1XK8A

Divalent cation tolerant protein cuta from homo sapiens o60888
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
YVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Divalent cation tolerant protein CUTA
publication title Divalent cation tolerant protein CUTA from Homo sapiens O60888
rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xk8A00
1NZAA 3L7PA 4CO3A 1XK8A 2XULA 3AH6A 4CNYA 3NCPA 2XBPA 3N5BA 4C3KA 1QY7A 3O8WA 2O66A 1H3DA 2GX8A 4WK3A 2NUUG 2RD5C 3O5TB 1PILA 2NS1B 3LF0A 4NYOA 4RLEA 4CO5A 2E66A 4OZJA 4OZNA 3HLUA 4IYQA 3TA2A 1VHFA 3CE8A 5D4LA 4ZK7M 1O51A 4D3GA 2GNKA 4USHA 4E98A 4Y65A 3TA1A 3X3UA 3NCRA 3BZQA 3MHYA 1OSCA 1HWUA 2ZFHA 3AA8A 1J2VA 4NYPA 2J9CA 4WK1A 1GNKA 5D4OA 4YB6A 2O67A 1UKUA 4CO1A 2XG8A 2DCLA 1O5JA 2EG1A 3NCQA 4RWXA 2VD3A 2Z0GA 3T9ZA 4CNZA 1NAQA 1P1LA 1V3RA 3GSDA 4USIA 2EG2A 1UL3A 3DFEA 4YB5A 1VFJA 3OPKA 2PIIA 5L9NA 4RWWA 1NH7A 2J9EA 4RX6A 2NUHA 4D3HA 3AA9A 1UMJA 4CO2A 4R25A 3TA0A 5DS7A 3M05A 2J9DA 4CO4A 4CO0A 2V5HG 4AFFA 4YB7A 1Q1KA 4C3MA 1KR4A 2ZOMA 1V3SA 2JJ4D 2J9DE 2XZWA 1UFLA 5DRKA 5D4NA 4OZLA 1NH8A 4Y6IA 1V9OA 2GW8A 2CZ4A 5D4PA 1V6HA 4USJC 4C3LA 3AHPA
chains in the Genus database with same CATH superfamily
5G4DA 5H9FJ 4F36A 1BWEA 3V6KA 1R6YA 4FPRA 3D1QA 2YWKA 4PRFA 4ZCKA 2MGZA 5FLXY 2B6AA 3WX8A 2VG7A 3OJUA 4I4BA 3C16B 2FLPA 5T7LB 2UXBJ 5H9EK 2CADA 4U67Q 2QE5A 1JMTA 1JJHA 1FTCA 4UF4A 2X7IA 4K0KJ 3R8YA 4DV2F 1N32F 4L76A 3BPDA 3BM7A 4FKYA 1JLAA 5KT5A 2OPSB 4YR2A 4OX7A 4J9SA 2VPYB 4TU9A 4YY3F 1SJFA 5KFFA 4WU3A 1Q8IA 2G1HA 3B6BA 1FX2A 2QA4G 4ZJQA 1I51B 1UMJA 1TP7A 2KXNB 5KFOA 3ZNUA 4GC7A 1YJNS 2I5JA 2BKOA 2C42A 2DGUA 1AB8A 1IKVA 2B4UA 4JI5J 1NNDA 2OFGX 4ILRA 4EUVA 4KO0B 1XN9A 1FJCA 1OS5A 3RAQA 1TKZB 1IBKF 3ZC4A 4K4XA 1FA0A 4I1TA 2HVHA 3MCMA 2N7CA 1JJCB 2ZH6A 1WTBA 4U9RA 3VVTA 1MNEA 3NNAA 1UWBB 1YG0A 3H4DA 4Q2MA 2LVWA 4KQZA 4LF5F 1UPMB 4LRFA 2JEIA 1E6VA 2MLYA 2QN6B 4RNHA 2M70A 2RHSB 1SKUB 4KKOB 5GADU 4O3RA 1D9DA 2E5LF 4P72A 2JZ5A 3UN5A 5IV4A 4UY8T 4ZVGA 2B6AB 2FHOB 3PR5B 1T03B 2WVEA 3HP6A 1XBWA 1WC3A 1LW0B 1P27B 4C9DA 3VAJA 1RT2A 3FMWA 2RQMA 4CCHA 3IA0A 1N5VA 3G82A 5C42A 3RAXA 1R43A 2BJ3A 1DRZA 1Q95G 3JTOA 4NE9C 4OJ1A 2L08A 4CH1A 2LKZA 3FK4A 4DG1A 4A8QA 2HAIA 2VBZA 4Y3CA 5CXTA 4GVBB 2W2PP 2RSQA 1XR7A 2I5JB 4MT1A 4QQBA 2IDLA 2M8DB 1YBUA 1IKVB 1TFYA 1K1SA 2APOA 2Q79A 2NZCA 1J2VA 3TZXA 1Y9OA 1K0VA 1JX4A 2VV5A 1RTDA 1UCNA 3KHHA 3W8PA 3G71S 4ZVEA 1S49A 3E3XA 3UR3C 1YRXA 3FDSA 3P3DA 5DM7Q 2H65B 3I5AA 1RLCL 1U0HB 3HHNB 2KJWA 1KD1T 3HSJA 3VAMA 4FDFA 4F04B 1HBUA 1Z4UA 4CT8A 2BW7A 2ZH9A 1IBLF 1RK8A 2XC9A 2R2SA 4TYAA 1FXDA 1W2IA 1QAIA 1T3NA 2CIMA 3P4UB 5M2PA 1AUSL 1RACB 1WOSA 2CQPA 2DXDA 4GO5X 4WYLA 1KBRA 1UA1A 1N34J 4ZK7M 2DNPA 2ZH8A 3G82B 1ROFA 3CCUS 3CTRA 1F3FA 5E3AA 4CH0S 1CJTA 4IQXA 2IRXA 3QNWB 2LYVA 4YHHF 4CLWA 2C3UA 1TL7B 5HLFB 2PA8D 1LXJA 3GIKA 2IVMA 1ULRA 3JAMY 3KWMA 2DISA 1MROA 2B7CB 1Z2LA 2C3OA 4HH1A 4ECXA 3CJ2A 4ERDA 2E1AA 3K5NA 1LV5A 2YPZA 2M8HA 3BR9A 2UVRA 1XTZA 4OX6A 2YWGA 3K89A 3W1YC 3TZYA 1U26A 2CZ4A 4PYAA 4DQRA 5ETSA 4USWA 1NDKA 4U95A 2EFVA 3FCHA 4IRKA 2E5HA 2VBXA 2AP6A 4FBUA 5I3UB 2FZCB 3LTOA 2ZKTA 2FGCA 2ZHBA 2V9KA 3W61A 3BO4A 3FBCA 2G4BA 1N5QA 7FD1A 3BYPA 3FBFA 1OIAA 3H98A 2XWYA 2FVQA 2XLKA 1U02A 4D3GA 4LF9J 4Y65A 3J7AN 2FVPA 2R7WA 3FRYA 1N52B 3AAWB 3ZXWA 3UR0A 4I0WA 3UCGA 3BREA 1N0UA 5CQGA 3UCZP 4HTIA 3PNIA 3N9UC 2CKWA 4X2BA 4A8YA 2LXIA 1EQMA 4O44A 4Q7AA 3KLEB 3T1HJ 3BDPA 2H5JB 2WSCC 4LRCA 2AYEA 3I0RB 4NLXA 1D9FA 3AOCA 2HQCA 3DLJA 1NJYA 5CABA 3S7RA 2HIYA 3R5CA 4NEYA 1UW9A 4NLGA 1JXEA 4GKJF 2B4VA 2C22A 3FJ2A 1G2EA 2MSTA 3B4MA 5KG7A 1T05A 3G86A 4LF8F 1X4HA 4YS2A 2OSQA 4G1QB 4ZCIA 4LFCJ 3PFEA 1VQ6S 1WEXA 2MSSA 1GFWB 2IC3B 4QU7A 4XPEA 5C24B 2H5IB 2HFOA 4MH8A 4A4JA 3L09A 3X3UA 2DXEA 2RILA 5M2UA 3AB2B 2WSFC 5KG1A 3GV7B 3ONQA 1B0TA 3MFHA 4J9LA 2HFZA 2C2DA 3JYTB 1KSPA 5E5NA 4F8RA 2AJQA 2GGPB 3KHLA 5GVQA 1JLCA 1Y00A 1NEEA 2CNLB 2XMUA 2R8KA 3EX7B 1N33F 1XWLA 2EXUA 5DRKA 2W9AA 1WELA 2HRUA 4O4GB 3PW7A 4NCBA 3L95X 2VFTA 2OIHA 2EFOA 2YX4A 4O44B 3O6QA 3GIRA 4ZPTR 5KFYA 1D8YA 3N4WA 5JJBA 3N6LA 3KUGA 1XMOF 1OPIA 2DNRA 5KG3A 1RT4A 5D77A 4OLPA 5BYQA 3NGSA 2L41A 1FNXH 4KC5A 2VBYA 2JDJA 3PIPQ 1YWXA 5D4OA 4H4KC 2V94A 2RQ4A 1C4AA 2HWTA 2AEMA 1HI0P 1D1UA 4NCGB 2IYIA 3PW5A 1K47A 1JB0C 5DETA 1S99A 1EJ7L 4MK7A 3H2VE 3QJLA 2DR5A 2IJRA 2QSWA 4CO2A 2HHTA 3OD2A 4JI8J 2HK2A 4I56A 5MLCV 1KR4A 5KG2A 2CXEA 3MURP 4A8MP 2XZWA 1UJ6A 3ILOA 3UNYA 5K8MA 5A8WA 5B0AA 3MCSA 3UDVA 2RVJA 1EHWA 2E1CA 3MPVA 2RUSA 5F8IA 4MYTA 3I32A 2X1BA 2XWXA 4C3KA 4OMFG 1NLKL 1H3DA 2OSRA 3NGDA 3QLHA 3KJNB 1ZTWA 1NRKA 4NRUA 3CSKA 2YKQA 5IT4A 2XMJA 4JI4J 4NA3A 4HHUA 2CNOB 2LLZA 4LF1A 4FS1A 2K7KA 1HL6A 5HROA 4DV5J 3MMBB 1PC4A 2JLFA 4C0BA 2VPWB 3HO1A 1T95A 2L9WA 1RWVB 4K59A 4U7CA 1Q78A 3CJKA 3M6VA 1VQPS 3I56S 5F9NA 1CULA 3M9NB 1RT4B 4WTYA 1RKIA 3W63A 5HJYA 4A46A 1MW7A 1S97A 3T41A 2FY1A 2CQDA 3KK3B 1S1VA 1S7IA 3TYTA 1JLQA 4X84A 1N0VC 1PJ6A 1FDDA 2DGQA 1V6HA 1HNWF 2YNIA 4K2XA 2NR0A 3IR7B 5CZVA 4QYRA 1QY7A 4LR7A 4HT7A 3WBZA 2XEXA 4CP5A 