4PYDA

Moac in complex with cpmp crystallized in space group p212121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
142
Chain Sequence
AHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGDFKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein MoaC
publication title Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
pubmed doi rcsb
total genus 35
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4pydA00
2OHDA 4FDFA 2EKNA 2EEYA 3JQMA 2IDEA 3JQKA 4PYAA 3JQJA 1EKRA 4PYDA 1EKSA 2IIHA
chains in the Genus database with same CATH superfamily
1SV5A 3L7OA 5K8MA 2HHWA 5LMNF 3AOBA 5IQ6A 1MN7A 3BGUA 3GIMA 2HHTA 1TKZB 4L75A 4P72A 3OFHA 2LQ5A 1YJUA 4EWTA 3T5JA 3MR5A 2FGCA 4ZPVR 1NAQA 2W2QP 2VBYA 1PJ5A 3H2VE 2FD2A 1AUSL 4MK8A 1YZ6A 1YJRA 3ENVA 3NP5A 4IFYA 1VR6A 3S7RA 2AIRB 2HS0A 4EYHB 2YPYA 2QMUB 3TX8A 3W61A 2VASA 4KHMA 1QUPA 3PO5A 4PUOB 4JI1F 2VG7A 1O0PA 3HFZB 2MQQA 2A10A 3BKUA 3NNHA 2ADBA 2YQ3A 3SEOA 4DPOA 4DJBA 1HQ2A 1TFYA 5JVHQ 3RB6A 4QW8A 3G96A 1Y3JA 3D0HE 1PAEX 1J5OB 1CULA 3IBWA 1NNDA 1UEUA 4QYRA 3GG1A 3CO9A 3CC7S 3A8JA 1Y4ZB 1SJ4P 1PILA 3NXZA 4Z7YA 3T1YF 1KOOA 5DLGA 1SJFA 2OMLA 3NWGA 2MHEA 4RO0A 1DQ9A 2W2OP 3MMAB 1N32F 1UVMA 1X4CA 2KXNB 2OPQA 1S6PA 3CCJS 5KFUA 1IQTA 2LU1A 3OUYB 3M8QA 1RWWB 2BW7A 2BQRA 5CYQB 3QFHA 1S48A 1GMWA 2E7XA 2BACA 3TUIC 2BQ3A 2JNJA 2R8KA 3M8SA 2BV3A 1H98A 4X64J 1V3RA 2D7SA 2ACYA 4RUAA 2J0SD 2GZOA 1HD1A 3GV8B 4PWWA 1APSA 1QUVA 5H9EJ 5KT4A 1CPZA 4OJHA 3GFYA 2XWXA 3ISND 4QU7A 2SXLA 4OHYA 4WFYA 1OY6A 4U7CA 2DY1A 1D8ZA 1HI8A 3ZTQA 4LF7J 1LWCB 3BJYA 4KYZA 5J1NA 1HBMB 2GIRA 4WKRA 1PGZA 2HYIB 2KN4A 3RBXA 1U25A 2XMJA 1HHTP 3DLEA 1WKLA 5LXRA 4DL5A 2Y3YA 1WC0A 1JKHB 1CJUB 2E66A 2QN6B 1BC6A 4TY8B 3CDUA 4ANEA 4NYOA 3LP1A 2UUAJ 3MAAA 2VBXA 3KKFA 2RH3A 4YHHJ 4CYUA 4ZHRB 5CXTA 4J90A 4C4WA 3TO8A 2UXBF 4B3OB 4L3KA 1RTDA 5L39A 1SC6A 2AP6A 3R3TA 4AQYJ 1N0VC 2ZFHA 5CYMA 3FNNA 1Q0NA 4I69A 3MCOA 3ENQA 2AD9A 1ITPA 1RI7A 4KQZA 3CJ0A 5DS7A 1IBKF 3BSAA 1U1PA 1G7CB 5KG5A 1HPZA 3Q8PB 2DH7A 3AJ2A 1NB7A 1IWGA 2MPUA 3PR4A 3QT7A 1VQPS 4LFBJ 4JYAJ 4Y2KA 2M2BA 1UAWA 2IRYA 2VONA 2XQCA 2GJIA 4BBYA 2CPEA 1WI8A 3GILA 4NLSA 4NE9C 2AYGA 4WFNQ 2VFVA 4IH5A 1UFLA 1LFPA 2HSEB 1RAAB 4MYUA 5LMUJ 2EFNA 1KFDA 3EGNA 4ZCLA 1YKWA 5GMEA 3HSGA 2DNRA 4CRJA 2XZTB 3SV4A 4DL2A 4WF9Q 3DOMB 3GFHA 2W4CA 1KTVA 3OL7A 5L1IA 5LXYA 5ETVA 1LEOA 3AA8A 3TNVA 3GYXB 2KT5A 3LGNA 4PXDA 1T9XA 1C0UB 3FBFA 5LJ3Y 3MEKA 1K44A 2XLJA 2ZH2A 3G71S 1UPPA 2POKA 3CPWR 2PMHA 2RS2A 2G1HA 3TJAA 1GK8A 1X9SA 2J7KA 1U2RA 3CMAS 2D3UA 4K5SA 4KB7A 2C2RA 1BUXA 2ROGA 3K8WA 1YITS 1RWVB 1NPKA 3G86A 2BJ7A 1HI0P 2AEMA 3I87A 2H4YB 3RJMB 3CDAA 4LFCF 3LP2B 4K4UA 2H54B 2MQPA 3NGTA 2E5HA 5C42A 3M6VA 4XO0A 2LMIA 1XMBA 5HAOA 4YN3B 1WD6A 2HK3A 5D4NA 1S1XB 1Q95G 1MROA 2GJ2A 3GJQB 3MPWA 4NEZA 2HHHF 2ERRA 1F9EB 4F4XA 1U45A 4DV5J 1REVA 3C66A 1N5YA 2HBQB 1MMNA 2V5HG 2ZD1A 1R8AA 1YTYA 2BOPA 2YTCA 1P9YA 4C2MA 2VPYB 2JFDA 4W4MA 5HN0A 3CCRS 3RBEA 4DR3F 4RX6A 2QFIA 3QYYA 3KHRA 1C1BA 2E7VA 4MFBB 1FD2A 4ED8A 4ECTA 2GVZB 2ZH7A 3RAMA 2GNKA 4ED4A 4NLYA 2ZH6A 2MEWA 3KLGB 1YJTA 2IBKA 1WNEA 1DFDA 2AJ0A 4LT6A 2RNEA 5D4PA 2CQ3A 2LECA 3UR3C 3VAIA 3SQGB 2AJ1A 2HNZA 1TKXB 2KHCA 1UJ4A 5EWEA 3I56S 1WWHA 5G0RA 2C3UA 1R0AB 4LMZA 3I0SA 3VZIA 2M88A 3NEKA 3T5KA 3THVA 4OX6A 4ANCA 3UI3A 3KG1A 4JI5J 3I5AA 5A8KA 4AD6A 2I6WA 4MKBA 4YB6A 4UTGA 4RLEA 2XS7A 4WFXA 9RUBA 3UO0A 2HS4A 2EI5A 1PYTA 1WSRA 2NZ4A 4NCAA 3H5XA 3GIIA 3MD1A 2B4OA 3FDSA 2XTJP 2DNGA 3W62A 2HWTA 3ZTSA 3CO0P 1JIHA 1VC6A 3EXCX 2Y9HA 4IG0B 3NNCA 2RQ4A 5EWFA 2V34A 2O5DA 2J8AA 1CJKA 4HHUA 2V8VA 3EZUA 2Q79A 3L09A 1NH8A 3HM9A 1T3NA 5KFGA 3HPOA 2RIJA 1F6TA 3CJ2A 4B3RF 1G4CA 3PO4A 2CZVC 1RT7A 2FHMA 3MMCA 4F8RA 4LF6J 4DCJB 2P8IA 4DR6J 2G2YA 1WOPA 4M5JA 3RUBL 3H5YA 1BMQB 3VZHA 3IXQA 1FXRA 2VKZG 4NCGB 4FKYA 1R89A 4QOTA 1WC4A 1KQSR 3DC2A 2DHXA 4FPIA 3DLBA 3ZZYA 1S57A 3N5BA 2CDRB 2IDEA 4ZVRB 4B3TJ 4C3KA 4A4JA 2UXDF 5KFFA 2B4UA 4O0IA 4OX9J 1NSAA 1F5CA 5HROB 3U1MA 4IDKA 1HQUA 4KBIA 1FI4A 4F4ZA 1N88A 2KM8B 3DYAB 2QG9B 1HNVA 5D4LA 1F3FA 5KFKA 4OHZA 4R8UA 2VIHA 1NCLA 2R7SA 3DDIA 3KLFA 1K1SA 5DO2A 3I5CA 3BQ1A 3ITHB 3FVYA 4FN5A 3POTB 3M2VA 4WP3A 1I3OB 1WACA 2HS3A 3GYGA 3K5NA 2IDLA 5IV3A 3ET6B 3KMQA 3PM9A 1MWYA 3SV3A 4X4QA 3DCAA 4R0JA 5GAHI 1HWLA 1XBWA 4J9NA 3GTYX 5F8GA 3N6LA 4PWUA 4WFZA 5MLCV 3ONQA 2VFSA 2XSFA 2J9DA 1XK8A 5HLFB 4I67A 4HDGA 1HLWA 2GV1A 4OL8A 2MQMA 3VVTA 4NLPA 3KNAA 3SDEB 1RT2A 5IT9U 4DS5A 4J9KA 4UY85 3LQVA 4AL5A 1N34J 1NK0A 2ZVSA 3LWLA 2CG4A 2BEFA 4J9RA 2BANB 1JXEA 2C2ZB 4F26A 2Z57B 2J0WA 2D1CA 2UV8A 1NPRA 2LQJA 4ZVEA 3MWBA 2HK2A 6FDRA 4MIBA 3PVXA 4DV7F 1VRQC 2Q66A 2OELA 1WHXA 4ZIVA 4DV3F 2MLZA 3CC4S 3JTPA 3H25A 3U1NA 1RACB 2IY5B 2VFTA 3CULA 2VV5A 2VQFJ 3JQJA 3P3DA 3QO9B 2COLA 1BD6A 5ITHA 3FJ2A 1Z2LA 3DDKA 1ZS6A 3EUNA 2V67A 1CC7A 2CG8A 1RUSA 3A3OB 2KJVA 3UNYA 5L1LA 1N6QB 2C3PA 4DX6A 1HWJA 1TELA 2YNIA 1GXTA 4CQ1A 5D6GA 1RTIB 3NL0A 2EK6A 2N4DA 1VRTA 4CO2A 2FVSA 4CTAB 4NXMF 2F40A 3NMRA 4OYXA 3W9IA 3UCUP 4Q8FA 1UCNA 3TOQA 4DG1B 1YGYA 4URQU 3TEGA 2F63A 1SQEA 2DPIA 1RU2A 5C5JA 1OSCA 2H48B 2H5EA 1YIJS 3TZWA 2AX0A 2D74B 4ELTA 3AODA 2YY3A 3B4MA 2P6TA 3OXGA 1SJQA 4WJBA 1H2TZ 4QWAA 1CJVA 1MWQA 4DPWA 1JLFA 1BWVA 2OSQA 4OLPA 1MNEA 1U2FA 2KM8C 1KN6A 3IRWP 3Q8RB 3PIOQ 1YG0A 4N8NA 2XMWA 3I4PA 1FKOA 1EKRA 3W65A 3LANA 5FD1A 1U26A 4DLEA 5I3QA 2X3DA 1TL7B 3BQ0A 2X1GA 3SBMA 3U1LA 1T03A 5KOWA 3DXBA 2G0CA 2OAUA 4BC9A 3BR9A 2YKNA 3VV2B 3DXSX 1ZA2B 2WTFA 3WQPA 5IM0A 1Q5YA 4DU8A 4QCLA 2HVIA 3MDFA 4M5MA 3F41A 2J5AA 1FRIA 1LK7A 1QTMA 2DNZA 2XLIA 4DV1F 5CZXA 2B9WA 2ZBPA 4QR2A 3JAMU 2MZQA 3RBZA 3ZXWA 3OXLA 2WONA 2KB2A 2QRRA 5L38A 2RAQA 1U0HB 5J2MB 2JLFA 2YNFA 5HP1A 1R8PA 5FDLB 3Q8SB 2CQBA 4Y2MA 1SH0A 2WCXA 3RYLA 4BWJA 2QLFB 3GJSB 2RUGA 2V8GA 4H4MA 1WOOA 1UWBA 2A2CA 1S0OA 3UD4P 1AFIA 1M5HA 3TARA 5T7LA 4RBTA 2GO9A 4FF2A 4FXWA 2LXIA 4LUBA 5GAGI 5I4MA 2YKPA 4ZOSA 4OYIA 2CNNB 3QGHA 3QPIA 2ZDPA 1SKUB 4C0BA 2B3TB 2FJVA 1HBUA 3J7YU 2QSWA 2LXFA 3UWTA 2MLXA 4HT7A 2ZUGA 4DDFA 2ZH1A 2ADCA 2W9AA 5DM6Q 2CQ4A 2QA1A 2VPWB 4DCPB 2BBEA 2XCPA 1XEZA 2RDIA 3HFKA 4DOZA 2W9BB 4CWBA 4DSFA 4MAKA 2OI2A 3HHKA 2OPRB 1V5IB 1HYSA 4WZQA 5GAHU 5IZHA 3M7VA 1M5VC 4ED1A 2DNQA 4CH7A 1RJJA 2CPXA 2IIHA 4ED7A 4ZPTR 2UUCF 4O23A 1PCAA 4IYQA 4UZCA 3TZXA 5E3AA 3OSNA 4PCQA 3C2PA 2G0JA 2D3ZA 2CRLA 3UCZP 2HFNA 3EE3A 4Y65A 3FRYA 4DUZF 2VJVA 1Y9OA 2DRAA 3DLJA 3CIMA 5AXMA 5BR8J 1DQAA 1S6UA 3CWJA 3MM8A 3KK1B 4U95A 4UZBA 1UETA 2ASYA 3DNCA 3SXLA 1L3KA 3UCGA 4WIQA 1YJ7A 3P5TL 1ELOA 1DHMA 2HRYA 4KIAA 4A8MP 3FCWA 2B7BB 3IM8A 4W98A 4OYBA 4CP5A 5BJRA 2V8DA 4K7QA 2NPFA 1UFKA 5F9NA 4QIWD 4O3PA 2XO7A 4ECWA 3M6WA 4QWEA 3C14B 2R7UA 1NK8A 1R43A 1RZMA 1VBXA 4USIA 4M5GA 5KFJA 2ZOGA 4ETZA 1HWIA 1FJ7A 3ZC4A 2AF6A 5FIIA 1H38A 2VC1A 2FJAB 1UVLA 4OI6A 4JI8J 4ES1A 3N0VA 3SSSA 2V2VA 4O3RA 2L9NA 3TA1A 4X66J 2KHDA 1RT1B 2HHXA 4B3MF 1M5SA 1Q1KA 2Y1RI 1TVRA 4ZMMA 3BYRA 3KJFB 2CDQA 3CD7A 2OD6A 5L1JA 4TU7A 4A8XA 4LBIA 3AD8C 2W4PA 3GB0A 4DN9A 3BSNA 4FYXB 3HLUA 5KFRA 5KG7A 3DKDA 2JSXA 2VKRA 3H5UA 3QZ7A 1SIZA 1G6BA 2FTRA 3IG1A 1FJGF 1WG1A 3R5CA 3HVTB 4C7QA 3SZ2A 1RLDA 4P2SA 3BDEA 1K47A 3FRZA 2A6MA 4HYKA 3L7PA 1W26A 5B0DA 2RHQB 2B51A 3V6KA 4CLPA 4FYVB 2WBMA 1MLAA 1YJ9S 1R7IA 1FNMA 1S9GB 3NKYA 1RHQB 4O44B 2YNGB 2JEFA 2D9OA 3VGVA 2XCAA 2V2ZA 2MZJA 3QAEA 5FLXY 1E6VA 4CT8A 1HNZF 1HQEB 3BEGB 3ILOA 2AGOA 1VQ5S 2DGQA 4H4KA 2HQ3A 5LMNJ 5J2QA 4JB8B 2ATLA 3VGUA 4XPEA 2GGPA 5HMWA 3UN2A 4DFJA 3FCHA 4Y00A 1HR0F 1EP4A 5KOXA 2RMLA 1RT5B 1YJWS 4B9SA 2HNDA 2DTJA 1Y5LB 3D1QA 3HHDA 3PJ9A 4I0WA 2D69A 4FBTA 4KSEB 4LVOP 2BJEA 3DGPB 2W9CA 3M2UA 1SH3A 2DEIA 4KAIA 3QLHA 2MKSA 2NXUA 3MUVP 3GLJA 1S77D 1JQGA 4HDHA 3KOAA 2LP4A 3QFWA 3VCDA 4JI1J 2NSBA 1U7LA 3K2YA 3RAXA 4C8NA 5GAGU 3DLKB 4P6QA 1S5ZA 3D0GE 2NYHA 4B9LA 3MM9A 2HZAA 1N33F 3DHXA 5F8LA 3MXHP 1VQ7S 3MFIA 1HBOB 2I5JB 2CPJA 1ZM4A 4NLQA 4CDIA 5J1EA 2CXEA 3OL8A 2OPPB 5E7OB 3OR1B 3IWLA 3T1YJ 4YDDB 4JP8A 2MYFA 4DQSA 4NEYA 3D0IE 1IKVB 1N32J 3QRPA 2AEJA 3M1VA 1AROP 1KSPA 3K58A 3TW0A 3FZBA 2HPUA 2DVIA 4C9DA 3J80U 5DQGA 3MOZA 4I2QA 2QMXA 4IKAA 2C22A 2V6AA 4DQPA 1EETA 5KFIA 2RRAA 2B0GA 2DNLA 4ZPCA 4C8MA 4DR2F 2AJQA 4OIXA 1FCAA 4IG3A 3C46A 2GAGC 1WC1A 4I68A 2VQEF 3V4MA 2BVZA 4NZ0A 2BXJA 4GRSA 1UA1A 1Z2ZA 3BR8A 3PFEA 3T5LA 4OZ1A 2F8MA 3B78A 1TKTB 3MEEA 3CJQA 4QPXA 1FDDA 4ZIWA 1NXIA 8ATCB 1VRUA 4FYWB 5D0EA 1C1CB 3HMJG 2R8JA 2E1CA 1B7FA 3OL9A 1YRTA 4HI2A 1KWMA 2VPXB 4URGA 5HMZA 1ZZNA 2N7YA 1FE0A 1FESA 3DM2B 3LGMA 1RB0A 5HQ8A 2F1FA 4ECZA 1NH7A 1KRPA 4FF3A 4F3OA 3G82A 2HW3A 2PD1A 2R7TA 2DR5A 4P71A 3PW2A 4MKAA 5F8IA 4WYWA 4QIVA 1VHFA 3CCUS 2FVRA 2QZ8A 2XM3A 2UXBJ 2FIUA 5KG6A 2J7UA 1Q5VA 4UOHA 2WAQD 2RKIB 1DURA 3TI0A 4NX9A 4NOHA 3GJTB 1RT4B 1NKBA 3GSDA 4O4RA 4NPOA 2KT3A 1ZAWA 1TL1A 3KK3B 1IBKJ 2AHOB 1TUWA 2JEIA 2OJ3A 4CLLA 1O51A 4ZVSB 5IOLA 4LSNB 3Q8QB 2P9GA 3LA0A 4QW9A 5KFXA 2V63A 4PEOA 1ZM2A 3DRXA 5DDQC 5JXSA 1F60B 3NS5A 4M5HA 3BPSP 1RAFB 2NSCA 5KFDA 1KKHA 5JMNA 2NR0A 3C6UA 5LM7E 1WSVA 4YB1P 5G4DA 1V6HA 3CGIA 3G6VA 1NJWA 2UU9F 5J2NB 4G65A 3NCQA 3FEYB 2LQBA 1VK8A 1S72S 1BQMB 1K8AT 3DMJB 4QYZJ 2MQLA 3MR3A 3M8WA 1VYAA 1N5TA 2KYXA 4F4WA 3OSPA 1RWKB 3RRHA 1ZH5A 5HQMA 3KHLA 2MKJA 2RSQA 4BHQA 3PYFA 3ZZUA 3AQPA 2AYMA 2M9KA 1QD1A 1NHUA 4I64A 3NBPB 4RW9B 1UP1A 1H2UX 2BE2B 4IFVB 4BWMA 5KFTA 1VIOA 4EYIB 2YNHB 1KVJA 1KP6A 2DXDA 4CNZA 5I3UA 3GONA 3W1YC 1XERA 1S6OA 3HZGA 1R31A 3GP9A 4AUKA 2WOMA 3K5LA 1T9TA 1NU4A 2QIFA 3GCXP 1S0VA 3C8YA 1E6YA 4LFCJ 4YY3F 1PJ7A 2PSZA 4IH6A 3FGVA 3VAGA 2JOQA 5ETSA 1HBNB 1TMMA 1X5TA 1CC8A 3GZ7A 2EC2A 4L72B 2C42A 3PRVA 3R5AA 4YMEA 1VDHA 1DLOB 2PA8D 3CSKA 4C0OC 4FS2A 4QIFA 3B6BA 4Z2XA 4ENOA 1VOMA 3OHBA 1CBKA 3FSXA 2HHHJ 2ROPA 2HZVA 2B5JA 5LOQA 2ZBIA 4L3NA 2XY7A 4LQ3A 3DGVA 2F4FA 3PJWA 3M9NB 2C2OB 1FHTA 4ANDA 3QJJA 4Y3CA 4ZPDA 3KNGA 3N28A 2BQUA 4DR3J 1LWCA 3CW2C 4KT0C 3DHWC 3OL6A 1NDPA 1RU1A 5AE2A 4KV8B 2H4WB 1TV6A 4DR4F 2I8EA 3UNGC 3OT9A 4LSLB 4Q45A 1CQNA 2IA6A 1LW0B 1JKHA 