4P2MA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
169
Chain Sequence
RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase
publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 36
structure length 169
sequence length 187
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2mA00
5D15A 3UVJB 4WP9A 3G82A 4OYMA 4OYWA 4OYPA 5D0GA 5D0RA 1WC3A 1CJKA 1FX4A 1U0HA 3R5GA 1CJUB 4P2MA 4USWA 1CJVB 4USTA 3ET6B 3C16B 4P2XA 4NI2B 2BW7A 2GVDB 4CLFA 1CJUA 4OYOA 4CM2A 4USVA 1CULB 1Y10A 1TL7B 4WP3A 1CJVA 4CLPA 1CS4B 4CLTA 4CLLA 1YK9A 2GVZB 4CLUA 3ET6A 1WC4A 5D0EA 3C16A 1WC6A 1YBUA 4NI2A 4OYZA 3C15B 1WC1A 4USUA 2GVDA 2WZ1A 4OYXA 4WPAA 3UVJA 3MAAB 5IV4A 1CULA 1TL7A 1WC0A 4OZ2A 1CS4A 4CLWA 2GVZA 4CLKA 2QV6A 3C15A 4CLYA 1Y11A 3C14B 3MAAA 4OZ3A 1AZSB 4CLSA 1CJTB 4OYBA 4CM0A 5IV3A 4P2FA 2W01A 4WP8A 1AB8A 3G82B 4CLZA 3C14A 4OYAA 4OYIA 1AZSA 1WC5A 1CJKB 1CJTA 1U0HB 1FX2A 3MR7A 5D0HA 1YBTA
chains in the Genus database with same CATH superfamily
1UA0A 4ZLLA 1TKTA 1XMOF 4Q8EA 2HS0A 3Q22A 4CDIA 3FEZA 2VD3A 4AQYJ 2NYIA 1FCAA 5AXNA 2AQ4A 1S1WA 2ZUAA 2ILYA 5DLFA 1DY3A 3LPEA 2EG1A 2L41A 4U7UK 1EJ7L 3TARA 3JYTA 1F5AA 3O8WA 1UJ6A 2FHJA 1Q8LA 4DF8A 2HQDA 2HG4A 1B0VA 5K8PA 3VAJA 3GIIA 1WSVA 2MPUA 4I6YA 4CCHA 3QYYA 3K5NA 3TQEA 3PKMA 2Q3PA 2XMTA 2DYAA 3MEGB 4HHJA 2ZVIA 2DXFA 2M0GB 5KT7A 2VKRA 3D6HB 2HFVA 1DHMA 1RHUB 4NOHA 1RCXB 1M1KT 1RT4B 3UPFA 2DH9A 3HM9A 2ZBCA 1TVRA 3K0JA 3D3CJ 3KWMA 1YGYA 1U1MA 4NA1A 2CG8A 2CJAA 5HP1B 2N7CA 1HBOB 3DOKB 4NCGB 4HYKA 3I6PA 3KKFA 4K4UA 4ZPCA 1LWEB 3P45B 1UW4A 4I69A 3G96A 1RDRA 4LSZB 2EW9A 3GJSB 5LSRA 2ZJQQ 1QDUB 1FK9B 4JBCA 1Q82T 4ID8A 5E7OB 4OV6A 3ET6A 3MM5B 1RBLA 4DV3J 2AGPA 1B0PA 2EBEA 5HLFA 3I5AA 3OLBA 2MGZA 5A8RA 3IRWP 4DUYJ 3PFEA 1PC4A 3K5LA 1QSSA 1CULA 2D9OA 3Q2TC 4KY3A 1JJHA 4AE5A 3D6FB 1KFDA 3J7ZT 1NK0A 3FGVA 4JI6F 4Y2KA 1HYSA 1BWVA 2AJ4A 2KZMA 1X4GA 2YPZA 2UVRA 4YDDB 1ZH5A 1MROB 3MAQA 1GK8A 1YG0A 5K5MA 4J9OA 4C8YA 1RADB 4WKRA 2IIHA 3ITHA 3UD4P 3O44A 1Q16B 5KFHA 3DU5A 2IA0A 2H48B 2OHDA 1NJWA 2V9KA 1HL6A 4HT5A 2AYEA 4LVOP 5LJ5Y 2RQCA 2XSFA 2LEBA 4KFBA 4QWEA 1V3SA 1YJVA 4DCJB 5E3AA 3ILOA 4WFBQ 2W2QP 4DV1J 3D5MA 2NXUA 2WZ1A 2K2PA 3RAXA 2RT3A 3JSBA 2MYFA 1JXEA 1TAQA 2C42A 3IM9A 2HZCA 2O3DA 4OZLA 5GAEU 2G2YA 1F2GA 4NA3A 3R9LA 2UXBJ 2ZH1A 3DXBA 3M8QB 4B3OA 3SYZA 2CQ4A 1K44A 4F3MA 2KL8A 3C14A 4OZ0A 3RR8A 4P73A 4CP5A 1DAXA 4A8XA 5D0HA 3EM1A 1RT2B 2XG8A 3IS9B 4G1QB 2DH7A 1QJHA 2HIQA 2CNKB 2IBKA 1IKWA 2I5JA 4DX7A 2BJEA 5HK4A 3ETMA 3T19A 2EKYA 2VUGA 1TV6A 2QRRA 4EEYA 1IBKJ 4DHVA 4GVBA 4DL2A 1IKYA 3PR5B 3OTOJ 3MXHP 2HVHA 3V4IB 1RBAA 2CVEA 2JLEA 2DBBA 1VIOA 3R3TA 4IG0A 1HNZF 3FNNA 3H90A 4MT1A 3E51A 3D3BJ 4B3RJ 3PM9A 2F5GA 2VH7A 2JL9A 2CJ9A 1RT1B 4UOGA 1RT7B 2ZC4A 1FT8A 1JLFA 5D4NA 4DBQA 1IN0A 2W01A 4J9QA 4NL5A 4TLQA 2R7QA 4NPOA 1XNRF 1JX4A 3RGIA 3RB3A 4IQMA 3OFGA 1U09A 1RT6A 3KLHA 1JLCA 5B0DA 5F8NA 3PW7A 3GZ7A 3ISNC 1OMSA 2XLIA 3TOQA 3EVMA 2AYGA 4PXCA 3V4MA 1X9MA 1RXOB 3M1VA 5KFBA 3I5BA 1WEZA 2OMLA 2ZNYA 4DWIA 4FYWB 1HLWA 2HWTA 1SC6A 1FA0A 3A8IA 3EGNA 4JI2F 3MOJB 4DR7J 2ERRA 1BQXA 3O6QA 3MM7B 1VBZA 1W7WA 5KOWA 4X84A 3MR2A 1S9GA 3TAMB 5I3UA 4K4ZA 1N36F 1Y7PA 4KV8A 3FMWA 3DRPA 4HH0A 1S6PA 3MDFA 3Q86A 4KQZA 2H5EA 2Q43A 4FP9A 3L4BC 3VALA 1FD8A 1MMDA 2LVWA 2XS2A 3T9NA 1P9QC 2WSCC 3E2EA 3D54A 3CJ3A 5DG8A 4DZDA 4EWTA 1W26A 3BGUA 2CQGA 4Z37A 3RBDA 4HACA 2LKZA 1HWUA 4JV5J 3JTOA 4O3OA 2HGNA 1RWUA 4TU9A 3M7VA 3CO9A 1GQEA 5C42A 3S1TA 3OT9A 2R2TA 3R8YA 2BX6A 4GO7X 1N52B 4LVNP 1CC7A 2A6OA 1C0UB 1TL7B 4DR3J 3G8SA 3TVZA 2HHSA 