2ACMA 4P2MA 3D67A 2V8GA 1RWMB 1R27B 9RUBA 3DMJB 2EW9A 2YX7A 1N5SA 1PBAA 4JBCA 2DY9A 4NLDA 1HWJA 4OL8A 4LVNP 2HBYB 2V4JA 3H25A 3OUYB 5KG0A 3TARA 3D3BJ 2VC0A 4P2XA 1HLWA 2P9GA 4AE5A 4X4UA 4RU9A 4QWAA 3BJYA 3BQ1A 2W8LA 5E7OB 2RUGA 3HVRA 1QSSA 2WW8A 3T3FA 1F2GA 2K2PA 3TW0A 4KTQA 2PIIA 3R6GB 3KUHA 4K0KF 1VRQC 1LNQA 4HKQA 3CD7A 2HQDA 4JV0A 5DS7A 2H4YB 2QZ8A 4UY85 1DLOA 1Q7LB 3G96A 5HL7Q 4ZHRA 1PJ7A 2QG9B 2RAQA 5L1KA 2FJDB 3IM8A 1FK9B 2DNHA 4LIRA 1P9QC 2CQCA 3MM9A 2HWHA 2F8MA 5E3RA 1H73A 2HZCA 1CULB 2BA9A 1LWCB 3VAKA 3GR0A 4JI5F 5EWEA 1GX5A 2ZC3A 4NLPA 1H2TZ 2W8KA 2NSBA 2GS8A 3NLCA 3EUNA 5ETLA 1S1VB 3NCRA 4DCOB 2MDAA 4KHRA 1HMVA 3TUPA 3CCQS 4ZCMA 2PEBA 3IG1A 1PC5A 3N28A 3KJQB 3W62A 2HHWA 3GG1A 2ZBIA 1NAQA 1S9GB 3R3TA 2HNZB 6FD1A 2QFJA 5CYJA 2AX0A 3HXMA 2EKNA 4ZPDA 3ISZA 1RBOB 3EGVA 5I3QA 5CYQA 3A3PB 3D7SB 2V6AA 2CA9A 4KYZA 2YQ0A 2ZBPA 5F3TA 4W92B 1HYSA 5D0EA 1HHQA 1SJQA 4J37A 1SC4B 4X65J 4IH5A 1D09B 3FEXB 3PACA 3J81U 3VALA 4WFXA 2HAFA 1J5OB 3DM2A 3I9V9 3WIVA 1VQMS 3MOZA 2MHEA 1S72S 3OR1B 2R8IA 5C2GA 1ZA1B 3IAS9 5A0YA 1IWGA 2CYYA 2VKRA 4P74A 2A3JA 4CLFA 2M88A 1HWUA 2DNGA 3J7YI 1RBLA 3HVTB 1A9NB 3MM9B 2XSFA 3FUYA 4N41A 4F3OA 2YNGA 4I6AA 1VBZA 4HLBA 5I3PA 4QW9A 1Q16B 4NLQA 1RCOB 2OPQA 2P8IA 2JEGA 1HMVB 1OQ3A 5ITHA 3NEKA 3W2WA 4I68A 3IG1B 2AZ1A 1S0VA 2R7VA 2KDOA 1QE1B 2Y1IA 2QRRA 1RAOA 2CQ2A 4ECTA 2PFFB 3PJ9A 1CC7A 4I64A 1ZM9A 3NL0A 4EO6A 1S59A 2YKPA 3HZEA 2NS1B 2DR9A 2UV8A 3EXYA 2A10A 2HNDB 4N56A 2CPXA 1H72C 5D4LA 4DR3J 3TEHB 2QEXS 1F3VA 2R7UA 1NO8A 3TQEA 2W7AA 2LFVA 4QIWD 1FRXA 1CJKB 2AV5A 4M5JA 2IIHA 3DM2B 1K9MT 1Q81T 3U1LA 4C8YA 1N34F 1RAEB 4EGLA 2MXYA 3MPWA 2AX1A 5A0YB 2XCPA 4A8SA 2IDEA 2BKPA 3G4SS 1TVRB 5FDLA 2YH1A 4PWWA 4HYKA 1VJWA 4EWTA 2DNZA 1SVDA 1FNOA 1R7IA 2KJVA 4QWDA 2GW8A 2KXHA 4M5MA 4EO8A 3EWGA 3HSDA 2YNGB 3C14A 2VL1A 1YSJA 1XK8A 5B0FA 1PAUB 4R8UA 3PRDA 2XYGB 3IRWP 3M8ZA 3QIPA 2COLA 2OPQB 4OYPA 4PCQA 3DOLA 4OZJA 1CQNA 3HCXA 2YVSA 1E6YA 2BACA 2B9YA 4ID5A 3W2WB 4ECQA 5D0HA 3OTEA 1X0FA 4M5KA 4TXSA 2D1CA 4KSEB 3RU0A 6FDRA 2Z30B 5KFRA 1PYTA 4OHVA 2OEKA 5RUBA 1RT7A 4M1KA 4ZLPA 2UUTA 1RDRA 2LXUA 2DGXA 4DBQA 4LF9F 1RT5A 3HD2A 3Q0AA 1ZPWX 4TVAB 4UUWA 4Y2CA 1GMWA 3M1VB 1N4LA 3I82A 1F1BB 5CA5A 3Q8UA 5IT0A 4NA2A 1FDBA 4JI3J 4DEZA 3OFHA 2R4FA 1S4FA 3R1LA 5KFAA 3AOBA 3IO1A 1HQEA 1SI9A 3NAIA 4CYUA 4ELUA 3WIUA 4OHWA 1C2PA 5BJRA 2H9ZA 4V19X 5HK4A 3T1HF 1Q4RA 2B51A 3MAQA 1AYEA 1S5ZA 2W4CA 3GJQB 5KFMA 5KAKA 2GZOA 2NLWA 2CWXA 3NY0A 1T0TV 1Q8LA 2QL5B 5L8RC 4CIOA 3LO3A 3TI0A 1L3KA 1NSQA 1XERA 3I0SB 1JNZB 1MLAA 2CPIA 4LFCF 3J7YU 3MZIA 5E3QA 2BZ2A 4C8ZA 3OTOJ 2IM1A 2LCWA 3A8KA 1N56A 5MAOA 5HQ8A 1PBUA 1E6YB 2A6MA 5ETKA 3WZ0A 2BYCA 2MQPA 4WU2A 4N8NA 3MI7X 2CAJA 1NPPA 1LWFB 1FRLA 3PJWA 1R6VA 3A13A 2DCUB 4Y2AA 2ADCA 4C11A 1RT7B 4DZ6A 2ZH5A 3OXGA 2V8PA 3E01A 4X4NA 5IFMA 5F8JA 1QM9A 1ZPVA 2RRNA 3O44A 1WACA 3V6JA 1HWLA 3EGZA 1TV6A 1O6XA 4ZPWR 1O51A 1LW2A 2IM2A 2UUBJ 4CYUB 1C1BA 5KFZA 4CLYA 2DHHA 3G9CA 4OHXA 5K8OA 1B4SA 2AJ0A 3H2UB 3PW0A 3N79A 1GT8A 3D4JA 4OYBA 3CJSA 3VGUA 3U1NA 1JLEB 3Q8SB 1B7YB 1S1WA 4KY3A 1N36J 5ADZA 4GMKA 2W1BA 4M8LA 4DSKA 1M1KT 1P6TA 2NPFA 2ALZA 3M4XA 2R7QA 1NK6A 2F8EX 3L9ZA 1FF2A 2BKNA 1YITS 1RT3A 3MDFA 2DNQA 2VG6B 4Y2KA 5D0GA 3D9BA 1KLMB 2C3MA 3ZTRA 5D6GA 2OLWA 2DIUA 2P9EA 2MQ8A 1FFGB 3MECA 2GMHA 2MJUA 1S1TA 4FXWA 1ZOTA 1MMLA 2IVFB 2D69A 2X3DA 3HHLC 1MSWD 2J0SD 3W3SA 1LWEB 1RWPB 4DX8H 1BQMA 4JI0J 2HK3A 3KLFA 3I4HX 4TLQA 4XDDA 4O3PA 4JI8F 4DQSA 1R0BG 2NUUG 3KK1A 3RUBL 4RUHA 2YNFB 4J9QA 1HBOA 2HS0A 3PYEA 2V0NA 1NJXA 3NOCA 1UA0A 4K7QA 3QMQA 2KT5A 3SSQA 4XK8C 2B8QA 3MOJB 3LP1A 4DZDA 5DG9A 3IBWA 4DCPB 2XHWA 2XMTA 3F44A 1R8PA 1O5JA 1JLFA 1YIJS 3FZ2A 1O8BA 2YX1A 4JI4F 2OPPB 1LW2B 4OZ5A 4D3HA 3UDCA 1X5OA 2BR0A 3PHTA 2ILYA 2G2YA 8RUCA 3VF0B 4DV5F 2NYIA 4GRSA 1VQ5S 2DBBA 5A6WA 1REGX 4PUOB 4RNMA 4LF6J 3LW5C 2KYZA 1HD0A 2ROEA 1R0AB 3R5BA 2CPDA 3MXHP 3IS9A 1S1WB 2CPYA 3GV8B 4DXLA 3CGIA 3JSMA 4OJ3A 1KQSR 4WKYA 1U1NA 3HT3A 2A1BA 3I4PA 3DDIA 1LFPA 4TYBA 1AXQA 1MWYA 3DLGB 3OJSA 2FGOA 3BGOP 1A6LA 3G6YA 3F73A 4ANEA 2VFUA 4WFYA 1Y5LB 2L48A 3DOKA 1XMQJ 5BYSA 1IJEB 2C2MB 5A6PA 4JV1A 2HHVA 2AF6A 2DO4A 4A8WA 4ICLA 2HVEA 1PIEA 4NMLA 1HBOB 5BXIA 4OV1A 4DV0F 3NGUA 2YWEA 3MM5B 4RW6B 3CO9A 2AKWB 1XR6A 2RHQB 2YY3A 3LP1B 2XGQA 4M5HA 2F9DA 1HW9A 2J6TA 1OYEA 3I5BA 3S8SA 1W2BR 2VB6A 1M5SA 3CCJS 3VZIA 5FD1A 2Z58B 3QWUA 1H38A 4IG3B 3G8SA 2RD5C 1PILA 4I6WA 2J8AA 3HX9A 2G13A 3OL6A 1U6FA 2F3JA 2CNNB 1HI1A 2NXJA 2BUNA 4M95A 2N7YA 3KDOA 3H4BA 1CJVA 3IS9B 4JI6F 2JVRA 4E0DA 5J1EB 3PY8A 3JSMB 1KVJA 1HWKA 1KTVA 4IO1A 2KTQA 2CNKB 1SC6A 3SI8A 1UVKA 2V2VA 2GVDB 4B02A 2GO9A 4ZVFA 3VTIA 2DK2A 2AJFE 2ZKUA 3BN4A 5KFHA 3DOKB 4EFAC 5HP1B 3A3NB 2C1EB 4ECSA 1ZM3A 4XAKA 4B08A 4ID8A 3SYZA 3NP5A 2M2BA 4LSLB 3MR6A 1SV5B 4CLUA 1QSLA 2IAJA 3GCXP 3TX8A 3DI6A 2XI3A 2MKKA 3ISNC 4NEZA 2XMMA 4FP9A 4X65F 4FYYB 4IFVA 1YJ7A 2GNKA 3KLVA 4KGKA 4F4KA 1SQFA 3VCDA 2C2NA 1H98A 4BHQA 2MZQA 1N5YB 2DR6A 4NXNJ 3KMQA 1P9YA 2LEPA 4B3MJ 1DTTB 1FD2A 4EMDA 3UQSA 3NS5A 4X66F 2KG0A 4LF7J 4PG8A 2DNMA 1BD6A 