1CJUA 4ZA1A 1QVGR 1GTEA 1OYDA 2CPDA 5ETOA 3NG8A 3MURP 4ID5A 1HNIA 2W4DA 4A8QA 4RW6B 2JJ4D 1AA1B 2M7SA 1FT8A 2CKWA 2QA4G 5DLFA 1NO8A 1AZSB 2CA9A 2BA9A 2M8HA 1EAYC 2GIQA 1HWKA 1EKSA 2DHSA 4QBUA 4K4TA 4F25A 2CQ2A 2C2NA 2KTQA 2AYBA 3TZYA 4NI2B 4USJC 1R8BA 3MEDB 3KK2B 4K2XA 4K4YA 2E29A 1PAUB 2HVEA 1T05B 1SKSA 3SCKE 2B9EA 2AYEA 4C11B 1FX4A 1QJHA 1FDAA 4B3RJ 2OP5A 5I42A 5HVHA 3HT3A 1ZPVA 4KGKA 4RU2A 3Q24A 2EPIA 2R7QA 4J9UE 3KJVB 3KG0A 4DSLA 3SFUA 2U1AA 3ZFVA 1S1WB 3EGZA 2DD8S 3E8OA 4DL6A 4S0MA 3ILJA 2X7IA 2YXLA 3DOMA 1WF1A 5KFQA 1SB6A 3QWPA 2HFZA 4K4SA 1FF2A 3MEGB 2UXDJ 2DO0A 2K2PA 4L6V3 3JTNA 3D54A 2FHJD 3HSDA 2HMIB 1I1GA 3I82A 2GVDA 2IRUA 2FJBB 2R8IA 4IQXA 3MMBA 4R5PB 3AY0A 4I4BA 5B0CA 1CQMA 3ZTRA 5K8PA 4ZLLA 1YBAA 1HFEL 2E9ZA 4CM0A 2IJFA 4A47A 4GKKF 4PWDB 1T11A 3MMJA 1SKWA 3LAMA 4DWIA 4ZP8A 5F8NA 5DETA 3QJLA 3M8YA 2QT7A 3NY0A 3UD3P 2DT9A 4ICLA 1VQOS 1VQYA 3OBIA 4WIIA 3C19A 1A0OB 5AJ3F 4Z37A 3I96A 1S1UA 1TKDA 3KUHA 4Y6IA 2HHQA 5IXUA 1MU2B 1IM6A 4NA3A 3ISNC 1EIYB 2APOA 4NLTA 5A8RB 5L9NA 2QLXA 2WW4A 5AXNA 3R5GA 2WSFC 1RWUA 2FLLA 3VQSA 3CDEA 2ZKTA 3V6DA 1K9MT 2DH9A 2JHEA 5HSPA 4MFBA 3V4IB 2KZZA 5L46A 1T0TV 4X65F 2FLNA 1S6QA 1R0BG 3KLGA 3I0RA 1Q7LB 2AKWB 1ZM9A 5HMYA 3MECA 4GO5X 2FY1A 1SV5B 3EZOA 3O6QA 4DQRA 1YBTA 2DBBA 4DV7J 5C24A 3GIKA 3RW6A 4MIAA 4DV3J 2Y0BB 3UW1A 1EB0A 1FRKA 3TA2A 2H3EB 4DV0F 5GAEI 3G87A 3CJKA 1N5QA 1RTJA 2W01A 3H4DA 2NXJA 5KFYA 2G9OA 2EKNA 4JI2F 2L9DA 1QE1A 1VQSA 3T41A 3HI9A 2E5GA 2XGQA 5J1PA 4X4UA 1W2BR 3N6NA 1D9AA 4Y2CA 3TJ8A 4CLYA 4YDXA 2L41A 4FNIA 1RWNB 2KG1A 2PO4A 3AT1B 2YWHA 3US5A 3PYGA 3MR7A 2VG7B 1HMVA 3M05A 1Y3KA 2OTLS 4AFFA 1RHUB 1R8CA 5K14B 2PT0A 1JLCB 3FMWA 2YKMA 4NXMJ 3ZZRA 2B6AA 3Q8YA 4X4VA 3BN4A 3Q2TC 4JI7F 2MGZA 1RAGB 3IAM9 4A8WA 2BZ2A 1WORA 3CDBA 1CULB 1LWEA 2NS1B 3UVJA 1X4GA 3IFEA 3ISZA 2HZCA 2VBZA 3BDPA 4DQQA 1BLUA 4RW7A 3FQKA 3BZQA 2R2UA 2ZZTA 4OZ2A 4C3MA 4QIEA 2QYCA 1FFSB 1TL4A 3M32A 4OZ5A 2OPQB 2XLKA 1B3TA 2ATCB 3M8QB 4K50A 4WP8A 2CFXA 3QZ8A 2YH0A 5C25A 2M52A 5KG1A 2ZNZA 1BE4A 2K7KA 3G6YA 4L74A 1FA0A 3QGGA 1KOHA 3UDEA 3CNQP 3TYTA 3QIPA 1VQMS 2QA2A 4JV1A 1YJVA 4DV1J 2RVJA 2K06A 3LP0A 3NGDA 2DR8A 4DSKA 2VOOA 1SKRA 2YX4A 2BW2A 4H4OA 1UMJA 4LR8A 2C28A 4C8YA 2AZ3A 5HJXA 3OVSA 4M5KA 1RT3B 1FK9A 3D6TB 4K59A 3W9JA 1PC5A 4ECQA 4NXNF 1WTBA 2MKYA 2QEXS 3DLEB 1NUEA 1X5SA 4HT5A 1J5EF 4JBCA 1RE1B 5HK4A 2E5IA 4DFPA 3A4TA 3LP1B 3HHLA 3MAAB 2YWWA 3A3PB 2FLPA 2XZWA 3BO4A 1U6ZA 2R2RA 4CYUB 4K8RA 1WDDA 2XYPB 4O0NA 2OPSA 8AT1B 3EVWA 3HJVA 3PACA 2JFKA 1RTDB 1JLQA 2ZBCA 2O66A 2LA6A 3F44A 4NLRA 3PYEA 2RILA 3T1HF 2MTLA 1MMDA 3SIPB 5CYMB 2ASJA 3W2VA 1RA7A 3WC2A 2L08A 5D0HA 3THPA 4DR7F 1HPZB 2JH3A 3W5XA 3JSBA 4Y2IA 2Z30B 1ZTWA 2ZKUA 4HKQA 2E1RA 2M0GB 4DSJA 5A0YA 2K1RB 1FJEB 4ECXA 3BF4A 2UUCJ 2YWGA 4DN0A 1NDKA 2OFHX 1DARA 2IJNA 3FMBA 1VQ9S 1N6QA 1P1LA 3MF5A 3WBZA 3K8VA 3P49B 2F8HA 2VC0A 2CUYA 2QX0A 5KT7A 1T8EA 2R3VA 4JV0A 5A6WA 2ZC4A 4DUZJ 4TLRA 1WKJA 3FBCA 2H5IB 4JI4F 4LR9A 4DBQA 1KEKA 5D78A 3M2RB 1Z4UA 3K17A 4EBCA 2N82B 3GE9A 1PYSB 2VBWA 3Q2SC 5AE1A 1U1OA 1U09A 2PEHA 1H72C 4ZVGA 2AQ4A 4RR5A 1G1XA 3H40A 5H9FJ 2R7RA 3NRBA 4DMZA 2J9DE 4OYMA 3R2CJ 1FERA 3D1HA 2UXCF 1WEXA 3G9CA 4OI1A 1BGXT 4TXSA 4NLWA 3DOLA 3G8TA 5KFNA 2BM1A 4KPCA 4DCOB 1VQ6S 4ILMA 1YDLA 3PRBA 2E7WA 2GS8A 1U6BA 1IBMF 3NCRA 2J8SA 5IWAF 2D3O1 1TFWA 3K57A 2UUWA 3EGWB 2Z2YB 5C42B 4N5SA 4WWSA 4NYZA 1NM2A 3D9BA 7AT1B 2DYAA 1B7YB 4B3MJ 1NHKL 3P4UB 5CABA 1MROB 2V8HA 4AL7A 3D3CJ 4USUA 3VAFA 4U67Q 2LEBA 4ZLJA 1REVB 4J5OA 1FEHA 1N5YB 2UUTA 2ZD1B 3ZNJ1 2UVRA 2GQCA 1FTCA 3MHYA 1XNQF 2D41A 2MY7A 1Z1ZA 3NS6A 5D3GA 4DEZA 1R8HA 5KT5A 2JVOA 3OTCA 3CXCR 5DQIA 1C1BB 4TYBA 5FDLA 1FJGJ 1AXQA 2EW9A 2WRMA 5AXKA 1XQIA 4LRBA 4GMKA 4M94A 2EG1A 4EZ9A 1VJQA 3OD2A 3CJSA 1KDNA 3EZ5A 1CJTA 3O1LA 1KBRA 4KO0A 2CPZA 3NGUA 2D9PA 2OMOA 2HLUA 5G0RB 1HNZJ 2HIQA 3I0SB 1VBZA 4YQWA 2CJYB 3C16A 5A8KB 2DNOA 1KLMA 3J7Z5 4NMLA 2BR0A 2ACMA 3WZ0A 4CO4A 1HR0J 4TKTA 3BQ2A 3NAHA 1HI1A 2MY8A 2QL5B 2GJFA 4DL0C 1GX5A 4EO6A 4RZRA 2ZVIA 2G2ZA 3TQEA 1A7GE 3RGIA 1N36F 3RB4A 1TL3A 4P7TA 1LOUA 1CJKB 2YX7A 2ZJRQ 5JJBA 4BC7A 5EUHA 3BGLA 4TLQA 2KH9A 4ECYA 2RU3A 1NBEB 1SL1A 5CYJA 4X84A 4FF1A 5A76A 4JI6F 1RWOB 2IAJA 3G4SS 2ZUAA 2P9CA 1URNA 3B54A 3MM7A 3D4JA 4YB5A 1VQNS 1K1QA 2RD5C 1YVFA 1N33J 5D0GA 2C3MA 3G8SA 2HWIA 3R5DA 3FFIA 3GSIA 2RRBA 2ILZA 5FJ4A 4OYWA 4FP9A 3CCSS 4ED0A 1NK5A 4Q8EA 4IDKB 2XB2D 2IM2A 1HQUB 1RISA 2F9JA 1I51B 2WK4A 4OLOA 1NSPA 5ETTA 4DPXA 2MZ1A 5DDRC 4Q0BA 1HNVB 3ETOA 1MSWD 2A18A 4R8UB 4LRCA 2NQPA 3NS7B 4YUDA 5M2UA 1U2CA 3KLFB 1TK5A 2W7AA 4DV6F 3FUYA 2HEKA 4ZCKA 1NHVA 3M2VB 3WX8A 2XMMA 5KFMA 4CLWA 3PX4A 4QR0A 4DR2J 1KLNA 4EMDA 5HL7Q 2VQEJ 1YJNS 4NL5A 5T41A 3MTKA 1TTHB 4FDFA 1NMEB 2ZWOA 4M5LA 1LW2A 3MD3A 3UN5A 3AA9A 3HHLD 2VH7A 1RT6A 3VGTA 4USMA 4EBDA 4WZMA 1IR2A 4MKVA 2F9DA 4AL6A 1PBAA 2RU9A 5IQQA 4B9TA 3CDWA 2WW8A 4HHJA 4A48A 5BXIA 3UDLA 4RWWA 2QMWA 1HNWF 1RT2B 3V6HA 2ZH4A 3KHGA 2F4VF 1RBLA 4A8OA 3GIJA 3NMAA 1UJ6A 1FVQA 2LXUA 9ATCB 3PHEA 2QGFB 2CQIA 4P75A 1M5OC 1UVIA 2R42A 3UDVA 3RAQA 5IT4A 2QE5A 5A8WA 1DZ5A 5ETQA 3VWSA 1X5PA 1SC3B 2QO3A 4DZDA 3CMES 1KR4A 2YNGA 1PC4A 2QLWA 1HQEA 5RUBA 5IV4A 3I9ZA 2BJ1A 2VU5A 4IRKA 3EX7B 3MPYA 4DR1F 2XI2A 2CJ9A 3P45B 3J7ZT 3H7HB 2CPFA 4UT4A 1EQMA 4ZN3A 2ZM6F 2R4FA 1SL2A 4OI2A 3AXKA 4NASA 4L76A 3MCNA 1TUVA 2XNQA 3EDQB 2JC0A 4DV4F 1KC8T 4KKOB 1U6FA 2DGUA 2OSRA 3KDOA 2RE1A 2CPHA 1ZAXA 1OSDA 1EHWA 3QRRA 4LRAA 1FDBA 5ETRA 2NXEA 3KUEA 4F2SA 2YNIB 1RHKB 3I31A 3B8HA 3EJMA 1RBOB 2CJKA 1VRTB 1L3TA 3GIRA 3JSRA 2UU9J 3U27A 2DGTA 3OR2A 2GA7A 4U8VA 3CJ8A 3DRSA 2I9SA 1GMUA 2AJFE 2KZMA 3VALA 3NCPA 1A9NB 2ZITA 4OZ0A 3VAHA 3GG0A 3JAMY 5KFAA 2NPIA 4YFUA 4PXEA 4B02A 5FLXU 1TAQA 4HHHA 4DFMA 4ZP6A 3BGOP 1RK8A 4ETXA 1QSSA 2Z4PA 4ZVPB 4KGZB 1CJVB 1JLFB 2V4QA 3R1LA 1FRXA 3H90A 3Q8VA 1PBUA 3IRXA 1FEEA 3PDNA 3H4BA 2J6TA 4EI2A 1RKJA 3CMQA 2I1RA 1FKOB 1O6XA 4B9UA 4Q2LA 1GFWB 2V68A 3C15B 4GC7A 4K0KF 1D9FA 2YH1A 1AW0A 3IBCB 5AXLA 2JDJA 1FXDA 1T03B 1PYOB 1GNKA 4UUXA 3O44A 3AJ1A 3TEHB 4C8KA 1V3SA 2IC3A 2YKNB 2DNMA 5IM0B 3MUTP 4YY3J 2XHCA 2ZH3A 2CJQA 1S4FA 6FD1A 4ZJOA 1IBLF 3D28A 2RRNA 4ZPWR 5CA5A 4QWCA 2V9WA 1OQ6A 3L7UA 4P9SA 1H74A 3RR8A 2G1DA 4DUYF 4O4GA 2WONB 2PFFB 2YNFB 5HP1B 2W2MP 3MGJA 5DM7Q 1JLGA 3CB4A 4K4XA 4FYDA 4ZJQA 5DGBA 3TRGA 3SCJE 3IR5B 4H4MB 2J6UA 1UWBB 1ZBTA 3ZZZA 1F3VA 3ETMA 2FYXA 4YR3A 2YQ1A 3TX0A 2V94A 4BS2A 2XMKA 1RYRA 4RNMA 4DR4J 7FD1A 4RNOA 3A8EA 2EC0A 3MPUB 1XIQA 3TJ9A 3UPFA 3HKZD 3W2WA 1NLKL 3SYZA 2UV8G 4OYAA 1HBUB 3JSMA 4XTTA 1SL0A 1S7HA 1T94A 2VDIA 4Q2MA 3IA0A 3GMGA 3PRDA 1TUGB 4RL1A 5K5MA 5C2GA 1Q79A 1YBUA 3T1AA 2BE7D 3K5PA 2ALYB 3KTQA 1IUJA 4P10A 5ETMA 3PIPQ 2E5JA 4F3MA 2CQ1A 1X4EA 4WU2A 1VFJA 3PZPA 1HYSB 4UUWA 4DL3A 3DI6A 4X4TA 3GU0A 2B56A 2ASDA 3TAMA 2CPYA 1CS4A 4IO1A 2HBZB 4DHVA 1U8WA 5DJBA 4ZVFA 1S1TA 2OTJS 1EQ0A 2VFRA 3KG4A 2XO6A 2VFUA 4PXBA 2KDOA 1HNXF 2WZ1A 4N7TA 2ZEJA 3GCWP 4OZ3A 1NEEA 2WVCA 2KXFA 1YX2A 1VQ8S 3ILIA 3KJQB 4NA2A 3MM8B 1XMQF 1G2EA 2XMAA 3QMQA 4P73A 4J9OA 4UQTA 4KFBA 5J2PA 3N9UC 4X4RA 4YEAA 3H0PA 2C1EB 2X1FA 4LF4F 1F0XA 2KXHA 2UUBF 3DU6A 4OV1A 1QDUB 3P8BB 2PE8A 1DAXA 3AD9C 5HI7A 3NBPA 3HVRA 1XJWB 4IFVA 1X60A 4OZNA 1GMWD 5KFPA 2FJEB 3PV8A 3D1OA 4QQBA 4CLSA 2V2KA 1LKZA 1Y5NB 2E9TA 2BJ8A 4AE5A 2VG5A 1U1QA 4OQJA 2Z2ZA 1QLNA 1FRJA 2CQ0A 4ZCMA 4EU0A 3K89A 2QA4S 1R6YA 4USTA 4J9SA 2F3JA 1K0TA 2E5LF 4DS4A 4KY3A 4IO9Q 4GKKJ 4J9PA 1TVRB 2Q6CA 3OVAA 3T6BA 3HD2A 2DISA 1HBNA 2KKHA 2W7PA 2GCFA 1TMJA 2BJ9A 3M6XA 3J7AN 2M4MA 4USVA 1I94F 1HARA 3TAQA 4WE1A 1F5BA 2LDIA 5HANA 3FSYA 5AJ3J 2ZNYA 1UEVA 1X9WA 1R6VA 3PCOB 2OGUA 2ZOMA 3IG1B 2A6OA 2R8HA 1WG4A 2P5VA 1AT1B 4OI3A 4C8LA 3W3SA 2UP1A 1QSYA 4M5DB 1JLBB 5DG7A 4GC6A 1LXJA 2YKAA 2DB1A 1WC6A 4RPFA 5DZ7A 3FEXB 5EWGA 2B9XA 1HA1A 4X65J 1IBCB 1RCXB 3F73A 2W2PP 3WDOA 2M70A 3PJXA 4N47A 2DKOB 1E6VB 4OJ3A 1FKAF 4TYAA 3EMTA 3PR5B 3EICA 1ZTTA 1HIYA 3AAWB 1B0VA 2EFOA 4TN2A 1IWAA 3KLEA 1HKAA 5J2QB 3I5BA 3T9ZA 4GKJF 2GGPB 3PHTA 4DV0J 4RW6A 1M1GA 2G4BA 1RWPB 1U47A 1J2VA 1GEHA 5IFMA 2HNDB 3CE8A 2MZTA 4O3OA 4JI2J 2QFJA 1Q16B 3LF0A 3E01A 5F9LA 5E41A 1FTRA 4I7FA 4ITSA 1WDTA 4EEYA 2W9CB 3M2UB 4Y34A 1S9EB 3QLHB 1IJEB 3CCTA 4KPYA 4MK7A 1GXLA 4QWBA 3KK2A 3CD5A 4WFBQ 3HVWA 2CJXB 4RW8A 2XZDB 3DLGA 2CYYA 2AW0A 3Q83A 3W5ZA 1ULRA 5DDPC 3Q23A 3D6HB 1S1VA 4IOBA 1Q81T 3RB3A 2IVFB 4DX7A 1IKYA 3MM9B 4JI7J 3D5MA 5M2PA 2DRDA 4NLXA 3LOUA 1VC5A 3PFOA 2R7WA 3KLHA 1VGYA 4F0HA 1GT8A 5J1EB 4G1QB 4OHWA 1O8BA 3BH7B 4PABA 4DL4A 1P27B 3JYTA 3T19A 2Z58B 3R27A 1PKUA 2XYGB 3CVKA 1V9OA 4WXOA 1JXVA 3M1VB 3MEGA 2XSJA 2MKHA 3KFWX 4M5NA 3DFEA 3BKFA 4WTOB 3QNWB 1WEZA 1OPIA 4DI6A 3V81A 4G3IA 2FQQB 4F4KA 3PKMA 1B64A 1EETB 2N3OA 4EGLA 2IPOB 4KJIA 3K7RA 3BGRA 4IG3B 4MH8A 1FWKA 4CZCA 1KD1T 2N3LA 4FVCA 2QL9B 1FO1A 3DDNA 5SUHA 5L1KA 3MAHA 3SSRA 1U49A 1VRUB 5HO4A 3I55S 1UTAA 4GVBA 2OO4A 4NWBA 1W7WA 1ZETA 3OFFA 4RJVA 2RF2A 4NXNJ 4AT1B 2EFPA 5ETKA 4Z7CA 2FDNA 1LWFA 1MU2A 4LVNP 1J5EJ 2CPIA 2KT2A 2GHVC 2PI5A 1KS2A 3ZZ0A 4WP9A 3G82B 2JEGA 5LSRA 1XMOF 4O3SA 1RADB 4ECVA 1YLXA 4NMXA 3M8PA 4FKXA 4J7CA 4UY8T 2KJWA 3MM5A 1IKWA 2KFNA 3W5YA 3WIVA 5AE3A 3BSOA 2WB1D 3CTRA 2I2YA 3H42A 2N7CA 3T1HJ 5E2QA 1SVDA 4LJMA 4B9VA 4DLGA 3AOCA 3VR1A 1TL1B 4HL9A 4BDPA 1JK9B 4DR7J 1FRHA 2DEJA 2LQ9A 3HULA 2EVZA 3HSZA 4CCHA 3JB9k 3LAKA 3QAUA 1TAUA 5K20B 2V4JB 3H20A 2ZBRA 4M95A 3C6UB 4RW4A 2BE9B 1JJHA 3VAMA 1JLAA 2DR9A 2EKYA 1REGX 4WFAQ 4ZVHA 3PX0A 4F02A 3UQSA 4Q43A 3IGNA 1N5VA 4NLOA 3MOJB 1ZAVA 5K14A 4TU8A 1JLCA 2UZAA 4JI4J 1WOSA 3IBFB 3LO3A 1KQFB 4J37A 2LYVA 2VDHA 2DCLA 4ZDNA 4FBUA 3M4XA 3HT0A 3M30A 1ICEB 3L95X 4KRWA 1DTTA 5D0RA 4OX8A 1P8GA 2DJWA 1X0PA 4XAKA 5E3QA 1D0EA 3SQOP 4FVMA 2KRBA 2OLWA 1QSLA 4EFAC 3N6MA 1H2VZ 2UXCJ 2OHDA 5I3UB 4RUHA 3TVZA 4ED3A 2MQOA 4ZK7M 3QQCD 1LFWA 4P2FA 4B9MA 1JLEA 5HATA 4PQUA 4JOUA 1FKPA 1WELA 1TP7A 3ENWA 2WOMB 3C6TA 4ER8A 1H6KX 2PGCA 1LNQA 1UVJA 1UL3A 3RBDA 1IBMJ 1E6YB 1FE4A 3J81Y 5IWAJ 1VISA 3MCMA 2HNYA 