5HP1B

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and foscarnet, a pyrophosphate analog
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
416
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 121
structure length 416
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hp1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hp1B03
5F8LA 5F9LA 3MFHA 4RW4A 1JLEB 4ECWA 3KLGB 2B5JA 1HNIA 3OLBA 5KG4A 4O3NA 4X2BA 2YNGA 5KFMA 4J9PA 1C0TB 2YNIA 1JLBB 1YVFA 2WOMB 3IGVA 4J9KA 1RDRA 4NLWA 3I5BA 2VG6B 2HMIA 2AGOA 4KO0A 4TYBA 4EYHB 1S6QA 2RKIB 3RB6A 1HPZB 4H4OB 1XR7A 4YP3A 3GV7B 5J2MA 4Q43A 1SH3A 4IDKB 3KLFB 5L1KA 2HNYA 2BANB 2RDJA 4EBDA 4DG1B 3MF5A 3QGHA 1TKXA 1RAJA 1WNEA 3H98A 2W9BA 3OL7A 4F4YA 3E01B 3PW7A 3I0SB 1MU2B 4MK7A 2XWYA 4IG0B 3TAMA 3DM2A 2FVPA 3H2LA 1TVRB 4NLTA 4O3PA 4U6PA 1RT7A 1IKWA 3LP0A 2IJFA 4H54A 4R8UA 2OPQA 4GC6A 4J9QA 1J5OA 4Y34A 4ED6A 1DTQA 1SUQB 3G86A 4MFBA 5KFYA 4ED0A 1C1BA 5DQHA 1HYSB 2E9RX 4F4WA 5JXSA 2QE5A 2V0NA 3HHKA 3T5LA 5J2NB 1MMLA 2W9AA 3LANA 1HARA 4I2PB 5HROA 4KHMA 4K4YA 2VG5A 4O3SA 3I0RA 1U09A 5KT4A 4YR3A 2VG7A 2ZKUA 3H5UA 5DGBA 1TKTB 5F8GA 4QW9A 5HLFA 3KLEB 4ZHRB 1XR5A 2HNDA 4IG3A 1T05B 3UPFA 2GIRA 5KT2A 3CDEA 3KHLA 3G6VA 5J2PA 3GYNA 1UWBB 1T3NA 3FSIA 2R8IA 1CSJA 3QLHB 3CJ2A 1RT3B 3QZ7A 4RW7A 1QAJA 3VQSA 2YNFA 5KFEA 3M8PB 2O5DA 4DL7A 4PWDB 1RTHA 1N5YA 3PR5B 3GIJA 4DL4A 2YKNA 3JYTA 1S9EB 5C5JA 2B43A 1SH0A 1EP4A 1RT6B 5L1IA 3OSPA 3HKWA 5KG3A 4WFYA 3IRXB 4EBCA 2W7PA 4FBTA 3DMJA 5KFXA 4ZP7A 3BGRA 4I2QA 4R0EA 5KFRA 4Q45A 1JKHA 4FBUA 3DI6B 1NHVA 3HVAA 5DQGA 2V4QA 3QYYA 4O4GB 1JLBA 1JLGB 3QGGA 4KHRA 1S1WA 2R2UA 1LWCB 1S1XB 1DTTB 1S1VB 5F8HA 3NBPB 5F8NA 3M8QA 2RF2A 3IG1A 2IC3B 1IKVB 2YNHA 4ICLB 3FQLA 3NAHA 2JLEA 3BQ2A 1S6PA 1EETB 4MK8A 5JUMA 1RT4A 2XCAA 4IOBA 3OL8A 4FS2A 2FLLA 4Q8FA 4ECSA 4I7FB 2J6TA 4NCGB 1OS5A 4DL2A 3HVTB 4R5PA 1Z4UA 5EDWA 2V4RA 3KMSA 5L9XA 3DRSA 5EWGA 4HYKA 4XPCA 4DL3A 4IFYB 2ZE2B 4F4XA 4LSNA 3RAXA 3DOLB 1W25A 2ILZA 3C6TA 1JLAB 2DPJA 4MK9A 3LP2A 5D3GA 4ZVHA 3ISND 4RNFA 4ZVEA 2IM2A 1QUVA 1IKXB 3DRRA 4PQUA 4MKAA 5C42B 3RBDA 2FJXA 1TQLA 1IKYB 2F8EX 2QV6A 3E51A 1BQNB 4RNMA 3ITHA 1FKOA 2I5JA 3NGDA 1TL1B 4Q44A 3DRPB 1C1CB 1RT1A 5DQIA 2IA6A 5CYQB 2OPPB 3DOKB 1REVA 1HQUB 2BR0A 3RB3A 3MR6A 3H4DA 4KFBA 4NLPA 5K14A 2WK4A 1BQMA 2B6AB 2C2RA 3C6UA 3UR0A 2OPSA 3FFIA 4ZHRA 4K4TA 3EPIA 2FVCA 5KFTA 3QO9A 1TV6A 3KK1A 2ASLA 4RUCA 4ID5A 3NKYA 3DLGA 4KV8A 1DLOB 3MR3A 4RU9A 1ZETA 3H5XA 3D5MA 5C25A 4K4XA 1S9GA 3LALA 1TL3A 3IS9A 2WHOA 3M9OB 4IH7A 3OSNA 3BSOA 4O44A 4K4VA 3T5HA 2W7OA 4O3RA 1FKPA 4PUOA 1S10A 1HNVB 4RW6B 5HP1B 4MIBA 1RTIA 2BQ3A 1FK9A 3DYAA 1HMVB 4ZPDA 1QE1B 3MEDA 2OPRB 3CDUA 3MFIA 4IFVB 5L1LA 4ED8A 4NRUA 2R2RA 2D3ZA 2WCXA 1DTTA 4URQU 4WFZA 4B3OB 3T1AA 5KFHA 4IRCA 3MEEB 5KT6A 3H5SA 5J1EB 5I42A 1D0EA 2CKWA 2IAJB 4G1QB 3OHAA 4J9SA 1RT5A 5KFVA 5KFKA 3V6DB 1S1TA 3G6XA 1S1UA 2RDIA 4TY8B 1JLFB 3HVTA 3PVXA 4URGA 2BE2A 4Q0BA 3DLKA 1KLMB 4H4MB 4TYAA 1JLCA 2D41A 2AX1A 4WFXA 5HBMA 4WXOA 4ED1A 3RAQA 5KFLA 4RW8B 2AX0A 1C2PA 1C0UA 4IKAA 2WTFA 1JLAA 3CJ3A 3BREA 2J6UA 1N6QA 3KLHB 1LW2A 2UUWA 1VRTB 1GX6A 2BRLA 2XGPA 1R0AA 1D1UA 2W8LA 1T03A 3KK3B 1ZTWA 4EBEA 2I1RA 4NLXA 4ZP9A 3KHHA 4K50A 5F8JA 3GQCA 3KMQA 4JV2A 3JSMB 3DOKA 3KJVB 4RW9B 4ED7A 3PZPA 3QIPB 2B6AA 3KLIA 3MTKA 4NLVA 1LWEB 3DLEA 3N6MA 1JIHA 4QPXA 2FLNA 1SV5A 2D3UA 4K4SA 3V6JA 2ZD1B 2GIQA 1DLOA 1RTJA 4KKOB 5KFBA 4TQSA 3KK2B 2YKMB 3MECB 1NHUA 1HQEA 4LSLA 4WE1A 4ECTA 4LQ9A 2UUTA 5T14A 3PR4A 4HKQA 2ASDA 5FDLB 4TLRA 1VRUA 3Q8RB 4QWAA 1JXLA 5KG2A 4EO8A 2AU0A 1JLEA 3KLGA 5KFFA 4ZMMA 1QAIA 3TQ1A 2BQRA 2ILYA 3PHEA 3KHRA 4Y2AA 1S0OA 1LWFB 4XPEA 1RA7A 1C0TA 1QE1A 2HNZB 5KT7A 2WOMA 4IH6A 2ATLA 4K4WA 2EC0A 3I5CA 4ECVA 5L1JA 1JLQB 2VG6A 2FVSA 3OL6A 3PW5A 1GX5A 2RKIA 3MEGB 3LP1B 1HPZA 4RNOA 4H4OA 2C2EA 5DG8A 2FLPA 1LW0B 4IDKA 3KLFA 1I6JA 2BANA 4DG1A 4TY9A 4RNHA 3CWJA 4ED2A 2AGPA 2IM3A 2XCPA 1KLMA 3E01A 2B5JB 3I0SA 4EO6A 3MR5A 1HNIB 1MU2A 4ECQA 5DG7A 4IG0A 1RA6A 4K4ZA 1TVRA 4RW8A 4GC7A 2IBKA 2YNIB 3GIKA 5KFNA 4OL8A 4O4RA 2XGQA 2HMIB 4WXWA 3CO9A 4KO0B 1SUQA 4QWBA 1S6QB 3H5YA 2ALZA 1S0NA 1VRTA 2JEGA 5F8MA 3QIDA 1HYSA 3Q8QB 3EPGA 3G6YA 5J2MB 4WZMA 3IGNA 2HNYB 5J2NA 2GC8A 4I2PA 1TKXB 2W9BB 5CYMB 1TKZB 1TKTA 3HVWA 3BQ0A 4JV0A 1TP7A 3Q8SB 1LWEA 3KLEA 3DM2B 1N48A 1T05A 1RT7B 1UWBA 5KG1A 4ED3A 4NLYA 3BQ1A 3QLHA 4NRTA 1RT3A 4R8UB 3T5JA 4YQWA 4KKOA 4XO0A 1KHVA 5KFAA 2W9CB 1JX4A 1DTQB 3M8PA 4MFBB 4PWDA 3MR2A 3MECA 1C1BB 4KBIA 4ECXA 3I5AA 3LAKA 2FJVA 1S9EA 2CJQA 3GILA 3BR9A 2UVUA 2JEFA 5FDLA 1RT2B 1RT6A 3DDKA 4NLSA 1RTDB 5HROB 4YR0A 3IRXA 5KFGA 3V4IB 2VG5B 4TQRA 3I0RB 3RBEA 1RYRA 2VG7B 4NLRA 3DI6A 5HLFB 4O3QA 2UVVA 2IM0A 3CJ0A 2HNDB 4IG3B 3D28A 4O4GA 4IR1A 1JLGA 5J2PB 4IH5A 4NLUA 4IRDA 3Q8PB 2E9ZA 4URSA 1LWCA 1S1XA 2AGQA 4RW7B 4J9OA 2V9WA 1S1VA 2YNFB 2VA3A 1RTHB 3LP1A 3NBPA 1N5YB 4ICLA 2IC3A 1IKVA 5F8IA 5DLFA 4DL5A 3JYTB 4KB7A 1EETA 4U7CA 1EP4B 2BRKA 5KFUA 5KG7A 4I7FA 4NCGA 3V81B 3DMJB 4M94A 3SFGA 2VA2A 3BGRB 4NZ0A 4I2QB 4MKBA 5KFOA 3H40A 2C22A 