2HFUA 2FVRA 4KE5A 2EC2A 3FBEA 3GSDA 2MQMA 1A0OB 1HR0J 3EPIA 5KG4A 1TKXA 1NHKL 1IVZA 4CLZA 3DLKA 4DV3J 1N48A 5IS2A 1SJ3P 1VC6A 1NZ8A 4KHPJ 1GTEA 1TK8A 4K8RA 5CCMA 3VWSA 1ACMB 3FC9A 4OZLA 1P1TA 3V81B 1FKPA 4WKRA 5DDQC 1QUVA 1CJUB 1AFIA 3B82A 4UQGA 3T6BA 3V4IB 3DKDA 3CCES 2OMLA 4ZS6A 1RLDA 3R1HA 3MUTP 2ABYA 5F41A 1VQLS 2PN6A 4Y34A 2DH8A 2QV6A 2RDJA 5KFNA 4ZA1A 2KG1A 2NZ4A 4HVZA 1UJ4A 4S0MA 4NYPA 2VA2A 5K14A 1C0UB 1H74A 1HQ2A 2O67A 3ZTOA 3OHBA 4H4MB 2UXDJ 5KT3A 3M2UA 2DGVA 3AJ2A 4QWBA 2M5YA 4DR3F 4RO0A 3DI6B 3W5ZA 3TANA 1B7FA 4IFVB 1NPRA 3TNVA 2BE2B 4ILMA 2UU9J 1ZA2B 5AXKA 1UVLA 3ENQA 2G2ZA 4C3MA 1X31C 4GC6A 3H0PA 1YZ7A 1NPKA 3LP0B 3GE9A 2J0XA 2F4VJ 4K5SA 4A8XA 2DNKA 4YB1P 1S1UB 3K8WA 2H1YA 2N4CA 5HI7A 4B3TJ 1XMBA 4WE1B 3KXDA 1L3TA 4XDCA 4YQWA 3C66A 3AH6A 5G0RB 2E5GA 2EFNA 4NZ7A 3JSBA 3J80Y 1SIZA 1RCXB 2GX8A 1MG7A 2AU0A 4TU7A 3DLKB 3I96A 2KVIA 3GWCA 4L72B 4Y2MA 4FBTA 4E98A 4WIQA 3VV2B 3NOGA 5C25B 4USTA 2HEKA 2AYGA 1KONA 1FKPB 4OI2A 4QPXA 2LA6A 1IR1A 1RI7A 1EARA 5DGAA 2XG8A 4OV6A 4KB7A 4Y28C 2A18A 2HRTA 1HNZJ 2O01C 1OJ4A 2QMXA 2AEFA 4C0OC 1K73T 3M30B 1C1CA 1GMUA 1C4CA 3ZFVA 4WJBA 5JMNA 4DN0A 5LT5A 1HBNB 3RGIA 3IP0A 4NRTA 4X4VA 1F6TA 2M9KA 3UNGC 1W7WA 5CD4A 1VQOS 1W25A 4TU8A 2K1RA 2BW2A 1TMMA 1H2UX 2OJ3A 1VQNS 3NNHA 1X4AA 4JI3F 3KLGA 1M5HA 5FLXU 4R5PB 2SXLA 2ATCB 1WUUA 1PKUA 2H48B 2F4FA 3J7A1 3GG0A 2KRRA 5T14A 2Q6CA 1DY3A 3CUNA 1KVKA 4MJKA 3MR5A 3BO3A 2QYCA 1JWWA 5HQMA 3LP2B 4EI2A 5DO2A 2BEFA 5ETPA 4DWIA 2B3TB 2Y0BB 4DF4A 1I6JA 3MMAB 5CYMB 3GB0A 2WW4A 4P2SA 2XQCA 2XY5A 1URNA 2MB0B 3QGPA 4ALZA 5AXMA 4RUAA 1YBTA 3OTOF 1U1QA 4RW4A 1TTHB 2LU1A 2WOMB 4UZBA 3QRQA 1HKAA 1FO1A 3AFGA 1RTZA 3K8VA 4DSLA 4IFYA 3KLHB 4DMZA 1RHJB 4CI0B 1VLOA 3MMCA 1TUWA 2CVEA 3CJ8A 2Y8WA 1G7CB 4MKVA 2XMVA 3T1YF 1LWXA 2UVVA 2CPFA 3D0IE 4FYWB 3UDLA 3MR2A 1TK0A 3OSPA 3MD1A 3N01A 4DPUA 3OQ2A 4MKBA 4DR5J 5LOQA 3DLLQ 4FXVA 1S57A 3PX6A 4B9LA 3FEZA 8ATCB 2MPUA 5DDOC 1GXUA 3TZWA 4C48A 2JFKA 4LMZA 1Q82T 1U8SA 4RWXA 1FWLA 2VFVA 3IGVA 4P6QA 3B78A 4IQMA 2UUBF 1VHIA 3CJRA 3H8YA 1VMBA 5E3PA 4A8FA 3SCLE 2HWIA 4QJVA 1VQ9S 2GAHC 2ZEJA 3QT6A 1N36F 1WNEA 4J9RA 1EB0A 1SL0A 2MQQA 3KKFA 1UETA 4DV1J 4YP3A 1UZHA 3W9JA 3BF4A 4ED3A 4O3OA 3N5BA 3CJ0A 5HMZA 2FUG9 1IXKA 4ELTA 4ZOSA 3W2VA 3H2LA 3IR5B 1TKDA 4WXOA 2K3IA 3TVZA 2V50A 3KG1A 2AD9A 4RNFA 2ZOGA 1YVFA 3J81j 3DLEA 2F7VA 3D1HA 3UD3P 2YH0A 4JI0F 5HVGA 5EUHA 2LA4A 2KM8C 1FVSA 1RHMB 5D15A 4OLOA 5KFJA 2VIHA 4DR7J 4IFYB 1CSJA 2DCLA 4LT6A 4F26A 4O23A 2MQNA 3GP9A 2WCXA 1AUDA 5KFKA 3GPAA 2R7RA 1HPZB 1NJIT 2V2ZA 1IKWA 1TL3A 4KFBB 1RJJA 1S6UA 2JVOA 2B7BB 2C2OB 2DRDA 1TZ0A 2W2MP 4Q44A 2W9BB 2ZH2A 2B9XA 2FB0A 1TELA 3PKYA 4KGXB 2AYMA 4J9MA 1RTJA 3FSYA 5KT4A 3VQSA 4OIXA 3M2RA 4CO3A 2KH9A 4RJVA 2IYGA 2O66A 3S6EA 5CHCB 2L9DA 2MTLA 2B5JB 4LVOP 1X5TA 1SXLA 4LF6F 4I2PB 2HRYA 3C3LA 3M8RA 3HHKA 3LH2S 3HHLB 4DX5A 2HGLA 3SQOP 2Y8YA 3IN5A 1T8EA 1VQYA 2EFPA 4TY8A 5D3GA 2Z2ZA 4KGMA 1YTYA 4ED5A 1EP4B 3GYNA 1IUJA 5LMUJ 3NKYA 5HATA 5DQIA 2GJFA 2EFQA 5A76A 3FKBA 4ETZA 1JXLA 4OFZA 5AXLA 2BRKA 2GJIA 1K44A 4HEA9 2DTJA 1ZYQA 3EYZA 4DR4J 3JXOA 4JI7F 3FFIA 2P2CB 1EZZB 4NPOA 2RDIA 3H7HB 3M8WA 2CPHA 4QWEA 3CCRS 4I7FB 3VGTA 4NX9A 4USVA 4F02A 1Y4ZB 1NSKL 1NHVA 4NLYA 1TL3B 4NLTA 2Y1LB 3M9OB 3BS9A 5H9FK 1SJ4P 4CT9A 3C15B 1FEEA 5KT2A 3QFWA 1XQIA 3BZQA 4V1Ak 4DDFA 3PDNA 1SC3B 5CCLA 2CG4A 2DRAA 5LSOA 2ATLA 1GNKA 2GIQA 3CCVS 1KOOA 3U02A 3VAHA 1IM4A 2A2DA 4ECVA 5KFLA 3K5OA 1RAAB 2HYIB 5HBMA 3ET6B 3MUVP 1FRKA 3DYAA 5ETTA 4O0IA 1X9WA 5AXNA 3PVXA 1VRTA 2V5HG 3BBBA 2HKEA 2J0WA 1T7PA 1R3NA 2ZOFA 2CUYA 3OV7A 3NBPA 3L4BC 1Y0HA 5B09A 1KHVA 4Q2LA 1WKJA 3GZ7A 1WORA 4DU8A 3TOQA 2AEJA 1IN0A 3HJVA 2HNYA 4DL5A 3V4MA 1NM2A 1B70B 3Q2SC 2QA4S 4N77A 2HMIA 3BN7A 2G1DA 1U2FA 2L3MA 3MAHA 4O3NA 1UVMA 3RAMA 4MKYA 4NWBA 4RUCA 1U1KA 2BQ3A 5F8NA 1YX2A 4JV2A 3R7NB 1BY9A 4F4WA 5C7PA 2LQBA 1U25A 2KT2A 2HBZB 2VODA 1UL3A 2PEHA 1JLBB 2JFDA 1U1MA 4NXNF 1HNVB 4MFBA 3F0NA 2PMZD 4B3MF 3W5XA 2J9DA 1T9XA 2PA3A 2IRYA 1LOUA 2OH2A 5KFQA 2BVZA 2DNNA 4LF7F 3GFHA 4ES2A 3UD4P 4CLLA 4WP8A 4QW8A 2UV8G 2CQ4A 2QL7B 1S9EA 4URQU 2CPEA 2HIQA 1HR0F 5HBMB 3NMRA 1J27A 2DPIA 5EX3A 3RBXA 2BANA 1FESA 1WC1A 3K57A 3C2PA 1WOOA 4M5GA 3Q8QB 4LRAA 4RW8A 4R0EA 3Q8VA 1UVNA 3UI3A 1X60A 3HFKA 2M4MA 2BDPA 1FKAF 2P6TA 2KVQE 2QMUB 4CLKA 1SL1A 4CZCA 2WVFA 3FRZA 3NBPB 3C19A 1KOHA 2DEIA 2ASJA 3D28A 4UOGA 1WHWA 4QYZJ 3EDQB 3U7JA 3VGVA 1N6QB 2R2RA 1FERA 2XY6A 2HNYB 3TJAA 3LQVA 3CJQA 4EK2A 1HQUA 1IKXA 1X4CA 2MEWA 2MY8A 4DFJA 2LQJA 3KJFB 2J9EA 4MAKA 1BQNB 4U8VA 5EHHA 1VK3A 3DHWC 1S6PA 1IBCB 1VRUB 4WPAA 3GIJA 4NMXA 5JVGQ 3QQCD 3SMZA 2XHCA 2F9JA 1JK9B 3TRGA 4ZLLA 1F9HA 2XCAA 1RAGB 4OHYA 2W9CA 2OMOA 1VS3A 2JNJA 2R7OA 4IRCA 1KFDA 2KN4A 3A8JA 2KHCA 2ZITA 2I6WA 2Z2MA 2F4VF 2E9TA 4NLVA 1WI8A 4B3TF 3P45B 2MGZB 4R0JA 2DR8A 1X4EA 2BABA 1WTFA 2VG7B 2V8VA 1S9EB 1YJWS 2YKNA 1YDLA 3FMBA 2G2OA 4HH0A 2YKMA 2BANB 1NSAA 1FKOA 2BJ9A 2VJVA 1S0NA 2W4DA 3M7VA 2DY1A 4AL7A 2EPIA 3PTWA 1JLAB 2PC6A 2P6SA 1B99A 2QL9B 3JB9k 1OQ6A 3MEKA 4CO4A 3T5HA 1YJVA 2ZOMA 4C8NA 3CDEA 