4PYDA

Moac in complex with cpmp crystallized in space group p212121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
142
Chain Sequence
AHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGDFKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
pubmed doi rcsb
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein MoaC
total genus 35
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4pydA00
2EKNA 4PYDA 3JQMA 2OHDA 3JQJA 1EKSA 2EEYA 2IIHA 3JQKA 4PYAA 4FDFA 2IDEA 1EKRA
chains in the Genus database with same CATH superfamily
3FRYA 3OUYB 4ATNA 3AOBA 3N5BA 2J9DE 2W2OP 3D54A 2IA0A 3D0GE 4URSA 4R5PB 2MXYA 3TUZC 4Q45A 3I9V9 4X4VA 4NCBA 2XZDB 5EX0A 2VQEF 4KJIA 2AP6A 2ZJQQ 3CTRA 3O8WA 1S1WA 5IT4A 1BLUA 1S48A 2M5YA 2JDJA 4IG3B 4NZ6A 5LMNF 1S9FA 4QW8A 2ZD1B 2RS2A 4ANCA 5FJ4A 1BD6A 4B3OA 4YEAA 4ZLLA 2F4FA 1FF2A 2ZJPQ 2VFSA 2C2EA 3UD3P 2F8MA 2POKA 3IG1A 1PYSB 5DDQC 3QSYB 1ULRA 1IBLF 4KR0B 2FHOB 2KXHA 2M4MA 3C14A 3G86A 3PFOA 1S6PB 3V2UC 2VICA 4Z2XA 1HI0P 2FJWA 3ENQA 3NGDA 2V4RA 4DLGA 1N5YB 3HZEA 1R8CA 4RL1A 1QVGR 1BC6A 3OD2A 4LJMA 2ZH8A 4CM2A 2KU7A 2YWKA 2GO8A 3KUEA 4I4BA 1RT2A 4DS4A 1T9XA 1FRIA 1SB6A 1TUWA 4LRAA 2O01C 3WIVA 4ECQA 4C8YA 2XZWA 3DHXA 4I69A 3DN9A 2HPUA 2R2TA 1S1WB 2Q6CA 4ZPWR 2IVYA 4ED8A 3TYTA 1V5VA 2DEJA 5J2NB 5MLCV 1RK8A 3EGNA 1NB7A 2J8AA 2HNZA 3DDIA 5BYQA 2OMOA 2JWNA 5L1IA 3SV3A 3ILIA 3EDRB 4JI5F 1FWKA 1OSDA 3OVBA 3ZC4A 3ZNUA 2LLZA 4DCOB 4AT1B 2R2UA 1EETA 3RGIA 4ECYA 3KNGA 1PCAA 3K8WA 4RO0A 2LDYA 4G65A 3DDNA 2I38A 3MMBB 1YBTA 1S6UA 2XGQA 5SUHA 3GR1A 1S6PA 3AOCA 2C3UA 2JLFA 1HI1A 2RDIA 3W2VA 4AD6A 3FNNA 3K5LA 2ALZA 1RHQB 4PWWA 5E5NA 2E29A 2OPQB 4NXNJ 2PMWA 1P1LA 2XMTA 3BS9A 2EKYA 4HHUA 5LXYA 5GAHI 1N0UA 4OYWA 1FJGF 1EARA 1RHMB 1E6VB 1MMNA 3N6NA 1RT1A 2UUWA 4DBQA 1NAQA 2QT7A 3GCXP 1C4AA 3OXLA 5LOQA 3HPOA 4LFBJ 2V63A 3ICLA 4WZMA 1N8RT 2BKPA 1EP4A 2DIVA 3F56A 4RKUC 5B0GA 4UT4A 2RDJA 4J9KA 1RTJB 1G2EA 2E5IA 2OTJS 1U1QA 1HHSA 2KYZA 1R8PA 3G6YA 2EXUA 1RDRA 2H65B 1UPPA 1JLBA 1NKEA 1FESA 1FRMA 2MYFA 3KDNA 5HATA 2DGSA 4OZLA 5HLFA 1T9TA 5KFWA 1UVMA 2PA3A 1XMBA 5GAGU 1NZAA 1UPMB 2BDPA 2DTJA 2Z2MA 3ILOA 3EPGA 2KXFA 3OT9A 4KGVB 4G1IA 1YI2S 2V9WA 4OZ1A 4YY3F 3HK2A 6AT1B 1D09B 4USWA 5KFCA 5KT6A 3NNAA 4KY3A 1SXLA 2RRBA 1JLGB 1JLAB 4DFMA 2IJNA 1RAHB 2LCWA 4F04B 3BSOA 2UV8A 2E9ZA 2ASLA 5E3PA 1RTZA 1XBWA 2BJEA 4NLUA 4J91A 1CEZA 2MKSA 2NUUG 4CLYA 2DNMA 4KH0B 2HQGA 1HW8A 1Q8BA 3CVKA 2FJXA 4NXMF 1SQFA 3IWLA 4N77A 4ZLJA 4DR4J 2VBWA 4YDXA 4QQBA 2NR0A 1RJJA 3AA9A 3BSCA 5H1SV 4USMA 3RB0A 1D9AA 3DU6A 1UA1A 3M8WA 1RABB 2FGCA 1HBUA 2CQIA 4DQIA 2HBZB 2B4VA 4IYQA 1IBKF 2YNHA 3QYYA 4DFKA 1FHTA 2JLGA 2MQLA 1YJTA 3OTCA 1ACMB 4ZITA 1EQ0A 3FGVA 4JI2F 5KT3A 2V2VA 2WONB 3O2IA 4O0NA 5HN0A 4LFCF 2C22A 3MAQA 1RWOB 3THPA 1Y00A 3KTQA 1LWFB 1TK8A 2ZBIA 3FKBA 3BR8A 3QGIA 2GMLA 3NGRA 5KFQA 2UUCF 2CPZA 2YX4A 3I0SA 2RVJA 3UD4P 4A8FA 3E2EA 3R9LA 4ZCIA 1LK7A 3CC2S 3VGVA 2DKOB 5C2GA 4AL5A 1ZM4A 2DH8A 3JAMY 4CLZA 4TU9A 3QMQA 3BKTA 5HP1A 4OX6A 5THWA 4HTIA 5A8KA 1DARA 1JLQA 3QFHA 4FVCA 2XHCA 2W2MP 4DCJB 5F8NA 1FX2A 3TWZA 2C2RA 3W62A 5KFMA 1VRTB 2DGOA 1EIYB 2EI5A 3CDUA 2ATLA 2ALYB 2X3DA 5DDPC 2NCKL 5LSLA 1R43A 4DUYJ 3MD1A 2CVEA 5LT5A 4CLSA 3PTWA 3JAMU 2DD8S 2J5AA 3IRXA 2AYBA 4F3QA 1F60B 3CE8A 4URQU 1S7IA 3CO9A 3FFIB 3DI6A 2RB7A 3M2UA 3M8QA 4PG4A 3W9JA 3IBCB 1RAOA 3LW5C 4ALZA 3S01A 1NK6A 3X1LB 5D0HA 3U1NA 2WBRA 1UVKA 3VVUA 1PJ5A 4WKRA 2ZE2B 5CA5A 2KH9A 3TVZA 1B0VA 1LWEA 3KOAA 4I2QA 2QA4S 1M1KT 1DZ5A 4JI1F 4U7UD 3CCQS 2CNKB 1FK9B 3JXOA 1NLKL 2MKCA 3W7BA 3I32A 4ZDNA 1UWBB 2GVZA 4OX9F 5KG3A 5RUBA 1L3KA 1T02A 3D6FB 4EGLA 1X5OA 3BO4A 4DWIA 3G8QA 4CT9A 2AX1A 3FCWA 3GJSB 4NLVA 1U6FA 3H40A 1VQ4S 2GQCA 2HFOA 4QBUA 3TX8A 2NSBA 2BXJA 5EWEA 4E0DA 3QIPB 2LECA 2D9PA 3TP2A 1YIJS 4ZVPB 5KFYA 3VAKA 1B0PA 1FKPB 3OLAA 1D9DA 3R5GA 3UN3A 1RAEB 4NLOA 1N6QA 4ECZA 3B4MA 4C4WA 4IG0A 4P2SA 1ZBTA 5CYJA 3KK2B 3VAFA 1S9GA 2ACMA 1E6YA 3J7AN 2XGPA 4J5OA 3T9NA 5DQGA 4I2QB 1N48A 5CAAA 3TUPA 2IRYA 3GWCA 1TFWA 2KI2A 4DV0F 4GRSA 4DV6F 1RT1B 3DLJA 4K2JA 1MN9A 3O6QA 4Y2IA 4B9NA 2M0GB 5J2QB 3NY0A 2V50A 4UOFA 4ZJQA 2EFQA 4GVBB 5H9FK 2FZGB 1S10A 3B78A 3F73A 4PAAA 4Y0FA 3PIPQ 1UEVA 2HWTA 2BZ2A 2IPOB 3OFGA 2A10A 2DHAA 2HGNA 1WEZA 3EGWB 4NA2A 2Z8QA 5CYQA 5A8RB 2VIHA 2B3TB 1FE0A 2Z0GA 4H4OA 2W7AA 1RCXB 3PRBA 2RAQA 3J7ZT 1FA0A 5DZ7A 4JI6F 3U1LA 4E8UA 1CJKB 4XDCA 4DQQA 3B8HA 1A6LA 1U48A 2G1HA 3EWGA 4CT8A 4MT1A 4C97A 1EB0A 2C28A 4EYHB 2OPSB 3L9ZA 5KAKA 1FVQA 1N32F 1FRHA 4QU6A 4I6YA 3AD9C 2QMUB 5KFVA 4YDDB 4U6PA 1ZTTA 2AZ1A 2LEPA 1MWYA 1D0EA 4C8KA 1HHQA 2K3IA 1CG2A 3OFFA 1ZZFA 4PPZA 4BC9A 2DH9A 4CM0A 3MPDA 7AT1B 3BV8A 1T3NA 2PEBA 3HZGA 4GO7X 5IZHA 1AZSB 1HNIB 3PYDA 4FS2A 3SQOP 2DHHA 3GG1A 2YH0A 4EO8A 2ZNYA 3MM5A 2Q1LA 3PO5A 1CULB 1RWPB 1WKKA 2X3GA 3HMJG 2GMHA 2ZZMA 1B7YB 2XULA 2WONA 4M5DB 4ZVEA 3KLHA 2CPIA 4QIFA 1KVKA 5AE2A 4ANEA 3V4MA 1NU4A 5HMWA 5D8HB 1FO1A 1S97A 5I4MA 3Q8VA 1KVIA 2C2NA 3KG4A 4C98A 2CDQA 3M8SA 1YJNS 1VHFA 4TYAA 4USVA 4DSLA 3I9ZA 2ZM6J 1SJ4P 4FF2A 3TEHB 3MOZA 4DSFA 3LWLA 1RT2B 1XEZA 2AEFA 2KB2A 4H4MA 4N5SA 4DSEA 1URNA 2UXCF 4OJGA 2OJ3A 2W1BA 2NPFA 1U1MA 1NO8A 1RBOB 5J2MB 3SQGB 3QZ8A 5J2PB 2BQRA 1VQ6S 4Y2CA 4CRJA 4Q44A 4X4RA 3MUTP 1NZ8A 3R3TA 1R8BA 4LF2A 2PA8D 2YH1A 2V8PA 1GT8A 2KT2A 3DRSA 1ZETA 1VC6A 3T1HJ 4HL9A 4K7QA 4AQYF 2LXIA 4ZN3A 2XBPA 1HQUB 1HNZJ 4ZOSA 4ZA1A 4G1PA 3THVA 1NSPA 1X5SA 4ZPTR 1K44A 3TJ8A 2F8HA 2UU9F 3EICA 4NLTA 2IRUA 4WP3A 1LV5A 1KLMA 1RHRB 4XPEA 1KHVA 1DTTA 3TAQA 2HMIB 3DOKA 4M5LA 2RDDA 3ZZOA 4PUOA 1FERA 4HVZA 1PILA 1VRTA 3FMWA 2W2NP 3RBDA 4FYYB 1T0TV 2DNLA 1J5EJ 2XLJA 3Q23A 2AYGA 1TMMA 2AJQA 1Q78A 1VJWA 3OTOJ 3R27A 3Q22A 2OFHX 4X66J 5LJ3Y 4O4GB 1TP7A 2B9XA 3IGNA 3K5PA 4FKXA 4K5SA 4QWEA 4WBFA 5D4NA 1JB0C 2CPEA 2EC2A 2ZDPA 4XO0A 3BM7A 1FDBA 4DMZA 3MURP 4DUZF 4TY8A 3BB5A 4LF4F 4JOUA 3CUNA 2J6UA 3NOGA 5B0AA 1TKZA 3IXQA 3ET6B 1HQUA 2HNYA 4NPOA 4P74A 4X62J 1VISA 2IIHA 1CJTA 2Q43A 1NJWA 3DGPA 3DMJB 2HQDA 3CB4A 4X84A 5KG2A 2O67A 2ZWOA 3A4TA 3EUNA 4B02A 4F4YA 5CYMA 3BZQA 4LF5F 4ZPVR 3SSRA 3JSMA 2Z2YB 2RRAA 2QSFA 4JI4F 4NXMJ 2OSQA 3IG1B 4B3TJ 2BE2A 1DFDA 2RQ4A 3M8PB 2DGXA 2Z57B 1DLOA 4DXLA 3TI0A 3OSPA 2W7PA 1JNRB 3GCWP 3HJVA 5J2QA 1ZM2A 1PO6A 2PFFB 2EBGA 1AXQA 2UVRA 3LPEA 3RBEA 2UUAJ 1GX6A 2QLJB 1VI7A 1TL1B 1YQHA 4DG1A 4CIOA 1X4AA 3C19A 4EFAC 4Z7CA 3NGTA 4OHVA 4UW2A 1RWMB 4Y2MA 4KHPF 2DNQA 2MSTA 1IWAA 4EWTA 4QWDA 5F9LA 1VDHA 1R6VA 2BBEA 4YB1P 3P5BP 1WKJA 4HH0A 5GAEI 3QWPA 4F25A 1HL6A 3AXMA 3N9UC 1TFYA 4OYXA 1CJVB 2DISA 2XSJA 3W66A 3ZZYA 4W4MA 5KG1A 4WZQA 3M2VB 4QPXA 4WFAQ 2YNIA 3FMBA 3ADAC 2FLOA 1WACA 2R7XA 3Q2TC 4KKOB 1AT1B 1P9QC 3TZYA 1QM9A 3PG9A 4CTAA 5KT7A 2HGMA 4OI2A 5DDRC 3I55S 3MCNA 4OHYA 2H3EB 4JI7F 2F4VF 2EFNA 3ZZTA 3Q0AA 1UJ4A 1Q8KA 2ILYA 5IT9Y 2VG6B 2H1YA 3UNYA 4DN9A 4DPXA 2IHR1 1KFDA 1CULA 1U26A 2DR6A 3ELHA 1QE1B 4NLQA 1Y10A 1NDPA 3ZXWA 3EX7B 1MG7A 1H0HB 3QWUA 1BY9A 1TKXA 3LOUA 5FDLB 4W92B 4OL8A 5G4DA 4DL3A 4KH1B 1YSJA 3UN5A 4Z37A 2UXDJ 2HHWA 3C6UB 3Q83A 4B3MJ 3SBMA 1R0BG 3LALA 2W2PP 3KUGA 4DCPB 3PX6A 1RUSA 4OYAA 1T8EA 3W60A 4Q8EA 3MHYA 4DDFA 4JI4J 2BANA 3HVTB 1JXLA 1JK9B 4LSNB 4Q43A 2ADCA 3HKZD 4ED4A 5A8WB 1K9MT 4ELTA 1ZPWX 3FRZA 3M2VA 3CCRS 4PXEA 2ASYA 2A6OA 5E3AA 4P6QA 3W2WB 2MZRA 3JYTA 1C1BA 2DR5A 2B6AA 2GW8A 1R6YA 2R3VA 2ZEJA 1Y3JA 3IS9B 2MLXA 4KIAA 1MNEA 5CHCB 1F5BA 5C24A 1VQMS 2B7BB 1QSYA 3UCUP 1REGX 3PO4A 5HBMB 1KKHA 2O66A 2VG6A 2VPWB 8ATCB 5L1JA 1UWBA 3GV5B 1S4FA 4DV1F 2FJAB 1H2UX 3PYFA 4TQSA 5BXIA 4RW8A 4DR3J 3BR9A 4ZP9A 1MU2A 4LRBA 4F2RA 4X66F 4U7UK 5HK4A 2U2FA 3Q8RB 1W2BR 3PYEA 3HF5A 3FZ2A 4DV4F 2XMKA 3HXMA 1CS4A 1NSKL 3GZ7A 5KFUA 2YY3A 3PACA 5EWFA 3PW0A 1KQSR 3RRKA 3MDFA 2Y8WA 3EVOA 4LVNP 4DEZA 4DF8A 2YWHA 3W65A 3HLUA 1U8WA 2AKWB 2BW7A 1WNEA 2LDIA 4MFBA 3R1HA 5DLGA 2DITA 5C25B 3V4IB 1Q16B 3RBXA 3GIKA 1RKJA 4AYBD 4YMEA 2L3MA 2GC8A 3A13A 3D68A 3DOLA 1WSRA 1MW7A 5LXRA 2BR0A 1JLQB 2C2MB 2HHPA 1V6HA 4HR2A 5DETA 3BH6B 4USIA 3ZZUA 5H9EJ 3K5OA 3NWGA 3BSNA 3RW6A 4I7FA 2OSRA 2BRKA 3KLVA 1J5OB 1S9GB 2VDHA 4FPRA 5BR8F 2CQHA 1UW9A 3I0SB 1U45A 1J27A 5K20B 1N33F 5ADZA 4KPCA 2BV3A 3PIOQ 2MZJA 3BO3A 1M5SA 3VAHA 4ETZA 5FLXU 3RZAA 5KOWA 3K57A 3GLJA 3W2WA 3JYTB 4DQPA 2JEIA 1S79A 1WELA 1Y5NB 2M8HA 2OPPA 1G4CA 1DQ9A 2RQMA 2Y0SD 3NP5A 5KFAA 3EZUA 1WHWA 1SVDA 5AT1B 3PRDA 3GONA 4PG7A 5KFZA 4MMOA 2NXJA 2CAJA 4F3MA 1U24A 2LMIA 1JJCB 2EG1A 1I5OB 5LMUF 4TY8B 2ADBA 1NH8A 1NUEA 3EDQB 1HBMB 1CBKA 1UJ5A 1VGYA 2A6MA 2JLEA 2OKQA 2PGCA 5AJ3F 3L3CA 1HYSA 2B4PA 4K2XA 4RBTA 2QJ3A 4RUHA 5HQ8A 5KFNA 1J5EF 4WTYA 3MM8A 3CJ4A 2GMJA 3QATA 4ZP7A 4ZCLA 5IC4B 2AJ2A 2F9DA 3NBPB 3PEHA 4PG8A 5KOXA 3DFEA 1UETA 4X2BA 1F3VA 2XG8A 5AJ3J 2BYCA 1QJHA 2OPQA 2HAFA 2HHHF 4Q2MA 4DR2J 3GSIA 4MIAA 5BYRA 4DL7A 1NJIT 3CGIA 2G0IA 2QMWA 3MCOA 1OY6A 4NXNF 1QTMA 3IM9A 3WC2A 3OSNA 2GX8A 3TRGA 3V5RA 3SCKE 2ZH6A 3WBZA 2K7KA 4DFPA 2ZBCA 2KT3A 4PKDB 1T3OA 1RTJA 2OHDA 2YVSA 5M2RA 4P71A 2QYGA 2DXEA 1Q4RA 2IMOA 3NAHA 2I6WA 4WFNQ 2MGZA 4XPCA 4OZNA 3T6BA 4DL5A 3IWNC 4XDDA 3C8YA 1NPPA 4KGXB 4I56A 1DY3A 1VIXA 1IKXA 2C3YA 3V81B 4F3OA 2HFNA 4I7FB 1NK4A 1I3OB 3B4DA 4LFAJ 1JMTA 2EBEA 1URRA 2V0NA 4DR1F 1FE4A 2CQ2A 2DXFA 4JBCA 3I87A 5AXMA 1RAAB 3A3NB 3NMRA 4KGMA 3TAPA 1FXLA 2HLTA 2XWYA 4Q2LA 2L9WA 4CO4A 5IS2A 2ZM6F 1T05B 4ECSA 3MWBA 2A0FB 4TY9A 4DR5F 3NKYA 4MKBA 2KXNB 2FLLA 1WOOA 1SKUB 4DLEA 2XMWA 4JI0F 4ENOA 3QJPA 3FSIA 2CG8A 3OV7A 4EZ9A 1O51A 2J9EA 2K8GA 3BEGB 4NA1A 1RT6A 2DY9A 1CVJA 1VBZA 1FRJA 5C24B 3JSYA 2J7WA 2M70A 2RH3A 3MUMP 3DMJA 5H9EK 1U1LA 4NCGB 1WF0A 2HVDA 4FBTA 1WC6A 3SSQA 3TZZA 3LTOA 1GXUA 2MQQA 4TU7A 1S6QB 2N3OA 2RU3A 2QRRA 3CEDA 4IFYA 4YN3B 4MKYA 3IC1A 4MKAA 5KG0A 1XIQA 3CDAA 3M8PA 3E8OA 3IR6B 4P72A 1YJUA 2GZOA 4A8MP 1ZZNA 3O5TB 1BMQB 4ED7A 3RB6A 3TUIC 3W2VB 1I94J 1Z2ZA 4WP8A 4FYDA 1Y3KA 3LP1A 2PI4A 2R42A 1RU2A 4MH8A 1CC8A 2YWWA 3PJXA 5KG4A 1CJKA 3D6TB 4C11B 5HSPA 2EWHA 2V5HG 3RRGA 2IBOA 1UJ6A 3S6EA 2V8GA 1HNVA 1PYTA 2BACA 2VD3A 2MKKA 1X4GA 1BQMB 