2R8JA 1JKHB 2JC1A 4ZPAA 4F50A 1S0MA 5KFCA 1T94A 2IM1A 4IFYA 2ZE2A 3N6NA 3GIMA 4IR9A 3DOLA 4KAIA 4TXSA 3PW0A 3GV8B 1S1WB 1KHWA 3BSNA 4J9RA 5DGAA 1S9FA 4ZPBA 1IM4A 1IKXA 3LAMA 5C42A 5C24B 4YMEA 4JV1A 1IKYA 3RB4A 3M9NB 1BQNA 2RF2B 3IG1B 2WONB 3M8QB 2YNHB 3CVKA 1SH2A 3OLAA 2C28A 1S6PB 2FVRA 1TL1A 1RT4B 3DRPA 4DEZA 1C1CA 3NMAA 5CYQA 2OPPA 3BJYA 1HQUA 5KFSA 5KFWA 4R5PB 1ZTTA 5CYMA 5KFQA 1TKZA 5I3UB 4J9LA 3QZ8A 3DRSB 3RB0A 4Y2CA 2JC0A 5DLGA 3OL9A 2HAIA 4Q8EA 4LSNB 3C6TB 3LP2B 3CDWA 5D3GB 4FS1A 3V6KA 2E9TA 2W9CA 1S48A 3DRRB 4YR2A 4PQUB 2WRMA 2HWIA 1RYSA 3KOAA 3ITHB 1FKOB 2I5JB 4ZVFA 5F9NA 4QWEA 3SI8A 4LQ3A 1RT1B 1RT2A 1RTDA 4RUAA 1REVB 5J2QB 3V4IA 2XI3A 4KE5A 4ZPCA 4KFBB 5KFJA 5K14B 4KSEB 4IRKA 1BQMB 4WYWA 1HNVA 3C6UB 2OPSB 3FFIB 4RW6A 5HP1A 5EWFA 2AWZA 4ECYA 1HMVA 1TV6B 3QO9B 3KK1B 2OPRA 4ID5B 3CJ5A 4IFVA 4NYZA 1N56A 3DLGB 4KV8B 4NLDA 3SFUA 4EYIB 4MIAA 2FVQA 5KFDA 4B3OA 3GIIA 2W8KA 5C25B 2ASJA 1N4LA 3MEEA 3T5KA 1S9GB 2IJNA 1TL3B 3IS9B 5J1EA 3TVKA 2IAJA 4G1QA 3M9MB 4K4UA 3V6DA 4Y3CA 5KFPA 4O44B 2WB4A 3V81A 3H59A 4TY8A 1JLFA 4WYLA 4ZP6A 2UVWA 1FKPB 4RW4B 4H4MA 4PUOB 2AQ4A 4NLGA 4M95A 1RTIB 2YNGB 1FK9B 3DYAB 2FJWA 4RNNA 3MEDB 5KFIA 5EUHA 1K1QA 2R2TA 3KLHA 2J6SA 3BSAA 2BQUA 5C24A 5KFZA 2WONA 5I42B 3KK3A 3EZUA 3FDSA 4RZRA 2DPIA 1RT5B 4MH8A 2D7SA 4J9NA 1S1TB 4ECRA 3KLVA 3JSMA 2JEJA 4G3IA 4F4ZA 3KNAA 3KJVA 4RW9A 4TN2A 5KT3A 1S1UB 2R8HA 3UQSA 3GV5B 3QIPA 4DL6A 2BE2B 4Q0BB 3DLKB 5I3UA 3QGIA 2IMWP 1JLCB 4ZVGA 5HBMB 5KG0A 3TAMB 3IN5A 1NNDA 1C0UB 3ICLA 3N6LA 2XC9A 1IKWB 3LP0B 3T19A 2ZD1A 4EEYA 2R2SA 2OH2A 2OPQB 4ECZA 1N6QB 3PW2A 2JEIA 1LW2B 1J5OB 3PJWA 3KK2A 3CIZA 2YKMA 5EWEA 3CJ4A 1R0AB 3UDLA 5KT5A 1T03B 1K1SA 4J9MA 3FRZA 4NLQA 4NLOA 3OHBA 2HWHA 5J2QA 2R8GA 1XR6A 5DG9A 2UVRA 3PJXA 3KLIB 3NAIA 3ISNC 2C2DA 4ZP8A 4QWDA 3DLEB 2XI2A 5KG5A 1LWFA 1SV5B 2R8KA 2HNZA 3FQKA 4WZQA 4JUZA 4QW8A 1RTJB 1JLQA 3H4BA 3MEGA 3BSCA 4O3OA 1HQEB 1S49A 1S97A 3V6HA 4LSLB 2YKNB 4WE1B 4QWCA 1LW0A 3NL0A 5KG6A 1S4FA 1VRUB 4IQXA 4ECUA 3PW4A 3KHGA
chains in the Genus database with same CATH superfamily
1HHSA 3VGTA 1Q53A 1RLDA 3M6UA 4F3QA 2AGOA 1XR7A 4A8WA 1RAJA 4N8OA 2HFZA 2MSSA 4MK7A 2XWYA 4P2MA 2XS2A 4GC6A 1S5ZA 2OEJA 1PYTA 3PFEA 3DU5A 4JI4F 4ANCA 4I2PB 1SJFA 2KZZA 3C2PA 3VAIA 1TKTB 2DGUA 2ERRA 2LA4A 4YB5A 2DGXA 5H9EK 4X66J 3I56S 2XY5A 1EP4A 2IYIA 4Q45A 2LU1A 3FBCA 5K20B 3QGGA 3DXSX 5G0RA 3QRRA 3IG1A 5C7PA 1IKVB 2F65A 5LM7E 2CUYA 2CJXB 1VQNS 3DRSA 2V2KA 1YI2S 2VFTA 3AOBA 4ZVEA 4Y6IA 1FE0A 2GJ2A 1TQLA 1SIZA 4JI3F 4JI5F 4GVBA 2V8HA 4FVCA 4KFBA 5KFTA 3PIPQ 3PYEA 3PACA 2RUGA 5C25A 3C15B 2JRSA 3RJMB 2LEPA 4P72A 1Y0HA 4DHVA 3PXGa 1RTIA 4NXNJ 2HK3A 4G1QB 1Q82T 1PYSB 1BLUA 4PRFA 1SB6A 2XS7A 4LMZA 4NA2A 3IR6B 4KH0B 4PXCA 1H7WA 1LW2A 2UUWA 1YTYA 1B7FA 4J37A 4NLXA 4X4RA 4ZP9A 4LREA 1TFWA 1HNWJ 4ELUA 4IO1A 4ILLA 2APOA 4I4BA 5FLXY 4DUYJ 4KTQA 1HLWA 3LPYA 2ZBIA 2ASDA 4CLSA 1IJEB 1QSYA 3HHNB 1Q8KA 1IWGA 2XMJA 4F26A 1WD6A 2ZOFA 3BBCA 2EK1A 4RNOA 3CMES 5AXLA 3X1LB 2UXDF 2B3TB 4OYWA 1KKHA 3DGPA 3K17A 5KFNA 1MWYA 2XGQA 2XLIA 1NJIT 2VBZA 4RR5A 1VK8A 4NI2B 2MKSA 5FLXU 1RWVB 1Q5VA 5HAOA 3MPWA 3MEKA 5CYMB 1FRLA 2C3MA 3Q8SB 5CAAA 3QFWA 2BKNA 3PJ9A 4CLUA 1CEZA 5B0BA 3TI0A 4LRDA 4I56A 3HO1A 3BR9A 3MPUB 2CPFA 2K1RB 3L4BC 4O3QA 3H20A 4ID8A 3RYLA 2V9WA 1S79A 1ZM3A 4WU2A 2LMIA 4ICLA 4U7CA 3TW0A 3V81B 1RWUA 2MHEA 1VFJA 2EFGA 4DUZJ 1UA1A 4TXSA 3BSNA 4YMEA 2HVDA 2UZAA 3BZQA 3THVA 3R7NB 3QJPA 1BQNA 3ZTPA 1QSSA 1RT4B 3KWMA 3QZ8A 3C6TB 3MMBA 5I3PA 4B9LA 3T1HJ 3ENAA 1FKOB 1QAYA 3MZIA 4LF2A 4F2RA 1WI8A 4WYWA 3FFIB 4UOHA 4ECYA 3PRBA 4A8KA 1KVJA 2MLYA 2W8KA 2VJUA 2XMWA 2ASJA 4ZVRB 5AE3A 4NX9A 1XK8A 2BJ9A 1Z1ZA 2DHGA 4KC5A 1CJTA 3HHLB 8RUCA 5HQLA 2IPOB 3TJ9A 4EI2A 5KOWA 1AZSA 1KC8T 4MH8A 2ZFHA 4JI8J 1S1TB 1WC6A 3GJSB 4KQZA 4Q0BB 2QLXA 3HCXA 1BXNA 3LA0A 1NNDA 2ZD1A 3R97A 4EEYA 3QPIA 5KT5A 5F3TA 3DRYA 3VAJA 6AT1B 4DV0F 2HZAA 5ADZA 5M2PA 1SV5B 3PNIA 3QT8A 2HZVA 4HTIA 1E6VA 4ER8A 1FD2A 3CCJS 4ECUA 3MCSA 3S1TA 3L09A 2GS8A 1VBKA 1X5PA 3K5MA 1I3OB 1S6QA 1RE1B 4UUXA 1I5OB 1LWXA 2Z2ZA 1O5JA 4AD6A 2CZ4A 1K47A 1IKWA 1J5OA 3EZOA 4EWTA 5DQHA 2WVFA 2MQPA 4A8OA 2NS1B 2HHVA 4QW9A 1T05B 2GIRA 4CCHA 1T3NA 4DL7A 1F1BB 3LPEA 1NJYA 2MQLA 4USVA 4P75A 3W9JA 1JKHA 3B4MA 4O4GB 4DN0A 3MM6B 4O0IA 2RF2A 1XMOJ 1PC4A 3NP5A 1RWNB 4FKXA 2YQ1A 4DL2A 1RHMB 1WC1A 3HVTB 4LR9A 2KB2A 4CM2A 1W25A 2GFFA 1U1KA 1PBAA 3MMCA 5DQIA 2OPPB 1T9YA 4PWUA 1LXJA 2PI5A 4LF6F 3POTB 4ANDA 1QD1A 4DV7J 3OR1B 4OYZA 3FSYA 3BV8A 4A48A 2E5HA 2H5EA 4X66F 4OV1A 4O44A 5EGYA 4DFMA 3G87A 1S10A 1Z2LA 3K5LA 3DYAA 4BWJA 1TUVA 2WCXA 3QNWB 2W2PP 3DC2A 4Z2XA 2DH9A 5I42A 4CLZA 3GCWP 1UVLA 3EXCX 4TY8B 1S7IA 1WSVA 3B6BA 2J6UA 3X3UA 4F7VA 1AB8A 4F25A 2HHPA 3GQCA 3P5BP 2M7SA 1XN9A 2BE9B 3MTKA 2PMZD 4BLGA 4NOHA 4MYTA 2M4MA 5SZTA 3AD9C 1RB0A 3M1VB 5GAHI 6FD1A 4LRAA 5AE2A 2EC0A 3GYGA 3QSIA 4NXNF 3AD7C 3NXZA 4WFAQ 2FLPA 1GMUA 3NGSA 8AT1B 1HKAA 1SL0A 2O67A 2JLGA 2FUG9 5GMDA 1IR1A 2AEJA 1JNZB 2IHR1 2M2BA 5CCMA 2NXUA 4OZ3A 1TP7A 3AAWB 2CIMA 1JX4A 3ADAC 2V8VA 5D77A 