5HP1B

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
416
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/inhibitor/dna
total genus 121
structure length 416
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B03
4TY8A 2R8KA 1TKXA 2FVCA 4DL5A 3I0SB 4G1QB 1BQNA 3QZ8A 4X2BA 2RKIA 1QAIA 4EYHB 5DLFA 3MF5A 4KO0A 3KLIB 4Q44A 4QWDA 2J6UA 5CYMA 4O44A 4TYBA 3EZUA 3C6TA 2F8EX 4Q8FA 3BGRB 4RW4A 5KT4A 1XR6A 5KFBA 4WXWA 4KBIA 3LP2A 3TVKA 3PW0A 2UUTA 2BANB 3C6UA 2YNIA 5DG9A 1IKVA 4IG0A 1N6QB 4RW6A 5C5JA 4KFBB 3KHGA 4JV1A 3GV5B 2HNDB 2ZE2B 4DG1A 5CYQA 3KLFB 5KFTA 1C0TA 1RT1A 1J5OA 4ECQA 4FS2A 2IC3A 5KG6A 2FVSA 1KLMA 4EBCA 5FDLB 3IG1B 2V4RA 1RA6A 2FVPA 4EBEA 3KJVB 2B6AB 4J9KA 4ECZA 1SUQB 1JX4A 3E01B 1HQUA 2D3ZA 3BR9A 5KG2A 5KFOA 3NBPA 1HMVA 1NNDA 4KHRA 3HVAA 4MK7A 1SV5A 5KFFA 2IM1A 3H4DA 2UVVA 1S9GB 4PUOB 1D1UA 5F8HA 1MU2A 1REVA 1K1SA 2XI3A 5DG8A 1S9FA 3PW2A 2HNYA 2WRMA 3ITHA 1S9EA 1JKHB 1C0UA 2FVQA 3MFIA 2ZD1A 4KB7A 4WFYA 4DL4A 1LW0B 1RT6B 4H4OA 2WCXA 5KFVA 3DM2A 2AWZA 5K14A 3DRSB 3ISNC 4H4MA 1KHVA 4ZP8A 3OLBA 4ECVA 4ED8A 4DL3A 1TVRA 4LSNB 2R2UA 1R0AA 3KLHA 3D5MA 5J2QA 3MEDA 5KG7A 1RT4B 2VG5A 1JLBB 2R8JA 4ZP6A 3N6MA 4J9RA 5HLFB 4ED0A 3KMQA 3DRRB 2W9BB 3OL7A 4DL7A 2YKNB 4IFYB 1LWFA 1S0NA 3OHAA 1SH2A 3H5XA 1N4LA 4NLVA 2E9TA 4IDKB 1N48A 4WFXA 1TV6A 5KT2A 3V6DA 2OH2A 3MEGB 5DQIA 3HKWA 4JV0A 3I0RA 5KFSA 3FSIA 1S48A 2JEIA 3H2LA 1HNVB 4LSLB 5EWFA 5C42A 2B5JA 3MR2A 1TP7A 1S1XA 4K4XA 1IKXB 1IKWA 4WZQA 2FVRA 2BE2B 2OPSB 3DYAB 5HBMB 2YNFB 3T19A 1RT7B 4Q0BB 1S4FA 4QW9A 3BSNA 4GC6A 5KFMA 3LANA 2UVUA 3MTKA 1N5YA 2VG7A 4HKQA 1VRUB 4KKOA 3KLEA 3G86A 4TY8B 3G6VA 2BR0A 1RTIA 5KG4A 1S0OA 4IRDA 4XO0A 1UWBA 1TKXB 1S6QA 2JC0A 4DL6A 1BQNB 4F4ZA 4NLWA 1EETA 2RKIB 3IRXA 2ZKUA 4TN2A 1ZTWA 4KO0B 5DQGA 3QIDA 3FFIA 5J2MA 4NZ0A 5CYMB 4O44B 2V4QA 1IKYA 3C6TB 4RW4B 4XPEA 1HQEA 3LP2B 4EO8A 2WONA 1JLGA 3C6UB 2C2EA 2YNIB 1IKVB 4IG0B 5I3UA 4RW6B 5DGBA 4MK9A 3Q8QB 4LQ9A 4DG1B 3HHKA 5CYQB 5KFGA 5KFYA 1C0TB 1ZETA 1MMLA 1RT1B 3DOKA 1J5OB 2IJNA 2BQRA 2IC3B 3SFGA 2E9RX 5HP1A 1KLMB 1CSJA 5J2NA 3FDSA 5KG3A 1LWCA 1DLOA 4ECRA 1S0MA 1HQUB 3TAMB 1RDRA 1LWEA 5L1JA 4F50A 3NBPB 1HMVB 4ECTA 4ED6A 1SH3A 3GV8B 4TYAA 3RB0A 2EC0A 3M9OB 1SV5B 2FJVA 2ASJA 4QWBA 3UQSA 5KFAA 2IA6A 5EUHA 3BSOA 3PW4A 5F8LA 5EWGA 2WK4A 4I2QA 1RT3A 5J2PA 3GV7B 1JLQA 4Q43A 1MU2B 2RDIA 1REVB 3H5SA 5EDWA 3GQCA 5L1KA 3T5LA 2HNYB 3OHBA 4WE1A 1W25A 2QE5A 3ITHB 3CJ2A 1S9EB 4J9LA 1C0UB 3M8QB 2AGPA 3BJYA 5F8MA 2ZD1B 4EO6A 2ALZA 3H59A 2GIQA 3CJ3A 3QLHA 4H4OB 2AX1A 3GIIA 4ZPCA 2E9ZA 4Y3CA 3DM2B 5DGAA 5K14B 1GX6A 5KFUA 4H4MB 3BSCA 4NLRA 2JEJA 3OLAA 3JSMA 1TVRB 1R0AB 4OL8A 3ICLA 3KLHB 4RNFA 5J2QB 3MEDB 4URGA 5KFJA 1NHUA 4HYKA 2VG5B 3NMAA 1RYRA 4I2PA 5C24A 4RUCA 3NKYA 2R2TA 4Y34A 1LWFB 3KK1A 3BQ0A 4MKBA 4TQRA 1TV6B 5I42A 3V6DB 3FQKA 3RB6A 4R8UA 4QWAA 4ZMMA 1TKTA 3QGGA 1T05A 3I0RB 4MH8A 3PJXA 3MEEA 2D3UA 3QIPA 2UVRA 5C42B 2B5JB 3RBDA 2BQUA 1S1XB 2ATLA 1IKWB 2I5JA 3TAMA 2AGQA 1HNIA 4ZVGA 1S97A 4IR9A 3GIMA 3E51A 4IG3A 1HYSA 3PW5A 2XCPA 5D3GA 2WOMA 4K4VA 3UDLA 1N5YB 1S1VA 4ZPBA 3OL6A 4JV2A 2VG7B 4KKOB 3KLEB 4ZP7A 4O3PA 2IAJA 1RTIB 4WZMA 1C1BA 5KG5A 1UWBB 3CDUA 1S6QB 3RBEA 2DPIA 1EETB 3IRXB 3CJ4A 4PQUA 3G6XA 2I1RA 3M8QA 4IFVA 3KMSA 5DG7A 3FFIB 5J2MB 2C28A 4G3IA 1JLFA 1S6PA 5KFCA 1IKYB 3RAXA 4WYLA 1HPZA 2WB4A 1HQEB 3KLGA 3CDWA 1GX5A 3OL9A 3KK3A 4IKAA 3PHEA 2WONB 1JLGB 4MIBA 3H4BA 2OPRA 3PVXA 4O3SA 1TKZA 3PJWA 4MIAA 5I3UB 2OPQA 4IRKA 1RTJA 2FJWA 2HMIA 1RT2A 3LAMA 3PR5B 4IOBA 1S1UA 3T1AA 3DOKB 2O5DA 5F9NA 4KV8A 5HP1B 1JLCB 3DI6A 4B3OA 5J2NB 2AQ4A 1DTQA 1LWCB 1DLOB 3IN5A 3FQLA 3KHHA 5C25A 1LWEB 3V81A 4TQSA 4PWDA 4NRUA 1S49A 2WHOA 1ZTTA 3DMJA 4M95A 4NLTA 3V6HA 4I2QB 1FKPA 4ZHRA 1RT3B 5KT5A 4IQXA 5F8GA 5J2PB 1JLQB 2YKMA 3MR5A 3M8PA 4NRTA 2WTFA 3DRPA 4EBDA 4LQ3A 1EP4A 4WE1B 3KHLA 3LP0A 5HROA 2IMWP 4WFZA 2XCAA 1DTTA 3CDEA 3QLHB 2XC9A 4RW9A 1Z4UA 2V0NA 3CWJA 2VA3A 2YNHA 1QAJA 5DQHA 5KFWA 2AU0A 3JSMB 3EPGA 3JYTA 2R8IA 2VG6A 1RAJA 1SH0A 1TL1A 2JLEA 4I2PB 5C24B 3V6JA 4NLQA 4J9QA 1JLAA 1RTHA 4I7FA 1JLEA 3NAHA 3Q8PB 3KK1B 4QPXA 4O3RA 3DLKA 5T14A 1C1CA 3PZPA 1FK9A 5I42B 4R8UB 4WYWA 1TKTB 4IH6A 4KAIA 4K4SA 3MECA 1T05B 2IM2A 4ED3A 3SI8A 5KT7A 1JXLA 4FBUA 1LW2A 3MEEB 2HWHA 2XWYA 1JLCA 3QIPB 4H54A 3EPIA 2IJFA 4O3OA 2W9CA 3I5BA 2I5JB 5L1LA 3CVKA 4MFBA 2QV6A 1HNIB 4F4XA 4R5PA 4IG3B 1TL3A 5EWEA 4J9PA 2OPPA 1HYSB 4TXSA 1T3NA 3HVTA 3CJ0A 1QE1A 5D3GB 2WOMB 1NHVA 2UUWA 3IS9A 1S10A 1S1VB 2AX0A 4TLRA 2BRKA 2IAJB 3QO9A 5KFQA 5KFEA 1C1BB 3KHRA 2C2RA 3Q8RB 2RDJA 3NL0A 4TY9A 2HNZA 4PQUB 3DLEA 4F4WA 4IFVB 2YNGA 1JLFB 1S6PB 5KG1A 1T94A 4NLYA 3M9NB 4ECYA 1HPZB 1WNEA 3LALA 3CO9A 3UR0A 3CJ5A 2GC8A 3KLGB 3IGNA 4NLSA 3KK3B 2FLLA 2IM3A 4U6PA 2OPRB 4J9OA 1TKZB 4R0EA 2W9AA 2OPQB 3NGDA 1RTJB 4K4ZA 3T5HA 2HMIB 3V4IA 1RT2B 4RW8B 4KE5A 4Y2CA 3SFUA 4RNHA 4ZVEA 3KK2A 4QWEA 3GIJA 5L1IA 4J9MA 1S1UB 3DOLA 4YR0A 3Q8SB 4KV8B 3IGVA 4NLXA 1T03A 3DI6B 4B3OB 4YQWA 4ED1A 2D41A 4RU9A 4K50A 1DTQB 2R8HA 4YR3A 1C2PA 5C25B 4ED2A 3V81B 5J1EA 