4OYZA 2XC9A 1RWKB 2OELA 2PC6A 4MYTA 4CLWA 2L41A 5HAOA 1C0TB 2IM2A 3DC2A 4CDIA 4UZCA 8AT1B 3UVJA 2ZBQA 3CMQA 3KLHB 1WUUA 2YNIB 3P6YC 2E5LF 1CJUA 3T41A 4DV0J 2BE9B 2PEHA 4O3OA 1SJFA 4NA3A 1DRZA 3EMTA 1IBCB 4PRFA 1KEKA 2LU1A 4KFBA 3US5A 3BDPA 5HJYA 5HROB 2BJ3A 3TOQA 3T5KA 3RBZA 1RTDB 3MEDB 2WSEC 1VHIA 3SQGA 3SZ2A 2R7TA 9ATCB 4K4TA 3GIMA 4IUFA 1XNQF 2QE5A 2VPYB 3BBBA 1CJVA 2XSJB 2DK2A 3GJRB 2R7QA 1YITS 2OAUA 3KG0A 4I6WA 2FGOA 2BABA 4B3OB 1NHUA 3P45B 3ILJA 3R97A 4ZPBA 3RAMA 5K8NA 1F9HA 1SKWA 3C3LA 2IAJB 2FC9A 1X4BA 3AODA 2MEWA 3A8JA 3MM6B 3CXCR 3PM9A 4OHXA 3CJQA 2W7OA 1IR2A 1RB0A 1T9YA 1VYAA 2FHKA 3E01A 2DNOA 1RADB 1H73A 3MMCA 3TR5A 4HEA9 2V2ZA 3W63A 1M5KC 3CF5Q 1WI6A 2GIRA 4WFYA 3NCPA 2MTLA 3MEKA 4D3GA 1XR5A 4EYIB 4ZVRB 2V4JA 3T1YF 1X4HA 1RWWB 3I56S 2Z2ZA 2R7RA 3K5MA 3QT5A 1RHKB 3MEDA 4OQJA 4P2MA 3KLIA 1LW0B 1KVJA 3D1OA 2VA2A 4MJKA 5IT0A 2CQGA 1HLWA 2HBRB 4DPOA 4U8YA 3EM1A 5KFIA 3R7BB 4MIWA 4WE1B 4RW4A 5L1KA 1VLOA 1OJ4A 2QN6B 3ITHA 4HDHA 1XTZA 1S5ZA 2CVIA 4G1QB 4PEOA 1U4BA 3T1AA 2AF6A 5GADI 1YZ6A 5HMZA 3AHPA 4J37A 3ET6A 3W9HA 2AT1B 4JI5J 1IKYB 2ZKTA 4CP5A 1W26A 4LBIA 3ZZPA 2FD2A 4A8KA 1RYSA 4DR7J 1SKSA 2UU9J 3LP0A 2KRRA 2CQDA 4UOCA 2ZBPA 3DM2B 4ETXA 2KYXA 1WWHA 3Q8QB 3NXZA 2VONA 1CC7A 1ITPA 2LA4A 4ED0A 4ECTA 1U6BA 2O3DA 1BQXA 3T1HF 1N5QA 4ES3A 4B9MA 3TAMB 4NYZA 3CJRA 5ETRA 3IN5A 1S0VA 5EWGA 4LF6J 4ZJLA 3UNGC 4LFBF 1Q5YA 3J81Y 4IRCA 2VQFJ 2AJ0A 2JVOA 4YHHJ 5AXNA 1FI4A 2C3PA 2G2ZA 1NKBA 2HNDB 4CYUA 3PZPA 2RD5C 1S1XA 3D9BA 4LF8F 4HI2A 4K4ZA 5IM0A 2YKAA 3RRHA 3VQTA 2HRTA 2Y0BB 1AA1B 1HIYA 1RWUA 2JC1A 3GFHA 4I2PB 5IV4A 3PKMA 2DCUB 2VF3A 4EBCA 3GFXA 1G7CB 2XYGB 2C3MA 1C1CA 2CQ0A 4B3SJ 3W64A 2HS0A 4TNOA 1SH2A 1SUQB 4Y65A 3GQCA 1O8BA 3HCXA 2WK4A 3HHKA 1KS2A 4PQAA 3GPAA 1TK0A 3KLIB 1KC8T 1J5OA 1UWAA 3OR1A 4B17A 2VJVA 4FF1A 3AY0A 4DUTA 1XC9A 3KLGB 3PNIA 3NGUA 5EX3A 2HVHA 4CLLA 1GTEA 2DEIA 1K1QA 3DOLB 5L9NA 3RR8A 3HSZA 1FNMA 2Q3PA 4G1QA 5IT9U 1FFWB 1R3NA 1KD1T 1XERA 4GMKA 4DSJA 3R5DA 3VHQA 1XMOF 2YXLA 4DZDA 4LF7J 1VRUB 1WI8A 2B9EA 1VQNS 1RLCL 2F7VA 4UY8T 3GIRA 3PHTA 4CWBA 1F5CA 4F50A 5F3TA 2M2BA 4FYVB 4MIBA 1Q8LA 4K50A 1YWXA 2HFZA 5LSOA 1MSWD 3PRVA 1U1RA 1ZS6A 2P5VA 2JSXA 2YNFB 3IO1A 4C3LA 3MEEA 5A8RA 1QAIA 4WWSA 3POTB 5B7WA 3ZO7A 4K4UA 1C2PA 5KFBA 2XLIA 3BGLA 4ECXA 5AXKA 4HH1A 1O5JA 1N32J 3J7A1 5DLFA 5HBMA 3D1HA 3TVYA 1SC4B 1HD0A 4S0MA 4GKKJ 4ID5A 1VQ5S 1TV6A 3FDSA 1HNXJ 2YKMB 3CULA 4DR6J 1M1GA 2B6AB 3IS9A 5L8RC 5AE1A 3ETMA 1VOMA 2DR8A 4BDPA 4JI7J 1F0XA 4NLYA 3K8VA 4PXDA 5C7PA 1RTIB 3HHEA 4ICLB 2HK2A 5DDOC 4O0IA 1NSAA 3SDEA 1H6KX 2I5JA 1ZAVA 2IAJA 3M1VA 4DV5F 4IOAQ 1VJQA 1EAYC 3CCES 1RWVB 1FTRA 2XM3A 3OVSA 1PC5A 3AD8C 4JYAF 2E5GA 3ONQA 4OHZA 3MR5A 3M8RA 3MOJB 3QRRA 1YRUA 1B4SA 1FDDA 2VU5A 4OYPA 3VF0B 1O0PA 1EP4B 1KDNA 3BREA 2LFVA 3H2UB 1R89A 3A12A 4YB6A 2VG5B 3Q2SC 3I4HX 1X60A 2V8HA 2ZOGA 4ZK7M 4ZLPA 3R2CJ 2KVQE 3V81A 2R7UA 1FFGB 2F65A 3TJ9A 4ECWA 1OY8A 3K17A 1JQGA 4OZ2A 4E98A 3BO2A 1VRUA 2E44A 5KG6A 2YWFA 3H4DA 2OI2A 4F2SA 4ILLA 4ILRA 4WP9A 4CTAB 2CJAA 1NM2A 1IKYA 1FDAA 1U0HB 2QLWA 4OZ5A 2EFOA 3MEGA 4ZPDA 5E3CA 3KMQA 4NCGA 1PC4A 2CQ4A 3DLKA 4OV6A 2HLUA 1S0OA 1VQPS 4FYWB 1JJ4A 4ZPCA 4BHQA 3D66A 4WYWA 2QLFB 1CSJA 3TEGA 3IAS9 1QAJA 3QZ7A 1SL2A 3HT3A 4DX7A 2HHTA 1BGXT 4CLPA 2CJXB 5B0CA 2MZSA 4NOHA 3KLEA 4B9SA 4Q8FA 1OIAA 1XK8A 5T41A 5DQHA 3KJQB 3TZWA 3BKFA 2HHSA 2RHSB 1R7IA 2GAHC 5KG5A 1MROA 5IQQA 5F3ZA 2D1CA 3LP1B 2KHCA 1BQNB 3PFEA 4QJVA 4LSZB 4QW9A 5GMDA 3J81U 1DBDA 5EN1A 3OTEA 1DAXA 4UUWA 3RG6A 1U1OA 2XI2A 1VC0A 3PR4A 2VKRA 3OL8A 1Q95G 1F2HA 1RAFB 3LP0B 3MCMA 4R8UB 4ICLA 4DV7J 1D1UA 2I9SA 2M3DA 3NWRA 3DLHA 3KHLA 5G0RB 1TVRB 4Q0BB 1TL4A 4YP3A 2GVDB 2LQJA 1RISA 3I0RB 4KE5A 4WKYA 1L3UA 1VQ9S 4HLBA 2HZAA 3NG8A 2KDOA 2ZHBA 3O44A 5HQMA 4L3KA 1LK5A 1HARA 1FWLA 1TKZB 3AXKA 5DO2A 2HNYB 1YX2A 2HBYB 1NHVA 4UOGA 1J2VA 2ZH2A 4DSIA 5C42B 5I42B 4EZ6A 1WG1A 3WX8A 4Y00A 4RW6A 4CLTA 3PW5A 2ROGA 2YWGA 4LRCA 4CNZA 4ZVHA 1G6BA 5HP1B 1ICEB 5B0EA 4DUZJ 3UR3C 1Q0NA 4M8LA 3R7NB 1TL5A 3QAEA 2QSWA 4NLSA 3A8KA 1ZM3A 1RA7A 2MQPA 4X64J 2SXLA 2YPYA 1UA0A 3KLGA 2KTQA 4CH1A 5HO4A 4LFCJ 3DRPA 3F0NA 2EFVA 2B4UA 5KFDA 4ID8A 2HQ3A 2ZKUA 2OTLS 2M52A 3MI7X 5CYQB 3CD7A 1IKXB 3PEJA 5G0RA 2NXCA 4USUA 4QYZJ 1N5YA 1RTHA 5J1NA 5HMXA 2AGPA 1RAIB 2ZITA 2FDNA 2G2OA 2L9NA 3CCWA 1YHQS 3CNQP 3A3OB 1U2CA 4EBDA 1JXVA 1VCTA 2DHGA 2QGFB 4WK3A 3MUVP 4ILMA 2CA9A 2ZZNA 5LJ5Y 3N79A 1IBMJ 1JJ2R 2D74B 2R2SA 1K0TA 1TMJA 2GQ2A 2NXUA 4NRUA 1U6ZA 2VG7B 2HKEA 3AA8A 3CPWR 2AIRB 2Z4PA 3NCRA 2GVZB 1YDLA 2VQEJ 3NGKA 4ZIWA 5J2PA 2Z30B 1NK0A 1JLEB 1HPZB 3HFZB 1WTBA 3M7VA 2M88A 3BBFA 2VKZG 4U9RA 2IBKA 1GMWD 1X7VA 1DQAA 1X4EA 4I68A 4ZS6A 4DX8H 1V3ZA 4EK2A 1A0OB 1N5VA 4X4QA 1T9VA 1XJWB 2FHJA 3OPKA 4GC6A 2MQMA 3ENVA 4UOHA 3OLBA 3TARA 1JWWA 3LGNA 4K8RA 3K89A 4F4AA 1HA1A 2J7KA 2MZTA 4G3IA 4RU2A 5IOLA 5B09A 1SV5B 3IGVA 4ID5B 2VA3A 4WFZA 1VQOS 4ZP6A 2JNJA 4JI8F 4DHVA 3SCIE 2HGLA 4OLOA 2R7VA 1HBMA 5DJBA 3JB9k 2KM8B 1HMVA 3M1VB 2BJ7A 4QIWD 1JIHA 2CJ9A 4O3NA 1RWXB 4JI8J 2FVPA 2EFGA 4DV6J 2A2CA 1SPBP 3VGTA 2F40A 4NLRA 1L3TA 3KDOA 1YVFA 1T95A 4ED2A 3LPYA 1AUDA 4LFAF 3E01B 3LWMA 1RU1A 3RW7A 2HZVA 3A1YG 4PXCA 3QRQA 3BYRA 3MM9A 2HHXA 2YKQA 3R7SB 3BSAA 4OMFG 4RNFA 4L75A 1APSA 1QSSA 1JXEA 2WOMA 3AJDA 1R27B 3JQKA 4O4GA 3EZOA 3HSGA 4CH7A 1N54B 2XYPB 5DM6Q 2XY6A 5B0BA 1XQIA 1ZA1B 2WZ1A 3MCSA 4C0HA 4CQ1A 2NREA 1LXJA 7FD1A 1C0UB 3N4WA 3M8YA 5CXTA 2ZUGA 4C0OC 2XMMA 3MPWA 1IN0A 1RXOB 4RW9A 1S12A 4TYBA 4QR0A 3C6TA 4L73A 1BWVA 4F4XA 3AB2B 3ULHA 4RNHA 2C2OB 4HHJA 4OIXA 5T7LB 4X4UA 1N52B 2R7OA 1RT7A 5ETOA 2DGWA 3JTPA 2OIHA 2E5HA 5E3RA 2BE7D 3FEZA 1S99A 3QIPA 5CZXA 4X4TA 1KTQA 2QFIA 1RBLA 4FXDA 4P10A 4ZHRA 4PWUA 3SCLE 4KV8B 1LXNA 3WIUA 4B9UA 1NHKL 2A3JA 2HIQA 4KRWA 1QY7A 1S7HA 5LMNJ 2UVVA 4DR1J 1QTNB 1FCAA 1RP5A 3IR5B 5KTQA 2MY8A 3G8TA 1F1BB 3CJ0A 3SV4A 2HFVA 4IG0B 3LQVA 1YBAA 2J7UA 2E7WA 2F5GA 4L6V3 4RUBA 3PW2A 5ETTA 2CPHA 4B9LA 3DRYA 3PCOB 5JVGQ 5GAHU 2EC0A 1VQ8S 1HYSB 2VDIA 3FQLA 3QQCD 2AU0A 4NLPA 1RYRA 2ZE2A 2FVSA 2CNLB 3JSBA 3GJTB 3TQEA 2WTFA 4WFBQ 1UZHA 2BX6A 1JX4A 4LR9A 3Q86A 1YKWA 4B3MF 1TUVA 3M9OB 3EVMA 2BOAA 2CJBA 3GMGA 2B5JA 4C11A 4B08A 3W3SA 4IQXA 2MQNA 1UL3A 3UO0A 4K4WA 2CKWA 3V6DA 3M6UA 4WXOA 4RR5A 3H25A 3LP2B 5ETMA 3CIZA 2HSEB 4CI0B 3CCJS 4K4SA 4HACB 3VAMA 3RR7A 2HQCA 2E5JA 4IH5A 3L4BC 1FKOB 1T03B 4MTPA 2UZAA 3I31A 5HVFA 1ZAWA 3UD5A 4EU0A 1S1TB 1XN9A 1RT3A 2G13A 1HQEA 5F9NA 5IWAJ 5A2QY 2D3ZA 2E9TA 4C2MA 5E33A 2BVZA 2K06A 1YJVA 2JRSA 4LF1A 4UF4A 3GYXB 2I1RA 3HX9A 2CWXA 1F6TA 3HT0A 2V34A 4ZMMA 4DR4F 5D4PA 4DU7A 2MHEA 4OJ1A 1VQKS 1VRQC 1U1NA 1U25A 1HNWF 4Y6IA 2IYIA 4WXWA 3OVAA 3BQ0A 2D3OR 1RWNB 2B9WA 4F7VA 4OI6A 2VASA 3NNCA 2B56A 2JEJA 4RLEA 1HFEL 1F5AA 2CYYA 1RBAA 2W4DA 3FJ2A 3NS7B 2IVFB 3HVWA 3Q8YA 1HQ2A 2LVWA 4NEZA 4O23A 3CJKA 2MHNA 3ISND 2CJQA 3OFEA 4X65F 1MROB 2WAQD 4JI3J 1IR1A 4L3NA 2OPRA 2X51A 1BQNA 3RB3A 4ERDA 2X1FA 1WOPA 1QAYA 3MMJA 1KHWA 4RW8B 2WCXA 2FVQA 3J81j 2ZH1A 2B8PA 2YKOA 4DQSA 4TN2A 2BQ3A 4NZ0A 2JFKA 2E7VA 2K7JA 1RAGB 3QO9B 5EHHA 1IKVB 2J9CA 2FJVA 3LF0A 1U47A 1U0SA 4QR2A 5BYSA 3OUYA 1LWEB 2HAIA 2XHWA 3EGVA 4J9VA 4UQTA 3VAGA 1R8HA 2ATCB 3R5JB 2GGPA 1GXTA 3VZHA 2CG4A 2G1DA 1HD1A 3CD0A 4NLWA 5K14B 3VVTA 4L72B 4R8UA 3BGOP 1Y7PA 3MR7A 2J9DA 2W9AA 1V9OA 2HYIB 3M32A 1FXDA 1RCOB 3IAM9 2C2DA 1HWUA 2O1PA 1NH7A 1XNRJ 2QTWA 4OI4A 3DLEB 1AFJA 1H7XA 4DX5A 4QYZK 2YQ1A 5J2MA 2I8EA 1UFWA 1JNZB 1PGZA 1WG5A 2Q6BA 2AYMA 2KHDA 3QT6A 1NCLA 4FXWA 1ZYQA 2LEAA 2FLNA 4V19X 2K2PA 2DJWA 2G0JA 5C2CA 4UZBA 3VAIA 1MMDA 4JV5F 2NPIA 1GAOA 4RW6B 2I5JB 2PSZA 4DOZA 5IFMA 5J1EB 3OFHA 4Q7AA 2R9LA 1VK3A 3OHBA 4USJC 2HNDA 1ZAXA 3UPFA 2GJIA 2MMYA 4YUDA 2HHHJ 3OL7A 3LA0A 1KTVA 3QSIA 4KYZA 5L1LA 3ZTSA 2W9CA 4B3RJ 2UXBF 2CQBA 2U1AA 2V8VA 3DRPB 5I3PA 5LM7E 1IR0A 1IBLJ 1MN7A 3DRRA 3OR2A 2QIFA 1QE1A 2HNZB 3ZZRA 4F0HA 5BR8J 3NNHA 4RW9B 1EKRA 3MECB 5KT2A 1K47A 2PN6A 4FF4A 3AQPA 4FKYA 5K5MA 3ZTPA 3UR0A 2CPXA 3DLGA 3NLCA 5KT4A 2DHSA 3M9NB 2RIJA 1HNIA 1UFLA 4UTGA 4N41A 1X9WA 2M8DB 1RI7A 2E1AA 3G6VA 5KFOA 1T94A 3E51A 1KONA 1VBXA 1VQLS 1I1GA 3H5SA 1P1TA 2C2ZB 2YTCA 4LIWA 1SJ3P 4PR6A 3TUJC 4ECVA 1AW0A 3I0RA 2OH2A 3U1MA 3H5XA 4JUZA 4HDGA 1TZ0A 1TR0A 5JMNA 3JSRA 1LW0A 2HG4A 2MGZB 2MKJA 2P2CB 3UDLA 1HBNB 1OYEA 3QGGA 5DG9A 2C1EB 4O44B 1CS4B 4KO0B 3JTOA 4XK8C 1BXNA 4DX6A 5CABA 3CCLS 4J7CA 2MY7A 1TAQA 3FCVA 4U95A 4QIGA 1YRXA 2CZ4A 2E66A 3ZFVA 4ECRA 1FNXH 1AROP 2QG9B 2Y1RI 2IJRA 3GYGA 1A7GE 3AJ1A 1RHUB 2VBXA 3UFCX 4TU8A 2EG2A 1LWCA 2IMWP 1FKOA 2MDAA 2YKNB 4NEYA 1IUJA 3LH2S 2ZFHA 2JVRA 4OX8A 1KN6A 4Q5VA 2UP1A 4M95A 3D3BJ 2YNFA 3SEOA 4OI0A 1JKHA 5KFSA 4DV3J 3C2PA 1BHNA 1G1XA 2XLKA 4E2FB 2MZQA 3VQSA 3V6DB 1P8GA 2C42A 5DS7A 1VQSA 2YPZA 2XS7A 4OJHA 1UFKA 2IC3B 2WVDA 4RNOA 3CJTA 2MLZA 1L3SA 3W8PA 4KPYA 3AH6A 3K2YA 5A0YA 2I0XA 5I3UA 1NJXA 3MM9B 4J9NA 3V6KA 3GYNA 1RTIA 3D28A 4DR7F 5D4OA 1JLBB 1OMSA 4QWBA 4BWJA 2HEKA 1NDLA 3H42A 3UQSA 1D3WA 4PYDA 2FJBB 1GMWA 2HRUA 3ENAA 4QOTA 2DNGA 2Q79A 3HJFA 4NMLA 2J0WA 3QO9A 3L09A 2P8IA 1R0CB 4GO5X 4DJBA 2NSCA 1KLMB 1RZMA 2L48A 4X4PA 4J9PA 4LR7A 2ZBRA 1N6QB 3VV2B 3R6LB 5T14A 2VV5A 3QIDA 2IC3A 4R25A 2CPFA 3CJKB 4PQUA 4DL6A 2R4FA 1WHXA 4KO0A 2W8KA 2ZVIA 3SFGA 4LVOP 3CT9A 4J9UE 4C3KA 4F4ZA 3MPUB 3VALA 1NDKA 2DGTA 4PG6A 2J0XA 4ZVUB 4N8NA 1HHTP 1REVA 3MFIA 2AGOA 2V9KA 1WC4A 3AD7C 1R0AA 2WBMA 4KGKA 4NL5A 2EEYA 2LQ5A 4ED6A 1IBKJ 4IO1A 4KBIA 1WDTA 3FBEA 2JEGA 3DGVA 4RW7A 4OI3A 3OJSA 2EFPA 3H2VE 4FDFA 2KT5A 2ZHOA 1H98A 4DL2A 3HI9A 5GADU 3OR1B 4FS1A 1FD8A 4OV1A 3SIPB 1Q53A 3UWTA 5KFPA 3LAMA 4A8YA 2OGUA 3A8IA 3R1LA 2LYVA 3IMQJ 1UP1A 4KHPJ 3B54A 5JXSA 2ZH4A 3BN4A 1X9SA 2RU9A 2YWEA 2AWZA 2GQQA 3BGRB 4KQZA 4KHMA 2GO9A 3CCTA 4DN0A 2W9CB 1LW2B 1KFSA 1YJRA 1YJ9S 4NLGA 5M2PA 2GNKA 3BKUA 1S1VB 4I64A 4F4WA 1HMVB 1M5HA 2AV5A 5I3QA 1FX4A 1N88A 4QIEA 2VUGA 3W8GA 4DR2F 1PKUA 1IKWB 5DG7A 1SL0A 2DO0A 1DURA 1EX8A 2GIQA 4PZVA 3KYLA 3LP2A 4FN5A 3BBCA 3QLHA 2GJFA 4K0KJ 2CXEA 2W9BB 4J9LA 