2VB6A 2IJRA 2KDOA 3DDKA 1RTDB 5HROB 4DCPB 3BO4A 2ADBA 4FF4A 4K0KJ 4IH5A 3Q8PB 3M2RB 4ED4A 4WFBQ 3BO3A 1RTHB 3NBPA 2DNRA 1M5SA 4NCGA 2XMMA 5HQ8A 2PA8D 1KHWA 1KQFB 3EJMA 3GZ7A 1HBUA 1FO1A 1FWLA 3HJVA 2UP1A 4B9VA 3EVWA 2MZTA 4GO7X 3BKUA 4N7TA 4ED5A 4WK3A 3D6TB 3HKZD 3HPOA 5H9EJ 3T41A 1SBRA 1HWKA 1HMVA 2NPIA 3K57A 2A1BA 3TNVA 1V3SA 1NSQA 1ZAWA 3IS9B 1V6HA 2RT3A 4NCBA 1OYEA 3O5TB 3M8SA 4PYDA 2N82B 4NA3A 4DUZF 2K7KA 3JS9A 3MOJB 4K5SA 3DHXA 3AJ1A 5T7LB 4G6VB 2GGPA 1WOOA 1FDNA 2R8HA 4BHQA 3UFCX 2FHJA 1HD0A 4DL6A 4ZVGA 1G2EA 3Q2SC 2OH2A 1UEUA 3NCQA 2YX4A 3CCZA 3T1HF 2ZH9A 4QU6A 1R6YA 5CH7B 2CFXA 2KL8A 1LV5A 1SQEA 2R8GA 3MUVP 5D78A 3FQKA 4Y65A 3MM7A 1SJ4P 1ZM9A 3TJ8A 4LSLB 3CC2S 1WTFA 1MWZA 4C3MA 1UFLA 1U1PA 1W2BR 2AJQA 1DQ8A 1I51B 3O6QA 1FTCA 2YNIA 2WOMB 2DR6A 3ZZRA 1RDRA 2HMIA 2VFSA 3HK2A 4TYBA 3W8PA 3AQOA 1KEKA 3KDNA 3R7BB 2CQBA 5HJYA 3MM8B 4ZOSA 3DDNA 4JI8F 5HK4A 5ETNA 3HSGA 3UR3C 1HHQA 5HATA 1F6TA 1ZM2A 5ETKA 2XO7A 1AUDA 2E1RA 1TK0A 2ZC3A 2OPQA 4MAKA 1TU0B 4Q5VA 1C1BA 3QJJA 3UD5A 3IM9A 1VISA 3EGVA 2CG4A 4F4WA 2QE5A 2DGWA 2ZKUA 3AQPA 4LFCF 5KT2A 2C1EB 3QLHB 3QZ7A 4RW7A 2QFJA 3A3NB 4LR8A 4DS5A 2YKNA 1LK5A 1Q1KA 2HFNA 5L1IA 2MKKA 4ZVOB 2HLUA 1HNXJ 2BBEA 2CQGA 2F9DA 1RACB 4F0MA 3UVJA 3PKMA 3EDRB 1H2VZ 2P6SA 1PSDA 3BEGB 3VAFA 4OZNA 3WC2A 2BEFA 1Z4UA 4FZVA 2CWKA 1V9OA 2LVWA 3MAAA 4ZCLA 3FUYA 3NWRA 2ASLA 3E51A 3ITHA 4X4NA 5CYQB 3DN9A 2B6AB 3ILOA 4UZBA 4F2SA 2CAJA 3MR3A 4RU9A 5LOQA 4ZN3A 5BR8J 1M5OC 2DNOA 3QAEA 2AIRB 4M5NA 1WC0A 2DY9A 1Q8LA 3ENQA 4CI0B 2VDHA 2Y8YA 2OPRB 1RAEB 4WFZA 1AYEA 1CVJA 3P96A 4X4UA 3CCES 1BQXA 2F7VA 2PDAA 3M6WA 1XMOF 2DNQA 2B4OA 4TNOA 3OVBA 4H4MB 2AX0A 2Y8WA 2MYFA 4NZ7A 3ETOA 4N41A 1VRTB 4CT8A 4JI2J 2XULA 4KGXB 5KAKA 5LXRA 5CZXA 4QPXA 2D3UA 4K4SA 4EGLA 1RTJA 4TQSA 5B7WA 5AJ3J 3VAKA 3IA0A 5FDLB 5KG2A 4DSKA 3Q0AA 1YRXA 3R5BA 3ENVA 2QL7B 3J80U 2ATLA 1RBAA 2BABA 1IBMJ 2B9EA 4NYPA 2CPXA 3BKFA 3WX4A 4IG0A 2WSFC 3KNGA 1QUPA 1SUQA 2O66A 3EPGA 1GMWD 4NL5A 3B8HA 3CMAS 3ILLA 1JJHA 1FHTA 3D68A 1VDHA 3H90A 1MWQA 1FE4A 3BQ1A 3SCLE 2CADA 2K3IA 4ECXA 1FDBA 3M30A 1SC4B 3C16B 1IBCB 1GNKA 4TQRA 2VG5B 2FYXA 1TL7A 4P2FA 4LBHA 2UVVA 1HNZJ 4ENOA 3P5TL 4L73A 2O1PA 2KKHA 2WBMA 4KB7A 1PC5A 2HHQA 2BRKA 2FHMA 2KRRA 2CJYB 4ZPAA 5LMNJ 4IFYA 4IR9A 2ZH3A 1XMBA 3R7SB 1F2HA 4B3TF 3U02A 1FX2A 3NCRA 3M9NB 1M1KT 4DV5J 5A8RB 1XNQJ 4R5PB 5DLGA 2L41A 4F3OA 3D1HA 4R0JA 4FS1A 2UUBJ 1VQPS 5L39A 3GTYX 3IMQJ 2EBEA 4RUAA 2DEJA 5IWAF 4ZPCA 3V4MA 4IRKA 1BQMB 1B0VA 4QJVA 5EWFA 5E3AA 3CJ5A 4IFVA 1WEXA 1MN9A 5D4PA 1FJGF 5J1EA 2CPYA 3TAPA 3V6DA 1NKBA 3QMQA 3H59A 3OPKA 2RMLA 1K0TA 3K2YA 2OFHX 1K1QA 5B08A 4DV2F 2BQUA 5C24A 1Q78A 1HQ2A 1F9EB 2R7TA 1U6FA 4TN2A 4LVNP 4N47A 4U95A 3BGOP 2DVIA 1CULA 1R0BG 4DZ6A 3LP0B 1OY9A 4B9TA 2CG8A 2YKMA 2HHHF 4LUBA 1TAUA 2X1BA 1ZA1B 4CQ1A 5DG9A 3PJXA 4QWDA 2MB0B 3I9V9 3A3OB 4UUWA 4WZQA 1S97A 2B0GA 2ZZTA 5HMWA 5D0HA 4ITSA 4OI1A 1X9SA 3EVOA 2B4UA 2ZUAA 1EX8A 1JLEB 4DR2F 2YNGA 5KFMA 1YVFA 2Z57B 2JZ5A 3ELHA 1TKDA 2GVZB 1RADB 1HPZB 2C2MB 1SL2A 4HT7A 2M9KA 1WNEA 3J7ZT 1GTHA 1Y10A 1JK9B 1LQ9A 3GB0A 1RT7A 2DKOB 5CZVA 3MMAA 1KFSA 4R8UA 1JXEA 2YQ3A 2BOAA 4JI6F 5GMKa 3IWXA 3ZZYA 2PD1A 1UVNA 3CCUS 1YQHA 4K4YA 2NUHA 4ZJOA 1R3NA 2ZZMA 4ZHRB 3PX6A 4IG3A 5LL6d 3FSIA 2R8IA 2W2NP 2M5YA 2PC6A 3KG4A 1PJ5A 4X4VA 1YIJS 3GR0A 4JI7F 3PYFA 2E1CA 1LWCB 3MPDA 3CJTA 2YNHA 1KNZA 5ETOA 4RKUC 2DTJA 3A8IA 1H38A 1OS5A 1VHFA 4HYKA 2Y1RI 4C97A 2GV1A 1GTEA 4CO0A 1IJFB 4MK9A 4FDFA 4ES1A 3ZZ0A 4DR7F 3RBDA 4FYVB 2BE7D 4N8NA 4NLPA 2CPIA 1OY8A 3KFWX 3QO9A 1YDLA 3IP0A 3DLGA 2OTLS 3OBIA 4DR5J 1TL3A 2L9NA 2QSFA 1N5TA 4DX6A 1U45A 4QPTA 2ZH2A 4PUOA 4DV6J 1HNXF 3HJFA 2VQFJ 3BH7B 5IQ6A 4F8RA 4M1KA 1KOOA 2CKWA 3DFEA 5KFKA 4WKRA 4HHJA 2MDAA 1EJ7L 2B4VA 1C2PA 1D8YA 4N56A 3E3XA 3TEHB 4CLPA 3KYLA 4RW9B 2ZH7A 4OYMA 3TUIC 1TUWA 1FFGB 1DLOA 2Q43A 2W2QP 3GYXB 1JJ2R 3TUJC 1WC3A 3Q24A 3CNQP 5KFFA 2BQRA 1S0OA 2RS2A 1QE1A 4K4WA 1CPZA 3DOMA 1WEYA 2YH1A 1V3ZA 3FEYB 4ZPVR 3SZ2A 1NCLA 2V5HG 1FRHA 4DR1J 3UN2A 2XCPA 1KLMA 1ICEB 3HHEA 5DG7A 5ETSA 4K4ZA 2W1BA 3HFVA 3MD1A 3GIKA 4QZVB 3HMJG 2HGMA 3HHLC 2B7BB 3HDSA 2HVZA 1KQGB 2GHWA 1TKXB 4QBUA 2QJ3A 2X1GA 1Y7PA 3VZHA 4B3MJ 2VPWB 5AJ3F 1AT1B 2CJQA 1YBTA 4NE9C 2DB1A 3I96A 3CUNA 3FCVA 4NLRA 5HLFB 4MYUA 4J90A 2J9CA 2HNDB 2OELA 5J2PB 2OSQA 2ZBRA 4URSA 1S1XA 3AA9A 1IBMF 1YJVA 1DQAA 4DL5A 3JXOA 5KG7A 4L3NA 2HYIB 5MLCV 1DY3A 1S0MA 1RQ0A 3HVRA 3VV2B 3MDFA 1YSJA 3GV8B 2D3O1 3CVKA 2FVRA 1Y5NB 2HGNA 1TL1A 3DRPA 3MHYA 2ZZNA 2U1AA 2LA6A 5K9FA 3OL9A 1FCAA 3LP2B 2E9TA 3V6KA 1N8RT 1RBOB 1RWKB 1RT1B 4OX9J 1FRIA 2MQQA 2IVYA 2N3LA 1HD1A 4MIWA 2UV8A 4LF5F 2I2YA 5KTQA 3KK1B 1N56A 1HNZF 7FD1A 2P8IA 4B3OA 1S9GB 1IR2A 3OTOJ 3CGIA 3BGUA 5DDRC 3M2VB 1KQSR 2PA3A 3MCNA 2R7UA 1JLFA 3Q22A 1FK9B 5LMNF 5KFIA 3NY0A 2B7CB 3QWUA 1NU4A 2LQ8A 2AEMA 2EI5A 3HHDA 1C4AA 4DPWA 1VC6A 4J9NA 1KTQA 2XZWA 1XJWB 3QATA 1XNQF 1CS4A 3MI7X 3S8SA 1WJ9A 4NA1A 2DHSA 2CQ4A 3BN4A 3CJ4A 5HVFA 3PO5A 2UUBF 3RW6A 4QCLA 4I69A 3SEOA 3BBBA 2UUCF 3N28A 3R2CJ 3NAIA 2BM1A 2KTQA 2DHHA 2R7QA 