1HNZF 1SJ1A 5I42A 4C2MA 3BDEA 3SFUA 5HMYA 2CQGA 4KH0B 3GJTB 1RWWB 4URSA 4WXWA 4XO0A 2JSXA 3O3LA 4DFMA 4GKKJ 3J7Z5 4C8KA 3E51A 4NLSA 1HHSA 2IMOA 1K0TA 3O5TB 4U96A 2BJEA 2HLUA 3QGIA 2F8HA 4FKXA 2FVCA 2D41A 3IFEA 3TAMA 1BMQB 4N7TA 2LECA 1S6QA 2DXFA 2HHXA 2DGOA 3T1AA 2KT3A 3EE3A 1I94F 3GIIA 4DUZJ 3MPYA 1E6VB 2Z57B 3ZZZA 3S01A 2PO4A 4A47A 1SB6A 2QA2A 3G2XA 5K20B 2KB2A 4AT1B 2Y1RI 3GILA 5F3ZA 4AYBD 2NQPA 1FRMA 3R9LA 3VAFA 2YKMB 1RT2B 1FKOB 5EWFA 1KHWA 1VBXA 2RS8A 4DS5A 3QWPA 5C42B 4FVMA 5DQGA 2DYAA 3Q86A 1NK7A 1TKTA 3O8WA 3SXLA 3H42A 1KN6A 2AJ2A 2OKQA 3CB4A 4IH6A 1N54B 3HJFA 2EFGA 4HHHA 4P7TA 4DG1B 4PG7A 1TL4A 2HFNA 5FIIA 3P49B 5CD4H 1RTHA 4RW9A 1AT1B 3SIPB 1ZZNA 2ZUGA 1Z2ZA 5HVHA 2O1PA 3RG6A 5L39A 3CC7S 2C3YA 5KFSA 3ZO7A 5JVHQ 2YNHA 3BSOA 3P6YC 3FQKA 2RNEA 2DKOB 4HACA 3W8GA 1VFJA 3N0VA 2R8HA 4DR5F 2UUCF 3BGUA 1F5AA 1RTDB 4HL9A 1U8WA 3TAMB 1UJ5A 4WFAQ 4WP3A 4USUA 2R3VA 2EI5A 2V4QA 3OFEA 4B3OA 1M1GA 1U1OA 3KNAA 2JC1A 4DLGA 2XS2A 2ZNYA 2IJFA 4PWDA 2Y0SD 2ROPA 4F25A 1VIOA 2HFSA 1HBUB 3DRYA 4ENOA 3ILIA 5GMKa 3I5CA 3HSGA 4PYDA 1IKYA 1URRA 3M6XA 3K5LA 4L75A 4DV1F 2QIFA 2CQBA 5DZ7A 1OSCA 3UVJA 5J2NA 3EXCX 1M5OC 4WK1A 5LMNF 4OI0A 4ECRA 1S76D 2JL9A 3R6LB 1FFWB 1XIQA 3GSIA 1OSDA 3M32A 2OPRA 2WB4A 1B3TA 1CJTB 1FE0A 1IWAA 4P7VA 5HN0A 3GJSB 3G8QA 4KT0C 2RDDA 3IBCB 2B9EA 1VGYA 3SQGA 1YJ9S 4KPCA 3BSNA 4DR7F 4RW9B 3TQ1A 2V8HA 1MROB 1WHVA 4TY9A 1QSYA 3ZNJ1 3RB6A 3F56A 2CDRB 2W2QP 4HACB 4DCJB 2VOPA 3EVMA 4UOCA 3D3CJ 4LSZB 1WC6A 2PDAA 4NLRA 1AFJA 1I1GA 3BSAA 4TQRA 3QIDA 2BQUA 3VVUA 5A8RA 2AJ4A 5DJBA 2HVDA 4O4RA 4RW7A 1T9UA 3SCKE 1U6BA 3BH7B 2JOQA 1B0PA 1RSCA 3AY0A 1HI8A 3M8YA 3G8TA 2E5JA 2WVBA 4QIVA 4WFZA 2AGPA 1S1XA 4RKUC 4B9MA 1FXLA 1HBMA 1RBAA 2MZJA 2V67A 4UOFA 2YWHA 3H20A 1BC6A 3D68A 4PWDB 2VU5A 3WX4A 3ZZOA 4LJMA 5DLGA 2EG1A 4CNZA 2J6SA 2XY7A 2EG2A 3AQOA 2IVYA 2V8DA 3DRSA 3SDEA 1S9FA 4ETXA 4MIWA 1HHTP 3EZUA 2QYGA 4WFNQ 4YR3A 4DLEA 1RAJA 3THTA 4NI2A 3UVJB 4WCEQ 1TR0A 4U7UK 5J2NB 1RAHB 3V6DA 1UFLA 1KVIA 2GO8A 1WDTA 1EKRA 3RRKA 3HD1A 4FF3A 1UP1A 2HURA 1CS4A 2V69A 1S0OA 2UUWA 4F0KA 2AGOA 3A8IA 4C3LA 2J7UA 1SL2A 2XMWA 4QR0A 2VFSA 4BLGA 3I31A 4J7CA 2IPOB 4ED8A 3G6ES 3CF5Q 4DN9A 1Q8KA 2P9CA 3IWXA 4DR4F 1T05B 1TUVA 1Q53A 3BGFA 1MMDA 3CE8A 4C8OA 5J2PA 2AJ1A 4QIFA 4N8OA 4CTAA 4G6VB 3GTYX 3W64A 2MKJA 2W7OA 1SQGA 2GQQA 1RWXB 1VQ7S 3TUJC 3T5KA 3RB4A 3ETOA 3MEDA 4J9NA 4G1IA 4ES3A 3DFEA 1QAXA 1CG2A 3DGVA 4O3SA 4DS4A 4ZPAA 1FJGJ 4QWCA 2JEJA 5KOWA 1HNXJ 1GMVA 4M5DA 3K2YA 4Q45A 1JLCB 1S1XB 4OX8A 2VQEJ 3LUYA 2AMCB 3JTPA 2OEJA 1EQ0A 2V34A 2GQCA 4IDKA 1U45A 1YJRA 4DHVA 4FF4A 3CJ4A 3THPA 3OW2R 2MKCA 3DRXA 1FRHA 1NXIA 3PW4A 3EMTA 2MZ1A 1X8DA 4M94A 5E3CA 4HHJA 2A6OA 3HLUA 2CJBA 4NI2B 2CJAA 3NMAA 2AYBA 1HWIA 4F4ZA 1UPPA 2IBOA 1KKHA 3BKTA 5THWA 2VA3A 5HVFA 2AHOB 1K1QA 3C8YA 1CS4B 3DU6A 3MHYA 1RP5A 3SBMA 4ZLJA 1PCAA 2R8GA 1RWOB 2VONA 5B0BA 2ZE2A 2AGQA 2D9PA 3M8SA 1UFWA 4ANCA 3JQJA 2Z4PA 4DI6A 3OXFA 1VQ4S 1S77D 4B9TA 5DDPC 4EZ9A 2FHMA 4OZ0A 3Q8RB 4I69A 5L9NA 3EVWA 4WYWA 5J2PB 1F0XA 4CTAB 4X64J 5J2QA 1KQFB 2E5IA 4WP9A 3TA0A 1RTIA 3GQCA 2R7TA 2VBWA 1Q1KA 2GAGC 1X9SA 2IA0A 3Q8PB 2XI2A 1FEHA 4DQIA 2V2QA 3CC2S 4WFBQ 1FT8A 1T9VA 2LEBA 3I87A 2VG5A 2GIRA 2V2KA 1RT1A 1WF0A 3MEDB 4G3IA 3R2CJ 4BS2A 5A8WB 1G1XA 4DUTA 3FCVA 5GMDA 1XEZA 1T94A 2Y3YA 1FI4A 2J7KA 1KQGB 1R89A 1HW8A 3CMES 1CVJA 1TU0B 4IDKB 3QLHB 4C6AA 3H5SA 2VASA 2UXBF 5KG6A 1UEKA 4DV4J 2G0CA 2R9LA 1YJTA 2JLGA 1WF1A 5KFUA 5FJ4A 1DARA 4IRDA 2QLFB 2QC3A 3BBCA 3LWMA 4G1PA 5KFGA 1X4GA 2C28A 3ILLA 2XSJA 1TL5A 2F65A 3OLAA 5HROB 2HSEB 4X4SA 3OVAA 3CJKB 3TJ9A 2E1RA 3L7OA 3DU5A 2KZMA 2ZE2B 4B3SJ 2J8SA 3BQ2A 1RADB 3AD7C 3ZTSA 2HZAA 1LKZA 2ALYB 5I4MA 1JLQB 1JIHA 3C16A 2F63A 3CCWA 2XNQA 5T7LA 2YNIB 4PG4A 2E66A 2PD1A 2VKZG 1RAFB 3BKFA 5E2QA 4ER8A 1BQXA 2RMLA 2XO6A 3Q2TC 2H3EB 3D1OA 1N5TA 2C2EA 2OPSA 1T9TA 2MZSA 1GX6A 4ZIWA 2VF3A 1M5VC 1Y10A 2V4JB 4G65A 1QLNA 1DFDA 1TK5A 2IFXA 3PX4A 3US5A 4BC9A 1DBDA 3CCZA 3HSZA 4P9SA 2DGTA 3OTDA 1B0VA 4B9UA 2BM1A 5B0DA 1R8BA 2ASLA 4KO0A 1F5CA 1JJ4A 2CFXA 1SKWA 1DAXA 3UPFA 4AXIA 1EETA 2D3O1 3POTA 2CZVC 3D2WA 3UD5A 3GFYA 2FHJD 3AHPA 1DLOB 2UUAJ 5LJ3Y 2DHGA 4V19J 2XSJB 2DD8S 2ZDOA 3RJMB 4F50A 4OZ1A 4ZHRB 5LJ5Y 2RU3A 1U2CA 1RXOB 2CJ9A 2E44A 1FTRA 3OL7A 4LFAJ 3MEGA 2YQ1A 1CEZA 1WKLA 2VUGA 2MYFA 3OHAA 1T9WA 2ZJPQ 4KKOA 2B56A 4ED2A 3LALA 1Y3KA 2MLZA 4TLRA 4GKKF 2HQIA 2ZDPA 4WF9Q 3K5PA 3LAMA 2DHAA 2ZWPA 1S0MA 4YB6A 4PR6A 2C2KB 1T03A 3LAKA 3A3OB 3QAUA 1LW0A 1KDNA 2EEYA 1KEKA 3IRXA 1NUEA 3UE2A 5KT7A 1NHUA 2V68A 3Q8YA 4FZVA 1NDCA 4DUZF 4KBIA 4E2FB 2R7SA 2LDYA 2CQ3A 2D7SA 1VOMA 3DRRA 4Q8FA 3RB3A 4DQPA 5CYQB 2NXCA 4IG0A 3M9MB 3PRBA 2FQQB 5D4PA 1PO6A 1QAJA 4LRDA 4ZDNA 1FE4A 1HYSB 4F4YA 1UTAA 3IWLA 2AW0A 3LGNA 1NJZA 4GVBA 2XBPA 2CQ1A 2YBVA 3RR7A 4MIBA 3L3CA 1VYAA 1R8HA 2LMIA 1WD6A 4RBVA 3PJXA 1DQ9A 3QJJA 3P5TL 3TA2A 2BJ8A 2WBRA 4RZRA 2O5DA 2QO3A 3JQKA 1WI6A 4RBUA 4P52A 3GYGA 1EETB 3POTB 1MN7A 4PXDA 3FEYB 5J1NA 4C97A 4KAIA 2WONA 2HGNA 1TUGB 3MEGB 3NGTA 1U0HA 4USKA 2RB7A 1ITPA 2DNOA 3PV8A 2DIVA 4N47A 2M0GB 4OX9J 