3N6NA 4U7CA 3MR3A 4ECWA 4PWDB 3BREA 1RTDA 3DMJB 1OS5A 1FKPB 4ZHRB 3BQ2A 5KT3A 2YKMB 3M8PB 3DRPB 4NLDA 3DLGA 5F9LA 3PW7A 1EP4B 3RB3A 2W7PA 4K4TA 2BQ3A 3LP0B 5HROB 4NCGA 4J9SA 3G6YA 1DTTB 4NYZA 4RNOA 2W7OA 3RAQA 4K4YA 3QGHA 4ID5A 4EEYA 5L9XA 4RW9B 2YNHB 4URSA 5KFHA 3JYTB 4K4WA 2VG6B 2FJXA 4NLGA 1N56A 1TL1B 5KT6A 3H5UA 4K4UA 1JLAB 1RTHB 4I7FB 1JLEB 4O4GA 3T5JA 3DLKB 5KFRA 1S1TA 4IR1A 1C1CB 3FRZA 1FK9B 3V6KA 4DL2A 1JIHA 4RW7A 1BQMA 2ILYA 3D28A 5JUMA 4RW8A 3QGIA 2RF2A 3MECB 4NLPA 3LP1A 2B43A 2C2DA 1FKOA 1LW2B 1RT5A 5KFZA 5KFIA 2W9CB 5KFLA 3UPFA 1HARA 4MFBB 1K1QA 1YVFA 4R5PB 4ICLA 1S1WA 1TL3B 1VRTA 3VQSA 2XI2A 4J9NA 2J6SA 2OPPB 2JEGA 3HVTB 3OL8A 3I0SA 4G1QA 4GC7A 3H98A 1QE1B 4FS1A 3TQ1A 2DPJA 3IS9B 4RNNA 4ZPDA 4QWCA 3KLIA 3DDKA 1TQLA 5F8IA 3QO9B 4O4RA 3BGRA 3OSNA 4ECXA 5KG0A 2HNZB 4F4YA 3DLEB 5F8JA 1XR5A 2BANA 4FBTA 2YNGB 4YMEA 1N6QA 4Q45A 4RNMA 4KFBA 3NAIA 2HNDA 2ZE2A 3KLFA 2ASLA 5KFDA 4DEZA 5JXSA 4ECSA 4KHMA 1XR7A 4RUAA 5FDLA 3IG1A 4ZVHA 3KJVA 2B6AA 3V4IB 4O3QA 1SUQA 5DLGA 4XPCA 3E01A 3KK2B 3BQ1A 2J6TA 4WXOA 4QW8A 3QZ7A 2IM0A 3DOLB 2GIRA 4MKAA 1QUVA 1T03B 3GYNA 5F8NA 2R8GA 1S9GA 4PUOA 5J1EB 4ZVFA 4EYIB 4M94A 2XGPA 1RTDB 4Y2AA 3CIZA 2HAIA 1KHWA 2ILZA 3QYYA 2W8LA 1JKHA 2D7SA 2V9WA 4ZPAA 3H5YA 2CKWA 1I6JA 1U09A 4ED7A 3DLGB 1LW0A 1RT6A 2C22A 3KOAA 3DRSA 5KFXA 4NCGB 2JC1A 4O3NA 4YR2A 1RYSA 2VA2A 2IBKA 4LSNA 3KLVA 3HVWA 4URQU 3GILA 4KSEB 1RT4A 4ID5B 2W8KA 2AGOA 3ISND 1JLBA 1S1WB 5HLFA 3DRRA 2W9BA 2YKNA 4IFYA 3I5CA 3H40A 4IDKA 3MFHA 2R2SA 4NLUA 2XGQA 4ECUA 4Q8EA 5KFKA 3MEGA 4O4GB 2HWIA 4IH5A 4RZRA 3OSPA 3T5KA 4IRCA 3MR6A 3M9MB 1S1TB 2BRLA 3BSAA 4MK8A 2FLPA 5KFNA 1RA7A 4ZP9A 1HNVA 3LAKA 4LSLA 4RW7B 1BQMB 3N6LA 5KFPA 1IKXA 2RF2B 4IH7A 3KNAA 1IM4A 3LP1B 2BE2A 2OPSA 1FKOB 3DYAA 5HBMA 2R2RA 3I5AA 2YNFA 4YP3A 2ASDA 2UVWA 1RT5B 1RT7A 4Q0BA 2FLNA 3GIKA 3RB4A 4NLOA 2CJQA 4JUZA 3PR4A 1D0EA 4ICLB 1VRUA 2JEFA 1VRTB
chains in the Genus database with same CATH superfamily
2IMOA 3TVYA 4NASA 1YJUA 4LSZB 4DPXA 1EB0A 4FKXA 3W9IA 1P1LA 5KT4A 4KBIA 4CZCA 3PW0A 1Q8LA 1BWVA 4OZ3A 5KFTA 3W63A 3W5XA 4HTJA 2IC3A 1T9XA 4ID8A 4YDXA 1B99A 4DR7J 1HMVA 1KS2A 1UFWA 4PUOB 1V9OA 1S9EA 1N33J 2XY7A 1TU0B 4ECVA 2IY5B 3W1YC 5IM0A 5HLFB 1K47A 1BE4A 1R8CA 3K8WA 5AE3A 3THPA 1NK6A 2DD8S 4LMZA 2XWXA 5C42A 1IKXB 4UY85 4UUXA 4DUYF 3IBCB 3MTKA 1N5YA 2YPYA 3BR8A 3C66A 2CNOB 3T1YF 4A8XA 1EETA 3PIOQ 3EGVA 3IM8A 2V4QA 3CDAA 2W2MP 3OR2B 2K3IA 4OYMA 1TELA 2MXYA 2RS2A 4DV0J 1KONA 2ERRA 4QIEA 1VQ8S 4ECTA 2B9EA 4WF9Q 2ASJA 2IA6A 4J5OA 1KP6A 2BE7D 2XTJP 3C3LA 4WE1A 1X60A 3CJ2A 2HFVA 1KQFB 2VBWA 3BJYA 2GIQA 3CJ3A 4OI0A 5KFJA 2UV8A 2BW2A 3CD0A 4DV2J 4MKBA 3M8YA 3MGJA 3PJXA 1E6YB 3ELHA 4MT1A 3TAMA 1K0VA 1H2TZ 1NJIT 3NGUA 1IUJA 1X4BA 4X65F 5D3GA 3UDLA 4ITSA 1S57A 1MMDA 1U25A 5J2MB 2VKZG 1JLFA 3HK2A 1X4DA 1HQEB 3CDWA 3PYFA 4IKAA 2WONB 5AXMA 4IRKA 2KYXA 2MKKA 1M5VC 4ZVUB 1T9TA 1S1UA 3SCJE 2Y1LB 4DR2F 2RHSB 1GMWD 1H6KX 3W64A 4PWDA 3TAPA 1VQNS 5F8GA 2YKMA 1PCAA 3WX8A 4CIOA 4LQ3A 2IPOB 1AFIA 2V8GA 3LP0A 3R1HA 1B0VA 3GONA 2YNHA 1Q5VA 3BBFA 1HBNA 3DLHA 1YTYA 3G82B 5A2QU 3K0JA 4K8RA 3BV8A 1U0SA 1PG5B 4KAIA 4KHPF 1U45A 1FRMA 4DPYA 1RKJA 2DR6A 4MFBA 3F56A 4NX9A 1ZOTA 2NXNA 1YWXA 3MXHP 3QQCD 2W1BA 1FO1A 2ZBQA 1HWIA 2V94A 2HIYA 2OEMA 4CCHA 1G1XA 4OYPA 4DR1F 4NLYA 4ECYA 4OLOA 4J9OA 4DCOB 3DLJA 1RT2B 2ZNYA 4ZVEA 1HNWJ 4J9MA 2ZDOA 2I38A 4U7UD 2LDYA 2HBZB 3Q8SB 2NYIA 5J1EA 3MM6A 3R1LA 4LRCA 1RBLA 4JI4J 4NLDA 1W2IA 2ZHOA 4K4TA 2H65B 3TUIC 1CQNA 4NYZA 3VVUA 1IBLF 1K0TA 4QPTA 3HXMA 4U8VA 1RSCA 1J5EJ 2OHDA 4WP8A 3G71S 4NA2A 2CJ9A 3H5UA 4B9VA 4DX7A 2MZSA 2V8HA 2QO3A 1FKOA 3FJ2A 1HARA 1KN6A 4TNOA 1H98A 3MMJA 2JFDA 3NRBA 4L73A 2DYAA 1RAEB 4KPYA 3HD1A 1WI6A 3OSNA 4WKYA 4DI6A 2HNDA 1OJ4A 3KDNA 4USJC 4DR3J 4DV7F 1QD1A 3VVTA 3VQTA 4WXOA 4CLFA 1YKWA 3P3DA 4FDFA 3QFWA 1UL3A 5D78A 1Q5YA 4ZPAA 1I6JA 3DRXA 3V5RA 1Y5IB 3KOAA 2HHVA 1N36J 2DO0A 1RAHB 3UE2A 4BDPA 1N5SA 4BWMA 2GJFA 5HATA 4XDCA 3NY0A 1NK0A 4P7VA 1Q95G 4RW7B 2A1BA 4F2RA 2MDAA 5CZVA 3CTRA 2LMIA 3DOMB 4FP9A 1HL6A 3EZ5A 4QQBA 2ZVSA 2MHNA 3TJ9A 1F0XA 2ZH7A 3FBFA 4USIA 2GGPB 4PR6A 3FBEA 2CNLB 2M8DB 1BMQB 1C0TA 3IG1B 1ZH5A 1NKBA 1D1UA 5DG8A 2YWEA 4JI7J 4H4OA 4LFCJ 4DL3A 4CLKA 5C7PA 1R0AA 4LFAF 2B4OA 2Y8YA 5T7LA 2C3UA 3OL7A 4OYWA 4OZ0A 4KQZA 2KB2A 5D77A 1QDUB 2QL7B 2GNKA 4JV0A 2JEIA 4FYWB 3H2LA 1HNVB 3NS5A 1EQ0A 1UCNA 2CDQA 3HSZA 4E2FB 1T95A 1S4FA 3GTYX 5KFMA 4BHQA 3QRQA 1XMOF 2XMUA 1KRPA 1N32J 4C3KA 2RKIB 3UD4P 2VFRA 4DOZA 5BYSA 1DRZA 4V1Ak 5E0OA 5D15A 2AT1B 3VGSA 1J5OB 3Q8UA 4J9UE 1P8GA 4ZLJA 4QWBA 2R7XA 2FJBB 3J7AN 4Q43A 4FN5A 1REVB 2FZGB 1OPZA 2YKAA 3SQGA 2CJKA 2HAFA 2DGTA 4CT8A 3CMES 3BYPA 3BKTA 3HF5A 5BXIA 4DN0A 3EX7B 3CCVS 3DM2B 4P2FA 4DS5A 2KU7A 4HYKA 4RBTA 3TJAA 2R2TA 1HI1A 2F8MA 3BQ0A 1NB2A 4PG5A 1TR0A 4M5IA 2BQUA 1S97A 3QMQA 2ZWOA 2IAJA 3UCGA 2AF6A 3BO4A 3G6XA 3R5AA 5JVGQ 3T1HF 4JI3J 4F2SA 3H4BA 3PVXA 5DJBA 4O3SA 1U7LA 3SYZA 4P52A 1RWXB 3T1AA 2MSTA 3AD9C 4KGMA 3DI6A 1W2BR 1WACA 1G3OA 2WHOA 2XZTB 5AXLA 3VAMA 2WTFA 4EBDA 