1S49A 2BW7A 1EHWA 3U7JA 1WI6A 1S4FA 3UNYA 4WIQA 2E7XA 5F9LA 2B5JA 3EX7B 3IFEA 2CDRB 5KG4A 4KHPF 2VG6B 4EYHB 3C19A 4OLOA 4H4OB 2P5VA 2HZCA 4CLKA 2Y1LB 2NYHA 1B70B 3I0SB 4D3HA 2DYAA 3VHQA 3DM2A 4U6PA 4M5DB 2Y0SD 3RBZA 4WIIA 3KKFA 1DTQA 4P7VA 3ZNUA 4LF9F 3T5LA 4KGZB 4YR3A 1R27B 1T0TV 2XHWA 3F44A 1X31C 2YNFA 4DL4A 3D0IE 7AT1B 3CJKA 2HQGA 1QY7A 1JLBA 1JLGB 2E1AA 3RRKA 1JJ4A 3VTIA 1K73T 4B02A 5F8NA 2IC3B 3K5OA 1A9NB 3DNCA 2MKCA 2J6TA 3KMSA 2H4YB 4DL3A 3DOLB 1FWKA 2RILA 1QM9A 4EFAC 2NLWA 4RO0A 5DO2A 1N32F 2XSJB 3THTA 1XMQJ 1UEKA 4ZJLA 1X0FA 4M8LA 1ZAVA 1XNRJ 2FVCA 4WK1A 2AEFA 3NKYA 4KV8A 4DN9A 3JTNA 3OSNA 1HWJA 1WTBA 2YWHA 1F0XA 3HM9A 4ZPDA 1T9WA 4KYZA 4B17A 1DTTA 3DHWC 2J0WA 2BX6A 2ZH8A 3U1LA 3OHAA 2NXNA 2HQCA 1GXUA 1M5KC 1F3FA 1YITS 3MMJA 2OD6A 3P45B 4WP9A 4CO3A 3LQVA 5KFLA 5F41A 2V69A 1XTZA 1SKWA 5DJBA 4AQYJ 1GX6A 4DV4F 1RISA 1T02A 3PZPA 2AYMA 3N6MA 3G8QA 2MTLA 3OFHA 1GXTA 4UT4A 5KFBA 2UUAF 4ECTA 4X4OA 1AA1B 2AZ1A 1GAOA 2VBXA 3I4HX 3SSQA 2VV5A 2J5AA 4B9MA 5JMNA 3S01A 3D3BJ 1ZPWX 3SSRA 2VJVA 3QSYB 2C2EA 2K06A 1Q5YA 2GJFA 4ZS6A 3ZTQA 5DG8A 4OFZA 3CWJA 1GQEA 1RA6A 4WP8A 4N5SA 2CNKB 4DU8A 3ZC4A 4PR6A 1RWWB 5HO4A 3IGNA 4F36A 1VQMS 3NNAA 3EM1A 2VU5A 4I2PA 1TKZB 1TKTA 5J1NA 3B54A 2W4PA 5L8RC 2N4CA 3OFGA 1KHVA 2LKZA 1OSDA 3MECA 1YJWS 2JEFA 1VHIA 1X7VA 4X65F 2ZJPQ 3D67A 2DBBA 6FDRA 2WSCC 1O6XA 4DQIA 4IRDA 3UW1A 3BO2A 1IKVA 1IWAA 4NXMF 2MMYA 5CABA 4MKBA 4DR1F 3N6NA 3OR2B 3A13A 5LMUJ 4ZPBA 4JV1A 2X3DA 2W4DA 1B7YB 3BJYA 1U1MA 3ZZOA 2YH0A 2CXEA 4OJ3A 2WB1D 2ZH1A 4JYAJ 4ZA1A 1S0VA 4YY3J 5DETA 2B4PA 2C2ZB 4CT9A 1UW4A 5J2QB 2E7VA 3L9ZA 2AWZA 1H3DA 2MZQA 4ZLPA 3E2EA 4G1QA 3M9MB 4DDFA 3GU0A 1FKPB 3W65A 3MPVA 3WDOA 3NGKA 4I68A 5KFZA 2PEHA 3I9ZA 4X4PA 4G3IA 5KT3A 1S1UB 3FEXB 2EFVA 5KG0A 5I3QA 2DNNA 2H5JB 1N34F 5SUHA 1QTNB 5GAGU 4DSEA 1T03B 4IQMA 4OX9F 2AT1B 2C2DA 1KR4A 3DLEB 1HFEL 4Z37A 1U2RA 3ZTRA 4QIWD 4KT0C 1NMEB 4OZ5A 4DR6F 1YZ7A 3FEZA 1UA0A 3TEGA 4OI3A 4OYAA 1HR0J 3IXQA 1R8PA 2VL1A 1F60B 2DRDA 2IIHA 4NI2A 2JWNA 2EG1A 3G2XA 4LVOP 1ZAXA 3OL7A 2G0CA 1MU2B 3H2LA 3W9IA 3QRQA 1X8DA 2RQ4A 1HYSB 1WF2A 1X9WA 3GR1A 2K1RA 4LT6A 5GAEU 5DGBA 2A2CA 4X4QA 5GADU 2HGLA 4J5OA 2V4JB 1RT6B 2CPJA 5IZHA 2CPEA 3DI6B 4ZDNA 4IYQA 4ANEA 4WF9Q 3D54A 5AE1A 1S1VB 1RT4A 3U1NA 3KTQA 1T7PA 4F3MA 2WBRA 2E44A 1NK9A 1B4SA 3C6TA 5IXUA 4RNFA 4MKAA 1JWWA 4WU3A 1FKOA 2DGOA 1VJQA 3FFIA 4ELTA 1A7GE 3DLHA 3D5MA 4K4XA 3W5YA 3C8YA 2B56A 1YKWA 2FJDB 2DXDA 3PDNA 1FD8A 2IYGA 4F0HA 3CDUA 5L1LA 3HHLA 2D3ZA 2ZJRQ 4U96A 5KFHA 5ETMA 5E3PA 5F0WA 3O44A 4CLWA 2OMLA 1S1TA 3D3CJ 3UN5A 4Q0BA 3HD2A 2W7AA 3TVYA 2Z30B 4E0DA 1JLAA 1N36J 3QQCD 2DR5A 3OXLA 4I6WA 4A8QA 3KHHA 3KMQA 3JSMB 2DCUB 2F40A 3KJVB 1XMQF 2AZ3A 1R7IA 1SV5A 3CC7S 5J1PA 2HS0A 4CH0S 2W24A 3KK2B 4FVMA 1NLKL 2X1FA 1KDNA 3PR4A 2RS8A 4DLEA 2OFGX 2DXFA 3R6LB 3R6GB 2ZC4A 4C11B 2CPZA 2X51A 4RW8A 2A10A 2QA4S 2VD3A 2RNEA 2PIIA 2AJ0A 1VQ8S 2GQQA 2L3MA 3BQ0A 1T05A 1ZPVA 1OPIA 3HD1A 1AFIA 4OHVA 4KKOA 4CLFA 1DBDA 1TAQA 2G13A 3ILJA 3P4UB 2IBOA 5G4DA 3GLJA 3SSSA 1FFWB 1NJXA 2IM0A 4O4GA 1OSCA 3MM6A 2LLZA 3JYTB 1OWXA 1G4CA 5KFUA 4L72B 2F4FA 4OIXA 3N79A 1S9FA 1CJTB 4ELVA 2CQ1A 3NEKA 1HBOA 1AZSB 2NPFA 4U7UK 2OEKA 1VI7A 2G1HA 2OPPA 4BDPA 4DQSA 3POTA 1BWVA 3IWNC 5CXTA 2IVMA 1D09B 3K8WA 2W9CA 2OAUA 2XYGB 1IBKJ 4J91A 1REVB 4KPYA 4OLPA 3UDCA 2OPSB 4L3KA 1RU2A 4LR7A 4DJBA 2DCLA 1E6VB 2JVOA 3TOQA 1R89A 4USMA 1KWMA 1Q86T 2ROEA 4TY8A 4M5LA 2QYGA 1T8EA 2E29A 5GAGI 4P9SA 3RBXA 5LMUF 1FRKA 3BSAA 3LGNA 5IM0B 2VPXB 1ZM4A 4LF8J 1U1NA 4QOTA 1N33J 3KLVA 3J81Y 2OEMA 3L95X 3N0VA 9ATCB 1IKWB 4DX5A 4JYAF 2LFVA 3US5A 1J5OB 2BA9A 4YY3F 3UDLA 2EFNA 4AL5A 2PEBA 2JH3A 1XR6A 3M1VA 3TVZA 2QL9B 2XI2A 4PPZA 1VQKS 4NEYA 1RP5A 2Q3PA 4WE1B 3SV4A 3C14B 5CA5A 2Z8QA 2XMAA 1VS3A 1VJWA 3VWSA 3J81U 3CTRA 2CJAA 5IT0A 4C8LA 3GV7B 2CPDA 3SBMA 2F8HA 4XDDA 4QYZK 4LFAJ 3GSIA 3O1LA 4YDXA 2V0NA 1PILA 2BJEA 5HROA 2R7VA 2NZ4A 2DNYA 1HWIA 3AFGA 3CJ2A 3M2RA 1RTHA 4PKDB 3GIJA 5C5JA 4PABA 3QRPA 3OTEA 1FJCA 3H0PA 3HKWA 1NEEA 5KFXA 2UXBF 2GO8A 3FCWA 4DR3J 1Q79A 5F8HA 3FQLA 2JLEA 3VGVA 4BBYA 3R1LA 2FLLA 3TAQA 5EWGA 4FXDA 4F4XA 2ILZA 5ETLA 2DPJA 1UJ6A 2VONA 3HSDA 3MM5B 3UDEA 3F56A 1KN6A 1C1CB 1HQUB 1NK0A 2FHOB 5DS7A 2HFOA 4NPOA 4HVZA 3R27A 2VASA 2LQ5A 5L9NA 3IS9A 1PAUB 3M9OB 2FD2A 5C2CA 3GFZA 1ACMB 3D2WA 2BYCA 1TUGB 3AB2B 1IBLJ 5T7LA 4J9SA 4JI1J 2JNJA 2I6WA 1VQOS 4URGA 4WFXA 2QZ8A 4ED1A 3OUYB 1FRXA 1R8HA 5IOLA 4B9NA 2FHJD 5IC4B 1WG5A 1D1UA 1WOPA 2I1RA 2NUUG 3DOKA 3W7BA 3RZAA 4XK8C 3IR7B 1VQ7S 1WSRA 1VRQC 4ZPTR 2FLNA 2R7WA 1UPMB 4FP9A 1MSWD 3OTCA 1YX2A 4UY8T 4LSLA 5T14A 4UTGA 4CWBA 3AOCA 3LOUA 2AYBA 3Q2TC 4L76A 2QLJB 2A18A 4XPEA 3BPSP 2WOMA 5AT1B 3OL6A 1GX5A 1MG7A 1LW0B 3MM8A 1X0PA 2RD5C 1HNIB 5M2RA 3A3PB 1R31A 2L9DA 2YTCA 4FF1A 1S76D 1QAXA 3VVUA 2Z0GA 4RLEA 3BKTA 2PMWA 4DI6A 1HBNA 4LFBJ 1N0VC 3N9UC 2HSEB 3HVWA 1LWEA 3B78A 2QYCA 1BY9A 3J7A1 3RTVA 3QLHA 5FIIA 2OKQA 3LAKA 4LF1A 2XS5A 2M88A 1PAEX 2Y0BB 4PXDA 4DQPA 1GFWB 1BGXT 2XYHB 1DFDA 3PY8A 3LP1A 5F8IA 2ZM6F 1HA1A 2D69A 5A76A 4OI0A 2QA1A 