3UCGA 3EGZA 4LF9J 3D0IE 2DGUA 1DHMA 3R5CA 2XS5A 3QGHA 1YLXA 5L46A 1U1PA 5KFJA 1SC6A 3UI3A 2OEKA 4DPUA 1KSPA 3L7PA 3QJLA 1UTAA 2X7IA 1VBKA 2OPPB 4U8VA 1WF2A 3M05A 2XCAA 1AFIA 2CNOB 2DBBA 5M2UA 1K0VA 2VH7A 4M5IA 4Y2KA 5F8GA 2DPJA 4J9RA 2UUBF 1UVJA 1ZM9A 1WJ9A 3DRSB 5B08A 1A9NB 3PR5B 2Q66A 1X0FA 3BQ1A 2R8KA 1RLDA 2IM3A 1RTHB 1X31C 3ZZZA 5A76A 3DLEA 4J90A 5CD4H 4P7VA 4IDKA 4X4SA 4Y34A 3BPDA 4ES2A 3CMES 2VFUA 2N7CA 3L95X 2B9YA 2F63A 4F02A 3RAQA 3TZXA 4IOBA 2GHPA 4LF6F 3LGHA 1WD6A 4OLPA 4Y28C 1KR4A 2ACYA 3D67A 4ZP8A 5KFHA 1UVNA 2GFFA 2XCPA 3SXLA 4H4KA 2RILA 3H5YA 3WC0A 1RAJA 5SZTA 3EXCX 5HQLA 4AE5A 1HBOA 2IM0A 3AAWB 4A47A 3OHAA 3GIIA 1CPZA 2RKIB 3C16B 1RT5B 2KL8A 4ZJOA 4A8SA 4IH6A 2HHUA 1DQ8A 1HWIA 2HHVA 3DLKB 4WF9Q 2RT3A 1XR7A 3P4UB 5ETLA 2ZNZA 2WVEA 5D78A 1T05A 1EETB 3HFKA 4LMZA 4H4OB 4X64F 2O5DA 3O3LA 1FEEA 1QDUB 2QYCA 2X1BA 3KWMA 1HQEB 4WYLA 1E6VA 3HSDA 2PO4A 3GILA 4BCAA 2DRAA 2NZ4A 5J2NA 3MMCB 2GV1A 2HWIA 5FD1A 4O3PA 4A8WA 2EVZA 5C42A 5I42A 3H20A 1YTYA 2GCFA 5K8PA 3OR2B 3G96A 3EPIA 1T03A 4ED1A 1D8YA 1HNWJ 3R2DJ 1AYEA 1TKTB 3S7RA 2LA6A 1YGYA 5LSRA 1OPIA 2DNRA 2DNNA 3GFYA 4DUYF 4BS2A 1SC3B 3RTVA 2CJKA 5F8JA 1TV6B 4OYBA 4PQUB 1RT6B 2E7XA 5D15A 1OWXA 1Q1KA 3QT8A 2BJ8A 1GMUA 2BJ1A 5KG7A 5J1EA 4ES1A 1W2IA 5LMUJ 3UW1A 1LWXA 4P2FA 3CMAS 2Y9HA 2ILZA 2LQ9A 4YS2A 2JC0A 3GG0A 4U67Q 2LQ8A 2KO1A 4RNMA 3MAHA 1M5VC 5EUHA 2D41A 4LF9F 1X5TA 1WKLA 2XMJA 2UXDF 3CC4S 4YB5A 1NXIA 4ANDA 3NBPA 3PHEA 2ZD1A 1QSLA 2DR7A 3ENWA 1L3VA 5GVQA 4NI2B 4DV3F 4IH7A 3J7Z5 2QEXS 4OYOA 2GIFA 2RRNA 1JLCB 1Q8IA 5ETSA 2HK3A 3OTDA 2XO7A 3UVJB 1NPRA 3T19A 4P9SA 1WEYA 3ISNC 1HBOB 4TVAB 3TO8A 2R8JA 2FLPA 4IR1A 3NL0A 1PBAA 4W90B 2FJEB 1LW2A 4USKA 5K14A 4JI3F 2CPJA 3BH7B 5JVHQ 2JX2A 5DRKA 2AJ1A 3C15A 3G87A 4K4XA 2QL9B 2P9CA 1WHYA 1TTHB 3MEGB 5LL6d 4PPDA 2R8GA 3BGRA 4IR9A 1SH3A 3CDWA 2Y1JA 1GH8A 3GIJA 3C6TB 1XMQF 4BLGA 1U2RA 4FVMA 1NSQA 3EYZA 4OX7A 2H9ZA 2WVBA 3CJ5A 1LWCB 4RWWA 3UDEA 5HMYA 1S1VA 5D0EA 4HKQA 3KLFA 3NMAA 1SH0A 1TL7B 2VG5A 3VR1A 3KHGA 1YJ7A 1PJ7A 3DLBA 4CH0S 3P96A 3H7HB 4URGA 4DR5J 4ELUA 3T1YJ 4Z7YA 2CDRB 3S1TA 1XNQJ 1AUSL 5EDWA 3KK3B 3M2RB 3R8YA 1Q79A 4H4KC 3FBCA 2CPDA 5CZVA 5IM0B 4ELVA 3N0VA 3SYZA 1TKDA 4K4YA 2P6TA 2BEFA 4B3TF 3FC9A 1M1HA 1FWPA 2GA7A 3CDBA 2VL1A 3DOMB 2MQ8A 3MM7B 5A2QU 3CCMS 3TW0A 1C1CB 3CD5A 4N76A 2K1RA 1FDNA 2FHMA 1EKSA 3IRXB 3MD3A 2QFJA 2BKNA 3GB0A 1S72S 1Z2LA 1Q82T 1KNZA 4DG1B 2JH3A 2B7CB 1H2VZ 1SQEA 2LU2A 3QLHB 1T9UA 2KKHA 1FXRA 1MU2B 2JZ5A 3ZZ0A 1H3DA 3I5AA 3NEKA 3TANA 3U27A 4PYAA 2I2YA 1PAUB 4C7QA 1X4CA 3EE3A 3P3DA 3VGSA 3VAJA 5L39A 1MMLA 1G3OA 4LF4J 2BJ9A 2M7SA 3JSMB 4IDKB 1P6TA 1Z4UA 2IDEA 2V4JB 5ETNA 2VJUA 3POTA 3ISZA 1TQLA 5IV3A 2VHGA 1NPKA 3BGFA 3UDVA 3D2WA 2HFUA 2XYHB 5ITHA 1JLFB 2XB2D 1U2FA 3BYPA 1YBUA 3MR6A 5C5JA 2ZH7A 2FYXA 1PYOB 2VFRA 4USHA 2XMUA 2YBVA 1U49A 3K0JA 2RKIA 3C16A 4Y2AA 3I4PA 4DV7F 2GVDA 2XNQA 1S49A 2F4VJ 2HS3A 4USTA 1ELOA 1V3SA 2H54B 3DM2A 4LUBA 4DF4A 4ZPAA 4QCLA 1X4FA 1I6JA 3I6PA 4CO0A 2BOPA 3HVRA 4RU9A 1N5TA 1N5SA 1VS3A 3D7SB 2CNNB 5IXUA 3KJVB 4B3RF 2CQCA 2OEJA 3OTOF 3CW2C 2FZKB 3AFGA 1BE4A 3SMZA 2YX1A 2QLBB 3L7OA 2CQ3A 4NRTA 2HVZA 4PABA 3THTA 3W9IA 2B43A 2HFSA 3ITHB 3Q8SB 3G4SS 4CO3A 4B9TA 1VR6A 3H4BA 3TNVA 4ZCMA 3K59A 4JI2J 2ZOMA 1SUQA 1OSCA 3S8SA 2VOPA 3BDEA 3CSKA 3R5AA 5D0RA 9RUBA 2IM1A 2APOA 2DT9A 4TLQA 3OL6A 3V6HA 4LF7F 2CRLA 1IBMF 1D8ZA 2KN4A 2WW4A 3L7UA 4I2PA 3ZTRA 4DV2J 5BJRA 3Q24A 2PFDA 2IYGA 2VFVA 1VIOA 5HJXA 4AQYJ 1FJCA 2WRMA 3W5ZA 2CUYA 3LO3A 1VC5A 4AL6A 2RJZA 1RA6A 1Y11A 2WSCC 3H2LA 4QYRA 3N01A 3QT7A 5ETQA 1HPZA 4ZVSB 2KZZA 3IM8A 3KK1B 1HWJA 2DRBA 3GFZA 2CPYA 4RUCA 3EZ5A 5U47A 5KFFA 3HHLB 3NOCA 1PIEA 3DGPB 2DB1A 5HROA 1U09A 2H5JB 3JTNA 4YB7A 5ETKA 4WPAA 4NX9A 4ECUA 1Q81T 4JI6J 1FJEB 4I6AA 4C8ZA 2UXCJ 2KM8C 2WSFC 2WB1D 2BQUA 3R5BA 4L74A 3IWXA 1TK5A 3UDCA 2ZC3A 3DDKA 3HKWA 2BE2B 3FBBA 3DCAA 1D9FA 4TQRA 1DLOB 1EJ7L 3WDOA 4MFBB 2ZC4A 4K5RA 5ETPA 3GP9A 5CYMB 2AYEA 4C3MA 4DV1J 1OQ6A 1FT8A 4WU2A 2VQFF 1UKUA 3FQKA 4M63A 3N28A 2PMZD 4RZRA 1YK9A 4DR6F 4YR3A 3MMBA 4OJ3A 4DL4A 3G82B 4YOEA 2LXUA 4YR0A 1KWMA 2YKMA 3G2XA 1QLNA 4ZLNA 3RJMB 4JV2A 2N3LA 3MZIA 4K4VA 3FBFA 2N7YA 2V8DA 4MK8A 1GEHA 1YZ7A 1FJGJ 4Q0BA 4EI2A 3Q8UA 4LBHA 1M5PC 2OFGX 3P5TL 4F8RA 2VC0A 4JP8A 3KK3A 1B3TA 2PMHA 2RF2A 3N6LA 1SJRA 2HRYA 2DR9A 2HHQA 1WOSA 2J6SA 2BA9A 1ROFA 2FVCA 3NGSA 2H5EA 4HACA 4DV2F 2D3UA 3DNCA 3PW7A 2MZ1A 1RSCA 3NCQA 1FD2A 2E1PA 3I96A 1E6YB 1IJFB 2XY5A 3D3CJ 3T9ZA 2RUGA 2WVCA 3MECA 3I5CA 1IQTA 2FVRA 2KZMA 1NK5A 1JLGA 3NS6A 1XMOJ 1KLNA 3OXGA 4UQGA 1UZDA 1FVSA 1WTFA 3FSYA 3TA0A 1WSVA 2ZH5A 3QJJA 3TA2A 1SCJB 1QD1A 1Y5IB 3AT1B 3C6UA 4FPIA 1VQ7S 1U1KA 5CQGA 4O44A 4DSKA 3BPSP 5A6PA 1TKTA 4CO1A 4I0WA 1RTDA 4IG3A 4P73A 4C8MA 1FRLA 1O6XA 2VBZA 1UCNA 1F3FA 3DXSX 2XZTB 4HTJA 3W1YC 1HNVB 1WEXA 5MAOA 4LSLA 3IRWP 2OD6A 4P75A 2W8LA 1OY9A 1WF1A 2HVEA 2CJYB 3D5MA 1VLYA 4FF3A 1S0MA 3QGPA 4NI2A 2JFDA 3M6VA 3QFWA 1Q7LB 4KV8A 4OZ0A 3RYLA 4QZVB 2HIYA 5FLXY 2Z2LA 4MK9A 4ER8A 2W24A 5DM7Q 1IKWA 2OUGA 3CJSA 1VBYA 4O4RA 1VQYA 1BUXA 4YFUA 3HP6A 1FKAF 2XEXA 3I82A 5A6WA 3OL9A 2G9OA 3AJ2A 4B9VA 4FBUA 4GKJF 1SIZA 3MR3A 3HSJA 2V69A 2W01A 5KFRA 5K8OA 2HS4A 4ZCKA 4NCAA 3ZTQA 3R6GB 4AFFA 3G6ES 4HHHA 4OX9J 1IJEB 2RQCA 1JLCA 1RKIA 4UY85 1QUPA 5KFKA 1RT4B 1YRTA 1IQZA 2MSSA 2EW9A 4J9OA 4DI6A 4F67A 1LFPA 1GFWB 4N56A 2KG0A 2NQPA 2PI5A 2DCLA 4NLDA 3W5YA 5E2QA 2AW0A 4ED3A 5GAEU 4JYAJ 1S0NA 3EVWA 4KTQA 3PVXA 4CLUA 3PW4A 4CO5A 4O3SA 1VFJA 3GV7B 2MKYA 2OO4A 1B70B 4RBVA 4H4MB 2VZ9A 3ZTOA 2D3O1 3PV8A 5KFEA 4X4NA 2V4QA 2QV6A 2UVUA 2AMCB 2AGQA 3KJFB 1OO0B 3PJ9A 4HT7A 3AOAA 4P7TA 3W5XA 2DH7A 3CO0P 3HHLC 4EUVA 1RT5A 1TVRA 2QL5B 1KOHA 3MM7A 2YX7A 3KHHA 2H4WB 2FHJD 2VB6A 2ROPA 1RACB 1CQMA 2W2QP 3H5UA 4FXVA 3VWSA 4YR2A 4QWAA 3DKDA 3OXFA 3PKYA 1LFWA 3HHDA 5F8IA 3FSXA 3LAKA 4NE9C 4YY3J 3M8ZA 3C15B 3NRBA 2XMAA 1B64A 2UUCJ 2VODA 3H0PA 5E0OA 2H48B 3GV8B 3PX4A 4M5HA 5E7OB 2RUSA 1RT3B 3OQ2A 2HWHA 2OD4A 4FYXB 4ZIVA 2BM0A 2Z58B 3CJ2A 3WZ0A 2XQCA 2QA1A 1FEHA 1DTQA 2G2YA 1KOOA 3M6WA 3KK1A 1S9EB 3HD2A 4LR8A 2E5LJ 1Q7YT 1GMVA 2CZVC 2NUHA 4IKAA 2OPRB 4A8OA 4KSEB 4EMDA 2FIUA 3V6JA 1JJHA 2IA6A 1X8DA 2N4DA 5A8WA 2AZ3A 2JHEA 2B0GA 3GU0A 5T7LA 4ZKAA 2AQ4A 4PWDB 2H5IB 4RJVA 1ZH5A 1V5IB 4KB7A 1BQMA 4MYUA 4IFVA 3HDSA 2NS1B 4NYOA 4CCHA 3JQJA 4M94A 4TKTA 1XMQJ 2EPIA 1Y5LB 3Q8PB 1NJZA 2MPUA 2YNGB 5KT5A 2HURA 3GJQB 2V67A 2RNEA 2FY1A 3KJVA 4M5KA 2PIIA 4I1TA 1HWLA 2LXFA 2YQ3A 4F0MA 2BANB 3HVTA 3ETOA 4NYPA 2KG1A 3G71S 1EHWA 2OPSA 4IO9Q 3T5JA 1Z1ZA 3ILLA 5J1PA 4LF5J 1XR6A 2AX0A 4QPTA 2QA4G 3ZNJ1 3CJ8A 4JV5J 2HBQB 3M30B 3P8BB 1C1BB 4LREA 2HW3A 2W9BA 2A1BA 4HYKA 3GSDA 1CJTB 2DNYA 2MJUA 4RWXA 4RX6A 1IM6A 1UVLA 3CCSS 1I94F 1N33J 4KC5A 1F2GA 2QMXA 1TL3A 2X1GA 1R8AA 3MMAB 2FQQB 4K59A 5HVGA 2DGQA 5F8MA 3K7RA 1P27B 2UUTA 1NB2A 1S1TA 1NMEB 2WVFA 1T9WA 3F41A 1UW4A 5KFTA 2F1FA 5IQ6A 3T5HA 3PJWA 2G4BA 3IFEA 4KKOA 1PSDA 4LBPA 3P49B 4WK1A 2OLWA 1U7LA 4AXIA 2DGVA 2BMBA 2J76E 4M5GA 3KLFB 4RW7B 3BJYA 3HHLA 1SV5A 5L38A 2B5JB 2GAGC 2LQBA 3TQ1A 1K1SA 6FD1A 1BWEA 4GVLA 1XNRF 4V19J 2JL9A 3LGMA 3FVYA 4CNYA 4B3SF 5F8HA 4AXJA 3KHRA 4IRDA 1H2TZ 2A2DA 2Y1LB 5F0UA 1RQ0A 4ZN1A 5DGBA 2UUBJ 2VC1A 2AEMA 2VFTA 3TX0A 5K8MA 2IY5B 4OHWA 1N4LA 2DIUA 2WHOA 4WJBA 1QVFR 2IFXA 5HLFB 4C8LA 1B99A 4FZVA 2M9KA 2CWKA 2CQPA 5L9XA 2DO4A 5JJBA 3MFHA 2QA2A 6FDRA 4YHHF 1Q86T 3QRPA 2R8IA 1S6OA 2VPXB 4GC7A 2DNZA 3M4XA 4W98A 1C0UA 5DQIA 2Y3YA 1TKXB 2LP4A 5FDLA 4JI1J 4ZHRB 1HR0J 2DNKA 3GE9A 2WOMB 1EZZB 4M5NA 1F9FA 4PCQA 4X65J 4R0EA 2AJFE 4OZ3A 2BRLA 2JOQA 3GR0A 4CLFA 3CIMA 1RT7B 3QNWB 1PG5B 1HBNA 4N47A 5GAGI 2FUG9 4DFJA 1NK9A 1ZTWA 1C0TA 2RMLA 5I3UB 4CYUB 2B51A 1W25A 1NDCA 3UE2A 1KRPA 2VG7A 1ZA2B 3A8EA 3DU5A 4A48A 1GNKA 5D3GB 4EBEA 2QL7B 3G82A 4G6VB 3BGUA 1JLFA 1S77D 1IWGA 2BM1A 3SCJE 4FP9A 1Q5VA 3DLLQ 1TELA 4RUAA 1IKVA 2MJNA 4GKKF 3A3PB 1AZSA 1S9EA 1HKAA 3H59A 4LSLB 3WQPA 2KFZA 4NLXA 1EQMA 4QWCA 5A8KB 2PD1A 1H72C 1SC1B 3TVKA 3D6HB 1WC1A 5GMEA 3T5LA 1ZOTA 1FRXA 4KGZB 2LEBA 3KXDA 4NWBA 2FZCB 2YQ0A 3DI6B 4BC7A 4F26A 4J9SA 1CQNA 1U8SA 3MTKA 2W4CA 3K58A 2QO3A 2V2KA 4O3RA 3FK4A 3KMSA 3O1LA 4DU8A 2ROEA 4QIVA 2W4PA 2J8SA 3QBCA 2ASJA 3VCDA 4DL0C 2ZDOA 2IDLA 1H74A 4C0BA 4RW4B 4ITSA 4FNHA 2NYIA 1P9YA 5E3QA 3MM6A 2ZJRQ 2RE1A 1Y0HA 2E1MC 5AE3A 1YG0A 1UEKA 4CO2A 2ZWPA 3H98A 4GKJJ 5H9FJ 3J7YU 2NXEA 2X1AA 4LQ9A 4D3HA 2HQIA 1K73T 2RS8A 3IR7B 3OW2R 2NXNA 1S4EA 2KRBA 3PYGA 1W7WA 3DXBA 1S59A 2XSFA 5CCMA 3HULA 4V1Ak 4NZ7A 3FEYB 2WB4A 1FNOA 2NYHA 2V6AA 3T6JA 5HANA 1N34F 2YNGA 1N36J 2UVWA 3HD1A 2XNRA 4OYIA 4LQ3A 1HNZF 2KFNA 4DS5A 1S57A 2EK1A 2QC3A 3D1QA 5F41A 2COLA 1SIWB 2MKHA 3D6MB 4IFVB 3J7YI 1Y4ZB 3C14B 3CWJA 2AJ4A 4PG5A 4C8NA 3U7JA 4CZCA 3MGJA 4X4OA 1DJ0A 2HQFA 1WORA 3E3XA 3LUYA 5HVHA 1RT4A 3M2RA 5D3GA 4AUKA 3M30A 5DG8A 3DOKB 2E1RA 3IA0A 1SJ1A 1CLFA 2FC8A 3AB4B 5KFXA 1FFSB 3J80U 2E9RX 2UXBJ 5B0DA 1NRKA 2G0CA 3M6XA 4KAIA 3U02A 1JLEA 4GVBA 1H7WA 3WHIA 1L5UA 5F0WA 3CCUS 4R5PA 3RAXA 2V68A 1JLAA 2J0SD 4RNNA 3B6BA 3WX4A 2OEMA 1H38A 3MM8B 4WFXA 2MQOA 4EEYA 2N4CA 1UVIA 3KNAA 2QLXA 4IRKA 4C8OA 2RF2B 4NMXA 2Z56B 3BF4A 2Y8YA 4LRDA 2RSQA 2JJ4D 2YKNA 3CDEA 3MPVA 4PXBA 1MWQA 2EKNA 2JEFA 4I67A 3HFVA 2H51B 3KFWX 3KJNB 1MWZA 4LSNA 5A0YB 3RUBL 4F4KA 4DV5J 1X0PA 3VZIA 1MLAA 4DPTA 4KHRA 1KP6A 1KQKA 3PDNA 2R2RA 1S1UA 3OTBA 2AHOB 2D7SA 2DXDA 4BWMA 1YJWS 1LNQA 1WC3A 4BBYA 4IQMA 2DYAA 2CFXA 3JS9A 1OS5A 2C2KB 1R31A 4L76A 4LT6A 1SI9A 3TA1A 2GS8A 4M5DA 1NBEB 2ERRA 1PBUA 3MF5A 2A18A 3OBIA 3MAAB 3MR2A 3SSSA 1S6QA 3X3UA 2ZH9A 1OQ3A 2IRXA 1QUVA 2XS2A 4IFYB 4P52A 2BKOA 2ZH3A 3PX0A 2ASDA 1HI8A 2BW2A 1IVZA 3G9CA 2KJWA 2XI3A 4FNIA 4LRFA 1TL7A 5CCLA 3MPYA 1HR0F 3F44A 3SFUA 2FB0A 3DYAA 1NNDA 1X5PA 3FEXB 2BJDA 2AEJA 3IP0A 1REVB 1R0AB 2H4YB 4YQWA 2PDAA 1KBRA 3K5NA 3DRRB 1RHJB 4JV1A 1B0TA 5HI7A 3B82A 1NJYA 4WCEQ 3AQOA 1TL1A 3CJ3A 2DNHA 2UUAF 2NLWA 3MXHP 1HW9A 1KQGB 1WC5A 2VPZB 3MEEB 5CD4A 4LIRA 2NZCA 4EO6A 3JQMA 4LF8J 1RGVA 1VMBA 3DLGB 