1HNIB 4AXJA 4IH7A 1KOHA 2V94A 4NZ0A 2XMUA 2MLZA 3FBBA 3ELHA 3PYGA 2BM0A 4F4YA 1V3RA 1EKRA 5IS2A 4W98A 3PYEA 4FS2A 4ECUA 2OPRA 1HQEA 5CCMA 2EBGA 3BPDA 4I2PB 2WCXA 3PHTA 2FPHX 3OVAA 4ZVHA 4A8QA 1Q7YT 4DSFA 3NL0A 2HNYA 2OPPA 3OR2B 4RLEA 2XZDB 5LMNF 4ED7A 3K5MA 3OPKA 3SZ2A 5J1PA 2QA1A 4DFKA 2Q66A 4AL5A 5C25A 4PEOA 2CQCA 5RUBA 4V19X 5KFTA 2B9YA 2PC6A 3CCQS 2YBVA 4ZVOB 2D69A 3Q0AA 2UXDF 5D78A 4QPXA 1X5OA 4OX6A 4C8NA 4OZ1A 3IRXB 3WQPA 2EKNA 5CQGA 4M5NA 2QIFA 4K4YA 4RU9A 4OYXA 3OHAA 4ZP9A 2DT9A 3FUYA 5LSOA 1F3FA 1ZTWA 2HBZB 2XYGB 1VLOA 3MMBB 4DZ6A 3IGVA 5HVFA 5BYRA 1VGYA 5HVHA 2XZTB 4DL6A 5LXYA 2FGCA 4IG3B 2V63A 3ENWA 2LEPA 4WCEQ 5IV3A 1KQGB 1RAIB 3UNGC 3VVTA 4K4TA 2H4WB 4J9LA 2KRRA 1IVZA 5DZ6A 1WTFA 3MEGA 4PAAA 2F65A 4HLBA 2UXCF 3IBFB 1QTNB 2JWNA 2DCUB 3DYAB 3V5RA 4QR0A 1RT4A 1S9EB 5D3GB 1Y4ZB 2AMCB 2BKPA 2DGQA 4MK9A 1SJ3P 4YDXA 3V6DB 1NHUA 3CCMS 1F1BB 1SC1B 5HP1A 4CO1A 4QYZJ 1HBOA 3CIMA 2X7IA 3DOKA 3W3SA 4NCGA 1KDNA 1LNQA 2OTLS 4WP3A 1HFEL 2AGOA 2BKOA 2RQKA 3CIZA 1NK5A 4ANEA 1LWEA 1QY7A 1G7CB 3DCAA 5CYMB 4PPDA 4NASA 4F36A 1B4SA 3GP9A 5AT1B 1FK9A 3HT0A 3MM5A 3NP5A 3EXCX 2KHCA 4Y3CA 3FCWA 1T05B 1U1NA 8ATCB 2WAQD 1TUWA 2DHHA 2IM0A 1RHKB 3LOUA 2R7OA 3TI0A 4OI0A 2ZH7A 3BBCA 2E5LJ 1W2IA 4FYDA 3E3XA 5G0RB 2DVIA 1KEKA 4Q43A 4MIBA 4LQ3A 1Y5NB 1H74A 1JJ4A 1FF2A 1MROA 4UF4A 1U1KA 1FX4A 2ZOFA 2HHTA 5HVGA 2YWKA 1ELOA 2R2RA 2HS4A 2LU2A 5KFVA 3ILLA 3KDNA 1FRMA 2J9DE 3GU0A 4A8KA 3RTVA 3D9BA 2YWEA 3GG0A 1XJWB 4KT0C 1IWGA 2MKYA 2NXCA 1Y10A 1NK8A 4LIRA 1IM6A 4DSLA 4U6PA 3CJSA 1WOSA 3QWPA 3Q2SC 1RZMA 2CPIA 2BE2B 4JI6J 1HI1A 4ECVA 3JQJA 1VC5A 3D66A 1ZPWX 5KT4A 4FYYB 3CJ8A 2R8HA 2F4VF 3HMJG 3OL6A 4XAKA 1WD6A 4DDFA 4ZPVR 1YDLA 1VYAA 2C3OA 3WZ0A 2EFVA 1X8DA 2MZ1A 2DY1A 4JI8J 1ROFA 4MKYA 3M8QA 4M5GA 3FCVA 3JTNA 3N9UC 3TRGA 5B0FA 2HW3A 3LUYA 1QVFR 4B17A 1RT2A 1Z1ZA 3NAIA 3IS9A 4G1QA 2QLBB 2XNQA 4PXDA 2KXHA 3HHEA 2UVWA 1UPMB 2E1PA 4BWJA 3IO1A 5EHHA 2QYCA 2HHHJ 3DRSB 1FNMA 2KM8B 4JI4J 4MFBB 1DQ9A 3DI6B 3M2RB 3QQCD 1SJRA 1WC0A 3V4IA 3GV8B 4CH1A 1R0CB 2XMKA 3G6XA 2DR5A 3PDNA 1NU4A 1R6VA 1UP1A 2H51B 5MLCV 1IBLF 1TKZB 2Q79A 2XHWA 1EIYB 3VAFA 3OLAA 1UWBB 5JVGQ 4B08A 2YKNB 1QTMA 2XS5A 1RT1A 1RT7A 3NOGA 4B3TF 5L9NA 5C2CA 1U2FA 4CYUB 3P4UB 3PO4A 2FVSA 2B6AB 3R97A 1BLUA 1FNXH 4K4XA 3M6VA 3VAKA 4LF2A 2LDYA 1VK8A 2ASDA 1SJFA 5CHCB 3UCUP 5KT3A 3CCES 1PJ5A 4M5IA 2FY8A 2MKHA 3CULA 3J7Z5 4USHA 4ECRA 4QCLA 5F3ZA 4DU7A 5HATA 5KFNA 2CUYA 2Q6BA 4WU3A 1T02A 3W5YA 5DDOC 1NPRA 2GVZB 2R8JA 1BQMB 3W5ZA 1AUDA 5BXIA 2R4FA 3DLLQ 3GFYA 3B78A 1AFJA 4J9PA 2HS3A 3GJTB 4BBYA 4PUOB 5F8GA 2Y9HA 1WHVA 1RLDA 3MM7A 1WI8A 3FKBA 3G87A 2ATCB 5L46A 3ZZ0A 5CYJA 4ED2A 3BV8A 3IWXA 3MUMP 1NSPA 3OXLA 3TAMA 1T9TA 4DX5A 2HIYA 4K7QA 4RJVA 5F8JA 3QGGA 1L3UA 2HZVA 2ZZMA 1VQYA 1D0EA 3PNIA 4QIVA 4I56A 2PN6A 3VAMA 5B7WA 3MAHA 1PCAA 2Z2YB 4Y28C 1RKJA 3IR7B 4LT6A 2VPWB 1R0BG 2QZ8A 4USTA 1RI7A 4EYHB 4PWWA 4HDHA 1U7LA 4OX7A 5D4PA 3NNHA 4TN2A 1RYSA 3VGTA 2XBPA 1D9DA 3CE8A 1N36J 2IM3A 1VQMS 2Q6CA 3BZQA 2UV8G 3G9CA 5B0BA 3LP1B 4ELVA 5C7PA 4TKTA 1C0UA 1S59A 1TL7A 3KMQA 3TA2A 3G6YA 1TL4A 1MWQA 1HNIA 4LR7A 2K3IA 2BVZA 2B3TB 1Z4UA 2NSBA 2HNDB 1F5CA 2L9WA 4DL5A 2M88A 1EQMA 3A8KA 1RGVA 3EICA 5AE1A 1HBNB 3OW2R 2VONA 1YJNS 5B0GA 3RR7A 4DQIA 2J0WA 5BR8J 2MHEA 2DPJA 3KLVA 4I2PA 3RW7A 2WOMB 2RQMA 2RB7A 4ENOA 2COLA 5D0GA 3K8VA 4K0KF 2E5JA 2HHPA 4CO5A 1M5OC 2HRYA 1EB0A 4DS5A 4LSNB 4J9UE 3OR2A 4WBFA 2QFIA 3HVAA 1I5OB 2LQ5A 3HHNB 4EZ9A 4FNHA 5E2QA 2ADCA 4J91A 1NO8A 1WKJA 2JDJA 2GS8A 1QAYA 1C1BB 2HVEA 1C4AA 3I5CA 4C8OA 1WC6A 