1XK8A

Divalent cation tolerant protein cuta from homo sapiens o60888
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent cation tolerant protein CUTA
publication title Divalent cation tolerant protein CUTA from Homo sapiens O60888
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 28
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xk8A00
5D4OA 1NH7A 3L7PA 3NCQA 4CNYA 4USIA 2NUUG 2J9DA 2JJ4D 3TA1A 4CO5A 4CO3A 4CO4A 3NCPA 4RLEA 1UFLA 4OZJA 2J9CA 1NH8A 3HLUA 4CO0A 5D4PA 2O67A 4OZNA 4E98A 2VD3A 5L9NA 3M05A 3TA0A 2EG2A 5DS7A 1V9OA 1O51A 4YB5A 1VFJA 4R25A 3N5BA 1V6HA 3AH6A 4WK1A 2GNKA 4YB6A 2XBPA 1V3SA 1XK8A 4Y6IA 1O5JA 1PILA 1QY7A 4CNZA 3AA9A 4C3LA 3BZQA 4ZK7M 3LF0A 4NYPA 2ZOMA 1NAQA 5DRKA 4D3HA 2CZ4A 4YB7A 3CE8A 1KR4A 1H3DA 2J9EA 4WK3A 2XZWA 2EG1A 4C3KA 4D3GA 3O5TB 4NYOA 1VHFA 4AFFA 1V3RA 4RWXA 4USJC 4Y65A 3T9ZA 4USHA 3MHYA 5D4NA 1OSCA 3O8WA 4IYQA 2NS1B 2Z0GA 1UMJA 4CO2A 1HWUA 4C3MA 2O66A 1NZAA 2DCLA 3GSDA 1P1LA 4OZLA 2GW8A 2GX8A 2PIIA 2NUHA 2RD5C 2E66A 3DFEA 3NCRA 4CO1A 3AHPA 2V5HG 2XULA 1J2VA 4RX6A 3OPKA 5D4LA 2J9DE 1GNKA 3TA2A 1UL3A 1UKUA 4RWWA 3X3UA 3AA8A 2ZFHA 2XG8A 1Q1KA
chains in the Genus database with same CATH superfamily
1S49A 3THPA 1KBRA 4NLXA 2E29A 1TL1A 1AA1B 3QT5A 1NHVA 3KLHA 2IC3B 4K2XA 3HFKA 5EWEA 4YUDA 3PJ9A 1X8DA 4DL0C 4UOHA 3OTDA 2R4FA 4AL7A 2VOOA 4OZ3A 2DIUA 2MY8A 4U96A 2HZCA 2MSSA 1QSSA 1PAUB 4C11A 2CZ4A 1P27B 4OYOA 2FGCA 3MEGB 5D3GB 4KGMA 4NYZA 5KFZA 4TY8A 4CLZA 3M8SA 4USHA 2IRXA 3M8RA 3LPYA 1KWMA 1Q79A 5K9FA 1QUVA 2XWXA 2AJQA 1S7IA 1FE4A 3BGLA 2JLGA 1KONA 3H0PA 3K89A 3QSYB 2M9KA 2NUHA 4NI2A 4WP3A 4JBCA 4J9NA 3BQ1A 3HHKA 3IM8A 2RIJA 4TN2A 5HP1A 2DXEA 2UV8G 5HVFA 4WCEQ 1HBMA 1KDNA 1FO1A 3ZTQA 1Q5VA 1M90T 3ENQA 2ZOFA 4KKOA 1KD1T 2MZSA 3T1AA 3MD3A 4PQAA 1MU2B 3R7SB 2E44A 1TFWA 3I96A 2CQIA 4URSA 4DSIA 1RTHA 3ZZ0A 3GYGA 1S9GA 3DXBA 4A8QA 3UNGC 1NK8A 4DR3F 3MGJA 1KQGB 3JYTB 3PG9A 1RT2A 4OX6A 3C2PA 1S6UA 4X4UA 4N8OA 4Z37A 5J1NA 3KK1A 3FBFA 2RF2A 1SKSA 3QSIA 3KDOA 1EAYC 2C2NA 4G1PA 5J2PA 5DM7Q 2N4DA 3V6KA 3KHLA 5KT4A 2HNYA 2JOQA 4KB7A 2QTWA 3TOQA 4NLYA 2H54B 3SCJE 3AA8A 3CEDA 3P4UB 4CWBA 4ICLA 3W2VB 1GK8A 1WORA 5HQ8A 1O8BA 1TUGB 1HBOB 3G2XA 4H4MA 1HLWA 2D9PA 4ES2A 4ECZA 3N6LA 3A8IA 4LF8F 2FY1A 2FVQA 2G0JA 4RW4B 4MH8A 5B0GA 1PG5B 2RU9A 3OJSA 1FRLA 3VAIA 2HQFA 2E9TA 4ZK7M 5F9NA 5HO4A 1SH3A 5GMKa 4URQU 4DN9A 1VQNS 1QVFR 1K1SA 2BBEA 4B02A 1RAAB 4RO0A 2AT1B 3LAMA 2XSJA 4F4AA 1VS3A 4MIWA 4MT1A 3M32A 4ECWA 1N36J 4JI5J 3TQ1A 3ZTSA 2IYGA 2Q6BA 2CJYB 4GO5X 3ETMA 1TELA 3HSJA 2BABA 1SC4B 1WUUA 4GVLA 1CQNA 3Q86A 4DV6J 1F0XA 2UZAA 2Y0BB 2UVWA 1UVLA 3NKYA 2OPRA 1RA7A 5KFPA 2HVIA 2YKAA 2CQ2A 2VBWA 5MLCV 4OZNA 4C48A 1SXLA 1P1TA 3MEEB 1FX4A 2DR7A 2IM1A 1LFWA 4RUAA 1VQ8S 2DHGA 1EP4A 2OD6A 1JIHA 2DT9A 1JJ2R 2K7JA 1YX2A 4HTIA 5D8HB 4ZPTR 2XLJA 3V6DB 4C8YA 3M9NB 1XJWB 3KNAA 3SQGA 3Q8PB 2UV8A 1E6VB 3A3OB 2VG6B 2QV6A 2JSXA 4NPOA 2FHJD 3IC1A 4OYPA 4LR9A 2PA8D 5KFTA 4F0MA 1SL0A 4A8SA 2B4VA 3DN9A 1RI7A 4DUZF 4X4RA 1JXLA 4C4WA 3PV8A 2EFGA 2RILA 3ULHA 4DI6A 3V81A 3ENVA 3JTOA 1FFGB 4X62J 4FVCA 2B8QA 3H4BA 1EKSA 3LP1B 2IFXA 2W1BA 2RUGA 1BD6A 2F8HA 2GHWA 4FNHA 3GFYA 2GIQA 4K7QA 1G4CA 4WK1A 4LQ3A 4XK8C 5F8GA 1OPIA 3NNCA 2IBOA 4CH0S 4UQTA 4J9RA 4WXWA 4X4VA 1RWOB 1EB0A 1U2CA 2DR9A 2K3KA 3E8OA 3DLEA 1AYEA 3RRGA 5HATA 3D6FB 4FF1A 2VZ9A 2M7SA 3ITHB 3RRHA 4YHHF 2EFVA 4J9UE 5F8NA 3MTKA 3GILA 1FDDA 1NB7A 1R8PA 5B0FA 1D0EA 2PDAA 3DRRA 3GSDA 5KTQA 4R8UA 2MKSA 3CIZA 3R2CJ 1N34F 3AODA 4EU0A 3LTOA 2IJNA 5T7LB 3QRRA 1Y5IB 1RTZA 1JX4A 3A3PB 1C1BB 4MK8A 3UDCA 5BR8F 1D9DA 1W7WA 2G0IA 4DLEA 1AW0A 1NDCA 2HQCA 5G0RB 2V8GA 5GMDA 4DS4A 2MZTA 3VQSA 2YNIB 4M5DB 4XPCA 2LEPA 8ATCB 4F4ZA 1X0FA 5GADI 4WPAA 3G82B 3NAIA 1MWQA 1RHMB 1J5EF 5DG8A 2QYCA 3C6UB 2HNDA 1AZSA 3QYYA 2LLZA 3HT0A 2EW9A 2YWEA 2XHCA 3CDUA 4J9VA 1UPPA 2CVEA 2HZAA 4AL5A 4RWXA 3J81Y 1RACB 1OSCA 2J7UA 3R5JB 1U1OA 5ETKA 3BYPA 3JB9k 4DUYF 1FRIA 4DL3A 3OVSA 2WTFA 2GW8A 2OPPB 1FRMA 3J7YU 4YR2A 4ZP9A 1N54B 2QC3A 1LWEA 3PEHA 5F8HA 4DV2J 2OFHX 4I4BA 1REVB 4P52A 1HI0P 3ENAA 3N9UC 2AF6A 1S0VA 4ID5B 5DQIA 2HQIA 2R2UA 1IXKA 4UUWA 4J9KA 3W5XA 4CH7A 1WKLA 4OJ3A 3H5SA 1ZAVA 4RNNA 2I1RA 2DR6A 4Q7AA 5DGBA 1TFYA 2VQFJ 3H90A 4CIOA 2G2OA 4BCAA 1QTMA 4AXIA 3G87A 5E3QA 3J7ZT 1MN7A 1DARA 1DQ8A 2CQDA 1LW2B 3M30A 2OKQA 1GXUA 1X4HA 2XMAA 2KYZA 2V9KA 1M0SA 1JK9B 1BQNA 2WB1D 4ZJOA 7FD1A 4IFYB 1WC1A 3M9MB 1U49A 3EXCX 3CT9A 4LF4J 4PG4A 1NHKL 1FK9A 2KN4A 2V5HG 3H59A 2C2RA 1IQTA 4YB1P 1U1PA 3TQEA 2XY6A 4OX7A 3PW4A 3R3TA 4FYXB 4DV1J 5HLFA 3TJ8A 3P8BB 1HNXJ 2QFJA 3MM6A 4W92B 4KRWA 2C42A 2DNGA 4ZVTB 4DQPA 3PIPQ 1A0OB 4M94A 2EI5A 2LP4A 1KKHA 1F5CA 3EJMA 4UQGA 3CDWA 2NYIA 4IH7A 3MM8A 1ZM9A 4FXDA 2M5YA 3JSRA 4DQQA 3L95X 4NZ7A 4JI0J 3K8WA 5IWAF 2MQNA 5IM0A 2XMUA 1GMUA 2POKA 2C3YA 2E1MC 2HBZB 2ZVSA 4RU9A 1WSRA 3HVTB 1TVRB 1GTEA 2G9OA 3BO2A 2HS0A 2DCUB 3QIDA 2AEMA 3FEYB 3I5BA 2R8GA 5ETOA 1NHUA 3CMES 2DGSA 2EKNA 4NEYA 3QBCA 3NNHA 3H2VE 4RX6A 3V4MA 3WIVA 3PO5A 3VTIA 2DVIA 3LP2B 2V68A 1SIWB 3FNNA 2IVFB 1G2EA 3AD7C 5I3QA 4NE9C 