0C A;  2BOP A;  2B5J A;  4ZP9 A;  2YKN B;  3TZW A;  3HHE A;  1NND A;  4QBU A;  4ZIV A;  3BQ0 A;  2ATC B;  3HHN B;  1U2R A;  5D3G B;  3OV7 A;  3CD6 S;  3SFG A;  4C97 A;  5JXS A;  2EPI A;  5HQM A;  3EPI A;  3CME S;  2DGO A;  2Y1R I;  2YKM A;  3CT9 A;  1X31 C;  3MM6 B;  4DV1 J;  2GMH A;  4DL5 A;  1XMQ J;  1VC6 A;  2JJ4 D;  1FD8 A;  3ET6 B;  3CJ4 A;  2L08 A;  5AXM A;  3SQG B;  4IG3 B;  2MGZ A;  1SIW B;  3D1O A;  4K4Y A;  2UV8 A;  2AJQ A;  4DUZ F;  1Q5Y A;  4HVZ A;  4A8W A;  4JYA J;  2XY6 A;  4XK8 C;  3FKB A;  1C2P A;  4ECW A;  1SV5 B;  1QLN A;  3MR2 A;  3NGK A;  1SC6 A;  4S0M A;  3MPD A;  4RW8 A;  2E9T A;  5IT9 Y;  2DNP A;  1RAH B;  2DIT A;  2GAH C;  1RTI A;  3Q86 A;  1U6B A;  3Q8P B;  1PIE A;  2F4F A;  4NRT A;  3OLA A;  1UJ4 A;  2DGT A;  2IMW P;  3BDP A;  3DMJ B;  1J5O A;  1RAD B;  2HQD A;  1MN7 A;  3ILI A;  3MCN A;  3MM8 A;  3PX4 A;  1I1G A;  1HNV A;  3FBE A;  3Q24 A;  1KSP A;  4KTQ A;  3PIO Q;  2J0S D;  3N01 A;  1KP6 A;  2IAJ A;  4A8M P;  3G96 A;  2NRE A;  4I4B A;  3HK2 A;  4F36 A;  1U8W A;  2GJF A;  5BR8 J;  1Y7P A;  5L1J A;  2VFU A;  1WHV A;  3OFE A;  4KV8 B;  1FT8 A;  2WVC A;  3MUV P;  1WC5 A;  4NML A;  3PYG A;  1S1U A;  4PWD A;  2H65 B;  4BS2 A;  1IM6 A;  1R27 B;  1ZA1 B;  2HVD A;  2IRU A;  4NOH A;  4JI2 F;  4CLU A;  3BJY A;  3GFZ A;  3TUP A;  3OHB A;  1QSL A;  1FDN A;  3E01 A;  3AJ1 A;  2JEF A;  2BAC A;  3CJT A;  4NYP A;  1SQG A;  4FXV A;  4KKO A;  4R5P B;  3JQK A;  4CO5 A;  3KK1 A;  2KXN B;  3F44 A;  4P74 A;  2JEJ A;  1U45 A;  3T19 A;  2FC9 A;  3OUY A;  2CQC A;  1S0N A;  4V19 X;  2ZJQ Q;  2G0C A;  1RXO B;  4HI1 A;  1VRU A;  4KB7 A;  4OHW A;  2QT7 A;  2HHW A;  3PR4 A;  1WF1 A;  1WC1 A;  1HMV A;  1SVD A;  3KJF B;  1TKX A;  1CS4 A;  1N0U A;  1YK9 A;  2JLF A;  2IA0 A;  3NKY A;  4HI2 A;  3ZNJ 1;  2QL7 B;  4DN9 A;  1GK8 A;  4XAK A;  2BAN A;  4Z7C A;  4CH0 S;  4CIO A;  4ED3 A;  3TAQ A;  4L73 A;  4OI0 A;  2Q1L A;  4CLF A;  1B3T A;  4L76 A;  1VYA A;  5KFO A;  3RRH A;  3N0V A;  2BJ7 A;  5IV4 A;  1UVL A;  2CG4 A;  3MAA A;  2YKA A;  3H5S A;  3BSA A;  4CO3 A;  2I0X A;  4K2J A;  4EUV A;  1NM2 A;  4UOH A;  4YN3 B;  1RA6 A;  1HHT P;  2MHE A;  3DM2 A;  4A47 A;  1X5T A;  3BSO A;  1NDK A;  4Q0B A;  2J0Q D;  4ZJQ A;  4DQS A;  1FRL A;  2MZQ A;  1NJX A;  3CIZ A;  1UKU A;  1HD0 A;  1MSW D;  3MED A;  1Y9O A;  3QO9 A;  3VVT A;  4OX7 A;  2MQP A;  4ED2 A;  1RT7 A;  4AL5 A;  2JLE A;  3C6U A;  1YBT A;  5KFS A;  5J2P B;  2C1E B;  2R4F A;  4KGM A;  5HRO B;  2BEF A;  2J76 E;  4C3K A;  5JUM A;  2OD6 A;  2WK4 A;  4WII A;  2F4V J;  3P49 B;  3LP1 B;  5D0G A;  4CCH A;  2FHJ A;  5DGA A;  3PVX A;  1WOR A;  2ACM A;  2R8G A;  2BKN A;  4CLZ A;  3UNG C;  2CZ9 A;  2PE8 A;  2X1G A;  2W4C A;  3TVZ A;  4J9O A;  2DR5 A;  1P8G A;  3AOC A;  1VBX A;  1XMQ F;  4H4O B;  2BM1 A;  5KFR A;  3HVR A;  1W2I A;  1XNR F;  3P5B P;  5AE3 A;  1S79 A;  2C2D A;  2B6A B;  2CZ4 A;  1WF2 A;  2FJD B;  3EVM A;  2VIH A;  3EMT A;  3MEG B;  3OXL A;  5DDP C;  1ZOT A;  3GII A;  5IM0 B;  1X9M A;  2UVR A;  3VGT A;  4YB7 A;  2CJY B;  1QAX A;  3S01 A;  3Q8U A;  1Q1K A;  5H1S V;  4J9L A;  3D68 A;  1VIO A;  4IOB A;  1HNI A;  4BC9 A;  1YJ7 A;  3DRS A;  2AYB A;  3H4D A;  5GAD I;  1CUL A;  4RO0 A;  1VRT B;  3R3T A;  3IWL A;  4U95 A;  3BF4 A;  4F4W A;  3PJW A;  3R6G B;  4I6W A;  1XER A;  5M2P A;  1C0U B;  1FER A;  2HGN A;  1VI7 A;  2P9C A;  4GKJ F;  2CAJ A;  1U1N A;  2W9C B;  1LQ9 A;  2V2V A;  2JHE A;  3CDU A;  4J9S A;  1PC5 A;  5C7P A;  2FY1 A;  2A2C A;  2JL9 A;  2GZO A;  2KHD A;  3BO3 A;  4U7U D;  4O0N A;  3BH6 B;  3VAM A;  1BQN B;  2VOP A;  2POK A;  1Q16 B;  4LQ3 A;  2ROE A;  3PW5 A;  1HA1 A;  1H98 A;  3ADA C;  4HH1 A;  3OTE A;  1DTT B;  4NMX A;  2DRB A;  1UW4 A;  4JI2 J;  3I4H X;  1FX2 A;  3DDN A;  1TL3 B;  4ECQ A;  3ZNU A;  1UL3 A;  1S7H A;  3BPS P;  4MIA A;  4A8K A;  3PX6 A;  4ANE A;  1XMO J;  1FK9 B;  5KG5 A;  2E5I A;  1CVJ A;  2RRA A;  1FI4 A;  2CJB A;  5E3C A;  4LRF A;  3UE2 A;  2BJ3 A;  2HHH J;  4B9V A;  3NL0 A;  2UXC J;  1S9E A;  1HQ2 A;  5KFZ A;  3UFC X;  2J0X A;  1L3T A;  2IVY A;  4WWS A;  4UTG A;  1WF0 A;  2DHA A;  2BDP A;  2FYX A;  3BM7 A;  4RW7 B;  4R25 A;  1SKR A;  4XIU A;  2R7U A;  4Q5V A;  1F5B A;  1AUS L;  4LSL B;  4WK3 A;  5HMY A;  3EZ5 A;  3KDO A;  2NZC A;  3W61 A;  2MZR A;  5D0R A;  2HLU A;  2R9L A;  2UVW A;  3NAH A;  4HTJ A;  3W7B A;  2CPF A;  1SC3 B;  4UUW A;  3ELH A;  1T05 B;  2DNO A;  2RU9 A;  2C42 A;  2VA3 A;  3RRK A;  3NOC A;  1RAJ A;  1RT2 B;  3B82 A;  1U1K A;  3MM5 B;  2NXU A;  5KFT A;  2GGP A;  1CJV B;  1WWH A;  5C2G A;  2CUY A;  2B6A A;  2XI2 A;  2W4D A;  1QUV