5FIIA 2XY7A 4XTTA 3MAAA 3NS5A 8RUCA 4A8XA 2F8EX 2CZ9A 4C9DA 1FK9A 1GQEA 1TL3B 2E1CA 1C4CA 4OZJA 1FKPA 1NK8A 1WC0A 2ZOFA 2FPHX 5DZ6A 4DZ6A 4DV4J 4PUOB 1S1UB 2DNPA 1LQ9A 1FTCA 2J0QD 2GHVC 3OJUA 3CC7S 3EJMA 3PY8A 3KK2A 3DOMA 3HHLD 4XAKA 4QR1A 1GX5A 2BUNA 5IWAF 2RQKA 5D4LA 4J9MA 1FJ7A 1NKCA 1SKRA 4JB8B 4ZVGA 1IM4A 3SDEB 1N56A 1KQFB 2V2QA 3HM9A 3C46A 3GTYX 4U7CA 2ZHAA 4MAKA 1Y9OA 4ZVQB 3M9MB 1M0SA 1SQGA 2DHXA 1UMJA 2GGPB 2ABYA 2K3KA 5ETVA 3TAMA 2F3JA 4M5MA 4K0KF 2XMVA 2PE8A 4DQRA 4OYMA 4HI1A 3D0HE 4M5JA 4A46A 5IC6B 3QAUA 4N8OA 5K9FA 3KLEB 4TXSA 2GJ2A 1UEUA 4TLRA 3G6XA 1NEEA 2MB0B 4ED5A 3DRXA 4H54A 4XIUA 5D0GA 4IOCQ 1PAEX 3FUYA 1S1XB 3UCZP 1T7PA 2MLYA 2C3OA 5AXLA 4WTOB 4QU7A 1X9MA 4C48A 3D4JA 4ZVTB 4PWDA 3LANA 2P9GA 3N6MA 1WHVA 2OMLA 2LKZA 4C6AA 1WDDA 2N82B 3CCZA 2XO6A 2DVIA 1ZPVA 3NAIA 4M1KA 5C25A 2FJDB 3V4IA 3CD6S 3DHWC 4A8QA 2L08A 4ZVOB 5DGAA 1JKHB 1N0VC 2FTRA 2ZVSA 4WE1A 1F9EB 4Y3CA 5CH7B 5D6GA 1V3RA 4A4JA 3FFIA 3M2UB 3M8QB 3J80Y 4F0KA 2J6TA 1I51B 1DTQB 1HWKA 3C66A 3CCVS 3EXYA 5B0FA 2XTJP 2QZ8A 4WIQA 3HO1A 4RBUA 2IJFA 2DRDA 2KVIA 3MM5B 3MTJA 2F9JA 4JI0J 2R7SA 3HVAA 1IXKA 1SJQA 1XWLA 2OP5A 2WW8A 4WU3A 1M5OC 1N34J 1OYDA 1N36F 1WG4A 2DY1A 3SI8A 1VK8A 4DR3F 1QAXA 3KKFA 4N7TA 3RU0A 3H90A 2KFYA 4WIIA 1U02A 2UV8G 4RPFA 4J9QA 2AD9A 4R0JA 2PT0A 2YKPA 2B4OA 1TU0B 4CLKA 2P9EA 4UUXA 4F36A 1GXLA 2GHWA 2XWXA 1M90T 1GTHA 1HNXF 2VOOA 2CQ1A 1SBRA 3QPIA 3PXGa 5KFLA 3KUHA 4DPWA 3FZBA 2CADA 2D9OA 1PJ6A 2MKIA 4AL7A 3VGUA 1NK7A 2YNHB 2VBYA 4MKVA 2R8HA 3W61A 5EGYA 2B8QA 2HVIA 3RB4A 2KJVA 3FCHA 3UN2A 5JUMA 1S76D 3I5BA 3N5FA 4KFBB 3MMAA 4ZVFA 2L9DA 3VTIA 3BN7A 2EK6A 2ZUAA 3H8YA 2CIMA 5KFGA 2Y1IA 1AB8A 1OPZA 1LOUA 4NASA 1RE1B 5D77A 4O3QA 1LWFA 5E41A 2V94A 5GMKa 1SL1A 1CJUB 3TJAA 1LKZA 1FRKA 1X4DA 4OI1A 4X62F 2W25A 4JV0A 2ZZTA 3BQ2A 2DPIA 2QX0A 2IVMA 4MK7A 3HHNB 4DPYA 1UAWA 2D69A 2K1RB 5HL7Q 1DTTB 1GK8A 1T11A 2FY8A 3IBWA 3M32B 4P2XA 2HMIA 4OFZA 2HZCA 3DYAB 3Q89A 2R7WA 3G8SA 3IBFB 4KT0C 5F8LA 1K8AT 1TAUA 1HBUB 1LEOA 3KG1A 1B7FA 7FDRA 4U96A 3T3FA 4HT5A 2RHQB 1U0HA 1TUGB 2P6SA
chains in the Genus database with same CATH topology
2EKNA 4PYDA 3JQMA 2OHDA 3JQJA 1EKSA 2EEYA 2IIHA 3JQKA 4PYAA 4FDFA 2IDEA 1EKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKN A;  4PYD A;  3JQM A;  2OHD A;  3JQJ A;  1EKS A;  2EEY A;  2IIH A;  3JQK A;  4PYA A;  4FDF A;  2IDE A;  1EKR A; 
#chains in the Genus database with same CATH topology
 3FRY A;  3OUY B;  4ATN A;  3AOB A;  3N5B A;  2J9D E;  2W2O P;  3D54 A;  2IA0 A;  3D0G E;  4URS A;  4R5P B;  2MXY A;  3TUZ C;  4Q45 A;  3I9V 9;  4X4V A;  4NCB A;  2XZD B;  5EX0 A;  2VQE F;  4KJI A;  2AP6 A;  2ZJQ Q;  3CTR A;  3O8W A;  1S1W A;  5IT4 A;  1BLU A;  1S48 A;  2M5Y A;  2JDJ A;  4IG3 B;  4NZ6 A;  5LMN F;  1S9F A;  4QW8 A;  2ZD1 B;  2RS2 A;  4ANC A;  5FJ4 A;  1BD6 A;  4B3O A;  4YEA A;  4ZLL A;  2F4F A;  1FF2 A;  2ZJP Q;  2VFS A;  2C2E A;  3UD3 P;  2F8M A;  2POK A;  3IG1 A;  1PYS B;  5DDQ C;  3QSY B;  1ULR A;  1IBL F;  4KR0 B;  2FHO B;  2KXH A;  2M4M A;  3C14 A;  3G86 A;  3PFO A;  1S6P B;  3V2U C;  2VIC A;  4Z2X A;  1HI0 P;  2FJW A;  3ENQ A;  3NGD A;  2V4R A;  4DLG A;  1N5Y B;  3HZE A;  1R8C A;  4RL1 A;  1QVG R;  1BC6 A;  3OD2 A;  4LJM A;  2ZH8 A;  4CM2 A;  2KU7 A;  2YWK A;  2GO8 A;  3KUE A;  4I4B A;  1RT2 A;  4DS4 A;  1T9X A;  1FRI A;  1SB6 A;  1TUW A;  4LRA A;  2O01 C;  3WIV A;  4ECQ A;  4C8Y A;  2XZW A;  3DHX A;  4I69 A;  3DN9 A;  2HPU A;  2R2T A;  1S1W B;  2Q6C A;  4ZPW R;  2IVY A;  4ED8 A;  3TYT A;  1V5V A;  2DEJ A;  5J2N B;  5MLC V;  1RK8 A;  3EGN A;  1NB7 A;  2J8A A;  2HNZ A;  3DDI A;  5BYQ A;  2OMO A;  2JWN A;  5L1I A;  3SV3 A;  3ILI A;  3EDR B;  4JI5 F;  1FWK A;  1OSD A;  3OVB A;  3ZC4 A;  3ZNU A;  2LLZ A;  4DCO B;  4AT1 B;  2R2U A;  1EET A;  3RGI A;  4ECY A;  3KNG A;  1PCA A;  3K8W A;  4RO0 A;  2LDY A;  4G65 A;  3DDN A;  2I38 A;  3MMB B;  1YBT A;  1S6U A;  2XGQ A;  5SUH A;  3GR1 A;  1S6P A;  3AOC A;  2C3U A;  2JLF A;  1HI1 A;  2RDI A;  3W2V A;  4AD6 A;  3FNN A;  3K5L A;  2ALZ A;  1RHQ B;  4PWW A;  5E5N A;  2E29 A;  2OPQ B;  4NXN J;  2PMW A;  1P1L A;  2XMT A;  3BS9 A;  2EKY A;  4HHU A;  5LXY A;  5GAH I;  1N0U A;  4OYW A;  1FJG F;  1EAR A;  1RHM B;  1E6V B;  1MMN A;  3N6N A;  1RT1 A;  2UUW A;  4DBQ A;  1NAQ A;  2QT7 A;  3GCX P;  1C4A A;  3OXL A;  5LOQ A;  3HPO A;  4LFB J;  2V63 A;  3ICL A;  4WZM A;  1N8R T;  2BKP A;  1EP4 A;  2DIV A;  3F56 A;  4RKU C;  5B0G A;  4UT4 A;  2RDJ A;  4J9K A;  1RTJ B;  1G2E A;  2E5I A;  2OTJ S;  1U1Q A;  1HHS A;  2KYZ A;  1R8P A;  3G6Y A;  2EXU A;  1RDR A;  2H65 B;  1UPP A;  1JLB A;  1NKE A;  1FES A;  1FRM A;  2MYF A;  3KDN A;  5HAT A;  2DGS A;  4OZL A;  5HLF A;  1T9T A;  5KFW A;  1UVM A;  2PA3 A;  1XMB A;  5GAG U;  1NZA A;  1UPM B;  2BDP A;  2DTJ A;  2Z2M A;  3ILO A;  3EPG A;  2KXF A;  3OT9 A;  4KGV B;  4G1I A;  1YI2 S;  2V9W A;  4OZ1 A;  4YY3 F;  3HK2 A;  6AT1 B;  1D09 B;  4USW A;  5KFC A;  5KT6 A;  3NNA A;  4KY3 A;  1SXL A;  2RRB A;  1JLG B;  1JLA B;  4DFM A;  2IJN A;  1RAH B;  2LCW A;  4F04 B;  3BSO A;  2UV8 A;  2E9Z A;  2ASL A;  5E3P A;  1RTZ A;  1XBW A;  2BJE A;  4NLU A;  4J91 A;  1CEZ A;  2MKS A;  2NUU G;  4CLY A;  2DNM A;  4KH0 B;  2HQG A;  1HW8 A;  1Q8B A;  3CVK A;  2FJX A;  4NXM F;  1SQF A;  3IWL A;  4N77 A;  4ZLJ A;  4DR4 J;  2VBW A;  4YDX A;  4QQB A;  2NR0 A;  1RJJ A;  3AA9 A;  3BSC A;  5H1S V;  4USM A;  3RB0 A;  1D9A A;  3DU6 A;  1UA1 A;  3M8W A;  1RAB B;  2FGC A;  1HBU A;  2CQI A;  4DQI A;  2HBZ B;  2B4V A;  4IYQ A;  1IBK F;  2YNH A;  3QYY A;  4DFK A;  1FHT A;  2JLG A;  2MQL A;  1YJT A;  3OTC A;  1ACM B;  4ZIT A;  1EQ0 A;  3FGV A;  4JI2 F;  5KT3 A;  2V2V A;  2WON B;  3O2I A;  4O0N A;  5HN0 A;  4LFC F;  2C22 A;  3MAQ A;  1RWO B;  3THP A;  1Y00 A;  3KTQ A;  1LWF B;  1TK8 A;  2ZBI A;  3FKB A;  3BR8 A;  3QGI A;  2GML A;  3NGR A;  5KFQ A;  2UUC F;  2CPZ A;  2YX4 A;  3I0S A;  2RVJ A;  3UD4 P;  4A8F A;  3E2E A;  3R9L A;  4ZCI A;  1LK7 A;  3CC2 S;  3VGV A;  2DKO B;  5C2G A;  4AL5 A;  1ZM4 A;  2DH8 A;  3JAM Y;  4CLZ A;  4TU9 A;  3QMQ A;  3BKT A;  5HP1 A;  4OX6 A;  5THW A;  4HTI A;  5A8K A;  1DAR A;  1JLQ A;  3QFH A;  4FVC A;  2XHC A;  2W2M P;  4DCJ B;  5F8N A;  1FX2 A;  3TWZ A;  2C2R A;  3W62 A;  5KFM A;  1VRT B;  2DGO A;  1EIY B;  2EI5 A;  3CDU A;  2ATL A;  2ALY B;  2X3D A;  5DDP C;  2NCK L;  5LSL A;  1R43 A;  4DUY J;  3MD1 A;  2CVE A;  5LT5 A;  4CLS A;  3PTW A;  3JAM U;  2DD8 S;  2J5A A;  3IRX A;  2AYB A;  4F3Q A;  1F60 B;  3CE8 A;  4URQ U;  1S7I A;  3CO9 A;  3FFI B;  3DI6 A;  2RB7 A;  3M2U A;  3M8Q A;  4PG4 A;  3W9J A;  3IBC B;  1RAO A;  3LW5 C;  4ALZ A;  3S01 A;  1NK6 A;  3X1L B;  5D0H A;  3U1N A;  2WBR A;  1UVK A;  3VVU A;  1PJ5 A;  4WKR A;  2ZE2 B;  5CA5 A;  2KH9 A;  3TVZ A;  1B0V A;  1LWE A;  3KOA A;  4I2Q A;  2QA4 S;  1M1K T;  1DZ5 A;  4JI1 F;  4U7U D;  3CCQ S;  2CNK B;  1FK9 B;  3JXO A;  1NLK L;  2MKC A;  3W7B A;  3I32 A;  4ZDN A;  1UWB B;  2GVZ A;  4OX9 F;  5KG3 A;  5RUB A;  1L3K A;  1T02 A;  3D6F B;  4EGL A;  1X5O A;  3BO4 A;  4DWI A;  3G8Q A;  4CT9 A;  2AX1 A;  3FCW A;  3GJS B;  4NLV A;  1U6F A;  3H40 A;  1VQ4 S;  2GQC A;  2HFO A;  4QBU A;  3TX8 A;  2NSB A;  2BXJ A;  5EWE A;  4E0D A;  3QIP B;  2LEC A;  2D9P A;  3TP2 A;  1YIJ S;  4ZVP B;  5KFY A;  3VAK A;  1B0P A;  1FKP B;  3OLA A;  1D9D A;  3R5G A;  3UN3 A;  1RAE B;  4NLO A;  1N6Q A;  4ECZ A;  3B4M A;  4C4W A;  4IG0 A;  4P2S A;  1ZBT A;  5CYJ A;  3KK2 B;  3VAF A;  1S9G A;  2ACM A;  1E6Y A;  3J7A N;  2XGP A;  4J5O A;  3T9N A;  5DQG A;  4I2Q B;  1N48 A;  5CAA A;  3TUP A;  2IRY A;  3GWC A;  1TFW A;  2KI2 A;  4DV0 F;  4GRS A;  4DV6 F;  1RT1 B;  3DLJ A;  4K2J A;  1MN9 A;  3O6Q A;  4Y2I A;  4B9N A;  2M0G B;  5J2Q B;  3NY0 A;  2V50 A;  4UOF A;  4ZJQ A;  2EFQ A;  4GVB B;  5H9F K;  2FZG B;  1S10 A;  3B78 A;  3F73 A;  4PAA A;  4Y0F A;  3PIP Q;  1UEV A;  2HWT A;  2BZ2 A;  2IPO B;  3OFG A;  2A10 A;  2DHA A;  2HGN A;  1WEZ A;  3EGW B;  4NA2 A;  2Z8Q A;  5CYQ A;  5A8R B;  2VIH A;  2B3T B;  1FE0 A;  2Z0G A;  4H4O A;  2W7A A;  1RCX B;  3PRB A;  2RAQ A;  3J7Z T;  1FA0 A;  5DZ7 A;  4JI6 F;  3U1L A;  4E8U A;  1CJK B;  4XDC A;  4DQQ A;  3B8H A;  1A6L A;  1U48 A;  2G1H A;  3EWG A;  4CT8 A;  4MT1 A;  4C97 A;  1EB0 A;  2C28 A;  4EYH B;  2OPS B;  3L9Z A;  5KAK A;  1FVQ A;  1N32 F;  1FRH A;  4QU6 A;  4I6Y A;  3AD9 C;  2QMU B;  5KFV A;  4YDD B;  4U6P A;  1ZTT A;  2AZ1 A;  2LEP A;  1MWY A;  1D0E A;  4C8K A;  1HHQ A;  2K3I A;  1CG2 A;  3OFF A;  1ZZF A;  4PPZ A;  4BC9 A;  2DH9 A;  4CM0 A;  3MPD A;  7AT1 B;  3BV8 A;  1T3N A;  2PEB A;  3HZG A;  4GO7 X;  5IZH A;  1AZS B;  1HNI B;  3PYD A;  4FS2 A;  3SQO P;  2DHH A;  3GG1 A;  2YH0 A;  4EO8 A;  2ZNY A;  3MM5 A;  2Q1L A;  3PO5 A;  1CUL B;  1RWP B;  1WKK A;  2X3G A;  3HMJ G;  2GMH A;  2ZZM A;  1B7Y B;  2XUL A;  2WON A;  4M5D B;  4ZVE A;  3KLH A;  2CPI A;  4QIF A;  1KVK A;  5AE2 A;  4ANE A;  3V4M A;  1NU4 A;  5HMW A;  5D8H B;  1FO1 A;  1S97 A;  5I4M A;  3Q8V A;  1KVI A;  2C2N A;  3KG4 A;  4C98 A;  2CDQ A;  3M8S A;  1YJN S;  1VHF A;  4TYA A;  4USV A;  4DSL A;  3I9Z A;  2ZM6 J;  1SJ4 P;  4FF2 A;  3TEH B;  3MOZ A;  4DSF A;  3LWL A;  1RT2 B;  1XEZ A;  2AEF A;  2KB2 A;  4H4M A;  4N5S A;  4DSE A;  1URN A;  2UXC F;  4OJG A;  2OJ3 A;  2W1B A;  2NPF A;  1U1M A;  1NO8 A;  1RBO B;  5J2M B;  3SQG B;  3QZ8 A;  5J2P B;  2BQR A;  1VQ6 S;  4Y2C A;  4CRJ A;  4Q44 A;  4X4R A;  3MUT P;  1NZ8 A;  3R3T A;  1R8B A;  4LF2 A;  2PA8 D;  2YH1 A;  2V8P A;  1GT8 A;  2KT2 A;  3DRS A;  1ZET A;  1VC6 A;  3T1H J;  4HL9 A;  4K7Q A;  4AQY F;  2LXI A;  4ZN3 A;  2XBP A;  1HQU B;  1HNZ J;  4ZOS A;  4ZA1 A;  4G1P A;  3THV A;  1NSP A;  1X5S A;  4ZPT R;  1K44 A;  3TJ8 A;  2F8H A;  2UU9 F;  3EIC A;  4NLT A;  2IRU A;  4WP3 A;  1LV5 A;  1KLM A;  1RHR B;  4XPE A;  1KHV A;  1DTT A;  3TAQ A;  2HMI B;  3DOK A;  4M5L A;  2RDD A;  3ZZO A;  4PUO A;  1FER A;  4HVZ A;  1PIL A;  1VRT