1VBYA 2HPUA 3D3BJ 4LRAA 2CG8A 3QFHA 4FNIA 2DPIA 2V8DA 2CJ9A 2YKQA 2FVCA 3QT8A 3BO4A 2EBGA 2QL5B 3MR3A 1K9MT 2MZQA 5HQMA 1TL5A 3RRKA 2UXDJ 3FSYA 3KKFA 2C2DA 1Q82T 4GKJJ 4CM2A 3DOLB 3RB0A 2R42A 3D9BA 3IWNC 2DBBA 1DLOB 1JJHA 4F7VA 4AFFA 3N6NA 3NAHA 2FHMA 1LWFB 1O6XA 5D0HA 5KFWA 1ULRA 4C7QA 3FSIA 3DRSA 1IBKJ 4JI2J 2C2KB 3V5RA 1VMBA 1FRJA 3EZ5A 4UOGA 4ZP7A 4RUCA 2F3JA 3SSRA 1XTZA 2MQOA 2GMHA 4ZLPA 1N56A 4KTQA 2HZVA 3MMBA 1U2FA 3MCNA 3MEGA 2W4CA 2F63A 1VQKS 4A8XA 4F0KA 4X4QA 4CO3A 1TU0B 2CNOB 3G4SS 1Q53A 1TV6B 4NLWA 1LK7A 4ZPAA 1ZTWA 2GIFA 2VOPA 4CLSA 2ABYA 1V3SA 3KJQB 3GFZA 5K8PA 2H48B 3BSNA 1NXIA 4CNZA 3C6TB 1NRKA 5CYJA 4LIWA 3DGPB 2Y0SD 1WTBA 2RB7A 3A13A 4CI0B 2X1AA 2B5JA 4PWWA 1TQLA 3UD4P 4FF2A 4AQYJ 5A2QY 2QMUB 1S79A 2BOAA 1PC5A 1VQ9S 1CBKA 4B9SA 2DHAA 5KT2A 4OFZA 2OO4A 5IQQA 3W3SA 3R5AA 1RTIB 4ES1A 4TYBA 3KJVA 4B17A 4DEZA 4OZ1A 3VAGA 3TUZC 4N41A 2PSZA 2E7XA 3ET6B 1Q8BA 4KHPF 5A8KA 2JH3A 4ITSA 2CPYA 5CAAA 4Y2IA 1SJRA 5HI7A 4ZPCA 2JL9A 4DCJB 1UFLA 2YXLA 5DDOC 3LA0A 2GJIA 4JOUA 3IA0A 2XBPA 1JLBB 2JNJA 2J0XA 4NOHA 3BN7A 1BC6A 4B3MJ 3S01A 4WE1B 2W8KA 2E7WA 1N33J 4PWDB 2MZ1A 2R8KA 3ILJA 4ECXA 1T9VA 5DM6Q 3W2VA 3H25A 5IOLA 4WP8A 1HBOA 3MMCB 1IWGA 3L7OA 2WW8A 2Y1LB 2RKIA 3DDKA 4RW7A 3B4MA 3CJQA 2Z2MA 4RW4A 2XWYA 2YX1A 1F60B 5EWGA 4LF1A 1WKJA 3OTCA 2HHHJ 1TP7A 2ZHAA 2FVPA 3EZUA 2Y9HA 2J6SA 1PGZA 1OJ4A 3T6BA 1NNDA 3DCAA 3EMTA 5KFAA 5DLFA 3IS9A 1KQKA 4DG1B 1VQ6S 2OI2A 2HYIB 2R9LA 2AX0A 2VBZA 2PO4A 1TK5A 2BVZA 1SCJB 4NLSA 3SYZA 4KGXB 1VJQA 3WX8A 1QDUB 1QAXA 2FLOA 3OL9A 3PXGa 4KFBB 4B3TJ 5AE3A 1ZH5A 2KHCA 2JRSA 4OI2A 2CPFA 3DLKB 2P6TA 4ZPBA 2NSBA 2J8AA 1N5YA 4F0HA 4ZVSB 1ZBTA 3EGNA 1S76D 1UJ5A 4CLYA 2AJ2A 3MEDA 2HHWA 3P49B 5HQLA 4O4GB 3CCTA 4N56A 4NA3A 1ROFA 3TUIC 1MW7A 4LF6F 4Q5VA 3DFEA 1RSCA 2B51A 5D0GA 3HHLC 4MKYA 3M8ZA 2WHOA 2KXFA 1RB0A 3V6DA 4O3RA 1WI8A 2YKMB 1OQ6A 2CXEA 2DR8A 1XR7A 4WU3A 3MFIA 3ZTRA 1CC7A 3MFHA 2P5VA 3PKMA 4DV4F 3KHGA 1YHQS 4C8MA 3IR6B 3FCVA 4HH1A 2RSQA 3FFIB 1O5JA 5C24B 2K3IA 2MPUA 1JLFA 3KLIB 2X1BA 5F3TA 2HNZA 1AB8A 3LP1A 1OS5A 2HK2A 5CD4H 3TAMB 2O01C 4IO9Q 3JSMB 3RR7A 1SL2A 5J2NA 1HHTP 4QR1A 2YH1A 2DGWA 4OHWA 1J5OB 4C8LA 1P8GA 1WDTA 3GFXA 2HGMA 5HAOA 3FBEA 4CYUA 2Q66A 1FFSB 2UUAF 2X51A 3ZZRA 4LFAF 2FJBB 4KO0A 4X64J 3EZOA 5KG2A 3KG1A 3PCOB 1XMOJ 4PCQA 1HQEA 2Z57B 1R27B 1VC5A 3UN3A 4PYDA 1IBLJ 2OH2A 2Q79A 3UW1A 4ECQA 4DS5A 3ITHA 8AT1B 2MQ8A 1Y10A 4ES3A 3IM9A 2Y1JA 4ECYA 5JJBA 2O1PA 1RU2A 2BJ8A 4BBYA 3EGZA 4FYDA 1R3NA 2ZNYA 2RQMA 1TKTB 3D1HA 3BKUA 5RUBA 2HGNA 4QZVB 2CPIA 4B3RJ 5E2QA 3OTOF 1C1BA 1FE0A 4M5IA 1T9WA 4K4ZA 1D9FA 5IT0A 4XTTA 4WTOB 1X5TA 3M8PB 1RGVA 3ILIA 1HYSB 2QO3A 4KE5A 2XMJA 3I6PA 1K0TA 3L9ZA 4V1Ak 4WJBA 1HD0A 4NXMF 5DDPC 4M5DA 2M52A 1F5BA 2F40A 2BV3A 2VPYB 2VPXB 4DPTA 5HSPA 1RWUA 2KG0A 2XO7A 5GAGI 2AWZA 3W8GA 4KGKA 3CCJS 4L72B 1BQMB 1WC3A 4F25A 4ZLJA 4HHHA 3IG1B 3LQVA 3FSXA 1DQ9A 2CQ0A 3V2UC 4X4SA 4OZ2A 2XM3A 3CD6S 5A8WA 2WBMA 1H0HB 2VBYA 3OFGA 5I42A 3T5LA 2LEAA 5IQ6A 2GAHC 4KR0B 1YI2S 3M8YA 1X4BA 4P7TA 3JTNA 1NK7A 2FD2A 4HT7A 3GFHA 2EFOA 2WAQD 3PVXA 1REVA 2JLFA 4PUOB 4LREA 2W9CB 3VF0B 3WX4A 2VA2A 2CQ1A 3NMAA 3D67A 1QJHA 4QYRA 1WC4A 2QA4G 4QWAA 1CJTB 1RJJA 4MIAA 1U4BA 2D3O1 4DSJA 4O44B 2R3VA 3K0JA 2UU9F 3K8VA 1AUSL 5CHCB 3GP9A 2J9DE 5HMZA 1YGYA 4DR6F 5IC4B 1NEEA 4DOZA 1NJZA 5KFJA 2HQ3A 1HHQA 3QGPA 2CWXA 2WONA 3GV7B 1B0PA 1ZPWX 2QE5A 4JI6F 2H3EB 3FBCA 4I69A 4F8RA 2O67A 5IFMA 3ELHA 3K58A 2MLYA 3FQLA 4LF9F 1SIZA 3P5BP 1QAJA 2CUYA 4DLGA 4NCAA 1SPBP 3MM7A 3PJWA 1QE1B 4NLVA 4I2QB 2DH9A 3EM1A 5A8RA 2X3GA 2NZ4A 1F3VA 1VQ5S 3CJSA 3NLCA 2DHHA 5T41A 3MI7X 1ZM4A 5HBMA 5EX3A 4LIRA 4HHUA 4NXNF 1LFPA 1TL3B 3KTQA 1HMVB 4LF7J 4IYQA 1CJVB 3OLBA 4EBCA 1H72C 1MMDA 4CLPA 1RWMB 1UZHA 4A47A 5A6PA 2YQ1A 2ZKUA 2A10A 2JX2A 3TA2A 3R5DA 2B0GA 2YNHB 2DITA 1TL7B 3QRQA 4KY3A 3U27A 3OT9A 4IRKA 1S4EA 2IDEA 2QFIA 2UUCF 2FDNA 4AE5A 3MCMA 3LH2S 3MD1A 3HVTA 3O44A 3BQ2A 2XY7A 1C1CB 4C8OA 1VIXA 3QT6A 2D3UA 2NREA 1OSDA 2BDPA 1U25A 5GADU 1SQFA 2UVRA 2NXNA 3RW6A 2A1BA 2GVZB 2OUGA 2ZOMA 2KXHA 5C7PA 1LOUA 1JLAB 3HSZA 1VQLS 4WK3A 3VV2B 1NK5A 2LKZA 2NYHA 3BGRA 4DL2A 2AW0A 1RKJA 2FIUA 5BYQA 1D8ZA 2LDYA 1IKYB 1MNEA 1QAYA 3DYAA 4ED3A 2BQRA 4N77A 1WELA 1XMQF 5F0UA 3VAFA 1X4GA 5HN0A 1YJNS 5KFGA 4ED5A 1RT6A 1NSKL 3OBIA 5F8IA 1T03A 1KVKA 3HDSA 2BQUA 3D66A 3DOLA 1WI6A 4I67A 5J1EB 4JV5J 1YBTA 3K2YA 3CSKA 2UXBF 1CG2A 3HFVA 1FERA 4Z7CA 2AV5A 2JWNA 3GCXP 4WF9Q 4PAAA 1LWFA 4K0KF 2YQ0A 2YVSA 4DL7A 1GMVA 3TZZA 1VQ7S 1VFJA 4IG0B 2XTJP 1UAWA 3RBDA 2ZE2A 3MM5B 1B4SA 2J8SA 1UEKA 1FJGJ 5FD1A 5M2UA 2OMOA 2K1RB 3OL6A 2BX6A 2VFVA 3I5AA 1Q4RA 4WXOA 3CDAA 2R7QA 2C2OB 2HS3A 2QYGA 2J0QD 4WZQA 2PIIA 2LXIA 1YBUA 3NCRA 2B56A 1YJTA 2JC0A 4DZ6A 2CPJA 3K5MA 4KV8A 3TVKA 2DJWA 2EWHA 1EQMA 3IRXB 1U1NA 4B9TA 4IKAA 1QD1A 3PR5B 2LQ5A 3OR1B 3CCES 3ZZUA 3MXHP 4RW9B 4OHVA 1MN9A 4KH1B 4JUZA 1PBUA 1RTIA 4OLOA 1S1XB 2HWHA 4CH1A 1UWAA 4W98A 3SCKE 5CH7B 3MEKA 4JV2A 4FZVA 1T05B 1JQGA 3BREA 2VFRA 2W9AA 3T1HJ 2V0NA 4P10A 4ZVEA 4DU8A 4N5SA 1IBMF 4QWCA 3IXQA 3EGWB 3DOKB 2HHVA 3QJJA 