4MTPA 1IR1A 5LL6d 2COLA 3PDNA 2VA3A 1QAJA 1UKUA 4RKUC 2GQCA 1E6VA 1U1LA 3KUHA 5B08A 3DLKA 5T14A 1FVQA 2V8VA 4TU9A 2HPUA 2YWHA 5CD4H 1Y00A 1TKTB 3SI8A 1UP1A 4Q2LA 4YOEA 3EPIA 2I5JB 1WDTA 1T3NA 2CQ4A 3CJ0A 1H3DA 1LXNA 4M5LA 2RDJA 4X64F 4F4WA 2GA7A 3SDEA 1UW4A 1FFWB 3MM5A 3KLGB 3HMJG 2J0SD 4RW8B 4CLSA 3CCQS 3M1VB 1UA1A 4KV8B 4LR8A 3JS9A 2R8HA 1RISA 2RUSA 1NDPA 2FTRA 2CFXA 1RTDA 1WC5A 3A1YG 1VR6A 1MW7A 3DCAA 2VQFJ 4O0IA 1IJEB 3BDEA 4NL5A 2DRDA 4C97A 2HBRB 3CJRA 1QM9A 1W26A 1X4HA 5CQGA 4IR1A 3DLLQ 3V6KA 1QAXA 4J90A 4FVMA 2H9ZA 3LP1A 1KVJA 4M5NA 5LMNJ 3SBMA 1FWKA 1UVIA 3HD2A 2BDPA 4QWCA 4O4RA 4AXIA 4ED4A 4C9DA 4FZVA 3DLEB 3SCLE 4YMEA 1SC6A 4CNZA 2E5IA 2IDLA 5FDLA 4ZVHA 5E41A 4LF5J 5B0EA 1S9GA 2RH3A 4EYIB 3R2DJ 4PQAA 3W2VA 2V9WA 3GU0A 3EM1A 3DLGB 5DRKA 4YHHJ 2LU1A 2M3DA 4PYAA 3SSSA 1JLBA 3CNQP 4LFBJ 2C3YA 4ZLLA 9RUBA 2KXHA 2B56A 3A8KA 5HMYA 3EJMA 2RRBA 5JJBA 2PO4A 2ZH9A 5KFNA 2V8DA 2ZFHA 1U47A 1CULB 3FEXB 5BR8F 1TAUA 1Q1KA 1JK9B 1M1HA 2ZWPA 2FY1A 2OFGX 3CC4S 3KLIB 4A4JA 3CJKB 5KFBA 5AE1A 1IKVA 2ZHAA 1CJKB 1FA0A 4N77A 3R6LB 1FNXH 5EX3A 5IT4A 1RA6A 3KJVB 1SJFA 5HL7Q 4DPTA 3I32A 4MK7A 1PC5A 3N9UC 3OUYB 1VGYA 4F4AA 2UXBF 4UUWA 2CQIA 3L3CA 1ZZNA 1AA1B 5KFVA 4LR7A 1PBAA 3LGMA 2R8JA 4IFYB 4ILRA 1YBUA 4LF9F 3HHDA 3ISZA 5D0EA 3M2UA 1XC9A 1D8YA 2QMUB 4LIRA 5JVHQ 2A0FB 1FJGF 4DU7A 2ZZNA 2E1MC 2B9XA 2XM3A 4B9SA 3FC9A 4DV3F 4CM2A 3G86A 2BJEA 1QAYA 1DARA 2JC0A 1S6QA 2EBEA 1BQXA 4P75A 2R3VA 3FFIA 3DFEA 2CQ1A 1IKYA 2UUAJ 1EHWA 1SC3B 2H54B 4FXWA 4LQ9A 1VS3A 3CCRS 1HQUB 4JI8J 2CQCA 4OV1A 4C8LA 1SH3A 3GV8B 3RB0A 3JQKA 2WK4A 3GV7B 1GT8A 3GYGA 3FCHA 1AXQA 1SL1A 2VBYA 2KH9A 3TW0A 4J9LA 1C0UB 3M8QB 2VUGA 4CLPA 2AX1A 2VPYB 3C2PA 3BSCA 3ETMA 1LV5A 4OJ3A 1NLKL 1WC0A 1KD1T 2NXUA 2EFGA 3CMQA 2AZ3A 3AOBA 3TAQA 3M7VA 4DV6J 4MH8A 2Y1RI 3MEEA 3HT0A 4ZIVA 3RBDA 2XNRA 3Q83A 4IG3A 3GG1A 1S1VA 2VG7B 2YH0A 4USTA 4G3IA 4OYAA 3RAXA 2F4VF 3FUYA 3NWGA 3IP0A 1RTJA 5GAEI 1EARA 3TA1A 2K7KA 1LWCB 1NZAA 4ZCKA 2YXLA 5M2RA 3DMJA 2DR8A 4P74A 3MPUB 2QRRA 3K57A 4ELVA 5CZXA 4YY3J 3QLHB 2RT3A 1I1GA 2AU0A 1F2HA 4KYZA 2CPEA 1RTHA 2OD6A 1PYOB 2N7YA 3TQEA 4WYWA 1T05B 2VH7A 2MEWA 2MJUA 3QIPB 4H54A 4O3OA 5L1LA 1HNIB 3SMZA 3R5JB 2WOMB 4TVAB 2FQQB 1X0FA 5A2QY 4PQUB 3NGTA 2MB0B 3UDCA 1S72S 3JSRA 5AXKA 4KE5A 1SI9A 2JDJA 4DUZJ 1R27B 5A8KB 4ES3A 3W62A 4PG4A 1F9EB 4GMKA 1FKPB 1VJQA 4EGLA 1H2UX 3M8PB 2P5VA 3PKYA 2XZWA 4ZJOA 2X1FA 1NAQA 4J9SA 3NP5A 2OIHA 3QT7A 2KL8A 1V3ZA 3GZ7A 3JYTB 1XNRJ 1G6BA 2J5AA 4WIIA 4QIFA 1VOMA 4RW8A 1U0HA 3CCWA 2HQGA 3MMCB 3OTBA 3H42A 4QCLA 4OHXA 3PRDA 1URRA 3VAHA 1U2FA 4R5PB 4LRFA 4ICLA 1VRTA 2XI2A 2DPJA 2DH7A 4C8NA 2PFDA 1PO6A 4Y2IA 3GSDA 2JX2A 1XR5A 2BANA 3QRPA 5AJ3F 4Y2KA 3D6HB 3HJVA 1Q7YT 2V68A 2UVRA 2B6AA 4HI2A 3DOLB 2BM1A 2OTLS 3CJQA 1U8WA 2BZ2A 4ANEA 3M6WA 4FYXB 2C3OA 1RYSA 3MM8B 2FJEB 3DRRA 2YKNA 1Y3JA 4I6WA 1SCJB 4HACA 2FLOA 2FLPA 3LAKA 1BQMB 2PA8D 4YP3A 2YNFA 4M1KA 3GIKA 3RB4A 5HMWA 3EVWA 1RAFB 1CQMA 4DV4J 4G65A 5HO4A 1VBZA 1NMEB 5A0YA 4I69A 3D3CJ 1V3RA 4K0KF 5LSOA 1P1TA 3GV5B 5DDQC 4UW2A 4IR9A 1DQ8A 2G1HA 1RHMB 3O8WA 3TJ8A 2DNLA 2EG2A 3JQJA 3PRBA 2IM1A 2NXEA 1LQ9A 3O5TB 2LFVA 1F5CA 3MMAB 1ICEB 1VISA 3EDQB 4USUA 5M2UA 1LKZA 2YKQA 3D0GE 1Y5NB 4LSNB 5J2QA 4ED0A 2GCFA 1MWYA 3X1LB 2V2VA 1S48A 2LEBA 1RP5A 1IKWA 4IOCQ 1Q16B 4F3MA 1HKAA 2HHXA 4J91A 3SZ2A 2BR0A 2DNNA 3QT5A 1RWWB 4C0HA 2QYCA 2VPWB 1NXIA 3TARA 2VFUA 4ZVQB 2Z2ZA 1MNEA 5CYQB 3BH6B 4RR5A 3MEKA 1MMLA 1ZA1B 2BQRA 1CSJA 2R7VA 2RMLA 4P2SA 2E7WA 4LF6J 4Z7CA 3MWBA 5L1JA 3NBPB 4B3SJ 1GK8A 3HHLC 3KG4A 3PW4A 3NLCA 1SJRA 2UZAA 5C2GA 2UUCF 1MMNA 2Z2LA 1CC8A 1RHJB 4UZBA 3DGPB 1O51A 4ZPCA 3OLAA 4URGA 2N3LA 1IR0A 1VLOA 2LA6A 5E2QA 1OIAA 3DLBA 3IAS9 4NMXA 4XAKA 1WF2A 3B78A 2LKZA 2N4DA 3HX9A 4CTAA 3GIMA 3NWRA 2CQ2A 3AOCA 3D0IE 3IRXB 3CJ4A 3M8QA 4IFVA 3Q0AA 3I4PA 1L3KA 3CSKA 1GX5A 4MIBA 4DF8A 4PCQA 5J2NB 2QJ3A 1WDDA 5K9FA 4ZHRA 2RNEA 2XY6A 1ZM9A 5GAEU 1OMSA 3KKFA 3H0PA 5CHCB 4N76A 4ZPWR 3MAAA 4RJVA 2I8EA 3W3SA 3KK1B 4QPXA 1FXLA 1FEEA 4ZJQA 3CEDA 3WC0A 1WOOA 3P8BB 1S6OA 2FDNA 4FYVB 4K4SA 5IS2A 2RIJA 1L3SA 1U1RA 1RQ0A 3QT6A 2KXFA 1S0VA 4F4XA 1IN0A 4YB7A 4LT6A 5EWEA 2Q1LA 1R8BA 2MQMA 5IWAF 2ZBCA 5KFEA 2HNZA 2HHHF 2GC8A 2EG1A 3BO3A 2XG8A 4DDFA 4ZOSA 3SFUA 1IBKJ 2GW8A 5G4DA 1U1NA 2CPZA 3IGVA 5B0DA 1PIEA 3V81B 3A8IA 1X4AA 1U1KA 4XIUA 4PWWA 1R6YA 1YJWS 2J8SA 3N4WA 3PEHA 3G6YA 2W7OA 4ID5A 4EEYA 2FJAB 4ZVSB 3QFHA 1HNXF 2XLJA 1FFSB 5KFRA 1VQMS 2CVIA 2RF2A 4K5SA 2HBQB 2Q3PA 1I94F 1RT5A 2DGWA 3GPAA 3GJRB 2CRLA 2E7XA 2MTLA 3CO0P 4ES1A 4BWJA 4KFBA 2K1RA 3THVA 2AJ1A 5H9EK 3AA8A 3V4IB 2C3PA 5CA5A 4C6AA 4MKAA 4X4NA 3QJPA 5A8RA 2XGPA 2ZH5A 2B4PA 1RT6A 3TR5A 3HVWA 4URQU 3HHEA 3VGTA 5D0GA 1YX2A 2JRSA 3MPVA 2M8HA 4ZP9A 1AFJA 1VQPS 4LUBA 2AEJA 5BYQA 4DSFA 1RT7A 2PEBA 2XYGB 1XMQF 3EDRB 2E29A 1TKXA 4DL5A 2IA0A 2XZDB 5L38A 1FDAA 4QWDA 4TYBA 3J80U 3BGRB 2HS0A 1OYDA 2MQLA 1RI7A 2DHHA 2ZM6J 4RW6A 5HN0A 5F0UA 3GP9A 1HHQA 4QJVA 2HZCA 1JX4A 5KG2A 2QGFB 1NNDA 3L7PA 4ER8A 1R3NA 5IV3A 3BN4A 5KFFA 1SV5A 1UAWA 3HZEA 