4PYDA

Moac in complex with cpmp crystallized in space group p212121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
142
Chain Sequence
AHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGDFKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein MoaC
publication title Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
pubmed doi rcsb
molecule tags Biosynthetic protein
total genus 35
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4pydA00
3JQJA 4PYAA 1EKRA 2OHDA 4PYDA 4FDFA 3JQKA 2EEYA 1EKSA 3JQMA 2EKNA 2IIHA 2IDEA
chains in the Genus database with same CATH superfamily
4BWMA 4UF4A 1U1KA 3FQLA 4DX7A 1VQYA 1VK3A 3FQKA 2UV8G 1T05A 3BZQA 3JQJA 3PEJA 2HK3A 1VHIA 1IBKF 5HMZA 2V68A 5LM7E 1WTBA 4MK7A 1V9OA 5A8WB 4F26A 2GO8A 3LP0A 2QYCA 3W65A 2HHTA 4KO0A 4QIFA 3LW5C 1WHXA 1DAXA 4QYZJ 4DHVA 3CDUA 3DGVA 2XZTB 2AYBA 1ZZFA 3G4SS 1MWYA 3MURP 3VF0B 3BBFA 2OP5A 3U1NA 3R5JB 5C25B 4A8XA 3CC7S 3EMTA 1GTEA 2M4MA 4GVLA 1GX6A 1YX2A 1T02A 4DPYA 2VF3A 1JLAB 4ZCMA 4BHQA 2HBRB 2YNHB 2N4CA 2HHQA 1YIJS 1TKDA 4TQSA 4PABA 2EC2A 4ZHRB 2FHJD 4QYZK 2HFUA 5IC4B 4LJMA 2VJUA 2ZWOA 1YI2S 4NWBA 1RT1B 1S9EB 2RUGA 2YQ0A 1APSA 2P2CB 4ZCKA 5LMUF 3KLGB 3PX6A 5F8MA 5DLFA 3VWSA 4QBUA 4F04B 5KT4A 5LMNF 1WDDA 2LXUA 5KFHA 4ZVQB 3FEZA 1HYSA 2CQ4A 4DQIA 4U6PA 2PD1A 2ZZNA 4KIAA 3POTB 1TL7B 1U1OA 1T03B 2MQMA 2DB1A 1RT2A 3TAQA 4J9QA 2WAQD 1SKUB 4LR7A 4QWDA 4M5HA 3D28A 1S1XA 2ROEA 2UZAA 4I67A 3TVKA 1RAAB 1S76D 3R5BA 1DLOA 1BQMB 1F9HA 3CB4A 4QPTA 3J81Y 5HP1A 2VA2A 1HMVA 5LOQA 1TFWA 5CYMB 5DQHA 4LFAJ 3GSDA 3HJFA 2BE2B 2Y9HA 1YSJA 3EXYA 3DLEB 3L4BC 2N4DA 4DV0F 2FB0A 3BKTA 3UNYA 2LP4A 5C24B 4X4UA 1FXRA 3T41A 5LXYA 5A0YA 3HSJA 3JSMB 3MCMA 3DLKA 3TAMB 2AGOA 1DTTA 2RIJA 4L3NA 2DH9A 4HHJA 4K50A 2YH0A 3R27A 2G2OA 2AW0A 3SCLE 4FPIA 3EICA 1M1HA 1LWEA 2MY8A 4JI8J 3HPOA 3ZC4A 5HVFA 2ZEJA 4NI2B 4ID5A 2DHHA 4U7UD 3LH2S 1S0MA 3PY8A 1CS4B 2A1BA 4KV8A 4Y00A 5RUBA 3UN3A 2HGLA 1TL4A 3V6DB 4JI6F 2J0QD 1PC4A 1YJ7A 3TEGA 4I2QA 3UWTA 3G86A 2A18A 2AEFA 3LAKA 3IRXB 5K9FA 4QIEA 4Y3CA 2XMAA 2H5IB 5DGBA 3QT7A 4DV5F 4U96A 2BW2A 1W2IA 2V2QA 2K8GA 1ZZNA 5HMYA 1YHQS 3BQ1A 2RRNA 3LP2A 1E6YB 4CO0A 4MJKA 1RT7B 1HBOA 5A8WA 2CQDA 5KOWA 4HR2A 3MXHP 2R7QA 2BZ2A 5K14A 1S10A 3M8RA 2CAJA 2C2RA 1J2VA 4Y34A 3BBBA 1LW2B 4UW2A 2JLFA 3CJSA 2HW3A 1RTIB 3SCKE 3K5NA 5C25A 4DR4J 4DPUA 2E5GA 3OFEA 1N54B 2YWKA 3O44A 2J8SA 3PACA 1A6LA 3M05A 4M5JA 4ANEA 1R0AB 3HT0A 3AJDA 3MZIA 3FMWA 4KPCA 4MK9A 1R8HA 1R8BA 4ZHRA 2B8PA 1KTVA 4Q5VA 3EGNA 5IV4A 4PG7A 4TY8A 2FVRA 1BMQB 2HRYA 1HNWJ 1F2GA 1RT1A 1OWXA 1S9EA 4N8OA 3T6BA 3KLGA 3SIPB 5K8MA 2V67A 1MWZA 5L38A 2J0XA 4NOHA 5THWA 3M8SA 3SSSA 5F41A 4NXNF 3M6VA 3VHQA 2BJEA 4BS2A 1B3TA 3POTA 1TL7A 4K0KJ 5AT1B 1JX4A 2JRSA 1WEZA 4OYWA 3CD7A 1H2TZ 4DV3F 4MIWA 1SVDA 1UAWA 2R8GA 1YJUA 5DG9A 4KB7A 3DXSX 5GAEI 4NYZA 2R7RA 1FRJA 2EFPA 3GONA 1BQMA 2UV8A 2O01C 2QSWA 4HDGA 1C4CA 3ETOA 4LVNP 3A8KA 1QSYA 5CYMA 3CMES 3OVSA 2OMOA 1JXEA 2BE2A 4DSKA 2V8PA 1VOMA 4DSJA 3BGFA 1XC9A 3PYFA 1SC1B 2GMJA 5IXUA 3J81U 3RAMA 4RJVA 5C24A 4DN0A 2HGNA 1N4LA 2J6TA 2NZ4A 2ZVSA 3JSMA 4EGLA 1NHUA 1M0SA 4HH0A 4IH7A 3TAMA 4LSNB 2C2MB 5AE2A 4KSEB 4K2JA 1UVMA 5E0OA 4DR3J 3WX4A 4J9OA 3FRYA 4USMA 4NI2A 1TQLA 3G82A 1WELA 2DIVA 3R1LA 3G9CA 3T5JA 3NKYA 3PW0A 2EW9A 1CS4A 3JB9k 3TUIC 4OZ0A 4OQJA 5C7PA 3OTBA 3T19A 1PKUA 4P71A 4GKJJ 5K8NA 4IKAA 3KLEB 4ITSA 1VI7A 4LRDA 2DHGA 2R7TA 2GQQA 4F2RA 2IVFB 5KFVA 2G2ZA 4AT1B 3TWZA 1QSSA 4BCAA 1ZYQA 1N5SA 3SFUA 1E6YA 2MSTA 1RT7A 3K57A 3ZZUA 2L9WA 1TL3B 3PDNA 3T1AA 3OXLA 3CIZA 5IM0B 1RCOB 4X66J 2BX6A 4NZ0A 2UUBF 1CQNA 2WCXA 3CO0P 2HFVA 2N3LA 2ZH3A 3IWNC 2NQPA 4GMKA 2Q6BA 4YN3B 1RTIA 1KS2A 4OJHA 3S6EA 1P1TA 2O67A 2FQQB 1DHMA 1MU2B 2QLWA 5ETPA 2EFOA 5E41A 1U47A 3AJ2A 1R0AA 2QA4G 4W98A 1MMDA 3JSBA 2IM1A 2QA2A 2IC3B 2RQKA 3CDBA 2J5AA 4U67Q 4ECRA 4IDKB 5KFNA 3Q8PB 3P8BB 5LSRA 5MLCV 4DR5J 4ILLA 4WXOA 2AMCB 2GVDA 1NB2A 1S4FA 2ZH6A 3CT9A 1RYRA 3QAUA 2GHVC 1EIYB 3PJWA 3EDRB 2YX1A 5BJRA 2J76E 3GFXA 3BGRB 2CNKB 4KY3A 1KVJA 3K58A 1FKPB 4PXCA 4A8WA 3L7UA 1XR5A 5HVHA 2D3ZA 4JV0A 4RUBA 2JLEA 1FRKA 3UE2A 4ZPCA 4MH8A 4OX9F 4RBUA 3NG8A 4MKBA 3L7OA 2AD9A 1EAYC 1T3OA 4NZ6A 2JNJA 2Z2YB 2Y0BB 1T9VA 4DV1F 3NCQA 1LV5A 4AQYF 2XBPA 3C14B 1DARA 4WE1B 4OHWA 5SUHA 1R31A 3CMAS 2VUGA 2YWHA 5I3UB 1GMUA 2OAUA 1QVGR 2HNZB 3I5CA 4ZVFA 1TK5A 2OLWA 4CLWA 1HHQA 2HWHA 4LSNA 3GSIA 3JYTB 2NLWA 1WC4A 2JLGA 2AJ4A 3D9BA 4V19J 1DQAA 3R6GB 4KHPF 5K8OA 5U47A 4K8RA 3NGTA 3H2LA 2BQUA 1VQ8S 4TYBA 4K4UA 2HHHJ 1H7WA 2YKPA 4MFBA 3AOBA 1HNXJ 1BQNB 2UXCF 4I0WA 5D0RA 2D9PA 3W7BA 5KFFA 3KLEA 1IR2A 5F8HA 8AT1B 2VB6A 2XWXA 2MZJA 2JEJA 5D77A 2CQ2A 1HBNA 5F9LA 4X65J 2RRBA 3PW2A 1RT6A 2R3VA 3SCJE 1NCLA 3CSKA 3PNIA 2BRLA 2E5JA 3IN5A 1ZETA 2FJVA 4PPDA 2DHSA 3THPA 2MJNA 3LAMA 3SQGA 1PJ7A 2XEXA 1TL3A 2WB4A 4LF5J 5IM0A 4QCLA 1VCTA 4HVZA 1S9FA 1MN9A 3GR1A 2PFDA 2D3O1 2FDNA 1T9XA 5EWFA 1U49A 2BJ3A 2L48A 5JJBA 2X3DA 1L3SA 4UZBA 3K5LA 2QIFA 4V1Ak 1V3RA 3FSXA 3CCWA 2CQCA 3OJUA 3H4DA 4PPZA 4J9KA 1S99A 2RF2B 3OBIA 3BBCA 2JC0A 1ZM3A 1K1QA 1MU2A 3AD8C 2DNHA 1NJYA 2C2EA 1JLQA 1CVJA 3KXDA 3H20A 2IY5B 4XIUA 2DNOA 1NXIA 2IC3A 5LL6d 4IDKA 3HDSA 2AYEA 2IM0A 4K4YA 1RQ0A 1F5BA 1JJ2R 3DU5A 2ZOMA 1K0TA 4E2FB 3SSQA 1HL6A 4F2SA 1OYEA 4OJGA 1UVKA 1N0UA 5HQMA 4K4VA 4JI2J 4NLWA 4U8YA 4YMEA 1MMNA 4NCGA 3BGRA 1H2UX 4DV2J 2VG5B 2ZKUA 1FKPA 4WFAQ 3DLGB 1UJ5A 3OXFA 1NNDA 1Q8IA 1R8AA 2F3JA 7AT1B 2H65B 2QMXA 2MYFA 4OI3A 3MM8B 2JFDA 2IA0A 1HARA 2CPZA 3ZNUA 2VL1A 2U1AA 2DGUA 4K2XA 4DL3A 2M7SA 3OL7A 3I4HX 2GHPA 3X3UA 4WE1A 4LF2A 1ACMB 2HPUA 2LA6A 2A6OA 1SJQA 2PT0A 2Z4PA 2CPDA 4TXSA 2CQPA 1EETB 5I3UA 1PCAA 4USVA 2VBXA 2HNZA 4DFKA 1OQ3A 5IT0A 2E1PA 4X64F 4C8ZA 2VC0A 3D1QA 4FYVB 4J91A 2ZD1A 3JYTA 3TZZA 3I5AA 3EPGA 4P73A 2HVZA 2AGPA 4OHYA 2DNPA 1ICEB 4J9RA 2OSQA 4LFAF 2P9EA 1X4GA 4ZCLA 4DR1J 1EP4B 3HHNB 2DJWA 3TJ9A 2V9WA 3TZYA 4LSLA 3R9LA 1FNXH 4ICLB 1S48A 5FIIA 5KFAA 2PMZD 1L3KA 2EWHA 2VQEF 3TX8A 1VLOA 4C11B 1PJ6A 2W9CB 4K5SA 1YKWA 3HI9A 1WKJA 4DPWA 3CDWA 1XN9A 1FJCA 4C98A 4YB1P 4JI8F 1S9GB 1YGYA 4HACB 3A13A 3E2EA 3I31A 1KD1T 1ZM9A 2VFRA 3UD5A 2NXEA 1TV6B 1W7WA 4OYXA 1N32J 3E3XA 3J80Y 4DDFA 3QT6A 3JSRA 1E6VB 1EX8A 3M8WA 3WIUA 3QGIA 5GMKa 2KJVA 2EBGA 2LQ9A 3EVMA 2IJFA 4ZA1A 2XI2A 4NYOA 5DJBA 5DS7A 5BXIA 2DRDA 3FBCA 1BC6A 3VAHA 3FRZA 4U95A 1QUVA 4ELUA 5KFWA 5EDWA 3DGPB 1YZ7A 1HR0F 3RR8A 4RNOA 1D9FA 2ALZA 1CPZA 2HIQA 4FN5A 1MWQA 2ZHOA 3V5RA 2IAJA 2QMWA 5E3AA 2R9LA 1EB0A 4OYAA 4C48A 1QAIA 4DR4F 2VG5A 3GV7B 3VGTA 3DLGA 5J2QB 2LFVA 2R8IA 3OL9A 2GA7A 3VVTA 4RLEA 5D4LA 1RGVA 2ZH7A 3MEDA 4NLXA 1HNWF 1Q78A 3KLFB 2FLPA 3W63A 4Z37A 1WC3A 2VONA 2FVPA 3JTNA 2BKOA 1TK8A 5B0DA 2OEKA 4RL1A 3FBFA 4IYQA 1EETA 1U0HB 4A4JA 1GMWA 4KGXB 2DPJA 3D6FB 2Z2LA 4DPTA 4I56A 4K0KF 2M2BA 2R42A 3QO9B 4Q44A 1R7IA 2E7VA 3FSYA 1OY9A 4UY85 1OPIA 4O23A 2QGFB 3MM6A 3PXGa 5A6WA 1UL3A 1U7LA 4NLRA 1DY3A 4F4KA 2R7UA 5KFRA 1H73A 1S57A 3MUTP 3DOMA 4DLGA 3O5TB 2CPXA 4J9MA 1S1VB 2HQGA 4WCEQ 3OVBA 2MPUA 1T3NA 1N52B 4Q2MA 1EP4A 3FK4A 3AHPA 1AXQA 4DF4A 5EX3A 2J8AA 1YTYA 3O8WA 1TKZB 2ZH1A 1Z1ZA 1IKVB 3FBEA 2WW8A 5I3PA 1Z2ZA 4B3TJ 3MM9B 4C11A 2CQ0A 3HK2A 2XI3A 1RWUA 3W64A 2NUUG 4DR3F 5GVQA 5F8GA 4OLOA 4J9PA 3PW7A 4RZRA 1S9GA 3QIPA 4HACA 1RAIB 4NEZA 2G1HA 3TA1A 2PA8D 2KYXA 1SJ3P 1KN6A 1N33J 1B4SA 3OTCA 1TV6A 1U1PA 2GX8A 1SKSA 3NOCA 4GKJF 3AQOA 1JLCA 4AXJA 1E6VA 3KLHB 4DX6A 2Q3PA 1FXDA 4AFFA 4NPOA 3TVZA 3ONQA 2QT7A 4LF9J 2Y0SD 3NNHA 3BDPA 5KT6A 1NEEA 4LREA 3TJ8A 1R0BG 4CM2A 1NZ8A 1U2FA 3J80U 1UPMB 1NPKA 3H98A 3A12A 5KFDA 4ECTA 2D3UA 2DHXA 1WF0A 1H2VZ 4ZVOB 1OSCA 1RP5A 4X66F 3D66A 1AROP 5DZ6A 2OFHX 3BQ2A 3O6QA 3ZZ0A 1VYAA 5F8IA 1KNZA 4LQ3A 1D8ZA 2XMWA 3BYPA 3IR7B 4ZVSB 2XMMA 1L5UA 3EE3A 2B56A 1A0OB 1LWCB 2CDRB 3BB5A 3EGZA 1LW0B 5JVGQ 1HNIA 1PAEX 2OTJS 2ZBRA 2FJEB 3UCZP 3FJ2A 3LP1B 1FX4A 4YR3A 1Q79A 1TR0A 2JOQA 5BR8J 2VIHA 4L3KA 2MXYA 1RU1A 3PFEA 3KLFA 2ZZTA 1VC0A 1Y4ZB 2DR8A 2H5JB 4OJ3A 4YEAA 4OHZA 4NLTA 4O3PA 4UUXA 4QR2A 2Y1IA 2OPPB 3TZWA 3KNGA 2VBWA 3GIJA 4PYAA 4XDDA 2L08A 1U0HA 3B54A 1G6BA 5HMWA 3FZBA 3BSOA 1TVRB 2ATCB 3MUVP 3HCXA 3QO9A 3EVOA 4DL4A 3H25A 4FPRA 3GE9A 2HZCA 4TU9A 3AB4B 1AW0A 2HVEA 1DURA 1X4AA 5KFKA 1XNQJ 2XULA 3KG0A 3UN2A 3PIOQ 3Q8QB 3L7PA 2KVQE 4FBUA 4Z7YA 2W2MP 4UOCA 3K5PA 1B0TA 1LFWA 3MR3A 5ETNA 2E1AA 2MKSA 3I4PA 2LQBA 1YITS 4ILRA 4DUZJ 2GAHC 2JX2A 1SCJB 1N6QB 2RS2A 2MZ1A 1FCAA 3WIVA 2YNGB 3DDNA 4F4XA 1XJWB 2DNZA 2QMUB 3V4MA 1TKZA 2E5HA 1UZHA 1IKVA 4S0MA 2JVRA 2DKOB 3SI8A 4ZLLA 1N5VA 1IWGA 1RBLA 4HT7A 4DU7A 4ETZA 3SV3A 2W25A 3BEGB 1GMWD 3FUYA 4Q0BB 4EMDA 2HHHF 1XIQA 4F36A 5F3ZA 3QT5A 5B08A 2HQDA 1RZMA 3S8SA 1HNXF 3KNAA 4ED6A 4TVAB 1V6HA 1OPZA 3UDVA 3B8HA 3KLHA 3TUJC 2HLUA 1GH8A 2DGVA 4WZQA 1U6FA 4FYDA 1UFWA 1VQ9S 4X65F 1GXLA 1L3VA 2FJDB 3NP5A 4PCQA 5F3TA 4DFMA 3OSNA 1RBAA 2UVVA 4ZCIA 2W2QP 4PYDA 5A2QU 3CTRA 3OJSA 3FFIB 1HW8A 5DRKA 1HBMB 3QWUA 2X1FA 4LF5F 3MAQA 1HW9A 2KG1A 1S12A 2LXIA 4F8RA 1R3NA 4QZVB 1DQ8A 4P72A 1HHSA 1NKBA 4PWDA 3B4MA 4ZPTR 2O66A 2VG7B 3EGVA 1PYSB 1LWCA 5CD4H 1FFGB 2YKOA 1LW0A 1Q7LB 1KR4A 5L46A 3BR8A 1EHWA 2LQ8A 2VFSA 2H4WB 3AT1B 3IBWA 3DYAB 4Q8FA 4DR2J 3LP1A 4DUYJ 3D4JA 3WC0A 5KG1A 2XSJB 3G2XA 5FD1A 1RAJA 2FC9A 1KOHA 1KP6A 4LRFA 3UW1A 3MEEB 1RWOB 2FPHX 4ZMMA 3SXLA 1Y00A 3JQKA 4YOEA 1YRTA 2OPPA 2Z8QA 3K7RA 4C4WA 2W2PP 2LLZA 5B0AA 4JI2F 2UU9J 4HKQA 4OV1A 4DG1A 3AH6A 1TVRA 4DV2F 5AXMA 1NHKL 4DLEA 2Q79A 3UI3A 2RQ4A 4MKVA 1VQOS 2IBOA 3CCUS 2HMIB 1Q82T 5L9XA 1VRUA 3KDNA 1OO0B 2YVSA 1FD8A 2OO4A 4OZLA 1V5VA 2B4VA 1SC6A 1NKEA 5J2MB 1Y3KA 3M2RB 1XTZA 3NXZA 1IN0A 2D3OR 3KLIB 4QU6A 3FBBA 3CCLS 2CG4A 5KFJA 3H2VE 3UR3C 3G8TA 5HLFB 1TP7A 3SFGA 3ZZRA 3W5ZA 1WI8A 2M5YA 5HQ8A 4OZ1A 4P10A 3IMQJ 1N6QA 4RW8B 1WOPA 1FEHA 1HWKA 1NLKL 3H40A 2XMVA 2YNGA 1W25A 1X5SA 5ETSA 3M1VB 2XO6A 3U27A 3HULA 1RT5B 1PILA 4EZ6A 3OFFA 2V2ZA 2Q6CA 4L72B 2QJ3A 4KAIA 2KRBA 4A46A 1REVB 2DBBA 2QFJA 3P5TL 4ECYA 4GVBB 3H5YA 4IG0B 1N88A 3DLHA 3Q8VA 3PX0A 3KHRA 4Q0BA 4UQGA 3FVYA 