4PYDA

Moac in complex with cpmp crystallized in space group p212121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
142
Chain Sequence
AHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGDFKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
pubmed doi rcsb
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein MoaC
total genus 35
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4pydA00
4PYDA 2IDEA 4PYAA 3JQJA 2IIHA 2EKNA 4FDFA 1EKRA 2OHDA 2EEYA 3JQKA 1EKSA 3JQMA
chains in the Genus database with same CATH superfamily
4CO1A 1I1GA 5BYQA 2RE1A 4A8SA 3CD7A 3AB4B 3K0JA 2KFZA 3P6YC 1T9YA 3ISNC 1NAQA 2DIUA 3DLEA 5C42A 3OFHA 2LQ8A 1RSCA 2YWKA 3PX0A 2BE2B 3PJ9A 4DQSA 4MK9A 4ILMA 2HHTA 1BE4A 4JI3J 2QMUB 5KT4A 4HDGA 3MUMP 3LOUA 4ZVSB 1I51B 1OYDA 3W9JA 4I6AA 2HGMA 1EKSA 4Y3CA 5CCMA 3IS9A 3W3SA 3MEKA 1OMSA 3BGFA 4F26A 4BS2A 2IRXA 1YLXA 2RILA 1MU2B 2DH7A 2WAQD 1Y7PA 2MSSA 2XMUA 1Q7YT 2N4CA 1QSLA 2M88A 4IRCA 1MU2A 3OPKA 2ROPA 2GJIA 3GCWP 1RAFB 1YBUA 4C8LA 1URNA 2Y8YA 1TKXA 1KHWA 4LSZB 3SIPB 3E8OA 1AYEA 4P2XA 2BQ3A 3PYEA 4HHJA 5CYMB 1QVGR 1UVIA 3OTOJ 2OI2A 1KRPA 5KFYA 3TZXA 4USMA 1PGZA 2L08A 2VQEJ 4EYIB 4I67A 2MQOA 4ETZA 2ZOFA 1REVA 4Y65A 3MR3A 2YBVA 4QIWD 2VIHA 2FVCA 1ZYQA 3TAQA 1AUSL 2GHVC 3NAHA 3TYTA 3IFEA 4OHVA 4PXEA 3IN5A 2RQ4A 1SJQA 4DR3F 2ASDA 3NGDA 2AJ1A 3HF5A 2D9PA 3TZYA 1TKDA 1HNXJ 2A6MA 2VA2A 4I7FA 1JLGA 2AZ1A 1XBWA 4R5PB 2JHEA 3EM1A 3VWSA 1IKVB 2XEXA 1DURA 4TY8A 1IKXB 3CDWA 1M0SA 3GYNA 1R7IA 1X9WA 4DUZF 5IT9U 3FDSA 1U4BA 1EJ7L 2AF6A 2VPYB 3HHKA 2MEWA 5EDWA 1NKBA 1SV5A 2H54B 1JJHA 1AA1B 2YQ0A 4DUZJ 1FRXA 1FHTA 2WBRA 2G1HA 4P73A 5IC4B 2KFYA 2LEBA 1ZPVA 3CJ8A 2RRAA 3QFHA 4KH0B 4NLXA 2D74B 5I3UB 2VF3A 1HI1A 3EJMA 3KK1B 1QDUB 1BQXA 2UV8A 3Q8RB 1HR0J 2MKHA 3JYTB 2VC0A 2IY5B 2HS0A 1QY7A 3BQ1A 1CVJA 3IBWA 1TV6B 2FHJA 3M2UB 5L9XA 1U2RA 1REVB 2IM3A 5I4MA 3JQKA 4NXNF 2J0SD 3DGPA 2G0JA 4UF4A 1JLQA 3ZZPA 1RWUA 4L76A 5AXKA 1OPIA 1B4SA 1S99A 5ETSA 2OMLA 2J0XA 3GIJA 1DJ0A 3LO3A 5D3GB 4X2BA 1UWBB 3PYGA 2D3OR 2G2ZA 4NLQA 2EFPA 3UDCA 1YRTA 2AEFA 4DUTA 5ADZA 2K3KA 4JV5J 2GIRA 2Q3PA 2H48B 3ENWA 1NK4A 4MAKA 2HWHA 3BO3A 3R2CJ 4WF9Q 4L75A 3Q8YA 4OZJA 3FSXA 2R8GA 1C0TB 2V4JA 4DU7A 1RHRB 1ZA2B 1ZAWA 3A8JA 2E5LJ 1C1CB 2PFDA 1B7YB 4E2FB 3PIOQ 3OSNA 1VQ9S 3HO1A 2AYGA 2GAGC 4TNOA 4ZS6A 3QJLA 2DNLA 1X4DA 1CQMA 1NDKA 1FEHA 2C2KB 2DNOA 3JTOA 3KLIA 3PFEA 3B8HA 2MKKA 2ILZA 3Q8SB 3GJTB 4DS5A 1RXOB 3VV2B 4X62J 4ECSA 2BJEA 3FCHA 2BW7A 1X4HA 1YJWS 3H7HB 1VRUB 2YNGB 3L3CA 2CVEA 5T7LB 3ILOA 3AOCA 3FZBA 3PACA 2DYAA 2JSXA 1RT1A 2CG8A 3I56S 4RW7A 5AE1A 3W2VA 4JI6J 2I9SA 4JOUA 3UDLA 1U6FA 2HFOA 4Y2IA 2EBEA 1H7XA 3KDNA 4J9OA 1RKJA 1HBNB 3AJDA 4LF2A 4ZCLA 3A3NB 4NYPA 2A10A 2RT3A 1SV5B 2QLWA 3AODA 4CO0A 4JV2A 2XI2A 1RT4B 2WK4A 3TR5A 5I3PA 3HJVA 4K4ZA 4WXWA 3R6GB 2NXCA 2PC6A 2M5YA 3GR0A 2XO6A 1S57A 3IG1A 1JLBB 1A0OB 4C7QA 2RIJA 4OX8A 4G3IA 4OYZA 2FY1A 2JDJA 2CJXB 2GA7A 2HAIA 3BO4A 3PCOB 2RF2A 4BLGA 4LF5F 4ANDA 3DNCA 3C8YA 1U25A 3OXFA 1VQ4S 3T19A 2ZVSA 4C6AA 4MYTA 2XC9A 1RLDA 2VFRA 3TUIC 8RUCA 5KFSA 2QG9B 3GILA 1RISA 2CKWA 2AMCB 1IJEB 2MKYA 1XK8A 4C11B 2YNGA 2V50A 1JMTA 1YJNS 1ICEB 3W9IA 2LKZA 3NS5A 4P72A 4O3NA 3VAGA 1HFEL 2V2ZA 3BPSP 1DAXA 5DZ6A 2NZCA 3DU5A 3VAIA 2ZFHA 1Z2LA 2I8EA 3KJNB 3VGSA 1RAEB 2C2OB 1Z2ZA 4MFBA 4C4WA 3MCMA 1UPMB 1X5PA 2LMIA 4C0OC 3W63A 3GSIA 4DR4F 2JEFA 2GHPA 2WZ1A 3TZZA 4PPZA 4GKKJ 1U0SA 4LRBA 2B9YA 5KFCA 1WHYA 4OI3A 2IC3B 4X66J 3ZNJ1 4LF4F 2WONB 3V4IB 1U1KA 4N77A 2MLZA 4ED1A 1IKWA 1X31C 2NUHA 5FLXU 1JXVA 3KLEA 4USHA 4F50A 2UP1A 2OSRA 2J0WA 4PWUA 2F4VF 3CDEA 3BQ0A 3MM8B 3M8QA 1QAYA 2MKCA 2ZC4A 2M0GB 4C97A 3A1YG 3EYZA 1X4CA 3ICLA 1TUWA 5THWA 2E9TA 3NMRA 2NXJA 1MMNA 2ZDOA 3LGNA 5FIIA 1KBRA 4EGLA 3M8YA 1U2FA 2MJNA 3NL0A 1Q5VA 1R43A 2AP6A 2LLZA 4PABA 1E6YA 4GKJF 2VOPA 1GH8A 4OYPA 1EIYB 1QJHA 2UXBJ 1T0TV 2HRTA 3SQGA 2RMLA 4AXJA 4FBTA 2V8VA 1X9SA 2OPRA 2Q1LA 3CJ0A 4ZVQB 4DJBA 2PD1A 4G1QB 4IG0A 5ETKA 1VBKA 3FNNA 3OV7A 4ED7A 1TK0A 3BR9A 3TRGA 1G4CA 1TL3B 2CAJA 1JXEA 3MMCA 3KHGA 1HMVB 2VFUA 4U7UK 3IMQJ 3ILLA 3TUZC 4XIUA 2XLIA 1HBUB 2N3LA 5A76A 3TAMB 4B3OA 4P9SA 5AXNA 2E44A 4OYIA 1XIQA 5L9NA 4R0EA 4JI8J 2R7XA 2VG7B 2DNMA 2HK3A 2DGXA 1AXQA 3KLHB 3G6YA 1UFKA 1ZZFA 3LP1A 3G71S 2DO0A 3ZO7A 3I4HX 4FKXA 4KHMA 2FGCA 2IVYA 3TAPA 2AYMA 1SJRA 4LF1A 1J2VA 4Y34A 4XO0A 1VDHA 4I7FB 1RT1B 1U24A 3AQPA 2AU0A 1TAUA 1UW9A 2BDPA 2UXDJ 3NEKA 4NXMF 2ZNZA 5AXMA 4CLZA 3ETOA 4YR0A 1VJQA 3DKDA 3M32A 2ZBIA 5D0RA 3NKYA 4Y2CA 5KG5A 3CD6S 5FDLB 4N47A 4HEA9 1FTCA 4ZLJA 2AV5A 3WBZA 4FYVB 4UZCA 1CJVA 1LXJA 2Z58B 5HI7A 3WX8A 4FF2A 2AX1A 3CUNA 5J2PA 5HROB 5AJ3J 3FK4A 2MB0B 1HHSA 3O6QA 3LF0A 3VZIA 2LA6A 1R6YA 1CS4A 2QA2A 1XR6A 3DMJA 2KYXA 2MPUA 3TA0A 1WTFA 1FRKA 2R8HA 1YJ9S 3EGWB 1NO8A 3DYAB 4R0JA 2GJFA 4MYUA 3MCSA 2MY7A 2LXIA 3T1YF 5HAOA 1UZDA 2V2QA 3M2VA 1U1NA 3R97A 1NK0A 1YX2A 3MURP 1WDDA 2UXBF 1NHUA 2RHSB 2DNYA 3D66A 2B8PA 3DLLQ 1F9EB 3I31A 1C0UB 4TY8B 3T6JA 3Q8UA 3B82A 3I0SB 3BPDA 2BOPA 1YBTA 2CQ4A 2GVDA 1XTZA 3QIDA 2B4VA 3QWPA 4P2MA 3UO0A 4LRAA 3EZ5A 3W2WB 1X5TA 4DR3J 2HHPA 2NUUG 2R2UA 4OHXA 5HP1B 4JYAJ 1N5TA 4PWDA 5L38A 2AYEA 1EETB 1KN6A 1RTHA 1T3OA 2CQ2A 3G6ES 4LR7A 2PA3A 4AE5A 4FXWA 3DYAA 2YX7A 3MUTP 1NXIA 4OHWA 5E5NA 3DRRB 4K2XA 2PA8D 2COLA 2W2MP 1VBXA 3NGSA 2V4QA 2Y0BB 3U1NA 4EZ9A 2XY6A 2LEPA 4DR7J 3HLUA 1AFIA 5HMZA 2BJ1A 3DOKB 4P75A 3ISZA 2JZ5A 1U45A 1J5OA 1K0VA 3CIMA 4O0NA 1HNWF 1YZ6A 2O1PA 2VB6A 4JB8B 5LT5A 4Y0FA 2LQ9A 1FD8A 2N82B 2W2OP 3M2RB 4KGMA 1D8ZA 2W1BA 1HR0F 2VPXB 3C15B 4HACB 2ZBRA 4NMXA 3BGRB 4ZIWA 3CPWR 1EKRA 1GAOA 2B6AB 4IOAQ 4NXNJ 2AJ2A 5LJ5Y 2F9DA 4OJ3A 1YKWA 2OKQA 4G1QA 5A0YB 4IRKA 2OSQA 3FKBA 4PAAA 2ZUGA 4QW9A 2R7RA 4RBVA 4RU2A 4L74A 2E9ZA 4RBUA 3SFGA 1N32F 1VLOA 4CO2A 3ZTOA 3H0PA 1VQSA 3TWZA 3ZZTA 1KTQA 1JXLA 1UVNA 4I4BA 1NCLA 1WNEA 2AEMA 3ADAC 4HTJA 4DV2J 1R0AA 2VG7A 2RDJA 3POTA 5J1PA 4ZPVR 2DIVA 2IYIA 1VGYA 4ED2A 3ZXWA 1KHVA 2H65B 4PG7A 1VJWA 2DHAA 3MEEA 2J7KA 3EVOA 4FPRA 1BQNB 1SIZA 3LGMA 5LSRA 1NZ8A 3U1MA 3U27A 4DX5A 2XWXA 3H5YA 3O1LA 1K8AT 4OHYA 4H4OA 1VIXA 1R8CA 4KGVB 2FJVA 2C3PA 4B3TJ 2JC1A 3KDOA 4DR4J 2QN6B 3W5XA 3KHRA 2A0FB 1S72S 2JJ4D 1N5SA 3GR1A 3SQGB 3T5HA 2DNNA 2RB7A 5FDLA 1LW2A 5KG6A 3NWRA 4PYAA 4X66F 2WTFA 2W4DA 3KG4A 3H2VE 4ID8A 1RHMB 3ISND 3J7Z5 2VG6A 2QO3A 4CO3A 1XC9A 4IYQA 3PW5A 4LMZA 2B51A 4QWEA 1CJKA 3T5JA 2XGPA 3EXYA 1FJEB 2VDHA 1Q4RA 1VC0A 2YH1A 1WOPA 1KC8T 4GVBA 2ZZMA 4NLDA 2IJNA 4WFYA 2J76E 5D6GA 3IP0A 5GADI 1SC3B 3GQCA 1RBLA 3DRPA 4CLYA 4CLSA 3Q86A 2H1YA 3HZGA 3LP0B 4LFBF 3D28A 3HDSA 3CO0P 3NLCA 3K58A 5HMYA 5GMKa 3FCWA 2OJ3A 4LQ3A 3THTA 5DRKA 2XYHB 5DO2A 1S0VA 3MWBA 1GNKA 3RG6A 5IOLA 3CJKA 1FFWB 1SL2A 1ROFA 2BX6A 1E6VB 2Z2MA 2VKRA 4NRUA 4WU2A 1UWBA 3FGVA 2N7CA 1FFGB 3K5LA 1OWXA 1YTYA 3OW2R 3Q2TC 3AJ2A 4A8MP 4FP9A 2VKZG 5K8OA 3SV3A 1CJUB 2UUAF 1FX4A 3CJ2A 1YRUA 2B3TB 2CNOB 4ANEA 4DV1F 4IG0B 2V8PA 2Q6CA 4RO0A 3MEGB 5CZVA 3V81A 4LF5J 1NJYA 2EFNA 1ZM4A 1BWEA 4RWWA 4DUYJ 3M1VA 2VBWA 1IVZA 1B64A 1Y5NB 1F6TA 3EDRB 3EMTA 2MJUA 3VAJA 1LWEB 1P9QC 5D78A 2L9NA 2XMJA 4Q5VA 2C3UA 2Z30B 3V6DB 4FYDA 2IHR1 3MD1A 2FD2A 2YH0A 3G82B 3CDUA 1HL6A 2IDLA 3H90A 4ZVOB 3CC7S 2G2OA 3KMQA 4IFYB 1K9MT 2FVQA 5IT0A 1JJ4A 2OD6A 2HBRB 2P9GA 2HRYA 2W9CB 1R89A 5H9FJ 4WKRA 4ECYA 2EK6A 1BC6A 3C19A 4X64F 3UVJB 2GGPA 4IG3A 1NBEB 4LJMA 1VBYA 1KQGB 1CJUA 2CXEA 1NHVA 2EWHA 2RS8A 3CO9A 3ZTSA 4FVMA 5IT4A 2Y1IA 1VLYA 1IKXA 1R8AA 1TQLA 1T9WA 3CDAA 3DU6A 3BKUA 1DFDA 3F44A 4MFBB 3G8QA 1S49A 2UXCJ 2RAQA 2OMOA 4CLKA 2CPJA 1HMVA 4X4PA 2J6UA 1VQ7S 5CABA 4Z2XA 2PEBA 1EZZB 2J8SA 3QAUA 4DR5J 1VC5A 1U8SA 1WKLA 3EVMA 3M30A 2O67A 2J7WA 2LQJA 2W2PP 3CT9A 1FXDA 3L9ZA 2Z2YB 1VMBA 8AT1B 3RTVA 5HLFA 1VQMS 3T9ZA 2QA4S 1D09B 2K3IA 1WELA 5B0GA 2DBBA 2VFVA 4DI6A 5KFAA 4Y6IA 2B9EA 1DLOB 2HSEB 3E51A 1QD1A 2QX0A 2YKNB 2BJ9A 2G9OA 5B0FA 3OFGA 3BYPA 5A8RA 5J1EB 3DHWC 3OTOF 4ELVA 5BJRA 2V4RA 1RHQB 2I5JA 1YGYA 5KFKA 1T05A 2OPSB 1XNRJ 2C28A 4OX7A 1RYSA 3PJWA 4DFPA 3S6EA 1S59A 3QJPA 2OFGX 4WK3A 4C8ZA 3M2RA 3TJAA 4KC5A 3CCUS 5GAGI 4WFBQ 1CULB 1T9VA 3TUJC 4YB1P 4OJ1A 2M70A 1LEOA 5IT9Y 2FVSA 1IM4A 1DQAA 1FWLA 3ITHA 4C3LA 5EGYA 2OEJA 2RU3A 4PQUA 1S1VA 1W26A 3AOAA 4PPDA 3KK3A 2VBZA 4CO4A 2UXDF 2HQ3A 1VS3A 2XULA 3OR2B 5C7PA 5KFOA 4KHPJ 5IWAF 5KFPA 4P7VA 3W64A 3CJTA 1DTQB 4U7UD 3NBPA 4CP5A 1U47A 5C24B 2ADBA 1J5EJ 2RS2A 1LOUA 4IFVB 1HQEA 4ZJLA 5BR8J 1BHNA 4N7TA 4ZN1A 5E41A 1OQ3A 1PJ6A 1S4EA 1IBKJ 3MCOA 3TI0A 1MLAA 5JXSA 2N4DA 5ETPA 5A8WA 1NSAA 2VJUA 4USJC 3SI8A 3PHEA 1NLKL 2KHDA 1MMDA 4DV6F 3AD8C 1LNQA 3BKFA 1F5CA 1RA6A 3CC2S 1NH8A 2DHHA 2XMTA 1TK5A 1N32J 2RQMA 4I6YA 2LVWA 1V9OA 2H3EB 1UP1A 2KXNB 1CULA 2YPYA 3M8SA 2YKMA 3ET6B 2YQ1A 2ZD1A 3C3LA 3NNCA 2IYGA 1K44A 1X4FA 3HHLD 4B08A 5BXIA 2QFIA 4OX9J 1QM9A 1WG1A 3LUYA 4P71A 3HSJA 3R6LB 4EO8A 4L3NA 3K5MA 3CCMS 3M6VA 4ECWA 4E0DA 1N88A 1PBAA 4LSNB 3I4PA 3A8EA 4C3MA 2F4VJ 4FNHA 2EI5A 1H6KX 2RD5C 3QSIA 1JB0C 3VVTA 4MIAA 4X65F 1OQ6A 2W8KA 2R7QA 3HHLB 4OV6A 3PM9A 4ZPWR 2CNKB 3R7NB 2JEJA 5C42B 2E5LF 1FRJA 2H9ZA 3I32A 4YY3F 4DQIA 1AFJA 3S8SA 2BANB 1GFWB 2BE9B 4QW8A 3DGVA 1JLAA 5HJXA 1T95A 3BGOP 5CQGA 1IQTA 2V5HG 2Y3YA 2HQDA 4MKVA 4J9KA 3N0VA 3FQLA 5I42A 2FLNA 3RB4A 4J9LA 3GFHA 4OZLA 2AEJA 1N36J 2HEKA 4M63A 5B0DA 2VH7A 5KFRA 1IBMF 3HPOA 1RHJB 3MTKA 3IR6B 2PEHA 4IQMA 1KEKA 2H4WB 1NHKL 2KN4A 3W66A 2CYYA 3OTDA 4ICLA 2ZH7A 2GJ2A 4QYZJ 1TU0B 1IBMJ 2AWZA 3ITHB 2XTJP 4J9PA 1P9YA 1BQMA 3U7JA 3W60A 1UAWA 2XS2A 2VPWB 2ZWOA 4LFBJ 3CF5Q 4CLWA 3KUGA 2FPHX 3O2IA 4EEYA 2DRBA 3I55S 3U1LA 1M5VC 2EFVA 4HL9A 5AE3A 2I2YA 2UXCF 1TKTA 2CFXA 2YWHA 2ZNYA 1QTMA 2RQKA 2Y0SD 3GIKA 2C3MA 4OYAA 1PSDA 4WP3A 1B0PA 3TA2A 4RWXA 4CDIA 4C98A 3TX8A 1UFWA 2QTWA 5B08A 2C2RA 3LH2S 4WK1A 3OL9A 1UZHA 5IXUA 1CLFA 3DOMA 1BUXA 3D2WA 3DLEB 3LW5C 2VU5A 3I87A 2B43A 4EBCA 3GONA 1VYAA 5T7LA 2R8KA 4XDDA 4FDFA 5H9EK 4NEYA 3MM5A 4K50A 2RQCA 2ZH4A 2K1RA 1WC6A 2HMIA 1R3NA 4HACA 4LFAJ 1RTIA 1S9GB 3M6UA 4C2MA 3BBFA 1NJWA 2HQIA 1IWAA 1S9GA 2QIFA 