A;  2CPI A;  3I5B A;  3W9H A;  4Q8E A;  4JI5 F;  2DR7 A;  3CWJ A;  4F0H A;  3OUY B;  1NB2 A;  1KQK A;  4QWD A;  3UCZ P;  2VC0 A;  4A48 A;  1R0B G;  1Q81 T;  2LP4 A;  4FKY A;  2FHO B;  1B0P A;  1VS3 A;  4M5I A;  3LWM A;  2C3Y A;  3DI6 B;  3W9J A;  1X9S A;  3PRB A;  2DTJ A;  1RK8 A;  2ZZM A;  1T3O A;  4NPO A;  5KFP A;  2ZOG A;  3H7H B;  3GPA A;  2DRD A;  2HGM A;  1TL5 A;  4BCA A;  4WTO B;  4UY8 T;  3LTO A;  3I0R B;  3HP6 A;  2RF2 A;  3EDQ B;  4PKD B;  4ECS A;  4P72 A;  2HK2 A;  3FFI A;  4CTA A;  4KGX B;  2J9C A;  2FJX A;  2A1B A;  2B4O A;  4Y28 C;  2JDJ A;  3CTR A;  3MM8 B;  2DGV A;  4NA1 A;  1AA1 B;  2GHV C;  3GIJ A;  1HQU A;  1FFS B;  1RQ0 A;  1TL3 A;  4OI2 A;  1ZTW A;  2G1D A;  2B3T B;  4E8U A;  2LU2 A;  1FWP A;  3FBC A;  3HKZ D;  1Q8K A;  3K59 A;  4KT0 C;  5LJ3 Y;  2YKQ A;  1RAG B;  1TZ0 A;  4I2Q B;  5CYQ A;  5IOL A;  4TQR A;  1SJF A;  2HKE A;  4RW4 B;  2OEL A;  2DCL A;  1XTZ A;  1TQL A;  2WHO A;  3GB0 A;  3D28 A;  5DDQ C;  3NS7 B;  3R27 A;  4OI3 A;  2E5H A;  3CDE A;  1WG4 A;  3UWT A;  2DIV A;  2W2P P;  3J7Y I;  1M90 T;  4ELV A;  3P8B B;  1K0V A;  4D3H A;  2HAI A;  2NYH A;  3IR6 B;  5A0Y A;  3UR3 C;  3OFF A;  2W9C A;  4RU9 A;  1LKZ A;  2L48 A;  3H2U B;  2RS2 A;  4C8K A;  5HAN A;  2FGC A;  4PPZ A;  5DG9 A;  2L9W A;  3OR1 A;  5A8W B;  1BUX A;  2ZUG A;  3CCZ A;  2EFQ A;  1WHX A;  1H74 A;  2FTR A;  2RHQ B;  4YP3 A;  2XCA A;  1URN A;  2IJR A;  1N6Q A;  1Q8L A;  3QT5 A;  1F9F A;  2HQC A;  2FJV A;  4OYB A;  3M1V A;  1NPK A;  3PYD A;  5KT3 A;  2DHX A;  3T1Y F;  2C2M B;  4DU7 A;  2QLF B;  4FZV A;  3ULH A;  3NGD A;  2IFX A;  4I64 A;  3Q0A A;  4A8S A;  3CUN A;  3O1L A;  4FF2 A;  1WDD A;  1HW9 A;  3M32 A;  1M5K C;  3ILO A;  1SQE A;  2V2Q A;  5FDL A;  1RU1 A;  4H4O A;  4NXN F;  2DXF A;  2ZNZ A;  1FK9 A;  4OX8 A;  3A12 A;  1FRH A;  2HG4 A;  4ZHR A;  4B3M F;  2CPY A;  3C66 A;  3JS9 A;  1U1P A;  1KS2 A;  2O1P A;  1RTI B;  3UD3 P;  4O3S A;  3Q2T C;  4CZC A;  3PYF A;  1SH0 A;  2VFT A;  3J7A N;  2HZA A;  2R7T A;  4QR1 A;  5KFU A;  3G82 B;  3GCX P;  4QIW D;  3JSB A;  2KT3 A;  1IQZ A;  3GG1 A;  4ZPB A;  4DZ6 A;  2VQE J;  4IOC Q;  3W5X A;  2J6U A;  1WEL A;  1XJW B;  2L3M A;  3F41 A;  4N7T A;  5E3P A;  2XZW A;  5FD1 A;  4TU7 A;  1K0T A;  4DMZ A;  3L7O A;  2R8H A;  4Y00 A;  1RJJ A;  3MHY A;  3JYT A;  3IAS 9;  2KL8 A;  3HPO A;  5ETR A;  3OTC A;  5C5J A;  3VHQ A;  1KNZ A;  2ZNY A;  3NY0 A;  3AQP A;  3CSK A;  5HLF B;  2CQB A;  1PG5 B;  1N48 A;  1KD1 T;  3PKY A;  1QD1 A;  3DKD A;  1XBW A;  2QMX A;  4O0I A;  4QIF A;  1NSA A;  1S9G A;  1E6V B;  3HHL C;  4USV A;  4IDK B;  3BKT A;  3DDI A;  4JI0 F;  5SUH A;  2WRM A;  3MMB B;  1K44 A;  2NR0 A;  3CC2 S;  1Q7Y T;  2BQR A;  1HNX J;  4KGZ B;  3LP0 A;  2GV1 A;  2UVU A;  4ELT A;  1F9H A;  2HBZ B;  4PXE A;  1PC4 A;  1T95 A;  1X60 A;  4IQX A;  2OMO A;  2HHQ A;  2HRT A;  3T6B A;  1YGY A;  1RT2 A;  4O4G A;  4URG A;  5DM7 Q;  2DPJ A;  1WJ9 A;  1UZD A;  3KLG B;  4BHQ A;  1NJZ A;  3FJ2 A;  2KG1 A;  1FHT A;  2V67 A;  3KUE A;  4KR0 B;  3KHG A;  5K14 B;  3CPW R;  2YH1 A;  1VJW A;  1RA7 A;  1Y11 A;  4X2B A;  3E2E A;  2C2N A;  2HFN A;  4ZLJ A;  3IWX A;  2E44 A;  2I6W A;  2YWK A;  4J91 A;  3TA0 A;  3CCM S;  5AJ3 F;  3FSY A;  2BR0 A;  2XYH B;  1D09 B;  3BN7 A;  1AUD A;  1M1K T;  2QTW A;  3QYY A;  4LF1 A;  4ES3 A;  1NKC A;  3IS9 A;  3QRR A;  4PQU A;  1AZS A;  1OIA A;  3US5 A;  3RB3 A;  2M0G B;  3N5B A;  5T14 A;  3QT6 A;  1KLM A;  2M4M A;  2MMY A;  1RT1 A;  2K3K A;  5F8G A;  3KLH A;  3T1H F;  3ILJ A;  3AT1 B;  2D41 A;  4ZVP B;  3BB5 A;  1RAF B;  2WTF A;  2V6A A;  4B3S J;  3KHL A;  1IJF B;  3LPE A;  4CO4 A;  4V19 J;  5DO2 A;  3R2C J;  5D4N A;  4B3M J;  3SSS A;  1IR1 A;  1K47 A;  2ZBC A;  2FVR A;  1IKW B;  2WB4 A;  5DET A;  5B0B A;  2CQ3 A;  3L7P A;  4LJM A;  5ETV A;  5IZH A;  4ERD A;  1NPP A;  1RT7 B;  4OLO A;  1KTV A;  1RT4 A;  4IH5 A;  2ZH7 A;  5RUB A;  3ET6 A;  4F4Z A;  4ZLP A;  4IOA Q;  4J9V A;  1YSJ A;  3M2U A;  2ZC3 A;  1N34 J;  4PAB A;  1JJC B;  2PFF B;  1BWV A;  3CCU S;  2WOM A;  2N3O A;  5KFV A;  1FEE A;  3L3C A;  3D3C J;  3QGI A;  3P96 A;  3MAH A;  1CUL B;  1FNO A;  4ZVT B;  1N5Q A;  1RTD B;  3ENW A;  4QR2 A;  2F8H A;  5AT1 B;  3VGU A;  3HUL A;  1K8A T;  3CC4 S;  4FVM A;  1NK5 A;  1EP4 B;  2U1A A;  1S12 A;  1F3F A;  1SJQ A;  2D9O A;  2MQL A;  2RH3 A;  2PDA A;  1AB8 A;  3I9V 9;  1UWB A;  4TLQ A;  2HFU A;  2QMU B;  3Q8Y A;  3H98 A;  3BS9 A;  3MEG A;  4F2S A;  2ZIT A;  1HPZ B;  3CCE S;  2E1R A;  1U6F A;  3BO2 A;  1DZ5 A;  1GH8 A;  4J37 A;  1IBK J;  2VG5 A;  2HFZ A;  2V2K A;  1N5T A;  5H9F J;  1TV6 A;  4QW9 A;  