3KFWX 2IPOB 3EPIA 4YEAA 3TUPA 4J90A 2IJRA 2N4CA 2J6UA 3V6HA 3BGOP 2ZBQA 5CD4A 4OJ1A 4U8YA 3KOAA 1UZDA 3QO9B 2CADA 2YKPA 1WG4A 3O6QA 3I9V9 5DG7A 1SV5B 2IAJA 5LSLA 1U48A 1JNRB 3CULA 2U2FA 4OHZA 5A76A 3MMCA 2QSWA 4B3OB 3U1LA 5LMNF 5EN1A 3MM9B 2Z4PA 5J2QB 2BZ2A 2W2PP 4K59A 1VRUB 3KK2B 4OYAA 3HULA 1XK8A 3POTB 2V34A 4TNOA 2GCFA 2LDIA 4PZVA 3PX0A 4LRBA 1EZZB 1T0TV 4HVZA 5LT5A 2B3TB 3SSQA 3G6VA 2V67A 2W4DA 3WBZA 3OXFA 3EDQB 1HR0J 4ZDNA 3Q2TC 5HMWA 4K8RA 3TI0A 2LYVA 4DR1F 4F2RA 5FLXU 5DQHA 5KG3A 3UR0A 1UEUA 4KFBA 3QRPA 3WIUA 4Q0BA 2XZDB 2FLLA 1RT7B 2B9EA 4NA2A 3Q8SB 8RUCA 4RPFA 4RNHA 2OJ3A 4FBUA 3VHQA 4LR8A 1L3VA 1NSAA 2Z2LA 4CLKA 3ZO7A 2A3JA 4CO0A 2AIRB 3CCLS 4O4GA 1UVJA 4K5RA 3EICA 3TNVA 1L3SA 3VZIA 3H20A 1IWAA 4OX8A 2VKZG 3LGMA 1NPKA 4RR5A 4RW8B 2AZ3A 3CTRA 4NYPA 3AOCA 5BJRA 2E9RX 4ID8A 3GZ7A 1N8RT 3H42A 3MMAA 2YKMA 1RCOB 3KLFB 1YLXA 1VGYA 1AFJA 1HW9A 4L76A 3HT3A 2AYMA 4CO2A 1R0BG 4R5PA 1RT5B 1IJFB 1WKKA 3FDSA 1YJVA 4JP8A 4ECUA 1YDLA 4BC7A 1X4EA 1EKRA 4ZHRB 4OJHA 2R8HA 1FDAA 4CTAA 1RTDB 2AJ0A 1ZZNA 2CQHA 4UUXA 4BWJA 1GH8A 4BC9A 2RE1A 3PYFA 3TZXA 1YWXA 4TLQA 2R8JA 2ATCB 2YNGB 4OYIA 4WIIA 4RBTA 2V4JB 1J5OA 3TA0A 2PT0A 3MCOA 3N5BA 1V6HA 2M0GB 4U6PA 3W61A 4H4KA 2E5LF 2RRNA 4Q43A 2YPZA 4DXLA 6FDRA 2I9SA 1HQUB 2L08A 1CQMA 2CRLA 4WKRA 1IBCB 2MGZA 4C6AA 3CC4S 4TYAA 5I3PA 4A8WA 1Q81T 2FY8A 3QAUA 2XCPA 2JEJA 5SZTA 4ECSA 3CD5A 1XNRJ 1UJ4A 3I4PA 2B9XA 2MB0B 2Y1RI 4JYAJ 2BE7D 4RJVA 4M5KA 2NS1B 2VG7A 1RK8A 2XZTB 1TKTA 1YK9A 3KUGA 2ZH7A 3SDEB 1HNZF 1HWJA 5E33A 4U7UK 3PM9A 1Q7YT 3KNGA 2ZFHA 1IUJA 1HNVA 1TKXB 4USMA 1HYSA 4V19X 4RNOA 2ZJQQ 4RUBA 1I94J 2C3PA 4CO5A 2AGQA 4M95A 3G8QA 1AROP 2L9WA 4FDFA 2QRRA 1DFDA 1I51B 1CJUB 3CCQS 4OMFG 2X1FA 1NKEA 2ILYA 2MKCA 1FEEA 4HDGA 4TLRA 4NCGB 1I6JA 2OPSB 3TZWA 4RUHA 1IQZA 2W2QP 3HVRA 3D6HB 3VGVA 4JI1J 4WBFA 3R6GB 1YJ9S 1N5VA 3J7A1 3M6XA 1IKXA 2MHNA 1S77D 3H7HB 3DRPB 1L3UA 2HHUA 4XDCA 1TUWA 4NLPA 1P9QC 2CWKA 3I9ZA 1XR5A 5KT6A 1RWXB 4X4NA 4KH0B 1PYSB 3F41A 2QMWA 5B08A 4GC7A 5HMXA 2UUBJ 2DGXA 1NSPA 3PEJA 4QIWD 5EDWA 3GONA 1TZ0A 5F8LA 4PUOA 3P45B 5IT4A 2FJXA 1YJWS 1WC6A 5B0AA 2G2YA 4NMXA 1ZYQA 4L6V3 2K06A 1FESA 5CYMB 3P5TL 1WEXA 2QZ8A 3EE3A 4K4YA 4GKKJ 1QSLA 1B99A 3BSAA 4ECTA 2HEKA 4LFBF 4USTA 2V4QA 2ZM6J 3PACA 2X3DA 4F50A 1FCAA 3RBEA 1XEZA 3HKWA 4JI7J 1B0VA 5C25A 1RE1B 3PJXA 2EEYA 3JSBA 3C3LA 1FJ7A 2XMVA 3LO3A 3R5CA 2R7XA 3M1VB 5AE2A 5CYQA 4ZJQA 4IQXA 3G71S 1T11A 2RD5C 2VJVA 3DLBA 4DFMA 4DV0J 2C28A 3UDVA 5KFRA 1GNKA 3NL0A 2IVYA 3GV8B 1X4FA 5LJ3Y 3HKZD 2VB6A 2MKYA 1DTQB 2OFGX 3U02A 4OIXA 3RW7A 2OMLA 2YWKA 2Z30B 1SL1A 2AGOA 2DHXA 2KRBA 2FZGB 1WD6A 2W2NP 3UVJB 4EO6A 1K0VA 2R7OA 1HBNB 2A18A 4DX5A 1S6PB 4Z2XA 3C16A 3IBWA 1Q95G 3T1YF 2YNHA 3BF4A 3MPWA 3R27A 4YY3F 3QMQA 3TZYA 1PJ5A 4MTPA 5CABA 1X4CA 4JI4J 1N32F 4USJC 4NRTA 4KPYA 3WZ0A 1RADB 1N88A 1C1CA 2O66A 3I0SA 2JEFA 1PSDA 1NZAA 2DCLA 5CXTA 4ZA1A 1GEHA 3M6WA 3Q22A 2N3OA 3VVUA 2WSEC 3DMJA 5GAGU 1DJ0A 1BQXA 3HHNB 3NOGA 3L09A 3MURP 5IV4A 2QMXA 1FKOA 3RBXA 3UCZP 3C15A 4R0EA 5CCLA 2JZ5A 4CLLA 4F67A 2FVSA 4CRJA 2WZ1A 1ZAXA 1A9NB 4F3OA 3J80Y 4ZITA 1KTVA 1TKZB 5EUHA 3AD8C 4DL4A 1S0OA 2GVDB 1HPZB 2MTLA 3UE2A 2YNFB 3KK3A 5AXLA 2ZUAA 5IS2A 4DR5J 3BBBA 3Q83A 4NL5A 4IFVB 2XMMA 3KLEA 1C0TA 4YB7A 1X5SA 2H4YB 1X9WA 2E5HA 3FZBA 4DR7F 5THWA 4MYTA 3G6YA 2PE8A 2B4UA 1YRTA 1XWLA 1F3FA 3PY8A 3T9NA 1T8EA 2GGPA 2OTLS 2XMWA 3B8HA 3K5NA 2XI3A 4JI3F 1U24A 4JI8F 3M6VA 4HL9A 4ELTA 1GX5A 4XPEA 3SZ2A 1HD1A 1S6QB 2HRUA 2JFKA 5KFCA 2CZVC 1SI9A 2NXJA 2RNEA 4ZLLA 1R0AB 4V19J 2CQPA 5KFMA 2IVMA 4ZKAA 2CPDA 4PKDB 4EWTA 3QZ7A 4YMEA 3GU0A 3ISZA 1UJ6A 2CQCA 4IH5A 5FJ4A 4OV6A 1RAGB 5LXYA 2OPQB 2P2CB 4OX9J 5LSRA 3RAQA 2DISA 2BYCA 2K7KA 3RB6A 3FEXB 3ISND 3BB5A 1UW9A 2MDAA 4OI1A 3BPDA 4DR2J 1TKDA 2A6MA 1CS4B 1KSPA 3GB0A 1N5TA 2KT3A 3TEHB 1VBZA 2YPYA 4DFKA 3D0IE 2RUSA 4RBUA 4J9LA 2HBRB 3RB3A 4CQ1A 2VKRA 2QEXS 3PW7A 1IKWB 3NBPB 3LWMA 4C0OC 4YR0A 1S1UA 1ACMB 3C14B 1KLNA 2R2RA 4X65J 1IJEB 4MMOA 2GS8A 4X4PA 4ECRA 4DFPA 5M2RA 1NK6A 4CT9A 3PFEA 1S1WB 2EC2A 5BXIA 2CVIA 3DM2B 3T3FA 4B3SJ 1NSQA 2VPZB 3CXCR 2W2MP 4CNYA 2BJEA 4LVNP 3DOKA 2UUTA 3AFGA 5E7OB 1FTRA 1JJ4A 1KEKA 3M05A 1M5SA 1LXNA 2VQEJ 5HANA 5J2MB 3DXSX 2QLXA 2V9WA 2VU5A 4RW6B 1KLMB 2QX0A 4PR6A 3I55S 2QA1A 4IG3B 1UPMB 3QGIA 1BWVA 2VG5A 4ZVGA 2PI4A 2AJ1A 3MECB 1PC4A 4G65A 2V8HA 3BZQA 4PG6A 1JKHB 4ZVHA 1HNWF 2J9EA 1XNQJ 3RAMA 3OW2R 1LWCB 4GRSA 2ZOGA 2E1CA 2HW3A 1PBAA 3UWTA 1DTTB 2EK1A 1VHFA 4BLGA 2KKHA 1RT3B 5LOQA 2C3MA 3PR4A 2GV1A 5DZ7A 5J2QA 1K44A 1U6ZA 2M4MA 2NLWA 4AD6A 4MFBA 3TJAA 4DV5F 4LSLA 3K5OA 5KG1A 1U7LA 2GO9A 3R7NB 2XLIA 5LL6d 1GXTA 4USUA 3D0HE 5MAOA 1T94A 1VHIA 3D5MA 1PIEA 1SH0A 1LV5A 4NLQA 1OIAA 5DDQC 1UVNA 4WFBQ 3UD3P 3QWPA 1FXLA 1NH8A 3A8EA 4DQRA 5D4PA 5KG0A 2LQBA 3KLGA 5HVHA 1JLQB 1H6KX 3K5LA 3RJMB 5AJ3F 1U2RA 4Q8EA 1E6YA 4FXWA 1K47A 3KJFB 1NM2A 3HPOA 1X4DA 1JLCB 1RXOB 1EQ0A 1NU4A 2MJUA 1FRKA 2AYBA 4LFCJ 1FRHA 3HCXA 1WEZA 1EETB 4X84A 5C42A 3M9OB 3QZ8A 3BYRA 3DI6B 4PPDA 2ACMA 3AD9C 2VONA 3CW2C 3PRBA 2CPZA 1S10A 5KT3A 2MQQA 3MAAB 4DZDA 5JVGQ 