1FKPB 1KFDA 4TU8A 1RTJB 4Q8EA 2Q6BA 3C66A 2E7VA 4PWWA 1N52B 1WWHA 4RW8B 5EX3A 1RAAB 3Q83A 1TL1B 1WORA 5F9LA 3GV8B 4C9DA 1VRTB 2BE7D 5ITHA 1RTDB 3F0NA 3IO1A 4NEZA 4DZ6A 4P2FA 4ZDNA 2MYFA 2HQGA 1S1XA 4YDDB 4K4SA 1Z4UA 3POTB 4QYZK 1NKCA 3D6FB 5AT1B 3TX0A 4WIQA 3OHBA 4ED6A 2C42A 3BYRA 1RT5B 2FJEB 2NYIA 1YZ7A 2DGSA 2V69A 5HJYA 4L3KA 2C2EA 2H4YB 3DRXA 2J6TA 4B3SJ 4K7QA 2KM8C 2KXFA 2EXUA 3QGHA 4FPIA 1HNVA 1T03A 4OI4A 1UMJA 4BWMA 2EPIA 3L09A 2YNFB 3FSYA 3I0SA 4NLSA 2AZ3A 4CTAA 4RNMA 3DXSX 3W5ZA 4B3SF 2G0CA 2R42A 1XQIA 3UN2A 1M5OC 3QNWB 5KFLA 4RW8A 1WOOA 3JXOA 3FUYA 3PG9A 5F8HA 1QLNA 2YKPA 1S1UB 4ZKAA 2W01A 5F3TA 2EKNA 3SXLA 1FK9A 2KYZA 3N79A 1X60A 3D7SB 4G6VB 2BRKA 4DBQA 3IG1B 4DR2J 2NZ4A 3TUPA 5L46A 3D0HE 5KT7A 2QJ3A 3QGPA 1Q53A 1TVRA 2IVFB 1YK9A 3AOBA 3OD2A 4DN9A 5GMEA 4DFKA 1OO0B 1S1WA 4DG1B 3RR8A 1YWXA 1NU4A 3QMQA 3AY0A 4LIWA 4ZPCA 3TJ8A 3OTBA 4A8OA 2EVZA 1LW0B 2AT1B 1BY9A 3FQKA 3TQEA 4QU6A 1NK7A 1Q8LA 3KKFA 4ZVRB 3GFXA 1G7CB 1B70B 3MGJA 4CM2A 3NOGA 2L41A 3TW0A 5HANA 4F02A 3P4UB 2HHXA 1C4CA 2FJWA 3BV8A 3OJSA 1RHUB 4UTGA 5HMWA 4O3OA 3BB5A 2HNDB 2V94A 4P6QA 2FLPA 4B9LA 3W2WA 4YDXA 3PW4A 4DXLA 4KO0A 4JI0J 4ALZA 2WVFA 2EEYA 4MIBA 1UVLA 2ZJQQ 1JJCB 1MWQA 3JQMA 1FKOB 1RB0A 3GFZA 1SKWA 1APSA 4QIVA 2KH9A 1GTHA 4YQWA 3R7BB 4QIFA 2L48A 2RJZA 1OY9A 3CJRA 1ZBTA 2X1GA 3IM8A 3CC4S 4IQXA 3GV5B 1N33F 2ALYB 2GNKA 4KR0B 4EWTA 2N3OA 1TVRB 1JLFA 3SDEA 1ZH5A 5AJ3F 4C0BA 4J9SA 1BXNA 3D54A 1WHWA 4HLBA 1NPPA 2XGQA 2AJ4A 1VQYA 2EFGA 1RWVB 2HNZB 4A8WA 1VQLS 3X3UA 2XG8A 1H98A 4B9TA 4NLGA 3OFEA 3MMBB 1RQ0A 4JV0A 4CLLA 3VQSA 2V9WA 3Q0AA 2R8IA 4WFZA 4OYMA 2M4MA 3NY0A 4NCBA 5JJBA 1ULRA 3FEZA 4OI1A 2DNZA 1WG4A 4W92B 3DGPB 4FN5A 2QE5A 1IR2A 5KG1A 4CWBA 5KT6A 1U1RA 3R7SB 5D15A 3BBBA 2RSQA 4NLYA 2VONA 2WSEC 2CPZA 1S1VB 4KHRA 1W2IA 2KFNA 2FJBB 2WB4A 1FFSB 1LWCB 3OTCA 1PIEA 3ZTRA 3GV7B 3CVKA 1TKXB 3VGUA 2HFSA 1RTJA 3AA9A 2CADA 2HVDA 3H2UB 4KB7A 4WTYA 1UJ4A 4F4AA 3Q8PB 4B3OB 2B7BB 3CCZA 4U95A 1VBZA 3QRPA 2DCLA 3P5TL 5KFWA 5L1KA 3VCDA 2EC2A 4ZPBA 1FNMA 1WC4A 2C2ZB 2WSCC 3M05A 2DNRA 4RJVA 1IQZA 1H2TZ 1Z1ZA 1QAXA 2F63A 3HD1A 2Z2LA 3N6MA 2PGCA 1J27A 2FHOB 1DLOA 4IDKA 3J7A1 2W9CA 4ZN3A 4JI2J 3LP2B 1JLGB 2DRDA 5KT2A 2VBYA 3H25A 3FRZA 3MM6A 2OPSA 2GFFA 2L3MA 2MY8A 4JI0F 5CA5A 5BR8F 1RYRA 1CSJA 2X1FA 1WACA 1QVFR 3HFKA 2B4PA 1V5VA 2I6WA 4F36A 4RL1A 4CLPA 5JMNA 1C2PA 1LW2B 3ZZ0A 1DQ8A 3MMAA 4E98A 3IBCB 1NH7A 4OZNA 4PXBA 1UA0A 4ELTA 4LSLB 2DXDA 2WONA 5CCLA 2Y1JA 3LQVA 1HNZJ 4A48A 2V8GA 2KZZA 3G6VA 1TKTB 1WF1A 3V5RA 4ECXA 1MG7A 4N41A 1RT3B 2LXUA 1ITPA 1KLMA 1O8BA 1WF0A 4ED4A 2HQCA 4LF9F 1LWXA 3H98A 1IKWB 3PKMA 1KLMB 1X4BA 4MK8A 4B3RF 3OL7A 1AT1B 1SBRA 1J5OB 1S0NA 1DQ9A 1Q78A 3I82A 3UCZP 4DR1J 1FXRA 3FFIB 3L7PA 4O4GB 2X7IA 1RT6B 4ZCKA 3PO4A 3V6HA 4F7VA 2AGPA 3BDEA 2FYXA 2O66A 1JQGA 3HFZB 4WYLA 4DR1F 5KFDA 3KLVA 4DV0F 2QL5B 1RHKB 1FDBA 1UW4A 4CIOA 2OAUA 4DF4A 3X1LB 2MQNA 2X1BA 3LTOA 3MHYA 4NLTA 4ZLLA 4KV8A 4PKDB 3BF4A 3R5JB 1HWIA 4QWBA 4WIIA 2PT0A 1WC0A 3CCJS 2UU9J 1HBOA 1JLCB 2LP4A 4K4XA 4I2PA 4DPTA 4C8YA 3I0RA 2WVBA 3CEDA 1RAJA 1JLBA 1H74A 1U26A 3OR2A 4EFAC 3R3TA 2OPQA 1D8YA 3TO8A 1NDLA 2ADCA 2E1CA 4MH8A 2IPOB 1VI7A 2PI4A 1X9MA 4YN3B 3K7RA 4RUCA 3AQOA 1SQGA 3EE3A 1PO6A 4RX6A 4NLRA 4K4WA 1WG5A 3DDNA 3QLHA 5F41A 3T41A 4AT1B 1BQNA 2JL9A 2BKNA 4YB7A 1R27B 1CJTA 4Q45A 1UL3A 2ATCB 2FJAB 2OFHX 3G2XA 5GMDA 4RW7B 5HQ8A 4KH1B 4ZHRB 1AW0A 3WHIA 3RJMB 2VASA 3IR5B 1RU1A 4MTPA 3GG1A 3HSGA 4RW4B 3M8RA 3MD3A 2BW2A 2DB1A 2Z56B 3N4WA 3THVA 4V19J 4M5NA 3UDEA 1NK5A 1T94A 1Y0HA 3CD5A 2OPRB 2LFVA 5C2CA 4FXVA 2M9KA 2M52A 2YNHB 3FCVA 4PG5A 1JLEA 4GC7A 1NDCA 3OLAA 3N6NA 4KY3A 2OIHA 2NCKL 3QSYB 2BKOA 2KTQA 2E1RA 2Q79A 1EP4B 2YVSA 3MR7A 2E5HA 1HI0P 4B9UA 2JEIA 2V63A 4F2RA 2YNIA 3GFYA 2ZVIA 1UEUA 2LDIA 2RF2B 3D1OA 1R8PA 3RB3A 1L3UA 1H38A 4JV1A 5H9FK 2DHXA 4DSIA 3TEGA 2W25A 1KKHA 4Q0BB 1Y5IB 4WU3A 4NZ0A 1KVKA 3WDOA 4E8UA 2ZZTA 2EBGA 3IAS9 4IDKB 3UD4P 1T05B 9ATCB 3RGIA 3IS9B 3SV4A 3TP2A 4W90B 3Q8QB 2F65A 3AXMA 1F2HA 4U9RA 3NNHA 2MZ1A 3N5FA 2MQ8A 3LALA 1U1LA 1PJ5A 2ZBCA 3AAWB 2CVIA 2G1DA 3J80Y 1Q95G 3K8WA 5KG2A 4U6PA 3A3PB 1C1BB 3B78A 4ID5A 4Q2LA 1N33J 1VQ6S 1W7WA 3RRGA 3EZOA 3KG1A 5K14B 2FLLA 2BJDA 4F8RA 2BYCA 1MN9A 4NL5A 3OR1B 4LBPA 1TL3A 2E5JA 4FBUA 5LJ3Y 1MWYA 2BM0A 2GIFA 1F9FA 3OXLA 4HH0A 4O3QA 2IM2A 2GV1A 4H4MA 5M2PA 3G87A 2MQPA 5A2QU 1U48A 4OI0A 4I1TA 3SBMA 4DR7F 3RR7A 4Z7CA 1S6QB 4RNHA 5CH7B 5HBMA 2GAHC 2KRBA 3PRVA 2JNJA 3G4SS 2BQRA 1N6QA 1JLFB 3H5SA 3D5MA 3BN7A 1VQKS 5CZXA 1S9EB 1TV6A 1O51A 2F40A 5D4PA 2MHEA 4AXIA 2FGOA 3TARA 2CZ4A 2GQQA 4KBIA 3QATA 4TXSA 3IBFB 2A2DA 3K5PA 5L1IA 1KFSA 4WE1A 2CZ9A 4BBYA 2HLTA 3C15A 3CNQP 3PNIA 4Q43A 1HLWA 1E6VA 3GG0A 4L72B 3KLGA 4WBFA 4IR1A 2XY5A 1RTIB 4NOHA 2VFSA 2KVIA 2HNDA 5CD4H 1JIHA 5T41A 2AGOA 2K1RB 1U1QA 2MKSA 4UUXA 2AIRB 1EHWA 2RVJA 4NI2A 2J8AA 3DLJA 2VFTA 2WW8A 3FZ2A 1RKIA 3AB2B 2KT2A 3BM7A 4UY85 3BR8A 2JLEA 2B8QA 1CJVB 2ASLA 2UUAJ 4DX8H 1DHMA 1S6QA 5J2MB 4GVBB 1SJFA 4I2PB 1S9FA 1T9TA 1M1HA 2B5JB 3CCRS 3EVWA 4AQYF 1EB0A 1H0HB 1HWJA 3CTRA 4KKOB 4USWA 5E3PA 2KO1A 3JYTA 1N34F 4JI4J 4PQAA 2D3UA 5F9NA 4K8RA 4J9VA 2X1AA 5IWAJ 2CDQA 4DF8A 4DV5F 2M2BA 3EXCX 4GKKF 4KPCA 4NXMJ 3UQSA 1TZ0A 2FQQB 4YS2A 1NJZA 4QIGA 2IM1A 1XR7A 5K8PA 4TLRA 1FD2A 3G8SA 4DFJA 2DGWA 5LSOA 2HW3A 2YTCA 2AW0A 3MDFA 2MGZA 4DLEA 4LVOP 5LMUF 3C6TA 3T1HF 3VGTA 1SB6A 2YX1A 4F4WA 2ILYA 1PCAA 3MI7X 2QA4G 2XMWA 1IKVA 3NGRA 1FJ7A 2LA4A 2Q66A 4CT8A 4Q7AA 2HHVA 2CWXA 3IRWP 1FK9B 1OPZA 4CLTA 5D3GA 2KJWA 2BV3A 2R2RA 1K0TA 4LF9J 5HROA 5K8NA 2AD9A 4B3RJ 4F3QA 4ED5A 4ZP6A 4HHUA 3UD3P 2CJAA 2IMWP 3WIVA 2DT9A 2C2MB 3FBBA 3RBXA 2HK2A 4UQTA 2Y1LB 2PMWA 2CPHA 1IWGA 3MPUB 4HDHA 4TU7A 2FJXA 3MAAB 1VISA 2P6SA 5L8RC 4LFCF 5D4NA 3EX7B 4CCHA 3KK2A 5DDPC 1WTBA 1OY8A 2HNZA 2DEIA 1LXNA 1D3WA 3JB9k 4ELUA 4KT0C 2ZDPA 2L9DA 4MKBA 4U96A 4CNZA 2OTJS 3WQPA 1N8RT 5IQQA 1FRLA 3BSNA 2DD8S 3R1HA 2UV8G 1RWNB 2LU2A 1HNXF 2XYPB 4RU9A 2HMIB 4JI5F 2FDNA 1IKYB 1P1TA 3M9NB 1VQNS 1F1BB 2BRLA 1Y9OA 1LWCA 3LPEA 2B9WA 2D7SA 4NYZA 2XCAA 2HGNA 1KS2A 3E3XA 2ATLA 1S79A 2JH3A 1WD6A 3HT0A 1XJWB 3OXGA 3AT1B 1RCOB 3MECB 4RBTA 1Y10A 4GRSA 2XMMA 4V1Ak 3PIPQ 3QT8A 4NPOA 3NXZA 3A8IA 4K5RA 4N8NA 3MCNA 3M30B 3H2LA 1S76D 2HRUA 5F0WA 5J2QA 1F3VA 3QGGA 2UVWA 3NWGA 5A8RB 2IMOA 4DSJA 2B4OA 4M5IA 2W2QP 4FNIA 2I0XA 1HKAA 3NRBA 2IVMA 3FMWA 3QT6A 4RLEA 4DV7F 1HPZA 3UW1A 4O0IA 2XQCA 4BWJA 1LW0A 3T1HJ 3BS9A 4HVZA 3KNGA 4IO1A 3TVZA 3PW0A 2DTJA 2GVZB 4R8UB 4OZ5A 1FDAA 3PJXA 1H73A 1WI6A 4FKYA 1F0XA 2RDDA 3BKTA 3MM7A 4I56A 4DL0C 4ZLNA 2ZZNA 1NJIT 1IR1A 1QE1B 3D6HB 2PN6A 2BUNA 3W5YA 2O01C 4DPOA 3OVAA 3VAHA 4JI3F 4Q44A 4LR9A 4IOCQ 3PXGa 2HHUA 1KTVA 4KAIA 1YG0A 4KO0B 7FDRA 2IA0A 3B4MA 3EICA 3MPWA 1LK5A 2LYVA 4K4VA 5HP1A 4KIAA 4O4RA 1NPKA 1RUSA 3MXHP 2P8IA 3QT7A 3US5A 3P5BP 1TFWA 2OUGA 1FRHA 5LXRA 1CPZA 5HBMB 1BWVA 2DEJA 1O5JA 2KT3A 3T5LA 1HBMB 3BSAA 4Y28C 4OX6A 4QPXA 4I0WA 1I94F 3DOLB 5LMNJ 3M2UA 2R7SA 3RBDA 3K89A 3P49B 3UNYA 3HP6A 5I42B 1RT6A 2JLFA 1SKRA 1PYTA 5KTQA 2F8HA 2K8GA 2FY8A 3I9V9 3MM8A 4WFNQ 1WHXA 4ZHRA 4LRCA 1HHTP 1Q8IA 1VCTA 1ELOA 3JAMU 3UI3A 2WSFC 3KLGB 3QWUA 2HG4A 3MEDB 1VOMA 2XNQA 4QYRA 4URQU 3NCQA 3SCIE 3WC0A 1MROB 2QA1A 5F8MA 1TELA 2QSFA 2XB2D 1SL0A 2EFQA 3NOCA 1P27B 2DNHA 2GIQA 4JI2F 3Q22A 2HVHA 1U1PA 1S4FA 2UUBF 2FZGB 3C6UA 1KSPA 1FE4A 3T6BA 4A8XA 4NLPA 4ZCIA 1K47A 3MMAB 1UEVA 2WOMA 4I69A 3RAXA 1NK9A 3Q8VA 1J5EF 1SC1B 2OD4A 4KRWA 4NWBA 3GSDA 1CS4B 2Q43A 2JFDA 1UCNA 3B6BA 4A8KA 3G82A 3FRYA 2ZC3A 2VQFJ 3HT3A 1JLAB 1RTZA 5D8HB 3DLHA 3D6MB 4RPFA 1RWXB 1UPPA 1PYSB 2KM8B 2CQPA 4FS2A 2XWYA 2QGFB 2CQ3A 2F7VA 2DNQA 1E6YB 2V8DA 2BMBA 2VDIA 2HZVA 2CJQA 2HBYB 1X7VA 4GC6A 3GIIA 2WCXA 4CLUA 3D1QA 5ETVA 4FYXB 4M5HA 1RWOB 3OTEA 2YX4A 3TEHB 3E2EA 1O0PA 4CZCA 4OJGA 1Y3KA 3T9NA 4OX9F 2GMHA 5KFQA 4JI4F 3CJ4A 3KUEA 1TL7A 1YI2S 2A1BA 1HBUA 1U09A 4HT7A 4XDCA 2J9DA 1ZA1B 3R9LA 3KK3B 2RRNA 3J7YU 3OFFA 4DV5J 1YDLA 1V5IB 4EU0A 1ZTWA 2YNIB 3NMAA 4DU8A 2HAFA 1IR0A 4QU7A 4YY3J 3OSPA 1FDDA 1I6JA 2B7CB 1UVJA 2VPZB 1VR6A 4ENOA 3CCLS 2DHSA 1WEXA 5KOWA 2HIYA 3R27A 2OPQB 3VZHA 4EBEA 3PW2A 2HWTA 1WC1A 1FNXH 4TVAB 1UTAA 3CW2C 2D1CA 4QBUA 4B3TF 3GU0A 4U7CA 3H59A 3CMQA 3BGLA 2OLWA 1FNOA 1YJUA 1D9AA 2QZ8A 3HKWA 1RT5A 2VZ9A 3I5AA 3D0IE 4L73A 1RWWB 3D3BJ 4FF1A 2FUG9 2BZ2A 2R9LA 1U7LA 3EWGA 4MK7A 3NCPA 4IOBA 2QRRA 3S1TA 2CPYA 2VOOA 3M8WA 3I5CA 2GVDB 3R5GA 5JUMA 1C1BA 3W7BA 3DLBA 4KTQA 3HVAA 4N56A 1U49A 3PRDA 4NX9A 2UUBJ 2BOAA 2OELA 4LREA 4F04B 2K7JA 4DL6A 1FJGJ 4X4NA 2DXFA 3RW6A 1IM6A 3J81j 1DBDA 4UOGA 2DXEA 4WWSA 4NA3A 2CQIA 1A6LA 2E5IA 2LCWA 4Q2MA 4WXOA 1X4GA 2DNGA 2GHWA 2E29A 4M95A 2DNKA 1KNZA 2WOMB 2HNYA 4M94A 2U2FA 2LQBA 1Q1KA 1LFPA 2YQ3A 3PTWA 3C16A 1TK8A 2KZMA 3I96A 5E3QA 5KFBA 3W8PA 3DXBA 3KJVA 1NSKL 4DUYF 3LP0A 2KRRA 4F2SA 2ZM6F 2JFKA 1FT8A 3OL6A 1SL1A 2R3VA 2B4UA 4O44B 4JI8F 4CH1A 3QFWA 4FVCA 2HS3A 4C48A 5ETQA 3H4DA 4B9MA 4V19X 4DV1J 1U6BA 2PMHA 2QLXA 3GTYX 3DN9A 3UN5A 4CT9A 5LSLA 4ED8A 4ZMMA 2AYBA 2XZWA 3DC2A 3H5XA 2GQ2A 3SSQA 4K59A 1RI7A 1FEEA 4IRDA 1TL4A 2BEFA 1FJCA 4G65A 1VQPS 4JV5F 3FMBA 3BGRA 4ILLA 3BQ2A 4FYYB 1RT7B 2YPZA 1NEEA 4ILRA 4RNOA 4B3MF 3FBFA 2UVVA 2B56A 4CH7A 2XSJA 1H2VZ 2AJ0A 2KG0A 3BEGB 4ETXA 1XMOF 1UEKA 2DY1A 4L6V3 4TKTA 3TNVA 1FWPA 3CE8A 3LAKA 3DLKB 1C0TA 2AQ4A 1YRXA 3ZZOA 2WW4A 2LQ5A 2UVUA 4ZCMA 1S77D 4TQSA 3M6XA 4CQ1A 3PW7A 3QRQA 4DOZA 3DDKA 2VV5A 4HI2A 3QO9B 2NXUA 1NRKA 1Y00A 2XZTB 3R8YA 1U2CA 4J91A 2NQPA 2D41A 2CJYB 3CCVS 2K2PA 4WPAA 2I5JB 4OJHA 3JS9A 4H54A 4QR0A 3LWLA 3QGIA 4AL5A 3BREA 2NXEA 1KWMA 1SJ3P 4OFZA 4KFBB 3RRKA 4C11A 4HTIA 4RZRA 3LWMA 3B54A 3SCLE 2X51A 1F9HA 3ZC4A 4X4SA 4OLPA 4D3HA 5KG7A 4ECUA 2H5EA 2IAJB 2Z0GA 1HNVB 4GMKA 4R25A 4ZK7M 5L1LA 2XLKA 1AZSB 3G9CA 2HHWA 5DLFA 1NSQA 1NMEB 1N48A 7FD1A 2CWKA 1FERA 4EK2A 4DL4A 1BGXT 1GMWA 3DM2B 4W4MA 3M9OB 2DO4A 1NNDA 4X4OA 2KHCA 3K5NA 2ZH5A 4PR6A 3QRRA 1PKUA 3SZ2A 2RNEA 5E3AA 2YXLA 3R5BA 1HD1A 3HVWA 2X3GA 2W24A 1S7IA 2IBOA 1Q5YA 