3LALA 3HZEA 3D3BJ 4KHRA 1Q53A 3AOAA 2HFUA 2DGSA 1Q78A 2DNKA 3KJNB 5U47A 3H5SA 1SJ3P 2EEYA 2IVYA 1MN9A 2H5JB 3GFZA 2IM3A 1ROFA 1SBRA 2XNRA 2X1BA 2B5JB 2BKOA 3PYDA 1ZZFA 3VQTA 4ZP9A 2HLTA 4DV2F 5H1SV 2GW8A 1X4HA 4DL7A 3PX6A 2KYZA 1XNQJ 3UD5A 3H2LA 3PEJA 1T9WA 3GR1A 3CF5Q 2Q6BA 1KHWA 2NREA 1RT3A 2FGOA 5D8HB 1EJ7L 4RNNA 1Y0HA 1VCTA 4DU7A 1TV6B 2J0XA 3DRPA 4NLVA 1PJ6A 5L9XA 3W63A 1GH8A 1RLCL 3LTOA 4CLUA 1P9QC 4DXLA 2E9RX 4DR5F 2FJWA 1SH2A 3W64A 1WUUA 4ID5B 1B0PA 3BKTA 1HNIB 2Q1LA 3QGIA 2EFVA 1U1KA 1BQNA 2CIMA 2XS2A 4QZVB 1FFWB 2AZ1A 4U6PA 2CWXA 2VG6A 4V19X 2WVEA 3UFCX 5B09A 2LEAA 2ILYA 3KLIB 3H8YA 3QIDA 2WVDA 2BOAA 2CNLB 1RTHA 2AGQA 1S0MA 4F50A 4X62F 1GAOA 1UVKA 4LBPA 2IYIA 3CJRA 3I9V9 3GQCA 2K1RA 3A8IA 5KTQA 1N36J 1HWUA 4R25A 2ZH8A 2J7WA 4JV5F 1N54B 3CIZA 3D6MB 5I42B 1VLYA 4JI6J 1PIEA 3CT9A 4P2MA 4J9QA 3X3UA 1M0SA 1S76D 4OV6A 1DTQA 1QVFR 3QJPA 1I6JA 2JWNA 3K5MA 2FVQA 1XNRF 3DRRB 3NGSA 3WIUA 2MDAA 5KFOA 2GHWA 4CIOA 3N01A 1C2PA 1D9DA 2EXUA 4LF2A 3M2RA 5CD4H 3NGRA 3OXFA 4F3QA 4TVAB 4IR9A 4KGMA 2IMWP 2V4RA 3N4WA 4C98A 2C2EA 2KI2A 2DGWA 4M1KA 1GMVA 2DNPA 3SCLE 3HD1A 1XC9A 2GVDB 3H2UB 4CO0A 3MMBB 2ALZA 4A8YA 4PYAA 1S97A 1M90T 2VICA 1VK3A 1VQ4S 5KG3A 2KFYA 5A2QY 2XMVA 2OEJA 4DV6J 3GJRB 2MJUA 3L4BC 2FHKA 2NXNA 4PG6A 1IR1A 2NLWA 1M1HA 3VF0B 2XHWA 4WXWA 3DLHA 1IKXA 4IH7A 4FF4A 3JQKA 4ICLB 3DN9A 3FKBA 2FJDB 3DOKA 3VAKA 3IS9A 3RB0A 4V19J 4MJKA 1F2GA 1DY3A 5F8MA 4ALZA 1S1UB 2VZ9A 5GMKa 2FHOB 4ELUA 2OKQA 2FLOA 1WC3A 4DF4A 5H9FK 4CO5A 4I1TA 3RTVA 2DK2A 2KRRA 2DITA 5A6PA 1HNWJ 3EPGA 1FRMA 4ZJLA 3V6DB 3NNAA 4U8YA 2F4VJ 5B0FA 1Y11A 3K0JA 2MHNA 2J9CA 1VC0A 1UPMB 1S6QB 4MT1A 3TVYA 3I0RB 2PIIA 1GTHA 3TR5A 3MECB 3K59A 2PN6A 1D3WA 5LJ5Y 1QAYA 2I38A 4WYLA 3MM6A 4E8UA 1KVIA 4YS2A 1QTNB 3LW5C 4C8ZA 5C24B 3CCLS 2ZE2B 1Q8BA 2ZHOA 2J0QD 2L48A 4BLGA 3OTOF 1NDCA 1BWEA 4N8OA 3HP6A 3H98A 4DR1J 3CJKB 1RTJB 2DCUB 1URRA 1NPPA 2ZM6J 1NZAA 5CCLA 3NGKA 2XY6A 3R8YA 5D15A 1QE1B 2UVVA 5BYSA 1V3ZA 2FVPA 2PFDA 1YSJA 4DV4J 2YWEA 4CLFA 1TKZA 3IAS9 2GQQA 3BBBA 2OH2A 4P74A 4LFAF 1HMVB 2Y1LB 4AXIA 2DXFA 4DX8H 4OYOA 2YKMB 5M2RA 2B6AB 1B99A 3HCXA 4KR0B 4ES2A 1VQKS 2LLZA 2MGZB 4A8SA 3W8GA 7FDRA 3A1YG 4PUOA 2KFZA 1LWEB 3UVJB 4DPUA 3QT8A 4ZITA 1QAXA 2RDDA 3A12A 2OIHA 2XYHB 4RW7B 3RZAA 1TU0B 2QLJB 1TK0A 5B0EA 1H3DA 3IC1A 1Q8LA 4OYPA 1X4BA 3B82A 3QT6A 3ILLA 4RWXA 3HK2A 3BS9A 5K8NA 1S10A 4J91A 5B0BA 1J5OA 5E5NA 1TK8A 2QLBB 3M32B 1JNRB 1IQZA 2IVMA 3DRYA 1L5UA 3AHPA 2AWZA 4K0KJ 4RUBA 1RABB 5C25B 4EBEA 4KHPF 1QY7A 3KWMA 3G2XA 1XR6A 2IHR1 4A8FA 3MMAA 3KDNA 1X4FA 3P96A 3J7YI 4C97A 5F0UA 4I6YA 4B08A 3GR0A 3L3CA 4HACB 5B08A 1NKEA 4UW2A 1U1LA 3QIPB 3GV7B 4P2XA 3OUYA 3JSYA 1IBLJ 1OY8A 2HBRB 3LP0B 4AYBD 5CAAA 2CQCA 5CYQA 5DQHA 2YKOA 2P6SA 2C2DA 3NLCA 3SFGA 2EWHA 4C48A 3UR0A 4DUYJ 1GXUA 4H4OB 2Y8YA 3A8KA 3OHAA 2BJDA 3GYNA 1U4BA 5KFZA 3GV5B 3A3NB 1FK9B 1TL5A 5CH7B 2PC6A 3MZIA 4BCAA 2JLGA 3PW7A 2AV5A 4B9NA 3IN5A 3D66A 5ADZA 5BYRA 4KH0B 2HVZA 2WSEC 1SUQB 3D68A 4RNHA 3HHLB 4NRTA 3QWUA 4LIWA 1HBMA 5HBMB 2JZ5A 1C4CA 4WU3A 1UZDA 2DPJA 3CCMS 5LSLA 2OPSB 2YVSA 2DNNA 1JLQB 2E1MC 2CADA 3OTDA 4MKYA 4TY8A 1F5AA 1LXNA 3W2VB 2HQFA 1WI6A 4DPTA 2NXCA 1RSCA 4USKA 2HFSA 2BM0A 1T3OA 2CJBA 2MQ8A 4ZHRA 4F4AA 4B3SF 2K8GA 2FZCB 4B3OA 2FPHX 5A0YB 2YWKA 3U7JA 8RUCA 3AJDA 5ETLA 1S49A 5H9EK 4N56A 1QAJA 1N52B 2V2QA 4USHA 2HAIA 4J9LA 3IWNC 1WKKA 3G6ES 1KQGB 4KKOA 3OJSA 2LU2A 2K3KA 3OFEA 4R0EA 2HURA 4WCEQ 1KHVA 1HNXJ 2HGNA 5KFSA 2F5GA 3CCQS 5IT0A 5K9FA 4FYYB 1UZHA 3UDCA 2R2TA 5C7PA 3RG6A 1FD8A 3BN7A 3BB5A 1XMQJ 2VPZB 1WF2A 1XR5A 1T9YA 3NWRA 1OY9A 4CLZA 1JX4A 1FXLA 5D4OA 2XMUA 1NK6A 2V0NA 3AB2B 3N5FA 4MK9A 2PMWA 4LF4J 2DNYA 2UUBJ 4CT9A 2DRBA 3FC9A 4X2BA 2MSTA 2W2NP 5IS2A 5B0GA 4PPZA 4JUZA 2ASLA 2HFVA 3D2WA 3DOLB 3E2EA 2VUGA 4J9VA 3S1TA 1IXKA 4IOCQ 2O1PA 4EZ6A 5F3TA 1C0UA 3LGHA 4OZJA 3MPDA 5F8HA 3MR2A 3K5OA 4E98A 4EUVA 3AQOA 1W25A 3C15A 3J81j 2EK1A 2XEXA 1BXNA 2O01C 4F7VA 3FCVA 1HHQA 4W90B 1O5JA 4OYZA 2E5LJ 5C2CA 2XWYA 3BREA 3ENAA 3CC2S 1C0TB 2Q43A 3AFGA 4FXVA 2KVIA 2CWKA 1TZ0A 5DZ6A 3Q86A 3V5RA 3LP2A 2VJUA 4PPDA 1I94J 2LVWA 4CLTA 4J9MA 1JXLA 1BHNA 4L73A 2BKNA 2JL9A 1WTFA 4RKUC 4ZCIA 4IR1A 5D3GB 4RBVA 2RHSB 1S1XA 2DO4A 5B0AA 2QL7B 2ZH5A 4K2JA 3ADAC 3HHLC 2EG2A 2Y0SD 4JI3F 3HHEA 3EVOA 1S79A 2W1BA 3RU0A 4IUFA 1PO6A 1CJTB 2B4PA 1KFSA 1RAHB 4KO0B 3IR6B 1EZZB 3TUZC 2IMOA 3RW7A 4LF8F 3OV7A 5E0OA 2GVZA 2HVDA 4PAAA 4O3QA 4I2PB 3C16B 2BKPA 2PA3A 4E2FB 4LF5F 1Y10A 2C2KB 1GX6A 4NLDA 1KLMB 3SQGA 2NYIA 2IM1A 4TNOA 4GKJJ 2ZH9A 1TKXA 3QGPA 1VI7A 2CQGA 4ILLA 4KGVB 3PNIA 1R0CB 1R0AA 5KT6A 1D09B 2IJRA 1FWPA 4QU6A 4DSEA 2HFOA 2MQNA 1TL3B 2VD3A 2KU7A 2GMJA 1LWXA 4ECRA 2WVFA 1DBDA 4IFYB 1ZYQA 2AGPA 2MXYA 2OEKA 4HH0A 1NK7A 4FXDA 1R3NA 4OMFG 2IAJB 5CCMA 1IN0A 4U9RA 2NCKL 3FQLA 4ED5A 2Z56B 4IG0A 3MM7B 2R7XA 1ZA1B 1MMLA 3HVAA 4ZVUB 1AYEA 1PG5B 4UOCA 4EO8A 2CVIA 1T02A 5KG2A 3FFIB 4U7UD 1T95A 4GO7X 4WKYA 1WJ9A 1NJYA 3F56A 2LFVA 2QC3A 2AJ4A 3I6PA 1GQEA 4JV2A 1NZ8A 3DLLQ 3JXOA 2DY9A 1SQGA 2XC9A 1NK9A 4Q0BB 1JB0C 1RWXB 3QSYB 2HHVA 4NCGA 1U24A 3TUJC 3J7A1 4CLKA 3W66A 1P6TA 1J27A 4TY9A 4X4PA 1VJWA 4WTYA 3CD6S 1SJ1A 1S6PB 1WHWA 1K0VA 5HROA 3VVUA 4AXJA 4PZVA 1YI2S 4LIRA 4C8OA 5JUMA 3DYAA 2ZJPQ 4ILRA 3NAIA 3OTBA 1X9MA 1S7IA 3LPYA 4WK1A 4OJGA 1Q4RA 3TWZA 4HH1A 2X3GA 3ITHA 5HVGA 3X1LB 1RA6A 4LF9F 1LW2B 2HQCA 3POTA 1JMTA 2A2DA 4LF1A 2NUUG 2H9ZA 1RT6B 3JS9A 3HJFA 2KO1A 1G3OA 1CG2A 2P2CB 4K4VA 2X51A 4ZVOB 3V6JA 2JC1A 3ET6A 2L9WA 4OJ1A 2VHGA 1X31C 4ES3A 3OJUA 2M3DA 4RU9A 4M5DA 1JLBA 3QBCA 2NZCA 1QM9A 2ZZMA 1HW8A 5KG4A 5HLFA 4JI0F 4NA1A 1XMOJ 3PXGa 2H1YA 3PW0A 2VA2A 4C3LA 4CI0B 5A8WB 2B8PA 1FRLA 2QYGA 2C3YA 3SDEA 3OW2R 2DR7A 2FZGB 4RNFA 4NZ7A 2MLYA 3GFXA 1ACMB 3SSQA 1VMBA 5K8OA 4YR2A 4N77A 2KL8A 2BANA 4KH1B 3S8SA 4PR6A 3R5BA 3NOGA 2FC8A 3IO1A 2ZHAA 4Y28C 3KUGA 1RHJB 1KVKA 1AUDA 1FFGB 1OIAA 2WSCC 1IR0A 3GPAA 2GX8A 2O3DA 3SMZA 1QAIA 2F65A 3QO9A 4QIGA 3QSIA 2HQIA 1EARA 3MR6A 3HKWA 4HVZA 1VLOA 1DJ0A 2HGMA 1S9EA 4USWA 5EN1A 4O3NA 4LBHA 3OLAA 3HXMA 3OR2B 1Y5IB 3DRSB 1FNOA 4PXCA 1Q8KA 5D77A 6AT1B 1CEZA 1RQ0A 3Q0AA 3L9ZA 1CVJA 4CM2A 4HR2A 3HDSA 5JVGQ 1HHSA 1S12A 3BBFA 1RTIA 2VOPA 2XG8A 2AJ2A 3PTWA 4TQRA 3O5TB 4CTAA 4IRCA 3FK4A 5LSOA 2W24A 1YHQS 1H7XA 4DG1A 4G1QA 3IRXB 1UW4A 1JNZB 2H51B 5T14A 5AT1B 4A46A 3M8RA 2GFFA 4FPRA 2BJ3A 3O2IA 1JJCB 2H65B 1L3VA 1U1NA 5GAEU 4IOAQ 3M8ZA 4I6AA 1BY9A 3ZNUA 2IC3B 4ED2A 2GHPA 2ZHBA 1TL7A 4UOGA 2MMYA 2FHJA 1SJRA 3EGVA 3PY8A 3CJ3A 4O4GB 5EX3A 5KAKA 3IMQJ 1RBAA 4DV2J 5SZTA 2QTWA 4X64F 1B0TA 2DHHA 1K73T 2R8GA 1JLGB 3W8PA 3BH6B 1N56A 3TZZA 2N4CA 2PI4A 1SCJB 1AB8A 2XULA 3IP0A 4F2RA 1FX2A 1NSQA 2IRXA 2YQ0A 2ZOFA 2RQMA 4LF7F 3OQ2A 1U0HA 5J2MA 2WVBA 2HRTA 5E3RA 1M5KC 4PG8A 3CCWA 4ZLPA 3W2WB 4K5RA 3N79A 3LPEA 2C3OA 4TU9A 4DR5J 3JSMB 3TQ1A 4DSIA 1RHRB 4PG7A 3BGFA 5HMXA 2HNZB 3R9LA 4MTPA 1Q7YT 2UUAF 2IA0A 4G1PA 2V50A 2M5YA 2RQKA 2IBOA 5HQLA 2FY8A 1LQ9A 1X8DA 2B43A 2GQ2A 4RBUA 4YHHF 1I5OB 5GADI 1SC4B 2W25A 3DI6B 1DQ8A 1H0HB 4XDDA 2FC9A 2RB7A 2CZ9A 3TAMB 4AQYF 2ZC3A 1CS4B 1Y7PA 1OMSA 2XS5A 5MAOA 4X62J 3O3LA 3Q8UA 2CQPA 1NSKL 1S1TB 4LRDA 2W9BA 3UE2A 1BQXA 3OLBA 3G6XA 2OPRA 2E1PA 2V4JA 3HFVA 4FS1A 4JV5J 4F67A 4LFBF 4JYAF 3AXMA 4WBFA 2Y1JA 3IR7B 1UWAA 3T9NA 4F04B 3U02A 3ICLA 1VBKA 4U7UK 3R6GB 1RT7B 3MMCB 4URSA 2QV6A 4KFBB 4F4YA 5CHCB 1XNRJ 5J2PB 5LMUF 2W8LA 2RS8A 2HVHA 1OJ4A 2BRKA 2HG4A 2DXEA 2KVQE 4XPCA 4HEA9 2MKCA 3H59A 3NOCA 3FBEA 1CLFA 1C4AA 2DNHA 1HL6A 3F0NA 1T9VA 2DHGA 3KK1A 3D67A 2ZZNA 5KT3A 3BPDA 2Z8QA 2R2SA 4MYTA 1RHMB 2VG5B 3OFGA 3AH6A 3WC0A 3LWMA 3HHNB 2HRUA 5IT9Y 3PEHA 5GMDA 2JEJA 4Q5VA 3KHHA 4P7VA 2HHPA 3PG9A 3C14A 1L3SA 1VIXA 1D8YA 2CNKB 5EDWA 2YKQA 5LT5A 2GAHC 2MB0B 4NLGA 2ZWPA 4IRDA 3PW5A 5IC4B 3T6JA 1U48A 4WE1B 2CJAA 2MSSA 2E44A 4M63A 1RT1A 3D7SB 3MI7X 2J76E 4QR1A 4DV5F 2HQDA 2B4VA 3BV8A 2K7JA 3S01A 1U0SA 3CD0A 4V1Ak 1RWMB 1MWZA 1B70B 3ZZOA 5KT2A 1LV5A 1WHYA 2OFGX 3R7BB 1X5OA 4YP3A 3KLVA 1H73A 4M8LA 3HVTA 2HHSA 4DF8A 2AX1A 2BABA 5KFLA 1RAIB 3J81U 1VHIA 3KLEB 1WF0A 1JWWA 4M5IA 2MZRA 4DPYA 2RUSA 3O8WA 4CNYA 3OTEA 2QJ3A 3OTOJ 4OFZA 4OHXA 4OI0A 1S9GA 5F3ZA 4O44A 1XWLA 3ZO7A 1M1KT 5LL6d 1M5PC 3CJ5A 2GC8A 3BO3A 1U1RA 3E51A 3I4HX 4PQAA 4NRUA 4ED6A 3W60A 4XK8C 4JI5F 3E01B 4UQGA 3EVMA 2HWHA 3KLIA 3VGSA 4I7FB 5CD4A 4N76A 2YWFA 2LDYA 4OZLA 3EM1A 1F9HA 3LUYA 2DR6A 3W7BA 4ZLNA 4DZ6A 4Y0FA 1RT5A 3G8QA 4LFAJ 2F8EX 4RW8B 3R7SB 3DLGB 4NZ6A 4DQIA 2B7CB 2OEMA 1XN9A 2FB0A 1RYSA 1S1VB 1U02A 3R2DJ 1IKYB 3DGPA 4ERDA 5KFEA 2M8DB 2CQDA 3ULHA 5KFCA 4I56A 5KFWA 4DUTA 3AD7C 3KLHB 3BM7A 1ZPWX 2MKKA 3QRQA 1NJXA 4LF6F 3DRRA 5KG0A 1V5VA 3JYTB 4DR6F 2R7OA 2V69A 4C6AA 5EX0A 1D1UA 3DLKA 1WC5A 4KE5A 5DRKA 5GADU 5B7WA 2XSJB 3OPKA 1HBOA 2I5JA 3MPVA 1RDRA 5IC6B 2YBVA 3V81B 4B3TF 3M6UA 1JJ4A 1N8RT 2OPPA 4OX9F 1FWLA 2JLEA 4KHPJ 3OR1A 2DGOA 2GMHA 3VHQA 1X4AA 2GIFA 2U2FA 1NRKA 4OI4A 3BGRB 3QATA 1IKVA 5E33A 1TR0A 2J6SA 1OYEA 4EK2A 1KNZA 2DIUA 3HF5A 3ZTPA 4ZS6A 3BBCA 4XDCA 2D3OR 3B4DA 2XMTA 1F9FA 3HO1A 4GVBB 5L8RC 3RR7A 3BSCA 2MKIA 1RAOA 1VS3A 3HSJA 2RF2B 2QSFA 1TKTA 3CCVS 1LWFB 3LH2S 5CZVA 1H7WA 3TUPA 2X1AA 1VQLS 3I32A 3JQMA 1C1CA 1NDLA 5HJYA 2FVCA 2P9EA 4ZP7A 1HW9A 5T7LB 2LA4A 1Q86T 4XIUA 3M8PB 1UVNA 2AMCB 3MM5B 3KMSA 5A2QU 1IKWB 4X4SA 3DM2A 1VBYA 4PYDA 2XGPA 2BUNA 2AU0A 3SCIE 1OO0B 1N34F 3RRGA 4YOEA 1Y00A 2OUGA 5E3CA 2CAJA 1JJ2R 2WBRA 1WG5A 2LEPA 3FSIA 2FZKB 2ZE2A 1DRZA 5BYQA 1NJIT 2HKEA 4LRFA 1WHVA 1IJFB 4QJVA 4DX5A 4MMOA 4B3SJ 2VF3A 2BX6A 1S0NA 4U96A 4ZKAA 3M9OB 2DHAA 2RKIA 3PW4A 1TQLA 2VQFF 1LK5A 1RT4A 4RW4B 1JLAB 3V2UC 1AFJA 2CZ4A 1OS5A 3KK3A 3QT5A 4P52A 1SC1B 4DFKA 2LKZA 4LSNA 1NK4A 3E3XA 1S99A 4Y2AA 4F0KA 2YPZA 1NJZA 4FNHA 2G0IA 1SQFA 1MG7A 4IQMA 1KQKA 2KG0A 2HQGA 4H54A 1X7VA 4QWDA 4ELVA 2V9KA 5F8JA 5I3PA 4UF4A 3M30B 5J2NA 2BRLA 1YZ7A 5CQGA 3EYZA 1KTQA 1DTTB 1NB2A 3Q22A 1BQMA 3DMJA 2L3MA 3EPIA 1N48A 3MTJA 3CCZA 3EDRB 3S6EA 2Z0GA 3IWXA 4G6VB 2XY5A 2IYGA 2PDAA 4ZVQB 1YQHA 4MIWA 3TANA 2B9YA 2W7OA 