4X4TA 1NDKA 3MAAB 3PJXA 3KNAA 3CTRA 5ETQA 3WDOA 1KONA 1TU0B 3IRXA 2FGOA 2BQ3A 1TQLA 3I56S 3CMES 1DTTB 3G71S 3V81B 3MMBA 2GFFA 4IFYB 3UNYA 1S76D 4MMOA 2DNYA 4IG3A 4B9UA 5K8MA 1FO1A 4OYIA 3TUZC 4C0OC 3MEEB 1UA1A 2QLWA 1I3OB 1YJWS 1HW8A 2C3UA 1B7FA 1M5SA 2XNRA 1AT1B 5HMXA 1T8EA 4USWA 4WFYA 1J5OB 5GAEI 5ETNA 4C7QA 3EDRB 3QRRA 1KLNA 2VQEJ 3MGJA 2RDIA 4DR4F 4DV5F 3L7UA 1S9EA 3KFWX 3R5DA 5D3GA 4U96A 3KHHA 1SV5B 1WF0A 2W9CB 1VQ7S 1HA1A 4BC7A 3J81j 3V6DA 3UFCX 4WWSA 3PTWA 2RF2B 2PFFB 3EE3A 2AYMA 4DR6F 3RZAA 5KFZA 2YWWA 1SCJB 1ZM2A 4I7FB 2R8KA 2W2PP 3ZC4A 1H38A 4CLWA 1PJ6A 2MQ8A 2OI2A 1X4FA 3HKWA 5CYMA 1V3ZA 2ILZA 1GAOA 1FJ7A 4DV4J 3H98A 1X4DA 4ED6A 4NEZA 1GTEA 2CQ2A 1FDAA 1QUVA 3CO0P 1V5IB 3I31A 3J80Y 1IR0A 3I9V9 3U02A 1LQ9A 4P52A 1B99A 2DNGA 1T05A 1U25A 1TELA 2PMHA 5LL6d 2IHR1 3I0SB 5D0RA 1OSDA 4FF4A 2J0SD 3GJQB 5G0RA 4ZPDA 2FHOB 3HSJA 5KT5A 2LEAA 1B70B 2KO1A 3T1AA 1PBAA 1WG1A 2D9PA 5IZHA 1FTRA 3B6BA 1HPZA 1ZM9A 2ZJPQ 4FKYA 3OVBA 3HSDA 2ZNZA 2KXFA 3IC1A 4FF1A 3AY0A 2V4JB 5H9FJ 4P10A 4R25A 3DU6A 4KYZA 4EO6A 4K50A 1SC3B 1PBUA 2XC9A 2DGWA 4IO1A 3UQSA 5LM7E 1Y0HA 4DJBA 2BE2A 3VQSA 3EPIA 4Q5VA 1LKZA 3BYRA 1DJ0A 4TY9A 3ILJA 4I64A 1UEVA 2HNZB 3JSRA 3PACA 3SBMA 1MW7A 4DLEA 3SFGA 4H4KA 4F4XA 4DL3A 4A8FA 2UUBF 3TEHB 4FZVA 3MUVP 3RJMB 4OYWA 4M95A 2VG7B 4R0JA 1HI0P 3N6MA 4DOZA 4NA2A 2R7UA 4ZCLA 3H5SA 4K59A 2VFTA 3MTKA 4RBVA 1P1LA 2YKMB 2CQ0A 3OL8A 2CIMA 1RT5B 1T11A 3C46A 3SI8A 3MEKA 5DQGA 1S49A 1GH8A 2GMLA 2L08A 2IM1A 2BM1A 1KHVA 1S0NA 3GIRA 4Y0FA 4RO0A 2ZM6J 5A2QY 2CPZA 4WFAQ 2R3VA 2XM3A 4XDDA 4KTQA 3LAKA 3CUNA 2YH0A 1P9YA 1MU2B 3DRSA 4F26A 3ISZA 2ZJRQ 4UY8T 4MFBA 4ZK7M 1VFJA 3DI6A 3M2RA 2DY9A 4XDCA 1RT3B 4OYBA 1NSAA 4EO8A 5GVQA 3QBCA 4PABA 3GE9A 1VJQA 5HMZA 3VR1A 5E5NA 4C11B 4I67A 3JXOA 3J80U 4IRCA 3ZTOA 3HO1A 3CCTA 4TQSA 1PYOB 1TKZA 2NPIA 3EPGA 2DIVA 3H40A 4LRBA 2EFQA 1NB2A 1UWBA 2HWHA 3MFHA 4WFXA 2YKNA 1FXRA 3UD5A 3ZTPA 5DQIA 2XEXA 1KC8T 3Q23A 1N5TA 2YNHB 1U2CA 4CYUA 2B6AA 4PG4A 4AUKA 1Q79A 2HHWA 4AYBD 2QLXA 2GX8A 2C1EB 4DFPA 1URNA 2V50A 3FBEA 1RHRB 4JV1A 4RNFA 4YY3J 3ISND 4Y2IA 4ZPBA 4YFUA 3IBWA 4MK7A 1YK9A 4CQ1A 3PW4A 2YVSA 1VQLS 1K9MT 3OSNA 1N33F 3P96A 3RB6A 2MB0B 1SQGA 3AD8C 2GVZA 1UETA 1BQMA 3FSYA 4PYAA 4DQRA 1NHVA 4X65F 4B3TJ 1S10A 3U1MA 5IC4B 5GMDA 5B0EA 3GCXP 2RHQB 1WF1A 4WYWA 4PUOA 1KVIA 3OUYB 1RTJB 1RJJA 3OR1B 5KG3A 2G1HA 4ZVFA 1DTQA 2WSFC 3M8RA 2DR7A 1NHKL 1KD1T 3VQTA 3KJVB 2AV5A 2VODA 4WIIA 3V6JA 4ITSA 1YJ7A 1RAGB 2YQ0A 2CQDA 3BO4A 3MUTP 2CQBA 2VFSA 5DS7A 1X4AA 4BCAA 3UR3C 1I94F 2V68A 1VCTA 3NXZA 2CQ1A 2XGPA 1M5HA 1YZ7A 3PXGa 3DDNA 5BYSA 4XO0A 2QMXA 4JI3F 3BGFA 1X9WA 5KG6A 5A2QU 4B9TA 4BWMA 3KK1B 3W9IA 3FBFA 1NKEA 3GR0A 3LH2S 2WVFA 4OI2A 4RZRA 3H4DA 2VKZG 2Z8QA 4DI6A 4ELUA 1UPPA 4X4QA 2FYXA 3LP1A 2VBWA 2HK2A 3F73A 5FD1A 5F8IA 1ZETA 1XTZA 1U47A 4YHHF 3OTCA 4CRJA 4WE1B 3IWLA 4LFCJ 2HKEA 2KI2A 2QL9B 3DGVA 3OFHA 8RUCA 1ZBTA 6FDRA 4KGZB 4MK8A 2HNDA 1GFWB 4GKKF 1FRKA 3KYLA 4RW7B 2HGMA 1HBNA 1WC3A 2V0NA 3UDVA 4I4BA 2RSQA 1DBDA 4TNOA 1CJVB 2WOMA 1U1PA 5CA5A 3HSGA 2XQCA 2HBYB 4R5PB 1WI6A 1NEEA 2C2RA 3C16B 3KOAA 1T3NA 4RUHA 2RRAA 2FC8A 3E8OA 2JZ5A 4LSNA 1NZ8A 1HMVB 4CNYA 2F9JA 4Y65A 4ZVUB 3BQ0A 3RB0A 4B02A 4DMZA 2NLWA 4RPFA 4IH5A 3UDEA 1VMBA 3BDPA 5IV4A 6FD1A 1U6FA 1RSCA 1UJ4A 3BH6B 1C1BA 2IDEA 5SUHA 2VASA 2DR6A 4OHVA 4M94A 3MAAA 1FRXA 3DRXA 2VIHA 2LLZA 4IH6A 2VC0A 2AJQA 1JJCB 5HL7Q 1YTYA 2FZCB 1DTTA 1BHNA 3MCOA 3DLJA 3V81A 4IFYA 4FVMA 3R5CA 2BEFA 3LGMA 5D6GA 2FJDB 1FJGJ 4DPWA 2F9DA 1I51B 4NRTA 1S57A 3I87A 3RBXA 1GT8A 2UUWA 2ROPA 