2RH3A 2QA4S 1RT1A 4H4OA 3VALA 1TL1B 3GWCA 3QT7A 4X66J 4USKA 4RW8A 3KLHB 4E0DA 5IT9Y 3CJKA 4DV3J 2ZUGA 4JV0A 3DDNA 3CC2S 4NLGA 4ILLA 2DNKA 1F2HA 4W90B 2A2CA 1RBLA 2GJ2A 5CQGA 2Y8YA 2FC8A 1UWBA 3UDLA 1U26A 1NDLA 4DU7A 4EZ6A 2EBEA 3DDIA 1RQ0A 1X4AA 4TY8B 2OEKA 5L1KA 1PILA 3QWUA 2XGPA 2CPEA 2AHOB 3FKBA 3R2DJ 3D2WA 2E5IA 2YNGA 4CM0A 3KG0A 4QU6A 1OYEA 1CULA 3IWXA 4NLDA 4NI2B 2Q3PA 3D6TB 2DH8A 2H9ZA 4ZMMA 2HQDA 1T9TA 2CG4A 4GVBB 4B9VA 2L3MA 1EIYB 4ED2A 5HP1B 1HBMB 4F02A 2FLPA 2BA9A 4KKOB 4HACA 4A8MP 1O0PA 1C0UA 3N6MA 4DCPB 3MPVA 4UZBA 4WIQA 2KYXA 3V4IA 5GMEA 4ED0A 2DNLA 2WB4A 4QR0A 3Q8QB 1FDNA 2KRRA 1S9GB 5HJYA 4MK9A 1ZETA 3HHLB 1ZM2A 3M2VA 2M88A 2ASLA 3ZC4A 4UOFA 2CPXA 3P96A 3KK1B 2VASA 5B7WA 2ZBIA 3A4TA 2PGCA 1KR4A 1RT4A 2DYAA 5J2PB 5K14A 1PJ7A 2AZ1A 1WC5A 2HNYB 3CVKA 2F8EX 4LF5J 3OTBA 1F1BB 1IR0A 2GQ2A 3H5XA 4FKYA 2I8EA 4K4XA 4ICLB 1S1TA 3NXZA 1N6QB 2RU3A 1N52B 1NK9A 4H4MB 2BE2A 1VQMS 2GHPA 1Q8IA 4NCGA 1BXNA 1C4AA 3D3CJ 3J81U 2DB1A 5G4DA 2MJNA 2OPSA 2V2QA 2FC9A 2EFPA 4LR7A 4ZVRB 3O3LA 1H7WA 4BDPA 3BGUA 3TA1A 1WACA 1HW8A 3ICLA 3M8WA 3W2WB 3EWGA 4DV7J 2MKHA 4F36A 4I2PA 1R8AA 1M5HA 1JLGA 5EGYA 4X4TA 4Z7YA 3AA9A 3G8SA 5D0RA 1AXQA 2YKNA 3T6JA 3M32B 4NYOA 2GC8A 1S6OA 1HWLA 4NX9A 3CCVS 2ZITA 4ZN3A 5KG6A 3RB4A 1S1VB 2ZJRQ 3KJNB 2OPRB 3IWLA 1V5IB 2HLTA 4ALZA 2CQ4A 1Y3KA 1S57A 3EUNA 2YX7A 4XO0A 2WVCA 1EP4B 1QSYA 5ITHA 2QG9B 4EZ9A 3IBCB 1FTCA 2C2MB 3CO0P 2LXFA 5KG5A 5ETQA 3R97A 1FVQA 1QLNA 1H2UX 3C66A 3C19A 1DY3A 3SQGB 5I3UB 3VGTA 5F9LA 3MPYA 4NCBA 1RAOA 2K8GA 2L41A 1RZMA 2ROGA 3OSNA 2D41A 2HRYA 2KJWA 2PN6A 2ZC3A 5KFLA 1SBRA 3N0VA 2BJ1A 3FEZA 4OI6A 3GG0A 1D8YA 1R8BA 4RZRA 3M8QA 1UVIA 4OYXA 1MROB 1NZ8A 2EVZA 4KYZA 3K7RA 2OELA 3PX6A 3T5KA 1N36F 2F4FA 4JI5F 3UVJA 1WWHA 1MSWD 3PTWA 1WDDA 4NASA 3TAPA 4M5JA 4I6AA 4DV6F 2QA2A 1Y5NB 1SUQB 2NXUA 2F4VJ 1F9HA 4WYWA 3NGRA 2E1AA 5LXRA 2ZBRA 3S1TA 4PWUA 1RHUB 2BRLA 3UR3C 2RHSB 3SBMA 2JC1A 5JMNA 2QLBB 5D78A 3MZIA 3KLVA 1NBEB 1FRXA 1JLEA 3DLEB 3FZ2A 3IAM9 2PMZD 3A8JA 5K8OA 3I5CA 3A12A 2I5JB 2W01A 1MWYA 2ZH9A 3D28A 1UP1A 4DPOA 2N82B 5LMUJ 1PYTA 3G8TA 1TK0A 3GR1A 1Q0NA 4CDIA 4Y28C 2G4BA 3OFEA 1RLDA 3DRRB 1RHKB 3CC7S 3PFOA 2G1HA 4R8UB 1ELOA 2EG1A 3OUYB 3TRGA 1IR2A 1EJ7L 4FF4A 2HRTA 3GIJA 4B9LA 1VR6A 3B6BA 2M70A 2G13A 4Q2LA 1CEZA 1REGX 4DR4J 3VAMA 4X62F 4LRCA 5HROA 1HPZA 3QAEA 1U02A 1X31C 2H4WB 2PFDA 4K4SA 3VR1A 2CYYA 4IFVA 1Z4UA 3G86A 1URRA 2B9YA 3RU0A 2MMYA 2HHSA 2OLWA 4DCOB 3DU5A 3W5YA 2ZH3A 2GMJA 1AZSB 1ZZFA 2B7CB 4WZMA 2KG1A 1RAEB 2QIFA 1WHXA 3Q8RB 2ZEJA 2XQCA 4F3QA 5A0YA 1NK0A 2DO0A 3ZZTA 2IM3A 1DHMA 4ZOSA 4Y3CA 2W7OA 5FIIA 2F65A 1Q78A 3E01A 3RG6A 2I38A 3H2LA 1X7VA 1FWPA 1QUPA 3KHHA 2JHEA 4I6YA 3Q0AA 2CJAA 2XY5A 4F26A 3FQKA 4L3NA 2JFDA 2XMTA 1HBUA 2KHDA 1UFWA 1LWEB 2CIMA 5D6GA 3DGVA 4ED7A 3PDNA 1RABB 2HFNA 2HK3A 4KHMA 2LU1A 3B54A 4Q44A 3MF5A 1JJCB 5E3RA 5A2QU 1BY9A 2GAGC 4PG7A 3W66A 3VQTA 1SJ3P 4DJBA 5ETSA 1IKWA 1TAUA 4DPUA 3NBPA 3THTA 1X5PA 3PKYA 3MUVP 2I0XA 2VL1A 4P2MA 1Y7PA 1VJWA 3DHWC 2QGFB 2F5GA 5ETVA 5LM7E 1XBWA 5L1LA 2IC3A 1BQNB 4BS2A 2CZ9A 4WU2A 4MK7A 4Y2MA 2QLWA 4HI2A 2XZWA 2YBVA 3FK4A 2AJFE 4ANDA 4DR3J 3IRWP 1NJYA 2PC6A 2BE9B 3CCSS 3SV4A 1FK9B 1OO0B 2GJFA 1KHWA 1KHVA 5D3GA 2R7UA 1ZS6A 3QQCD 2MQMA 4EUVA 5HLFB 3Q89A 4ILRA 5JVHQ 3MECA 3W8PA 4QWBA 1WF2A 4N7TA 3DLJA 1UVMA 4P72A 4KPCA 2GMLA 1LWCA 2U1AA 4KJIA 4CLWA 4YS2A 1DTTA 1TL4A 4P7VA 4RLEA 2C2ZB 3ZZYA 1Y3JA 2FTRA 2VQFF 3MM8B 3VWSA 1OQ3A 4IQMA 1B0TA 2E1PA 3E51A 2Z58B 1KVIA 2QN6B 3TR5A 2W4PA 2F9JA 4ZP8A 1H74A 2AQ4A 1MU2A 4LF8J 1HNIB 2HWTA 5IM0B 2QL9B 3Q24A 4QWDA 1VC6A 3AT1B 1PCAA 1WJ9A 2GA7A 3MAQA 4AT1B 3AQOA 2HGLA 1PO6A 1KS2A 2B7BB 5ETMA 3I56S 2BJ9A 2BJDA 1SC1B 4LBHA 1FNOA 4YDDB 2N3LA 3R6LB 4QYZJ 4QW8A 3W9JA 1Q86T 2CJXB 4LF4F 3QGGA 3K57A 1U0SA 3JYTA 1JXVA 1WEYA 2BEFA 4OHXA 4NRUA 1JLCA 1YJUA 1NJIT 2HQGA 4J9QA 4JB8B 5L9XA 3CJ0A 1B7FA 4DV1F 1EETA 3D1QA 1HNXF 4RKUC 1S0NA 2HFZA 3PYEA 2D3ZA 2MHEA 5KOXA 2L9NA 4USWA 2JJ4D 3KHRA 3JAMY 1TMMA 3MAAA 2JVOA 1CVJA 4NLOA 2MLZA 4UT4A 5HJXA 5F8JA 2KVQE 1FA0A 4B9NA 1RHQB 1WHYA 3GLJA 5D0EA 4F3MA 2XS5A 2YX4A 4JI0F 4EK2A 1ZA2B 2IRUA 4FYVB 4NLUA 1WF0A 1HI1A 4ANEA 3DRSB 3HD1A 1ZAWA 3T9ZA 2ZJPQ 4Y2AA 2Z0GA 2XNRA 2HLUA 1WC0A 3MMBB 3PYDA 2EFQA 1NKBA 2H5IB 3FBBA 4LQ9A 5KFBA 3D4JA 2DPJA 1WSVA 3JS9A 1HWKA 4PG5A 3FRYA 4LSNB 2VFSA 1IM4A 2IIHA 4DUZJ 2YQ3A 4WKYA 2XMKA 3A8KA 4EYHB 4A8FA 1RHJB 3OXLA 3GV5B 1KQSR 2HKEA 4IDKB 4PYAA 5F3ZA 3G6ES 5H9FJ 5KFYA 1U8WA 3PW2A 4J91A 1KP6A 2HWIA 1SVDA 2B43A 3K5PA 3W62A 2ZZMA 2D1CA 3GYXB 4ZVQB 3TJ9A 1LXJA 1N5SA 2PMWA 4GVBA 2VD3A 3GIIA 4HI1A 3BR8A 2XS2A 3CCZA 3CNQP 2UXDF 2R7RA 2FZCB 2AD9A 2HBQB 2PI5A 4H54A 1ZOTA 5KFVA 4O3PA 5KT5A 1P9YA 4Y6IA 2DHSA 3H98A 1PAEX 4GKJF 1MG7A 2B5JB 1KC8T 2F1FA 4MKBA 2ZD1B 3MEEA 3CIMA 1B3TA 2G2ZA 4BHQA 3Q2SC 4L73A 3MR5A 2N7CA 4TU8A 1RP5A 3KJVB 3CD7A 3CJ3A 1IBKF 2V94A 4JI2F 1FHTA 3L4BC 3BV8A 4YHHJ 3E3XA 3LP0B 1F9FA 1GMWA 4C3MA 4TKTA 2ROPA 2RT3A 3PHEA 4P75A 5A8KB 3E2EA 2NR0A 3HHLA 1Z2LA 1C2PA 3DC2A 1D9AA 3O2IA 2Y1IA 1E6VA 3D7SB 3NOCA 4EFAC 2VG6A 4F2SA 2W7AA 