A;  3FMW A;  2W2N P;  3RBD A;  4FYY B;  1T0T V;  2DNL A;  1J5E J;  2XLJ A;  3Q23 A;  2AYG A;  1TMM A;  2AJQ A;  1Q78 A;  1VJW A;  3OTO J;  3R27 A;  3Q22 A;  2OFH X;  4X66 J;  5LJ3 Y;  4O4G B;  1TP7 A;  2B9X A;  3IGN A;  3K5P A;  4FKX A;  4K5S A;  4QWE A;  4WBF A;  5D4N A;  1JB0 C;  2CPE A;  2EC2 A;  2ZDP A;  4XO0 A;  3BM7 A;  1FDB A;  4DMZ A;  3MUR P;  4DUZ F;  4TY8 A;  3BB5 A;  4LF4 F;  4JOU A;  3CUN A;  2J6U A;  3NOG A;  5B0A A;  1TKZ A;  3IXQ A;  3ET6 B;  1HQU A;  2HNY A;  4NPO A;  4P74 A;  4X62 J;  1VIS A;  2IIH A;  1CJT A;  2Q43 A;  1NJW A;  3DGP A;  3DMJ B;  2HQD A;  3CB4 A;  4X84 A;  5KG2 A;  2O67 A;  2ZWO A;  3A4T A;  3EUN A;  4B02 A;  4F4Y A;  5CYM A;  3BZQ A;  4LF5 F;  4ZPV R;  3SSR A;  3JSM A;  2Z2Y B;  2RRA A;  2QSF A;  4JI4 F;  4NXM J;  2OSQ A;  3IG1 B;  4B3T J;  2BE2 A;  1DFD A;  2RQ4 A;  3M8P B;  2DGX A;  2Z57 B;  1DLO A;  4DXL A;  3TI0 A;  3OSP A;  2W7P A;  1JNR B;  3GCW P;  3HJV A;  5J2Q A;  1ZM2 A;  1PO6 A;  2PFF B;  2EBG A;  1AXQ A;  2UVR A;  3LPE A;  3RBE A;  2UUA J;  1GX6 A;  2QLJ B;  1VI7 A;  1TL1 B;  1YQH A;  4DG1 A;  4CIO A;  1X4A A;  3C19 A;  4EFA C;  4Z7C A;  3NGT A;  4OHV A;  4UW2 A;  1RWM B;  4Y2M A;  4KHP F;  2DNQ A;  2MST A;  1IWA A;  4EWT A;  4QWD A;  5F9L A;  1VDH A;  1R6V A;  2BBE A;  4YB1 P;  3P5B P;  1WKJ A;  4HH0 A;  5GAE I;  3QWP A;  4F25 A;  1HL6 A;  3AXM A;  3N9U C;  1TFY A;  4OYX A;  1CJV B;  2DIS A;  2XSJ A;  3W66 A;  3ZZY A;  4W4M A;  5KG1 A;  4WZQ A;  3M2V B;  4QPX A;  4WFA Q;  2YNI A;  3FMB A;  3ADA C;  2FLO A;  1WAC A;  2R7X A;  3Q2T C;  4KKO B;  1AT1 B;  1P9Q C;  3TZY A;  1QM9 A;  3PG9 A;  4CTA A;  5KT7 A;  2HGM A;  4OI2 A;  5DDR C;  3I55 S;  3MCN A;  4OHY A;  2H3E B;  4JI7 F;  2F4V F;  2EFN A;  3ZZT A;  3Q0A A;  1UJ4 A;  1Q8K A;  2ILY A;  5IT9 Y;  2VG6 B;  2H1Y A;  3UNY A;  4DN9 A;  4DPX A;  2IHR 1;  1KFD A;  1CUL A;  1U26 A;  2DR6 A;  3ELH A;  1QE1 B;  4NLQ A;  1Y10 A;  1NDP A;  3ZXW A;  3EX7 B;  1MG7 A;  1H0H B;  3QWU A;  1BY9 A;  1TKX A;  3LOU A;  5FDL B;  4W92 B;  4OL8 A;  5G4D A;  4DL3 A;  4KH1 B;  1YSJ A;  3UN5 A;  4Z37 A;  2UXD J;  2HHW A;  3C6U B;  3Q83 A;  4B3M J;  3SBM A;  1R0B G;  3LAL A;  2W2P P;  3KUG A;  4DCP B;  3PX6 A;  1RUS A;  4OYA A;  1T8E A;  3W60 A;  4Q8E A;  3MHY A;  4DDF A;  4JI4 J;  2BAN A;  3HVT B;  1JXL A;  1JK9 B;  4LSN B;  4Q43 A;  2ADC A;  3HKZ D;  4ED4 A;  5A8W B;  1K9M T;  4ELT A;  1ZPW X;  3FRZ A;  3M2V A;  3CCR S;  4PXE A;  2ASY A;  2A6O A;  5E3A A;  4P6Q A;  3W2W B;  2MZR A;  3JYT A;  1C1B A;  2DR5 A;  2B6A A;  2GW8 A;  1R6Y A;  2R3V A;  2ZEJ A;  1Y3J A;  3IS9 B;  2MLX A;  4KIA A;  1MNE A;  5CHC B;  1F5B A;  5C24 A;  1VQM S;  2B7B B;  1QSY A;  3UCU P;  1REG X;  3PO4 A;  5HBM B;  1KKH A;  2O66 A;  2VG6 A;  2VPW B;  8ATC B;  5L1J A;  1UWB A;  3GV5 B;  1S4F A;  4DV1 F;  2FJA B;  1H2U X;  3PYF A;  4TQS A;  5BXI A;  4RW8 A;  4DR3 J;  3BR9 A;  4ZP9 A;  1MU2 A;  4LRB A;  4F2R A;  4X66 F;  4U7U K;  5HK4 A;  2U2F A;  3Q8R B;  1W2B R;  3PYE A;  3HF5 A;  3FZ2 A;  4DV4 F;  2XMK A;  3HXM A;  1CS4 A;  1NSK L;  3GZ7 A;  5KFU A;  2YY3 A;  3PAC A;  5EWF A;  3PW0 A;  1KQS R;  3RRK A;  3MDF A;  2Y8W A;  3EVO A;  4LVN P;  4DEZ A;  4DF8 A;  2YWH A;  3W65 A;  3HLU A;  1U8W A;  2AKW B;  2BW7 A;  1WNE A;  2LDI A;  4MFB A;  3R1H A;  5DLG A;  2DIT A;  5C25 B;  3V4I B;  1Q16 B;  3RBX A;  3GIK A;  1RKJ A;  4AYB D;  4YME A;  2L3M A;  2GC8 A;  3A13 A;  3D68 A;  3DOL A;  1WSR A;  1MW7 A;  5LXR A;  2BR0 A;  1JLQ B;  2C2M B;  2HHP A;  1V6H A;  4HR2 A;  5DET A;  3BH6 B;  4USI A;  3ZZU A;  5H9E J;  3K5O A;  3NWG A;  3BSN A;  3RW6 A;  4I7F A;  2OSR A;  2BRK A;  3KLV A;  1J5O B;  1S9G B;  2VDH A;  4FPR A;  5BR8 F;  2CQH A;  1UW9 A;  3I0S B;  1U45 A;  1J27 A;  5K20 B;  1N33 F;  5ADZ A;  4KPC A;  2BV3 A;  3PIO Q;  2MZJ A;  3BO3 A;  1M5S A;  3VAH A;  4ETZ A;  5FLX U;  3RZA A;  5KOW A;  3K57 A;  3GLJ A;  3W2W A;  3JYT B;  4DQP A;  2JEI A;  1S79 A;  1WEL A;  1Y5N B;  2M8H A;  2OPP A;  1G4C A;  1DQ9 A;  2RQM A;  2Y0S D;  3NP5 A;  5KFA A;  3EZU A;  1WHW A;  1SVD A;  5AT1 B;  3PRD A;  3GON A;  4PG7 A;  5KFZ A;  4MMO A;  2NXJ A;  2CAJ A;  4F3M A;  1U24 A;  2LMI A;  1JJC B;  2EG1 A;  1I5O B;  5LMU F;  4TY8 B;  2ADB A;  1NH8 A;  1NUE A;  3EDQ B;  1HBM B;  1CBK A;  1UJ5 A;  1VGY A;  2A6M A;  2JLE A;  2OKQ A;  2PGC A;  5AJ3 F;  3L3C A;  1HYS A;  2B4P A;  4K2X A;  4RBT A;  2QJ3 A;  4RUH A;  5HQ8 A;  5KFN A;  1J5E F;  4WTY A;  3MM8 A;  3CJ4 A;  2GMJ A;  3QAT A;  4ZP7 A;  4ZCL A;  5IC4 B;  2AJ2 A;  2F9D A;  3NBP B;  3PEH A;  4PG8 A;  5KOX A;  3DFE A;  1UET A;  4X2B A;  1F3V A;  2XG8 A;  5AJ3 J;  2BYC A;  1QJH A;  2OPQ A;  2HAF A;  2HHH F;  4Q2M A;  4DR2 J;  3GSI A;  4MIA A;  5BYR A;  4DL7 A;  1NJI T;  3CGI A;  2G0I A;  2QMW A;  3MCO A;  1OY6 A;  4NXN F;  1QTM A;  3IM9 A;  3WC2 A;  3OSN A;  2GX8 A;  3TRG A;  3V5R A;  3SCK E;  2ZH6 A;  3WBZ A;  2K7K A;  4DFP A;  2ZBC A;  2KT3 A;  4PKD B;  1T3O A;  1RTJ A;  2OHD A;  2YVS A;  5M2R A;  4P71 A;  2QYG A;  2DXE A;  1Q4R A;  2IMO A;  3NAH A;  2I6W A;  4WFN Q;  2MGZ A;  4XPC A;  4OZN A;  3T6B A;  4DL5 A;  3IWN C;  4XDD A;  3C8Y A;  1NPP A;  4KGX B;  4I56 A;  1DY3 A;  1VIX A;  1IKX A;  2C3Y A;  3V81 B;  4F3O A;  2HFN A;  4I7F B;  1NK4 A;  1I3O B;  3B4D A;  4LFA J;  1JMT A;  2EBE A;  1URR A;  2V0N A;  4DR1 F;  1FE4 A;  2CQ2 A;  2DXF A;  4JBC A;  3I87 A;  5AXM A;  1RAA B;  3A3N B;  3NMR A;  4KGM A;  3TAP A;  1FXL A;  2HLT A;  2XWY A;  4Q2L A;  2L9W A;  4CO4 A;  5IS2 A;  2ZM6 F;  1T05 B;  4ECS A;  3MWB A;  2A0F B;  4TY9 A;  4DR5 F;  3NKY A;  4MKB A;  2KXN B;  2FLL A;  1WOO A;  1SKU B;  4DLE A;  2XMW A;  4JI0 F;  4ENO A;  3QJP A;  3FSI A;  2CG8 A;  3OV7 A;  4EZ9 A;  1O51 A;  2J9E A;  2K8G A;  3BEG B;  4NA1 A;  1RT6 A;  2DY9 A;  1CVJ A;  1VBZ A;  1FRJ A;  5C24 B;  3JSY A;  2J7W A;  2M70 A;  2RH3 A;  3MUM P;  3DMJ A;  5H9E K;  1U1L A;  4NCG B;  1WF0 A;  2HVD A;  4FBT A;  1WC6 A;  3SSQ A;  3TZZ A;  3LTO A;  1GXU A;  2MQQ A;  4TU7 A;  1S6Q B;  2N3O A;  2RU3 A;  2QRR A;  3CED A;  4IFY A;  4YN3 B;  4MKY A;  3IC1 A;  4MKA A;  5KG0 A;  1XIQ A;  3CDA A;  3M8P A;  3E8O A;  3IR6 B;  4P72 A;  1YJU A;  2GZO A;  4A8M P;  1ZZN A;  3O5T B;  1BMQ B;  4ED7 A;  3RB6 A;  3TUI C;  3W2V B;  1I94 J;  1Z2Z A;  4WP8 A;  4FYD A;  1Y3K A;  3LP1 A;  2PI4 A;  2R42 A;  1RU2 A;  4MH8 A;  1CC8 A;  2YWW A;  3PJX A;  5KG4 A;  1CJK A;  3D6T B;  4C11 B;  5HSP A;  2EWH A;  2V5H G;  3RRG A;  2IBO A;  1UJ6 A;  3S6E A;  2V8G A;  1HNV A;  1PYT A;  2BAC A;  2VD3 A;  2MKK A;  1X4G A;  1BQM B;  4OYZ A;  2XC9 A;  1RWK B;  2OEL A;  2PC6 A;  4MYT A;  4CLW A;  2L41 A;  5HAO A;  1C0T B;  2IM2 A;  3DC2 A;  4CDI A;  4UZC A;  8AT1 B;  3UVJ A;  2ZBQ A;  3CMQ A;  3KLH B;  1WUU A;  2YNI B;  3P6Y C;  2E5L F;  1CJU A;  3T41 A;  4DV0 J;  2BE9 B;  2PEH A;  4O3O A;  1SJF A;  4NA3 A;  1DRZ A;  3EMT A;  1IBC B;  4PRF A;  1KEK A;  2LU1 A;  4KFB A;  3US5 A;  3BDP A;  5HJY A;  5HRO B;  2BJ3 A;  3TOQ A;  3T5K A;  3RBZ A;  1RTD B;  3MED B;  2WSE C;  1VHI A;  3SQG A;  3SZ2 A;  2R7T A;  9ATC B;  4K4T A;  3GIM A;  4IUF A;  1XNQ F;  2QE5 A;  2VPY B;  3BBB A;  1CJV A;  2XSJ B;  2DK2 A;  3GJR B;  2R7Q A;  1YIT S;  2OAU A;  3KG0 A;  4I6W A;  2FGO A;  2BAB A;  4B3O B;  1NHU A;  3P45 B;  3ILJ A;  3R97 A;  4ZPB A;  3RAM A;  5K8N A;  1F9H A;  1SKW A;  3C3L A;  2IAJ B;  2FC9 A;  1X4B A;  3AOD A;  2MEW A;  3A8J A;  3MM6 B;  3CXC R;  3PM9 A;  4OHX A;  3CJQ A;  2W7O A;  1IR2 A;  1RB0 A;  1T9Y A;  1VYA A;  2FHK A;  3E01 A;  2DNO A;  1RAD B;  1H73 A;  3MMC A;  3TR5 A;  4HEA 9;  2V2Z A;  3W63 A;  1M5K C;  3CF5 Q;  1WI6 A;  2GIR A;  4WFY A;  3NCP A;  2MTL A;  3MEK A;  4D3G A;  1XR5 A;  4EYI B;  4ZVR B;  2V4J A;  3T1Y F;  1X4H A;  1RWW B;  3I56 S;  2Z2Z A;  2R7R A;  3K5M A;  3QT5 A;  1RHK B;  3MED A;  4OQJ A;  4P2M A;  3KLI A;  1LW0 B;  1KVJ A;  3D1O A;  2VA2 A;  4MJK A;  5IT0 A;  2CQG A;  1HLW A;  2HBR B;  4DPO A;  4U8Y A;  3EM1 A;  5KFI A;  3R7B B;  4MIW A;  4WE1 B;  4RW4 A;  5L1K A;  1VLO A;  1OJ4 A;  2QN6 B;  3ITH A;  4HDH A;  1XTZ A;  1S5Z A;  2CVI A;  4G1Q B;  4PEO A;  1U4B A;  3T1A A;  2AF6 A;  5GAD I;  1YZ6 A;  5HMZ A;  3AHP A;  4J37 A;  3ET6 A;  3W9H A;  2AT1 B;  4JI5 J;  1IKY B;  2ZKT A;  4CP5 A;  1W26 A;  4LBI A;  3ZZP A;  2FD2 A;  4A8K A;  1RYS A;  4DR7 J;  1SKS A;  2UU9 J;  3LP0 A;  2KRR A;  2CQD A;  4UOC A;  2ZBP A;  3DM2 B;  4ETX A;  2KYX A;  1WWH A;  3Q8Q B;  3NXZ A;  2VON A;  1CC7 A;  1ITP A;  2LA4 A;  4ED0 A;  4ECT A;  1U6B A;  2O3D A;  1BQX A;  3T1H F;  1N5Q A;  4ES3 A;  4B9M A;  3TAM B;  4NYZ A;  3CJR A;  5ETR A;  3IN5 A;  1S0V A;  5EWG A;  4LF6 J;  4ZJL A;  3UNG C;  4LFB F;  1Q5Y A;  3J81 Y;  4IRC A;  2VQF J;  2AJ0 A;  2JVO A;  4YHH J;  5AXN A;  1FI4 A;  2C3P A;  2G2Z A;  1NKB A;  2HND B;  4CYU A;  3PZP A;  2RD5 C;  1S1X A;  3D9B A;  4LF8 F;  4HI2 A;  4K4Z A;  5IM0 A;  2YKA A;  3RRH A;  3VQT A;  2HRT A;  2Y0B B;  1AA1 B;  1HIY A;  1RWU A;  2JC1 A;  3GFH A;  4I2P B;  5IV4 A;  3PKM A;  2DCU B;  2VF3 A;  4EBC A;  3GFX A;  1G7C B;  2XYG B;  2C3M A;  1C1C A;  2CQ0 A;  4B3S J;  3W64 A;  2HS0 A;  4TNO A;  1SH2 A;  1SUQ B;  4Y65 A;  3GQC A;  1O8B A;  3HCX A;  2WK4 A;  3HHK A;  1KS2 A;  4PQA A;  3GPA A;  1TK0 A;  3KLI B;  1KC8 T;  1J5O A;  1UWA A;  3OR1 A;  4B17 A;  2VJV A;  4FF1 A;  3AY0 A;  4DUT A;  1XC9 A;  3KLG B;  3PNI A;  3NGU A;  5EX3 A;  2HVH A;  4CLL A;  1GTE A;  2DEI A;  1K1Q A;  3DOL B;  5L9N A;  3RR8 A;  3HSZ A;  1FNM A;  2Q3P A;  4G1Q A;  5IT9 U;  1FFW B;  1R3N A;  1KD1 T;  1XER A;  4GMK A;  4DSJ A;  3R5D A;  3VHQ A;  1XMO F;  2YXL A;  4DZD A;  4LF7 J;  1VRU B;  1WI8 A;  2B9E A;  1VQN S;  1RLC L;  2F7V A;  4UY8 T;  3GIR A;  3PHT A;  4CWB A;  1F5C A;  4F50 A;  5F3T A;  2M2B A;  4FYV B;  4MIB A;  1Q8L A;  4K50 A;  1YWX A;  2HFZ A;  5LSO A;  1MSW D;  3PRV A;  1U1R A;  1ZS6 A;  2P5V A;  2JSX A;  2YNF B;  3IO1 A;  4C3L A;  3MEE A;  5A8R A;  1QAI