4X4SA 4ZDNA 4C8LA 1X5SA 1VBYA 3LAMA 3M6UA 7FDRA 5EDWA 3MEEA 2V9WA 2VF3A 2H65B 3ICLA 3ADAC 3MF5A 3VAIA 2G0CA 2PEHA 2RU9A 4P75A 4JB8B 2DNPA 1J5OA 5H1SV 1WWHA 1YWXA 1OY6A 4DV7F 2ZWOA 4WXWA 2D3UA 4FS1A 3NBPB 4NMLA 1SV5A 1HR0F 4DSIA 2PI5A 2W9CA 3MFIA 3QAEA 3UE2A 4A4JA 2RF2A 3PW5A 4PYDA 2C2KB 1GXLA 3CW2C 4DR1F 3CCRS 1ZYQA 1TAUA 1N5SA 1XNQF 1BMQB 4I7FA 4DPUA 2QO3A 4F4WA 4OI3A 3X3UA 4DUTA 2MKCA 1KHWA 2FIUA 4OX9F 2VC1A 4P9SA 3QATA 1D3WA 1U0HB 3A1YG 4YR0A 4M1KA 3CMAS 1APSA 4Y00A 5J2MB 1TMJA 4LF6F 3CDUA 2DCLA 3OXFA 2GJIA 3G8QA 4DV5J 2RAQA 4Y2CA 4ZA1A 5IFMA 2J6UA 3IFEA 2PO4A 1M0SA 2WVCA 1NSKL 5AJ3F 5GAHU 4B9LA 2VPYB 3MPVA 3I0SA 5EGYA 2UUAJ 5K8NA 2V5HG 1K0VA 4N41A 2YKOA 4OHZA 3BO3A 2BANB 4URQU 1UVIA 3PYDA 2RH3A 1JK9B 2RMLA 4WPAA 4WKYA 1QAJA 2QJ3A 2IY5B 1TUVA 2BZ2A 1YZ6A 2AJFE 4RX6A 3GV5B 4KHPJ 4X4PA 3TVKA 3HFKA 2YNIB 2R8IA 2W7OA 2V4JA 2IM2A 3DLGB 5D4OA 4MH8A 3GQCA 4F2RA 1Y3KA 2J0QD 2G9OA 1T9VA 2BBEA 1VBXA 1JMTA 2ZH5A 3W62A 3JS9A 1U1RA 3H20A 1NH8A 2GHPA 1U02A 3CD6S 1A9NB 2HNZA 1S0MA 3FSXA 2NUUG 2FJBB 1ZOTA 2UVUA 5JVHQ 5ETSA 4QW9A 4ETXA 3SV4A 4FBTA 1RACB 1XIQA 3OTBA 3TUJC 1UVKA 2KYZA 1FI4A 3GSIA 2VG7A 2QMWA 5T7LB 5ITHA 2W9AA 1UKUA 3C66A 4ES2A 3HSZA 3CJ5A 2AZ3A 5EUHA 1YHQS 5GAGU 4NYOA 1OSCA 1N0VC 1J5EF 3D0HE 2W2MP 2YKMA 1RT5A 2PFDA 5EX0A 2HGLA 3HJFA 4ILMA 1A0OB 1NKCA 1HIYA 2KXNB 2OELA 1ZA2B 3GV7B 2ZFHA 3DKDA 1IQTA 2UUBJ 1TL5A 3QRQA 1LWXA 5A6PA 1RISA 4DL7A 1MU2A 2MEWA 1KKHA 2NSCA 4OJGA 1LXNA 2I38A 3D6TB 4FBUA 1RT3A 2ACYA 4D3HA 1X4CA 2XMJA 1WOOA 4C11A 4DL0C 3PX0A 4ED0A 3AB4B 3A3PB 5A6WA 3IXQA 2CJXB 2XWXA 3KLGB 1H3DA 3GB0A 4Z7CA 2FY1A 1IQZA 2YNHA 4ZP6A 2IPOB 1RAHB 1IBMF 4ECXA 1M5VC 2LDIA 1FVSA 2J0XA 4NXMJ 4TYBA 1MMLA 2VBYA 3QZ8A 2ZKUA 4JI7F 4B9NA 1S4EA 3MM8B 1HD0A 3UN2A 1NCLA 3T9ZA 4EI2A 3ITHB 2F8MA 1WUUA 1FJCA 1EAYC 3WC2A 4DX8H 3BF4A 2ZH6A 1AB8A 1T7PA 1S99A 4PG7A 2W4PA 5D77A 2XMAA 4ATNA 2BJ1A 1SPBP 4P72A 4KGVB 1WOPA 3HULA 4X4RA 2I8EA 3S6EA 3OVSA 1VHIA 3KLIB 3PZPA 4LBHA 3OUYA 1RTJA 4ZMMA 4F4ZA 3OR1A 3LTOA 2RHSB 3Q89A 4XK8C 3KJVA 1PO6A 2U2FA 3PV8A 4WFNQ 3PVXA 4GKJF 5KT2A 2GC8A 3L09A 4W92B 4DFMA 5FIIA 1RE1B 1S9FA 2E1AA 2XO7A 1FE4A 2KRBA 1VQOS 1OO0B 4X65J 2KG0A 2WTFA 4USUA 3PRVA 3PIOQ 2NXEA 3U1LA 1L5UA 4JV2A 4NLWA 5ETPA 4JUZA 2B8PA 1Q53A 1UEUA 1F5BA 2B8QA 3SCLE 3AOBA 3UN3A 3EDQB 2Y1JA 2BJDA 4ECYA 3W63A 3KK1A 1FJEB 4CLSA 4YR3A 3N79A 1R0AB 3PKYA 1HNWF 2DJWA 3RB4A 1RAFB 4OLPA 3V2UC 3GJRB 1LW0B 3NS7B 3W61A 3W8PA 4WE1A 4XPEA 3T1HJ 4U67Q 3VAGA 4RL1A 2AHOB 1VQPS 2BQRA 5F8MA 3T1YF 2JFKA 1TL3B 2W8LA 3PIPQ 4X64F 1M90T 4UY85 5CH7B 2ADBA 4RW7A 3TW0A 5A8WB 4NXNJ 3CJ0A 4X4OA 1D9FA 5CCLA 2FJEB 2V67A 1YX2A 4WXOA 3CCZA 3W64A 1YRXA 2C3YA 3VWSA 3TAPA 2DHXA 1WACA 1CJVA 4R5PA 1CC8A 3C16A 3HK2A 1WC1A 2EC2A 2Y1LB 2B7CB 1AXQA 2QL5B 3SCJE 2CRLA 2FHJD 2MQNA 2V8GA 2Z56B 1N88A 5CXTA 1JLAB 3AT1B 1HMVA 4AXIA 9ATCB 3M8PB 5I3QA 3O2IA 2R8GA 3FDSA 3BREA 2N3LA 4EBEA 4GKKJ 2UV8A 2Z58B 2MSSA 1RWNB 1M1GA 4DPOA 5I42B 3UDCA 1DLOB 3D67A 4EBCA 4ZVEA 4LF8J 2YXLA 2HSEB 4EFAC 1REVB 2GJFA 4B3MJ 3OQ2A 1H6KX 4C48A 2JEJA 3UDLA 2MJNA 4OHYA 2CDQA 1BUXA 5ETKA 2PDAA 5HO4A 3RYLA 2HHQA 4NLOA 5DDQC 3ONQA 1XK8A 3CT9A 3CJRA 1FFWB 1AA1B 2HFZA 5DDPC 4ZS6A 2RQ4A 5FLXY 1PYSB 4B9SA 2W4CA 4O0NA 1VQ8S 1H0HB 1SJQA 3FMBA 4P2SA 3BGOP 2EFNA 4RW6B 1GX6A 1W25A 1UJ5A 2WSEC 3NNAA 3NBPA 4RUAA 2ZDPA 4KKOB 2DRBA 1RUSA 2VA3A 3BKFA 2LCWA 4KSEB 2L3MA 3EZOA 1N0UA 2FD2A 1OIAA 3B54A 2E7XA 2RE1A 3OTDA 1ZAXA 5KFOA 2JEFA 1H72C 3W2WB 1KOOA 4J90A 3VCDA 2WB1D 2E9TA 4I6WA 3O3LA 2QC3A 4PZVA 3FQKA 5HJXA 1U0HA 4P71A 4ETZA 