1DURA 1FX2A 1N34J 2UXCF 1KOOA 2HIYA 3KUHA 3VAKA 3SCLE 3BO3A 2B4PA 1DAXA 1XERA 3EGVA 4LVOP 3PZPA 7FDRA 3GJQB 5BR8J 1S4FA 2UVUA 3IAS9 1X9SA 2WOMB 3GSIA 4E8UA 4PXDA 2IM0A 4XDDA 2MXYA 3KXDA 2C1EB 3D54A 4NLTA 4R25A 3AH6A 3X1LB 2KB2A 2H5EA 4P74A 4Y0FA 1YRUA 1N6QA 2HIQA 3LPEA 3CJ2A 3QIPB 1GQEA 4F4WA 5GAEI 3BN4A 2GFFA 1J5EJ 1RWPB 2RKIB 3RZAA 4IH6A 2XLKA 3CJTA 3RUBL 4RW7B 4AQYF 4O0NA 4DQSA 5H9EK 1H98A 3LALA 4A8YA 3FCHA 3M4XA 1WHWA 5FDLB 1VQYA 1UW4A 5E5NA 1XC9A 3OXGA 3W2WA 4TQRA 2VDIA 5ETLA 1ZA1B 4DSLA 1L3KA 2B6AB 3CJ5A 3RBZA 2RMLA 1NDPA 5KFSA 4DUYJ 3IS9B 4OL8A 4G1QB 5KAKA 3M7VA 4L74A 4PXCA 3OV7A 3IO1A 5D4OA 1MLAA 4MKAA 3L7PA 3NCQA 2IHR1 1RCXB 1JNZB 5T7LA 6FD1A 3MOJB 4FP9A 1QAIA 3GYNA 1BLUA 3W65A 5H1SV 1X0PA 2G0CA 1NPPA 3R8YA 1O51A 4B3MF 1S1VA 1NDKA 3SEOA 1N5YB 2Y8WA 3CO9A 5AT1B 2AKWB 4QCLA 1N33F 1QY7A 1Y4ZB 3JTPA 4KHRA 4Y2KA 3MEDB 5G0RA 2HBYB 1WF1A 1NAQA 5GAHI 2YNIA 3TARA 1U1MA 3G82A 2WW4A 1FKAF 2FPHX 4CLUA 1MMNA 3C6UA 1CPZA 2CQBA 2HURA 4K50A 2XHWA 4RBVA 2RS2A 2EFNA 2HHHF 3VVTA 1P1LA 5L39A 4NLRA 5I3UA 1IKVB 1Z2ZA 4DSKA 4TU9A 5KFOA 4CO1A 1R7IA 1XN9A 3NGKA 2MQLA 1KNZA 3GG1A 4LT6A 1LNQA 1KQFB 1FFWB 1S9FA 3R5GA 1R43A 2APOA 3EVOA 3KWMA 2HVZA 4XIUA 2OPPA 2XI2A 3LWLA 2YH0A 1FXDA 3R7BB 2AP6A 2LMIA 3TVZA 1MROA 2ASDA 2FB0A 1JLFB 3I32A 3ZFVA 5L9NA 4NEZA 1TTHB 4B3TF 2HNZB 2LECA 2GNKA 4ID5A 1LKZA 1G6BA 3LGNA 1SUQA 5J2NB 2ZH4A 3HVWA 1RTJB 4CZCA 4OV1A 4QPXA 5DJBA 3GMGA 1FDBA 4CYUB 4E2FB 4GC6A 3O5TB 1A6LA 4KO0B 1DZ5A 1HQEB 9RUBA 5IWAJ 1LW2A 4K4TA 2E9ZA 1Y0HA 2ZH6A 4ED1A 1X9MA 2BM1A 1RU1A 2I5JA 5KG7A 3RGIA 4DWIA 3UN2A 1D09B 1H2TZ 4IFYA 5E0OA 1NH7A 3OUYA 2H1YA 3BR9A 2DNRA 2BM0A 4TXSA 1FT8A 3N4WA 1NJXA 2JVRA 3KG4A 3F0NA 2UUWA 3ZZZA 3MWBA 3NRBA 2OGUA 5HL7Q 3QLHB 3OFFA 4A8OA 3R9LA 4FBTA 1VC0A 3BS9A 2BR0A 5KFNA 3CUNA 1NKCA 2HHPA 4R0JA 1S0MA 3T19A 5AXKA 4ETZA 2AU0A 4EMDA 1KVJA 2PFFB 4OYMA 3UO0A 3MR2A 1Q16B 3SV3A 4X64F 1GX6A 1LW0B 2VPWB 2BKNA 2J0WA 1CJKB 1XMOF 3RR8A 2Y3YA 1VQSA 5DG9A 3BDPA 1WG1A 1IBLF 2XNQA 2OEMA 4DUTA 3BKTA 3H5UA 3NGTA 4M5HA 1TVRA 2IM2A 3NNAA 1VIOA 3GJTB 3M2UB 3ZTPA 4WFAQ 3GIMA 1YZ7A 1A7GE 3J7AN 5A8WB 2KTQA 1RUSA 2QL7B 5I42B 3GJSB 3WC0A 2D7SA 4S0MA 3LP2A 1SQGA 1SKWA 3N28A 1NLKL 1V9OA 4B3RF 5F41A 1S7HA 1HI8A 2IRYA 4YB6A 1U0HB 2MY7A 3I4HX 3W9IA 3IR7B 4MJKA 1NK4A 2R2TA 4USVA 4ECVA 1U1RA 4WWSA 5M2PA 3Q8VA 2DEIA 4KGVB 4FS2A 2LA6A 2R7VA 2M8DB 3TW0A 4GO7X 2W9BB 1GT8A 4ENOA 1TAQA 3OR2B 3OL8A 1YSJA 1DLOA 3TP2A 2GX8A 3UDEA 2WONB 1RWKB 1KRPA 3AJDA 3HZGA 1JWWA 4U67Q 1FWKA 1VYAA 2MZRA 1T9YA 2J7WA 2VH7A 4WFNQ 2JLEA 3R1HA 2WVFA 4KHPJ 2CAJA 4DSFA 3MM7B 2DKOB 4ETXA 2L48A 4E98A 2OHDA 2BJ7A 5A8RB 3P6YC 1VRTB 4A48A 2B9WA 5L1IA 1NPRA 5HBMB 2H5JB 1S72S 4FF3A 2YWWA 2MEWA 1TV6A 1M1GA 5SUHA 4PG8A 2R8IA 1HA1A 3KMSA 2DXDA 2BANB 1OYDA 4QIGA 4KGZB 4QIEA 3WQPA 1EHWA 2M3DA 2Z2ZA 1EARA 3C6TA 2YWHA 4W4MA 1G7CB 4CLFA 3DGPA 3VAHA 2MZJA 2P8IA 4KQZA 1IVZA 2RRBA 2Z8QA 3ADAC 3CWJA 1JB0C 4YDXA 1W2IA 5KT7A 3R1LA 1AT1B 3ENWA 1Y5LB 1HNIA 3UCGA 3H8YA 2A2DA 1VK8A 4ZIWA 1OY6A 3ISNC 4ZCMA 2E5JA 1Y9OA 1GFWB 3N5FA 3ET6A 4M5NA 4B9UA 3AB4B 1OWXA 1UTAA 3DOMB 3BGRB 4QIFA 4IOBA 2W24A 2DD8S 4AL6A 3FC9A 3DYAB 5ETPA 1ICEB 3SFUA 2ZHBA 3CE8A 3IMQJ 2MSTA 3CJ8A 1JLBA 4LF7F 4HR2A 3HF5A 1VQPS 3BH7B 4C98A 4J7CA 2VA3A 1S9EB 2MKJA 1RT6B 4WE1A 1T03B 2AYGA 4PWDA 4B9MA 2V63A 2BACA 3FJ2A 3EDRB 1K1QA 4ZJLA 3NGSA 2MKIA 1WHVA 2AX1A 3RYLA 3IBFB 1J2VA 4U8VA 3DKDA 4Q2MA 4LF6J 3ETOA 2GZOA 2LFVA 1UCNA 4LF2A 3RTVA 4YFUA 1R0CB 2CQ3A 2ZE2B 4HT5A 3TAQA 3A1YG 2CJBA 3D68A 4OZJA 3SSSA 5B0BA 1YITS 5LSOA 3AJ2A 1N48A 2DNOA 1OY9A 5BYRA 4ELUA 2UXCJ 2DK2A 4FXVA 3QPIA 1HWIA 4LBIA 4DG1A 4DV4J 3H5YA 4LSNA 2ZBCA 3HFZB 4FS1A 3V6JA 3VZHA 1R8CA 2IA0A 3AOAA 1S12A 4IDKA 2FUG9 4QW9A 4P71A 4ZS6A 1UFKA 1C4CA 2K2PA 3DLKA 4U9RA 3W1YC 2ZNZA 4WFZA 2KDOA 4KV8B 4WTYA 2KXNB 3SIPB 3H2UB 3CDBA 2HAFA 4JV5F 4P6QA 2DGVA 2UUAJ 4QPTA 4LFAJ 2ZD1A 3BSOA 4DSEA 1N0UA 1NUEA 1V5VA 1T3OA 2LQJA 4F4XA 3SCIE 2KU7A 4NMLA 3PIOQ 3IR5B 4UOCA 3R5BA 3LP0A 1SC3B 5E3PA 2J5AA 3MUTP 4ERDA 1RAFB 1WOPA 4LRFA 1FJGF 2DEJA 3CF5Q 3NG8A 4DMZA 4OYWA 4CCHA 3LOUA 3DRYA 1TUVA 4NWBA 3FRZA 1H2VZ 1OY8A 2MKKA 3ZNJ1 1T7PA 3OTOJ 4RU2A 2R7SA 1LQ9A 5D77A 3FFIA 5C24A 4RNFA 1SC6A 2WOMA 2HSEB 4K5SA 2V2ZA 3KLIA 4N8NA 4M63A 3UI3A 3GIRA 1VCTA 2D74B 3NS5A 4WFXA 3TAMA 4F4YA 2IAJB 1YZ6A 1M5VC 3JSMA 2GHVC 4NXMJ 2H65B 3QIPA 2V2KA 2DRAA 1NO8A 2DY9A 4DDFA 3H4DA 2V50A 1Q8KA 5GVQA 1YJ7A 2VJUA 5E3CA 2P9EA 3NGDA 4QR2A 3JXOA 3SXLA 5IC6B 5FDLA 3H40A 3BJYA 4PQUB 1UA1A 2FLNA 1UEVA 2EG2A 5DS7A 2PEHA 4CLTA 2B6AA 1I1GA 3LGHA 1S59A 1FKPB 5C2CA 4HH0A 2OSQA 3T1HF 4G1QA 4I0WA 4C8KA 4DF4A 2DGUA 5DZ6A 1T02A 2H51B 4URGA 4HLBA 2ROEA 1G1XA 4Q0BB 3C46A 5LJ5Y 3NMRA 1UA0A 1UMJA 4DHVA 3OD2A 1M5PC 2OP5A 3M8PA 3OTEA 2GQCA 2Q1LA 2O5DA 3GCWP 1KFDA 4KBIA 3GIKA 7AT1B 2RAQA 1UETA 2UU9J 3TWZA 2V2VA 1Z1ZA 1U8SA 1PJ6A 2DGTA 4EBEA 4UY8T 2RQCA 4DR6J 3OLAA 1K73T 2AJ4A 2YWGA 2J9CA 2FHJA 1H73A 3VCDA 1GXLA 4JI6J 2CKWA 1N5QA 5EHHA 1VLYA 1BQMA 3MMAB 1IKVA 2CPHA 2A0FB 4UTGA 1U1KA 3IG1A 4LF9J 3AJ1A 4MIBA 5H9EJ 2W25A 4KC5A 2J6TA 2BXJA 4OHYA 