A;  4WWS A;  3POT B;  5B7W A;  3ZO7 A;  4K4U A;  1C2P A;  5KFB A;  2XLI A;  3BGL A;  4ECX A;  5AXK A;  4HH1 A;  1O5J A;  1N32 J;  3J7A 1;  5DLF A;  5HBM A;  3D1H A;  3TVY A;  1SC4 B;  1HD0 A;  4S0M A;  4GKK J;  4ID5 A;  1VQ5 S;  1TV6 A;  3FDS A;  1HNX J;  2YKM B;  3CUL A;  4DR6 J;  1M1G A;  2B6A B;  3IS9 A;  5L8R C;  5AE1 A;  3ETM A;  1VOM A;  2DR8 A;  4BDP A;  4JI7 J;  1F0X A;  4NLY A;  3K8V A;  4PXD A;  5C7P A;  1RTI B;  3HHE A;  4ICL B;  2HK2 A;  5DDO C;  4O0I A;  1NSA A;  3SDE A;  1H6K X;  2I5J A;  1ZAV A;  2IAJ A;  3M1V A;  4DV5 F;  4IOA Q;  1VJQ A;  1EAY C;  3CCE S;  1RWV B;  1FTR A;  2XM3 A;  3OVS A;  1PC5 A;  3AD8 C;  4JYA F;  2E5G A;  3ONQ A;  4OHZ A;  3MR5 A;  3M8R A;  3MOJ B;  3QRR A;  1YRU A;  1B4S A;  1FDD A;  2VU5 A;  4OYP A;  3VF0 B;  1O0P A;  1EP4 B;  1KDN A;  3BRE A;  2LFV A;  3H2U B;  1R89 A;  3A12 A;  4YB6 A;  2VG5 B;  3Q2S C;  3I4H X;  1X60 A;  2V8H A;  2ZOG A;  4ZK7 M;  4ZLP A;  3R2C J;  2KVQ E;  3V81 A;  2R7U A;  1FFG B;  2F65 A;  3TJ9 A;  4ECW A;  1OY8 A;  3K17 A;  1JQG A;  4OZ2 A;  4E98 A;  3BO2 A;  1VRU A;  2E44 A;  5KG6 A;  2YWF A;  3H4D A;  2OI2 A;  4F2S A;  4ILL A;  4ILR A;  4WP9 A;  4CTA B;  2CJA A;  1NM2 A;  1IKY A;  1FDA A;  1U0H B;  2QLW A;  4OZ5 A;  2EFO A;  3MEG A;  4ZPD A;  5E3C A;  3KMQ A;  4NCG A;  1PC4 A;  2CQ4 A;  3DLK A;  4OV6 A;  2HLU A;  1S0O A;  1VQP S;  4FYW B;  1JJ4 A;  4ZPC A;  4BHQ A;  3D66 A;  4WYW A;  2QLF B;  1CSJ A;  3TEG A;  3IAS 9;  1QAJ A;  3QZ7 A;  1SL2 A;  3HT3 A;  4DX7 A;  2HHT A;  1BGX T;  4CLP A;  2CJX B;  5B0C A;  2MZS A;  4NOH A;  3KLE A;  4B9S A;  4Q8F A;  1OIA A;  1XK8 A;  5T41 A;  5DQH A;  3KJQ B;  3TZW A;  3BKF A;  2HHS A;  2RHS B;  1R7I A;  2GAH C;  5KG5 A;  1MRO A;  5IQQ A;  5F3Z A;  2D1C A;  3LP1 B;  2KHC A;  1BQN B;  3PFE A;  4QJV A;  4LSZ B;  4QW9 A;  5GMD A;  3J81 U;  1DBD A;  5EN1 A;  3OTE A;  1DAX A;  4UUW A;  3RG6 A;  1U1O A;  2XI2 A;  1VC0 A;  3PR4 A;  2VKR A;  3OL8 A;  1Q95 G;  1F2H A;  1RAF B;  3LP0 B;  3MCM A;  4R8U B;  4ICL A;  4DV7 J;  1D1U A;  2I9S A;  2M3D A;  3NWR A;  3DLH A;  3KHL A;  5G0R B;  1TVR B;  4Q0B B;  1TL4 A;  4YP3 A;  2GVD B;  2LQJ A;  1RIS A;  3I0R B;  4KE5 A;  4WKY A;  1L3U A;  1VQ9 S;  4HLB A;  2HZA A;  3NG8 A;  2KDO A;  2ZHB A;  3O44 A;  5HQM A;  4L3K A;  1LK5 A;  1HAR A;  1FWL A;  1TKZ B;  3AXK A;  5DO2 A;  2HNY B;  1YX2 A;  2HBY B;  1NHV A;  4UOG A;  1J2V A;  2ZH2 A;  4DSI A;  5C42 B;  5I42 B;  4EZ6 A;  1WG1 A;  3WX8 A;  4Y00 A;  4RW6 A;  4CLT A;  3PW5 A;  2ROG A;  2YWG A;  4LRC A;  4CNZ A;  4ZVH A;  1G6B A;  5HP1 B;  1ICE B;  5B0E A;  4DUZ J;  3UR3 C;  1Q0N A;  4M8L A;  3R7N B;  1TL5 A;  3QAE A;  2QSW A;  4NLS A;  3A8K A;  1ZM3 A;  1RA7 A;  2MQP A;  4X64 J;  2SXL A;  2YPY A;  1UA0 A;  3KLG A;  2KTQ A;  4CH1 A;  5HO4 A;  4LFC J;  3DRP A;  3F0N A;  2EFV A;  2B4U A;  5KFD A;  4ID8 A;  2HQ3 A;  2ZKU A;  2OTL S;  2M52 A;  3MI7 X;  5CYQ B;  3CD7 A;  1IKX B;  3PEJ A;  5G0R A;  2NXC A;  4USU A;  4QYZ J;  1N5Y A;  1RTH A;  5J1N A;  5HMX A;  2AGP A;  1RAI B;  2ZIT A;  2FDN A;  2G2O A;  2L9N A;  3CCW A;  1YHQ S;  3CNQ P;  3A3O B;  1U2C A;  4EBD A;  1JXV A;  1VCT A;  2DHG A;  2QGF B;  4WK3 A;  3MUV P;  4ILM A;  2CA9 A;  2ZZN A;  5LJ5 Y;  3N79 A;  1IBM J;  1JJ2 R;  2D74 B;  2R2S A;  1K0T A;  1TMJ A;  2GQ2 A;  2NXU A;  4NRU A;  1U6Z A;  2VG7 B;  2HKE A;  3AA8 A;  3CPW R;  2AIR B;  2Z4P A;  3NCR A;  2GVZ B;  1YDL A;  2VQE J;  3NGK A;  4ZIW A;  5J2P A;  2Z30 B;  1NK0 A;  1JLE B;  1HPZ B;  3HFZ B;  1WTB A;  3M7V A;  2M88 A;  3BBF A;  2VKZ G;  4U9R A;  2IBK A;  1GMW D;  1X7V A;  1DQA A;  1X4E A;  4I68 A;  4ZS6 A;  4DX8 H;  1V3Z A;  4EK2 A;  1A0O B;  1N5V A;  4X4Q A;  1T9V A;  1XJW B;  2FHJ A;  3OPK A;  4GC6 A;  2MQM A;  3ENV A;  4UOH A;  3OLB A;  3TAR A;  1JWW A;  3LGN A;  4K8R A;  3K89 A;  4F4A A;  1HA1 A;  2J7K A;  2MZT A;  4G3I A;  4RU2 A;  5IOL A;  5B09 A;  1SV5 B;  3IGV A;  4ID5 B;  2VA3 A;  4WFZ A;  1VQO S;  4ZP6 A;  2JNJ A;  4JI8 F;  4DHV A;  3SCI E;  2HGL A;  4OLO A;  2R7V A;  1HBM A;  5DJB A;  3JB9 k;  2KM8 B;  1HMV A;  3M1V B;  2BJ7 A;  4QIW D;  1JIH A;  2CJ9 A;  4O3N A;  1RWX B;  4JI8 J;  2FVP A;  2EFG A;  4DV6 J;  2A2C A;  1SPB P;  3VGT A;  2F40 A;  4NLR A;  1L3T A;  3KDO A;  1YVF A;  1T95 A;  4ED2 A;  3LPY A;  1AUD A;  4LFA F;  3E01 B;  3LWM A;  1RU1 A;  3RW7 A;  2HZV A;  3A1Y G;  4PXC A;  3QRQ A;  3BYR A;  3MM9 A;  2HHX A;  2YKQ A;  3R7S B;  3BSA A;  4OMF G;  4RNF A;  4L75 A;  1APS A;  1QSS A;  1JXE A;  2WOM A;  3AJD A;  1R27 B;  3JQK A;  4O4G A;  3EZO A;  3HSG A;  4CH7 A;  1N54 B;  2XYP B;  5DM6 Q;  2XY6 A;  5B0B A;  1XQI A;  1ZA1 B;  2WZ1 A;  3MCS A;  4C0H A;  4CQ1 A;  2NRE A;  1LXJ A;  7FD1 A;  1C0U B;  3N4W A;  3M8Y A;  5CXT A;  2ZUG A;  4C0O C;  2XMM A;  3MPW A;  1IN0 A;  1RXO B;  4RW9 A;  1S12 A;  4TYB A;  4QR0 A;  3C6T A;  4L73 A;  1BWV A;  4F4X A;  3AB2 B;  3ULH A;  4RNH A;  2C2O B;  4HHJ A;  4OIX A;  5T7L B;  4X4U A;  1N52 B;  2R7O A;  1RT7 A;  5ETO A;  2DGW A;  3JTP A;  2OIH A;  2E5H A;  5E3R A;  2BE7 D;  3FEZ A;  1S99 A;  3QIP A;  5CZX A;  4X4T A;  1KTQ A;  2QFI A;  1RBL A;  4FXD A;  4P10 A;  4ZHR A;  4PWU A;  3SCL E;  4KV8 B;  1LXN A;  3WIU A;  4B9U A;  1NHK L;  2A3J A;  2HIQ A;  4KRW A;  1QY7 A;  1S7H A;  5LMN J;  2UVV A;  4DR1 J;  1QTN B;  1FCA A;  1RP5 A;  3IR5 B;  5KTQ A;  2MY8 A;  3G8T A;  1F1B B;  3CJ0 A;  3SV4 A;  2HFV A;  4IG0 B;  3LQV A;  1YBA A;  2J7U A;  2E7W A;  2F5G A;  4L6V 3;  4RUB A;  3PW2 A;  5ETT A;  2CPH A;  4B9L A;  3DRY A;  3PCO B;  5JVG Q;  5GAH U;  2EC0 A;  1VQ8 S;  1HYS B;  2VDI A;  3FQL A;  3QQC D;  2AU0 A;  4NLP A;  1RYR A;  2ZE2 A;  2FVS A;  2CNL B;  3JSB A;  3GJT B;  3TQE A;  2WTF A;  4WFB Q;  1UZH A;  2BX6 A;  1JX4 A;  4LR9 A;  3Q86 A;  1YKW A;  4B3M F;  1TUV A;  3M9O B;  3EVM A;  2BOA A;  2CJB A;  3GMG A;  2B5J A;  4C11 A;  4B08 A;  3W3S A;  4IQX A;  2MQN A;  1UL3 A;  3UO0 A;  4K4W A;  2CKW A;  3V6D A;  3M6U A;  4WXO A;  4RR5 A;  3H25 A;  3LP2 B;  5ETM A;  3CIZ A;  2HSE B;  4CI0 B;  3CCJ S;  4K4S A;  4HAC B;  3VAM A;  3RR7 A;  2HQC A;  2E5J A;  4IH5 A;  3L4B C;  1FKO B;  1T03 B;  4MTP A;  2UZA A;  3I31 A;  5HVF A;  1ZAW A;  3UD5 A;  4EU0 A;  1S1T B;  1XN9 A;  1RT3 A;  2G13 A;  1HQE A;  5F9N A;  5IWA J;  5A2Q Y;  2D3Z A;  2E9T A;  4C2M A;  5E33 A;  2BVZ A;  2K06 A;  1YJV A;  2JRS A;  4LF1 A;  4UF4 A;  3GYX B;  2I1R A;  3HX9 A;  2CWX A;  1F6T A;  3HT0 A;  2V34 A;  4ZMM A;  4DR4 F;  5D4P A;  4DU7 A;  2MHE A;  4OJ1 A;  1VQK S;  1VRQ C;  1U1N A;  1U25 A;  1HNW F;  4Y6I A;  2IYI A;  4WXW A;  3OVA A;  3BQ0 A;  2D3O R;  1RWN B;  2B9W A;  4F7V A;  4OI6 A;  2VAS A;  3NNC A;  2B56 A;  2JEJ A;  4RLE A;  1HFE L;  1F5A A;  2CYY A;  1RBA A;  2W4D A;  3FJ2 A;  3NS7 B;  2IVF B;  3HVW A;  3Q8Y A;  1HQ2 A;  2LVW A;  4NEZ A;  4O23 A;  3CJK A;  2MHN A;  3ISN D;  2CJQ A;  3OFE A;  4X65 F;  1MRO B;  2WAQ D;  4JI3 J;  1IR1 A;  4L3N A;  2OPR A;  2X51 A;  1BQN A;  3RB3 A;  4ERD A;  2X1F A;  1WOP A;  1QAY A;  3MMJ A;  1KHW A;  4RW8 B;  2WCX A;  2FVQ A;  3J81 j;  2ZH1 A;  2B8P A;  2YKO A;  4DQS A;  4TN2 A;  2BQ3 A;  4NZ0 A;  2JFK A;  2E7V A;  2K7J A;  1RAG B;  3QO9 B;  5EHH A;  1IKV B;  2J9C A;  2FJV A;  3LF0 A;  1U47 A;  1U0S A;  4QR2 A;  5BYS A;  3OUY A;  1LWE B;  2HAI A;  2XHW A;  3EGV A;  4J9V A;  4UQT A;  3VAG A;  1R8H A;  2ATC B;  3R5J B;  2GGP A;  1GXT A;  3VZH A;  2CG4 A;  2G1D A;  1HD1 A;  3CD0 A;  4NLW A;  5K14 B;  3VVT A;  4L72 B;  4R8U A;  3BGO P;  1Y7P A;  3MR7 A;  2J9D A;  2W9A A;  1V9O A;  2HYI B;  3M32 A;  1FXD A;  1RCO B;  3IAM 9;  2C2D A;  1HWU A;  2O1P A;  1NH7 A;  1XNR J;  2QTW A;  4OI4 A;  3DLE B;  1AFJ A;  1H7X A;  4DX5 A;  4QYZ K;  2YQ1 A;  5J2M A;  2I8E A;  1UFW A;  1JNZ B;  1PGZ A;  1WG5 A;  2Q6B A;  2AYM A;  2KHD A;  3QT6 A;  1NCL A;  4FXW A;  1ZYQ A;  2LEA A;  2FLN A;  4V19 X;  2K2P A;  2DJW A;  2G0J A;  5C2C A;  4UZB A;  3VAI A;  1MMD A;  4JV5 F;  2NPI A;  1GAO A;  4RW6 B;  2I5J B;  2PSZ A;  4DOZ A;  5IFM A;  5J1E B;  3OFH A;  4Q7A A;  2R9L A;  1VK3 A;  3OHB A;  4USJ C;  2HND A;  1ZAX A;  3UPF A;  2GJI A;  2MMY A;  4YUD A;  2HHH J;  3OL7 A;  3LA0 A;  1KTV A;  3QSI A;  4KYZ A;  5L1L A;  3ZTS A;  2W9C A;  4B3R J;  2UXB F;  2CQB A;  2U1A A;  2V8V A;  3DRP B;  5I3P A;  5LM7 E;  1IR0 A;  1IBL J;  1MN7 A;  3DRR A;  3OR2 A;  2QIF A;  1QE1 A;  2HNZ B;  3ZZR A;  4F0H A;  5BR8 J;  3NNH A;  4RW9 B;  1EKR A;  3MEC B;  5KT2 A;  1K47 A;  2PN6 A;  4FF4 A;  3AQP A;  4FKY A;  5K5M A;  3ZTP A;  3UR0 A;  2CPX A;  3DLG A;  3NLC A;  5KT4 A;  2DHS A;  3M9N B;  2RIJ A;  1HNI A;  1UFL A;  4UTG A;  4N41 A;  1X9W A;  2M8D B;  1RI7 A;  2E1A A;  3G6V A;  5KFO A;  1T94 A;  3E51 A;  1KON A;  1VBX A;  1VQL S;  1I1G A;  3H5S A;  1P1T A;  2C2Z B;  2YTC A;  4LIW A;  1SJ3 P;  4PR6 A;  3TUJ C;  4ECV A;  1AW0 A;  3I0R A;  2OH2 A;  3U1M A;  3H5X A;  4JUZ A;  4HDG A;  1TZ0 A;  1TR0 A;  5JMN A;  3JSR A;  1LW0 A;  2HG4 A;  2MGZ B;  2MKJ A;  2P2C B;  3UDL A;  1HBN B;  1OYE A;  3QGG A;  5DG9 A;  2C1E B;  4O44 B;  1CS4 B;  4KO0 B;  3JTO A;  4XK8 C;  1BXN A;  4DX6 A;  5CAB A;  3CCL S;  4J7C A;  2MY7 A;  1TAQ A;  3FCV A;  4U95 A;  4QIG A;  1YRX A;  2CZ4 A;  2E66 A;  3ZFV A;  4ECR A;  1FNX H;  1ARO P;  2QG9 B;  2Y1R I;  2IJR A;  3GYG A;  1A7G E;  3AJ1 A;  1RHU B;  2VBX A;  3UFC X;  4TU8 A;  2EG2 A;  1LWC A;  2IMW P;  1FKO A;  2MDA A;  2YKN B;  4NEY A;  1IUJ A;  3LH2 S;  2ZFH A;  2JVR A;  4OX8 A;  1KN6 A;  4Q5V A;  2UP1 A;  4M95 A;  3D3B J;  2YNF A;  3SEO A;  4OI0 A;  1JKH A;  5KFS A;  4DV3 J;  3C2P A;  1BHN A;  1G1X A;  2XLK A;  4E2F B;  2MZQ A;  3VQS A;  3V6D B;  1P8G A;  2C42 A;  5DS7 A;  1VQS A;  2YPZ A;  2XS7 A;  4OJH A;  1UFK A;  2IC3 B;  2WVD A;  4RNO A;  3CJT A;  2MLZ A;  1L3S A;  3W8P A;  4KPY A;  3AH6 A;  3K2Y A;  5A0Y A;  2I0X A;  5I3U A;  1NJX A;  3MM9 B;  4J9N A;  3V6K A;  3GYN A;  1RTI A;  3D28 A;  4DR7 F;  5D4O A;  1JLB B;  1OMS A;  