2K7JA 2DGSA 1LQ9A 4LBHA 1SBRA 1VDHA 1RU2A 2FJVA 1REVA 3NNCA 1T3OA 3EZOA 1UEUA 5BYRA 3NXZA 3BV8A 1WC5A 3HFVA 2OAUA 1SKSA 1GMWD 1CBKA 4DSFA 5H9EJ 2ADBA 3IRXB 4IUFA 3KG0A 2NYHA 3CJTA 1RZMA 3BYRA 3MAAA 2ZBRA 4Z2XA 4ECZA 1T11A 4X4OA 4F67A 5BR8J 1NKBA 4J9KA 1NBEB 1HNIA 3DRRB 3RBDA 4IG0B 4CLPA 2E29A 2HLTA 1TL7A 5HLFA 2ZVSA 2DHXA 2J9CA 1BUXA 5B0CA 1RHRB 3DLBA 2V63A 4CO1A 3V5RA 4JI1J 3CO0P 3EGWB 3R7SB 2HPUA 4QPTA 2F5GA 4AL5A 4DL4A 1WJ9A 3WC0A 3QRPA 5IV3A 1S10A 2NXEA 3SV4A 1QJHA 3LGMA 4M5LA 1S6OA 2WBMA 4F2RA 3FCWA 5L46A 2QMWA 2WRMA 2MQOA 2NREA 1GTHA 3T5JA 3QAEA 1NB7A 2UP1A 4RR5A 1ZM2A 2IRUA 5I3UA 2WONB 5FDLB 3IMQJ 4ZN3A 2OFHX 4YDXA 3W9IA 3KG4A 4NLWA 3T9NA 4PG6A 3CXCR 1Y5NB 2FJWA 3C14B 3LF0A 5ETMA 4U6PA 2MLXA 3N6NA 4R8UB 1KFSA 1REVB 1ZM4A 3HF5A 3QIPB 2RT3A 4LBPA 4ZVUB 3DOLB 2ASYA 1NKEA 4LBIA 1UEVA 1RHQB 4ID5B 4LREA 2JEFA 2ZM6J 3KLEA 1SH0A 1HARA 2ZH4A 2OI2A 3MAAB 3I0RA 5IOLA 5DZ6A 4ZVOB 1EX8A 3TAQA 1SJRA 1NH7A 1HNIB 1AA1B 2NUHA 4J91A 2OO4A 2CRLA 2B0GA 4Y00A 3CCLS 1RT5B 2F1FA 1VCTA 2JH3A 3CDUA 3KK2A 4DQQA 2FZKB 2HHUA 4ATNA 2CPJA 4DSIA 3RR8A 2XO7A 1VBKA 5AT1B 4G1QA 4EBDA 4XPCA 1HQEB 2IC3A 2J6UA 4JUZA 5H1SV 5C24A 3J80U 1VC0A 4DR6J 3QZ8A 3M2VA 4X62J 4QIGA 1R0CB 2LQ5A 1DURA 4DL7A 1U6ZA 1K8AT 2GV1A 3JYTA 4EZ6A 2RKIA 4EU0A 4JOUA 2GGPA 1IQTA 3OL8A 2CVIA 4PG5A 4YEAA 1RT6A 1KQKA 2R7XA 5KFEA 1V3RA 4RU2A 2Z56B 3QT8A 5A2QU 3UO0A 2B9WA 3RRHA 4BCAA 4O4GA 1QVFR 4EYIB 5HQLA 1U47A 2DPJA 3FVYA 1UFKA 2XTJP 2DRBA 1SPBP 2WVCA 3QO9A 3CPWR 2PSZA 3BSCA 2W2OP 1WDDA 1FJGF 3W60A 4DPTA 1HNXF 4TKTA 4C11B 1U09A 2VQEF 3E01B 3PX0A 3DXSX 2QT7A 3KK2B 1V3ZA 4M5NA 4K4YA 1FDAA 1NDPA 1TV6B 4NCGA 1ZS6A 3UWTA 1XNQJ 2DB1A 2HS3A 1FXRA 1KP6A 1C1BB 3T5LA 4LFBJ 1D9AA 3M2VB 3DRPA 2PI4A 5K8PA 2GC8A 5L1IA 4I2QA 3SCIE 4XIUA 1N88A 4MK9A 2NXNA 2RKIB 2MZTA 5DG8A 2VQFJ 2VDIA 4L3NA 4OI6A 1RT3B 2DNYA 4OYXA 4JYAJ 1RT6B 3OFFA 4MKAA 1OMSA 5DGBA 4OI3A 4KGVB 4YMEA 1MN9A 4U8YA 3MECB 4X64F 1S1TB 1WEYA 1YLXA 2V9WA 4DX6A 2BMBA 4BBYA 5CAAA 4RLEA 1JXVA 1IQZA 4YR0A 3M8PA 5D78A 2ZZMA 1BQMB 5DLFA 2FDNA 3KLFB 3HHDA 3KK1B 4DUYJ 2XYHB 4NXMJ 3IBFB 3MMBA 4LF4J 3QO9B 4FNIA 4TQSA 4F2SA 1WF2A 1BLUA 2LQ8A 4K2JA 3UN3A 3NCQA 2YKOA 3ENVA 4HI2A 1GXTA 4PXEA 3VGSA 3CULA 4MK8A 2CQ0A 4ZP6A 5IT9U 3ZZRA 4DV4F 4L6V3 3HMJG 4A48A 3KK3A 4ZP9A 1JLFB 4C8MA 1HA1A 1KLNA 1WC0A 2FJAB 3DHXA 1PGZA 2XZDB 4OYOA 2L9NA 3DRPB 3H5UA 3E2EA 5F9LA 3HVWA 2OTJS 4NZ0A 4DR1J 3KHGA 1Q8BA 4I2QB 3BO2A 3DMJA 2QTWA 4B3RJ 2WAQD 3KFWX 3W7BA 3DGPA 4B3SF 1A7GE 5JXSA 3K58A 3CIZA 1T9YA 4PKDB 3OUYA 3GCWP 4JV5J 2DJWA 2X51A 4JB8B 2VPXB 2PI5A 3WHIA 3VAGA 1L3SA 4C4WA 4DPWA 3CMQA 1VR6A 2ZH3A 1LFWA 2WZ1A 2QX0A 3M8PB 2VH7A 5EGYA 3GJRB 5ETQA 3H90A 4P73A 1XR5A 3R7BB 2DO0A 4ICLB 3CNQP 1FK9A 3MD3A 1NMEB 3QGHA 3PEJA 3OFGA 3JS9A 2Z8QA 3DN9A 2I1RA 1V9OA 3G6XA 4EEYA 3BBFA 1LWCA 4LR8A 5ETVA 4OHZA 3T19A 4KJIA 4DPXA 3SFGA 5M2RA 4B9VA 3BR8A 4NYOA 3TUIC 2RRAA 3IC1A 5EWGA 3DLHA 3GONA 4JI2J 2FC8A 3CIMA 2UUAF 3A4TA 1W26A 3MM8A 4KHMA 2MKYA 4X4QA 3WQPA 1S9GA 2BOAA 2HNZA 3U1MA 4LFAF 3I9ZA 2I38A 2N4DA 2CG8A 1Q79A 1CJVB 5LSRA 4DV0J 1IBMJ 3DGPB 1G6BA 2AZ3A 3LOUA 4K4SA 4J5OA 2FLLA 3E8OA 1MU2A 5ETNA 5IM0A 5LXYA 5IWAJ 3ULHA 5CZXA 1KWMA 3BH6B 4PPZA 2B43A 2DITA 4DV7J 2AQ4A 1J5OA 1KC8T 3NAHA 4HDHA 3GFZA 2KFNA 3Q89A 4K50A 1HFEL 3EZ5A 3ZTQA 3OR1A 2FTRA 3RRGA 1F9EB 1C0TA 4ZKAA 2CQIA 3G87A 2EC0A 2YWWA 1SCJB 4F7VA 2HBRB 1LK5A 2QJ3A 2OUGA 3AJDA 3AT1B 5DG7A 2DEJA 2ZH7A 2CJXB 4NCAA 3HVTA 2IAJB 4BC7A 4DV6J 2KRBA 3Q23A 2B8PA 4ZCLA 4CDIA 4JI6J 4ANDA 2VICA 1GH8A 1UKUA 4DPOA 4ES1A 4MYUA 3QT7A 2D3ZA 2GCFA 4J90A 4C98A 3OPKA 3DC2A 1RA7A 3AXMA 4RX6A 2HHHJ 3PO4A 1MMNA 1DZ5A 2E7WA 5EX0A 2B4OA 1D3WA 2C2ZB 3IWNC 3MM8B 1QE1A 1TKXB 2JJ4D 3C6UA 1JNRB 4LQ9A 4ZMMA 3MPUB 2UXCJ 2KFYA 1X7VA 2E7XA 2N3OA 2HNDA 3CD0A 4OX9F 4PQAA 4DL2A 4C0HA 5LXRA 4HR2A 1MU2B 4QCLA 4CO5A 5IM0B 4YUDA 5J2MA 2CJKA 5K9FA 3OTCA 4BWMA 4PABA 2NCKL 4UT4A 2IBKA 1VC5A 1CJKA 1NK4A 1SKRA 1G4CA 1TAQA 2PMHA 4X66J 3LGHA 3SSSA 1C0TB 4LSNA 1PSDA 5BR8F 1OY6A 5K14B 1TVRA 2OD6A 4ZPBA 3I6PA 3CMAS 5IXUA 5KFPA 3M2UB 4FXDA 3AA9A 1BHNA 1PYSB 1M1HA 4R25A 3R2DJ 4F0MA 1WOPA 4JI1F 1OY9A 3OBIA 2DT9A 4ZIVA 2KKHA 5GAHI 1S79A 2JRSA 3K5MA 5C2CA 3TJ8A 1S12A 2FHJA 4P10A 5E41A 1Q7YT 1MWZA 1NSPA 2EVZA 2Z2LA 3PYFA 3MCNA 3CEDA 5A8KA 1NU4A 3ZZTA 4PQUA 3D5MA 3FSIA 4WZMA 5F0UA 2VHGA 1RU1A 3C6UB 2MQLA 1TL1A 2GMJA 4NOHA 3OVBA 2LEAA 3HKZD 3N6MA 3OTBA 3A1YG 3UCUP 1UAWA 4EBCA 2HHQA 1R8AA 1Y7PA 1UW4A 5EDWA 3F41A 2FLOA 3SV3A 3M1VA 3J7ZT 3O2IA 1JKHA 2E1PA 2ZC4A 1RKJA 5KFCA 2K3KA 4DL0C 5J2MB 3VHQA 2BRLA 5AJ3J 4MIAA 5IC4B 4X4TA 2GMLA 2Y1JA 4ZVTB 2ZM6F 1V5IB 3ADAC 1D8ZA 3FZBA 1J5EJ 1FRIA 4URGA 1C1CB 5T41A 5LM7E 4KIAA 4LSNB 2HHSA 3DNCA 2D9OA 1VJQA 3OR2A 3L7PA 2GIFA 2ZVIA 4OYAA 5LSLA 3QZ7A 4F4AA 4K4WA 1GK8A 3IR6B 2C2RA 3HHLD 2K1RB 3CD6S 1QDUB 3QSYB 4ZPVR 4O3QA 4X4PA 3I0SA 3KLGB 5L1JA 3TX0A 5J1PA 3NRBA 4DR6F 2RQCA 3W66A 4ELVA 4HT5A 4X62F 4FF2A 3NGKA 4NZ6A 5A8KB 8AT1B 4PQUB 1UWAA 1LWFA 3QGGA 4RWWA 4ZN1A 1RYSA 1F9FA 2R42A 2LU2A 1TL1B 1DQ8A 3PO5A 2LP4A 4L73A 4OYZA 3R5GA 2HW3A 3KDNA 4CO0A 