4TYAA 4ZPAA 5IM0A 1PG5B 2CRLA 3D0GE 3CJ3A 3UPFA 4DQPA 2B9XA 2HWIA 4EO6A 3PKYA 1OSDA 1NB7A 3PHTA 3VHQA 1KR4A 1FDNA 6FD1A 1DTTA 2ASYA 3IGVA 3MEEB 3DOMB 5IFMA 1B7FA 3PO5A 3W2VB 1FVSA 3UWTA 2Z4PA 1TKZB 2W7AA 5ETRA 2HHHF 3IWLA 4KGXB 1TMMA 2NPFA 2BACA 2ZWPA 1I5OB 1DARA 5J1NA 4F25A 4DV7J 2B6AA 2F9JA 3LA0A 2ERRA 4AL7A 3N01A 1K1SA 4DPWA 1XERA 2W2NP 3ONQA 3RW7A 1HNZF 2J9DE 3M1VB 3FC9A 4TYBA 4YUDA 4A8YA 3QPIA 5C2GA 4MT1A 3M9MB 4ZOSA 2ZHBA 1C1CA 3KXDA 3V81B 2QLFB 5A6PA 3MAHA 1NZAA 1YBAA 5HVHA 2OTLS 1R8BA 1EX8A 1UFLA 4HKQA 1IXKA 2UUTA 3O44A 4OYBA 3TJ9A 5I3UA 2FHMA 3DRRA 8ATCB 1EQMA 1T9XA 1U02A 4RW9B 3THPA 2W7OA 3AHPA 1MMLA 3CCWA 2J9EA 3HHLC 3NGUA 4NRTA 5EWGA 1H72C 4M5LA 1KOOA 3CGIA 3DFEA 4IFYA 3QLHB 1IBLF 3AD7C 2WB1D 3MAAA 3QBCA 5KFUA 3CMES 3NP5A 4ED0A 3MR2A 3SMZA 3CCTA 2YWGA 4F3MA 3UR3C 4LF8J 1IBLJ 2HVIA 2ZH1A 4DMZA 3J80U 2DNPA 3ILIA 1RT7A 2AHOB 2JOQA 3ZZRA 3MOJB 3CSKA 4OZ0A 2MKJA 2RUSA 3MAQA 5HSPA 5T14A 1S12A 2MQMA 2VQEF 2IBKA 4WFAQ 2HHQA 4O3PA 2VG6B 1I94J 1YJVA 2IRYA 1U1MA 3D6TB 3QZ8A 3PEHA 1KLNA 3F41A 1T7PA 5A2QY 3SSRA 2E1MC 2OPPA 5IS2A 2F5GA 5IC6B 3KTQA 1Q16B 2K06A 1OJ4A 1H7WA 2HFZA 2POKA 2ZBPA 4OYWA 2HFVA 1KQKA 2ZUAA 3KLEB 2QV6A 5HQMA 3CCES 1D0EA 1X4AA 2UU9F 2ZOMA 4K4UA 5CHCB 5F8GA 4KYZA 1GXUA 2EFOA 2VA3A 1FXLA 5DGAA 4WKYA 1IBCB 3VQTA 3V2UC 3KLHA 3HVRA 2VODA 3KLFA 5B0AA 2E1PA 2QMWA 3GJQB 4P52A 3A4TA 3BO2A 1XWLA 2VUGA 2C1EB 1EQ0A 3QT5A 5EHHA 1R0BG 3TQ1A 1FE0A 3RUBL 4JI7F 2BA9A 3H42A 6FDRA 4J9QA 2J9CA 3CJKB 3EGNA 4P10A 1HNWJ 1XR5A 5E0OA 5E2QA 2NLWA 5KG3A 3W62A 5LXYA 4USKA 4PCQA 1IN0A 2DKOB 4NMLA 1EARA 1T02A 4KV8B 5D4OA 4B02A 3CMAS 1D9FA 1RAOA 1HARA 5K14A 4RUHA 4M5MA 1CQNA 2Z57B 1BD6A 2EW9A 3GYGA 2ZOGA 3OL8A 2VJVA 2HZCA 2HKEA 2V4JB 3GZ7A 4G1PA 5C24A 1MNEA 1M5PC 3O8WA 1SC4B 3CIZA 4UOCA 2CIMA 3JSBA 1LV5A 1V3RA 1N34J 5CAAA 2APOA 3MPDA 1HNIA 3L95X 3OUYB 1Q8BA 2NXNA 4PG4A 1U0HA 3G86A 2YKOA 3HX9A 3RZAA 4CRJA 1SH0A 4LRFA 4DN0A 3KK2B 4RR5A 4JI1J 4PRFA 5IV3A 3A12A 4NA1A 1GTEA 1X8DA 4F0KA 3P3DA 3C2PA 2DVIA 3HHNB 4DFMA 5LMNF 3DRSA 1SC6A 4URSA 4ZP8A 4ER8A 2LU1A 2RKIB 1R6VA 1N5QA 3I9ZA 2XLJA 2XY7A 2RDIA 5KFZA 1UETA 5A0YA 2WVCA 4CNYA 4XPEA 4WYWA 4J9MA 5KG0A 2RU9A 2XMAA 3ETMA 4ECRA 2M8DB 2RUGA 5CXTA 5ETOA 3ENQA 3OLBA 1DTQA 1VQ5S 2CQBA 3VAKA 2CZVC 2HS4A 2OEMA 1FA0A 2MTLA 5FJ4A 4I64A 5DS7A 3MPYA 4YR2A 4IR9A 2V6AA 3FBEA 2W8LA 2IFXA 3SEOA 3HSZA 3V4IA 2DPJA 4ZLPA 1V3SA 3AD9C 3LGHA 2KT5A 2LXFA 1M5SA 4NLOA 3QZ7A 2CQ0A 2V0NA 3MMBA 1NB2A 3P45B 4OZ3A 4ZIVA 1RWKB 4IH6A 4PXCA 3UVJA 1RZMA 1U0HB 2VD3A 4CYUB 2RHQB 2VQFF 5K20B 2YKMB 3ET6A 1O6XA 4H4KA 1QUPA 4ATNA 3C6TB 3SCJE 4DCOB 3RB6A 2FJDB 2F4FA 2OGUA 4CH0S 2ZJPQ 2C3OA 5D0GA 2ROEA 2EKYA 3RBZA 5J2NA 4MIWA 2DK2A 1R31A 3MM9B 3HI9A 1FKOA 1MW7A 4DL5A 3TA1A 5MAOA 4LF7J 3KNAA 2O5DA 2YNHA 1RJJA 3HHLA 1Q79A 2OPPB 3MM9A 1X0FA 3J7AN 5HLFB 1JK9B 1HBOB 4YP3A 4USVA 1S7HA 2GMLA 4LSNA 2FZCB 5ETLA 3A8KA 3KJVB 1ZETA 3MMJA 1LWFB 2C22A 3NBPB 2QT7A 4G1IA 2VL1A 3JTNA 2VG5A 3HFVA 5D4LA 5KFVA 1XMBA 9RUBA 4AQYJ 1YJRA 2HFNA 3C16B 3L4BC 4UOFA 5KOXA 4IUFA 2R7UA 1KQSR 2BM1A 1M5KC 3HZEA 1OY6A 1SQEA 4WCEQ 4F4YA 2ZBQA 4MMOA 2W7PA 3T5KA 2PIIA 1SCJB 2MQLA 5HATA 5EN1A 4H4OB 4J37A 5CYJA 2BJ8A 1VHFA 4EUVA 5E3CA 5KFNA 1KONA 4X4UA 3ENVA 4ZJOA 5B7WA 2BXJA 1G6BA 2D69A 4M5GA 4WP9A 4O3RA 2ZKUA 1MROA 4C8OA 3ZTQA 2DGVA 2V68A 4B9SA 4DSEA 2EG2A 2ZKTA 4QR1A 2ZD1B 3EDQB 2M8HA 3QAEA 2FLOA 4QQBA 1QSSA 1EETA 1S1UA 4OZ1A 3SFUA 2H5IB 4LIRA 4TU9A 3MR6A 1F3FA 3BGUA 2K7KA 1ZS6A 4LBIA 2NR0A 1HI8A 5L39A 3W1YC 3UN3A 5JVHQ 4ECTA 2FC9A 1SH2A 1N56A 5J2MA 4ERDA 1S6PB 1ACMB 2P9EA 4XPCA 1GXTA 5M2RA 4O44A 5HL7Q 4LFCJ 3A3OB 1VRTA 4X4QA 5HQLA 4DR2F 1F2GA 5B0CA 3RB0A 2E9RX 1T8EA 3G8TA 4NA2A 3IWXA 4QIEA 4TLQA 1S48A 2G2YA 4DQRA 2D9OA 3BSOA 4H4KC 2FHJD 2DGTA 3HHDA 3J7ZT 2YWWA 2BABA 2QYCA 1HIYA 1U1OA 1B0VA 3JAMY 4P74A 2F3JA 2ZM6J 2Y8WA 1XNRF 2DR8A 4QJVA 4XTTA 4ECZA 5LL6d 5LM7E 2D3O1 3IAM9 1CBKA 2MGZB 4LF4J 1BLUA 1HD0A 1KDNA 3QYYA 4YHHF 1XN9A 2HVEA 4ZPDA 1B99A 2HURA 4JUZA 2DR6A 1ZM3A 2QFJA 1ZAVA 3KUHA 3VR1A 1VHIA 3I0RB 4KGKA 2E1AA 1RTHB 1GMWD 2ZITA 5GADU 3KHHA 4J9NA 4UT4A 2QEXS 1TFYA 2FZKB 1RE1B 1RK8A 1RACB 2IJRA 1KQFB 5J2QB 5JVGQ 1S97A 3KFWX 4K4YA 1S6OA 1FWKA 2KU7A 2XM3A 1FI4A 3TANA 2W4CA 1S6UA 4N5SA 2DR7A 4LF6J 1U8WA 2R7WA 1S1XB 2XSFA 2DR9A 3PFOA 5G0RA 4DX6A 5EUHA 4FF3A 5F8LA 4QCLA 1RWPB 5C5JA 1UA1A 4UY8T 4TY9A 2PMZD 4YB6A 3CXCR 3VALA 2ABYA 4EI2A 3MFHA 1IBKF 1WHVA 2CUYA 4A47A 4S0MA 1TUGB 3W9HA 5E3RA 4Q8FA 1RDRA 2MZSA 3WIUA 4GO7X 1T9UA 3HHEA 4M1KA 2PFFB 1TTHB 2A18A 3VTIA 2HHSA 3K57A 4EBDA 2GO9A 1FTRA 3M7VA 3C6UB 4LF8F 1HWLA 3FEXB 3MMCB 3ZFVA 4PXDA 4UZBA 1S10A 3DM2A 1FVQA 5KFGA 3HK2A 1JWWA 4GVLA 4EYHB 1HHQA 2B5JA 1FO1A 3H20A 2HGLA 5F0UA 2R7TA 2CQHA 3KMSA 1N6QB 2P9CA 2X3DA 4NCGA 5G0RB 3PX4A 2VBXA 3VF0B 2PO4A 3DI6A 2DH9A 1PBUA 4JBCA 4IFVA 2HFUA 4A8QA 4RNNA 3UDVA 3R2DJ 4ZVEA 2E66A 1S1WB 2KL8A 2XBPA 3J81Y 5AXLA 4OI2A 4DV3J 3C46A 1QUVA 3GJRB 4FS1A 2UUCF 3DCAA 2OP5A 4LQ9A 4M8LA 1KP6A 5CD4A 4CI0B 3OHAA 4DV3F 3KHLA 1OS5A 2NPIA 4CM0A 5SZTA 5DG7A 5RUBA 3LANA 4YHHJ 4DSKA 2I1RA 2XHCA 1PAEX 1RT4A 2AGQA 3NS6A 4NI2B 1GMUA 1PAUB 2U1AA 4UQGA 2W9BB 3EPIA 3KJQB 1SJ4P 4J9RA 3RBEA 2MMYA 2Z8QA 5KT3A 2HHHJ 1FKPA 3N28A 4LSLA 4NASA 2NYHA 2HQFA 2DHGA 2MZTA 2DGUA 3V6JA 2KDOA 4LR8A 4QOTA 3TAMA 2XO7A 3HJFA 4RW9A 2R4FA 7AT1B 1VK3A 3Q23A 3PX6A 4X4RA 1QAIA 1VQOS 1R0AB 2ZH9A 1FKAF 1RAIB 1Y4ZB 2QLJB 2GC8A 4M5KA 3VVUA 2MDAA 3GP9A 5DETA 1FRMA 4UUWA 5DQGA 4RUAA 3JSMA 4Z7YA 1L3KA 1Q7LB 1M5HA 2IRUA 2A2CA 2YKAA 3DRPB 3IGNA 2FIUA 1REGX 3DI6B 3N5BA 5DDQC 4DV6J 4DL3A 1HBMA 1WUUA 3LP2A 2CG4A 1VRQC 2V34A 1TMJA 2ACMA 2KXHA 4KPYA 1DTTB 1JKHB 3GJSB 4KFBA 1SXLA 2W4PA 4YMEA 1X4EA 5CYQB 3AJ1A 3WX4A 5D0HA 4RW4A 3T1YJ 2L9WA 3MPVA 3P96A 3MM6B 4J90A 1RCXB 1NUEA 4KGZB 2NREA 2HLUA 1N5YB 4ID5B 1TL7B 3J7YI 3QIPB 3B4DA 2CPDA 5KFFA 1JJ2R 3Q24A 1CC8A 4UOHA 1PC5A 3IRXB 4I2QB 2VHGA 2IC3A 2MLYA 3K59A 3QQCD 2V2VA 3D67A 3T1AA 3MTJA 4ZA1A 2MZQA 3MFIA 4I2QA 3JQJA 4F0HA 3ZZZA 5KAKA 5IM0B 1KOHA 3HMJG 4DR6J 4WZQA 4B17A 4HH1A 1HW9A 5D0EA 2DH8A 3D1HA 4QWDA 5LMUJ 5KFEA 1WKJA 2M3DA 3GYXB 2N7YA 1RT2B 4NCAA 1WF2A 1YITS 3GIRA 3PR5B 1A9NB 4Y2KA 3SCKE 1LFWA 4OMFG 1W2BR 2CJKA 1TP7A 2Z2ZA 2MLXA 3M8QB 3OBIA 4URGA 2Y9HA 1TKZA 2ZE2A 1S1TB 1TR0A 2BKPA 3EZUA 3IM9A 3ULHA 2RKIA 5KFXA 2J6SA 3PYFA 2V67A 2R7OA 1SJ1A 2C2NA 2CA9A 4OV1A 2QL7B 1I3OB 2BVZA 3GPAA 4J7CA 4P7TA 4PEOA 5J2NB 5C25B 4F4ZA 4DCPB 4JI7J 4ZVFA 1N54B 2W9BA 1SKSA 3UCUP 2DR5A 4M5DB 3HCXA 3HSDA 4YR3A 1L5UA 1P6TA 1RA7A 2BBEA 2HNYB 4HT5A 4AFFA 2V9KA 2XS7A 2CQGA 4QPTA 1SUQB 3M8ZA 4TN2A 4BDPA 2JRSA 1H2UX 3HKZD 1WC3A 2VG5B 4LUBA 3JSYA 1B0TA 1LQ9A 4PYDA 2G13A 2DITA 2O3DA 4BHQA 3BZQA 2CNNB 3C14A 2YKNA 5J1EA 4WZMA 3DOLA 1ZZNA 2BE2A 3OT9A 5IZHA 4DPYA 1HPZB 1XNQJ 2CQCA 1W25A 2OH2A 1C0UA 1RWMB 1S0MA 4LFAF 4GO5X 3ZNUA 1Q82T 3M32B 1IUJA 1TL5A 4DHVA 1AB8A 5IQ6A 1SI9A 4ZVGA 1ZTTA 1CC7A 2CQDA 5I3QA 2H5JB 3GLJA 4F4XA 4IO9Q 5A8KA 4HI1A 3ENAA 4ECQA 5DM7Q 1L3VA 5FD1A 2XCPA 1L3TA 3DRYA 2GZOA 3CJQA 2Y1RI 3IR7B 4KE5A 2R2TA 3EPGA 2DPIA 3OVBA 2R7VA 5DM6Q 3H5UA 2JVOA 5BYSA 4DCJB 2E7XA 4M5DA 4CO5A 3S01A 1BQMB 1S0OA 3O3LA 4I68A 2XI3A 2UVRA 1MN7A 1ZOTA 3JSRA 1LKZA 1XMOJ 2CPEA 5J2PB 4WTOB 1SUQA 1RLCL 1RGVA 3MZIA 1YJTA 2VC1A 3E01B 3D9BA 3ZTPA 4X62F 5KFIA 2ZHOA 2ZH3A 1NK6A 1SVDA 3DMJB 1HQEB 1F60B 2QLBB 5E7OB 5DQIA 1SPBP 1RP5A 3PYDA 4WJBA 3BBCA 4KJIA 5GAHU 1JLQB 3EGVA 2B0GA 4F0MA 5F3ZA 4ZP9A 5B0BA 3PR4A 3RRHA 4A46A 5KFMA 4PUOB 3M8PA 4O3SA 3BH7B 2AJFE 2AX0A 1HWKA 4DX7A 3UR0A 4XAKA 3CCQS 1VC6A 3GE9A 2JEGA 1JNRB 4DPUA 4PQUB 1NKEA 3KYLA 2XMKA 4OIXA 4ES3A 4K2JA 5DDRC 2M7SA 2CPFA 3IRXA 2WVEA 4YEAA 3NCRA 3V6KA 1P1LA 2E7WA 3IXQA 1FX2A 3MECA 2CJ9A 1L3SA 2MSTA 3E01A 3PRBA 1X0PA 4ZVUB 1ZPWX 2V2KA 3QO9A 3UD5A 2UUCJ 1RBOB 3OJUA 1RT3A 4MJKA 5B0EA 4DDFA 1TL1A 1UWAA 4USTA 2PI5A 2KVQE 3PZPA 2OO4A 4NZ7A 4Y2AA 3N6LA 3NGKA 4X84A 2EK1A 2J5AA 5KFTA 3GIMA 2ZH6A 3A13A 2D3ZA 1S9EA 4NE9C 4RKUC 4BCAA 1M1KT 4OHZA 4C0HA 5A8WB 3KOAA 4AYBD 2V8HA 2GO8A 2ZE2B 1S5ZA 1WSVA 2ACYA 4NZ6A 2HVZA 4I6WA 4K5SA 4C3KA 2JLGA 4J5OA 2WHOA 5CYQA 1PC4A 2MZJA 3CWJA 3RAMA 5GAHI 2DRAA 2HPUA 1X5SA 3ILJA 3FBCA 4X64J 4DWIA 1PILA 1FCAA 4OZ2A 4X4TA 5KFHA 1UVKA 2AJQA 1FF2A 1K73T 5ETMA 1M90T 5MLCV 4KQZA 1MWZA 1TAQA 3H4BA 3R1LA 1OSCA 3I6PA 1D1UA 4LF6F 4FXDA 4Y00A 2XYGB 4ES1A 3F73A 1BMQB 1QTNB 3DLKA 1B3TA 3R5CA 3MOZA 3H8YA 2HBQB 1T3NA 4N8OA 5FLXY 1HYSA 5D77A 5DJBA 3OVSA 4LVNP 4B9VA 2KI2A 2HIQA 4Q0BA 3V4MA 3EUNA 1HYSB 5E33A 5DDOC 3SQOP 3CD0A 2MZRA 3DLGB 3DOKA 2FVPA 5GVQA 1G2EA 5SUHA 4ZVHA 5G4DA 4FF4A 2GVZA 4R8UA 4EZ6A 2GS8A 1RBAA 2I38A 4B9NA 3PEJA 4DV4F 1WKKA 1AZSA 4WFXA 1OYEA 3GWCA 2YWEA 2J0QD 3CB4A 3MEDA 5KG4A 2ZH2A 1M1GA 1UJ6A 4LT6A 4R5PA 2MKIA 1T03B 4PUOA 1D9DA 3CCSS 1Q86T 2EC0A 3BSCA 5M2UA 3MEGA 2W9AA 1R8HA 4DSFA 1N36F 3BN4A 2JVRA 1NK8A 4P2SA 1CJKB 4OYOA 3FJ2A 1KD1T 1OIAA 4HHHA 1HQUB 4DR6F 1RABB 1RU2A 2NSCA 1P8GA 2ZEJA 3OR1A 4KKOA 1WEYA 4QR2A 1YIJS 3KK1A 4C8KA 2DJWA 2E5GA 2IM0A 1WEZA 2SXLA 2PE8A 2R8JA 1RAHB 2OEKA 2XNRA 4NCGB 2MQQA 4OI6A 4PG6A 3SDEB 1UJ5A 3AFGA 5HVFA 3RYLA 3DDIA 4DZDA 1V6HA 1SKUB 1AROP 1RTDA 2XS5A 3CJ5A 1GXLA 2G0IA 2MXYA 2LDYA 1WOSA 3KLFB 4XK8C 2IJFA 3WZ0A 4BC7A 4ZJQA 3HULA 2GGPB 4IG3B 2BJ3A 4U8VA 5HN0A 2J7UA 4JI5J 3G96A 2CPIA 2GQCA 3PDNA 3PV8A 2F8MA 2ALZA 2QSWA 1GT8A 4M5JA 3BH6B 3D3CJ 1S1TA 3TVYA 3ZZYA 1VRUA 1XMQJ 2PDAA 1HWUA 2QYGA 1V3ZA 1F5AA 3Q89A 4Y2MA 3IWNC 4A8FA 1SQFA 5AE2A 1WSRA 3L7OA 3WC2A 4MKYA 1UVMA 2KB2A 5DLGA 2ASJA 1YSJA 3AA8A 1XMQF 2XHWA 2ROGA 4KHPF 2BQUA 1ZM9A 3D4JA 4J9UE 3AXKA 4JP8A 2AKWB 3Q2SC 4RW6B 4PZVA 3P8BB 2F8EX 4OYXA 3SSSA 3G6XA 4QWCA 3NG8A 4NLWA 1GK8A 3BJYA 2JWNA 4K4TA 1LK7A 2EG1A 5U47A 2GMJA 3MR5A 4FZVA 3R5DA 3JSMB 4LF7F 1GX6A 3IA0A 3KLIB 4EMDA 4OQJA 4ECVA 3M6WA 3NNAA 2DGOA 4K0KF 2QC3A 4DS4A 4ZP7A 1IJFB 3DHXA 3JTPA 3K2YA 4MKAA 2KJVA 4DV4J 3HM9A 3K5OA 4WE1B 3TOQA 5EX0A 1Q81T 3HVTA 4JI1F 1HA1A 1R0CB 1T11A 5K9FA 4DV0J 3MM7B 3NS7B 4OL8A 4DSLA 1CEZA 4F4KA 3IC1A 3MM5B 1IKYA 2DY9A 4Z37A 