4QWB A;  4BWJ A;  2HEK A;  1NDL A;  3H42 A;  3UQS A;  1D3W A;  4PYD A;  2FJB B;  1GMW A;  2HRU A;  3ENA A;  4QOT A;  2DNG A;  2Q79 A;  3HJF A;  4NML A;  2J0W A;  3QO9 A;  3L09 A;  2P8I A;  1R0C B;  4GO5 X;  4DJB A;  2NSC A;  1KLM B;  1RZM A;  2L48 A;  4X4P A;  4J9P A;  4LR7 A;  2ZBR A;  1N6Q B;  3VV2 B;  3R6L B;  5T14 A;  2VV5 A;  3QID A;  2IC3 A;  4R25 A;  2CPF A;  3CJK B;  4PQU A;  4DL6 A;  2R4F A;  1WHX A;  4KO0 A;  2W8K A;  2ZVI A;  3SFG A;  4LVO P;  3CT9 A;  4J9U E;  4C3K A;  4F4Z A;  3MPU B;  3VAL A;  1NDK A;  2DGT A;  4PG6 A;  2J0X A;  4ZVU B;  4N8N A;  1HHT P;  1REV A;  3MFI A;  2AGO A;  2V9K A;  1WC4 A;  3AD7 C;  1R0A A;  2WBM A;  4KGK A;  4NL5 A;  2EEY A;  2LQ5 A;  4ED6 A;  1IBK J;  4IO1 A;  4KBI A;  1WDT A;  3FBE A;  2JEG A;  3DGV A;  4RW7 A;  4OI3 A;  3OJS A;  2EFP A;  3H2V E;  4FDF A;  2KT5 A;  2ZHO A;  1H98 A;  4DL2 A;  3HI9 A;  5GAD U;  3OR1 B;  4FS1 A;  1FD8 A;  4OV1 A;  3SIP B;  1Q53 A;  3UWT A;  5KFP A;  3LAM A;  4A8Y A;  2OGU A;  3A8I A;  3R1L A;  2LYV A;  3IMQ J;  1UP1 A;  4KHP J;  3B54 A;  5JXS A;  2ZH4 A;  3BN4 A;  1X9S A;  2RU9 A;  2YWE A;  2AWZ A;  2GQQ A;  3BGR B;  4KQZ A;  4KHM A;  2GO9 A;  3CCT A;  4DN0 A;  2W9C B;  1LW2 B;  1KFS A;  1YJR A;  1YJ9 S;  4NLG A;  5M2P A;  2GNK A;  3BKU A;  1S1V B;  4I64 A;  4F4W A;  1HMV B;  1M5H A;  2AV5 A;  5I3Q A;  1FX4 A;  1N88 A;  4QIE A;  2VUG A;  3W8G A;  4DR2 F;  1PKU A;  1IKW B;  5DG7 A;  1SL0 A;  2DO0 A;  1DUR A;  1EX8 A;  2GIQ A;  4PZV A;  3KYL A;  3LP2 A;  4FN5 A;  3BBC A;  3QLH A;  2GJF A;  4K0K J;  2CXE A;  2W9B B;  4J9L A;  3UCG A;  3EGZ A;  4LF9 J;  3D0I E;  2DGU A;  1DHM A;  3R5C A;  2XS5 A;  3QGH A;  1YLX A;  5L46 A;  1U1P A;  5KFJ A;  1SC6 A;  3UI3 A;  2OEK A;  4DPU A;  1KSP A;  3L7P A;  3QJL A;  1UTA A;  2X7I A;  1VBK A;  2OPP B;  4U8V A;  1WF2 A;  3M05 A;  2XCA A;  1AFI A;  2CNO B;  2DBB A;  5M2U A;  1K0V A;  2VH7 A;  4M5I A;  4Y2K A;  5F8G A;  2DPJ A;  4J9R A;  2UUB F;  1UVJ A;  1ZM9 A;  1WJ9 A;  3DRS B;  5B08 A;  1A9N B;  3PR5 B;  2Q66 A;  1X0F A;  3BQ1 A;  2R8K A;  1RLD A;  2IM3 A;  1RTH B;  1X31 C;  3ZZZ A;  5A76 A;  3DLE A;  4J90 A;  5CD4 H;  4P7V A;  4IDK A;  4X4S A;  4Y34 A;  3BPD A;  4ES2 A;  3CME S;  2VFU A;  2N7C A;  3L95 X;  2B9Y A;  2F63 A;  4F02 A;  3RAQ A;  3TZX A;  4IOB A;  2GHP A;  4LF6 F;  3LGH A;  1WD6 A;  4OLP A;  4Y28 C;  1KR4 A;  2ACY A;  3D67 A;  4ZP8 A;  5KFH A;  1UVN A;  2GFF A;  2XCP A;  3SXL A;  4H4K A;  2RIL A;  3H5Y A;  3WC0 A;  1RAJ A;  5SZT A;  3EXC X;  5HQL A;  4AE5 A;  1HBO A;  2IM0 A;  3AAW B;  4A47 A;  3OHA A;  3GII A;  1CPZ A;  2RKI B;  3C16 B;  1RT5 B;  2KL8 A;  4ZJO A;  4A8S A;  4IH6 A;  2HHU A;  1DQ8 A;  1HWI A;  2HHV A;  3DLK B;  4WF9 Q;  2RT3 A;  1XR7 A;  3P4U B;  5ETL A;  2ZNZ A;  2WVE A;  5D78 A;  1T05 A;  1EET B;  3HFK A;  4LMZ A;  4H4O B;  4X64 F;  2O5D A;  3O3L A;  1FEE A;  1QDU B;  2QYC A;  2X1B A;  3KWM A;  1HQE B;  4WYL A;  1E6V A;  3HSD A;  2PO4 A;  3GIL A;  4BCA A;  2DRA A;  2NZ4 A;  5J2N A;  3MMC B;  2GV1 A;  2HWI A;  5FD1 A;  4O3P A;  4A8W A;  2EVZ A;  5C42 A;  5I42 A;  3H20 A;  1YTY A;  2GCF A;  5K8P A;  3OR2 B;  3G96 A;  3EPI A;  1T03 A;  4ED1 A;  1D8Y A;  1HNW J;  3R2D J;  1AYE A;  1TKT B;  3S7R A;  2LA6 A;  1YGY A;  5LSR A;  1OPI A;  2DNR A;  2DNN A;  3GFY A;  4DUY F;  4BS2 A;  1SC3 B;  3RTV A;  2CJK A;  5F8J A;  1TV6 B;  4OYB A;  4PQU B;  1RT6 B;  2E7X A;  5D15 A;  1OWX A;  1Q1K A;  3QT8 A;  2BJ8 A;  1GMU A;  2BJ1 A;  5KG7 A;  5J1E A;  4ES1 A;  1W2I A;  5LMU J;  3UW1 A;  1LWX A;  4P2F A;  3CMA S;  2Y9H A;  2ILZ A;  2LQ9 A;  4YS2 A;  2JC0 A;  3GG0 A;  4U67 Q;  2LQ8 A;  2KO1 A;  4RNM A;  3MAH A;  1M5V C;  5EUH A;  2D41 A;  4LF9 F;  1X5T A;  1WKL A;  2XMJ A;  2UXD F;  3CC4 S;  4YB5 A;  1NXI A;  4AND A;  3NBP A;  3PHE A;  2ZD1 A;  1QSL A;  2DR7 A;  3ENW A;  1L3V A;  5GVQ A;  4NI2 B;  4DV3 F;  4IH7 A;  3J7Z 5;  2QEX S;  4OYO A;  2GIF A;  2RRN A;  1JLC B;  1Q8I A;  5ETS A;  2HK3 A;  3OTD A;  2XO7 A;  3UVJ B;  1NPR A;  3T19 A;  4P9S A;  1WEY A;  3ISN C;  1HBO B;  4TVA B;  3TO8 A;  2R8J A;  2FLP A;  4IR1 A;  3NL0 A;  1PBA A;  4W90 B;  2FJE B;  1LW2 A;  4USK A;  5K14 A;  4JI3 F;  2CPJ A;  3BH7 B;  5JVH Q;  2JX2 A;  5DRK A;  2AJ1 A;  3C15 A;  3G87 A;  4K4X A;  2QL9 B;  2P9C A;  1WHY A;  1TTH B;  3MEG B;  5LL6 d;  4PPD A;  2R8G A;  3BGR A;  4IR9 A;  1SH3 A;  3CDW A;  2Y1J A;  1GH8 A;  3GIJ A;  3C6T B;  1XMQ F;  4BLG A;  1U2R A;  4FVM A;  1NSQ A;  3EYZ A;  4OX7 A;  2H9Z A;  2WVB A;  3CJ5 A;  1LWC B;  4RWW A;  3UDE A;  5HMY A;  1S1V A;  5D0E A;  4HKQ A;  3KLF A;  3NMA A;  1SH0 A;  1TL7 B;  2VG5 A;  3VR1 A;  3KHG A;  1YJ7 A;  1PJ7 A;  3DLB A;  4CH0 S;  3P96 A;  3H7H B;  4URG A;  4DR5 J;  4ELU A;  3T1Y J;  4Z7Y A;  2CDR B;  3S1T A;  1XNQ J;  1AUS L;  5EDW A;  3KK3 B;  3M2R B;  3R8Y A;  1Q79 A;  4H4K C;  3FBC A;  2CPD A;  5CZV A;  5IM0 B;  4ELV A;  3N0V A;  3SYZ A;  1TKD A;  4K4Y A;  2P6T A;  2BEF A;  4B3T F;  3FC9 A;  1M1H A;  1FWP A;  2GA7 A;  3CDB A;  2VL1 A;  3DOM B;  2MQ8 A;  3MM7 B;  5A2Q U;  3CCM S;  3TW0 A;  1C1C B;  3CD5 A;  4N76 A;  2K1R A;  1FDN A;  2FHM A;  1EKS A;  3IRX B;  3MD3 A;  2QFJ A;  2BKN A;  3GB0 A;  1S72 S;  1Z2L A;  1Q82 T;  1KNZ A;  4DG1 B;  2JH3 A;  2B7C B;  1H2V Z;  1SQE A;  2LU2 A;  3QLH B;  1T9U A;  2KKH A;  1FXR A;  1MU2 B;  2JZ5 A;  3ZZ0 A;  1H3D A;  3I5A A;  3NEK A;  3TAN A;  3U27 A;  4PYA A;  2I2Y A;  1PAU B;  4C7Q A;  1X4C A;  3EE3 A;  3P3D A;  3VGS A;  3VAJ A;  5L39 A;  1MML A;  1G3O A;  4LF4 J;  2BJ9 A;  2M7S A;  3JSM B;  4IDK B;  1P6T A;  1Z4U A;  2IDE A;  2V4J B;  5ETN A;  2VJU A;  3POT A;  3ISZ A;  1TQL A;  5IV3 A;  2VHG A;  1NPK A;  3BGF A;  3UDV A;  3D2W A;  2HFU A;  2XYH B;  5ITH A;  1JLF B;  2XB2 D;  1U2F A;  3BYP A;  1YBU A;  3MR6 A;  5C5J A;  2ZH7 A;  2FYX A;  1PYO B;  2VFR A;  4USH A;  2XMU A;  2YBV A;  1U49 A;  3K0J A;  2RKI A;  3C16 A;  4Y2A A;  3I4P A;  4DV7 F;  2GVD A;  2XNQ A;  1S49 A;  2F4V J;  2HS3 A;  4UST A;  1ELO A;  1V3S A;  2H54 B;  3DM2 A;  4LUB A;  4DF4 A;  4ZPA A;  4QCL A;  1X4F A;  1I6J A;  3I6P A;  4CO0 A;  2BOP A;  3HVR A;  4RU9 A;  1N5T A;  1N5S A;  1VS3 A;  3D7S B;  2CNN B;  5IXU A;  3KJV B;  4B3R F;  2CQC A;  2OEJ A;  3OTO F;  3CW2 C;  2FZK B;  3AFG A;  1BE4 A;  3SMZ A;  2YX1 A;  2QLB B;  3L7O A;  2CQ3 A;  4NRT A;  2HVZ A;  4PAB A;  3THT A;  3W9I A;  2B43 A;  2HFS A;  3ITH B;  3Q8S B;  3G4S S;  4CO3 A;  4B9T A;  1VR6 A;  3H4B A;  3TNV A;  4ZCM A;  3K59 A;  4JI2 J;  2ZOM A;  1SUQ A;  1OSC A;  3S8S A;  2VOP A;  3BDE A;  3CSK A;  3R5A A;  5D0R A;  9RUB A;  2IM1 A;  2APO A;  2DT9 A;  4TLQ A;  3OL6 A;  3V6H A;  4LF7 F;  2CRL A;  1IBM F;  1D8Z A;  2KN4 A;  2WW4 A;  3L7U A;  4I2P A;  3ZTR A;  4DV2 J;  5BJR A;  3Q24 A;  2PFD A;  2IYG A;  2VFV A;  1VIO A;  5HJX A;  4AQY J;  1FJC A;  2WRM A;  3W5Z A;  2CUY A;  3LO3 A;  1VC5 A;  4AL6 A;  2RJZ A;  1RA6 A;  1Y11 A;  2WSC C;  3H2L A;  4QYR A;  3N01 A;  3QT7 A;  5ETQ A;  1HPZ A;  4ZVS B;  2KZZ A;  3IM8 A;  3KK1 B;  1HWJ A;  2DRB A;  3GFZ A;  2CPY A;  4RUC A;  3EZ5 A;  5U47 A;  5KFF A;  3HHL B;  3NOC A;  1PIE A;  3DGP B;  2DB1 A;  5HRO A;  1U09 A;  2H5J B;  3JTN A;  4YB7 A;  5ETK A;  4WPA A;  4NX9 A;  4ECU A;  1Q81 T;  4JI6 J;  1FJE B;  4I6A A;  4C8Z A;  2UXC J;  2KM8 C;  2WSF C;  2WB1 D;  2BQU A;  3R5B A;  4L74 A;  3IWX A;  1TK5 A;  3UDC A;  2ZC3 A;  3DDK A;  3HKW A;  2BE2 B;  3FBB A;  3DCA A;  1D9F A;  4TQR A;  1DLO B;  1EJ7 L;  3WDO A;  4MFB B;  2ZC4 A;  4K5R A;  5ETP A;  3GP9 A;  5CYM B;  2AYE A;  4C3M A;  4DV1 J;  1OQ6 A;  1FT8 A;  4WU2 A;  2VQF F;  1UKU A;  3FQK A;  4M63 A;  3N28 A;  2PMZ D;  4RZR A;  1YK9 A;  4DR6 F;  4YR3 A;  3MMB A;  4OJ3 A;  4DL4 A;  3G82 B;  4YOE A;  2LXU A;  4YR0 A;  1KWM A;  2YKM A;  3G2X A;  1QLN A;  4ZLN A;  3RJM B;  4JV2 A;  2N3L A;  3MZI A;  4K4V A;  3FBF A;  2N7Y A;  2V8D A;  4MK8 A;  1GEH A;  1YZ7 A;  1FJG J;  4Q0B A;  4EI2 A;  3Q8U A;  4LBH A;  1M5P C;  2OFG X;  3P5T L;  4F8R A;  2VC0 A;  4JP8 A;  3KK3 A;  1B3T A;  2PMH A;  2RF2 A;  3N6L A;  1SJR A;  2HRY A;  2DR9 A;  2HHQ A;  1WOS A;  2J6S A;  2BA9 A;  1ROF A;  2FVC A;  3NGS A;  2H5E A;  4HAC A;  4DV2 F;  2D3U A;  3DNC A;  3PW7 A;  2MZ1 A;  1RSC A;  3NCQ A;  1FD2 A;  2E1P A;  3I96 A;  1E6Y B;  1IJF B;  2XY5 A;  3D3C J;  3T9Z A;  2RUG A;  2WVC A;  3MEC A;  3I5C A;  1IQT A;  2FVR A;  2KZM A;  1NK5 A;  1JLG A;  3NS6 A;  1XMO J;  1KLN A;  3OXG A;  4UQG A;  1UZD A;  1FVS A;  1WTF A;  3FSY A;  3TA0 A;  1WSV A;  2ZH5 A;  3QJJ A;  3TA2 A;  1SCJ B;  1QD1 A;  1Y5I B;  3AT1 B;  3C6U A;  4FPI A;  1VQ7 S;  1U1K A;  5CQG A;  4O44 A;  4DSK A;  3BPS P;  5A6P A;  1TKT A;  4CO1 A;  4I0W A;  1RTD A;  4IG3 A;  4P73 A;  4C8M A;  1FRL A;  1O6X A;  2VBZ A;  1UCN A;  1F3F A;  3DXS X;  2XZT B;  4HTJ A;  3W1Y C;  1HNV B;  1WEX A;  5MAO A;  4LSL A;  3IRW P;  2OD6 A;  4P75 A;  2W8L A;  1OY9 A;  1WF1 A;  2HVE A;  2CJY B;  3D5M A;  1VLY A;  4FF3 A;  1S0M A;  3QGP A;  4NI2 A;  2JFD A;  3M6V A;  3QFW A;  1Q7L B;  4KV8 A;  4OZ0 A;  3RYL A;  4QZV B;  2HIY A;  5FLX Y;  2Z2L A;  4MK9 A;  4ER8 A;  2W24 A;  5DM7 Q;  1IKW A;  2OUG A;  3CJS A;  1VBY A;  4O4R A;  1VQY A;  1BUX A;  4YFU A;  3HP6 A;  1FKA F;  2XEX A;  3I82 A;  5A6W A;  3OL9 A;  2G9O A;  3AJ2 A;  4B9V A;  4FBU A;  4GKJ F;  1SIZ A;  3MR3 A;  3HSJ A;  2V69 A;  2W01 A;  5KFR A;  5K8O A;  2HS4 A;  4ZCK A;  4NCA A;  3ZTQ A;  3R6G B;  4AFF A;  3G6E S;  4HHH A;  4OX9 J;  1IJE B;  2RQC A;  1JLC A;  1RKI A;  4UY8 5;  1QUP A;  5KFK A;  1RT4 B;  1YRT A;  1IQZ A;  2MSS A;  2EW9 A;  4J9O A;  4DI6 A;  4F67 A;  1LFP A;  1GFW B;  4N56 A;  2KG0 A;  2NQP A;  2PI5 A;  2DCL A;  4NLD A;  3W5Y A;  5E2Q A;  2AW0 A;  4ED3 A;  5GAE U;  4JYA J;  1S0N A;  3EVW A;  4KTQ A;  3PVX A;  4CLU A;  3PW4 A;  4CO5 A;  4O3S A;  1VFJ A;  3GV7 B;  2MKY A;  2OO4 A;  1B70 B;  4RBV A;  4H4M B;  2VZ9 A;  3ZTO A;  2D3O 1;  3PV8 A;  5KFE A;  4X4N A;  2V4Q A;  