3MFHA 2B8QA 1U1MA 1MW7A 1JLEB 4PQUB 1R27B 1N5SA 1FKPB 2JRSA 3OVBA 3C6TB 5ETPA 3ZZTA 4RW9A 2BYCA 2BE2A 4KC5A 3CUNA 3TA0A 1F1BB 1SI9A 1B4SA 3R7NB 1CSJA 2ZDOA 3W9HA 2YNHA 2HNYB 4I6WA 3T3FA 5DG9A 3MUMP 2UVUA 3C3LA 3TP2A 4D3GA 1UJ5A 2XI3A 2YX1A 3ZZPA 4HACA 4GVLA 2C2MB 1RKIA 1FJCA 4UOFA 1Q8IA 1T7PA 2V8PA 4E0DA 1UW9A 3MAQA 3GWCA 4KTQA 4QYZK 4PG4A 2IFXA 4F0MA 1DLOA 2ZBQA 4ECSA 1X4DA 2AT1B 2EBEA 2R9LA 4CO3A 4HI1A 4Q7AA 2NUHA 2R7VA 1FNXH 3RRKA 4JI3J 1FDNA 3DRPB 5KFHA 1UKUA 1OQ3A 3PKYA 4X4NA 5DG8A 2I0XA 2GMLA 2Z2MA 4CO1A 2CVEA 3CCES 4N41A 1OWXA 2O67A 4ZPAA 2J9EA 2OD4A 1ZOTA 1YRUA 1SUQA 1N0UA 1A6LA 2FJXA 4PKDB 1ZM3A 4LF8J 5HBMA 2W8KA 4KV8A 1BQNB 2MZSA 4B17A 5F0WA 2HIYA 2LQ8A 3SI8A 1X0FA 4LSLA 3THTA 4CH0S 4LF5J 2VG6B 1HD0A 5EGYA 1LW0A 2EFGA 1SPBP 1F2HA 1RAJA 4K4ZA 2K3IA 2ABYA 1UEKA 4PRFA 4NYPA 1RTHB 2RQCA 1Q82T 1EP4B 1RGVA 4OX7A 2MJNA 4X4OA 3JTOA 1UFWA 1AZSA 2PEBA 2CQHA 2PMZD 2VODA 2LCWA 2EFQA 4K4WA 2BDPA 4ZVTB 4D3HA 4F36A 3J80Y 2UVWA 1RP5A 3D6FB 3FZ2A 4NI2A 2A3JA 2Z2LA 4ECUA 1YWXA 2GO8A 5DDOC 3KYLA 3MEDA 4LR7A 1YK9A 1RAEB 4C0HA 1DTQB 2G13A 3P5BP 4LQ9A 2VA3A 2HHUA 1XR7A 4ATNA 1T05A 2RJZA 4WK3A 2XBPA 5GVQA 1YRXA 4C11A 5F41A 4W92B 1P1TA 1W2IA 5BR8F 5EHHA 4LREA 1KONA 3IGVA 3BYPA 4HTIA 5E3PA 2DGVA 3EXYA 1S9FA 2VL1A 3KJVA 3UN3A 2HBYB 1S1WA 4YB7A 3ZTOA 3P6YC 1RCOB 4HLBA 3VAJA 3R97A 5ETNA 1XTZA 2G2OA 2AEFA 2E1AA 3IM9A 2Q3PA 4ZPBA 3TAPA 2WHOA 4G1IA 3ELHA 4I2QB 2HMIA 2A1BA 3KXDA 1IM4A 1UA0A 2JX2A 4TQSA 2ZJQQ 1IKXB 4WPAA 1PSDA 2RDJA 4R5PA 4JI8F 1SXLA 2HGLA 3DOKB 5KFVA 3IS9B 3T5HA 3WX4A 4X66F 3EWGA 4YR0A 1C0TA 4LF9J 1WEYA 3R5JB 1RTZA 3DU5A 1NKCA 1OPZA 4PWDA 3MEEB 4HTJA 3WHIA 1U8SA 1S59A 2DGXA 4CH1A 3A13A 5THWA 2FUG9 2CNOB 5KFBA 4ZN1A 3M9MB 4NCBA 2VB6A 3CJTA 2JVRA 2Y1IA 2HAFA 4FZVA 1EX8A 3TVKA 4PG5A 3AB4B 2WB4A 3CJ4A 1RXOB 4A8KA 4JI0J 3CEDA 2DH8A 4RUCA 2Y8WA 5A8RA 2A0FB 2BMBA 1FVSA 3MM6B 1T9UA 3R1HA 5DGAA 3MCSA 4Q44A 2DIVA 3R6LB 2IM0A 2F7VA 1N4LA 2ROEA 2EBGA 3BO2A 1IVZA 3FBBA 3V4IA 4OHVA 3VTIA 2RT3A 4H4KC 4QPTA 4LSZB 4I2PA 4ID8A 1S4EA 3Q89A 3FEZA 3HX9A 5HVFA 4KGXB 1L3UA 1SIWB 4NLUA
chains in the Genus database with same CATH topology
2OHDA 4FDFA 2EKNA 2EEYA 3JQMA 2IDEA 3JQKA 4PYAA 3JQJA 1EKRA 4PYDA 1EKSA 2IIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHD A;  4FDF A;  2EKN A;  2EEY A;  3JQM A;  2IDE A;  3JQK A;  4PYA A;  3JQJ A;  1EKR A;  4PYD A;  1EKS A;  2IIH A; 
#chains in the Genus database with same CATH topology
 1SV5 A;  3L7O A;  5K8M A;  2HHW A;  5LMN F;  3AOB A;  5IQ6 A;  1MN7 A;  3BGU A;  3GIM A;  2HHT A;  1TKZ B;  4L75 A;  4P72 A;  3OFH A;  2LQ5 A;  1YJU A;  4EWT A;  3T5J A;  3MR5 A;  2FGC A;  4ZPV R;  1NAQ A;  2W2Q P;  2VBY A;  1PJ5 A;  3H2V E;  2FD2 A;  1AUS L;  4MK8 A;  1YZ6 A;  1YJR A;  3ENV A;  3NP5 A;  4IFY A;  1VR6 A;  3S7R A;  2AIR B;  2HS0 A;  4EYH B;  2YPY A;  2QMU B;  3TX8 A;  3W61 A;  2VAS A;  4KHM A;  1QUP A;  3PO5 A;  4PUO B;  4JI1 F;  2VG7 A;  1O0P A;  3HFZ B;  2MQQ A;  2A10 A;  3BKU A;  3NNH A;  2ADB A;  2YQ3 A;  3SEO A;  4DPO A;  4DJB A;  1HQ2 A;  1TFY A;  5JVH Q;  3RB6 A;  4QW8 A;  3G96 A;  1Y3J A;  3D0H E;  1PAE X;  1J5O B;  1CUL A;  3IBW A;  1NND A;  1UEU A;  4QYR A;  3GG1 A;  3CO9 A;  3CC7 S;  3A8J A;  1Y4Z B;  1SJ4 P;  1PIL A;  3NXZ A;  4Z7Y A;  3T1Y F;  1KOO A;  5DLG A;  1SJF A;  2OML A;  3NWG A;  2MHE A;  4RO0 A;  1DQ9 A;  2W2O P;  3MMA B;  1N32 F;  1UVM A;  1X4C A;  2KXN B;  2OPQ A;  1S6P A;  3CCJ S;  5KFU A;  1IQT A;  2LU1 A;  3OUY B;  3M8Q A;  1RWW B;  2BW7 A;  2BQR A;  5CYQ B;  3QFH A;  1S48 A;  1GMW A;  2E7X A;  2BAC A;  3TUI C;  2BQ3 A;  2JNJ A;  2R8K A;  3M8S A;  2BV3 A;  1H98 A;  4X64 J;  1V3R A;  2D7S A;  2ACY A;  4RUA A;  2J0S D;  2GZO A;  1HD1 A;  3GV8 B;  4PWW A;  1APS A;  1QUV A;  5H9E J;  5KT4 A;  1CPZ A;  4OJH A;  3GFY A;  2XWX A;  3ISN D;  4QU7 A;  2SXL A;  4OHY A;  4WFY A;  1OY6 A;  4U7C A;  2DY1 A;  1D8Z A;  1HI8 A;  3ZTQ A;  4LF7 J;  1LWC B;  3BJY A;  4KYZ A;  5J1N A;  1HBM B;  2GIR A;  4WKR A;  1PGZ A;  2HYI B;  2KN4 A;  3RBX A;  1U25 A;  2XMJ A;  1HHT P;  3DLE A;  1WKL A;  5LXR A;  4DL5 A;  2Y3Y A;  1WC0 A;  1JKH B;  1CJU B;  2E66 A;  2QN6 B;  1BC6 A;  4TY8 B;  3CDU A;  4ANE A;  4NYO A;  3LP1 A;  2UUA J;  3MAA A;  2VBX A;  3KKF A;  2RH3 A;  4YHH J;  4CYU A;  4ZHR B;  5CXT A;  4J90 A;  4C4W A;  3TO8 A;  2UXB F;  4B3O B;  4L3K A;  1RTD A;  5L39 A;  1SC6 A;  2AP6 A;  3R3T A;  4AQY J;  1N0V C;  2ZFH A;  5CYM A;  3FNN A;  1Q0N A;  4I69 A;  3MCO A;  3ENQ A;  2AD9 A;  1ITP A;  1RI7 A;  4KQZ A;  3CJ0 A;  5DS7 A;  1IBK F;  3BSA A;  1U1P A;  1G7C B;  5KG5 A;  1HPZ A;  3Q8P B;  2DH7 A;  3AJ2 A;  1NB7 A;  1IWG A;  2MPU A;  3PR4 A;  3QT7 A;  1VQP S;  4LFB J;  4JYA J;  4Y2K A;  2M2B A;  1UAW A;  2IRY A;  2VON A;  2XQC A;  2GJI A;  4BBY A;  2CPE A;  1WI8 A;  3GIL A;  4NLS A;  4NE9 C;  2AYG A;  4WFN Q;  2VFV A;  4IH5 A;  1UFL A;  1LFP A;  2HSE B;  1RAA B;  4MYU A;  5LMU J;  2EFN A;  1KFD A;  3EGN A;  4ZCL A;  1YKW A;  5GME A;  3HSG A;  2DNR A;  4CRJ A;  2XZT B;  3SV4 A;  4DL2 A;  4WF9 Q;  3DOM B;  3GFH A;  2W4C A;  1KTV A;  3OL7 A;  5L1I A;  5LXY A;  5ETV A;  1LEO A;  3AA8 A;  3TNV A;  3GYX B;  2KT5 A;  3LGN A;  4PXD A;  1T9X A;  1C0U B;  3FBF A;  5LJ3 Y;  3MEK A;  1K44 A;  2XLJ A;  2ZH2 A;  3G71 S;  1UPP A;  2POK A;  3CPW R;  2PMH A;  2RS2 A;  2G1H A;  3TJA A;  1GK8 A;  1X9S A;  2J7K A;  1U2R A;  3CMA S;  2D3U A;  4K5S A;  4KB7 A;  2C2R A;  1BUX A;  2ROG A;  3K8W A;  1YIT S;  1RWV B;  1NPK A;  3G86 A;  2BJ7 A;  1HI0 P;  2AEM A;  3I87 A;  2H4Y B;  3RJM B;  3CDA A;  4LFC F;  3LP2 B;  4K4U A;  2H54 B;  2MQP A;  3NGT A;  2E5H A;  5C42 A;  3M6V A;  4XO0 A;  2LMI A;  1XMB A;  5HAO A;  4YN3 B;  1WD6 A;  2HK3 A;  5D4N A;  1S1X B;  1Q95 G;  1MRO A;  2GJ2 A;  3GJQ B;  3MPW A;  4NEZ A;  2HHH F;  2ERR A;  1F9E B;  4F4X A;  1U45 A;  4DV5 J;  1REV A;  3C66 A;  1N5Y A;  2HBQ B;  1MMN A;  2V5H G;  2ZD1 A;  1R8A A;  1YTY A;  2BOP A;  2YTC A;  1P9Y A;  4C2M A;  2VPY B;  2JFD A;  4W4M A;  5HN0 A;  3CCR S;  3RBE A;  4DR3 F;  4RX6 A;  2QFI A;  3QYY A;  3KHR A;  1C1B A;  2E7V A;  4MFB B;  1FD2 A;  4ED8 A;  4ECT A;  2GVZ B;  2ZH7 A;  3RAM A;  2GNK A;  4ED4 A;  4NLY A;  2ZH6 A;  2MEW A;  3KLG B;  1YJT A;  2IBK A;  1WNE A;  1DFD A;  2AJ0 A;  4LT6 A;  2RNE A;  5D4P A;  2CQ3 A;  2LEC A;  3UR3 C;  3VAI A;  3SQG B;  2AJ1 A;  2HNZ A;  1TKX B;  2KHC A;  1UJ4 A;  5EWE A;  3I56 S;  1WWH A;  5G0R A;  2C3U A;  1R0A B;  4LMZ A;  3I0S A;  3VZI A;  2M88 A;  3NEK A;  3T5K A;  3THV A;  4OX6 A;  4ANC A;  3UI3 A;  3KG1 A;  4JI5 J;  3I5A A;  5A8K A;  4AD6 A;  2I6W A;  4MKB A;  4YB6 A;  4UTG A;  4RLE A;  2XS7 A;  4WFX A;  9RUB A;  3UO0 A;  2HS4 A;  2EI5 A;  1PYT A;  1WSR A;  2NZ4 A;  4NCA A;  3H5X A;  3GII A;  3MD1 A;  2B4O A;  3FDS A;  2XTJ P;  2DNG A;  3W62 A;  2HWT A;  3ZTS A;  3CO0 P;  1JIH A;  1VC6 A;  3EXC X;  2Y9H A;  4IG0 B;  3NNC A;  2RQ4 A;  5EWF A;  2V34 A;  2O5D A;  2J8A A;  1CJK A;  4HHU A;  2V8V A;  3EZU A;  2Q79 A;  3L09 A;  1NH8 A;  3HM9 A;  1T3N A;  5KFG A;  3HPO A;  2RIJ A;  1F6T A;  3CJ2 A;  4B3R F;  1G4C A;  3PO4 A;  2CZV C;  1RT7 A;  2FHM A;  3MMC A;  4F8R A;  4LF6 J;  4DCJ B;  2P8I A;  4DR6 J;  2G2Y A;  1WOP A;  4M5J A;  3RUB L;  3H5Y A;  1BMQ B;  3VZH A;  3IXQ A;  1FXR A;  2VKZ G;  4NCG B;  4FKY A;  1R89 A;  4QOT A;  1WC4 A;  1KQS R;  3DC2 A;  2DHX A;  4FPI A;  3DLB A;  3ZZY A;  1S57 A;  3N5B A;  2CDR B;  2IDE A;  4ZVR B;  4B3T J;  4C3K A;  4A4J A;  2UXD F;  5KFF A;  2B4U A;  4O0I A;  4OX9 J;  1NSA A;  1F5C A;  5HRO B;  3U1M A;  4IDK A;  1HQU A;  4KBI A;  1FI4 A;  4F4Z A;  1N88 A;  2KM8 B;  3DYA B;  2QG9 B;  1HNV A;  5D4L A;  1F3F A;  5KFK A;  4OHZ A;  4R8U A;  2VIH A;  1NCL A;  2R7S A;  3DDI A;  3KLF A;  1K1S A;  5DO2 A;  3I5C A;  3BQ1 A;  3ITH B;  3FVY A;  4FN5 A;  3POT B;  3M2V A;  4WP3 A;  1I3O B;  1WAC A;  2HS3 A;  3GYG A;  3K5N A;  2IDL A;  5IV3 A;  3ET6 B;  3KMQ A;  3PM9 A;  1MWY A;  3SV3 A;  4X4Q A;  3DCA A;  4R0J A;  5GAH I;  1HWL A;  1XBW A;  4J9N A;  3GTY X;  5F8G A;  3N6L A;  4PWU A;  4WFZ A;  5MLC V;  3ONQ A;  2VFS A;  2XSF A;  2J9D A;  1XK8 A;  5HLF B;  4I67 A;  4HDG A;  1HLW A;  2GV1 A;  4OL8 A;  2MQM A;  3VVT A;  4NLP A;  3KNA A;  3SDE B;  1RT2 A;  5IT9 U;  4DS5 A;  4J9K A;  4UY8 5;  3LQV A;  4AL5 A;  1N34 J;  1NK0 A;  2ZVS A;  3LWL A;  2CG4 A;  2BEF A;  4J9R A;  2BAN B;  1JXE A;  2C2Z B;  4F26 A;  2Z57 B;  2J0W A;  2D1C A;  2UV8 A;  1NPR A;  2LQJ A;  4ZVE A;  3MWB A;  2HK2 A;  6FDR A;  4MIB A;  3PVX A;  4DV7 F;  1VRQ C;  2Q66 A;  2OEL A;  1WHX A;  4ZIV A;  4DV3 F;  2MLZ A;  3CC4 S;  3JTP A;  3H25 A;  3U1N A;  1RAC B;  2IY5 B;  2VFT A;  3CUL A;  2VV5 A;  2VQF J;  3JQJ A;  3P3D A;  3QO9 B;  2COL A;  1BD6 A;  5ITH A;  3FJ2 A;  1Z2L A;  3DDK A;  1ZS6 A;  3EUN A;  2V67 A;  1CC7 A;  2CG8 A;  1RUS A;  3A3O B;  2KJV A;  3UNY A;  5L1L A;  1N6Q B;  2C3P A;  4DX6 A;  1HWJ A;  1TEL A;  2YNI A;  1GXT A;  4CQ1 A;  5D6G A;  1RTI B;  3NL0 A;  2EK6 A;  2N4D A;  1VRT A;  4CO2 A;  2FVS A;  4CTA B;  4NXM F;  2F40 A;  3NMR A;  4OYX A;  3W9I A;  3UCU P;  4Q8F A;  1UCN A;  3TOQ A;  4DG1 B;  1YGY A;  4URQ U;  3TEG A;  2F63 A;  1SQE A;  2DPI A;  1RU2 A;  5C5J A;  1OSC A;  2H48 B;  2H5E A;  1YIJ S;  3TZW A;  2AX0 A;  2D74 B;  4ELT A;  3AOD A;  2YY3 A;  3B4M A;  2P6T A;  3OXG A;  1SJQ A;  4WJB A;  1H2T Z;  4QWA A;  1CJV A;  1MWQ A;  4DPW A;  1JLF A;  1BWV A;  2OSQ A;  4OLP A;  1MNE A;  1U2F A;  2KM8 C;  1KN6 A;  3IRW P;  3Q8R B;  3PIO Q;  1YG0 A;  4N8N A;  2XMW A;  3I4P A;  1FKO A;  1EKR A;  3W65 A;  3LAN A;  5FD1 A;  1U26 A;  4DLE A;  5I3Q A;  2X3D A;  1TL7 B;  3BQ0 A;  2X1G A;  3SBM A;  3U1L A;  1T03 A;  5KOW A;  3DXB A;  2G0C A;  2OAU A;  4BC9 A;  3BR9 A;  2YKN A;  3VV2 B;  3DXS X;  1ZA2 B;  2WTF A;  3WQP A;  5IM0 A;  1Q5Y A;  4DU8 A;  4QCL A;  2HVI A;  3MDF A;  4M5M A;  3F41 A;  2J5A A;  1FRI A;  1LK7 A;  1QTM A;  2DNZ A;  2XLI A;  4DV1 F;  5CZX