1L5U A;  4K8R A;  5IS2 A;  3TYT A;  2ZE2 B;  2VQF J;  3GFH A;  3BSC A;  3FDS A;  2WVD A;  3MR5 A;  3MZI A;  1RTZ A;  4KBI A;  4Y2K A;  1S1V B;  2RHS B;  3BYP A;  3DN9 A;  1L3V A;  2CJ9 A;  2MQ8 A;  3V6H A;  1J2V A;  4FYY B;  5ETQ A;  5J1E A;  2K7K A;  4U8V A;  2AU0 A;  4F8R A;  4I6Y A;  3C8Y A;  1Y3K A;  2XGQ A;  1M5S A;  2CPJ A;  3DOM A;  1KEK A;  2GVZ A;  3FUY A;  2HWT A;  4JI0 J;  2LFV A;  2LXI A;  1KVK A;  1RGV A;  2VPW B;  4KO0 B;  3MED B;  2Z58 B;  2MZJ A;  2ZD1 A;  3TX0 A;  2HFV A;  2W7P A;  4X4P A;  4USW A;  1TKZ B;  3PJ9 A;  2YPZ A;  2ZBR A;  3TZZ A;  1RUS A;  3HFZ B;  3MI7 X;  1X7V A;  4K5R A;  3DLG A;  2YWH A;  3SBM A;  4DV3 J;  1UW9 A;  2L9D A;  4O3Q A;  3MR3 A;  2XMJ A;  1M0S A;  4DV4 F;  1H2V Z;  2ADB A;  3BYR A;  2N7C A;  2YWF A;  2YPY A;  4CLS A;  3M8Z A;  4MYT A;  3PV8 A;  4KGV B;  4CYU B;  4URS A;  1BMQ B;  3SIP B;  4HKQ A;  3J7Y U;  4DF4 A;  3DHX A;  2KT5 A;  5CCM A;  3NOG A;  2HWH A;  5IQQ A;  1JLE A;  2V4J A;  2AEM A;  3T9N A;  4ZK7 M;  2C2R A;  2HHU A;  1RLC L;  1FE4 A;  2ZHO A;  1FDA A;  1FKP A;  2OPP A;  4ZLN A;  4C4W A;  1S48 A;  2IM1 A;  2XYG B;  3EYZ A;  2IDE A;  3PXG a;  2HUR A;  1NJW A;  1AFI A;  2A18 A;  4KFB B;  1JWW A;  2MJN A;  2K8G A;  2I5J B;  3BH7 B;  4DPX A;  4MK8 A;  3EGZ A;  2YKM B;  5K5M A;  5IWA J;  4EZ9 A;  4LIR A;  4C8L A;  1JLB B;  3R5B A;  4EEY A;  1VQ6 S;  2VG6 A;  1RWP B;  2HNZ B;  5BR8 F;  2NZ4 A;  2ZH1 A;  2DR6 A;  3QZ8 A;  3D9B A;  1BE4 A;  4F02 A;  1RE1 B;  3O2I A;  8ATC B;  4OMF G;  1U1O A;  4D3G A;  4FS1 A;  1KRP A;  1YIJ S;  1YKW A;  2YKN A;  3W2W B;  3TRG A;  2GJ2 A;  4MFB B;  1HKA A;  4X62 J;  1YJR A;  1VQP S;  2AD9 A;  4F25 A;  2SXL A;  3HFV A;  5HI7 A;  5KG2 A;  3RW6 A;  4OLP A;  4QPT A;  2XMW A;  5CYM B;  3MUR P;  1S0M A;  3GR0 A;  3KLE B;  2PI4 A;  2DNR A;  2QA4 G;  3WDO A;  4UZB A;  3MWB A;  2XM3 A;  4JI7 F;  2IC3 B;  1RKI A;  2Y1J A;  1BQM B;  2WBR A;  2VIC A;  4USU A;  2MTL A;  3OR2 A;  4USJ C;  2OLW A;  2Z30 B;  1YWX A;  2V8P A;  3HLU A;  2GHP A;  3KWM A;  1ZBT A;  2MZ1 A;  4J9R A;  2I38 A;  4WU3 A;  2R8J A;  3BBC A;  5F8N A;  1FO1 A;  3M05 A;  1MW7 A;  3M4X A;  4AL6 A;  4IG0 B;  1HHS A;  4DSE A;  1D9F A;  1DBD A;  4WFY A;  2V4J B;  1UCN A;  1EKR A;  4DQQ A;  3TWZ A;  1FJG J;  1HBU A;  3V5R A;  4AQY J;  4E0D A;  1TEL A;  4EBE A;  4P73 A;  1KKH A;  1KFS A;  2ZJP Q;  3MM6 A;  4WFZ A;  3I0S B;  1FKO A;  1SB6 A;  3KG0 A;  2DCU B;  3ISN D;  5H9E K;  5KTQ A;  4UT4 A;  5U47 A;  1ITP A;  2FHK A;  2MKI A;  2XQC A;  4QPX A;  4U8Y A;  3HO1 A;  2V8D A;  4HHU A;  5DM6 Q;  3GWC A;  3M9N B;  2C28 A;  3Q23 A;  5HN0 A;  4DUY F;  3N9U C;  3TEH B;  3MF5 A;  4RUC A;  4XDD A;  5KOW A;  4DV2 F;  2AX1 A;  3KUH A;  1VIS A;  4QW8 A;  5A2Q U;  3CUL A;  2CQ1 A;  3CMQ A;  5T7L B;  4F26 A;  1SL0 A;  4G65 A;  3T5L A;  5DS7 A;  2OEM A;  5GAH I;  2EW9 A;  4GO5 X;  4OJ3 A;  5KFA A;  4Q45 A;  4K2X A;  5CA5 A;  2FLN A;  3VQS A;  3PTW A;  1WC4 A;  3IFE A;  1YZ7 A;  2AGQ A;  2E5J A;  3M8P B;  4M5L A;  4MKV A;  5I4M A;  2Q6C A;  4XO0 A;  4ECX A;  3BEG B;  1IR0 A;  2LXF A;  3UN3 A;  1TAU A;  1XK8 A;  3HD2 A;  4DR1 F;  2J9E A;  2MDA A;  5DGB A;  2B43 A;  2KHC A;  4DL7 A;  4C0H A;  1HBN B;  2MY7 A;  2ZEJ A;  4F0K A;  3D0I E;  3HM9 A;  3AJ2 A;  2ASD A;  1YI2 S;  5IV3 A;  2WVE A;  3EWG A;  5HLF A;  1U2F A;  1BLU A;  1BY9 A;  4FYV B;  4KC5 A;  5KFC A;  5GAE U;  1NK4 A;  2PN6 A;  3A13 A;  3N6L A;  5A76 A;  1ZPW X;  4ED7 A;  4PQU B;  3GV8 B;  3MD3 A;  3K5L A;  2D74 B;  5B0D A;  1OS5 A;  1T03 A;  2CPD A;  2FVQ A;  2VPX B;  3UDV A;  2YWE A;  3D6H B;  4WTY A;  2B9X A;  3BGR B;  2CDQ A;  2H51 B;  2OHD A;  3RZA A;  1WKK A;  3HKW A;  2KM8 B;  3BSN A;  2UP1 A;  4HH0 A;  4LF4 F;  3BZQ A;  2E9R X;  3QZ7 A;  3Q8V A;  5KFN A;  1S97 A;  1WOS A;  2DO4 A;  2Y8Y A;  2VG6 B;  5BYQ A;  2R7V A;  3NMR A;  1FJE B;  5EDW A;  3D4J A;  3QAU A;  2GIF A;  2IM0 A;  3HF5 A;  4P7T A;  1S1W B;  2JX2 A;  4KIA A;  3LH2 S;  5E5N A;  3PX0 A;  2HHH F;  1F5A A;  1YJ9 S;  1C0T B;  3PO4 A;  3NGS A;  2YNH B;  3BGO P;  4Y2C A;  2ALY B;  7AT1 B;  1WEZ A;  1X4A A;  1YJT A;  5F41 A;  1GQE A;  4NXM F;  2E1M C;  2G9O A;  1Y00 A;  4IRD A;  5D0E A;  4NLR A;  1F60 B;  2H9Z A;  4A46 A;  1MU2 B;  1MNE A;  1XMB A;  2Y0S D;  1DY3 A;  1T02 A;  2J7U A;  3C15 B;  4CLW A;  4DLG A;  2ZOF A;  1OQ6 A;  1IKY A;  4IYQ A;  4NAS A;  3R7N B;  4JI7 J;  2HND A;  4F2R A;  4NI2 A;  2Y3Y A;  2VZ9 A;  5GME A;  3DLG B;  2HIY A;  2AMC B;  4PXB A;  4C2M A;  1P27 B;  4TXS A;  2E9Z A;  4IH7 A;  5FLX Y;  3V6D A;  1UFL A;  4DR3 J;  4RW7 A;  4FYD A;  3G8Q A;  4A8O A;  