2DKOB

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2dkoB00
2CNOB 1PYOB 1RWMB 2QL9B 5IC6B 2C2MB 1ICEB 1I3OB 3GJRB 3P4UB 1PAUB 2C1EB 2CJXB 2Y1LB 3GJTB 3RJMB 1RWXB 2QLBB 2QL7B 2QL5B 1SC3B 4ZVOB 2HBYB 1RWNB 4ZVSB 3SIPB 1RWWB 1F9EB 4ZVTB 1RHQB 3R7SB 2CNNB 2XZDB 1SC1B 2H65B 2HBZB 1BMQB 3D6MB 1IBCB 2XYGB 1GFWB 2QLJB 3EDQB 3GJSB 4ZVQB 3D6FB 5IC4B 4ZVRB 1RWOB 3R6LB 2H4YB 1RWKB 2P2CB 4ZVPB 5K20B 3GJQB 2C2OB 1QDUB 2XZTB 2H4WB 2H48B 3EDRB 3D6HB 2HBRB 4DCJB 1RHRB 1RHKB 4JB8B 2XYHB 3R7BB 3R5JB 3KJNB 4DCPB 2HBQB 2CNLB 2Y0BB 3NS7B 4ZVUB 2C2KB 3P45B 3KJFB 2FQQB 2C2ZB 2DKOB 3R6GB 2CJYB 4DCOB 2H5IB 1SC4B 3R7NB 2H5JB 2H54B 1RHUB 3KJQB 2QLFB 2CNKB 1NMEB 1I51B 1RWPB 1RHJB 1RWVB 2H51B 1RHMB 4LSZB 1QTNB 3IBCB 1RE1B 2CDRB 3QNWB 2XYPB 3IBFB
chains in the Genus database with same CATH superfamily
3E01A 4RJVA 1HWLA 4ZKAA 1X0FA 3GILA 1SH0A 3W8GA 2G2YA 4DHVA 2Y1JA 3CCZA 3JS9A 3UNGC 3CVKA 2J5AA 5CQGA 2KRRA 1PKUA 4X2BA 1GMUA 3MM5A 1VBYA 4KY3A 2NREA 3HSGA 3D6MB 1TL1B 3NBPA 4GVBB 2Z2LA 1I6JA 2HHHJ 4ZLPA 2D7SA 3MAQA 2DO0A 2M88A 3ZTPA 4M5JA 2UVUA 7FDRA 4F8RA 2VFSA 3CCRS 1OYEA 1RHRB 4RNFA 1QJHA 5DG7A 2XTJP 5KFFA 1WELA 4FYYB 1KVKA 1HNZF 4F67A 2AP6A 3MEGA 3R5GA 2XY7A 1KFDA 2IRUA 5KFZA 1CULA 5DS7A 4FS2A 4DLGA 3CJ2A 2ZOMA 2VU5A 2EFQA 4ZCIA 1KEKA 4G1QA 1FX2A 2VF3A 2B7BB 4EUVA 3BGUA 5CH7B 1HBOA 4P71A 4ZP7A 1S49A 2CQBA 1OWXA 3IO1A 2WRMA 3H2UB 3PXGa 5KFCA 2LA6A 1DZ5A 3W62A 3Q2SC 3QAEA 2NXNA 4MIAA 3BV8A 2JFDA 2OAUA 2Z4PA 3IWLA 2HMIA 2KJVA 2EFNA 4Y2IA 5G4DA 2D74B 5GAGU 5KFEA 3UWTA 3DI6B 2QV6A 4DSLA 2KU7A 4O3PA 2VA2A 4NCGA 5B0DA 1LK7A 1JKHB 5I3QA 1H2VZ 3R9LA 3CD7A 1B99A 2VODA 3ILIA 1MWYA 5HLFB 1QVGR 5M2UA 3TVYA 3R97A 1LNQA 1MROA 4OQJA 2CQ2A 3D66A 3NNCA 3C6UA 1SJRA 2JH3A 5CCLA 4N41A 2RQ4A 1F9FA 3FRYA 3MOZA 2AX1A 2K06A 4RW4B 5HVGA 2DNLA 2ZUGA 1WHXA 4AYBD 1SJ4P 2BE9B 2OSQA 4EBDA 1Y5LB 5J2MB 4DV2F 1T9UA 3K5OA 3CWJA 4DFJA 1NKEA 4F0HA 3ZZPA 4HTJA 3AHPA 2DEJA 1SKWA 2MLYA 2MDAA 1Q78A 4OHVA 3W60A 3OHBA 2VFVA 3KLEB 2HS3A 2KDOA 1LOUA 4CLWA 3UN2A 2VG6B 3E01B 2W9CA 1ZS6A 4CWBA 5IM0A 1Y9OA 3KFWX 1IBMF 3GJQB 3ISZA 5EWEA 2BJ1A 2OEJA 4EYHB 2GAGC 3RBDA 4AQYF 2QFJA 5DO2A 4EZ9A 3CF5Q 3MMAB 2QA1A 2Q3PA 3HMJG 2W4CA 5GAGI 2Z58B 2Y9HA 4CH1A 2IVFB 2MZRA 2C22A 2FJAB 4PXEA 3EXYA 4OL8A 1JNZB 3W1YC 5BR8F 1QAIA 1HBUA 5K14B 4USIA 1EQMA 3LGHA 1RE1B 4AE5A 1AFIA 4JI6J 2CXEA 3VV2B 2W8LA 1JLAA 2B9XA 3BYPA 1AROP 1F0XA 2FYXA 1PG5B 2Z30B 3IAM9 2OEKA 4F4ZA 1WUUA 4XTTA 4L72B 4CLLA 3CCUS 1CULB 2XGPA 4RW6A 4NCBA 2QN6B 4YB7A 5KAKA 2DHGA 4ZPCA 2D69A 2LLZA 5K9FA 3EUNA 3QQCD 4Q5VA 4QYZK 5A6PA 5DM7Q 1GMVA 4DCPB 1FRIA 3KLFB 3D68A 4OV6A 3RAMA 4WE1A 3QWUA 3SFGA 3ILOA 3Q8PB 2G2OA 2VQEJ 3UD4P 1L5UA 5LJ3Y 3KHHA 3KK3A 2Z8QA 4X62F 2MKKA 3BQ1A 4DSKA 2FJWA 3T1YJ 2BEFA 2GO8A 4LFCF 4BC9A 1NDKA 3NMRA 2LXFA 2DPIA 3C6UB 3SCLE 2PEHA 3CO0P 4LREA 1SC3B 3WIUA 2ERRA 1VQLS 3LP1B 2JX2A 3HHKA 4OX9F 2VHGA 1M90T 4C3KA 3A8KA 2OFGX 4A47A 2CQGA 1U4BA 2Z2YB 2X3GA 2MLZA 4QWBA 1Y0HA 4NMXA 5GAHU 3W7BA 2DNHA 4P9SA 2G1DA 4DV5F 1IBLJ 2CPJA 1IJFB 3G87A 5LMNJ 1SKSA 2CNLB 2C3PA 3S8SA 2W2NP 2ZH5A 4JV1A 2BW2A 1LWFB 2HQGA 2YWHA 3QGPA 1HWIA 3DGVA 3BJYA 3MEEB 5DJBA 1HQUB 2VPZB 3W5ZA 2O01C 1ZA2B 3BBFA 1TMMA 2ZVIA 4A4JA 5B0EA 2Q79A 1NSPA 4ANDA 4WKYA 4YB1P 2U1AA 3LGMA 4J9VA 4DR7F 2BKNA 5KG5A 2FGCA 4K5SA 2IJFA 1HBUB 4LIRA 1X31C 2UUTA 1S1WA 5DGBA 4KAIA 2F63A 5EDWA 2Q66A 4I6WA 3H4DA 1N32J 1RA7A 4WP3A 1JLAB 4DPOA 3DLGA 4OYZA 1ZTTA 3LAMA 1U1MA 5JUMA 3HVTA 1PO6A 1RHKB 1GMWA 3M32A 2IBKA 4C98A 3MUVP 1FVSA 4CO2A 1NCLA 4RW6B 1YJ9S 5BYSA 5K8NA 3GV7B 1FJ7A 4J9NA 2VFRA 4LFAJ 4DV1J 5GAHI 1XEZA 1U26A 4MKVA 2LXUA 1NAQA 2V9KA 3MWBA 5HQ8A 4PG6A 3G71S 2HRTA 3PVXA 3H8YA 3TZYA 2R8KA 1BQNA 4U6PA 4WE1B 2ZH8A 1U45A 1JX4A 2HVZA 3AAWB 2QZ8A 4OIXA 2Z2ZA 4O0NA 4KC5A 3B82A 2R7VA 3KK3B 1LQ9A 2PA8D 3FCWA 3RR7A 3TOQA 4DN9A 1QSYA 2YKOA 5E0OA 3HHLA 3BSOA 4OZ3A 3S6EA 5KFSA 4EYIB 4V1Ak 4ZP6A 3AJ1A 1SV5A 2POKA 2JFKA 4EMDA 3OTEA 3VAJA 2HNYB 4RW7A 4LF9J 3VHQA 1KR4A 3CCES 4PG8A 5AT1B 4TXSA 4LBPA 1IQZA 4TKTA 1NEEA 1RACB 4C3LA 3R7NB 2P9EA 3MR5A 4N56A 5LSLA 1PAEX 1QE1A 2Q1LA 2DCLA 4LQ9A 1W7WA 3KG1A 5HJYA 4CRJA 3ISNC 2L9NA 3T5HA 4DQQA 1N34F 1TK8A 2NXUA 2UUBF 2WBRA 4FVMA 2RDJA 4M1KA 4FXDA 2V63A 2H5EA 3OSNA 1YJUA 2BUNA 4AD6A 4NLPA 4DU7A 4DV7F 2B5JA 3ZTRA 2VBXA 1YSJA 4KJIA 4IRDA 5IC4B 4JYAJ 3LWLA 2KHDA 4GC7A 5L8RC 1SH3A 1HMVA 2WVCA 4B9TA 5K20B 4P73A 4R25A 1B70B 1HR0F 2Z56B 1XNRJ 1T05B 1J5OA 4LR8A 4F02A 1YX2A 2PDAA 1X9WA 2IJNA 2OPQB 1H7XA 3MUMP 1RI7A 2DJWA 3ILJA 1KLMB 1S1WB 3D0GE 2EBEA 3FBFA 2BKPA 4BC7A 1BXNA 2YY3A 1U1LA 2DH8A 1FJGF 1HNIB 2AWZA 3QJJA 1G3OA 2B56A 4CM2A 4B9VA 4DBQA 5E7OB 2QLFB 1MWZA 4HH0A 2MJNA 3DLGB 4X4OA 1ZBTA 4Y2KA 4K4UA 2F4FA 3ENAA 4TN2A 4XO0A 2HHPA 4F3OA 3C15B 3RUBL 2XWYA 1H74A 1CSJA 3DM2A 3FFIA 4ES3A 2OIHA 5EWFA 2XMVA 5KFVA 3CJ0A 3E3XA 1M5SA 3MPYA 1HD1A 1P9YA 1FJCA 4ZVGA 3RAQA 3OTOF 1MNEA 3H2VE 3W2VB 2R3VA 3ZO7A 2ZBRA 4NXNJ 1RWOB 1BQNB 1Q8BA 2ZNZA 2HURA 3AD9C 3Q24A 2DRBA 2YNGA 3TZWA 2ZM6J 1KN6A 5HO4A 2GQCA 3Q89A 2BA9A 3I0RA 2DGTA 3HJFA 2QT7A 1JLQA 2XCPA 5A8RA 4QU6A 4DMZA 4ATNA 4KPYA 3M2RA 4S0MA 1RHJB 1S6OA 1RWUA 3MEDB 1FDDA 3D6TB 4B08A 2DGOA 4DL2A 1I3OB 1RU1A 2UZAA 2MZSA 2ZJPQ 5MLCV 4J9MA 2W9AA 1VI7A 2QL5B 5ETOA 3OTDA 3C8YA 2F8MA 3RYLA 3PX4A 1N5YB 2MLXA 3TQ1A 2P9CA 2GC8A 1QUPA 1F2HA 1HNZJ 2FJDB 3P5TL 1X8DA 3SCIE 3MGJA 1TVRA 3BR8A 2QMUB 2WHOA 2E7WA 2YPYA 4ECSA 4FYWB 2GVDB 4CLTA 2KT2A 2MKIA 3MAHA 2IC3A 2UUCF 1YZ7A 3J80Y 1HWJA 2G2ZA 3OBIA 3W66A 4E2FB 1HI1A 3W63A 2BANA 2N3OA 5B0AA 3P45B 2A10A 4CCHA 1UVNA 1N36F 1RB0A 3LPEA 1YBUA 3HF5A 3ILLA 2BRLA 3V4IA 1FNOA 1TKTA 2VG7A 1XMBA 3C19A 3SQOP 1T94A 4U67Q 3FSIA 2UVWA 1R0CB 3UFCX 3EVMA 4NZ7A 5KT4A 5IV3A 2Z57B 4ZPDA 2YKMA 1J5OB 2DGSA 3JSYA 2BE2B 3M30B 2A6OA 4KBIA 2VOOA 4YP3A 2ZKTA 1VQYA 3H5SA 2XB2D 2V8VA 4MFBB 2YKNA 5GAEU 4R0EA 2QLWA 3MM7A 3C6TA 2LDIA 3MTJA 3LP0A 5H1SV 3BN4A 1H3DA 1X4FA 4DS4A 2R7OA 5D77A 4KYZA 4MH8A 4UOHA 1CC7A 1PBAA 3AD7C 5D4OA 3KJVA 4KR0B 4WTYA 1VRTB 2B9WA 3LO3A 3UCUP 3Q8QB 3GV8B 4QCLA 4XDDA 4OHWA 4L74A 2RS8A 3DHXA 2CPIA 4DQIA 1U2CA 3CT9A 4DV2J 4QU7A 1NJXA 5HP1A 5EWGA 3BF4A 2HRUA 2RU3A 1SC4B 5KTQA 2IHR1 4CLPA 1VRQC 4NI2B 2YNGB 3O6QA 2DITA 1TUVA 3GCXP 2YX7A 3W9HA 3BKFA 1DTTB 3PYEA 1NK0A 1V5VA 1WI8A 5SZTA 1IBMJ 1JLQB 2O66A 3FSYA 2KVQE 2CZ4A 4YFUA 2B4UA 4AQYJ 3KUGA 2OTLS 3QZ8A 1KWMA 2WW8A 3ZC4A 4ECXA 1T3NA 4ZP8A 4KO0A 2EKYA 1Q8LA 2QX0A 2W24A 4M95A 4WFAQ 4Q2LA 4C3MA 2F65A 3T1HF 2XY6A 5BR8J 2WVDA 3U27A 3BO2A 5GAEI 4J9QA 4YY3F 1RU2A 1NDPA 2IVYA 1HL6A 1RABB 2YTCA 2IMOA 1WEXA 1IR1A 2CZ9A 1NPPA 3IS9B 2I6WA 2HG4A 2I5JA 4FDFA 1TUGB 1YIJS 3J7YU 4DCOB 2Q6CA 4FP9A 5I3UB 2A2DA 5KFPA 4YB6A 3S7RA 4DL4A 4C11B 1OMSA 3CD5A 2XQCA 2JZ5A 4I64A 3THVA 3M8SA 1UFKA 3D1HA 2KT3A 1VC0A 1R8HA 1FKOB 4CP5A 2YNFB 5HMXA 3V4IB 2B8QA 1TKTB 2XO7A 2VG7B 4B9MA 1VFJA 3TUJC 1ZM2A 3CD6S 4NLWA 3NS5A 4DZ6A 3ICLA 4N8OA 5ETQA 1O6XA 4LF8F 2LYVA 1U6BA 1X4DA 3GJSB 2Z0GA 4YMEA 3PKYA 5D4NA 4QWEA 4X62J 1NJWA 1CPZA 1RTIA 1B0TA 1RAOA 3FQKA 3NGUA 2FD2A 2YXLA 2H48B 1U49A 4LFCJ 4NLQA 2XHWA 2MYFA 2Y8WA 3HFKA 2L08A 4B9UA 6FD1A 4GC6A 3MM8A 3C16A 3R5CA 2KG1A 1Z2ZA 2W4DA 5FLXY 3GFHA 4OX9J 3UCGA 2RQKA 1S0MA 3EZUA 1RDRA 4KFBA 3NGRA 3FZBA 2XC9A 1ICEB 2ZWOA 1VQPS 2VB6A 2CQ3A 2QYGA 3J7YI 3PYFA 3O3LA 2ASDA 3HT0A 4DV5J 1CLFA 2AD9A 1NHUA 4A8XA 1NK8A 5F8IA 3EZ5A 4JP8A 3ZXWA 2OHDA 3SZ2A 3PW2A 5AXLA 2JLEA 3Q8YA 2CQ4A 2DNNA 1GXUA 3CCLS 2YNIA 3LP2B 3CDBA 2XS7A 3VGTA 1KTQA 4EFAC 2RHQB 2BJ8A 3HX9A 3GB0A 3NKYA 2R7SA 2RT3A 4DR7J 3NXZA 1WOPA 2A1BA 1RKJA 1XWLA 4KO0B 4OMFG 1H73A 2OPSA 4PPZA 2ROPA 3DOMA 4DUYF 2VKRA 4EBEA 3DRPA 3K17A 3PX6A 3FEYB 4K8RA 2PFDA 2A0FB 2A3JA 1FRLA 2OPRB 1RLCL 3PW4A 1G2EA 1S9GA 3FJ2A 2AGOA 1RSCA 5J2QB 2F1FA 3TANA 1RQ0A 5D4PA 4IUFA 3J7A1 4J9RA 2RQMA 5AXKA 1NPKA 3V6DA 3DYAA 1S1UA 1K47A 1HKAA 2BACA 2R7RA 1KQSR 4C7QA 2XMAA 2ZH9A 5D6GA 3LF0A 4Q0BA 1U24A 2Y1RI 3A8JA 3GPAA 3KOAA 2CYYA 1WWHA 1O8BA 4B3RF 5LXYA 3BGRA 2HK3A 1FI4A 4UUXA 1K73T 4AL5A 3RZAA 1KQFB 4JI2F 2XM3A 3ZZOA 3OVBA 3WZ0A 2ILZA 3LALA 4OZ5A 3QZ7A 4DWIA 2H54B 1X9SA 1FRJA 3POTB 2RUSA 2AJQA 4L75A 1DQ9A 3EXCX 1NHKL 5KG2A 4F26A 1K44A 2W7PA 1MMDA 3C3LA 3RRGA 1N5QA 2EFVA 1HBNB 1FTCA 2UV8G 4TY8B 1F1BB 4NLSA 1SUQB 4IG0B 3TJ9A 3MM8B 3DRSA 4ECUA 1TR0A 5BYQA 3SSQA 2FUG9 4ZVTB 2HNZA 2YWKA 3FEXB 4FS1A 1RT5A 5I42A 3CW2C 3QO9A 1NNDA 1FO1A 4UY8T 4HVZA 1FJEB 1UJ4A 2MJUA 1X5SA 2IA0A 3TA2A 1N48A 2DR5A 3CB4A 1UJ5A 2XYHB 2XI3A 3BQ2A 1HPZA 2M7SA 3H20A 4NLGA 2LDYA 5HI7A 4Y28C 3NS7B 2JEJA 3FC9A 1N34J 2UUBJ 2BJEA 4IRKA 2F8HA 4JI1F 3JB9k 3MPUB 2CQCA 5THWA 4DV7J 3US5A 4KH0B 2CDRB 4URSA 1C1CA 2XYPB 1BWVA 4CLKA 2MQLA 4QW8A 1APSA 5F8JA 2CPHA 1FEEA 3UDLA 3UR3C 5DQHA 1ZZNA 2VKZG 1HR0J 2J7KA 3GFYA 1SKRA 4RUHA 4K4TA 1S1XB 5B0GA 1X0PA 4Y65A 3N28A 1L3UA 3OXGA 3DOMB 3T9NA 4ZIVA 1V6HA 1KKHA 2GHWA 5HMYA 4IQXA 2V2KA 2MKSA 2FVRA 5ETNA 1UZHA 1FJGJ 3IA0A 3M2UB 1N5VA 3RU0A 2BQ3A 4LQ3A 1KP6A 3R3TA 1HI0P 3KTQA 3F44A 3GIRA 4M8LA 3J7Z5 1WOOA 5ETLA 4U95A 5DRKA 3Q2TC 2DB1A 4OYOA 2ZHOA 3KK2A 2KFYA 2D9PA 4Y3CA 3OTOJ 3BGFA 3EJMA 3AB4B 2LQJA 2ZHAA 3HT3A 1D0EA 2DTJA 3HKWA 2R8JA 3GJRB 3FEZA 3MTKA 3TJ8A 4ZCKA 4QBUA 2L3MA 1YRTA 2C3OA 2DGQA 4XPCA 2M8HA 1HQ2A 4XDCA 3BR9A 3CCTA 4RNOA 1T03A 4FKXA 3MF5A 4A46A 3PJ9A 4YS2A 2VFUA 1RGVA 2A6MA 4DJBA 2YKQA 3KUHA 1JXVA 1D8YA 2PI4A 1JNRB 3ULHA 3J7AN 2E1CA 2GQQA 1VK3A 4DL6A 2VQFF 4DS5A 3I6PA 4YHHF 4I7FB 1K0VA 5ITHA 4ZN3A 1H72C 4NRUA 1GX5A 4EI2A 1IKWB 3DMJA 3R8YA 2CJQA 4NYOA 1RT5B 2XS5A 3QO9B 3DRXA 1X5PA 3CSKA 2RUGA 3E2EA 4FXWA 1UL3A 1EETA 4N5SA 1JWWA 2XMKA 3ENWA 3UE2A 1RWVB 3Q22A 4C8ZA 1TL7A 1TL4A 4ES2A 2QA4S 4CYUA 2E5HA 2K7JA 4J9PA 3IC1A 1MMNA 4DV6J 1KLNA 3V6HA 4X4TA 4OYAA 4DV3F 3KNAA 2MQNA 4IYQA 2XI2A 3PZPA 1RISA 2UUCJ 1Q81T 1KHVA 2RF2A 5HATA 2E1MC 4LRFA 2ZH1A 4ZVSB 1IKXA 3H5XA 3N4WA 4DR3F 2FVPA 1S72S 1F3FA 4X4VA 1N36J 2HZCA 1TKZA 2KM8B 4PQUA 3TR5A 3KHRA 1UW9A 2J76E 5BJRA 1NXIA 1FWKA 2KT5A 5I4MA 4HDHA 5E3CA 1NK4A 4Q44A 1XQIA 3BSAA 4V19X 3NOGA 3ZZ0A 3MR3A 4ETXA 2BKOA 4LSNA 2GMLA 2E7VA 4G65A 1HW9A 4USWA 2DO4A 3D7SB 2H5JB 1JLGA 4PQAA 3DDIA 4K4YA 3LTOA 4LSZB 4K4ZA 2OSRA 3MFIA 2EEYA 1PYOB 3JYTA 4EO8A 4USKA 1MN7A 1RTHA 2KXFA 3DOKA 1KVIA 2ATLA 3RRHA 2FVQA 3NCPA 1UP1A 4LF6F 3BDPA 2ZITA 1RTDB 1HFEL 4USJC 3IXQA 1U6ZA 1FHTA 1WG4A 1T9YA 3RGIA 3M8PB 5F0UA 2HZVA 3QFWA 1OO0B 3ISND 1OQ3A 2YH0A 3L9ZA 