4P2MA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
169
Chain Sequence
RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Adenylate cyclase
publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 36
structure length 169
sequence length 187
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2mA00
4USTA 4WP9A 3C14A 4CLSA 1CJTB 4CM2A 3MR7A 4CLTA 2GVDA 1AZSA 4WPAA 1CULA 4CLPA 4OYXA 4P2XA 1WC6A 1CJKB 1Y11A 1YBTA 4P2MA 4CLZA 1YK9A 4OYMA 1CJTA 1U0HA 1TL7B 3UVJB 1CJUB 1AB8A 5D0RA 4CLFA 5D15A 1FX2A 1TL7A 1WC4A 3MAAB 4USWA 1YBUA 4OYIA 4NI2B 1FX4A 4NI2A 1WC0A 4OYOA 4CLYA 2BW7A 1CJVB 5IV3A 1CJVA 2GVZB 3ET6B 1CJKA 3G82B 3ET6A 4CLUA 4OYZA 3G82A 1Y10A 5D0GA 4WP8A 3UVJA 1CJUA 4USVA 3MAAA 4OZ2A 2WZ1A 4OZ3A 1WC3A 4P2FA 3C16B 4CLWA 4CLLA 4OYBA 3C16A 4CM0A 1WC5A 3C14B 4CLKA 1CS4B 4WP3A 1CS4A 2GVZA 2QV6A 2GVDB 4OYWA 1AZSB 5IV4A 4OYAA 4USUA 4OYPA 3C15B 1CULB 3C15A 5D0HA 2W01A 5D0EA 3R5GA 1WC1A 1U0HB
chains in the Genus database with same CATH superfamily
4FS2A 2M52A 3BN7A 2UUCF 1FRKA 4JYAF 1SJRA 2CNLB 4B9TA 2KZZA 2CJBA 2WB1D 2FHOB 4DF8A 4WU2A 2IDEA 2E7XA 3UR3C 4LF5J 2G1HA 4B17A 2AQ4A 5B0AA 3TANA 3OTOJ 1S6PA 6AT1B 4WFNQ 3KLHB 1K1QA 1W2BR 1NNDA 4LF9F 1IKWB 2WBMA 1VRTB 1I51B 3Q8QB 2V2VA 2AW0A 3TJ9A 1WF2A 2B5JA 4CQ1A 4G1PA 5D6GA 4OFZA 2QE5A 1GXTA 4DG1A 1TL1A 4F4ZA 1ZZNA 5SUHA 4ED1A 4A8SA 2N3LA 2AYEA 2FDNA 2P2CB 1X4FA 3TVZA 2RS2A 1NHUA 1WKLA 1TKTA 2EK6A 3QRQA 2FLOA 4CH7A 3TEHB 1J27A 5BR8J 1L3UA 1Q53A 2ZJPQ 1S12A 3HXMA 4ED5A 3EJMA 1UWAA 2MJNA 2G0IA 1LKZA 4U96A 1IKYB 3U1MA 1Q8IA 4RUHA 3H2LA 1RTDB 3CCTA 4ILRA 1CJTA 3KHGA 2FY1A 5KFTA 3D6MB 3NCQA 1RP5A 1MMDA 4ZA1A 1X4AA 4HACA 1JLEA 2JDJA 4LRBA 1T3NA 1F60B 4M95A 1U45A 2VG5B 2LECA 3BO4A 3GV5B 3SCJE 1FVSA 1A9NB 2ZKTA 2C2ZB 2O3DA 4JP8A 1S1VA 2ZH8A 4HKQA 2HHHF 2E66A 1QDUB 1PYOB 2RRNA 2DNZA 2OFHX 3I32A 5L1LA 2IC3A 4JI3F 4NLQA 4KY3A 3ENAA 1TKXB 5G4DA 2NPIA 2XSJA 3KMQA 2J7WA 4ZK7M 2BW2A 3BSNA 4TY8B 4G1QB 5DZ7A 5F8MA 4M5DA 1WHWA 1V5IB 3CO9A 1JLAB 3MEKA 3T5HA 1YQHA 4E2FB 1EETB 5IS2A 3KUHA 4NYOA 4J7CA 1ZAXA 1UFLA 1KBRA 1MG7A 4P52A 3HHDA 3CJRA 2Q1LA 4NYZA 3S01A 4LVOP 3J81j 3UQSA 4DUZJ 2VC1A 3P45B 2DR5A 1MWQA 2A10A 3GU0A 3B4DA 2ASDA 4U7UD 3PNIA 5DDPC 5HLFA 5I4MA 2CQPA 4N8NA 1WTBA 3R5DA 2RT3A 1WACA 2CQ3A 5C42A 1IJEB 3M30A 1U24A 4OI3A 1GMWD 1JX4A 4NLVA 1ZM9A 4HI2A 2U2FA 2R8IA 2Z0GA 3TQEA 1IBMJ 2VG6B 3C14A 1NAQA 5DQGA 1S6PB 2B0GA 4RNFA 2H9ZA 2OPPB 2HVDA 1XN9A 2C2KB 2P6TA 2VJVA 2IFXA 3KG0A 4P72A 2CPXA 3BSCA 1WSRA 2XHWA 1JNRB 4X84A 4N47A 2Z8QA 2VDIA 3HHLD 3BN4A 4ZS6A 3A3NB 2ALZA 2PSZA 3KYLA 4DSKA 2HHUA 4F02A 4DFKA 4DV2F 2XM3A 1HWUA 4NXNJ 3BZQA 4PWWA 2DKOB 4DG1B 4YR3A 3ELHA 4KB7A 3K5MA 2FVPA 2JEFA 3EICA 3FFIA 1UA0A 4Q0BB 4KJIA 4FKXA 1EP4A 2I8EA 5F8NA 1TKTB 4MT1A 3L7UA 1SUQB 2HAIA 2BR0A 1VHIA 1N34J 4ID5A 4OI4A 4NE9C 3H90A 4WE1A 4YUDA 2FQQB 2YNGA 3H4BA 5T7LB 1HHQA 5DQHA 1M5HA 4ZPWR 2FGCA 3NMAA 3UDCA 3M8PA 2MKJA 1CJTB 3G86A 4KTQA 5ETVA 4YY3J 4HACB 4MFBA 4JBCA 1PC4A 4QWBA 2M5YA 4K4UA 4YB5A 1J5EJ 3G96A 1YJWS 3C6UB 3T6BA 3IXQA 1U0HA 2ZH4A 2G2ZA 4MK9A 4CT8A 9ATCB 3MI7X 4DR5J 2GJ2A 1QM9A 2Z58B 3IBCB 2ASYA 1NH8A 2J76E 2DNRA 1VQLS 1N32F 3DNCA 1FXDA 3ISND 3LP0A 4ED8A 2O66A 4UOFA 2XSJB 3GPAA 4MK7A 1N6QB 1S6UA 1BQNB 5JVHQ 3P5TL 4WP3A 4KFBA 2QV6A 1U1LA 2CQ4A 1BHNA 4M5DB 1R8HA 1HNXJ 3C15A 3RU0A 2CNNB 2CQDA 4LVNP 3I9V9 4DPTA 5I3QA 1RT2A 1KFSA 3L7OA 3JSRA 2FJVA 3C8YA 3HHNB 3GIIA 4KO0A 3B8HA 1AROP 2IM3A 3N28A 5F8IA 4ED2A 3C19A 4TU8A 2XG8A 8AT1B 3CVKA 4UY85 1CQMA 3PKYA 3BGLA 5D4NA 1HNWJ 3DOMA 2HFUA 4BS2A 4F04B 1MMLA 1FKAF 1RACB 5C42B 2GIFA 4R8UA 2HGLA 1NPRA 1X8DA 2H3EB 3EGZA 1C0TA 1VQ6S 2YKMB 3C14B 4DPOA 1AW0A 4RW7B 1NXIA 2C2NA 3R8YA 3GJQB 2EWHA 2BKPA 3FEXB 3A1YG 4JI1J 4Q7AA 2E44A 4CO3A 3I6PA 3W63A 2FZGB 4PWUA 1VC5A 4WP9A 2OPSB 4ZCIA 1OQ3A 1JLCA 1JJHA 3BM7A 3BV8A 2W2NP 1R31A 2E1PA 2EC2A 3D4JA 4NASA 4LSZB 2W1BA 1H3DA 1KRPA 5D15A 4LF6F 4IFVB 5JVGQ 4DV4F 4K4YA 2NXCA 1E6YA 1RQ0A 2JLFA 3VGSA 2QYCA 2IM0A 3HF5A 4PG4A 4C3MA 1N36J 3SQGA 5EWGA 2YNGB 5A2QU 3K57A 4K7QA 3DLHA 1CJUA 1UEKA 3BKUA 1S72S 3OPKA 4DR3F 4RBTA 4IFYA 2LFVA 3PYFA 3M8PB 1IKXA 1RCOB 1HNIA 2EFNA 3QGGA 2EBEA 4KAIA 4OX6A 2VU5A 3PIPQ 4MFBB 3I4HX 1LOUA 1FEEA 3DFEA 1SC1B 4LRFA 1DQAA 2H48B 1ZM4A 3ENWA 4BBYA 4IOCQ 1U1RA 1NK4A 2CQHA 3RB6A 2Q79A 4F36A 3BDEA 2CQIA 1U0HB 2NSCA 4UTGA 1BWVA 2AYBA 5ETOA 4CM2A 1QAJA 1NK6A 3DGVA 1CPZA 4LRDA 2RAQA 2OEMA 3QZ8A 1UCNA 3DLLQ 4DV1F 1Y3KA 2VA2A 3PZPA 3JAMY 2BQUA 2IVFB 3K8WA 4DSEA 3CMES 3PX0A 2X1AA 4PR6A 1M5OC 4O44A 1Q78A 1SV5B 2K1RA 5HBMA 2W7OA 2ILZA 4KFBB 1LWXA 1X60A 3ET6A 3BJYA 3RB3A 2V50A 2QJ3A 3A3OB 4DPUA 1NDPA 3QGPA 1Y4ZB 2MZRA 1T03B 2YNHA 2QMWA 3R6GB 3DU5A 3I5BA 2MQLA 5LT5A 4CLKA 4OMFG 4QCLA 4L3NA 2ZM6J 2HHVA 3DLKA 2A6OA 4A8FA 2L41A 3PY8A 3HPOA 1NDKA 1FRXA 5LMNJ 2R8HA 1L3TA 2CJ9A 3DRSB 5DDOC 4OI1A 2GHVC 3I82A 2MHEA 1SPBP 1SJ1A 3AOAA 3GFHA 3GILA 1XNQJ 2W9BA 2P5VA 3MM9A 2JFKA 1JQGA 2XTJP 3TQ1A 3WQPA 3LO3A 2QL9B 2IDLA 4PG8A 3C46A 2M4MA 3CC7S 1KLMA 3DOMB 1X9MA 2R7RA 1ROFA 1RHMB 1JJ4A 4R8UB 2RF2A 1WG1A 3RTVA 1XR5A 4KKOA 1HNZJ 2V67A 4C9DA 4C0OC 5HQ8A 1VQYA 3MFIA 3R7NB 1L3VA 3KG1A 3P3DA 1RHKB 3M8ZA 1FD8A 4NLUA 3M8WA 2WCXA 3PEHA 2Y1RI 3QIPA 5F3TA 2GHPA 3QT5A 4DR1J 1SXLA 1RAFB 2CPDA 3LH2S 4U6PA 5ETTA 1T11A 1VBZA 1UJ5A 5IT9Y 2RJZA 1YKWA 2BACA 1IKVB 3KUEA 1RLCL 2YPYA 2XS7A 1HD0A 1NK5A 2VASA 5HROB 2DO4A 3IRWP 2SXLA 4HLBA 5C25A 2XO6A 2AEMA 1FE4A 4DX6A 1NH7A 2UVVA 2KTQA 1CJUB 3KWMA 1Q8KA 1FI4A 3K5LA 4IFYB 3NWRA 1IKXB 3DLBA 4ECTA 1KLNA 1HWJA 4UQTA 5KG4A 3MCMA 1U26A 4LBIA 1PC5A 5KFOA 3CCMS 2GJFA 2CQBA 2GA7A 2MKHA 3FNNA 5F0WA 4X4PA 1NZAA 2VQEJ 1QSLA 1C4AA 4U8YA 4QPTA 4DV6J 1RBLA 3C16B 4XPCA 1RTHB 3CCWA 3HHLC 3LALA 3BPDA 4DJBA 4USUA 2V4JB 1NJXA 2WVDA 3AXKA 1QAYA 1NSAA 3T3FA 2XLJA 1KTVA 1XBWA 4Y2IA 1VC0A 4DWIA 1AUSL 4O44B 4RW4A 3MR7A 4MKVA 2UUAJ 5JMNA 4ED6A 2K1RB 3F41A 3V4MA 3IRXB 1WEZA 3GJSB 3GSDA 3NP5A 1FX2A 2MHNA 4P74A 3J7AN 5LXYA 2V4QA 1KQKA 3NEKA 2HQIA 3PM9A 2M9KA 4LFCJ 2MY8A 1BGXT 2YXLA 4B08A 3U7JA 2EBGA 1UJ4A 1S9GA 1S59A 3JQKA 4J9VA 2JC1A 1GT8A 1WC3A 2VOOA 3RJMB 5KT2A 3EPGA 1UJ6A 5DG7A 5KFCA 3MM9B 1YTYA 2R8GA 5BXIA 3T1AA 4DV0J 2QA4S 1VJQA 4KGXB 2W01A 4QPXA 1KLMB 3A8KA 2PGCA 4K8RA 4OQJA 2VKRA 1ACMB 4IRDA 2VPZB 2OGUA 2RF2B 2B4OA 4I69A 4WZMA 4YQWA 3ISNC 3OHBA 4KKOB 3G8SA 1MN9A 3HZGA 4DPYA 5HI7A 3GIKA 4OLPA 4RPFA 3AB4B 1Y11A 4YOEA 3W65A 4DQRA 4FP9A 3HHLB 1BQMA 1IBKF 5G0RB 3TZYA 5A6PA 2E1MC 2C2RA 2H4YB 1CJVB 4W4MA 4A46A 3CCSS 2O1PA 3TOQA 3PCOB 3TYTA 1TK5A 4ICLB 3CT9A 3SDEA 2V8VA 4FF4A 4OIXA 4DU8A 3H5YA 1X5TA 5J1PA 2GV1A 5M2PA 3KMSA 4AQYF 1VISA 3LGNA 2NCKL 4BHQA 3H5XA 4FVCA 5C25B 1KP6A 4DV7J 2DISA 4AL6A 1MSWD 8RUCA 1O6XA 5HAOA 2PFFB 4KGZB 3CJ5A 5HVGA 3H5SA 1XJWB 2WW8A 3DOLB 1OMSA 3M6UA 2VF3A 3BGRA 1LXNA 3V6JA 2J6SA 4ETZA 2M0GB 1FESA 2AU0A 3FRZA 1RT4A 3GR0A 2FYXA 4F7VA 2E29A 2LEPA 2W4CA 3LAMA 2G2YA 4NOHA 2VICA 3WDOA 1BWEA 5ETPA 3N9UC 4M5HA 3KHHA 4DL6A 3VGVA 4OX7A 3LWMA 4LF5F 2EK1A 4UZCA 2UVUA 3GG1A 4H4OA 3E2EA 3OTOF 1RGVA 2DY9A 4V1Ak 5EX0A 2EG1A 2M2BA 1NKEA 3O44A 4J9NA 4RW4B 3Q8SB 3FEZA 3RW6A 3GFZA 1S1TA 3TA2A 5D0HA 3IC1A 1WOPA 3K0JA 2Y0SD 3P5BP 4KGMA 4QWAA 1RT3A 3U02A 5B0DA 2EFGA 3LA0A 3QNWB 1UMJA 4ZVPB 3T6JA 2LA4A 4CLZA 1S9GB 2XZDB 1TL7B 4IR9A 2WVEA 2EXUA 1T3OA 1QD1A 1I1GA 5BR8F 4FBTA 3NWGA 2BQRA 4ED7A 3R9LA 2UU9J 4C8NA 2HHPA 1NPKA 2ZDOA 3TJ8A 2MZSA 4A48A 3D68A 2Z2ZA 3GFXA 2KG0A 2CPJA 1QJHA 3NRBA 2ROPA 4TQRA 2OTLS 3OBIA 4KYZA 1H7WA 3QSIA 5GMDA 2HNYA 4IO1A 1EKRA 3RRHA 2I2YA 1WEXA 1S1UA 1WOSA 1IVZA 3UCZP 4YEAA 5KG0A 1F3FA 2CZVC 5B0BA 3U1NA 2RS8A 1NJYA 5F8LA 1M5KC 4EK2A 4UUXA 5K8PA 1N33J 5D0EA 2GO9A 2F9JA 4E0DA 1F1BB 4IG3A 4F8RA 3AQOA 1RT1B 4ZCLA 3IWLA 1VQ7S 1JLFB 3J7Z5 2EKYA 1BQMB 3DMJA 4ZKAA 4WZQA 1EKSA 4IQXA 1XK8A 4C8OA 1FERA 3WIUA 5I42A 1T95A 2FGOA 3AD8C 3PRBA 1JMTA 1P27B 5A8KA 5K14A 3CCQS 1YK9A 1R0AA 2AV5A 5DRKA 1RHUB 4B9LA 2XMKA 3SDEB 4K0KJ 3IR6B 4QIEA 2J7UA 1RT5A 5KOXA 1I94J 4F2SA 4KHMA 5HN0A 1AYEA 2NREA 2XMUA 2H51B 5C24A 1P8GA 2BE7D 4OI0A 1X9WA 1XNRJ 2OJ3A 3CDEA 3V6KA 3MAAA 4C8KA 2YH1A 1ZTTA 3RBZA 5EX3A 3BGRB 4OV6A 3QGIA 3KHRA 3KLVA 2D41A 1QVFR 2HGNA 1RWNB 1RE1B 3UE2A 4DUZF 4ZMMA 5LSLA 3CULA 4USTA 2HHSA 4QJVA 1WDTA 2OTJS 2MKIA 3PG9A 2QFIA 3OXLA 4KRWA 3MMBB 4FBUA 4I2QA 5IC4B 1Q8BA 4OJGA 2WVCA 4K5RA 4A4JA 2QYGA 2HZAA 1PBUA 3KK3A 1ZTWA 1FKPB 3KJFB 4H4OB 1IBMF 2A2DA 2HPUA 3FJ2A 4OL8A 2QLXA 3RAMA 1TAUA 2BW7A 2MZTA 5M2RA 4DX8H 3CD6S 4DFMA 2A1BA 3POTA 4R25A 5D4PA 3OUYA 5GVQA 1S1TB 3UVJA 5IM0A 3SFGA 4PYAA 2D69A 3H40A 2J5AA 3OVAA 1K0TA 1HBMA 1WHVA 4ED3A 4DZDA 2W2OP 1FTRA 4DN9A 3MMCA 1DRZA 2DR9A 4NXNF 3DHWC 4J9PA 4X65F 1P1LA 4UOHA 3MURP 2OLWA 4LF1A 1FVQA 1C1BA 2IM2A 4AL7A 2CPFA 5HVFA 2BABA 1SC6A 3KLFB 3SIPB 2D3UA 3NGUA 3K8VA 2M8DB 3TVYA 3DM2B 5HANA 4GC6A 1REVB 2A6MA 1TTHB 3AA9A 3BR8A 5KG1A 1N34F 5AJ3J 1UW4A 2CZ9A 5KFBA 3JTPA 4W92B 2PC6A 1J5OA 1KTQA 3KNGA 1RTJA 1OYDA 2MPUA 2ZHOA 2J0WA 5GAEI 2VB6A 2HNYB 2HBRB 1TP7A 4YY3F 3PW4A 1JLGA 4HHJA 4P71A 3GYGA 1S1UB 2E5GA 5CD4A 1WUUA 1J5EF 1FRHA 3BREA 3VZHA 5AXMA 1GNKA 4IG3B 5EWFA 2W2MP 2ADBA 4K5SA 3T1HJ 2ZJRQ 2W8LA 3IA0A 1N88A 3DMJB 4JI2J 4MTPA 3MR3A 2HNZB 4XIUA 3EWGA 3CD5A 3UD3P 2MLXA 3MM8A 4HVZA 3GJTB 5A8KB 3A4TA 4JI0J 4WF9Q 3LGMA 1UWBA 2C3UA 4FYYB 3VAIA 5ITHA 5KFYA 4O3QA 3D0IE 3Q24A 4JI7J 4X4VA 4O0IA 4O0NA 4QWEA 2QGFB 2HVIA 2KFNA 2O67A 1U6FA 4ZIWA 1HNXF 1RABB 4NLDA 2C3OA 3MAAB 4M5GA 4N8OA 2ZZTA 5EHHA 1M90T 1HPZA 1WDDA 1ZH5A 3DRPB 3VAKA 4BLGA 2R7SA 5HVHA 2XWYA 2HAFA 4UOCA 2XGQA 3M7VA 2V2ZA 5KFEA 4Y34A 1SKSA 1HBOA 2E9RX 3ZNUA 3BQ0A 5C2GA 3HD2A 2N3OA 1WNEA 1M1KT 5I3UB 4FYDA 3NNHA 2WSFC 3L3CA 1PJ7A 2VFSA 2XMTA 3CCLS 2I5JB 2HLUA 5E3AA 1FFGB 1HNWF 1K0VA 1LWFA 5FDLB 4RU2A 1N54B 3KK3B 1G4CA 3IG1B 5HQLA 3J7YI 1URNA 1X7VA 4IH7A 4ZVOB 4ZPAA 4JI1F 3POTB 2B4UA 3OUYB 5I3PA 3UVJB 1AB8A 3OTEA 4DV3J 5IM0B 2M70A 1U0SA 1HBMB 2X3DA 3AJ2A 2HNDB 3T5JA 2MQMA 2QT7A 4USHA 1YJVA 1Q7YT 4EO8A 4AXIA 1CLFA 5D0GA 1YJ9S 2LCWA 3MEEB 3Q8YA 1S77D 3VCDA 4HEA9 4ZJLA 5D4OA 3R5JB 2ZOFA 2AWZA 4B02A 4Q44A 1H2TZ 1NO8A 1T02A 4OHVA 1WD6A 2VPXB 1F5CA 1HBUB 1N36F 2DPJA 4C11A 1U48A 2MYFA 1IBLF 4PXDA 3FC9A 3NAHA 3RBXA 2LQ5A 2K2PA 4ZVRB 5DGAA 2LLZA 3FVYA 2DD8S 4F67A 5C7PA 3CNQP 4A8OA 2VZ9A 1JLGB 3FBEA 1UP1A 4CLPA 2ZH7A 1OPIA 5LSOA 1B4SA 3FBBA 3PYEA 1LW2A 1MLAA 2C2MB 4G65A 1QAIA 4PUOA 3SZ2A 