3QBCA 2RE1A 3KOAA 2JWNA 4DL6A 3BEGB 2Q43A 4H4OA 2BOPA 1NH8A 2KU7A 1JKHB 3CJ5A 4RW4B 5E0OA 1VQSA 2XULA 4X4RA 4OJHA 2HS4A 1NK5A 1WSRA 5U47A 3FNNA 4FYXB 1RB0A 1RAIB 3CJ3A 4QR1A 4MTPA 1F2HA 3NWRA 3MMCB 1H7XA 4ZPCA 2QGFB 4ZLNA 3QYYA 4DR2J 4WBFA 4BWJA 4QIEA 1YBAA 3PHEA 2VC1A 1JLEA 3OR2B 2DHSA 1CQMA 3ICLA 3AD9C 1AZSA 5B7WA 2GFFA 2VG6A 1P1LA 4K5RA 2QLXA 3MWBA 1KLMA 1I3OB 4RNNA 1RGVA 3I55S 3N5FA 4OI4A 3MR7A 3SSRA 1AROP 1XNQF 2ZWOA 4CLTA 2I9SA 2HQGA 4LFBF 2MMYA 1TAUA 3DXBA 2OD4A 1LWEA 2UVWA 4B9NA 1NK0A 5GAHU 1FRJA 4ED6A 4Q0BA 4NYZA 1FJ7A 3H59A 2MY7A 2KFZA 2YNFA 4FYVB 1FD8A 5KTQA 3HVAA 2GHWA 1NKCA 1NB2A 2H54B 2VQFF 3T1YJ 1PAEX 1YRUA 4OZNA 3OT9A 5LL6d 1FX4A 4JYAF 3W2VB 1M0SA 1XJWB 4H4OB 3MMJA 3P96A 4DSEA 3Q83A 1X4BA 3ZZ0A 3JAMU 3SZ2A 5GAGI 2ZFHA 3GLJA 4YOEA 1H6KX 3M8QA 1X4DA 3DLEB 4P75A 1XMQF 2OPPA 5KFWA 3K0JA 2FYXA 2KL8A 2WB1D 3JTNA 3KUEA 4H4KA 2EK1A 4DUYF 4NXMF 4JP8A 2OTLS 4LF4F 1AW0A 2K06A 4WWSA 4PUOA 3D0GE 4PXCA 2ZZTA 3LA0A 4OYMA 3BQ0A 1BGXT 1R0AA 2OHDA 4ZJLA 4DL3A 2H51B 1CC8A 3R5AA 1IKWB 3PYGA 3L7UA 1AZSB 2GVZA 2XLJA 1UVJA 2YWFA 3EPGA 3RBZA 4CLSA 2XMKA 3W9HA 3EDRB 4FPIA 3DLGA 4ZVRB 1RTJB 3OSNA 3V6HA 2ZZNA 2B4PA 3M2RB 3RW7A 4ED4A 2XS7A 4IKAA 1G3OA 1QUPA 3TA1A 4RNOA 1YQHA 4DR1F 2CZ9A 3ISND 2WSEC 4Q0BB 3B8HA 2HVZA 2E9ZA 4B3RF 3BGRA 2NXUA 1KRPA 2BM0A 1NDLA 2LDIA 2FC9A 3HFZB 3S1TA 2VD3A 4NASA 3MM5A 3T6JA 4TY8B 4RW6A 5D3GB 5DM6Q 4JV5F 1PYOB 2ROGA 3W65A 3EVOA 3QFHA 4IOBA 1FVQA 2IY5B 3QRRA 4QYZK 2AT1B 1ICEB 4AXJA 2PGCA 2K8GA 2VPZB 4NLOA 3M8QB 1XNRJ 1LEOA 2ZH1A 2BXJA 5HMXA 4KV8A 2Q66A 2U1AA 2XNRA 3ENAA 2OELA 3PCOB 2R2UA 4IG3A 3OL9A 2DH9A 1APSA 1FWPA 2OP5A 4ED0A 3H5YA 3FFIB 2R8JA 2HHPA 3J81Y 3K7RA 1YI2S 2O3DA 3VR1A 1S7HA 3D6MB 4HTJA 4A8KA 1F5BA 4DU7A 2KXFA 2P5VA 5J1EA 2FZGB 5EN1A 3SCJE 4WTOB 1YZ6A 4J9PA 2GVZB 2Q6BA 6AT1B 2MKIA 3K17A 2GJ2A 4BDPA 4Y2IA 4HI1A 2GVDA 3P5BP 2R2TA 1WHYA 1GEHA 3AD8C 4JI2F 3FSXA 1XC9A 3R27A 2ZUAA 4ECUA 1WG5A 2FY8A 3JSYA 4YB5A 1CLFA 1WEZA 2MKSA 2EBEA 5HP1A 1R31A 5ETRA 3NS7B 3UN2A 1QTNB 4ZP8A 2IJNA 1OY8A 1SH2A 4DV3F 4JI7J 2IM0A 2VJUA 2RRBA 3DYAB 4ECWA 5KFTA 1MWQA 3FQLA 3M6WA 4LSLA 3Q22A 3BGRB 4KHPF 4CM2A 3DCAA 1IBMF 4Q8EA 1VRTB 1RABB 3UFCX 5IQ6A 1SV5A 3PM9A 3TVKA 2UVUA 1KS2A 2IA6A 1B64A 2AIRB 2RJZA 2NPIA 4ZVPB 5IWAF 2EWHA 2QSFA 4LUBA 4DV7F 1N5YA 1UVIA 2YTCA 2JX2A 1VHFA 3C6TA 2G0IA 3NG8A 2HQFA 1DTTA 4USHA 2E1MC 5KOXA 4AQYJ 1SUQA 3EGNA 4KV8B 2FLNA 3GIMA 3EJMA 2G0JA 5HAOA 2HMIB 2J5AA 3AA8A 4J9OA 4ZVHA 5GAEI 5GAGU 1VISA 4P2FA 4DFKA 1X0PA 3AOAA 4IR9A 3GV5B 5HSPA 2BE7D 2W2NP 2UXDF 3CWJA 1RE1B 2HGMA 1H0HB 1TQLA 4LR9A 1EAYC 4DV6F 1Q5YA 1U2RA 4AUKA 2QFIA 1GXLA 2H4WB 4DSJA 2LQ9A 5K8NA 1VQ8S 4F3MA 1RWNB 3CCSS 3TAPA 3V81A 2UU9F 1LXNA 3P8BB 2M7SA 1CJUA 1F60B 4MFBB 2X1AA 4ZJOA 3V4IA 4I67A 3H5XA 1ZAVA 4UZCA 3OXLA 2HHHF 4K4ZA 3HT0A 2HG4A 2XMAA 3AXKA 3ENWA 2ZBCA 4J9UE 2QLJB 4UTGA 2ZHAA 3JSRA 4GVLA 2HZVA 1ZETA 3K59A 2EKYA 1ZAXA 1FDNA 4RW8B 2UXCF 1OPZA 4E8UA 1C0UA 5KG5A 1QTMA 1U1RA 3BPSP 4H4MA 1U48A 4K4VA 2M3DA 2WTFA 1QD1A 2UZAA 3KYLA 4FNHA 4QBUA 3CDBA 4DF8A 3MGJA 4TN2A 2CJQA 2JLEA 2FJXA 1RWUA 4ILLA 1VBYA 1FWKA 2BE2A 2I2YA 4A8OA 3DDNA 2W4PA 4KR0B 3CC4S 1FFSB 2J76E 3C6TB 1L3VA 3LP0A 1Q5VA 1X4FA 3UDEA 5KFDA 7FDRA 1SUQB 3C46A 1S1UA 1HQUB 1IKXB 1PG5B 4AFFA 4WE1A 1V3SA 2J9DE 1RQ0A 4UQTA 5HANA 2POKA 2DGWA 5F8LA 5G0RA 3Q24A 2CQHA 4UW2A 3KLIA 3ILJA 3A8EA 1S6PB 1RISA 3BGLA 3IGNA 1HIYA 1S48A 4CRJA 2BJ7A 3V2UC 1Y3JA 3MR3A 4DV2J 3MM7A 3IM9A 1N32J 1ZBTA 5C25A 3D54A 2W9CB 1BWVA 4RBTA 4YY3J 2BX6A 5HO4A 2J0QD 4PPDA 4AD6A 1YRTA 2QLWA 4P71A 1TMJA 1PJ5A 3PEHA 3GYXB 4ED1A 4F0HA 1RYRA 3TR5A 4KRWA 4OYIA 1RWKB 4QZVB 3HULA 2YKNB 3RBEA 2Y9HA 3M30A 2XS5A 4KPYA 1VLYA 3PRVA 1SH3A 4Q5VA 1U4BA 1IJFB 5IC6B 2U2FA 1HBNA 1Z1ZA 4RPFA 1IBKJ 2F40A 4RL1A 3TUZC 1M5KC 1ELOA 3R5JB 4QOTA 2FJBB 3HKWA 1KNZA 3CDAA 3QPIA 4FN5A 3OVSA 4IO9Q 4LF5J 2RQKA 5AJ3F 5I42B 4R5PA 3ITHA 2BV3A 1ZAWA 4KH1B 5K5MA 1WHXA 4LF2A 1J5EF 2E5LJ 5L38A 1OO0B 2FJEB 4N76A 3KNGA 1BXNA 5DQHA 1IR2A 4F4XA 1FNMA 4W90B 3KLIB 1SC1B 3LP2A 3MTJA 5B0EA 3D6TB 5GAEU 3MM7B 1S6QB 2G9OA 3MMAA 5CYMA 1QVGR 3T9ZA 2GHPA 3PKMA 2V4RA 4USIA 2MKHA 5KT6A 1D0EA 3DDKA 4ZVSB 2A0FB 3TO8A 4DFPA 1ZTTA 2WOMA 4CM0A 4Z7YA 4FS2A 1T02A 4L3KA 4DOZA 3W5YA 1M5PC 3RYLA 5SZTA 2W25A 3KLHA 2FPHX 5A2QY 4K4UA 4USJC 1HD1A 5CH7B 3MF5A 2DH7A 2KZZA 2PMWA 5KFXA 4YFUA 5B0GA 2BJDA 2RU9A 1VIXA 5AE1A 1M90T 4K4TA 4WZQA 2IMWP 1TKTB 2BBEA 5KFBA 4AL6A 3QATA 3HHEA 4RUBA 1YKWA 2E7VA 2YXLA 4CQ1A 2I8EA 3HPOA 1ZZFA 4GO7X 1I94J 2C3PA 3AQPA 4Z7CA 3ITHB 4USMA 3U27A 1RTHB 2ZD1A 5SUHA 2KO1A 2ASDA 1Q0NA 3R97A 4DR2F 4B17A 1IBLJ 3MEEA 2BQRA 2YNHB 4OI1A 2ZNZA 4PEOA 1VQKS 1P8GA 3EICA 4O0NA 2ACYA 2QA1A 2N82B 4OZ3A 2J7WA 1VK8A 2YPYA 3WC2A 2X3GA 3ZTPA 2KYXA 3LANA 2CPZA 3PZPA 4I6YA 4ZVQB 4LRBA 1YGYA 3PG9A 2MHNA 1NK8A 4B3OB 2N3LA 5HMWA 2I0XA 2PFDA 3B54A 3CW2C 2W24A 4YHHJ 5IQQA 3KHRA 3PW2A 3TEGA 4IYQA 3PIOQ 4MMOA 3OLBA 1EIYB 3NGRA 5E33A 7AT1B 1U7LA 3PXGa 2PT0A 3ZZYA 2DR7A 3D66A 1L3UA 4H54A 1RUSA 2KM8B 3LPYA 1IKYB 2ILZA 2OEMA 3GMGA 1BE4A 3KMSA 3CVKA 1FHTA 1HPZA 1JLGA 5LMUF 4KFBA 