3N6MA 1RT6B 1RTZA 4H4OA 4ID8A 4O44B 3OFFA 3P8BB 3CC2S 5IZHA 4J9OA 3CGIA 1U09A 2N7YA 2LP4A 4LSLA 4AUKA 4O4RA 2CRLA 4WFZA 2ZH4A 4DUZF 5IT9U 4DF4A 4WIIA 5IQQA 3PG9A 2JEIA 4ZA1A 1NH7A 1T7PA 1DY3A 1JLEB 1AZSB 2DXDA 2VBWA 4C0BA 1B7FA 1N4LA 3QRPA 9RUBA 1UVIA 1WI6A 2OPPB 4ZS6A 3D0IE 5CZVA 3T1HJ 5C7PA 2C2DA 1CC8A 4RNNA 1XERA 4YY3J 4HI1A 5KT5A 1RT1A 4RWXA 2JVOA 3ENQA 1VBKA 3CD0A 3FBEA 3H25A 3W5XA 1EETB 2M0GB 3G6VA 2OKQA 1FNXH 4LRBA 4CYUB 4BS2A 2E9RX 3VQSA 3UN3A 1EP4B 1LW2A 4X4RA 4DDFA 2YH1A 1H6KX 1T3OA 4CLZA 3TJAA 5DDRC 2RJZA 2W2QP 3MR7A 2L41A 1CJUA 1FDAA 3T6JA 3D3CJ 2WB1D 4KGMA 4M5KA 4CO4A 3EMTA 1R8AA 1RLDA 2XNRA 2FTRA 1TKZB 4NEZA 1UKUA 2D9OA 1JLFA 4F36A 4F2SA 3WBZA 3BPSP 2WK4A 2PSZA 2X1GA 4LF8J 4PRFA 1U02A 3LA0A 2FC9A 2QL9B 1DARA 5JJBA 2WSCC 1SBRA 2VG5B 1S10A 1WF0A 4PUOA 3BH6B 2DXEA 4D3GA 1JLGB 4IG3A 5HROA 3IFEA 1YITS 1PIEA 3I4PA 3OR1B 5ETSA 3MUTP 4OI2A 2WVEA 4UTGA 1FK9A 1LEOA 1DLOA 2KXNB 3I9ZA 4ZVHA 2JHEA 1WEZA 3PTWA 1AA1B 3MM9B 1RYSA 5HMZA 3VTIA 1OIAA 2HVDA 5IV4A 5KFTA 1VQ6S 2XSJB 2ZH7A 5L38A 1PCAA 2E5GA 4HACB 1EJ7L 1D09B 1XR6A 1HQEA 1U6FA 4G1PA 2EFPA 4C8YA 2RDIA 5DG8A 2YWFA 5E3QA 5ETRA 1KQGB 3AFGA 1QTNB 3HULA 4URQU 3E51A 2R2TA 2CQPA 3PHEA 4NLVA 5T7LA 2V2QA 4LSLB 2W01A 5H9EK 2Z2MA 3UDVA 1WC0A 3BBBA 2W25A 4DR2F 2I9SA 3WX8A 5A2QU 1YBTA 1TZ0A 2XY5A 1S99A 3HSDA 5A0YA 4P2SA 4M5IA 1N5SA 4DG1B 4WFYA 1VC5A 1W26A 1EKRA 4RZRA 3SYZA 3QPIA 3M1VB 2V69A 1OSCA 3PYGA 4MYTA 2CWKA 3NCRA 2UU9F 1Y7PA 4HT7A 1F5AA 3UNYA 4DUYJ 3D3BJ 2HNDA 2LKZA 2WTFA 1DURA 2ZHBA 4WFXA 4YDDB 1KS2A 2BJ3A 4DPUA 4DSIA 2HRYA 4R5PA 2VBYA 1C1BA 5D0HA 2HBQB 1UWBA 4DR4J 2RVJA 1TP7A 1R6VA 4K59A 3SCJE 1PJ6A 5KFNA 3D67A 2UUAF 1DQAA 2MQOA 3A4TA 2ZH6A 2LU2A 1P1LA 1Q0NA 4TLRA 2MB0B 2B4VA 1S9EA 1G1XA 2OO4A 2WOMB 1X5TA 1CJUB 3TAMB 3TUZC 4LFBF 1BQMB 2BDPA 1LFPA 3AJDA 1HNXF 4B3RJ 1UPPA 2LECA 4MAKA 2XLJA 4ILMA 4O4GA 3EVOA 5KFRA 2NZCA 4WJBA 5D4LA 1WC5A 1KRPA 1RAJA 3K8VA 4JI2J 3GE9A 1P27B 4ZPBA 4EBCA 1FRMA 3GLJA 2DNKA 2R2UA 4FZVA 4DPXA 4CZCA 1NSKL 2GVZA 3HVWA 3U7JA 1RTJA 1W2IA 2DNOA 1W2BR 2DR6A 4IG3B 1MWQA 1WTBA 5U47A 1U1RA 1WDTA 1FK9B 2K8GA 1NHVA 3DLEB 4GO5X 3AA8A 5F0WA 5DLGA 4OHYA 5A6WA 3R1HA 2RRAA 1IKVB 3VVTA 2DD8S 1KONA 1TUWA 5DDQC 4ZLNA 1S6UA 1UVJA 3N01A 4KPCA 3KLIA 4ED7A 4ZCMA 5JVHQ 1E6VB 2BR0A 2BRKA 1T0TV 3JAMY 2E7XA 2NXEA 1HQEB 3VGSA 3QATA 1U7LA 3AT1B 1S0VA 2HEKA 4IDKB 1SC1B 2FB0A 4P2MA 2WVFA 1T8EA 4Y2AA 5G0RB 4JI1J 1D3WA 5T7LB 1GXLA 1REVA 4NLOA 2JL9A 4QWCA 2J8SA 1F5BA 2J7UA 3MAAA 1WDDA 2DEIA 2DR9A 1S6PA 4RW9B 1JXLA 3OW2R 3DDKA 1NJYA 3H0PA 1LK5A 2MSSA 1VHFA 5EX3A 3G6YA 3G8SA 4LF9F 2CFXA 4N7TA 3NAIA 2J0QD 3I0SA 3BYRA 2GFFA 2AZ1A 1RHUB 1XIQA 1GTEA 2DGUA 1UFWA 2HNDB 2F4VF 2H51B 3QIDA 1JJCB 2NR0A 3M6XA 5JVGQ 4WFNQ 1H7WA 1I5OB 1FKPB 3IRXB 2KRBA 1AB8A 5KFKA 5FIIA 1WHWA 3G82A 3BQ0A 1T95A 3MR6A 1L3TA 4EO6A 2YKAA 4RNHA 5KFHA 5IQ6A 4JI3F 4NYZA 4B3OA 2AMCB 2CQIA 3VAKA 2MHEA 1YGYA 3PHTA 4CTAA 3CJSA 1C4CA 1AUSL 4LF2A 4A48A 5HQMA 4LRCA 2XBPA 4IFYB 3WHIA 3KHLA 2VBZA 4PPDA 2RD5C 4LF4F 1R27B 3GYNA 1V9OA 3TNVA 1JB0C 5IOLA 3IG1A 2BVZA 1RBLA 1PGZA 3TW0A 2VPYB 1UVKA 3C2PA 2YQ1A 3R5DA 3I4HX 1SB6A 3DOLB 3L7OA 2GVZB 1FRXA 2V68A 1CVJA 2FVSA 3NG8A 2OTJS 1RTJB 4IO9Q 1LFWA 3IRWP 3SDEA 4R0JA 2HKEA 1IKYA 2OJ3A 4OZ2A 4HHUA 2PN6A 3BS9A 2VFTA 3RJMB 2ZE2A 2VQFJ 4YHHJ 1CJVA 2XEXA 2X7IA 3OTCA 3U1LA 1ZPVA 4FBTA 3OUYA 5C2GA 2M3DA 2XYGB 1FRKA 1VHIA 2WONB 1KOHA 3LH2S 2YNHA 1IJEB 4IH6A 3OVSA 1SL2A 3DRRB 1RWKB 2IM1A 4ICLA 3QRQA 1DTQA 2ZNYA 1FEHA 2P9GA 3IM8A 3P5BP 1RT2A 3D5MA 3PIPQ 2RU9A 3OT9A 3VZIA 1GNKA 1VLYA 5D0RA 1TL3B 3KDOA 4NCAA 2J9DA 4DV3J 4BBYA 1Y11A 3M8QB 4TYAA 1FA0A 5IWAF 4OYBA 2JC0A 1REVB 2HQIA 4DR3J 5B0BA 4V19J 1S6PB 4MMOA 1H98A 3MD1A 2FZGB 2CQHA 2YWWA 2VICA 2LU1A 3ZZRA 2CPZA 2CG4A 3M2VB 4OYWA 1KC8T 2MGZA 1TKXB 4IQMA 1H38A 1RAHB 2YVSA 3DLJA 1HNVA 2XGQA 3B4DA 4H4KC 2AQ4A 4CLYA 2RKIA 4LBHA 4IRCA 4CT9A 4CO1A 2E5LF 2PMHA 5J1NA 3CPWR 4C4WA 5CCMA 4Q7AA 3GWCA 4JV0A 4NOHA 5I3PA 1Q79A 3TYTA 4DL5A 4MTPA 3JQJA 1XN9A 2H4WB 3ELHA 4DCJB 1CJTB 4I2PA 3KLHA 1R0AB 1F6TA 1LWEA 5C42B 3FGVA 2B8PA 4LF6J 5LSRA 1CQMA 3G9CA 2J7WA 2C2RA 3QGGA 1PSDA 4DOZA 2DCUB 6AT1B 5C24A 3SXLA 2DY1A 1LW0A 4TU7A 2Y8YA 3ITHA 1NK9A 2J6SA 1R8CA 1N8RT 4Q8EA 2AGPA 2CJAA 3CMQA 1PAUB 1YZ6A 5HMWA 4KGKA 1HYSA 2R2SA 3MPVA 1QLNA 2C3UA 1C0TB 3CO9A 1O0PA 3CJKA 3SIPB 3D4JA 4UZCA 4DUZJ 5KFLA 2Q6BA 3R5BA 3L7UA 2ASLA 2ALYB 2MTLA 1NSQA 1S59A 1GFWB 1UEUA 1ZM3A 3EICA 3TARA 1IKYB 4ZVPB 4I69A 4ECRA 3DLKB 3LANA 3NNHA 2W8KA 1IM4A 4HDGA 1U1NA 3VALA 2QMWA 4JI8F 5SUHA 2ZZTA 4ZVUB 3HPOA 3H2LA 4KB7A 4G3IA 2R2RA 1NB7A 1ZETA 1TU0B 2V50A 2CPEA 1Z1ZA 4K4XA 2DK2A 4TYBA 1DTQB 3QJLA 3I5BA 1KNZA 3OD2A 2MQPA 2CNOB 1NRKA 1ELOA 1RT2B 2K3IA 3A12A 4A8MP 3JTPA 4Y0FA 3PACA 1RP5A 1M1HA 5CHCB 3A8IA 1F9EB 5HN0A 3EGWB 4ANEA 3PEJA 2E1RA 1B0VA 3KDNA 4WPAA 3MM5B 4H54A 1TELA 3HVRA 2H4YB 3CEDA 2K1RA 2HQFA 4RLEA 1M5OC 4JV5F 1S12A 3NBPB 5EHHA 4DX8H 3T41A 2MEWA 1WSRA 4USHA 2RILA 1V5IB 3KKFA 3MHYA 2L9DA 4ZN1A 1G7CB 1YDLA 5D3GA 3QMQA 2LQBA 3OLBA 2NXCA 1RBOB 1IR0A 1SKUB 2RKIB 4ERDA 2MY7A 4J91A 2AZ3A 3QYYA 4ECZA 3EX7B 5E5NA 5A8WA 2JNJA 4UQTA 3MEGB 2DHAA 3L4BC 1BUXA 4PYDA 3FCHA 1S7IA 3B8HA 3OV7A 1IM6A 1D8ZA 5KG1A 4IR9A 2Y1LB 2QLXA 4G1QB 2QA4G 4M5GA 2DYAA 5CD4H 3VVUA 1IUJA 1HBOB 2DNMA 2PO4A 1G6BA 5KFQA 2QA2A 5C24B 2PGCA 1M5KC 1RT4A 1IBCB 2IM2A 1K1SA 4AL7A 4B9LA 1K9MT 2AX0A 4WXOA 3V6KA 4TU8A 2HMIB 2CG8A 1SQFA 1TK0A 2XSFA 3Q0AA 3DC2A 2IM3A 2E5JA 2KVIA 2QRRA 3HI9A 4XIUA 4IFVA 2X51A 3IWXA 4O3RA 4NCGB 4URGA 3CJKB 2Y0BB 4K4WA 2XCAA 1U0SA 3NGDA 2C28A 4DR2J 2GJ2A 1KSPA 3FK4A 4Q2MA 4HI2A 2KKHA 3EGVA 2XULA 1MROB 1Y10A 3P3DA 4JI0F 4PCQA 5ETPA 3CDAA 3WDOA 4J5OA 3GYXB 3CC4S 2CIMA 3ETOA 1EZZB 3TP2A 2RMLA 2UU9J 3T3FA 2HFNA 1CBKA 2DH9A 2RB7A 5BYRA 5KFUA 4F04B 4DX7A 2PMZD 2QLBB 2GX8A 1RT3A 3BREA 2QC3A 1IR2A 1SI9A 3O1LA 1YLXA 4X66F 5KT3A 4DR5F 2J0WA 1RT7A 4DR6F 4RUCA 2UUAJ 3HK2A 3DNCA 5KT2A 5D0GA 3EPIA 2H9ZA 2GNKA 4PXCA 2W9CB 4F0KA 4OZJA 5IM0B 2OI2A 4NLTA 3HFZB 2DBBA 1UAWA 4EEYA 4XK8C 2IRYA 4LFBJ 4OJGA 4NRTA 1HNXJ 4FPIA 3J81j 2NZ4A 4OLOA 3J81Y 4ES1A 1L3SA 5DQGA 2VPWB 5CZXA 2XLIA 4P75A 4QW9A 2AYMA 2MZ1A 2JLGA 2ZBIA 2ZFHA 3WX4A 3KNGA 4KHRA 1GT8A 1UZDA 1V3ZA 5D3GB 3LQVA 1OS5A 2XMTA 4I0WA 1TQLA 2HHUA 3T1AA 5E3AA 5DLFA 3EZOA 1REGX 4OYPA 3PEHA 2HHTA 5HL7Q 2HAIA 5A8WB 3K7RA 2OELA 3VZHA 2HK2A 1BE4A 4ID5A 4TU9A 4YR3A 1GAOA 3DXBA 2QG9B 4KKOA 3RAXA 2LCWA 3PYDA 4LF1A 3THTA 3SV4A 4ELVA 5H9FJ 2ACYA 3CDEA 1YJRA 1FFWB 2GGPA 1RT4B 1IWAA 2B6AA 3AD8C 4ECTA 5E33A 1BD6A 2I0XA 1X4AA 3TVKA 4Y34A 5J1EA 4NWBA 2D3UA 1A0OB 3FVYA 4LRDA 4UZBA 1U8WA 1NDLA 1CJKA 5KFYA 4RBVA 3EGZA 4A8WA 2CJXB 2BX6A 4PG4A 2MMYA 4QPTA 3RBXA 3W9IA 4LUBA 3KLGA 4Y00A 1HNWF 3CCJS 4X65F 1NK5A 3PJWA 3AQOA 3D6FB 1TMJA 4KSEB 1SH2A 4K2JA 5HBMA 2BM1A 2F4VJ 4ED0A 2R9LA 4UY85 4K7QA 2A18A 3D6HB 2AJ1A 1YG0A 2L9WA 3QWPA 4ZJQA 3GFXA 3BBCA 4KQZA 3UI3A 3CCVS 4CNYA 2E5IA 4ED2A 4ED6A 3EE3A 4PWDA 1BY9A 4JI3J 4ED5A 2CVIA 3CIMA 2F5GA 2C2MB 2NPFA 4A8YA 3KK1A 1NKCA 1S1TA 3FRZA 4D3HA 2DNPA 4N8NA 1VQ4S 1UCNA 4F4KA 2GW8A 2AJ0A 2NPIA 4OZNA 5CA5A 2NQPA 4LF4J 1HIYA 3NWRA 1D9AA 4PXBA 1Q7LB 3DHWC 1LV5A 2ZD1A 4ZMMA 3A1YG 1XJWB 2GJIA 1O51A 3A3NB 2QSFA 5J2PA 3QAUA 4PABA 4OZ1A 2O67A 1AW0A 4C8KA 2MQMA 1X4HA 3TVZA 8ATCB 2GHPA 5F9LA 2MZTA 5KG6A 4QIVA 3M6WA 2DR8A 3ET6A 4GRSA 4P72A 2C2KB 4OZLA 3HVTB 2LEAA 4LRAA 3DLLQ 3M32B 2FLPA 5K8PA 4ECYA 1EB0A 1A9NB 5F8LA 2M8DB 3AXKA 3A13A 3HD2A 3UD5A 1N33F 3M8ZA 2CPFA 4KKOB 1PILA 3JQKA 3JQMA 2BQUA 4PYAA 3A3PB 4DF8A 4USUA 2HS4A 2HHSA 5IT9Y 3HM9A 3C14A 5D78A 2GGPB 1QY7A 4ETZA 3SEOA 4EK2A 1Y4ZB 1TL1A 3MCNA 4DX6A 3D1OA 4OJ1A 3R7SB 2CNNB 5J1EB 2EK1A 1U8SA 4JBCA 2E9TA 1H0HB 2V8DA 5IWAJ 2E9ZA 2LA4A 2V8PA 2R7QA 3HHLB 3K5PA 1Q53A 2C2OB 1WKJA 1WF2A 5DETA 4YR2A 1SV5B 2U2FA 3KLGB 4LT6A 3BKUA 1J5EF 4RW7B 4OI1A 2D3ZA 3J7ZT 4CQ1A 4K4VA 1R43A 4RWWA 4C2MA 3HZGA 4X4NA 5HVFA 2I38A 2FC8A 3FNNA 2LEPA 1RHMB 1WOSA 1HI8A 1SJFA 1IN0A 2E5LJ 1Z2LA 2ZZNA 3Q8RB 1QTMA 3R2CJ 1D1UA 1SL0A 4U7UK 1YHQS 1QE1B 2AYGA 3AOAA 2G0JA 4P7TA 2KYXA 1RWXB 1S48A 4DV6F 2JC1A 1BQXA 4JI7F 2IRXA 1RJJA 2SXLA 1AT1B 3DI6A 4HHJA 4I6AA 1NJIT 4PWDB 1JKHA 2KFNA 2VC0A 4TVAB 4MK7A 3KK1B 2W7OA 3MMJA 1U0HA 1S0OA 4F25A 1U1QA 2B5JB 2KZZA 5HLFA 4LVNP 3SFUA 2ADCA 2PE8A 3T9ZA 5CYMA 5JMNA 1NB2A 4FNIA 6FDRA 1VQSA 1SJQA 3DLBA 4ECQA 1HMVB 1RADB 3GIIA 2HIQA 2D41A 5GMKa 2BJ7A 3CXCR 4I4BA 2OFHX 2ZD1B 2J9EA 1U25A 2ZOFA 4DU8A 2PI5A 5AE3A 4RW4A 2VIHA 3KJQB 1EARA 1VBZA 1FX4A 5KFDA 2HYIB 2JLFA 5J2MA 3IBFB 3PV8A 2AYBA 3PO4A 1YK9A 1OQ6A 3ADAC 1FFSB 3ET6B 3W2WA 3I31A 2DNYA 3NGKA 2MZQA 1JQGA 3GJTB 3ZTOA 2HHXA 1AFJA 4IR1A 2VG6A 3DM2B 4JI8J 2DISA 3QRRA 4L76A 3D9BA 3FFIB 3OXFA 2HBZB 1YRUA 2NSBA 4DPYA 2MXYA 4OV1A 1QAJA 2HWTA 3SSRA 1WORA 1AYEA 5CYQA 1F9HA 4CLFA 4P7VA 3MMAA 2ZEJA 3O44A 5A2QY 3C14B 4ZIWA 3VGVA 2COLA 2UV8A 5DG9A 5B09A 3DLHA 2CA9A 5K14A 4N77A 3I0RB 2RSQA 4LVOP 2CAJA 1ZM4A 3CUNA 4IO1A 1X4CA 5A8RB 2IYIA 4JOUA 3OXLA 2MKCA 2CPDA 2HIYA 5T41A 1SIZA 3M2RB 3TX0A 1B64A 4O23A 2AHOB 2G13A 2CWXA 3KYLA 2G9OA 2HWIA 1ZPWX 4USVA 4JV5J 4F2RA 2B43A 4RU9A 3AOBA 1S97A 4ED3A 4HT5A 1Z4UA 1NBEB 2XNQA 4J37A 2DIUA 2XZDB 1GQEA 2NXJA 2KB2A 3TEGA 4EGLA 2VC1A 3WC0A 1T02A 2EG1A 5IXUA 4NA1A 1DHMA 2YX4A 2GMHA 1Q8KA 3KLFA 3KWMA 2AU0A 4PZVA 1TVRB 4LR7A 2MY8A 3RTVA 1Y3JA 2IFXA 3NNAA 3TZXA 4L3NA 4AXIA 2IC3B 2C2ZB 5KOWA 2XO6A 4YR0A 3Q83A 1P8GA 1JLCA 1S6QA 1VS3A 4K0KF 4BDPA 2VA3A 2BANB 2FZKB 2WZ1A 1R0BG 3DDNA 3GIKA 1U0HB 4U96A 2H1YA 1PYSB 5BXIA 1XC9A 2YKPA 3CCQS 5CYMB 4C6AA 2HLUA 4DL3A 3K59A 1G4CA 5GVQA 3FDSA 1M1GA 4W90B 3LP1A 2YKMB 2VZ9A 1YRXA 3RG6A 1LKZA 2B51A 5E3RA 1EIYB 1VR6A 2A2CA 3CJQA 3BN7A 2CQDA 4P10A 2YKNB 2RIJA 2B3TB 2KJWA 2V6AA 3SMZA 3MM7B 3H90A 3C6TB 1H2UX 2X3DA 2E66A 3LP0B 1VQNS 2P2CB 4JI0J 2BJDA 3W2WB 1KFSA 2ZH2A 1S57A 4ZDNA 1UA1A 3EYZA 4F3MA 1C2PA 4QR1A 2MZJA 2ZBPA 4DQSA 1LWFA 3KJVB 4DFKA 3G86A 4CLUA 4DSJA 1RAFB 3MEEA 1N5TA 1HQUA 3U1MA 1IWGA 4ZJLA 4JV2A 3T6BA 3OVAA 1KD1T 3H5YA 3RW7A 4MYUA 3K5NA 1RWPB 5CYQB 2MKJA 3EPGA 1HLWA 3QT5A 1DJ0A 1GH8A 4X66J 5HP1B 3FBBA 4DR5J 4DR6J 4DEZA 3BKTA 3NS6A 3K0JA 3BH7B 3TUIC 2FZCB 5B7WA 1F5CA 3VAHA 4LF5F 3OLAA 4I56A 5F8NA 2FHJD 1AXQA 1OY8A 3TZZA 1XNQF 2DHHA 2ZBCA 2NYHA 3AODA 4X4QA 5AE1A 3G4SS 5J2NA 1I1GA 1U2FA 1TTHB 3N5BA 3D1QA 3MEKA 1VJQA 2V34A 5KG7A 1AUDA 2UXBF 4NYPA 5EUHA 3HHLC 3P6YC 