2OEKA 2L9DA 4X4SA 3VALA 2BKNA 1W26A 2CDRB 3NNAA 1V9OA 1DTTA 2DNYA 2XZWA 3M1VB 3Q89A 1M1GA 2BA9A 4J9SA 3MM8B 3KK1A 2AGOA 1YGYA 2AF6A 3M8YA 1TU0B 1VDHA 1TZ0A 4WKYA 2BE9B 1DTQB 3W8GA 4L74A 3FCWA 2RILA 2QG9B 1KDNA 3QT8A 4XDCA 3ZZOA 1UWBB 1B64A 1FTCA 2DHGA 2J9EA 4B3TJ 4FYXB 4WKRA 4LR8A 1XWLA 2CWXA 5KFMA 2GMJA 4QZVB 4LQ3A 2C3YA 5E41A 3V6DB 2VG7A 1YLXA 3R1LA 4GVBA 2VQFJ 1Q8LA 1VC6A 4DX7A 2HFVA 1DQ9A 2B9EA 2ZM6F 4FF3A 4USIA 3BEGB 5DS7A 3MUVP 3CCZA 1FCAA 1M1HA 3HVTA 4Q43A 5LOQA 1FJGF 5FD1A 5LMNF 1BMQB 4NWBA 5KFHA 3NNCA 3QQCD 4OHXA 3DDNA 1NBEB 5E2QA 2F4FA 3HJFA 2YKNA 3K7RA 3CMQA 3MDFA 1XNQF 1HBOB 2AEJA 2OPQA 2VFUA 4Y28C 1ITPA 1GXLA 3EE3A 4WP8A 4JI5J 1KVKA 3CD7A 3ZZTA 1HNZF 2G1DA 4AT1B 3QT6A 4USMA 5CHCB 4B3OA 2YNFA 3P96A 2VODA 2V2QA 1VQ4S 2HS4A 1VRUA 2OSQA 5F3ZA 2ERRA 4OI6A 1BUXA 2B51A 4ZJQA 2XSFA 4ZVGA 4A47A 3R3TA 4YB6A 4DR1F 1N5YB 1HMVA 1N8RT 1CSJA 4FZVA 5C2CA 1D8YA 3H0PA 1IWAA 3UR0A 3MTJA 4NI2B 2HQDA 3NOGA 1LW0A 2V8HA 3KLGB 2ZC4A 1G6BA 1OS5A 2ZD1A 3M6VA 4QR1A 4MK8A 4C11B 1DARA 4ZITA 4H4MA 4ZHRA 1XIQA 1TMJA 3MEGA 3TJAA 2YH0A 4IH6A 3DRXA 2AZ1A 2ZUAA 2BBEA 4ES1A 2MY7A 1CS4B 4XTTA 3OVBA 3CMAS 2OO4A 3OTCA 2NR0A 1B0PA 5LL6d 3CIZA 4IKAA 3CJKA 2VQEF 3J7A1 3ILJA 1UPPA 3LTOA 2BOPA 4DV6F 1GX5A 4WCEQ 2E1CA 4KBIA 1V6HA 3VVUA 4J37A 4WTOB 5IQ6A 4A8XA 3TA0A 4EU0A 2DR7A 4I2PA 4XDDA 3KK1B 4KHPJ 3SYZA 3AH6A 2KH9A 3M9OB 4FXDA 5DLGA 4V19J 1HHSA 5ETNA 1SL0A 3CO0P 2R9LA 3MM7A 4D3HA 2YBVA 5F8HA 5HO4A 3MFHA 4KR0B 4F4AA 2UUAF 1Z2ZA 4NLRA 4OYZA 2VPWB 1KD1T 4RW8A 1RAAB 3TX0A 3MOZA 1AXQA 2VG7B 2HVHA 1RAJA 5AT1B 4QBUA 1T9UA 1HLWA 1YJUA 2ZE2A 3QBCA 1DHMA 4RZRA 4LFCF 3MR5A 5IQQA 3H8YA 4K4ZA 3MM6A 1X4BA 3I0RA 3D2WA 4DR7J 2Y9HA 2WONB 2CPIA 3W5YA 2O5DA 3HVTB 3Q8PB 1SH2A 2DH7A 1U1KA 1IR1A 4PG5A 3M9MB 2ZNYA 1ULRA 2YKNB 4YDDB 2BJDA 4E8UA 1U02A 2JNJA 4ZPCA 1TK8A 1AFJA 3VTIA 2OPQB 1LWCA 1QLNA 4O3OA 4DV0F 4IQMA 4ZVQB 2WAQD 5B7WA 1VOMA 1D8ZA 5HSPA 2OUGA 3A13A 3TEGA 3DLGB 2MKYA 4NLXA 3D5MA 2X3GA 3T9ZA 1LNQA 3DRRA 3MR2A 2V2KA 5A0YB 3MPWA 1H73A 3BR9A 2LVWA 2I0XA 1PKUA 1PYTA 3M8SA 1VRUB 3N6LA 5ETQA 1UVNA 1TKDA 3OL7A 2ZKUA 4RW9A 2JSXA 2QLJB 3L95X 3OTBA 5LMUJ 3NS7B 2HYIB 5DO2A 3DCAA 3R7SB 2B9YA 2G13A 3GYNA 4C48A 3H2VE 5L1KA 2MKCA 3QO9A 3L09A 3ZTRA 1NZ8A 1S4EA 2HFZA 4Y2CA 3U27A 1HMVB 1KHWA 5A8WA 1HYSA 1LWEA 3S6EA 4OJHA 2XMJA 1YZ7A 1L3KA 3M2VA 2IA0A 4ANEA 3FZBA 2PIIA 1WF0A 3P49B 3OTDA 4DPXA 2I38A 3KJVA 4TLRA 2L9NA 4FNIA 3GE9A 4B3MJ 4F4WA 2XI3A 2FC9A 3R2DJ 2QFJA 2DHHA 2ZD1B 4DV7F 1DAXA 2VL1A 3CJQA 2W4DA 1NKBA 1WKJA 4E98A 4ZHRB 3RAQA 3DOKB 1OY8A 3UDEA 1PYSB 2ZVIA 2FPHX 2CPYA 4F4XA 3W2WB 2BJ7A 2FJBB 1VRTA 2QEXS 4M8LA 3ISZA 4N5SA 1N52B 3FK4A 3PJXA 2XLIA 2XY5A 2V9KA 1F0XA 4EZ9A 1KC8T 5C5JA 4QW9A 2APOA 3ITHA 2C3PA 2GIRA 1JKHA 4ITSA 3CJ4A 3M2UB 4PRFA 1OSDA 1U1NA 4MJKA 3ENVA 3TAMA 4N41A 3P4UB 1KN6A 3W66A 1VBKA 5MLCV 5GAEU 4PG7A 4TXSA 4JB8B 4K4TA 1BQXA 2ZOMA 3MM7B 4YR2A 1QAXA 5BYQA 2NXEA 1JK9B 4CI0B 3M8RA 3CCVS 3PO5A 4Y2MA 3CXCR 4KT0C 3V5RA 4U9RA 1FNXH 1Y7PA 4ALZA 3CDAA 2HHXA 1KHVA 5KT4A 2VG5A 3I0RB 4GKJJ 3GCXP 2DNQA 2AGQA 3B78A 3ILOA 2DGSA 5HK4A 2F9DA 4OZ2A 4FDFA 1WJ9A 1EZZB 1H72C 4ZOSA 1NKCA 1VQPS 2PO4A 2CPEA 3C3LA 1Y5LB 2BJ1A 2UU9F 3OR2B 2VBWA 3Q8UA 1JJ2R 2YWKA 3IFEA 2MQNA 3R27A 2EG2A 2LDYA 1RA6A 2N4CA 4TYAA 3VAFA 2B6AA 2N4DA 2CRLA 1P6TA 4Y6IA 3T1YJ 3DI6B 4TLQA 1JIHA 2ZDPA 3NCPA 4TY8A 4G1QA 2N82B 3VF0B 3PYDA 3IM8A 4ZPDA 3RR8A 1N33F 2B7BB 1VQOS 1JLAA 3MMAA 4CLFA 1KSPA 1WC4A 1O51A 3C66A 1EETA 2XYPB 4ECQA 2NQPA 2UUWA 1L5UA 1EJ7L 1S7IA 3NOCA 5KFSA 2BANA 3D6FB 4ECSA 3QO9B 2GZOA 1HBNB 3SV4A 1ZA1B 4IDKB 3G82B 1A6LA 5L9NA 3DLEA 1X0PA 3UD5A 1RKJA 4ZLJA 2CWKA 3OW2R 1YJRA 5CYMB 4DSJA 3G6YA 4K0KF 2R7QA 1OSCA 2YTCA 3J7YU 4W98A 3KJVB 1TVRA 4TKTA 2ZH9A 2V8PA 4DV5J 3AODA 2KB2A 5BYRA 1EAYC 3M2RB 1SH3A 5T41A 3HO1A 1U6ZA 3MCOA 3QGHA 1SC4B 3TUZC 4C2MA 1XNRF 5CZXA 1VLYA 4RNNA 2ZBRA 4ANDA 2F63A 1P9YA 3BGUA 2BEFA 5KAKA 2HGMA 2VG6A 5L1JA 2ZWOA 1ZM2A 4LMZA 2YNIA 3WX4A 3W9JA 3PX6A 2OPPA 4CTAA 1YIJS 1YBTA 3EYZA 1QY7A 2IVYA 2X1BA 2GQQA 4DCOB 4LRCA 5IOLA 5DJBA 3BBFA 2DRAA 1MNEA 3ITHB 1JKHB 1U2FA 4USKA 5KFVA 2VONA 2HKEA 4LR9A 2ZHBA 1FDDA 2QIFA 4USVA 3TAMB 4Q0BA 3TNVA 2QA1A 4CZCA 2QN6B 2EW9A 2WTFA 2F3JA 4WTYA 4O3PA 1SUQA 3TAPA 1YRXA 1UZDA 4P7VA 3SSQA 2KM8C 2UVRA 4FPRA 4NMXA 2HSEB 4PABA 3HDSA 3CCUS 5T7LA 1JWWA 3EGNA 3BO3A 2LKZA 2IJRA 3I5CA 2ZZNA 3A8EA 4URGA 1D3WA 2AZ3A 2JVOA 1TL4A 5B0GA 9RUBA 2J0SD 1NK7A 4HT5A 1MROB 2RHQB 2CVEA 3W5XA 4QR2A 2V63A 1EHWA 3C6UA 4A8WA 3HFZB 3US5A 2Z2YB 4JUZA 4CO2A 2VFTA 3IGVA 1NK0A 2ASLA 1G1XA 1TKZB 5AJ3F 1YJ7A 2K7JA 4M94A 2PT0A 4KPYA 3KUGA 1CVJA 1Q7LB 3N6MA 2DTJA 3CDWA 4C8LA 2B6AB 3THPA 4ETXA 4A8YA 1DY3A 4CM0A 4HHHA 2JJ4D 1N6QA 1BQNA 2R7VA 1NB2A 4O23A 4NLWA 4DXLA 1JLBB 1S57A 3GONA 3IBWA 1IM6A 1NUEA 2FVQA 2PFDA 2JLGA 3MMAB 1S79A 3A12A 3HX9A 3GZ7A 3T1HF 2RRAA 4GO5X 4UF4A 2HBYB 4Y00A 2PI5A 2BANB 2BOAA 4M5KA 1AZSA 2JX2A 4JI2F 2VOPA 1CC7A 2GW8A 1NK9A 3QWPA 3T19A 2WSEC 1HQEA 5F8GA 3DLEB 2CJAA 2ALYB 4JI0F 4F3OA 3AD9C 3IR5B 2KN4A 4WWSA 4CO0A 7FD1A 2EC0A 2KM8B 1RAEB 4JI7F 3RB4A 3MF5A 4P2SA 4ELVA 1TVRB 2MEWA 4ED4A 2QA4G 4MIBA 2Y0BB 2FHJA 3RYLA 4RU9A 3R2CJ 3HVRA 1LV5A 1ZAWA 5CA5A 2YKMA 4WIIA 2EFPA 2LYVA 4DL0C 4IUFA 2YNIB 4C0HA 1N56A 4RW7A 4N76A 4CTAB 1YZ6A 2RRBA 2H65B 1UVKA 3BH6B 4MKYA 4CNYA 5K5MA 2MQQA 3VZIA 1SKUB 3NG8A 4OJ3A 2ZUGA 1RBAA 1DLOB 4IOAQ 2OPSA 4PEOA 3IP0A 1LK5A 2YX1A 3GB0A 3C2PA 2P9CA 2ZNZA 2HHWA 4DU7A 3HCXA 4ZVEA 5KG7A 4X65J 2PI4A 3ZZUA 4MMOA 4I6AA 1N4LA 1I3OB 4P73A 3UO0A 3LWLA 4IFVA 4QR0A 2LXIA 3BPSP 2J9CA 1TFYA 3FQKA 3HSDA 1RAGB 2KT5A 3OL9A 3DDIA 4X4NA 3MZIA 4DV3F 3G8QA 4OX9J 1FRJA 2LEBA 5F9LA 1QE1B 1RWWB 3OT9A 3M8QA 1IXKA 4IYQA 5JJBA 1OJ4A 4QQBA 3X1LB 4D3GA 2KHCA 1TV6B 4ZP8A 4RR5A 1NDCA 3WIVA 5A6WA 4B9VA 3MHYA 4YR0A 1N48A 2KJVA 2HQGA 3EGWB 3J81U 1SJQA 4QYZK 1RYRA 1O5JA 5E33A 4CT9A 2MXYA 2KYZA 1RISA 2N7CA 2D3ZA 4A8QA 3GG0A 5HMXA 4OI2A 5ETSA 2RSQA 4ZCMA 1N0UA 2F65A 1SV5A 5JUMA 3UN2A 1KEKA 3K58A 4I1TA 2CA9A 1BLUA 3OJUA 4P75A 5L39A 3THVA 4HDGA 1T03A 2V4RA 3JB9k 2N7YA 1HI0P 1KWMA 2UVWA 3B6BA 2HFOA 2OPRB 5HQMA 1AZSB 3QWUA 4TYBA 1WELA 1FNMA 1S7HA 1RT6A 2VBYA 1HQEB 5HMZA 1SKWA 2IBKA 3DRSA 2RQKA 3OV7A 1SIWB 5D8HB 2J0XA 4Q8EA 3PDNA 4B3TF 2RDJA 2HZCA 3EXCX 3R5AA 3THTA 2FIUA 1WKKA 2IRYA 1WG4A 1N5QA 4U7UK 1OIAA 1DBDA 2IYGA 3OXFA 5AXLA 1XR7A 4U67Q 2VQFF 4M1KA 3QJLA 4LUBA 5AE3A 3DLJA 1F5BA 5A8RB 2OFGX 1UVMA 5KFPA 3BSOA 4PZVA 3CE8A 1U7LA 1R8PA 3QRRA 4JI6J 2HFSA 3BB5A 4DI6A 1CQNA 2ZBIA 2KT3A 1S76D 2OH2A 1CEZA 2F4VJ 3W60A 1HD1A 5A2QY 4AL5A 2DGXA 2LXFA 3PJ9A 4NLYA 1XMOJ 2V5HG 1FE0A 4JI5F 2ZH2A 1IKVA 4LJMA 3EXYA 3NS5A 1NSKL 2BJ3A 2W8KA 1S4FA 4LF8J 3QRPA 4NLPA 3W1YC 5EGYA 4TU9A 1F2GA 2J0QD 4S0MA 2IAJA 3OD2A 4RBVA 1I6JA 1Q95G 1C1CA 5HROA 1NLKL 3MGJA 4QWDA 3FGVA 2CNKB 3D6HB 3SCLE 4OYMA 1FFWB 1A0OB 3CCJS 1IBLJ 1U1PA 3SI8A 2JLEA 1NMEB 2GMHA 1U8SA 2EFOA 2P9GA 3M8QB 3R5BA 1SH0A 4DDFA 2C2OB 4HHUA 2KJWA 1RSCA 5HJXA 3K2YA 3N6NA 1VQKS 2HQCA 1GMVA 3C6TB 2BUNA 3C16A 2DH8A 1RTHA 4LIRA 4DCJB 3VAJA 1S10A 2DIUA 1TAQA 4QOTA 2CNOB 1DURA 3QPIA 4HH0A 2B4VA 2V4JA 2MMYA 4DL4A 4F3MA 1VQ8S 3NKYA 5ADZA 2H1YA 2UUBJ 2DGOA 4HYKA 6FDRA 2V34A 3D0HE 3I56S 3WBZA 2WK4A 5KT7A 2ZBCA 2GNKA 3KOAA 1QTNB 3CIMA 4KE5A 2QL7B 4M5MA 3IRXA 2KRBA 5KFWA 3RR7A 2YX7A 2HG4A 1SJFA 1SI9A 4ZVFA 2KXFA 4EYHB 4PWDB 3D1OA 3WZ0A 5EN1A 3MUTP 4KIAA 2H4WB 1N0VC 4OZ0A 2D7SA 3G6VA 1FJGJ 1VGYA 1YJNS 1NSPA 2CJXB 4KHPF 2FJWA 2BRLA 1RT6B 5D3GB 4X66F 1YJTA 3HSJA 4P10A 1V3SA 1EQ0A 2WSCC 2R7TA 3TZXA 4RJVA 2ZWPA 4AXJA 1RCXB 4KGKA 3TZZA 1CC8A 4ES3A 2MGZB 1GK8A 5K8NA 4F25A 2XY7A 2IBOA 1GMWA 2KFYA 5FLXY 1FK9B 5E7OB 1MWYA 3MD1A 3ZFVA 4RW6B 1XMQJ 2PMWA 4X62J 2PDAA 4JV5F 3HHEA 2U1AA 3AOBA 3BGFA 2CPHA 2HK2A 4DR7F 2W2QP 1U09A 2MZJA 4J9UE 5JXSA 3FSXA 1VBYA 2BQ3A 4PQUB 1GH8A 1WF1A 2ZVSA 1MW7A 3FBFA 2GCFA 3HHLA 2DK2A 3D66A 2RNEA 2DRBA 5G0RA 3GV7B 2X1GA 5F9NA 4LFBJ 1CJVA 2AGPA 3Q2SC 4DEZA 4CO5A 4DPWA 4CCHA 1SL2A 4ICLA 1HI1A 5DG9A 3EZUA 2JHEA 3JTNA 3JS9A 1R8AA 4GRSA 2LA6A 2OD6A 2VC0A 1RHQB 2IAJB 3DU6A 3L9ZA 2FZCB 1S9EA 1Q5YA 2P9EA 1S1XA 1C1CB 2K3IA 5KFUA 4LIWA 1FXLA 4IOBA 1YSJA 3HT0A 2XBPA 4ELUA 5CABA 3O2IA 1RHRB 5LMUF 5BJRA 4DX5A 3DOLA 2V0NA 2H5IB 3IO1A 3DRYA 4OZ1A 2DHXA 3ZTOA 4MIAA 1ELOA 1RTIA 3Q2TC 3TZWA 2JEJA 4LFAJ 2A3JA 2E7WA 2PMHA 3G8TA 1XMBA 4CH1A 3MCSA 3GFYA 3OXGA 4AE5A 3LOUA 5GMEA 2AJFE 3UCGA 1RTZA 3GIJA 4B3MF 4IRKA 1LK7A 2E7VA 1TQLA 1WI6A 1GMUA 1VRQC 3AT1B 2K06A 3PO4A 2QLFB 3VV2B 1M0SA 1T9TA 4F4YA 4MH8A 2NYIA 2D74B 4M5IA 2XZTB 3PEJA 1MWZA 4XO0A 1VS3A 2WHOA 4M5LA 4EBEA 4L6V3 1ZPVA 4PYDA 3JXOA 3QZ7A 4QYZJ 2EEYA 3GWCA 1Y5NB 1Q81T 1X5OA 1OY6A 3SSSA 5DETA 1HKAA 2GFFA 4CP5A 1R3NA 1U1QA 4YP3A 3OLAA 2L3MA 3DGPA 2HVZA 4CRJA 3TVKA 3TUIC 1TL7A 4MKBA 2M3DA 3NGTA 2B9WA 1ZZFA 2UV8A 1Y0HA 4HDHA 4ECVA 3CUNA 4L73A 4HL9A 4NA3A 2HRUA 3KK2A 2MLYA 4O4GA 1LFWA 2I9SA 1Q0NA 1XERA 1MU2B 1VBXA 3RBEA 3OL6A 5F8JA 4ECUA 1KR4A 4GKJF 1V3ZA 2ATCB 4CDIA 1KKHA 3BYRA 4I64A 2DEIA 1WI8A 1KFDA 4LSLA 3D6TB 5IZHA 1RT1A 1YG0A 4NPOA 3PXGa 3I87A 5DM6Q 2I6WA 1JLFA 3IS9B 1HHTP 3QATA 3DC2A 4P2XA 3BBBA 2CJKA 4NZ7A 2YQ3A 4TU7A 5AXKA 2VHGA 1RWMB 1T7PA 3OHAA 2E9TA 1HA1A 1FX4A 5E3CA 1OY9A 3T1YF 4DR2J 2LP4A 3KLEA 1S9EB 1R8CA 4DL3A 1S1XB 4HT7A 2RQCA 3AQPA 3E3XA 2AJQA 1NRKA 5E3QA 2LXUA 3M6XA 1H98A 5E3PA 3PYGA 2E5JA 3ZZZA 3H4DA 4I0WA 4LR7A 4FF2A 5E3RA 4DMZA 3FQLA 2RD5C 2IRUA 4EUVA 4C8MA 4LF4J 4OYPA 4RBUA 4RUBA 1F9FA 1RTIB 2YVSA 5IWAJ 5GADI 5KFGA 3RW7A 1Q79A 3MTKA 1S6QB 2KVIA 2W25A 3HVAA 1Z2LA 3MMBA 2OI2A 3I9ZA 2WBRA 1RZMA 2NXNA 4DV5F 3CDUA 2R7OA 2Y3YA 3BF4A 4ZVSB 3SEOA 5RUBA 3KXDA 4BWMA 4QW8A 4LSNB 3ZNJ1 1FKPA 4USJC 2OAUA 3KJNB 3KNAA 4CWBA 1K47A 4ZP9A 1S49A 1IJFB 1VHFA 1URRA 4EEYA 4RWWA 4C3LA 5E0OA 1FRMA 2V8GA 4F0HA 3F73A 1WEYA 4WFBQ 1KQFB 4RLEA 2V6AA 3CSKA 1YRUA 3ETMA 3FSIA 2HEKA 4IRCA 2KFZA 4CYUB 1NB7A 1OWXA 3H25A 1U2CA 2CAJA 3MEDB 1FHTA 3D1HA 2NXJA 3PR5B 1HFEL 4DL2A 1T8EA 1X31C 3RAXA 1KS2A 4KV8B 4PPDA 3DGPB 4QU7A 2QSFA 4F2RA 3KLFA 3EX7B 3MPVA 3DM2A 3KKFA 1REVA 4P7TA 5CAAA 2B4PA 5KG2A 4P9SA 4QU6A 2ZC3A 2DXFA 2FVRA 5FJ4A 1HQ2A 4UUWA 3BSAA 4FXVA 4ECXA 2LU1A 2IVMA 5M2UA 2QO3A 1GX6A 2IJFA 1VIOA 1RWVB 4ILLA 1SKRA 3FCVA 1HNVA 1SC3B 1R43A 4K50A 1EX8A 3Q0AA 2MQ8A 3TA1A 4OV1A 1I5OB 3KK2B 2MDAA 1SB6A 4O4GB 3BO2A 2R2UA 2DGVA 1FRIA 4DCPB 1R0CB 1KVIA 2KG1A 2ZH3A 