2EBE A;  4I56 A;  4ZCI A;  3OW2 R;  4MKB A;  1KHV A;  4LFC J;  4ZVS B;  5J2N A;  2MST A;  4LR8 A;  4TU9 A;  1U47 A;  5D15 A;  1YBA A;  1B7F A;  1S1X B;  4DXL A;  3KLF B;  3RAQ A;  1T3N A;  1SQF A;  4M5N A;  4ZVU B;  4GRS A;  5K14 A;  5C2C A;  1HWJ A;  2HEK A;  4WF9 Q;  4B02 A;  1RHM B;  3FC9 A;  2ZE2 A;  2Y1I A;  3FNN A;  5EWF A;  2HS3 A;  1VOM A;  4LF5 F;  2PII A;  1ULR A;  1DQ8 A;  4OJG A;  1YDL A;  5FDL B;  4MAK A;  3K5N A;  2KJV A;  1ARO P;  2OAU A;  3BBF A;  4DQR A;  2WW8 A;  2Q79 A;  3LO3 A;  1K1Q A;  4I2P B;  4DJB A;  2OEK A;  1RBL A;  3J7A 1;  1V5V A;  3EZO A;  2BE7 D;  1U0H B;  1HQE A;  4DOZ A;  5I42 B;  3BGU A;  1X5S A;  3T1A A;  5A8R B;  3K89 A;  2AJ4 A;  2CJK A;  2ZJR Q;  2J5A A;  3F0N A;  3IBC B;  1NK7 A;  4H54 A;  4LRA A;  5K8P A;  2CRL A;  1UPM B;  4QWE A;  4G1Q B;  1QVF R;  1UEU A;  1YVF A;  2DPI A;  1OPZ A;  4WE1 A;  3AAW B;  3BPD A;  4DCO B;  8AT1 B;  4AUK A;  1UWA A;  2C2Z B;  4WYL A;  4X66 J;  1RYS A;  2UUC J;  5GAG I;  3ZZP A;  4ED5 A;  3DU6 A;  4C48 A;  2ATL A;  3X1L B;  3LAM A;  1HWU A;  2XHC A;  4WJB A;  4MIW A;  4EMD A;  5EHH A;  2J8A A;  5DG8 A;  2MXY A;  3AOD A;  2W9B B;  2D3U A;  4CI0 B;  4CT8 A;  1V3R A;  2GVD A;  2YNF A;  3H59 A;  4LSN B;  2D3O R;  4DR7 F;  2IVM A;  1F9E B;  3FSI A;  3QLH B;  5A6W A;  4DUT A;  4IDK A;  1QY7 A;  1IN0 A;  5K8O A;  1NHK L;  4W90 B;  3J80 Y;  2QZ8 A;  2RD5 C;  3MTJ A;  4LSL A;  4K4X A;  4X4N A;  4AT1 B;  2F40 A;  3RAX A;  2F63 A;  2JC0 A;  1WEX A;  1JKH B;  4KGK A;  2A0F B;  1H2T Z;  2OEJ A;  1UTA A;  2MZS A;  4GKK F;  1HR0 J;  1YQH A;  1GTE A;  1Q79 A;  1ZM9 A;  2OPQ B;  3H2V E;  4O4R A;  4C8Z A;  2DY9 A;  4P2X A;  3O6Q A;  2V8V A;  4ILR A;  4WP9 A;  1NK6 A;  3HMJ G;  4L6V 3;  3W9I A;  2HS0 A;  3E8O A;  3I32 A;  5DQI A;  3OR1 B;  2E29 A;  1HWI A;  3AXK A;  2A6M A;  1S6O A;  3QPI A;  4USH A;  3G6X A;  7FDR A;  2L41 A;  4C3L A;  2EFG A;  1SL1 A;  1NPR A;  1VBK A;  2OP5 A;  4ECY A;  4RNO A;  3D54 A;  5F8H A;  2BW2 A;  3HVW A;  2LEP A;  4JV5 J;  2IDL A;  3TEG A;  3SEO A;  1SC4 B;  3MM7 B;  3NXZ A;  2F9D A;  2Y0B B;  4LF6 J;  3HSG A;  4EU0 A;  2MEW A;  4FNI A;  2M5Y A;  3RBD A;  1SUQ B;  4R8U B;  2UUA F;  3GR1 A;  3CCJ S;  3KLI B;  3N4W A;  1G6B A;  1X4H A;  1T05 A;  2H4W B;  4JI5 J;  2R7R A;  3DGV A;  3NS6 A;  4NLS A;  2K1R B;  1IKV B;  2MQN A;  4O3P A;  4YY3 F;  5CH7 B;  2XCP A;  3OT9 A;  3UW1 A;  4DV6 J;  4NCA A;  2UXD J;  3PRV A;  2HMI A;  5H9F K;  1A7G E;  2AX0 A;  5EUH A;  5L8R C;  7FD1 A;  3JAM Y;  3GIR A;  1T8E A;  4TY9 A;  2UZA A;  1OSD A;  4OZL A;  3V4I A;  2XEX A;  1TR0 A;  4K4W A;  1PAU B;  3ZXW A;  4ED0 A;  5F3T A;  1UA0 A;  2HQG A;  2BMB A;  4YUD A;  5L1K A;  3OSP A;  1RAE B;  1PKU A;  2DGX A;  3HXM A;  1FNX H;  4P71 A;  4RLE A;  5CXT A;  4HTI A;  3QSI A;  2VDI A;  4PWD B;  4I0W A;  3DMJ A;  1J5O B;  2AZ1 A;  3MUT P;  4O23 A;  1HQU B;  2LA6 A;  3LUY A;  4PG4 A;  2UXC F;  2NYI A;  2IMO A;  5LM7 E;  2C3O A;  1S6Q B;  1SUQ A;  2DNZ A;  3BGL A;  4R8U A;  4ZHR B;  2RSQ A;  1Q86 T;  3OL9 A;  4OJ1 A;  4GKK J;  1BQN A;  5ETO A;  4C0O C;  1DLO A;  2NXC A;  3GSI A;  4UQT A;  4ZP7 A;  3SFU A;  3W3S A;  2NXE A;  1UVN A;  3CJ3 A;  2EC2 A;  4ZA1 A;  2VHG A;  5T41 A;  4CNZ A;  2XSF A;  3M30 B;  4DCP B;  4DPO A;  3R1H A;  3WC2 A;  2CKW A;  4RR5 A;  3ZZ0 A;  3SQG A;  4R5P A;  4TKT A;  3T1H J;  4GC6 A;  5C42 B;  3B78 A;  4OJH A;  4Q0B B;  2P9G A;  1F0X A;  3E01 B;  1YLX A;  2RKI A;  3G86 A;  3MUM P;  3A8E A;  3FZ2 A;  4O44 A;  1Q78 A;  1TP7 A;  4RNM A;  2BJE A;  4ZVE A;  5HBM A;  2C3U A;  2VJU A;  1PJ5 A;  1HNI B;  5KFL A;  4JI8 J;  1N52 B;  2PEH A;  3ILL A;  4QWB A;  3IC1 A;  4DV0 J;  3M7V A;  1W7W A;  5G0R A;  2V68 A;  2DNH A;  1JKH A;  2YKP A;  3AB4 B;  1GXL A;  3QID A;  1CS4 B;  5BYS A;  5C25 A;  1R89 A;  4X4R A;  5LMN J;  3MM7 A;  4USI A;  3M8Q A;  3V6J A;  4B3O A;  1FRI A;  4F50 A;  3GCW P;  3JB9 k;  3MFH A;  2FZG B;  2JZ5 A;  2KVQ E;  1S6Q A;  3NGR A;  4B9T A;  2ZKT A;  5EX3 A;  1LK7 A;  2DYA A;  4FPR A;  3W2V B;  2ZH8 A;  1LW2 B;  1WOP A;  4TQS A;  3IA0 A;  1EQ0 A;  2R7X A;  5K9F A;  3IGV A;  2D7S A;  5IXU A;  3NNA A;  2ROP A;  3OL7 A;  2GVD B;  2Z2Y B;  5E3R A;  1SKW A;  1NH8 A;  1B70 B;  2F65 A;  5J2P A;  2A6O A;  2CPZ A;  6FDR A;  4JI1 J;  4QOT A;  5KG4 A;  4KSE B;  4Y2I A;  3I5A A;  4WXW A;  5D77 A;  1TKD A;  3AJD A;  4WZQ A;  3W8G A;  4DZD A;  1M5H A;  2QEX S;  2M3D A;  3I82 A;  2RUG A;  5I3U B;  3Q8Q B;  1LEO A;  2J0W A;  3D3B J;  3DRP B;  4MFB A;  4X84 A;  3TR5 A;  1N8R T;  2W25 A;  5F8L A;  3KMQ A;  1AT1 B;  2AGP A;  4I67 A;  4NZ6 A;  5KFG A;  2K06 