3OJUA 3NP5A 3VGUA 4ENOA 3NY0A 3KLVA 4IOBA 5IFMA 4JB8B 3X1LB 1CQNA 4YDXA 4ZCLA 2QSWA 1VIOA 1WKLA 4DR4F 3HFVA 1Y5IB 2B0GA 4E98A 4B3MF 3MOJB 2I5JB 2B9EA 3G6ES 2FPHX 3FQLA 4QWAA 4RU2A 4MK8A 2FHKA 4PG5A 5IS2A 1S77D 3TAQA 4KHMA 3G8TA 3HXMA 4RUAA 4ALZA 1J2VA 2ZOGA 1RCXB 3LAKA 1QD1A 1SQEA 2V4JA 4DFMA 4CO0A 4FBUA 2QL7B 3RBEA 3SQGA 1JLCB 1S6QB 4F3QA 4FYXB 1K0TA 1VQMS 3HHNB 1RYRA 3M7VA 2VUGA 7FD1A 4HHHA 4B9NA 4XPEA 4RR5A 4GKJF 2HNYA 3PY8A 1U48A 2IVMA 4ZVEA 2DGVA 2JOQA 1FNMA 1JJ4A 3OQ2A 2XZWA 1QDUB 2KYZA 3OPKA 4PEOA 4BLGA 4X4SA 1RTIB 2VD3A 3HO1A 5F9NA 2GIQA 4DFPA 4QWDA 2BABA 3K57A 2GHVC 3CULA 3KG4A 3IBWA 3CDWA 2DGWA 1HNWJ 3MZIA 4X65J 1S4EA 1HW8A 3C16B 1UMJA 3CJ5A 1KHWA 3R1LA 4YOEA 4C48A 2P8IA 3Q23A 3NLCA 1HARA 3GTYX 3MXHP 2C3MA 2HFSA 1DAXA 1PBUA 4YN3B 4KFBB 2WW4A 5M2PA 4O3NA 1CG2A 3DU6A 1VDHA 5ETKA 1OY6A 5CABA 2BV3A 4QPXA 3VAGA 4HEA9 1MU2A 4DX5A 2DNRA 3JTNA 1N88A 3W3SA 2QJ3A 5GMEA 2R7UA 4UT4A 1T05A 3S01A 2HHWA 4X64F 5HK4A 2W9BA 3CCMS 5DQIA 2OPQA 1B4SA 1N6QA 2J8AA 3LPYA 1KLMA 1UVLA 2H3EB 2QMXA 3CNQP 3SBMA 2YNIB 1SJ1A 4OFZA 1EQ0A 1HNIA 5J2NB 2CJKA 2FDNA 3OL8A 2CJ9A 2D1CA 1S1VA 3LWMA 4XAKA 1WTFA 4DL7A 3C15A 4YUDA 4DPTA 3ETMA 4UW2A 1KDNA 4ZOSA 3M9NB 3CJ8A 4ZPAA 3IBCB 2OPSB 1SQGA 1JLBA 4Q43A 3PNIA 3T19A 3DRPB 2DR7A 1Q7YT 2IM0A 3GU0A 3Q86A 1QAXA 2VPXB 4MT1A 4EWTA 2KZMA 4WP8A 1SVDA 3IGVA 4NMLA 3W2VA 1S9GB 2M70A 1NUEA 4OJHA 2PMWA 3I9V9 1SXLA 4WTOB 4QIWD 1RHQB 4F7VA 3TAPA 4F4YA 5H9EJ 4PXDA 4KHPF 3UVJA 4PR6A 3V6DB 2AEMA 2DGXA 2HFZA 3DYAB 2E1AA 3CE8A 3MM6A 1S1UB 1VJWA 2FJBB 3FCVA 1N33J 1FDNA 3IR7B 3H98A 2N4CA 2V4JB 3GSDA 2GQ2A 2NUUG 4ED1A 4Q0BB 3SQGB 4LIWA 2FLNA 1N0VC 5DDPC 3Q8SB 4DV4F 4ITSA 3BGRB 4PAAA 5LXRA 2GA7A 4M5MA 3DCAA 4K5RA 3OR2A 3MEDA 4B17A 4U7CA 3RB3A 3PO5A 1WJ9A 1M1KT 1EAYC 2CNKB 1YVFA 4X84A 3UD3P 3D54A 1I94F 5FJ4A 3KG0A 4B3SF 2WB4A 1NH8A 1SL1A 3W64A 2P6TA 3MMBA 3ZZUA 4AT1B 3GQCA 1N5YA 4B3TF 2FGOA 1S0NA 4NZ0A 3O2IA 5B08A 3M6UA 5HQLA 5HJXA 2W1BA 3K5LA 4ZVOB 2YPZA 3UO0A 2UXCF 3AB2B 2CQ1A 1J5EJ 3MD3A 3DRSB 3VAFA 4WK3A 4ED8A 2AJ2A 3A8EA 1KTVA 2GVDA 2MQ8A 2HNZB 5L9XA 3I87A 1DBDA 5K5MA 5I42B 5KG3A 5IT4A 5IT0A 2F9JA 2GCFA 1FESA 4JI4F 5ADZA 3P49B 1MU2B 2EC0A 1LXJA 1UEKA 1HPZB 2EXUA 4QJVA 4DSEA 4JI7J 4U8YA 8AT1B 2CADA 2W9BB 3A3OB 3NGTA 3V5RA 2BE2A 1FTRA 2VDIA 3M30A 2GO9A 1N6QB 4ZJOA 1ZOTA 5D0EA 4MFBA 3ZTQA 3UPFA 1RAAB 2FLLA 2VDHA 2AJFE 1C1CB 3BGLA 3IN5A 2RRBA 4A8FA 1QM9A 1S1VB 1Q16B 2HQ3A 1Q5VA 2OEMA 1Q8IA 2QYCA 3Q8UA 4CI0B 4C8OA 4K2XA 1OYDA 1TK5A 1FERA 1WD6A 2KG0A 1VRTA 3G8QA 4RBTA 1JLBB 2HFVA 2EK6A 1S76D 2CPYA 2ZBQA 2D3O1 2JVRA 1U47A 2B9YA 2MKYA 1QSLA 2DH7A 2HSEB 2VJUA 4EZ6A 1EHWA 4NLYA 3R7BB 1VK8A 2KN4A 3ZFVA 3JSRA 2MSTA 4QIFA 4ELTA 2LXIA 4NI2A 2ACMA 5FD1A 3DXSX 5DZ7A 2KH9A 3UVJB 3H40A 4ZPWR 1FE0A 4WU3A 1JMTA 4O3SA 3MM6B 4UOGA 2ROEA 2IBOA 1DTTA 2FJVA 4NXMF 1RKIA 4TQSA 3KK2B 3JAMU 3EM1A 3TI0A 2IIHA 4ZPVR 3BM7A 3UR0A 1VC6A 3HLUA 5HSPA 3OR2B 4FYVB 3ZZYA 3U1NA 3B6BA 4DQPA 2HGLA 4FN5A 3MCOA 4J7CA 1M5PC 3KUEA 2HLTA 3BEGB 5KG4A 1TFYA 2M2BA 3OL7A 1NLKL 4ZVFA 2GIRA 4DV0F 2YX1A 1T03B 3MMBB 1C0UA 3IM9A 3IS9A 2CVEA 2BJ9A 1VIXA 4ZITA 4HYKA 2ATCB 3W65A 4CLSA 1HWKA 3KJNB 3GR1A 2V94A 4OI4A 1Q5YA 2MQQA 2IAJA 5I3UA 1UFLA 4LJMA 3QIPA 4WBFA 3GMGA 4LF7F 1ZAWA 4C11A 1NMEB 2EFOA 3JSMA 3DMJB 1PC5A 2AJ4A 4J9SA 1IVZA 2V8HA 3QNWB 3M9OB 1FKOA 2YNFA 4NE9C 2DNGA 2QTWA 2C1EB 2CJBA 2NCKL 4Y2MA 1NJZA 1TL7B 2P5VA 4FNHA 3IP0A 2N82B 1JK9B 4RL1A 4A8SA 3NGSA 3N0VA 4GMKA 4E0DA 1NU4A 2BOAA 5GADU 3KMQA 2QGFB 3HSZA 4YEAA 2RF2B 3OTBA 1NZ8A 2AV5A 2FJXA 4K0KJ 1IKXB 1OJ4A 2B7CB 4W92B 2IA6A 1C4AA 1CS4A 1OY9A 4HR2A 4PQUB 3AY0A 2QIFA 1WHYA 1UTAA 2W2OP 2QO3A 1LWXA 3ONQA 3NOCA 2VONA 1BWEA 5E3PA 3K5MA 1LWCA 3D28A 4FKYA 1R8PA 1VLOA 3QT7A 2AGQA 4KIAA 1XK8A 2HVIA 3FMWA 2XMWA 4DR1F 4J9KA 4LSNB 2I8EA 2ZJRQ 3SCKE 2BOPA 1E6YA 2JEFA 2YBVA 1XMOF 2LVWA 2VH7A 3MPDA 3JYTB 3HHDA 1P6TA 1RTHB 2FVCA 3DOKB 3M9MB 1VBXA 1BLUA 4A8KA 3BDEA 3K89A 4HL9A 1URRA 2C42A 3LP2A 1W25A 2L48A 1U1OA 4OLPA 4OYXA 3L09A 1UPMB 2HQCA 5E41A 1WG1A 3F0NA 1DQ8A 3CDUA 4H4OB 5GADI 5H9FK 1S9FA 4PG7A 5C2CA 1NKBA 3TQEA 3QLHA 4CIOA 4LF5J 2R7WA 3CMAS 3I96A 3HHEA 2Q43A 4NPOA 2CPXA 2UVRA 2G4BA 1XNQJ 3NWGA 3QT8A 1LXNA 1KOOA 2OPRA 3W9JA 2XS2A 3PFEA 4OYIA 1FXLA 5E2QA 4NLRA 1C0UB 1Q86T 5J2QA 1NPRA 1F3VA 2UXBJ 3GSIA 1N54B 3P4UB 3N5FA 2FHOB 4P52A 4CNZA 2IAJB 2LQ8A 3QIPB 2ZKUA 4NEYA 1X4BA 2PEBA 2BQRA 3M05A 4TNOA 4KE5A 2KXHA 4E8UA 4O3QA 3JSMB 1PJ7A 3MCMA 1RT1B 1FFGB 4JI5F 2QLJB 1PYTA 4ZPTR 1OSDA 4ZVRB 3X3UA 2XMJA 3K2YA 1B3TA 4B3MJ 1BHNA 2W4PA 3RBZA 4ELUA 2FY8A 2G1HA 1VCTA 2XZTB 4C0OC 2ZWPA 3JXOA 1EKSA 1D9FA 1LW2B 3PKMA 2M52A 1QVFR 2GIFA 3M8WA 3L95X 3R5JB 2ASYA 1B0PA 4Y6IA 4F0MA 2J0XA 3POTA 1ROFA 3DKDA 3I32A 1RZMA 4NLUA 2Y3YA 1YQHA 4C8NA 4W4MA 2RH3A 4HTIA 1HBNA 4O3OA 1CS4B 4F4WA 3OSPA 4N47A 2YWEA 4TY8A 4USTA 4HKQA 3CC7S 1JLFB 1SUQA 4IG0A 4GKJJ 1TFWA 4P6QA 3IR6B 3TEHB 2KM8C 4KTQA 1LWCB 4ECVA 8RUCA 2NSCA 2UP1A 1BC6A 2NLWA 4AXJA 2AYEA 5KFIA 1IBKF 5A76A 2R4FA 1RWNB 4HH1A 4U9RA 4PUOB 1V3SA 3T5JA 1WEYA 3F73A 1E6YB 5HROB 2R7XA 1U1PA 1ACMB 1FDBA 1DLOB 1YJNS 1GEHA 4ZP9A 2YQ3A 3IWNC 3LGNA 1VQ9S 4MKBA 4J9UE 3SV3A 2HFUA 3CMES 5HAOA 1ZAXA 3RB0A 1XR5A 1VOMA 1ZYQA 2JDJA 2DHSA 2V9WA 4Z7CA 1MG7A 2DY9A 3OJSA 2OH2A 3AOCA 1SPBP 4IOCQ 4LMZA 2QEXS 3W61A 4X64J 4RNMA 1S1XA 3QLHB 2YQ0A 1S7HA 2HGNA 4QQBA 2V2ZA 2EVZA 5KFBA 3H59A 2C2EA 4L6V3 3MR2A 2F8EX 4ANCA 1N52B 2AIRB 1S5ZA 3M2UA 5KT7A 2O3DA 4M5HA 1XBWA 5A0YB 2AT1B 4C9DA 2GV1A 4IH7A 5DZ6A 4ILLA 1RAGB 1GK8A 1FD8A 1FWPA 1VRUA 2LQ9A 4TQRA 5L9NA 3CJ4A 1NDCA 4QYZJ 5EX0A 3N9UC 3M8YA 2EI5A 4FYDA 4R5PB 2X1BA 4MKYA 4GKKF 1C1BB 4P2XA 1UWBB 3NL0A 4WFBQ 5LMUF 2FHMA 5LSOA 3TX8A 3D2WA 1BGXT 4KHPJ 4GVLA 4ZK7M 2NUHA 2RDDA 4OX8A 1GMWD 2JEGA 3I5CA 3QGIA 1MSWD 1S9EB 1S4FA 4J90A 1GXTA 1ZAVA 2BMBA 3B54A 3FKBA 3PX0A 2VOPA 4O0IA 2HBYB 1TL5A 3B78A 4DV4J 4BHQA 4R8UA 2V4QA 4OI3A 4O4GB 4RPFA 1F2GA 3TUPA 3CCSS 4A8OA 4ED4A 3H7HB 4NZ6A 4DXLA 4WYWA 2EW9A 1NK6A 3EVWA 2KFZA 3B4MA 1Y5NB 4I7FA 1VQ7S 3QJPA 3PFOA 1I94J 2RQCA 3WC2A 1IKWA 1R31A 4B3SJ 3QFHA 4USMA 4KRWA 1Q4RA 2OMLA 1RK8A 3R27A 3MFHA 3GR0A 2ZVSA 3ZNJ1 4B3TJ 2LMIA 4M63A 1WC4A 4WP9A 4CO5A 3HHLD 2V4RA 2XG8A 4CH7A 2UXCJ 3I56S 1HD0A 1NM2A 2LEBA 3HCXA 4ILRA 4MJKA 3T5KA 3NAHA 3UW1A 3HSJA 2ZDOA 1RWMB 4B9SA 4ZLLA 2XLKA 4KH1B 1FXDA 4I1TA 2O1PA 3AJ2A 1T11A 2M4MA 3DRYA 2GS8A 5AXMA 5KFXA 3KLIB 4JI4J 1OPIA 2ZC3A 1TAUA 3RR8A 2V67A 4P2FA 4UOCA 4M5DA 1UW4A 2HPUA 2BYCA 1JIHA 3PJXA 4NLXA 1UEVA 1VQKS 3KMSA 2EKNA 4I2QA 3J81U 3MAAB 3ZZZA 1A7GE 3AH6A 4FPRA 2N4DA 3G96A 2EC2A 3KXDA 5KFAA 3LOUA 5KFJA 1FXRA 2H5IB 3GG1A 1N0UA 3I55S 3G6XA 4AL6A 1VRUB 1N56A 1CEZA 2HHVA 3V6JA 2ZH3A 3EGNA 1FVQA 3SSSA 3I0SB 1KBRA 2V5HG 5CAAA 4F50A 5L39A 2J6UA 1NSAA 3VQTA 1HHTP 1RTDA 2OP5A 2WAQD 2KI2A 1Q82T 1H2TZ 1VQ5S 1FRHA 3M8PA 2V8GA 4L73A 2ABYA 4QR0A 4G6VB 3OFEA 3V2UC 1JJ2R 5RUBA 3L3CA 2CQ0A 4DUTA 1RT6A 2UXDF 1YJWS 3H5UA 2H65B 4O44A 2QE5A 3GIMA 5M2RA 3G82B 2DIVA 1Q1KA 1T9WA 1FT8A 5CYJA 5L1LA 2IDLA 2RRNA 1X9MA 1YKWA 3GV5B 3R6LB 2FY1A 1M5HA 3PDNA 4NXMJ 3P96A 4QYRA 4B3OB 1S79A 2DVIA 5LOQA 1SCJB 4QR2A 4CTAB 3UDEA 1HBMA 2RHSB 2R42A 1JLEA 1AZSA 2LQ5A 5AJ3F 4R8UB 4K50A 5B0FA 3VR1A 2OLWA 4WF9Q 2I2YA 2CDQA 3CIZA 1XMQF 4RBUA 2OPPA 3QSIA 3M4XA 5L1IA 3MI7X 3PR5B 3THPA 4C8MA 3IG1B 3SI8A 1SIWB 3WQPA 1RUSA 1X5OA 3OFGA 4DV0J 4QZVB 5C25A 3VF0B 4WXWA 1MN9A 2AEFA 5KFWA 1OPZA 2HWHA 3SDEB 4G1IA 2C3YA 1HHQA 3DN9A 4OI0A 2I1RA 1ZA1B 2KO1A 4MKAA 2EFGA 1ULRA 3GZ7A 5DDOC 1EP4A 3NMAA 2HVEA 2ZE2B 3FZ2A 4IH5A 2F3JA 1CJVB 4LF7J 2R8IA 3NEKA 3R5AA 3OUYB 2WCXA 2OUGA 4A8QA 3MECA 2MHNA 2KTQA 2YNHB 4EU0A 3T5LA 1HA1A 3VAMA 2WSEC 3EWGA 4ICLB 3QGHA 4Q8FA 1TV6A 2J6TA 1URNA 3QSYB 4OYMA 1QUVA 3WIVA 2RE1A 5J1PA 2IDEA 4ECWA 3OHAA 3V81A 1VQ8S 2ZC4A 4C8LA 2IMWP 2ALZA 2HHHF 1R6YA 4M5DB 2C2NA 2HHQA 2QFIA 3RB4A 1WHVA 2UUWA 2VG5A 4UOFA 1VISA 2FJEB 3LUYA 1UWAA 2DXFA 2EBGA 3MPWA 4I2QB 1YBAA 3DGPA 1FWLA 3IGNA 3OR1A 3JTOA 4RUBA 3GONA 5JXSA 1RWWB 1DFDA 4KGZB 3HJVA 4FF3A 2R8HA 4WZQA 3PIOQ 3D0HE 4WYLA 2MGZB 5EN1A 1HNVB 2E29A 3MM9A 4DR1J 3PM9A 1R7IA 3IR5B 5HVHA 1WSVA 2EWHA 4Y2CA 1L3VA 2BW7A 2XSJA 4M94A 3Q8VA 3AXMA 4HACA 3HKZD 2HQDA 1X7VA 4JUZA 4K4SA 4X4PA 2CKWA 1FKAF 3RW6A 4KGVB 2ZUAA 1XMOJ 1Y00A 3QBCA 4H4MA 4I2PB 4AFFA 5LJ5Y 9ATCB 3KLHB 1LWEB 4HLBA 2PC6A 5F3ZA 2HS0A 2CUYA 4F4AA 1WC3A 1M0SA 3N79A 1RBAA 2K7KA 1LW0B 2CZVC 1HBMB 3CJTA 3VAIA 1YJ7A 3ITHB 1NO8A 2OGUA 4DG1A 5D15A 2DRDA 4OHXA 2JRSA 2OD4A 2B4OA 3O5TB 2F7VA 4H4KA 3M1VA 3W5YA 5F3TA 4YB5A 4LR9A 3BZQA 3ZTSA 1XTZA 1HYSB 4DSFA 4NASA 3C66A 2WVBA 2OD6A 3PW0A 4ZVQB 3ENVA 5AXNA 2V2VA 4MIBA 5K8OA 3JSBA 2PIIA 4FF1A 5C25B 4WU2A 1QSSA 4NLDA 4UQGA 3W8PA 4RX6A 4OHZA 5K8MA 3V4MA 2R7TA 5A8KA 1VYAA 2ASJA 4NL5A 4I67A 5ETTA 2FHJA 3R6GB 4NX9A 3G2XA 3CTRA 2EG2A 3FUYA 5DGAA 2WOMA 3TAMA 4DI6A 2W2MP 2K3KA 3MECB 2BE7D 2BM0A 1BQMA 3OL6A 4JI5J 3PRBA 2N3LA 2UVVA 1B7YB 2AKWB 2IJRA 3R2DJ 1KQKA 1WC1A 1JJHA 1TV6B 2XWXA 3DFEA 4WZMA 2GAHC 2G0IA 4QOTA 3V81B 1V3RA 3J80U 2RNEA 4M5LA 4KV8A 4Q45A 1FE4A 1PJ5A 3K58A 2D3OR 1U1KA 1BMQB 3GIJA 4JI6F 4FF4A 3TA1A 3GYGA 5FDLA 2XHCA 3DGPB 1A6LA 1UVMA 2NS1B 4ER8A 1IQTA 2K1RB 3VWSA 3RRKA 3HP6A 2HW3A 4NA2A 1ITPA 3DLEA 5AE2A 4QIEA 2FIUA 2GZOA 5ETVA 1IKVA 1IBKJ 3MURP 2RS2A 2LFVA 4WCEQ 4OX6A 5MAOA 1P9QC 4P74A 1E6VA 5IC6B 4F4XA 2VQEF 2P6SA 4GO7X 3BSNA 3GG0A 1VGYA 1WKKA 4IDKA 1GX6A 4H4MB 2KHCA 1F60B 3HVAA 5G0RA 1R8BA 4OX7A 5D8HB 3T1YF 3S1TA 2ILYA 2BZ2A 4U8VA 3H42A 4RW9A 2PA3A 2VJVA 3M6VA 2IYGA 3FSXA 4WK1A 5LM7E 4PWUA 3IMQJ 2DNZA 3MCSA 1UJ6A 1L3KA 1ZH5A 2JWNA 1NZAA 3AA9A 2VL1A 2DNQA 4WIQA 2ROGA 2ADBA 2HZAA 4CT8A 1J27A 2Y1IA 3UCZP 2N7CA 4IFVB 4ZLJA 1JXEA 4OI6A 1VQOS 4C0HA 4MIWA 3FBCA 1ZTWA 4DL0C 1RCOB 1I51B 4WWSA 4I68A 4Z2XA 3C46A 1FKPA 1QAYA 2HGMA 3RB6A 3IRXA 1DRZA 3QT6A 1IBLF 3DU5A 3BSCA 5L46A 5A8KB 5LMNF 4TY9A 4FXVA 2E1PA 4X4UA 1RAIB 1SJ3P 2ZJQQ 3KHGA 5KFMA 3UN5A 3GFZA 3BB5A 4BWMA 1FF2A 4IOAQ 2HFOA 3CCWA 1RT3B 4LBIA 4GKKJ 4RW8A 4OZ0A 4NA3A 2VASA 3N6LA 3N6NA 4W98A 4B02A 4DPWA 1WACA 5LMUJ 4IFYA 1RT7B 2G0CA 3PRDA 4CO3A 1GTHA 1RXOB 2HBRB 2X1AA 2MKHA 3UDCA 1MLAA 4KV8B 4DZDA 3LW5C 4BCAA 3KJFB 4Z7YA 5L1JA 3DOLA 4Z37A 2HAFA 3TO8A 1UA0A 1N32F 5FDLB 1ZM9A 3MMCA 1FD2A 1WNEA 5C5JA 5CXTA 2W7AA 3PW7A 2M9KA 2DPJA 3O8WA 1IXKA 5KG0A 1X4EA 1SC6A 4ZHRA 1P1TA 1K1QA 4KT0C 2BBEA 5F8MA 5F8GA 3TA0A 2WONA 1TAQA 4BWJA 3CJRA 4LFAF 4DV1F 3TRGA 2APOA 3DRRA 3PW5A 2O5DA 4UUWA 1VMBA 2J0SD 1XR7A 1T9XA 3EDQB 1T9TA 2AW0A 1O5JA 4FVCA 5FLXU 3BO3A 5KT6A 1WF1A 3HZEA 3MDFA 4U7UD 3BPDA 4OJ3A 3BGOP 3OL9A 3M8RA 2F9DA 5KOXA 3I5AA 1TL3A 2WSFC 2W2PP 4PKDB 3EDRB 3M8QA 3HDSA 2X1FA 1MW7A 4ID5B 2AEJA 3K8WA 4RKUC 1T9VA 3ZNUA 5CD4A 2DKOB 1M5VC 2CJYB 4KGXB 3CJ3A 5L1KA 1PC4A 1R89A 2IY5B 1NK7A 2NYIA 2B6AB 3M2VA 4GVBA 5LL6d 4MK9A 1RA6A 1TKXA 2WBMA 1R3NA 3ZZTA 1YTYA 2VV5A 3IAS9 2PFFB 5T14A 2F40A 1CJKB 3UQSA 4CH0S 3L7PA 3FMBA 1WG5A 4TLQA 1X60A 2XMMA 4YQWA 2KL8A 2XMUA 4L3KA 1CJTA 2EPIA 2DT9A 4IKAA 2J9CA 2E44A 1R0AA 3OFHA 2MPUA 5C42A 2AF6A 5F8HA 2GJFA 5HBMB 3VCDA 3BO4A 1X4GA 1HWUA 1UETA 2IPOB 5ETMA 2FQQB 3PRVA 5KFGA 4J9LA 2ZDPA 4CM0A 1YWXA 4RW8B 1Q95G 4JYAF 1U2RA 5DM6Q 3GP9A 1YI2S 2UXDJ 2JJ4D 3HD1A 4QIGA 1XNRF 2J9DE 4CDIA 3PCOB 1C0TA 2DRAA 4DQRA 3U02A 4PWWA 1Y3KA 3F41A 2YWGA 1HHSA 3I82A 1D9DA 2JSXA 1YJTA 2K2PA 4M5NA 1S1TB 2DHXA 5LT5A 4C97A 3NRBA 2GMJA 5GMDA 5AJ3J 2RAQA 3MMCB 1TKDA 3DLKA 3GCWP 2FLOA 2V0NA 5F41A 1XMQJ 1FCAA 3PR4A 4WKRA 5HANA 5KFOA 2ZZMA 4I6YA 1WC6A 4DLEA 1K8AT 4N76A 7AT1B 4ZHRB 5EGYA 2M5YA 2R8GA 3E8OA 1EX8A 2OMOA 5J2PB 1RAEB 2Y0SD 1MMLA 2PT0A 5B0CA 4DN0A 2BXJA 3F56A 2PD1A 3NCQA 3H4BA 2HVHA 4NXNF 3TWZA 4RO0A 1YJVA 1ZZFA 3AQPA 3KLEA 2ZM6F 1KVJA 2B4PA 4UF4A 4FF2A