2QV6 A;  2UVU A;  2AMC B;  2AGQ A;  3KJF B;  1OO0 B;  3PJ9 A;  4HT7 A;  3AOA A;  4P7T A;  3W5X A;  2DH7 A;  3CO0 P;  3HHL C;  4EUV A;  1RT5 A;  1TVR A;  2QL5 B;  1KOH A;  3MM7 A;  2YX7 A;  3KHH A;  2H4W B;  2FHJ D;  2VB6 A;  2ROP A;  1RAC B;  1CQM A;  2W2Q P;  3H5U A;  4FXV A;  3VWS A;  4YR2 A;  4QWA A;  3DKD A;  3OXF A;  3PKY A;  1LFW A;  3HHD A;  5F8I A;  3FSX A;  3LAK A;  4NE9 C;  4YY3 J;  3M8Z A;  3C15 B;  3NRB A;  2XMA A;  1B64 A;  2UUC J;  2VOD A;  3H0P A;  5E0O A;  2H48 B;  3GV8 B;  3PX4 A;  4M5H A;  5E7O B;  2RUS A;  1RT3 B;  3OQ2 A;  2HWH A;  2OD4 A;  4FYX B;  4ZIV A;  2BM0 A;  2Z58 B;  3CJ2 A;  3WZ0 A;  2XQC A;  2QA1 A;  1FEH A;  1DTQ A;  2G2Y A;  1KOO A;  3M6W A;  3KK1 A;  1S9E B;  3HD2 A;  4LR8 A;  2E5L J;  1Q7Y T;  1GMV A;  2CZV C;  2NUH A;  4IKA A;  2OPR B;  4A8O A;  4KSE B;  4EMD A;  2FIU A;  3V6J A;  1JJH A;  2IA6 A;  1X8D A;  2N4D A;  5A8W A;  2AZ3 A;  2JHE A;  2B0G A;  3GU0 A;  5T7L A;  4ZKA A;  2AQ4 A;  4PWD B;  2H5I B;  4RJV A;  1ZH5 A;  1V5I B;  4KB7 A;  1BQM A;  4MYU A;  4IFV A;  3HDS A;  2NS1 B;  4NYO A;  4CCH A;  3JQJ A;  4M94 A;  4TKT A;  1XMQ J;  2EPI A;  1Y5L B;  3Q8P B;  1NJZ A;  2MPU A;  2YNG B;  5KT5 A;  2HUR A;  3GJQ B;  2V67 A;  2RNE A;  2FY1 A;  3KJV A;  4M5K A;  2PII A;  4I1T A;  1HWL A;  2LXF A;  2YQ3 A;  4F0M A;  2BAN B;  3HVT A;  3ETO A;  4NYP A;  2KG1 A;  3G71 S;  1EHW A;  2OPS A;  4IO9 Q;  3T5J A;  1Z1Z A;  3ILL A;  5J1P A;  4LF5 J;  1XR6 A;  2AX0 A;  4QPT A;  2QA4 G;  3ZNJ 1;  3CJ8 A;  4JV5 J;  2HBQ B;  3M30 B;  3P8B B;  1C1B B;  4LRE A;  2HW3 A;  2W9B A;  2A1B A;  4HYK A;  3GSD A;  1CJT B;  2DNY A;  2MJU A;  4RWX A;  4RX6 A;  1IM6 A;  1UVL A;  3CCS S;  1I94 F;  1N33 J;  4KC5 A;  1F2G A;  2QMX A;  1TL3 A;  2X1G A;  1R8A A;  3MMA B;  2FQQ B;  4K59 A;  5HVG A;  2DGQ A;  5F8M A;  3K7R A;  1P27 B;  2UUT A;  1NB2 A;  1S1T A;  1NME B;  2WVF A;  1T9W A;  3F41 A;  1UW4 A;  5KFT A;  2F1F A;  5IQ6 A;  3T5H A;  3PJW A;  2G4B A;  3IFE A;  4KKO A;  1PSD A;  4LBP A;  3P49 B;  4WK1 A;  2OLW A;  1U7L A;  4AXI A;  2DGV A;  2BMB A;  2J76 E;  4M5G A;  3KLF B;  4RW7 B;  3BJY A;  3HHL A;  1SV5 A;  5L38 A;  2B5J B;  2GAG C;  2LQB A;  3TQ1 A;  1K1S A;  6FD1 A;  1BWE A;  4GVL A;  1XNR F;  4V19 J;  2JL9 A;  3LGM A;  3FVY A;  4CNY A;  4B3S F;  5F8H A;  4AXJ A;  3KHR A;  4IRD A;  1H2T Z;  2A2D A;  2Y1L B;  5F0U A;  1RQ0 A;  4ZN1 A;  5DGB A;  2UUB J;  2VC1 A;  2AEM A;  2VFT A;  3TX0 A;  5K8M A;  2IY5 B;  4OHW A;  1N4L A;  2DIU A;  2WHO A;  4WJB A;  1QVF R;  2IFX A;  5HLF B;  4C8L A;  1B99 A;  4FZV A;  2M9K A;  2CWK A;  2CQP A;  5L9X A;  2DO4 A;  5JJB A;  3MFH A;  2QA2 A;  6FDR A;  4YHH F;  1Q86 T;  3QRP A;  2R8I A;  1S6O A;  2VPX B;  4GC7 A;  2DNZ A;  3M4X A;  4W98 A;  1C0U A;  5DQI A;  2Y3Y A;  1TKX B;  2LP4 A;  5FDL A;  4JI1 J;  4ZHR B;  1HR0 J;  2DNK A;  3GE9 A;  2WOM B;  1EZZ B;  4M5N A;  1F9F A;  4PCQ A;  4X65 J;  4R0E A;  2AJF E;  4OZ3 A;  2BRL A;  2JOQ A;  3GR0 A;  4CLF A;  3CIM A;  1RT7 B;  3QNW B;  1PG5 B;  1HBN A;  4N47 A;  5GAG I;  2FUG 9;  4DFJ A;  1NK9 A;  1ZTW A;  1C0T A;  2RML A;  5I3U B;  4CYU B;  2B51 A;  1W25 A;  1NDC A;  3UE2 A;  1KRP A;  2VG7 A;  1ZA2 B;  3A8E A;  3DU5 A;  4A48 A;  1GNK A;  5D3G B;  4EBE A;  2QL7 B;  3G82 A;  4G6V B;  3BGU A;  1JLF A;  1S77 D;  1IWG A;  2BM1 A;  3SCJ E;  4FP9 A;  1Q5V A;  3DLL Q;  1TEL A;  4RUA A;  1IKV A;  2MJN A;  4GKK F;  3A3P B;  1AZS A;  1S9E A;  1HKA A;  3H59 A;  4LSL B;  3WQP A;  2KFZ A;  4NLX A;  1EQM A;  4QWC A;  5A8K B;  2PD1 A;  1H72 C;  1SC1 B;  3TVK A;  3D6H B;  1WC1 A;  5GME A;  3T5L A;  1ZOT A;  1FRX A;  4KGZ B;  2LEB A;  3KXD A;  4NWB A;  2FZC B;  2YQ0 A;  3DI6 B;  4BC7 A;  4F26 A;  4J9S A;  1CQN A;  1U8S A;  3MTK A;  2W4C A;  3K58 A;  2QO3 A;  2V2K A;  4O3R A;  3FK4 A;  3KMS A;  3O1L A;  4DU8 A;  2ROE A;  4QIV A;  2W4P A;  2J8S A;  3QBC A;  2ASJ A;  3VCD A;  4DL0 C;  2ZDO A;  2IDL A;  1H74 A;  4C0B A;  4RW4 B;  4ITS A;  4FNH A;  2NYI A;  1P9Y A;  5E3Q A;  3MM6 A;  2ZJR Q;  2RE1 A;  1Y0H A;  2E1M C;  5AE3 A;  1YG0 A;  1UEK A;  4CO2 A;  2ZWP A;  3H98 A;  4GKJ J;  5H9F J;  3J7Y U;  2NXE A;  2X1A A;  4LQ9 A;  4D3H A;  2HQI A;  1K73 T;  2RS8 A;  3IR7 B;  3OW2 R;  2NXN A;  1S4E A;  2KRB A;  3PYG A;  1W7W A;  3DXB A;  1S59 A;  2XSF A;  5CCM A;  3HUL A;  4V1A k;  4NZ7 A;  3FEY B;  2WB4 A;  1FNO A;  2NYH A;  2V6A A;  3T6J A;  5HAN A;  1N34 F;  2YNG A;  1N36 J;  2UVW A;  3HD1 A;  2XNR A;  4OYI A;  4LQ3 A;  1HNZ F;  2KFN A;  4DS5 A;  1S57 A;  2EK1 A;  2QC3 A;  3D1Q A;  5F41 A;  2COL A;  1SIW B;  2MKH A;  3D6M B;  4IFV B;  3J7Y I;  1Y4Z B;  3C14 B;  3CWJ A;  2AJ4 A;  4PG5 A;  4C8N A;  3U7J A;  4CZC A;  3MGJ A;  4X4O A;  1DJ0 A;  2HQF A;  1WOR A;  3E3X A;  3LUY A;  5HVH A;  1RT4 A;  3M2R A;  5D3G A;  4AUK A;  3M30 A;  5DG8 A;  3DOK B;  2E1R A;  3IA0 A;  1SJ1 A;  1CLF A;  2FC8 A;  3AB4 B;  5KFX A;  1FFS B;  3J80 U;  2E9R X;  2UXB J;  5B0D A;  1NRK A;  2G0C A;  3M6X A;  4KAI A;  3U02 A;  1JLE A;  4GVB A;  1H7W A;  3WHI A;  1L5U A;  5F0W A;  3CCU S;  4R5P A;  3RAX A;  2V68 A;  1JLA A;  2J0S D;  4RNN A;  3B6B A;  3WX4 A;  2OEM A;  1H38 A;  3MM8 B;  4WFX A;  2MQO A;  4EEY A;  2N4C A;  1UVI A;  3KNA A;  2QLX A;  4IRK A;  4C8O A;  2RF2 B;  4NMX A;  2Z56 B;  3BF4 A;  2Y8Y A;  4LRD A;  2RSQ A;  2JJ4 D;  2YKN A;  3CDE A;  3MPV A;  4PXB A;  1MWQ A;  2EKN A;  2JEF A;  4I67 A;  3HFV A;  2H51 B;  3KFW X;  3KJN B;  1MWZ A;  4LSN A;  5A0Y B;  3RUB L;  4F4K A;  4DV5 J;  1X0P A;  3VZI A;  1MLA A;  4DPT A;  4KHR A;  1KP6 A;  1KQK A;  3PDN A;  2R2R A;  1S1U A;  3OTB A;  2AHO B;  2D7S A;  2DXD A;  4BWM A;  1YJW S;  1LNQ A;  1WC3 A;  4BBY A;  4IQM A;  2DYA A;  2CFX A;  3JS9 A;  1OS5 A;  2C2K B;  1R31 A;  4L76 A;  4LT6 A;  1SI9 A;  3TA1 A;  2GS8 A;  4M5D A;  1NBE B;  2ERR A;  1PBU A;  3MF5 A;  2A18 A;  3OBI A;  3MAA B;  3MR2 A;  3SSS A;  1S6Q A;  3X3U A;  2ZH9 A;  1OQ3 A;  2IRX A;  1QUV A;  2XS2 A;  4IFY B;  4P52 A;  2BKO A;  2ZH3 A;  3PX0 A;  2ASD A;  1HI8 A;  2BW2 A;  1IVZ A;  3G9C A;  2KJW A;  2XI3 A;  4FNI A;  4LRF A;  1TL7 A;  5CCL A;  3MPY A;  1HR0 F;  3F44 A;  3SFU A;  2FB0 A;  3DYA A;  1NND A;  1X5P A;  3FEX B;  2BJD A;  2AEJ A;  3IP0 A;  1REV B;  1R0A B;  2H4Y B;  4YQW A;  2PDA A;  1KBR A;  3K5N A;  3DRR B;  1RHJ B;  4JV1 A;  1B0T A;  5HI7 A;  3B82 A;  1NJY A;  4WCE Q;  3AQO A;  1TL1 A;  3CJ3 A;  2DNH A;  2UUA F;  2NLW A;  3MXH P;  1HW9 A;  1KQG B;  1WC5 A;  2VPZ B;  3MEE B;  5CD4 A;  4LIR A;  2NZC A;  4EO6 A;  3JQM A;  4LF8 J;  1RGV A;  1VMB A;  3DLG B;  5FII A;  2XY7 A;  4XTT A;  3MAA A;  3NS5 A;  8RUC A;  4A8X A;  2F8E X;  2CZ9 A;  4C9D A;  1FK9 A;  1GQE A;  1TL3 B;  2E1C A;  1C4C A;  4OZJ A;  1FKP A;  1NK8 A;  1WC0 A;  2ZOF A;  2FPH X;  5DZ6 A;  4DZ6 A;  4DV4 J;  4PUO B;  1S1U B;  2DNP A;  1LQ9 A;  1FTC A;  2J0Q D;  2GHV C;  3OJU A;  3CC7 S;  3EJM A;  3PY8 A;  3KK2 A;  3DOM A;  3HHL D;  4XAK A;  4QR1 A;  1GX5 A;  2BUN A;  5IWA F;  2RQK A;  5D4L A;  4J9M A;  1FJ7 A;  1NKC A;  1SKR A;  4JB8 B;  4ZVG A;  1IM4 A;  3SDE B;  1N56 A;  1KQF B;  2V2Q A;  3HM9 A;  3C46 A;  3GTY X;  4U7C A;  2ZHA A;  4MAK A;  1Y9O A;  4ZVQ B;  3M9M B;  1M0S A;  1SQG A;  2DHX A;  1UMJ A;  2GGP B;  2ABY A;  2K3K A;  5ETV A;  3TAM A;  2F3J A;  4M5M A;  4K0K F;  2XMV A;  2PE8 A;  4DQR A;  4OYM A;  4HI1 A;  3D0H E;  4M5J A;  4A46 A;  5IC6 B;  3QAU A;  4N8O A;  5K9F A;  3KLE B;  4TXS A;  2GJ2 A;  1UEU A;  4TLR A;  3G6X A;  1NEE A;  2MB0 B;  4ED5 A;  3DRX A;  4H54 A;  4XIU A;  5D0G A;  4IOC Q;  1PAE X;  3FUY A;  1S1X B;  3UCZ P;  1T7P A;  2MLY A;  2C3O A;  5AXL A;  4WTO B;  4QU7 A;  1X9M A;  4C48 A;  3D4J A;  4ZVT B;  4PWD A;  3LAN A;  2P9G A;  3N6M A;  1WHV A;  2OML A;  2LKZ A;  4C6A A;  1WDD A;  2N82 B;  3CCZ A;  2XO6 A;  2DVI A;  1ZPV A;  3NAI A;  4M1K A;  5C25 A;  2FJD B;  3V4I A;  3CD6 S;  3DHW C;  4A8Q A;  2L08 A;  4ZVO B;  5DGA A;  1JKH B;  1N0V C;  2FTR A;  2ZVS A;  4WE1 A;  1F9E B;  4Y3C A;  5CH7 B;  5D6G A;  1V3R A;  4A4J A;  3FFI A;  3M2U B;  3M8Q B;  3J80 Y;  4F0K A;  2J6T A;  1I51 B;  1DTQ B;  1HWK A;  3C66 A;  3CCV S;  3EXY A;  5B0F A;  2XTJ P;  2QZ8 A;  4WIQ A;  3HO1 A;  4RBU A;  2IJF A;  2DRD A;  2KVI A;  3MM5 B;  3MTJ A;  2F9J A;  4JI0 J;  2R7S A;  3HVA A;  1IXK A;  1SJQ A;  1XWL A;  2OP5 A;  2WW8 A;  4WU3 A;  1M5O C;  1N34 J;  1OYD A;  1N36 F;  1WG4 A;  2DY1 A;  3SI8 A;  1VK8 A;  4DR3 F;  1QAX A;  3KKF A;  4N7T A;  3RU0 A;  3H90 A;  2KFY A;  4WII A;  1U02 A;  2UV8 G;  4RPF A;  4J9Q A;  2AD9 A;  4R0J A;  2PT0 A;  2YKP A;  2B4O A;  1TU0 B;  4CLK A;  2P9E A;  4UUX A;  4F36 A;  1GXL A;  2GHW A;  2XWX A;  1M90 T;  1GTH A;  1HNX F;  2VOO A;  2CQ1 A;  1SBR A;  3QPI A;  3PXG a;  5KFL A;  3KUH A;  4DPW A;  3FZB A;  2CAD A;  2D9O A;  1PJ6 A;  2MKI A;  4AL7 A;  3VGU A;  1NK7 A;  2YNH B;  2VBY A;  4MKV A;  2R8H A;  3W61 A;  5EGY A;  2B8Q A;  2HVI A;  3RB4 A;  2KJV A;  3FCH A;  3UN2 A;  5JUM A;  1S76 D;  3I5B A;  3N5F A;  4KFB B;  3MMA A;  4ZVF A;  2L9D A;  3VTI A;  3BN7 A;  2EK6 A;  2ZUA A;  3H8Y A;  2CIM A;  5KFG A;  2Y1I A;  1AB8 A;  1OPZ A;  1LOU A;  4NAS A;  1RE1 B;  5D77 A;  4O3Q A;  1LWF A;  5E41 A;  2V94 A;  5GMK a;  1SL1 A;  1CJU B;  3TJA A;  1LKZ A;  1FRK A;  1X4D A;  4OI1 A;  4X62 F;  2W25 A;  4JV0 A;  2ZZT A;  3BQ2 A;  2DPI A;  2QX0 A;  2IVM A;  4MK7 A;  3HHN B;  4DPY A;  1UAW A;  2D69 A;  2K1R B;  5HL7 Q;  1DTT B;  1GK8 A;  1T11 A;  2FY8 A;  3IBW A;  3M32 B;  4P2X A;  2HMI A;  4OFZ A;  2HZC A;  3DYA B;  3Q89 A;  2R7W A;  3G8S A;  3IBF B;  4KT0 C;  5F8L A;  1K8A T;  1TAU A;  1HBU B;  1LEO A;  3KG1 A;  1B7F A;  7FDR A;  4U96 A;  3T3F A;  4HT5 A;  2RHQ B;  1U0H A;  1TUG B;  2P6S A; 
#chains in the Genus database with same CATH homology
 2EKN A;  4PYD A;  3JQM A;  2OHD A;  3JQJ A;  1EKS A;  2EEY A;  2IIH A;  3JQK A;  4PYA A;  4FDF A;  2IDE A;  1EKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...