2MLXA 3OHAA 4D3HA 3NWRA 1URNA 1HR0F 1FNXH 3S8SA 4R5PB 3ILLA 1RYRA 4OZ0A 4EEYA 3MR7A 1L3TA 1V3ZA 4PEOA 4OJGA 4CTAB 5IV3A 3Q8YA 3JQMA 2CFXA 4NXNJ 5ADZA 2IDLA 2W9CA 1G3OA 2HMIB 3T5JA 3HHEA 1U1LA 1XIQA 3CB4A 2FHOB 2V69A 1CJTA 5D4LA 4IO1A 1RTJA 4M8LA 1U6BA 4J9SA 1Y00A 4O44A 2WSFC 3PNIA 4X2BA 1Q7LB 5KFFA 3J7Z5 5DGAA 4U7UD 4ZP6A 2MGZB 2DIVA 1NJWA 2UUCJ 3CJRA 1S5ZA 2QJ3A 3PW0A 2LQ8A 2JEIA 2XB2D 3QFWA 1XMBA 3SI8A 4Y2CA 3TEGA 5B0DA 5T14A 2ATLA 3FCWA 4TVAB 2HVEA 2VG7B 4J37A 2V8PA 5GAEU 2VICA 4NZ6A 1KTQA 3J80U 1W2BR 2YTCA 4DBQA 2PA3A 4L75A 4I7FB 4ZPVR 2CJKA 3MDFA 3SMZA 1QE1A 1VQOS 4I2QA 1JMTA 4Q8FA 3BPSP 4EBDA 3MAHA 1HNVB 4HYKA 3QLHA 3L3CA 1TL3A 1XMQJ 1HMVA 1RAHB 1CJVA 5CCMA 1AUDA 1R6YA 4TY9A 1Q1KA 4DL5A 3FVYA 2DTJA 2Q6CA 3NY0A 5JXSA 2WSCC 1VLOA 4Q45A 2OIHA 2UXBJ 1JXEA 2VC0A 1LW0A 3GR0A 1TL7A 1CJKA 9ATCB 4K0KJ 4AUKA 3DLGB 3I0RB 3M2RB 2DGOA 2LU2A 2XEXA 2HAIA 1M1KT 5GAHU 1XNRF 1IKXB 3M2UA 2D3OR 5F8MA 2ZDOA 4JYAF 4ZN1A 3FMWA 5A6WA 2KT2A 2BRKA 3KUEA 2HG4A 1HL6A 1I5OB 2GVZA 2C3OA 2CNLB 1JLAA 2VBXA 4FYYB 3HD2A 3WC2A 2ALZA 1U0HA 3VGSA 3EPGA 4FYWB 2BMBA 1UVKA 2X1GA 1APSA 2YY3A 4P2XA 1IKYA 2E1RA 2Z56B 2ZH8A 1S48A 1RISA 3X3UA 1I94F 3JQKA 2NZCA 2UVVA 1IN0A 2W9BA 2KFYA 2EKYA 3MCSA 1SJFA 3OR2A 4FVMA 2DNHA 5E41A 4QU7A 2MYFA 5EX0A 1HFEL 2VDHA 5L38A 5J1EA 2BW2A 4LJMA 1GTHA 2RDDA 3N01A 2HFSA 3Q8UA 3U1MA 2UP1A 2HVHA 4G1IA 2HFVA 3DLHA 1FJEB 2XYPB 4C3LA 2ZKTA 1FD2A 5C25B 2CQGA 5DRKA 2DY1A 4IG0A 4C2MA 5C2GA 2AMCB 4C0BA 2RQ4A 4JI1F 3MM5A 3ZZOA 4JV1A 5CYQB 1Q8LA 4IRDA 4K4VA 2W8LA 1IBMJ 1CSJA 3HVAA 2K1RA 2KM8B 2NCKL 1VRTA 4UZCA 1YQHA 4OZLA 3OJUA 2LEBA 2UUBF 3D1OA 4HHJA 4KSEB 1FF2A 3OPKA 1T9XA 2DNMA 3U7JA 3UQSA 1YIJS 3NS7B 4RWWA 2BUNA 2BANA 4NZ0A 2R2SA 3G6XA 4YN3B 3CD0A 4MAKA 1HARA 4GKKF 3C16B 4ZPDA 4BWMA 3UPFA 3IRXA 4OYBA 2C3UA 3MTJA 3EYZA 2CDQA 5LMNJ 1YKWA 3OR1A 3DU6A 1VISA 3BGFA 2IA6A 2ZM6F 1F6TA 4FKXA 3TYTA 2PMHA 4RW9A 4M5MA 4DX7A 2IMWP 4PABA 3THVA 5BYSA 4JI7F 3I0SB 3UFCX 1S1XA 4EO8A 4ZVOB 1R6VA 2BQ3A 4QYZK 4EGLA 1VBKA 2JEGA 3B78A 2ASYA 3HJFA 1T05A 3DMJB 2IMOA 2F9DA 3CDEA 1ZTTA 2QLJB 5AXNA 1AFIA 4Y34A 1BUXA 4DV0F 1FKOB 4DR1J 4C97A 3DOMA 2V4RA 3C15B 3MMJA 2PD1A 2FJDB 3HSGA 3OL7A 4N76A 5K8MA 4DF8A 1HKAA 5EWFA 4ILMA 1QTNB 4M1KA 2I2YA 4I56A 3S6EA 1R8HA 1DQAA 1B70B 2XG8A 1X60A 2XS7A 2BJ3A 3HJVA 3CMQA 3QO9A 4O3SA 1S9EA 3DNCA 4U95A 3KK3B 2LVWA 5IXUA 3UN5A 5L8RC 3WDOA 1SV5A 4O3QA 3RAXA 5HVGA 3KLEB 1C0TB 4YB5A 5IT9U 1YTYA 4OI0A 4FN5A 4B3OA 4QBUA 1T95A 1T3NA 2RJZA 5CZXA 3LF0A 3MM9A 5C5JA 2J0SD 4JI4F 4ZVUB 2E7VA 2R7WA 5AE1A 1VRUA 1OPZA 2GGPB 3KK2A 3MR6A 2HFOA 4K4UA 3B82A 3POTA 1D1UA 1SQEA 5KFKA 4PRFA 2FYXA 2G1DA 1N4LA 4ZCLA 4P73A 1HWUA 4C8ZA 1YVFA 1HIYA 1FXRA 4YOEA 4F04B 4OYZA 1RAIB 2LXUA 1R31A 4M5LA 2F8MA 1YJRA 2ALYB 2DNPA 5H9FK 3BM7A 1HQ2A 3D6MB 5E3AA 4M5GA 2BOPA 3G9CA 2DXFA 2YKOA 1RWNB 1RT7A 2KZMA 3GTYX 1VDHA 1TK8A 3SFGA 4O0IA 3IP0A 1NMEB 2D69A 2AGPA 4IOAQ 4DR5F 4KIAA 3WHIA 1WOOA 5KFIA 2WRMA 3NS6A 3S7RA 2HVDA 2NPIA 4G6VB 1DRZA 1KN6A 5JUMA 3OQ2A 3T41A 4KT0C 3ZNUA 2E5LJ 2BW7A 3O1LA 4YQWA 1S1UB 1RWWB 2SXLA 3ZTOA 4UY85 2VC1A 3TANA 2RQKA 2N7YA 2KT5A 3DHXA 2KVIA 4ER8A 1X5OA 2IYIA 3NP5A 4DL6A 3KLFA 2W7PA 4IUFA 5DDRC 1U09A 3P3DA 3GE9A 1HNZJ 4C11B 1RT5A 5HK4A 4YP3A 4ZHRA 1RTDA 4WP9A 4CO4A 3F56A 2VG5B 4OX9F 5K5MA 2I6WA 2NSCA 2L9DA 2KJVA 3W64A 3EX7B 2CA9A 5ETNA 5L46A 4A8KA 4ZCIA 3TX8A 1NB2A 4O23A 4DR2F 2VHGA 5HMYA 1IR1A 2GQQA 1U6FA 3MOZA 2RDIA 3QJPA 2JDJA 2V4JA 5DQGA 5J1PA 2WVDA 2VIHA 3AOBA 1F9EB 2FGOA 3QATA 2KO1A 4MFBB 2EPIA 3CJ4A 4LSLB 4O4RA 2ILZA 1HQUA 4L3KA 3K59A 4X65F 3T5HA 2VFTA 4PQUA 2Q43A 2DRBA 1J27A 3LW5C 3I87A 4OZ5A 3QNWB 5KFQA 2DGQA 3TVYA 1EX8A 2WBRA 1FKPA 4QJVA 3BH6B 3D0GE 1S99A 4ZCKA 2ZH1A 1RTHB 4UW2A 3NWGA 1CLFA 4B3SF 4OQJA 1U47A 1I3OB 2ZDPA 1BMQB 3KLGB 4ZVFA 2ASJA 3JQJA 3CCMS 2KL8A 2M8HA 5U47A 3SDEA 1RT2B 3HP6A 2DR5A 1E6YB 4DX8H 3F44A 1T9UA 4LUBA 2VQEF 3HX9A 4HDHA 2V8VA 2EC0A 2RF2B 4J5OA 4IR9A 3PRDA 1GMWD 2YWFA 4ZVPB 4IR1A 2DNZA 3AB2B 3HHLD 5KG4A 1GAOA 1VBXA 2A6OA 2IBKA 1TKXA 3AXMA 2DNNA 2RS8A 5C42B 4XAKA 3VAJA 1FD8A 1H38A 4ED6A 2VUGA 1XNQF 4OI3A 3FGVA 2NQPA 4PXBA 1WNEA 2XO6A 4LMZA 1RT1B 5K8NA 5B0EA 1CJUA 5KFXA 4LFBJ 4H4OB 1ITPA 1V3RA 3ILOA 1U1QA 1XQIA 2P6SA 5D4NA 2PEBA 3O8WA 1SJ1A 3CJKB 4EYIB 2BKOA 3PHTA 4C8NA 3OVAA 4I6WA 2VFUA 1SKRA 2NXEA 4IRCA 3BSCA 1R89A 3HZEA 3DRPA 4QIVA 3HHDA 4FPRA 1UWBB 4DQIA 4RL1A 3KDNA 2J9DA 2P9CA 2KZZA 5ETTA 4UF4A 1RKIA 2ZWOA 1RWVB 5CZVA 2XSJB 4J9OA 2HMIA 2XGQA 3LUYA 4LFCF 2LA4A 3M6UA 2LQ9A 2QLFB 3BKFA 3GQCA 4ED8A 1CULB 3DRXA 5FLXY 3G96A 1IM6A 3LANA 1WTFA 5CYMA 1SJ4P 4H4KC 2XYGB 5KOWA 2M2BA 2J7KA 3N79A 3CCWA 4C3KA 2B8PA 3Q23A 3T1YJ 4P2SA 4YY3J 2DRDA 3OFHA 2GO8A 5DLGA 1DBDA 1M5KC 1YG0A 4N47A 4HACB 1N32J 1C0UB 3NEKA 3U1NA 4FPIA 2KI2A 4X66F 2X7IA 3W7BA 2XCAA 5D15A 3V4IB 3J7YI 3UNYA 2E66A 4B08A 2ZH2A 2J76E 4DV3F 2FHKA 5AXMA 3ONQA 1NCLA 4DPWA 3M1VA 1RBOB 4A4JA 2FZKB 2AEFA 4EI2A 3TUJC 3M2VB 1VRQC 2COLA 2NUUG 4J9MA 2D9OA 2DNQA 4I7FA 1SB6A 2DNYA 4O3NA 3W5ZA 4I68A 3GPAA 3HO1A 4ZLNA 1RT4B 2QT7A 2Z2YB 3KYLA 5K14B 1TR0A 1DTQA 2DH7A 