1ZH5A 4FVCA 2UUCJ 3NS6A 1EKSA 4F3QA 3GFXA 3M32B 2W9BA 2OPRB 2GHVC 2W01A 2HBQB 3RZAA 5C5JA 2YKAA 3GR1A 2XLIA 4IR1A 3RW6A 2CWKA 2MZRA 3G6VA 3SQGB 4FYDA 1Y11A 2BE9B 4W98A 5IT9Y 5KFIA 1L5UA 2ZD1B 3PYDA 2B5JA 1R8CA 4ED7A 3SEOA 5B08A 2VFRA 4I2PA 3MEEB 1X9MA 3RB0A 3HHLA 2BJ1A 2FD2A 3BB5A 3QSIA 4WIIA 5D0RA 3CD5A 2JC0A 2RH3A 4CWBA 5AE3A 1GAOA 3D0HE 5A8RB 4EBEA 3CCTA 1EP4A 2ERRA 5LMNJ 5L1LA 4RW7B 1QAYA 3D6FB 4IOAQ 3KJVA 4OZ2A 3ZZUA 3ZZPA 1WSVA 5KFVA 3HDSA 1X5SA 3KTQA 1JQGA 3LWLA 1KTQA 2HVIA 2JHEA 4LQ3A 1HBMB 2ZHOA 4PAAA 4ITSA 1U1PA 4GKJJ 2DNLA 1SIWB 4ECYA 4LF8J 3DOMA 1FCAA 2PE8A 3DRSB 4I7FA 3SDEB 3FBBA 3TZZA 1NJWA 2OGUA 1JLGB 3BKUA 1NZAA 1O0PA 3V6DB 1U0SA 1CPZA 4IOCQ 4DPYA 2RF2A 3HI9A 4Q43A 4WK3A 3C15A 4KGZB 1IM6A 2XZTB 5HJXA 3RTVA 1XNRF 3GU0A 2XB2D 3VZHA 4FF1A 1GQEA 5AE2A 1I5OB 1RHUB 4C7QA 4Z37A 3MUMP 5DDRC 1Y5IB 2QLBB 4UOHA 4PXBA 1YK9A 3MM6A 3ET6A 4M63A 1X5PA 1DTQA 4C8LA 1U1LA 1N33J 3B4DA 2X1FA 2LXFA 4DJBA 1H2VZ 3D6HB 2CJYB 4XTTA 2D74B 2ZJRQ 3HK2A 3WDOA 4NLUA 2GA7A 4N5SA 2WK4A 4J9VA 1FJEB 2KHDA 2XGPA 4B9SA 3PFOA 4NL5A 3PR4A 5IZHA 4UUXA 2FHKA 3KJVB 4YN3B 1TFWA 4M5DB 1DJ0A 1XMOJ 3R5DA 1JJ2R 3CCMS 5GMEA 4M5IA 4NA1A 2ZJQQ 5JUMA 3MTKA 3NCPA 4OJGA 2W7PA 2FIUA 1RHKB 2EBGA 1RA6A 2VZ9A 3DOMB 4W4MA 1DHMA 4L74A 3CT9A 3ETMA 1OWXA 2KI2A 3MPDA 1YHQS 3HZGA 1NCLA 5L9XA 1H7WA 2X1GA 2E9RX 1NK9A 3H40A 5GADI 2RS2A 4PWUA 4ZITA 4YDDB 3LPEA 5F8GA 1N8RT 4PZVA 1JLBA 1WWHA 2XM3A 3CDWA 3MCOA 2RIJA 2RF2B 3TWZA 2Z0GA 3MFIA 1HNVA 5F0WA 4EYHB 3IXQA 1S4EA 4AQYF 2D3UA 1U49A 2IM3A 4QR2A 1Q86T 4ZP7A 1WG4A 2WHOA 3ELHA 3TVYA 2MJNA 2VDHA 3M05A 4YB7A 4CH7A 4LIWA 2HFVA 5F8MA 2HQ3A 3AODA 2FVSA 3MM6B 1UZDA 1YJUA 9ATCB 5J2QB 1DTQB 4OYWA 4Y6IA 1RTIB 4OQJA 5D8HB 3JQMA 2Z2YB 4QU6A 2WVDA 2Q3PA 4CNYA 3EM1A 2VG5B 4HDGA 2VOOA 1RT1B 1VI7A 4Y0FA 2GQ2A 1OYDA 3FGVA 5ETOA 1V5VA 2D3OR 3X1LB 1WKKA 2IHR1 1N6QA 1WC4A 2A2CA 1U24A 2ZBQA 2YQ3A 4IH7A 2Q1LA 3NWGA 1SQEA 3UW1A 1IR0A 2NSCA 2XYPB 3M6UA 3AB4B 1BQNA 3O1LA 1WG1A 3VQTA 1DQAA 3QT5A 1TKZA 5F8HA 1VRUA 1HNWJ 3TP2A 2EK6A 3A12A 3VAIA 4TNOA 3HM9A 2DVIA 2M52A 3THVA 2CDQA 1UWBA 3IAM9 2H5EA 1LK7A 4DX7A 3QJPA 3AJ1A 2AWZA 5D4NA 4U7UD
chains in the Genus database with same CATH topology
5G4DA 5H9FJ 2CPYA 1Q7YT 1MWZA 3GV8B 1BWEA 2VOPA 4UOCA 3CGIA 3JSMA 4OJ3A 1KQSR 2EVZA 3V6KA 1R6YA 2PDAA 4WKYA 4NLRA 4FPRA 1U1NA 1AFJA 3HT3A 3D1QA 2YWKA 2A1BA 1I1GA 3BSAA 4TQRA 2Z2LA 3QIDA 2BQUA 4PRFA 4ZCKA 2MGZA 3I4PA 3CEDA 5A8KA 1NU4A 5A8RA 2AJ4A 1LFPA 3ZZTA 5FLXY 2B6AA 4TYBA 4PQUA 3D5MA 3FSIA 1AXQA 2VG7A 5DJBA 4WZMA 5F0UA 3OJUA 4I4BA 1MWYA 2FLPA 4O4RA 3DLGB 4RW7A 3SCKE 5T7LB 3C6UB 3OJSA 1U6BA 2JOQA 2MQLA 1TL1A 1B0PA 2FGOA 2GMJA 3AY0A 1HI8A 4U67Q 2QE5A 1JMTA 1A6LA 4NOHA 3G8TA 1JJHA 1FTCA 2E5JA 3G6YA 3F73A 3OVBA 4QIVA 4WFZA 2AGPA 1S1XA 2LEAA 4RKUC 4B9MA 3HKZD 3N6MA 4DV2F 3OTBA 1FXLA 1HBMA 2VFUA 3A1YG 4WFYA 2MZJA 3UCUP 1Y5LB 2L48A 3DOKA 1N32F 5BYSA 2YWHA 3H20A 1IJEB 1UAWA 4EBCA 1BC6A 3BM7A 4PWDB 2HHQA 1R8AA 1JLAA 5A6PA 5KT5A 4JV1A 1Y7PA 3WX4A 2HHVA 3ZZOA 1UW4A 4LJMA 2OPSB 3F41A 5EDWA 2FLOA 3SV3A 5DLGA 2EG1A 4YR2A 3M1VA 2AF6A 4OX7A 4J9SA 2VPYB 3O2IA 4CNZA 4YY3F 4TU9A 3J7ZT 2XY7A 1JKHA 1SJFA 2J6SA 2DO4A 5KFFA 4WU3A 4A8WA 2ZC4A 4ICLA 1RKJA 2EG2A 2K3KA 1Q8IA 3AQOA 2IVYA 5KFCA 4DL0C 5J2MB 4NMLA 1HBOB 4OV1A 4DV0F 2V8DA 3DRSA 2BRLA 2YWEA 4MIAA 2QA4G 3MM5B 3SDEA 4X4TA 4RW6B 4ETXA 3CO9A 4MIWA 1UMJA 2GMLA 1TP7A 2KXNB 3EZUA 1S9FA 1HHTP 4WFNQ 5KFOA 4YR3A 4DLEA 2Y1JA 1RAJA 1XR6A 4GC7A 3THTA 2YY3A 4WCEQ 1TR0A 3LP1B 4U7UK 2XGQA 2ZM6F 1YJNS 5J2NB 2F9DA 2I5JA 2C42A 1HW9A 3V6DA 1D8ZA 3FZBA 1UFLA 1KVIA 1FRIA 4URGA 2GO8A 2DGUA 1IKVA 2J6TA 2B4UA 1C1CB 3RRKA 5T41A 1NNDA 4FF3A 2OFGX 4ILRA 1UP1A 4KIAA 4LSNB 3DNCA 2HHSA 1TKDA 3I5BA 4EUVA 4KO0B 2D9OA 3S8SA 1S0OA 2UUWA 1W2BR 2AGOA 2VB6A 3OR2A 1XN9A 4C3LA 2J7UA 1FJCA 1SL2A 1OS5A 3L7PA 2XMWA 1M5SA 3RAQA 3CCJS 1TKZB 5LSLA 4QR0A 2VFSA 3QZ7A 3VZIA 1IBKF 5FD1A 3I31A 3ZC4A 3QWUA 1H38A 4K4WA 4K4XA 4ED8A 4IG3B 3G8SA 1FA0A 3IR6B 3G6ES 3CF5Q 4DN9A 2RD5C 4I1TA 2HVHA 2C2RA 1PILA 3HHLD 2P9CA 2N7CA 3IWXA 4DR4F 4I6WA 2K1RB 1T05B 1TUVA 3CD6S 2ZH6A 2J8AA 1WTBA 3HX9A 2G13A 4U9RA 1Q53A 3OL6A 3BGFA 1MNEA 3NNAA 1MMDA 1UWBB 1YG0A 1U6FA 4ZPVR 3CE8A 2F3JA 3H4DA 4Q2MA 4O3QA 4C8OA 5J2PA 4X4PA 2LVWA 3I0SA 1HI1A 3KLGB 2AJ1A 2BUNA 4KQZA 4N8OA 4QIFA 4CTAA 4M95A 4G6VB 5L1JA 4LF5F 5J1PA 2N7YA 2MKJA 2JEIA 3NRBA 3H4BA 1E6VA 2W7OA 4DR6F 3IS9B 2GQQA 4RNHA 2M70A 4JI6F 2RQCA 1VQ7S 4ELVA 2JVRA 4KKOB 4E0DA 5J1EB 3PY8A 4HT5A 5GADU 3JSMB 1KVJA 4O3RA 4X62F 1D9DA 2E5LF 4FF2A 3TUJC 1HWKA 1KTVA 3NGKA 2JZ5A 4NZ6A 3T5KA 3RB4A 3ETOA 5A8KB 4IO1A 3MEDA 4UY8T 2KTQA 4ZVGA 2B6AB 4J9NA 4PQUB 2FHOB 4G1IA 1SC6A 4ES3A 3SI8A 3DFEA 3PR5B 1UVKA 1QAXA 1T03B 1CG2A 4B02A 1LWFA 2GO9A 3QGGA 4RWWA 4ZVFA 3HP6A 3VTIA 4DS4A 1RYSA 4O3SA 1F9FA 1XBWA 2LU2A 2DK2A 4ZPAA 2AJFE 1TL1B 4QWCA 1LW0B 1DQ8A 1P27B 4C9DA 3PO5A 2JEJA 3VAJA 5KOWA 1RT2A 4M5DA 3K2YA 2ZKUA 3FMWA 2HW3A 3BN4A 4CO0A 4Q45A 1JLCB 1S1XB 2RQMA 4OX8A 4CCHA 3IA0A 2RE1A 3KOAA 5KFHA 3LUYA 3DOKB 3JTPA 4EFAC 5HP1B 2JWNA 4DL6A 1N5VA 3BEGB 2GQCA 4IDKA 