3TO8A 2IRXA 2AEMA 5J2MA 2K1RA 4DV7J 4JYAF 3EX7B 1DZ5A 4ILLA 2V34A 2AX0A 2RS8A 2C22A 4RR5A 1HR0J 4RKUC 3PG9A 3CJ4A 4NLTA 4OFZA 2BE7D 4D3GA 2UU9J 1PJ7A 2ZOGA 5LMUF 1C0TB 2D74B 1S0OA 2E1RA 3F0NA 3OXGA 1LWFB 1FXDA 3ZZOA 2ZOMA 1GNKA 1HNXF 2BANA 4OX9J 4X66F 2M5YA 1OPZA 1HWKA 2R2UA 1T9YA 4L74A 1YI2S 3KLEB 4LF6J 4OJ1A 2YNIA 2YWGA 4KIAA 4HVZA 1NBEB 3EVOA 2HBQB 4L72B 4RUCA 4LF4F 3NEKA 3DLGA 3KJNB 1WSRA 5AJ3J 5KG7A 1PGZA 4KB7A 2HWIA 1VS3A 5J2QB 2MJUA 2QSWA 3FQLA 3OJSA 4PXEA 2E7WA 4JI1F 4HI2A 2F7VA 5HANA 2RRNA 4ZLJA 4JI0J 1BC6A 4DV2J 1BWEA 3DMJB 4ED8A 1P6TA 2DEIA 4DU8A 3R6LB 3T6JA 2K06A 2HFUA 2GMJA 3KUHA 5IM0B 1WKLA 4QYZK 1XWLA 2KM8C 5FLXU 5L1JA 2IVYA 4C2MA 5T7LA 2DIUA 1NJXA 1EARA 2HQ3A 5IOLA 5EWEA 1UVJA 3RW6A 4FNIA 3UD3P 1JKHB 2EFPA 1R43A 2CPFA 4PG5A 2KU7A 1KSPA 4IYQA 1VIXA 4EYIB 1L3KA 4U8YA 1P8GA 1CVJA 1AFIA 2WHOA 4LFAJ 1L3VA 3MM9B 2MLXA 2FJAB 2IC3B 5HMYA 4ZOSA 2VOPA 5IXUA 3B82A 2B4UA 3VGUA 1OQ3A 1EZZB 4P2MA 5IT4A 1J5EJ 3H25A 4URGA 2AIRB 3SV3A 1MMNA 5KFKA 5KFSA 1SKWA 2BMBA 1Y9OA 3TANA 3KLGA 3OHBA 3ZTRA 3OL7A 3C15B 4RBTA 5E41A 4CO0A 1VQSA 2H5JB 3HHLB 1FD2A 2ZVSA 4QR1A 4H54A 4X4UA 3MM8A 1F6TA 1D8YA 3PJ9A 4LR9A 5J2NB 2CNOB 4ZITA 4Q2MA 4ZHRB 1IR2A 5KFPA 3NMAA 4UOFA 1IBCB 4HHHA 2GHVC 2XY5A 4X62J 2AEJA 2HHXA 4C8MA 1TK8A 4LFBJ 2HRUA 5C24B 3DGPB 3KLIA 3SMZA 1DRZA 4C8KA 3BEGB 4JI7J 4E2FB 3M2VB 4J9SA 2OGUA 1YRUA 1XR5A 4CM2A 3K89A 5C2GA 1SUQB 1CSJA 4F7VA 1N32J 2LQ8A 3W1YC 4NCBA 2LQBA 4QPTA 2ZZTA 3EMTA 4YUDA 5KOXA 1HHSA 1TKDA 3EWGA 2X51A 3ZXWA 2MQQA 4A8MP 2Y1IA 1OPIA 3QSIA 3FRZA 5ETMA 4LF9F 1WF2A 5DM6Q 1VR6A 3ZZZA 2W7AA 3HI9A 4WU2A 1S0VA 1WKKA 4PRFA 1Y5IB 2LFVA 5AXKA 1XMQF 2IYIA 1DQ8A 2POKA 2CNNB 3OJUA 1P1TA 4GKJJ 1R0AA 3MOZA 1U49A 3P6YC 1Q81T 3C3LA 1LW0A 4KPCA 1ZAVA 2A18A 2D3O1 4EU0A 3PJWA 1U1OA 4X2BA 3ZNJ1 2W2OP 1GMWA 2OO4A 1TL3A 3FSIA 2W8KA 1Q0NA 3GG1A 4DR2F 3IMQJ 4WZMA 5A8WA 2AJ1A 2DR9A 3H42A 1XMBA 2JSXA 3G6ES 2R2SA 4KHMA 4NLGA 2QN6B 4RWXA 1HNWJ 4AQYF 3J81Y 2QL7B 1Q8IA 4I68A 4LRDA 3KDOA 3NWGA 2DXEA 1JLAA 1QUPA 1I1GA 3M8PA 3BKUA 1Z2ZA 2VDIA 4MJKA 4RW4B 1U2RA 3KTQA 2LA4A 3BYPA 4X64J 2FVPA 3IAM9 4ZVSB 2YNFB 2UUCF 1GMUA 3AH6A 4N5SA 3TJ8A 4RNMA 5IT9Y 5I42A 4DPTA 3TZZA 2FZGB 3JQKA 1DLOA 3PEHA 2F8HA 5J1NA 2BDPA 2CPHA 3DDKA 3BR8A 3R7BB 4P2XA 1REVA 2PD1A 3G86A 1SIWB 2WONB 4CWBA 2ZHAA 4USVA 2JLFA 2NS1B 5IWAF 3RU0A 4Z2XA 3ZZYA 4H4MB 1RBOB 4QBUA 2OTJS 2MMYA 4QZVB 3G4SS 3TZYA 3DOMB 2D3ZA 5ETOA 3AAWB 3BSOA 3KJQB 2VJVA 5HQMA 3TA1A 3IM8A 4RW6A 4USKA 3UCGA 1WORA 2K3KA 2MZQA 2J6TA 5L9XA 4OZJA 1SKRA 4HTJA 3QGHA 5GAGI 4KKOA 1CJKB 4FF3A 2JVOA 3JB9k 1TKXB 5J2PB 4DUYF 5DG7A 3Q8VA 2CXEA 4DSKA 2VA2A 1N5VA 5HN0A 4KH1B 2AP6A 4B9VA 2Z2MA 2EXUA 4G1IA 3W2WA 3TP2A 1D1UA 3IR6B 2PEBA 2FVRA 2FC9A 4KJIA 1AW0A 4FN5A 5F9LA 5KFMA 2ZITA 4CH0S 2DNHA 2WW4A 2OIHA 4PWUA 5AXMA 3V6HA 4GRSA 3WX8A 1NSQA 3W8GA 2U1AA 4K5RA 3J81U 1C0TA 1DARA 2N4DA 1LWFA 4KHRA 1CJTB 3NCPA 1C2PA 2DXDA 1RWWB 2MY7A 3GPAA 1QSLA 3CC4S 2V8HA 2PIIA 4CLZA 3SCIE 2XMVA 3KLEA 4ECWA 2PMWA 2MKKA 3FEYB 4DV1F 1T0TV 4QOTA 2VOOA 1T9XA 3JSMA 5DRKA 3SQGB 3TX0A 4OYMA 1FRJA 3RRGA 2BYCA 2CJBA 1VQKS 4ZCMA 2MKSA 5IT9U 1REGX 3I4HX 4DQPA 4ZPAA 1S1TB 2XYHB 5J2QA 4LF7J 4OIXA 2UXBF 3M9NB 1FDDA 1S6UA 1NMEB 1H2UX 4K5SA 3FBCA 4U9RA 2BRKA 4LF5J 3DMJA 2R7WA 3GCWP 2QTWA 2HLTA 1CS4B 1C4CA 2PA8D 5DGBA 2OD6A 1F2HA 4L75A 1RWXB 2VV5A 4F3QA 2B9WA 2WRMA 4RBUA 3M8SA 5IM0A 1Y5LB 1XMOJ 5LT5A 2ZD1B 4OI4A 1X7VA 2DNQA 2QMUB 4UUXA 3BGRB 3ZZPA 1Q1KA 1HWJA 1X5PA 1VDHA 1IBKF 1JNRB 1S7HA 2FJWA 4I0WA 5SZTA 3LP2B 1SI9A 1JKHA 2OEJA 3BBBA 4J9VA 1SL1A 4N8OA 