3QJLA 2VA2A 3BGRB 2C22A 1SQGA 1W7WA 1EQMA 3FVYA 4X84A 3IBFB 1PCAA 1P1LA 1RCOB 3BBFA 3VR1A 5CYQA 2YWGA 2F4VJ 4GKJJ 2MSTA 1NRKA 4FYWB 3CDWA 4CDIA 1I94J 2Y3YA 3UN3A 3KXDA 5ITHA 4CTAB 2KVQE 4KSEB 3C6UB 3K59A 5I4MA 2HHXA 1EKSA 2OPRA 4ID5B 5M2UA 4UQGA 4MIAA 1VQ4S 4X4SA 2H51B 1Q4RA 2GW8A 1YJUA 4DPOA 1NPRA 2Z56B 3Q83A 4H4MA 2YPYA 1UZDA 1YWXA 3SIPB 2FJWA 2HG4A 5A0YB 1E6YB 4WFNQ 2K2PA 2WONA 3ET6B 3HZEA 2JEJA 3WBZA 2CRLA 2MY7A 3GV5B 4C2MA 3K5NA 2OPQB 1RUSA 2JEIA 3QT6A 3PYDA 1IVZA 1U6ZA 4N77A 4U8VA 1UJ4A 3OHBA 1Y5LB 2VICA 2G2YA 2HWHA 4P10A 2IDEA 1RHQB 5HJXA 2CQ3A 4V19X 3IM8A 1SI9A 4OX8A 4U7UD 3LWLA 2XEXA 3LO3A 2YKNB 3CD0A 5KG6A 3WQPA 4IQXA 4I67A 2G9OA 1MNEA 2UU9J 4X2BA 4PEOA 3EWGA 3IGVA 4P6QA 3L3CA 3UVJB 4G1IA 4C48A 5L1KA 2ZHBA 1Q7LB 3EGZA 2ALYB 1LEOA 1FNXH 1N54B 1UP1A 5CD4A 4X62F 3F41A 2IJFA 2AJ1A 4ED6A 1Q7YT 4ZIVA 3G86A 4ED0A 2VH7A 3C16A 2CA9A 5LJ3Y 4O3SA 2VG5A 2NR0A 1RI7A 4RUBA 3KHLA 2VPYB 4ZVPB 4A46A 3M8PB 3MM9B 4UOFA 5AXNA 9RUBA 2B43A 1NSPA 3OSPA 4WFYA 1EQ0A 2E1MC 5DQGA 2V4QA 1TFYA 1AROP 4C98A 2YKQA 2KI2A 2DO4A 1APSA 2MPUA 2FLOA 2PO4A 1EETB 2XCAA 5A8RA 4LBPA 4R5PA 2V4RA 4XAKA 3W2VB 3J7YU 3J7Z5 4ZK7M 4ZVHA 1QUVA 2CWXA 2QV6A 3UWTA 2DH8A 4BWMA 1X5OA 3FSXA 2WK4A 3JQKA 1BQMA 3W63A 1N52B 2P9GA 1ELOA 2CNNB 2J7UA 4QIFA 1BUXA 4DXLA 2HW3A 1JJCB 2R7RA 2DNKA 1JXVA 3BYPA 4O3RA 4CYUB 5F3ZA 3ZZPA 3BS9A 4GKKF 4NRUA 1FEEA 2CZ9A 4DR3F 4WBFA 3MEEB 5KT6A 2DR7A 3NS6A 1Y5IB 5KFVA 5ETQA 3Q8UA 2RQMA 5A6PA 2ZNZA 1LK7A 1FT8A 1UFWA 3VAHA 2OJ3A 4DV1J 3S7RA 1HIYA 3QIPB 1O0PA 1EB0A 2F9JA 2HS3A 1S6OA 3V6JA 4FN5A 4DR4J 3PX4A 4G65A 5B0EA 2VZ9A 1JLEA 1TL7B 2CQDA 2D9PA 4IH6A 2H54B 3MEGB 4OYIA 1HPZA 1IQZA 2X3GA 5K8MA 3M2UA 3P8BB 3TX0A 5A8KB 1X60A 4QWBA 2VC0A 3B82A 4U67Q 1DRZA 2L08A 5HANA 2PN6A 4ETZA 3AA8A 1QSLA 4ED3A 5FD1A 5U47A 4KBIA 3MURP 1WF0A 1S7HA 3NRBA 3VZIA 3I0RB 1AFJA 1L3TA 2EKNA 4F4AA 1LWCA 3VGSA 2A6OA 4J9OA 3KG0A 3DLBA 1OQ6A 2GO9A 2V67A 4J9UE 4M94A 1U0SA 5IV4A 3H40A 1NK5A 4EZ9A 1RHJB 4IO9Q 2KFYA 3MAQA 2LQ9A 4C7QA 2HHUA 5C24B 3ENWA 1TK8A 2EKYA 4QYZJ 1JMTA 4LFBF 3W9HA 3MXHP 4NCAA 2MKIA 5E41A 2DO0A 1FF2A 3M8ZA 2HQFA 3N01A 2VOOA 3T6BA 2LQJA 4YS2A 4PQUB 2HWIA 1RYSA 4GVLA 3PO4A 1WKJA 1ITPA 2BW2A 1FVQA 4NYZA 1BE4A 2DY1A 2FVQA 3T5KA 2IJNA 5L38A 5LSOA 3DGVA 1QLNA 4Q7AA 2BXJA 4ALZA 2E5LJ 3BDEA 2M8HA 2YNGB 5H9FJ 5BJRA 4OI4A 1Q95G 3H2VE 1OO0B 4RW9A 4BCAA 2F4VF 2BE2B 3D6HB 3DLKB 5I3UA 1U02A 3D66A 1C0UB 3AODA 3BGFA 3MMAB 1N6QB 2FY1A 5A2QY 1K1SA 4F02A 4ZCIA 3DXBA 3M7VA 2GX8A 3KLIB 3ISNC 4HH0A 1VIOA 4A4JA 2JJ4D 3BSCA 1MMNA 1TMMA 3AOAA 1HQEB 4B3SJ 3W3SA 2DD8S 3L7PA 2LXIA 1D9DA 3KLGB 1KS2A 1PJ7A 1PYOB 1U6BA 3UNGC 2RKIB 3RB6A 2GVDA 5A2QU 3MF5A 4FF2A 1TKXA 1MROB 2OI2A 2LXUA 3NS7B 5F0UA 2V8GA 1TVRB 4Q2LA 4NLTA 2G0JA 1VR6A 1FX4A 4YB7A 3CJSA 2J8SA 4EZ6A 4QR0A 2AW0A 5HLFA 2ZVIA 2YX7A 3AXKA 3KLEB 1N88A 2HNDA 1CQNA 4P71A 5J2PA 2JDJA 1DAXA 4PPDA 5D8HB 3PM9A 3H8YA 1NB7A 3J7YI 4FBTA 1T9UA 5KFRA 3G9CA 2ZBCA 2UU9F 2CZVC 3MUTP 2ZITA 1MN7A 3WX8A 3NAHA 4MKYA 2LDIA 4Q8FA 1RGVA 4ZLJA 2IY5B 3FZBA 2NQPA 2VOPA 3M6VA 2RDDA 3LP2A 4U9RA 2BUNA 5C42B 1YK9A 2VC1A 1RT1A 1R6VA 2BR0A 2VF3A 4PG7A 2DHXA 4K5RA 4K4TA 1RAHB 1HNWF 1RWXB 3KK1A 3IAM9 1DLOB 1ZETA 1S9GA 3LALA 4DUYF 3M2VA 3D9BA 3G8TA 3T5HA 8ATCB 2KZMA 2EFPA 3CD5A 4MIBA 1FK9A 4ED7A 4J7CA 1QE1B 3HZGA 2JVRA 3LH2S 1U48A 3H5SA 4AYBD 1D0EA 3D0GE 1KLMB 2YWWA 3CJ3A 3BREA 3IBCB 2HHTA 2W8LA 3CCLS 4JI5J 3AY0A 4E98A 4Y28C 1J5EJ 1M0SA 4O23A 4IUFA 2NSBA 3KDOA 2Z2YB 1UW9A 1U0HB 2UUTA 4TLRA 1B64A 1VMBA 1WWHA 3IBWA 3KHRA 4LRBA 4JI0J 2V63A 2C2NA 1S57A 2VG6A 1YJRA 3R5AA 1LOUA 3OXFA 2DNMA 4H4OA 1QDUB 3VF0B 4FPRA 4TY9A 2PSZA 3I0SA 3IWLA 2F1FA 4M5DA 2R7OA 2V2VA 2MHNA 4KO0B 5IC6B 4WTOB 3QIDA 2CYYA 3HF5A 2VQEJ 2HNYB 2GC8A 1WC5A 3J7AN 5HMZA 2HFSA 2UXCJ 2O01C 2W25A 4NLYA 4W90B 4DR4F 4MFBB 3M32B 2DR8A 1YRTA 3P49B 1WHXA 1UZHA 4DBQA 1RYRA 2P2CB 2QL5B 3D28A 4DV3J 1JLGA 2AV5A 4DF4A 2AGQA 4PG8A 2QA2A 4HI1A 2IC3A 3QAUA 3NGUA 2MQ8A 5BXIA 2UXDJ 4U8YA 3DMJB 2BJ3A 4KJIA 2R8JA 2J8AA 1VC0A 1V5VA 3DOLA 4Y00A 4QIVA 2ZH5A 1KVIA 4FYXB 3M8QB 2HKEA 2XSJA 1NK6A 3GMGA 1S6UA 1RZMA 4LRCA 1VBZA 2BJ8A 5KFQA 4Y2MA 4LSNB 4OHYA 2AF6A 2LYVA 4JV5J 1T3OA 3KOAA 4CZCA 2DRAA 1WKLA 2Q6BA 3K7RA 1HL6A 1FNMA 1YBAA 2N7YA 2J0XA 4NLDA 1N4LA 4OHZA 1N5VA 3TVKA 4Y3CA 4JBCA 3R1HA 2DGVA 1FI4A 2U2FA 3CULA 3MEDB 1D9AA 2R2TA 2J6SA 3TZWA 4C8ZA 1IN0A 1U1QA 3PYGA 2FGCA 4TVAB 5DDOC 1TZ0A 2LEAA 1F9HA 2JL9A 1CJKB 3EGWB 3MAHA 4V19J 1RHUB 2NYIA 2KYZA 2LECA 1UVIA 4GRSA 1F9FA 3GPAA 4JUZA 3TA1A 1KTVA 4QWCA 3MGJA 1CJUB 2QLBB 1VRUB 2QN6B 3KHGA 5F8LA 1CC7A 1RWOB 4RW4A 3CDBA 4ECWA 2ZWPA 1JLBB 3QT7A 1REGX 1T9TA 1NO8A 2QEXS 4YP3A 2Q6CA 1U2CA 1ZBTA 4USUA 2HIQA 3E01B 2IMOA 4CO5A 3HFKA 3CJ8A 1VYAA 1WOSA 1HWUA 2QMUB 4EU0A 2KFNA 4DV0J 2MLXA 1U09A 4S0MA 5C2GA 3GYNA 3P3DA 4DV7F 1RT3B 1QAJA 2O5DA 4LF4J 2GQCA 3LGHA 2MZRA 1NKEA 5IT4A 1S9EB 1SH0A 2M52A 2QC3A 2V6AA 1B99A 3IRXB 2DNHA 3QYYA 1G6BA 3OR2A 2R2UA 1DTTB 1R43A 1WF1A 3THPA 2VUGA 4IOBA 4KRWA 1NZ8A 3OJSA 4I7FB 4PXEA 2W4CA 2PFDA 4OZ2A 1W26A 4RPFA 1IKXB 2HBQB 1IKYB 