chains in the Genus database with same CATH topology
2CNOB 1PYOB 1RWMB 2QL9B 5IC6B 2C2MB 1ICEB 1I3OB 3GJRB 3P4UB 1PAUB 2C1EB 2CJXB 2Y1LB 3GJTB 3RJMB 1RWXB 2QLBB 2QL7B 2QL5B 1SC3B 4ZVOB 2HBYB 1RWNB 4ZVSB 3SIPB 1RWWB 1F9EB 4ZVTB 1RHQB 3R7SB 2CNNB 2XZDB 1SC1B 2H65B 2HBZB 1BMQB 3D6MB 1IBCB 2XYGB 1GFWB 2QLJB 3EDQB 3GJSB 4ZVQB 3D6FB 5IC4B 4ZVRB 1RWOB 3R6LB 2H4YB 1RWKB 2P2CB 4ZVPB 5K20B 3GJQB 2C2OB 1QDUB 2XZTB 2H4WB 2H48B 3EDRB 3D6HB 2HBRB 4DCJB 1RHRB 1RHKB 4JB8B 2XYHB 3R7BB 3R5JB 3KJNB 4DCPB 2HBQB 2CNLB 2Y0BB 3NS7B 4ZVUB 2C2KB 3P45B 3KJFB 2FQQB 2C2ZB 2DKOB 3R6GB 2CJYB 4DCOB 2H5IB 1SC4B 3R7NB 2H5JB 2H54B 1RHUB 3KJQB 2QLFB 2CNKB 1NMEB 1I51B 1RWPB 1RHJB 1RWVB 2H51B 1RHMB 4LSZB 1QTNB 3IBCB 1RE1B 2CDRB 3QNWB 2XYPB 3IBFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNO B;  1PYO B;  1RWM B;  2QL9 B;  5IC6 B;  2C2M B;  1ICE B;  1I3O B;  3GJR B;  3P4U B;  1PAU B;  2C1E B;  2CJX B;  2Y1L B;  3GJT B;  3RJM B;  1RWX B;  2QLB B;  2QL7 B;  2QL5 B;  1SC3 B;  4ZVO B;  2HBY B;  1RWN B;  4ZVS B;  3SIP B;  1RWW B;  1F9E B;  4ZVT B;  1RHQ B;  3R7S B;  2CNN B;  2XZD B;  1SC1 B;  2H65 B;  2HBZ B;  1BMQ B;  3D6M B;  1IBC B;  2XYG B;  1GFW B;  2QLJ B;  3EDQ B;  3GJS B;  4ZVQ B;  3D6F B;  5IC4 B;  4ZVR B;  1RWO B;  3R6L B;  2H4Y B;  1RWK B;  2P2C B;  4ZVP B;  5K20 B;  3GJQ B;  2C2O B;  1QDU B;  2XZT B;  2H4W B;  2H48 B;  3EDR B;  3D6H B;  2HBR B;  4DCJ B;  1RHR B;  1RHK B;  4JB8 B;  2XYH B;  3R7B B;  3R5J B;  3KJN B;  4DCP B;  2HBQ B;  2CNL B;  2Y0B B;  3NS7 B;  4ZVU B;  2C2K B;  3P45 B;  3KJF B;  2FQQ B;  2C2Z B;  2DKO B;  3R6G B;  2CJY B;  4DCO B;  2H5I B;  1SC4 B;  3R7N B;  2H5J B;  2H54 B;  1RHU B;  3KJQ B;  2QLF B;  2CNK B;  1NME B;  1I51 B;  1RWP B;  1RHJ B;  1RWV B;  2H51 B;  1RHM B;  4LSZ B;  1QTN B;  3IBC B;  1RE1 B;  2CDR B;  3QNW B;  2XYP B;  3IBF B; 
#chains in the Genus database with same CATH topology
 3E01 A;  4RJV A;  1HWL A;  4ZKA A;  1X0F A;  3GIL A;  1SH0 A;  3W8G A;  2G2Y A;  4DHV A;  2Y1J A;  3CCZ A;  3JS9 A;  3UNG C;  3CVK A;  2J5A A;  5CQG A;  2KRR A;  1PKU A;  4X2B A;  1GMU A;  3MM5 A;  1VBY A;  4KY3 A;  2NRE A;  3HSG A;  3D6M B;  1TL1 B;  3NBP A;  4GVB B;  2Z2L A;  1I6J A;  2HHH J;  4ZLP A;  2D7S A;  3MAQ A;  2DO0 A;  2M88 A;  3ZTP A;  4M5J A;  2UVU A;  7FDR A;  4F8R A;  2VFS A;  3CCR S;  1OYE A;  1RHR B;  4RNF A;  1QJH A;  5DG7 A;  2XTJ P;  5KFF A;  1WEL A;  4FYY B;  1KVK A;  1HNZ F;  4F67 A;  2AP6 A;  3MEG A;  3R5G A;  2XY7 A;  1KFD A;  2IRU A;  5KFZ A;  1CUL A;  5DS7 A;  4FS2 A;  4DLG A;  3CJ2 A;  2ZOM A;  2VU5 A;  2EFQ A;  4ZCI A;  1KEK A;  4G1Q A;  1FX2 A;  2VF3 A;  2B7B B;  4EUV A;  3BGU A;  5CH7 B;  1HBO A;  4P71 A;  4ZP7 A;  1S49 A;  2CQB A;  1OWX A;  3IO1 A;  2WRM A;  3H2U B;  3PXG a;  5KFC A;  2LA6 A;  1DZ5 A;  3W62 A;  3Q2S C;  3QAE A;  2NXN A;  4MIA A;  3BV8 A;  2JFD A;  2OAU A;  2Z4P A;  3IWL A;  2HMI A;  2KJV A;  2EFN A;  4Y2I A;  5G4D A;  2D74 B;  5GAG U;  5KFE A;  3UWT A;  3DI6 B;  2QV6 A;  4DSL A;  2KU7 A;  4O3P A;  2VA2 A;  4NCG A;  5B0D A;  1LK7 A;  1JKH B;  5I3Q A;  1H2V Z;  3R9L A;  3CD7 A;  1B99 A;  2VOD A;  3ILI A;  1MWY A;  5HLF B;  1QVG R;  5M2U A;  3TVY A;  3R97 A;  1LNQ A;  1MRO A;  4OQJ A;  2CQ2 A;  3D66 A;  3NNC A;  3C6U A;  1SJR A;  2JH3 A;  5CCL A;  4N41 A;  2RQ4 A;  1F9F A;  3FRY A;  3MOZ A;  2AX1 A;  2K06 A;  4RW4 B;  5HVG A;  2DNL A;  2ZUG A;  1WHX A;  4AYB D;  1SJ4 P;  2BE9 B;  2OSQ A;  4EBD A;  1Y5L B;  5J2M B;  4DV2 F;  1T9U A;  3K5O A;  3CWJ A;  4DFJ A;  1NKE A;  4F0H A;  3ZZP A;  4HTJ A;  3AHP A;  2DEJ A;  1SKW A;  2MLY A;  2MDA A;  1Q78 A;  4OHV A;  3W60 A;  3OHB A;  2VFV A;  3KLE B;  2HS3 A;  2KDO A;  1LOU A;  4CLW A;  3UN2 A;  2VG6 B;  3E01 B;  2W9C A;  1ZS6 A;  4CWB A;  5IM0 A;  1Y9O A;  3KFW X;  1IBM F;  3GJQ B;  3ISZ A;  5EWE A;  2BJ1 A;  2OEJ A;  4EYH B;  2GAG C;  3RBD A;  4AQY F;  2QFJ A;  5DO2 A;  4EZ9 A;  3CF5 Q;  3MMA B;  2QA1 A;  2Q3P A;  3HMJ G;  2W4C A;  5GAG I;  2Z58 B;  2Y9H A;  4CH1 A;  2IVF B;  2MZR A;  2C22 A;  2FJA B;  4PXE A;  3EXY A;  4OL8 A;  1JNZ B;  3W1Y C;  5BR8 F;  1QAI A;  1HBU A;  5K14 B;  4USI A;  1EQM A;  3LGH A;  1RE1 B;  4AE5 A;  1AFI A;  4JI6 J;  2CXE A;  3VV2 B;  2W8L A;  1JLA A;  2B9X A;  3BYP A;  1ARO P;  1F0X A;  2FYX A;  1PG5 B;  2Z30 B;  3IAM 9;  2OEK A;  4F4Z A;  1WUU A;  4XTT A;  4L72 B;  4CLL A;  3CCU S;  1CUL B;  2XGP A;  4RW6 A;  4NCB A;  2QN6 B;  4YB7 A;  5KAK A;  2DHG A;  4ZPC A;  2D69 A;  2LLZ A;  5K9F A;  3EUN A;  3QQC D;  4Q5V A;  4QYZ K;  5A6P A;  5DM7 Q;  1GMV A;  4DCP B;  1FRI A;  3KLF B;  3D68 A;  4OV6 A;  3RAM A;  4WE1 A;  3QWU A;  3SFG A;  3ILO A;  3Q8P B;  2G2O A;  2VQE J;  3UD4 P;  1L5U A;  5LJ3 Y;  3KHH A;  3KK3 A;  2Z8Q A;  4X62 F;  2MKK A;  3BQ1 A;  4DSK A;  2FJW A;  3T1Y J;  2BEF A;  2GO8 A;  4LFC F;  4BC9 A;  1NDK A;  3NMR A;  2LXF A;  2DPI A;  3C6U B;  3SCL E;  2PEH A;  3CO0 P;  4LRE A;  1SC3 B;  3WIU A;  2ERR A;  1VQL S;  3LP1 B;  2JX2 A;  3HHK A;  4OX9 F;  2VHG A;  1M90 T;  4C3K A;  3A8K A;  2OFG X;  4A47 A;  2CQG A;  1U4B A;  2Z2Y B;  2X3G A;  2MLZ A;  4QWB A;  1Y0H A;  4NMX A;  5GAH U;  3W7B A;  2DNH A;  4P9S A;  2G1D A;  4DV5 F;  1IBL J;  2CPJ A;  1IJF B;  3G87 A;  5LMN J;  1SKS A;  2CNL B;  2C3P A;  3S8S A;  2W2N P;  2ZH5 A;  4JV1 A;  2BW2 A;  1LWF B;  2HQG A;  2YWH A;  3QGP A;  1HWI A;  3DGV A;  3BJY A;  3MEE B;  5DJB A;  1HQU B;  2VPZ B;  3W5Z A;  2O01 C;  1ZA2 B;  3BBF A;  1TMM A;  2ZVI A;  4A4J A;  5B0E A;  2Q79 A;  1NSP A;  4AND A;  4WKY A;  4YB1 P;  2U1A A;  3LGM A;  4J9V A;  4DR7 F;  2BKN A;  5KG5 A;  2FGC A;  4K5S A;  2IJF A;  1HBU B;  4LIR A;  1X31 C;  2UUT A;  1S1W A;  5DGB A;  4KAI A;  2F63 A;  5EDW A;  2Q66 A;  4I6W A;  3H4D A;  1N32 J;  1RA7 A;  4WP3 A;  1JLA B;  4DPO A;  3DLG A;  4OYZ A;  1ZTT A;  3LAM A;  1U1M A;  5JUM A;  3HVT A;  1PO6 A;  1RHK B;  1GMW A;  3M32 A;  2IBK A;  4C98 A;  3MUV P;  1FVS A;  4CO2 A;  1NCL A;  4RW6 B;  1YJ9 S;  5BYS A;  5K8N A;  3GV7 B;  1FJ7 A;  4J9N A;  2VFR A;  4LFA J;  4DV1 J;  5GAH I;  1XEZ A;  1U26 A;  4MKV A;  2LXU A;  1NAQ A;  2V9K A;  3MWB A;  5HQ8 A;  4PG6 A;  3G71 S;  2HRT A;  3PVX A;  3H8Y A;  3TZY A;  2R8K A;  1BQN A;  4U6P A;  4WE1 B;  2ZH8 A;  1U45 A;  1JX4 A;  2HVZ A;  3AAW B;  2QZ8 A;  4OIX A;  2Z2Z A;  4O0N A;  4KC5 A;  3B82 A;  2R7V A;  3KK3 B;  1LQ9 A;  2PA8 D;  3FCW A;  3RR7 A;  3TOQ A;  4DN9 A;  1QSY A;  2YKO A;  5E0O A;  3HHL A;  3BSO A;  4OZ3 A;  3S6E A;  5KFS A;  4EYI B;  4V1A k;  4ZP6 A;  3AJ1 A;  1SV5 A;  2POK A;  2JFK A;  4EMD A;  3OTE A;  3VAJ A;  2HNY B;  4RW7 A;  4LF9 J;  3VHQ A;  1KR4 A;  3CCE S;  4PG8 A;  5AT1 B;  4TXS A;  4LBP A;  1IQZ A;  4TKT A;  1NEE A;  1RAC B;  4C3L A;  3R7N B;  2P9E A;  3MR5 A;  4N56 A;  5LSL A;  1PAE X;  1QE1 A;  2Q1L A;  2DCL A;  4LQ9 A;  1W7W A;  3KG1 A;  5HJY A;  4CRJ A;  3ISN C;  2L9N A;  3T5H A;  4DQQ A;  1N34 F;  1TK8 A;  2NXU A;  2UUB F;  2WBR A;  4FVM A;  2RDJ A;  4M1K A;  4FXD A;  2V63 A;  2H5E A;  3OSN A;  1YJU A;  2BUN A;  4AD6 A;  4NLP A;  4DU7 A;  4DV7 F;  2B5J A;  3ZTR A;  2VBX A;  1YSJ A;  4KJI A;  4IRD A;  5IC4 B;  4JYA J;  3LWL A;  2KHD A;  4GC7 A;  5L8R C;  1SH3 A;  1HMV A;  2WVC A;  4B9T A;  5K20 B;  4P73 A;  4R25 A;  1B70 B;  1HR0 F;  2Z56 B;  1XNR J;  1T05 B;  1J5O A;  4LR8 A;  4F02 A;  1YX2 A;  2PDA A;  1X9W A;  2IJN A;  2OPQ B;  1H7X A;  3MUM P;  1RI7 A;  2DJW A;  3ILJ A;  1KLM B;  1S1W B;  3D0G E;  2EBE A;  3FBF A;  2BKP A;  4BC7 A;  1BXN A;  2YY3 A;  1U1L A;  2DH8 A;  1FJG F;  1HNI B;  2AWZ A;  3QJJ A;  1G3O A;  2B56 A;  4CM2 A;  4B9V A;  4DBQ A;  5E7O B;  2QLF B;  1MWZ A;  4HH0 A;  2MJN A;  3DLG B;  4X4O A;  1ZBT A;  4Y2K A;  4K4U A;  2F4F A;  3ENA A;  4TN2 A;  4XO0 A;  2HHP A;  4F3O A;  3C15 B;  3RUB L;  2XWY A;  1H74 A;  1CSJ A;  3DM2 A;  3FFI A;  4ES3 A;  2OIH A;  5EWF A;  2XMV A;  5KFV A;  3CJ0 A;  3E3X A;  1M5S A;  3MPY A;  1HD1 A;  1P9Y A;  1FJC A;  4ZVG A;  3RAQ A;  3OTO F;  1MNE A;  3H2V E;  3W2V B;  2R3V A;  3ZO7 A;  2ZBR A;  4NXN J;  1RWO B;  1BQN B;  1Q8B A;  2ZNZ A;  2HUR A;  3AD9 C;  3Q24 A;  2DRB A;  2YNG A;  3TZW A;  2ZM6 J;  1KN6 A;  5HO4 A;  2GQC A;  3Q89 A;  2BA9 A;  3I0R A;  2DGT A;  3HJF A;  2QT7 A;  1JLQ A;  2XCP A;  5A8R A;  4QU6 A;  4DMZ A;  4ATN A;  4KPY A;  3M2R A;  4S0M A;  1RHJ B;  1S6O A;  1RWU A;  3MED B;  1FDD A;  3D6T B;  4B08 A;  2DGO A;  4DL2 A;  1I3O B;  1RU1 A;  2UZA A;  2MZS A;  2ZJP Q;  5MLC V;  4J9M A;  2W9A A;  1VI7 A;  2QL5 B;  5ETO A;  3OTD A;  3C8Y A;  2F8M A;  3RYL A;  3PX4 A;  1N5Y B;  2MLX A;  3TQ1 A;  2P9C A;  2GC8 A;  1QUP A;  1F2H A;  1HNZ J;  2FJD B;  3P5T L;  1X8D A;  3SCI E;  3MGJ A;  1TVR A;  3BR8 A;  2QMU B;  2WHO A;  2E7W A;  2YPY A;  4ECS A;  4FYW B;  2GVD B;  4CLT A;  2KT2 A;  2MKI A;  3MAH A;  2IC3 A;  2UUC F;  1YZ7 A;  3J80 Y;  1HWJ A;  2G2Z A;  3OBI A;  3W66 A;  4E2F B;  1HI1 A;  3W63 A;  2BAN A;  2N3O A;  5B0A A;  3P45 B;  2A10 A;  4CCH A;  