3M6WA 3OFEA 3NNCA 3QZ7A 5D15A 4ZCKA 4DCOB 3W9JA 3H5YA 4B3RF 3MM9A 1LW2B 2I1RA 2IC3A 1RQ0A 3QJLA 1MN7A 1S79A 3KK3B 2ZBPA 1TR0A 2QEXS 3H5UA 1RU2A 1NDLA 5H9EJ 3NG8A 4WTYA 1RAJA 1RU1A 3OSPA 3RG6A 3IWNC 5D0EA 3DRRB 3QO9B 1K73T 1XEZA 2VFVA 2KJWA 3GIMA 2QGFB 4ERDA 5EWGA 5DG9A 2FZKB 4TYAA 1UZDA 5KT6A 4C3LA 3C15A 5I3PA 4C97A 3PYFA 4K8RA 1XERA 2OEKA 4F0MA 1U1LA 3HHLA 3D2WA 1YIJS 4PG6A 2I0XA 1BE4A 1HPZB 4DR7F 2F3JA 3PX6A 4YEAA 1SXLA 2DITA 3BM7A 1XQIA 2MLYA 1SKSA 2GO9A 3K5PA 5J2NA 4HT7A 4IDKB 1EETB 3LO3A 4ZHRA 2L48A 1JQGA 3H7HB 4Z7YA 3VZIA 2BOAA 2IDLA 1JJ2R 4W4MA 3CD0A 3GYGA 4LF1A 3TZWA 1U26A 1WTBA 2HVIA 5C24A 3DGPA 3MI7X 2P2CB 1O8BA 4CLUA 1CLFA 3CB4A 2OEMA 3GTYX 3M2VA 5KTQA 3M9MB 4DCPB 2Z4PA 4AFFA 5G4DA 3MEDB 1WJ9A 3GLJA 1SUQA 1X0FA 1CG2A 1O51A 4JV5F 1FDBA 3B8HA 3T41A 3JTPA 1NUEA 2FTRA 3CCWA 2YNGB 3ENVA 3MECB 1OQ6A 4CO2A 4W90B 2GO8A 2VG5B 3AD7C 4LREA 3MR6A 2XMWA 2NREA 1H73A 2ZE2B 2MHNA 4LRFA 3N6NA 5D8HB 2KJVA 2DNLA 2X3DA 1LV5A 2DNKA 4RNHA 3R1HA 3DLHA 3US5A 2CZVC 4LR8A 1R8AA 1JLGB 5KFUA 3PX4A 2W2NP 2XI2A 4FPIA 2QX0A 2MKIA 2FHKA 3D0GE 2JEIA 4LRCA 3SFUA 2DGOA 3BGLA 4O23A 2AGQA 1KTQA 4LF9J 3L95X 3UVJA 3O5TB 2KB2A 1NJIT 3HLUA 4KBIA 3AFGA 5E3RA 1WEXA 2V2KA 2E1MC 1G1XA 4I2QB 3RBZA 4L3KA 4P7VA 4MTPA 2BACA 3PHEA 1FRLA 9RUBA 4M5HA 4KO0B 2XSJB 4ZN1A 5AE2A 1S72S 4Q0BB 1K8AT 2AD9A 5CABA 1HNZJ 4RW4A 4EUVA 2BE9B 4ECSA 4XIUA 2V6AA 5B0AA 2Y3YA 1RWKB 1U4BA 2YNFA 2QG9B 3KNGA 3L7OA 3NGTA 3Q8PB 2O66A 3IA0A 2GVDB 2IVMA 2J7WA 3M8WA 4OZ5A 3DNCA 1XNRJ 2RVJA 1VQ4S 1DTQB 2W4DA 4Q44A 1IKVB 2WONA 4UQTA 2JHEA 1UFLA 4H4MA 3NCQA 3J7YU 4ZP8A 5E3PA 4N47A 3PFOA 2FVQA 4CLYA 4ID5B 3NY0A 1TUGB 2EFGA 4NLRA 4FVCA 4HI1A 1UAWA 4F0HA 2NQPA 3DOMA 3GYXB 4EGLA 2UUCJ 2FJVA 3QIDA 4JI2J 1BXNA 2IYGA 3Q8RB 1WDDA 1H2VZ 1B64A 3FVYA 4HHUA 2YWFA 1CJKA 4DN9A 4QIEA 1HHQA 2R7RA 5IWAJ 2E1CA 1TKXA 5J2PA 2ZHBA 1HBUB 3CVKA 1YQHA 2NPFA 4NX9A 2LQJA 3SXLA 2E5LF 2MZSA 5K8OA 1HHTP 3SSRA 1N56A 5CD4A 1YBUA 2GW8A 3F56A 4EMDA 3H2VE 3BSAA 4OV1A 4CLKA 3A3NB 1PC5A 3I9ZA 3A3OB 2ZC3A 1UZHA 2LU1A 3NS5A 4HR2A 3O1LA 1FKAF 5KFFA 2G13A 4ZVPB 3QGIA 1CJTA 2BUNA 3T6BA 2J7UA 2ZEJA 3IG1B 4IR1A 2IBOA 3R5GA 4JOUA 3CC2S 2HFOA 3QJJA 4FXDA 4ECQA 3SQGA 5F8HA 5A0YB 2ZBIA 2F4FA 2WW8A 3D1HA 4QU6A 4OYOA 1JNZB 1G2EA 2AZ1A 1S1TA 1RHJB 5AXLA 2D3OR 1N6QB 2VFUA 4JI8F 2EG2A 2DGTA 1E6VB 4QWBA 1JB0C 4WZQA 4KGXB 2FLOA 1FEEA 2K7KA 2CPYA 5LMNJ 1CS4A 2OFHX 1O0PA 4G1PA 4O4RA 3CC7S 1N54B 5HQLA 4IQXA 3W5XA 2B4PA 4OZ3A 4F67A 1UL3A 2VPXB 2C2DA 4UZCA 3NGDA 3A12A 4C98A 4N7TA 2MZRA 5GMKa 2ZD1A 1SC4B 2UXDJ 3BGRA 4GMKA 1CEZA 1WNEA 4P7TA 2HHHF 3CPWR 2H5IB 3LGHA 5F0WA 4QJVA 2CQIA 4O3RA 4JI4F 7AT1B 3MMAB 2XZWA 3DXSX 5THWA 3AHPA 3LP2A 1B3TA 1S97A 3OBIA 5IT0A 3Q8YA 3HKZD 4EZ6A 4S0MA 1ZAWA 3OTEA 3WC0A 2AJ2A 2PE8A 1FRIA 3H5XA 5L1KA 1VRUB 2KHDA 2BW7A 1HWLA 1LW2A 2OSRA 2YQ1A 2FDNA 3KHLA 3TUIC 1KNZA 2UXCJ 1KQFB 3KK3A 4NLPA 4DPYA 3R1LA 2M9KA 4DXLA 3H4BA 2HQIA 2C2OB 2WK4A 2BRLA 1YJRA 1FFSB 3DRRA 3QO9A 3C6UB 3CSKA 4GC7A 2RDDA 4IOBA 1MSWD 2RILA 1DURA 1VQ6S 4DL4A 2GGPB 3SIPB 5GMEA 4RNNA 2X1AA 1W2BR 2VBZA 2CJYB 4MIWA 3ZZTA 2V2QA 2RUSA 3LGNA 4PG8A 2M2BA 1ZM3A 2QT7A 3GILA 4M5KA 3C6TB 2ASYA 2WVDA 3CJTA 3MR5A 2YQ3A 2JRSA 2RS2A 1RTZA 2H54B 2AX1A 4QWCA 1OJ4A 4IDKA 3VF0B 1EETA 4PQUB 2I2YA 3I0RB 3PEJA 4NZ6A 3TNVA 4NYZA 2JFDA 2KYXA 3R27A 1WELA 1NNDA 5BYQA 3J7AN 4P74A 2W9BB 1F9HA 2KDOA 2WVBA 2DHAA 2C3PA 3AA8A 4CT9A 3R5AA 4MKAA 3U1NA 2M70A 2V8DA 3MEDA 4H4OB 4DR5F 2XMMA 3TJAA 3FRYA 2GNKA 2Q1LA 2OFGX 4M63A 1FFGB 2CAJA 4J37A 3JSYA 2DRDA 2YNGA 4NLYA 4MYTA 4OYAA 3MECA 1N8RT 