3Q8RB 2B5JB 3I4PA 3K17A 3SQOP 2EI5A 3O1LA 2W2PP 2AIRB 2F8HA 4LSLB 4OYBA 5E5NA 1VR6A 3QAUA 2XQCA 1TL1B 4WK3A 5A76A 2RH3A 4U7CA 2GIQA 2FLLA 3UNYA 2HNZA 4KH1B 4ED0A 2OMLA 2RKIA 1W2IA 2B8PA 5KFXA 2E5HA 2FLNA 4M5NA 3T5LA 2VFVA 3KJQB 1L3SA 2A2CA 2BJEA 3VAGA 4R5PA 3KLEB 2JRSA 5DZ6A 3WC0A 4RNMA 2XYGB 3BGOP 1PAUB 3QFHA 1JLEB 4C7QA 3HKZD 6FD1A 4Y65A 4B9NA 1V3RA 1FA0A 3DRPA 3ENQA 1NSQA 4PPZA 2Q43A 4OHZA 3OSNA 1AUDA 2RU3A 3GTYX 2E5LJ 2NUHA 4OZ3A 2VV5A 2DNMA 2JOQA 3N79A 1TELA 3NY0A 2VDHA 4UZBA 4C97A 1S1VB 3CJSA 4QIVA 2XMMA 2UXBJ 1GXUA 1B0TA 3GP9A 5I3UA 1UFWA 4WXWA 1O8BA 1FDBA 4CO1A 1JLQA 2I5JA 4UY8T 5FDLA 4DLEA 2IC3B 4C6AA 3PACA 2FC8A 2FJEB 1Z4UA 1DZ5A 2G0CA 4Q8FA 1R8BA 3AY0A 3IG1A 2QRRA 2QSWA 3OFHA 1Q82T 3RUBL 3M4XA 3CD0A 5HATA 3PRDA 3LGHA 2AP6A 2OD4A 4P2MA 4F0MA 1PIEA 2FTRA 4ZVTB 5KG3A 4H54A 3CJ2A 1HWIA 3I5AA 2W9AA 4K2JA 1PO6A 4Y2KA 2RVJA 2YWFA 1WSVA 2DITA 2HNDA 2DNKA 2V8DA 4EWTA 3DXSX 4J9QA 1NJWA 3OSPA 2HZVA 2ZITA 3OFGA 2X7IA 4HI1A 1YX2A 3MEEA 5CYJA 4I67A 3NL0A 3ADAC 2NZCA 4M5JA 4UOGA 3HMJG 2PMZD 5HLFB 2FJAB 4B3SJ 1APSA 4AD6A 4KQZA 2F40A 1HBUA 3M30B 1K73T 5B0CA 3KFWX 2YWGA 4LRAA 1HNVB 1M5SA 4J9LA 4OX9F 1LEOA 4Q2MA 2XS2A 4ECWA 2WW4A 4CLTA 3AJ1A 1F9HA 2GVDA 5J2QA 2C1EB 1TK0A 2BE2A 1R89A 2CG4A 1FF2A 1Y9OA 5CYQA 2IIHA 2LQJA 2CVIA 1B3TA 1BD6A 2Q6CA 4C4WA 5IT0A 1RJJA 2B9XA 1RI7A 4ILMA 2MTLA 2P8IA 3DDKA 3ILLA 3MMJA 2E1RA 2CYYA 4I7FA 3M1VA 2R7WA 5H9FK 2E9ZA 3HD1A 2MB0B 3JYTA 2L48A 2J8AA 3HSGA 3UN5A 1LQ9A 3FFIB 3JSYA 4YHHJ 3EDQB 4X4UA 1EP4B 4WIQA 5KFAA 2RKIB 3QLHA 4OHWA 4JOUA 3H98A 1DTQA 2XCPA 3D3BJ 4DQIA 4ID5B 4Y0FA 4WE1B 3DHXA 4OYWA 2BV3A 3QJPA 4C3KA 4R5PB 3G2XA 1FDAA 4LF7J 3V6DA 1AA1B 4DSLA 2M8HA 2G9OA 2KYXA 3NGRA 1WHXA 3SSRA 3A8IA 3BS9A 3IR7B 4WXOA 1YRTA 1FEHA 2FB0A 2VUGA 2HQ3A 4RKUC 3L7PA 4Q2LA 2FVSA 2RQ4A 5GAHI 2BDPA 1SIZA 5K20B 2RDIA 4WYWA 3MAQA 2VFRA 2IRXA 2IM1A 2R2SA 4GC7A 3TRGA 2GGPA 2UXCJ 2DGTA 3CGIA 2YQ0A 1G3OA 3F44A 3LQVA 3PHTA 1JLQB 3LP0B 1UEVA 1RXOB 1X5PA 1Y00A 2F8MA 3LAKA 3ZTPA 3C15B 2W4PA 1FWLA 3K5OA 2DR8A 1TUWA 1X4HA 1UA1A 4JI6F 4ES2A 1WC1A 2H54B 4RNHA 3AOCA 4O3SA 1RT2B 1TL3A 2F4VF 4Q5VA 2AEFA 3JSMA 4Q45A 2C22A 1TFWA 4DQQA 1K8AT 2D3OR 3TUJC 2WVBA 2RUSA 3JAMU 4KO0B 1N5YA 3PKMA 3MXHP 1FJ7A 1XMOF 4UW2A 3NXZA 1PCAA 5LM7E 5D78A 4P6QA 4RNOA 4J9MA 4NXMF 2GX8A 4LF8F 4NI2A 3PIOQ 4LREA 4NA2A 4B9MA 3SV3A 2CZ4A 4ZVHA 4ZP7A 3KLGA 2ILYA 3HI9A 5HMWA 2GC8A 2CIMA 2Z30B 5L38A 2MLZA 5KTQA 4OJ1A 3I55S 3PW0A 2YKPA 1C0TB 2IA6A 5D77A 2DBBA 4C8ZA 4F26A 2ROEA 4JV0A 1CS4A 4GMKA 2GVDB 5J2QB 1IN0A 4DFJA 4B9SA 2BE2B 2QC3A 4OYAA 5THWA 3V4IA 3IM9A 2DHAA 3W7BA 4K4WA 1ZPWX 1S0MA 5CYQB 2VD3A 3DKDA 1VK3A 5B08A 2NYHA 2JH3A 3FRYA 1D09B 1JLCB 2ZOGA 4N77A 5FLXU 5B0FA 3TW0A 4I7FB 3W2VA 2R8JA 1XTZA 3JYTB 3M6WA 2DNOA 3RGIA 1E6YB 2CUYA 3QLHB 2UUBF 5H9EK 2Y1LB 1H6KX 2OMOA 4EI2A 3TAQA 1RDRA 2QX0A 1VI7A 3HFVA 2M88A 1B7YB 3SQGB 5ETMA 1UL3A 3HP6A 1Q1KA 1RHJB 2UXDJ 1SBRA 2XS5A 1TUGB 4NLTA 1SQGA 1Q4RA 2E5IA 1WORA 3E51A 4EGLA 4Y3CA 4DF4A 4ENOA 1HNIB 4CLLA 3RRGA 2RHSB 5IT9U 5L8RC 5DQIA 1X4GA 3FMBA 2HWHA 3K59A 3R1HA 3D9BA 1IUJA 1H38A 3AB2B 2WONA 4YDXA 2G4BA 4X64J 3EVWA 3ZXWA 1RUSA 2Y8YA 3B54A 3K5NA 5KFQA 3OR1A 3CF5Q 3UN3A 1R6VA 5KG6A 4DFPA 2GAHC 2GQ2A 2GGPB 3VAMA 3FZ2A 4G6VB 4WPAA 2RMLA 2DB1A 3EMTA 4OZJA 3HJVA 3CJ0A 4ZLNA 3D3CJ 2M7SA 3Q8VA 2BJ8A 3LPYA 2C28A 2HW3A 2DT9A 3EM1A 1G2EA 3GCWP 1X4EA 1XMQF 2J6TA 5HBMB 4GVLA 4X62F 3DLGA 1O0PA 3ET6B 5GADU 3OVSA 3RRKA 3CW2C 5A0YA 1NCLA 1M5VC 2YNHB 4QIGA 2VJUA 4KHRA 2B8QA 2BRKA 4TVAB 1TL3B 3TWZA 3DLKB 1VQMS 3JSMB 1S0OA 1D9AA 4DUTA 4LT6A 2POKA 3EZ5A 1FRLA 4LFBF 4ZCKA 4FF1A 4FYVB 3ZZ0A 2XNRA 3PHEA 4U95A 1WHYA 1DJ0A 1S97A 3HFKA 2OELA 3W9IA 1RBOB 2YKOA 2W9BB 2DVIA 3KDOA 2BZ2A 4EBCA 3SFUA 5K9FA 1VQ9S 5DLFA 2AMCB 4O3RA 1T9YA 3R5CA 3SCIE 4JI8J 4AFFA 3ZZPA 3HKWA 4NRTA 4DL7A 3TARA 4WJBA 1GAOA 3E01A 1F2HA 4GKKJ 2R42A 3AJDA 4B3RJ 2LQ8A 4QIWD 2AT1B 2KT2A 3V6HA 4WU3A 3DOKA 3HSZA 3GJRB 2R4FA 1HWKA 1B0VA 2HMIA 2HIYA 4EFAC 2QMUB 2V9WA 3PRVA 3W2WA 3JTOA 1WG5A 3M32A 3T9NA 3MECA 1QUPA 1IR0A 3FEYB 3V4IB 4LFAF 5ETKA 1PILA 1YVFA 4ID8A 2DCLA 5LJ3Y 2GHWA 3PR4A 4QIFA 2GJIA 3QIPB 3ZO7A 5F41A 1H74A 3EVOA 4WFYA 5J2PA 4ECRA 2XI2A 2F8EX 1NJIT 4ANCA 2FZKB 3UFCX 3M2UA 3ILIA 4FVMA 3G6ES 4W90B 1CBKA 3W2VB 1R27B 3MWBA 1U2RA 1AT1B 3CEDA 4ZPBA 4JI4J 2HQFA 3LF0A 2HHQA 5F0UA 2CJQA 2R3VA 4X66J 4MIWA 1HR0J 2WOMA 4F0KA 4NCAA 2J9DE 4K59A 4DUYF 5H9FJ 2XO7A 1ZETA 3CB4A 4NLGA 3UD4P 3BYPA 1GQEA 2G2OA 5FIIA 4BCAA 2W9CA 3GR1A 1IM4A 2LQ9A 1T9XA 2Z2LA 1U25A 2R8KA 2LU2A 3W5ZA 4JV5J 4DZ6A 5KFZA 1VFJA 1QTMA 3JQMA 2HRTA 2QMXA 5IFMA 1RK8A 3OR1B 2XNQA 1FNOA 3SBMA 2FVCA 4CO4A 4YN3B 3OR2A 3W64A 3UW1A 2FY8A 2AX1A 2DGUA 2FHMA 4NX9A 1VLOA 5CCLA 5K8MA 4YB7A 3F56A 1SL1A 2BVZA 3QFWA 3QSYB 1U6BA 5AE1A 1S5ZA 4X2BA 4J91A 5GAGI 3PX4A 3CC4S 1KNZA 3J80Y 4DHVA 5KFRA 3DI6A 2ZH1A 4KSEB 4ZLLA 4OYXA 2KO1A 3CJTA 4JV2A 2QLBB 3UNGC 4PXBA 4J9OA 4DR6J 2F7VA 4NRUA 3AAWB 1KOOA 2JFDA 2J7KA 3SXLA 3OJSA 2KL8A 2XMVA 1V5VA 2HIQA 3W62A 1BY9A 5LXRA 2ROGA 1RWOB 1HBNA 4YB1P 3D1QA 3J7ZT 3H59A 2LEAA 2UV8G 4IDKA 3G82A 4NLSA 2L9WA 3F0NA 4RUCA 2K7KA 4PG6A 3Q86A 2AYGA 1IR2A 5CYMA 1GTHA 3G71S 4JV1A 3D28A 2HHTA 1ZOTA 1ICEB 4DR2F 3AD7C 3CDBA 4DS5A 4R0EA 3M2RA 3B82A 4K2XA 2ACMA 4DR4J 1UETA 2XC9A 2DXDA 4PQAA 3N5FA 1H2VZ 3E01B 1P9QC 4L72B 2DNNA 2RU9A 2WB4A 2DHSA 2YQ1A 2HMIB 2NUUG 1CULA 1WC6A 4LF4F 3I31A 1QSYA 3M32B 3AHPA 3MECB 5KFKA 5IWAF 1TR0A 2B56A 3MM5A 3TR5A 1FJEB 4FPIA 5ETRA 4C0BA 3BQ2A 3OFFA 5DDRC 3W9HA 3G4SS 2C42A 5J2PB 3FBCA 5U47A 3N01A 1XR6A 4PXCA 4J5OA 2XHCA 2V68A 1HQUA 7AT1B 2CADA 1XEZA 2NLWA 5J1EA 3ZTSA 2J8SA 1PG5B 2OKQA 1RYSA 2UUCJ 2CQCA 4JYAJ 2C3MA 1M5PC 2LQBA 4DSFA 2FJDB 3FUYA 5KFIA 2WOMB 4ZIVA 4O4RA 3E8OA 1ZYQA 3V81A 4WFAQ 4HTIA 1B7FA 1F9EB 2QL5B 1PGZA 5HJYA 3KHLA 1T9VA 3MPYA 4DQSA 2HK3A 2W9CB 2HWIA 2DO0A 4LF9J 5H9EJ 1MROA 1T9WA 1QSSA 1RT4B 1UPMB 4IG0A 2KXNB 3QMQA 3H7HB 3NGKA 4MYUA 1YI2S 1F6TA 1P1TA 2PA8D 3D0GE 3Q23A 2DIVA 1H7XA 3UI3A 2IY5B 1TKZA 5IV3A 2W24A 1FKOA 3DXBA 1N5SA 1J2VA 4G3IA 2DNGA 3EVMA 1VJWA 4PXEA 1ZA2B 1UVLA 1VYAA 1WC5A 1NDLA 2HURA 5J2MA 2Z57B 2HBZB 4FXWA 4NEZA 2DPIA 5KFDA 5GAHU 1JLBA 2LDIA 4Z37A 1VQNS 1RAOA 2Z4PA 2DEJA 2Q6BA 2GAGC 2XMWA 2W7AA 2Z2MA 2LMIA 4LQ9A 3GMGA 1UKUA 3LANA 4BC9A 1RT3B 2DRDA 2XWXA 3A3PB 2CQ1A 2BX6A 4KH0B 4R0JA 2AJ2A 3JSBA 1SJ4P 3N4WA 3SMZA 2XLKA 3G6XA 2GQCA 5EUHA 1SQEA 4G1IA 3NGSA 4OYIA 2JEIA 3UPFA 1FWKA 1C2PA 4X4OA 4OYOA 2HHHJ 2AJ1A 3KLIA 3GIMA 2R2RA 1KOHA 2ABYA 3ZZRA 2HWTA 3ULHA 4YMEA 4RUAA 3WHIA 3HZEA 5MAOA 5KFFA 4JI3J 1X5SA 1GFWB 2XCAA 5IXUA 4BC7A 3CWJA 4B9UA 1VK8A 4OHYA 3FCHA 4IR1A 2UZAA 1YITS 1S0NA 5EWEA 4J9KA 2B3TB 2KKHA 1CULB 3PFEA 3BQ1A 1RWUA 1H0HB 2JC0A 5LSRA 3UDLA 2FLPA 2E5LF 3MM5B 4Y2AA 4DR5F 2COLA 1G7CB 2KVQE 1Y5IB 3RZAA 1WTFA 2V94A 1DLOA 2RDDA 2ASJA 1OYEA 2V69A 5DDQC 3K89A 1LFPA 5I42B 2UXBF 2OP5A 4C98A 3PW7A 5K14B 2XULA 1U8WA 4DSIA 2KZMA 1R0AB 4OLOA 3TO8A 1HQUB 3O6QA 1JXLA 1WOOA 1RT5B 5J1EB 1VQSA 3LP1A 2HBQB 3R6LB 4WFXA 4PAAA 4ZP6A 2GMLA 5CZVA 3GLJA 1FJCA 1S99A 4HTJA 2KHDA 1SQFA 5C24B 4KPCA 5L46A 1UAWA 3EGVA 3CCRS 2MSSA 4FNHA 2EKNA 1NK8A 3V81B 3BBCA 4HR2A 2HRYA 1QE1A 2VBXA 3O3LA 2ACYA 5CXTA 2OEJA 2A0FB 4OX8A 1KQGB 1RT7A 4MYTA 3MUMP 1C0UA 1R7IA 1N5VA 5BYSA 2XEXA 3UCUP 2VBZA 3VWSA 3H42A 5CQGA 3R7BB 1FFSB 4ZLPA 4IG0B 1TV6A 3PTWA 2BKOA 4ZDNA 4DV2J 4I2QB 2YKQA 4A8MP 5KT5A 4B3SF 3P6YC 4OZ5A 2O01C 3NBPA 3KG4A 4BDPA 3VQTA 1FKOB 3NAIA 3K5PA 3D7SB 3X3UA 3QYYA 1YBAA 1PBAA 1R0BG 2Y1IA 4TN2A 2AHOB 1S0VA 3GV8B 2QTWA 2PEHA 1N5TA 4FKYA 4F50A 3CJ8A 3BDPA 4ERDA 2X1FA 5J2MB 2AJ0A 5HL7Q 1ZS6A 1K9MT 1WWHA 4ECZA 1Y10A 2IPOB 2DH9A 4URQU 4KGVB 1JXEA 1T05A 1RWPB 1SJ3P 5SZTA 3MMCB 4ER8A 1C1BB 1C4CA 3EPIA 1T94A 5IV4A 2OPRA 4F4KA 1W7WA 3I96A 5DM7Q 1HW8A 1NHKL 4YHHF 3JQJA 4DS4A 2PN6A 4ZVUB 4AUKA 2JEGA 3VGUA 2YWWA 1IWGA 1NJZA 1RADB 5AXNA 2CQ2A 1ZM3A 3IWXA 2CJYB 3KLIB 2XGPA 1RKIA 1J5OB 2BM1A 3TX8A 1N32J 3H5UA 4HH1A 4NLOA 4LF7F 1RTJB 4YS2A 4NCGA 1BXNA 5KG5A 2DNHA 1FT8A 3ONQA 4AYBD 3LUYA 5A8RA 2NXUA 3Q22A 1E6VA 3D54A 4M63A 2CKWA 3LPEA 2CQ0A 4WYLA 2DCUB 4Z7YA 2DY1A 3VR1A 3T5KA 2UXCF 2DYAA 4XPEA 1HI8A 3P8BB 4NZ0A 5KT6A 3ETOA 3ZC4A 4WFZA 3HM9A 1X9SA 2EFVA 2D1CA 3R5GA 7FDRA 1GTEA 3Q83A 2DGWA 3MAHA 3LP1B 2OSRA 3OQ2A 1HWLA 1VMBA 1UFKA 2IMWP 3TI0A 5CD4H 1U49A 3HK2A 4CIOA 2MZQA 3IGNA 3IBFB 1PSDA 2JVRA 5B0EA 1YBUA 1JJCB 3J81Y 2BXJA 5K8OA 2DR6A 2FHKA 3H20A 4PCQA 2C2EA 1HPZB 3L4BC 1TUVA 3VVTA 1PJ5A 2X51A 1RT7B 1C0UB 1JXVA 1QUVA 3UDVA 4TY9A 2RB7A 4IO9Q 3D67A 4FS1A 4Z7CA 3C6TA 3BKTA 2FJXA 5J2NA 3QT7A 5B09A 3DYAA 4NL5A 3I0SA 2Q66A 2PEBA 4I68A 2EPIA 4RL1A 1LWFB 4DOZA 3IN5A 2AX0A 1IBCB 3NBPB 1U1OA 4X4RA 3W8PA 1JNZB 2DGQA 4LBPA 4LF6J 2MKKA 1AFIA 1Q5VA 2EVZA 4DV4J 4EBDA 2HS0A 1T0TV 4OZLA 3WC2A 3IAS9 1BC6A 4CLSA 5KFJA 3HT3A 3RB0A 4DN0A 1UEUA 1HARA 3IMQJ 4WK1A 4ZPTR 1D9FA 1ZBTA 2DNPA 5DGBA 4TNOA 1PAEX 2AYMA 4DR3J 4X4QA 3PV8A 5L9XA 5HP1A 4EZ6A 1RU2A 1T05B 2QA2A 4PWDA 2B7CB 2MQPA 1S9FA 1S1WA 2D3O1 2CG8A 1MN7A 1GEHA 1F3VA 4DL5A 2WZ1A 3CC2S 5D3GA 2E1AA 5GAGU 1XC9A 4TQSA 1UZHA 2IMOA 2CDQA 2UXDF 2CFXA 2DXEA 4DV1J 2Y8WA 1D0EA 1OO0B 3AA8A 2NZ4A 3QIDA 2RE1A 3LW5C 2ADCA 2MGZA 2FD2A 2MKSA 1FK9A 1Q86T 3GQCA 4NCGB 1X4CA 4K4SA 4BWJA 2B43A 4RW6A 1HIYA 3N0VA 5LJ5Y 2R2TA 3UWTA 2KU7A 4WBFA 4IH5A 1E6VB 2A18A 2P6SA 1RAHB 1LW2B 3CPWR 4A8KA 4PUOB 1NHVA 4X64F 1KONA 2BJ9A 2ZBQA 4PQUA 3OL8A 1UTAA 3EDRB 1S6OA 1DTTB 2Q3PA 1WC0A 5ETLA 1K44A 1OPZA 3AFGA 4MAKA 3CTRA 3VGTA 2W7PA 4ELTA 1UVIA 3HLUA 2XMAA 1F5AA 2PE8A 2Z56B 5AE2A 2HFNA 3MCNA 1HW9A 3WX8A 2XB2D 2DNLA 4CLWA 2YKAA 4NXMJ 2GO8A 2KRRA 4CH0S 3SCKE 3PFOA 3GIRA 3CCES 2GVZA 2MJUA 2ZHAA 2YY3A 2AKWB 1VQ5S 3OFEA 1B99A 4I4BA 3MOJB 2NPFA 4RO0A 2CXEA 4NA1A 2AJ4A 1EIYB 4GVBB 1IQTA 3ZTQA 4EMDA 3H2UB 2NS1B 2ZH6A 1ZAVA 1QVGR 3TP2A 1R6YA 1PJ6A 4YFUA 1EARA 5D0RA 4CNZA 2UUTA 3VAHA 2G0JA 4NEYA 4L76A 2DJWA 1EQMA 4CLYA 2UP1A 1RU1A 5J2NB 3DYAB 3I0SB 3R97A 1CJKA 2J9DA 2ZEJA 2J6UA 1FXRA 1LXJA 2IJNA 4JI8F 3LP2A 3BH7B 2I1RA 1W25A 1DFDA 1REGX 1U1MA 3FMWA 4GKKF 2YWEA 5EDWA 3G87A 4B3RF 3QAEA 3VHQA 2D9PA 4J90A 3M9NB 4FYWB 1NM2A 4GO7X 2VH7A 2KDOA 1UW9A 4B3OB 1RA7A 2YNFB 3GYXB 2PA3A 2RUGA 4QWCA 2F1FA 3O5TB 2MSTA 5CH7B 2GS8A 4QYRA 1U4BA 2AD9A 3O8WA 2WRMA 3NCRA 1FDNA 5HP1B 2D9OA 5KFNA 3ICLA 4DQPA 4XAKA 1YWXA 2H5JB 3PW2A 3J80U 4XK8C 4H4KA 1S1WB 1K1SA 