1UVN A;  1N36 F;  1RB0 A;  3LPE A;  1YBU A;  3HF5 A;  3ILL A;  2BRL A;  3V4I A;  1FNO A;  1TKT A;  2VG7 A;  1XMB A;  3C19 A;  3SQO P;  1T94 A;  4U67 Q;  3FSI A;  2UVW A;  1R0C B;  3UFC X;  3EVM A;  4NZ7 A;  5KT4 A;  5IV3 A;  2Z57 B;  4ZPD A;  2YKM A;  1J5O B;  2DGS A;  3JSY A;  2BE2 B;  3M30 B;  2A6O A;  4KBI A;  2VOO A;  4YP3 A;  2ZKT A;  1VQY A;  3H5S A;  2XB2 D;  2V8V A;  4MFB B;  2YKN A;  5GAE U;  4R0E A;  2QLW A;  3MM7 A;  3C6T A;  2LDI A;  3MTJ A;  3LP0 A;  5H1S V;  3BN4 A;  1H3D A;  1X4F A;  4DS4 A;  2R7O A;  5D77 A;  4KYZ A;  4MH8 A;  4UOH A;  1CC7 A;  1PBA A;  3AD7 C;  5D4O A;  3KJV A;  4KR0 B;  4WTY A;  1VRT B;  2B9W A;  3LO3 A;  3UCU P;  3Q8Q B;  3GV8 B;  4QCL A;  4XDD A;  4OHW A;  4L74 A;  2RS8 A;  3DHX A;  2CPI A;  4DQI A;  1U2C A;  3CT9 A;  4DV2 J;  4QU7 A;  1NJX A;  5HP1 A;  5EWG A;  3BF4 A;  2HRU A;  2RU3 A;  1SC4 B;  5KTQ A;  2IHR 1;  4CLP A;  1VRQ C;  4NI2 B;  2YNG B;  3O6Q A;  2DIT A;  1TUV A;  3GCX P;  2YX7 A;  3W9H A;  3BKF A;  1DTT B;  3PYE A;  1NK0 A;  1V5V A;  1WI8 A;  5SZT A;  1IBM J;  1JLQ B;  2O66 A;  3FSY A;  2KVQ E;  2CZ4 A;  4YFU A;  2B4U A;  4AQY J;  3KUG A;  2OTL S;  3QZ8 A;  1KWM A;  2WW8 A;  3ZC4 A;  4ECX A;  1T3N A;  4ZP8 A;  4KO0 A;  2EKY A;  1Q8L A;  2QX0 A;  2W24 A;  4M95 A;  4WFA Q;  4Q2L A;  4C3M A;  2F65 A;  3T1H F;  2XY6 A;  5BR8 J;  2WVD A;  3U27 A;  3BO2 A;  5GAE I;  4J9Q A;  4YY3 F;  1RU2 A;  1NDP A;  2IVY A;  1HL6 A;  1RAB B;  2YTC A;  2IMO A;  1WEX A;  1IR1 A;  2CZ9 A;  1NPP A;  3IS9 B;  2I6W A;  2HG4 A;  2I5J A;  4FDF A;  1TUG B;  1YIJ S;  3J7Y U;  4DCO B;  2Q6C A;  4FP9 A;  5I3U B;  2A2D A;  5KFP A;  4YB6 A;  3S7R A;  4DL4 A;  4C11 B;  1OMS A;  3CD5 A;  2XQC A;  2JZ5 A;  4I64 A;  3THV A;  3M8S A;  1UFK A;  3D1H A;  2KT3 A;  1VC0 A;  1R8H A;  1FKO B;  4CP5 A;  2YNF B;  5HMX A;  3V4I B;  2B8Q A;  1TKT B;  2XO7 A;  2VG7 B;  4B9M A;  1VFJ A;  3TUJ C;  1ZM2 A;  3CD6 S;  4NLW A;  3NS5 A;  4DZ6 A;  3ICL A;  4N8O A;  5ETQ A;  1O6X A;  4LF8 F;  2LYV A;  1U6B A;  1X4D A;  3GJS B;  2Z0G A;  4YME A;  3PKY A;  5D4N A;  4QWE A;  4X62 J;  1NJW A;  1CPZ A;  1RTI A;  1B0T A;  1RAO A;  3FQK A;  3NGU A;  2FD2 A;  2YXL A;  2H48 B;  1U49 A;  4LFC J;  4NLQ A;  2XHW A;  2MYF A;  2Y8W A;  3HFK A;  2L08 A;  4B9U A;  6FD1 A;  4GC6 A;  3MM8 A;  3C16 A;  3R5C A;  2KG1 A;  1Z2Z A;  2W4D A;  5FLX Y;  3GFH A;  4OX9 J;  3UCG A;  2RQK A;  1S0M A;  3EZU A;  1RDR A;  4KFB A;  3NGR A;  3FZB A;  2XC9 A;  1ICE B;  2ZWO A;  1VQP S;  2VB6 A;  2CQ3 A;  2QYG A;  3J7Y I;  3PYF A;  3O3L A;  2ASD A;  3HT0 A;  4DV5 J;  1CLF A;  2AD9 A;  1NHU A;  4A8X A;  1NK8 A;  5F8I A;  3EZ5 A;  4JP8 A;  3ZXW A;  2OHD A;  3SZ2 A;  3PW2 A;  5AXL A;  2JLE A;  3Q8Y A;  2CQ4 A;  2DNN A;  1GXU A;  3CCL S;  2YNI A;  3LP2 B;  3CDB A;  2XS7 A;  3VGT A;  1KTQ A;  4EFA C;  2RHQ B;  2BJ8 A;  3HX9 A;  3GB0 A;  3NKY A;  2R7S A;  2RT3 A;  4DR7 J;  3NXZ A;  1WOP A;  2A1B A;  1RKJ A;  1XWL A;  4KO0 B;  4OMF G;  1H73 A;  2OPS A;  4PPZ A;  2ROP A;  3DOM A;  4DUY F;  2VKR A;  4EBE A;  3DRP A;  3K17 A;  3PX6 A;  3FEY B;  4K8R A;  2PFD A;  2A0F B;  2A3J A;  1FRL A;  2OPR B;  1RLC L;  3PW4 A;  1G2E A;  1S9G A;  3FJ2 A;  2AGO A;  1RSC A;  5J2Q B;  2F1F A;  3TAN A;  1RQ0 A;  5D4P A;  4IUF A;  3J7A 1;  4J9R A;  2RQM A;  5AXK A;  1NPK A;  3V6D A;  3DYA A;  1S1U A;  1K47 A;  1HKA A;  2BAC A;  2R7R A;  1KQS R;  4C7Q A;  2XMA A;  2ZH9 A;  5D6G A;  3LF0 A;  4Q0B A;  1U24 A;  2Y1R I;  3A8J A;  3GPA A;  3KOA A;  2CYY A;  1WWH A;  1O8B A;  4B3R F;  5LXY A;  3BGR A;  2HK3 A;  1FI4 A;  4UUX A;  1K73 T;  4AL5 A;  3RZA A;  1KQF B;  4JI2 F;  2XM3 A;  3ZZO A;  3OVB A;  3WZ0 A;  2ILZ A;  3LAL A;  4OZ5 A;  3QZ7 A;  4DWI A;  2H54 B;  1X9S A;  1FRJ A;  3POT B;  2RUS A;  2AJQ A;  4L75 A;  1DQ9 A;  3EXC X;  1NHK L;  5KG2 A;  4F26 A;  1K44 A;  2W7P A;  1MMD A;  3C3L A;  3RRG A;  1N5Q A;  2EFV A;  1HBN B;  1FTC A;  2UV8 G;  4TY8 B;  1F1B B;  4NLS A;  1SUQ B;  4IG0 B;  3TJ9 A;  3MM8 B;  3DRS A;  4ECU A;  1TR0 A;  5BYQ A;  3SSQ A;  2FUG 9;  4ZVT B;  2HNZ A;  2YWK A;  3FEX B;  4FS1 A;  1RT5 A;  5I42 A;  3CW2 C;  3QO9 A;  1NND A;  1FO1 A;  4UY8 T;  4HVZ A;  1FJE B;  1UJ4 A;  2MJU A;  1X5S A;  2IA0 A;  3TA2 A;  1N48 A;  2DR5 A;  3CB4 A;  1UJ5 A;  2XYH B;  2XI3 A;  3BQ2 A;  1HPZ A;  2M7S A;  3H20 A;  4NLG A;  2LDY A;  5HI7 A;  4Y28 C;  3NS7 B;  2JEJ A;  3FC9 A;  1N34 J;  2UUB J;  2BJE A;  4IRK A;  2F8H A;  4JI1 F;  3JB9 k;  3MPU B;  2CQC A;  5THW A;  4DV7 J;  3US5 A;  4KH0 B;  2CDR B;  4URS A;  1C1C A;  2XYP B;  1BWV A;  4CLK A;  2MQL A;  4QW8 A;  1APS A;  5F8J A;  2CPH A;  1FEE A;  3UDL A;  3UR3 C;  5DQH A;  1ZZN A;  2VKZ G;  1HR0 J;  2J7K A;  3GFY A;  1SKR A;  4RUH A;  4K4T A;  1S1X B;  5B0G A;  1X0P A;  4Y65 A;  3N28 A;  1L3U A;  3OXG A;  3DOM B;  3T9N A;  4ZIV A;  1V6H A;  1KKH A;  2GHW A;  5HMY A;  4IQX A;  2V2K A;  2MKS A;  2FVR A;  5ETN A;  1UZH A;  1FJG J;  3IA0 A;  3M2U B;  1N5V A;  3RU0 A;  2BQ3 A;  4LQ3 A;  1KP6 A;  3R3T A;  1HI0 P;  3KTQ A;  3F44 A;  3GIR A;  4M8L A;  3J7Z 5;  1WOO A;  5ETL A;  4U95 A;  5DRK A;  3Q2T C;  2DB1 A;  4OYO A;  2ZHO A;  3KK2 A;  2KFY A;  2D9P A;  4Y3C A;  3OTO J;  3BGF A;  3EJM A;  3AB4 B;  2LQJ A;  2ZHA A;  3HT3 A;  1D0E A;  2DTJ A;  3HKW A;  2R8J A;  3GJR B;  3FEZ A;  3MTK A;  3TJ8 A;  4ZCK A;  4QBU A;  2L3M A;  1YRT A;  2C3O A;  2DGQ A;  4XPC A;  2M8H A;  1HQ2 A;  4XDC A;  3BR9 A;  3CCT A;  4RNO A;  1T03 A;  4FKX A;  3MF5 A;  4A46 A;  3PJ9 A;  4YS2 A;  2VFU A;  1RGV A;  2A6M A;  4DJB A;  2YKQ A;  3KUH A;  1JXV A;  1D8Y A;  2PI4 A;  1JNR B;  3ULH A;  3J7A N;  2E1C A;  2GQQ A;  1VK3 A;  4DL6 A;  2VQF F;  4DS5 A;  3I6P A;  4YHH F;  4I7F B;  1K0V A;  5ITH A;  4ZN3 A;  1H72 C;  4NRU A;  1GX5 A;  4EI2 A;  1IKW B;  3DMJ A;  3R8Y A;  2CJQ A;  4NYO A;  1RT5 B;  2XS5 A;  3QO9 B;  3DRX A;  1X5P A;  3CSK A;  2RUG A;  3E2E A;  4FXW A;  1UL3 A;  1EET A;  4N5S A;  1JWW A;  2XMK A;  3ENW A;  3UE2 A;  1RWV B;  3Q22 A;  4C8Z A;  1TL7 A;  1TL4 A;  4ES2 A;  2QA4 S;  4CYU A;  2E5H A;  2K7J A;  4J9P A;  3IC1 A;  1MMN A;  4DV6 J;  1KLN A;  3V6H A;  4X4T A;  4OYA A;  4DV3 F;  3KNA A;  2MQN A;  4IYQ A;  2XI2 A;  3PZP A;  1RIS A;  2UUC J;  1Q81 T;  1KHV A;  2RF2 A;  5HAT A;  2E1M C;  4LRF A;  2ZH1 A;  4ZVS B;  1IKX A;  3H5X A;  3N4W A;  4DR3 F;  2FVP A;  1S72 S;  1F3F A;  4X4V A;  1N36 J;  2HZC A;  1TKZ A;  2KM8 B;  4PQU A;  3TR5 A;  3KHR A;  1UW9 A;  2J76 E;  5BJR A;  1NXI A;  1FWK A;  2KT5 A;  5I4M A;  4HDH A;  5E3C A;  1NK4 A;  4Q44 A;  1XQI A;  3BSA A;  4V19 X;  3NOG A;  3ZZ0 A;  3MR3 A;  4ETX A;  2BKO A;  4LSN A;  2GML A;  2E7V A;  4G65 A;  1HW9 A;  4USW A;  2DO4 A;  3D7S B;  2H5J B;  1JLG A;  4PQA A;  3DDI A;  4K4Y A;  3LTO A;  4LSZ B;  4K4Z A;  2OSR A;  3MFI A;  2EEY A;  1PYO B;  3JYT A;  4EO8 A;  4USK A;  1MN7 A;  1RTH A;  2KXF A;  3DOK A;  1KVI A;  2ATL A;  3RRH A;  2FVQ A;  3NCP A;  1UP1 A;  4LF6 F;  3BDP A;  2ZIT A;  1RTD B;  1HFE L;  4USJ C;  3IXQ A;  1U6Z A;  1FHT A;  1WG4 A;  1T9Y A;  3RGI A;  3M8P B;  5F0U A;  2HZV A;  3QFW A;  1OO0 B;  3ISN D;  1OQ3 A;  2YH0 A;  3L9Z A;  3N6M A;  1RT6 B;  1RTZ A;  4H4O A;  4ID8 A;  4O44 B;  3OFF A;  3P8B B;  3CC2 S;  5IZH A;  4J9O A;  3CGI A;  1U09 A;  2N7Y A;  2LP4 A;  4LSL A;  4AUK A;  4O4R A;  2CRL A;  4WFZ A;  2ZH4 A;  4DUZ F;  5IT9 U;  4DF4 A;  4WII A;  5IQQ A;  3PG9 A;  2JEI A;  4ZA1 A;  1NH7 A;  1T7P A;  1DY3 A;  1JLE B;  1AZS B;  2DXD A;  2VBW A;  4C0B A;  1B7F A;  1N4L A;  3QRP A;  9RUB A;  1UVI A;  1WI6 A;  2OPP B;  4ZS6 A;  3D0I E;  5CZV A;  3T1H J;  5C7P A;  2C2D A;  1CC8 A;  4RNN A;  1XER A;  4YY3 J;  4HI1 A;  5KT5 A;  1RT1 A;  4RWX A;  2JVO A;  3ENQ A;  1VBK A;  3CD0 A;  3FBE A;  3H25 A;  3W5X A;  1EET B;  2M0G B;  3G6V A;  2OKQ A;  1FNX H;  4LRB A;  4CYU B;  4BS2 A;  2E9R X;  3VQS A;  3UN3 A;  1EP4 B;  1LW2 A;  4X4R A;  4DDF A;  2YH1 A;  1H6K X;  1T3O A;  4CLZ A;  3TJA A;  5DDR C;  2RJZ A;  2W2Q P;  3MR7 A;  2L41 A;  1CJU A;  1FDA A;  3T6J A;  3D3C J;  2WB1 D;  4KGM A;  4M5K A;  4CO4 A;  3EMT A;  1R8A A;  1RLD A;  2XNR A;  2FTR A;  1TKZ B;  4NEZ A;  1UKU A;  2D9O A;  1JLF A;  4F36 A;  4F2S A;  3WBZ A;  3BPS P;  2WK4 A;  2PSZ A;  2X1G A;  4LF8 J;  4PRF A;  1U02 A;  3LA0 A;  2FC9 A;  2QL9 B;  1DAR A;  5JJB A;  2WSC C;  1SBR A;  2VG5 B;  1S10 A;  1WF0 A;  4PUO A;  3BH6 B;  2DXE A;  4D3G A;  1JLG B;  4IG3 A;  5HRO A;  3IFE A;  1YIT S;  1PIE A;  3I4P A;  3OR1 B;  5ETS A;  3MUT P;  4OI2 A;  2WVE A;  4UTG A;  1FK9 A;  1LEO A;  1DLO A;  2KXN B;  3I9Z A;  4ZVH A;  2JHE A;  1WEZ A;  3PTW A;  1AA1 B;  3MM9 B;  1RYS A;  5HMZ A;  3VTI A;  1OIA A;  2HVD A;  5IV4 A;  5KFT A;  1VQ6 S;  2XSJ B;  2ZH7 A;  5L38 A;  1PCA A;  2E5G A;  4HAC B;  1EJ7 L;  1D09 B;  1XR6 A;  1HQE A;  1U6F A;  4G1P A;  2EFP A;  4C8Y A;  2RDI A;  5DG8 A;  2YWF A;  5E3Q A;  5ETR A;  1KQG B;  3AFG A;  1QTN B;  3HUL A;  4URQ U;  3E51 A;  2R2T A;  2CQP A;  3PHE A;  4NLV A;  5T7L A;  2V2Q A;  4LSL B;  2W01 A;  5H9E K;  2Z2M A;  3UDV A;  1WC0 A;  3BBB A;  2W25 A;  4DR2 F;  2I9S A;  3WX8 A;  5A2Q U;  1YBT A;  1TZ0 A;  2XY5 A;  1S99 A;  3HSD A;  5A0Y A;  4P2S A;  4M5I A;  1N5S A;  4DG1 B;  4WFY A;  1VC5 A;  1W26 A;  1EKR A;  4RZR A;  3SYZ A;  3QPI A;  3M1V B;  2V69 A;  1OSC A;  3PYG A;  4MYT A;  2CWK A;  3NCR A;  2UU9 F;  1Y7P A;  4HT7 A;  1F5A A;  3UNY A;  4DUY J;  3D3B J;  2HND A;  2LKZ A;  2WTF A;  1DUR A;  2ZHB A;  4WFX A;  4YDD B;  1KS2 A;  2BJ3 A;  4DPU A;  4DSI A;  2HRY A;  4R5P A;  2VBY A;  1C1B A;  5D0H A;  2HBQ B;  1UWB A;  4DR4 J;  2RVJ A;  1TP7 A;  1R6V A;  4K59 A;  3SCJ E;  1PJ6 A;  5KFN A;  3D67 A;  2UUA F;  1DQA A;  2MQO A;  3A4T A;  2ZH6 A;  2LU2 A;  1P1L A;  1Q0N A;  4TLR A;  2MB0 B;  2B4V A;  1S9E A;  1G1X A;  2OO4 A;  2WOM B;  1X5T A;  1CJU B;  3TAM B;  3TUZ C;  4LFB F;  1BQM B;  2BDP A;  1LFP A;  3AJD A;  1HNX F;  4B3R J;  1UPP A;  2LEC A;  4MAK A;  2XLJ A;  4ILM A;  4O4G A;  3EVO A;  5KFR A;  2NZC A;  4WJB A;  5D4L A;  1WC5 A;  1KRP A;  1RAJ A;  3K8V A;  4JI2 J;  3GE9 A;  1P27 B;  4ZPB A;  4EBC A;  1FRM A;  3GLJ A;  2DNK A;  2R2U A;  4FZV A;  4DPX A;  4CZC A;  1NSK L;  2GVZ A;  3HVW A;  3U7J A;  1RTJ A;  1W2I A;  2DNO A;  1W2B R;  2DR6 A;  4IG3 B;  1MWQ A;  1WTB A;  5U47 A;  