4F3OA 3CJSA 2IIHA 4F67A 1JKHA 2ZHAA 2YNFA 3FEYB 1GQEA 2IAJA 3O5TB 2CDRB 3M8PB 4U8YA 4CTAB 4U67Q 2ZJRQ 1EAYC 3BDPA 4JYAF 1DY3A 4NLVA 3I5BA 5A8KB 1KVIA 1C4AA 4QZVB 5HO4A 5K5MA 4HR2A 2LECA 2YWFA 5F8NA 1N0UA 5K8MA 2P2CB 3VAMA 1EP4A 2DCUB 3R5AA 3OQ2A 4RW6A 2DGQA 1G1XA 1FRIA 3CULA 1RAGB 4DPXA 1GEHA 5H1SV 1WDTA 3TZWA 3MUVP 3GB0A 2C3YA 5GAEU 1WJ9A 2FHKA 2OHDA 4YB5A 2JC0A 4JI6F 4DG1A 4GKJJ 3U02A 1DZ5A 3FVYA 3UCGA 3LAMA 1N0VC 3KWMA 3M2VB 1FJGF 3VGVA 3EGZA 2MHNA 2WRMA 3MF5A 1HNIB 3F56A 2FTRA 4CLFA 3OUYA 2HBZB 5HK4A 1H3DA 2VICA 2XZDB 3K17A 2HZAA 1U6ZA 2IDEA 4DL7A 5DGBA 1FESA 5F8JA 1Y3JA 3QJJA 1DRZA 1F5BA 2UZAA 2XMVA 2HYIB 1HBNA 1PJ7A 3SYZA 5BYRA 5L1JA 1QAJA 5HMXA 1UKUA 2XSJB 4LRDA 1JNZB 4DV2F 2DISA 4UW2A 2BJ7A 1NJXA 1ZM2A 5DQHA 1PYOB 1RADB 1NPRA 4H4MB 3PVXA 3HXMA 3GCXP 5CYMA 5HVGA 3KG0A 4O23A 1G3OA 4DLGA 1LWFA 3VAFA 1XNQF 3RAQA 1VQ8S 1RT2A 4RUBA 2KKHA 2BANA 3CDBA 3W8GA 4ZVTB 4X4VA 2F1FA 1WI8A 3AH6A 3M4XA 2R2SA 3D68A 2WVDA 4IH5A 1CJTB 3TVKA 5GAEI 4CYUA 3LPYA 2P5VA 5EWEA 5IV4A 5A6WA 2QMXA 3C14B 3DRSB 4C8NA 3LP1B 5DG9A 3H40A 4B3MJ 2NSBA 1Q0NA 2RRBA 3FFIA 1X5OA 2FB0A 2LEAA 2YY3A 4NLUA 4O4GA 3HD2A 3RU0A 3UFCX 4ZVPB 4ICLB 2NS1B 1QSYA 2FVRA 4AD6A 4OLOA 2P6TA 2YKQA 4N76A 4DL2A 1YHQS 2G4BA 2FC8A 1A7GE 3NAIA 1Y11A 4ZITA 1HW8A 5ETTA 4KSEB 2QL9B 3KJFB 1N5YA 1JLCA 4HYKA 4PWDB 1N5VA 5F8IA 1HQUA 4ANCA 2JX2A 1SIWB 1VIOA 1LWEA 3V6DA 1MSWD 4C8MA 4ZPTR 1NM2A 3K8VA 2A3JA 2H51B 1S6PA 2RH3A 5DZ7A 3S7RA 1VFJA 1WC5A 2CPXA 4DEZA 4DR5F 3L7UA 2C2DA 2GW8A 4LBHA 4A4JA 1YQHA 1AUDA 4ITSA 1K1QA 2KG1A 4X65J 2UUWA 4IKAA 4YOEA 5H9EJ 4NYOA 4QWAA 2CJBA 3W65A 5B09A 4TQRA 4USUA 3NGTA 3J81U 2IA6A 3DLGA 1GX5A 1Q8KA 3HVTB 1YJ7A 4USIA 2A6OA 2GX8A 4FYWB 3T3FA 3ZZUA 3FSIA 3PY8A 5LOQA 5KFJA 4ES2A 5ETNA 4D3GA 3UNGC 5KT5A 4DQQA 2CQ1A 1N4LA 1YVFA 3W61A 1QE1A 2GCFA 3ELHA 4IH7A 2CNLB 5GAGU 4RNFA 2PSZA 4BC9A 1URRA 4AL6A 5C25A 4PG8A 6AT1B 2BR0A 3UE2A 1SH3A 3N9UC 3QIPA 1JX4A 1ZAXA 4K0KJ 1NDPA 4WP8A 4YFUA 1JLEB 5EWFA 1XEZA 4ED3A 1GMVA 1TUVA 1Y5LB 2WBMA 5DG8A 4AUKA 2ZH8A 1HQ2A 1CG2A 1KVJA 3GMGA 1VK8A 1NSPA 4W98A
chains in the Genus database with same CATH topology
4PYDA 2IDEA 4PYAA 3JQJA 2IIHA 2EKNA 4FDFA 1EKRA 2OHDA 2EEYA 3JQKA 1EKSA 3JQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYD A;  2IDE A;  4PYA A;  3JQJ A;  2IIH A;  2EKN A;  4FDF A;  1EKR A;  2OHD A;  2EEY A;  3JQK A;  1EKS A;  3JQM A; 
#chains in the Genus database with same CATH topology
 4CO1 A;  1I1G A;  5BYQ A;  2RE1 A;  4A8S A;  3CD7 A;  3AB4 B;  3K0J A;  2KFZ A;  3P6Y C;  1T9Y A;  3ISN C;  1NAQ A;  2DIU A;  3DLE A;  5C42 A;  3OFH A;  2LQ8 A;  1RSC A;  2YWK A;  3PX0 A;  2BE2 B;  3PJ9 A;  4DQS A;  4MK9 A;  4ILM A;  2HHT A;  1BE4 A;  4JI3 J;  2QMU B;  5KT4 A;  4HDG A;  3MUM P;  3LOU A;  4ZVS B;  1I51 B;  1OYD A;  3W9J A;  4I6A A;  2HGM A;  1EKS A;  4Y3C A;  5CCM A;  3IS9 A;  3W3S A;  3MEK A;  1OMS A;  3BGF A;  4F26 A;  4BS2 A;  2IRX A;  1YLX A;  2RIL A;  1MU2 B;  2DH7 A;  2WAQ D;  1Y7P A;  2MSS A;  2XMU A;  1Q7Y T;  2N4C A;  1QSL A;  2M88 A;  4IRC A;  1MU2 A;  3OPK A;  2ROP A;  2GJI A;  3GCW P;  1RAF B;  1YBU A;  4C8L A;  1URN A;  2Y8Y A;  1TKX A;  1KHW A;  4LSZ B;  3SIP B;  3E8O A;  1AYE A;  4P2X A;  2BQ3 A;  3PYE A;  4HHJ A;  5CYM B;  1QVG R;  1UVI A;  3OTO J;  2OI2 A;  1KRP A;  5KFY A;  3TZX A;  4USM A;  1PGZ A;  2L08 A;  2VQE J;  4EYI B;  4I67 A;  2MQO A;  4ETZ A;  2ZOF A;  1REV A;  4Y65 A;  3MR3 A;  2YBV A;  4QIW D;  2VIH A;  2FVC A;  1ZYQ A;  3TAQ A;  1AUS L;  2GHV C;  3NAH A;  3TYT A;  3IFE A;  4OHV A;  4PXE A;  3IN5 A;  2RQ4 A;  1SJQ A;  4DR3 F;  2ASD A;  3NGD A;  2AJ1 A;  3HF5 A;  2D9P A;  3TZY A;  1TKD A;  1HNX J;  2A6M A;  2VA2 A;  4I7F A;  1JLG A;  2AZ1 A;  1XBW A;  4R5P B;  2JHE A;  3EM1 A;  3VWS A;  1IKV B;  2XEX A;  1DUR A;  4TY8 A;  1IKX B;  3CDW A;  1M0S A;  3GYN A;  1R7I A;  1X9W A;  4DUZ F;  5IT9 U;  3FDS A;  1U4B A;  1EJ7 L;  2AF6 A;  2VPY B;  3HHK A;  2MEW A;  5EDW A;  1NKB A;  1SV5 A;  2H54 B;  1JJH A;  1AA1 B;  2YQ0 A;  4DUZ J;  1FRX A;  1FHT A;  2WBR A;  2G1H A;  4P73 A;  5IC4 B;  2KFY A;  2LEB A;  1ZPV A;  3CJ8 A;  2RRA A;  3QFH A;  4KH0 B;  4NLX A;  2D74 B;  5I3U B;  2VF3 A;  1HI1 A;  3EJM A;  3KK1 B;  1QDU B;  1BQX A;  2UV8 A;  3Q8R B;  1HR0 J;  2MKH A;  3JYT B;  2VC0 A;  2IY5 B;  2HS0 A;  1QY7 A;  3BQ1 A;  1CVJ A;  3IBW A;  1TV6 B;  2FHJ A;  3M2U B;  5L9X A;  1U2R A;  1REV B;  2IM3 A;  5I4M A;  3JQK A;  4NXN F;  2J0S D;  3DGP A;  2G0J A;  4UF4 A;  1JLQ A;  3ZZP A;  1RWU A;  4L76 A;  5AXK A;  1OPI A;  1B4S A;  1S99 A;  5ETS A;  2OML A;  2J0X A;  3GIJ A;  1DJ0 A;  3LO3 A;  5D3G B;  4X2B A;  1UWB B;  3PYG A;  2D3O R;  2G2Z A;  4NLQ A;  2EFP A;  3UDC A;  1YRT A;  2AEF A;  4DUT A;  5ADZ A;  2K3K A;  4JV5 J;  2GIR A;  2Q3P A;  2H48 B;  3ENW A;  1NK4 A;  4MAK A;  2HWH A;  3BO3 A;  3R2C J;  4WF9 Q;  4L75 A;  3Q8Y A;  4OZJ A;  3FSX A;  2R8G A;  1C0T B;  2V4J A;  4DU7 A;  1RHR B;  1ZA2 B;  1ZAW A;  3A8J A;  2E5L J;  1C1C B;  2PFD A;  1B7Y B;  4E2F B;  3PIO Q;  3OSN A;  1VQ9 S;  3HO1 A;  2AYG A;  2GAG C;  4TNO A;  4ZS6 A;  3QJL A;  2DNL A;  1X4D A;  1CQM A;  1NDK A;  1FEH A;  2C2K B;  2DNO A;  3JTO A;  3KLI A;  3PFE A;  3B8H A;  2MKK A;  2ILZ A;  3Q8S B;  3GJT B;  4DS5 A;  1RXO B;  3VV2 B;  4X62 J;  4ECS A;  2BJE A;  3FCH A;  2BW7 A;  1X4H A;  1YJW S;  3H7H B;  1VRU B;  2YNG B;  3L3C A;  2CVE A;  5T7L B;  3ILO A;  3AOC A;  3FZB A;  3PAC A;  2DYA A;  2JSX A;  1RT1 A;  2CG8 A;  3I56 S;  4RW7 A;  5AE1 A;  3W2V A;  4JI6 J;  2I9S A;  4JOU A;  3UDL A;  1U6F A;  2HFO A;  4Y2I A;  2EBE A;  1H7X A;  3KDN A;  4J9O A;  1RKJ A;  1HBN B;  3AJD A;  4LF2 A;  4ZCL A;  3A3N B;  4NYP A;  2A10 A;  2RT3 A;  1SV5 B;  2QLW A;  3AOD A;  4CO0 A;  4JV2 A;  2XI2 A;  1RT4 B;  2WK4 A;  3TR5 A;  5I3P A;  3HJV A;  4K4Z A;  4WXW A;  3R6G B;  2NXC A;  2PC6 A;  2M5Y A;  3GR0 A;  2XO6 A;  1S57 A;  3IG1 A;  1JLB B;  1A0O B;  4C7Q A;  2RIJ A;  4OX8 A;  4G3I A;  4OYZ A;  2FY1 A;  2JDJ A;  2CJX B;  2GA7 A;  2HAI A;  3BO4 A;  3PCO B;  2RF2 A;  4BLG A;  4LF5 F;  4AND A;  3DNC A;  3C8Y A;  1U25 A;  3OXF A;  1VQ4 S;  3T19 A;  2ZVS A;  4C6A A;  4MYT A;  2XC9 A;  1RLD A;  2VFR A;  3TUI C;  8RUC A;  5KFS A;  2QG9 B;  3GIL A;  1RIS A;  2CKW A;  2AMC B;  1IJE B;  2MKY A;  1XK8 A;  4C11 B;  2YNG A;  2V50 A;  1JMT A;  1YJN S;  1ICE B;  3W9I A;  2LKZ A;  3NS5 A;  4P72 A;  4O3N A;  3VAG A;  1HFE L;  2V2Z A;  3BPS P;  1DAX A;  5DZ6 A;  2NZC A;  3DU5 A;  3VAI A;  2ZFH A;  1Z2L A;  2I8E A;  3KJN B;  3VGS A;  1RAE B;  2C2O B;  1Z2Z A;  4MFB A;  4C4W A;  3MCM A;  1UPM B;  1X5P A;  2LMI A;  4C0O C;  3W63 A;  3GSI A;  4DR4 F;  2JEF A;  2GHP A;  2WZ1 A;  3TZZ A;  4PPZ A;  4GKK J;  1U0S A;  4LRB A;  2B9Y A;  5KFC A;  1WHY A;  4OI3 A;  2IC3 B;  4X66 J;  3ZNJ 1;  4LF4 F;  2WON B;  3V4I B;  1U1K A;  4N77 A;  2MLZ A;  4ED1 A;  1IKW A;  1X31 C;  2NUH A;  5FLX U;  1JXV A;  3KLE A;  4USH A;  4F50 A;  2UP1 A;  2OSR A;  2J0W A;  4PWU A;  2F4V F;  3CDE A;  3BQ0 A;  3MM8 B;  3M8Q A;  1QAY A;  2MKC A;  2ZC4 A;  2M0G B;  4C97 A;  3A1Y G;  3EYZ A;  1X4C A;  3ICL A;  1TUW A;  5THW A;  2E9T A;  3NMR A;  2NXJ A;  1MMN A;  2ZDO A;  3LGN A;  5FII A;  1KBR A;  4EGL A;  3M8Y A;  1U2F A;  2MJN A;  3NL0 A;  1Q5V A;  1R43 A;  2AP6 A;  2LLZ A;  4PAB A;  1E6Y A;  4GKJ F;  2VOP A;  1GH8 A;  4OYP A;  1EIY B;  1QJH A;  2UXB J;  1T0T V;  2HRT A;  3SQG A;  2RML A;  4AXJ A;  4FBT A;  2V8V A;  1X9S A;  2OPR A;  2Q1L A;  3CJ0 A;  4ZVQ B;  4DJB A;  2PD1 A;  4G1Q B;  4IG0 A;  5ETK A;  1VBK A;  3FNN A;  3OV7 A;  4ED7 A;  1TK0 A;  3BR9 A;  3TRG A;  1G4C A;  1TL3 B;  2CAJ A;  1JXE A;  3MMC A;  3KHG A;  1HMV B;  2VFU A;  4U7U K;  3IMQ J;  3ILL A;  3TUZ C;  4XIU A;  2XLI A;  1HBU B;  2N3L A;  5A76 A;  3TAM B;  4B3O A;  4P9S A;  5AXN A;  2E44 A;  4OYI A;  1XIQ A;  5L9N A;  4R0E A;  4JI8 J;  2R7X A;  2VG7 B;  2DNM A;  2HK3 A;  2DGX A;  1AXQ A;  3KLH B;  3G6Y A;  1UFK A;  1ZZF A;  3LP1 A;  3G71 S;  2DO0 A;  3ZO7 A;  3I4H X;  4FKX A;  4KHM A;  2FGC A;  2IVY A;  3TAP A;  2AYM A;  1SJR A;  4LF1 A;  1J2V A;  4Y34 A;  4XO0 A;  1VDH A;  4I7F B;  1RT1 B;  1U24 A;  3AQP A;  2AU0 A;  1TAU A;  1UW9 A;  2BDP A;  2UXD J;  3NEK A;  4NXM F;  2ZNZ A;  5AXM A;  4CLZ A;  3ETO A;  4YR0 A;  1VJQ A;  3DKD A;  3M32 A;  2ZBI A;  5D0R A;  3NKY A;  4Y2C A;  5KG5 A;  3CD6 S;  5FDL B;  4N47 A;  4HEA 9;  1FTC A;  4ZLJ A;  2AV5 A;  3WBZ A;  4FYV B;  4UZC A;  1CJV A;  1LXJ A;  2Z58 B;  5HI7 A;  3WX8 A;  4FF2 A;  2AX1 A;  3CUN A;  5J2P A;  5HRO B;  5AJ3 J;  3FK4 A;  2MB0 B;  1HHS A;  3O6Q A;  3LF0 A;  3VZI A;  2LA6 A;  1R6Y A;  1CS4 A;  2QA2 A;  1XR6 A;  3DMJ A;  2KYX A;  2MPU A;  3TA0 A;  1WTF A;  1FRK A;  2R8H A;  1YJ9 S;  3EGW B;  1NO8 A;  3DYA B;  4R0J A;  2GJF A;  4MYU A;  3MCS A;  2MY7 A;  2LXI A;  3T1Y F;  5HAO A;  1UZD A;  2V2Q A;  3M2V A;  1U1N A;  3R97 A;  1NK0 A;  1YX2 A;  3MUR P;  1WDD A;  2UXB F;  1NHU A;  2RHS B;  2DNY A;  3D66 A;  2B8P A;  3DLL Q;  1F9E B;  3I31 A;  1C0U B;  4TY8 B;  3T6J A;  3Q8U A;  3B82 A;  3I0S B;  3BPD A;  2BOP A;  1YBT A;  2CQ4 A;  2GVD A;  1XTZ A;  3QID A;  2B4V A;  3QWP A;  4P2M A;  3UO0 A;  4LRA A;  3EZ5 A;  3W2W B;  1X5T A;  4DR3 J;  2HHP A;  2NUU G;  2R2U A;  4OHX A;  5HP1 B;  4JYA J;  1N5T A;  4PWD A;  5L38 A;  2AYE A;  1EET B;  1KN6 A;  1RTH A;  1T3O A;  2CQ2 A;  3G6E S;  4LR7 A;  2PA3 A;  4AE5 A;  4FXW A;  3DYA A;  2YX7 A;  3MUT P;  1NXI A;  4OHW A;  5E5N A;  3DRR B;  4K2X A;  2PA8 D;  2COL A;  2W2M P;  1VBX A;  3NGS A;  2V4Q A;  2Y0B B;  3U1N A;  4EZ9 A;  2XY6 A;  2LEP A;  4DR7 J;  3HLU A;  1AFI A;  5HMZ A;  2BJ1 A;  3DOK B;  4P75 A;  3ISZ A;  2JZ5 A;  1U45 A;  1J5O A;  1K0V A;  3CIM A;  4O0N A;  1HNW F;  1YZ6 A;  2O1P A;  2VB6 A;  4JB8 B;  5LT5 A;  4Y0F A;  2LQ9 A;  1FD8 A;  2N82 B;  2W2O P;  3M2R B;  4KGM A;  1D8Z A;  2W1B A;  1HR0 F;  2VPX B;  3C15 B;  4HAC B;  2ZBR A;  4NMX A;  3BGR B;  4ZIW A;  3CPW