3AXMA 1VIXA 3A8JA 3HULA 4K4XA 3B4MA 4FN5A 1B70B 4K4VA 2JL9A 1TMMA 2VIHA 4JI4F 1FO1A 1LW0B 1HR0F 2BMBA 5GMKa 4RX6A 4RWXA 3NGDA 4MKAA 2CPZA 2XYHB 3NS6A 2ZH5A 2YX4A 4H4MB 2FHJD 2NSBA 1Y3JA 4N56A 3MPDA 1TL5A 4ECYA 3S1TA 1NPPA 3MEGB 2HS3A 3KLHA 2HVEA 5IC6B 1VCTA 1NEEA 3IWNC 4N7TA 1IKWA 4DLGA 1MU2A 3W3SA 5L1IA 4I56A 4NMLA 5KOWA 1RLDA 1YDLA 3CJKB 3DN9A 3MR6A 2PD1A 3IAM9 3PJWA 2KI2A 3G9CA 2VA3A 3OLBA 3QJJA 4V19X 5HMYA 3BKFA 3IS9A 3ZZYA 2OIHA 2RQMA 2KXHA 3TUPA 4I2PB 2H5EA 1D9DA 4EYIB 3V2UC 4L75A 5KFLA 4H4KC 4X4TA 3PVXA 3PW5A 4PKDB 2YPZA 4ZPVR 3M05A 3N5BA 5D4LA 2R7UA 2QLWA 2QZ8A 4L3KA 1RWKB 2VPYB 2RIJA 2EFQA 2HLTA 4NYPA 1IKYA 2GVZB 4NCBA 3VQSA 1RTDA 4RW8B 4CLUA 2XY6A 1YHQS 4C8YA 1CG2A 2IHR1 1RAIB 3S7RA 1OQ6A 2WVFA 2ZFHA 4DR6F 1HL6A 1S48A 3FSYA 4U8VA 2ZJQQ 1DQ8A 2VKZG 2ZE2B 4P2FA 3RBDA 3CJ3A 1FD2A 1Z1ZA 2ZZMA 5CCMA 3MM6B 4URSA 3EZOA 4ZJOA 3EUNA 3GSIA 3RG6A 4LBHA 2ATLA 4UT4A 4KC5A 1BE4A 4J9RA 2BYCA 4ZN3A 5T14A 1SVDA 2IYIA 1JB0C 1IQZA 4F3QA 4EO6A 2JZ5A 3MPUB 4DBQA 3S8SA 1U47A 2C2DA 1IBKJ 1S6QA 1X4DA 1KVJA 1LWCB 2CQGA 2MZ1A 2Y1JA 1CJKB 1X0FA 3FDSA 3HVWA 5J1NA 4DR4F 3LP2B 1FWPA 4I6YA 1SCJB 1TKXA 1KQSR 2OHDA 4USWA 4LSNA 5DG8A 2K8GA 3KDNA 1RWXB 1A7GE 4ATNA 5H1SV 2ZBPA 4I6WA 4AQYJ 3NLCA 4LF2A 3DRRB 1D1UA 1RB0A 1MMNA 1XQIA 2R7XA 2YWHA 3MD3A 4ZN1A 2BM0A 4DUYJ 4RW9B 3FKBA 2FUG9 3NMRA 2MQOA 5KT3A 4CYUA 2JWNA 4NZ6A 1EB0A 8ATCB 3KTQA 4Z2XA 1Q16B 2L08A 3MEDA 3W61A 3T41A 5A8WB 1HYSB 3HHKA 1LWEB 4OZNA 3U1LA 4O3NA 1NU4A 1H2UX 4UQGA 3M2VB 4KV8A 5IT4A 2F5GA 1I94F 2K3KA 1UVJA
chains in the Genus database with same CATH topology
4USTA 4WP9A 3C14A 4CLSA 1CJTB 4CM2A 3MR7A 4CLTA 2GVDA 1AZSA 4WPAA 1CULA 4CLPA 4OYXA 4P2XA 1WC6A 1CJKB 1Y11A 1YBTA 4P2MA 4CLZA 1YK9A 4OYMA 1CJTA 1U0HA 1TL7B 3UVJB 1CJUB 1AB8A 5D0RA 4CLFA 5D15A 1FX2A 1TL7A 1WC4A 3MAAB 4USWA 1YBUA 4OYIA 4NI2B 1FX4A 4NI2A 1WC0A 4OYOA 4CLYA 2BW7A 1CJVB 5IV3A 1CJVA 2GVZB 3ET6B 1CJKA 3G82B 3ET6A 4CLUA 4OYZA 3G82A 1Y10A 5D0GA 4WP8A 3UVJA 1CJUA 4USVA 3MAAA 4OZ2A 2WZ1A 4OZ3A 1WC3A 4P2FA 3C16B 4CLWA 4CLLA 4OYBA 3C16A 4CM0A 1WC5A 3C14B 4CLKA 1CS4B 4WP3A 1CS4A 2GVZA 2QV6A 2GVDB 4OYWA 1AZSB 5IV4A 4OYAA 4USUA 4OYPA 3C15B 1CULB 3C15A 5D0HA 2W01A 5D0EA 3R5GA 1WC1A 1U0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UST A;  4WP9 A;  3C14 A;  4CLS A;  1CJT B;  4CM2 A;  3MR7 A;  4CLT A;  2GVD A;  1AZS A;  4WPA A;  1CUL A;  4CLP A;  4OYX A;  4P2X A;  1WC6 A;  1CJK B;  1Y11 A;  1YBT A;  4P2M A;  4CLZ A;  1YK9 A;  4OYM A;  1CJT A;  1U0H A;  1TL7 B;  3UVJ B;  1CJU B;  1AB8 A;  5D0R A;  4CLF A;  5D15 A;  1FX2 A;  1TL7 A;  1WC4 A;  3MAA B;  4USW A;  1YBU A;  4OYI A;  4NI2 B;  1FX4 A;  4NI2 A;  1WC0 A;  4OYO A;  4CLY A;  2BW7 A;  1CJV B;  5IV3 A;  1CJV A;  2GVZ B;  3ET6 B;  1CJK A;  3G82 B;  3ET6 A;  4CLU A;  4OYZ A;  3G82 A;  1Y10 A;  5D0G A;  4WP8 A;  3UVJ A;  1CJU A;  4USV A;  3MAA A;  4OZ2 A;  2WZ1 A;  4OZ3 A;  1WC3 A;  4P2F A;  3C16 B;  4CLW A;  4CLL A;  4OYB A;  3C16 A;  4CM0 A;  1WC5 A;  3C14 B;  4CLK A;  1CS4 B;  4WP3 A;  1CS4 A;  2GVZ A;  2QV6 A;  2GVD B;  4OYW A;  1AZS B;  5IV4 A;  4OYA A;  4USU A;  4OYP A;  3C15 B;  1CUL B;  3C15 A;  5D0H A;  2W01 A;  5D0E A;  3R5G A;  1WC1 A;  1U0H B; 
#chains in the Genus database with same CATH topology
 4FS2 A;  2M52 A;  3BN7 A;  2UUC F;  1FRK A;  4JYA F;  1SJR A;  2CNL B;  4B9T A;  2KZZ A;  2CJB A;  2WB1 D;  2FHO B;  4DF8 A;  4WU2 A;  2IDE A;  2E7X A;  3UR3 C;  4LF5 J;  2G1H A;  4B17 A;  2AQ4 A;  5B0A A;  3TAN A;  3OTO J;  1S6P A;  6AT1 B;  4WFN Q;  3KLH B;  1K1Q A;  1W2B R;  1NND A;  4LF9 F;  1IKW B;  2WBM A;  1VRT B;  1I51 B;  3Q8Q B;  2V2V A;  2AW0 A;  3TJ9 A;  1WF2 A;  2B5J A;  4CQ1 A;  4G1P A;  5D6G A;  4OFZ A;  2QE5 A;  1GXT A;  4DG1 A;  1TL1 A;  4F4Z A;  1ZZN A;  5SUH A;  4ED1 A;  4A8S A;  2N3L A;  2AYE A;  2FDN A;  2P2C B;  1X4F A;  3TVZ A;  2RS2 A;  1NHU A;  1WKL A;  1TKT A;  2EK6 A;  3QRQ A;  2FLO A;  4CH7 A;  3TEH B;  1J27 A;  5BR8 J;  1L3U A;  1Q53 A;  2ZJP Q;  1S12 A;  3HXM A;  4ED5 A;  3EJM A;  1UWA A;  2MJN A;  2G0I A;  1LKZ A;  4U96 A;  1IKY B;  3U1M A;  1Q8I A;  4RUH A;  3H2L A;  1RTD B;  3CCT A;  4ILR A;  1CJT A;  3KHG A;  2FY1 A;  5KFT A;  3D6M B;  3NCQ A;  1RP5 A;  1MMD A;  4ZA1 A;  1X4A A;  4HAC A;  1JLE A;  2JDJ A;  4LRB A;  1T3N A;  1F60 B;  4M95 A;  1U45 A;  2VG5 B;  2LEC A;  3BO4 A;  3GV5 B;  3SCJ E;  1FVS A;  1A9N B;  2ZKT A;  2C2Z B;  2O3D A;  4JP8 A;  1S1V A;  2ZH8 A;  4HKQ A;  2HHH F;  2E66 A;  1QDU B;  1PYO B;  2RRN A;  2DNZ A;  2OFH X;  3I32 A;  5L1L A;  2IC3 A;  4JI3 F;  4NLQ A;  4KY3 A;  3ENA A;  1TKX B;  5G4D A;  2NPI A;  2XSJ A;  3KMQ A;  2J7W A;  4ZK7 M;  2BW2 A;  3BSN A;  4TY8 B;  4G1Q B;  5DZ7 A;  5F8M A;  4M5D A;  1WHW A;  1V5I B;  3CO9 A;  1JLA B;  3MEK A;  3T5H A;  1YQH A;  4E2F B;  1EET B;  5IS2 A;  3KUH A;  4NYO A;  4J7C A;  1ZAX A;  1UFL A;  1KBR A;  1MG7 A;  4P52 A;  3HHD A;  3CJR A;  2Q1L A;  4NYZ A;  3S01 A;  4LVO P;  3J81 j;  3UQS A;  4DUZ J;  2VC1 A;  3P45 B;  2DR5 A;  1MWQ A;  2A10 A;  3GU0 A;  3B4D A;  2ASD A;  4U7U D;  3PNI A;  5DDP C;  5HLF A;  5I4M A;  2CQP A;  4N8N A;  1WTB A;  3R5D A;  2RT3 A;  1WAC A;  2CQ3 A;  5C42 A;  1IJE B;  3M30 A;  1U24 A;  4OI3 A;  1GMW D;  1JX4 A;  4NLV A;  1ZM9 A;  4HI2 A;  2U2F A;  2R8I A;  2Z0G A;  3TQE A;  1IBM J;  2VG6 B;  3C14 A;  1NAQ A;  5DQG A;  1S6P B;  2B0G A;  4RNF A;  2H9Z A;  2OPP B;  2HVD A;  1XN9 A;  2C2K B;  2P6T A;  2VJV A;  2IFX A;  3KG0 A;  4P72 A;  2CPX A;  3BSC A;  1WSR A;  2XHW A;  1JNR B;  4X84 A;  4N47 A;  2Z8Q A;  2VDI A;  3HHL D;  3BN4 A;  4ZS6 A;  3A3N B;  2ALZ A;  2PSZ A;  3KYL A;  4DSK A;  2HHU A;  4F02 A;  4DFK A;  4DV2 F;  2XM3 A;  1HWU A;  4NXN J;  3BZQ A;  4PWW A;  2DKO B;  4DG1 B;  4YR3 A;  3ELH A;  4KB7 A;  3K5M A;  2FVP A;  2JEF A;  3EIC A;  3FFI A;  1UA0 A;  4Q0B B;  4KJI A;  4FKX A;  1EP4 A;  2I8E A;  5F8N A;  1TKT B;  4MT1 A;  3L7U A;  1SUQ B;  2HAI A;  2BR0 A;  1VHI A;  1N34 J;  4ID5 A;  4OI4 A;  4NE9 C;  3H90 A;  4WE1 A;  4YUD A;  2FQQ B;  2YNG A;  3H4B A;  5T7L B;  1HHQ A;  5DQH A;  1M5H A;  4ZPW R;  2FGC A;  3NMA A;  3UDC A;  3M8P A;  2MKJ A;  1CJT B;  3G86 A;  4KTQ A;  5ETV A;  4YY3 J;  4HAC B;  4MFB A;  4JBC A;  1PC4 A;  4QWB A;  2M5Y A;  4K4U A;  4YB5 A;  1J5E J;  3G96 A;  1YJW S;  3C6U B;  3T6B A;  3IXQ A;  1U0H A;  2ZH4 A;  2G2Z A;  4MK9 A;  4CT8 A;  9ATC B;  3MI7 X;  4DR5 J;  2GJ2 A;  1QM9 A;  2Z58 B;  3IBC B;  2ASY A;  1NH8 A;  2J76 E;  2DNR A;  1VQL S;  1N32 F;  3DNC A;  1FXD A;  3ISN D;  3LP0 A;  4ED8 A;  2O66 A;  4UOF A;  2XSJ B;  3GPA A;  4MK7 A;  1N6Q B;  1S6U A;  1BQN B;  5JVH Q;  3P5T L;  4WP3 A;  4KFB A;  2QV6 A;  1U1L A;  2CQ4 A;  1BHN A;  4M5D B;  1R8H A;  1HNX J;  3C15 A;  3RU0 A;  2CNN B;  2CQD A;  4LVN P;  3I9V 9;  4DPT A;  5I3Q A;  1RT2 A;  1KFS A;  3L7O A;  3JSR A;  2FJV A;  3C8Y A;  3HHN B;  3GII A;  4KO0 A;  3B8H A;  1ARO P;  2IM3 A;  3N28 A;  5F8I A;  4ED2 A;  3C19 A;  4TU8 A;  2XG8 A;  8AT1 B;  3CVK A;  4UY8 5;  1CQM A;  3PKY A;  3BGL A;  5D4N A;  1HNW J;  3DOM A;  2HFU A;  4BS2 A;  4F04 B;  1MML A;  1FKA F;  1RAC B;  5C42 B;  2GIF A;  4R8U A;  2HGL A;  1NPR A;  1X8D A;  2H3E B;  3EGZ A;  1C0T A;  1VQ6 S;  2YKM B;  3C14 B;  4DPO A;  1AW0 A;  4RW7 B;  1NXI A;  2C2N A;  3R8Y A;  3GJQ B;  2EWH A;  2BKP A;  3FEX B;  3A1Y G;  4JI1 J;  4Q7A A;  2E44 A;  4CO3 A;  3I6P A;  3W63 A;  2FZG B;  4PWU A;  1VC5 A;  4WP9 A;  2OPS B;  4ZCI A;  1OQ3 A;  1JLC A;  1JJH A;  3BM7 A;  3BV8 A;  2W2N P;  1R31 A;  2E1P A;  2EC2 A;  3D4J A;  4NAS A;  4LSZ B;  2W1B A;  1H3D A;  1KRP A;  5D15 A;  4LF6 F;  4IFV B;  5JVG Q;  4DV4 F;  4K4Y A;  2NXC A;  1E6Y A;  1RQ0 A;  2JLF A;  3VGS A;  2QYC A;  2IM0 A;  3HF5 A;  4PG4 A;  4C3M A;  1N36 J;  3SQG A;  5EWG A;  2YNG B;  5A2Q U;  3K57 A;  4K7Q A;  3DLH A;  1CJU A;  1UEK A;  3BKU A;  1S72 S;  3OPK A;  4DR3 F;  4RBT A;  4IFY A;  2LFV A;  3PYF A;  3M8P B;  1IKX A;  1RCO B;  1HNI A;  2EFN A;  3QGG A;  2EBE A;  4KAI A;  4OX6 A;  2VU5 A;  3PIP Q;  4MFB B;  3I4H X;  1LOU A;  1FEE A;  3DFE A;  1SC1 B;  4LRF A;  1DQA A;  2H48 B;  1ZM4 A;  3ENW A;  4BBY A;  4IOC Q;  1U1R A;  1NK4 A;  2CQH A;  3RB6 A;  2Q79 A;  4F36 A;  3BDE A;  2CQI A;  1U0H B;  2NSC A;  4UTG A;  1BWV A;  2AYB A;  5ETO A;  4CM2 A;  1QAJ A;  1NK6 A;  3DGV A;  1CPZ A;  4LRD A;  2RAQ A;  2OEM A;  3QZ8 A;  1UCN A;  3DLL Q;  4DV1 F;  1Y3K A;  2VA2 A;  3PZP A;  3JAM Y;  2BQU A;  2IVF B;  3K8W A;  4DSE A;  3CME S;  3PX0 A;  2X1A A;  4PR6 A;  1M5O C;  4O44 A;  1Q78 A;  1SV5 B;  2K1R A;  5HBM A;  2W7O A;  2ILZ A;  4KFB B;  1LWX A;  1X60 A;  3ET6 A;  3BJY A;  3RB3 A;  2V50 A;  2QJ3 A;  3A3O B;  4DPU A;  1NDP A;  3QGP A;  1Y4Z B;  2MZR A;  1T03 B;  2YNH A;  2QMW A;  3R6G B;  3DU5 A;  3I5B A;  2MQL A;  5LT5 A;  4CLK A;  4OMF G;  4QCL A;  4L3N A;  2ZM6 J;  2HHV A;  3DLK A;  2A6O A;  4A8F A;  2L41 A;  3PY8 A;  3HPO A;  1NDK A;  1FRX A;  5LMN J;  2R8H A;  1L3T A;  2CJ9 A;  3DRS B;  5DDO C;  4OI1 A;  2GHV C;  3I82 A;  2MHE A;  1SPB P;  1SJ1 A;  3AOA A;  3GFH A;  3GIL A;  1XNQ J;  2W9B A;  2P5V A;  3MM9 A;  2JFK A;  1JQG A;  2XTJ P;  3TQ1 A;  3WQP A;  3LO3 A;  2QL9 B;  2IDL A;  4PG8 A;  3C46 A;  2M4M A;  3CC7 S;  1KLM A;  3DOM B;  1X9M A;  2R7R A;  1ROF A;  1RHM B;  1JJ4 A;  4R8U B;  2RF2 A;  1WG1 A;  3RTV A;  1XR5 A;  4KKO A;  1HNZ J;  2V67 A;  4C9D A;  4C0O C;  5HQ8 A;  1VQY A;  3MFI A;  3R7N B;  1L3V A;  3KG1 A;  3P3D A;  1RHK B;  3M8Z A;  1FD8 A;  4NLU A;  3M8W A;  2WCX A;  3PEH A;  2Y1R I;  3QIP A;  5F3T A;  2GHP A;  3QT5 A;  4DR1 J;  1SXL A;  1RAF B;  2CPD A;  3LH2 S;  4U6P A;  5ETT A;  1T11 A;  1VBZ A;  1UJ5 A;  5IT9 Y;  2RJZ A;  1YKW A;  2BAC A;  1IKV B;  3KUE A;  1RLC L;  2YPY A;  2XS7 A;  1HD0 A;  1NK5 A;  2VAS A;  5HRO B;  2DO4 A;  3IRW P;  2SXL A;  4HLB A;  5C25 A;  2XO6 A;  2AEM A;  1FE4 A;  4DX6 A;  1NH7 A;  2UVV A;  2KTQ A;  1CJU B;  3KWM A;  1Q8K A;  1FI4 A;  3K5L A;  4IFY B;  3NWR A;  1IKX B;  3DLB A;  4ECT A;  1KLN A;  1HWJ A;  4UQT A;  5KG4 A;  3MCM A;  1U26 A;  4LBI A;  1PC5 A;  5KFO A;  3CCM S;  2GJF A;  2CQB A;  2GA7 A;  2MKH A;  3FNN A;  5F0W A;  4X4P A;  1NZA A;  2VQE J;  1QSL A;  1C4A A;  4U8Y A;  4QPT A;  4DV6 J;  1RBL A;  3C16 B;  4XPC A;  1RTH B;  3CCW A;  3HHL