1U1R A;  1WDT A;  1FK9 B;  2K8G A;  1NHV A;  3DLE B;  4GO5 X;  3AA8 A;  5F0W A;  5DLG A;  4OHY A;  5A6W A;  3R1H A;  2RRA A;  1IKV B;  3VVT A;  2DD8 S;  1KON A;  1TUW A;  5DDQ C;  4ZLN A;  1S6U A;  1UVJ A;  3N01 A;  4KPC A;  3KLI A;  4ED7 A;  4ZCM A;  5JVH Q;  1E6V B;  2BR0 A;  2BRK A;  1T0T V;  3JAM Y;  2E7X A;  2NXE A;  1HQE B;  3VGS A;  3QAT A;  1U7L A;  3AT1 B;  1S0V A;  2HEK A;  4IDK B;  1SC1 B;  2FB0 A;  4P2M A;  2WVF A;  1T8E A;  4Y2A A;  5G0R B;  4JI1 J;  1D3W A;  5T7L B;  1GXL A;  1REV A;  4NLO A;  2JL9 A;  4QWC A;  2J8S A;  1F5B A;  2J7U A;  3MAA A;  1WDD A;  2DEI A;  2DR9 A;  1S6P A;  4RW9 B;  1JXL A;  3OW2 R;  3DDK A;  1NJY A;  3H0P A;  1LK5 A;  2MSS A;  1VHF A;  5EX3 A;  3G6Y A;  3G8S A;  4LF9 F;  2CFX A;  4N7T A;  3NAI A;  2J0Q D;  3I0S A;  3BYR A;  2GFF A;  2AZ1 A;  1RHU B;  1XIQ A;  1GTE A;  2DGU A;  1UFW A;  2HND B;  2F4V F;  2H51 B;  3QID A;  1JJC B;  2NR0 A;  3M6X A;  5JVG Q;  4WFN Q;  1H7W A;  1I5O B;  1FKP B;  3IRX B;  2KRB A;  1AB8 A;  5KFK A;  5FII A;  1WHW A;  3G82 A;  3BQ0 A;  1T95 A;  3MR6 A;  1L3T A;  4EO6 A;  2YKA A;  4RNH A;  5KFH A;  5IQ6 A;  4JI3 F;  4NYZ A;  4B3O A;  2AMC B;  2CQI A;  3VAK A;  2MHE A;  1YGY A;  3PHT A;  4CTA A;  3CJS A;  1C4C A;  1AUS L;  4LF2 A;  4A48 A;  5HQM A;  4LRC A;  2XBP A;  4IFY B;  3WHI A;  3KHL A;  2VBZ A;  4PPD A;  2RD5 C;  4LF4 F;  1R27 B;  3GYN A;  1V9O A;  3TNV A;  1JB0 C;  5IOL A;  3IG1 A;  2BVZ A;  1RBL A;  1PGZ A;  3TW0 A;  2VPY B;  1UVK A;  3C2P A;  2YQ1 A;  3R5D A;  3I4H X;  1SB6 A;  3DOL B;  3L7O A;  2GVZ B;  1FRX A;  2V68 A;  1CVJ A;  2FVS A;  3NG8 A;  2OTJ S;  1RTJ B;  4IO9 Q;  1LFW A;  3IRW P;  3SDE A;  4R0J A;  2HKE A;  1IKY A;  2OJ3 A;  4OZ2 A;  4HHU A;  2PN6 A;  3BS9 A;  2VFT A;  3RJM B;  2ZE2 A;  2VQF J;  4YHH J;  1CJV A;  2XEX A;  2X7I A;  3OTC A;  3U1L A;  1ZPV A;  4FBT A;  3OUY A;  5C2G A;  2M3D A;  2XYG B;  1FRK A;  1VHI A;  2WON B;  1KOH A;  3LH2 S;  2YNH A;  1IJE B;  4IH6 A;  3OVS A;  1SL2 A;  3DRR B;  1RWK B;  2IM1 A;  4ICL A;  3QRQ A;  1DTQ A;  2ZNY A;  1FEH A;  2P9G A;  3IM8 A;  3P5B P;  1RT2 A;  3D5M A;  3PIP Q;  2RU9 A;  3OT9 A;  3VZI A;  1GNK A;  1VLY A;  5D0R A;  1TL3 B;  3KDO A;  4NCA A;  2J9D A;  4DV3 J;  4BBY A;  1Y11 A;  3M8Q B;  4TYA A;  1FA0 A;  5IWA F;  4OYB A;  2JC0 A;  1REV B;  2HQI A;  4DR3 J;  5B0B A;  4V19 J;  1S6P B;  4MMO A;  1H98 A;  3MD1 A;  2FZG B;  2CQH A;  2YWW A;  2VIC A;  2LU1 A;  3ZZR A;  2CPZ A;  2CG4 A;  3M2V B;  4OYW A;  1KC8 T;  2MGZ A;  1TKX B;  4IQM A;  1H38 A;  1RAH B;  2YVS A;  3DLJ A;  1HNV A;  2XGQ A;  3B4D A;  4H4K C;  2AQ4 A;  4CLY A;  2RKI A;  4LBH A;  4IRC A;  4CT9 A;  4CO1 A;  2E5L F;  2PMH A;  5J1N A;  3CPW R;  4C4W A;  5CCM A;  4Q7A A;  3GWC A;  4JV0 A;  4NOH A;  5I3P A;  1Q79 A;  3TYT A;  4DL5 A;  4MTP A;  3JQJ A;  1XN9 A;  2H4W B;  3ELH A;  4DCJ B;  1CJT B;  4I2P A;  3KLH A;  1R0A B;  1F6T A;  1LWE A;  5C42 B;  3FGV A;  2B8P A;  4LF6 J;  5LSR A;  1CQM A;  3G9C A;  2J7W A;  2C2R A;  3QGG A;  1PSD A;  4DOZ A;  2DCU B;  6AT1 B;  5C24 A;  3SXL A;  2DY1 A;  1LW0 A;  4TU7 A;  2Y8Y A;  3ITH A;  1NK9 A;  2J6S A;  1R8C A;  1N8R T;  4Q8E A;  2AGP A;  2CJA A;  3CMQ A;  1PAU B;  1YZ6 A;  5HMW A;  4KGK A;  1HYS A;  2R2S A;  3MPV A;  1QLN A;  2C3U A;  1C0T B;  3CO9 A;  1O0P A;  3CJK A;  3SIP B;  3D4J A;  4UZC A;  4DUZ J;  5KFL A;  2Q6B A;  3R5B A;  3L7U A;  2ASL A;  2ALY B;  2MTL A;  1NSQ A;  1S59 A;  1GFW B;  1UEU A;  1ZM3 A;  3EIC A;  3TAR A;  1IKY B;  4ZVP B;  4I69 A;  4ECR A;  3DLK B;  3LAN A;  3NNH A;  2W8K A;  1IM4 A;  4HDG A;  1U1N A;  3VAL A;  2QMW A;  4JI8 F;  5SUH A;  2ZZT A;  4ZVU B;  3HPO A;  3H2L A;  4KB7 A;  4G3I A;  2R2R A;  1NB7 A;  1ZET A;  1TU0 B;  2V50 A;  2CPE A;  1Z1Z A;  4K4X A;  2DK2 A;  4TYB A;  1DTQ B;  3QJL A;  3I5B A;  1KNZ A;  3OD2 A;  2MQP A;  2CNO B;  1NRK A;  1ELO A;  1RT2 B;  2K3I A;  3A12 A;  4A8M P;  3JTP A;  4Y0F A;  3PAC A;  1RP5 A;  1M1H A;  5CHC B;  3A8I A;  1F9E B;  5HN0 A;  3EGW B;  4ANE A;  3PEJ A;  2E1R A;  1B0V A;  3KDN A;  4WPA A;  3MM5 B;  4H54 A;  1TEL A;  3HVR A;  2H4Y B;  3CED A;  2K1R A;  2HQF A;  4RLE A;  1M5O C;  4JV5 F;  1S12 A;  3NBP B;  5EHH A;  4DX8 H;  3T41 A;  2MEW A;  1WSR A;  4USH A;  2RIL A;  1V5I B;  3KKF A;  3MHY A;  2L9D A;  4ZN1 A;  1G7C B;  1YDL A;  5D3G A;  3QMQ A;  2LQB A;  3OLB A;  2NXC A;  1RBO B;  1IR0 A;  1SKU B;  2RKI B;  4ERD A;  2MY7 A;  4J91 A;  2AZ3 A;  3QYY A;  4ECZ A;  3EX7 B;  5E5N A;  5A8W A;  2JNJ A;  4UQT A;  3MEG B;  2DHA A;  3L4B C;  1BUX A;  4PYD A;  3FCH A;  1S7I A;  3B8H A;  3OV7 A;  1IM6 A;  1D8Z A;  5KG1 A;  4IR9 A;  2Y1L B;  2QLX A;  4G1Q B;  2QA4 G;  4M5G A;  2DYA A;  5CD4 H;  3VVU A;  1IUJ A;  1HBO B;  2DNM A;  2PO4 A;  1G6B A;  5KFQ A;  2QA2 A;  5C24 B;  2PGC A;  1M5K C;  1RT4 A;  1IBC B;  2IM2 A;  1K1S A;  4AL7 A;  4B9L A;  1K9M T;  2AX0 A;  4WXO A;  3V6K A;  4TU8 A;  2HMI B;  2CG8 A;  1SQF A;  1TK0 A;  2XSF A;  3Q0A A;  3DC2 A;  2IM3 A;  2E5J A;  2KVI A;  2QRR A;  3HI9 A;  4XIU A;  4IFV A;  2X51 A;  3IWX A;  4O3R A;  4NCG B;  4URG A;  3CJK B;  2Y0B B;  4K4W A;  2XCA A;  1U0S A;  3NGD A;  2C28 A;  4DR2 J;  2GJ2 A;  1KSP A;  3FK4 A;  4Q2M A;  4HI2 A;  2KKH A;  3EGV A;  2XUL A;  1MRO B;  1Y10 A;  3P3D A;  4JI0 F;  4PCQ A;  5ETP A;  3CDA A;  3WDO A;  4J5O A;  3GYX B;  3CC4 S;  2CIM A;  3ETO A;  1EZZ B;  3TP2 A;  2RML A;  2UU9 J;  3T3F A;  2HFN A;  1CBK A;  2DH9 A;  2RB7 A;  5BYR A;  5KFU A;  4F04 B;  4DX7 A;  2PMZ D;  2QLB B;  2GX8 A;  1RT3 A;  3BRE A;  2QC3 A;  1IR2 A;  1SI9 A;  3O1L A;  1YLX A;  4X66 F;  5KT3 A;  4DR5 F;  2J0W A;  1RT7 A;  4DR6 F;  4RUC A;  2UUA J;  3HK2 A;  3DNC A;  5KT2 A;  5D0G A;  3EPI A;  2H9Z A;  2GNK A;  4PXC A;  2W9C B;  4F0K A;  4OZJ A;  5IM0 B;  2OI2 A;  4NLT A;  3HFZ B;  2DBB A;  1UAW A;  4EEY A;  4XK8 C;  2IRY A;  4LFB J;  4OJG A;  4NRT A;  1HNX J;  4FPI A;  3J81 j;  2NZ4 A;  4OLO A;  3J81 Y;  4ES1 A;  1L3S A;  5DQG A;  2VPW B;  5CZX A;  2XLI A;  4P75 A;  4QW9 A;  2AYM A;  2MZ1 A;  2JLG A;  2ZBI A;  2ZFH A;  3WX4 A;  3KNG A;  4KHR A;  1GT8 A;  1UZD A;  1V3Z A;  5D3G B;  3LQV A;  1OS5 A;  2XMT A;  4I0W A;  1TQL A;  2HHU A;  3T1A A;  5E3A A;  5DLF A;  3EZO A;  1REG X;  4OYP A;  3PEH A;  2HHT A;  5HL7 Q;  2HAI A;  5A8W B;  3K7R A;  2OEL A;  3VZH A;  2HK2 A;  1BE4 A;  4ID5 A;  4TU9 A;  4YR3 A;  1GAO A;  3DXB A;  2QG9 B;  4KKO A;  3RAX A;  2LCW A;  3PYD A;  4LF1 A;  3THT A;  3SV4 A;  4ELV A;  5H9F J;  2ACY A;  3CDE A;  1YJR A;  1FFW B;  2GGP A;  1RT4 B;  1IWA A;  2B6A A;  3AD8 C;  4ECT A;  5E33 A;  1BD6 A;  2I0X A;  1X4A A;  3TVK A;  4Y34 A;  5J1E A;  4NWB A;  2D3U A;  1A0O B;  3FVY A;  4LRD A;  4UZB A;  1U8W A;  1NDL A;  1CJK A;  5KFY A;  4RBV A;  3EGZ A;  4A8W A;  2CJX B;  2BX6 A;  4PG4 A;  2MMY A;  4QPT A;  3RBX A;  3W9I A;  4LUB A;  3KLG A;  4Y00 A;  1HNW F;  3CCJ S;  4X65 F;  1NK5 A;  3PJW A;  3AQO A;  3D6F B;  1TMJ A;  4KSE B;  1SH2 A;  4K2J A;  5HBM A;  2BM1 A;  2F4V J;  4ED0 A;  2R9L A;  4UY8 5;  4K7Q A;  2A18 A;  3D6H B;  2AJ1 A;  1YG0 A;  2L9W A;  3QWP A;  4ZJQ A;  3GFX A;  3BBC A;  4KQZ A;  3UI3 A;  3CCV S;  4CNY A;  2E5I A;  4ED2 A;  4ED6 A;  3EE3 A;  4PWD A;  1BY9 A;  4JI3 J;  4ED5 A;  2CVI A;  3CIM A;  2F5G A;  2C2M B;  2NPF A;  4A8Y A;  3KK1 A;  1NKC A;  1S1T A;  3FRZ A;  4D3H A;  2DNP A;  4N8N A;  1VQ4 S;  1UCN A;  4F4K A;  2GW8 A;  2AJ0 A;  2NPI A;  4OZN A;  5CA5 A;  2NQP A;  4LF4 J;  1HIY A;  3NWR A;  1D9A A;  4PXB A;  1Q7L B;  3DHW C;  1LV5 A;  2ZD1 A;  4ZMM A;  3A1Y G;  1XJW B;  2GJI A;  1O51 A;  3A3N B;  2QSF A;  5J2P A;  3QAU A;  4PAB A;  4OZ1 A;  2O67 A;  1AW0 A;  4C8K A;  2MQM A;  1X4H A;  3TVZ A;  8ATC B;  2GHP A;  5F9L A;  2MZT A;  5KG6 A;  4QIV A;  3M6W A;  2DR8 A;  3ET6 A;  4GRS A;  4P72 A;  2C2K B;  4OZL A;  3HVT B;  2LEA A;  4LRA A;  3DLL Q;  3M32 B;  2FLP A;  5K8P A;  4ECY A;  1EB0 A;  1A9N B;  5F8L A;  2M8D B;  3AXK A;  3A13 A;  3HD2 A;  3UD5 A;  1N33 F;  3M8Z A;  2CPF A;  4KKO B;  1PIL A;  3JQK A;  3JQM A;  2BQU A;  4PYA A;  3A3P B;  4DF8 A;  4USU A;  2HS4 A;  2HHS A;  5IT9 Y;  3HM9 A;  3C14 A;  5D78 A;  2GGP B;  1QY7 A;  4ETZ A;  3SEO A;  4EK2 A;  1Y4Z B;  1TL1 A;  3MCN A;  4DX6 A;  3D1O A;  4OJ1 A;  3R7S B;  2CNN B;  5J1E B;  2EK1 A;  1U8S A;  4JBC A;  2E9T A;  1H0H B;  2V8D A;  5IWA J;  2E9Z A;  2LA4 A;  2V8P A;  2R7Q A;  3HHL B;  3K5P A;  1Q53 A;  2C2O B;  1WKJ A;  1WF2 A;  5DET A;  4YR2 A;  1SV5 B;  2U2F A;  3KLG B;  4LT6 A;  3BKU A;  1J5E F;  4RW7 B;  4OI1 A;  2D3Z A;  3J7Z T;  4CQ1 A;  4K4V A;  1R43 A;  4RWW A;  4C2M A;  3HZG A;  4X4N A;  5HVF A;  2I38 A;  2FC8 A;  3FNN A;  2LEP A;  1RHM B;  1WOS A;  1HI8 A;  1SJF A;  1IN0 A;  2E5L J;  1Z2L A;  2ZZN A;  3Q8R B;  1QTM A;  3R2C J;  1D1U A;  1SL0 A;  4U7U K;  1YHQ S;  1QE1 B;  2AYG A;  3AOA A;  2G0J A;  4P7T A;  2KYX A;  1RWX B;  1S48 A;  4DV6 F;  2JC1 A;  1BQX A;  4JI7 F;  2IRX A;  1RJJ A;  2SXL A;  1AT1 B;  3DI6 A;  4HHJ A;  4I6A A;  1NJI T;  4PWD B;  1JKH A;  2KFN A;  2VC0 A;  4TVA B;  4MK7 A;  3KK1 B;  2W7O A;  3MMJ A;  1U0H A;  1S0O A;  4F25 A;  1U1Q A;  2B5J B;  2KZZ A;  5HLF A;  4LVN P;  3SFU A;  2ADC A;  2PE8 A;  3T9Z A;  5CYM A;  5JMN A;  1NB2 A;  4FNI A;  6FDR A;  1VQS A;  1SJQ A;  3DLB A;  4ECQ A;  1HMV B;  1RAD B;  3GII A;  2HIQ A;  2D41 A;  5GMK a;  2BJ7 A;  3CXC R;  4I4B A;  2OFH X;  2ZD1 B;  2J9E A;  1U25 A;  2ZOF A;  4DU8 A;  2PI5 A;  5AE3 A;  4RW4 A;  2VIH A;  3KJQ B;  1EAR A;  1VBZ A;  1FX4 A;  5KFD A;  2HYI B;  2JLF A;  5J2M A;  3IBF B;  3PV8 A;  2AYB A;  3PO4 A;  1YK9 A;  1OQ6 A;  3ADA C;  1FFS B;  3ET6 B;  3W2W A;  3I31 A;  2DNY A;  3NGK A;  2MZQ A;  1JQG A;  3GJT B;  3ZTO A;  2HHX A;  1AFJ A;  4IR1 A;  2VG6 A;  3DM2 B;  4JI8 J;  2DIS A;  3QRR A;  4L76 A;  3D9B A;  3FFI B;  3OXF A;  2HBZ B;  1YRU A;  2NSB A;  4DPY A;  2MXY A;  4OV1 A;  1QAJ A;  2HWT A;  3SSR A;  1WOR A;  1AYE A;  5CYQ A;  1F9H A;  4CLF A;  4P7V A;  3MMA A;  2ZEJ A;  3O44 A;  5A2Q Y;  3C14 B;  4ZIW A;  3VGV A;  2COL A;  2UV8 A;  5DG9 A;  5B09 A;  3DLH A;  2CA9 A;  5K14 A;  4N77 A;  3I0R B;  2RSQ A;  4LVO P;  2CAJ A;  1ZM4 A;  3CUN A;  4IO1 A;  1X4C A;  5A8R B;  2IYI A;  4JOU A;  3OXL A;  2MKC A;  2CPD A;  2HIY A;  5T41 A;  1SIZ A;  3M2R B;  3TX0 A;  1B64 A;  