A;  2B9W A;  2ZBP A;  4QR2 A;  3JAM U;  2MZQ A;  3RBZ A;  3ZXW A;  3OXL A;  2WON A;  2KB2 A;  2QRR A;  5L38 A;  2RAQ A;  1U0H B;  5J2M B;  2JLF A;  2YNF A;  5HP1 A;  1R8P A;  5FDL B;  3Q8S B;  2CQB A;  4Y2M A;  1SH0 A;  2WCX A;  3RYL A;  4BWJ A;  2QLF B;  3GJS B;  2RUG A;  2V8G A;  4H4M A;  1WOO A;  1UWB A;  2A2C A;  1S0O A;  3UD4 P;  1AFI A;  1M5H A;  3TAR A;  5T7L A;  4RBT A;  2GO9 A;  4FF2 A;  4FXW A;  2LXI A;  4LUB A;  5GAG I;  5I4M A;  2YKP A;  4ZOS A;  4OYI A;  2CNN B;  3QGH A;  3QPI A;  2ZDP A;  1SKU B;  4C0B A;  2B3T B;  2FJV A;  1HBU A;  3J7Y U;  2QSW A;  2LXF A;  3UWT A;  2MLX A;  4HT7 A;  2ZUG A;  4DDF A;  2ZH1 A;  2ADC A;  2W9A A;  5DM6 Q;  2CQ4 A;  2QA1 A;  2VPW B;  4DCP B;  2BBE A;  2XCP A;  1XEZ A;  2RDI A;  3HFK A;  4DOZ A;  2W9B B;  4CWB A;  4DSF A;  4MAK A;  2OI2 A;  3HHK A;  2OPR B;  1V5I B;  1HYS A;  4WZQ A;  5GAH U;  5IZH A;  3M7V A;  1M5V C;  4ED1 A;  2DNQ A;  4CH7 A;  1RJJ A;  2CPX A;  2IIH A;  4ED7 A;  4ZPT R;  2UUC F;  4O23 A;  1PCA A;  4IYQ A;  4UZC A;  3TZX A;  5E3A A;  3OSN A;  4PCQ A;  3C2P A;  2G0J A;  2D3Z A;  2CRL A;  3UCZ P;  2HFN A;  3EE3 A;  4Y65 A;  3FRY A;  4DUZ F;  2VJV A;  1Y9O A;  2DRA A;  3DLJ A;  3CIM A;  5AXM A;  5BR8 J;  1DQA A;  1S6U A;  3CWJ A;  3MM8 A;  3KK1 B;  4U95 A;  4UZB A;  1UET A;  2ASY A;  3DNC A;  3SXL A;  1L3K A;  3UCG A;  4WIQ A;  1YJ7 A;  3P5T L;  1ELO A;  1DHM A;  2HRY A;  4KIA A;  4A8M P;  3FCW A;  2B7B B;  3IM8 A;  4W98 A;  4OYB A;  4CP5 A;  5BJR A;  2V8D A;  4K7Q A;  2NPF A;  1UFK A;  5F9N A;  4QIW D;  4O3P A;  2XO7 A;  4ECW A;  3M6W A;  4QWE A;  3C14 B;  2R7U A;  1NK8 A;  1R43 A;  1RZM A;  1VBX A;  4USI A;  4M5G A;  5KFJ A;  2ZOG A;  4ETZ A;  1HWI A;  1FJ7 A;  3ZC4 A;  2AF6 A;  5FII A;  1H38 A;  2VC1 A;  2FJA B;  1UVL A;  4OI6 A;  4JI8 J;  4ES1 A;  3N0V A;  3SSS A;  2V2V A;  4O3R A;  2L9N A;  3TA1 A;  4X66 J;  2KHD A;  1RT1 B;  2HHX A;  4B3M F;  1M5S A;  1Q1K A;  2Y1R I;  1TVR A;  4ZMM A;  3BYR A;  3KJF B;  2CDQ A;  3CD7 A;  2OD6 A;  5L1J A;  4TU7 A;  4A8X A;  4LBI A;  3AD8 C;  2W4P A;  3GB0 A;  4DN9 A;  3BSN A;  4FYX B;  3HLU A;  5KFR A;  5KG7 A;  3DKD A;  2JSX A;  2VKR A;  3H5U A;  3QZ7 A;  1SIZ A;  1G6B A;  2FTR A;  3IG1 A;  1FJG F;  1WG1 A;  3R5C A;  3HVT B;  4C7Q A;  3SZ2 A;  1RLD A;  4P2S A;  3BDE A;  1K47 A;  3FRZ A;  2A6M A;  4HYK A;  3L7P A;  1W26 A;  5B0D A;  2RHQ B;  2B51 A;  3V6K A;  4CLP A;  4FYV B;  2WBM A;  1MLA A;  1YJ9 S;  1R7I A;  1FNM A;  1S9G B;  3NKY A;  1RHQ B;  4O44 B;  2YNG B;  2JEF A;  2D9O A;  3VGV A;  2XCA A;  2V2Z A;  2MZJ A;  3QAE A;  5FLX Y;  1E6V A;  4CT8 A;  1HNZ F;  1HQE B;  3BEG B;  3ILO A;  2AGO A;  1VQ5 S;  2DGQ A;  4H4K A;  2HQ3 A;  5LMN J;  5J2Q A;  4JB8 B;  2ATL A;  3VGU A;  4XPE A;  2GGP A;  5HMW A;  3UN2 A;  4DFJ A;  3FCH A;  4Y00 A;  1HR0 F;  1EP4 A;  5KOX A;  2RML A;  1RT5 B;  1YJW S;  4B9S A;  2HND A;  2DTJ A;  1Y5L B;  3D1Q A;  3HHD A;  3PJ9 A;  4I0W A;  2D69 A;  4FBT A;  4KSE B;  4LVO P;  2BJE A;  3DGP B;  2W9C A;  3M2U A;  1SH3 A;  2DEI A;  4KAI A;  3QLH A;  2MKS A;  2NXU A;  3MUV P;  3GLJ A;  1S77 D;  1JQG A;  4HDH A;  3KOA A;  2LP4 A;  3QFW A;  3VCD A;  4JI1 J;  2NSB A;  1U7L A;  3K2Y A;  3RAX A;  4C8N A;  5GAG U;  3DLK B;  4P6Q A;  1S5Z A;  3D0G E;  2NYH A;  4B9L A;  3MM9 A;  2HZA A;  1N33 F;  3DHX A;  5F8L A;  3MXH P;  1VQ7 S;  3MFI A;  1HBO B;  2I5J B;  2CPJ A;  1ZM4 A;  4NLQ A;  4CDI A;  5J1E A;  2CXE A;  3OL8 A;  2OPP B;  5E7O B;  3OR1 B;  3IWL A;  3T1Y J;  4YDD B;  4JP8 A;  2MYF A;  4DQS A;  4NEY A;  3D0I E;  1IKV B;  1N32 J;  3QRP A;  2AEJ A;  3M1V A;  1ARO P;  1KSP A;  3K58 A;  3TW0 A;  3FZB A;  2HPU A;  2DVI A;  4C9D A;  3J80 U;  5DQG A;  3MOZ A;  4I2Q A;  2QMX A;  4IKA A;  2C22 A;  2V6A A;  4DQP A;  1EET A;  5KFI A;  2RRA A;  2B0G A;  2DNL A;  4ZPC A;  4C8M A;  4DR2 F;  2AJQ A;  4OIX A;  1FCA A;  4IG3 A;  3C46 A;  2GAG C;  1WC1 A;  4I68 A;  2VQE F;  3V4M A;  2BVZ A;  4NZ0 A;  2BXJ A;  4GRS A;  1UA1 A;  1Z2Z A;  3BR8 A;  3PFE A;  3T5L A;  4OZ1 A;  2F8M A;  3B78 A;  1TKT B;  3MEE A;  3CJQ A;  4QPX A;  1FDD A;  4ZIW A;  1NXI A;  8ATC B;  1VRU A;  4FYW B;  5D0E A;  1C1C B;  3HMJ G;  2R8J A;  2E1C A;  1B7F A;  3OL9 A;  1YRT A;  4HI2 A;  1KWM A;  2VPX B;  4URG A;  5HMZ A;  1ZZN A;  2N7Y A;  1FE0 A;  1FES A;  3DM2 B;  3LGM A;  1RB0 A;  5HQ8 A;  2F1F A;  4ECZ A;  1NH7 A;  1KRP A;  4FF3 A;  4F3O A;  3G82 A;  2HW3 A;  2PD1 A;  2R7T A;  2DR5 A;  4P71 A;  3PW2 A;  4MKA A;  5F8I A;  4WYW A;  4QIV A;  1VHF A;  3CCU S;  2FVR A;  2QZ8 A;  2XM3 A;  2UXB J;  2FIU A;  5KG6 A;  2J7U A;  1Q5V A;  4UOH A;  2WAQ D;  2RKI B;  1DUR A;  3TI0 A;  4NX9 A;  4NOH A;  3GJT B;  1RT4 B;  1NKB A;  3GSD A;  4O4R A;  4NPO A;  2KT3 A;  1ZAW A;  1TL1 A;  3KK3 B;  1IBK J;  2AHO B;  1TUW A;  2JEI A;  2OJ3 A;  4CLL A;  1O51 A;  4ZVS B;  5IOL A;  4LSN B;  3Q8Q B;  2P9G A;  3LA0 A;  4QW9 A;  5KFX A;  2V63 A;  4PEO A;  1ZM2 A;  3DRX A;  5DDQ C;  5JXS A;  1F60 B;  3NS5 A;  4M5H A;  3BPS P;  1RAF B;  2NSC A;  5KFD A;  1KKH A;  5JMN A;  2NR0 A;  3C6U A;  5LM7 E;  1WSV A;  4YB1 P;  5G4D A;  1V6H A;  3CGI A;  3G6V A;  1NJW A;  2UU9 F;  5J2N B;  4G65 A;  3NCQ A;  3FEY B;  2LQB A;  1VK8 A;  1S72 S;  1BQM B;  1K8A T;  3DMJ B;  4QYZ J;  2MQL A;  3MR3 A;  3M8W A;  1VYA A;  1N5T A;  2KYX A;  4F4W A;  3OSP A;  1RWK B;  3RRH A;  1ZH5 A;  5HQM A;  3KHL A;  2MKJ A;  2RSQ A;  4BHQ A;  3PYF A;  3ZZU A;  3AQP A;  2AYM A;  2M9K A;  1QD1 A;  1NHU A;  4I64 A;  3NBP B;  4RW9 B;  1UP1 A;  1H2U X;  2BE2 B;  4IFV B;  4BWM A;  5KFT A;  1VIO A;  4EYI B;  2YNH B;  1KVJ A;  1KP6 A;  2DXD A;  4CNZ A;  5I3U A;  3GON A;  3W1Y C;  1XER A;  1S6O A;  3HZG A;  1R31 A;  3GP9 A;  4AUK A;  2WOM A;  3K5L A;  1T9T A;  1NU4 A;  2QIF A;  3GCX P;  1S0V A;  3C8Y A;  1E6Y A;  4LFC J;  4YY3 F;  1PJ7 A;  2PSZ A;  4IH6 A;  3FGV A;  3VAG A;  2JOQ A;  5ETS A;  1HBN B;  1TMM A;  1X5T A;  1CC8 A;  3GZ7 A;  2EC2 A;  4L72 B;  2C42 A;  3PRV A;  3R5A A;  4YME A;  1VDH A;  1DLO B;  2PA8 D;  3CSK A;  4C0O C;  4FS2 A;  4QIF A;  3B6B A;  4Z2X A;  4ENO A;  1VOM A;  3OHB A;  1CBK A;  3FSX A;  2HHH J;  2ROP A;  2HZV A;  2B5J A;  5LOQ A;  2ZBI A;  4L3N A;  2XY7 A;  4LQ3 A;  3DGV A;  2F4F A;  3PJW A;  3M9N B;  2C2O B;  1FHT A;  4AND A;  3QJJ A;  4Y3C A;  4ZPD A;  3KNG A;  3N28 A;  2BQU A;  4DR3 J;  1LWC A;  3CW2 C;  4KT0 C;  3DHW C;  3OL6 A;  1NDP A;  1RU1 A;  5AE2 A;  4KV8 B;  2H4W B;  1TV6 A;  4DR4 F;  2I8E A;  3UNG C;  3OT9 A;  4LSL B;  4Q45 A;  1CQN A;  2IA6 A;  1LW0 B;  1JKH A;  1CJU A;  4ZA1 A;  1QVG R;  1GTE A;  1OYD A;  2CPD A;  5ETO A;  3NG8 A;  3MUR P;  4ID5 A;  1HNI A;  2W4D A;  4A8Q A;  4RW6 B;  2JJ4 D;  1AA1 B;  2M7S A;  1FT8 A;  2CKW A;  2QA4 G;  5DLF A;  1NO8 A;  1AZS B;  2CA9 A;  2BA9 A;  2M8H A;  1EAY C;  2GIQ A;  1HWK A;  1EKS A;  2DHS A;  4QBU A;  4K4T A;  4F25 A;  2CQ2 A;  2C2N A;  2KTQ A;  2AYB A;  3TZY A;  4NI2 B;  4USJ C;  1R8B A;  3MED B;  3KK2 B;  4K2X A;  4K4Y A;  2E29 A;  1PAU B;  2HVE A;  1T05 B;  1SKS A;  3SCK E;  2B9E A;  2AYE A;  4C11 B;  1FX4 A;  1QJH A;  1FDA A;  4B3R J;  2OP5 A;  5I42 A;  5HVH A;  3HT3 A;  1ZPV A;  4KGK A;  4RU2 A;  3Q24 A;  2EPI A;  2R7Q A;  4J9U E;  3KJV B;  3KG0 A;  4DSL A;  3SFU A;  2U1A A;  3ZFV A;  1S1W B;  3EGZ A;  2DD8 S;  3E8O A;  4DL6 A;  4S0M A;  3ILJ A;  2X7I A;  2YXL A;  3DOM A;  1WF1 A;  5KFQ A;  1SB6 A;  3QWP A;  2HFZ A;  4K4S A;  1FF2 A;  3MEG B;  2UXD J;  2DO0 A;  2K2P A;  4L6V 3;  3JTN A;  3D54 A;  2FHJ D;  3HSD A;  2HMI B;  1I1G A;  3I82 A;  2GVD A;  2IRU A;  2FJB B;  2R8I A;  4IQX A;  3MMB A;  4R5P B;  3AY0 A;  4I4B A;  5B0C A;  1CQM A;  3ZTR A;  5K8P A;  4ZLL A;  1YBA A;  1HFE L;  2E9Z A;  4CM0 A;  2IJF A;  4A47 A;  4GKK F;  4PWD B;  1T11 A;  3MMJ A;  1SKW A;  3LAM A;  4DWI A;  4ZP8 A;  5F8N A;  5DET A;  3QJL A;  3M8Y A;  2QT7 A;  3NY0 A;  3UD3 P;  2DT9 A;  4ICL A;  1VQO S;  1VQY A;  3OBI A;  4WII A;  3C19 A;  1A0O B;  5AJ3 F;  4Z37 A;  3I96 A;  1S1U A;  1TKD A;  3KUH A;  4Y6I A;  2HHQ A;  5IXU A;  1MU2 B;  1IM6 A;  4NA3 A;  3ISN C;  1EIY B;  2APO A;  4NLT A;  5A8R B;  5L9N A;  2QLX A;  2WW4 A;  5AXN A;  3R5G A;  2WSF C;  1RWU A;  2FLL A;  3VQS A;  3CDE A;  2ZKT A;  3V6D A;  1K9M T;  2DH9 A;  2JHE A;  5HSP A;  4MFB A;  3V4I B;  2KZZ A;  5L46 A;  1T0T V;  4X65 F;  2FLN A;  1S6Q A;  1R0B G;  3KLG A;  3I0R A;  1Q7L B;  2AKW B;  1ZM9 A;  5HMY A;  3MEC A;  4GO5 X;  2FY1 A;  1SV5 B;  3EZO A;  3O6Q A;  4DQR A;  1YBT A;  2DBB A;  4DV7 J;  5C24 A;  3GIK A;  3RW6 A;  4MIA A;  4DV3 J;  2Y0B B;  3UW1 A;  1EB0 A;  1FRK A;  3TA2 A;  2H3E B;  4DV0 F;  5GAE I;  3G87 A;  3CJK A;  1N5Q A;  1RTJ A;  2W01 A;  3H4D A;  2NXJ A;  5KFY A;  2G9O A;  2EKN A;  4JI2 F;  2L9D A;  1QE1 A;  1VQS A;  3T41 A;  3HI9 A;  2E5G A;  2XGQ A;  5J1P A;  4X4U A;  1W2B R;  3N6N A;  1D9A A;  4Y2C A;  3TJ8 A;  4CLY A;  4YDX A;  2L41 A;  4FNI A;  1RWN B;  2KG1 A;  2PO4 A;  3AT1 B;  2YWH A;  3US5 A;  3PYG A;  3MR7 A;  2VG7 B;  1HMV A;  3M05 A;  1Y3K A;  2OTL S;  4AFF A;  1RHU B;  1R8C A;  5K14 B;  2PT0 A;  1JLC B;  3FMW A;  2YKM A;  4NXM J;  3ZZR A;  2B6A A;  3Q8Y A;  4X4V A;  3BN4 A;  3Q2T C;  4JI7 F;  2MGZ A;  1RAG B;  3IAM 9;  4A8W A;  2BZ2 A;  1WOR A;  3CDB A;  1CUL B;  1LWE A;  2NS1 B;  3UVJ A;  1X4G A;  3IFE A;  3ISZ A;  2HZC A;  2VBZ A;  3BDP A;  4DQQ A;  1BLU A;  4RW7 A;  3FQK A;  3BZQ A;  2R2U A;  2ZZT A;  4OZ2 A;  4C3M A;  4QIE A;  2QYC A;  1FFS B;  1TL4 A;  3M32 A;  4OZ5 A;  2OPQ B;  2XLK A;  1B3T A;  2ATC B;  3M8Q B;  4K50 A;  4WP8 A;  2CFX A;  3QZ8 A;  2YH0 A;  5C25 A;  2M52 A;  5KG1 A;  2ZNZ A;  1BE4 A;  2K7K A;  3G6Y A;  4L74 A;  1FA0 A;  3QGG A;  1KOH A;  3UDE A;  3CNQ P;  3TYT A;  3QIP A;  1VQM S;  2QA2 A;  4JV1 A;  1YJV A;  4DV1 J;  2RVJ A;  2K06 A;  3LP0 A;  3NGD A;  2DR8 A;  4DSK A;  2VOO A;  1SKR A;  2YX4 A;  2BW2 A;  4H4O A;  1UMJ A;  4LR8 A;  2C28 A;  4C8Y A;  2AZ3 A;  5HJX A;  3OVS