R;  1EKR A;  1GAO A;  2B6A B;  4IOA Q;  4NXN J;  2AJ2 A;  5LJ5 Y;  2F9D A;  4OJ3 A;  1YKW A;  2OKQ A;  4G1Q A;  5A0Y B;  4IRK A;  2OSQ A;  3FKB A;  4PAA A;  2ZUG A;  4QW9 A;  2R7R A;  4RBV A;  4RU2 A;  4L74 A;  2E9Z A;  4RBU A;  3SFG A;  1N32 F;  1VLO A;  4CO2 A;  3ZTO A;  3H0P A;  1VQS A;  3TWZ A;  3ZZT A;  1KTQ A;  1JXL A;  1UVN A;  4I4B A;  1NCL A;  1WNE A;  2AEM A;  3ADA C;  4HTJ A;  4DV2 J;  1R0A A;  2VG7 A;  2RDJ A;  3POT A;  5J1P A;  4ZPV R;  2DIV A;  2IYI A;  1VGY A;  4ED2 A;  3ZXW A;  1KHV A;  2H65 B;  4PG7 A;  1VJW A;  2DHA A;  3MEE A;  2J7K A;  3EVO A;  4FPR A;  1BQN B;  1SIZ A;  3LGM A;  5LSR A;  1NZ8 A;  3U1M A;  3U27 A;  4DX5 A;  2XWX A;  3H5Y A;  3O1L A;  1K8A T;  4OHY A;  4H4O A;  1VIX A;  1R8C A;  4KGV B;  2FJV A;  2C3P A;  4B3T J;  2JC1 A;  3KDO A;  4DR4 J;  2QN6 B;  3W5X A;  3KHR A;  2A0F B;  1S72 S;  2JJ4 D;  1N5S A;  3GR1 A;  3SQG B;  3T5H A;  2DNN A;  2RB7 A;  5FDL A;  1LW2 A;  5KG6 A;  3NWR A;  4PYA A;  4X66 F;  2WTF A;  2W4D A;  3KG4 A;  3H2V E;  4ID8 A;  1RHM B;  3ISN D;  3J7Z 5;  2VG6 A;  2QO3 A;  4CO3 A;  1XC9 A;  4IYQ A;  3PW5 A;  4LMZ A;  2B51 A;  4QWE A;  1CJK A;  3T5J A;  2XGP A;  3EXY A;  1FJE B;  2VDH A;  1Q4R A;  1VC0 A;  2YH1 A;  1WOP A;  1KC8 T;  4GVB A;  2ZZM A;  4NLD A;  2IJN A;  4WFY A;  2J76 E;  5D6G A;  3IP0 A;  5GAD I;  1SC3 B;  3GQC A;  1RBL A;  3DRP A;  4CLY A;  4CLS A;  3Q86 A;  2H1Y A;  3HZG A;  3LP0 B;  4LFB F;  3D28 A;  3HDS A;  3CO0 P;  3NLC A;  3K58 A;  5HMY A;  5GMK a;  3FCW A;  2OJ3 A;  4LQ3 A;  3THT A;  5DRK A;  2XYH B;  5DO2 A;  1S0V A;  3MWB A;  1GNK A;  3RG6 A;  5IOL A;  3CJK A;  1FFW B;  1SL2 A;  1ROF A;  2BX6 A;  1E6V B;  2Z2M A;  2VKR A;  4NRU A;  4WU2 A;  1UWB A;  3FGV A;  2N7C A;  1FFG B;  3K5L A;  1OWX A;  1YTY A;  3OW2 R;  3Q2T C;  3AJ2 A;  4A8M P;  4FP9 A;  2VKZ G;  5K8O A;  3SV3 A;  1CJU B;  2UUA F;  1FX4 A;  3CJ2 A;  1YRU A;  2B3T B;  2CNO B;  4ANE A;  4DV1 F;  4IG0 B;  2V8P A;  2Q6C A;  4RO0 A;  3MEG B;  5CZV A;  3V81 A;  4LF5 J;  1NJY A;  2EFN A;  1ZM4 A;  1BWE A;  4RWW A;  4DUY J;  3M1V A;  2VBW A;  1IVZ A;  1B64 A;  1Y5N B;  1F6T A;  3EDR B;  3EMT A;  2MJU A;  3VAJ A;  1LWE B;  1P9Q C;  5D78 A;  2L9N A;  2XMJ A;  4Q5V A;  2C3U A;  2Z30 B;  3V6D B;  4FYD A;  2IHR 1;  3MD1 A;  2FD2 A;  2YH0 A;  3G82 B;  3CDU A;  1HL6 A;  2IDL A;  3H90 A;  4ZVO B;  3CC7 S;  2G2O A;  3KMQ A;  4IFY B;  1K9M T;  2FVQ A;  5IT0 A;  1JJ4 A;  2OD6 A;  2HBR B;  2P9G A;  2HRY A;  2W9C B;  1R89 A;  5H9F J;  4WKR A;  4ECY A;  2EK6 A;  1BC6 A;  3C19 A;  4X64 F;  3UVJ B;  2GGP A;  4IG3 A;  1NBE B;  4LJM A;  1VBY A;  1KQG B;  1CJU A;  2CXE A;  1NHV A;  2EWH A;  2RS8 A;  3CO9 A;  3ZTS A;  4FVM A;  5IT4 A;  2Y1I A;  1VLY A;  1IKX A;  1R8A A;  1TQL A;  1T9W A;  3CDA A;  3DU6 A;  3BKU A;  1DFD A;  3F44 A;  4MFB B;  3G8Q A;  1S49 A;  2UXC J;  2RAQ A;  2OMO A;  4CLK A;  2CPJ A;  1HMV A;  4X4P A;  2J6U A;  1VQ7 S;  5CAB A;  4Z2X A;  2PEB A;  1EZZ B;  2J8S A;  3QAU A;  4DR5 J;  1VC5 A;  1U8S A;  1WKL A;  3EVM A;  3M30 A;  2O67 A;  2J7W A;  2LQJ A;  2W2P P;  3CT9 A;  1FXD A;  3L9Z A;  2Z2Y B;  1VMB A;  8AT1 B;  3RTV A;  5HLF A;  1VQM S;  3T9Z A;  2QA4 S;  1D09 B;  2K3I A;  1WEL A;  5B0G A;  2DBB A;  2VFV A;  4DI6 A;  5KFA A;  4Y6I A;  2B9E A;  1DLO B;  2HSE B;  3E51 A;  1QD1 A;  2QX0 A;  2YKN B;  2BJ9 A;  2G9O A;  5B0F A;  3OFG A;  3BYP A;  5A8R A;  5J1E B;  3DHW C;  3OTO F;  4ELV A;  5BJR A;  2V4R A;  1RHQ B;  2I5J A;  1YGY A;  5KFK A;  1T05 A;  2OPS B;  1XNR J;  2C28 A;  4OX7 A;  1RYS A;  3PJW A;  4DFP A;  3S6E A;  1S59 A;  3QJP A;  2OFG X;  4WK3 A;  4C8Z A;  3M2R A;  3TJA A;  4KC5 A;  3CCU S;  5GAG I;  4WFB Q;  1CUL B;  1T9V A;  3TUJ C;  4YB1 P;  4OJ1 A;  2M70 A;  1LEO A;  5IT9 Y;  2FVS A;  1IM4 A;  1DQA A;  1FWL A;  3ITH A;  4C3L A;  5EGY A;  2OEJ A;  2RU3 A;  4PQU A;  1S1V A;  1W26 A;  3AOA A;  4PPD A;  3KK3 A;  2VBZ A;  4CO4 A;  2UXD F;  2HQ3 A;  1VS3 A;  2XUL A;  3OR2 B;  5C7P A;  5KFO A;  4KHP J;  5IWA F;  5KFP A;  4P7V A;  3W64 A;  3CJT A;  1DTQ B;  4U7U D;  3NBP A;  4CP5 A;  1U47 A;  5C24 B;  2ADB A;  1J5E J;  2RS2 A;  1LOU A;  4IFV B;  1HQE A;  4ZJL A;  5BR8 J;  1BHN A;  4N7T A;  4ZN1 A;  5E41 A;  1OQ3 A;  1PJ6 A;  1S4E A;  1IBK J;  3MCO A;  3TI0 A;  1MLA A;  5JXS A;  2N4D A;  5ETP A;  5A8W A;  1NSA A;  2VJU A;  4USJ C;  3SI8 A;  3PHE A;  1NLK L;  2KHD A;  1MMD A;  4DV6 F;  3AD8 C;  1LNQ A;  3BKF A;  1F5C A;  1RA6 A;  3CC2 S;  1NH8 A;  2DHH A;  2XMT A;  1TK5 A;  1N32 J;  2RQM A;  4I6Y A;  2LVW A;  1V9O A;  2H3E B;  1UP1 A;  2KXN B;  1CUL A;  2YPY A;  3M8S A;  2YKM A;  3ET6 B;  2YQ1 A;  2ZD1 A;  3C3L A;  3NNC A;  2IYG A;  1K44 A;  1X4F A;  3HHL D;  4B08 A;  5BXI A;  2QFI A;  4OX9 J;  1QM9 A;  1WG1 A;  3LUY A;  4P71 A;  3HSJ A;  3R6L B;  4EO8 A;  4L3N A;  3K5M A;  3CCM S;  3M6V A;  4ECW A;  4E0D A;  1N88 A;  1PBA A;  4LSN B;  3I4P A;  3A8E A;  4C3M A;  2F4V J;  4FNH A;  2EI5 A;  1H6K X;  2RD5 C;  3QSI A;  1JB0 C;  3VVT A;  4MIA A;  4X65 F;  1OQ6 A;  2W8K A;  2R7Q A;  3HHL B;  4OV6 A;  3PM9 A;  4ZPW R;  2CNK B;  3R7N B;  2JEJ A;  5C42 B;  2E5L F;  1FRJ A;  2H9Z A;  3I32 A;  4YY3 F;  4DQI A;  1AFJ A;  3S8S A;  2BAN B;  1GFW B;  2BE9 B;  4QW8 A;  3DGV A;  1JLA A;  5HJX A;  1T95 A;  3BGO P;  5CQG A;  1IQT A;  2V5H G;  2Y3Y A;  2HQD A;  4MKV A;  4J9K A;  3N0V A;  3FQL A;  5I42 A;  2FLN A;  3RB4 A;  4J9L A;  3GFH A;  4OZL A;  2AEJ A;  1N36 J;  2HEK A;  4M63 A;  5B0D A;  2VH7 A;  5KFR A;  1IBM F;  3HPO A;  1RHJ B;  3MTK A;  3IR6 B;  2PEH A;  4IQM A;  1KEK A;  2H4W B;  1NHK L;  2KN4 A;  3W66 A;  2CYY A;  3OTD A;  4ICL A;  2ZH7 A;  2GJ2 A;  4QYZ J;  1TU0 B;  1IBM J;  2AWZ A;  3ITH B;  2XTJ P;  4J9P A;  1P9Y A;  1BQM A;  3U7J A;  3W60 A;  1UAW A;  2XS2 A;  2VPW B;  2ZWO A;  4LFB J;  3CF5 Q;  4CLW A;  3KUG A;  2FPH X;  3O2I A;  4EEY A;  2DRB A;  3I55 S;  3U1L A;  1M5V C;  2EFV A;  4HL9 A;  5AE3 A;  2I2Y A;  2UXC F;  1TKT A;  2CFX A;  2YWH A;  2ZNY A;  1QTM A;  2RQK A;  2Y0S D;  3GIK A;  2C3M A;  4OYA A;  1PSD A;  4WP3 A;  1B0P A;  3TA2 A;  4RWX A;  4CDI A;  4C98 A;  3TX8 A;  1UFW A;  2QTW A;  5B08 A;  2C2R A;  3LH2 S;  4WK1 A;  3OL9 A;  1UZH A;  5IXU A;  1CLF A;  3DOM A;  1BUX A;  3D2W A;  3DLE B;  3LW5 C;  2VU5 A;  3I87 A;  2B43 A;  4EBC A;  3GON A;  1VYA A;  5T7L A;  2R8K A;  4XDD A;  4FDF A;  5H9E K;  4NEY A;  3MM5 A;  4K50 A;  2RQC A;  2ZH4 A;  2K1R A;  1WC6 A;  2HMI A;  1R3N A;  4HAC A;  4LFA J;  1RTI A;  1S9G B;  3M6U A;  4C2M A;  3BBF A;  1NJW A;  2HQI A;  1IWA A;  1S9G A;  2QIF A;  1FKP B;  1KFD A;  4TU8 A;  1RTJ B;  4Q8E A;  2Q6B A;  3C66 A;  2E7V A;  4PWW A;  1N52 B;  1WWH A;  4RW8 B;  5EX3 A;  1RAA B;  3Q83 A;  1TL1 B;  1WOR A;  5F9L A;  3GV8 B;  4C9D A;  1VRT B;  2BE7 D;  5ITH A;  1RTD B;  3F0N A;  3IO1 A;  4NEZ A;  4DZ6 A;  4P2F A;  4ZDN A;  2MYF A;  2HQG A;  1S1X A;  4YDD B;  4K4S A;  1Z4U A;  3POT B;  4QYZ K;  1NKC A;  3D6F B;  5AT1 B;  3TX0 A;  4WIQ A;  3OHB A;  4ED6 A;  2C42 A;  3BYR A;  1RT5 B;  2FJE B;  2NYI A;  1YZ7 A;  2DGS A;  2V69 A;  5HJY A;  4L3K A;  2C2E A;  2H4Y B;  3DRX A;  2J6T A;  4B3S J;  4K7Q A;  2KM8 C;  2KXF A;  2EXU A;  3QGH A;  4FPI A;  1HNV A;  1T03 A;  4OI4 A;  1UMJ A;  4BWM A;  2EPI A;  3L09 A;  2YNF B;  3FSY A;  3I0S A;  4NLS A;  2AZ3 A;  4CTA A;  4RNM A;  3DXS X;  3W5Z A;  4B3S F;  2G0C A;  2R42 A;  1XQI A;  3UN2 A;  1M5O C;  3QNW B;  5KFL A;  4RW8 A;  1WOO A;  3JXO A;  3FUY A;  3PG9 A;  5F8H A;  1QLN A;  2YKP A;  1S1U B;  4ZKA A;  2W01 A;  5F3T A;  2EKN A;  3SXL A;  1FK9 A;  2KYZ A;  3N79 A;  1X60 A;  3D7S B;  4G6V B;  2BRK A;  4DBQ A;  3IG1 B;  4DR2 J;  2NZ4 A;  3TUP A;  5L46 A;  3D0H E;  5KT7 A;  2QJ3 A;  3QGP A;  1Q53 A;  1TVR A;  2IVF B;  1YK9 A;  3AOB A;  3OD2 A;  4DN9 A;  5GME A;  4DFK A;  1OO0 B;  1S1W A;  4DG1 B;  3RR8 A;  1YWX A;  1NU4 A;  3QMQ A;  3AY0 A;  4LIW A;  4ZPC A;  3TJ8 A;  3OTB A;  4A8O A;  2EVZ A;  1LW0 B;  2AT1 B;  1BY9 A;  3FQK A;  3TQE A;  4QU6 A;  1NK7 A;  1Q8L A;  3KKF A;  4ZVR B;  3GFX A;  1G7C B;  1B70 B;  3MGJ A;  4CM2 A;  3NOG A;  2L41 A;  3TW0 A;  5HAN A;  4F02 A;  3P4U B;  2HHX A;  1C4C A;  2FJW A;  3BV8 A;  3OJS A;  1RHU B;  4UTG A;  5HMW A;  4O3O A;  3BB5 A;  2HND B;  2V94 A;  4P6Q A;  2FLP A;  4B9L A;  3W2W A;  4YDX A;  3PW4 A;  4DXL A;  4KO0 A;  4JI0 J;  4ALZ A;  2WVF A;  2EEY A;  4MIB A;  1UVL A;  2ZJQ Q;  1JJC B;  1MWQ A;  3JQM A;  1FKO B;  1RB0 A;  3GFZ A;  1SKW A;  1APS A;  4QIV A;  2KH9 A;  1GTH A;  4YQW A;  3R7B B;  4QIF A;  2L48 A;  2RJZ A;  1OY9 A;  3CJR A;  1ZBT A;  2X1G A;  3IM8 A;  3CC4 S;  4IQX A;  3GV5 B;  1N33 F;  2ALY B;  2GNK A;  4KR0 B;  4EWT A;  2N3O A;  1TVR B;  1JLF A;  3SDE A;  1ZH5 A;  5AJ3 F;  4C0B A;  4J9S A;  1BXN A;  3D54 A;  1WHW A;  4HLB A;  1NPP A;  2XGQ A;  2AJ4 A;  1VQY A;  2EFG A;  1RWV B;  2HNZ B;  4A8W A;  1VQL S;  3X3U A;  2XG8 A;  1H98 A;  4B9T A;  4NLG A;  3OFE A;  3MMB B;  1RQ0 A;  4JV0 A;  4CLL A;  3VQS A;  2V9W A;  3Q0A A;  2R8I A;  4WFZ A;  4OYM A;  2M4M A;  3NY0 A;  4NCB A;  5JJB A;  1ULR A;  3FEZ A;  4OI1 A;  2DNZ A;  1WG4 A;  4W92 B;  3DGP B;  4FN5 A;  2QE5 A;  1IR2 A;  5KG1 A;  4CWB A;  5KT6 A;  1U1R A;  3R7S B;  5D15 A;  3BBB A;  2RSQ A;  4NLY A;  2VON A;  2WSE C;  2CPZ A;  1S1V B;  4KHR A;  1W2I A;  2KFN A;  2FJB B;  2WB4 A;  1FFS B;  1LWC B;  3OTC A;  1PIE A;  3ZTR A;  3GV7 B;  3CVK A;  1TKX B;  3VGU A;  2HFS A;  1RTJ A;  3AA9 A;  2CAD A;  2HVD A;  3H2U B;  4KB7 A;  4WTY A;  1UJ4 A;  4F4A A;  3Q8P B;  4B3O B;  2B7B B;  3CCZ A;  4U95 A;  1VBZ A;  3QRP A;  2DCL A;  3P5T L;  5KFW A;  5L1K A;  3VCD A;  2EC2 A;  4ZPB A;  1FNM A;  1WC4 A;  2C2Z B;  2WSC C;  3M05 A;  2DNR A;  4RJV A;  1IQZ A;  1H2T Z;  1Z1Z A;  1QAX A;  2F63 A;  3HD1 A;  2Z2L A;  3N6M A;  2PGC A;  1J27 A;  2FHO B;  1DLO A;  4IDK A;  3J7A 1;  2W9C A;  4ZN3 A;  4JI2 J;  3LP2 B;  1JLG B;  2DRD A;  5KT2 A;  2VBY A;  3H25 A;  3FRZ A;  3MM6 