3HHLD 2XI3A 3MCMA 2IFXA 2V34A 2HGLA 2WRMA 3K7RA 5L46A 2OEKA 2ZD1A 4E8UA 2R2UA 3MEDA 3IMQJ 3LWMA 3S6EA 2W01A 3V6DA 1D9AA 2QMXA 3VAJA 2B8QA 2B5JA 1KTQA 2ZNZA 1SQFA 3M2VA 4OZNA 4B3MF 1N8RT 3UR3C 2B4VA 3VV2B 3SIPB 4F7VA 4JV5J 2ZKUA 3M6UA 2B8PA 3M30A 2FD2A 4HT5A 5IT9U 1KDNA 3C6UB 2E5LJ 3Q8QB 3BPSP 4BCAA 4ZVRB 4DG1B 3DOKA 3G9CA 1S12A 1WG4A 1Q8KA 1S0MA 2WBMA 2PI5A 3TANA 4U95A 3EWGA 1X4GA 2RDIA 3H5SA 1WUUA 2MZQA 1RUSA 2EI5A 5F8MA 4EO6A 4Q2MA 1HD0A 4AYBD 5IXUA 3UFCX 1V5IB 3EXYA 4KIAA 4C8OA 4A8YA 1DZ5A 1S1XB 2KG1A 1T02A 2C42A 4KC5A 3HZGA 2W2OP 3HKZD 4JV2A 4OZ5A 1R43A 1O0PA 4C8YA 2C28A 4LF8J 1S6PA 1RXOB 2WB4A 1MN7A 1R0CB 2YH1A 1TKZA 5D6GA 1IBCB 1HBMB 2ASYA 3CJSA 2V50A 2C2OB 5HP1B 1DLOB 7FD1A 1X9MA 1JWWA 4NRUA 1S79A 1SQGA 3AJ1A 4NYPA 4X62F 2VPZB 3NOCA 4OYZA 3QATA 2XYHB 3HHNB 4LF7J 3TYTA 5DQHA 3JSMB 1LOUA 1Q86T 1RAJA 4RBUA 2B0GA 3P6YC 3NAHA 4I7FA 3D67A 3IXQA 2EEYA 3I96A 5I42B 3J81j 2M0GB 2NS1B 2IJFA 3N28A 1FDBA 4QU6A 4WFAQ 1TL3A 5E3AA 3W7BA 3HVTA 1X5TA 2UUWA 3ILJA 2X7IA 5CD4A 2DHGA 4TY9A 2WAQD 3MM9A 5AE2A 2JH3A 2ZZMA 1AUDA 4DR5J 3NGDA 2HMIB 4QWEA 3KK2A 2MKJA 5ETSA 1WHXA 2AZ1A 2FHMA 4YR3A 5A8WA 3TOQA 4KGZB 2C3MA 1CVJA 1RADB 1EP4B 2BOAA 1DTTB 2VC1A 4RW9B 1B7FA 3FMWA 2CPDA 4JI2J 2OSRA 3BPDA 1LW2B 4XTTA 4CH7A 1VHFA 4L6V3 3OQ2A 3SSRA 1WD6A 5B0CA 3FMBA 5IC6B 2BMBA 2CYYA 1QE1B 3IS9B 3K5MA 3IWXA 2DCLA 1R0BG 2KZMA 1C4CA 3NAIA 1WI8A 3FGVA 2ZE2A 2HQIA 3MUVP 1PYTA 4QOTA 4F04B 2AKWB 3SCKE 4A46A 3D2WA 1VQLS 1JKHA 2YKOA 1LW0A 2YWKA 2RUGA 2DXEA 5CAAA 4C48A 2YQ1A 2LCWA 2DXDA 1JB0C 4LF1A 2DHAA 3OVBA 3OSPA 2KO1A 4MK8A 4DS4A 3IRWP 4YB6A 3HULA 2DIVA 4GVBB 1VRUA 2JEFA 1D9FA 3ZXWA 5DLFA 4O44A 4RW4A 5ETTA 4WXWA 3HHLA 5M2PA 4IUFA 3C46A 2QA2A 2OKQA 1F5BA 4X4UA 4EBCA 3WIUA 1YSJA 3AHPA 1ZPVA 1RE1B 4OHWA 2O1PA 4QBUA 3CCSS 5F8HA 2D74B 2KRBA 2HNYA 4LBPA 1WKJA 2BJDA 2WCXA 3DRSB 3I9V9 5GADI 2VG5A 3VHQA 3PO4A 5A6PA 3CCZA 2PMZD 2XMTA 2YWFA 3MEGB 2VFVA 3U1MA 1RKIA 2MYFA 3FSIA 4LSLB 3NOGA 2FVRA 3DYAB 4Q0BB 4RLEA 3L7UA 1RTIA 2HGNA 4NLWA 1UJ4A 3CGIA 1D9DA 3FEZA 5KFGA 3M2RA 1RT1B 1V3SA 4M5DB 5RUBA 5KG3A 4ECRA 2YQ0A 3CXCR 1LWEA 1NDKA 2Z8QA 4ED6A 2N7CA 4F36A 1KBRA 2BE9B 1MU2B 2V5HG 1FCAA 2DGOA 2JVRA 3PYEA 2D9OA 4H4MB 3W8GA 4OL8A 3DU6A 1RYRA 3LPYA 1UA0A 1LWFB 2DGVA 3PEJA 3F44A 3ZZ0A 3FQKA 3EICA 3I0RB 2HBYB 2LQBA 4CLYA 3JAMY 3T6BA 4ZPBA 2G2YA 1PGZA 4WYLA 4DLGA 4YN3B 2MY7A 3PJWA 3BGUA 4MIAA 5I3UB 1VQOS 1TL7B 3LAMA 4QYZK 4PWUA 2DNYA 4DUYJ 1FI4A 2AQ4A 1QTNB 1JJ2R 1JJHA 3T1YJ 4I2QB 1RT3B 3O3LA 5GVQA 4BLGA 4PXEA 1K9MT 3CD5A 1Z4UA 3CWJA 5KFWA 2EFVA 2PDAA 2HQDA 4NXNF 2J9EA 4DPWA 3A8JA 3HM9A 4AQYF 5GAGI 3FNNA 4WP3A 4WWSA 3MECA 1UZHA 1KNZA 3T6JA 2W9CA 2QV6A 1B70B 2Q6CA 3MMBB 1HYSB 2YVSA 3I55S 2GX8A 3KHRA 1VMBA 1FRIA 1RAIB 1SL0A 4R0JA 3HFZB 5K8MA 2JNJA 3I31A 3IBWA 2XMJA 4NLSA 4U6PA 2OPRB 2OFHX 1HBUA 1LFWA 5MLCV 2OSQA 3T5HA 1AROP 4NOHA 2LQ9A 4ED1A 3I9ZA 4X65J 3N6NA 4E98A 3MR3A 5G0RB 2CWXA 3VAGA 2M4MA 2MPUA 4HLBA 3MCOA 4NCGA 3I82A 1RBAA 4FKYA 2YQ3A 1Y0HA 2VG6B 4DR2J 4NLGA 1TL1B 2B7CB 1NH8A 4O4GA 1JLEB 4DSIA 5JUMA 2G2OA 2JOQA 4JOUA 3WIVA 1S1WA 3EE3A 1FVSA 4CRJA 5DDOC 2OPPB 3OL8A 2N82B 2XSJB 1WF0A 2HW3A 1XJWB 1HBOB 4RNMA 3SV3A 2Y9HA 3S1TA 1ITPA 4V19X 4KHPJ 2ADBA 2UP1A 2J6TA 4UOFA 1HIYA 1QUVA 4B9UA 4ZN1A 5F8NA 2AD9A 2NUHA 1A0OB 1CLFA 2ZOMA 2DCUB 4DR1J 1X4EA 5B0GA 4YR2A 4USVA 2G0JA 2GV1A 2XMAA 3KNGA 1X9WA 1N0VC 4F0MA 1TK0A 2LDIA 1NK7A 4ECUA 3L9ZA 2QL5B 1DHMA 1RA7A 2E7VA 1Q53A 4IO9Q 2OPSA 2HRUA 1RHRB 2UVWA 2HVDA 1XERA 2WSFC 2GVDA 1IBLJ 3PG9A 2FVCA 1FTCA 2MKYA 1U1PA 3I87A 3AD8C 5IC4B 4RUBA 2WVCA 5A76A 2F8EX 1H2VZ 1M1KT 2AMCB 2YNIA 2HHWA 2YKPA 1X4CA 2MQPA 3M32A 3MPYA 3LW5C 1KLMA 4JYAF 1MLAA 3PRVA 1SUQB 3E01B 1CJVB 1VBXA 2LXIA 4QR1A 2CZ4A 4X4PA 3J80Y 2RJZA 3AAWB 4C3LA 4KB7A 4FXDA 4C2MA 5D4PA 3BDPA 5K14A 4ED8A 4DV7J 3D5MA 4J9RA 2G0IA 1IXKA 1PAUB 1N48A 3WX4A 2HHSA 1TV6A 2GIFA 3GR1A 1QLNA 3K59A 2EKYA 2BE2B 2BKNA 5GADU 5D4LA 1RCOB 2XULA 2WVEA 4U9RA 3N5FA 1UZDA 1WTBA 4BS2A 5D0RA 4TN2A 4WKRA 3FBBA 4PG6A 1N54B 5AT1B 1LEOA 2VV5A 4DFKA 2C2EA 4IG0B 3EGZA 4LBHA 2CJXB 2MLZA 4D3HA 2V69A 3QAEA 3LO3A 4UF4A 2R7RA 3M9OB 5E3QA 3N79A 4OV6A 5J2PA 1JLQA 1NSAA 3ET6B 3MDFA 5J1PA 4C11B 1S7IA 3ITHB 4CO2A 1XMBA 5H9FJ 4EFAC 5DGAA 4NI2B 2IRYA 1TVRB 4FF2A 2HRYA 2BYCA 3UN2A 2GVZB 2VBZA 1QTMA 3GFZA 1ZA2B 3T9ZA 5B09A 2DR5A 4R8UA 1YRUA 4ZVOB 5LM7E 3BKFA 1KFSA 5K20B 3KWMA 2XHCA 2GO8A 4LFAJ 4MYUA 3B8HA 4ZP7A 2H1YA 3CDUA 4B9NA 1VQYA 4F3QA 1NJZA 1EAYC 5DZ6A 3KMSA 2HFNA 3LQVA 2VJVA 1HPZA 4RPFA 1VCTA 2FB0A 1NJXA 1ZM4A 1FRJA 2FJWA 4KH0B 2DEIA 2E1PA 3N0VA 3ENAA 3G96A 3SCIE 1XMOJ 1H7XA 1ZTTA 4M95A 1YLXA 4L76A 1M5SA 3D1OA 5LSRA 4P73A 2R8IA 2HEKA 3R7SB 5C24B 4B3TF 1F3FA 4NLQA 2CA9A 4LF2A 3VALA 1C1CA 1FK9A 1M0SA 1EJ7L 2HS4A 3H25A 3OR1B 5I3QA 2KT2A 4HI1A 1FT8A 2PT0A 1H72C 3BYRA 3BGLA 3IFEA 3I5BA 2ROGA 4NA3A 3OJSA 2VL1A 4KR0B 3T3FA 2YX7A 2HSEB 3ENQA 1DURA 5GAGU 1UVLA 1C1BB 4YEAA 1MG7A 3DHXA 3G4SS 3LALA 1L5UA 3UR0A 3IGNA 2MZ1A 2Q6BA 1UEVA 5MAOA 2W9AA 3C15B 1AZSA 4NLXA 3HSGA 4L74A 4RU9A 5C25B 1PKUA 