A;  4M5K A;  1RT3 B;  1FK9 A;  3D6T B;  4K59 A;  3W9J A;  1PC5 A;  4ECQ A;  4NXN F;  1WTB A;  2MKY A;  2QEX S;  3DLE B;  1NUE A;  1X5S A;  4HT5 A;  1J5E F;  4JBC A;  1RE1 B;  5HK4 A;  2E5I A;  4DFP A;  3A4T A;  3LP1 B;  3HHL A;  3MAA B;  2YWW A;  3A3P B;  2FLP A;  2XZW A;  3BO4 A;  1U6Z A;  2R2R A;  4CYU B;  4K8R A;  1WDD A;  2XYP B;  4O0N A;  2OPS A;  8AT1 B;  3EVW A;  3HJV A;  3PAC A;  2JFK A;  1RTD B;  1JLQ A;  2ZBC A;  2O66 A;  2LA6 A;  3F44 A;  4NLR A;  3PYE A;  2RIL A;  3T1H F;  2MTL A;  1MMD A;  3SIP B;  5CYM B;  2ASJ A;  3W2V A;  1RA7 A;  3WC2 A;  2L08 A;  5D0H A;  3THP A;  4DR7 F;  1HPZ B;  2JH3 A;  3W5X A;  3JSB A;  4Y2I A;  2Z30 B;  1ZTW A;  2ZKU A;  4HKQ A;  2E1R A;  2M0G B;  4DSJ A;  5A0Y A;  2K1R B;  1FJE B;  4ECX A;  3BF4 A;  2UUC J;  2YWG A;  4DN0 A;  1NDK A;  2OFH X;  1DAR A;  2IJN A;  3FMB A;  1VQ9 S;  1N6Q A;  1P1L A;  3MF5 A;  3WBZ A;  3K8V A;  3P49 B;  2F8H A;  2VC0 A;  2CUY A;  2QX0 A;  5KT7 A;  1T8E A;  2R3V A;  4JV0 A;  5A6W A;  2ZC4 A;  4DUZ J;  4TLR A;  1WKJ A;  3FBC A;  2H5I B;  4JI4 F;  4LR9 A;  4DBQ A;  1KEK A;  5D78 A;  3M2R B;  1Z4U A;  3K17 A;  4EBC A;  2N82 B;  3GE9 A;  1PYS B;  2VBW A;  3Q2S C;  5AE1 A;  1U1O A;  1U09 A;  2PEH A;  1H72 C;  4ZVG A;  2AQ4 A;  4RR5 A;  1G1X A;  3H40 A;  5H9F J;  2R7R A;  3NRB A;  4DMZ A;  2J9D E;  4OYM A;  3R2C J;  1FER A;  3D1H A;  2UXC F;  1WEX A;  3G9C A;  4OI1 A;  1BGX T;  4TXS A;  4NLW A;  3DOL A;  3G8T A;  5KFN A;  2BM1 A;  4KPC A;  4DCO B;  1VQ6 S;  4ILM A;  1YDL A;  3PRB A;  2E7W A;  2GS8 A;  1U6B A;  1IBM F;  3NCR A;  2J8S A;  5IWA F;  2D3O 1;  1TFW A;  3K57 A;  2UUW A;  3EGW B;  2Z2Y B;  5C42 B;  4N5S A;  4WWS A;  4NYZ A;  1NM2 A;  3D9B A;  7AT1 B;  2DYA A;  1B7Y B;  4B3M J;  1NHK L;  3P4U B;  5CAB A;  1MRO B;  2V8H A;  4AL7 A;  3D3C J;  4USU A;  3VAF A;  4U67 Q;  2LEB A;  4ZLJ A;  1REV B;  4J5O A;  1FEH A;  1N5Y B;  2UUT A;  2ZD1 B;  3ZNJ 1;  2UVR A;  2GQC A;  1FTC A;  3MHY A;  1XNQ F;  2D41 A;  2MY7 A;  1Z1Z A;  3NS6 A;  5D3G A;  4DEZ A;  1R8H A;  5KT5 A;  2JVO A;  3OTC A;  3CXC R;  5DQI A;  1C1B B;  4TYB A;  5FDL A;  1FJG J;  1AXQ A;  2EW9 A;  2WRM A;  5AXK A;  1XQI A;  4LRB A;  4GMK A;  4M94 A;  2EG1 A;  4EZ9 A;  1VJQ A;  3OD2 A;  3CJS A;  1KDN A;  3EZ5 A;  1CJT A;  3O1L A;  1KBR A;  4KO0 A;  2CPZ A;  3NGU A;  2D9P A;  2OMO A;  2HLU A;  5G0R B;  1HNZ J;  2HIQ A;  3I0S B;  1VBZ A;  4YQW A;  2CJY B;  3C16 A;  5A8K B;  2DNO A;  1KLM A;  3J7Z 5;  4NML A;  2BR0 A;  2ACM A;  3WZ0 A;  4CO4 A;  1HR0 J;  4TKT A;  3BQ2 A;  3NAH A;  1HI1 A;  2MY8 A;  2QL5 B;  2GJF A;  4DL0 C;  1GX5 A;  4EO6 A;  4RZR A;  2ZVI A;  2G2Z A;  3TQE A;  1A7G E;  3RGI A;  1N36 F;  3RB4 A;  1TL3 A;  4P7T A;  1LOU A;  1CJK B;  2YX7 A;  2ZJR Q;  5JJB A;  4BC7 A;  5EUH A;  3BGL A;  4TLQ A;  2KH9 A;  4ECY A;  2RU3 A;  1NBE B;  1SL1 A;  5CYJ A;  4X84 A;  4FF1 A;  5A76 A;  4JI6 F;  1RWO B;  2IAJ A;  3G4S S;  2ZUA A;  2P9C A;  1URN A;  3B54 A;  3MM7 A;  3D4J A;  4YB5 A;  1VQN S;  1K1Q A;  2RD5 C;  1YVF A;  1N33 J;  5D0G A;  2C3M A;  3G8S A;  2HWI A;  3R5D A;  3FFI A;  3GSI A;  2RRB A;  2ILZ A;  5FJ4 A;  4OYW A;  4FP9 A;  3CCS S;  4ED0 A;  1NK5 A;  4Q8E A;  4IDK B;  2XB2 D;  2IM2 A;  1HQU B;  1RIS A;  2F9J A;  1I51 B;  2WK4 A;  4OLO A;  1NSP A;  5ETT A;  4DPX A;  2MZ1 A;  5DDR C;  4Q0B A;  1HNV B;  3ETO A;  1MSW D;  2A18 A;  4R8U B;  4LRC A;  2NQP A;  3NS7 B;  4YUD A;  5M2U A;  1U2C A;  3KLF B;  1TK5 A;  2W7A A;  4DV6 F;  3FUY A;  2HEK A;  4ZCK A;  1NHV A;  3M2V B;  3WX8 A;  2XMM A;  5KFM A;  4CLW A;  3PX4 A;  4QR0 A;  4DR2 J;  1KLN A;  4EMD A;  5HL7 Q;  2VQE J;  1YJN S;  4NL5 A;  5T41 A;  3MTK A;  1TTH B;  4FDF A;  1NME B;  2ZWO A;  4M5L A;  1LW2 A;  3MD3 A;  3UN5 A;  3AA9 A;  3HHL D;  2VH7 A;  1RT6 A;  3VGT A;  4USM A;  4EBD A;  4WZM A;  1IR2 A;  4MKV A;  2F9D A;  4AL6 A;  1PBA A;  2RU9 A;  5IQQ A;  4B9T A;  3CDW A;  2WW8 A;  4HHJ A;  4A48 A;  5BXI A;  3UDL A;  4RWW A;  2QMW A;  1HNW F;  1RT2 B;  3V6H A;  2ZH4 A;  3KHG A;  2F4V F;  1RBL A;  4A8O A;  3GIJ A;  3NMA A;  1UJ6 A;  1FVQ A;  2LXU A;  9ATC B;  3PHE A;  2QGF B;  2CQI A;  4P75 A;  1M5O C;  1UVI A;  2R42 A;  3UDV A;  3RAQ A;  5IT4 A;  2QE5 A;  5A8W A;  1DZ5 A;  5ETQ A;  3VWS A;  1X5P A;  1SC3 B;  2QO3 A;  4DZD A;  3CME S;  1KR4 A;  2YNG A;  1PC4 A;  2QLW A;  1HQE A;  5RUB A;  5IV4 A;  3I9Z A;  2BJ1 A;  2VU5 A;  4IRK A;  3EX7 B;  3MPY A;  4DR1 F;  2XI2 A;  2CJ9 A;  3P45 B;  3J7Z T;  3H7H B;  2CPF A;  4UT4 A;  1EQM A;  4ZN3 A;  2ZM6 F;  2R4F A;  1SL2 A;  4OI2 A;  3AXK A;  4NAS A;  4L76 A;  3MCN A;  1TUV A;  2XNQ A;  3EDQ B;  2JC0 A;  4DV4 F;  1KC8 T;  4KKO B;  1U6F A;  2DGU A;  2OSR A;  3KDO A;  2RE1 A;  2CPH A;  1ZAX A;  1OSD A;  1EHW A;  3QRR A;  4LRA A;  1FDB A;  5ETR A;  2NXE A;  3KUE A;  4F2S A;  2YNI B;  1RHK B;  3I31 A;  3B8H A;  3EJM A;  1RBO B;  2CJK A;  1VRT B;  1L3T A;  3GIR A;  3JSR A;  2UU9 J;  3U27 A;  2DGT A;  3OR2 A;  2GA7 A;  4U8V A;  3CJ8 A;  3DRS A;  2I9S A;  1GMU A;  2AJF E;  2KZM A;  3VAL A;  3NCP A;  1A9N B;  2ZIT A;  4OZ0 A;  3VAH A;  3GG0 A;  3JAM Y;  5KFA A;  2NPI A;  4YFU A;  4PXE A;  4B02 A;  5FLX U;  1TAQ A;  4HHH A;  4DFM A;  4ZP6 A;  3BGO P;  1RK8 A;  4ETX A;  1QSS A;  2Z4P A;  4ZVP B;  4KGZ B;  1CJV B;  1JLF B;  2V4Q A;  3R1L A;  1FRX A;  3H90 A;  3Q8V A;  1PBU A;  3IRX A;  1FEE A;  3PDN A;  3H4B A;  2J6T A;  4EI2 A;  1RKJ A;  3CMQ A;  2I1R A;  1FKO B;  1O6X A;  4B9U A;  4Q2L A;  1GFW B;  2V68 A;  3C15 B;  4GC7 A;  4K0K F;  1D9F A;  2YH1 A;  1AW0 A;  3IBC B;  5AXL A;  2JDJ A;  1FXD A;  1T03 B;  1PYO B;  1GNK A;  4UUX A;  3O44 A;  3AJ1 A;  3TEH B;  4C8K A;  1V3S A;  2IC3 A;  2YKN B;  2DNM A;  5IM0 B;  3MUT P;  4YY3 J;  2XHC A;  2ZH3 A;  2CJQ A;  1S4F A;  6FD1 A;  4ZJO A;  1IBL F;  3D28 A;  2RRN A;  4ZPW R;  5CA5 A;  4QWC A;  2V9W A;  1OQ6 A;  3L7U A;  4P9S A;  1H74 A;  3RR8 A;  2G1D A;  4DUY F;  4O4G A;  2WON B;  2PFF B;  2YNF B;  5HP1 B;  2W2M P;  3MGJ A;  5DM7 Q;  1JLG A;  3CB4 A;  4K4X A;  4FYD A;  4ZJQ A;  5DGB A;  3TRG A;  3SCJ E;  3IR5 B;  4H4M B;  2J6U A;  1UWB B;  1ZBT A;  3ZZZ A;  1F3V A;  3ETM A;  2FYX A;  4YR3 A;  2YQ1 A;  3TX0 A;  2V94 A;  4BS2 A;  2XMK A;  1RYR A;  4RNM A;  4DR4 J;  7FD1 A;  4RNO A;  3A8E A;  2EC0 A;  3MPU B;  1XIQ A;  3TJ9 A;  3UPF A;  3HKZ D;  3W2W A;  1NLK L;  3SYZ A;  2UV8 G;  4OYA A;  1HBU B;  3JSM A;  4XTT A;  1SL0 A;  1S7H A;  1T94 A;  2VDI A;  4Q2M A;  3IA0 A;  3GMG A;  3PRD A;  1TUG B;  4RL1 A;  5K5M A;  5C2G A;  1Q79 A;  1YBU A;  3T1A A;  2BE7 D;  3K5P A;  2ALY B;  3KTQ A;  1IUJ A;  4P10 A;  5ETM A;  3PIP Q;  2E5J A;  4F3M A;  2CQ1 A;  1X4E A;  4WU2 A;  1VFJ A;  3PZP A;  1HYS B;  4UUW A;  4DL3 A;  3DI6 A;  4X4T A;  3GU0 A;  2B56 A;  2ASD A;  3TAM A;  2CPY A;  1CS4 A;  4IO1 A;  2HBZ B;  4DHV A;  1U8W A;  5DJB A;  4ZVF A;  1S1T A;  2OTJ S;  1EQ0 A;  2VFR A;  3KG4 A;  2XO6 A;  2VFU A;  4PXB A;  2KDO A;  1HNX F;  2WZ1 A;  4N7T A;  2ZEJ A;  3GCW P;  4OZ3 A;  1NEE A;  2WVC A;  2KXF A;  1YX2 A;  1VQ8 S;  3ILI A;  3KJQ B;  4NA2 A;  3MM8 B;  1XMQ F;  1G2E A;  2XMA A;  3QMQ A;  4P73 A;  4J9O A;  4UQT A;  4KFB A;  5J2P A;  3N9U C;  4X4R A;  4YEA A;  3H0P A;  2C1E B;  2X1F A;  4LF4 F;  1F0X A;  2KXH A;  2UUB F;  3DU6 A;  4OV1 A;  1QDU B;  3P8B B;  2PE8 A;  1DAX A;  3AD9 C;  5HI7 A;  3NBP A;  3HVR A;  1XJW B;  4IFV A;  1X60 A;  4OZN A;  1GMW D;  5KFP A;  2FJE B;  3PV8 A;  3D1O A;  4QQB A;  4CLS A;  2V2K A;  1LKZ A;  1Y5N B;  2E9T A;  2BJ8 A;  4AE5 A;  2VG5 A;  1U1Q A;  4OQJ A;  2Z2Z A;  1QLN A;  1FRJ A;  2CQ0 A;  4ZCM A;  4EU0 A;  3K89 A;  2QA4 S;  1R6Y A;  4UST A;  4J9S A;  2F3J A;  1K0T A;  2E5L F;  4DS4 A;  4KY3 A;  4IO9 Q;  4GKK J;  4J9P A;  1TVR B;  2Q6C A;  3OVA A;  3T6B A;  3HD2 A;  2DIS A;  1HBN A;  2KKH A;  2W7P A;  2GCF A;  1TMJ A;  2BJ9 A;  3M6X A;  3J7A N;  2M4M A;  4USV A;  1I94 F;  1HAR A;  3TAQ A;  4WE1 A;  1F5B A;  2LDI A;  5HAN A;  3FSY A;  5AJ3 J;  2ZNY A;  1UEV A;  1X9W A;  1R6V A;  3PCO B;  2OGU A;  2ZOM A;  3IG1 B;  2A6O A;  2R8H A;  1WG4 A;  2P5V A;  1AT1 B;  4OI3 A;  4C8L A;  3W3S A;  2UP1 A;  1QSY A;  4M5D B;  1JLB B;  5DG7 A;  4GC6 A;  1LXJ A;  2YKA A;  2DB1 A;  1WC6 A;  4RPF A;  5DZ7 A;  3FEX B;  5EWG A;  2B9X A;  1HA1 A;  4X65 J;  1IBC B;  1RCX B;  3F73 A;  2W2P P;  3WDO A;  2M70 A;  3PJX A;  4N47 A;  2DKO B;  1E6V B;  4OJ3 A;  1FKA F;  4TYA A;  3EMT A;  3PR5 B;  3EIC A;  1ZTT A;  1HIY A;  3AAW B;  1B0V A;  2EFO A;  4TN2 A;  1IWA A;  3KLE A;  1HKA A;  5J2Q B;  3I5B A;  3T9Z A;  4GKJ F;  2GGP B;  3PHT A;  4DV0 J;  4RW6 A;  1M1G A;  2G4B A;  1RWP B;  1U47 A;  1J2V A;  1GEH A;  5IFM A;  2HND B;  3CE8 A;  2MZT A;  4O3O A;  4JI2 J;  2QFJ A;  1Q16 B;  3LF0 A;  3E01 A;  5F9L A;  5E41 A;  1FTR A;  4I7F A;  4ITS A;  1WDT A;  4EEY A;  2W9C B;  3M2U B;  4Y34 A;  1S9E B;  3QLH B;  1IJE B;  3CCT A;  4KPY A;  4MK7 A;  1GXL A;  4QWB A;  3KK2 A;  3CD5 A;  4WFB Q;  3HVW A;  2CJX B;  4RW8 A;  2XZD B;  3DLG A;  2CYY A;  2AW0 A;  3Q83 A;  3W5Z A;  1ULR A;  5DDP C;  3Q23 A;  3D6H B;  1S1V A;  4IOB A;  1Q81 T;  3RB3 A;  2IVF B;  4DX7 A;  1IKY A;  3MM9 B;  4JI7 J;  3D5M A;  5M2P A;  2DRD A;  4NLX A;  3LOU A;  1VC5 A;  3PFO A;  2R7W A;  3KLH A;  1VGY A;  4F0H A;  1GT8 A;  5J1E B;  4G1Q B;  4OHW A;  1O8B A;  3BH7 B;  4PAB A;  4DL4 A;  1P27 B;  3JYT A;  3T19 A;  2Z58 B;  3R27 A;  1PKU A;  2XYG B;  3CVK A;  1V9O A;  4WXO A;  1JXV A;  3M1V B;  3MEG A;  2XSJ A;  2MKH A;  3KFW X;  4M5N A;  3DFE A;  3BKF A;  4WTO B;  3QNW B;  1WEZ A;  1OPI A;  4DI6 A;  3V81 A;  4G3I A;  2FQQ B;  4F4K A;  3PKM A;  1B64 A;  1EET B;  2N3O A;  4EGL A;  2IPO B;  4KJI A;  3K7R A;  3BGR A;  4IG3 B;  4MH8 A;  1FWK A;  4CZC A;  1KD1 T;  2N3L A;  4FVC A;  2QL9 B;  1FO1 A;  3DDN A;  5SUH A;  5L1K A;  3MAH A;  3SSR A;  1U49 A;  1VRU B;  5HO4 A;  3I55 S;  1UTA A;  4GVB A;  2OO4 A;  4NWB A;  1W7W A;  1ZET A;  3OFF A;  4RJV A;  2RF2 