4RWWA 3ENWA 4I6YA 2ZH8A 3J7Z5 2POKA 4KTQA 3AXKA 2YXLA 1FX2A 2B5JB 4DR1F 4N76A 4ES1A 5M2PA 3VQSA 4CT9A 3D0IE 3PW4A 1FTRA 3ICLA 3HZGA 4Y65A 3CC2S 1ELOA 1TKTB 1C1CB 1F60B 2PN6A 2HSEB 2CQIA 1Y5LB 4B3RJ 4JI1J 1M5PC 5CD4A 4USKA 2OTLS 1VBZA 4XTTA 2J7KA 3PJXA 4NRTA 4QQBA 3Q83A 2MLXA 2IDLA 3R5AA 3IAM9 5F0UA 3C6TB 3MTJA 3NRBA 3MGJA 3M6WA 3FFIA 1F1BB 5IQQA 3MM7B 1HBMA 3M2VB 4EI2A 2DGWA 2AYGA 2CG8A 4G6VB 3N6MA 5CXTA 2RHQB 7FD1A 5IT9Y 4IFYB 3HXMA 1VJQA 2CJQA 2AWZA 3FMBA 4WFZA 3US5A 4DWIA 1N32F 2D1CA 1UWBB 4ECQA 5JMNA 2VG7A 2WB1D 2RDIA 1Q5YA 3CJTA 4DV7J 3R97A 4F7VA 3KHHA 1CEZA 4N5SA 2H48B 2XY5A 2C28A 3D68A 1IQTA 5L9NA 2YKMB 1N34J 2XLKA 1MG7A 3A1YG 3CF5Q 2XSJA 2Z56B 1GX5A 3GU0A 3HSGA 2Y1RI 5JXSA 1U1NA 5KFQA 3MEEA 2JZ5A 2B0GA 2E5LJ 1SUQB 4ZJOA 4WPAA 4DCPB 3F56A 2ASLA 3JSYA 1IKWB 4OYZA 5AE3A 4WP3A 5GMEA 1J5OB 2OD4A 4RUHA 4K7QA 4O3RA 5L1LA 5EN1A 3BYRA 3OR1B 4K4XA 1HHTP 1GXUA 4ECUA 2XS7A 2ZHAA 2IYGA 3W2WB 3BREA 4CZCA 4LFBJ 2EC0A 2HMIA 1XMQJ 1HWIA 4R25A 2DHAA 3V6JA 1JKHB 1RAGB 2IYIA 3CJ0A 4JI4J 2AZ1A 3W66A 5AJ3J 2CWXA 1O5JA 2C42A 2KXFA 5KFTA 4A8SA 3RBDA 3KLIA 4FNHA 5HANA 4M95A 2R7WA 2ILYA 3EZ5A 3GB0A 1NMEB 3GV8B 4O44B 3D54A 3NGDA 3BH6B 4PG5A 4Y28C 1S6OA 3CW2C 3GPAA 3I0RA 4JUZA 4RW8A 4DQSA 4Q8EA 4DZ6A 1Q8BA 3RJMB 1SL0A 3M1VA 2K7KA 5D3GB 1RT5A 3FGVA 1KRPA 1EZZB 3FC9A 2DNYA 1FF2A 2PEHA 4B08A 4ED4A 2KDOA 2CPJA 1Q8LA 2MKKA 3VGSA 4NLQA 4IG0A 2MGZB 4N8NA 3L95X 2I6WA 3UCGA 1TL5A 1EQ0A 3TA2A 3MMCA 1JLBB 4IRKA 3OHBA 1QAXA 4WF9Q 4Y2CA 3C16B 2B5JA 3MMBB 5HROB 3GCWP 4QW9A 2HBQB 2I1RA 4X2BA 5IV3A 2EK1A 1VBXA 1TKTA 3BO4A 2KFYA 2MKJA 1N5QA 1WD6A 1GEHA 5T14A 4TYAA 1U02A 3Q8RB 3P4UB 4KHMA 4CLKA 4OZ5A 4WFBQ 2W7OA 4ZLJA 1P8GA 1RWWB 2A3JA 1PJ5A 4F4WA 4LR9A 2DK2A 2YY3A 4B3TF 1YRUA 1CJKB 2PGCA 4KT0C 2Z2ZA 2R8KA 2W4CA 3C6TA 4DCJB 3FCVA 1VLYA 2BE7D 2CQGA 3MM7A 3PRDA 2ZITA 3M2VA 4H4MB 1H7XA 1Z4UA 2BJDA 1KLMB 3R6LB 1HNZJ 2FHKA 1N33F 4CO4A 1SV5B 4IFYA 1UCNA 4YUDA 3PTWA 3QJPA 2H51B 2DNMA 2YX7A 2KT3A 2AV5A 2K7JA 1UWBA 4LRBA 3G8QA 1HWLA 4F67A 2BJ9A 2FLNA 3W5YA 4LQ9A 2FYXA 2VDHA 4P2XA 2XZWA 3NL0A 1RTHB 2XTJP 4RNFA 5IT9U 4DL6A 3W2VB 3EUNA 5T7LB 2YKMA 5F8JA 4JV1A 1WHVA 3BKUA 1NUEA 4PXBA 4MIBA 2IPOB 2XQCA 3J81j 5DDQC 4LRCA 1N48A 3GLJA 2L9DA 4C0OC 1TAQA 2EG1A 2OEMA 4CRJA 5M2UA 4IH5A 1IKWA 5A6PA 1J5OA 4M94A 2X1GA 3OR1A 3CE8A 3V81B 4KJIA 2HFOA 5F8NA 2F7VA 1S97A 4F3OA 1UETA 3PV8A 2J9EA 2VKRA 2AQ4A 1JKHA 4P75A 1Y5NB 5F0WA 3MR7A 3KDOA 2M88A 1MROA 4B9UA 4ZVGA 1AYEA 2XNQA 3DOKB 5BR8F 4ZPWR 2GFFA 1BD6A 3G6XA 2WVEA 5KAKA 4DV6J 1M5HA 4OHVA 4K4ZA 2DD8S 4KO0B 3LPEA 1M5OC 1ZAWA 1C0TB 2JH3A 1HWUA 2DNLA 2W4DA 3VGVA 2APOA 4JV5J 2V8VA 3MCOA 3HFZB 2H3EB 1Q81T 4IH6A 4TLRA 4G1QA 4OHXA 2NXCA 1RHMB 5B0CA 5D3GA 2B7BB 5KFYA 3H4BA 2DNQA 2ZJPQ 2ZWPA 3IRWP 2B4PA 3OW2R 3I6PA 1XNQF 1Q4RA 2MGZA 1Y0HA 1OY6A 1O0PA 2NPIA 4OI6A 2B4UA 4WP9A 4ES2A 2VPXB 2CJKA 5MAOA 3KWMA 3A3OB 1JLBA 2QFIA 2QA4S 3C16A 3WHIA 5BYRA 3LA0A 3MMBA 5ETOA 2DYAA 5HROA 4DUZF 3UO0A 2HNDB 5AXLA 2HAIA 1K9MT 4F0KA 1PGZA 1KBRA 1IJEB 5H9EJ 3CUNA 4USUA 2MKCA 1SIWB 2ZBCA 3FNNA 1RT2B 1TMMA 1BXNA 3GJSB 1RKJA 1YVFA 2CJAA 2A0FB 1I51B 1CJKA 1U25A 2GW8A 5IT4A 5G4DA 4CLSA 1O8BA 2F8MA 5DDOC 4L76A 1DLOB 2MQPA 4FBTA 3VZIA 3FCWA 1VQ6S 5H9EK 4CO3A 1QDUB 5HP1B 4TN2A 2XYPB 2UXDJ 1SV5A 4DJBA 3LALA 4OMFG 1ITPA 1FFSB 4X62J 1RBOB 1NDPA 3G71S 1D8YA 4CDIA 7FDRA 1SQEA 1JXVA 1TL1B 3E01B 4FXDA 3PX4A 3B6BA 5CZVA 4LMZA 4ILMA 1FT8A 3KJNB 4F25A 3C2PA 2VG6A 4P2FA 3DLKB 3MFHA 4DR7J 1DTTB 3W2VA 4QW8A 1IBMJ 3LOUA 1LWEB 4ZOSA 5A8KB 3RW7A 4G1IA 2FY1A 4USWA 4CLPA 4ETXA 3LGNA 2K1RA 2F4VJ 5C42B 4C97A 1WC5A 5B0FA 2B6AB 2AEMA 1RAFB 4I2QB 4WFNQ 4LVOP 4X4RA 2RQMA 5M2RA 3V81A 5B09A 4N56A 3QJJA 2EG2A 3DI6B 2LU1A 4PQUA 3T9NA 1FJEB 1SKRA 1N0VC 3UFCX 3Q8UA 4USTA 1VQPS 1ZH5A 1FE0A 3HT3A 3IWLA 3LP2B 4DR2F 3RB0A 4DUYF 4J7CA 1KHVA 4DSFA 2NYHA 2BJ8A 3DOKA 2CPEA 1HBOB 1CSJA 3TO8A 4R5PB 2R7VA 5K14B 1WI6A 1C0TA 4PG8A 3MI7X 1RA6A 3M6UA 3DN9A 1GT8A 1S7HA 2FJXA 2GAGC 1GAOA 2UU9F 3HO1A 2V8DA 2YKAA 4FKYA 2V94A 3CEDA 4PG4A 3V2UC 3MMAB 1X4CA 1RTDB 1U26A 2RD5C 5FLXU 1WG1A 3AA9A 1KFDA 3OUYB 3BN7A 4MK8A 2H9ZA 1NDCA 2JJ4D 2NYIA 1X4EA 4TY8B 4P74A 2IBKA 5HK4A 4FYYB 2FZGB 3UVJA 3J7YU 1Q7YT 2GO9A 2COLA 4WK1A 3AY0A 2GGPB 2K3IA 5EX0A 4OL8A 3ENVA 2J0WA 2HNDA 2KYZA 2R7OA 4WYLA 1NAQA 3QPIA 4HI2A 2VQFJ 2GMHA 2VH7A 4J9NA 4JI0J 3C6UA 3SDEA 3CCVS 4MYUA 3THVA 1VIXA 2UXBJ 2EKNA 5KG7A 4JI7J 2OMLA 4ANDA 4CH7A 1R6YA 3DFEA 2E9ZA 4ECSA 1ZM2A 2Z58B 3BN4A 4C3MA 1VISA 5GAGU 2DEJA 1WHYA 1IBKJ 3D6HB 4FF1A 4CLZA 3KYLA 5B0GA 3MOZA 3NBPB 3K5OA 5I3QA 2VA3A 4NCAA 2ZVIA 1XNRJ 2GQ2A 1TL1A 2DRAA 2IMOA 3E01A 3DRSA 2DGSA 4B3RF 4JI1F 3GMGA 2QLJB 3PYEA 2CZVC 3I56S 4EBCA 3GV5B 2R2TA 3GYXB 1RWNB 1TKXB 1FWKA 3R7BB 5J2NA 3LF0A 3PM9A 2M52A 3RGIA 2I2YA 4YY3J 4A8FA 5A8KA 2R7SA 3G82B 3O2IA 1AA1B 4DPXA 3IR5B 3Q89A 4QIVA 1TAUA 1OY8A 2U2FA 3UD3P 4UTGA 4NCBA 5C42A 2CDQA 3HHLB 2XMKA 1VS3A 2B6AA 4QJVA 1TZ0A 2ASYA 1VQNS 4D3HA 4K4SA 1FVSA 1K8AT 2RT3A 4LIRA 3DI6A 4I69A 4HTJA 4DV7F 3TRGA 3BS9A 1T9WA 3JAMY 3T9ZA 3TA0A 2G0CA 2WVFA 4ANCA 2DISA 3LPYA 4P7VA 4JB8B 2HS0A 1NJWA 4DR6J 2VDIA 2FHMA 1I5OB 3D0GE 4EEYA 2RDDA 1IM6A 3R7NB 3NY0A 4R5PA 1UVLA 3D2WA 4ZVEA 1SB6A 4GRSA 2E5LF 2PDAA 4CQ1A 2XO7A 3IXQA 4EBDA 3LGHA 4F02A 5LT5A 2QRRA 3R5CA 3MMAA 1BUXA 3VAJA 4LFBF 4NYPA 1RTDA 2GJIA 1XMQF 2HHUA 2MKIA 3OUYA 4PG6A 2WVCA 1XEZA 4JI3J 3OSPA 2XMUA 3GG0A 3AD7C 3ILIA 3VALA 4TU7A 2QE5A 3R3TA 2BW7A 4O0NA 2GVDB 1F5AA 3KK1B 1RU2A 2HLTA 1RACB 4KC5A 2CA9A 4F4YA 4C9DA 2GGPA 3A8JA 1VQLS 3PRVA 1WF1A 4CO2A 3G8SA 2JEGA 2CPIA 4G65A 2BXJA 4KGKA 1NZAA 1RI7A 2M8DB 2JC1A 2F1FA 1XK8A 1UJ4A 2ZH5A 4RBVA 4Y6IA 5KT5A 2HVHA 3CCSS 3DCAA 1RHUB 2MMYA 4BLGA 1F9EB 2GZOA 4DN9A 4ZP7A 4CH1A 3ILLA 2B9YA 1HD1A 3OFGA 4LR8A 3PKMA 1NJIT 2KTQA 3NBPA 3IR6B 2J9DE 3KLVA 1WG4A 2W8LA 5KFPA 3QSYB 1UJ6A 2E1CA 2KH9A 3Q24A 1QAJA 2UUAJ 4IFVB 4CTAB 2NZCA 2RHSB 5BYSA 4KGVB 2HYIB 4BC9A 3KK2B 3BSCA 4KPYA 2AJQA 3CJ5A 1TKXA 2RU3A 4KQZA 5C5JA 1T0TV 2ZHBA 5ETVA 3D5MA 1F0XA 1M1GA 2LDIA 4F0HA 1KWMA 1U2RA 2CADA 3IFEA 4G1PA 2OPRB 1CULB 1HNZF 3C8YA 3N5BA 4MFBB 2XY6A 3HHLA 4ZJQA 1VRTA 1U6ZA 2DGQA 4UOGA 3RZAA 4A8KA 3IGNA 2CJYB 2NXJA 2HHPA 3H2UB 2EI5A 2WOMA 1UZDA 1WUUA 1U1RA 4Y2IA 4C0BA 2RRAA 2RSQA 3AA8A 1IR1A 2AYMA 5IOLA 6FDRA 1KHWA 1HBNB 2C3MA 1B99A 1RT6B 3RB4A 3M8QB 3BO2A 4KYZA 1G1XA 2LEPA 1X4FA 2ADBA 1VQ4S 3SQGB 3AOCA 5L1JA 2PI5A 2GHWA 4W90B 3JAMU 1JNZB 2F5GA 3ZZYA 4R0EA 1ZTTA 4DL0C 3HSDA 5DG8A 1S0NA 4JYAF 3BH7B 1FJGJ 3CCRS 4RW7A 4ECXA 3WDOA 2DVIA 1GNKA 2XMJA 4X4SA 1Y3JA 3M9MB 3HHEA 1WEYA 1B64A 4P2SA 1FKOB 2H1YA 1FWPA 4HDHA 1JLQB 4WTOB 3ILJA 4WFYA 5KFXA 3NGUA 5D4NA 1RTJA 3EDQB 4IQXA 1HQEB 4L74A 1BWVA 3CJKA 3DHXA 3MCNA 5EWEA 1S6PB 1S72S 2BMBA 4DV6F 2GNKA 3MOJB 2KL8A 3KK1A 1B0VA 3JTPA 2VFTA 5I4MA 3WQPA 4F4AA 1ZTWA 3CC4S 4J5OA 1UKUA 1Q1KA 4ZVUB 4CO1A 3MR2A 4JV5F 4ED5A 1H38A 1T11A 1FRXA 2PMWA 2DNGA 4NCGB 3ILOA 2IVYA 1X9MA 2G1DA 1DZ5A 4DFJA 5AE1A 3EX7B 3PYGA 2EFVA 2SXLA 2CXEA 1LEOA 4LBIA 2V4JA 1YDLA 1MW7A 1Y5IB 4DZDA 2WBRA 3B78A 1CBKA 3AJ1A 4DU8A 3BO3A 2HHXA 4ECZA 3MM5B 3M2UB 5J1EB 1RHJB 3IO1A 1QLNA 4OZ2A 5IZHA 3GJQB 4ED7A 1A7GE 5HJXA 2ZOGA 2D9OA 2DR6A 2YH1A 1NSAA 3GYNA 1S1TB 3C15B 2KT5A 4IFVA 1WG5A 4CTAA 3Q22A 2KRRA 2W2NP 3UNGC 2CVIA 2RJZA 1BQXA 5DM7Q 3PW5A 1TFYA 3W9IA 4XPEA 3I32A 1RLCL 2HHSA 3KK2A 1TUGB 2OFGX 3MWBA 1KC8T 1OIAA 2ZD1B 1UA1A 5E3PA 2HQ3A 3NWGA 3W8GA 3DKDA 2FJWA 4LF7J 3CWJA 2GVZA 3KHGA 1SQGA 2MJUA 3OTOJ 3AXMA 1Q8KA 4DXLA 4I7FB 2HFNA 2BOPA 1SC3B 2XYHB 4WP8A 3EZOA 5ETLA 2XZDB 3VGUA 2OPRA 4E98A 1CULA 3G96A 3UN5A 2UXDF 1SXLA 3QJLA 4X62F 2B9WA 4QOTA 1S59A 4DL5A 4R8UB 2BQ3A 4LSLB 1ZBTA 2RH3A 2J9CA 1KSPA 1FESA 3ZO7A 4OI4A 2UUCJ 3DM2B 2HIYA 3M8QA 2WK4A 3JXOA 3WX8A 2ROPA 4DR7F 3DLBA 4U9RA 2DGOA 2MB0B 5KFIA 1IBMF 1RT3A 3MECB 4ERDA 4GKKJ 2WVBA 4ZP8A 2ZZMA 3E51A 3V6HA 4OX6A 4A8YA 4RNMA 3QSIA 2W9AA 4BC7A 1W26A 2I5JB 1HQ2A 2HBYB 2EK6A 4O3SA 5KFUA 2F4VF 1L3TA 4X4OA 2XSFA 1B70B 5KT7A 1QY7A 4W92B 3VZHA 3MEKA 3G6VA 3N01A 2N7YA 3VR1A 2YWEA 2O3DA 1FKOA 3PG9A 2W9BA 1JMTA 1XQIA 5L1KA 4OJ1A 1IUJA 4IO9Q 1UEKA 3E8OA 1QJHA 1NK0A 1WTFA 2BKNA 2E9RX 2Y8WA 3HVAA 5CYJA 3HHLD 3GFYA 2MZRA 2X1BA 3CVKA 1HQEA 4K5RA 2XLJA 2IDEA 3GIKA 1RWPB 2AF6A 1S6PA 1SJRA 2ASDA 2L3MA 2V9KA 5D78A 2ERRA 3CD5A 1G4CA 1WOOA 2FLOA 5J1NA 3MPUB 3HHKA 2FD2A 3EJMA 2R2UA 3EXCX 2IAJB 2YPZA 1K47A 2R2RA 5CABA 3T1YJ 5A76A 1S4EA 2HK2A 5KFOA 2F8EX 3NWRA 2C3UA 2C22A 4YP3A 5K5MA 4EU0A 3TNVA 2Z0GA 5KG0A 2Y8YA 2LU2A 3MEDB 1M5VC 4IG3B 3RR7A 1DTQA 3MM5A 3M2UA 5J1EA 3GFZA 5CH7B 4ZP9A 5J2PB 4NLPA 2DR9A 4Q2LA 2XC9A 3HSZA 1SJ1A 3NAHA 2A2DA 4I6WA 1S1TA 3C15A 2D69A 4ZJLA 4YDDB 2HURA 2P9GA 2VQFF 2Z30B 2W8KA 1NPPA 2UUTA 5CZXA 4AYBD 3P5BP 2KJWA 2G4BA 4JI0F 2OEJA 2KM8C 3D3CJ 2RS8A 2KKHA 4UOHA 2UXBF 1TUWA 3MM6B 4AL7A 1NB7A 2VHGA 4JI7F 4PXEA 2CJ9A 2CFXA 2IRUA 2CWKA 3LQVA 2NUHA 4I7FA 1HI0P 3KTQA 2DY1A 3DOMB 1SQFA 4LF6J 4GO5X 4M5KA 1NK4A 2R7XA 1G7CB 1RADB 1FD2A 3M30B 1CLFA 1KDNA 2XS2A 4OV6A 4L73A 5DETA 2BUNA 4YFUA 2W7PA 4KH1B 3I82A 2V6AA 1SKWA 2WONA 1NJZA 1S1UA 4R8UA 2HZVA 1XNRF 1NK9A 1R6VA 3UDEA 2LEBA 2ZBIA 1UPPA 3DM2A 1VC5A 1FE4A 2HVDA 4HT5A 4KHRA 1WACA 3TW0A 3HF5A 1OSDA 1RHQB 1YWXA 4NRUA 5DQGA 3M6XA 2FTRA 3MECA 4WTYA 4ZIVA 5IFMA 1FVQA 2HWTA 1U1QA 3NOGA 1XBWA 3R2DJ 4YY3F 1Q16B 4OLPA 3K0JA 3TI0A 2CNNB 4ED2A 3QIPB 1VJWA 2I5JA 2MQQA 5KG4A 5D4OA 4MT1A 3ZZPA 2I38A 4D3GA 2RE1A 1VBKA 1U48A 3AQPA 3HVTB 3ZFVA 3MHYA 3CULA 5EHHA 4QR1A 1JLCB 1HPZB 3KK3B 1RUSA 2IIHA 3N28A 5GADU 3QMQA 2HQIA 4YHHJ 2YQ3A 1VGYA 1WC6A 3PEHA 3OVAA 3PKYA 4MKYA 3NS6A 3CO9A 1D3WA 1NO8A 1RISA 4XAKA 1OYDA 1XERA 2FZCB 2B9XA 2LA4A 4X64J 4DR6F 4Q43A 2HKEA 3MD3A 3RRHA 1MSWD 3VTIA 4C8MA 3A3NB 2WVDA 1AZSB 1G2EA 3N0VA 2NPFA 4X4PA 3CNQP 3OFHA 2X3GA 3OR2B 3BSNA 1FEEA 3G87A 2BANB 1WSVA 4KKOB 3MUMP 4LUBA 2J9DA 2KO1A 4C7QA 2J0SD 4RW6B 3QRRA 3AODA 1URRA 1MMLA 2R2SA 4WU3A 4OYOA 3C19A 4ZP6A 1U8SA 2YX4A 2ZH4A 3QGHA 1V3SA 3W9HA 2XHCA 1HNIB 2QN6B 1KOOA 2FY8A 4CT8A 4JI3F 1UP1A 2CJXB 2H5EA 2KXHA 2RDJA 