4AUKA 3TRGA 1OPZA 4QU7A 4RUCA 3VGUA 4M5IA 4EMDA 3ETMA 1TL4A 3TJAA 3W66A 2N7CA 3BSOA 4L75A 1VBYA 2W7OA 1FKPA 3GG0A 1RAGB 5HP1B 1FDDA 2HURA 1RK8A 4RU2A 2I9SA 1Y11A 3I55S 1F5CA 2JHEA 2ADCA 1S1UA 2HAFA 2D41A 2MKJA 5DZ6A 3T1YJ 4PZVA 2YWFA 4BC7A 2XNQA 3KLHB 3MR7A 1T03A 4M5MA 5LT5A 1O8BA 3T9NA 1U4BA 5F8JA 4JV2A 4I0WA 4LF6J 4K2XA 4UQTA 3DLEA 5HI7A 4QR1A 2DNLA 3OTDA 2A0FB 2WVDA 2CPHA 3MECB 4ATNA 2R3VA 4A8XA 1NPPA 1FFSB 5THWA 2ILYA 2CVEA 4K0KF 2C3YA 3I5CA 5HVGA 1WHVA 1BWEA 4HEA9 2QIFA 5E3RA 2CNOB 1FXLA 3TARA 2MXYA 2DK2A 4DQQA 2F63A 1TELA 4ECQA 1MU2A 1SJRA 1EAYC 4BS2A 4O4RA 2JEGA 1S0NA 2ZH4A 5B0DA 1HYSA 2HWTA 2VFUA 5J2MB 1AXQA 4PG5A 4Y2KA 2KT5A 4JV0A 1J5EF 1N48A 1V3RA 3BR8A 5KG1A 3T5JA 4YQWA 2DNGA 2W01A 2V4JA 3K58A 2MJNA 5D15A 1RT6A 4YR0A 4KGMA 3DI6A 1UL3A 4JI0F 4CM0A 1S1VA 1N5YB 3W62A 3GP9A 1RTZA 4I2QB 1Y3KA 1WUUA 2QMXA 1FESA 5IV3A 2XB2D 5HSPA 2OP5A 1S6PB 2VQEF 2ZHOA 3CCQS 2MLZA 4C3LA 2UXCF 1GH8A 1EIYB 3A4TA 5D3GB 3ISZA 4YN3B 1H74A 4FNHA 3A8JA 2CJKA 2WVBA 2XMVA 2RIJA 1RT2A 4L74A 3O2IA 4J9VA 2QX0A 2RU9A 1FRMA 1RCXB 4QIEA 4DV3F 2J9DE 3GFXA 3GIIA 2RU3A 1RAAB 4K4UA 3HHLD 2QFIA 4OHXA 2AQ4A 2RB7A 4LIRA 5LXYA 4I6YA 5GAHU 4UOCA 1FXDA 3I87A 2DPIA 4ILMA 1RT5B 3JSMA 3KNAA 3KJVA 4OJHA 5HBMB 3KK2A 4JV5F 4NZ6A 3T3FA 4NLQA 4NLOA 2I0XA 5E3QA 2HIYA 2UVRA 4I1TA 2RHQB 2R8KA 2KM8B 3CEDA 4C11A 4QW8A 1T9VA 3H4BA 2C3UA 2W2OP 1NJZA 2IVFB 3PEJA 3UD3P 4CLYA 3OLBA 2R9LA 4UF4A 1C0TB 3I5BA 2RQKA 1B3TA 4GMKA 5D4NA 4EBDA 2BANB 4DG1B 5CYJA 3PX0A 1VGYA 3FMWA 1SQFA 3PHTA 2DGQA 4H54A 2GAHC 4QYRA 4ZITA 3A8KA 5KFYA 4E2FB 1T9XA 3AH6A 4H4KC 5JXSA 3CSKA 3ZFVA 1SCJB 1YJTA 4RX6A 4HT5A 5K8PA 1RSCA 3SCIE 1UWBB 4JP8A 2MGZB 4PWDB 1SJ1A 5BR8F 3JYTA 4Y2IA 1R8CA 3NOGA 4OZ0A 1X4EA 3DU6A 4FBUA 4M63A 1H2UX 3G82A 1RU1A 2XO6A 1U1OA 1NDCA 4ILRA 3R2DJ 1CJVB 3BQ2A 4CNYA 3FJ2A 4FS2A 1NHKL 2VDIA 2YX1A 3Q8YA 4XPCA 1FERA 1YJ7A 4YOEA 3HP6A 1JLAB 1MLAA 4FPIA 2IM2A 4QQBA 1H0HB 3PG9A 4JI2F 3NGDA 1REVA 4RUHA 3TQEA 4LFCJ 2C2RA 2OPSA 3SDEB 3EPIA 3CD6S 1H6KX 2VBWA 4LF4F 5DM6Q 2KFZA 2P9EA 2Q79A 1HNVB 1OMSA 3MFIA 1RXOB 5IM0A 4YDDB 1QTMA 2IAJB 1OY6A 4LJMA 3FNNA 3UO0A 5K5MA 4KIAA 4MTPA 4DX8H 4HR2A 4WXOA 4RW8B 2C3PA 2OHDA 2J76E 2WVCA 1XIQA 3OQ2A 1U49A 3HT3A 1UCNA 4FXWA 4C0BA 1KRPA 3CCSS 1F5BA 1ZZFA 3FGVA 1NZAA 1X9MA 3S6EA 2JX2A 4KKOB 2R4FA 1NHUA 4WE1A 3C14A 2J9EA 3M6XA 4QWAA 1TMJA 3ZTSA 2AU0A 1QAIA 3PHEA 2HNZB 1P27B 2FVSA 1NXIA 3TA2A 5EN1A 3ZNJ1 2GHVC 4LF7J 3EZ5A 2BKPA 4GC7A 3FC9A 3T1YF 3H5YA 1NDKA 1HBOB 2IFXA 4DV5F 4DFKA 2Q1LA 2W9BB 4OZLA 2XLKA 3PKYA 4D3GA 1YZ6A 3RRHA 4NRTA 4XO0A 3MWBA 5KFAA 2W9CB 1J27A 4USJC 2UVUA 2FC9A 4OJ1A 4UY85 2VG7B 2FTRA 1HI0P 5ETTA 1VQ5S 4OZ1A 1HBMB 4OX7A 3OFEA 1YGYA 1RHKB 4CRJA 3TYTA 2OUGA 4OJGA 1T94A 2IM1A 2PMHA 5BYRA 2A2DA 4HACB 1S1WB 4J9RA 1H98A 4K2JA 1FTRA 4C8MA 2COLA 3RB4A 3OT9A 2FQQB 3MM5A 1X4DA 4HL9A 2VIHA 5DZ7A 4DEZA 1C1CA 1HQUA 4P52A 5HL7Q 5D0RA 2JFKA 2B9YA 4EUVA 4Q8EA 3AJ2A 2QLFB 1AW0A 3F0NA 1Y4ZB 5A8WB 3DRRB 4G1PA 4JOUA 5LSRA 2I5JB 3MCOA 5F9NA 4QWEA 3QBCA 4CLLA 4LQ3A 5B0CA 2HVIA 3V4IA 3PRVA 3JQMA 5K14B 1BHNA 2G0IA 1TV6B 3SFUA 2CQ2A 1ROFA 1TK5A 1IQTA 5DDPC 5KFPA 2WB4A 2KT3A 3OUYA 2HEKA 4M5HA 4B3TJ 3AXMA 2XQCA 5D4LA 3W1YC 4RZRA 3WZ0A 1P8GA 4ZCKA 1JLCB 3IN5A 1OJ4A 2EBGA 2Q66A 3N6LA 2XBPA 5K8OA 2X1AA 1R0AB 4C0OC 3Q8VA 2BKOA 5IWAJ 3V2UC 2HFUA 3CCWA 2ROPA 2KXNB 5CQGA 1FJGJ 2D74B 2ZJQQ 2XY7A 1LW0A 3NL0A 3ONQA 1URRA 3MFHA 2AD9A 2EPIA 1HNIA 3W5XA 1FEHA 4O3NA 3DLJA 1NSKL 4DV2J 3KJFB 2AJFE 1WDDA 3CE8A 4Q43A 4IDKB 3KLFB 1EZZB 2V9KA 1FXRA 4ZVUB 3TAMA 3TUZC 2FVPA 2DITA 2CQ0A 4O3PA 2J0SD 1MW7A 2AP6A 4J9QA 2HHHJ 5HMXA 5J2NB 1MMLA 2H5IB 3QFHA 4N76A 3W2WB 2AKWB 4OZJA 3ILIA 4ERDA 2EG2A 2FJAB 1WHYA 4DR5F 1X4BA 4PWWA 3BGRA 4DR2J 2HS4A 4B3RJ 1UVMA 4DV6F 4CH1A 2HHSA 2VQFF 1X4FA 1IM6A 1D3WA 3RR7A 2YWEA 3OL8A 1SKRA 3TZXA 4OX6A 3CIMA 2MY8A 2H9ZA 4YB6A 2ZE2B 3RAXA 4JI6J 2JOQA 1CLFA 2XMKA 4IOCQ 3PCOB 4CTAA 3DOKB 3A1YG 2YY3A 3C6UA 4OYBA 3M8WA 4ES3A 4ID5A 4X4TA 3TX8A 3H25A 1Y3JA 2KH9A 2HVEA 2Y1IA 2XZTB 4K4VA 3IC1A 2HFVA 4JI7J 3WIUA 3SXLA 4RW6B 1FA0A 2AMCB 4ED8A 4URQU 5A0YA 1E6YA 2IA0A 3K89A 2ZH6A 2D9OA 3ET6A 4ZN1A 2AHOB 3JSRA 2AX1A 4IKAA 2OD4A 3FBFA 4C9DA 4DR7J 2RUSA 2BRLA 1NPKA 3KK3B 4XDCA 1HBNB 5LSLA 3DCAA 2ATCB 4NLVA 1LWEB 2MKHA 3MOZA 3C15A 4B3MF 3SQGB 4OI2A 1B0TA 3BN7A 4KPCA 1U2FA 4ZMMA 5HN0A 2PFFB 5ETRA 2VFVA 4Y2AA 1LWFB 3JQJA 1H2TZ 5KT7A 4IOAQ 1JLQB 3RW7A 3PW5A 3LP1B 1G3OA 4WP3A 3H7HB 4DSFA 1M5HA 2H65B 2BV3A 3U1MA 2R7XA 2IM3A 4TKTA 2FJEB 2JLFA 3ZZTA 3FBBA 3LW5C 4WXWA 3Q8QB 2RE1A 1U7LA 4V1Ak 2MQOA 1FDAA 2HLTA 2M8DB 5ETVA 2O3DA 3M8PA 3G96A 3MM9A 3I5AA 2A6MA 3DDIA 4HHUA 4DSJA 3NGRA 2Z4PA 4DOZA 1GEHA 4WCEQ 1R8BA 4YEAA 2DNZA 3UI3A 3OTOF 1EETA 4TU9A 1EP4B 3SFGA 3J80Y 4LF7F 1BC6A 4F50A 2GMJA 3W2VA 3GIMA 2KU7A 5DGAA 5G0RB 2XLJA 4PCQA 3IG1B 3RG6A 2WONB 1SH2A 2WZ1A 1WDTA 2HBZB 5KFSA 3N5BA 4FXVA 5CHCB 5CYMA 2NSCA 3DRSB 3JTPA 2FJBB 2AJ2A 2FIUA 4NEZA 2CJBA 2F3JA 2E1PA 4GVBB 4A8SA 4KE5A 1RKIA 4KFBB 2LXFA 4CYUA 1RLCL 1Q16B 1LKZA 2DJWA 1PO6A 5C25B 3MEEA 4XTTA 4DX7A 3V81A 1N5SA 4WYLA 