4O23 A;  2AHO B;  2G13 A;  2CWX A;  3KYL A;  2G9O A;  2HWI A;  1ZPW X;  4USV A;  4JV5 J;  4F2R A;  2B43 A;  4RU9 A;  3AOB A;  1S97 A;  4ED3 A;  4HT5 A;  1Z4U A;  1NBE B;  2XNQ A;  4J37 A;  2DIU A;  2XZD B;  1GQE A;  2NXJ A;  2KB2 A;  3TEG A;  4EGL A;  2VC1 A;  3WC0 A;  1T02 A;  2EG1 A;  5IXU A;  4NA1 A;  1DHM A;  2YX4 A;  2GMH A;  1Q8K A;  3KLF A;  3KWM A;  2AU0 A;  4PZV A;  1TVR B;  4LR7 A;  2MY8 A;  3RTV A;  1Y3J A;  2IFX A;  3NNA A;  3TZX A;  4L3N A;  4AXI A;  2IC3 B;  2C2Z B;  5KOW A;  2XO6 A;  4YR0 A;  3Q83 A;  1P8G A;  1JLC A;  1S6Q A;  1VS3 A;  4K0K F;  4BDP A;  2VA3 A;  2BAN B;  2FZK B;  2WZ1 A;  1R0B G;  3DDN A;  3GIK A;  1U0H B;  4U96 A;  2H1Y A;  1PYS B;  5BXI A;  1XC9 A;  2YKP A;  3CCQ S;  5CYM B;  4C6A A;  2HLU A;  4DL3 A;  3K59 A;  1G4C A;  5GVQ A;  3FDS A;  1M1G A;  4W90 B;  3LP1 A;  2YKM B;  2VZ9 A;  1YRX A;  3RG6 A;  1LKZ A;  2B51 A;  5E3R A;  1EIY B;  1VR6 A;  2A2C A;  3CJQ A;  3BN7 A;  2CQD A;  4P10 A;  2YKN B;  2RIJ A;  2B3T B;  2KJW A;  2V6A A;  3SMZ A;  3MM7 B;  3H90 A;  3C6T B;  1H2U X;  2X3D A;  2E66 A;  3LP0 B;  1VQN S;  2P2C B;  4JI0 J;  2BJD A;  3W2W B;  1KFS A;  2ZH2 A;  1S57 A;  4ZDN A;  1UA1 A;  3EYZ A;  4F3M A;  1C2P A;  4QR1 A;  2MZJ A;  2ZBP A;  4DQS A;  1LWF A;  3KJV B;  4DFK A;  3G86 A;  4CLU A;  4DSJ A;  1RAF B;  3MEE A;  1N5T A;  1HQU A;  3U1M A;  1IWG A;  4ZJL A;  4JV2 A;  3T6B A;  3OVA A;  1KD1 T;  3H5Y A;  3RW7 A;  4MYU A;  3K5N A;  1RWP B;  5CYQ B;  2MKJ A;  3EPG A;  1HLW A;  3QT5 A;  1DJ0 A;  1GH8 A;  4X66 J;  5HP1 B;  3FBB A;  4DR5 J;  4DR6 J;  4DEZ A;  3BKT A;  3NS6 A;  3K0J A;  3BH7 B;  3TUI C;  2FZC B;  5B7W A;  1F5C A;  3VAH A;  4LF5 F;  3OLA A;  4I56 A;  5F8N A;  2FHJ D;  1AXQ A;  1OY8 A;  3TZZ A;  1XNQ F;  2DHH A;  2ZBC A;  2NYH A;  3AOD A;  4X4Q A;  5AE1 A;  3G4S S;  5J2N A;  1I1G A;  1U2F A;  1TTH B;  3N5B A;  3D1Q A;  3MEK A;  1VJQ A;  2V34 A;  5KG7 A;  1AUD A;  2UXB F;  4NYP A;  5EUH A;  3HHL C;  3P6Y C;  3OJU A;  3NP5 A;  3VGU A;  4ENO A;  3NY0 A;  3KLV A;  4IOB A;  5IFM A;  4JB8 B;  3X1L B;  1CQN A;  4YDX A;  4ZCL A;  2QSW A;  1VIO A;  1WKL A;  4DR4 F;  3HFV A;  1Y5I B;  2B0G A;  4E98 A;  4B3M F;  3MOJ B;  2I5J B;  2B9E A;  3G6E S;  2FPH X;  3FQL A;  4QWA A;  4RU2 A;  4MK8 A;  2FHK A;  4PG5 A;  5IS2 A;  1S77 D;  3TAQ A;  4KHM A;  3G8T A;  3HXM A;  4RUA A;  4ALZ A;  1J2V A;  2ZOG A;  1RCX B;  3LAK A;  1QD1 A;  1SQE A;  2V4J A;  4DFM A;  4CO0 A;  4FBU A;  2QL7 B;  3RBE A;  3SQG A;  1JLC B;  1S6Q B;  4F3Q A;  4FYX B;  1K0T A;  1VQM S;  3HHN B;  1RYR A;  3M7V A;  2VUG A;  7FD1 A;  4HHH A;  4B9N A;  4XPE A;  4RR5 A;  4GKJ F;  2HNY A;  3PY8 A;  1U48 A;  2IVM A;  4ZVE A;  2DGV A;  2JOQ A;  1FNM A;  1JJ4 A;  3OQ2 A;  2XZW A;  1QDU B;  2KYZ A;  3OPK A;  4PEO A;  4BLG A;  4X4S A;  1RTI B;  2VD3 A;  3HO1 A;  5F9N A;  2GIQ A;  4DFP A;  4QWD A;  2BAB A;  3K57 A;  2GHV C;  3CUL A;  3KG4 A;  3IBW A;  3CDW A;  2DGW A;  1HNW J;  3MZI A;  4X65 J;  1S4E A;  1HW8 A;  3C16 B;  1UMJ A;  3CJ5 A;  1KHW A;  3R1L A;  4YOE A;  4C48 A;  2P8I A;  3Q23 A;  3NLC A;  1HAR A;  3GTY X;  3MXH P;  2C3M A;  2HFS A;  1DAX A;  1PBU A;  4YN3 B;  4KFB B;  2WW4 A;  5M2P A;  4O3N A;  1CG2 A;  3DU6 A;  1VDH A;  5ETK A;  1OY6 A;  5CAB A;  2BV3 A;  4QPX A;  3VAG A;  4HEA 9;  1MU2 A;  4DX5 A;  2DNR A;  3JTN A;  1N88 A;  3W3S A;  2QJ3 A;  5GME A;  2R7U A;  4UT4 A;  1T05 A;  3S01 A;  2HHW A;  4X64 F;  5HK4 A;  2W9B A;  3CCM S;  5DQI A;  2OPQ A;  1B4S A;  1N6Q A;  2J8A A;  3LPY A;  1KLM A;  1UVL A;  2H3E B;  2QMX A;  3CNQ P;  3SBM A;  2YNI B;  1SJ1 A;  4OFZ A;  1EQ0 A;  1HNI A;  5J2N B;  2CJK A;  2FDN A;  3OL8 A;  2CJ9 A;  2D1C A;  1S1V A;  3LWM A;  4XAK A;  1WTF A;  4DL7 A;  3C15 A;  4YUD A;  4DPT A;  3ETM A;  4UW2 A;  1KDN A;  4ZOS A;  3M9N B;  3CJ8 A;  4ZPA A;  3IBC B;  2OPS B;  1SQG A;  1JLB A;  4Q43 A;  3PNI A;  3T19 A;  3DRP B;  2DR7 A;  1Q7Y T;  2IM0 A;  3GU0 A;  3Q86 A;  1QAX A;  2VPX B;  4MT1 A;  4EWT A;  2KZM A;  4WP8 A;  1SVD A;  3IGV A;  4NML A;  3W2V A;  1S9G B;  2M70 A;  1NUE A;  4OJH A;  2PMW A;  3I9V 9;  1SXL A;  4WTO B;  4QIW D;  1RHQ B;  4F7V A;  3TAP A;  4F4Y A;  5H9E J;  4PXD A;  4KHP F;  3UVJ A;  4PR6 A;  3V6D B;  2AEM A;  2DGX A;  2HFZ A;  3DYA B;  2E1A A;  3CE8 A;  3MM6 A;  1S1U B;  1VJW A;  2FJB B;  3FCV A;  1N33 J;  1FDN A;  3IR7 B;  3H98 A;  2N4C A;  2V4J B;  3GSD A;  2GQ2 A;  2NUU G;  4ED1 A;  4Q0B B;  3SQG B;  4LIW A;  2FLN A;  1N0V C;  5DDP C;  3Q8S B;  4DV4 F;  4ITS A;  3BGR B;  4PAA A;  5LXR A;  2GA7 A;  4M5M A;  3DCA A;  4K5R A;  3OR2 A;  3MED A;  4B17 A;  4U7C A;  3RB3 A;  3PO5 A;  1WJ9 A;  1M1K T;  1EAY C;  2CNK B;  1YVF A;  4X84 A;  3UD3 P;  3D54 A;  1I94 F;  5FJ4 A;  3KG0 A;  4B3S F;  2WB4 A;  1NH8 A;  1SL1 A;  3W64 A;  2P6T A;  3MMB A;  3ZZU A;  4AT1 B;  3GQC A;  1N5Y A;  4B3T F;  2FGO A;  1S0N A;  4NZ0 A;  3O2I A;  5B08 A;  3M6U A;  5HQL A;  5HJX A;  2W1B A;  3K5L A;  4ZVO B;  2YPZ A;  3UO0 A;  2UXC F;  3AB2 B;  2CQ1 A;  1J5E J;  3MD3 A;  3DRS B;  3VAF A;  4WK3 A;  4ED8 A;  2AJ2 A;  3A8E A;  1KTV A;  2GVD A;  2MQ8 A;  2HNZ B;  5L9X A;  3I87 A;  1DBD A;  5K5M A;  5I42 B;  5KG3 A;  5IT4 A;  5IT0 A;  2F9J A;  2GCF A;  1FES A;  4JI4 F;  5ADZ A;  3P49 B;  1MU2 B;  2EC0 A;  1LXJ A;  1UEK A;  1HPZ B;  2EXU A;  4QJV A;  4DSE A;  4JI7 J;  4U8Y A;  8AT1 B;  2CAD A;  2W9B B;  3A3O B;  3NGT A;  3V5R A;  2BE2 A;  1FTR A;  2VDI A;  3M30 A;  2GO9 A;  1N6Q B;  4ZJO A;  1ZOT A;  5D0E A;  4MFB A;  3ZTQ A;  3UPF A;  1RAA B;  2FLL A;  2VDH A;  2AJF E;  1C1C B;  3BGL A;  3IN5 A;  2RRB A;  4A8F A;  1QM9 A;  1S1V B;  1Q16 B;  2HQ3 A;  1Q5V A;  2OEM A;  1Q8I A;  2QYC A;  3Q8U A;  4CI0 B;  4C8O A;  4K2X A;  1OYD A;  1TK5 A;  1FER A;  1WD6 A;  2KG0 A;  1VRT A;  3G8Q A;  4RBT A;  1JLB B;  2HFV A;  2EK6 A;  1S76 D;  2CPY A;  2ZBQ A;  2D3O 1;  2JVR A;  1U47 A;  2B9Y A;  2MKY A;  1QSL A;  2DH7 A;  2HSE B;  2VJU A;  4EZ6 A;  1EHW A;  4NLY A;  3R7B B;  1VK8 A;  2KN4 A;  3ZFV A;  3JSR A;  2MST A;  4QIF A;  4ELT A;  2LXI A;  4NI2 A;  2ACM A;  5FD1 A;  3DXS X;  5DZ7 A;  2KH9 A;  3UVJ B;  3H40 A;  4ZPW R;  1FE0 A;  4WU3 A;  1JMT A;  4O3S A;  3MM6 B;  4UOG A;  2ROE A;  2IBO A;  1DTT A;  2FJV A;  4NXM F;  1RKI A;  4TQS A;  3KK2 B;  3JAM U;  3EM1 A;  3TI0 A;  2IIH A;  4ZPV R;  3BM7 A;  3UR0 A;  1VC6 A;  3HLU A;  5HSP A;  3OR2 B;  4FYV B;  3ZZY A;  3U1N A;  3B6B A;  4DQP A;  2HGL A;  4FN5 A;  3MCO A;  4J7C A;  1M5P C;  3KUE A;  2HLT A;  3BEG B;  5KG4 A;  1TFY A;  2M2B A;  3OL7 A;  1NLK L;  4ZVF A;  2GIR A;  4DV0 F;  2YX1 A;  1T03 B;  3MMB B;  1C0U A;  3IM9 A;  3IS9 A;  2CVE A;  2BJ9 A;  1VIX A;  4ZIT A;  4HYK A;  2ATC B;  3W65 A;  4CLS A;  1HWK A;  3KJN B;  3GR1 A;  2V94 A;  4OI4 A;  1Q5Y A;  2MQQ A;  2IAJ A;  5I3U A;  1UFL A;  4LJM A;  3QIP A;  4WBF A;  3GMG A;  4LF7 F;  1ZAW A;  4C11 A;  1NME B;  2EFO A;  3JSM A;  3DMJ B;  1PC5 A;  2AJ4 A;  4J9S A;  1IVZ A;  2V8H A;  3QNW B;  3M9O B;  1FKO A;  2YNF A;  4NE9 C;  2DNG A;  2QTW A;  2C1E B;  2CJB A;  2NCK L;  4Y2M A;  1NJZ A;  1TL7 B;  2P5V A;  4FNH A;  3IP0 A;  2N82 B;  1JK9 B;  4RL1 A;  4A8S A;  3NGS A;  3N0V A;  4GMK A;  4E0D A;  1NU4 A;  2BOA A;  5GAD U;  3KMQ A;  2QGF B;  3HSZ A;  4YEA A;  2RF2 B;  3OTB A;  1NZ8 A;  2AV5 A;  2FJX A;  4K0K J;  1IKX B;  1OJ4 A;  2B7C B;  4W92 B;  2IA6 A;  1C4A A;  1CS4 A;  1OY9 A;  4HR2 A;  4PQU B;  3AY0 A;  2QIF A;  1WHY A;  1UTA A;  2W2O P;  2QO3 A;  1LWX A;  3ONQ A;  3NOC A;  2VON A;  1BWE A;  5E3P A;  3K5M A;  1LWC A;  3D28 A;  4FKY A;  1R8P A;  1VLO A;  3QT7 A;  2AGQ A;  4KIA A;  1XK8 A;  2HVI A;  3FMW A;  2XMW A;  4DR1 F;  4J9K A;  4LSN B;  2I8E A;  2ZJR Q;  3SCK E;  2BOP A;  1E6Y A;  2JEF A;  2YBV A;  1XMO F;  2LVW A;  2VH7 A;  3MPD A;  3JYT B;  3HHD A;  1P6T A;  1RTH B;  2FVC A;  3DOK B;  3M9M B;  1VBX A;  1BLU A;  4A8K A;  3BDE A;  3K89 A;  4HL9 A;  1URR A;  2C42 A;  3LP2 A;  1W25 A;  2L48 A;  1U1O A;  4OLP A;  4OYX A;  3L09 A;  1UPM B;  2HQC A;  5E41 A;  1WG1 A;  3F0N A;  1DQ8 A;  3CDU A;  4H4O B;  5GAD I;  5H9F K;  1S9F A;  4PG7 A;  5C2C A;  1NKB A;  3TQE A;  3QLH A;  4CIO A;  4LF5 J;  2R7W A;  3CMA S;  3I96 A;  3HHE A;  2Q43 A;  4NPO A;  2CPX A;  2UVR A;  2G4B A;  1XNQ J;  3NWG A;  3QT8 A;  1LXN A;  1KOO A;  2OPR A;  3W9J A;  2XS2 A;  3PFE A;  4OYI A;  1FXL A;  5E2Q A;  4NLR A;  1C0U B;  1Q86 T;  5J2Q A;  1NPR A;  1F3V A;  2UXB J;  3GSI A;  1N54 B;  3P4U B;  3N5F A;  2FHO B;  4P52 A;  4CNZ A;  2IAJ B;  2LQ8 A;  3QIP B;  2ZKU A;  4NEY A;  1X4B A;  2PEB A;  2BQR A;  3M05 A;  4TNO A;  4KE5 A;  2KXH A;  4E8U A;  4O3Q A;  3JSM B;  1PJ7 A;  3MCM A;  1RT1 B;  1FFG B;  4JI5 F;  2QLJ B;  1PYT A;  4ZPT R;  1OSD A;  4ZVR B;  3X3U A;  2XMJ A;  3K2Y A;  1B3T A;  4B3M J;  1BHN A;  2W4P A;  3RBZ A;  4ELU A;  2FY8 A;  2G1H A;  1VCT A;  2XZT B;  4C0O C;  2ZWP A;  3JXO A;  1EKS A;  1D9F A;  1LW2 B;  3PKM A;  2M52 A;  1QVF R;  2GIF A;  3M8W A;  3L95 X;  3R5J B;  2ASY A;  1B0P A;  4Y6I A;  4F0M A;  2J0X A;  3POT A;  1ROF A;  3DKD A;  3I32 A;  1RZM A;  4NLU A;  2Y3Y A;  1YQH A;  4C8N A;  4W4M A;  2RH3 A;  4HTI A;  1HBN A;  4O3O A;  1CS4 B;  4F4W A;  3OSP A;  4N47 A;  2YWE A;  4TY8 A;  4UST A;  4HKQ A;  3CC7 S;  1JLF B;  1SUQ A;  4IG0 A;  4GKJ J;  1TFW A;  4P6Q A;  3IR6 B;  3TEH B;  2KM8 C;  4KTQ A;  1LWC B;  4ECV A;  8RUC A;  2NSC A;  2UP1 A;  1BC6 A;  2NLW A;  4AXJ A;  2AYE A;  5KFI A;  1IBK F;  5A76 A;  2R4F A;  1RWN B;  4HH1 A;  4U9R A;  4PUO B;  1V3S A;  3T5J A;  1WEY A;  3F73 A;  1E6Y B;  5HRO B;  2R7X A;  1U1P A;  1ACM B;  1FDB A;  1DLO B;  1YJN S;  1GEH A;  4ZP9 A;  2YQ3 A;  3IWN C;  3LGN A;  1VQ9 S;  4MKB A;  4J9U E;  3SV3 A;  2HFU A;  3CME S;  5HAO A;  1ZAX A;  3RB0 A;  1XR5 A;  1VOM A;  1ZYQ A;  2JDJ A;  2DHS A;  2V9W A;  4Z7C A;  1MG7 A;  2DY9 A;  3OJS A;  2OH2 A;  3AOC A;  1SPB P;  4IOC Q;  4LMZ A;  2QEX S;  3W61 A;  4X64 J;  4RNM A;  1S1X A;  3QLH B;  2YQ0 A;  1S7H A;  2HGN A;  4QQB A;  2V2Z A;  2EVZ A;  5KFB A;  3H59 A;  2C2E A;  4L6V 3;  3MR2 A;  2F8E X;  4ANC A;  1N52 B;  2AIR B;  1S5Z A;  3M2U A;  5KT7 A;  2O3D A;  4M5H A;  1XBW A;  5A0Y B;  2AT1 B;  4C9D A;  2GV1 A;  4IH7 A;  5DZ6 A;  4ILL A;  1RAG B;  1GK8 A;  1FD8 A;  1FWP A;  1VRU A;  2LQ9 A;  4TQR A;  5L9N A;  