3OPKA 4J9UE 4IG3A 4WBFA 8RUCA 1CJUB 4ZVTB 2KB2A 3ISND 3K17A 2VQEJ 3FCHA 1RA7A 1U1LA 3UCUP 2DPIA 3KJFB 5LXRA 5J2PA 2IHR1 3KMSA 3MAAB 3H42A 2RQCA 1UEUA 4ELVA 4N41A 1LXNA 3QGPA 3HD2A 2PI4A 1UMJA 4DV4J 3QZ7A 3H8YA 1SH0A 2HRTA 2AJ2A 4A48A 4L75A 4RX6A 3GIMA 3PRBA 3H0PA 4DFPA 2DNRA 4RU9A 2CZ9A 3RRGA 2CIMA 1U6BA 4H4KA 2KFNA 2ZKTA 2G13A 4JI5J 3TOQA 2CKWA 1LOUA 1M5SA 1RHKB 1YK9A 1PBAA 1YLXA 4YDXA 4JV2A 2MLZA 1IVZA 1X7VA 3M30A 1FRIA 2KG0A 2XG8A 3HD1A 4FVCA 1H0HB 2XWYA 1SL1A 3PO5A 2CQBA 5ETTA 3QFHA 2HEKA 1HR0J 1YBAA 5DDRC 2UUAF 1VQ5S 3BV8A 1KEKA 3CJ4A 5DLGA 2EPIA 1KTQA 4G3IA 4GC7A 2HFZA 3EWGA 1UA0A 2ZH9A 1HD0A 1ZM4A 4J9LA 2KZMA 2OHDA 1V5IB 3P6YC 5LJ5Y 2J6UA 1YBUA 1JLAA 2YNHA 4C8LA 1M90T 3TYTA 1CG2A 5FDLB 2MEWA 4CWBA 4OFZA 4M5IA 4OZ3A 3G6ES 2QYGA 3HVTA 2MZSA 3FEYB 1HPZA 3KK3A 3CCTA 5FJ4A 1T7PA 2WW4A 2V2VA 1CC8A 2F40A 3AFGA 3M9OB 4P9SA 1YZ6A 1IM4A 1UFLA 1VIOA 1NK5A 2ZOFA 2QO3A 1UWAA 5KG2A 1FDNA 3RAQA 1BWEA 5ADZA 1T03A 4LF8J 4QR0A 3IM8A 5HAOA 4NMLA 1YJNS 3F73A 2E44A 2HS3A 2MHEA 1AZSA 3MFIA 2M9KA 3ZTPA 2VFUA 4BBYA 1XR7A 2BE9B 3OR2A 3TP2A 2BANA 3MDFA 2W24A 3VAFA 4X4NA 4KKOA 1RABB 3GTYX 2BV3A 4DL7A 3MD1A 4RW6A 4OI1A 4PWDB 4AL6A 1FJGF 3P96A 3TUZC 2KVIA 3D67A 1YBTA 4OYIA 4OI2A 3HM9A 2VICA 2UVRA 2IRYA 4NX9A 2HZAA 2LXFA 3D1OA 3RW6A 4HHUA 4ATNA 3DLEA 4KGMA 1H3DA 4XPCA 5ETKA 1DJ0A 1F2HA 1C0UB 2BOAA 1P9QC 2DO0A 1FO1A 4F4ZA 4DR5F 4Y0FA 1CJUA 4RO0A 1XWLA 1J27A 3M7VA 3RRKA 4DS5A 5D4PA 2G0JA 1RE1B 5HN0A 1RTZA 3MAAA 4KGZB 4TQRA 4DG1B 4MTPA 5AXKA 3GP9A 4FP9A 1REGX 2MZQA 3MPWA 1FFWB 3DDKA 1HNVB 2GS8A 2AP6A 4XDCA 3V6DA 3TR5A 1WC1A 2DITA 5E33A 3S01A 3TAPA 2EFNA 1VRUB 2WRMA 2V50A 2VKZG 3MR6A 2Z2MA 3Q8YA 4I1TA 3IRXA 1EQMA 2ZBPA 4PXDA 4M5MA 3BDEA 1U24A 4OYPA 2IMWP 4DEZA 1X4HA 4FNIA 1JQGA 1N36J 1N5YB 1T94A 2RB7A 4ZITA 2FVSA 4URQU 4RR5A 1WKKA 2GMLA 2K3KA 2DIUA 3NGKA 3L9ZA 2XLIA 2BBEA 2F63A 2P9CA 3F0NA 3SEOA 1LW2A 2LMIA 4F50A 3U02A 3R2CJ 3UQSA 4ES3A 4BWJA 1OJ4A 3HVRA 1I94J 3QIDA 4H4OB 3ENAA 1T95A 2AHOB 4LF7F 4NA3A 1N56A 3OTOF 2LVWA 4IRCA 4B9VA 2P6SA 5FDLA 2QC3A 4I6AA 2EFGA 5KFGA 1WC0A 4EO8A 1KQKA 3KOAA 5GMDA 4B3OB 2DXEA 4J9VA 4ZN3A 1VC6A 2MKHA 2GIQA 4LF1A 4QIWD 2AIRB 4QWBA 4IOBA 5KT3A 2UUCF 2HHWA 1QAYA 2HS4A 4IR1A 5DGAA 3CDEA 1LK7A 4RW9B 1GK8A 2C2ZB 1JXLA 2LCWA 3CXCR 1GQEA 2OSRA 4GKKF 2VODA 2PE8A 2YTCA 2XCPA 4LT6A 5F9NA 3KKFA 1Y11A 5GAHI 1VQKS 4PAAA 4ZVPB 2OELA 5K8PA 3U7JA 3SV4A 3IWXA 3KHLA 3FKBA 1CQMA 4LFCJ 1QD1A 3FSIA 3J7YI 4ZK7M 3GG1A 4ED3A 1PSDA 2A6MA 2YKQA 5H1SV 1P9YA 3EVWA 5E5NA 3OL6A 1RSCA 3SCIE 1X0FA 3LTOA 2DXFA 3QFWA 4RUCA 2NXNA 1WOSA 1C0UA 1D1UA 4DUTA 1LWXA 4N47A 3PO4A 2VZ9A 4CLFA 4LF4J 4ZDNA 1IJFB 1NPRA 3FDSA 3B4DA 2EEYA 5LSLA 4NLSA 3S7RA 2HFSA 1SIZA 1K73T 4KH0B 2E29A 4DSIA 5CHCB 4UY8T 1TU0B 2ACMA 2CQ3A 2GJFA 4TLQA 1TELA 5GAGI 3MF5A 3M32B 4NMXA 5HMXA 3QGGA 1HNVA 4NE9C 4Y2MA 3W8PA 3T1YF 2VASA 3IP0A 1YQHA 3DRYA 1KFSA 4B9MA 2ACYA 3O3LA 4PEOA 2W2OP 3PR5B 2VJVA 5E3CA 1M1KT 4UT4A 3CD0A 2QV6A 1JIHA 2PO4A 2ZBQA 4F0MA 5D0GA 4CLUA 2G9OA 2XNRA 2LKZA 1I3OB 3KJQB 3PR4A 2NREA 1N5YA 3DMJB 4NASA 2HHVA 5IWAJ 3AAWB 3QATA 3BQ0A 2BKPA 1WSRA 1U45A 3I0RB 2CJBA 3N9UC 4USJC 2ZC3A 3D6MB 4PWUA 2CYYA 3JTOA 3PVXA 2YWWA 1NK7A 2JL9A 4FVMA 2W4PA 3MCSA 3M8YA 3W62A 3RAXA 3QNWB 4HEA9 4Y2AA 4H4OA 4B3MJ 3EPIA 2QL7B 4FDFA 1JLEB 1A9NB 1WF2A 4XO0A 4LF6F 3MMCB 5T41A 4C8KA 5BYQA 1VQMS 2UUWA 4MAKA 4ENOA 2BR0A 2RVJA 5J1PA 1UVIA 2KM8B 3NLCA 2WSEC 2QX0A 3NGSA 2L9NA 2ROGA 4NA2A 3H90A 3OV7A 3OQ2A 4B3OA 2P8IA 4CO5A 3NS7B 3K8VA 3QLHB 1WKLA 2V69A 1U8WA 4I2PB 3NMRA 3I55S 3UDLA 5DG7A 5DZ7A 2NSCA 2F9DA 1F3VA 2DY9A 3HHLC 2HAFA 4TU8A 1YRXA 4RW9A 3QAEA 4DF8A 3V6KA 2YPYA 5DQIA 2KZZA 2DNKA 3WBZA 1QTNB 2R8JA 1XR6A 4WXWA 4M5GA 3A8IA 2OD6A 1F6TA 4PZVA 1HWJA 4IR9A 2GC8A 1AUDA 3DXBA 1FERA 1RYSA 1EKRA 1YJRA 1NK8A 2AU0A 2HRUA 4C3KA 2ZJQQ 2IVMA 9RUBA 1VBYA 1RT4B 1ZAVA 2CNLB 1DBDA 3HHDA 4AE5A 2OGUA 2IM3A 4CYUB 3C14A 3OT9A 4YHHF 4OX8A 1S1WB 2VBZA 1RDRA 1RWMB 4HI1A 4PKDB 1V3ZA 1NSPA 4DI6A 1RK8A 4P6QA 3ELHA 3CJ8A 3I9V9 4N7TA 5KFCA 3D0HE 3JS9A 4AL5A 4NEYA 1MNEA 4X4QA 1O6XA 1CJTB 1RWVB 3BPDA 3PZPA 2E66A 4LBPA 3I0SB 3M32A 4FKXA 1JJHA 1Q53A 2K2PA 1U2CA 1OQ6A 3GFHA 1BQNA 1YJ9S 2CPYA 4NXMJ 2FVQA 3CJ2A 2KU7A 4C3LA 1MROB 3LANA 4Z2XA 1T9YA 4I4BA 3SMZA 4DMZA 3DLLQ 2FLLA 1FHTA 3CCQS 2FGOA 3DMJA 1X4BA 1AFIA 3NGRA 3T3FA 4C6AA 2J6SA 3D7SB 2EVZA 3HLUA 2NCKL 3PHTA 1Y9OA 3GIRA 2YQ1A 1VHFA 2ZUGA 4G1QB 5E7OB 4CP5A 3CCZA 2BYCA 2GQCA 4DV4F 1PC5A 1FA0A 1IR0A 1KQSR 2N82B 3H5XA 2CPHA 3W61A 2DO4A 3Q23A 1AB8A 2RF2A 1F3FA 1AT1B 2V4RA 4EK2A 3IM9A 3P3DA 1JLEA 4HYKA 2HG4A 4JI5F 1S6UA 1NK6A 2M70A 4H54A 1NH7A 1WORA 1FDDA 1C2PA 3ISZA 2CPFA 4CCHA 2AJ1A 2VOOA 1PO6A 2GV1A 1LQ9A 3PFOA 2R4FA 3P49B 2C2DA 3VV2B 1NH8A 2A10A 3QLHA 4I2PA 2RMLA 1NRKA 4Q45A 1SI9A 3K89A 4ZPVR 2BVZA 2ZDPA 5LJ3Y 1TMJA 5KFEA 2NR0A 4O4GB 2FGCA 3R5DA 4FF3A 3QYYA 3J7A1 5D8HB 2FVCA 2E7XA 3RU0A 1H72C 2CNOB 1VR6A 3N6LA 4B02A 4GC6A 4DBQA 4ECVA 2BQRA 4JBCA 3PJ9A 2AT1B 3QWPA 3IA0A 2KHDA 4FYXB 3SBMA 4B3SJ 1NJXA 3MM8A 4DS4A 4NLUA 2NS1B 3CCJS 2LEAA 2F9JA 2FUG9 3GR0A 5E2QA 2BDPA 3HKZD 1NDKA 1PIEA 5D0HA 1RT4A 3WZ0A 4DX5A 2VBYA 3RYLA 2VPWB 2E1RA 2BEFA 1X0PA 2HBZB 3HZEA 1S49A 3OTEA 4IOAQ 4CYUA 3ZTSA 3HFKA 3VAIA 2ASJA 3TQ1A 4LF9F 1S1WA 3ZZZA 1YJTA 5JUMA 2VG6B 2QSFA 5ITHA 2EKYA 3H5SA 4WK3A 1U09A 4J9SA 1U1MA 4RBTA 4LF8F 2IFXA 2ILZA 3ISNC 2ZUAA 3ULHA 1Y10A 4AXIA 1FDAA 1P6TA 3CIMA 1CJTA 3W3SA 3UR0A 4KFBB 3CJ3A 2K1RB 5G0RB 3CCES 1BE4A 2MLYA 3BPSP 1QE1B 3B82A 1IBLJ 3C66A 5HSPA 3ZZTA 4MYTA 3I0SA 1UTAA 1Q86T 5KT2A 1SJ4P 1HI1A 4PQUB 2DCLA 3AD9C 1P1LA 1OS5A 2LYVA 1S0OA 1J5EJ 2K06A 4L6V3 3ENQA 2VPYB 1X5PA 3MMJA 4ZLPA 3N6NA 4ICLA 5B7WA 4I64A 1LNQA 2IJNA 3O1LA 3LWMA 4LBHA 1SL2A 2W9CA 4ZPAA 3GIIA 5KG5A 3LWLA 4A47A 5K20B 2RUSA 3K5MA 3RG6A 2JEFA 3EM1A 5D15A 2F65A 2XS5A 4JP8A 4W4MA 1QM9A 2WBMA 1X31C 4QWEA 1QTMA 3EZUA 5KFBA 3ET6B 1HQUB 3UPFA 2XYGB 2YWFA 3C46A 5A2QY 3J7ZT 4EYHB 3CJRA 2KFZA 4C8OA 3W60A 2OIHA 3OL8A 4LRAA 1CC7A 2QL5B 1H6KX 5GAEU 3RBZA 3ZTRA 3KG4A 2QA1A 4YS2A 4ZKAA 1LXJA 2OJ3A 1S5ZA 4KRWA 3K8WA 2OH2A 3UVJB 1N36F 2B4OA 1HI8A 1PG5B 4WKRA 1DQ9A 2Q1LA 3L09A 2XGPA 5KFZA 1P27B 3Q0AA 3DGPA 4DQPA 4HHHA 1XMOJ 3CCMS 3K2YA 2VFVA 2BJ1A 2UVWA 4ZVRB 1T8EA 3N79A 1IXKA 3CPWR 1VDHA 3K59A 3M9NB 1U4BA 3C6UB 3SDEB 4O4GA 2UVUA 1KLNA 1DFDA 2ZM6J 1GMVA 4IO1A 3THTA 1I94F 5HL7Q 2GCFA 2DXDA 2UP1A 5J2QA 5D0EA 1WEXA 4IQMA 4ZN1A 5B0BA 5DDPC 4RNNA 3H59A 8ATCB 1VQ7S 4PUOB 2AEJA 3PCOB 4MKAA 4MIAA 3GYGA 3OXGA 4CNZA 3MEGB 3DRSB 4CI0B 3NNAA 1C1BB 1BGXT 4U8VA 6AT1B 4RW4B 1B7YB 1SJFA 2E9TA 5CCMA 2FIUA 2M0GB 4RNHA 4YB7A 2C2OB 2YWGA 2C2NA 4DSLA 5J2NB 3KJVB 3F41A 2MY7A 4CNYA 2Q43A 2CVEA 5CQGA 3DHWC 1JNRB 1WWHA 1IKYB 4QWAA 1FNOA 4PRFA 4KFBA 5G0RA 4J37A 3BSAA 1QE1A 4FS1A 1NSKL 4LFCF 1L3UA 1FWLA 4B17A 4DCOB 1NBEB 2QG9B 2LDYA 5IC6B 1S1VA 3V4IB 1X4DA 3T5KA 2LQJA 3D3BJ 3DRRB 1R0CB 1RWKB 5CYQB 1TK0A 1Q95G 3OLAA 3BJYA 2RNEA 1S7IA 1KQGB 1LWFB 1ULRA 3DC2A 5IQ6A 3VAKA 3VQTA 5HVGA 1FTCA 3BGLA 4LF4F 1X8DA 3T1HJ 1JWWA 3MPYA 5KOXA 4USIA 2MQ8A 2V34A 3MM9A 2JDJA 2PA3A 1NU4A 4FS2A 2MZTA 1EJ7L 3RBXA 4U7CA 4DL2A 1DRZA 2YBVA 2QTWA 2ATLA 4ZIWA 4I68A 4B9NA 3ET6A 1HQUA 1R8PA 4X4VA 2CRLA 3VVUA 4M5LA 5H9FJ 5HBMB 2O5DA 2I8EA 2J7WA 2I9SA 1SH2A 5ETRA 2BM0A 5GAHU 2GIFA 4M8LA 2XY7A 5HJYA 3OHAA 3KMQA 5HO4A 4DQRA 1K44A 3N5FA 2G2YA 4NLVA 4DQQA 3DOLB 4FXVA 1JJCB 5IWAF 3ETMA 2DEIA 2D7SA 1F5CA 5H9FK 1EARA 2O1PA 1C4AA 1RCXB 4H4KC 2OPSB 2ZC4A 1BY9A 3NCRA 3QRQA 4AD6A 4QYRA 2PSZA 1RAOA 3IGVA 4E0DA 3W1YC 3R5GA 3HKWA 3LO3A 4YR2A 4Z7CA 4CLLA 3BGOP 5GADI 2V5HG 2FJAB 4QPXA 3CMQA 4WYWA 4LIWA 4TY9A 2FZKB 4UUWA 4B3MF 1CJVB 1HBUB 3PHEA 3MR5A 3R1HA 2CZ4A 2F4FA 2C1EB 4PUOA 4RKUC 4NL5A 2QEXS 4UQTA 1MN7A 1R43A 4JOUA 1FRMA 2R8HA 4N77A 3RUBL 2RAQA 3MEGA 1UVJA 1FK9B 3IBCB 1T9UA 4WKYA 3SQOP 1C1BA 2DTJA 3OTDA 1RAHB 5A8RB 2H54B 4WIIA 4RW4A 4IOCQ 3I87A 1HFEL 4DPOA 5LSOA 2QLBB 2MDAA 3OLBA 5CCLA 1URNA 3DNCA 3KJVA 5CA5A 4EWTA 3DRPB 5D6GA 3GILA 2M3DA 2V63A 3H5UA 5IS2A 4P52A 2XGQA 2AX1A 5AXNA 1IKYA 4IUFA 2QZ8A 1QVFR 2YNFB 5HQLA 3F44A 2MTLA 5E3RA 4BDPA 4HL9A 1KQFB 3M8ZA 1RXOB 1VRTB 1R27B 2BABA 1FJ7A 4LSZB 5LMUJ 2WOMB 1O51A 5EUHA 2BACA 4ED8A 1RHRB 2E7WA 3R8YA 4DX8H 2PMHA 3M4XA 3V4IA 2DR5A 2G0IA 2CUYA 5LMNJ 3MAHA 3DRRA 5CYQA 4GO7X 1B0PA 5KG6A 2JFKA 2HNYB 4DOZA 3L3CA 2IM2A 2B7CB 3RTVA 4K4TA 3HMJG 1LWFA 4NLYA 1N34F 4USHA 2ZNZA 2VC1A 4ECWA 1I6JA 2MQOA 2H4YB 1RJJA 1UEVA 1LFPA 1PBUA 4DSEA 3C3LA 2VPZB 1B7FA 2ZE2B 4QU7A 3QQCD 2B3TB 1UVNA 1JLGB 3FEXB 4KBIA 5KTQA 4EBEA 4RW7B 2X51A 4O4RA 1FI4A 1D9DA 2PEBA 2J7UA 3BM7A 4EO6A 1GTHA 2OUGA 1BLUA 2ZJRQ 2VD3A 2EFQA 3I9ZA 5HBMA 4NXMF 3HP6A 2P5VA 1SBRA 4EZ9A 4DV0J 1FRHA 4JI4F 3QRPA 1RTJB 5AJ3F 2V2KA 1HKAA 3PIPQ 5C2CA 3CJKB 1VMBA 3RB3A 3IS9B 3CJQA 2XM3A 3T5LA 4PWWA 4KE5A 3DOLA 4CLTA 2B9EA 1QUPA 1AUSL 1X5TA 1IKXB 1VRQC 2XB2D 3T6JA 2V4QA 4O3NA 2AX0A 1JLFB 1I1GA 3D6TB 2OPSA 1NSQA 2GJ2A 2AKWB 1HA1A 2B51A 1FXLA 2QL9B 3A3PB 2HWIA 1ROFA 1QSLA 4JI6J 2FJBB 2BM1A 2IA6A 4M63A 1YJWS 2N3OA 3ITHB 2V4JB 2NXUA 3M8PB 3DLJA 2B43A 2MQLA 2HQFA 4FF2A 4ZVHA 1CJVA 3SSRA 4ELTA 1HBUA 3SYZA 3WC2A 2BRKA 4DV5J 4M1KA 2M8HA 3CDAA 4PR6A 5HATA 3DYAA 3TARA 4AUKA 3X1LB 3U1LA 3A4TA 1KONA 3W5XA 4ZPDA 3HJVA 1FK9A 5HI7A 1OMSA 3TQEA 2AJ0A 5A8RA 4RPFA 4M5DB 3GWCA 2Y3YA 3TUPA 2GIRA 2C3PA 3ZNJ1 3UDCA 3DRXA 2HQCA 5L1IA 3HVWA 3DRPA 2GVZB 4UZCA 3KUEA 1FNMA 2YNFA 3MPDA 3KUHA 1HLWA 1H98A 4B3SF 2KI2A 4EFAC 4WU2A 2Z57B 5J2MA 1IWAA 3NMAA 3M2RA 3Q2SC 4MMOA 2V0NA 2V8HA 2VOPA 4PQAA 4ID8A 1AFJA 3IC1A 2XHWA 5HLFA 3CGIA 4P7TA 4NLOA 2CQ1A 4NXNJ 3CD6S 1S6QB 1WNEA 2HNYA 2JWNA 2MSSA 5DO2A 4A8OA 2WTFA 2L41A 5KFLA 1FDBA 1VFJA 2C3OA 6FD1A 1RT3B 2F8HA 3AOAA 3NAIA 2Y1JA 4X4TA 2VU5A 4DV3J 2IRXA 4OYMA 3DU6A 2X1AA 2ZE2A 9ATCB 4QWCA 2LECA 3N4WA 4RU2A 1JLGA 1SPBP 1REVA 4GVBA 3NCPA 4URSA 4CIOA 1IBLF 3Q8SB 4FF4A 1PAUB 4FZVA 1HIYA 1SH3A 1JJ4A 4F3MA 5F8LA 2C2KB 3LUYA 1R8CA 1X5OA 3HFVA 3KUGA 2RU9A 3BKFA 2W9BB 1ZS6A 2EBEA 5I42B 2FC8A 2E5IA 2YNIB 4XK8C 1S77D 1J5EF 2ZFHA 3ZXWA 2QLXA 2FHOB 