2DGSA 3R5JB 2CNLB 2E7WA 2DGTA 1RTIB 4RNNA 2W2MP 4WKYA 1UTAA 4BC9A 5D6GA 4H4KA 3FDSA 1URNA 3EVMA 2CVIA 2XM3A 3QIPA 1RBLA 4Z7CA 3W5ZA 2XC9A 2ZDOA 2DNPA 4I6AA 4EK2A 4HDHA 1LW2B 2N3OA 4J9MA 1NDLA 1NDPA 4DPXA 3FRZA 3W64A 4USKA 4LF5J 2B9WA 4YB1P 3MEGA 2MZ1A 3ZXWA 1NSAA 1VBXA 5A6WA 1TTHB 5A8KA 4NLWA 2KG0A 1YHQS 2GAGC 3OFFA 2MJUA 3W8GA 3NNCA 3SCKE 3SYZA 3PW7A 2Z2LA 2E5GA 5IT9Y 3DGPB 1UKUA 2DXEA 2FZKB 4ZVTB 1XWLA 2E9RX 2UUCJ 2W9AA 3LANA 4I64A 3I0RA 2DIUA 3MPYA 3SCJE 1XNRF 1NJWA 3CDEA 3G6VA 3TZYA 1ZH5A 4DFJA 2QSWA 4PYAA 2P9CA 2GMHA 3V5RA 4HDGA 2ZUGA 3JAMY 4P74A 2YKPA 4C4WA 4EBCA 4R25A 1S12A 3H42A 4KHPJ 4C8YA 4Z7YA 2MQNA 5IT9U 4FKYA 1DURA 4ICLB 2C2KB 2NCKL 3I32A 5L9XA 4DSIA 3BYRA 2QTWA 2RSQA 1UEVA 4KR0B 4PQUA 2UV8G 4AQYF 1BQNB 4RNMA 1YJNS 4LF9J 1EARA 3QGPA 4K59A 3M8RA 2FPHX 3CCRS 3RB3A 1HI8A 3JAMU 2HPUA 3SQOP 3MMBB 1Y9OA 2ZKTA 3HXMA 4HI2A 3M05A 2VKZG 4UW2A 2EXUA 1U47A 1NK7A 1TL5A 4DPYA 4B3RF 2BQ3A 1IR0A 3IRWP 2JSXA 3T1AA 2GJIA 1DQ9A 4TU8A 4HTJA 4WWSA 1X5SA 1R0CB 3RAMA 2YWKA 3HVTA 3TP2A 3VVTA 2BE2A 2IA6A 3DLKA 4JB8B 3M2UB 1C0UA 1N6QA 4HLBA 2XGPA 1N32J 2OLWA 3I4PA 3DKDA 2LDYA 3D0HE 2YKOA 5HVHA 4X64J 1P9QC 2OMOA 3KLIA 4USIA 1S77D 3P6YC 2ZD1B 2GIQA 3OR1A 3RR8A 3UCZP 1HQEA 2R42A 3VAGA 2QLWA 2FY8A 1FJ7A 4CLTA 3R9LA 2XSFA 3KLGA 4AXIA 4RBTA 4ZIWA 3HFZB 3LTOA 2RKIA 1PBUA 2DR9A 2HHWA 1ZOTA 3HI9A 1A0OB 1MROA 4ED2A 2B8PA 4DMZA 1TVRA 3BB5A 1P1TA 1U8SA 2KRBA 2XZDB 1S6QB 4DV4J 1HI1A 1NAQA 4NMLA 3G8SA 4WZMA 2NXJA 5H1SV 2QMWA 3UE2A 3CCVS 3KLEA 4TU7A 1KBRA 2M70A 5JVGQ 2UUAJ 4AT1B 3MR2A 2I38A 3CCMS 5E3CA 2B9XA 2GIFA 3RBEA 1LFPA 3KJNB 4DUTA 3G6ES 3CJQA 5D0EA 5FJ4A 1U1LA 2KM8C 3PRDA 3CF5Q 1FJEB 1PKUA 5DLFA 1VIXA 1SJQA 4NYOA 3PIOQ 4NZ0A 1JKHB 1D8ZA 4OYPA 4ES2A 4KAIA 3OTBA 4C8KA 1F2GA 3LAMA 5C42A 2HRTA 4W98A 5GAEI 2RF2B 2ZHAA 3R5DA 1ZS6A 2BZ2A 5GADI 1L3VA 1LXNA 3VCDA 5KFWA 1ZTTA 3O8WA 5I3UB 2K3KA 2JC0A 4OMFG 3NMRA 3PTWA 4RJVA 4CO2A 4YR2A 2PGCA 1TR0A 4USHA 3MMCB 3SI8A 3AHPA 2L48A 2GQ2A 4X65J 1RTDA 1S72S 4RL1A 5KFJA 2KYXA 2VFRA 1KLNA 2LU2A 3T6JA 1B0PA 1U8WA 2DRBA 2OTJS 3LUYA 4ZKAA 4MJKA 4NXMJ 4K8RA 2DIVA 2M0GB 2E5JA 4O44B 3IAS9 5B0AA 2WW4A 4YHHJ 1VQSA 3DYAB 1HR0F 3HT0A 3LWMA 5I42B 2QA4G 4ZVSB 2GVDB 2D7SA 4ECRA 5H9FK 4F4ZA 1U24A 4CNZA 2R2SA 3FBEA 3PW2A 1OYDA 3CO0P 3DRXA 1U0HA 2IDLA 3OVSA 1SXLA 2WSEC 4E8UA 2Z58B 3FZ2A 5KG5A 3EUNA 2QRRA 4F4KA 4DWIA 5IS2A 1UAWA 3PW4A 5HQMA 1CQMA 4DCOB 3NWGA 4J9PA 3CDAA 1L5UA 3E8OA 4KO0A 3EMTA 5KOXA 1OQ3A 1FRJA 5BYSA 1UETA 2KJVA 2HNYA 2RDJA 5CD4H 2HRYA 4P2SA 1UVKA 4ZPWR 3HSJA 1N34J 2OO4A 2OGUA 3GCXP 4MFBA 4A8MP 2ZOGA 3M32A 2E5IA 3K8VA 2MKYA 1RAFB 1VQLS 2RAQA 4KGVB 2B8QA 3UPFA 3CD7A 3W60A 1CSJA 5D4OA 2V2QA 4CO4A 3MCMA 5KFEA 1LFWA 3JSBA 4DR6J 3WC0A 2RH3A 5KG3A 2W7PA 4A8YA 3DMJA 2YXLA 3TANA 4YUDA 3OW2R 2H3EB 2P6TA 1WACA 2V50A 4MKVA 1CG2A 1YBUA 3NBPB 3M8QA 3BPDA 1XEZA 2AJ4A 1DJ0A 4MK8A 4ECSA 4NCGB 1UWAA 1UVJA 5B09A 5EDWA 4C0HA 4LSNA 1X4AA 1HBUB 1N36F 2AYGA 2ZBQA 4NWBA 2RRBA 4Q44A 3H4DA 1K44A 2VKRA 3B4DA 3UCGA 1S4EA 2XG8A 2IRXA 1FWPA 2IRYA 3H5XA 1WELA 5E0OA 1ZYQA 4DCJB 1UMJA 4IH7A 3CXCR 1G7CB 1GK8A 1N5QA 1U25A 2XYPB 1HMVB 3MEDA 1K9MT 1WEZA 3C3LA 4IRCA 3R5GA 1RKJA 4YFUA 1SJ3P 2RDIA 4AXJA 3NNHA 3RGIA 3RAQA 1SC6A 2WTFA 1CJKA 4B08A 3GSDA 1UJ5A 4ZVQB 4EBEA 1KFDA 1ZTWA 3AJDA 3ZTOA 1T95A 1WG1A 4OV6A 2GGPB 3EDQB 3DLLQ 4MMOA 3TZZA 2B6AA 2YPZA 2ZBPA 3EICA 4RBVA 2KHCA 4PG6A 4Q2MA 4B9SA 3GFHA 1CJUA 4HKQA 1LNQA 1VRUA 2KXFA 4KY3A 2XTJP 3MM7B 2G1DA 1VCTA 1RABB 1M1GA 1Z2ZA 3OV7A 1ZZNA 3NS5A 2RRNA 3E01A 1S99A 2BM0A 4EO6A 3MR5A 5AXMA 3FK4A 2YNIB 3R8YA 2HMIB 1RHRB 1VRTA 2V2ZA 3PFOA 4FYYB 1D9FA 2BDPA 3BDPA 3TA0A 4UZCA 1IUJA 1HW9A 4ZLLA 7FDRA 4DSLA 4X64F 1NK4A 4RWWA 1RT3A 1EKRA 2X7IA 1YLXA 1C1BB 1J2VA 3GILA 1S9EA 2BACA 5FDLA 2BJDA 3IRXA 2V68A 3M8YA 5KFGA 1IBKF 2MZSA 3A8EA 4HH1A 2MZJA 3RUBL 2RJZA 3L7UA 4IR1A 4NLUA 2EWHA 4RW7B 1G1XA 2VA3A 1UPPA 4I7FA 2PI4A 1IKXA 1RWPB 1IKYA 5BYQA 2VHGA 2C28A 4LF8F 1KONA 3QWPA 1N33F 1Q8BA 3BH6B 1H73A 4DFPA 1F5AA 2DH7A 3MAAB 2YKAA 2NXCA 2HVHA 1S48A 2HQIA 3SV3A 3ITHB 1I1GA 4OYXA 2XNRA 2XI3A 3ZO7A 1JB0C 4AFFA 5HP1A 1YRUA 5GVQA 1NH8A 4EYIB 1RAOA 4FYDA 4ZP6A 2BVZA 2UVWA 4RW4B 4NLGA 4M95A 2V8PA 1SC1B 3RRGA 3KLHA 4PG4A 3BM7A 2NZCA 3FCHA 3EZUA 2RRAA 2ZOMA 3RU0A 3UQSA 3QGIA 2IMWP 1XQIA 2VPZB 2HQ3A 1NUEA 4LFAF 3CIZA 3GIRA 1BD6A 2QO3A 2KN4A 3O3LA 3NLCA 2HRUA 1SKUB 1RTJB 1VOMA 2GZOA 2EFOA 2GMLA 1R8AA 1F3VA 3CW2C 3FRYA 1U1RA 2C2OB 2SXLA 4M5GA 4F67A 3AT1B 3NG8A 2K8GA 3C66A 4YHHF 2KO1A 5CCLA 3JB9k 3NOCA 1CBKA 1Y00A 5J2MA 1UFKA 4C8NA 3QGHA 3H98A 4F4YA 2ZDPA 4OHWA 4IG0B 1O51A 3OJUA 2CQHA 2QGFB 1GMWA 3LP0A 2EC2A 1SUQB 2EFQA 3QT5A 3HHKA 2DEIA 5KT4A 3H5UA 3A12A 1XR5A 2Z2MA 3HSZA 2LQBA 1N5YA 2EVZA 3M30B 2XWXA 1WKKA 3D1OA 1ZA2B 4I2QA 4R0EA 3EGNA 1NHVA 4ETXA 1IBLF 2GVZA 1L3SA 3MUMP 2YQ0A 2J9DA 1S6PA 4ZJQA 4JI1F 1PIEA 2D3OR 2H48B 1VLOA 2HQDA 4IFYB 3OVAA 5D3GA 3ISND 1V5IB 1Q81T 5DRKA 1KD1T 3I82A 2K7JA 4CH7A 3UR0A 4ZHRA 4PQAA 1YJ9S 3CMQA 3UD4P 1VLYA 5EHHA 2FZGB 2WHOA 4CO1A 2B51A 4CP5A 2UXBJ 1IXKA 3D7SB 4IFVB 2R2RA 5J1EB 