3CJ4 A;  1NDC A;  4QYZ J;  5EX0 A;  3N9U C;  3M8Y A;  2EI5 A;  4FYD A;  4R5P B;  2X1B A;  4MKY A;  4GKK F;  1C1B B;  4P2X A;  1UWB B;  3NL0 A;  4WFB Q;  5LMU F;  2FHM A;  5LSO A;  3TX8 A;  3D2W A;  1BGX T;  4KHP J;  4GVL A;  4ZK7 M;  2NUH A;  2RDD A;  4OX8 A;  1GMW D;  2JEG A;  3I5C A;  3QGI A;  1MSW D;  1S9E B;  1S4F A;  4J90 A;  1GXT A;  1ZAV A;  2BMB A;  3B54 A;  3FKB A;  3PX0 A;  2VOP A;  4O0I A;  2HBY B;  1TL5 A;  3B78 A;  4DV4 J;  4BHQ A;  4R8U A;  2V4Q A;  4OI3 A;  4O4G B;  4RPF A;  1F2G A;  3TUP A;  3CCS S;  4A8O A;  4ED4 A;  3H7H B;  4NZ6 A;  4DXL A;  4WYW A;  2EW9 A;  1NK6 A;  3EVW A;  2KFZ A;  3B4M A;  1Y5N B;  4I7F A;  1VQ7 S;  3QJP A;  3PFO A;  1I94 J;  2RQC A;  3WC2 A;  1IKW A;  1R31 A;  4B3S J;  3QFH A;  4USM A;  4KRW A;  1Q4R A;  2OML A;  1RK8 A;  3R27 A;  3MFH A;  3GR0 A;  2ZVS A;  3ZNJ 1;  4B3T J;  2LMI A;  4M63 A;  1WC4 A;  4WP9 A;  4CO5 A;  3HHL D;  2V4R A;  2XG8 A;  4CH7 A;  2UXC J;  3I56 S;  1HD0 A;  1NM2 A;  2LEB A;  3HCX A;  4ILR A;  4MJK A;  3T5K A;  3NAH A;  3UW1 A;  3HSJ A;  2ZDO A;  1RWM B;  4B9S A;  4ZLL A;  2XLK A;  4KH1 B;  1FXD A;  4I1T A;  2O1P A;  3AJ2 A;  1T11 A;  2M4M A;  3DRY A;  2GS8 A;  5AXM A;  5KFX A;  3KLI B;  4JI4 J;  1OPI A;  2ZC3 A;  1TAU A;  3RR8 A;  2V67 A;  4P2F A;  4UOC A;  4M5D A;  1UW4 A;  2HPU A;  2BYC A;  1JIH A;  3PJX A;  4NLX A;  1UEV A;  1VQK S;  3KMS A;  2EKN A;  4I2Q A;  3J81 U;  3MAA B;  3ZZZ A;  1A7G E;  3AH6 A;  4FPR A;  2N4D A;  3G96 A;  2EC2 A;  3KXD A;  5KFA A;  3LOU A;  5KFJ A;  1FXR A;  2H5I B;  3GG1 A;  1N0U A;  3I55 S;  3G6X A;  4AL6 A;  1VRU B;  1N56 A;  1CEZ A;  2HHV A;  3V6J A;  2ZH3 A;  3EGN A;  1FVQ A;  3SSS A;  3I0S B;  1KBR A;  2V5H G;  5CAA A;  4F50 A;  5L39 A;  2J6U A;  1NSA A;  3VQT A;  1HHT P;  1RTD A;  2OP5 A;  2WAQ D;  2KI2 A;  1Q82 T;  1H2T Z;  1VQ5 S;  1FRH A;  3M8P A;  2V8G A;  4L73 A;  2ABY A;  4QR0 A;  4G6V B;  3OFE A;  3V2U C;  1JJ2 R;  5RUB A;  3L3C A;  2CQ0 A;  4DUT A;  1RT6 A;  2UXD F;  1YJW S;  3H5U A;  2H65 B;  4O44 A;  2QE5 A;  3GIM A;  5M2R A;  3G82 B;  2DIV A;  1Q1K A;  1T9W A;  1FT8 A;  5CYJ A;  5L1L A;  2IDL A;  2RRN A;  1X9M A;  1YKW A;  3GV5 B;  3R6L B;  2FY1 A;  1M5H A;  3PDN A;  4NXM J;  3P96 A;  4QYR A;  4B3O B;  1S79 A;  2DVI A;  5LOQ A;  1SCJ B;  4QR2 A;  4CTA B;  3UDE A;  1HBM A;  2RHS B;  2R42 A;  1JLE A;  1AZS A;  2LQ5 A;  5AJ3 F;  4R8U B;  4K50 A;  5B0F A;  3VR1 A;  2OLW A;  4WF9 Q;  2I2Y A;  2CDQ A;  3CIZ A;  1XMQ F;  4RBU A;  2OPP A;  3QSI A;  3M4X A;  5L1I A;  3MI7 X;  3PR5 B;  3THP A;  4C8M A;  3IG1 B;  3SI8 A;  1SIW B;  3WQP A;  1RUS A;  1X5O A;  3OFG A;  4DV0 J;  4QZV B;  5C25 A;  3VF0 B;  4WXW A;  1MN9 A;  2AEF A;  5KFW A;  1OPZ A;  2HWH A;  3SDE B;  4G1I A;  2C3Y A;  1HHQ A;  3DN9 A;  4OI0 A;  2I1R A;  1ZA1 B;  2KO1 A;  4MKA A;  2EFG A;  1ULR A;  3GZ7 A;  5DDO C;  1EP4 A;  3NMA A;  2HVE A;  2ZE2 B;  3FZ2 A;  4IH5 A;  2F3J A;  1CJV B;  4LF7 J;  2R8I A;  3NEK A;  3R5A A;  3OUY B;  2WCX A;  2OUG A;  4A8Q A;  3MEC A;  2MHN A;  2KTQ A;  2YNH B;  4EU0 A;  3T5L A;  1HA1 A;  3VAM A;  2WSE C;  3EWG A;  4ICL B;  3QGH A;  4Q8F A;  1TV6 A;  2J6T A;  1URN A;  3QSY B;  4OYM A;  1QUV A;  3WIV A;  2RE1 A;  5J1P A;  2IDE A;  4ECW A;  3OHA A;  3V81 A;  1VQ8 S;  2ZC4 A;  4C8L A;  2IMW P;  2ALZ A;  2HHH F;  1R6Y A;  4M5D B;  2C2N A;  2HHQ A;  2QFI A;  3RB4 A;  1WHV A;  2UUW A;  2VG5 A;  4UOF A;  1VIS A;  2FJE B;  3LUY A;  1UWA A;  2DXF A;  2EBG A;  3MPW A;  4I2Q B;  1YBA A;  3DGP A;  1FWL A;  3IGN A;  3OR1 A;  3JTO A;  4RUB A;  3GON A;  5JXS A;  1RWW B;  1DFD A;  4KGZ B;  3HJV A;  4FF3 A;  2R8H A;  4WZQ A;  3PIO Q;  3D0H E;  4WYL A;  2MGZ B;  5EN1 A;  1HNV B;  2E29 A;  3MM9 A;  4DR1 J;  3PM9 A;  1R7I A;  3IR5 B;  5HVH A;  1WSV A;  2EWH A;  4Y2C A;  1L3V A;  2BW7 A;  2XSJ A;  4M94 A;  3Q8V A;  3AXM A;  4HAC A;  3HKZ D;  2HQD A;  1X7V A;  4JUZ A;  4K4S A;  4X4P A;  2CKW A;  1FKA F;  3RW6 A;  4KGV B;  2ZUA A;  1XMO J;  1Y00 A;  3QBC A;  4H4M A;  4I2P B;  4AFF A;  5LJ5 Y;  9ATC B;  3KLH B;  1LWE B;  4HLB A;  2PC6 A;  5F3Z A;  2HS0 A;  2CUY A;  4F4A A;  1WC3 A;  1M0S A;  3N79 A;  1RBA A;  2K7K A;  1LW0 B;  2CZV C;  1HBM B;  3CJT A;  3VAI A;  1YJ7 A;  3ITH B;  1NO8 A;  2OGU A;  4DG1 A;  5D15 A;  2DRD A;  4OHX A;  2JRS A;  2OD4 A;  2B4O A;  3O5T B;  2F7V A;  4H4K A;  3M1V A;  3W5Y A;  5F3T A;  4YB5 A;  4LR9 A;  3BZQ A;  3ZTS A;  1XTZ A;  1HYS B;  4DSF A;  4NAS A;  3C66 A;  2WVB A;  2OD6 A;  3PW0 A;  4ZVQ B;  3ENV A;  5AXN A;  2V2V A;  4MIB A;  5K8O A;  3JSB A;  2PII A;  4FF1 A;  5C25 B;  4WU2 A;  1QSS A;  4NLD A;  4UQG A;  3W8P A;  4RX6 A;  4OHZ A;  5K8M A;  3V4M A;  2R7T A;  5A8K A;  1VYA A;  2ASJ A;  4NL5 A;  4I67 A;  5ETT A;  2FHJ A;  3R6G B;  4NX9 A;  3G2X A;  3CTR A;  2EG2 A;  3FUY A;  5DGA A;  2WOM A;  3TAM A;  4DI6 A;  2W2M P;  2K3K A;  3MEC B;  2BE7 D;  2BM0 A;  1BQM A;  3OL6 A;  4JI5 J;  3PRB A;  2N3L A;  2UVV A;  1B7Y B;  2AKW B;  2IJR A;  3R2D J;  1KQK A;  1WC1 A;  1JJH A;  1TV6 B;  2XWX A;  3DFE A;  4WZM A;  2GAH C;  2G0I A;  4QOT A;  3V81 B;  1V3R A;  3J80 U;  2RNE A;  4M5L A;  4KV8 A;  4Q45 A;  1FE4 A;  1PJ5 A;  3K58 A;  2D3O R;  1U1K A;  1BMQ B;  3GIJ A;  4JI6 F;  4FF4 A;  3TA1 A;  3GYG A;  5FDL A;  2XHC A;  3DGP B;  1A6L A;  1UVM A;  2NS1 B;  4ER8 A;  1IQT A;  2K1R B;  3VWS A;  3RRK A;  3HP6 A;  2HW3 A;  4NA2 A;  1ITP A;  3DLE A;  5AE2 A;  4QIE A;  2FIU A;  2GZO A;  5ETV A;  1IKV A;  1IBK J;  3MUR P;  2RS2 A;  2LFV A;  4WCE Q;  4OX6 A;  5MAO A;  1P9Q C;  4P74 A;  1E6V A;  5IC6 B;  4F4X A;  2VQE F;  2P6S A;  4GO7 X;  3BSN A;  3GG0 A;  1VGY A;  1WKK A;  4IDK A;  1GX6 A;  4H4M B;  2KHC A;  1F60 B;  3HVA A;  5G0R A;  1R8B A;  4OX7 A;  5D8H B;  3T1Y F;  3S1T A;  2ILY A;  2BZ2 A;  4U8V A;  3H42 A;  4RW9 A;  2PA3 A;  2VJV A;  3M6V A;  2IYG A;  3FSX A;  4WK1 A;  5LM7 E;  4PWU A;  3IMQ J;  2DNZ A;  3MCS A;  1UJ6 A;  1L3K A;  1ZH5 A;  2JWN A;  1NZA A;  3AA9 A;  2VL1 A;  2DNQ A;  4WIQ A;  2ROG A;  2ADB A;  2HZA A;  4CT8 A;  1J27 A;  2Y1I A;  3UCZ P;  2N7C A;  4IFV B;  4ZLJ A;  1JXE A;  4OI6 A;  1VQO S;  4C0H A;  4MIW A;  3FBC A;  1ZTW A;  4DL0 C;  1RCO B;  1I51 B;  4WWS A;  4I68 A;  4Z2X A;  3C46 A;  1FKP A;  1QAY A;  2HGM A;  3RB6 A;  3IRX A;  1DRZ A;  3QT6 A;  1IBL F;  3DU5 A;  3BSC A;  5L46 A;  5A8K B;  5LMN F;  4TY9 A;  4FXV A;  2E1P A;  4X4U A;  1RAI B;  1SJ3 P;  2ZJQ Q;  3KHG A;  5KFM A;  3UN5 A;  3GFZ A;  3BB5 A;  4BWM A;  1FF2 A;  4IOA Q;  2HFO A;  3CCW A;  1RT3 B;  4LBI A;  4GKK J;  4RW8 A;  4OZ0 A;  4NA3 A;  2VAS A;  3N6L A;  3N6N A;  4W98 A;  4B02 A;  4DPW A;  1WAC A;  5LMU J;  4IFY A;  1RT7 B;  2G0C A;  3PRD A;  4CO3 A;  1GTH A;  1RXO B;  2HBR B;  2X1A A;  2MKH A;  3UDC A;  1MLA A;  4KV8 B;  4DZD A;  3LW5 C;  4BCA A;  3KJF B;  4Z7Y A;  5L1J A;  3DOL A;  4Z37 A;  2HAF A;  3TO8 A;  1UA0 A;  1N32 F;  5FDL B;  1ZM9 A;  3MMC A;  1FD2 A;  1WNE A;  5C5J A;  5CXT A;  2W7A A;  3PW7 A;  2M9K A;  2DPJ A;  3O8W A;  1IXK A;  5KG0 A;  1X4E A;  1SC6 A;  4ZHR A;  1P1T A;  1K1Q A;  4KT0 C;  2BBE A;  5F8M A;  5F8G A;  3TA0 A;  2WON A;  1TAQ A;  4BWJ A;  3CJR A;  4LFA F;  4DV1 F;  3TRG A;  2APO A;  3DRR A;  3PW5 A;  2O5D A;  4UUW A;  1VMB A;  2J0S D;  1XR7 A;  1T9X A;  3EDQ B;  1T9T A;  2AW0 A;  1O5J A;  4FVC A;  5FLX U;  3BO3 A;  5KT6 A;  1WF1 A;  3HZE A;  3MDF A;  4U7U D;  3BPD A;  4OJ3 A;  3BGO P;  3OL9 A;  3M8R A;  2F9D A;  5KOX A;  3I5A A;  1TL3 A;  2WSF C;  2W2P P;  4PKD B;  3EDR B;  3M8Q A;  3HDS A;  2X1F A;  1MW7 A;  4ID5 B;  2AEJ A;  3K8W A;  4RKU C;  1T9V A;  3ZNU A;  5CD4 A;  2DKO B;  1M5V C;  2CJY B;  4KGX B;  3CJ3 A;  5L1K A;  1PC4 A;  1R89 A;  2IY5 B;  1NK7 A;  2NYI A;  2B6A B;  3M2V A;  4GVB A;  5LL6 d;  4MK9 A;  1RA6 A;  1TKX A;  2WBM A;  1R3N A;  3ZZT A;  1YTY A;  2VV5 A;  3IAS 9;  2PFF B;  5T14 A;  2F40 A;  1CJK B;  3UQS A;  4CH0 S;  3L7P A;  3FMB A;  1WG5 A;  4TLQ A;  1X60 A;  2XMM A;  4YQW A;  2KL8 A;  2XMU A;  4L3K A;  1CJT A;  2EPI A;  2DT9 A;  4IKA A;  2J9C A;  2E44 A;  1R0A A;  3OFH A;  2MPU A;  5C42 A;  2AF6 A;  5F8H A;  2GJF A;  5HBM B;  3VCD A;  3BO4 A;  1X4G A;  1HWU A;  1UET A;  2IPO B;  5ETM A;  2FQQ B;  3PRV A;  5KFG A;  4J9L A;  2ZDP A;  4CM0 A;  1YWX A;  4RW8 B;  1Q95 G;  4JYA F;  1U2R A;  5DM6 Q;  3GP9 A;  1YI2 S;  2UXD J;  2JJ4 D;  3HD1 A;  4QIG A;  1XNR F;  2J9D E;  4CDI A;  3PCO B;  1C0T A;  2DRA A;  4DQR A;  3U02 A;  4PWW A;  1Y3K A;  3F41 A;  2YWG A;  1HHS A;  3I82 A;  1D9D A;  2JSX A;  1YJT A;  2K2P A;  4M5N A;  1S1T B;  2DHX A;  5LT5 A;  4C97 A;  3NRB A;  2GMJ A;  5GMD A;  5AJ3 J;  2RAQ A;  3MMC B;  1TKD A;  3DLK A;  3GCW P;  2FLO A;  2V0N A;  5F41 A;  1XMQ J;  1FCA A;  3PR4 A;  4WKR A;  5HAN A;  5KFO A;  2ZZM A;  4I6Y A;  1WC6 A;  4DLE A;  1K8A T;  4N76 A;  7AT1 B;  4ZHR B;  5EGY A;  2M5Y A;  2R8G A;  3E8O A;  1EX8 A;  2OMO A;  5J2P B;  1RAE B;  2Y0S D;  1MML A;  2PT0 A;  5B0C A;  4DN0 A;  2BXJ A;  3F56 A;  2PD1 A;  3NCQ A;  3H4B A;  2HVH A;  4NXN F;  3TWZ A;  4RO0 A;  1YJV A;  1ZZF A;  3AQP A;  3KLE A;  2ZM6 F;  1KVJ A;  2B4P A;  4UF4 A;  4FF2 A; 
#chains in the Genus database with same CATH homology
 2CNO B;  1PYO B;  1RWM B;  2QL9 B;  5IC6 B;  2C2M B;  1ICE B;  1I3O B;  3GJR B;  3P4U B;  1PAU B;  2C1E B;  2CJX B;  2Y1L B;  3GJT B;  3RJM B;  1RWX B;  2QLB B;  2QL7 B;  2QL5 B;  1SC3 B;  4ZVO B;  2HBY B;  1RWN B;  4ZVS B;  3SIP B;  1RWW B;  1F9E B;  4ZVT B;  1RHQ B;  3R7S B;  2CNN B;  2XZD B;  1SC1 B;  2H65 B;  2HBZ B;  1BMQ B;  3D6M B;  1IBC B;  2XYG B;  1GFW B;  2QLJ B;  3EDQ B;  3GJS B;  4ZVQ B;  3D6F B;  5IC4 B;  4ZVR B;  1RWO B;  3R6L B;  2H4Y B;  1RWK B;  2P2C B;  4ZVP B;  5K20 B;  3GJQ B;  2C2O B;  1QDU B;  2XZT B;  2H4W B;  2H48 B;  3EDR B;  3D6H B;  2HBR B;  4DCJ B;  1RHR B;  1RHK B;  4JB8 B;  2XYH B;  3R7B B;  3R5J B;  3KJN B;  4DCP B;  2HBQ B;  2CNL B;  2Y0B B;  3NS7 B;  4ZVU B;  2C2K B;  3P45 B;  3KJF B;  2FQQ B;  2C2Z B;  2DKO B;  3R6G B;  2CJY B;  4DCO B;  2H5I B;  1SC4 B;  3R7N B;  2H5J B;  2H54 B;  1RHU B;  3KJQ B;  2QLF B;  2CNK B;  1NME B;  1I51 B;  1RWP B;  1RHJ B;  1RWV B;  2H51 B;  1RHM B;  4LSZ B;  1QTN B;  3IBC B;  1RE1 B;  2CDR B;  3QNW B;  2XYP B;  3IBF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...