5L39A 3VAGA 1C1CA 4URGA 2XMTA 1NKCA 1VQSA 1GXTA 4QIGA 4IRDA 4Q7AA 4C2MA 4P2MA 1JB0C 3IS9A 2MQNA 4B9SA 3S1TA 3J7AN 2DGTA 1RAEB 2RKIB 5KFMA 1NHVA 4HTIA 2A2CA 2JHEA 4NZ7A 2NSBA 4ZPBA 2DGXA 1IKXA 4J90A 1YG0A 4B9TA 1ZA2B 2W01A 1JLFA 1NM2A 2OKQA 2DH8A 2W1BA 2DRBA 4RUAA 4F3QA 2ZNYA 4YR0A 2EXUA 4U7UK 5E3QA 1UW9A 1S79A 5EWGA 3ITHA 3M8PA 3IG1B 2D74B 2MKYA 3TZXA 3ZTOA 2ALYB 2OPQB 5C2GA 4Y2KA 3Q86A 1WDTA 1EKSA 2DT9A 3NEKA 1N8RT 2AGQA 1KVIA 2DCUB 5CAAA 4OI0A 2LQ5A 3I96A 1DTQB 4NA1A 4O3QA 4YB5A 3GZ7A 1ZAXA 3JQMA 3ADAC 2C3YA 2DR7A 4C8YA 1R89A 2KN4A 1RKIA 2RILA 1XMOF 2I0XA 2DNNA 2UUBJ 4WFXA 1SUQA 3KG1A 3VCDA 4OZJA 4M5DA 2YKNB 1N5TA 1X9SA 4JYAJ 2FHJA 3PYDA 3FZ2A 2ZDOA 3HX9A 2WSCC 2ZM6F 2IJRA 1D09B 1FRLA 1M5KC 2OI2A 3RBEA 3W2WA 3SZ2A 3R7SB 3T5HA 2DH7A 2VV5A 1TUVA 1RWXB 1T05B 4OYBA 1ZPWX 1K0VA 4OIXA 2AZ3A 2AJFE 4K59A 4X84A 2QLFB 2ABYA 1T9TA 1Q0NA 3BR9A 2JVOA 2WSFC 1NDLA 2Y1LB 1Q5VA 2WONB 1ZPVA 3LP0B 4WJBA 1S1UB 1FKAF 5L8RC 2PFFB 4TKTA 3P45B 3IAS9 2PC6A 3GQCA 2PIIA 5FLXY 4O44A 1LKZA 4YQWA 4KR0B 1S6QA 4CM0A 3W9JA 3I5BA 4EUVA 2X7IA 2E1MC 1BHNA 1H74A 4YB6A 1GFWB 1PYOB 3H7HB 2WHOA 3Q2TC 4WWSA 2P6TA 2KT2A 1WJ9A 2MHNA 4OX9J 3TJAA 3QZ8A 1RLDA 4CH0S 1UW4A 4V19X 3IBFB 4WZMA 4OZNA 4NLGA 2BJ7A 2ZH2A 2XCAA 1ZA1B 5DM6Q 3A8EA 4DV1J 5EGYA 3RB6A 4AQYJ 3TX0A 4ER8A 5KFSA 1IBCB 2HGMA 4O3OA 5I42A 1TTHB 2N7CA 2V8GA 3KFWX 3QT8A 2KXNB 2YNIA 1HYSB 4K4WA 4EYIB 2Q66A 3TVYA 2D41A 3ZTQA 1X60A 3OD2A 1K1SA 1Y7PA 3DDIA 3VAMA 1WHWA 2BA9A 3AB2B 1Z2LA 3T1HF 4WIQA 5B0EA 2JEIA 2RKIA 1S1XB 1PYTA 3QBCA 5ETQA 4ED1A 1F9FA 4KHPJ 4E8UA 1U0SA 3BGUA 4HLBA 4NLDA 1D9AA 4ZS6A 4H4MA 2HVIA 1KLMA 3MTKA 2B8QA 1HMVB 1G3OA 5SZTA 1VK8A 5ETMA 4TNOA 2JSXA 1D0EA 2UXCJ 1MLAA 4R0JA 3UD4P 4B9LA 1KVKA 4ALZA 4OX7A 1SC4B 3IG1A 3ZZOA 4A8QA 1XMBA 1KKHA 3D1HA 2OPQA 3LGMA 1W2BR 3TEHB 3NNCA 5A0YB 3EYZA 4C8NA 2WZ1A 2ADCA 3U1MA 1RTHA 1JK9B 3GCXP 4FYWB 1X9WA 5T7LA 3EGWB 1RB0A 1LK5A 3NS5A 3GJTB 3MPVA 4ED0A 4ID5B 2KHCA 1UFKA 2CQHA 4HH1A 4CLYA 1S0VA 4O0IA 5JVHQ 4A8MP 5KG3A 2W7AA 3G6YA 4KV8B 4ZLNA 1IQZA 1YJVA 3TANA 2YKNA 4UOFA 3BF4A 4C0HA 3GJRB 4M5NA 4RWXA 1ZOTA 4FXWA
chains in the Genus database with same CATH topology
3JQJA 4PYAA 1EKRA 2OHDA 4PYDA 4FDFA 3JQKA 2EEYA 1EKSA 3JQMA 2EKNA 2IIHA 2IDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQJ A;  4PYA A;  1EKR A;  2OHD A;  4PYD A;  4FDF A;  3JQK A;  2EEY A;  1EKS A;  3JQM A;  2EKN A;  2IIH A;  2IDE A; 
#chains in the Genus database with same CATH topology
 4BWM A;  4UF4 A;  1U1K A;  3FQL A;  4DX7 A;  1VQY A;  1VK3 A;  3FQK A;  2UV8 G;  1T05 A;  3BZQ A;  3JQJ A;  3PEJ A;  2HK3 A;  1VHI A;  1IBK F;  5HMZ A;  2V68 A;  5LM7 E;  1WTB A;  4MK7 A;  1V9O A;  5A8W B;  4F26 A;  2GO8 A;  3LP0 A;  2QYC A;  3W65 A;  2HHT A;  4KO0 A;  4QIF A;  3LW5 C;  1WHX A;  1DAX A;  4QYZ J;  4DHV A;  3CDU A;  3DGV A;  2XZT B;  2AYB A;  1ZZF A;  3G4S S;  1MWY A;  3MUR P;  3VF0 B;  3BBF A;  2OP5 A;  3U1N A;  3R5J B;  5C25 B;  4A8X A;  3CC7 S;  3EMT A;  1GTE A;  2M4M A;  4GVL A;  1GX6 A;  1YX2 A;  1T02 A;  4DPY A;  2VF3 A;  1JLA B;  4ZCM A;  4BHQ A;  2HBR B;  2YNH B;  2N4C A;  2HHQ A;  1YIJ S;  1TKD A;  4TQS A;  4PAB A;  2EC2 A;  4ZHR B;  2FHJ D;  4QYZ K;  2HFU A;  5IC4 B;  4LJM A;  2VJU A;  2ZWO A;  1YI2 S;  4NWB A;  1RT1 B;  1S9E B;  2RUG A;  2YQ0 A;  1APS A;  2P2C B;  4ZCK A;  5LMU F;  3KLG B;  3PX6 A;  5F8M A;  5DLF A;  3VWS A;  4QBU A;  4F04 B;  5KT4 A;  5LMN F;  1WDD A;  2LXU A;  5KFH A;  4ZVQ B;  3FEZ A;  1HYS A;  2CQ4 A;  4DQI A;  4U6P A;  2PD1 A;  2ZZN A;  4KIA A;  3POT B;  1TL7 B;  1U1O A;  1T03 B;  2MQM A;  2DB1 A;  1RT2 A;  3TAQ A;  4J9Q A;  2WAQ D;  1SKU B;  4LR7 A;  4QWD A;  4M5H A;  3D28 A;  1S1X A;  2ROE A;  2UZA A;  4I67 A;  3TVK A;  1RAA B;  1S76 D;  3R5B A;  1DLO A;  1BQM B;  1F9H A;  3CB4 A;  4QPT A;  3J81 Y;  5HP1 A;  2VA2 A;  1HMV A;  5LOQ A;  1TFW A;  5CYM B;  5DQH A;  4LFA J;  3GSD A;  3HJF A;  2BE2 B;  2Y9H A;  1YSJ A;  3EXY A;  3DLE B;  3L4B C;  2N4D A;  4DV0 F;  2FB0 A;  3BKT A;  3UNY A;  2LP4 A;  5C24 B;  4X4U A;  1FXR A;  3T41 A;  5LXY A;  5A0Y A;  3HSJ A;  3JSM B;  3MCM A;  3DLK A;  3TAM B;  2AGO A;  1DTT A;  2RIJ A;  4L3N A;  2DH9 A;  4HHJ A;  4K50 A;  2YH0 A;  3R27 A;  2G2O A;  2AW0 A;  3SCL E;  4FPI A;  3EIC A;  1M1H A;  1LWE A;  2MY8 A;  4JI8 J;  3HPO A;  3ZC4 A;  5HVF A;  2ZEJ A;  4NI2 B;  4ID5 A;  2DHH A;  4U7U D;  3LH2 S;  1S0M A;  3PY8 A;  1CS4 B;  2A1B A;  4KV8 A;  4Y00 A;  5RUB A;  3UN3 A;  2HGL A;  1TL4 A;  3V6D B;  4JI6 F;  2J0Q D;  1PC4 A;  1YJ7 A;  3TEG A;  4I2Q A;  3UWT A;  3G86 A;  2A18 A;  2AEF A;  3LAK A;  3IRX B;  5K9F A;  4QIE A;  4Y3C A;  2XMA A;  2H5I B;  5DGB A;  3QT7 A;  4DV5 F;  4U96 A;  2BW2 A;  1W2I A;  2V2Q A;  2K8G A;  1ZZN A;  5HMY A;  1YHQ S;  3BQ1 A;  2RRN A;  3LP2 A;  1E6Y B;  4CO0 A;  4MJK A;  1RT7 B;  1HBO A;  5A8W A;  2CQD A;  5KOW A;  4HR2 A;  3MXH P;  2R7Q A;  2BZ2 A;  5K14 A;  1S10 A;  3M8R A;  2CAJ A;  2C2R A;  1J2V A;  4Y34 A;  3BBB A;  1LW2 B;  4UW2 A;  2JLF A;  3CJS A;  2HW3 A;  1RTI B;  3SCK E;  3K5N A;  5C25 A;  4DR4 J;  4DPU A;  2E5G A;  3OFE A;  1N54 B;  2YWK A;  3O44 A;  2J8S A;  3PAC A;  1A6L A;  3M05 A;  4M5J A;  4ANE A;  1R0A B;  3HT0 A;  3AJD A;  3MZI A;  3FMW A;  4KPC A;  4MK9 A;  1R8H A;  1R8B A;  4ZHR A;  2B8P A;  1KTV A;  4Q5V A;  3EGN A;  5IV4 A;  4PG7 A;  4TY8 A;  2FVR A;  1BMQ B;  2HRY A;  1HNW J;  1F2G A;  1RT1 A;  1OWX A;  1S9E A;  4N8O A;  3T6B A;  3KLG A;  3SIP B;  5K8M A;  2V67 A;  1MWZ A;  5L38 A;  2J0X A;  4NOH A;  5THW A;  3M8S A;  3SSS A;  5F41 A;  4NXN F;  3M6V A;  3VHQ A;  2BJE A;  4BS2 A;  1B3T A;  3POT A;  1TL7 A;  4K0K J;  5AT1 B;  1JX4 A;  2JRS A;  1WEZ A;  4OYW A;  3CD7 A;  1H2T Z;  4DV3 F;  4MIW A;  1SVD A;  1UAW A;  2R8G A;  1YJU A;  5DG9 A;  4KB7 A;  3DXS X;  5GAE I;  4NYZ A;  2R7R A;  1FRJ A;  2EFP A;  3GON A;  1BQM A;  2UV8 A;  2O01 C;  2QSW A;  4HDG A;  1C4C A;  3ETO A;  4LVN P;  3A8K A;  1QSY A;  5CYM A;  3CME S;  3OVS A;  2OMO A;  1JXE A;  2BE2 A;  4DSK A;  2V8P A;  1VOM A;  4DSJ A;  3BGF A;  1XC9 A;  3PYF A;  1SC1 B;  2GMJ A;  5IXU A;  3J81 U;  3RAM A;  4RJV A;  5C24 A;  4DN0 A;  2HGN A;  1N4L A;  2J6T A;  2NZ4 A;  2ZVS A;  3JSM A;  4EGL A;  1NHU A;  1M0S A;  4HH0 A;  4IH7 A;  3TAM A;  4LSN B;  2C2M B;  5AE2 A;  4KSE B;  4K2J A;  1UVM A;  5E0O A;  4DR3 J;  3WX4 A;  4J9O A;  3FRY A;  4USM A;  4NI2 A;  1TQL A;  3G82 A;  1WEL A;  2DIV A;  3R1L A;  3G9C A;  3T5J A;  3NKY A;  3PW0 A;  2EW9 A;  1CS4 A;  3JB9 k;  3TUI C;  4OZ0 A;  4OQJ A;  5C7P A;  3OTB A;  3T19 A;  1PKU A;  4P71 A;  4GKJ J;  5K8N A;  4IKA A;  3KLE B;  4ITS A;  1VI7 A;  4LRD A;  2DHG A;  2R7T A;  2GQQ A;  4F2R A;  2IVF B;  5KFV A;  2G2Z A;  4AT1 B;  3TWZ A;  1QSS A;  4BCA A;  1ZYQ A;  1N5S A;  3SFU A;  1E6Y A;  2MST A;  1RT7 A;  3K57 A;  3ZZU A;  2L9W A;  1TL3 B;  3PDN A;  3T1A A;  3OXL A;  3CIZ A;  5IM0 B;  1RCO B;  4X66 J;  2BX6 A;  4NZ0 A;  2UUB F;  1CQN A;  2WCX A;  3CO0 P;  2HFV A;  2N3L A;  2ZH3 A;  3IWN C;  2NQP A;  4GMK A;  2Q6B A;  4YN3 B;  1RTI A;  1KS2 A;  4OJH A;  3S6E A;  1P1T A;  2O67 A;  2FQQ B;  1DHM A;  1MU2 B;  2QLW A;  5ETP A;  2EFO A;  5E41 A;  1U47 A;  3AJ2 A;  1R0A A;  2QA4 G;  4W98 A;  1MMD A;  3JSB A;  2IM1 A;  2QA2 A;  2IC3 B;  2RQK A;  3CDB A;  2J5A A;  4U67 Q;  4ECR A;  4IDK B;  5KFN A;  3Q8P B;  3P8B B;  5LSR A;  5MLC V;  4DR5 J;  4ILL A;  4WXO A;  2AMC B;  2GVD A;  1NB2 A;  1S4F A;  2ZH6 A;  3CT9 A;  1RYR A;  3QAU A;  2GHV C;  1EIY B;  3PJW A;  3EDR B;  2YX1 A;  5BJR A;  2J76 E;  3GFX A;  3BGR B;  2CNK B;  4KY3 A;  1KVJ A;  3K58 A;  1FKP B;  4PXC A;  4A8W A;  3L7U A;  1XR5 A;  5HVH A;  2D3Z A;  4JV0 A;  4RUB A;  2JLE A;  1FRK A;  3UE2 A;  4ZPC A;  4MH8 A;  4OX9 F;  4RBU A;  3NG8 A;  4MKB A;  3L7O A;  2AD9 A;  1EAY C;  1T3O A;  4NZ6 A;  2JNJ A;  2Z2Y B;  2Y0B B;  1T9V A;  4DV1 F;  3NCQ A;  1LV5 A;  4AQY F;  2XBP A;  3C14 B;  1DAR A;  4WE1 B;  4OHW A;  5SUH A;  1R31 A;  3CMA S;  2VUG A;  2YWH A;  5I3U B;  1GMU A;  2OAU A;  1QVG R;  2HNZ B;  3I5C A;  4ZVF A;  1TK5 A;  2OLW A;  4CLW A;  1HHQ A;  2HWH A;  4LSN A;  3GSI A;  3JYT B;  2NLW A;  1WC4 A;  2JLG A;  2AJ4 A;  3D9B A;  4V19 J;  1DQA A;  3R6G B;  4KHP F;  5K8O A;  5U47 A;  4K8R A;  3NGT A;  3H2L A;  2BQU A;  1VQ8 S;  4TYB A;  4K4U A;  2HHH J;  1H7W A;  2YKP A;  4MFB A;  3AOB A;  1HNX J;  1BQN B;  2UXC F;  4I0W A;  5D0R A;  2D9P A;  3W7B A;  5KFF A;  3KLE A;  1IR2 A;  5F8H A;  8AT1 B;  2VB6 A;  2XWX A;  2MZJ A;  2JEJ A;  5D77 A;  2CQ2 A;  1HBN A;  5F9L A;  4X65 J;  2RRB A;  3PW2 A;  1RT6 A;  2R3V A;  3SCJ E;  1NCL A;  3CSK A;  3PNI A;  2BRL A;  2E5J A;  3IN5 A;  1ZET A;  2FJV A;  4PPD A;  2DHS A;  3THP A;  2MJN A;  3LAM A;  3SQG A;  1PJ7 A;  2XEX A;  1TL3 A;  2WB4 A;  4LF5 J;  5IM0 A;  4QCL A;  1VCT A;  4HVZ A;  1S9F A;  1MN9 A;  3GR1 A;  2PFD A;  2D3O 1;  2FDN A;  1T9X A;  5EWF A;  1U49 A;  2BJ3 A;  2L48 A;  5JJB A;  2X3D A;  1L3S A;  4UZB A;  3K5L A;  2QIF A;  4V1A k;  1V3R A;  3FSX A;  3CCW A;  2CQC A;  3OJU A;  3H4D A;  4PPZ A;  4J9K A;  1S99 A;  2RF2 B;  3OBI A;  3BBC A;  2JC0 A;  1ZM3 A;  1K1Q A;  1MU2 A;  3AD8 C;  2DNH A;  1NJY A;  2C2E A;  1JLQ A;  1CVJ A;  3KXD A;  3H20 A;  2IY5 B;  4XIU A;  2DNO A;  1NXI A;  2IC3 A;  5LL6 d;  4IDK A;  3HDS A;  2AYE A;  2IM0 A;  4K4Y A;  1RQ0 A;  1F5B A;  1JJ2 R;  3DU5 A;  2ZOM A;  1K0T A;  4E2F B;  3SSQ A;  1HL6 A;  4F2S A;  1OYE A;  4OJG A;  1UVK A;  1N0U A;  5HQM A;  4K4V A;  4JI2 J;  4NLW A;  4U8Y A;  4YME A;  1MMN A;  4NCG A;  3BGR A;  1H2U X;  4DV2 J;  2VG5 B;  2ZKU A;  1FKP A;  4WFA Q;  3DLG B;  1UJ5 A;  3OXF A;  1NND A;  1Q8I A;  1R8A A;  2F3J A;  7AT1 B;  2H65 B;  2QMX A;  2MYF A;  4OI3 A;  3MM8 B;  2JFD A;  2IA0 A;  1HAR A;  2CPZ A;  3ZNU A;  2VL1 A;  2U1A A;  2DGU A;  4K2X A;  4DL3 A;  2M7S A;  3OL7 A;  3I4H X;  2GHP A;  3X3U A;  4WE1 A;  4LF2 A;  1ACM B;  2HPU A;  2LA6 A;  2A6O A;  1SJQ A;  2PT0 A;  2Z4P A;  