C;  3LAL A;  3BPD A;  4DJB A;  4USU A;  2V4J B;  1NJX A;  2WVD A;  3AXK A;  1QAY A;  1NSA A;  3T3F A;  2XLJ A;  1KTV A;  1XBW A;  4Y2I A;  1VC0 A;  4DWI A;  1AUS L;  4O44 B;  4RW4 A;  3MR7 A;  4MKV A;  2UUA J;  5JMN A;  4ED6 A;  2K1R B;  3F41 A;  3V4M A;  3IRX B;  1WEZ A;  3GJS B;  3GSD A;  3NP5 A;  1FX2 A;  2MHN A;  4P74 A;  3J7A N;  5LXY A;  2V4Q A;  1KQK A;  3NEK A;  2HQI A;  3PM9 A;  2M9K A;  4LFC J;  2MY8 A;  1BGX T;  2YXL A;  4B08 A;  3U7J A;  2EBG A;  1UJ4 A;  1S9G A;  1S59 A;  3JQK A;  4J9V A;  2JC1 A;  1GT8 A;  1WC3 A;  2VOO A;  3RJM B;  5KT2 A;  3EPG A;  1UJ6 A;  5DG7 A;  5KFC A;  3MM9 B;  1YTY A;  2R8G A;  5BXI A;  3T1A A;  4DV0 J;  2QA4 S;  1VJQ A;  4KGX B;  2W01 A;  4QPX A;  1KLM B;  3A8K A;  2PGC A;  4K8R A;  4OQJ A;  2VKR A;  1ACM B;  4IRD A;  2VPZ B;  2OGU A;  2RF2 B;  2B4O A;  4I69 A;  4WZM A;  4YQW A;  3ISN C;  3OHB A;  4KKO B;  3G8S A;  1MN9 A;  3HZG A;  4DPY A;  5HI7 A;  3GIK A;  4OLP A;  4RPF A;  3AB4 B;  1Y11 A;  4YOE A;  3W65 A;  4DQR A;  4FP9 A;  3HHL B;  1BQM A;  1IBK F;  5G0R B;  3TZY A;  5A6P A;  2E1M C;  2C2R A;  2H4Y B;  1CJV B;  4W4M A;  4A46 A;  3CCS S;  2O1P A;  3TOQ A;  3PCO B;  3TYT A;  1TK5 A;  4ICL B;  3CT9 A;  3SDE A;  2V8V A;  4FF4 A;  4OIX A;  4DU8 A;  3H5Y A;  1X5T A;  5J1P A;  2GV1 A;  5M2P A;  3KMS A;  4AQY F;  1VIS A;  3LGN A;  2NCK L;  4BHQ A;  3H5X A;  4FVC A;  5C25 B;  1KP6 A;  4DV7 J;  2DIS A;  4AL6 A;  1MSW D;  8RUC A;  1O6X A;  5HAO A;  2PFF B;  4KGZ B;  3CJ5 A;  5HVG A;  3H5S A;  1XJW B;  2WW8 A;  3DOL B;  1OMS A;  3M6U A;  2VF3 A;  3BGR A;  1LXN A;  3V6J A;  2J6S A;  4ETZ A;  2M0G B;  1FES A;  2AU0 A;  3FRZ A;  1RT4 A;  3GR0 A;  2FYX A;  4F7V A;  2E29 A;  2LEP A;  2W4C A;  3LAM A;  2G2Y A;  4NOH A;  2VIC A;  3WDO A;  1BWE A;  5ETP A;  3N9U C;  4M5H A;  3KHH A;  4DL6 A;  3VGV A;  4OX7 A;  3LWM A;  4LF5 F;  2EK1 A;  4UZC A;  2UVU A;  3GG1 A;  4H4O A;  3E2E A;  3OTO F;  1RGV A;  2DY9 A;  4V1A k;  5EX0 A;  2EG1 A;  2M2B A;  1NKE A;  3O44 A;  4J9N A;  4RW4 B;  3Q8S B;  3FEZ A;  3RW6 A;  3GFZ A;  1S1T A;  3TA2 A;  5D0H A;  3IC1 A;  1WOP A;  3K0J A;  2Y0S D;  3P5B P;  4KGM A;  4QWA A;  1RT3 A;  3U02 A;  5B0D A;  2EFG A;  3LA0 A;  3QNW B;  1UMJ A;  4ZVP B;  3T6J A;  2LA4 A;  4CLZ A;  1S9G B;  2XZD B;  1TL7 B;  4IR9 A;  2WVE A;  2EXU A;  1T3O A;  1QD1 A;  1I1G A;  5BR8 F;  4FBT A;  3NWG A;  2BQR A;  4ED7 A;  3R9L A;  2UU9 J;  4C8N A;  2HHP A;  1NPK A;  2ZDO A;  3TJ8 A;  2MZS A;  4A48 A;  3D68 A;  2Z2Z A;  3GFX A;  2KG0 A;  2CPJ A;  1QJH A;  3NRB A;  2ROP A;  4TQR A;  2OTL S;  3OBI A;  4KYZ A;  1H7W A;  3QSI A;  5GMD A;  2HNY A;  4IO1 A;  1EKR A;  3RRH A;  2I2Y A;  1WEX A;  1S1U A;  1WOS A;  1IVZ A;  3UCZ P;  4YEA A;  5KG0 A;  1F3F A;  2CZV C;  5B0B A;  3U1N A;  2RS8 A;  1NJY A;  5F8L A;  1M5K C;  4EK2 A;  4UUX A;  5K8P A;  1N33 J;  5D0E A;  2GO9 A;  2F9J A;  4E0D A;  1F1B B;  4IG3 A;  4F8R A;  3AQO A;  1RT1 B;  4ZCL A;  3IWL A;  1VQ7 S;  1JLF B;  3J7Z 5;  2EKY A;  1BQM B;  3DMJ A;  4ZKA A;  4WZQ A;  1EKS A;  4IQX A;  1XK8 A;  4C8O A;  1FER A;  3WIU A;  5I42 A;  1T95 A;  2FGO A;  3AD8 C;  3PRB A;  1JMT A;  1P27 B;  5A8K A;  5K14 A;  3CCQ S;  1YK9 A;  1R0A A;  2AV5 A;  5DRK A;  1RHU B;  4B9L A;  2XMK A;  3SDE B;  4K0K J;  3IR6 B;  4QIE A;  2J7U A;  1RT5 A;  5KOX A;  1I94 J;  4F2S A;  4KHM A;  5HN0 A;  1AYE A;  2NRE A;  2XMU A;  2H51 B;  5C24 A;  1P8G A;  2BE7 D;  4OI0 A;  1X9W A;  1XNR J;  2OJ3 A;  3CDE A;  3V6K A;  3MAA A;  4C8K A;  2YH1 A;  1ZTT A;  3RBZ A;  5EX3 A;  3BGR B;  4OV6 A;  3QGI A;  3KHR A;  3KLV A;  2D41 A;  1QVF R;  2HGN A;  1RWN B;  1RE1 B;  3UE2 A;  4DUZ F;  4ZMM A;  5LSL A;  3CUL A;  4UST A;  2HHS A;  4QJV A;  1WDT A;  2OTJ S;  2MKI A;  3PG9 A;  2QFI A;  3OXL A;  4KRW A;  3MMB B;  4FBU A;  4I2Q A;  5IC4 B;  1Q8B A;  4OJG A;  2WVC A;  4K5R A;  4A4J A;  2QYG A;  2HZA A;  1PBU A;  3KK3 A;  1ZTW A;  1FKP B;  3KJF B;  4H4O B;  1IBM F;  2A2D A;  2HPU A;  3FJ2 A;  4OL8 A;  2QLX A;  3RAM A;  1TAU A;  2BW7 A;  2MZT A;  5M2R A;  4DX8 H;  3CD6 S;  4DFM A;  2A1B A;  3POT A;  4R25 A;  5D4P A;  3OUY A;  5GVQ A;  1S1T B;  3UVJ A;  5IM0 A;  3SFG A;  4PYA A;  2D69 A;  3H40 A;  2J5A A;  3OVA A;  1K0T A;  1HBM A;  1WHV A;  4ED3 A;  4DZD A;  2W2O P;  1FTR A;  4DN9 A;  3MMC A;  1DRZ A;  2DR9 A;  4NXN F;  3DHW C;  4J9P A;  4X65 F;  1P1L A;  4UOH A;  3MUR P;  2OLW A;  4LF1 A;  1FVQ A;  1C1B A;  2IM2 A;  4AL7 A;  2CPF A;  5HVF A;  2BAB A;  1SC6 A;  3KLF B;  3SIP B;  2D3U A;  3NGU A;  3K8V A;  2M8D B;  3TVY A;  3DM2 B;  5HAN A;  4GC6 A;  1REV B;  2A6M A;  1TTH B;  3AA9 A;  3BR8 A;  5KG1 A;  1N34 F;  5AJ3 J;  1UW4 A;  2CZ9 A;  5KFB A;  3JTP A;  4W92 B;  2PC6 A;  1J5O A;  1KTQ A;  3KNG A;  1RTJ A;  1OYD A;  2MPU A;  2ZHO A;  2J0W A;  5GAE I;  2VB6 A;  2HNY B;  2HBR B;  1TP7 A;  4YY3 F;  3PW4 A;  1JLG A;  4HHJ A;  4P71 A;  3GYG A;  1S1U B;  2E5G A;  5CD4 A;  1WUU A;  1J5E F;  1FRH A;  3BRE A;  3VZH A;  5AXM A;  1GNK A;  4IG3 B;  5EWF A;  2W2M P;  2ADB A;  4K5S A;  3T1H J;  2ZJR Q;  2W8L A;  3IA0 A;  1N88 A;  3DMJ B;  4JI2 J;  4MTP A;  3MR3 A;  2HNZ B;  4XIU A;  3EWG A;  3CD5 A;  3UD3 P;  2MLX A;  3MM8 A;  4HVZ A;  3GJT B;  5A8K B;  3A4T A;  4JI0 J;  4WF9 Q;  3LGM A;  1UWB A;  2C3U A;  4FYY B;  3VAI A;  5ITH A;  5KFY A;  4O3Q A;  3D0I E;  3Q24 A;  4JI7 J;  4X4V A;  4O0I A;  4O0N A;  4QWE A;  2QGF B;  2HVI A;  2KFN A;  2O67 A;  1U6F A;  4ZIW A;  1HNX F;  1RAB B;  4NLD A;  2C3O A;  3MAA B;  4M5G A;  4N8O A;  2ZZT A;  5EHH A;  1M90 T;  1HPZ A;  1WDD A;  1ZH5 A;  3DRP B;  3VAK A;  4BLG A;  2R7S A;  5HVH A;  2XWY A;  2HAF A;  4UOC A;  2XGQ A;  3M7V A;  2V2Z A;  5KFE A;  4Y34 A;  1SKS A;  1HBO A;  2E9R X;  3ZNU A;  3BQ0 A;  5C2G A;  3HD2 A;  2N3O A;  1WNE A;  1M1K T;  5I3U B;  4FYD A;  3NNH A;  2WSF C;  3L3C A;  1PJ7 A;  2VFS A;  2XMT A;  3CCL S;  2I5J B;  2HLU A;  5E3A A;  1FFG B;  1HNW F;  1K0V A;  1LWF A;  5FDL B;  4RU2 A;  1N54 B;  3KK3 B;  1G4C A;  3IG1 B;  5HQL A;  3J7Y I;  1URN A;  1X7V A;  4IH7 A;  4ZVO B;  4ZPA A;  4JI1 F;  3POT B;  2B4U A;  3OUY B;  5I3P A;  3UVJ B;  1AB8 A;  3OTE A;  4DV3 J;  5IM0 B;  2M70 A;  1U0S A;  1HBM B;  2X3D A;  3AJ2 A;  2HND B;  3T5J A;  2MQM A;  2QT7 A;  4USH A;  1YJV A;  1Q7Y T;  4EO8 A;  4AXI A;  1CLF A;  5D0G A;  1YJ9 S;  2LCW A;  3MEE B;  3Q8Y A;  1S77 D;  3VCD A;  4HEA 9;  4ZJL A;  5D4O A;  3R5J B;  2ZOF A;  2AWZ A;  4B02 A;  4Q44 A;  1H2T Z;  1NO8 A;  1T02 A;  4OHV A;  1WD6 A;  2VPX B;  1F5C A;  1HBU B;  1N36 F;  2DPJ A;  4C11 A;  1U48 A;  2MYF A;  1IBL F;  4PXD A;  3FC9 A;  3NAH A;  3RBX A;  2LQ5 A;  2K2P A;  4ZVR B;  5DGA A;  2LLZ A;  3FVY A;  2DD8 S;  4F67 A;  5C7P A;  3CNQ P;  4A8O A;  2VZ9 A;  1JLG B;  3FBE A;  1UP1 A;  4CLP A;  2ZH7 A;  1OPI A;  5LSO A;  1B4S A;  3FBB A;  3PYE A;  1LW2 A;  1MLA A;  2C2M B;  4G65 A;  1QAI A;  4PUO A;  3SZ2 A;  2OEK A;  2L9D A;  4X4S A;  3VAL A;  2BKN A;  1W26 A;  2CDR B;  3NNA A;  1V9O A;  1DTT A;  2DNY A;  2XZW A;  3M1V B;  3Q89 A;  1M1G A;  2BA9 A;  4J9S A;  3MM8 B;  3KK1 A;  2AGO A;  1YGY A;  2AF6 A;  3M8Y A;  1TU0 B;  1VDH A;  1TZ0 A;  4WKY A;  2BE9 B;  1DTQ B;  3W8G A;  4L74 A;  3FCW A;  2RIL A;  2QG9 B;  1KDN A;  3QT8 A;  4XDC A;  3ZZO A;  1UWB B;  1B64 A;  1FTC A;  2DHG A;  2J9E A;  4B3T J;  4FYX B;  4WKR A;  4LR8 A;  1XWL A;  2CWX A;  5KFM A;  2GMJ A;  4QZV B;  4LQ3 A;  2C3Y A;  5E41 A;  3V6D B;  2VG7 A;  1YLX A;  3R1L A;  4GVB A;  2VQF J;  1Q8L A;  1VC6 A;  4DX7 A;  2HFV A;  1DQ9 A;  2B9E A;  2ZM6 F;  4FF3 A;  4USI A;  3BEG B;  5DS7 A;  3MUV P;  3CCZ A;  1FCA A;  1M1H A;  3HVT A;  4Q43 A;  5LOQ A;  1FJG F;  5FD1 A;  5LMN F;  1BMQ B;  4NWB A;  5KFH A;  3NNC A;  3QQC D;  4OHX A;  3DDN A;  1NBE B;  5E2Q A;  2F4F A;  3HJF A;  2YKN A;  3K7R A;  3CMQ A;  3MDF A;  1XNQ F;  1HBO B;  2AEJ A;  2OPQ A;  2VFU A;  4Y28 C;  1ITP A;  1GXL A;  3EE3 A;  4WP8 A;  4JI5 J;  1KVK A;  3CD7 A;  3ZZT A;  1HNZ F;  2G1D A;  4AT1 B;  3QT6 A;  4USM A;  5CHC B;  4B3O A;  2YNF A;  3P96 A;  2VOD A;  2V2Q A;  1VQ4 S;  2HS4 A;  1VRU A;  2OSQ A;  5F3Z A;  2ERR A;  4OI6 A;  1BUX A;  2B51 A;  4ZJQ A;  2XSF A;  4ZVG A;  4A47 A;  3R3T A;  4YB6 A;  4DR1 F;  1N5Y B;  1HMV A;  1N8R T;  1CSJ A;  4FZV A;  5C2C A;  1D8Y A;  3H0P A;  1IWA A;  3UR0 A;  3MTJ A;  4NI2 B;  2HQD A;  3NOG A;  1LW0 A;  2V8H A;  3KLG B;  2ZC4 A;  1G6B A;  1OS5 A;  2ZD1 A;  3M6V A;  4QR1 A;  4MK8 A;  4C11 B;  1DAR A;  4ZIT A;  4H4M A;  4ZHR A;  1XIQ A;  1TMJ A;  3MEG A;  3TJA A;  2YH0 A;  4IH6 A;  3DRX A;  2AZ1 A;  2ZUA A;  2BBE A;  4ES1 A;  2MY7 A;  1CS4 B;  4XTT A;  3OVB A;  3CMA S;  2OO4 A;  3OTC A;  2NR0 A;  1B0P A;  5LL6 d;  3CIZ A;  4IKA A;  3CJK A;  2VQE F;  3J7A 1;  3ILJ A;  1UPP A;  3LTO A;  2BOP A;  4DV6 F;  1GX5 A;  4WCE Q;  2E1C A;  4KBI A;  1V6H A;  3VVU A;  4J37 A;  4WTO B;  5IQ6 A;  4A8X A;  3TA0 A;  4EU0 A;  2DR7 A;  4I2P A;  4XDD A;  3KK1 B;  4KHP J;  3SYZ A;  3AH6 A;  2KH9 A;  3M9O B;  4FXD A;  5DLG A;  4V19 J;  1HHS A;  5ETN A;  1SL0 A;  3CO0 P;  2R9L A;  3MM7 A;  4D3H A;  2YBV A;  5F8H A;  5HO4 A;  3MFH A;  4KR0 B;  4F4A A;  2UUA F;  1Z2Z A;  4NLR A;  4OYZ A;  2VPW B;  1KD1 T;  4RW8 A;  1RAA B;  3TX0 A;  3MOZ A;  1AXQ A;  2VG7 B;  2HVH A;  1RAJ A;  5AT1 B;  4QBU A;  1T9U A;  1HLW A;  1YJU A;  2ZE2 A;  3QBC A;  1DHM A;  4RZR A;  4LFC F;  3MR5 A;  5IQQ A;  3H8Y A;  4K4Z A;  3MM6 A;  1X4B A;  3I0R A;  3D2W A;  4DR7 J;  2Y9H A;  2WON B;  2CPI A;  3W5Y A;  2O5D A;  3HVT B;  3Q8P B;  1SH2 A;  2DH7 A;  1U1K A;  1IR1 A;  4PG5 A;  3M9M B;  2ZNY A;  1ULR A;  2YKN B;  4YDD B;  2BJD A;  4E8U A;  1U02 A;  2JNJ A;  4ZPC A;  1TK8 A;  1AFJ A;  3VTI A;  2OPQ B;  1LWC A;  1QLN A;  4O3O A;  4DV0 F;  4IQM A;  4ZVQ B;  2WAQ D;  5B7W A;  1VOM A;  1D8Z A;  5HSP A;  2OUG A;  3A13 A;  3TEG A;  3DLG B;  2MKY A;  4NLX A;  3D5M A;  2X3G A;  3T9Z A;  1LNQ A;  3DRR A;  3MR2 A;  2V2K A;  5A0Y B;  3MPW A;  1H73 A;  3BR9 A;  2LVW A;  2I0X A;  1PKU A;  1PYT A;  3M8S A;  1VRU B;  3N6L A;  5ETQ A;  1UVN A;  1TKD A;  3OL7 A;  2ZKU A;  4RW9 A;  2JSX A;  2QLJ B;  3L95 X;  3OTB A;  5LMU J;  3NS7 B;  2HYI B;  5DO2 A;  3DCA A;  3R7S B;  2B9Y A;  2G13 A;  3GYN A;  4C48 A;  3H2V E;  5L1K A;  2MKC A;  3QO9 A;  3L09 A;  3ZTR A;  