1HW8A 1RT5A 3EXYA 3V6DB 2MQMA 3PVXA 5T41A 2R7SA 4TYAA 5HBMA 4TLQA 1QJHA 4HHHA 2CQCA 3KUHA 3OXGA 2N4DA 1WG4A 3K5PA 4ZCMA 1CULB 2ZWOA 2V34A 4RWXA 2YKMB 1ULRA 1WORA 2FZCB 4NMXA 3G71S 4LQ9A 1YG0A 1BMQB 5B0FA 3D6FB 2DISA 3ULHA 4M5JA 3NGTA 1C0TA 3R3TA 4ECVA 3GJTB 3GFYA 3C46A 3CJRA 1XERA 4OI6A 2BANA 4DG1A 4RNHA 1KSPA 3LF0A 2IBKA 1AUSL 4OL8A 5LJ5Y 2ALZA 2ACMA 1S59A 2OSRA 2Y1JA 3VAMA 4ZLNA 3GJRB 3TR5A 4GKJF 3U27A 1Q8IA 1RT7B 1UWBA 3TWZA 4R8UB 2MGZA 4PWDA 1I94F 5E7OB 4P2XA 4OQJA 1RT2B 3H2UB 5E5NA 4M5KA 2PT0A 1FNOA 3CJ0A 4IG3B 1NK8A 3ZZZA 2E9ZA 2F5GA 1CJVA 1SC3B 4W4MA 2DT9A 2FGOA 5EX0A 4QR2A 2WVEA 5DDQC 1IM4A 3GE9A 2BJ1A 2YNHB 3NMAA 1FVSA 2HBYB 3RB0A 3SDEA 2XY6A 2HAIA 4USWA 1GXLA 1P6TA 1W2IA 5DM7Q 2KJWA 2H4WB 4ZVFA 4WPAA 3MTJA 4W92B 3BF4A 1X4CA 1HNVA 3QO9B 2H1YA 3HLUA 3WIVA 3DLGB 2E66A 4UOGA 3W61A 1TL3B 1QVFR 2IAJA 2ZM6J 2D1CA 4C3KA 3D4JA 1XC9A 2MEWA 4QIGA 2LP4A 2XMTA 4PUOB 2J7WA 1HWLA 5K8NA 2LCWA 2FDNA 4LRFA 3GG1A 1PG5B 3KUEA 3N4WA 3VQTA 4MT1A 2YVSA 4XIUA 2G4BA 4AL7A 1VQYA 1SKSA 3AB4B 3PJWA 5EWEA 2NREA 4JI4J 2ZEJA 2RVJA 5JJBA 4USTA 4AE5A 2HNZA 3WHIA 2DHAA 4O3OA 3ZZUA 1DARA 3V6HA 2JFDA 2A3JA 2IRUA 2POKA 3Q86A 3HX9A 1H72C 3G82B 3JTOA 4J9KA 3DOMB 2J7KA 3CT9A 1SH3A 1PJ6A 2W9BA 3NCPA 1VQ9S 1VK3A 1GMVA 5IQQA 4K7QA 1T11A 4Y0FA 1KVKA 2FHKA 4Y34A 2RQCA 3FKBA 1VQ6S 4JI3J 1K0VA 3EYZA 2WAQD 1HARA 4KHMA 2HBRB 4PAAA 3M4XA 2VG7A 5F8GA 1JNRB 2WW8A 2HK2A 3PV8A 3JSYA 2L9WA 1HBMA 3VQSA 3PR5B 3I31A 4ZP7A 1SIWB 2XHCA 3HVAA 4KHRA 4WTYA 4HACA 1S1WA 1SPBP 5D0GA 1S1XB 5AXKA 1A6LA 3T9ZA 4DLGA 1KQKA 1FKAF 4A47A 3CB4A 3MD3A 4F04B 5JUMA 1HHTP 5E2QA 1WC4A 3TO8A 4X62J 2VODA 2BOPA 2PE8A 4DPTA 4LSZB 3Q23A 3KJQB 5A8WA 3DRRA 5EX3A 2FJXA 2F8EX 2QG9B 2I5JA 1WHWA 3OD2A 1RJJA 1TL1B 2ZNYA 3DRPB 3I6PA 4DV1F 1NH7A 5RUBA 3MR6A 5K14A 1RAIB 2F8MA 1TV6A 5HMYA 3VALA 1Q0NA 3SMZA 1JQGA 4FF3A 4DQRA 2CQPA 4DPUA 3FMBA 2BJ7A 3GJQB 1VC5A 4O0NA 1KP6A 1L3UA 4PXBA 1MMDA 1SVDA 4B3OB 3BGLA 3LGMA 2C3OA 2XMUA 1NKCA 4NASA 1X5TA 3F73A 3KUGA 3G6XA 5IFMA 1JLFB 3R5CA 1GT8A 1JLCA 4AL6A 4KH1B 1R0AA 3CCTA 2ABYA 3UDVA 4K50A 3Q89A 2GCFA 1U26A 5L46A 4F0KA 2FB0A 1JIHA 2ACYA 1CS4B 3D6MB 2KT2A 4OYOA 4C8OA 2G2ZA 3CC4S 1QVGR 3Q8RB 5GMEA 3D1QA 4A8FA 1JXLA 4EO8A 2CDQA 3TQ1A 1P9YA 1RA7A 4GKKJ 1L3KA 4RBUA 5L1JA 2YBVA 3N5FA 3AD8C 4IDKA 3KLFA 1I6JA 1SL1A 1N0UA 2KHDA 2AGPA 2GA7A 2B5JB 4C6AA 2ZVSA 3J81j 5B0GA 2QT7A 1PGZA 3CO9A 2KXHA 5F8MA 1X4GA 2CJ9A 3G6YA 1M90T 1M1HA 3CPWR 5JVHQ 3K0JA 5J2NA 1CC8A 1RWMB 4L6V3 3DM2B 3W2WA 2G2OA 4CIOA 1OIAA 1DTQB 2Y9HA 2AYEA 1K8AT 2FJVA 2LEBA 2BMBA 4P73A 4NLSA 2GNKA 3V4IB 4B9UA 1DHMA 4KGKA 2YNFB 2I8EA 2OIHA 2C42A 1NBEB 5KFOA 4DS4A 1M5PC 2JC1A 3CJKB 3GONA 5KFCA 2E5LF 2ZE2A 3PW0A 3OLAA 2EEYA 5ETPA 1TKZA 4J9LA 4Y2CA 4DZDA 1X4HA 4LBIA 1KOHA 2WRMA 3IR5B 3KG1A 4LIWA 4GO5X 2RHSB 2M3DA 3G4SS 4RW6A 2KVIA 4P7TA 4KV8B 3EE3A 2ROGA 4WJBA 2KG1A 5KFDA 2EK6A 3GWCA 4DL0C 3UCUP 4B3SF 2V8DA 3HULA 2CQIA 4FNIA 5EUHA 2ASYA 3KK3A 1DZ5A 1XBWA 2VBYA 4DU7A 2EW9A 2J0QD 3L7OA 2FC8A 4DF8A 3TAMB 3ICLA 3T19A 4ECZA 2GHPA 1NM2A 3SQGA 1NB2A 5MAOA 5J2QA 3IO1A 5E33A 4ZP8A 1H7XA 1LWFA 2V94A 3TUPA 1JLQA 1C4CA 3PEHA 1M5VC 2NXEA
chains in the Genus database with same CATH topology
1HHSA 1D9DA 5F9LA 5A6WA 3KLGB 2B5JA 1Q53A 3EX7B 1KS2A 3IFEA 5KG4A 4KHPF 1U6BA 3M6UA 3UNGC 4NLWA 5A8KA 2KG0A 4F3QA 2VG6B 2AGOA 1YHQS 4EYHB 3OFFA 2RKIB 4OLOA 3RB6A 2MJUA 4H4OB 1XR7A 2P5VA 2HZCA 3NNCA 3MF5A 4A8WA 4FF2A 1TKXA 1RAJA 1MROB 4N8OA 2HFZA 3SCKE 2LXUA 3SYZA 2Z2LA 3I0SB 3PW7A 2MSSA 4MK7A 5F0UA 2XWYA 4D3HA 2V8GA 3DM2A 2E5GA 5IT9Y 1TVRB 4Q2LA 4NLTA 4U6PA 1UKUA 4M5DB 2XS2A 2Y0SD 4WIIA 4GC6A 4YB7A 3KKFA 1DTQA 1XWLA 3PFEA 4P7VA 4EZ6A 2E9RX 4QR0A 4LF9F 3DU5A 3T5LA 4JI4F 2W9AA 3LANA 4I64A 4I2PB 1SJFA 2KZZA 3C2PA 3I0RA 4YR3A 3VAIA 2AW0A 2DIUA 1TKTB 3MPYA 2DGUA 5HLFA 2YX7A 1R27B 3KLEB 3SCJE 1N88A 1XNRF 2HNDA 1NJWA 1CQNA 3CDEA 2ERRA 3G6VA 5J2PA 2LA4A 2JDJA 2XHWA 3F44A 1DAXA 1ZH5A 4YB5A 4DFJA 2YNFA 2DGXA 2QSWA 2P9CA 2GMHA 4PPDA 5D8HB 3PM9A 3V5RA 4DL4A 4HDGA 3I56S 2ZUGA 3JAMY 1EP4A 2XY5A 3H8YA 2YKPA 1NB7A 3D0IE 4C4WA 2IYIA 3J7YI 4EBCA 4FBTA 4R25A 5KFRA 4Q45A 3G9CA 2LU1A 3CJKA 2ZBCA 2UU9F 2CZVC 4C8YA 1QY7A 1JLBA 1JLGB 2E1AA 2MQNA 3DXSX 3QGGA 5G0RA 3RRKA 3MUTP 1JJ4A 2ZITA 3VTIA 1K73T 4B02A 1DURA 5F8NA 4ICLB 3IG1A 2IC3B 1IKVB 3K5OA 3NAHA 4MKYA 1A9NB 2LDIA 4Q8FA 3I32A 3DNCA 2MKCA 2J6TA 1VQNS 1RGVA 3FZBA 2NQPA 3KMSA 5L9XA 3DRSA 2VOPA 4DL3A 4DSIA 2V2KA 3DOLB 3M6VA 2RSQA 2VFTA 1YI2S 3LP2A 1UEVA 2RILA 1QM9A 4KR0B 4U9RA 4Y6IA 4ZVEA 2BUNA 2GJ2A 4PQUA 1FE0A 5C42B 2NLWA 2UV8G 1TQLA 4AQYF 1BQNB 1SIZA 4RNMA 4JI3F 5DO2A 1YJNS 1N32F 2VC1A 2XSJB 3THTA 4JI5F 3QGPA 1RT1A 4K59A 3M8RA 1X0FA 2V8HA 2FPHX 2BR0A 4FVCA 4M8LA 3CCRS 3RB3A 1HI8A 1ZAVA 4PG7A 4KFBA 2DHXA 4K5RA 4K4TA 2HPUA 1HNWF 2FVCA 4WK1A 5KFTA 3KK1A 3MMBB 3NKYA 4KV8A 1Y9OA 1DLOB 3IAM9 2ZKTA 4DN9A 3PACA 3PIPQ 2RUGA 1ZETA 3HXMA 4HI2A 5C25A 1S9GA 3LALA 2JRSA 3M05A 4DUYF 3JTNA 2VKZG 3OSNA 3M2VA 1HWJA 1WTBA 4UW2A 2LEPA 3G8TA 3T5HA 2YWHA 2KZMA 1F0XA 1U47A 1Y0HA 4DHVA 3PXGa 1NK7A 1TL5A 2EFPA 3CD5A