A;  3FRY A;  3PCO B;  2V5H G;  3U1N A;  4C0B A;  4N56 A;  3CJK A;  2QN6 B;  3IGN A;  3VAG A;  1SKS A;  3QJP A;  2AJ1 A;  4LBI A;  1R43 A;  4YS2 A;  2CPH A;  2EFV A;  3RB0 A;  2M9K A;  1RU2 A;  3MDF A;  3KJV B;  3TZX A;  4KHM A;  4I2P A;  3AOB A;  3RU0 A;  4JI6 F;  5CAB A;  1U8S A;  2CQI A;  1YRX A;  3FRZ A;  2FUG 9;  4HDG A;  1NKE A;  1JLF B;  1WHY A;  2E7V A;  3DHW C;  2LLZ A;  3EXY A;  1TAQ A;  4I6A A;  4EGL A;  3NCQ A;  1X4F A;  2RS8 A;  4L3K A;  4HR2 A;  5B0F A;  1NZ8 A;  1QE1 B;  1TKT A;  2DY1 A;  2H5E A;  3P3D A;  5KAK A;  2RDJ A;  2FVP A;  2Z4P A;  1WI8 A;  2LDY A;  3FCH A;  2C2E A;  4PR6 A;  5A6P A;  1T11 A;  2GQQ A;  4G1Q A;  1SJR A;  1C0U A;  4NL5 A;  3PHT A;  1FD2 A;  3FK4 A;  3KLF A;  2QIF A;  1JQG A;  3KLE A;  1WSV A;  4DR2 F;  4ICL B;  1VBZ A;  2B7B B;  2J7K A;  4NCB A;  3BBB A;  4PG6 A;  1SJ1 A;  3CCR S;  1XWL A;  2OSR A;  3KOA A;  1G2E A;  1C1C A;  3EZU A;  3ETM A;  2ZZT A;  2HHS A;  2XMT A;  1GMW A;  2DGW A;  2KYZ A;  1VJQ A;  5CZX A;  2DGS A;  4X4T A;  2QA1 A;  2FZC B;  3KG1 A;  3R5J B;  2U2F A;  4NLP A;  3VQT A;  4ETZ A;  2VBX A;  4NI2 B;  4DU8 A;  2CNK B;  1KQS R;  4NWB A;  1H6K X;  1HYS A;  2FJB B;  1S1T B;  2YNG B;  2VDH A;  4HAC B;  3RTV A;  4KRW A;  1PAE X;  4LBH A;  1JMT A;  5HL7 Q;  1EIY B;  4DUZ J;  5L1L A;  2PA3 A;  2EWH A;  3GZ7 A;  2XLJ A;  1WKL A;  3RGI A;  4LRC A;  1D8Z A;  4CQ1 A;  2W2O P;  1TU0 B;  3SMZ A;  5HSP A;  2X7I A;  2ZVS A;  3ITH A;  4RPF A;  1YIT S;  3CJR A;  4RNF A;  4OZJ A;  3UD4 P;  2GQ2 A;  3Q89 A;  4PG8 A;  1U26 A;  4PYA A;  3DDK A;  1REG X;  4X64 F;  3FQL A;  1VGY A;  4OZ3 A;  4LF6 F;  4Q2L A;  2WZ1 A;  3D6T B;  3ZZU A;  1EET B;  2G0I A;  3CCL S;  2IYI A;  3QQC D;  3HHL D;  2B0G A;  4DL6 A;  1RT5 B;  4QWC A;  3FZB A;  1ZZF A;  2BQU A;  1CC8 A;  2F5G A;  2C3P A;  2Z0G A;  2IRY A;  2Z8Q A;  4LIW A;  5IT9 U;  3TAP A;  1JLB A;  4N8O A;  1WG1 A;  1TKZ A;  2ZH5 A;  3DGP B;  3MPW A;  3THV A;  3VV2 B;  2G1H A;  1VK3 A;  2ACY A;  1HNZ F;  2UV8 G;  3J81 U;  4OYM A;  2BX6 A;  4PG7 A;  2H5J B;  1QTN B;  2HQI A;  4Q8F A;  3I96 A;  1R7I A;  1V9O A;  4LT6 A;  5ETS A;  9ATC B;  2HLT A;  1LWE B;  2DNQ A;  4X4V A;  1SH2 A;  4CO1 A;  4ID5 B;  3VCD A;  1PO6 A;  3H90 A;  1KN6 A;  4J5O A;  2HVH A;  1PYT A;  3QRP A;  5LL6 d;  1EX8 A;  2EXU A;  1S1V A;  1RT3 A;  1RT6 A;  1WTF A;  6AT1 B;  1BWE A;  1ZAX A;  1YX2 A;  3GYG A;  2QA2 A;  2V8H A;  4YB5 A;  4WP8 A;  4DSL A;  1NBE B;  1BXN A;  4Q44 A;  2UUB F;  4NYO A;  4PXD A;  3F56 A;  1HL6 A;  1RIS A;  4LVO P;  2J9D E;  4JI3 F;  1TMM A;  4QYZ K;  1SJ3 P;  4RUA A;  3GJS B;  3TUJ C;  2VG7 B;  2EKN A;  2OPS A;  3JTO A;  3QIP B;  2W2Q P;  4XDC A;  1GXT A;  2W4P A;  4ZVF A;  1RYR A;  4FF3 A;  3T9Z A;  4HEA 9;  4B3T J;  4FXW A;  2Q66 A;  4WCE Q;  3GJQ B;  4KHP J;  5DZ7 A;  2E5L F;  2FIU A;  2XLI A;  4OI1 A;  3LAK A;  4NEY A;  2P9E A;  1ZH5 A;  3GU0 A;  3WX8 A;  3K5M A;  1LWC B;  2FJA B;  2LCW A;  2CZV C;  1VQ5 S;  1KWM A;  3B6B A;  1VDH A;  3BN4 A;  3C19 A;  3SI8 A;  4OZN A;  1PIL A;  1QE1 A;  3W62 A;  4K7Q A;  5ITH A;  3JTP A;  3VWS A;  3CDB A;  4C11 B;  5GAH U;  1X4C A;  3JXO A;  4LF2 A;  3IRX A;  2VOD A;  1LK5 A;  4OV6 A;  1RKJ A;  3T1Y J;  4RW9 A;  4OYI A;  3ITH B;  1Q7L B;  1N32 F;  3MMC B;  4UOG A;  3PNI A;  3I56 S;  3FBF A;  3N28 A;  3W65 A;  3A3O B;  3G4S S;  3GFX A;  3MMB A;  5ETL A;  2H4Y B;  1D9A A;  4KHR A;  1S1W A;  4ZCL A;  3M6U A;  4ZDN A;  4YHH F;  2NUU G;  1S49 A;  5JVH Q;  3DLE B;  4ZCM A;  3TJ9 A;  2IC3 A;  2FQQ B;  1IKX B;  2E66 A;  1R8A A;  1WI6 A;  4NX9 A;  2KN4 A;  2AF6 A;  3PG9 A;  4M5D B;  1RHJ B;  4OI4 A;  3RBE A;  2RQC A;  1S59 A;  1URR A;  5CYM A;  4DL3 A;  1ZYQ A;  4DWI A;  2OTJ S;  4JYA F;  2HSE B;  2VH7 A;  3I0S A;  3BGR A;  3CNQ P;  1CEZ A;  2F9J A;  2RIL A;  1O0P A;  2OPS B;  2CQ0 A;  3O5T B;  2IA6 A;  1CJT A;  4M5G A;  2KKH A;  3EGV A;  3RJM B;  1MLA A;  3J81 Y;  2F4V F;  3KNA A;  3UCU P;  3LGN A;  4ER8 A;  1IKX A;  4KJI A;  5IWA F;  3DOL A;  1IBL F;  3K0J A;  4ZMM A;  2QFI A;  1RT3 B;  1RT6 B;  3DOK B;  2CVI A;  3PJX A;  4RKU C;  4MH8 A;  1IVZ A;  2XZT B;  4I68 A;  3V81 B;  4R0J A;  3RBZ A;  2EFO A;  5D4O A;  3W2V A;  4QCL A;  4ID5 A;  3PW7 A;  1NU4 A;  4A8X A;  5DJB A;  4AFF A;  3KLH B;  4DR4 J;  4OX9 F;  4OI6 A;  4EYI B;  2A10 A;  2HAF A;  2GW8 A;  4X4Q A;  2J9D A;  1BD6 A;  3GLJ A;  3M8S A;  3G6E S;  4DSK A;  1EQM A;  2LYV A;  3W63 A;  3SV3 A;  1JK9 B;  4DR2 J;  2MLY A;  5EWE A;  5B0G A;  1X0P A;  4QU6 A;  1G1X A;  1Y0H A;  1ROF A;  3KFW X;  4PG5 A;  2LKZ A;  2HVE A;  4WIQ A;  2JNJ A;  3BR8 A;  1ZTT A;  2CG8 A;  