1NZ8 A;  1S4E A;  2HFZ A;  4Y2C A;  3U27 A;  1HMV B;  1KHW A;  5A8W A;  1HYS A;  1LWE A;  3S6E A;  4OJH A;  2XMJ A;  1YZ7 A;  1L3K A;  3M2V A;  2IA0 A;  4ANE A;  3FZB A;  2PII A;  1WF0 A;  3P49 B;  3OTD A;  4DPX A;  2I38 A;  3KJV A;  4TLR A;  2L9N A;  4FNI A;  3GE9 A;  4B3M J;  4F4W A;  2XI3 A;  2FC9 A;  3R2D J;  2QFJ A;  2DHH A;  2ZD1 B;  4DV7 F;  1DAX A;  2VL1 A;  3CJQ A;  2W4D A;  1NKB A;  1WKJ A;  4E98 A;  4ZHR B;  3RAQ A;  3DOK B;  1OY8 A;  3UDE A;  1PYS B;  2ZVI A;  2FPH X;  2CPY A;  4F4X A;  3W2W B;  2BJ7 A;  2FJB B;  1VRT A;  2QEX S;  4M8L A;  3ISZ A;  4N5S A;  1N52 B;  3FK4 A;  3PJX A;  2XLI A;  2XY5 A;  2V9K A;  1F0X A;  4EZ9 A;  1KC8 T;  5C5J A;  4QW9 A;  2APO A;  3ITH A;  2C3P A;  2GIR A;  1JKH A;  4ITS A;  3CJ4 A;  3M2U B;  4PRF A;  1OSD A;  1U1N A;  4MJK A;  3ENV A;  3TAM A;  4N41 A;  3P4U B;  1KN6 A;  3W66 A;  1VBK A;  5MLC V;  5GAE U;  4PG7 A;  4TXS A;  4JB8 B;  4K4T A;  1BQX A;  2ZOM A;  3MM7 B;  4YR2 A;  1QAX A;  5BYQ A;  2NXE A;  1JK9 B;  4CI0 B;  3M8R A;  3CCV S;  3PO5 A;  4Y2M A;  3CXC R;  4KT0 C;  3V5R A;  4U9R A;  1FNX H;  1Y7P A;  4ALZ A;  3CDA A;  2HHX A;  1KHV A;  5KT4 A;  2VG5 A;  3I0R B;  4GKJ J;  3GCX P;  2DNQ A;  2AGQ A;  3B78 A;  3ILO A;  2DGS A;  5HK4 A;  2F9D A;  4OZ2 A;  4FDF A;  1WJ9 A;  1EZZ B;  1H72 C;  4ZOS A;  1NKC A;  1VQP S;  2PO4 A;  2CPE A;  3C3L A;  1Y5L B;  2BJ1 A;  2UU9 F;  3OR2 B;  2VBW A;  3Q8U A;  1JJ2 R;  2YWK A;  3IFE A;  2MQN A;  3R27 A;  2EG2 A;  2LDY A;  1RA6 A;  2N4C A;  4TYA A;  3VAF A;  2B6A A;  2N4D A;  2CRL A;  1P6T A;  4Y6I A;  3T1Y J;  3DI6 B;  4TLQ A;  1JIH A;  2ZDP A;  3NCP A;  4TY8 A;  4G1Q A;  2N82 B;  3VF0 B;  3PYD A;  3IM8 A;  4ZPD A;  3RR8 A;  1N33 F;  2B7B B;  1VQO S;  1JLA A;  3MMA A;  4CLF A;  1KSP A;  1WC4 A;  1O51 A;  3C66 A;  1EET A;  2XYP B;  4ECQ A;  2NQP A;  2UUW A;  1L5U A;  1EJ7 L;  1S7I A;  3NOC A;  5KFS A;  2BAN A;  3D6F B;  4ECS A;  3QO9 B;  2GZO A;  1HBN B;  3SV4 A;  1ZA1 B;  4IDK B;  3G82 B;  1A6L A;  5L9N A;  3DLE A;  1X0P A;  3UD5 A;  1RKJ A;  4ZLJ A;  2CWK A;  3OW2 R;  1YJR A;  5CYM B;  4DSJ A;  3G6Y A;  4K0K F;  2R7Q A;  1OSC A;  2YTC A;  3J7Y U;  4W98 A;  3KJV B;  1TVR A;  4TKT A;  2ZH9 A;  2V8P A;  4DV5 J;  3AOD A;  2KB2 A;  5BYR A;  1EAY C;  3M2R B;  1SH3 A;  5T41 A;  3HO1 A;  1U6Z A;  3MCO A;  3QGH A;  1SC4 B;  3TUZ C;  4C2M A;  1XNR F;  5CZX A;  1VLY A;  4RNN A;  2ZBR A;  4AND A;  2F63 A;  1P9Y A;  3BGU A;  2BEF A;  5KAK A;  2HGM A;  2VG6 A;  5L1J A;  2ZWO A;  1ZM2 A;  4LMZ A;  2YNI A;  3WX4 A;  3W9J A;  3PX6 A;  2OPP A;  4CTA A;  1YIJ S;  1YBT A;  3EYZ A;  1QY7 A;  2IVY A;  2X1B A;  2GQQ A;  4DCO B;  4LRC A;  5IOL A;  5DJB A;  3BBF A;  2DRA A;  1MNE A;  3ITH B;  1JKH B;  1U2F A;  4USK A;  5KFV A;  2VON A;  2HKE A;  4LR9 A;  2ZHB A;  1FDD A;  2QIF A;  4USV A;  3TAM B;  4Q0B A;  3TNV A;  2QA1 A;  4CZC A;  2QN6 B;  2EW9 A;  2WTF A;  2F3J A;  4WTY A;  4O3P A;  1SUQ A;  3TAP A;  1YRX A;  1UZD A;  4P7V A;  3SSQ A;  2KM8 C;  2UVR A;  4FPR A;  4NMX A;  2HSE B;  4PAB A;  3HDS A;  3CCU S;  5T7L A;  1JWW A;  3EGN A;  3BO3 A;  2LKZ A;  2IJR A;  3I5C A;  2ZZN A;  3A8E A;  4URG A;  1D3W A;  2AZ3 A;  2JVO A;  1TL4 A;  5B0G A;  9RUB A;  2J0S D;  1NK7 A;  4HT5 A;  1MRO B;  2RHQ B;  2CVE A;  3W5X A;  4QR2 A;  2V63 A;  1EHW A;  3C6U A;  4A8W A;  3HFZ B;  3US5 A;  2Z2Y B;  4JUZ A;  4CO2 A;  2VFT A;  3IGV A;  1NK0 A;  2ASL A;  1G1X A;  1TKZ B;  5AJ3 F;  1YJ7 A;  2K7J A;  4M94 A;  2PT0 A;  4KPY A;  3KUG A;  1CVJ A;  1Q7L B;  3N6M A;  2DTJ A;  3CDW A;  4C8L A;  2B6A B;  3THP A;  4ETX A;  4A8Y A;  1DY3 A;  4CM0 A;  4HHH A;  2JJ4 D;  1N6Q A;  1BQN A;  2R7V A;  1NB2 A;  4O23 A;  4NLW A;  4DXL A;  1JLB B;  1S57 A;  3GON A;  3IBW A;  1IM6 A;  1NUE A;  2FVQ A;  2PFD A;  2JLG A;  3MMA B;  1S79 A;  3A12 A;  3HX9 A;  3GZ7 A;  3T1H F;  2RRA A;  4GO5 X;  4UF4 A;  2HBY B;  4Y00 A;  2PI5 A;  2BAN B;  2BOA A;  4M5K A;  1AZS A;  2JX2 A;  4JI2 F;  2VOP A;  1CC7 A;  2GW8 A;  1NK9 A;  3QWP A;  3T19 A;  2WSE C;  1HQE A;  5F8G A;  3DLE B;  2CJA A;  2ALY B;  4JI0 F;  4F3O A;  3AD9 C;  3IR5 B;  2KN4 A;  4WWS A;  4CO0 A;  7FD1 A;  2EC0 A;  2KM8 B;  1RAE B;  4JI7 F;  3RB4 A;  3MF5 A;  4P2S A;  4ELV A;  1TVR B;  2MEW A;  4ED4 A;  2QA4 G;  4MIB A;  2Y0B B;  2FHJ A;  3RYL A;  4RU9 A;  3R2C J;  3HVR A;  1LV5 A;  1ZAW A;  5CA5 A;  2YKM A;  4WII A;  2EFP A;  2LYV A;  4DL0 C;  4IUF A;  2YNI B;  4C0H A;  1N56 A;  4RW7 A;  4N76 A;  4CTA B;  1YZ6 A;  2RRB A;  2H65 B;  1UVK A;  3BH6 B;  4MKY A;  4CNY A;  5K5M A;  2MQQ A;  3VZI A;  1SKU B;  3NG8 A;  4OJ3 A;  2ZUG A;  1RBA A;  1DLO B;  4IOA Q;  2OPS A;  4PEO A;  3IP0 A;  1LK5 A;  2YX1 A;  3GB0 A;  3C2P A;  2P9C A;  2ZNZ A;  2HHW A;  4DU7 A;  3HCX A;  4ZVE A;  5KG7 A;  4X65 J;  2PI4 A;  3ZZU A;  4MMO A;  4I6A A;  1N4L A;  1I3O B;  4P73 A;  3UO0 A;  3LWL A;  4IFV A;  4QR0 A;  2LXI A;  3BPS P;  2J9C A;  1TFY A;  3FQK A;  3HSD A;  1RAG B;  2KT5 A;  3OL9 A;  3DDI A;  4X4N A;  3MZI A;  4DV3 F;  3G8Q A;  4OX9 J;  1FRJ A;  2LEB A;  5F9L A;  1QE1 B;  1RWW B;  3OT9 A;  3M8Q A;  1IXK A;  4IYQ A;  5JJB A;  1OJ4 A;  4QQB A;  3X1L B;  4D3G A;  2KHC A;  1TV6 B;  4ZP8 A;  4RR5 A;  1NDC A;  3WIV A;  5A6W A;  4B9V A;  3MHY A;  4YR0 A;  1N48 A;  2KJV A;  2HQG A;  3EGW B;  3J81 U;  1SJQ A;  4QYZ K;  1RYR A;  1O5J A;  5E33 A;  4CT9 A;  2MXY A;  2KYZ A;  1RIS A;  2N7C A;  2D3Z A;  4A8Q A;  3GG0 A;  5HMX A;  4OI2 A;  5ETS A;  2RSQ A;  4ZCM A;  1N0U A;  2F65 A;  1SV5 A;  5JUM A;  3UN2 A;  1KEK A;  3K58 A;  4I1T A;  2CA9 A;  1BLU A;  3OJU A;  4P75 A;  5L39 A;  3THV A;  4HDG A;  1T03 A;  2V4R A;  3JB9 k;  2N7Y A;  1HI0 P;  1KWM A;  2UVW A;  3B6B A;  2HFO A;  2OPR B;  5HQM A;  1AZS B;  3QWU A;  4TYB A;  1WEL A;  1FNM A;  1S7H A;  1RT6 A;  2VBY A;  1HQE B;  5HMZ A;  1SKW A;  2IBK A;  3DRS A;  2RQK A;  3OV7 A;  1SIW B;  5D8H B;  2J0X A;  4Q8E A;  3PDN A;  4B3T F;  2RDJ A;  2HZC A;  3EXC X;  3R5A A;  3THT A;  2FIU A;  1WKK A;  2IRY A;  1WG4 A;  1N5Q A;  4U7U K;  1OIA A;  1DBD A;  2IYG A;  3OXF A;  5AXL A;  1XR7 A;  4U67 Q;  2VQF F;  4M1K A;  3QJL A;  4LUB A;  5AE3 A;  3DLJ A;  1F5B A;  5A8R B;  2OFG X;  1UVM A;  5KFP A;  3BSO A;  4PZV A;  3CE8 A;  1U7L A;  1R8P A;  3QRR A;  4JI6 J;  2HFS A;  3BB5 A;  4DI6 A;  1CQN A;  2ZBI A;  2KT3 A;  1S76 D;  2OH2 A;  1CEZ A;  2F4V J;  3W60 A;  1HD1 A;  5A2Q Y;  4AL5 A;  2DGX A;  2LXF A;  3PJ9 A;  4NLY A;  1XMO J;  2V5H G;  1FE0 A;  4JI5 F;  2ZH2 A;  1IKV A;  4LJM A;  3EXY A;  3NS5 A;  1NSK L;  2BJ3 A;  2W8K A;  1S4F A;  4LF8 J;  3QRP A;  4NLP A;  3W1Y C;  5EGY A;  4TU9 A;  1F2G A;  2J0Q D;  4S0M A;  2IAJ A;  3OD2 A;  4RBV A;  1I6J A;  1Q95 G;  1C1C A;  5HRO A;  1NLK L;  3MGJ A;  4QWD A;  3FGV A;  2CNK B;  3D6H B;  3SCL E;  4OYM A;  1FFW B;  1A0O B;  3CCJ S;  1IBL J;  1U1P A;  3SI8 A;  2JLE A;  1NME B;  2GMH A;  1U8S A;  2EFO A;  2P9G A;  3M8Q B;  3R5B A;  1SH0 A;  4DDF A;  2C2O B;  4HHU A;  2KJW A;  1RSC A;  5HJX A;  3K2Y A;  3N6N A;  1VQK S;  2HQC A;  1GMV A;  3C6T B;  2BUN A;  3C16 A;  2DH8 A;  1RTH A;  4LIR A;  4DCJ B;  3VAJ A;  1S10 A;  2DIU A;  1TAQ A;  4QOT A;  2CNO B;  1DUR A;  3QPI A;  4HH0 A;  2B4V A;  2V4J A;  2MMY A;  4DL4 A;  4F3M A;  1VQ8 S;  3NKY A;  5ADZ A;  2H1Y A;  2UUB J;  2DGO A;  4HYK A;  6FDR A;  2V34 A;  3D0H E;  3I56 S;  3WBZ A;  2WK4 A;  5KT7 A;  2ZBC A;  2GNK A;  3KOA A;  1QTN B;  3CIM A;  4KE5 A;  2QL7 B;  4M5M A;  3IRX A;  2KRB A;  5KFW A;  3RR7 A;  2YX7 A;  2HG4 A;  1SJF A;  1SI9 A;  4ZVF A;  2KXF A;  4EYH B;  4PWD B;  3D1O A;  3WZ0 A;  5EN1 A;  3MUT P;  4KIA A;  2H4W B;  1N0V C;  4OZ0 A;  2D7S A;  3G6V A;  1FJG J;  1VGY A;  1YJN S;  1NSP A;  2CJX B;  4KHP F;  2FJW A;  2BRL A;  1RT6 B;  5D3G B;  4X66 F;  1YJT A;  3HSJ A;  4P10 A;  1V3S A;  1EQ0 A;  2WSC C;  2R7T A;  3TZX A;  4RJV A;  2ZWP A;  4AXJ A;  1RCX B;  4KGK A;  3TZZ A;  1CC8 A;  4ES3 A;  2MGZ B;  1GK8 A;  5K8N A;  4F25 A;  2XY7 A;  2IBO A;  1GMW A;  2KFY A;  5FLX Y;  1FK9 B;  5E7O B;  1MWY A;  3MD1 A;  3ZFV A;  4RW6 B;  1XMQ J;  2PMW A;  4X62 J;  2PDA A;  4JV5 F;  3HHE A;  2U1A A;  3AOB A;  3BGF A;  2CPH A;  2HK2 A;  4DR7 F;  2W2Q P;  1U09 A;  2MZJ A;  4J9U E;  5JXS A;  3FSX A;  1VBY A;  2BQ3 A;  4PQU B;  1GH8 A;  1WF1 A;  2ZVS A;  1MW7 A;  3FBF A;  2GCF A;  3HHL A;  2DK2 A;  3D66 A;  2RNE A;  2DRB A;  5G0R A;  3GV7 B;  2X1G A;  5F9N A;  4LFB J;  1CJV A;  2AGP A;  3Q2S C;  4DEZ A;  4CO5 A;  4DPW A;  4CCH A;  1SL2 A;  4ICL A;  1HI1 A;  5DG9 A;  3EZU A;  2JHE A;  3JTN A;  3JS9 A;  1R8A A;  4GRS A;  2LA6 A;  2OD6 A;  2VC0 A;  1RHQ B;  2IAJ B;  3DU6 A;  3L9Z A;  2FZC B;  1S9E A;  1Q5Y A;  2P9E A;  1S1X A;  1C1C B;  2K3I A;  5KFU A;  4LIW A;  1FXL A;  4IOB A;  1YSJ A;  3HT0 A;  2XBP A;  4ELU A;  5CAB A;  3O2I A;  1RHR B;  5LMU F;  5BJR A;  4DX5 A;  3DOL A;  2V0N A;  2H5I B;  3IO1 A;  3DRY A;  4OZ1 A;  2DHX A;  3ZTO A;  4MIA A;  1ELO A;  1RTI A;  3Q2T C;  3TZW A;  2JEJ A;  4LFA J;  2A3J A;  2E7W A;  2PMH A;  3G8T A;  1XMB A;  4CH1 A;  3MCS A;  3GFY A;  3OXG A;  4AE5 A;  3LOU A;  5GME A;  2AJF E;  3UCG A;  1RTZ A;  3GIJ A;  4B3M F;  4IRK A;  1LK7 A;  2E7V A;  1TQL A;  1WI6 A;  1GMU A;  1VRQ C;  3AT1 B;  2K06 A;  3PO4 A;  2QLF B;  3VV2 B;  1M0S A;  1T9T A;  4F4Y A;  4MH8 A;  2NYI A;  2D74 B;  4M5I A;  2XZT B;  3PEJ A;  1MWZ A;  4XO0 A;  1VS3 A;  2WHO A;  4M5L A;  4EBE A;  4L6V 3;  1ZPV A;  4PYD A;  3JXO A;  3QZ7 A;  4QYZ J;  2EEY A;  3GWC A;  1Y5N B;  1Q81 T;  1X5O A;  1OY6 A;  3SSS A;  5DET A;  1HKA A;  2GFF A;  4CP5 A;  1R3N A;  1U1Q A;  4YP3 A;  3OLA A;  2L3M A;  3DGP A;  2HVZ A;  4CRJ A;  3TVK A;  3TUI C;  1TL7 A;  4MKB A;  2M3D A;  3NGT A;  2B9W A;  1ZZF A;  2UV8 A;  1Y0H A;  4HDH A;  4ECV A;  3CUN A;  4L73 A;  4HL9 A;  4NA3 A;  2HRU A;  3KK2 A;  2MLY A;  4O4G A;  1LFW A;  2I9S A;  1Q0N A;  1XER A;  1MU2 B;  1VBX A;  3RBE A;  3OL6 A;  5F8J A;  4ECU A;  1KR4 A;  4GKJ F;  1V3Z A;  2ATC B;  4CDI A;  1KKH A;  3BYR A;  4I64 A;  2DEI A;  1WI8 A;  1KFD A;  4LSL A;  3D6T B;  5IZH A;  1RT1 A;  1YG0 A;  4NPO A;  3PXG a;  3I87 A;  5DM6 Q;  2I6W A;  1JLF A;  3IS9 B;  1HHT P;  3QAT A;  3DC2 A;  4P2X A;  3BBB A;  2CJK A;  4NZ7 A;  2YQ3 A;  4TU7 A;  5AXK A;  2VHG A;  1RWM B;  1T7P A;  