3ETOA 3MR7A 1OS5A 1YJVA 2Y8WA 3DRPB 3T1HJ 1RWKB 2BQ3A 5HROB 4X66F 3UVJA 4WFNQ 2CNNB 2V4JA 2GS8A 3CCJS 2HZAA 2UV8G 4URSA 1OQ3A 2HKEA 2FJXA 1N56A 1X8DA 3Q8YA 1GXLA 3UN3A 2RQKA 4DV5F 2PMHA 3C16B 4NLPA 3K5OA 5LJ3Y 1HW8A 3R7NB 3C14B 4EMDA 1H74A 3W2WA 1VC5A 4KPCA 2JLFA 3TQ1A 1N5VA 5LJ5Y 2Z2YB 4RNNA 3QPIA 1JMTA 2DGXA 2PI4A 2BW7A 3MM7B 2QYGA 1WOSA 2MGZB 2YNGB 2WVDA 3KLFA 5K5MA 2DRAA 3HJFA 1HW9A 3CCUS 1RLDA 1NB7A 4K59A 2VQEF 1U8SA 2DR7A 4ZVTB 4A8KA 4X64J 1R8HA 4CYUB 2C22A 2ABYA 2LECA 3QRRA 1EKRA 2H5EA 2BX6A 5JMNA 3EGNA 2W9BA 3HSJA 4FPRA 3AB2B 3D9BA 4Q8EA 2CJYB 1S1TB 1UW9A 4CNYA 3J7YI 5ETRA 1LWXA 4N8OA 5IV4A 3UCUP 3R8YA 1FF2A 3MD1A 1ZTWA 1VQ5S 4DX8H 2B7BB 3I0SB 1U49A 2IRXA 4KO0A 3QAUA 1HLWA 2U1AA 3KTQA 3EZUA 3C6TA 4F4KA 4DFMA 1N6QB 1FWLA 3QWPA 4HHUA 4OX8A 1AYEA 1HI8A 2G9OA 2AYEA 3EZOA 4UOGA 2MQQA 4W90B 3MZIA 4G6VB 1XWLA 2ZKTA 4ILLA 3Q86A 2XS2A 4RX6A 5IOLA 3NNCA 1X5PA 5ETVA 3RG6A 3KLHA 3IA0A 5GMDA 1OQ6A 2E5GA 3BEGB 4OX6A 5KT2A 4F67A 1M1GA 4NPOA 2XHWA 1TUWA 4K4XA 1TK5A 1RTZA 2AJ4A 4HH1A 2FGOA 4KKOA 2FHJD 3KLEA 2RE1A 4TY8B 4XO0A 1UWBA 3FK4A 4DL6A 3PFEA 1BQNB 2D69A 5CYMB 3LP2B 2DNGA 2I2YA 3POTA 2MZJA 2IJNA 2YX4A 5BR8J 2E9RX 1UEKA 3LA0A 4YB5A 2PMWA 2XY5A 3M8SA 1BLUA 1N34F 1T8EA 5EDWA 1IWAA 4OYOA 1FEHA 4OYXA 1GX6A 3ICLA 4I2PA 4Y34A 2LXUA 2KVQE 4LREA 4QWAA 4ZMMA 2DHSA 3U1LA 2UXBJ 4X4OA 2EKNA 4CO3A 4NZ7A 2MHEA 4K4VA 3VTIA 3RW7A 4HDHA 3VAIA 1YJNS 4LF9J 1F3VA 1GAOA 3DGVA 2YPZA 1Z2ZA 3OL9A 1JLGB 2E1AA 4L3KA 1B0TA 3AXKA 1FJGJ 1HHSA 1FX2A 2ZC4A 4DV3J 1A6LA 1HWLA 4L75A 3KHLA 2NZ4A 2DGUA 4ZIWA 3FCVA 1SKWA 3RYLA 2OJ3A 3RRGA 4GRSA 1CJUA 2ACYA 1SH0A 4ZKAA 1CJTA 4O3RA 1QSSA 4ETZA 4C8MA 2AJFE 4DR4F 3A4TA 2IHR1 4TXSA 2AX0A 3QO9A 5KFQA 1MROA 1WORA 2ZH4A 3FZ2A 1NJWA 4GO7X 3DRYA 3KK3B 2FLLA 1FWPA 2E5JA 5GMKa 2OPQB 4USHA 3GIJA 3LF0A 5THWA 4B3OB 3BN7A 3VAKA 1GXUA 1DTQB 1TMJA 4AUKA 5EHHA 1SIWB 5LMUF 1CS4B 3ZZUA 3HDSA 1TKDA 5KT3A 4LF4F 1S76D 1BXNA 3CW2C 3NGRA 2F4VJ 3GLJA 5HI7A 3OD2A 1OYEA 1JLAB 2NCKL 2QT7A 4XK8C 4PXBA 2B43A 3W61A 4F26A 5KFZA 4QIVA 1MN9A 2FZKB 4DL0C 1WHYA 2J7WA 2V9KA 4P2XA 4GC7A 5F3ZA 4ECXA 5KG0A 1B0PA 4KHMA 1XR7A 4N8NA 3AH6A 4K7QA 1T03B 1ZS6A 2AJQA 4PUOA 2GJ2A 1NRKA 4Y2AA 2W8LA 5DDPC 4V19J 2D7SA 3H5YA 4GKJF 4DQPA 4DQRA 2ZH1A 4ED7A 2KN4A 1TL5A 3MAQA 5LT5A 4CP5A 2VA2A 2AEMA 2IBKA 3E8OA 4C0OC 1NU4A 3HFKA 5HLFA 2CIMA 1UETA 4AE5A 2QLWA 5E7OB 3NS6A 5BJRA 2F40A 4C4WA 1RU2A 3ZTRA 2A6MA 1IKXA 4PRFA 3QBCA 2GMHA 2MSSA 4RU2A 5A6WA 1TTHB 3H7HB 4G1QB 2JL9A 2LYVA 4KGKA 3J7YU 3GJSB 3LGHA 3OR2A 3NNAA 3PTWA 4JV1A 1WKKA 4FS2A 4NYOA 2ZH6A 4KHRA 4DSLA 3NCRA 1HA1A 3MURP 1B64A 3PY8A 1RWNB 5AJ3J 3L4BC 3PHTA 1QVFR 2FC9A 3ISNC 3ZO7A 1R7IA 1RT4B 4IYQA 2HFOA 3THTA 4OI1A 5ITHA 4CI0B 3OHAA 2FHJA 2QA1A 4HH0A 4IDKB 3D1QA 2CG4A 1E6YA 3QWUA 1BWEA 2CADA 2XS5A 4JI5F 3S8SA 5HBMB 3VAFA 4BC7A 1V5VA 3R5DA 3BSNA 1NPRA 2R7QA 3LANA 4P2MA 4YB1P 3D6FB 1S0OA 4ANDA 1ZAVA 3AB4B 2L9DA 5J2MA 2CQPA 3TNVA 4A8SA 1SL2A 2VHGA 1EIYB 1HQEA 2WONA 2DR9A 2ALYB 1BC6A 5KFYA 3KJQB 2IC3B 3SFGA 2W4CA 2RSQA 1RHQB 4OHYA 1HMVB 1TAQA 3CE8A 4DJBA 1Q79A 5F3TA 1VQKS 2KM8B 3ZZOA 3AODA 4TU7A 1M5PC 2EK1A 2BKPA 1S9EB 4K0KJ 3H59A 3K5NA 2JEJA 5IM0B 1X9SA 2EFNA 1EQMA 2JHEA 2Z4PA 2UXCF 3G82A 2QSWA 4DV1F 3ZFVA 2F9JA 2ZJPQ 5C42B 5SUHA 3GYXB 4KH1B 1VFJA 1WEZA 1P27B 3PW5A 2BACA 2UUBF 1N5YB 1M5HA 1WF1A 3RBEA 4F0KA 2KFZA 2XBPA 1EETB 2I1RA 3TP2A 3TUJC 1FDNA 3BB5A 1RT2A 2EVZA 3M8ZA 4IOBA 3PV8A 2L48A 2F9DA 4MKVA 1S49A 4PG7A 4I0WA 1F5AA 2Z58B 4NXMF 2UXDF 4IQXA 3MR5A 4ZDNA 4DQQA 4WE1B 2BKOA 3P5BP 4DFJA 5FD1A 2OELA 1TK8A 5LOQA 4N5SA 2JLEA 4JI6F 3Q2SC 3Q8PB 3RTVA 1X7VA 5IZHA 1W7WA 4CO5A 2UUCJ 3H20A 3K5LA 2PFFB 5DM6Q 1NZ8A 2MY8A 3SXLA 4U96A 3OVSA 3KDOA 2O3DA 5D3GB 2NPIA 2JWNA 3UW1A 2VICA 3P49B 3NL0A 4ZJLA 1JLFB 3J7Z5 1SKUB 2NZCA 4R0EA 2DJWA 1N5TA 3P45B 1IVZA 2EK6A 4ZN3A 5BYRA 1S4EA 1S1UB 2KYZA 1C2PA 2KHCA 4U7CA 2DHXA 4CWBA 4PWDB 2HVHA 1WHVA 2YKMB 3U02A 1NK5A 3LP0B 4NEZA 4FYDA 1J2VA 1QUPA 2AYGA 2DISA 1AB8A 5L9XA 3PIPQ 2YNHB 4I6YA 1HBNB 1SB6A 1XIQA 5EN1A 2VFTA 4TU8A 1YJTA 4RW7A 1VQ6S 2WB1D 1RHKB 4MFBB 3DOMA 2J6SA 4QU7A 2DY9A 1B3TA 2GGPA 2FY8A 2U2FA 2NREA 3DHWC 3CMAS 2G4BA 3K58A 1YJ7A 4DCJB 1HWJA 4JB8B 1FRHA 2QSFA 3IG1A 2XLIA 1D3WA 2QX0A 2IM0A 4HTIA 1X4FA 2R8GA 5J1EB 1ZAWA 5IWAJ 3MM6B 2K3KA 2HHHJ 2HURA 4ILMA 1F60B 1RGVA 2D9PA 4ED5A 2JC1A 1RK8A 4O3NA 4KSEB 2XB2D 2FHOB 2ROEA 3ISND 2K8GA 3UNGC 3CDBA 1UFKA 1GH8A 2R2SA 4RO0A 4RZRA 1NSKL 1O5JA 3MR6A 1R8PA 3RW6A 2BRLA 1OY8A 3BSAA 1HNVA 3DKDA 3P96A 4IH7A 3ZZRA 1FKOB 2ASDA 3ILLA 2GHWA 2QFIA 1D0EA 1MWQA 2KHDA 3QGIA 4OZ1A 5HVHA 3WHIA 1CPZA 1KLNA 4WJBA 3RBXA 2VPXB 2RKIA 1QAIA 4PG8A 1HNXJ 2R7OA 2HNDB 3UN5A 1I94J 1J5OA 4ECQA 3CC7S 3BBBA 4KTQA 4J9KA 2D3ZA 3SSQA 4Y0FA 3R7BB 4RUHA 4OX9F 2KRRA 1REVA 1KQGB 3CUNA 4EU0A 4ZS6A 3DM2A 2AWZA 4OZLA 3GR0A 1UVKA 1SIZA 3D7SB 1DJ0A 2OMOA 1X5SA 3HCXA 2YBVA 2V67A 4WFXA 2Z30B 1GEHA 3TZYA 4AXJA 1SVDA 5CCMA 3T19A 3K2YA 1Y7PA 2CQHA 4Z7YA 1ZYQA 4KJIA 4HKQA 2RQ4A 3OJUA 4MMOA 2VBXA 1QJHA 2L3MA 4ELTA 2Y1JA 1Z2LA 3P5TL 4EWTA 1CG2A 1C0TB 