A;  4NXN J;  4AT1 B;  2EFP A;  5ETK A;  4Z7C A;  2FDN A;  1LWF A;  1MU2 A;  4LVN P;  1J5E J;  2CPI A;  2KT2 A;  2GHV C;  2PI5 A;  1KS2 A;  3ZZ0 A;  4WP9 A;  3G82 B;  2JEG A;  5LSR A;  1XMO F;  4O3S A;  1RAD B;  4ECV A;  1YLX A;  4NMX A;  3M8P A;  4FKX A;  4J7C A;  4UY8 T;  2KJW A;  3MM5 A;  1IKW A;  2KFN A;  3W5Y A;  3WIV A;  5AE3 A;  3BSO A;  2WB1 D;  3CTR A;  2I2Y A;  3H42 A;  2N7C A;  3T1H J;  5E2Q A;  1SVD A;  4LJM A;  4B9V A;  4DLG A;  3AOC A;  3VR1 A;  1TL1 B;  4HL9 A;  4BDP A;  1JK9 B;  4DR7 J;  1FRH A;  2DEJ A;  2LQ9 A;  3HUL A;  2EVZ A;  3HSZ A;  4CCH A;  3JB9 k;  3LAK A;  3QAU A;  1TAU A;  5K20 B;  2V4J B;  3H20 A;  2ZBR A;  4M95 A;  3C6U B;  4RW4 A;  2BE9 B;  1JJH A;  3VAM A;  1JLA A;  2DR9 A;  2EKY A;  1REG X;  4WFA Q;  4ZVH A;  3PX0 A;  4F02 A;  3UQS A;  4Q43 A;  3IGN A;  1N5V A;  4NLO A;  3MOJ B;  1ZAV A;  5K14 A;  4TU8 A;  1JLC A;  2UZA A;  4JI4 J;  1WOS A;  3IBF B;  3LO3 A;  1KQF B;  4J37 A;  2LYV A;  2VDH A;  2DCL A;  4ZDN A;  4FBU A;  3M4X A;  3HT0 A;  3M30 A;  1ICE B;  3L95 X;  4KRW A;  1DTT A;  5D0R A;  4OX8 A;  1P8G A;  2DJW A;  1X0P A;  4XAK A;  5E3Q A;  1D0E A;  3SQO P;  4FVM A;  2KRB A;  2OLW A;  1QSL A;  4EFA C;  3N6M A;  1H2V Z;  2UXC J;  2OHD A;  5I3U B;  4RUH A;  3TVZ A;  4ED3 A;  2MQO A;  4ZK7 M;  3QQC D;  1LFW A;  4P2F A;  4B9M A;  1JLE A;  5HAT A;  4PQU A;  4JOU A;  1FKP A;  1WEL A;  1TP7 A;  3ENW A;  2WOM B;  3C6T A;  4ER8 A;  1H6K X;  2PGC A;  1LNQ A;  1UVJ A;  1UL3 A;  3RBD A;  1IBM J;  1E6Y B;  1FE4 A;  3J81 Y;  5IWA J;  1VIS A;  3MCM A;  2HNY A;  3LAL A;  3HZE A;  3D3B J;  4KHR A;  1Q53 A;  3AOA A;  2HFU A;  2DGS A;  1Q78 A;  2DNK A;  3KJN B;  5U47 A;  3H5S A;  1SJ3 P;  2EEY A;  2IVY A;  1MN9 A;  2H5J B;  3GFZ A;  2IM3 A;  1ROF A;  1SBR A;  2XNR A;  2X1B A;  2B5J B;  2BKO A;  3PYD A;  1ZZF A;  3VQT A;  4ZP9 A;  2HLT A;  4DV2 F;  5H1S V;  2GW8 A;  1X4H A;  4DL7 A;  3PX6 A;  2KYZ A;  1XNQ J;  3UD5 A;  3H2L A;  3PEJ A;  1T9W A;  3GR1 A;  3CF5 Q;  2Q6B A;  1KHW A;  2NRE A;  1RT3 A;  2FGO A;  5D8H B;  1EJ7 L;  4RNN A;  1Y0H A;  1VCT A;  4DU7 A;  1TV6 B;  2J0X A;  3DRP A;  4NLV A;  1PJ6 A;  5L9X A;  3W63 A;  1GH8 A;  1RLC L;  3LTO A;  4CLU A;  1P9Q C;  4DXL A;  2E9R X;  4DR5 F;  2FJW A;  1SH2 A;  3W64 A;  1WUU A;  4ID5 B;  1B0P A;  3BKT A;  1HNI B;  2Q1L A;  3QGI A;  2EFV A;  1U1K A;  1BQN A;  2CIM A;  2XS2 A;  4QZV B;  1FFW B;  2AZ1 A;  4U6P A;  2CWX A;  2VG6 A;  4V19 X;  2WVE A;  3UFC X;  5B09 A;  2LEA A;  2ILY A;  3KLI B;  3H8Y A;  3QID A;  2WVD A;  2BOA A;  2CNL B;  1RTH A;  2AGQ A;  1S0M A;  4F50 A;  4X62 F;  1GAO A;  1UVK A;  4LBP A;  2IYI A;  3CJR A;  3I9V 9;  3GQC A;  2K1R A;  3A8I A;  5KTQ A;  1N36 J;  1HWU A;  4R25 A;  2ZH8 A;  2J7W A;  4JV5 F;  1N54 B;  3CIZ A;  3D6M B;  5I42 B;  1VLY A;  4JI6 J;  1PIE A;  3CT9 A;  4P2M A;  4J9Q A;  3X3U A;  1M0S A;  1S76 D;  4OV6 A;  1DTQ A;  1QVF R;  3QJP A;  1I6J A;  2JWN A;  3K5M A;  2FVQ A;  1XNR F;  3DRR B;  3NGS A;  3WIU A;  2MDA A;  5KFO A;  2GHW A;  4CIO A;  3N01 A;  1C2P A;  1D9D A;  2EXU A;  4LF2 A;  3M2R A;  5CD4 H;  3NGR A;  3OXF A;  4F3Q A;  4TVA B;  4IR9 A;  4KGM A;  2IMW P;  2V4R A;  3N4W A;  4C98 A;  2C2E A;  2KI2 A;  2DGW A;  4M1K A;  1GMV A;  2DNP A;  3SCL E;  3HD1 A;  1XC9 A;  2GVD B;  3H2U B;  4CO0 A;  3MMB B;  2ALZ A;  4A8Y A;  4PYA A;  1S97 A;  1M90 T;  2VIC A;  1VK3 A;  1VQ4 S;  5KG3 A;  2KFY A;  5A2Q Y;  2XMV A;  2OEJ A;  4DV6 J;  3GJR B;  2MJU A;  3L4B C;  2FHK A;  2NXN A;  4PG6 A;  1IR1 A;  2NLW A;  1M1H A;  3VF0 B;  2XHW A;  4WXW A;  3DLH A;  1IKX A;  4IH7 A;  4FF4 A;  3JQK A;  4ICL B;  3DN9 A;  3FKB A;  2FJD B;  3DOK A;  3VAK A;  3IS9 A;  3RB0 A;  4V19 J;  4MJK A;  1F2G A;  1DY3 A;  5F8M A;  4ALZ A;  1S1U B;  2VZ9 A;  5GMK a;  2FHO B;  4ELU A;  2OKQ A;  2FLO A;  1WC3 A;  4DF4 A;  5H9F K;  4CO5 A;  4I1T A;  3RTV A;  2DK2 A;  2KRR A;  2DIT A;  5A6P A;  1HNW J;  3EPG A;  1FRM A;  4ZJL A;  3V6D B;  3NNA A;  4U8Y A;  2F4V J;  5B0F A;  1Y11 A;  3K0J A;  2MHN A;  2J9C A;  1VC0 A;  1UPM B;  1S6Q B;  4MT1 A;  3TVY A;  3I0R B;  2PII A;  1GTH A;  3TR5 A;  3MEC B;  3K59 A;  2PN6 A;  1D3W A;  5LJ5 Y;  1QAY A;  2I38 A;  4WYL A;  3MM6 A;  4E8U A;  1KVI A;  4YS2 A;  1QTN B;  3LW5 C;  4C8Z A;  5C24 B;  3CCL S;  2ZE2 B;  1Q8B A;  2ZHO A;  2J0Q D;  2L48 A;  4BLG A;  3OTO F;  1NDC A;  1BWE A;  4N8O A;  3HP6 A;  3H98 A;  4DR1 J;  3CJK B;  1RTJ B;  2DCU B;  1URR A;  1NPP A;  2ZM6 J;  1NZA A;  5CCL A;  3NGK A;  2XY6 A;  3R8Y A;  5D15 A;  1QE1 B;  2UVV A;  5BYS A;  1V3Z A;  2FVP A;  2PFD A;  1YSJ A;  4DV4 J;  2YWE A;  4CLF A;  1TKZ A;  3IAS 9;  2GQQ A;  3BBB A;  2OH2 A;  4P74 A;  4LFA F;  1HMV B;  2Y1L B;  4AXI A;  2DXF A;  4DX8 H;  4OYO A;  2YKM B;  5M2R A;  2B6A B;  1B99 A;  3HCX A;  4KR0 B;  4ES2 A;  1VQK S;  2LLZ A;  2MGZ B;  4A8S A;  3W8G A;  7FDR A;  3A1Y G;  4PUO A;  2KFZ A;  1LWE B;  3UVJ B;  4DPU A;  3QT8 A;  4ZIT A;  1QAX A;  2RDD A;  3A12 A;  2OIH A;  2XYH B;  4RW7 B;  3RZA A;  1TU0 B;  2QLJ B;  1TK0 A;  5B0E A;  1H3D A;  3IC1 A;  1Q8L A;  4OYP A;  1X4B A;  3B82 A;  3QT6 A;  3ILL A;  4RWX A;  3HK2 A;  3BS9 A;  5K8N A;  1S10 A;  4J91 A;  5B0B A;  1J5O A;  5E5N A;  1TK8 A;  2QLB B;  3M32 B;  1JNR B;  1IQZ A;  2IVM A;  3DRY A;  1L5U A;  3AHP A;  2AWZ A;  4K0K J;  4RUB A;  1RAB B;  5C25 B;  4EBE A;  4KHP F;  1QY7 A;  3KWM A;  3G2X A;  1XR6 A;  2IHR 1;  4A8F A;  3MMA A;  3KDN A;  1X4F A;  3P96 A;  3J7Y I;  4C97 A;  5F0U A;  4I6Y A;  4B08 A;  3GR0 A;  3L3C A;  4HAC B;  5B08 A;  1NKE A;  4UW2 A;  1U1L A;  3QIP B;  3GV7 B;  4P2X A;  3OUY A;  3JSY A;  1IBL J;  1OY8 A;  2HBR B;  3LP0 B;  4AYB D;  5CAA A;  2CQC A;  5CYQ A;  5DQH A;  2YKO A;  2P6S A;  2C2D A;  3NLC A;  3SFG A;  2EWH A;  4C48 A;  3UR0 A;  4DUY J;  1GXU A;  4H4O B;  2Y8Y A;  3A8K A;  3OHA A;  2BJD A;  3GYN A;  1U4B A;  5KFZ A;  3GV5 B;  3A3N B;  1FK9 B;  1TL5 A;  5CH7 B;  2PC6 A;  3MZI A;  4BCA A;  2JLG A;  3PW7 A;  2AV5 A;  4B9N A;  3IN5 A;  3D66 A;  5ADZ A;  5BYR A;  4KH0 B;  2HVZ A;  2WSE C;  1SUQ B;  3D68 A;  4RNH A;  3HHL B;  4NRT A;  3QWU A;  4LIW A;  1HBM A;  5HBM B;  2JZ5 A;  1C4C A;  4WU3 A;  1UZD A;  2DPJ A;  3CCM S;  5LSL A;  2OPS B;  2YVS A;  2DNN A;  1JLQ B;  2E1M C;  2CAD A;  3OTD A;  4MKY A;  4TY8 A;  1F5A A;  1LXN A;  3W2V B;  2HQF A;  1WI6 A;  4DPT A;  2NXC A;  1RSC A;  4USK A;  2HFS A;  2BM0 A;  1T3O A;  2CJB A;  2MQ8 A;  4ZHR A;  4F4A A;  4B3S F;  2K8G A;  2FZC B;  4B3O A;  2FPH X;  5A0Y B;  2YWK A;  3U7J A;  8RUC A;  3AJD A;  5ETL A;  1S49 A;  5H9E K;  4N56 A;  1QAJ A;  1N52 B;  2V2Q A;  4USH A;  2HAI A;  4J9L A;  3IWN C;  1WKK A;  3G6E S;  1KQG B;  4KKO A;  3OJS A;  2LU2 A;  2K3K A;  3OFE A;  4R0E A;  2HUR A;  4WCE Q;  1KHV A;  1HNX J;  2HGN A;  5KFS A;  2F5G A;  3CCQ S;  5IT0 A;  5K9F A;  4FYY B;  1UZH A;  3UDC A;  2R2T A;  5C7P A;  3RG6 A;  1FD8 A;  3BN7 A;  3BB5 A;  1XMQ J;  2VPZ B;  1WF2 A;  1XR5 A;  1T9Y A;  3NWR A;  1OY9 A;  4CLZ A;  1JX4 A;  1FXL A;  5D4O A;  2XMU A;  1NK6 A;  2V0N A;  3AB2 B;  3N5F A;  4MK9 A;  2PMW A;  4LF4 J;  2DNY A;  2UUB J;  4CT9 A;  2DRB A;  3FC9 A;  4X2B A;  2MST A;  2W2N P;  5IS2 A;  5B0G A;  4PPZ A;  4JUZ A;  2ASL A;  2HFV A;  3D2W A;  3DOL B;  3E2E A;  2VUG A;  4J9V A;  3S1T A;  1IXK A;  4IOC Q;  2O1P A;  4EZ6 A;  5F3T A;  1C0U A;  3LGH A;  4OZJ A;  3MPD A;  5F8H A;  3MR2 A;  3K5O A;  4E98 A;  4EUV A;  3AQO A;  1W25 A;  3C15 A;  3J81 j;  2EK1 A;  2XEX A;  1BXN A;  2O01 C;  4F7V A;  3FCV A;  1HHQ A;  4W90 B;  1O5J A;  4OYZ A;  2E5L J;  5C2C A;  2XWY A;  3BRE A;  3ENA A;  3CC2 S;  1C0T B;  2Q43 A;  3AFG A;  4FXV A;  2KVI A;  2CWK A;  1TZ0 A;  5DZ6 A;  3Q86 A;  3V5R A;  3LP2 A;  2VJU A;  4PPD A;  1I94 J;  2LVW A;  4CLT A;  4J9M A;  1JXL A;  1BHN A;  4L73 A;  2BKN A;  2JL9 A;  1WTF A;  4RKU C;  4ZCI A;  4IR1 A;  5D3G B;  4RBV A;  2RHS B;  1S1X A;  2DO4 A;  5B0A A;  2QL7 B;  2ZH5 A;  4K2J A;  3ADA C;  3HHL C;  2EG2 A;  2Y0S D;  4JI3 F;  3HHE A;  3EVO A;  1S79 A;  2W1B A;  3RU0 A;  4IUF A;  1PO6 A;  1CJT B;  2B4P A;  1KFS A;  1RAH B;  4KO0 B;  3IR6 B;  1EZZ B;  3TUZ C;  2IMO A;  3RW7 A;  4LF8 F;  3OV7 A;  5E0O A;  2GVZ A;  2HVD A;  4PAA A;  4O3Q A;  4I2P B;  3C16 B;  2BKP A;  2PA3 A;  4E2F B;  4LF5 F;  1Y10 A;  2C2K B;  1GX6 A;  4NLD A;  1KLM B;  3SQG A;  2NYI A;  2IM1 A;  4TNO A;  4GKJ J;  2ZH9 A;  1TKX A;  3QGP A;  1VI7 A;  2CQG A;  4ILL A;  4KGV B;  3PNI A;  1R0C B;  1R0A A;  5KT6 A;  1D09 B;  2IJR A;  1FWP A;  4QU6 A;  4DSE A;  2HFO A;  2MQN A;  1TL3 B;  2VD3 A;  2KU7 A;  2GMJ A;  1LWX A;  4ECR A;  2WVF A;  1DBD A;  4IFY B;  1ZYQ A;  2AGP A;  2MXY A;  2OEK A;  4HH0 A;  1NK7 A;  4FXD A;  1R3N A;  4OMF G;  2IAJ B;  5CCM A;  1IN0 A;  4U9R A;  2NCK L;  3FQL A;  4ED5 A;  2Z56 B;  4IG0 A;  3MM7 B;  2R7X A;  1ZA1 B;  1MML A;  3HVA A;  4ZVU B;  1AYE A;  1PG5 B;  4UOC A;  4EO8 A;  2CVI A;  1T02 A;  5KG2 A;  3FFI B;  4U7U D;  1T95 A;  4GO7 X;  4WKY A;  1WJ9 A;  1NJY A;  3F56 A;  2LFV A;  2QC3 A;  2AJ4 A;  3I6P A;  1GQE A;  4JV2 A;  1NZ8 A;  3DLL Q;  3JXO A;  2DY9 A;  1SQG A;  2XC9 A;  1NK9 A;  4Q0B B;  1JB0 C;  1RWX B;  3QSY B;  2HHV A;  4NCG A;  1U24 A;  3TUJ C;  3J7A 1;  4CLK A;  3W66 A;  1P6T A;  1J27 A;  4TY9 A;  4X4P A;  1VJW A;  4WTY A;  3CD6 S;  1SJ1 A;  1S6P B;  1WHW A;  1K0V A;  5HRO A;  3VVU A;  4AXJ A;  4PZV A;  1YI2 S;  4LIR A;  4C8O A;  5JUM A;  3DYA A;  2ZJP Q;  4ILR A;  3NAI A;  3OTB A;  1X9M A;  1S7I A;  3LPY A;  4WK1 A;  4OJG A;  1Q4R A;  3TWZ A;  4HH1 A;  2X3G A;  3ITH A;  5HVG A;  3X1L B;  1RA6 A;  4LF9 F;  1LW2 B;  2HQC A;  3POT A;  1JMT A;  2A2D A;  4LF1 A;  2NUU G;  2H9Z A;  1RT6 B;  3JS9 A;  3HJF A;  2KO1 A;  1G3O A;  1CG2 A;  2P2C B;  4K4V A;  2X51 A;  4ZVO B;  3V6J A;  2JC1 A;  3ET6 A;  2L9W A;  4OJ1 A;  2VHG A;  1X31 C;  4ES3 A;  3OJU A;  2M3D A;  4RU9 A;  4M5D A;  1JLB A;  3QBC A;  2NZC A;  1QM9 A;  2ZZM A;  1HW8 A;  5KG4 A;  5HLF