3OHA A;  2E9T A;  1HA1 A;  1FX4 A;  5E3C A;  1OY9 A;  3T1Y F;  4DR2 J;  2LP4 A;  3KLE A;  1S9E B;  1R8C A;  4DL3 A;  1S1X B;  4HT7 A;  2RQC A;  3AQP A;  3E3X A;  2AJQ A;  1NRK A;  5E3Q A;  2LXU A;  3M6X A;  1H98 A;  5E3P A;  3PYG A;  2E5J A;  3ZZZ A;  3H4D A;  4I0W A;  4LR7 A;  4FF2 A;  5E3R A;  4DMZ A;  3FQL A;  2RD5 C;  2IRU A;  4EUV A;  4C8M A;  4LF4 J;  4OYP A;  4RBU A;  4RUB A;  1F9F A;  1RTI B;  2YVS A;  5IWA J;  5GAD I;  5KFG A;  3RW7 A;  1Q79 A;  3MTK A;  1S6Q B;  2KVI A;  2W25 A;  3HVA A;  1Z2L A;  3MMB A;  2OI2 A;  3I9Z A;  2WBR A;  1RZM A;  2NXN A;  4DV5 F;  3CDU A;  2R7O A;  2Y3Y A;  3BF4 A;  4ZVS B;  3SEO A;  5RUB A;  3KXD A;  4BWM A;  4QW8 A;  4LSN B;  3ZNJ 1;  1FKP A;  4USJ C;  2OAU A;  3KJN B;  3KNA A;  4CWB A;  1K47 A;  4ZP9 A;  1S49 A;  1IJF B;  1VHF A;  1URR A;  4EEY A;  4RWW A;  4C3L A;  5E0O A;  1FRM A;  2V8G A;  4F0H A;  3F73 A;  1WEY A;  4WFB Q;  1KQF B;  4RLE A;  2V6A A;  3CSK A;  1YRU A;  3ETM A;  3FSI A;  2HEK A;  4IRC A;  2KFZ A;  4CYU B;  1NB7 A;  1OWX A;  3H25 A;  1U2C A;  2CAJ A;  3MED B;  1FHT A;  3D1H A;  2NXJ A;  3PR5 B;  1HFE L;  4DL2 A;  1T8E A;  1X31 C;  3RAX A;  1KS2 A;  4KV8 B;  4PPD A;  3DGP B;  4QU7 A;  2QSF A;  4F2R A;  3KLF A;  3EX7 B;  3MPV A;  3DM2 A;  3KKF A;  1REV A;  4P7T A;  5CAA A;  2B4P A;  5KG2 A;  4P9S A;  4QU6 A;  2ZC3 A;  2DXF A;  2FVR A;  5FJ4 A;  1HQ2 A;  4UUW A;  3BSA A;  4FXV A;  4ECX A;  2LU1 A;  2IVM A;  5M2U A;  2QO3 A;  1GX6 A;  2IJF A;  1VIO A;  1RWV B;  4ILL A;  1SKR A;  3FCV A;  1HNV A;  1SC3 B;  1R43 A;  4K50 A;  1EX8 A;  3Q0A A;  2MQ8 A;  3TA1 A;  4OV1 A;  1I5O B;  3KK2 B;  2MDA A;  1SB6 A;  4O4G B;  3BO2 A;  2R2U A;  2DGV A;  1FRI A;  4DCP B;  1R0C B;  1KVI A;  2KG1 A;  2ZH3 A;  3Q8R B;  2B5J B;  3I4P A;  3K17 A;  3SQO P;  2EI5 A;  3O1L A;  2W2P P;  2AIR B;  2F8H A;  4LSL B;  4OYB A;  5E5N A;  1VR6 A;  3QAU A;  2XQC A;  1TL1 B;  4WK3 A;  5A76 A;  2RH3 A;  4U7C A;  2GIQ A;  2FLL A;  3UNY A;  2HNZ A;  4KH1 B;  4ED0 A;  2OML A;  2RKI A;  1W2I A;  2B8P A;  5KFX A;  2E5H A;  2FLN A;  4M5N A;  3T5L A;  2VFV A;  3KJQ B;  1L3S A;  2A2C A;  2BJE A;  3VAG A;  4R5P A;  3KLE B;  2JRS A;  5DZ6 A;  3WC0 A;  4RNM A;  2XYG B;  3BGO P;  1PAU B;  3QFH A;  1JLE B;  4C7Q A;  3HKZ D;  6FD1 A;  4Y65 A;  4B9N A;  1V3R A;  1FA0 A;  3DRP A;  3ENQ A;  1NSQ A;  4PPZ A;  2Q43 A;  4OHZ A;  3OSN A;  1AUD A;  2RU3 A;  3GTY X;  2E5L J;  2NUH A;  4OZ3 A;  2VV5 A;  2DNM A;  2JOQ A;  3N79 A;  1TEL A;  3NY0 A;  2VDH A;  4UZB A;  4C97 A;  1S1V B;  3CJS A;  4QIV A;  2XMM A;  2UXB J;  1GXU A;  1B0T A;  3GP9 A;  5I3U A;  1UFW A;  4WXW A;  1O8B A;  1FDB A;  4CO1 A;  1JLQ A;  2I5J A;  4UY8 T;  5FDL A;  4DLE A;  2IC3 B;  4C6A A;  3PAC A;  2FC8 A;  2FJE B;  1Z4U A;  1DZ5 A;  2G0C A;  4Q8F A;  1R8B A;  3AY0 A;  3IG1 A;  2QRR A;  2QSW A;  3OFH A;  1Q82 T;  3RUB L;  3M4X A;  3CD0 A;  5HAT A;  3PRD A;  3LGH A;  2AP6 A;  2OD4 A;  4P2M A;  4F0M A;  1PIE A;  2FTR A;  4ZVT B;  5KG3 A;  4H54 A;  3CJ2 A;  1HWI A;  3I5A A;  2W9A A;  4K2J A;  1PO6 A;  4Y2K A;  2RVJ A;  2YWF A;  1WSV A;  2DIT A;  2HND A;  2DNK A;  2V8D A;  4EWT A;  3DXS X;  4J9Q A;  1NJW A;  3OSP A;  2HZV A;  2ZIT A;  3OFG A;  2X7I A;  4HI1 A;  1YX2 A;  3MEE A;  5CYJ A;  4I67 A;  3NL0 A;  3ADA C;  2NZC A;  4M5J A;  4UOG A;  3HMJ G;  2PMZ D;  5HLF B;  2FJA B;  4B3S J;  1APS A;  4AD6 A;  4KQZ A;  2F40 A;  1HBU A;  3M30 B;  1K73 T;  5B0C A;  3KFW X;  2YWG A;  4LRA A;  1HNV B;  1M5S A;  4J9L A;  4OX9 F;  1LEO A;  4Q2M A;  2XS2 A;  4ECW A;  2WW4 A;  4CLT A;  3AJ1 A;  1F9H A;  2GVD A;  5J2Q A;  2C1E B;  1TK0 A;  2BE2 A;  1R89 A;  2CG4 A;  1FF2 A;  1Y9O A;  5CYQ A;  2IIH A;  2LQJ A;  2CVI A;  1B3T A;  1BD6 A;  2Q6C A;  4C4W A;  5IT0 A;  1RJJ A;  2B9X A;  1RI7 A;  4ILM A;  2MTL A;  2P8I A;  3DDK A;  3ILL A;  3MMJ A;  2E1R A;  2CYY A;  4I7F A;  3M1V A;  2R7W A;  5H9F K;  2E9Z A;  3HD1 A;  2MB0 B;  3JYT A;  2L48 A;  2J8A A;  3HSG A;  3UN5 A;  1LQ9 A;  3FFI B;  3JSY A;  4YHH J;  3EDQ B;  4X4U A;  1EP4 B;  4WIQ A;  5KFA A;  2RKI B;  3QLH A;  4OHW A;  4JOU A;  3H98 A;  1DTQ A;  2XCP A;  3D3B J;  4DQI A;  4ID5 B;  4Y0F A;  4WE1 B;  3DHX A;  4OYW A;  2BV3 A;  3QJP A;  4C3K A;  4R5P B;  3G2X A;  1FDA A;  4LF7 J;  3V6D A;  1AA1 B;  4DSL A;  2M8H A;  2G9O A;  2KYX A;  3NGR A;  1WHX A;  3SSR A;  3A8I A;  3BS9 A;  3IR7 B;  4WXO A;  1YRT A;  1FEH A;  2FB0 A;  2VUG A;  2HQ3 A;  4RKU C;  3L7P A;  4Q2L A;  2FVS A;  2RQ4 A;  5GAH I;  2BDP A;  1SIZ A;  5K20 B;  2RDI A;  4WYW A;  3MAQ A;  2VFR A;  2IRX A;  2IM1 A;  2R2S A;  4GC7 A;  3TRG A;  2GGP A;  2UXC J;  2DGT A;  3CGI A;  2YQ0 A;  1G3O A;  3F44 A;  3LQV A;  3PHT A;  1JLQ B;  3LP0 B;  1UEV A;  1RXO B;  1X5P A;  1Y00 A;  2F8M A;  3LAK A;  3ZTP A;  3C15 B;  2W4P A;  1FWL A;  3K5O A;  2DR8 A;  1TUW A;  1X4H A;  1UA1 A;  4JI6 F;  4ES2 A;  1WC1 A;  2H54 B;  4RNH A;  3AOC A;  4O3S A;  1RT2 B;  1TL3 A;  2F4V F;  4Q5V A;  2AEF A;  3JSM A;  4Q45 A;  2C22 A;  1TFW A;  4DQQ A;  1K8A T;  2D3O R;  3TUJ C;  2WVB A;  2RUS A;  3JAM U;  4KO0 B;  1N5Y A;  3PKM A;  3MXH P;  1FJ7 A;  1XMO F;  4UW2 A;  3NXZ A;  1PCA A;  5LM7 E;  5D78 A;  4P6Q A;  4RNO A;  4J9M A;  4NXM F;  2GX8 A;  4LF8 F;  4NI2 A;  3PIO Q;  4LRE A;  4NA2 A;  4B9M A;  3SV3 A;  2CZ4 A;  4ZVH A;  4ZP7 A;  3KLG A;  2ILY A;  3HI9 A;  5HMW A;  2GC8 A;  2CIM A;  2Z30 B;  5L38 A;  2MLZ A;  5KTQ A;  4OJ1 A;  3I55 S;  3PW0 A;  2YKP A;  1C0T B;  2IA6 A;  5D77 A;  2DBB A;  4C8Z A;  4F26 A;  2ROE A;  4JV0 A;  1CS4 A;  4GMK A;  2GVD B;  5J2Q B;  1IN0 A;  4DFJ A;  4B9S A;  2BE2 B;  2QC3 A;  4OYA A;  5THW A;  3V4I A;  3IM9 A;  2DHA A;  3W7B A;  4K4W A;  1ZPW X;  1S0M A;  5CYQ B;  2VD3 A;  3DKD A;  1VK3 A;  5B08 A;  2NYH A;  2JH3 A;  3FRY A;  1D09 B;  1JLC B;  2ZOG A;  4N77 A;  5FLX U;  5B0F A;  3TW0 A;  4I7F B;  3W2V A;  2R8J A;  1XTZ A;  3JYT B;  3M6W A;  2DNO A;  3RGI A;  1E6Y B;  2CUY A;  3QLH B;  2UUB F;  5H9E K;  2Y1L B;  1H6K X;  2OMO A;  4EI2 A;  3TAQ A;  1RDR A;  2QX0 A;  1VI7 A;  3HFV A;  2M88 A;  1B7Y B;  3SQG B;  5ETM A;  1UL3 A;  3HP6 A;  1Q1K A;  1RHJ B;  2UXD J;  1SBR A;  2XS5 A;  1TUG B;  4NLT A;  1SQG A;  1Q4R A;  2E5I A;  1WOR A;  3E51 A;  4EGL A;  4Y3C A;  4DF4 A;  4ENO A;  1HNI B;  4CLL A;  3RRG A;  2RHS B;  5IT9 U;  5L8R C;  5DQI A;  1X4G A;  3FMB A;  2HWH A;  3K59 A;  3R1H A;  3D9B A;  1IUJ A;  1H38 A;  3AB2 B;  2WON A;  4YDX A;  2G4B A;  4X64 J;  3EVW A;  3ZXW A;  1RUS A;  2Y8Y A;  3B54 A;  3K5N A;  5KFQ A;  3OR1 A;  3CF5 Q;  3UN3 A;  1R6V A;  5KG6 A;  4DFP A;  2GAH C;  2GQ2 A;  2GGP B;  3VAM A;  3FZ2 A;  4G6V B;  4WPA A;  2RML A;  2DB1 A;  3EMT A;  4OZJ A;  3HJV A;  3CJ0 A;  4ZLN A;  3D3C J;  2M7S A;  3Q8V A;  2BJ8 A;  3LPY A;  2C28 A;  2HW3 A;  2DT9 A;  3EM1 A;  1G2E A;  3GCW P;  1X4E A;  1XMQ F;  2J6T A;  5HBM B;  4GVL A;  4X62 F;  3DLG A;  1O0P A;  3ET6 B;  5GAD U;  3OVS A;  3RRK A;  3CW2 C;  5A0Y A;  1NCL A;  1M5V C;  2YNH B;  4QIG A;  2VJU A;  4KHR A;  2B8Q A;  2BRK A;  4TVA B;  1TL3 B;  3TWZ A;  3DLK B;  1VQM S;  3JSM B;  1S0O A;  1D9A A;  4DUT A;  4LT6 A;  2POK A;  3EZ5 A;  1FRL A;  4LFB F;  4ZCK A;  4FF1 A;  4FYV B;  3ZZ0 A;  2XNR A;  3PHE A;  4U95 A;  1WHY A;  1DJ0 A;  1S97 A;  3HFK A;  2OEL A;  3W9I A;  1RBO B;  2YKO A;  2W9B B;  2DVI A;  3KDO A;  2BZ2 A;  4EBC A;  3SFU A;  5K9F A;  1VQ9 S;  5DLF A;  2AMC B;  4O3R A;  1T9Y A;  3R5C A;  3SCI E;  4JI8 J;  4AFF A;  3ZZP A;  3HKW A;  4NRT A;  4DL7 A;  3TAR A;  4WJB A;  1GAO A;  3E01 A;  1F2H A;  4GKK J;  2R42 A;  3AJD A;  4B3R J;  2LQ8 A;  4QIW D;  2AT1 B;  2KT2 A;  3V6H A;  4WU3 A;  3DOK A;  3HSZ A;  3GJR B;  2R4F A;  1HWK A;  1B0V A;  2HMI A;  2HIY A;  4EFA C;  2QMU B;  2V9W A;  3PRV A;  3W2W A;  3JTO A;  1WG5 A;  3M32 A;  3T9N A;  3MEC A;  1QUP A;  1IR0 A;  3FEY B;  3V4I B;  4LFA F;  5ETK A;  1PIL A;  1YVF A;  4ID8 A;  2DCL A;  5LJ3 Y;  2GHW A;  3PR4 A;  4QIF A;  2GJI A;  3QIP B;  3ZO7 A;  5F41 A;  1H74 A;  3EVO A;  4WFY A;  5J2P A;  4ECR A;  2XI2 A;  2F8E X;  1NJI T;  4ANC A;  2FZK B;  3UFC X;  3M2U A;  3ILI A;  4FVM A;  3G6E S;  4W90 B;  1CBK A;  3W2V B;  1R27 B;  3MWB A;  1U2R A;  1AT1 B;  3CED A;  4ZPB A;  4JI4 J;  2HQF A;  3LF0 A;  2HHQ A;  5F0U A;  2CJQ A;  2R3V A;  4X66 J;  4MIW A;  1HR0 J;  2WOM A;  4F0K A;  4NCA A;  2J9D E;  4K59 A;  4DUY F;  5H9F J;  2XO7 A;  1ZET A;  3CB4 A;  4NLG A;  3UD4 P;  3BYP A;  1GQE A;  2G2O A;  5FII A;  4BCA A;  2W9C A;  3GR1 A;  1IM4 A;  2LQ9 A;  1T9X A;  2Z2L A;  1U25 A;  2R8K A;  2LU2 A;  3W5Z A;  4JV5 J;  4DZ6 A;  5KFZ A;  1VFJ A;  1QTM A;  3JQM A;  2HRT A;  2QMX A;  5IFM A;  1RK8 A;  3OR1 B;  2XNQ A;  1FNO A;  3SBM A;  2FVC A;  4CO4 A;  4YN3 B;  3OR2 A;  3W64 A;  3UW1 A;  2FY8 A;  2AX1 A;  2DGU A;  2FHM A;  4NX9 A;  1VLO A;  5CCL A;  5K8M A;  4YB7 A;  3F56 A;  1SL1 A;  2BVZ A;  3QFW A;  3QSY B;  1U6B A;  5AE1 A;  1S5Z A;  4X2B A;  4J91 A;  5GAG I;  3PX4 A;  3CC4 S;  1KNZ A;  3J80 Y;  4DHV A;  5KFR A;  3DI6 A;  2ZH1 A;  4KSE B;  4ZLL A;  4OYX A;  2KO1 A;  3CJT A;  4JV2 A;  2QLB B;  3UNG C;  4PXB A;  4J9O A;  4DR6 J;  2F7V A;  4NRU A;  3AAW B;  1KOO A;  2JFD A;  2J7K A;  3SXL A;  3OJS A;  2KL8 A;  2XMV A;  1V5V A;  2HIQ A;  3W62 A;  1BY9 A;  5LXR A;  2ROG A;  1RWO B;  1HBN A;  4YB1 P;  3D1Q A;  3J7Z T;  3H59 A;  2LEA A;  2UV8 G;  4IDK A;  3G82 A;  4NLS A;  2L9W A;  3F0N A;  4RUC A;  2K7K A;  4PG6 A;  3Q86 A;  2AYG A;  1IR2 A;  5CYM A;  1GTH A;  3G71 S;  4JV1 A;  3D28 A;  2HHT A;  1ZOT A;  1ICE B;  4DR2 F;  3AD7 C;  3CDB A;  4DS5 A;  4R0E A;  3M2R A;  3B82 A;  4K2X A;  2ACM A;  4DR4 J;  1UET A;  2XC9 A;  2DXD A;  4PQA A;  3N5F A;  1H2V Z;  3E01 B;  1P9Q C;  4L72 B;  2DNN A;  2RU9 A;  2WB4 A;  2DHS A;  2YQ1 A;  2HMI B;  2NUU G;  1CUL A;  1WC6 A;  4LF4 F;  3I31 A;  1QSY A;  3M32 B;  3AHP A;  3MEC B;  5KFK A;  5IWA F;  1TR0 A;  2B56 A;  3MM5 A;  3TR5 A;  1FJE B;  4FPI A;  5ETR A;  4C0B A;  3BQ2 A;  3OFF A;  5DDR C;  3W9H A;  3G4S S;  2C42 A;  5J2P B;  3FBC A;  5U47 A;  3N01 A;  1XR6 A;  4PXC A;  4J5O A;  2XHC A;  2V68 A;  1HQU A;  7AT1 B;  2CAD A;  1XEZ A;  2NLW A;  5J1E A;  3ZTS A;  2J8S A;  1PG5 B;  2OKQ A;  1RYS A;  2UUC J;  2CQC A;  4JYA J;  2C3M A;  1M5P C;  2LQB A;  4DSF A;  2FJD B;  3FUY