1VQ4S 5DZ7A 2VIHA 4I68A 1NK4A 1XMQJ 4DZDA 1SJ3P 3R3TA 3UQSA 3BSOA 5F8LA 2J8AA 2XO6A 1P9YA 4JP8A 3O44A 1WKLA 4H4OB 1Y9OA 3PCOB 1R0AB 5T7LB 1D09B 1HNZF 2IVFB 2BXJA 2R9LA 1TKTA 2A18A 2VJUA 2I5JA 4B3RF 1CC7A 2XCPA 1N52B 1YGYA 1LXJA 1WSRA 1RCXB 1XEZA 5D4NA 3CCMS 2CPFA 1WG5A 3QT8A 3KLGA 4FF1A 3MPDA 2QTWA 2HVEA 3M1VA 1HD1A 2O5DA 4KV8A 3DDNA 4B3MJ 2Y0BB 5H9EJ 2I6WA 3Q8VA 4NEYA 2CQ0A 3G8SA 4KGXB 3KJFB 3SQGB 3IR5B 1IBMF 4WFZA 2XCAA 4OYIA 1H73A 3G2XA 5FJ4A 3L7OA 2XC9A 1S77D 5KOXA 1RABB 3V6JA 5L9NA 2E1RA 2J0XA 1K73T 3PZPA 2X1BA 3BO2A 3CJ8A 4FBUA 1T7PA 4DR6F 2ZHBA 1T9YA 1WC4A 4J9PA 2BJ1A 1FD8A 5K8NA 2IAJB 3H2VE 3SV4A 4QYRA 3Q8RB 2PN6A 4ZITA 3DLEA 5IFMA 2CZVC 1T94A 3CJ5A 3IAM9 3LWLA 4X4TA 3UNYA 3TEGA 2HVZA 3CB4A 4I64A 3DI6B 4NE9C 4O0NA 5HANA 5DM7Q 5ADZA 3DLGA 3RB3A 2M70A 1HWUA 1U2RA 3EYZA 1KOOA 2DVIA 1E6VB 1Z1ZA 2WSEC 2AHOB 3KXDA 4E0DA 2GZOA 3DLKB 4DL2A 2RQMA 3E3XA 2NYHA 1Q0NA 2Y1IA 1CULA 4X62J 2RQCA 2BJ9A 3UPFA 5U47A 3GCXP 4DZ6A 3R2CJ 2EC2A 1NDCA 2E1CA 3VZIA 1P9QC 4LRDA 2AP6A 2J9DE 4CH1A 3KLIA 4X4SA 1REGX 3CJKA 5KOWA 1O6XA 5F8JA 3SDEB 4FBTA 5HQLA 1CJKA 3MM5B 1NKCA 1TL4A 1I5OB 3KJVA 4QW8A 3S01A 2GIRA 3WZ0A 2L08A 4P71A 2H5IB 3OUYA 1YJ9S 1RAAB 1KSPA 2RU9A 1RTDB 2LP4A 3A12A 3QYYA 1N88A 2JSXA 4AL6A 3JB9k 5KFXA 3ZTPA 4KT0C 5FLXU 3ADAC 5H1SV 1WC1A 3OTOF 4IFYA 3PYGA 3H40A 1QY7A 3O2IA 4NLUA 2PD1A 1XNQF 2ZOGA 4IO1A 4O23A 1KTVA 5KFPA 1YZ6A 4Y2MA 3LP1B 2FLNA 2W2QP 4NCBA 3FKBA 1FTRA 3JAMU 5ETNA 4GKKJ 3KYLA 2J76E 4GO5X 4WK1A 5H9FK 2HLTA 1XR6A 3GSIA 4YUDA 5C5JA 3KHGA 3Q23A 2A3JA 2CQBA 1WC6A 5KG6A 3OBIA 3ZZPA 5FDLB 1Y3KA 2FVPA 3EUNA 1HQUA 1HR0J 1S9GB 1FJEB 4Y28C 3D1HA 3W2VB 2F63A 1C0UA 4P9SA 3D68A 4WCEQ 4WFYA 4DL4A 2KFYA 2M88A 3PYDA 2VF3A 1IWGA 4Z2XA 2CPHA 1JLBB 4ZP6A 2VB6A 5IT0A 1FJCA 1SH2A 1IM6A 3GFXA 4CLUA 5KFSA 5EWFA 1TP7A 1U4BA 2MKCA 3BH7B 3BZQA 1FX4A 2K06A 2WVBA 2RU3A 2KVIA 2XS7A 3IR7B 4PABA 2VG7A 2MKSA 4ZLNA 3G6VA 1BD6A 2N4CA 1QVGR 5DQGA 5B7WA 2ADCA 4HHJA 3K89A 1APSA 1IKVB 2DB1A 4UQTA 4WP9A 1FERA 1LWCA 1DQAA 1RDRA 3ZNJ1 4TYAA 3I6PA 3M4XA 4Y6IA 1M5OC 4NCAA 1VYAA 4KGVB 4OZJA 4S0MA 2W2NP 3D3BJ 2M2BA 3QLHA 2DK2A 1VQ7S 3D6MB 1RWUA 1NHUA 4CLZA 2DXFA 2FIUA 5L8RC 4JI1F 3I56S 2NSBA 1GNKA 4A48A 5F0WA 1OY6A 1T05A 3M2UB 4H4KC 2GO9A 3QIPA 2ATLA 3X3UA 2AGQA 1HNIA 1VHIA 4DXLA 1FXRA 2WOMA 4P72A 4I4BA 2RDDA 3FRYA 2L9NA 1S6QB 4QZVB 2DPIA 4PQUA 2ZVIA 1R8AA 3FFIB 1K8AT 3B6BA 1IKYB 2LA4A 1UJ6A 3OVAA 3UDVA 3U27A 4DN9A 4DHVA 1ZAXA 2E44A 2DTJA 2KDOA 5F9NA 5A8KA 2LQ5A 1S6UA 1VQ9S 4ENOA 4JI0F 1FKPA 2B9YA 3HPOA 3M8PA 2XMKA 3NS7B 2HIQA 3LOUA 4OHZA 1OWXA 3F0NA 1H7WA 2V0NA 2OMLA 2ZBPA 3EPGA 3JYTA 3QGPA 2HHTA 2NXCA 4J9QA 2NSCA 1XN9A 5LXRA 3GMGA 2FZCB 2IM2A 5KT7A 3MMCA 3MEEB 2XWYA 3JTOA 4KY3A 4A8QA 4R5PA 4IG3B 4C7QA 4UQGA 3MHYA 1Q4RA 2QFJA 2DY1A 1S1VB 4HT7A 4RWXA 2CPJA 2JFKA 1JQGA 1VBYA 1NKEA 1NK8A 3AJDA 4F8RA 1RTJB 2DEJA 1S10A 2RAQA 5L1IA 3DOLA 4DPOA 2MMYA 2LLZA 1FXDA 2CQ3A 3DMJB 2GQ2A 2L41A 2CAJA 2UU9F 5F9LA 2HLUA 2KZZA 4FF3A 3MM8A 4RNOA 2RD5C 2OUGA 3QGHA 1GMWA 4F0HA 1JXVA 4CH0S 4ES2A 1DAXA 2V2QA 1U1QA 1RTHB 4F3OA 1FE4A 3DC2A 3IR6B 2HHUA 1BQMA 2ILYA 4ZCIA 1K1QA 4DR7F 3M05A 2P6SA 4CO4A 4NXNJ 4OMFG 1N33F 4F4YA 4AQYJ 3MUTP 3OV7A 2H3EB 4DEZA 5E3PA 4USMA 2F1FA 3PNIA 3BQ1A 2ZZTA 3IC1A 1VBKA 3GYNA 1GQEA 4MJKA 5KAKA 4WTYA 3MMAA 2ILZA 3J7ZT 2JZ5A 3OFHA 4LSNA 5D0HA 4D3GA 3KLVA 3ZZZA 2GMJA 2AGOA 2MJNA 1YIJS 2QA4G 4QR2A 3M6XA 2OAUA 4IH5A 3QSIA 2XSFA 2IRUA 3N6LA 1U0HB 1WJ9A 2R2RA 1NSQA 1B4SA 2EW9A 3AOAA 1OY9A 4DV0F 4OFZA 2KI2A 1HHTP 4NLOA 2AV5A 4ICLB 3DDIA 1VRTB 2V63A 3NXZA 4OI6A 1LK5A 1URNA 2UUTA 3KJNB 2BANB 1TFYA 1RBOB 1IQTA 4J37A 5CYQA 1RJJA 4X84A 2B6AB 3NBPA 4QYZJ 4DV2F 2QLFB 5DDRC 3MOZA 2C2KB 5HJXA 2Q79A 3PW2A 3DGPA 3WQPA 2C1EB 1NDLA 4M63A 3VCDA 3EVOA 3FCWA 2J9DA 3B4MA 3N6MA 3KUGA 3DRRB 4DL7A 2QZ8A 2YKNB 2LXFA 4RBVA 1A7GE 3W60A 4CLLA 4HACB 5DQIA 3HKWA 1XK8A 4USWA 4W98A 3HVRA 1UTAA 1FD2A 1GTHA 2YNFB 2WW4A 2PGCA 2WVFA 3J81Y 3L09A 2D1CA 2ZEJA 3RRKA 1EZZB 2CPIA 3K17A 3IRXA 2QLBB 3O6QA 2AYMA 4I56A 5A0YB 2KFNA 1AT1B 5DGBA 1YBAA 2X1AA 5J2NA 2NLWA 3MAHA 2CUYA 4EUVA 1PJ6A 3M6VA 1OO0B 2FJVA 1NK9A 2CQDA 2W24A 4CT9A 1K44A 4WU3A 1GFWB 5L1KA 3GCWP 3T5LA 4F25A 3OHBA 3UI3A 3R9LA 2AGPA 4FXVA 4Y3CA 1NH7A 2MLXA 4MIWA 4NLRA 4UOHA 3R5BA 5J2QB 4JYAJ 3AD7C 2RRAA 2KKHA 2OO4A 4PYDA 3KK1A 1LNQA 3D4JA 1TMMA 1F1BB 4N7TA 2PA3A 2R7UA 1X0PA 1IKWB 2ZJQQ 1HNWF 1PAEX 5I4MA 4Q5VA 1S5ZA 4WPAA 2OP5A 2NUUG 2ZJRQ 4WZMA 5KG5A 2PE8A 4JI4F 2FUG9 1UVMA 2MKHA 4X4RA 2A2DA 4I6AA 3W5ZA 1J5EF 2HGMA 3FVYA 3V81A 1VRQC 4NLTA 3ILIA 3V6HA 2CPXA 5KT5A 1T11A 2ATCB 2CXEA 1NBEB 3CDEA 2YY3A 3L95X 2HK2A 4A47A 2V6AA 3G8QA 2QG9B 1U24A 1WOPA 5ETPA 3MI7X 2MLYA 4DR3F 1VI7A 3PX0A 4CTAB 4PZVA 5HQ8A 2Z56B 4NZ6A 1NHVA 2ZBIA 4OZ2A 2BRKA 2C2ZB 2C2RA 3H8YA 4IFVB 1Q7LB 2J0WA 5KG1A 4LVOP 1Q8IA 1N36F 1JJ4A 3JSBA 4ETXA 1YHQS 3OTCA 3V4IA 2VZ9A 2Z2MA 2D41A 1FNMA 4WFBQ 4ECWA 1WHWA 5K8PA 4ZHRB 2W7PA 2P2CB 2BV3A 3A3OB 4WU2A 2BOPA 1NPPA 3MAAB 4C0BA 1O8BA 4FVCA 3FRZA 4UY8T 1MWZA 4K2XA 5KFIA 2R7SA 1FNOA 5HVGA 4J9NA 4AFFA 