2CPD A;  4TXS A;  2CQP A;  1EET B;  5I3U A;  1PCA A;  4USV A;  2VBX A;  2HNZ A;  4DFK A;  1OQ3 A;  5IT0 A;  2E1P A;  4X64 F;  4C8Z A;  2VC0 A;  3D1Q A;  4FYV B;  4J91 A;  2ZD1 A;  3JYT A;  3TZZ A;  3I5A A;  3EPG A;  4P73 A;  2HVZ A;  2AGP A;  4OHY A;  2DNP A;  1ICE B;  4J9R A;  2OSQ A;  4LFA F;  2P9E A;  1X4G A;  4ZCL A;  4DR1 J;  1EP4 B;  3HHN B;  2DJW A;  3TJ9 A;  2V9W A;  3TZY A;  4LSL A;  3R9L A;  1FNX H;  4ICL B;  1S48 A;  5FII A;  5KFA A;  2PMZ D;  1L3K A;  2EWH A;  2VQE F;  3TX8 A;  1VLO A;  4C11 B;  1PJ6 A;  2W9C B;  4K5S A;  1YKW A;  3HI9 A;  1WKJ A;  4DPW A;  3CDW A;  1XN9 A;  1FJC A;  4C98 A;  4YB1 P;  4JI8 F;  1S9G B;  1YGY A;  4HAC B;  3A13 A;  3E2E A;  3I31 A;  1KD1 T;  1ZM9 A;  2VFR A;  3UD5 A;  2NXE A;  1TV6 B;  1W7W A;  4OYX A;  1N32 J;  3E3X A;  3J80 Y;  4DDF A;  3QT6 A;  3JSR A;  1E6V B;  1EX8 A;  3M8W A;  3WIU A;  3QGI A;  5GMK a;  2KJV A;  2EBG A;  2LQ9 A;  3EVM A;  2IJF A;  4ZA1 A;  2XI2 A;  4NYO A;  5DJB A;  5DS7 A;  5BXI A;  2DRD A;  3FBC A;  1BC6 A;  3VAH A;  3FRZ A;  4U95 A;  1QUV A;  4ELU A;  5KFW A;  5EDW A;  3DGP B;  1YZ7 A;  1HR0 F;  3RR8 A;  4RNO A;  1D9F A;  2ALZ A;  1CPZ A;  2HIQ A;  4FN5 A;  1MWQ A;  2ZHO A;  3V5R A;  2IAJ A;  2QMW A;  5E3A A;  2R9L A;  1EB0 A;  4OYA A;  4C48 A;  1QAI A;  4DR4 F;  2VG5 A;  3GV7 B;  3VGT A;  3DLG A;  5J2Q B;  2LFV A;  2R8I A;  3OL9 A;  2GA7 A;  3VVT A;  4RLE A;  5D4L A;  1RGV A;  2ZH7 A;  3MED A;  4NLX A;  1HNW F;  1Q78 A;  3KLF B;  2FLP A;  3W63 A;  4Z37 A;  1WC3 A;  2VON A;  2FVP A;  3JTN A;  2BKO A;  1TK8 A;  5B0D A;  2OEK A;  4RL1 A;  3FBF A;  4IYQ A;  1EET A;  1U0H B;  4A4J A;  1GMW A;  4KGX B;  2DPJ A;  3D6F B;  2Z2L A;  4DPT A;  4I56 A;  4K0K F;  2M2B A;  2R42 A;  3QO9 B;  4Q44 A;  1R7I A;  2E7V A;  3FSY A;  1OY9 A;  4UY8 5;  1OPI A;  4O23 A;  2QGF B;  3MM6 A;  3PXG a;  5A6W A;  1UL3 A;  1U7L A;  4NLR A;  1DY3 A;  4F4K A;  2R7U A;  5KFR A;  1H73 A;  1S57 A;  3MUT P;  3DOM A;  4DLG A;  3O5T B;  2CPX A;  4J9M A;  1S1V B;  2HQG A;  4WCE Q;  3OVB A;  2MPU A;  1T3N A;  1N52 B;  4Q2M A;  1EP4 A;  3FK4 A;  3AHP A;  1AXQ A;  4DF4 A;  5EX3 A;  2J8A A;  1YTY A;  3O8W A;  1TKZ B;  2ZH1 A;  1Z1Z A;  1IKV B;  3FBE A;  2WW8 A;  5I3P A;  1Z2Z A;  4B3T J;  3MM9 B;  4C11 A;  2CQ0 A;  3HK2 A;  2XI3 A;  1RWU A;  3W64 A;  2NUU G;  4DR3 F;  5GVQ A;  5F8G A;  4OLO A;  4J9P A;  3PW7 A;  4RZR A;  1S9G A;  3QIP A;  4HAC A;  1RAI B;  4NEZ A;  2G1H A;  3TA1 A;  2PA8 D;  2KYX A;  1SJ3 P;  1KN6 A;  1N33 J;  1B4S A;  3OTC A;  1TV6 A;  1U1P A;  2GX8 A;  1SKS A;  3NOC A;  4GKJ F;  3AQO A;  1JLC A;  4AXJ A;  1E6V A;  3KLH B;  4DX6 A;  2Q3P A;  1FXD A;  4AFF A;  4NPO A;  3TVZ A;  3ONQ A;  2QT7 A;  4LF9 J;  2Y0S D;  3NNH A;  3BDP A;  5KT6 A;  1NEE A;  4LRE A;  3TJ8 A;  1R0B G;  4CM2 A;  1NZ8 A;  1U2F A;  3J80 U;  1UPM B;  1NPK A;  3H98 A;  3A12 A;  5KFD A;  4ECT A;  2D3U A;  2DHX A;  1WF0 A;  1H2V Z;  4ZVO B;  1OSC A;  1RP5 A;  4X66 F;  3D66 A;  1ARO P;  5DZ6 A;  2OFH X;  3BQ2 A;  3O6Q A;  3ZZ0 A;  1VYA A;  5F8I A;  1KNZ A;  4LQ3 A;  1D8Z A;  2XMW A;  3BYP A;  3IR7 B;  4ZVS B;  2XMM A;  1L5U A;  3EE3 A;  2B56 A;  1A0O B;  1LWC B;  2CDR B;  3BB5 A;  3EGZ A;  1LW0 B;  5JVG Q;  1HNI A;  1PAE X;  2OTJ S;  2ZBR A;  2FJE B;  3UCZ P;  3FJ2 A;  3LP1 B;  1FX4 A;  4YR3 A;  1Q79 A;  1TR0 A;  2JOQ A;  5BR8 J;  2VIH A;  4L3K A;  2MXY A;  1RU1 A;  3PFE A;  3KLF A;  2ZZT A;  1VC0 A;  1Y4Z B;  2DR8 A;  2H5J B;  4OJ3 A;  4YEA A;  4OHZ A;  4NLT A;  4O3P A;  4UUX A;  4QR2 A;  2Y1I A;  2OPP B;  3TZW A;  3KNG A;  2VBW A;  3GIJ A;  4PYA A;  4XDD A;  2L08 A;  1U0H A;  3B54 A;  1G6B A;  5HMW A;  3FZB A;  3BSO A;  1TVR B;  2ATC B;  3MUV P;  3HCX A;  3QO9 A;  3EVO A;  4DL4 A;  3H25 A;  4FPR A;  3GE9 A;  2HZC A;  4TU9 A;  3AB4 B;  1AW0 A;  2HVE A;  1DUR A;  1X4A A;  5KFK A;  1XNQ J;  2XUL A;  3KG0 A;  3UN2 A;  3PIO Q;  3Q8Q B;  3L7P A;  2KVQ E;  4FBU A;  4Z7Y A;  2W2M P;  4UOC A;  3K5P A;  1B0T A;  1LFW A;  3MR3 A;  5ETN A;  2E1A A;  2MKS A;  3I4P A;  2LQB A;  1YIT S;  4ILR A;  4DUZ J;  2GAH C;  2JX2 A;  1SCJ B;  1N6Q B;  2RS2 A;  2MZ1 A;  1FCA A;  3WIV A;  2YNG B;  3DDN A;  4F4X A;  1XJW B;  2DNZ A;  2QMU B;  3V4M A;  1TKZ A;  2E5H A;  1UZH A;  1IKV A;  4S0M A;  2JVR A;  2DKO B;  3SI8 A;  4ZLL A;  1N5V A;  1IWG A;  1RBL A;  4HT7 A;  4DU7 A;  4ETZ A;  3SV3 A;  2W25 A;  3BEG B;  1GMW D;  3FUY A;  4Q0B B;  4EMD A;  2HHH F;  1XIQ A;  4F36 A;  5F3Z A;  3QT5 A;  5B08 A;  2HQD A;  1RZM A;  3S8S A;  1HNX F;  3KNA A;  4ED6 A;  4TVA B;  1V6H A;  1OPZ A;  3UDV A;  3B8H A;  3KLH A;  3TUJ C;  2HLU A;  1GH8 A;  2DGV A;  4WZQ A;  1U6F A;  4FYD A;  1UFW A;  1VQ9 S;  4X65 F;  1GXL A;  1L3V A;  2FJD B;  3NP5 A;  4PCQ A;  5F3T A;  4DFM A;  3OSN A;  1RBA A;  2UVV A;  4ZCI A;  2W2Q P;  4PYD A;  5A2Q U;  3CTR A;  3OJS A;  3FFI B;  1HW8 A;  5DRK A;  1HBM B;  3QWU A;  2X1F A;  4LF5 F;  3MAQ A;  1HW9 A;  2KG1 A;  1S12 A;  2LXI A;  4F8R A;  1R3N A;  4QZV B;  1DQ8 A;  4P72 A;  1HHS A;  1NKB A;  4PWD A;  3B4M A;  4ZPT R;  2O66 A;  2VG7 B;  3EGV A;  1PYS B;  1LWC A;  5CD4 H;  1FFG B;  2YKO A;  1LW0 A;  1Q7L B;  1KR4 A;  5L46 A;  3BR8 A;  1EHW A;  2LQ8 A;  2VFS A;  2H4W B;  3AT1 B;  3IBW A;  3DYA B;  4Q8F A;  4DR2 J;  3LP1 A;  4DUY J;  3D4J A;  3WC0 A;  5KG1 A;  2XSJ B;  3G2X A;  5FD1 A;  1RAJ A;  2FC9 A;  1KOH A;  1KP6 A;  4LRF A;  3UW1 A;  3MEE B;  1RWO B;  2FPH X;  4ZMM A;  3SXL A;  1Y00 A;  3JQK A;  4YOE A;  1YRT A;  2OPP A;  2Z8Q A;  3K7R A;  4C4W A;  2W2P P;  2LLZ A;  5B0A A;  4JI2 F;  2UU9 J;  4HKQ A;  4OV1 A;  4DG1 A;  3AH6 A;  1TVR A;  4DV2 F;  5AXM A;  1NHK L;  4DLE A;  2Q79 A;  3UI3 A;  2RQ4 A;  4MKV A;  1VQO S;  2IBO A;  3CCU S;  2HMI B;  1Q82 T;  5L9X A;  1VRU A;  3KDN A;  1OO0 B;  2YVS A;  1FD8 A;  2OO4 A;  4OZL A;  1V5V A;  2B4V A;  1SC6 A;  1NKE A;  5J2M B;  1Y3K A;  3M2R B;  1XTZ A;  3NXZ A;  1IN0 A;  2D3O R;  3KLI B;  4QU6 A;  3FBB A;  3CCL S;  2CG4 A;  5KFJ A;  3H2V E;  3UR3 C;  3G8T A;  5HLF B;  1TP7 A;  3SFG A;  3ZZR A;  3W5Z A;  1WI8 A;  2M5Y A;  5HQ8 A;  4OZ1 A;  4P10 A;  3IMQ J;  1N6Q A;  4RW8 B;  1WOP A;  1FEH A;  1HWK A;  1NLK L;  3H40 A;  2XMV A;  2YNG A;  1W25 A;  1X5S A;  5ETS A;  3M1V B;  2XO6 A;  3U27 A;  3HUL A;  1RT5 B;  1PIL A;  4EZ6 A;  3OFF A;  2V2Z A;  2Q6C A;  4L72 B;  2QJ3 A;  4KAI A;  2KRB A;  4A46 A;  1REV B;  2DBB A;  2QFJ A;  3P5T L;  4ECY A;  4GVB B;  3H5Y A;  4IG0 B;  1N88 A;  3DLH A;  3Q8V A;  3PX0 A;  3KHR A;  4Q0B A;  4UQG A;  3FVY A;  4RWW A;  3ENW A;  4I6Y A;  2ZH8 A;  3J7Z 5;  2POK A;  4KTQ A;  3AXK A;  2YXL A;  1FX2 A;  2B5J B;  4DR1 F;  4N76 A;  4ES1 A;  5M2P A;  3VQS A;  4CT9 A;  3D0I E;  3PW4 A;  1FTR A;  3ICL A;  3HZG A;  4Y65 A;  3CC2 S;  1ELO A;  1TKT B;  1C1C B;  1F60 B;  2PN6 A;  2HSE B;  2CQI A;  1Y5L B;  4B3R J;  4JI1 J;  1M5P C;  5CD4 A;  4USK A;  2OTL S;  1VBZ A;  4XTT A;  2J7K A;  3PJX A;  4NRT A;  4QQB A;  3Q83 A;  2MLX A;  2IDL A;  3R5A A;  3IAM 9;  5F0U A;  3C6T B;  3MTJ A;  3NRB A;  3MGJ A;  3M6W A;  3FFI A;  1F1B B;  5IQQ A;  3MM7 B;  1HBM A;  3M2V B;  4EI2 A;  2DGW A;  2AYG A;  2CG8 A;  4G6V B;  3N6M A;  5CXT A;  2RHQ B;  7FD1 A;  5IT9 Y;  4IFY B;  3HXM A;  1VJQ A;  2CJQ A;  2AWZ A;  3FMB A;  4WFZ A;  3US5 A;  4DWI A;  1N32 F;  2D1C A;  1UWB B;  4ECQ A;  5JMN A;  2VG7 A;  2WB1 D;  2RDI A;  1Q5Y A;  3CJT A;  4DV7 J;  3R97 A;  4F7V A;  3KHH A;  1CEZ A;  4N5S A;  2H48 B;  2XY5 A;  2C28 A;  3D68 A;  1IQT A;  5L9N A;  2YKM B;  1N34 J;  2XLK A;  1MG7 A;  3A1Y G;  3CF5 Q;  2XSJ A;  2Z56 B;  1GX5 A;  3GU0 A;  3HSG A;  2Y1R I;  5JXS A;  1U1N A;  5KFQ A;  3MEE A;  2JZ5 A;  2B0G A;  2E5L J;  1SUQ B;  4ZJO A;  4WPA A;  4DCP B;  3F56 A;  2ASL A;  3JSY A;  1IKW B;  4OYZ A;  5AE3 A;  4WP3 A;  5GME A;  1J5O B;  2OD4 A;  4RUH A;  4K7Q A;  4O3R A;  5L1L A;  5EN1 A;  3BYR A;  3OR1 B;  4K4X A;  1HHT P;  1GXU A;  4ECU A;  2XS7 A;  2ZHA A;  2IYG A;  3W2W B;  3BRE A;  4CZC A;  4LFB J;  2EC0 A;  2HMI A;  1XMQ J;  1HWI A;  4R25 A;  2DHA A;  3V6J A;  1JKH B;  1RAG B;  2IYI A;  3CJ0 A;  4JI4 J;  2AZ1 A;  3W66 A;  5AJ3 J;  2CWX A;  1O5J A;  2C42 A;  2KXF A;  5KFT A;  4A8S A;  3RBD A;  3KLI A;  4FNH A;  5HAN A;  4M95 A;  2R7W A;  2ILY A;  3EZ5 A;  3GB0 A;  1NME B;  3GV8 B;  4O44 B;  3D54 A;  3NGD A;  3BH6 B;  4PG5 A;  4Y28 C;  1S6O A;  3CW2 C;  3GPA A;  3I0R A;  4JUZ A;  4RW8 A;  4DQS A;  4Q8E A;  4DZ6 A;  1Q8B A;  3RJM B;  1SL0 A;  3M1V A;  2K7K A;  5D3G B;  1RT5 A;  3FGV A;  1KRP A;  1EZZ B;  3FC9 A;  2DNY A;  1FF2 A;  2PEH A;  4B08 A;  4ED4 A;  2KDO A;  2CPJ A;  1Q8L A;  2MKK A;  3VGS A;  4NLQ A;  4IG0 A;  2MGZ B;  4N8N A;  3L95 X;  2I6W A;  3UCG A;  1TL5 A;  1EQ0 A;  3TA2 A;  3MMC A;  1JLB B;  4IRK A;  3OHB A;  1QAX A;  4WF9 Q;  4Y2C A;  3C16 B;  2B5J A;  3MMB B;  5HRO B;  3GCW P;  4QW9 A;  2HBQ B;  2I1R A;  4X2B A;  5IV3 A;  2EK1 A;  1VBX A;  1TKT A;  3BO4 A;  2KFY A;  2MKJ A;  1N5Q A;  1WD6 A;  1GEH A;  5T14 A;  4TYA A;  1U02 A;  3Q8R B;  3P4U B;  4KHM A;  4CLK A;  4OZ5 A;  4WFB Q;  2W7O A;  4ZLJ A;  1P8G A;  1RWW B;  2A3J A;  1PJ5 A;  4F4W A;  4LR9 A;  2DK2 A;  2YY3 A;  4B3T F;  1YRU A;  1CJK B;  2PGC A;  4KT0 C;  2Z2Z A;  2R8K A;  2W4C A;  3C6T A;  4DCJ B;  3FCV A;  1VLY A;  2BE7 D;  2CQG A;  3MM7 A;  3PRD A;  2ZIT A;  3M2V A;  4H4M B;  1H7X A;  1Z4U A;  2BJD A;  1KLM B;  3R6L B;  1HNZ J;  2FHK A;  1N33 F;  4CO4 A;  1SV5 B;  4IFY A;  1UCN A;  4YUD A;  3PTW A;  3QJP A;  2H51 B;  2DNM A;  2YX7 A;  2KT3 A;  2AV5 A;  2K7J A;  1UWB A;  4LRB A;  3G8Q A;  1HWL A;  4F67 A;  2BJ9 A;  2FLN A;  3W5Y A;  4LQ9 A;  2FYX A;  2VDH A;  4P2X A;  2XZW A;  3NL0 A;  1RTH B;  2XTJ P;  4RNF A;  5IT9 U;  4DL6 A;  3W2V B;  3EUN A;  5T7L B;  2YKM A;  5F8J A;  4JV1 A;  1WHV A;  3BKU A;  1NUE A;  4PXB A;  4MIB A;  2IPO B;  2XQC A;  3J81 j;  5DDQ C;  4LRC A;  1N48 A;  3GLJ A;  2L9D A;  4C0O C;  1TAQ A;  2EG1 A;  2OEM A;  4CRJ A;  5M2U A;  4IH5 