A;  5KFI A;  2WOM B;  4ZIV A;  4O4R A;  3E8O A;  1ZYQ A;  3V81 A;  4WFA Q;  4HTI A;  1B7F A;  1F9E B;  2QL5 B;  1PGZ A;  5HJY A;  3KHL A;  1T9V A;  3MPY A;  4DQS A;  2HK3 A;  2W9C B;  2HWI A;  2DO0 A;  4LF9 J;  5H9E J;  1MRO A;  1T9W A;  1QSS A;  1RT4 B;  1UPM B;  4IG0 A;  2KXN B;  3QMQ A;  3H7H B;  3NGK A;  4MYU A;  1YI2 S;  1F6T A;  1P1T A;  2PA8 D;  3D0G E;  3Q23 A;  2DIV A;  1H7X A;  3UI3 A;  2IY5 B;  1TKZ A;  5IV3 A;  2W24 A;  1FKO A;  3DXB A;  1N5S A;  1J2V A;  4G3I A;  2DNG A;  3EVM A;  1VJW A;  4PXE A;  1ZA2 B;  1UVL A;  1VYA A;  1WC5 A;  1NDL A;  2HUR A;  5J2M A;  2Z57 B;  2HBZ B;  4FXW A;  4NEZ A;  2DPI A;  5KFD A;  5GAH U;  1JLB A;  2LDI A;  4Z37 A;  1VQN S;  1RAO A;  2Z4P A;  2DEJ A;  2Q6B A;  2GAG C;  2XMW A;  2W7A A;  2Z2M A;  2LMI A;  4LQ9 A;  3GMG A;  1UKU A;  3LAN A;  4BC9 A;  1RT3 B;  2DRD A;  2XWX A;  3A3P B;  2CQ1 A;  2BX6 A;  4KH0 B;  4R0J A;  2AJ2 A;  3JSB A;  1SJ4 P;  3N4W A;  3SMZ A;  2XLK A;  3G6X A;  2GQC A;  5EUH A;  1SQE A;  4G1I A;  3NGS A;  4OYI A;  2JEI A;  3UPF A;  1FWK A;  1C2P A;  4X4O A;  4OYO A;  2HHH J;  2AJ1 A;  3KLI A;  3GIM A;  2R2R A;  1KOH A;  2ABY A;  3ZZR A;  2HWT A;  3ULH A;  4YME A;  4RUA A;  3WHI A;  3HZE A;  5MAO A;  5KFF A;  4JI3 J;  1X5S A;  1GFW B;  2XCA A;  5IXU A;  4BC7 A;  3CWJ A;  4B9U A;  1VK8 A;  4OHY A;  3FCH A;  4IR1 A;  2UZA A;  1YIT S;  1S0N A;  5EWE A;  4J9K A;  2B3T B;  2KKH A;  1CUL B;  3PFE A;  3BQ1 A;  1RWU A;  1H0H B;  2JC0 A;  5LSR A;  3UDL A;  2FLP A;  2E5L F;  3MM5 B;  4Y2A A;  4DR5 F;  2COL A;  1G7C B;  2KVQ E;  1Y5I B;  3RZA A;  1WTF A;  2V94 A;  1DLO A;  2RDD A;  2ASJ A;  1OYE A;  2V69 A;  5DDQ C;  3K89 A;  1LFP A;  5I42 B;  2UXB F;  2OP5 A;  4C98 A;  3PW7 A;  5K14 B;  2XUL A;  1U8W A;  4DSI A;  2KZM A;  1R0A B;  4OLO A;  3TO8 A;  1HQU B;  3O6Q A;  1JXL A;  1WOO A;  1RT5 B;  5J1E B;  1VQS A;  3LP1 A;  2HBQ B;  3R6L B;  4WFX A;  4PAA A;  4ZP6 A;  2GML A;  5CZV A;  3GLJ A;  1FJC A;  1S99 A;  4HTJ A;  2KHD A;  1SQF A;  5C24 B;  4KPC A;  5L46 A;  1UAW A;  3EGV A;  3CCR S;  2MSS A;  4FNH A;  2EKN A;  1NK8 A;  3V81 B;  3BBC A;  4HR2 A;  2HRY A;  1QE1 A;  2VBX A;  3O3L A;  2ACY A;  5CXT A;  2OEJ A;  2A0F B;  4OX8 A;  1KQG B;  1RT7 A;  4MYT A;  3MUM P;  1C0U A;  1R7I A;  1N5V A;  5BYS A;  2XEX A;  3UCU P;  2VBZ A;  3VWS A;  3H42 A;  5CQG A;  3R7B B;  1FFS B;  4ZLP A;  4IG0 B;  1TV6 A;  3PTW A;  2BKO A;  4ZDN A;  4DV2 J;  4I2Q B;  2YKQ A;  4A8M P;  5KT5 A;  4B3S F;  3P6Y C;  4OZ5 A;  2O01 C;  3NBP A;  3KG4 A;  4BDP A;  3VQT A;  1FKO B;  3NAI A;  3K5P A;  3D7S B;  3X3U A;  3QYY A;  1YBA A;  1PBA A;  1R0B G;  2Y1I A;  4TN2 A;  2AHO B;  1S0V A;  3GV8 B;  2QTW A;  2PEH A;  1N5T A;  4FKY A;  4F50 A;  3CJ8 A;  3BDP A;  4ERD A;  2X1F A;  5J2M B;  2AJ0 A;  5HL7 Q;  1ZS6 A;  1K9M T;  1WWH A;  4ECZ A;  1Y10 A;  2IPO B;  2DH9 A;  4URQ U;  4KGV B;  1JXE A;  1T05 A;  1RWP B;  1SJ3 P;  5SZT A;  3MMC B;  4ER8 A;  1C1B B;  1C4C A;  3EPI A;  1T94 A;  5IV4 A;  2OPR A;  4F4K A;  1W7W A;  3I96 A;  5DM7 Q;  1HW8 A;  1NHK L;  4YHH F;  3JQJ A;  4DS4 A;  2PN6 A;  4ZVU B;  4AUK A;  2JEG A;  3VGU A;  2YWW A;  1IWG A;  1NJZ A;  1RAD B;  5AXN A;  2CQ2 A;  1ZM3 A;  3IWX A;  2CJY B;  3KLI B;  2XGP A;  1RKI A;  1J5O B;  2BM1 A;  3TX8 A;  1N32 J;  3H5U A;  4HH1 A;  4NLO A;  4LF7 F;  1RTJ B;  4YS2 A;  4NCG A;  1BXN A;  5KG5 A;  2DNH A;  1FT8 A;  3ONQ A;  4AYB D;  3LUY A;  5A8R A;  2NXU A;  3Q22 A;  1E6V A;  3D54 A;  4M63 A;  2CKW A;  3LPE A;  2CQ0 A;  4WYL A;  2DCU B;  4Z7Y A;  2DY1 A;  3VR1 A;  3T5K A;  2UXC F;  2DYA A;  4XPE A;  1HI8 A;  3P8B B;  4NZ0 A;  5KT6 A;  3ETO A;  3ZC4 A;  4WFZ A;  3HM9 A;  1X9S A;  2EFV A;  2D1C A;  3R5G A;  7FDR A;  1GTE A;  3Q83 A;  2DGW A;  3MAH A;  3LP1 B;  2OSR A;  3OQ2 A;  1HWL A;  1VMB A;  1UFK A;  2IMW P;  3TI0 A;  5CD4 H;  1U49 A;  3HK2 A;  4CIO A;  2MZQ A;  3IGN A;  3IBF B;  1PSD A;  2JVR A;  5B0E A;  1YBU A;  1JJC B;  3J81 Y;  2BXJ A;  5K8O A;  2DR6 A;  2FHK A;  3H20 A;  4PCQ A;  2C2E A;  1HPZ B;  3L4B C;  1TUV A;  3VVT A;  1PJ5 A;  2X51 A;  1RT7 B;  1C0U B;  1JXV A;  1QUV A;  3UDV A;  4TY9 A;  2RB7 A;  4IO9 Q;  3D67 A;  4FS1 A;  4Z7C A;  3C6T A;  3BKT A;  2FJX A;  5J2N A;  3QT7 A;  5B09 A;  3DYA A;  4NL5 A;  3I0S A;  2Q66 A;  2PEB A;  4I68 A;  2EPI A;  4RL1 A;  1LWF B;  4DOZ A;  3IN5 A;  2AX0 A;  1IBC B;  3NBP B;  1U1O A;  4X4R A;  3W8P A;  1JNZ B;  2DGQ A;  4LBP A;  4LF6 J;  2MKK A;  1AFI A;  1Q5V A;  2EVZ A;  4DV4 J;  4EBD A;  2HS0 A;  1T0T V;  4OZL A;  3WC2 A;  3IAS 9;  1BC6 A;  4CLS A;  5KFJ A;  3HT3 A;  3RB0 A;  4DN0 A;  1UEU A;  1HAR A;  3IMQ J;  4WK1 A;  4ZPT R;  1D9F A;  1ZBT A;  2DNP A;  5DGB A;  4TNO A;  1PAE X;  2AYM A;  4DR3 J;  4X4Q A;  3PV8 A;  5L9X A;  5HP1 A;  4EZ6 A;  1RU2 A;  1T05 B;  2QA2 A;  4PWD A;  2B7C B;  2MQP A;  1S9F A;  1S1W A;  2D3O 1;  2CG8 A;  1MN7 A;  1GEH A;  1F3V A;  4DL5 A;  2WZ1 A;  3CC2 S;  5D3G A;  2E1A A;  5GAG U;  1XC9 A;  4TQS A;  1UZH A;  2IMO A;  2CDQ A;  2UXD F;  2CFX A;  2DXE A;  4DV1 J;  2Y8W A;  1D0E A;  1OO0 B;  3AA8 A;  2NZ4 A;  3QID A;  2RE1 A;  3LW5 C;  2ADC A;  2MGZ A;  2FD2 A;  2MKS A;  1FK9 A;  1Q86 T;  3GQC A;  4NCG B;  1X4C A;  4K4S A;  4BWJ A;  2B43 A;  4RW6 A;  1HIY A;  3N0V A;  5LJ5 Y;  2R2T A;  3UWT A;  2KU7 A;  4WBF A;  4IH5 A;  1E6V B;  2A18 A;  2P6S A;  1RAH B;  1LW2 B;  3CPW R;  4A8K A;  4PUO B;  1NHV A;  4X64 F;  1KON A;  2BJ9 A;  2ZBQ A;  4PQU A;  3OL8 A;  1UTA A;  3EDR B;  1S6O A;  1DTT B;  2Q3P A;  1WC0 A;  5ETL A;  1K44 A;  1OPZ A;  3AFG A;  4MAK A;  3CTR A;  3VGT A;  2W7P A;  4ELT A;  1UVI A;  3HLU A;  2XMA A;  1F5A A;  2PE8 A;  2Z56 B;  5AE2 A;  2HFN A;  3MCN A;  1HW9 A;  3WX8 A;  2XB2 D;  2DNL A;  4CLW A;  2YKA A;  4NXM J;  2GO8 A;  2KRR A;  4CH0 S;  3SCK E;  3PFO A;  3GIR A;  3CCE S;  2GVZ A;  2MJU A;  2ZHA A;  2YY3 A;  2AKW B;  1VQ5 S;  3OFE A;  1B99 A;  4I4B A;  3MOJ B;  2NPF A;  4RO0 A;  2CXE A;  4NA1 A;  2AJ4 A;  1EIY B;  4GVB B;  1IQT A;  3ZTQ A;  4EMD A;  3H2U B;  2NS1 B;  2ZH6 A;  1ZAV A;  1QVG R;  3TP2 A;  1R6Y A;  1PJ6 A;  4YFU A;  1EAR A;  5D0R A;  4CNZ A;  2UUT A;  3VAH A;  2G0J A;  4NEY A;  4L76 A;  2DJW A;  1EQM A;  4CLY A;  2UP1 A;  1RU1 A;  5J2N B;  3DYA B;  3I0S B;  3R97 A;  1CJK A;  2J9D A;  2ZEJ A;  2J6U A;  1FXR A;  1LXJ A;  2IJN A;  4JI8 F;  3LP2 A;  3BH7 B;  2I1R A;  1W25 A;  1DFD A;  1REG X;  1U1M A;  3FMW A;  4GKK F;  2YWE A;  5EDW A;  3G87 A;  4B3R F;  3QAE A;  3VHQ A;  2D9P A;  4J90 A;  3M9N B;  4FYW B;  1NM2 A;  4GO7 X;  2VH7 A;  2KDO A;  1UW9 A;  4B3O B;  1RA7 A;  2YNF B;  3GYX B;  2PA3 A;  2RUG A;  4QWC A;  2F1F A;  3O5T B;  2MST A;  5CH7 B;  2GS8 A;  4QYR A;  1U4B A;  2AD9 A;  3O8W A;  2WRM A;  3NCR A;  1FDN A;  5HP1 B;  2D9O A;  5KFN A;  3ICL A;  4DQP A;  4XAK A;  1YWX A;  2H5J B;  3PW2 A;  3J80 U;  4XK8 C;  4H4K A;  1S1W B;  1K1S A;  3AXM A;  1VIX A;  3A8J A;  3HUL A;  4K4X A;  3B4M A;  4FN5 A;  1B70 B;  4K4V A;  2JL9 A;  1TMM A;  2VIH A;  4JI4 F;  1FO1 A;  1LW0 B;  1HR0 F;  2BMB A;  5GMK a;  4RX6 A;  4RWX A;  3NGD A;  4MKA A;  2CPZ A;  2XYH B;  3NS6 A;  2ZH5 A;  2YX4 A;  4H4M B;  2FHJ D;  2NSB A;  1Y3J A;  4N56 A;  3MPD A;  1TL5 A;  4ECY A;  3S1T A;  1NPP A;  3MEG B;  2HS3 A;  3KLH A;  2HVE A;  5IC6 B;  1VCT A;  1NEE A;  3IWN C;  4N7T A;  1IKW A;  4DLG A;  1MU2 A;  3W3S A;  5L1I A;  4I56 A;  4NML A;  5KOW A;  1RLD A;  1YDL A;  3CJK B;  3DN9 A;  3MR6 A;  2PD1 A;  3IAM 9;  3PJW A;  2KI2 A;  3G9C A;  2VA3 A;  3OLB A;  3QJJ A;  4V19 X;  5HMY A;  3BKF A;  3IS9 A;  3ZZY A;  2OIH A;  2RQM A;  2KXH A;  3TUP A;  4I2P B;  2H5E A;  1D9D A;  4EYI B;  3V2U C;  4L75 A;  5KFL A;  4H4K C;  4X4T A;  3PVX A;  3PW5 A;  4PKD B;  2YPZ A;  4ZPV R;  3M05 A;  3N5B A;  5D4L A;  2R7U A;  2QLW A;  2QZ8 A;  4L3K A;  1RWK B;  2VPY B;  2RIJ A;  2EFQ A;  2HLT A;  4NYP A;  1IKY A;  2GVZ B;  4NCB A;  3VQS A;  1RTD A;  4RW8 B;  4CLU A;  2XY6 A;  1YHQ S;  4C8Y A;  1CG2 A;  2IHR 1;  1RAI B;  3S7R A;  1OQ6 A;  2WVF A;  2ZFH A;  4DR6 F;  1HL6 A;  1S48 A;  3FSY A;  4U8V A;  2ZJQ Q;  1DQ8 A;  2VKZ G;  2ZE2 B;  4P2F A;  3RBD A;  3CJ3 A;  1FD2 A;  1Z1Z A;  2ZZM A;  5CCM A;  3MM6 B;  4URS A;  3EZO A;  4ZJO A;  3EUN A;  3GSI A;  3RG6 A;  4LBH A;  2ATL A;  4UT4 A;  4KC5 A;  1BE4 A;  4J9R A;  2BYC A;  4ZN3 A;  5T14 A;  1SVD A;  2IYI A;  1JB0 C;  1IQZ A;  4F3Q A;  4EO6 A;  2JZ5 A;  3MPU B;  4DBQ A;  3S8S A;  1U47 A;  2C2D A;  1IBK J;  1S6Q A;  1X4D A;  1KVJ A;  1LWC B;  2CQG A;  2MZ1 A;  2Y1J A;  1CJK B;  1X0F A;  3FDS A;  3HVW A;  5J1N A;  4DR4 F;  3LP2 B;  1FWP A;  4I6Y A;  1SCJ B;  1TKX A;  1KQS R;  2OHD A;  4USW A;  4LSN A;  5DG8 A;  2K8G A;  3KDN A;  1RWX B;  1A7G E;  4ATN A;  5H1S V;  2ZBP A;  4I6W A;  4AQY J;  3NLC A;  4LF2 A;  3DRR B;  1D1U A;  1RB0 A;  1MMN A;  1XQI A;  2R7X A;  2YWH A;  3MD3 A;  4ZN1 A;  2BM0 A;  4DUY J;  4RW9 B;  3FKB A;  2FUG 9;  3NMR A;  2MQO A;  5KT3 A;  4CYU A;  2JWN A;  4NZ6 A;  1EB0 A;  8ATC B;  3KTQ A;  4Z2X A;  1Q16 B;  2L08 A;  3MED A;  3W61 A;  3T41 A;  5A8W B;  1HYS B;  3HHK A;  1LWE B;  4OZN A;  3U1L A;  4O3N A;  1NU4 A;  1H2U X;  4UQG A;  3M2V B;  4KV8 A;  5IT4 A;  2F5G A;  1I94 F;  2K3K A;  1UVJ A; 
#chains in the Genus database with same CATH homology
 4UST A;  4WP9 A;  3C14 A;  4CLS A;  1CJT B;  4CM2 A;  3MR7 A;  4CLT A;  2GVD A;  1AZS A;  4WPA A;  1CUL A;  4CLP A;  4OYX A;  4P2X A;  1WC6 A;  1CJK B;  1Y11 A;  1YBT A;  4P2M A;  4CLZ A;  1YK9 A;  4OYM A;  1CJT A;  1U0H A;  1TL7 B;  3UVJ B;  1CJU B;  1AB8 A;  5D0R A;  4CLF A;  5D15 A;  1FX2 A;  1TL7 A;  1WC4 A;  3MAA B;  4USW A;  1YBU A;  4OYI A;  4NI2 B;  1FX4 A;  4NI2 A;  1WC0 A;  4OYO A;  4CLY A;  2BW7 A;  1CJV B;  5IV3 A;  1CJV A;  2GVZ B;  3ET6 B;  1CJK A;  3G82 B;  3ET6 A;  4CLU A;  4OYZ A;  3G82 A;  1Y10 A;  5D0G A;  4WP8 A;  3UVJ A;  1CJU A;  4USV A;  3MAA A;  4OZ2 A;  2WZ1 A;  4OZ3 A;  1WC3 A;  4P2F A;  3C16 B;  4CLW A;  4CLL A;  4OYB A;  3C16 A;  4CM0 A;  1WC5 A;  3C14 B;  4CLK A;  1CS4 B;  4WP3 A;  1CS4 A;  2GVZ A;  2QV6 A;  2GVD B;  4OYW A;  1AZS B;  5IV4 A;  4OYA A;  4USU A;  4OYP A;  3C15 B;  1CUL B;  3C15 A;  5D0H A;  2W01 A;  5D0E A;  3R5G A;  1WC1 A;  1U0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...