A;  2OPS A;  2GFF A;  2L3M A;  2MY8 A;  4JI0 F;  5CA5 A;  5BR8 F;  1RYR A;  1CSJ A;  2X1F A;  1WAC A;  1QVF R;  3HFK A;  2B4P A;  1V5V A;  2I6W A;  4F36 A;  4RL1 A;  4CLP A;  5JMN A;  1C2P A;  1LW2 B;  3ZZ0 A;  1DQ8 A;  3MMA A;  4E98 A;  3IBC B;  1NH7 A;  4OZN A;  4PXB A;  1UA0 A;  4ELT A;  4LSL B;  2DXD A;  2WON A;  5CCL A;  2Y1J A;  3LQV A;  1HNZ J;  4A48 A;  2V8G A;  2KZZ A;  3G6V A;  1TKT B;  1WF1 A;  3V5R A;  4ECX A;  1MG7 A;  4N41 A;  1RT3 B;  2LXU A;  1ITP A;  1KLM A;  1O8B A;  1WF0 A;  4ED4 A;  2HQC A;  4LF9 F;  1LWX A;  3H98 A;  1IKW B;  3PKM A;  1KLM B;  1X4B A;  4MK8 A;  4B3R F;  3OL7 A;  1AT1 B;  1SBR A;  1J5O B;  1S0N A;  1DQ9 A;  1Q78 A;  3I82 A;  3UCZ P;  4DR1 J;  1FXR A;  3FFI B;  3L7P A;  4O4G B;  2X7I A;  1RT6 B;  4ZCK A;  3PO4 A;  3V6H A;  4F7V A;  2AGP A;  3BDE A;  2FYX A;  2O66 A;  1JQG A;  3HFZ B;  4WYL A;  4DR1 F;  5KFD A;  3KLV A;  4DV0 F;  2QL5 B;  1RHK B;  1FDB A;  1UW4 A;  4CIO A;  2OAU A;  4DF4 A;  3X1L B;  2MQN A;  2X1B A;  3LTO A;  3MHY A;  4NLT A;  4ZLL A;  4KV8 A;  4PKD B;  3BF4 A;  3R5J B;  1HWI A;  4QWB A;  4WII A;  2PT0 A;  1WC0 A;  3CCJ S;  2UU9 J;  1HBO A;  1JLC B;  2LP4 A;  4K4X A;  4I2P A;  4DPT A;  4C8Y A;  3I0R A;  2WVB A;  3CED A;  1RAJ A;  1JLB A;  1H74 A;  1U26 A;  3OR2 A;  4EFA C;  3R3T A;  2OPQ A;  1D8Y A;  3TO8 A;  1NDL A;  2ADC A;  2E1C A;  4MH8 A;  2IPO B;  1VI7 A;  2PI4 A;  1X9M A;  4YN3 B;  3K7R A;  4RUC A;  3AQO A;  1SQG A;  3EE3 A;  1PO6 A;  4RX6 A;  4NLR A;  4K4W A;  1WG5 A;  3DDN A;  3QLH A;  5F41 A;  3T41 A;  4AT1 B;  1BQN A;  2JL9 A;  2BKN A;  4YB7 A;  1R27 B;  1CJT A;  4Q45 A;  1UL3 A;  2ATC B;  2FJA B;  2OFH X;  3G2X A;  5GMD A;  4RW7 B;  5HQ8 A;  4KH1 B;  4ZHR B;  1AW0 A;  3WHI A;  3RJM B;  2VAS A;  3IR5 B;  1RU1 A;  4MTP A;  3GG1 A;  3HSG A;  4RW4 B;  3M8R A;  3MD3 A;  2BW2 A;  2DB1 A;  2Z56 B;  3N4W A;  3THV A;  4V19 J;  4M5N A;  3UDE A;  1NK5 A;  1T94 A;  1Y0H A;  3CD5 A;  2OPR B;  2LFV A;  5C2C A;  4FXV A;  2M9K A;  2M52 A;  2YNH B;  3FCV A;  4PG5 A;  1JLE A;  4GC7 A;  1NDC A;  3OLA A;  3N6N A;  4KY3 A;  2OIH A;  2NCK L;  3QSY B;  2BKO A;  2KTQ A;  2E1R A;  2Q79 A;  1EP4 B;  2YVS A;  3MR7 A;  2E5H A;  1HI0 P;  4B9U A;  2JEI A;  2V63 A;  4F2R A;  2YNI A;  3GFY A;  2ZVI A;  1UEU A;  2LDI A;  2RF2 B;  3D1O A;  1R8P A;  3RB3 A;  1L3U A;  1H38 A;  4JV1 A;  5H9F K;  2DHX A;  4DSI A;  3TEG A;  2W25 A;  1KKH A;  4Q0B B;  1Y5I B;  4WU3 A;  4NZ0 A;  1KVK A;  3WDO A;  4E8U A;  2ZZT A;  2EBG A;  3IAS 9;  4IDK B;  3UD4 P;  1T05 B;  9ATC B;  3RGI A;  3IS9 B;  3SV4 A;  3TP2 A;  4W90 B;  3Q8Q B;  2F65 A;  3AXM A;  1F2H A;  4U9R A;  3NNH A;  2MZ1 A;  3N5F A;  2MQ8 A;  3LAL A;  1U1L A;  1PJ5 A;  2ZBC A;  3AAW B;  2CVI A;  2G1D A;  3J80 Y;  1Q95 G;  3K8W A;  5KG2 A;  4U6P A;  3A3P B;  1C1B B;  3B78 A;  4ID5 A;  4Q2L A;  1N33 J;  1VQ6 S;  1W7W A;  3RRG A;  3EZO A;  3KG1 A;  5K14 B;  2FLL A;  2BJD A;  4F8R A;  2BYC A;  1MN9 A;  4NL5 A;  3OR1 B;  4LBP A;  1TL3 A;  2E5J A;  4FBU A;  5LJ3 Y;  1MWY A;  2BM0 A;  2GIF A;  1F9F A;  3OXL A;  4HH0 A;  4O3Q A;  2IM2 A;  2GV1 A;  4H4M A;  5M2P A;  3G87 A;  2MQP A;  5A2Q U;  1U48 A;  4OI0 A;  4I1T A;  3SBM A;  4DR7 F;  3RR7 A;  4Z7C A;  1S6Q B;  4RNH A;  5CH7 B;  5HBM A;  2GAH C;  2KRB A;  3PRV A;  2JNJ A;  3G4S S;  2BQR A;  1N6Q A;  1JLF B;  3H5S A;  3D5M A;  3BN7 A;  1VQK S;  5CZX A;  1S9E B;  1TV6 A;  1O51 A;  2F40 A;  5D4P A;  2MHE A;  4AXI A;  2FGO A;  3TAR A;  2CZ4 A;  2GQQ A;  4KBI A;  3QAT A;  4TXS A;  3IBF B;  2A2D A;  3K5P A;  5L1I A;  1KFS A;  4WE1 A;  2CZ9 A;  4BBY A;  2HLT A;  3C15 A;  3CNQ P;  3PNI A;  4Q43 A;  1HLW A;  1E6V A;  3GG0 A;  4L72 B;  3KLG A;  4WBF A;  4IR1 A;  2XY5 A;  1RTI B;  4NOH A;  2VFS A;  2KVI A;  2HND A;  5CD4 H;  1JIH A;  5T41 A;  2AGO A;  2K1R B;  1U1Q A;  2MKS A;  4UUX A;  2AIR B;  1EHW A;  2RVJ A;  4NI2 A;  2J8A A;  3DLJ A;  2VFT A;  2WW8 A;  3FZ2 A;  1RKI A;  3AB2 B;  2KT2 A;  3BM7 A;  4UY8 5;  3BR8 A;  2JLE A;  2B8Q A;  1CJV B;  2ASL A;  2UUA J;  4DX8 H;  1DHM A;  1S6Q A;  5J2M B;  4GVB B;  1SJF A;  4I2P B;  1S9F A;  1T9T A;  1M1H A;  2B5J B;  3CCR S;  3EVW A;  4AQY F;  1EB0 A;  1H0H B;  1HWJ A;  3CTR A;  4KKO B;  4USW A;  5E3P A;  2KO1 A;  3JYT A;  1N34 F;  4JI4 J;  4PQA A;  2D3U A;  5F9N A;  4K8R A;  4J9V A;  2X1A A;  5IWA J;  2CDQ A;  4DF8 A;  4DV5 F;  2M2B A;  3EXC X;  4GKK F;  4KPC A;  4NXM J;  3UQS A;  1TZ0 A;  2FQQ B;  4YS2 A;  1NJZ A;  4QIG A;  2IM1 A;  1XR7 A;  5K8P A;  4TLR A;  1FD2 A;  3G8S A;  4DFJ A;  2DGW A;  5LSO A;  2HW3 A;  2YTC A;  2AW0 A;  3MDF A;  2MGZ A;  4DLE A;  4LVO P;  5LMU F;  3C6T A;  3T1H F;  3VGT A;  1SB6 A;  2YX1 A;  4F4W A;  2ILY A;  1PCA A;  3MI7 X;  2QA4 G;  2XMW A;  1IKV A;  3NGR A;  1FJ7 A;  2LA4 A;  2Q66 A;  4CT8 A;  4Q7A A;  2HHV A;  2CWX A;  3IRW P;  1FK9 B;  1OPZ A;  4CLT A;  5D3G A;  2KJW A;  2BV3 A;  2R2R A;  1K0T A;  4LF9 J;  5HRO A;  5K8N A;  2AD9 A;  4B3R J;  4F3Q A;  4ED5 A;  4ZP6 A;  4HHU A;  3UD3 P;  2CJA A;  2IMW P;  3WIV A;  2DT9 A;  2C2M B;  3FBB A;  3RBX A;  2HK2 A;  4UQT A;  2Y1L B;  2PMW A;  2CPH A;  1IWG A;  3MPU B;  4HDH A;  4TU7 A;  2FJX A;  3MAA B;  1VIS A;  2P6S A;  5L8R C;  4LFC F;  5D4N A;  3EX7 B;  4CCH A;  3KK2 A;  5DDP C;  1WTB A;  1OY8 A;  2HNZ A;  2DEI A;  1LXN A;  1D3W A;  3JB9 k;  4ELU A;  4KT0 C;  2ZDP A;  2L9D A;  4MKB A;  4U96 A;  4CNZ A;  2OTJ S;  3WQP A;  1N8R T;  5IQQ A;  1FRL A;  3BSN A;  2DD8 S;  3R1H A;  2UV8 G;  1RWN B;  2LU2 A;  1HNX F;  2XYP B;  4RU9 A;  2HMI B;  4JI5 F;  2FDN A;  1IKY B;  1P1T A;  3M9N B;  1VQN S;  1F1B B;  2BRL A;  1Y9O A;  1LWC A;  3LPE A;  2B9W A;  2D7S A;  4NYZ A;  2XCA A;  2HGN A;  1KS2 A;  3E3X A;  2ATL A;  1S79 A;  2JH3 A;  1WD6 A;  3HT0 A;  1XJW B;  3OXG A;  3AT1 B;  1RCO B;  3MEC B;  4RBT A;  1Y10 A;  4GRS A;  2XMM A;  4V1A k;  3PIP Q;  3QT8 A;  4NPO A;  3NXZ A;  3A8I A;  4K5R A;  4N8N A;  3MCN A;  3M30 B;  3H2L A;  1S76 D;  2HRU A;  5F0W A;  5J2Q A;  1F3V A;  3QGG A;  2UVW A;  3NWG A;  5A8R B;  2IMO A;  4DSJ A;  2B4O A;  4M5I A;  2W2Q P;  4FNI A;  2I0X A;  1HKA A;  3NRB A;  2IVM A;  3FMW A;  3QT6 A;  4RLE A;  4DV7 F;  1HPZ A;  3UW1 A;  4O0I A;  2XQC A;  4BWJ A;  1LW0 A;  3T1H J;  3BS9 A;  4HVZ A;  3KNG A;  4IO1 A;  3TVZ A;  3PW0 A;  2DTJ A;  2GVZ B;  4R8U B;  4OZ5 A;  1FDA A;  3PJX A;  1H73 A;  1WI6 A;  4FKY A;  1F0X A;  2RDD A;  3BKT A;  3MM7 A;  4I56 A;  4DL0 C;  4ZLN A;  2ZZN A;  1NJI T;  1IR1 A;  1QE1 B;  3D6H B;  2PN6 A;  2BUN A;  3W5Y A;  2O01 C;  4DPO A;  3OVA A;  3VAH A;  4JI3 F;  4Q44 A;  4LR9 A;  4IOC Q;  3PXG a;  2HHU A;  1KTV A;  4KAI A;  1YG0 A;  4KO0 B;  7FDR A;  2IA0 A;  3B4M A;  3EIC A;  3MPW A;  1LK5 A;  2LYV A;  4K4V A;  5HP1 A;  4KIA A;  4O4R A;  1NPK A;  1RUS A;  3MXH P;  2P8I A;  3QT7 A;  3US5 A;  3P5B P;  1TFW A;  2OUG A;  1FRH A;  5LXR A;  1CPZ A;  5HBM B;  1BWV A;  2DEJ A;  1O5J A;  2KT3 A;  3T5L A;  1HBM B;  3BSA A;  4Y28 C;  4OX6 A;  4QPX A;  4I0W A;  1I94 F;  3DOL B;  5LMN J;  3M2U A;  2R7S A;  3RBD A;  3K89 A;  3P49 B;  3UNY A;  3HP6 A;  5I42 B;  1RT6 A;  2JLF A;  1SKR A;  1PYT A;  5KTQ A;  2F8H A;  2K8G A;  2FY8 A;  3I9V 9;  3MM8 A;  4WFN Q;  1WHX A;  4ZHR A;  4LRC A;  1HHT P;  1Q8I A;  1VCT A;  1ELO A;  3JAM U;  3UI3 A;  2WSF C;  3KLG B;  3QWU A;  2HG4 A;  3MED B;  1VOM A;  2XNQ A;  4QYR A;  4URQ U;  3NCQ A;  3SCI E;  3WC0 A;  1MRO B;  2QA1 A;  5F8M A;  1TEL A;  2QSF A;  2XB2 D;  1SL0 A;  2EFQ A;  3NOC A;  1P27 B;  2DNH A;  2GIQ A;  4JI2 F;  3Q22 A;  2HVH A;  1U1P A;  1S4F A;  2UUB F;  2FZG B;  3C6U A;  1KSP A;  1FE4 A;  3T6B A;  4A8X A;  4NLP A;  4ZCI A;  1K47 A;  3MMA B;  1UEV A;  2WOM A;  4I69 A;  3RAX A;  1NK9 A;  3Q8V A;  1J5E F;  1SC1 B;  2OD4 A;  4KRW A;  4NWB A;  3GSD A;  1CS4 B;  2Q43 A;  2JFD A;  1UCN A;  3B6B A;  4A8K A;  3G82 A;  3FRY A;  2ZC3 A;  2VQF J;  3HT3 A;  1JLA B;  1RTZ A;  5D8H B;  3DLH A;  3D6M B;  4RPF A;  1RWX B;  1UPP A;  1PYS B;  2KM8 B;  2CQP A;  4FS2 A;  2XWY A;  2QGF B;  2CQ3 A;  2F7V A;  2DNQ A;  1E6Y B;  2V8D A;  2BMB A;  2VDI A;  2HZV A;  2CJQ A;  2HBY B;  1X7V A;  4GC6 A;  3GII A;  2WCX A;  4CLU A;  3D1Q A;  5ETV A;  4FYX B;  4M5H A;  1RWO B;  3OTE A;  2YX4 A;  3TEH B;  3E2E A;  1O0P A;  4CZC A;  4OJG A;  1Y3K A;  3T9N A;  4OX9 F;  2GMH A;  5KFQ A;  4JI4 F;  3CJ4 A;  3KUE A;  1TL7 A;  1YI2 S;  2A1B A;  1HBU A;  1U09 A;  4HT7 A;  4XDC A;  2J9D A;  1ZA1 B;  3R9L A;  3KK3 B;  2RRN A;  3J7Y U;  3OFF A;  4DV5 J;  1YDL A;  1V5I B;  4EU0 A;  1ZTW A;  2YNI B;  3NMA A;  4DU8 A;  2HAF A;  1IR0 A;  4QU7 A;  4YY3 J;  3OSP A;  1FDD A;  1I6J A;  2B7C B;  1UVJ A;  2VPZ B;  1VR6 A;  4ENO A;  3CCL S;  2DHS A;  1WEX A;  5KOW A;  2HIY A;  3R27 A;  2OPQ B;  3VZH A;  4EBE A;  3PW2 A;  2HWT A;  1WC1 A;  1FNX H;  4TVA B;  1UTA A;  3CW2 C;  2D1C A;  4QBU A;  4B3T F;  3GU0 A;  4U7C A;  3H59 A;  3CMQ A;  3BGL A;  2OLW A;  1FNO A;  1YJU A;  1D9A A;  2QZ8 A;  3HKW A;  1RT5 A;  2VZ9 A;  3I5A A;  3D0I E;  4L73 A;  1RWW B;  3D3B J;  4FF1 A;  2FUG 9;  2BZ2 A;  2R9L A;  1U7L A;  3EWG A;  4MK7 A;  3NCP A;  4IOB A;  2QRR A;  3S1T A;  2CPY A;  2VOO A;  3M8W A;  3I5C A;  2GVD B;  3R5G A;  5JUM A;  1C1B A;  3W7B A;  3DLB A;  4KTQ A;  3HVA A;  4N56 A;  1U49 A;  3PRD A;  4NX9 A;  2UUB J;  2BOA A;  2OEL A;  4LRE A;  4F04 B;  2K7J A;  4DL6 A;  1FJG J;  4X4N A;  2DXF A;  3RW6 A;  1IM6 A;  3J81 j;  1DBD A;  4UOG A;  2DXE A;  4WWS A;  4NA3 A;  2CQI A;  1A6L A;  2E5I A;  2LCW A;  4Q2M A;  4WXO A;  1X4G A;  2DNG A;  2GHW A;  2E29 A;  4M95 A;  2DNK A;  1KNZ A;  2WOM B;  2HNY A;  4M94 A;  2U2F A;  2LQB A;  1Q1K A;  1LFP A;  2YQ3 A;  3PTW A;  3C16 A;  1TK8 A;  2KZM A;  3I96 A;  5E3Q A;  5KFB A;  3W8P A;  3DXB A;  3KJV A;  1NSK L;  4DUY F;  3LP0 A;  2KRR A;  4F2S A;  2ZM6 F;  2JFK A;  1FT8 A;  3OL6 A;  1SL1 A;  2R3V A;  2B4U A;  4O44 B;  4JI8 F;  4CH1 A;  3QFW A;  4FVC A;  2HS3 A;  4C48 A;  5ETQ A;  