4Y00A 1WWHA 3WBZA 3H98A 3OXLA 1TQLA 2BJ8A 4B3TJ 4JI7F 3BGRA 3MTJA 1R89A 1UEUA 3IM9A 2HNZB 3RR8A 4LFCF 3T41A 1FFGB 3UD3P 4UOCA 5JXSA 4ECSA 1F2GA 4RUAA 2ROPA 4WTOB 3MPWA 3AY0A 1KFDA 4QIWD 3D54A 1NSPA 1TZ0A 4W4MA 3CIZA 3AJ2A 1KHWA 1UPMB 2C2MB 3I4HX 4G1IA 4MAKA 3TRGA 2R7WA 4LVNP 1FRLA 4QR0A 4ID5B 1N32F 3CCES 1RWMB 2HRTA 4MKYA 1F9HA 4DWIA 2DT9A 2O01C 2HWIA 3ENWA 4IRCA 3NCQA 1PSDA 2RF2B 3KUEA 1VK3A 3I5AA 1RT5B 1U6ZA 1WTFA 4X66J 5FLXY 3PR4A 1U1MA 1JXEA 5GAHI 4Q7AA 4FNHA 4X2BA 4EYHB 3MF5A 2VODA 3CCTA 2X3GA 3C6UA 4DV5J 4KFBB 2K1RB 4DG1A 4K2JA 3W9HA 2M5YA 3BBCA 3W9JA 3Q2TC 4AL7A 1T9WA 3BR9A 5KFOA 1RAOA 5AXNA 2GQQA 2FYXA 2AW0A 2VKRA 3TVZA 3GFYA 5A8RB 1KVKA 4CQ1A 2FVQA 4B02A 4B9MA 3IWNC 4OI3A 4LIWA 1RT6B 4H4KA 3OLBA 5HQMA 5CXTA 2G1DA 3KMQA 3NGSA 1S0NA 1SC4B 2VU5A 3H5XA 1N4LA 3D6TB 4EK2A 2VQEJ 4HVZA 4JI3F 3KG1A 3CF5Q 3V2UC 2DH8A 1S1XA 2QC3A 2OD4A 4GVLA 3OFEA 3E2EA 1ELOA 1RT7B 2HHPA 2G13A 4CLTA 3RZAA 1TKXB 4F4ZA 2B3TB 2ZITA 3R97A 1U26A 2IYIA 2ZUGA 5GMEA 4RW6B 4MK9A 3WDOA 1HBMA 1ZETA 1YZ7A 3DXSX 5HP1A 1SJQA 2PC6A 3RJMB 1AUSL 3FDSA 1DLOA 4J7CA 1VIOA 1SV5B 5EWGA 5HAOA 3BGOP 3MCNA 2ZD1B 2ALZA 2G0CA 3OW2R 4DSKA 5KFUA 3JSMA 4RNFA 3MEDB 4LR9A 4ZPVR 3MOJB 1KEKA 5I42A 3V6DB 4NMLA 4FYYB 3QGGA 4WBFA 2DGQA 2W25A 2B5JB 1C4AA 2QEXS 3M2VB 5HSPA 3AT1B 3E51A 2H51B 2H4YB 2FHKA 3OXGA 4B17A 2DNZA 5ETLA 1TFWA 3M30B 2VQFF 2R4FA 1RB0A 3OXFA 4WK3A 3EMTA 3Q22A 1Y5LB 2DNQA 3EVMA 2HVIA 1GTEA 2HMIA 3W8PA 4L3NA 3DNCA 3DOKB 5CCLA 2AEFA 2F5GA 2P9GA 1YRXA 3AQOA 2EPIA 5ETKA 1G2EA 5K8OA 1IQZA 1EP4A 5IQQA 5LMNF 1DTTA 3W66A 4AT1B 2BM0A 1FJ7A 4RW9A 2IVMA 3C19A 1RLCL 4IOAQ 3LH2S 4HEA9 1UWAA 2P9EA 1BGXT 1N34J 2JVOA 5SZTA 1LW2A 4HDGA 3WC2A 1IR2A 2HZVA 3QJJA 3CVKA 2W4DA 4UTGA 4LF5F 1I51B 1QE1A 3IS9A 2Q43A 3IWLA 1DFDA 1S59A 1S6PB 1NCLA 4N47A 4HHHA 4YHHF 1TKZB 2XO7A 1ZPWX 4LFBF 3W65A 2MZTA 2H48B 4K50A 2VOOA 4B9LA 4WIQA 2Q66A 2W7AA 2O66A 2FPHX 3PW7A 4DX5A 2WBRA 3KG0A 2GAHC 1R31A 4K4YA 1GXTA 4ERDA 3CULA 4I7FB 1ACMB 3T5JA 2HQCA 3H90A 2HWTA 3D28A 3RGIA 3FSXA 3GE9A 2CVEA 4GVBA 1TL3B 1KKHA 2AJ0A 3HVTB 1PYSB 2BEFA 2M52A 4M5MA 2GAGC 8RUCA 1HQ2A 3MM9B 4ATNA 2F8HA 3ULHA 3U1NA 1ZM2A 4DR4J 2CNKB 3KK2B 3BF4A 1A9NB 5A8WB 2H5JB 4A8MP 1VIXA 4IQMA 4U8YA 4DFPA 1U09A 6FD1A 3CPWR 3DRSA 3VGVA 5CABA 2YWWA 4ALZA 4DPUA 2W8KA 2IYGA 3JXOA 1XTZA 4LJMA 5LMUJ 3MEGA 3T5KA 4FF4A 4P10A 2UUAF 4LSLA 2MQ8A 1IM4A 4LF4J 3DYAA 1FKAF 2QN6B 2QL9B 4Q0BA 5DS7A 3HT3A 4JUZA 4JI8F 3NMRA 3MUMP 1P6TA 3QZ8A 2DRBA 1PJ5A 6FDRA 4TLQA 3TVKA 2I0XA 1G7CB 3NEKA 5DG9A 2F4FA 1NM2A 2ZE2B 1RT1A 4M5DA 4QIGA 4YS2A 2V4RA 4EBEA 4ECZA 5GAHU 1HWKA 2K2PA 1TUVA 2UVVA 3JSYA 2LU2A 1VC0A 4DV6F 1MU2A 1S9FA 2E66A 4EI2A 2CPYA 1JKHB 1KWMA 2IJRA 3DXBA 3LTOA 1LW0B 1T0TV 2WW8A 2P9CA 4H4MA 4ZP8A 5D8HB 3K8VA 5KG7A 1UFLA 2XNQA 5F41A 1LWFA 4NLVA 1Y4ZB 2APOA 1SKSA 3GG0A 1GMVA 5C2CA 2CWKA 3RR7A 1H0HB 2FJDB 3I0RA 4GKJJ 2Z0GA 1S7HA 4GC6A 4U7UK 3EXCX 2UVUA 2DNPA 1VRUB 4IRDA 4OHVA 3R27A 1WSVA 4ZCMA 1KC8T 4O44B 1BHNA 1X31C 4RW4B 4XPEA 3TZWA 3HHLB 3OFFA 4YY3F 3OT9A 5I3UA 2M9KA 1TL7A 2AJ2A 1OSCA 5CYJA 3TZZA 1PC4A 2W4PA 2MZRA 3HO1A 3UO0A 3D0HE 2VDIA 4I2QA 3GB0A 1RT3A 1YI2S 2HNYB 2DNKA 2LQJA 2EBGA 2GHVC 2KJVA 2VG5B 4RUCA 3NKYA 3VR1A 3JTNA 3RB6A 3R5GA 1RAGB 1KOHA 1I3OB 2A2CA 2X1GA 1BUXA 2BUNA 1Q8BA 4DUZF 2Z57B 4C8ZA 3MMBA 1HYSA 3ZZYA 4U67Q 1DBDA 1RTIB 2HFUA 3TUZC 1ZZFA 1N0UA 2OPRA 2J9CA 2DNOA 4JI5J 3M2RB 3HP6A 2EFPA 2NR0A 3C8YA 1GMUA 5E33A 1XNRF 2QIFA 1CBKA 4A8OA 1LWEB 4TQSA 5G0RA 5IQ6A 2D3OR 2EFOA 5E3CA 3F41A 4I1TA 2FC8A 5HJYA 2VG6A 1S99A 1TL1A 1JLEA 1RHUB 3J7A1 1JXLA 2F65A 3R6GB 2OPPA 4K5RA 2ZDPA 4AD6A 2XSJA 5CH7B 2UXCJ 4DSEA 4BBYA 1HBOA 4DV1J 4DUTA 1WNEA 1WC3A 2DGSA 3CO9A 2DITA 4Y2CA 3BKUA 3BGFA 2NXJA 1N5QA 3VF0B 3FBCA 2UUBJ 1XQIA 1WEXA 4W92B 5DO2A 3CC2S 1U1OA 3HFVA 3AXMA 2QA4S 2JLGA 2NQPA 3BM7A 2L9WA 1HI0P 1SPBP 4X4QA 3RAQA 4DF4A 2QLJB 4DV4F 3ZC4A 2KG0A 2MKIA 1B7YB 2WZ1A 2SXLA 1SC1B 3D66A 1VC6A 1JIHA 4AL5A 2UXDJ 4NXMJ 3MECB 5B0BA 2W9CB 1SJ1A 2ZH2A 3VQSA 3G6ES 4PXCA 4XDDA 4FS1A 2LVWA 1FRXA 3ZTOA 3DDKA 5F8IA 4JI6J 4OX7A 1UPPA 3ENVA 2XYPB 1G4CA 1F6TA 1RACB 3FSYA 3NG8A 1HBUB 2ACMA 3A3NB 4O3QA 1SUQA 3E01A 3QZ7A 1CJVA 3PM9A 1VJWA 1FHTA 2ZUAA 3TA0A 2O67A 4RL1A 2CKWA 3VWSA 3HSDA 2RB7A 4NCGB 2ZC3A 2H4WB 1YG0A 2LEAA 3PO5A 1L3UA 4J9VA 4C8KA 3MFHA 2OGUA 4O4GB 2YWGA 3MD3A 3M9MB 5KTQA 2RRNA 4JBCA 2BE2A 4PKDB 1RZMA 2HFSA 4LF6F 2CJQA 2B51A 4L72B 1S1WB 3KFWX 2DNMA 2R8KA 4B3SF 4Q44A 4Q8FA 4CO1A 4DQIA 2ZBRA 4M5GA 1NEEA 3W5YA 1LFPA 2BJ3A 4IG0A 1D8ZA 1MSWD 4GKKF 2FVSA 4RWWA 1M5KC 2ZH8A 4DSJA 3HVAA 3H4DA 3PACA 2DH9A 1K1SA 3ET6A 4C11A 4N41A 3ITHA 2Y0SD 4ELUA 7AT1B 5E5NA 3US5A 2B4UA 1HR0F 5L39A 4NI2A 1TVRA 3OTEA 1JNRB 5LXYA 2EWHA 2GVZA 3SEOA 3ZTSA 2OLWA 3MR2A 3AA9A 4WZQA 4USKA 2OPSB 3UCZP 3P4UB 4PAAA 1WEYA 3Q89A 2DBBA 7FDRA 2GVDB 2KT3A 2XLKA 4A8FA 1FRKA 2HK3A 1Y11A 2DIUA 3QIDA 2HFZA 4C98A 3IBFB 2CJAA 2YNIB 5E3RA 4P7TA 1KVIA 1JJCB 3M32B 1KLMB 4KRWA 2DO4A 4F50A 3GIRA 2EC0A 3GJQB 1NPKA 5KFAA 2VASA 1IJFB 4B08A 1UVJA 4YDDB 1W25A 2ZH3A 1QSLA 3ZNUA 1NO8A 