A;  1IKW A;  5A6P A;  1J5O A;  4M94 A;  2X1G A;  3OR1 A;  3CE8 A;  3V81 B;  4KJI A;  2HFO A;  5F8N A;  2F7V A;  1S97 A;  4F3O A;  1UET A;  3PV8 A;  2J9E A;  2VKR A;  2AQ4 A;  1JKH A;  4P75 A;  1Y5N B;  5F0W A;  3MR7 A;  3KDO A;  2M88 A;  1MRO A;  4B9U A;  4ZVG A;  1AYE A;  2XNQ A;  3DOK B;  5BR8 F;  4ZPW R;  2GFF A;  1BD6 A;  3G6X A;  2WVE A;  5KAK A;  4DV6 J;  1M5H A;  4OHV A;  4K4Z A;  2DD8 S;  4KO0 B;  3LPE A;  1M5O C;  1ZAW A;  1C0T B;  2JH3 A;  1HWU A;  2DNL A;  2W4D A;  3VGV A;  2APO A;  4JV5 J;  2V8V A;  3MCO A;  3HFZ B;  2H3E B;  1Q81 T;  4IH6 A;  4TLR A;  4G1Q A;  4OHX A;  2NXC A;  1RHM B;  5B0C A;  5D3G A;  2B7B B;  5KFY A;  3H4B A;  2DNQ A;  2ZJP Q;  2ZWP A;  3IRW P;  2B4P A;  3OW2 R;  3I6P A;  1XNQ F;  1Q4R A;  2MGZ A;  1Y0H A;  1OY6 A;  1O0P A;  2NPI A;  4OI6 A;  2B4U A;  4WP9 A;  4ES2 A;  2VPX B;  2CJK A;  5MAO A;  3KWM A;  3A3O B;  1JLB A;  2QFI A;  2QA4 S;  3C16 A;  3WHI A;  5BYR A;  3LA0 A;  3MMB A;  5ETO A;  2DYA A;  5HRO A;  4DUZ F;  3UO0 A;  2HND B;  5AXL A;  2HAI A;  1K9M T;  4F0K A;  1PGZ A;  1KBR A;  1IJE B;  5H9E J;  3CUN A;  4USU A;  2MKC A;  1SIW B;  2ZBC A;  3FNN A;  1RT2 B;  1TMM A;  1BXN A;  3GJS B;  1RKJ A;  1YVF A;  2CJA A;  2A0F B;  1I51 B;  1CJK A;  1U25 A;  2GW8 A;  5IT4 A;  5G4D A;  4CLS A;  1O8B A;  2F8M A;  5DDO C;  4L76 A;  1DLO B;  2MQP A;  4FBT A;  3VZI A;  3FCW A;  1VQ6 S;  5H9E K;  4CO3 A;  1QDU B;  5HP1 B;  4TN2 A;  2XYP B;  2UXD J;  1SV5 A;  4DJB A;  3LAL A;  4OMF G;  1ITP A;  1FFS B;  4X62 J;  1RBO B;  1NDP A;  3G71 S;  1D8Y A;  4CDI A;  7FDR A;  1SQE A;  1JXV A;  1TL1 B;  3E01 B;  4FXD A;  3PX4 A;  3B6B A;  5CZV A;  4LMZ A;  4ILM A;  1FT8 A;  3KJN B;  4F25 A;  3C2P A;  2VG6 A;  4P2F A;  3DLK B;  3MFH A;  4DR7 J;  1DTT B;  3W2V A;  4QW8 A;  1IBM J;  3LOU A;  1LWE B;  4ZOS A;  5A8K B;  3RW7 A;  4G1I A;  2FY1 A;  4USW A;  4CLP A;  4ETX A;  3LGN A;  2K1R A;  2F4V J;  5C42 B;  4C97 A;  1WC5 A;  5B0F A;  2B6A B;  2AEM A;  1RAF B;  4I2Q B;  4WFN Q;  4LVO P;  4X4R A;  2RQM A;  5M2R A;  3V81 A;  5B09 A;  4N56 A;  3QJJ A;  2EG2 A;  3DI6 B;  2LU1 A;  4PQU A;  3T9N A;  1FJE B;  1SKR A;  1N0V C;  3UFC X;  3Q8U A;  4UST A;  1VQP S;  1ZH5 A;  1FE0 A;  3HT3 A;  3IWL A;  3LP2 B;  4DR2 F;  3RB0 A;  4DUY F;  4J7C A;  1KHV A;  4DSF A;  2NYH A;  2BJ8 A;  3DOK A;  2CPE A;  1HBO B;  1CSJ A;  3TO8 A;  4R5P B;  2R7V A;  5K14 B;  1WI6 A;  1C0T A;  4PG8 A;  3MI7 X;  1RA6 A;  3M6U A;  3DN9 A;  1GT8 A;  1S7H A;  2FJX A;  2GAG C;  1GAO A;  2UU9 F;  3HO1 A;  2V8D A;  2YKA A;  4FKY A;  2V94 A;  3CED A;  4PG4 A;  3V2U C;  3MMA B;  1X4C A;  1RTD B;  1U26 A;  2RD5 C;  5FLX U;  1WG1 A;  3AA9 A;  1KFD A;  3OUY B;  3BN7 A;  4MK8 A;  2H9Z A;  1NDC A;  2JJ4 D;  2NYI A;  1X4E A;  4TY8 B;  4P74 A;  2IBK A;  5HK4 A;  4FYY B;  2FZG B;  3UVJ A;  3J7Y U;  1Q7Y T;  2GO9 A;  2COL A;  4WK1 A;  3AY0 A;  2GGP B;  2K3I A;  5EX0 A;  4OL8 A;  3ENV A;  2J0W A;  2HND A;  2KYZ A;  2R7O A;  4WYL A;  1NAQ A;  3QPI A;  4HI2 A;  2VQF J;  2GMH A;  2VH7 A;  4J9N A;  4JI0 J;  3C6U A;  3SDE A;  3CCV S;  4MYU A;  3THV A;  1VIX A;  2UXB J;  2EKN A;  5KG7 A;  4JI7 J;  2OML A;  4AND A;  4CH7 A;  1R6Y A;  3DFE A;  2E9Z A;  4ECS A;  1ZM2 A;  2Z58 B;  3BN4 A;  4C3M A;  1VIS A;  5GAG U;  2DEJ A;  1WHY A;  1IBK J;  3D6H B;  4FF1 A;  4CLZ A;  3KYL A;  5B0G A;  3MOZ A;  3NBP B;  3K5O A;  5I3Q A;  2VA3 A;  4NCA A;  2ZVI A;  1XNR J;  2GQ2 A;  1TL1 A;  2DRA A;  2IMO A;  3E01 A;  3DRS A;  2DGS A;  4B3R F;  4JI1 F;  3GMG A;  2QLJ B;  3PYE A;  2CZV C;  3I56 S;  4EBC A;  3GV5 B;  2R2T A;  3GYX B;  1RWN B;  1TKX B;  1FWK A;  3R7B B;  5J2N A;  3LF0 A;  3PM9 A;  2M52 A;  3RGI A;  2I2Y A;  4YY3 J;  4A8F A;  5A8K A;  2R7S A;  3G82 B;  3O2I A;  1AA1 B;  4DPX A;  3IR5 B;  3Q89 A;  4QIV A;  1TAU A;  1OY8 A;  2U2F A;  3UD3 P;  4UTG A;  4NCB A;  5C42 A;  2CDQ A;  3HHL B;  2XMK A;  1VS3 A;  2B6A A;  4QJV A;  1TZ0 A;  2ASY A;  1VQN S;  4D3H A;  4K4S A;  1FVS A;  1K8A T;  2RT3 A;  4LIR A;  3DI6 A;  4I69 A;  4HTJ A;  4DV7 F;  3TRG A;  3BS9 A;  1T9W A;  3JAM Y;  3T9Z A;  3TA0 A;  2G0C A;  2WVF A;  4ANC A;  2DIS A;  3LPY A;  4P7V A;  4JB8 B;  2HS0 A;  1NJW A;  4DR6 J;  2VDI A;  2FHM A;  1I5O B;  3D0G E;  4EEY A;  2RDD A;  1IM6 A;  3R7N B;  3NY0 A;  4R5P A;  1UVL A;  3D2W A;  4ZVE A;  1SB6 A;  4GRS A;  2E5L F;  2PDA A;  4CQ1 A;  2XO7 A;  3IXQ A;  4EBD A;  3LGH A;  4F02 A;  5LT5 A;  2QRR A;  3R5C A;  3MMA A;  1BUX A;  3VAJ A;  4LFB F;  4NYP A;  1RTD A;  2GJI A;  1XMQ F;  2HHU A;  2MKI A;  3OUY A;  4PG6 A;  2WVC A;  1XEZ A;  4JI3 J;  3OSP A;  2XMU A;  3GG0 A;  3AD7 C;  3ILI A;  3VAL A;  4TU7 A;  2QE5 A;  3R3T A;  2BW7 A;  4O0N A;  2GVD B;  1F5A A;  3KK1 B;  1RU2 A;  2HLT A;  1RAC B;  4KC5 A;  2CA9 A;  4F4Y A;  4C9D A;  2GGP A;  3A8J A;  1VQL S;  3PRV A;  1WF1 A;  4CO2 A;  3G8S A;  2JEG A;  2CPI A;  4G65 A;  2BXJ A;  4KGK A;  1NZA A;  1RI7 A;  2M8D B;  2JC1 A;  2F1F A;  1XK8 A;  1UJ4 A;  2ZH5 A;  4RBV A;  4Y6I A;  5KT5 A;  2HVH A;  3CCS S;  3DCA A;  1RHU B;  2MMY A;  4BLG A;  1F9E B;  2GZO A;  4DN9 A;  4ZP7 A;  4CH1 A;  3ILL A;  2B9Y A;  1HD1 A;  3OFG A;  4LR8 A;  3PKM A;  1NJI T;  2KTQ A;  3NBP A;  3IR6 B;  2J9D E;  3KLV A;  1WG4 A;  2W8L A;  5KFP A;  3QSY B;  1UJ6 A;  2E1C A;  2KH9 A;  3Q24 A;  1QAJ A;  2UUA J;  4IFV B;  4CTA B;  2NZC A;  2RHS B;  5BYS A;  4KGV B;  2HYI B;  4BC9 A;  3KK2 B;  3BSC A;  4KPY A;  2AJQ A;  3CJ5 A;  1TKX A;  2RU3 A;  4KQZ A;  5C5J A;  1T0T V;  2ZHB A;  5ETV A;  3D5M A;  1F0X A;  1M1G A;  2LDI A;  4F0H A;  1KWM A;  1U2R A;  2CAD A;  3IFE A;  4G1P A;  2OPR B;  1CUL B;  1HNZ F;  3C8Y A;  3N5B A;  4MFB B;  2XY6 A;  3HHL A;  4ZJQ A;  1VRT A;  1U6Z A;  2DGQ A;  4UOG A;  3RZA A;  4A8K A;  3IGN A;  2CJY B;  2NXJ A;  2HHP A;  3H2U B;  2EI5 A;  2WOM A;  1UZD A;  1WUU A;  1U1R A;  4Y2I A;  4C0B A;  2RRA A;  2RSQ A;  3AA8 A;  1IR1 A;  2AYM A;  5IOL A;  6FDR A;  1KHW A;  1HBN B;  2C3M A;  1B99 A;  1RT6 B;  3RB4 A;  3M8Q B;  3BO2 A;  4KYZ A;  1G1X A;  2LEP A;  1X4F A;  2ADB A;  1VQ4 S;  3SQG B;  3AOC A;  5L1J A;  2PI5 A;  2GHW A;  4W90 B;  3JAM U;  1JNZ B;  2F5G A;  3ZZY A;  4R0E A;  1ZTT A;  4DL0 C;  3HSD A;  5DG8 A;  1S0N A;  4JYA F;  3BH7 B;  1FJG J;  3CCR S;  4RW7 A;  4ECX A;  3WDO A;  2DVI A;  1GNK A;  2XMJ A;  4X4S A;  1Y3J A;  3M9M B;  3HHE A;  1WEY A;  1B64 A;  4P2S A;  1FKO B;  2H1Y A;  1FWP A;  4HDH A;  1JLQ B;  4WTO B;  3ILJ A;  4WFY A;  5KFX A;  3NGU A;  5D4N A;  1RTJ A;  3EDQ B;  4IQX A;  1HQE B;  4L74 A;  1BWV A;  3CJK A;  3DHX A;  3MCN A;  5EWE A;  1S6P B;  1S72 S;  2BMB A;  4DV6 F;  2GNK A;  3MOJ B;  2KL8 A;  3KK1 A;  1B0V A;  3JTP A;  2VFT A;  5I4M A;  3WQP A;  4F4A A;  1ZTW A;  3CC4 S;  4J5O A;  1UKU A;  1Q1K A;  4ZVU B;  4CO1 A;  3MR2 A;  4JV5 F;  4ED5 A;  1H38 A;  1T11 A;  1FRX A;  2PMW A;  2DNG A;  4NCG B;  3ILO A;  2IVY A;  1X9M A;  2G1D A;  1DZ5 A;  4DFJ A;  5AE1 A;  3EX7 B;  3PYG A;  2EFV A;  2SXL A;  2CXE A;  1LEO A;  4LBI A;  2V4J A;  1YDL A;  1MW7 A;  1Y5I B;  4DZD A;  2WBR A;  3B78 A;  1CBK A;  3AJ1 A;  4DU8 A;  3BO3 A;  2HHX A;  4ECZ A;  3MM5 B;  3M2U B;  5J1E B;  1RHJ B;  3IO1 A;  1QLN A;  4OZ2 A;  5IZH A;  3GJQ B;  4ED7 A;  1A7G E;  5HJX A;  2ZOG A;  2D9O A;  2DR6 A;  2YH1 A;  1NSA A;  3GYN A;  1S1T B;  3C15 B;  2KT5 A;  4IFV A;  1WG5 A;  4CTA A;  3Q22 A;  2KRR A;  2W2N P;  3UNG C;  2CVI A;  2RJZ A;  1BQX A;  5DM7 Q;  3PW5 A;  1TFY A;  3W9I A;  4XPE A;  3I32 A;  1RLC L;  2HHS A;  3KK2 A;  1TUG B;  2OFG X;  3MWB A;  1KC8 T;  1OIA A;  2ZD1 B;  1UA1 A;  5E3P A;  2HQ3 A;  3NWG A;  3W8G A;  3DKD A;  2FJW A;  4LF7 J;  3CWJ A;  2GVZ A;  3KHG A;  1SQG A;  2MJU A;  3OTO J;  3AXM A;  1Q8K A;  4DXL A;  4I7F B;  2HFN A;  2BOP A;  1SC3 B;  2XYH B;  4WP8 A;  3EZO A;  5ETL A;  2XZD B;  3VGU A;  2OPR A;  4E98 A;  1CUL A;  3G96 A;  3UN5 A;  2UXD F;  1SXL A;  3QJL A;  4X62 F;  2B9W A;  4QOT A;  1S59 A;  4DL5 A;  4R8U B;  2BQ3 A;  4LSL B;  1ZBT A;  2RH3 A;  2J9C A;  1KSP A;  1FES A;  3ZO7 A;  4OI4 A;  2UUC J;  3DM2 B;  2HIY A;  3M8Q A;  2WK4 A;  3JXO A;  3WX8 A;  2ROP A;  4DR7 F;  3DLB A;  4U9R A;  2DGO A;  2MB0 B;  5KFI A;  1IBM F;  1RT3 A;  3MEC B;  4ERD A;  4GKK J;  2WVB A;  4ZP8 A;  2ZZM A;  3E51 A;  3V6H A;  4OX6 A;  4A8Y A;  4RNM A;  3QSI A;  2W9A A;  4BC7 A;  1W26 A;  2I5J B;  1HQ2 A;  2HBY B;  2EK6 A;  4O3S A;  5KFU A;  2F4V F;  1L3T A;  4X4O A;  2XSF A;  1B70 B;  5KT7 A;  1QY7 A;  4W92 B;  3VZH A;  3MEK A;  3G6V A;  3N01 A;  2N7Y A;  3VR1 A;  2YWE A;  2O3D A;  1FKO A;  3PG9 A;  2W9B A;  1JMT A;  1XQI A;  5L1K A;  4OJ1 A;  1IUJ A;  4IO9 Q;  1UEK A;  3E8O A;  1QJH A;  1NK0 A;  1WTF A;  2BKN A;  2E9R X;  2Y8W A;  3HVA A;  5CYJ A;  3HHL D;  3GFY A;  2MZR A;  2X1B A;  3CVK A;  1HQE A;  4K5R A;  2XLJ A;  2IDE A;  3GIK A;  1RWP B;  2AF6 A;  1S6P A;  1SJR A;  2ASD A;  2L3M A;  2V9K A;  5D78 A;  2ERR A;  3CD5 A;  1G4C A;  1WOO A;  2FLO A;  5J1N A;  3MPU B;  3HHK A;  2FD2 A;  3EJM A;  2R2U A;  3EXC X;  2IAJ B;  2YPZ A;  1K47 A;  2R2R A;  5CAB A;  3T1Y J;  5A76 A;  1S4E A;  2HK2 A;  5KFO A;  2F8E X;  3NWR A;  2C3U A;  2C22 A;  4YP3 A;  5K5M A;  4EU0 A;  3TNV A;  2Z0G A;  5KG0 A;  2Y8Y A;  2LU2 A;  3MED B;  1M5V C;  4IG3 B;  3RR7 A;  1DTQ A;  3MM5 A;  3M2U A;  5J1E A;  3GFZ A;  5CH7 B;  4ZP9 A;  5J2P B;  4NLP A;  2DR9 A;  4Q2L A;  2XC9 A;  3HSZ A;  1SJ1 A;  3NAH A;  2A2D A;  4I6W A;  1S1T A;  3C15 A;  2D69 A;  4ZJL A;  4YDD B;  2HUR A;  2P9G A;  2VQF F;  2Z30 B;  2W8K A;  1NPP A;  2UUT A;  5CZX A;  4AYB D;  3P5B P;  2KJW A;  2G4B A;  4JI0 F;  2OEJ A;  2KM8 C;  3D3C J;  2RS8 A;  2KKH A;  4UOH A;  2UXB F;  1TUW A;  3MM6 B;  4AL7 A;  1NB7 A;  2VHG A;  4JI7 F;  4PXE A;  2CJ9 A;  2CFX A;  2IRU A;  2CWK A;  3LQV A;  2NUH A;  4I7F A;  1HI0 P;  3KTQ A;  2DY1 A;  3DOM B;  1SQF A;  4LF6 J;  4GO5 X;  4M5K A;  1NK4 A;  2R7X A;  1G7C B;  1RAD B;  1FD2 A;  3M30 B;  1CLF A;  1KDN A;  2XS2 