1X5P A;  4UOC A;  4DR5 J;  2LA4 A;  1NME B;  1A0O B;  1B0V A;  1OQ3 A;  1Q53 A;  4NYZ A;  2ZM6 F;  1VQL S;  5AXK A;  3D7S B;  2EI5 A;  3UCG A;  4MMO A;  1JNZ B;  3M2U B;  1VQY A;  2X51 A;  1D1U A;  1MRO B;  1HBU B;  4RWX A;  3MFI A;  4LF9 F;  3PW4 A;  3SCJ E;  1YTY A;  3NGT A;  5ETT A;  1D9D A;  3HZE A;  2R8K A;  3GON A;  1I94 J;  2H48 B;  4B9U A;  4F0M A;  1JLG A;  2B4U A;  3DCA A;  2I2Y A;  1HD1 A;  5SZT A;  3OTO F;  2LDI A;  2K7J A;  1N5Y A;  1DAX A;  1E6Y A;  1H7W A;  3DOL B;  1RAC B;  4U9R A;  3MCO A;  4M5J A;  3J7Z 5;  1R0C B;  4W98 A;  4DFJ A;  4ILL A;  3MM9 A;  3J7Z T;  2Q43 A;  1QVG R;  3M32 B;  4C98 A;  5C25 B;  2AV5 A;  2CPX A;  2M70 A;  1VRQ C;  3RW7 A;  5A2Q Y;  1GNK A;  5CHC B;  3PW2 A;  1NK8 A;  2GO8 A;  1NK9 A;  3TVK A;  4ZPC A;  1HFE L;  4DG1 A;  1QSS A;  2YY3 A;  3MMA A;  1RTJ A;  4LFB F;  2HVI A;  3M6W A;  1C1C B;  4ENO A;  2KZZ A;  1JLA A;  3P4U B;  4OYX A;  1C4A A;  2JVO A;  3C6T A;  4OYZ A;  1JXV A;  4WZM A;  3DOM B;  4ZJO A;  4DFK A;  2DNY A;  1QAI A;  2BRL A;  3EDR B;  4JBC A;  1UZH A;  3LP2 B;  1N5S A;  4GVB A;  1F1B B;  1TVR A;  2QL9 B;  1UP1 A;  4HT5 A;  4CNY A;  5I3Q A;  1NKB A;  1JLC A;  3E3X A;  2DJW A;  3K17 A;  2E7X A;  3UDC A;  1N36 J;  4QQB A;  1AFJ A;  1X4G A;  3P5T L;  2XNQ A;  4F4Y A;  2FVS A;  4BLG A;  4JI6 J;  5MLC V;  5KFM A;  3QJL A;  2PA8 D;  2MKK A;  1RTH B;  1TL7 A;  1N33 J;  1TV6 B;  4F3O A;  1VCT A;  5HVF A;  1IBL J;  4H4M B;  1N36 F;  5HP1 A;  2XO6 A;  1RB0 A;  4DCJ B;  3KG4 A;  2ILY A;  2J7W A;  1JXE A;  2MQM A;  3CCQ S;  2WON B;  5JJB A;  1N56 A;  1DQA A;  2KVI A;  5F3Z A;  3MPV A;  4PWU A;  4WYW A;  1IJE B;  1WAC A;  4A8Y A;  2ASL A;  1RAI B;  2OML A;  1S9G B;  3ZZO A;  3K58 A;  2EK1 A;  4G1I A;  2GC8 A;  4ZP8 A;  1NRK A;  4K5S A;  4CLL A;  1UMJ A;  4DR3 F;  3JSR A;  1N6Q B;  1RTD A;  1HYS B;  1F2G A;  2DIS A;  2YH0 A;  2KM8 C;  1HI0 P;  2W2M P;  3PO5 A;  1XNQ J;  1S10 A;  1JXL A;  3M2V A;  3NAI A;  4DX5 A;  3G71 S;  3EGN A;  3T41 A;  4NZ0 A;  2VPZ B;  1TL1 B;  2RB7 A;  3LQV A;  2IHR 1;  1T9T A;  4O3O A;  4BBY A;  2QLB B;  4NLQ A;  2ZH3 A;  4FF4 A;  4CLK A;  1KOO A;  3TAM A;  2DH9 A;  2XMV A;  2C2K B;  2FLL A;  4OL8 A;  2QX0 A;  4OIX A;  4WFA Q;  3ZZZ A;  2ASY A;  1U1M A;  4LF9 J;  4QJV A;  4RBV A;  4DL4 A;  4M95 A;  2EFP A;  4YR2 A;  1NSP A;  4YY3 J;  5LSO A;  4DV6 F;  2AJ2 A;  4ZS6 A;  5J1E B;  3IXQ A;  3WIV A;  3OXG A;  3H25 A;  5DDO C;  3UR0 A;  4DR5 F;  1GTH A;  2OFH X;  3RBX A;  3FBB A;  3M8R A;  4M94 A;  1DQ9 A;  3A8I A;  2CQ2 A;  2VF3 A;  3W64 A;  3NCP A;  3PEH A;  4QIE A;  2DT9 A;  3DRR B;  5B09 A;  1CLF A;  2BW7 A;  3HZG A;  3VF0 B;  4DLE A;  1JJ4 A;  3M8Q B;  3GV5 B;  4ZLL A;  1S57 A;  3IS9 B;  2PT0 A;  2I1R A;  3C16 A;  4J90 A;  1YJU A;  1T0T V;  2UXB J;  1H0H B;  3CXC R;  1NK0 A;  4RU2 A;  1Y5N B;  4K50 A;  1CJU A;  2YNI A;  3SSR A;  1U2C A;  3EVW A;  3C46 A;  1CJK A;  2PC6 A;  2G2Y A;  3UQS A;  5HO4 A;  2HZV A;  4EFA C;  1S4F A;  1NSK L;  2P6S A;  4UW2 A;  1R6Y A;  2YXL A;  1ACM B;  3KYL A;  3BQ2 A;  5HQL A;  2ASJ A;  4NLU A;  3KLG A;  2UUW A;  2OPQ A;  1YRT A;  3OTD A;  1HQE B;  5I42 A;  3BR9 A;  3R5C A;  3G6Y A;  1JLQ A;  2P8I A;  3R5G A;  4L72 B;  1VR6 A;  3CE8 A;  1PBA A;  3OBI A;  4NLT A;  1M5V C;  4B3R J;  1UAW A;  1DLO B;  1ZA2 B;  3IM9 A;  3CCS S;  1HR0 F;  3FVY A;  4LFB J;  2GGP B;  2B56 A;  4OX9 J;  2QGF B;  2R42 A;  2BZ2 A;  2XUL A;  4WU2 A;  2JLG A;  4RWW A;  3SV4 A;  4TY8 A;  3HVT A;  3HHL A;  1Q4R A;  5HMX A;  5DQG A;  4YQW A;  3H8Y A;  1HIY A;  5EGY A;  2WVB A;  1CSJ A;  3JSM B;  3H40 A;  2QA4 S;  1RT1 B;  2CQH A;  4MTP A;  1FWK A;  1MML A;  3SZ2 A;  1R3N A;  1SKU B;  2HS4 A;  4M5H A;  4MKA A;  1CQM A;  3CED A;  4FBU A;  3QRQ A;  3BKU A;  4USM A;  1FDB A;  3LAL A;  4LF8 J;  2QO3 A;  2MLZ A;  3D67 A;  3I0R A;  2YQ1 A;  2RF2 B;  3D6M B;  3QGG A;  4YB6 A;  4J9M A;  4WKR A;  4LBP A;  1Z4U A;  2V69 A;  3GMG A;  2JSX A;  3HDS A;  3R7S B;  5F9N A;  5G0R B;  1YJV A;  3IO1 A;  3QO9 B;  2C2O B;  4F4A A;  3Q22 A;  3RR8 A;  2IIH A;  2WVF A;  1Y5L B;  3OTB A;  3FMB A;  1QJH A;  2MQO A;  3PRD A;  4W92 B;  2IRX A;  2PD1 A;  3WHI A;  5J2Q A;  1XNQ F;  4K4T A;  3VZH A;  1V3S A;  2CJX B;  3EVO A;  2GML A;  1VLY A;  5L1I A;  2MKY A;  3OPK A;  2WSE C;  3A8J A;  3MAA B;  1RAA B;  3DRS B;  1WHW A;  1L3K A;  2K1R A;  2R2S A;  4H4K A;  4JV5 F;  3CW2 C;  2KFY A;  4NEZ A;  4P2F A;  4QIV A;  2JVR A;  1DTQ A;  4DDF A;  5CD4 A;  4CM2 A;  3DLJ A;  1FRK A;  3KLI A;  3M30 A;  2NQP A;  1NJY A;  4MYU A;  2DBB A;  4ECV A;  2AZ3 A;  4MIB A;  2ALZ A;  4GC7 A;  2ADC A;  