2E9RX 2B43A 3DFEA 2YPYA 1ZTTA 2KFYA 2DGSA 2VG5A 3QFHA 1HBMB 1YBTA 4WP9A 1X4EA 2ZE2A 1GX5A 3ENQA 2FQQB 3GR1A 2KT2A 3LWLA 4DV6F 3POTA 2F4VJ 4OI6A 1UCNA 1KS2A 4JV0A 1JLGA 4E98A 4WIQA 4ZLNA 4LUBA 3SSSA 1RHMB 1S77D 2HQFA 2RKIB 1YSJA 4DPXA 2CJKA 3C2PA 4CNZA 4A8SA 1WG4A 2QLFB 4RUBA 5HQ8A 5BR8F 4F02A 2JVRA 1IJEB 2RD5C 5DO2A 3NGSA 1Z2LA 3D4JA 4LBPA 3GIKA 2CZ9A 2LXIA 4UOHA 3W7BA 4TVAB 2ZUGA 3QPIA 4TXSA 1X4HA 2E5HA 4KH0B 3ETOA 1XC9A 4NZ7A 2D41A 4ELTA 5KG0A 2VU5A 2VJUA 2W25A 2XCAA 2J8SA 1R3NA 2AJ0A 4N8NA 2HHUA 4OJ3A 3OV7A 1VQ5S 2HAFA 3X1LB 5BJRA 3TVYA 3AQOA 1X4BA 4I2QA 3KLFB 4OQJA 1NRKA 2XLJA 4A46A 1S4FA 4IOCQ 4KO0A 2XSJA 2M4MA 1UVLA 3MHYA 2DGUA 3Q8UA 4N56A 3A13A 3GSDA 1U48A 1U8WA 4Q0BA 3M2UB 1KVJA 2OKQA 1CQMA 3D1OA 2CQ3A 1IBLJ 2XY6A 1NDCA 4UT4A 2Y8YA 4Q45A 1OY9A 2EPIA 3NGRA 3BB5A 1PYTA 3KUEA 3M9OB 5DQHA 5HI7A 3N28A 3N6LA 1J2VA 5CAAA 3T5LA 1RWMB 2R7SA 1R31A 2AEFA 2GVDA 3B4DA 4BC9A 4I6AA 1Q8KA 1FDNA 2FB0A 2E5IA 4NEYA 1S5ZA 4A48A 1VQNS 1IKVA 1UVNA 2V8PA 1WEYA 2B4VA 2IMOA 2VQEF 4FPRA 2LMIA 4RWWA 1RYRA 4OMFG 3QFWA 2AT1B 4ID5A 4F4AA 1V9OA 4NYPA 3CD5A 2V2ZA 2HLUA 2VL1A 1S1VB 3C8YA 3MWBA 2HK3A 5K14B 2M3DA 4FF2A 4PQAA 3ZFVA 2CWXA 1TK0A 2G1DA 4DV4F 4NRUA 3ILIA 4O4GB 1NH7A 2BJ8A 1QAXA 2BXJA 1YJ9S 2AWZA 3RRHA 3A4TA 2HAIA 5A8KB 1HBUA 3TEGA 1S48A 3HFZB 2VPZB 4CTAB 4ER8A 4Y34A 3NMRA 3BH7B 4DG1B 5AE3A 1PSDA 3DN9A 1CQNA 2MZTA 2J76E 3R2CJ 2B4OA 4L76A 2QA4G 4FKXA 3DHXA 4WF9Q 4KGKA 1E6YB 1TMMA 3AA9A 2VICA 3HX9A 5KFWA 5LOQA 1EHWA 1RB0A 1EX8A 3TYTA 2IRYA 1RAEB 1OS5A 2UVVA 1Y3JA 1IR1A 4LIWA 3EZ5A 1FKOB 2MTLA 2PMZD 4KC5A 1NK6A 4ECTA 2H4YB 3IG1A 5KFGA 2DRAA 2KT5A 4ED3A 3L9ZA 3ZZRA 1RAAB 3UCZP 1S1XB 3I82A 4YB7A 3AJDA 4XPCA 2CPJA 5A0YA 1SB6A 3P3DA 3BPSP 3VZHA 1Q86T 4O44B 3AOCA 4K0KJ 4M5DB 1N6QA 2IRUA 2DKOB 2B9EA 1S6QB 2X1FA 1E6VA 2BKNA 3HPOA 4L3NA 3GFZA 1RHQB 4DQQA 3K8WA 5DM7Q 2ROGA 1BQNB 3NS6A 4AD6A 1AROP 2ZH2A 1FKPB 2ZM6F 1VK3A 5JMNA 3F41A 2GIQA 1XBWA 3K59A 3AJ2A 3H0PA 3MD3A 4QW8A 4C3KA 2QA4S 2Y8WA 2PI4A 1MLAA 3ZTQA 2NUHA 3R6GB 1VHFA 2N4CA 4C8ZA 1FRHA 2GAGC 4KRWA 4G6VB 1B7YB 3MMAA 1HARA 3LQVA 4NLDA 4V19J 1RA7A 1K47A 1O5JA 3CJKB 2MY8A 3W60A 1KN6A 1K1QA 2VG6B 4UW2A 1YLXA 3E01B 3FCHA 1JLEB 2CWKA 4ZPWR 1R8CA 5DGAA 2HQGA 1VRUA 1KRPA 1JLQB 3HHLC 3U27A 2O01C 2NXNA 2DGXA 3M30B 4B3SF 2MZJA 2CQPA 1M1HA 4Y2AA 2E9ZA 3KHGA 1IUJA 1VC6A 2C2EA 1PG5B 2ZBRA 4PPZA 3WBZA 2CA9A 2K1RB 4DR4J 3S8SA 5L8RC 4DF4A 3EUNA 3TUPA 2P8IA 1QE1B 2JNJA 4YY3F 3C6UA 5CYQB 2VHGA 3FJ2A 4PCQA 2A0FB 2EVZA 1R7IA 2GGPA 4EK2A 4DR6J 3EGVA 1GMVA 5KFAA 2DO4A 2VDHA 2NYHA 5F0UA 1CJUB 3CEDA 4ES3A 1LK7A 4ZVQB 2YKAA 1QM9A 1Y00A 1U24A 4Q2LA 3C6TA 2LQ9A 4RNOA 4LBIA 4BS2A 2P6SA 3MURP 2QSFA 2XULA 4GC6A 4CLPA 5HMWA 5ETRA 4PQUA 3GFHA 1F9EB 3I0RA 1RK8A 3W66A 3LANA 1RABB 4UOCA 3BN4A 2DNRA 4C0BA 1AUSL 3DDIA 2W9BA 3AQPA 4U95A 2DNMA 3CCUS 2GMHA 1TFYA 2KFNA 3NRBA 3VGSA 1FWLA 2HHVA 1UFWA 1HNVB 2A6MA 5L38A 3VTIA 4ZKAA 4NLQA 4O3SA 3N0VA 3T3FA 1NZAA 4H4OA 4F4KA 4DN0A 1FVQA 2HMIB 1LWCB 2DR8A 4YQWA 5F8LA 1Q5VA 1D8ZA 2G0IA 1HQUB 1JIHA 3S7RA 1QAIA 2KN4A 1MN9A 1NXIA 4C9DA 2OMOA 5HROB 1R89A 3J7YI 3GFXA 1HBMA 3L7PA 4CO3A 3DHWC 2P9GA 4ZJQA 2GJ2A 4IRKA 4LFCF 3BN7A 1LEOA 4NLSA 1D9AA 5KG4A 2LA6A 3SDEB 2HPUA 2RDJA 4CLLA 5CD4H 1UVMA 1EKSA 4DR5J 1VJWA 3H2LA 1NAQA 1IKXB 1WHWA 2RKIA 2NCKL 2UP1A 2PGCA 2GZOA 3QSYB 2YX1A 2APOA 2Y1RI 1AZSB 2UZAA 1KWMA 2ATLA 2B56A 1SH2A 1IM4A 2A1BA 3SSQA 4TY8B 3PR4A 2EC0A 3G82B 4UZBA 5KFYA 1TL1B 2NZ4A 4ANCA 2A2DA 1XR6A 4CI0B 4IOAQ 3LALA 4DV0F 4DV6J 3HP6A 4DQSA 2XB2D 1NM2A 2HFNA 4C0HA 1AYEA 3BSNA 3AD9C 4R8UB 