3LUYA 1YK9A 1ULRA 3GIIA 3VGUA 2E9ZA 5K14B 5C24A 4OI4A 4DU8A 5EX0A 3LGNA 4OI2A 2KM8C 2C2NA 4DCPB 4TQRA 1TV6B 3OR1A 4OX9J 1ZBTA 1WG1A 4BC9A 3IO1A 1U6FA 2LQ8A 4PEOA 1IBKF 2J7UA 2J0QD 3FZBA 2OEJA 2X3DA 3OL6A 1XBWA 4O3PA 1C1BA 1U02A 3FEYB 3A3PB 5DG7A 5KFCA 3PHEA 1CEZA 3C15A 3PR5B 3RUBL 3TO8A 4DX6A 4ZPTR 1OSDA 1JLCB 4ZA1A 3IN5A 3FQLA 5C25A 2HYIB 4CDIA 3CJTA 4ZLPA 4X4VA 3N01A 5J2PB 1JLQB 3DRPA 5HROA 2IMWP 4PPDA 5I3PA 3LPEA 2RHQB 1TUGB 3A13A 1M90T 1LK7A 2QMWA 2KTQA 4R8UB 3RBZA 4IH6A 4ED3A 3C16A 3GFHA 3RU0A 2P8IA 3C14A 8ATCB 2VDHA 1Q78A 2RS8A 3OPKA 4R25A 3VZHA 1HNZJ 4G1PA 3MM7A 2MGZA 2YNGA 2V2ZA 3M9NB 1HPZB 2AYBA 2IM3A 4M5HA 3NNHA 2CG8A 1NHKL 4K4ZA 4OLPA 2CJBA 4RNHA 2B9WA 4YR0A 4EZ9A 4B3RJ 2J7KA 4ED2A 2KJWA 2HS3A 1JNZB 3BQ2A 3M8RA 3TWZA 9ATCB 4CYUA 3HI9A 3PKMA 2V8PA 5KFHA 4NA1A 1RWVB 2DKOB 1PJ7A 5KT6A 2NPFA 3DU5A 4NWBA 1S1TA 1C1CB 2POKA 1FK9B 2ZM6F 4Z37A 2A10A 2HG4A 1IBMJ 1J27A 3K5PA 3O1LA 3UDEA 2JEGA 1ROFA 3I0SA 1RWPB 1ZM3A 2VC0A 4ZPDA 1Q82T 2CZ9A 2X51A 2HHQA 2XEXA 4OIXA 1N6QA 4Q45A 2KXNB 1FESA 2XMVA 4ZVPB 2ASLA 4OQJA 4DR6J 1AZSB 5DLGA 4XPCA 3B82A 4MYTA 1YBTA 2CDRB 4ZCLA 3TX8A 3ZTQA 1OPIA 4M94A 4ZK7M 2M7SA 5LSLA 1KQSR 5ETQA 2HQ3A 1VK8A 3PJ9A 1T9UA 3UVJB 1EX8A 3ONQA 3GILA 2IIHA 2V4JB 1RWOB 4JV5F 2LEPA 3AFGA 2XGQA 1UMJA 3ZZTA 5KFKA 3NGKA 3CIMA 3T9NA 3QJLA 5ETMA 1HFEL 3M8WA 5B0FA 1YITS 2E5LF 2QLXA 5FIIA 1PILA 1QSYA 3W2WB 4TY8A 1KR4A 1BQNA 2J6UA 5HK4A 8AT1B 5CYMA 4PPZA 3LP2A 2VOPA 1NJYA 3TEHB 3KLFB 2Y3YA 4CLWA 3UWTA 1DY3A 4A8WA 2VONA 2IVYA 3TZXA 1VQSA 3G8TA 3V4MA 2HQFA 2V2KA 2AIRB 1SXLA 1V6HA 4I67A 3MFIA 2G2ZA 3PX4A 2MQOA 1KHVA 2W9BB 2GMLA 2E9TA 1SKRA 4LF8F 2OH2A 3QNWB 2RILA 2ZOFA 4FPIA 3SQOP 4UZCA 2GHPA 1WELA 4DQSA 2YX1A 4LRBA 4QW9A 4EZ6A 3TUPA 2PEHA 5KG4A 3OTOJ 2R7TA 4KO0B 4NZ0A 1XNQJ 3C6TB 1VDHA 3PFOA 3UD5A 2KT5A 2BA9A 4EO8A 1JLGA 4DLEA 4M5KA 3HHKA 4LF7F 1YQHA 5ETOA 3S7RA 4HR2A 3TAMB 2E5HA 5HVFA 5EUHA 5HMZA 3GQCA 2QE5A 2PIIA 2R42A 1DQ9A 5B0AA 3KLHB 3RAMA 3NMAA 3MCSA 3R5CA 3GJTB 3N5BA 2FGCA 4PXDA 1Q81T 2D3UA 4DR5F 2IBOA 2N3OA 5T41A 4ZVGA 1AW0A 3CT9A 4N56A 4KKOB 3B4DA 3KLEB 1UWBB 1VLYA 4C3MA 1U2CA 3KK3A 2OPQA 4HL9A 3POTB 4B3OA 1DTQA 4P6QA 3KHHA 1CS4A 4JI2F 3DN9A 1YDLA 4LBIA 4NRTA 2K7JA 2XQCA 1T3OA 2VFSA 2DNRA 4CO0A 4I2PB 1KQKA 1JLAA 3NCPA 2W2PP 1SBRA 2A6OA 3CCLS 2YTCA 2HWHA 1JLCA 1YJRA 3OFGA 4OJHA 3PX6A 4FNIA 4M8LA 3CD6S 5D4OA 4TLRA 3QSYB 1RU1A 5IT9Y 1EKSA 3BS9A 4JI1J 2VD3A 1PBUA 4CM0A 5HMXA 3OTDA 1X5OA 6AT1B 2GFFA 5DETA 4DMZA 2JJ4D 2D3O1 1T03A 4YQWA 2P6TA 3BREA 2BVZA 2XMWA 3CD7A 1U48A 1NUEA 4DBQA 2RVJA 3H2UB 1BY9A 3HLUA 2DNHA 4B9TA 3TI0A 1FDDA 4K4WA 4ANCA 1CJUB 4K4UA 1CJTB 2EFQA 1YRTA 4JI0J 2BABA 5J1NA 2C2DA 1H38A 1SJ4P 1L3VA 2CQGA 2F7VA 2PSZA 5KFLA 2BBEA 1YVFA 2MQNA 1U6BA 4G1QA 3J81U 3B54A 3U7JA 2GJIA 3JTPA 3QO9B 1MROB 4YFUA 2F3JA 5EGYA 3JQMA 4TKTA 4OJGA 2OTJS 5KFDA 1FE0A 4LRAA 1F9FA 3ILOA 3TX0A 2OI2A 3AQPA 1UJ5A 3G87A 4F02A 1L3TA 2WSCC 4ZVFA 3RRHA 1Y10A 2HAIA 3TA2A 3A8EA 1UVNA 4M5JA 4Y65A 3GWCA 2EXUA 1RT4A 3I5CA 2I9SA 2IDEA 4IDKA 4UT4A 4OJ1A 3F73A 3EGWB 2BJ7A 4OYBA 1R6VA 1T9VA 3PXGa 2XMMA 3Q24A 3KNAA 5HBMA 2UU9J 1SQEA
chains in the Genus database with same CATH topology
2IMOA 1JXEA 5GAHI 4Q7AA 2E29A 1TKXA 3TVYA 2IA0A 4DL5A 4G1QB 1YJUA 4FNHA 4EYHB 2JL9A 2LYVA 4KGKA 5L38A 3MF5A 4X2BA 1FDAA 4QWDA 4TYBA 2VODA 3J7YU 3BGRB 3CCTA 1P1LA 5KT4A 3OR2A 2HS0A 3NNAA 4KBIA 4CZCA 3PW0A 2MQLA 1RI7A 2X3GA 3C6UA 1Q8LA 4RW6A 4KFBB 2K1RB 5HN0A 4JV1A 5F0UA 4DG1A 5KFTA 4HTJA 4FS2A 2IC3A 2M5YA 4QJVA 4NYOA 3Q2TC 4AL7A 2HZCA 1JX4A 4ID8A 4YDXA 3BR9A 2ZH6A 5KG2A 5KFOA 1HMVA 1NNDA 1KS2A 3L7PA 1R3NA 4KHRA 4DSLA 1UFWA 3BN4A 3NCRA 1SV5A 1UAWA 2GQQA 5AXNA 5KFFA 3HZEA 2AW0A 2VKRA 4PUOB 1V9OA 3TVZA 1HA1A 3GFYA 5A8RB 3HHLD 2XI3A 2IFXA 4CQ1A 2HGLA 2WRMA 3K7RA 3MURP 1S9EA 2XY7A 1B64A 2FVQA 4B02A 3PY8A 2ZD1A 4B9MA 3IWNC 4OI3A 4LIWA 1RT6B 1QVFR 2FC9A 4H4KA 3ISNC 4ECVA 3OLBA 4E8UA 2R2UA 5IM0A 5CXTA 3MEDA 1R7IA 1RT4B 2G1DA 5HLFB 4IYQA 3KMQA 2HFOA 1S0NA 3LWMA 3THTA 4OI1A 1R8CA 4CI0B 5ITHA 3OHAA 2FHJA 3K8WA 3H5XA 2QA1A 1N4LA 3S6EA 4HH0A 4IDKB 3D1QA 3V6DA 5AE3A 1D9AA 4HVZA 4JI3F 2QMXA 3KG1A 3THPA 3CF5Q 1NK6A 2DD8S 3VAJA 2CG4A 4LMZA 3V2UC 1E6YA 2DH8A 2XWXA 3QWUA 5C42A 2B5JA 1KTQA 2ZNZA 1S1XA 2XS5A 1IKXB 4UY85 1BWEA 4UUXA 4JI5F 2OD4A 3S8SA 3M2VA 5HBMB 3OFEA 3VAFA 3E2EA 1ELOA 4OZNA 4BC7A 1RT7B 4DUYF 3R5DA 3BSNA 4B3MF 2R7QA 1N8RT 3LANA 3UR3C 4YB1P 3MTKA 1N5YA 2HHPA 2G13A 2B4VA 3BR8A 3C66A 1S0OA 3RZAA 1TKXB 3T1YF 4A8XA 1ZAVA 2B3TB 4F4ZA 1EETA 2ZKUA 3M6UA 3AB4B 3PIOQ 2L9DA 2ZITA 5J2MA 2CQPA 3TNVA 3M30A 2V4QA 4A8SA 2FD2A 3CDAA 4HT5A 1SL2A 1U26A 1HQEA 3OR2B 2K3IA 2IYIA 2WONA 3C6UB 2ZUGA 2DR9A 4RW6B 3Q8QB 4MK9A 4BCAA 3WDOA 1BC6A 1HBMA 4DG1B 2MXYA 5KFYA 1ZETA 3DOKA 2RS2A 2IC3B 3SFGA 3DXSX 3G9CA 5HP1A 1SJQA 2PC6A 1WG4A 1KONA 2W4CA 2ERRA 3FDSA 2RSQA 2WBMA 1DLOA 1S0MA 4QIEA 1VQ8S 4OHYA 2PI5A 1HMVB 4ECTA 4WF9Q 1VIOA 2ASJA 1SV5B 1TAQA 3TANA 2IA6A 4J5OA 5EWGA 3CE8A 4DJBA 1Q79A 5F3TA 1X4GA 2RDIA 3H5SA 1VQKS 2KM8B 3ZZOA 4TU7A 1M5PC 3C3LA 4WE1A 2EK1A 2