1CJV A;  2ERR A;  2R7W A;  3C3L A;  1HHQ A;  2ZUA A;  3L7U A;  3MCS A;  2N3L A;  4DX6 A;  3IAM 9;  5CZV A;  4DV5 F;  1EB0 A;  1Z2Z A;  2MZT A;  2O5D A;  1AXQ A;  2XTJ P;  4P52 A;  4BWM A;  3TJ8 A;  2AKW B;  4OZ1 A;  3UPF A;  2AQ4 A;  3E51 A;  1N88 A;  1Q0N A;  3CGI A;  3K7R A;  1U1Q A;  3PKM A;  1SBR A;  1LXJ A;  2W1B A;  2QYC A;  3QWP A;  2B9Y A;  5AXN A;  1CQN A;  2RKI B;  4PUO A;  1RBO B;  2GHW A;  5A8W A;  2HRY A;  3QT8 A;  4X4O A;  4DSJ A;  5F8J A;  2F7V A;  2I9S A;  4J9P A;  4DL2 A;  4KE5 A;  1U0H A;  2LXU A;  2Y8W A;  4DF8 A;  3MMA B;  1ZPV A;  4KV8 A;  5EX0 A;  2VV5 A;  4BC7 A;  5KG3 A;  5J2M B;  2KI2 A;  2KO1 A;  3UO0 A;  4YOE A;  1H73 A;  2G2O A;  4Q7A A;  2V9W A;  3POT A;  3M6X A;  4DSI A;  2XWY A;  3HJF A;  3KJQ B;  2HMI B;  1UPP A;  3N5F A;  4IRC A;  2OFG X;  3JSY A;  2N82 B;  1P1L A;  4Y2M A;  3UVJ B;  3HHL B;  3CD0 A;  1NAQ A;  3QLH A;  4AYB D;  4ECU A;  1V6H A;  1LW2 A;  4F67 A;  2DRA A;  4ES1 A;  5L9X A;  1RWU A;  1X9W A;  1S77 D;  2ZWO A;  2BOA A;  4P75 A;  5GVQ A;  2AJ0 A;  4DR7 J;  3CJQ A;  4K4V A;  1NCL A;  4XPC A;  2JEI A;  2PMH A;  2HRU A;  1S1X A;  3WX4 A;  2QG9 B;  5CYJ A;  2FGO A;  2W9B A;  3FEX B;  1TMJ A;  2BJD A;  4P7V A;  3QSY B;  2E1C A;  1W2B R;  1UVM A;  4H4K C;  3WQP A;  3TQ1 A;  3G87 A;  4N41 A;  2NXN A;  3OFG A;  3TNV A;  2CQP A;  3V4M A;  3KK2 B;  3VAL A;  1HNW F;  5THW A;  1P9Y A;  4AL7 A;  2JC1 A;  1XR6 A;  4NCG A;  3RUB L;  1Y4Z B;  1TL1 A;  1NXI A;  5LMU F;  5D6G A;  4NXM J;  3DRX A;  5DQH A;  2MB0 B;  4IO1 A;  4DFM A;  2YBV A;  5KG1 A;  1REV B;  4NLG A;  1Y5I B;  3HCX A;  3G8S A;  4ILM A;  1J5E J;  2FZK B;  3R97 A;  5K8N A;  3DI6 A;  4J7C A;  3J81 j;  5J2Q B;  3K8V A;  2B7C B;  4NZ7 A;  4YME A;  2XY5 A;  1PGZ A;  5E3Q A;  3CB4 A;  4DSF A;  2AWZ A;  2W24 A;  1WSR A;  3AD8 C;  3C15 A;  1F5C A;  3NBP A;  2KJW A;  4DHV A;  5A0Y B;  2BAN B;  2MKC A;  2KB2 A;  3KK2 A;  2G4B A;  1TUV A;  1O6X A;  1Z1Z A;  2QC3 A;  5KT5 A;  3BO4 A;  4PUO B;  4YDD B;  3FCV A;  2Z57 B;  1N34 F;  2OTL S;  4C9D A;  3H5U A;  4OX6 A;  1LFW A;  1C0T A;  3G9C A;  2V2Z A;  5FLX U;  2W7A A;  4NRU A;  3MR6 A;  3NGU A;  2ZHB A;  3H2L A;  3A3N B;  6FD1 A;  3BDE A;  1OJ4 A;  2IJN A;  4ZPA A;  4LSN A;  3EUN A;  1TVR B;  4P2S A;  2V94 A;  3MPU B;  1VQ4 S;  5A8K A;  4OYO A;  4USK A;  2OKQ A;  2RML A;  4B17 A;  2XS5 A;  4U96 A;  1RWW B;  3C6U B;  2FHM A;  3TOQ A;  2PI5 A;  1FX4 A;  3CD5 A;  3U02 A;  1FTR A;  2GNK A;  3EM1 A;  3PEJ A;  4TYA A;  1KQF B;  3AB2 B;  1S9F A;  1X4E A;  1IBM J;  4HHJ A;  1SL2 A;  4EZ6 A;  2MLX A;  2HWI A;  2YX4 A;  3M2V B;  4ZPT R;  3R2D J;  1DUR A;  4GKJ J;  4OZ0 A;  1R31 A;  3M2R A;  1ZM2 A;  4O3N A;  4P6Q A;  1S0O A;  1KOH A;  1H7X A;  3HHK A;  1HNZ J;  4M5D A;  4QZV B;  1RHU B;  1XQI A;  2AT1 B;  3DRY A;  2HQF A;  2Y1L B;  1SCJ B;  4ZN1 A;  3EXC X;  2MKH A;  1U24 A;  1MMD A;  4JI4 F;  2VOO A;  2CXE A;  5HAO A;  1B4S A;  4Y34 A;  3CMA S;  1JLG B;  5HVG A;  1VQ9 S;  3CJ8 A;  4LRD A;  2YNF B;  5J1P A;  3DLH A;  4YEA A;  4ED4 A;  3M8P A;  3OL6 A;  2DHG A;  1ZS6 A;  1VRU B;  1CPZ A;  1M5O C;  2LEA A;  2VKZ G;  4DPW A;  5E3A A;  3DRR A;  1SC1 B;  3IN5 A;  4QIG A;  4B3O B;  1P1T A;  1I5O B;  3U1L A;  2XNR A;  3DNC A;  2W8L A;  2MGZ B;  4RX6 A;  3R1L A;  1R0A B;  3I5C A;  3CVK A;  3KK1 B;  4EO8 A;  3PW0 A;  4OYP A;  2CQG A;  4KY3 A;  4FBT A;  3OJS A;  2CQ4 A;  5IT4 A;  4DS5 A;  4N8N A;  1VC5 A;  3NRB A;  5LMU J;  4WKY A;  4YB1 P;  4AQY F;  3P6Y C;  3IBW A;  4I1T A;  2WBM A;  3C6T B;  3KKF A;  4M1K A;  2ZKU A;  4PPD A;  1NSQ A;  1EAY C;  1X5O A;  4KHP F;  2IBO A;  2VKR A;  3PFO A;  2KFZ A;  5DLF A;  1XMO F;  3LGH A;  1JJ2 R;  1N32 J;  1RHQ B;  4B9L A;  4QU7 A;  4HL9 A;  4TN2 A;  5L46 A;  4LFA J;  4ATN A;  1S9E B;  2YWG A;  4CM0 A;  1GAO A;  4ZKA A;  5AXL A;  1R6V A;  3IM8 A;  3NWG A;  2IAJ B;  3U27 A;  1VHI A;  2CA9 A;  4V1A k;  3SYZ A;  1NB7 A;  1R8P A;  2NXJ A;  2QE5 A;  4FYW B;  4ELU A;  3LW5 C;  4EWT A;  3JSM A;  1HW8 A;  4YFU A;  4B3T F;  3M9M B;  2XBP A;  5H9E J;  3PFE A;  4ZVH A;  4LRB A;  3W1Y C;  2ZH4 A;  2HHX A;  2FD2 A;  3L9Z A;  3M8W A;  1N5Y B;  1BHN A;  4OYA A;  3Q8S B;  3Q2S C;  1VQO S;  3TX8 A;  2HZC A;  3AFG A;  2OH2 A;  2V9K A;  3R5A A;  4PEO A;  4L75 A;  1YBU A;  4Y6I A;  1U25 A;  1CJT B;  4X62 F;  4HYK A;  1FKP B;  5LOQ A;  1XEZ A;  2XLK A;  4C8Y A;  1HBM A;  3DLK A;  1RCX B;  2BE2 B;  1JLQ B;  2D69 A;  1WTB A;  4WE1 B;  3WBZ A;  5K8M A;  1RWO B;  4A8Q A;  5EN1 A;  2F1F A;  2K3I A;  3B4M A;  1Q8I A;  4ZPV R;  4OHX A;  3UN5 A;  4DV5 J;  3MEC B;  2NUH A;  2FPH X;  2RJZ A;  3UDL