2ERRA 4K4WA 1B64A 1N0VC 2FJEB 3V81B 3SQOP 4ZIVA 6AT1B 2AYEA 4D3GA 1L5UA 1BHNA 1HBNA 1S1TB 2RVJA 1S6PA 1KOHA 3B4DA 2OAUA 2BE2B 4DR7J 4I64A 2KH9A 4WYLA 4PXEA 4TU7A 3IGVA 2MQPA 2ZBPA 1Q5YA 1TMJA 2KFNA 3BQ0A 3DLGA 2HFUA 3I0RA 3M2RA 1W26A 2CNNB 4JI3J 2QSFA 4JI8J 1PYOB 3IGNA 3JSYA 3PO4A 5KFHA 4WFYA 2C2EA 4NA1A 4PPZA 1FNMA 5B09A 3QJLA 2ADBA 4I2PB 2WK4A 1JLGB 1RA6A 1YBAA 2R7TA 1U45A 2XSFA 3L7UA 1FI4A 1W25A 4A46A 2YKNB 4F4KA 4Y00A 1FEHA 4RNMA 3OVBA 2FVRA 5KFUA 3CCUS 3MPDA 1TKZA 1F5AA 4HKQA 2V6AA 3I31A 1H7XA 4QQBA 5IZHA 2GVDA 2P9GA 4LF5F 2YNFA 3HK2A 2KFZA 4O3OA 1D3WA 2VV5A 4LSZB 2IY5B 5F0WA 3F73A 3CGIA 1RLCL 4DN0A 1QVGR 3KMQA 3CMAS 1RAJA 2VODA 3VGUA 4GMKA 4TQSA 3AHPA 2HNDB 3MUMP 2NXCA 2GIRA 4CT8A 3AXKA 3PX4A 1CC8A 4C0HA 2NPFA 3EXYA 1K8AT 4USIA 2KM8C 4DV7F 1SKUB 2C22A 2ZC4A 4J9PA 1S6QA 1BGXT 1MWZA 2HHTA 2WCXA 1R0AA 2FJAB 4ED4A 3ZZPA 2VF3A 1S97A 3NGUA 3PYGA 1YRXA 2DO4A 1FJCA 3BEGB 1HHSA 2HHQA 3M8QB 1VI7A 1M1HA 3UD5A 4CP5A 2ZZTA 3MPUB 5L1JA 1H3DA 2OPQA 3FUYA 4U7CA 3HM9A 2EXUA 2B4OA 4P9SA 1HNWJ 4C9DA 1CS4A 4MYUA 3HXMA 3PRVA 4KAIA 4DPYA 3A3NB 1RBAA 1VOMA 5KFDA 4K2JA 4X4OA 3HMJG 1LWXA 4DV5J 3C14A 1UL3A 1UKUA 3EVWA 4ANCA 3M30B 2ZVIA 2WVBA 2OSRA 1JLEB 1RDRA 2HS4A 3OHBA 2ZH5A 1SH2A 2F7VA 2OD4A 2LCWA 3BBCA 3HLUA 1S1WA 4P2FA 3AAWB 3DM2A 1MMLA 2EK6A 2O3DA 4ELVA 4OLPA 3W60A 4LRDA 1OMSA 3CCRS 3PW5A 2RHQB 5AJ3J 1ZM3A 4MKVA 3ZXWA 1Y11A 1F2GA 2FJWA 3JAMU 5J2MA 3IN5A 4RW6A 1KLMA 3IFEA 4DV2F 4IG3A 2BKPA 5HROB 4Y65A 2RDJA 2FJVA 2OTJS 3MM6B 3MHYA 5K20B 1RHRB 4HTJA 1JKHA 2E5GA 1M5OC 1LEOA 2F4VF 3EVMA 2XYHB 1RYSA 2ADCA 2AEJA 3BDEA 3UCUP 1P6TA 1RT3A 2CNKB 2ZHOA 2CJQA 1B7YB 1VQ4S 2WVEA 3J81j 2RRAA 3HSDA 4IOCQ 2ZWPA 5A0YB 4ZPWR 3I82A 3DLLQ 2FQQB 5ETRA 3NCPA 4DFJA 3E01B 4DPXA 3TO8A 4LBPA 1LK5A 1FVSA 5LMUF 3HI9A 3BBFA 5DETA 4YR3A 1BWEA 4I1TA 3W9HA 5I4MA 4AYBD 1HBUB 5DO2A 4G3IA 4QWEA 3AY0A 3W63A 5B0CA 3LAKA 1SJQA 2IJFA 1BE4A 3US5A 4AXJA 1QM9A 1JLQA 3AQPA 4ATNA 2W2OP 1ZPVA 4DX6A 3K17A 4QOTA 5CA5A 1FWLA 1WG5A 3TX0A 2HHXA 1XR6A 2XC9A 4DR4F 4HEA9 3C8YA 1PKUA 2CDRB 1KFSA 3OSPA 2OEJA 2ZZNA 1WOSA 3DI6A 3FMBA 3GJRB 5KFEA 3QGHA 2XULA 1VK3A 4OI4A 2ACYA 3CPWR
chains in the Genus database with same CATH topology
2P9EA 1S49A 3THPA 3NGDA 4QR2A 4NLXA 2E29A 3SXLA 1TL1A 1EP4B 3U27A 1QSYA 5ITHA 4IRKA 5FDLA 2UUCF 2FDNA 1NHVA 3KLHA 3H40A 4AE5A 4EZ9A 1FTCA 2IC3B 4K2XA 3BJYA 3HFKA 4PQUB 1UA1A 3LH2S 2LXFA 2FLNA 1UEVA 3MD1A 5EWEA 5KG5A 3HVTA 2EG2A 3O44A 5DS7A 4YUDA 3BQ2A 1C1CB 2PEHA 2XY7A 1VIXA 4C8OA 1FVQA 2D3UA 1X8DA 4DL0C 1QLNA 2B6AA 1H2UX 3C66A 1I1GA 3OTDA 2R4FA 3SQGB 5I3UB 4AL7A 2NREA 2VOOA 1OSDA 2BDPA 1U25A 1FKPB 2DIUA 5F9LA 3MPYA 5GADU 4NCBA 2K8GA 4HH0A 2L41A 2OSQA 2ROGA 2UVRA 2MY8A 3T1HF 4G1QA 4I0WA 3RW6A 2A1BA 3OSNA 2D41A 2HRYA 2HZCA 2MSSA 2KJWA 1QSSA 2ZOMA 2KXHA 4C11A 2CZ4A 1LOUA 1JLAB 2PN6A 2ZC3A 1VQLS 4DF4A 4C8KA 1P27B 4WK3A 5KFLA 1SBRA 2DGUA 2FGCA 3MEGB 5D3GB 3N0VA 1NK5A 2LKZA 3BGRA 3FEZA 4DL2A 1T02A 2AW0A 4KGMA 4OI6A 4URGA 4NYZA 4HLBA 5KFZA 1RKJA 3GG0A 4TY8A 1R8BA 4RZRA 1D8YA 2ROEA 3M8QA 1UVIA 1G1XA 2FIUA 5BYQA 3M8SA 3C46A 1D8ZA 4Q0BB 1MROB 2LDYA 4USHA 2IRXA 1IKYB 3M8RA 1MNEA 2EVZA 1QAYA 3DYAA 3LPYA 5LJ5Y 4ED3A 3NMRA 3K7RA 2BQRA 1Q79A 5K9FA 1UA0A 1UMJA 4N77A 3PX6A 3T5KA 1N36F 4DHVA 4JI5F 1QUVA 1WELA 1WWHA 2XWXA 2AJQA 1XMQF 1M5PC 2OP5A 3M8PA 5F0UA 1FE4A 1MSWD 3BGLA 3OTEA 2GQCA 2JLGA 3VAFA 2Q1LA 1X4GA 1KONA 5HN0A 1YJNS 2M9KA 2O5DA 5KFGA 2NUHA 3TAPA 4ED5A 4I6AA 4DV6F 2QA2A 4JBCA 1KFDA 1RT6A 1Y5NB 4KBIA 3GIKA 3OBIA 4J9NA 1SUQB 5F8IA 2NXUA 1T03A 3HDSA 4WYWA 2BQUA 3BQ1A 3HHKA 1UETA 2RIJA 3DOLA 1WI6A 2E1AA 4TN2A 4I67A 5LXRA 5J1EB 5HP1A 2UV8G 4WCEQ 3S1TA 4PWUA 1HBMA 3K2YA 3CSKA 2UXBF 1CG2A 1Z1ZA 1FO1A 1U8SA 2DGTA 1FERA 4EBEA 1M90T 2AV5A 2BRLA 3UR3C 4UY8T 3ENQA 2RQCA 2JWNA 2ZOFA 4KKOA 3OLAA 1KD1T 2JC1A 2MZSA 1K73T 2AJ4A 2YWGA 3T1AA 3MD3A 4WF9Q 4PQAA 1MU2B 2J9CA 1LWFA 4K0KF 2FHJA 2YVSA 5D78A 4DL7A 3MZIA 3KLVA 3VCDA 2E44A 1VQ7S 1FRXA 1GXLA 1JLEA 2CKWA 3DLEB 1N5QA 1VFJA 3FZ2A 2CQIA 3I96A 4IG0B 5EHHA 3IAM9 1TFWA 2PMZD 1VLYA 1UAWA 1BQMA 3RBDA 2ZE2A 5K8OA 3MMAB 3I5CA 1IKVA 4URSA 2I5JB 3MM5B 4DSIA 1RTHA 2CPHA 3ZZ0A 1MWYA 2ZH9A 1U1KA 3D28A 3IG1A 3AJ1A 4MIBA 1S9GA 5H9EJ 2W25A 1UP1A 4DPOA 2N82B 4KC5A 2J6TA 3DXBA 2BXJA 4OHYA 3G8TA 3OHAA 1TK0A 3GR1A 5FD1A 4Y28C 4A8QA 3UNGC 4D3HA 5M2UA 2OMOA 2G4BA 2K1RB 1URNA 1NK8A 4DR3F 3MGJA 1HR0F 3OFEA 1KQGB 3DRRB 3JYTB 1FNXH 3S8SA 4R5PB 3CC7S 3PFOA 3OL6A 4R8UB 1ELOA 2EG1A 1RYRA 4OZ0A 4EEYA 2VFVA 3I5AA 1RT2A 4OX6A 1Q4RA 3OUYB 3C2PA 1S6UA 4X4UA 1L3TA 1V3ZA 4N8OA 4WXOA 5J1NA 3TRGA 4Z37A 3CDAA 2R7QA 4OJGA 4CTAB 3KK1A 4FF4A 2RF2A 1SKSA 2HS3A 3GIJA 4B9LA 2J0QD 2M70A 2CFXA 2G13A 4Q2LA 1CEZA 5ADZA 2W9CA 4WZQA 4G1PA 5J2PA 1G3OA 5DM7Q 3VAMA 2N4DA 3V6KA 2HMIB 3T5JA 2PIIA 2LXIA 4X62F 3HHEA 3KHLA 5HROA 1HPZA 3QAEA 5KT4A 1U1LA 2HNYA 2JOQA 3CB4A 4KB7A 2FHOB 3NCRA 3TOQA 2B56A 1YJTA 2JC0A 4K4SA 3VR1A 2CYYA 5D4LA 2CPJA 4IFVA 3K5MA 4NLYA 4IO1A 1Z4UA 4KV8A 1RTJA 3TVKA 3G86A 3SCJE 4M8LA 3AA8A 2DJWA 4J9SA 2EWHA 1URRA 1Y00A 1U6BA 3CEDA 3IRXB 4B9TA 1U1NA 4IKAA 4ICLA 