5C42A 4ECSA 2Q43A 4H4OA 3RAXA 1R43A 1U45A 2BOPA 1NH8A 1ZM3A 1YJRA 1DRZA 4XAKA 4B08A 4ID8A 4DHVA 4FF4A 3CJ4A 3JTOA 2KU7A 1JKHB 3CJ5A 3NP5A 4OJ1A 3THPA 2M2BA 4RW4B 3SYZA 5E0OA 3OW2R 2MKCA 2L08A 4LSLB 3DRXA 1VQSA 1FRHA 2XULA 4CH1A 3MR6A 2LKZA 3PW4A 1SV5B 4X4RA 2MZ1A 1QSLA 4OJHA 2IAJA 4DG1A 2HS4A 4A8QA 2HAIA 1NK5A 2VBZA 1X8DA 3TX8A 4Y3CA 5U47A 5CXTA 3DI6A 2XI3A 2MKKA 4M94A 5E3CA 3ISNC 4HHJA 3FNNA 2XMMA 3HLUA 3CJ3A 2CJBA 4FP9A 4QR1A 2CJAA 4MTPA 2RSQA 1XR7A 2AYBA 3NMAA 2I5JB 4X65F 4QQBA 1HWIA 2IBOA 4IFVA 4F4ZA 2M8DB 2GNKA 3MMCB 3KLVA 4KGKA 1H7XA 1IKVB 4ZPCA 4F4KA 3QYYA 1TFYA 3VCDA 5THWA 2VA3A 4BWJA 1H98A 4QIEA 1YBAA 1K1SA 2VC1A 2APOA 1K1QA 3C8YA 3PHEA 2MZQA 3DU6A 3MHYA 4BHQA 1RP5A 1N5YB 2Q79A 3KMQA 1JLEA 3OR2B 2DHSA 2R8GA 2LEPA 2VONA 1CQMA 2ZE2A 5B0BA 1J2VA 2AGQA 3ICLA 1DTTB 2D9PA 3M8SA 1UFWA 1Y9OA 1FD2A 1K0VA 1JX4A 3UQSA 3NS5A 4X66F 2KG0A 2VV5A 2Z4PA 3OXFA 5B7WA 1VQ4S 1S77D 1RTDA 4PG8A 4B9TA 5DDPC 3KHHA 2DNMA 1BD6A 4EZ9A 2FHMA 2GFFA 2VG6A 1P1LA 4K5RA 2FVRA 4KE5A 4OZ0A 2QLXA 3Q8RB 4I69A 3G71S 3GSDA 3MWBA 1KLMA 4RNNA 4ZVEA 2MQMA 1RGVA 3I55S 1S49A 5L9NA 3EPIA 3E3XA 3N5FA 5KG4A 4WYWA 3UR3C 5J2PB 1TKXA 1YRXA 3FDSA 3P3DA 1F0XA 4CTAB 4OI4A 5J2QA 1KQFB 3SSRA 1AROP 2E5IA 1XNQF 3DLKA 5DM7Q 1N48A 5IS2A 3TA0A 1RTIA 3GQCA 2R7TA 1SJ3P 3I5AA 2VBWA 1Q1KA 1X9SA 2I9SA 2IA0A 1VC6A 3HHNB 4LFBF 3Q8PB 2KJWA 1KD1T 2XI2A 2MMYA 1TAUA 3DXBA 1FEHA 4DQIA 2OD4A 1GTEA 1TK8A 1LWEA 5CCMA 3VWSA 2UVWA 3CC2S 4B9NA 1NK0A 4WFBQ 1FT8A 4OZLA 1P1TA 3VAMA 3V81B 1FKPA 5GAHU 1FRJA 3I87A 4ED6A 2LEBA 4Q0BA 4WKRA 2VG5A 2GIRA 2V2KA 5DDQC 1HBUA 1Z4UA 4NYZA 4CT8A 2ZH9A 1QUVA 1IBLF 1RK8A 1RT1A 1WF0A 1FJ7A 3MEDB 2XC9A 2R2SA 1AFIA 4G3IA 4TYAA 3H59A 3B82A 4UQGA 2MY7A 2KFZA 1FXDA 1W2IA 2YNFA 3T6BA 1FD8A 1QAIA 4BS2A 5A8WB 1T3NA 2CIMA 5KTQA 3HVAA 1G1XA 2GHWA 5M2PA 1NKCA 3V4IB 2CQPA 2VQFF 3CCES 2OMLA 1XEZA 4ZS6A 3R1HA 3MUTP 1YRUA 1T94A 4GO5X 4WYLA 4OZNA 2ABYA 2J7KA 1KQGB 5F41A 1VQLS 5LL6d 2PN6A 1R89A 4JYAF 1UA1A 4Y34A 4ZK7M 1HW8A 3W2VB 2DNPA 3CMES 2DH8A 2ZH8A 1M0SA 1CVJA 4IDKB 3QLHB 4H4OB 1ROFA 3MMJA 2QV6A 3P96A 2RDJA 3CCUS 3H5SA 2VASA 3CTRA 4DSEA 5KFNA 5KG6A 2UXBF 4ZA1A 2KG1A 2NZ4A 2G0CA 2R9LA 1YJTA 1X4BA 4HVZA 3ZZ0A 5E3AA 1UJ4A 3SZ2A 2JLGA 4CH0S 5GAGI 2ZFHA 4IQXA 1WF1A 4NYPA 4YOEA 2VA2A 5K14A 5KFUA 1C0UB 1H6KX 3M8QA 2IRXA 2O67A 1X4DA 2LYVA 3OHBA 4YHHF 3DLEB 5FJ4A 1DARA 4H4MB 1XMQF 4IRDA 2C3UA 5KT3A 3M2UA 2DGVA 3AJ2A 3LWMA 2OPPA 4QWBA 5HLFB 4G1PA 5KFWA 3K0JA 5KFGA 2PA8D 2WB1D 3JTNA 1X4GA 2M5YA 4DR3F 4H4KA 3DI6B 2C28A 1LXJA 2XSJA 1TL5A 3OLAA 3TANA 2EK1A 4DUYF 5HROB 2IVMA 1ULRA 3JAMY 3GIKA 3KWMA 1B7FA 4NXMF 2DISA 1MROA 2B7CB 1Z2LA 4IFVB 2OTLS 4LF4F 1AW0A 4X4SA 2C3OA 3TNVA 4HH1A 4ECXA 4PUOA 2BE2B 4ILMA 3D0GE 4PXCA 3OVAA 3CJ2A 3CJKB 3BQ0A 5AXKA 2E1AA 2E1RA 4ERDA 1UVLA 1BGXT 3ENQA 3K5NA 1R0AA 1LV5A 4C3MA 3L7OA 3DU5A 4GC6A 2KZMA 4DL3A 2M8HA 2ZE2B 3BR9A 3LP0B 2UVRA 1CC8A 1XTZA 3GE9A 2J0XA 4OX6A 2YWGA 3R5AA 4K5SA 1IKWB 4A8XA 2DNKA 4YB1P 1S1UB 1U26A 3BQ2A 3K8WA 2CZ4A 2N4CA 5HI7A 1XMBA 4WE1B 4DQRA 2XLJA 1UVJA 2YWFA 1L3TA 4XDCA 3EPGA 4YQWA 2EFVA 3FCHA 4IRKA 2E5HA 2VBXA 2XMKA 3C66A 3AH6A 5G0RB 2AP6A 2E5GA 1LKZA 2EFNA 4NZ7A 4FBUA 5I4MA 5I3UB 1JLQB 1JIHA 3JSBA 3J80Y 1SIZA 3CCWA 2XNQA 2ZKTA 2FGCA 3DLGA 2ZHBA 5T7LA 2V9KA 3BO4A 2GX8A 1RTJB 2AU0A 2G4BA 2YNIB 4PG4A 3OSNA 4TU7A 3V6HA 2ZZNA 2B4PA 2E66A 1N5QA 3DLKB 3M2RB 2PD1A 2VKZG 3I96A 7FD1A 3RW7A 2KVIA 5E2QA 2XS7A 4IKAA 3GWCA 1G3OA 4L72B 1BQXA 1OIAA 3H98A 2XWYA 4Y2MA 2FVQA 2RMLA 2XLKA 3Q2TC 4D3GA 4FBTA 4E98A 4Y65A 1QUPA 3TA1A 4RNOA 1YQHA 2FVPA 5C25B 2R7WA 3D1OA 3FRYA 4DR1F 2AYGA 1N52B 3AAWB 1KONA 1FKPB 1N5TA 3ISND 4OI2A 4QPXA 2LA6A 2WSEC 2C2EA 4Q0BB 3UR0A 2OPSA 3B8HA 2HVZA 4I0WA 2E9ZA 3UCGA 1RI7A 2MZSA 3BREA 1GX6A 1N0UA 4B3RF 5CQGA 3UCZP 3BGRA 4HTIA 5DGAA 2NXUA 1KRPA 2BM0A 2XG8A 2LDIA 3PNIA 1M5VC 2FC9A 4KB7A 2V4JB 2CKWA 3N9UC 4Y28C 1QLNA 3S1TA 2A18A 2VD3A 3MM5A 3T6JA 1DFDA 2O01C 4TY8B 4RW6A 5D3GB 2QMXA 5DM6Q 1TK5A 2IFXA 4X2BA 4A8YA 3US5A 3PX4A 4JV5F 4BC9A 2ROGA 2LXIA 1DBDA 4IOBA 4O44A 1FVQA 3CCZA 4Q7AA 3KLEB 4C0OC 3BDPA 2WSCC 1K73T 2DGTA 3OTDA 3M30B 1B0VA 1C1CA 2AYEA 3I0RB 1C4CA 4AXJA 4NLXA 4B9UA 1D9FA 2BM1A 5B0DA 3ZFVA 1R8BA 4WJBA 2ASLA 2PGCA 4KO0A 2K8GA 1F5CA 1JJ4A 2VPZB 2CFXA 4NLOA 1SKWA 4DN0A 5LT5A 3DLJA 3M8QB 1HBNB 1NJYA 4NRTA 1DAXA 3S7RA 4X4VA 2ZH1A 3R5CA 2BXJA 5HMXA 3UPFA 2M9KA 4KV8A 3UNGC 2U1AA 4AXIA 2Q66A 1EETA 2XNRA 3POTA 2CZVC 3D2WA 4NLGA 2R2UA 1JXEA 1VQOS 4GKJF 2B4VA 1W25A 4IG3A 2C22A 4TU8A 3GFYA 2DH9A 3OL9A 2FHJD 3AHPA 1APSA 1DLOB 3FJ2A 1G2EA 2OP5A 2MSTA 5LJ3Y 3B4MA 5KG7A 4ED0A 2DHGA 3H5YA 2K1RA 2BW2A 2XSJB 3FFIB 2DD8S 1T05A 4V19J 2R8JA 2ZDOA 2HHPA 3J81Y 4OZ1A 4F50A 3K7RA 1H2UX 3G86A 2OJ3A 1VQNS 4ZHRB 4LF8F 1X4HA 5LJ5Y 2RU3A 3NNHA 2OSQA 4G1QB 1YI2S 1X4AA 4ZCIA 4JI3F 3KLGA 2CJ9A 2O3DA 3PFEA 2E44A 1VQ6S 1M5HA 1WEXA 2MSSA 1FTRA 3OL7A 2IC3B 3MEGA 4R5PB 4QU7A 3VR1A 1S7HA 4XPEA 5C24B 2SXLA 1CEZA 2VUGA 2MYFA 3OHAA 2ZJPQ 2HFOA 4HTJA 4A8KA 1F5BA 4MH8A 2KXFA 2P5VA 4KKOA 2B56A 4A4JA 5J1EA 4ED2A 3J7A1 3L09A 3LALA 3SCJE 3X3UA 5EN1A 3GG0A 2KRRA