A;  4B3S F;  1WD6 A;  1ZAW A;  1FKO B;  3AD7 C;  3EJM A;  4NE9 C;  2AEF A;  2ZFH A;  2LQ5 A;  2HHV A;  4DV7 F;  1MMN A;  1SPB P;  5KOX A;  1HMV B;  2DH7 A;  5GAE I;  4CRJ A;  1DFD A;  4FDF A;  3MM9 B;  5J1N A;  4RW9 B;  2M8H A;  4H4M A;  1M1G A;  3BGF A;  3L4B C;  4DEZ A;  4FS2 A;  2RDD A;  1YG0 A;  1FDD A;  3D1Q A;  3T5K A;  2MJU A;  2YX7 A;  3IG1 A;  3OR2 B;  2HFS A;  2YKO A;  2KG0 A;  4JV1 A;  3CIM A;  3L95 X;  3A1Y G;  2E7W A;  4ALZ A;  2VJV A;  1ZET A;  5MAO A;  1N4L A;  2KDO A;  3KMS A;  2H54 B;  4P2M A;  1M5P C;  1JJH A;  2GJI A;  3OD2 A;  2HNY B;  1RSC A;  1V5I B;  4K59 A;  2FVC A;  2RU3 A;  2DR9 A;  1VIX A;  2E1P A;  3CCT A;  4P9S A;  4WPA A;  2MQQ A;  2WW4 A;  4FP9 A;  1IR2 A;  1MRO A;  2GFF A;  2H5I B;  3GTY X;  3UDE A;  1KR4 A;  5C24 B;  5KFE A;  3CF5 Q;  1IBK F;  2HBY B;  3QAT A;  3W8P A;  3CJS A;  1S99 A;  2FB0 A;  1DJ0 A;  1S6P A;  3IR7 B;  3QGH A;  1FF2 A;  2AYM A;  2NSB A;  3TA1 A;  5GAG U;  4ICL A;  3SCK E;  2B9W A;  5D3G A;  3ICL A;  2ABY A;  2CIM A;  1GXU A;  1VHF A;  5IFM A;  3BV8 A;  2ZHA A;  2YWW A;  1S72 S;  1IM4 A;  3FQK A;  1Z2L A;  2WOM B;  3ENQ A;  4IRK A;  1TUW A;  4HDH A;  4LF5 J;  1Q82 T;  2PO4 A;  5L39 A;  3ZC4 A;  2EG2 A;  2W8K A;  1HLW A;  4Z7Y A;  1O8B A;  2RAQ A;  3OXF A;  2I8E A;  4A8F A;  3SSQ A;  4U7C A;  2F8E X;  2R7O A;  3QNW B;  3PHE A;  4NLV A;  5KFX A;  3GJT B;  1SV5 A;  2G0J A;  4TYB A;  4Y2A A;  4DV0 F;  1RHR B;  4LSZ B;  1JLE B;  3OFH A;  2V8G A;  3A3P B;  3R6L B;  5K20 B;  2M8D B;  2V4Q A;  1KBR A;  2D9P A;  3ZFV A;  1FCA A;  2GMJ A;  2X3D A;  3DXS X;  3LA0 A;  1HI8 A;  2R7Q A;  5AE2 A;  5D78 A;  4UF4 A;  3VAF A;  4DQP A;  4FYX B;  1HWL A;  4YR3 A;  4DV4 J;  2HQ3 A;  3ONQ A;  4X64 J;  3LP2 A;  4GVB B;  3ISZ A;  5F0U A;  4U67 Q;  2DXE A;  2D3Z A;  1EAR A;  2VPY B;  3HHD A;  4BWJ A;  4RUH A;  3OTO J;  1RWN B;  4R0E A;  1AZS B;  1Q8B A;  3K5O A;  2NPF A;  1S6P B;  1WUU A;  4KH0 B;  3SDE B;  4DL0 C;  2R2U A;  4J9Q A;  3HT0 A;  3VR1 A;  5KFF A;  2ZH9 A;  2GAG C;  3SQO P;  1F2H A;  1LFP A;  3MMJ A;  4LQ9 A;  3O3L A;  3EX7 B;  2A2D A;  2QL5 B;  1V3Z A;  4K4U A;  2NLW A;  2IJF A;  4X65 F;  4XTT A;  2XSJ A;  1P6T A;  2JOQ A;  3N6N A;  1TUG B;  4IG0 A;  3Q8R B;  3IWN C;  1NDC A;  2AJF E;  2MSS A;  5E7O B;  5KFW A;  3RYL A;  5KFQ A;  4ITS A;  1FJ7 A;  3NMA A;  4B08 A;  1FXL A;  2UUC F;  1JB0 C;  2ZM6 J;  2X1B A;  3KXD A;  3DOK A;  3TUZ C;  3PZP A;  1R0A A;  2VAS A;  3D0H E;  4C6A A;  2HW3 A;  5LXR A;  4LF8 F;  1VQK S;  4FPI A;  3U7J A;  5KFD A;  4JI4 J;  3BKF A;  2RT3 A;  1SH3 A;  3GIL A;  1JNR B;  5L9N A;  2VD3 A;  4ZOS A;  2ZZN A;  3R5D A;  3I55 S;  4FNH A;  4ED8 A;  4HT7 A;  1OSC A;  3VZI A;  4MK9 A;  4EBD A;  4IG3 A;  2KRB A;  1D3W A;  5LSR A;  2BQ3 A;  5IT0 A;  1HWK A;  2BJ8 A;  1FVQ A;  3NNH A;  1E6V A;  1ZZN A;  1S5Z A;  1WC0 A;  2RQ4 A;  1X0F A;  3CJK B;  2NPI A;  1BC6 A;  3KK3 B;  4O44 B;  2R3V A;  1W26 A;  2XYP B;  3PAC A;  2PGC A;  2LVW A;  2DNN A;  2AIR B;  2VL1 A;  3KHH A;  2WSF C;  3D66 A;  1RBA A;  1EET A;  1OWX A;  2Q3P A;  3A4T A;  4FKX A;  4CO0 A;  3DC2 A;  2CJA A;  3GJR B;  1TKT B;  2B8Q A;  3CJ0 A;  3T5J A;  1IQT A;  2AYE A;  3HX9 A;  4OHZ A;  2Z56 B;  1HBM B;  1FES A;  3DLK B;  2BE2 A;  1JLF A;  1YRU A;  4I7F A;  4DR1 J;  2D3O 1;  5DG7 A;  1GMW D;  3G6V A;  3TAR A;  4IFV B;  3VAH A;  2FLO A;  4P10 A;  3SXL A;  3NNC A;  1F6T A;  3G2X A;  4RBU A;  3BQ1 A;  4I2Q A;  1IUJ A; 
#chains in the Genus database with same CATH homology
 5IC4 B;  1F9E B;  3IBF B;  2H54 B;  1RWW B;  3P45 B;  3D6M B;  3GJS B;  3D6F B;  3R7S B;  2H5I B;  3D6H B;  2C2O B;  2H51 B;  2HBY B;  3GJQ B;  3P4U B;  2H65 B;  1PYO B;  2CDR B;  3EDR B;  2CJX B;  1RHU B;  2QL9 B;  2Y1L B;  1SC3 B;  1BMQ B;  3SIP B;  2CNO B;  1RWM B;  2P2C B;  3QNW B;  5IC6 B;  3GJT B;  2HBZ B;  1SC4 B;  1RHR B;  1GFW B;  4LSZ B;  2Y0B B;  3KJF B;  2XYG B;  4ZVO B;  4DCJ B;  3R6L B;  1SC1 B;  5K20 B;  1I3O B;  2QL7 B;  2DKO B;  2H4Y B;  2H4W B;  3R7N B;  2FQQ B;  1RWP B;  1RHJ B;  4JB8 B;  1RWN B;  1RE1 B;  4ZVQ B;  1RWX B;  1IBC B;  1RHQ B;  2QLB B;  2XYH B;  1PAU B;  2HBR B;  1RWV B;  2QLJ B;  2QL5 B;  2C2K B;  3EDQ B;  4ZVS B;  3R5J B;  1I51 B;  2C1E B;  4ZVR B;  3RJM B;  2HBQ B;  1RHK B;  3KJQ B;  2CNK B;  3KJN B;  4ZVU B;  1RWK B;  4ZVP B;  2CNN B;  2XZD B;  2XZT B;  1RHM B;  1ICE B;  3NS7 B;  3R7B B;  4DCP B;  1RWO B;  2CJY B;  1QDU B;  3IBC B;  2XYP B;  3R6G B;  1NME B;  4ZVT B;  2C2M B;  3GJR B;  2QLF B;  4DCO B;  2C2Z B;  2H5J B;  1QTN B;  2H48 B;  2CNL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...