4O44A 3W2VB 5HQ8A 3PR5B 2LQ5A 2B9YA 3RU0A 2MMYA 2WSFC 1O8BA 3OR1B 2HHSA 2OLWA 3PNIA 4X2BA 3CCES 1Q7LB 3ZZUA 1HBOB 5KFFA 4H4MA 3J7Z5 3MXHP 5DGAA 3DU5A 2ZH3A 2GMJA 2D9PA 4RW9B 4ZP6A 4ES2A 4OHVA 1ZZFA 4ECZA 2B7CB 2MGZB 4WZMA 2DIVA 2KG1A 2QIFA 1NJWA 1WHXA 3Q8RB 3N6LA 4LF8F 4JUZA 3PW0A 2FY1A 2FVQA 4F3QA 1RTIA 4RW4B 4OLOA 5A0YA 1NK0A 1S1XB 2DO0A 4MH8A 3ZZTA 5B0GA 2RU9A 2XB2D 2HWHA 2IM3A 1XMBA 3OJSA 4CH1A 1DHMA 3SCKE 3SI8A 4Y2CA 1FRLA 4ZOSA 4Y3CA 5B0DA 3VAIA 5CH7B 3MEKA 2W7OA 5FIIA 4JV2A 4FZVA 5T14A 2ATLA 1Q78A 3E01A 1T05B 2I38A 2E9TA 4ZK7M 3H2LA 1X7VA 1QUPA 3KHHA 2VG7B 4J37A 5F9NA 5GAEU 2JHEA 3BREA 4I6YA 2VFRA 3Q0AA 5HO4A 1SH3A 2W9AA 2CJAA 2V0NA 4NZ6A 5GMKa 2XY5A 4ZVEA 1KTQA 4F26A 1W2BR 4URQU 4N5SA 2YTCA 4DN9A 1IBMF 3FQKA 1VQNS 4L3NA 4DBQA 4QWCA 3IXQA 2JFDA 2PA3A 1HBUA 2XMTA 3EGWB 1QVFR 1K1SA 4I7FB 4ZPVR 2BBEA 3DOKB 3MDFA 4B02A 3SMZA 2CJKA 2HHVA 3QJJA 1QE1A 2KHDA 1VQOS 4I2QA 3KFWX 3EPIA 4YEAA 1JMTA 1UFWA 1LWEB 3LAMA 2CIMA 2N4CA 2XSJA 5D6GA 2J6UA 4ED7A 3V6HA 4Q8FA 1VS3A 3PDNA 4MIWA 4EBDA 3M32A 2HFNA 3MAHA 1HNVB 4OJ1A 4HYKA 4ECWA 4KHMA 2LU1A 3QLHA 3TQ1A 3KOAA 3L3CA 1TL3A 2IYGA 2Q6BA 3QO9B 1HMVA 4N76A 4Q44A 4GO5X 3MF5A 5CCMA 2YKPA 1AUDA 1WG4A 5E3RA 3O6QA 1BY9A 2BABA 1CQNA 3I9V9 1R6YA 4PG7A 5DG7A 1F0XA 1SV5B 4TY9A 1Q1KA 2IAJA 2UZAA 4DL5A 3VQTA 5LSLA 1SJ3P 1U48A 1JNRB 3FVYA 3CULA 2U2FA 2DTJA 4OHZA 2Q6CA 2UVWA 4DJBA 5JXSA 2WSCC 4Q45A 1UVLA 3MMCA 2E9RX 2QSWA 3NKYA 2OPRA 1IKWA 4B3OB 1RA7A 1TAUA 5KFPA 3NBPA 2HVIA 3U1LA 2OIHA 1JXEA 2YKAA 3THTA 1X5PA 2CQ2A 2VBWA 5MLCV 3PKYA 4OZNA 3MUVP 5LMNF 1SXLA 1P1TA 5EN1A 2I0XA 2VC0A 3MM9B 2Z4PA 5J2QB 2VL1A 3MEEB 2BZ2A 1LW0A 3GR0A 4K59A 2DR7A 2IM1A 1LFWA 1Y7PA 1VJWA 4RUAA 1VRUB 3KK2B 1VQ8S 3DHWC 2DHGA 1EP4A 4AUKA 1XK8A 3POTB 3DLGB 2OD6A 1XBWA 3I0RB 1JIHA 4TNOA 2DT9A 5L1LA 3M2RB 2GCFA 2LDIA 2DGOA 2IC3A 2LU2A 3PX0A 1JJ2R 1BQNB 2K7JA 2XEXA 2HAIA 4HTIA 4BS2A 4WU2A 1M1KT 5D8HB 5GAHU 1XNRF 4ZPTR 4HVZA 4MK7A 1IKXB 2QLWA 3M2UA 4Y2MA 5LT5A 2B3TB 5F8MA 4HI2A 2XLJA 3M9NB 2XZWA 3V6DB 3KNAA 4C8YA 3SQGA 2ZDOA 3SSQA 3G6VA 4JYAF 3Q8PB 2UV8A 2AJFE 2W4DA 1E6VB 3FMWA 3WBZA 5A6WA 2KT2A 2BRKA 3OXFA 2HG4A 2VG6B 1HL6A 4ZDNA 2QV6A 3IRWP 2JSXA 5HMWA 3Q2TC 1NJYA 2PC6A 4NPOA 3TI0A 2FHJD 2LYVA 3CCSS 4DR1F 1FK9B 3SV4A 3IC1A 1OO0B 4F2RA 2C3OA 1KHWA 1JLAA 2PA8D 5KFTA 1SL0A 1KHVA 4A8SA 2B4VA 2VBXA 3DN9A 5D3GA 5DQHA 1RI7A 4DUZF 2R7UA 5KG3A 3UR0A 4X4RA 1JXLA 4C4WA 3WC2A 2ALZA 1UEUA 3PV8A 3EPGA 4KFBA 2X1GA 1UVKA 2MQMA 4EUVA 5HLFB 1APSA 4Q0BA 2YY3A 2EFGA 4ILRA 2FLLA 1RT7B 5JVHQ 1IKYA 3MECA 2RILA 2E1RA 4NA2A 3ULHA 3Q8SB 2ZH8A 3V81A 3ENVA 4QWBA 1S48A 3JTOA 1WF2A 3DLJA 1RISA 4FVCA 1UVMA 3H4BA 3X3UA 2GMLA 1I94F 3LP1B 1LWCA 2U1AA 4RNHA 4KJIA 2OJ3A 4FBUA 2IFXA 2UVVA 1IN0A 1DTTA 2W9BA 2KFYA 2RUGA 1BD6A 2F8HA 1L3VA 2EKYA 1TL4A 3MCSA 2Z2LA 1SJFA 3OR2A 4FVMA 2DNHA 4P7VA 4RLEA 5E41A 4QU7A 2A3JA 2MYFA 5EX0A 1HFEL 3ZZYA 4CO0A 5L38A 3CCLS 2GHWA 4FNHA 1Y3JA 4O4GA 2BW2A 2FTRA 3GFYA 2GIQA 4K5RA 5J1EA 4LJMA 2VQFF 1UVJA 1GTHA 3MM8B 3VWSA 1OQ3A 4WK1A 4LQ3A 3N01A 4IQMA 4XK8C 3TNVA 5F8GA 1B0TA 1OPIA 1L3SA 3VZIA 3H20A 3NNCA 3U1MA 3E51A 1KVIA 2IBOA 4OX8A 4CH0S 2UP1A 3TR5A 4UQTA 2W4PA 2HVHA 2F9JA 4J9RA 2VKZG 4ZP8A 4WXWA 4X4VA 2AQ4A 1MU2A 4G1IA 1HNIB 3LGMA 2HWTA 3DLHA 1FJEB 4RW8B 4C3LA 5IM0B 2ZKTA 1FD2A 5C25B 2CQGA 3CTRA 4NYPA 2DR9A 3Q24A 2K3KA 4QWDA 1VC6A 5DRKA 3E8OA 3DLEA 2GA7A 4IG0A 3MAQA 3RRGA 4C2MA 3AQOA 5BJRA 2HGLA 4ID8A 1PO6A 3GZ7A 1KS2A 4C0BA 4FF1A 2VZ9A 1N8RT 2B7BB 2RQ4A 2M7SA 3MMAA 3I56S 4JI1F 2BJDA 3ITHB 3MM5A 3RRHA 2YKMA 3ZZOA 4YHHF 4JV1A 5CYQB 2EFVA 3KLFB 5F8NA 3MTKA 3GILA 1FDDA 1Q8LA 1FNOA 1NB7A 4IRDA 4K4VA 4YDDB 1VGYA 2N3LA 1AFJA 2W8LA 4QYZJ 1HW9A 1R8PA 4QW8A 3HT3A 5B0FA 1CSJA 3HVAA 2PDAA 1D0EA 1Q86T 2AYMA 2K1RA 3QGGA 4CO2A 2KM8B 3K57A 4LF4F 3JYTA 3DRRA 4R5PA 3GSDA 1VRTA 1RT5B 5KTQA 1IJFB 1WEYA 4R8UA 3FDSA 2MKSA 3CIZA 1YQHA 4OZLA 1YJVA 4OHXA 4ECUA 1N34F 3OJUA 2LEBA 2UUBF 4NRUA 4BC7A 1X4EA 4EU0A 4ZHRB 4OJHA 3D1OA 2R8HA 1FDAA 1JLCA 1YJUA 4CTAA 4HHJA 1NJIT 1RTDB 2IJNA 2AJ0A 5T7LB 2CQHA 1ZZNA 4J9QA 4UUXA 1Y5IB 4KSEB 1JX4A 4BWJA 1FF2A 3CJ0A 5L9XA 4BC9A 2RE1A 1B7FA 1GH8A 1C1BB 3OPKA 4MK8A 4DV1F 3UDCA 2DNMA 3U7JA 3UQSA 5BR8F 1YIJS 1D9DA 1YWXA 4RWWA 1EETA 2BUNA 3D1QA 4TLQA 1HNXF 2D3OR 2BANA 4DLEA 4RKUC 2R8JA 4NZ0A 1S0NA 2HFZA 2D3ZA 2MHEA 2YNGB 5KOXA 2L9NA 2R2SA 1AW0A 2JJ4D 3G6XA 3KHRA 4WIIA 3CD0A 4MAKA 3JAMY 4RBTA 1HARA 2JVOA 5G0RB 4GKKF 2V4JB 1J5OA 1CVJA 4ZPDA 4BWMA 3TA0A 2V8GA 4NLOA 4DS4A 2PT0A 3UPFA 2MZTA 3IRXA 3N5BA 1V6HA 3VQSA 2M0GB 2C3UA 2YNIB 3MTJA 2LEPA 4M5DB 4XPCA 4U6PA 4F4ZA 3EYZA 5F8JA 2CDQA 1X0FA 1FA0A 3OR1A 4B9NA 4H4KA 5GADI 1WHYA 3DU6A 2E5LF 2RRNA 3NAIA 1J5EF 4Q43A 3BGFA 2IA6A 4F3MA 2ZM6F 3TYTA 6FDRA 2QYCA 2I9SA 2PMHA 5DG8A 1HQUB 2YX4A 4RW9A 2L08A 2XS5A 3C6UB 1CQMA 2HNDA 2CRLA 4WKRA 2MGZA 4JI0F 2IMWP 2IRUA 3QYYA 3CC4S 3THVA 4TYAA 5I3PA 4NLUA 4A8WA 5BYSA 1Q81T 4JI7F 2LLZA 1WF0A 1HI1A 3I0SB 2EW9A 2YWEA 3DRSB 3QAUA 3UFCX 1S1XA 2XCPA 4EO8A 2JEJA 3CDUA 2BQ3A 4EGLA 2CVEA 2JEGA 5SZTA 3B78A 4ECSA 3CD5A 2ASYA 4AL5A 3HJFA 1UJ4A 1ZAWA 3I4PA 4RWXA