A;  4OV6 A;  4L73 A;  5DET A;  2BUN A;  4YFU A;  2W7P A;  4KH1 B;  3I82 A;  2V6A A;  1SKW A;  2WON A;  1NJZ A;  1S1U A;  4R8U A;  2HZV A;  1XNR F;  1NK9 A;  1R6V A;  3UDE A;  2LEB A;  2ZBI A;  1UPP A;  3DM2 A;  1VC5 A;  1FE4 A;  2HVD A;  4HT5 A;  4KHR A;  1WAC A;  3TW0 A;  3HF5 A;  1OSD A;  1RHQ B;  1YWX A;  4NRU A;  5DQG A;  3M6X A;  2FTR A;  3MEC A;  4WTY A;  4ZIV A;  5IFM A;  1FVQ A;  2HWT A;  1U1Q A;  3NOG A;  1XBW A;  3R2D J;  4YY3 F;  1Q16 B;  4OLP A;  3K0J A;  3TI0 A;  2CNN B;  4ED2 A;  3QIP B;  1VJW A;  2I5J A;  2MQQ A;  5KG4 A;  5D4O A;  4MT1 A;  3ZZP A;  2I38 A;  4D3G A;  2RE1 A;  1VBK A;  1U48 A;  3AQP A;  3HVT B;  3ZFV A;  3MHY A;  3CUL A;  5EHH A;  4QR1 A;  1JLC B;  1HPZ B;  3KK3 B;  1RUS A;  2IIH A;  3N28 A;  5GAD U;  3QMQ A;  2HQI A;  4YHH J;  2YQ3 A;  1VGY A;  1WC6 A;  3PEH A;  3OVA A;  3PKY A;  4MKY A;  3NS6 A;  3CO9 A;  1D3W A;  1NO8 A;  1RIS A;  4XAK A;  1OYD A;  1XER A;  2FZC B;  2B9X A;  2LA4 A;  4X64 J;  4DR6 F;  4Q43 A;  2HKE A;  3MD3 A;  3RRH A;  1MSW D;  3VTI A;  4C8M A;  3A3N B;  2WVD A;  1AZS B;  1G2E A;  3N0V A;  2NPF A;  4X4P A;  3CNQ P;  3OFH A;  2X3G A;  3OR2 B;  3BSN A;  1FEE A;  3G87 A;  2BAN B;  1WSV A;  4KKO B;  3MUM P;  4LUB A;  2J9D A;  2KO1 A;  4C7Q A;  2J0S D;  4RW6 B;  3QRR A;  3AOD A;  1URR A;  1MML A;  2R2S A;  4WU3 A;  4OYO A;  3C19 A;  4ZP6 A;  1U8S A;  2YX4 A;  2ZH4 A;  3QGH A;  1V3S A;  3W9H A;  2XHC A;  1HNI B;  2QN6 B;  1KOO A;  2FY8 A;  4CT8 A;  4JI3 F;  1UP1 A;  2CJX B;  2H5E A;  2KXH A;  2RDJ A;  3OPK A;  4J9U E;  4IG3 A;  4WBF A;  8RUC A;  1CJU B;  4ZVT B;  2KB2 A;  3ISN D;  3K17 A;  2VQE J;  3FCH A;  1RA7 A;  1U1L A;  3UCU P;  2DPI A;  3KJF B;  5LXR A;  5J2P A;  2IHR 1;  3KMS A;  3MAA B;  3H42 A;  2RQC A;  1UEU A;  4ELV A;  4N41 A;  1LXN A;  3QGP A;  3HD2 A;  2PI4 A;  1UMJ A;  4DV4 J;  3QZ7 A;  3H8Y A;  1SH0 A;  2HRT A;  2AJ2 A;  4A48 A;  4L75 A;  4RX6 A;  3GIM A;  3PRB A;  3H0P A;  4DFP A;  2DNR A;  4RU9 A;  2CZ9 A;  3RRG A;  2CIM A;  1U6B A;  4H4K A;  2KFN A;  2ZKT A;  2G13 A;  4JI5 J;  3TOQ A;  2CKW A;  1LOU A;  1M5S A;  1RHK B;  1YK9 A;  1PBA A;  1YLX A;  4YDX A;  4JV2 A;  2MLZ A;  1IVZ A;  1X7V A;  3M30 A;  1FRI A;  2KG0 A;  2XG8 A;  3HD1 A;  4FVC A;  1H0H B;  2XWY A;  1SL1 A;  3PO5 A;  2CQB A;  5ETT A;  3QFH A;  2HEK A;  1HR0 J;  1YBA A;  5DDR C;  2UUA F;  1VQ5 S;  3BV8 A;  1KEK A;  3CJ4 A;  5DLG A;  2EPI A;  1KTQ A;  4G3I A;  4GC7 A;  2HFZ A;  3EWG A;  1UA0 A;  2ZH9 A;  1HD0 A;  1ZM4 A;  4J9L A;  2KZM A;  2OHD A;  1V5I B;  3P6Y C;  5LJ5 Y;  2J6U A;  1YBU A;  1JLA A;  2YNH A;  4C8L A;  1M90 T;  3TYT A;  1CG2 A;  5FDL B;  2MEW A;  4CWB A;  4OFZ A;  4M5I A;  4OZ3 A;  3G6E S;  2QYG A;  3HVT A;  2MZS A;  3FEY B;  1HPZ A;  3KK3 A;  3CCT A;  5FJ4 A;  1T7P A;  2WW4 A;  2V2V A;  1CC8 A;  2F40 A;  3AFG A;  3M9O B;  4P9S A;  1YZ6 A;  1IM4 A;  1UFL A;  1VIO A;  1NK5 A;  2ZOF A;  2QO3 A;  1UWA A;  5KG2 A;  1FDN A;  3RAQ A;  1BWE A;  5ADZ A;  1T03 A;  4LF8 J;  4QR0 A;  3IM8 A;  5HAO A;  4NML A;  1YJN S;  3F73 A;  2E44 A;  2HS3 A;  2MHE A;  1AZS A;  3MFI A;  2M9K A;  3ZTP A;  2VFU A;  4BBY A;  1XR7 A;  2BE9 B;  3OR2 A;  3TP2 A;  2BAN A;  3MDF A;  2W24 A;  3VAF A;  4X4N A;  4KKO A;  1RAB B;  3GTY X;  2BV3 A;  4DL7 A;  3MD1 A;  4RW6 A;  4OI1 A;  4PWD B;  4AL6 A;  1FJG F;  3P96 A;  3TUZ C;  2KVI A;  3D67 A;  1YBT A;  4OYI A;  4OI2 A;  3HM9 A;  2VIC A;  2UVR A;  2IRY A;  4NX9 A;  2HZA A;  2LXF A;  3D1O A;  3RW6 A;  4HHU A;  4ATN A;  3DLE A;  4KGM A;  1H3D A;  4XPC A;  5ETK A;  1DJ0 A;  1F2H A;  1C0U B;  2BOA A;  1P9Q C;  2DO0 A;  1FO1 A;  4F4Z A;  4DR5 F;  4Y0F A;  1CJU A;  4RO0 A;  1XWL A;  1J27 A;  3M7V A;  3RRK A;  4DS5 A;  5D4P A;  2G0J A;  1RE1 B;  5HN0 A;  1RTZ A;  3MAA A;  4KGZ B;  4TQR A;  4DG1 B;  4MTP A;  5AXK A;  3GP9 A;  4FP9 A;  1REG X;  2MZQ A;  3MPW A;  1FFW B;  3DDK A;  1HNV B;  2GS8 A;  2AP6 A;  4XDC A;  3V6D A;  3TR5 A;  1WC1 A;  2DIT A;  5E33 A;  3S01 A;  3TAP A;  2EFN A;  1VRU B;  2WRM A;  2V50 A;  2VKZ G;  3MR6 A;  2Z2M A;  3Q8Y A;  4I1T A;  3IRX A;  1EQM A;  2ZBP A;  4PXD A;  4M5M A;  3BDE A;  1U24 A;  4OYP A;  2IMW P;  4DEZ A;  1X4H A;  4FNI A;  1JQG A;  1N36 J;  1N5Y B;  1T94 A;  2RB7 A;  4ZIT A;  2FVS A;  4URQ U;  4RR5 A;  1WKK A;  2GML A;  2K3K A;  2DIU A;  3NGK A;  3L9Z A;  2XLI A;  2BBE A;  2F63 A;  2P9C A;  3F0N A;  3SEO A;  1LW2 A;  2LMI A;  4F50 A;  3U02 A;  3R2C J;  3UQS A;  4ES3 A;  4BWJ A;  1OJ4 A;  3HVR A;  1I94 J;  3QID A;  4H4O B;  3ENA A;  1T95 A;  2AHO B;  4LF7 F;  4NA3 A;  1N56 A;  3OTO F;  2LVW A;  4IRC A;  4B9V A;  2P6S A;  5FDL A;  2QC3 A;  4I6A A;  2EFG A;  5KFG A;  1WC0 A;  4EO8 A;  1KQK A;  3KOA A;  5GMD A;  4B3O B;  2DXE A;  4J9V A;  4ZN3 A;  1VC6 A;  2MKH A;  2GIQ A;  4LF1 A;  4QIW D;  2AIR B;  4QWB A;  4IOB A;  5KT3 A;  2UUC F;  2HHW A;  1QAY A;  2HS4 A;  4IR1 A;  5DGA A;  3CDE A;  1LK7 A;  4RW9 B;  1GK8 A;  2C2Z B;  1JXL A;  2LCW A;  3CXC R;  1GQE A;  2OSR A;  4GKK F;  2VOD A;  2PE8 A;  2YTC A;  2XCP A;  4LT6 A;  5F9N A;  3KKF A;  1Y11 A;  5GAH I;  1VQK S;  4PAA A;  4ZVP B;  2OEL A;  5K8P A;  3U7J A;  3SV4 A;  3IWX A;  3KHL A;  3FKB A;  1CQM A;  4LFC J;  1QD1 A;  3FSI A;  3J7Y I;  4ZK7 M;  3GG1 A;  4ED3 A;  1PSD A;  2A6M A;  2YKQ A;  5H1S V;  1P9Y A;  3EVW A;  5E5N A;  3OL6 A;  1RSC A;  3SCI E;  1X0F A;  3LTO A;  2DXF A;  3QFW A;  4RUC A;  2NXN A;  1WOS A;  1C0U A;  1D1U A;  4DUT A;  1LWX A;  4N47 A;  3PO4 A;  2VZ9 A;  4CLF A;  4LF4 J;  4ZDN A;  1IJF B;  1NPR A;  3FDS A;  3B4D A;  2EEY A;  5LSL A;  4NLS A;  3S7R A;  2HFS A;  1SIZ A;  1K73 T;  4KH0 B;  2E29 A;  4DSI A;  5CHC B;  4UY8 T;  1TU0 B;  2ACM A;  2CQ3 A;  2GJF A;  4TLQ A;  1TEL A;  5GAG I;  3MF5 A;  3M32 B;  4NMX A;  5HMX A;  3QGG A;  1HNV A;  4NE9 C;  4Y2M A;  3W8P A;  3T1Y F;  2VAS A;  3IP0 A;  1YQH A;  3DRY A;  1KFS A;  4B9M A;  2ACY A;  3O3L A;  4PEO A;  2W2O P;  3PR5 B;  2VJV A;  5E3C A;  1M1K T;  4UT4 A;  3CD0 A;  2QV6 A;  1JIH A;  2PO4 A;  2ZBQ A;  4F0M A;  5D0G A;  4CLU A;  2G9O A;  2XNR A;  2LKZ A;  1I3O B;  3KJQ B;  3PR4 A;  2NRE A;  1N5Y A;  3DMJ B;  4NAS A;  2HHV A;  5IWA J;  3AAW B;  3QAT A;  3BQ0 A;  2BKP A;  1WSR A;  1U45 A;  3I0R B;  2CJB A;  3N9U C;  4USJ C;  2ZC3 A;  3D6M B;  4PWU A;  2CYY A;  3JTO A;  3PVX A;  2YWW A;  1NK7 A;  2JL9 A;  4FVM A;  2W4P A;  3MCS A;  3M8Y A;  3W62 A;  3RAX A;  3QNW B;  4HEA 9;  4Y2A A;  4H4O A;  4B3M J;  3EPI A;  2QL7 B;  4FDF A;  1JLE B;  1A9N B;  1WF2 A;  4XO0 A;  4LF6 F;  3MMC B;  5T41 A;  4C8K A;  5BYQ A;  1VQM S;  2UUW A;  4MAK A;  4ENO A;  2BR0 A;  2RVJ A;  5J1P A;  1UVI A;  2KM8 B;  3NLC A;  2WSE C;  2QX0 A;  3NGS A;  2L9N A;  2ROG A;  4NA2 A;  3H90 A;  3OV7 A;  3OQ2 A;  4B3O A;  2P8I A;  4CO5 A;  3NS7 B;  3K8V A;  3QLH B;  1WKL A;  2V69 A;  1U8W A;  4I2P B;  3NMR A;  3I55 S;  3UDL A;  5DG7 A;  5DZ7 A;  2NSC A;  2F9D A;  1F3V A;  2DY9 A;  3HHL C;  2HAF A;  4TU8 A;  1YRX A;  4RW9 A;  3QAE A;  4DF8 A;  3V6K A;  2YPY A;  5DQI A;  2KZZ A;  2DNK A;  3WBZ A;  1QTN B;  2R8J A;  1XR6 A;  4WXW A;  4M5G A;  3A8I A;  2OD6 A;  1F6T A;  4PZV A;  1HWJ A;  4IR9 A;  2GC8 A;  1AUD A;  3DXB A;  1FER A;  1RYS A;  1EKR A;  1YJR A;  1NK8 A;  2AU0 A;  2HRU A;  4C3K A;  2ZJQ Q;  2IVM A;  9RUB A;  1VBY A;  1RT4 B;  1ZAV A;  2CNL B;  1DBD A;  3HHD A;  4AE5 A;  2OGU A;  2IM3 A;  4CYU B;  3C14 A;  3OT9 A;  4YHH F;  4OX8 A;  1S1W B;  2VBZ A;  1RDR A;  1RWM B;  4HI1 A;  4PKD B;  1V3Z A;  1NSP A;  4DI6 A;  1RK8 A;  4P6Q A;  3ELH A;  3CJ8 A;  3I9V 9;  4N7T A;  5KFC A;  3D0H E;  3JS9 A;  4AL5 A;  4NEY A;  1MNE A;  4X4Q A;  1O6X A;  1CJT B;  1RWV B;  3BPD A;  3PZP A;  2E66 A;  4LBP A;  3I0S B;  3M32 A;  4FKX A;  1JJH A;  1Q53 A;  2K2P A;  1U2C A;  1OQ6 A;  3GFH A;  1BQN A;  1YJ9 S;  2CPY A;  4NXM J;  2FVQ A;  3CJ2 A;  2KU7 A;  4C3L A;  1MRO B;  3LAN A;  4Z2X A;  1T9Y A;  4I4B A;  3SMZ A;  4DMZ A;  3DLL Q;  2FLL A;  1FHT A;  3CCQ S;  2FGO A;  3DMJ A;  1X4B A;  1AFI A;  3NGR A;  3T3F A;  4C6A A;  2J6S A;  3D7S B;  2EVZ A;  3HLU A;  2NCK L;  3PHT A;  1Y9O A;  3GIR A;  2YQ1 A;  1VHF A;  2ZUG A;  4G1Q B;  5E7O B;  4CP5 A;  3CCZ A;  2BYC A;  2GQC A;  4DV4 F;  1PC5 A;  1FA0 A;  1IR0 A;  1KQS R;  2N82 B;  3H5X A;  2CPH A;  3W61 A;  2DO4 A;  3Q23 A;  1AB8 A;  2RF2 A;  1F3F A;  1AT1 B;  2V4R A;  4EK2 A;  3IM9 A;  3P3D A;  1JLE A;  4HYK A;  2HG4 A;  4JI5 F;  1S6U A;  1NK6 A;  2M70 A;  4H54 A;  1NH7 A;  1WOR A;  1FDD A;  1C2P A;  3ISZ A;  2CPF A;  4CCH A;  2AJ1 A;  2VOO A;  1PO6 A;  2GV1 A;  1LQ9 A;  3PFO A;  2R4F A;  3P49 B;  2C2D A;  3VV2 B;  1NH8 A;  2A10 A;  3QLH A;  4I2P A;  2RML A;  1NRK A;  4Q45 A;  1SI9 A;  3K89 A;  4ZPV R;  2BVZ A;  2ZDP A;  5LJ3 Y;  1TMJ A;  5KFE A;  2NR0 A;  4O4G B;  2FGC A;  3R5D A;  4FF3 A;  3QYY A;  3J7A 1;  5D8H B;  2FVC A;  2E7X A;  3RU0 A;  1H72 C;  2CNO B;  1VR6 A;  3N6L A;  4B02 A;  4GC6 A;  4DBQ A;  4ECV A;  2BQR A;  4JBC A;  3PJ9 A;  2AT1 B;  3QWP A;  3IA0 A;  2KHD A;  4FYX B;  3SBM A;  4B3S J;  1NJX A;  3MM8 A;  4DS4 A;  4NLU A;  2NS1 B;  3CCJ S;  2LEA A;  2F9J A;  2FUG 9;  3GR0 A;  5E2Q A;  2BDP A;  3HKZ D;  1NDK A;  1PIE A;  5D0H A;  1RT4 A;  3WZ0 A;  4DX5 A;  2VBY A;  3RYL A;  2VPW B;  2E1R A;  2BEF A;  1X0P A;  2HBZ B;  3HZE A;  1S49 A;  3OTE A;  4IOA Q;  4CYU A;  3ZTS A;  3HFK A;  3VAI A;  2ASJ A;  3TQ1 A;  4LF9 F;  1S1W A;  3ZZZ A;  1YJT A;  5JUM A;  2VG6 B;  2QSF A;  5ITH A;  2EKY A;  3H5S A;  4WK3 A;  1U09 A;  4J9S A;  1U1M A;  4RBT A;  4LF8 F;  2IFX A;  2ILZ A;  3ISN C;  2ZUA A;  3ULH A;  1Y10 A;  4AXI A;  1FDA A;  1P6T A;  3CIM A;  1CJT A;  3W3S A;  3UR0 A;  4KFB B;  3CJ3 A;  2K1R B;  5G0R B;  3CCE S;  1BE4 A;  2MLY A;  3BPS P;  1QE1 B;  3B82 A;  1IBL J;  3C66 A;  5HSP A;  3ZZT A;  4MYT A;  3I0S A;  1UTA A;  1Q86 T;  5KT2 A;  1SJ4 P;  1HI1 A;  4PQU B;  2DCL A;  3AD9 C;  1P1L A;  1OS5 A;  2LYV A;  1S0O A;  1J5E J;  2K06 A;  4L6V 3;  3ENQ A;  