3H4D A;  4B9M A;  4V19 X;  4DV1 J;  1U6B A;  2PMH A;  2QLX A;  3GTY X;  3DN9 A;  3UN5 A;  4CT9 A;  5LSL A;  4ED8 A;  4ZMM A;  2AYB A;  2XZW A;  3DC2 A;  3H5X A;  2GQ2 A;  3SSQ A;  4K59 A;  1RI7 A;  1FEE A;  4IRD A;  1TL4 A;  2BEF A;  1FJC A;  4G65 A;  1VQP S;  4JV5 F;  3FMB A;  3BGR A;  4ILL A;  3BQ2 A;  4FYY B;  1RT7 B;  2YPZ A;  1NEE A;  4ILR A;  4RNO A;  4B3M F;  3FBF A;  2UVV A;  2B56 A;  4CH7 A;  2XSJ A;  1H2V Z;  2AJ0 A;  2KG0 A;  3BEG B;  4ETX A;  1XMO F;  1UEK A;  2DY1 A;  4L6V 3;  4TKT A;  3TNV A;  1FWP A;  3CE8 A;  3LAK A;  3DLK B;  1C0T A;  2AQ4 A;  1YRX A;  3ZZO A;  2WW4 A;  2LQ5 A;  2UVU A;  4ZCM A;  1S77 D;  4TQS A;  3M6X A;  4CQ1 A;  3PW7 A;  3QRQ A;  4DOZ A;  3DDK A;  2VV5 A;  4HI2 A;  3QO9 B;  2NXU A;  1NRK A;  1Y00 A;  2XZT B;  3R8Y A;  1U2C A;  4J91 A;  2NQP A;  2D41 A;  2CJY B;  3CCV S;  2K2P A;  4WPA A;  2I5J B;  4OJH A;  3JS9 A;  4H54 A;  4QR0 A;  3LWL A;  3QGI A;  4AL5 A;  3BRE A;  2NXE A;  1KWM A;  1SJ3 P;  4OFZ A;  4KFB B;  3RRK A;  4C11 A;  4HTI A;  4RZR A;  3LWM A;  3B54 A;  3SCL E;  2X51 A;  1F9H A;  3ZC4 A;  4X4S A;  4OLP A;  4D3H A;  5KG7 A;  4ECU A;  2H5E A;  2IAJ B;  2Z0G A;  1HNV B;  4GMK A;  4R25 A;  4ZK7 M;  5L1L A;  2XLK A;  1AZS B;  3G9C A;  2HHW A;  5DLF A;  1NSQ A;  1NME B;  1N48 A;  7FD1 A;  2CWK A;  1FER A;  4EK2 A;  4DL4 A;  1BGX T;  1GMW A;  3DM2 B;  4W4M A;  3M9O B;  2DO4 A;  1NND A;  4X4O A;  2KHC A;  3K5N A;  2ZH5 A;  4PR6 A;  3QRR A;  1PKU A;  3SZ2 A;  2RNE A;  5E3A A;  2YXL A;  3R5B A;  1HD1 A;  3HVW A;  2X3G A;  2W24 A;  1S7I A;  2IBO A;  1Q5Y A;  4TYA A;  4ZPA A;  5IM0 A;  1PG5 B;  2CRL A;  3D0G E;  3CJ3 A;  3UPF A;  4DQP A;  2B9X A;  2HWI A;  4EO6 A;  3PKY A;  1OSD A;  1NB7 A;  3PHT A;  3VHQ A;  1KR4 A;  1FDN A;  6FD1 A;  1DTT A;  2ASY A;  3IGV A;  3MEE B;  3DOM B;  5IFM A;  1B7F A;  3PO5 A;  3W2V B;  1FVS A;  3UWT A;  2Z4P A;  1TKZ B;  2W7A A;  5ETR A;  2HHH F;  3IWL A;  4KGX B;  1TMM A;  2NPF A;  2BAC A;  2ZWP A;  1I5O B;  1DAR A;  5J1N A;  4F25 A;  4DV7 J;  2B6A A;  2F9J A;  3LA0 A;  2ERR A;  4AL7 A;  3N01 A;  1K1S A;  4DPW A;  1XER A;  2W2N P;  3ONQ A;  3RW7 A;  1HNZ F;  2J9D E;  3M1V B;  3FC9 A;  4TYB A;  4YUD A;  4A8Y A;  3QPI A;  5C2G A;  4MT1 A;  3M9M B;  4ZOS A;  2ZHB A;  1C1C A;  3KXD A;  3V81 B;  2QLF B;  5A6P A;  3MAH A;  1NZA A;  1YBA A;  5HVH A;  2OTL S;  1R8B A;  1EX8 A;  1UFL A;  4HKQ A;  1IXK A;  2UUT A;  3O44 A;  4OYB A;  3TJ9 A;  5I3U A;  2FHM A;  3DRR A;  8ATC B;  1EQM A;  1T9X A;  1U02 A;  4RW9 B;  3THP A;  2W7O A;  3AHP A;  1MML A;  3CCW A;  2J9E A;  3HHL C;  3NGU A;  4NRT A;  5EWG A;  1H72 C;  4M5L A;  1KOO A;  3CGI A;  3DFE A;  4IFY A;  3QLH B;  1IBL F;  3AD7 C;  2WB1 D;  3MAA A;  3QBC A;  5KFU A;  3CME S;  3NP5 A;  4ED0 A;  3MR2 A;  3SMZ A;  3CCT A;  2YWG A;  4F3M A;  3UR3 C;  4LF8 J;  1IBL J;  2HVI A;  2ZH1 A;  4DMZ A;  3J80 U;  2DNP A;  3ILI A;  1RT7 A;  2AHO B;  2JOQ A;  3ZZR A;  3MOJ B;  3CSK A;  4OZ0 A;  2MKJ A;  2RUS A;  3MAQ A;  5HSP A;  5T14 A;  1S12 A;  2MQM A;  2VQE F;  2IBK A;  4WFA Q;  2HHQ A;  4O3P A;  2VG6 B;  1I94 J;  1YJV A;  2IRY A;  1U1M A;  3D6T B;  3QZ8 A;  3PEH A;  1KLN A;  3F41 A;  1T7P A;  5A2Q Y;  3SSR A;  2E1M C;  2OPP A;  5IS2 A;  2F5G A;  5IC6 B;  3KTQ A;  1Q16 B;  2K06 A;  1OJ4 A;  1H7W A;  2HFZ A;  2POK A;  2ZBP A;  4OYW A;  2HFV A;  1KQK A;  2ZUA A;  3KLE B;  2QV6 A;  5HQM A;  3CCE S;  1D0E A;  1X4A A;  2UU9 F;  2ZOM A;  4K4U A;  5CHC B;  5F8G A;  4KYZ A;  1GXU A;  2EFO A;  2VA3 A;  1FXL A;  5DGA A;  4WKY A;  1IBC B;  3VQT A;  3V2U C;  3KLH A;  3HVR A;  2VOD A;  3KLF A;  5B0A A;  2E1P A;  2QMW A;  3GJQ B;  4P52 A;  3A4T A;  3BO2 A;  1XWL A;  2VUG A;  2C1E B;  1EQ0 A;  3QT5 A;  5EHH A;  1R0B G;  3TQ1 A;  1FE0 A;  3RUB L;  4JI7 F;  2BA9 A;  3H42 A;  6FDR A;  4J9Q A;  2J9C A;  3CJK B;  3EGN A;  4P10 A;  1HNW J;  1XR5 A;  5E0O A;  5E2Q A;  2NLW A;  5KG3 A;  3W62 A;  5LXY A;  4USK A;  4PCQ A;  1IN0 A;  2DKO B;  4NML A;  1EAR A;  1T02 A;  4KV8 B;  5D4O A;  4B02 A;  3CMA S;  1D9F A;  1RAO A;  1HAR A;  5K14 A;  4RUH A;  4M5M A;  1CQN A;  2Z57 B;  1BD6 A;  2EW9 A;  3GYG A;  2ZOG A;  3OL8 A;  2VJV A;  2HZC A;  2HKE A;  2V4J B;  3GZ7 A;  4G1P A;  5C24 A;  1MNE A;  1M5P C;  3O8W A;  1SC4 B;  3CIZ A;  4UOC A;  2CIM A;  3JSB A;  1LV5 A;  1V3R A;  1N34 J;  5CAA A;  2APO A;  3MPD A;  1HNI A;  3L95 X;  3OUY B;  1Q8B A;  2NXN A;  4PG4 A;  1U0H A;  3G86 A;  2YKO A;  3HX9 A;  3RZA A;  4CRJ A;  1SH0 A;  4LRF A;  4DN0 A;  3KK2 B;  4RR5 A;  4JI1 J;  4PRF A;  5IV3 A;  3A12 A;  4NA1 A;  1GTE A;  1X8D A;  4F0K A;  3P3D A;  3C2P A;  2DVI A;  3HHN B;  4DFM A;  5LMN F;  3DRS A;  1SC6 A;  4URS A;  4ZP8 A;  4ER8 A;  2LU1 A;  2RKI B;  1R6V A;  1N5Q A;  3I9Z A;  2XLJ A;  2XY7 A;  2RDI A;  5KFZ A;  1UET A;  5A0Y A;  2WVC A;  4CNY A;  4XPE A;  4WYW A;  4J9M A;  5KG0 A;  2RU9 A;  2XMA A;  3ETM A;  4ECR A;  2M8D B;  2RUG A;  5CXT A;  5ETO A;  3ENQ A;  3OLB A;  1DTQ A;  1VQ5 S;  2CQB A;  3VAK A;  2CZV C;  2HS4 A;  2OEM A;  1FA0 A;  2MTL A;  5FJ4 A;  4I64 A;  5DS7 A;  3MPY A;  4YR2 A;  4IR9 A;  2V6A A;  3FBE A;  2W8L A;  2IFX A;  3SEO A;  3HSZ A;  3V4I A;  2DPJ A;  4ZLP A;  1V3S A;  3AD9 C;  3LGH A;  2KT5 A;  2LXF A;  1M5S A;  4NLO A;  3QZ7 A;  2CQ0 A;  2V0N A;  3MMB A;  1NB2 A;  3P45 B;  4OZ3 A;  4ZIV A;  1RWK B;  4IH6 A;  4PXC A;  3UVJ A;  1RZM A;  1U0H B;  2VD3 A;  4CYU B;  2RHQ B;  2VQF F;  5K20 B;  2YKM B;  3ET6 A;  1O6X A;  4H4K A;  1QUP A;  4ATN A;  3C6T B;  3SCJ E;  4DCO B;  3RB6 A;  2FJD B;  2F4F A;  2OGU A;  4CH0 S;  2ZJP Q;  2C3O A;  5D0G A;  2ROE A;  2EKY A;  3RBZ A;  5J2N A;  4MIW A;  2DK2 A;  1R31 A;  3MM9 B;  3HI9 A;  1FKO A;  1MW7 A;  4DL5 A;  3TA1 A;  5MAO A;  4LF7 J;  3KNA A;  2O5D A;  2YNH A;  1RJJ A;  3HHL A;  1Q79 A;  2OPP B;  3MM9 A;  1X0F A;  3J7A N;  5HLF B;  1JK9 B;  1HBO B;  4YP3 A;  4USV A;  1S7H A;  2GML A;  4LSN A;  2FZC B;  5ETL A;  3A8K A;  3KJV B;  1ZET A;  3MMJ A;  1LWF B;  2C22 A;  3NBP B;  2QT7 A;  4G1I A;  2VL1 A;  3JTN A;  2VG5 A;  3HFV A;  5D4L A;  5KFV A;  1XMB A;  9RUB A;  4AQY J;  1YJR A;  2HFN A;  3C16 B;  3L4B C;  4UOF A;  5KOX A;  4IUF A;  2R7U A;  1KQS R;  2BM1 A;  1M5K C;  3HZE A;  1OY6 A;  1SQE A;  4WCE Q;  4F4Y A;  2ZBQ A;  4MMO A;  2W7P A;  3T5K A;  2PII A;  1SCJ B;  2MQL A;  5HAT A;  5EN1 A;  4H4O B;  4J37 A;  5CYJ A;  2BJ8 A;  1VHF A;  4EUV A;  5E3C A;  5KFN A;  1KON A;  4X4U A;  3ENV A;  4ZJO A;  5B7W A;  2BXJ A;  1G6B A;  2D69 A;  4M5G A;  4WP9 A;  4O3R A;  2ZKU A;  1MRO A;  4C8O A;  3ZTQ A;  2DGV A;  2V68 A;  4B9S A;  4DSE A;  2EG2 A;  2ZKT A;  4QR1 A;  2ZD1 B;  3EDQ B;  2M8H A;  3QAE A;  2FLO A;  4QQB A;  1QSS A;  1EET A;  1S1U A;  4OZ1 A;  3SFU A;  2H5I B;  4LIR A;  4TU9 A;  3MR6 A;  1F3F A;  3BGU A;  2K7K A;  1ZS6 A;  4LBI A;  2NR0 A;  1HI8 A;  5L39 A;  3W1Y C;  3UN3 A;  5JVH Q;  4ECT A;  2FC9 A;  1SH2 A;  1N56 A;  5J2M A;  4ERD A;  1S6P B;  1ACM B;  2P9E A;  4XPC A;  1GXT A;  5M2R A;  4O44 A;  5HL7 Q;  4LFC J;  3A3O B;  1VRT A;  4X4Q A;  5HQL A;  4DR2 F;  1F2G A;  5B0C A;  3RB0 A;  2E9R X;  1T8E A;  3G8T A;  4NA2 A;  3IWX A;  4QIE A;  4TLQ A;  1S48 A;  2G2Y A;  4DQR A;  2D9O A;  3BSO A;  4H4K C;  2FHJ D;  2DGT A;  3HHD A;  3J7Z T;  2YWW A;  2BAB A;  2QYC A;  1HIY A;  1U1O A;  1B0V A;  3JAM Y;  4P74 A;  2F3J A;  2ZM6 J;  2Y8W A;  1XNR F;  2DR8 A;  4QJV A;  4XTT A;  4ECZ A;  5LL6 d;  5LM7 E;  2D3O 1;  3IAM 9;  1CBK A;  2MGZ B;  4LF4 J;  1BLU A;  1HD0 A;  1KDN A;  3QYY A;  4YHH F;  1XN9 A;  2HVE A;  4ZPD A;  1B99 A;  2HUR A;  4JUZ A;  2DR6 A;  1ZM3 A;  2QFJ A;  1ZAV A;  3KUH A;  3VR1 A;  1VHI A;  3I0R B;  4KGK A;  2E1A A;  1RTH B;  1GMW D;  2ZIT A;  5GAD U;  3KHH A;  4J9N A;  4UT4 A;  2QEX S;  1TFY A;  2FZK B;  1RE1 B;  1RK8 A;  1RAC B;  2IJR A;  1KQF B;  5J2Q B;  5JVG Q;  1S97 A;  3KFW X;  4K4Y A;  1S6O A;  1FWK A;  2KU7 A;  2XM3 A;  1FI4 A;  3TAN A;  2W4C A;  1S6U A;  4N5S A;  2DR7 A;  4LF6 J;  1U8W A;  2R7W A;  1S1X B;  2XSF A;  2DR9 A;  3PFO A;  5G0R A;  4DX6 A;  5EUH A;  4FF3 A;  5F8L A;  4QCL A;  1RWP B;  5C5J A;  1UA1 A;  4UY8 T;  4TY9 A;  2PMZ D;  4YB6 A;  3CXC R;  3VAL A;  2ABY A;  4EI2 A;  3MFH A;  1IBK F;  1WHV A;  2CUY A;  4A47 A;  4S0M A;  1TUG B;  3W9H A;  5E3R A;  4Q8F A;  1RDR A;  2MZS A;  3WIU A;  4GO7 X;  1T9U A;  3HHE A;  4M1K A;  2PFF B;  1TTH B;  2A18 A;  3VTI A;  2HHS A;  3K57 A;  4EBD A;  2GO9 A;  1FTR A;  3M7V A;  3C6U B;  4LF8 F;  1HWL A;  3FEX B;  3MMC B;  3ZFV A;  4PXD A;  4UZB A;  1S10 A;  3DM2 A;  1FVQ A;  5KFG A;  3HK2 A;  1JWW A;  4GVL A;  4EYH B;  1HHQ A;  2B5J A;  1FO1 A;  3H20 A;  2HGL A;  5F0U A;  2R7T A;  2CQH A;  3KMS A;  1N6Q B;  2P9C A;  2X3D A;  4NCG A;  5G0R B;  3PX4 A;  2VBX A;  3VF0 B;  2PO4 A;  3DI6 A;  2DH9 A;  1PBU A;  4JBC A;  4IFV A;  2HFU A;  4A8Q A;  4RNN A;  3UDV A;  3R2D J;  4ZVE A;  2E66 A;  1S1W B;  2KL8 A;  2XBP A;  3J81 Y;  5AXL A;  4OI2 A;  4DV3 J;  3C46 A;  1QUV A;  3GJR B;  4FS1 A;  2UUC F;  3DCA A;  2OP5 A;  4LQ9 A;  4M8L A;  1KP6 A;  5CD4 A;  4CI0 B;  3OHA A;  4DV3 F;  3KHL A;  1OS5 A;  2NPI A;  4CM0 A;  5SZT A;  5DG7 A;  5RUB A;  3LAN A;  4YHH J;  4DSK A;  2I1R A;  2XHC A;  1PAE X;  1RT4 A;  2AGQ A;  3NS6 A;  4NI2 B;  1GMU A;  1PAU B;  2U1A A;  4UQG A;  2W9B B;  3EPI A;  3KJQ B;  1SJ4 P;  4J9R A;  3RBE A;  2MMY A;  2Z8Q A;  5KT3 A;  2HHH J;  1FKP A;  3N28 A;  4LSL A;  4NAS A;  2NYH A;  2HQF A;  2DHG A;  2MZT A;  2DGU A;  3V6J A;  2KDO A;  4LR8 A;  4QOT A;  3TAM A;  2XO7 A;  3HJF A;  4RW9 A;  2R4F A;  7AT1 B;  1VK3 A;  3Q23 A;  3PX6 A;  4X4R A;  1QAI A;  1VQO S;  1R0A B;  2ZH9 A;  1FKA F;  1RAI B;  1Y4Z B;  2QLJ B;  2GC8 A;  4M5K A;  3VVU A;  2MDA A;  3GP9 A;  5DET A;  1FRM A;  4UUW A;  5DQG A;  4RUA A;  3JSM A;  4Z7Y A;  1L3K A;  1Q7L B;  1M5H A;  2IRU A;  2A2C A;  2YKA A;  3DRP B;  3IGN A;  2FIU A;  1REG X;  3DI6 B;  3N5B A;  5DDQ C;  4DV6 J;  4DL3 A;  1HBM A;  