A;  4JI0 F;  4NA1 A;  1XMO J;  3PXG a;  2H1Y A;  3PW0 A;  2VA2 A;  4C3L A;  4CI0 B;  5A8W B;  2B8P A;  1FRL A;  2QYG A;  2C3Y A;  3SDE A;  3OW2 R;  2DR7 A;  2FZG B;  4RNF A;  4NZ7 A;  2MLY A;  3GFX A;  1ACM B;  3SSQ A;  1VMB A;  5K8O A;  4YR2 A;  4N77 A;  2KL8 A;  2BAN A;  4KH1 B;  3S8S A;  4PR6 A;  3R5B A;  3NOG A;  2FC8 A;  3IO1 A;  2ZHA A;  4Y28 C;  3KUG A;  1RHJ B;  1KVK A;  1AUD A;  1FFG B;  1OIA A;  2WSC C;  1IR0 A;  3GPA A;  2GX8 A;  2O3D A;  3SMZ A;  1QAI A;  2F65 A;  3QO9 A;  4QIG A;  3QSI A;  2HQI A;  1EAR A;  3MR6 A;  3HKW A;  4HVZ A;  1VLO A;  1DJ0 A;  2HGM A;  1S9E A;  4USW A;  5EN1 A;  4O3N A;  4LBH A;  3OLA A;  3HXM A;  3OR2 B;  1Y5I B;  3DRS B;  1FNO A;  4PXC A;  1Q8K A;  5D77 A;  6AT1 B;  1CEZ A;  1RQ0 A;  3Q0A A;  3L9Z A;  1CVJ A;  4CM2 A;  4HR2 A;  3HDS A;  5JVG Q;  1HHS A;  1S12 A;  3BBF A;  1RTI A;  2VOP A;  2XG8 A;  2AJ2 A;  3PTW A;  4TQR A;  3O5T B;  4CTA A;  4IRC A;  3FK4 A;  5LSO A;  2W24 A;  1YHQ S;  1H7X A;  4DG1 A;  4G1Q A;  3IRX B;  1UW4 A;  1JNZ B;  2H51 B;  5T14 A;  5AT1 B;  4A46 A;  3M8R A;  2GFF A;  4FPR A;  2BJ3 A;  3O2I A;  1JJC B;  2H65 B;  1L3V A;  1U1N A;  5GAE U;  4IOA Q;  3M8Z A;  4I6A A;  1BY9 A;  3ZNU A;  2IC3 B;  4ED2 A;  2GHP A;  2ZHB A;  1TL7 A;  4UOG A;  2MMY A;  2FHJ A;  1SJR A;  3EGV A;  3PY8 A;  3CJ3 A;  4O4G B;  5EX3 A;  5KAK A;  3IMQ J;  1RBA A;  4DV2 J;  5SZT A;  2QTW A;  4X64 F;  1B0T A;  2DHH A;  1K73 T;  2R8G A;  1JLG B;  3W8P A;  3BH6 B;  1N56 A;  3TZZ A;  2N4C A;  2PI4 A;  1SCJ B;  1AB8 A;  2XUL A;  3IP0 A;  4F2R A;  1FX2 A;  1NSQ A;  2IRX A;  2YQ0 A;  2ZOF A;  2RQM A;  4LF7 F;  3OQ2 A;  1U0H A;  5J2M A;  2WVB A;  2HRT A;  5E3R A;  1M5K C;  4PG8 A;  3CCW A;  4ZLP A;  3W2W B;  4K5R A;  3N79 A;  3LPE A;  2C3O A;  4TU9 A;  4DR5 J;  3JSM B;  3TQ1 A;  4DSI A;  1RHR B;  4PG7 A;  3BGF A;  5HMX A;  2HNZ B;  3R9L A;  4MTP A;  1Q7Y T;  2UUA F;  2IA0 A;  4G1P A;  2V50 A;  2M5Y A;  2RQK A;  2IBO A;  5HQL A;  2FY8 A;  1LQ9 A;  1X8D A;  2B43 A;  2GQ2 A;  4RBU A;  4YHH F;  1I5O B;  5GAD I;  1SC4 B;  2W25 A;  3DI6 B;  1DQ8 A;  1H0H B;  4XDD A;  2FC9 A;  2RB7 A;  2CZ9 A;  3TAM B;  4AQY F;  2ZC3 A;  1CS4 B;  1Y7P A;  1OMS A;  2XS5 A;  5MAO A;  4X62 J;  3O3L A;  3Q8U A;  2CQP A;  1NSK L;  1S1T B;  4LRD A;  2W9B A;  3UE2 A;  1BQX A;  3OLB A;  3G6X A;  2OPR A;  2E1P A;  2V4J A;  3HFV A;  4FS1 A;  4JV5 J;  4F67 A;  4LFB F;  4JYA F;  3AXM A;  4WBF A;  2Y1J A;  3IR7 B;  1UWA A;  3T9N A;  4F04 B;  3U02 A;  3ICL A;  1VBK A;  4U7U K;  3R6G B;  1RT7 B;  3MMC B;  4URS A;  2QV6 A;  4KFB B;  4F4Y A;  5CHC B;  1XNR J;  5J2P B;  5LMU F;  2W8L A;  2RS8 A;  2HVH A;  1OJ4 A;  2BRK A;  2HG4 A;  2DXE A;  2KVQ E;  4XPC A;  4HEA 9;  2MKC A;  3H59 A;  3NOC A;  3FBE A;  1CLF A;  1C4A A;  2DNH A;  1HL6 A;  3F0N A;  1T9V A;  2DHG A;  3KK1 A;  3D67 A;  2ZZN A;  5KT3 A;  3BPD A;  2Z8Q A;  2R2S A;  4MYT A;  1RHM B;  2VG5 B;  3OFG A;  3AH6 A;  3WC0 A;  3LWM A;  3HHN B;  2HRU A;  5IT9 Y;  3PEH A;  5GMD A;  2JEJ A;  4Q5V A;  3KHH A;  4P7V A;  2HHP A;  3PG9 A;  3C14 A;  1L3S A;  1VIX A;  1D8Y A;  2CNK B;  5EDW A;  2YKQ A;  5LT5 A;  2GAH C;  2MB0 B;  4NLG A;  2ZWP A;  4IRD A;  3PW5 A;  5IC4 B;  3T6J A;  1U48 A;  4WE1 B;  2CJA A;  2MSS A;  2E44 A;  4M63 A;  1RT1 A;  3D7S B;  3MI7 X;  2J76 E;  4QR1 A;  4DV5 F;  2HQD A;  2B4V A;  3BV8 A;  2K7J A;  3S01 A;  1U0S A;  3CD0 A;  4V1A k;  1RWM B;  1MWZ A;  1B70 B;  3ZZO A;  5KT2 A;  1LV5 A;  1WHY A;  2OFG X;  3R7B B;  1X5O A;  4YP3 A;  3KLV A;  1H73 A;  4M8L A;  3HVT A;  2HHS A;  4DF8 A;  2AX1 A;  2BAB A;  5KFL A;  1RAI B;  3J81 U;  1VHI A;  3KLE B;  1WF0 A;  1JWW A;  4M5I A;  2MZR A;  4DPY A;  2RUS A;  3O8W A;  4CNY A;  3OTE A;  2QJ3 A;  3OTO J;  4OFZ A;  4OHX A;  4OI0 A;  1S9G A;  5F3Z A;  4O44 A;  1XWL A;  3ZO7 A;  1M1K T;  5LL6 d;  1M5P C;  3CJ5 A;  2GC8 A;  3BO3 A;  1U1R A;  3E51 A;  3I4H X;  4PQA A;  4NRU A;  4ED6 A;  3W60 A;  4XK8 C;  4JI5 F;  3E01 B;  4UQG A;  3EVM A;  2HWH A;  3KLI A;  3VGS A;  4I7F B;  5CD4 A;  4N76 A;  2YWF A;  2LDY A;  4OZL A;  3EM1 A;  1F9H A;  3LUY A;  2DR6 A;  3W7B A;  4ZLN A;  4DZ6 A;  4Y0F A;  1RT5 A;  3G8Q A;  4LFA J;  2F8E X;  4RW8 B;  3R7S B;  3DLG B;  4NZ6 A;  4DQI A;  2B7C B;  2OEM A;  1XN9 A;  2FB0 A;  1RYS A;  1S1V B;  1U02 A;  3R2D J;  1IKY B;  3DGP A;  4ERD A;  5KFE A;  2M8D B;  2CQD A;  3ULH A;  5KFC A;  4I56 A;  5KFW A;  4DUT A;  3AD7 C;  3KLH B;  3BM7 A;  1ZPW X;  2MKK A;  3QRQ A;  1NJX A;  4LF6 F;  3DRR A;  5KG0 A;  1V5V A;  3JYT B;  4DR6 F;  2R7O A;  2V69 A;  4C6A A;  5EX0 A;  1D1U A;  3DLK A;  1WC5 A;  4KE5 A;  5DRK A;  5GAD U;  5B7W A;  2XSJ B;  3OPK A;  1HBO A;  2I5J A;  3MPV A;  1RDR A;  5IC6 B;  2YBV A;  3V81 B;  4B3T F;  3M6U A;  1JJ4 A;  1N8R T;  2OPP A;  4OX9 F;  1FWL A;  2JLE A;  4KHP J;  3OR1 A;  2DGO A;  2GMH A;  3VHQ A;  1X4A A;  2GIF A;  2U2F A;  1NRK A;  4OI4 A;  3BGR B;  3QAT A;  1IKV A;  5E33 A;  1TR0 A;  2J6S A;  1OYE A;  4EK2 A;  1KNZ A;  2DIU A;  3HF5 A;  3ZTP A;  4ZS6 A;  3BBC A;  4XDC A;  2D3O R;  3B4D A;  2XMT A;  1F9F A;  3HO1 A;  4GVB B;  5L8R C;  3RR7 A;  3BSC A;  2MKI A;  1RAO A;  1VS3 A;  3HSJ A;  2RF2 B;  2QSF A;  1TKT A;  3CCV S;  1LWF B;  3LH2 S;  5CZV A;  1H7W A;  3TUP A;  2X1A A;  1VQL S;  3I32 A;  3JQM A;  1C1C A;  1NDL A;  5HJY A;  2FVC A;  2P9E A;  4ZP7 A;  1HW9 A;  5T7L B;  2LA4 A;  1Q86 T;  4XIU A;  3M8P B;  1UVN A;  2AMC B;  3MM5 B;  3KMS A;  5A2Q U;  1IKW B;  4X4S A;  3DM2 A;  1VBY A;  4PYD A;  2XGP A;  2BUN A;  2AU0 A;  3SCI E;  1OO0 B;  1N34 F;  3RRG A;  4YOE A;  1Y00 A;  2OUG A;  5E3C A;  2CAJ A;  1JJ2 R;  2WBR A;  1WG5 A;  2LEP A;  3FSI A;  2FZK B;  2ZE2 A;  1DRZ A;  5BYQ A;  1NJI T;  2HKE A;  4LRF A;  1WHV A;  1IJF B;  4QJV A;  4DX5 A;  4MMO A;  4B3S J;  2VF3 A;  2BX6 A;  1S0N A;  4U96 A;  4ZKA A;  3M9O B;  2DHA A;  2RKI A;  3PW4 A;  1TQL A;  2VQF F;  1LK5 A;  1RT4 A;  4RW4 B;  1JLA B;  3V2U C;  1AFJ A;  2CZ4 A;  1OS5 A;  3KK3 A;  3QT5 A;  4P52 A;  1SC1 B;  4DFK A;  2LKZ A;  4LSN A;  1NK4 A;  3E3X A;  1S99 A;  4Y2A A;  4F0K A;  2YPZ A;  1NJZ A;  4FNH A;  2G0I A;  1SQF A;  1MG7 A;  4IQM A;  1KQK A;  2KG0 A;  2HQG A;  4H54 A;  1X7V A;  4QWD A;  4ELV A;  2V9K A;  5F8J A;  5I3P A;  4UF4 A;  3M30 B;  5J2N A;  2BRL A;  1YZ7 A;  5CQG A;  3EYZ A;  1KTQ A;  1DTT B;  1NB2 A;  3Q22 A;  1BQM A;  3DMJ A;  2L3M A;  3EPI A;  1N48 A;  3MTJ A;  3CCZ A;  3EDR B;  3S6E A;  2Z0G A;  3IWX A;  4G6V B;  2XY5 A;  2IYG A;  2PDA A;  4ZVQ B;  1YQH A;  4MIW A;  3TAN A;  2B9Y A;  2W7O A;  3MFH A;  2B8Q A;  1U1M A;  1MW7 A;  1JLE B;  4PQU B;  1R27 B;  1N5S A;  1FKP B;  2JRS A;  3OVB A;  3C6T B;  5ETP A;  3ZZT A;  4RW9 A;  2BYC A;  2BE2 A;  4KC5 A;  3CUN A;  3TA0 A;  1F1B B;  1SI9 A;  1B4S A;  3R7N B;  1CSJ A;  2ZDO A;  3W9H A;  2YNH A;  2HNY B;  4I6W A;  3T3F A;  5DG9 A;  3MUM P;  2UVU A;  3C3L A;  3TP2 A;  4D3G A;  1UJ5 A;  2XI3 A;  2YX1 A;  3ZZP A;  4HAC A;  4GVL A;  2C2M B;  1RKI A;  1FJC A;  4UOF A;  1Q8I A;  1T7P A;  2V8P A;  4E0D A;  1UW9 A;  3MAQ A;  3GWC A;  4KTQ A;  4QYZ K;  4PG4 A;  2IFX A;  4F0M A;  1DLO A;  2ZBQ A;  4ECS A;  1X4D A;  2AT1 B;  2EBE A;  2R9L A;  4CO3 A;  4HI1 A;  4Q7A A;  2NUH A;  2R7V A;  1FNX H;  3RRK A;  4JI3 J;  1FDN A;  3DRP B;  5KFH A;  1UKU A;  1OQ3 A;  3PKY A;  4X4N A;  5DG8 A;  2I0X A;  2GML A;  2Z2M A;  4CO1 A;  2CVE A;  3CCE S;  4N41 A;  1OWX A;  2O67 A;  4ZPA A;  2J9E A;  2OD4 A;  1ZOT A;  1YRU A;  1SUQ A;  1N0U A;  1A6L A;  2FJX A;  4PKD B;  1ZM3 A;  4LF8 J;  5HBM A;  2W8K A;  4KV8 A;  1BQN B;  2MZS A;  4B17 A;  5F0W A;  2HIY A;  2LQ8 A;  3SI8 A;  1X0F A;  4LSL A;  3THT A;  4CH0 S;  4LF5 J;  2VG6 B;  1HD0 A;  5EGY A;  1LW0 A;  2EFG A;  1SPB P;  1F2H A;  1RAJ A;  4K4Z A;  2K3I A;  2ABY A;  1UEK A;  4PRF A;  4NYP A;  1RTH B;  2RQC A;  1Q82 T;  1EP4 B;  1RGV A;  4OX7 A;  2MJN A;  4X4O A;  3JTO A;  1UFW A;  1AZS A;  2PEB A;  2CQH A;  2PMZ D;  2VOD A;  2LCW A;  2EFQ A;  4K4W A;  2BDP A;  4ZVT B;  4D3H A;  4F36 A;  3J80 Y;  2UVW A;  1RP5 A;  3D6F B;  3FZ2 A;  4NI2 A;  2A3J A;  2Z2L A;  4ECU A;  1YWX A;  2GO8 A;  5DDO C;  3KYL A;  3MED A;  4LR7 A;  1YK9 A;  1RAE B;  4C0H A;  1DTQ B;  2G13 A;  3P5B P;  4LQ9 A;  2VA3 A;  2HHU A;  1XR7 A;  4ATN A;  1T05 A;  2RJZ A;  4WK3 A;  2XBP A;  5GVQ A;  1YRX A;  4C11 A;  5F41 A;  4W92 B;  1P1T A;  1W2I A;  5BR8 F;  5EHH A;  4LRE A;  1KON A;  3IGV A;  3BYP A;  4HTI A;  5E3P A;  2DGV A;  3EXY A;  1S9F A;  2VL1 A;  3KJV A;  3UN3 A;  2HBY B;  1S1W A;  4YB7 A;  3ZTO A;  3P6Y C;  1RCO B;  4HLB A;  3VAJ A;  3R97 A;  5ETN A;  1XTZ A;  2G2O A;  2AEF A;  2E1A A;  3IM9 A;  2Q3P A;  4ZPB A;  3TAP A;  2WHO A;  4G1I A;  3ELH A;  4I2Q B;  2HMI A;  2A1B A;  3KXD A;  1IM4 A;  1UA0 A;  2JX2 A;  4TQS A;  2ZJQ Q;  1IKX B;  4WPA A;  1PSD A;  2RDJ A;  4R5P A;  4JI8 F;  1SXL A;  2HGL A;  3DOK B;  5KFV A;  3IS9 B;  3T5H A;  3WX4 A;  4X66 F;  3EWG A;  4YR0 A;  1C0T A;  4LF9 J;  1WEY A;  3R5J B;  1RTZ A;  3DU5 A;  1NKC A;  1OPZ A;  4PWD A;  3MEE B;  4HTJ A;  3WHI A;  1U8S A;  1S59 A;  2DGX A;  4CH1 A;  3A13 A;  5THW A;  2FUG 9;  2CNO B;  5KFB A;  4ZN1 A;  3M9M B;  4NCB A;  2VB6 A;  3CJT A;  2JVR A;  2Y1I A;  2HAF A;  4FZV A;  1EX8 A;  3TVK A;  4PG5 A;  3AB4 B;  2WB4 A;  3CJ4 A;  1RXO B;  4A8K A;  4JI0 J;  3CED A;  2DH8 A;  4RUC A;  2Y8W A;  5A8R A;  2A0F B;  2BMB A;  1FVS A;  3MM6 B;  1T9U A;  3R1H A;  5DGA A;  3MCS A;  4Q44 A;  2DIV A;  3R6L B;  2IM0 A;  2F7V A;  1N4L A;  2ROE A;  2EBG A;  3BO2 A;  1IVZ A;  3FBB A;  3V4I A;  4OHV A;  3VTI A;  2RT3 A;  4H4K C;  4QPT A;  4LSZ B;  4I2P A;  4ID8 A;  1S4E A;  3Q89 A;  3FEZ A;  3HX9 A;  5HVF A;  4KGX B;  1L3U A;  1SIW B;  4NLU A; 
#chains in the Genus database with same CATH homology
 2OHD A;  4FDF A;  2EKN A;  2EEY A;  3JQM A;  2IDE A;  3JQK A;  4PYA A;  3JQJ A;  1EKR A;  4PYD A;  1EKS A;  2IIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...