2VPY B;  1X5P A;  3MMJ A;  4ZLP A;  3N6N A;  4ICL A;  5B7W A;  4I64 A;  1LNQ A;  2IJN A;  3O1L A;  3LWM A;  4LBH A;  1SL2 A;  2W9C A;  4ZPA A;  3GII A;  5KG5 A;  3LWL A;  4A47 A;  5K20 B;  2RUS A;  3K5M A;  3RG6 A;  2JEF A;  3EM1 A;  5D15 A;  2F65 A;  2XS5 A;  4JP8 A;  4W4M A;  1QM9 A;  2WBM A;  1X31 C;  4QWE A;  1QTM A;  3EZU A;  5KFB A;  3ET6 B;  1HQU B;  3UPF A;  2XYG B;  2YWF A;  3C46 A;  5A2Q Y;  3J7Z T;  4EYH B;  3CJR A;  2KFZ A;  4C8O A;  3W60 A;  2OIH A;  3OL8 A;  4LRA A;  1CC7 A;  2QL5 B;  1H6K X;  5GAE U;  3RBZ A;  3ZTR A;  3KG4 A;  2QA1 A;  4YS2 A;  4ZKA A;  1LXJ A;  2OJ3 A;  1S5Z A;  4KRW A;  3K8W A;  2OH2 A;  3UVJ B;  1N36 F;  2B4O A;  1HI8 A;  1PG5 B;  4WKR A;  1DQ9 A;  2Q1L A;  3L09 A;  2XGP A;  5KFZ A;  1P27 B;  3Q0A A;  3DGP A;  4DQP A;  4HHH A;  1XMO J;  3CCM S;  3K2Y A;  2VFV A;  2BJ1 A;  2UVW A;  4ZVR B;  1T8E A;  3N79 A;  1IXK A;  3CPW R;  1VDH A;  3K59 A;  3M9N B;  1U4B A;  3C6U B;  3SDE B;  4O4G A;  2UVU A;  1KLN A;  1DFD A;  2ZM6 J;  1GMV A;  4IO1 A;  3THT A;  1I94 F;  5HL7 Q;  2GCF A;  2DXD A;  2UP1 A;  5J2Q A;  5D0E A;  1WEX A;  4IQM A;  4ZN1 A;  5B0B A;  5DDP C;  4RNN A;  3H59 A;  8ATC B;  1VQ7 S;  4PUO B;  2AEJ A;  3PCO B;  4MKA A;  4MIA A;  3GYG A;  3OXG A;  4CNZ A;  3MEG B;  3DRS B;  4CI0 B;  3NNA A;  1C1B B;  1BGX T;  4U8V A;  6AT1 B;  4RW4 B;  1B7Y B;  1SJF A;  2E9T A;  5CCM A;  2FIU A;  2M0G B;  4RNH A;  4YB7 A;  2C2O B;  2YWG A;  2C2N A;  4DSL A;  5J2N B;  3KJV B;  3F41 A;  2MY7 A;  4CNY A;  2Q43 A;  2CVE A;  5CQG A;  3DHW C;  1JNR B;  1WWH A;  1IKY B;  4QWA A;  1FNO A;  4PRF A;  4KFB A;  5G0R A;  4J37 A;  3BSA A;  1QE1 A;  4FS1 A;  1NSK L;  4LFC F;  1L3U A;  1FWL A;  4B17 A;  4DCO B;  1NBE B;  2QG9 B;  2LDY A;  5IC6 B;  1S1V A;  3V4I B;  1X4D A;  3T5K A;  2LQJ A;  3D3B J;  3DRR B;  1R0C B;  1RWK B;  5CYQ B;  1TK0 A;  1Q95 G;  3OLA A;  3BJY A;  2RNE A;  1S7I A;  1KQG B;  1LWF B;  1ULR A;  3DC2 A;  5IQ6 A;  3VAK A;  3VQT A;  5HVG A;  1FTC A;  3BGL A;  4LF4 F;  1X8D A;  3T1H J;  1JWW A;  3MPY A;  5KOX A;  4USI A;  2MQ8 A;  2V34 A;  3MM9 A;  2JDJ A;  2PA3 A;  1NU4 A;  4FS2 A;  2MZT A;  1EJ7 L;  3RBX A;  4U7C A;  4DL2 A;  1DRZ A;  2YBV A;  2QTW A;  2ATL A;  4ZIW A;  4I68 A;  4B9N A;  3ET6 A;  1HQU A;  1R8P A;  4X4V A;  2CRL A;  3VVU A;  4M5L A;  5H9F J;  5HBM B;  2O5D A;  2I8E A;  2J7W A;  2I9S A;  1SH2 A;  5ETR A;  2BM0 A;  5GAH U;  2GIF A;  4M8L A;  2XY7 A;  5HJY A;  3OHA A;  3KMQ A;  5HO4 A;  4DQR A;  1K44 A;  3N5F A;  2G2Y A;  4NLV A;  4DQQ A;  3DOL B;  4FXV A;  1JJC B;  5IWA F;  3ETM A;  2DEI A;  2D7S A;  1F5C A;  5H9F K;  1EAR A;  2O1P A;  1C4A A;  1RCX B;  4H4K C;  2OPS B;  2ZC4 A;  1BY9 A;  3NCR A;  3QRQ A;  4AD6 A;  4QYR A;  2PSZ A;  1RAO A;  3IGV A;  4E0D A;  3W1Y C;  3R5G A;  3HKW A;  3LO3 A;  4YR2 A;  4Z7C A;  4CLL A;  3BGO P;  5GAD I;  2V5H G;  2FJA B;  4QPX A;  3CMQ A;  4WYW A;  4LIW A;  4TY9 A;  2FZK B;  4UUW A;  4B3M F;  1CJV B;  1HBU B;  3PHE A;  3MR5 A;  3R1H A;  2CZ4 A;  2F4F A;  2C1E B;  4PUO A;  4RKU C;  4NL5 A;  2QEX S;  4UQT A;  1MN7 A;  1R43 A;  4JOU A;  1FRM A;  2R8H A;  4N77 A;  3RUB L;  2RAQ A;  3MEG A;  1UVJ A;  1FK9 B;  3IBC B;  1T9U A;  4WKY A;  3SQO P;  1C1B A;  2DTJ A;  3OTD A;  1RAH B;  5A8R B;  2H54 B;  4WII A;  4RW4 A;  4IOC Q;  3I87 A;  1HFE L;  4DPO A;  5LSO A;  2QLB B;  2MDA A;  3OLB A;  5CCL A;  1URN A;  3DNC A;  3KJV A;  5CA5 A;  4EWT A;  3DRP B;  5D6G A;  3GIL A;  2M3D A;  2V63 A;  3H5U A;  5IS2 A;  4P52 A;  2XGQ A;  2AX1 A;  5AXN A;  1IKY A;  4IUF A;  2QZ8 A;  1QVF R;  2YNF B;  5HQL A;  3F44 A;  2MTL A;  5E3R A;  4BDP A;  4HL9 A;  1KQF B;  3M8Z A;  1RXO B;  1VRT B;  1R27 B;  2BAB A;  1FJ7 A;  4LSZ B;  5LMU J;  2WOM B;  1O51 A;  5EUH A;  2BAC A;  4ED8 A;  1RHR B;  2E7W A;  3R8Y A;  4DX8 H;  2PMH A;  3M4X A;  3V4I A;  2DR5 A;  2G0I A;  2CUY A;  5LMN J;  3MAH A;  3DRR A;  5CYQ A;  4GO7 X;  1B0P A;  5KG6 A;  2JFK A;  2HNY B;  4DOZ A;  3L3C A;  2IM2 A;  2B7C B;  3RTV A;  4K4T A;  3HMJ G;  1LWF A;  4NLY A;  1N34 F;  4USH A;  2ZNZ A;  2VC1 A;  4ECW A;  1I6J A;  2MQO A;  2H4Y B;  1RJJ A;  1UEV A;  1LFP A;  1PBU A;  4DSE A;  3C3L A;  2VPZ B;  1B7F A;  2ZE2 B;  4QU7 A;  3QQC D;  2B3T B;  1UVN A;  1JLG B;  3FEX B;  4KBI A;  5KTQ A;  4EBE A;  4RW7 B;  2X51 A;  4O4R A;  1FI4 A;  1D9D A;  2PEB A;  2J7U A;  3BM7 A;  4EO6 A;  1GTH A;  2OUG A;  1BLU A;  2ZJR Q;  2VD3 A;  2EFQ A;  3I9Z A;  5HBM A;  4NXM F;  3HP6 A;  2P5V A;  1SBR A;  4EZ9 A;  4DV0 J;  1FRH A;  4JI4 F;  3QRP A;  1RTJ B;  5AJ3 F;  2V2K A;  1HKA A;  3PIP Q;  5C2C A;  3CJK B;  1VMB A;  3RB3 A;  3IS9 B;  3CJQ A;  2XM3 A;  3T5L A;  4PWW A;  4KE5 A;  3DOL A;  4CLT A;  2B9E A;  1QUP A;  1AUS L;  1X5T A;  1IKX B;  1VRQ C;  2XB2 D;  3T6J A;  2V4Q A;  4O3N A;  2AX0 A;  1JLF B;  1I1G A;  3D6T B;  2OPS A;  1NSQ A;  2GJ2 A;  2AKW B;  1HA1 A;  2B51 A;  1FXL A;  2QL9 B;  3A3P B;  2HWI A;  1ROF A;  1QSL A;  4JI6 J;  2FJB B;  2BM1 A;  2IA6 A;  4M63 A;  1YJW S;  2N3O A;  3ITH B;  2V4J B;  2NXU A;  3M8P B;  3DLJ A;  2B43 A;  2MQL A;  2HQF A;  4FF2 A;  4ZVH A;  1CJV A;  3SSR A;  4ELT A;  1HBU A;  3SYZ A;  3WC2 A;  2BRK A;  4DV5 J;  4M1K A;  2M8H A;  3CDA A;  4PR6 A;  5HAT A;  3DYA A;  3TAR A;  4AUK A;  3X1L B;  3U1L A;  3A4T A;  1KON A;  3W5X A;  4ZPD A;  3HJV A;  1FK9 A;  5HI7 A;  1OMS A;  3TQE A;  2AJ0 A;  5A8R A;  4RPF A;  4M5D B;  3GWC A;  2Y3Y A;  3TUP A;  2GIR A;  2C3P A;  3ZNJ 1;  3UDC A;  3DRX A;  2HQC A;  5L1I A;  3HVW A;  3DRP A;  2GVZ B;  4UZC A;  3KUE A;  1FNM A;  2YNF A;  3MPD A;  3KUH A;  1HLW A;  1H98 A;  4B3S F;  2KI2 A;  4EFA C;  4WU2 A;  2Z57 B;  5J2M A;  1IWA A;  3NMA A;  3M2R A;  3Q2S C;  4MMO A;  2V0N A;  2V8H A;  2VOP A;  4PQA A;  4ID8 A;  1AFJ A;  3IC1 A;  2XHW A;  5HLF A;  3CGI A;  4P7T A;  4NLO A;  2CQ1 A;  4NXN J;  3CD6 S;  1S6Q B;  1WNE A;  2HNY A;  2JWN A;  2MSS A;  5DO2 A;  4A8O A;  2WTF A;  2L41 A;  5KFL A;  1FDB A;  1VFJ A;  2C3O A;  6FD1 A;  1RT3 B;  2F8H A;  3AOA A;  3NAI A;  2Y1J A;  4X4T A;  2VU5 A;  4DV3 J;  2IRX A;  4OYM A;  3DU6 A;  2X1A A;  2ZE2 A;  9ATC B;  4QWC A;  2LEC A;  3N4W A;  4RU2 A;  1JLG A;  1SPB P;  1REV A;  4GVB A;  3NCP A;  4URS A;  4CIO A;  1IBL F;  3Q8S B;  4FF4 A;  1PAU B;  4FZV A;  1HIY A;  1SH3 A;  1JJ4 A;  4F3M A;  5F8L A;  2C2K B;  3LUY A;  1R8C A;  1X5O A;  3HFV A;  3KUG A;  2RU9 A;  3BKF A;  2W9B B;  1ZS6 A;  2EBE A;  5I42 B;  2FC8 A;  2E5I A;  2YNI B;  4XK8 C;  1S77 D;  1J5E F;  2ZFH A;  3ZXW A;  2QLX A;  2FHO B;  5L39 A;  3VAG A;  1C1C A;  4URG A;  2XMT A;  1NKC A;  1VQS A;  1GXT A;  4QIG A;  4IRD A;  4Q7A A;  4C2M A;  4P2M A;  1JB0 C;  3IS9 A;  2MQN A;  4B9S A;  3S1T A;  3J7A N;  2DGT A;  1RAE B;  2RKI B;  5KFM A;  1NHV A;  4HTI A;  2A2C A;  2JHE A;  4NZ7 A;  2NSB A;  4ZPB A;  2DGX A;  1IKX A;  4J90 A;  1YG0 A;  4B9T A;  1ZA2 B;  2W01 A;  1JLF A;  1NM2 A;  2OKQ A;  2DH8 A;  2W1B A;  2DRB A;  4RUA A;  4F3Q A;  2ZNY A;  4YR0 A;  2EXU A;  4U7U K;  5E3Q A;  1UW9 A;  1S79 A;  5EWG A;  3ITH A;  3M8P A;  3IG1 B;  2D74 B;  2MKY A;  3TZX A;  3ZTO A;  2ALY B;  2OPQ B;  5C2G A;  4Y2K A;  3Q86 A;  1WDT A;  1EKS A;  2DT9 A;  3NEK A;  1N8R T;  2AGQ A;  1KVI A;  2DCU B;  5CAA A;  4OI0 A;  2LQ5 A;  3I96 A;  1DTQ B;  4NA1 A;  4O3Q A;  4YB5 A;  3GZ7 A;  1ZAX A;  3JQM A;  3ADA C;  2C3Y A;  2DR7 A;  4C8Y A;  1R89 A;  2KN4 A;  1RKI A;  2RIL A;  1XMO F;  2I0X A;  2DNN A;  2UUB J;  4WFX A;  1SUQ A;  3KG1 A;  3VCD A;  4OZJ A;  4M5D A;  2YKN B;  1N5T A;  1X9S A;  4JYA J;  2FHJ A;  3PYD A;  3FZ2 A;  2ZDO A;  3HX9 A;  2WSC C;  2ZM6 F;  2IJR A;  1D09 B;  1FRL A;  1M5K C;  2OI2 A;  3RBE A;  3W2W A;  3SZ2 A;  3R7S B;  3T5H A;  2DH7 A;  2VV5 A;  1TUV A;  1RWX B;  1T05 B;  4OYB A;  1ZPW X;  1K0V A;  4OIX A;  2AZ3 A;  2AJF E;  4K59 A;  4X84 A;  2QLF B;  2ABY A;  1T9T A;  1Q0N A;  3BR9 A;  2JVO A;  2WSF C;  1NDL A;  2Y1L B;  1Q5V A;  2WON B;  1ZPV A;  3LP0 B;  4WJB A;  1S1U B;  1FKA F;  5L8R C;  2PFF B;  4TKT A;  3P45 B;  3IAS 9;  2PC6 A;  3GQC A;  2PII A;  5FLX Y;  4O44 A;  1LKZ A;  4YQW A;  4KR0 B;  1S6Q A;  4CM0 A;  3W9J A;  3I5B A;  4EUV A;  2X7I A;  2E1M C;  1BHN A;  1H74 A;  4YB6 A;  1GFW B;  1PYO B;  3H7H B;  2WHO A;  3Q2T C;  4WWS A;  2P6T A;  2KT2 A;  1WJ9 A;  2MHN A;  4OX9 J;  3TJA A;  3QZ8 A;  1RLD A;  4CH0 S;  1UW4 A;  4V19 X;  3IBF B;  4WZM A;  4OZN A;  4NLG A;  2BJ7 A;  2ZH2 A;  2XCA A;  1ZA1 B;  5DM6 Q;  3A8E A;  4DV1 J;  5EGY A;  3RB6 A;  4AQY J;  3TX0 A;  4ER8 A;  5KFS A;  1IBC B;  2HGM A;  4O3O A;  5I42 A;  1TTH B;  2N7C A;  2V8G A;  3KFW X;  3QT8 A;  2KXN B;  2YNI A;  1HYS B;  4K4W A;  4EYI B;  2Q66 A;  3TVY A;  2D41 A;  3ZTQ A;  1X60 A;  3OD2 A;  1K1S A;  1Y7P A;  3DDI A;  3VAM A;  1WHW A;  2BA9 A;  3AB2 B;  1Z2L A;  3T1H F;  4WIQ A;  5B0E A;  2JEI A;  2RKI A;  1S1X B;  1PYT A;  3QBC A;  5ETQ A;  4ED1 A;  1F9F A;  4KHP J;  4E8U A;  1U0S A;  3BGU A;  4HLB A;  4NLD A;  1D9A A;  4ZS6 A;  4H4M A;  2HVI A;  1KLM A;  3MTK A;  2B8Q A;  1HMV B;  1G3O A;  5SZT A;  1VK8 A;  5ETM A;  4TNO A;  2JSX A;  1D0E A;  2UXC J;  1MLA A;  4R0J A;  3UD4 P;  4B9L A;  1KVK A;  4ALZ A;  4OX7 A;  1SC4 B;  3IG1 A;  3ZZO A;  4A8Q A;  1XMB A;  1KKH A;  3D1H A;  2OPQ A;  3LGM A;  1W2B R;  3TEH B;  3NNC A;  5A0Y B;  3EYZ A;  4C8N A;  2WZ1 A;  2ADC A;  3U1M A;  1RTH A;  1JK9 B;  3GCX P;  4FYW B;  1X9W A;  5T7L A;  3EGW B;  1RB0 A;  1LK5 A;  3NS5 A;  3GJT B;  3MPV A;  4ED0 A;  4ID5 B;  2KHC A;  1UFK A;  2CQH A;  4HH1 A;  4CLY A;  1S0V A;  4O0I A;  5JVH Q;  4A8M P;  5KG3 A;  2W7A A;  3G6Y A;  4KV8 B;  4ZLN A;  1IQZ A;  1YJV A;  3TAN A;  2YKN A;  4UOF A;  3BF4 A;  4C0H A;  3GJR B;  4M5N A;  4RWX A;  1ZOT A;  4FXW A; 
#chains in the Genus database with same CATH homology
 3JQJ A;  4PYA A;  1EKR A;  2OHD A;  4PYD A;  4FDF A;  3JQK A;  2EEY A;  1EKS A;  3JQM A;  2EKN A;  2IIH A;  2IDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...