1WUU A;  3LP2 A;  2CG4 A;  1VRQ C;  2V34 A;  1TMJ A;  2ACM A;  2KXH A;  4KPY A;  1DTT B;  1JKH B;  3GJS B;  4KFB A;  1SXL A;  2W4P A;  4YME A;  1X4E A;  5CYQ B;  3AJ1 A;  3WX4 A;  5D0H A;  4RW4 A;  3T1Y J;  2L9W A;  3MPV A;  3P96 A;  3MM6 B;  4J90 A;  1RCX B;  1NUE A;  4KGZ B;  2NRE A;  2HLU A;  1N5Y B;  4ID5 B;  1TL7 B;  3J7Y I;  3QIP B;  3B4D A;  2CPD A;  5KFF A;  1JJ2 R;  3Q24 A;  1CC8 A;  4UOH A;  1PC5 A;  3IRX B;  4I2Q B;  2VHG A;  2IC3 A;  2MLY A;  3K59 A;  3QQC D;  2V2V A;  3D67 A;  3T1A A;  3MTJ A;  4ZA1 A;  2MZQ A;  3MFI A;  4I2Q A;  3JQJ A;  4F0H A;  3ZZZ A;  5KAK A;  5IM0 B;  1KOH A;  3HMJ G;  4DR6 J;  4WZQ A;  4B17 A;  4HH1 A;  1HW9 A;  5D0E A;  2DH8 A;  3D1H A;  4QWD A;  5LMU J;  5KFE A;  1WKJ A;  2M3D A;  3GYX B;  2N7Y A;  1RT2 B;  4NCA A;  1WF2 A;  1YIT S;  3GIR A;  3PR5 B;  1A9N B;  4Y2K A;  3SCK E;  1LFW A;  4OMF G;  1W2B R;  2CJK A;  1TP7 A;  2Z2Z A;  2MLX A;  3M8Q B;  3OBI A;  4URG A;  2Y9H A;  1TKZ A;  2ZE2 A;  1S1T B;  1TR0 A;  2BKP A;  3EZU A;  3IM9 A;  3ULH A;  2RKI A;  5KFX A;  2J6S A;  3PYF A;  2V67 A;  2R7O A;  1SJ1 A;  2C2N A;  2CA9 A;  4OV1 A;  2QL7 B;  1I3O B;  2BVZ A;  3GPA A;  4J7C A;  4P7T A;  4PEO A;  5J2N B;  5C25 B;  4F4Z A;  4DCP B;  4JI7 J;  4ZVF A;  1N54 B;  2W9B A;  1SKS A;  3UCU P;  2DR5 A;  4M5D B;  3HCX A;  3HSD A;  4YR3 A;  1L5U A;  1P6T A;  1RA7 A;  2BBE A;  2HNY B;  4HT5 A;  4AFF A;  2V9K A;  2XS7 A;  2CQG A;  4QPT A;  1SUQ B;  3M8Z A;  4TN2 A;  4BDP A;  2JRS A;  1H2U X;  3HKZ D;  1WC3 A;  2VG5 B;  4LUB A;  3JSY A;  1B0T A;  1LQ9 A;  4PYD A;  2G13 A;  2DIT A;  2O3D A;  4BHQ A;  3BZQ A;  2CNN B;  3C14 A;  2YKN A;  5J1E A;  4WZM A;  3DOL A;  1ZZN A;  2BE2 A;  3OT9 A;  5IZH A;  4DPY A;  1HPZ B;  1XNQ J;  2CQC A;  1W25 A;  2OH2 A;  1C0U A;  1RWM B;  1S0M A;  4LFA F;  4GO5 X;  3ZNU A;  1Q82 T;  3M32 B;  1IUJ A;  1TL5 A;  4DHV A;  1AB8 A;  5IQ6 A;  1SI9 A;  4ZVG A;  1ZTT A;  1CC7 A;  2CQD A;  5I3Q A;  2H5J B;  3GLJ A;  4F4X A;  4IO9 Q;  5A8K A;  4HI1 A;  3ENA A;  4ECQ A;  5DM7 Q;  1L3V A;  5FD1 A;  2XCP A;  1L3T A;  3DRY A;  2GZO A;  3CJQ A;  2Y1R I;  3IR7 B;  4KE5 A;  2R2T A;  3EPG A;  2DPI A;  3OVB A;  2R7V A;  5DM6 Q;  3H5U A;  2JVO A;  5BYS A;  4DCJ B;  2E7X A;  4M5D A;  4CO5 A;  3S01 A;  1BQM B;  1S0O A;  3O3L A;  4I68 A;  2XI3 A;  2UVR A;  1MN7 A;  1ZOT A;  3JSR A;  1LKZ A;  1XMO J;  2CPE A;  5J2P B;  4WTO B;  1SUQ A;  1RLC L;  1RGV A;  3MZI A;  1YJT A;  2VC1 A;  3E01 B;  3D9B A;  3ZTP A;  4X62 F;  5KFI A;  2ZHO A;  2ZH3 A;  1NK6 A;  1SVD A;  3DMJ B;  1HQE B;  1F60 B;  2QLB B;  5E7O B;  5DQI A;  1SPB P;  1RP5 A;  3PYD A;  4WJB A;  3BBC A;  4KJI A;  5GAH U;  1JLQ B;  3EGV A;  2B0G A;  4F0M A;  5F3Z A;  4ZP9 A;  5B0B A;  3PR4 A;  3RRH A;  4A46 A;  5KFM A;  4PUO B;  3M8P A;  4O3S A;  3BH7 B;  2AJF E;  2AX0 A;  1HWK A;  4DX7 A;  3UR0 A;  4XAK A;  3CCQ S;  1VC6 A;  3GE9 A;  2JEG A;  1JNR B;  4DPU A;  4PQU B;  1NKE A;  3KYL A;  2XMK A;  4OIX A;  4ES3 A;  4K2J A;  5DDR C;  2M7S A;  2CPF A;  3IRX A;  2WVE A;  4YEA A;  3NCR A;  3V6K A;  1P1L A;  2E7W A;  3IXQ A;  1FX2 A;  3MEC A;  2CJ9 A;  1L3S A;  2MST A;  3E01 A;  3PRB A;  1X0P A;  4ZVU B;  1ZPW X;  2V2K A;  3QO9 A;  3UD5 A;  2UUC J;  1RBO B;  3OJU A;  1RT3 A;  4MJK A;  5B0E A;  4DDF A;  1TL1 A;  1UWA A;  4UST A;  2PI5 A;  2KVQ E;  3PZP A;  2OO4 A;  4NZ7 A;  4Y2A A;  3N6L A;  3NGK A;  4X84 A;  2EK1 A;  2J5A A;  5KFT A;  3GIM A;  2ZH6 A;  3A13 A;  2D3Z A;  1S9E A;  4NE9 C;  4RKU C;  4BCA A;  1M1K T;  4OHZ A;  4C0H A;  5A8W B;  3KOA A;  4AYB D;  2V8H A;  2GO8 A;  2ZE2 B;  1S5Z A;  1WSV A;  2ACY A;  4NZ6 A;  2HVZ A;  4I6W A;  4K5S A;  4C3K A;  2JLG A;  4J5O A;  2WHO A;  5CYQ A;  1PC4 A;  2MZJ A;  3CWJ A;  3RAM A;  5GAH I;  2DRA A;  2HPU A;  1X5S A;  3ILJ A;  3FBC A;  4X64 J;  4DWI A;  1PIL A;  1FCA A;  4OZ2 A;  4X4T A;  5KFH A;  1UVK A;  2AJQ A;  1FF2 A;  1K73 T;  5ETM A;  1M90 T;  5MLC V;  4KQZ A;  1MWZ A;  1TAQ A;  3H4B A;  3R1L A;  1OSC A;  3I6P A;  1D1U A;  4LF6 F;  4FXD A;  4Y00 A;  2XYG B;  4ES1 A;  3F73 A;  1BMQ B;  1QTN B;  3DLK A;  1B3T A;  3R5C A;  3MOZ A;  3H8Y A;  2HBQ B;  1T3N A;  4N8O A;  5FLX Y;  1HYS A;  5D77 A;  5DJB A;  3OVS A;  4LVN P;  4B9V A;  2KI2 A;  2HIQ A;  4Q0B A;  3V4M A;  3EUN A;  1HYS B;  5E33 A;  5DDO C;  3SQO P;  3CD0 A;  2MZR A;  3DLG B;  3DOK A;  2FVP A;  5GVQ A;  1G2E A;  5SUH A;  4ZVH A;  5G4D A;  4FF4 A;  2GVZ A;  4R8U A;  4EZ6 A;  2GS8 A;  1RBA A;  2I38 A;  4B9N A;  3PEJ A;  4DV4 F;  1WKK A;  1AZS A;  4WFX A;  1OYE A;  3GWC A;  2YWE A;  2J0Q D;  3CB4 A;  3MED A;  5KG4 A;  2ZH2 A;  1M1G A;  1UJ6 A;  4LT6 A;  4R5P A;  2MKI A;  1T03 B;  4PUO A;  1D9D A;  3CCS S;  1Q86 T;  2EC0 A;  3BSC A;  5M2U A;  3MEG A;  2W9A A;  1R8H A;  4DSF A;  1N36 F;  3BN4 A;  2JVR A;  1NK8 A;  4P2S A;  1CJK B;  4OYO A;  3FJ2 A;  1KD1 T;  1OIA A;  4HHH A;  1HQU B;  4DR6 F;  1RAB B;  1RU2 A;  2NSC A;  1P8G A;  2ZEJ A;  3OR1 A;  4KKO A;  1WEY A;  4QR2 A;  1YIJ S;  3KK1 A;  4C8K A;  2DJW A;  2E5G A;  2IM0 A;  1WEZ A;  2SXL A;  2PE8 A;  2R8J A;  1RAH B;  2OEK A;  2XNR A;  4NCG B;  2MQQ A;  4OI6 A;  4PG6 A;  3SDE B;  1UJ5 A;  3AFG A;  5HVF A;  3RYL A;  3DDI A;  4DZD A;  1V6H A;  1SKU B;  1ARO P;  1RTD A;  2XS5 A;  3CJ5 A;  1GXL A;  2G0I A;  2MXY A;  2LDY A;  1WOS A;  3KLF B;  4XK8 C;  2IJF A;  3WZ0 A;  4BC7 A;  4ZJQ A;  3HUL A;  2GGP B;  4IG3 B;  2BJ3 A;  4U8V A;  5HN0 A;  2J7U A;  4JI5 J;  3G96 A;  2CPI A;  2GQC A;  3PDN A;  3PV8 A;  2F8M A;  2ALZ A;  2QSW A;  1GT8 A;  4M5J A;  3BH6 B;  3D3C J;  1S1T A;  3TVY A;  3ZZY A;  1VRU A;  1XMQ J;  2PDA A;  1HWU A;  2QYG A;  1V3Z A;  1F5A A;  3Q89 A;  4Y2M A;  3IWN C;  4A8F A;  1SQF A;  5AE2 A;  1WSR A;  3L7O A;  3WC2 A;  4MKY A;  1UVM A;  2KB2 A;  5DLG A;  2ASJ A;  1YSJ A;  3AA8 A;  1XMQ F;  2XHW A;  2ROG A;  4KHP F;  2BQU A;  1ZM9 A;  3D4J A;  4J9U E;  3AXK A;  4JP8 A;  2AKW B;  3Q2S C;  4RW6 B;  4PZV A;  3P8B B;  2F8E X;  4OYX A;  3SSS A;  3G6X A;  4QWC A;  3NG8 A;  4NLW A;  1GK8 A;  3BJY A;  2JWN A;  4K4T A;  1LK7 A;  2EG1 A;  5U47 A;  2GMJ A;  3MR5 A;  4FZV A;  3R5D A;  3JSM B;  4LF7 F;  1GX6 A;  3IA0 A;  3KLI B;  4EMD A;  4OQJ A;  4ECV A;  3M6W A;  3NNA A;  2DGO A;  4K0K F;  2QC3 A;  4DS4 A;  4ZP7 A;  1IJF B;  3DHX A;  3JTP A;  3K2Y A;  4MKA A;  2KJV A;  4DV4 J;  3HM9 A;  3K5O A;  4WE1 B;  3TOQ A;  5EX0 A;  1Q81 T;  3HVT A;  4JI1 F;  1HA1 A;  1R0C B;  1T11 A;  5K9F A;  4DV0 J;  3MM7 B;  3NS7 B;  4OL8 A;  4DSL A;  1CEZ A;  4F4K A;  3IC1 A;  3MM5 B;  1IKY A;  2DY9 A;  4Z37 A;  4F3O A;  3CJS A;  2IIH A;  4F67 A;  1JKH A;  2ZHA A;  2YNF A;  3FEY B;  1GQE A;  2IAJ A;  3O5T B;  2CDR B;  3M8P B;  4U8Y A;  4CTA B;  4U67 Q;  2ZJR Q;  1EAY C;  3BDP A;  4JYA F;  1DY3 A;  4NLV A;  3I5B A;  5A8K B;  1KVI A;  1C4A A;  4QZV B;  5HO4 A;  5K5M A;  4HR2 A;  2LEC A;  2YWF A;  5F8N A;  1N0U A;  5K8M A;  2P2C B;  3VAM A;  1EP4 A;  2DCU B;  3R5A A;  3OQ2 A;  4RW6 A;  2DGQ A;  1G1X A;  1FRI A;  3CUL A;  1RAG B;  4DPX A;  1GEH A;  5H1S V;  1WDT A;  3TZW A;  3MUV P;  3GB0 A;  2C3Y A;  5GAE U;  1WJ9 A;  2FHK A;  2OHD A;  4YB5 A;  2JC0 A;  4JI6 F;  4DG1 A;  4GKJ J;  3U02 A;  1DZ5 A;  3FVY A;  3UCG A;  3LAM A;  1N0V C;  3KWM A;  3M2V B;  1FJG F;  3VGV A;  3EGZ A;  2MHN A;  2WRM A;  3MF5 A;  1HNI B;  3F56 A;  2FTR A;  4CLF A;  3OUY A;  2HBZ B;  5HK4 A;  1H3D A;  2VIC A;  2XZD B;  3K17 A;  2HZA A;  1U6Z A;  2IDE A;  4DL7 A;  5DGB A;  1FES A;  5F8J A;  1Y3J A;  3QJJ A;  1DRZ A;  1F5B A;  2UZA A;  2XMV A;  2HYI B;  1HBN A;  1PJ7 A;  3SYZ A;  5BYR A;  5L1J A;  1QAJ A;  5HMX A;  1UKU A;  2XSJ B;  4LRD A;  1JNZ B;  4DV2 F;  2DIS A;  4UW2 A;  2BJ7 A;  1NJX A;  1ZM2 A;  5DQH A;  1PYO B;  1RAD B;  1NPR A;  4H4M B;  3PVX A;  3HXM A;  3GCX P;  5CYM A;  5HVG A;  3KG0 A;  4O23 A;  1G3O A;  4DLG A;  1LWF A;  3VAF A;  1XNQ F;  3RAQ A;  1VQ8 S;  1RT2 A;  4RUB A;  2KKH A;  2BAN A;  3CDB A;  3W8G A;  4ZVT B;  4X4V A;  2F1F A;  1WI8 A;  3AH6 A;  3M4X A;  2R2S A;  3D68 A;  2WVD A;  4IH5 A;  1CJT B;  3TVK A;  5GAE I;  4CYU A;  3LPY A;  2P5V A;  5EWE A;  5IV4 A;  5A6W A;  2QMX A;  3C14 B;  3DRS B;  4C8N A;  3LP1 B;  5DG9 A;  3H40 A;  4B3M J;  2NSB A;  1Q0N A;  2RRB A;  3FFI A;  1X5O A;  2FB0 A;  2LEA A;  2YY3 A;  4NLU A;  4O4G A;  3HD2 A;  3RU0 A;  3UFC X;  4ZVP B;  4ICL B;  2NS1 B;  1QSY A;  2FVR A;  4AD6 A;  4OLO A;  2P6T A;  2YKQ A;  4N76 A;  4DL2 A;  1YHQ S;  2G4B A;  2FC8 A;  1A7G E;  3NAI A;  1Y11 A;  4ZIT A;  1HW8 A;  5ETT A;  4KSE B;  2QL9 B;  3KJF B;  1N5Y A;  1JLC A;  4HYK A;  4PWD B;  1N5V A;  5F8I A;  1HQU A;  4ANC A;  2JX2 A;  1SIW B;  1VIO A;  1LWE A;  3V6D A;  1MSW D;  4C8M A;  4ZPT R;  1NM2 A;  3K8V A;  2A3J A;  2H51 B;  1S6P A;  2RH3 A;  5DZ7 A;  3S7R A;  1VFJ A;  1WC5 A;  2CPX A;  4DEZ A;  4DR5 F;  3L7U A;  2C2D A;  2GW8 A;  4LBH A;  4A4J A;  1YQH A;  1AUD A;  4ITS A;  1K1Q A;  2KG1 A;  4X65 J;  2UUW A;  4IKA A;  4YOE A;  5H9E J;  4NYO A;  4QWA A;  2CJB A;  3W65 A;  5B09 A;  4TQR A;  4USU A;  3NGT A;  3J81 U;  2IA6 A;  3DLG A;  1GX5 A;  1Q8K A;  3HVT B;  1YJ7 A;  4USI A;  2A6O A;  2GX8 A;  4FYW B;  3T3F A;  3ZZU A;  3FSI A;  3PY8 A;  5LOQ A;  5KFJ A;  4ES2 A;  5ETN A;  4D3G A;  3UNG C;  5KT5 A;  4DQQ A;  2CQ1 A;  1N4L A;  1YVF A;  3W61 A;  1QE1 A;  2GCF A;  3ELH A;  4IH7 A;  2CNL B;  5GAG U;  4RNF A;  2PSZ A;  4BC9 A;  1URR A;  4AL6 A;  5C25 A;  4PG8 A;  6AT1 B;  2BR0 A;  3UE2 A;  1SH3 A;  3N9U C;  3QIP A;  1JX4 A;  1ZAX A;  4K0K J;  1NDP A;  4WP8 A;  4YFU A;  1JLE B;  5EWF A;  1XEZ A;  4ED3 A;  1GMV A;  1TUV A;  1Y5L B;  2WBM A;  5DG8 A;  4AUK A;  2ZH8 A;  1HQ2 A;  1CG2 A;  1KVJ A;  3GMG A;  1VK8 A;  1NSP A;  4W98 A; 
#chains in the Genus database with same CATH homology
 4PYD A;  2IDE A;  4PYA A;  3JQJ A;  2IIH A;  2EKN A;  4FDF A;  1EKR A;  2OHD A;  2EEY A;  3JQK A;  1EKS A;  3JQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...