3N01A 1G3OA 3T5KA 4Y2MA 3LP0B 3KLFA 4AL6A 2R7XA 1T95A 5L1LA 2OSQA 3FFIB 2E5GA 4NI2B 5D4LA 3R7NB 1VRQC 4ANDA 4YB1P 5F9NA 1BD6A 1SQEA 4FXVA 3J7A1 2JX2A 3M2UA 1ZZFA 1R8BA 4CLTA 3AXKA 1WC4A 2AW0A 1P27B 3QT6A 1RCOB 2DK2A 1FJGF 2E44A 1RWVB 4USJC 2OJ3A 4OZNA 3CJQA 2PA3A 1B0TA 5ADZA 5DDRC 2XHCA 2G4BA 4FDFA 1SH0A 1H98A 5KFRA 1X5TA 1SJ1A 3CGIA 4WYLA 3ZO7A 1NJYA 3DLBA 2RU3A 2FLNA 3EGZA 3OD2A 3THPA 4OLOA 4RW8B 2HQCA 2MQLA 4M5LA 2DHGA 1N33J 4K4SA 4WJBA 5DJBA 2ZH9A 3D68A 3HCXA 2MSTA 4L73A 1F9FA 1S1UB 3G8TA 1S1VA 1TZ0A 1Q95G 3BO2A 3M8YA 2WBRA 1PILA 5K14A 5B0CA 2WVEA 4ICLB 3BJYA 3KG1A 3M4XA 5C5JA 4HEA9 2W24A 4OHWA 1HI8A 3QAUA 2SXLA 2G2OA 2DGVA 2GIRA 4O4GA 2DNNA 5K9FA 3DYAA 5E3CA 2MKJA 1Q5YA 2YTCA 3RAMA 2FUG9 2M8DB 4L6V3 5A8KA 1A6LA 5KFJA 2XO6A 3SCKE 3HFVA 2RUGA 3PO5A 1FWKA 3QT7A 3BKTA 3JQMA 1U45A 4CTAA 2J6SA 1I94J 2VQFF 1R27B 2EK1A 4AT1B 1VLYA 2UUAF 3LWMA 2BW2A 4CIOA 3W65A 1WC5A 4DG1A 3H2UB 4JI3J 2DISA 3MR7A 2YH1A 3T5HA 2CKWA 3KK2B 1TFWA 3M32B 2UUTA 4KHPF 1HW9A 1E6YA 4U8VA 2VB6A 5DETA 2HRTA 2C2ZB 3UN5A 4BLGA 1K1SA 3NCRA 2KKHA 2WB4A 1UFKA 1SL0A 2LP4A 2LXUA 1JXLA 2FLLA 3D1QA 1T03B 4YHHJ 4USIA 2GA7A 3SEOA 2EK6A 1WG5A 3CMQA 5HJYA 1FKOA 4A8WA 2MQOA 2M7SA 3GWCA 1CPZA 1SL2A 3THVA 3NKYA 2AF6A 2F40A 2KVQE 1I6JA 2DD8S 4TU8A 3MPYA 2DNOA 1S1XA 2V4RA 1M5KC 4CT8A 4CH7A 3K58A 3QIPB 3ZTSA 4ZIVA 3I55S 4O44A 1Q4RA 1R8HA 4IFVB 3PY8A 1URRA 4V1Ak 4YMEA 4M5DA 5HBMB 3M8ZA 4YOEA 2R7VA 1S6QA 5B09A 3MPUB 4ZPTR 1U6BA 3DM2B 4KE5A 2W1BA 1KR4A 4PR6A 2OUGA 2K7JA 2CFXA 1BQNA 2HZAA 1QVGR 3I96A 1RTIB 1FKPA 5CZXA 1SVDA 3RBEA 3H59A 2JC0A 4A8OA 4HDGA 5I4MA 1FEHA 1RLCL 2M8HA 2BJ7A 2ALZA 3BR9A 2ABYA 2KZZA 3KXDA 4F50A 3R2DJ 1MNEA 3CJKA 1VISA 2OD4A 2VG6A 5GADU 3E01A 1JLEA 3EYZA 2F1FA 2DB1A 1Q8BA 1NPPA 1SJ4P 3FEXB 1JLQA 2GQCA 3EVWA 4N77A 5KFXA 2OPQB 3M30A 1YITS 3K57A 3KUGA 1F3VA 1VOMA 2ROEA 2J7KA 4C6AA 1JXVA 1K0TA 2Y0SD 2IA6A 2JOQA 4GO5X 4ZIWA 2BQUA 3BS9A 4ECZA 3QRPA 2OPSB 5ETLA 2NZCA 4NXMF 5KFCA 1LK5A 1EQ0A 2J9CA 3CWJA 3DRYA 2W7PA 2X1BA 2J9EA 1QE1A 2IVFB 5CYQA 3JAMY 3IN5A 4RW9B 1WHYA 2OP5A 2X1GA 2XLKA 2AU0A 5E3QA 1N5YB 5T14A 4ZJOA 2VFRA 2MXYA 4DR1J 4BDPA 1KLMB 5L39A 1XNQJ 1ZA1B 3S01A 1YJTA 1CJUA 4B3SJ 2Y0BB 1G6BA 5ETVA 2CVIA 1UWAA 5E0OA 1T3OA 3MR3A 2BJ9A 3QGPA 4HL9A 3WIUA 1Q7LB 4CO4A 3JSMB 1GXTA 2DEJA 2ZHOA 2LXFA 5JUMA 1BGXT 2LYVA 1S12A 1FERA 4J7CA 2BR0A 4X4NA 1UMJA 1HWIA 5T41A 3CD7A 2QE5A 4WK3A 1OY8A 1N34F 3B4MA 2ZZNA 3HZEA 3DLKB 3KG0A 3NLCA 2IMWP 1RTHB 1HNVA 3R7SB 4UQGA 1U6ZA 5FJ4A 4ZCIA 1QLNA 1ITPA 2DH8A 1C1CB 2N3OA 2QYGA 2HMIA 1LWCA 2E29A 2IJRA 2V2VA 1HQUA 3MTJA 4X4VA 2DPIA 5HROA 3HF5A 1GMWD 4KGMA 2VZ9A 5M2RA 3RUBL 3CNQP 2EWHA 1N4LA 3HD2A 5H9EK 3T1HF 1U0SA 3QLHB 3SDEA 1LFWA 2MQPA 1DFDA 3UWTA 3AOAA 4MIAA 1GEHA 3GYNA 1JLBB 5K20B 1IKXA 1KP6A 4NXNF 4QR2A 2E66A 3MPDA 1RTDB 4DEZA 2FLPA 1AZSA 2CZ4A 2YKQA 3LW5C 4EBDA 4OHXA 2CDRB 3KMSA 4QIGA 4ZLPA 3PRDA 3H8YA 4TY8A 3N5FA 3TQ1A 3G82A 2B9XA 3FZBA 3JAMU 2HEKA 1TL1A 4J9MA 3Q83A 3UW1A 1NDPA 1N5QA 4NE9C 4M8LA 2MQMA 3DLEB 5EWFA 4R8UA 1T9WA 3LP0A 1ICEB 2NR0A 2DO0A 3MMCB 5U47A 2OLWA 2RJZA 4O3QA 2YKPA 3MMJA 3V6KA 3FFIA 1H2TZ 4NI2A 3AB2B 1J27A 4LF8F 3MCNA 5DLGA 2GAHC 3D7SB 1FHTA 2M52A 3OL9A 3G2XA 2YX4A 5A76A 4B3MF 4YR2A 2CPDA 4NLXA 4LJMA 3MZIA 4PWDB 1SH3A 4KPYA 4QU7A 4P2FA 4DV0J 3CF5Q 4JI5F 4PXBA 4JP8A 4ED4A 1LOUA 1IBMJ 5IQ6A 3W2VB 4ZP7A 3DOLB 1FNOA 8AT1B 2H9ZA 5DZ7A 2FJXA 1RAOA 1NLKL 2A3JA 7FD1A 4TLRA 3HVTB 3R5BA 3GMGA 1VQ9S 3WX4A 4RW8A 3P5BP 3WHIA 5F3TA 2CYYA 2XYPB 4URSA 2N7YA 1FXLA 2J9DA 1GXUA 1S1UA 4ZVRB 2B0GA 3HVWA 2MDAA 2KG1A 3HT3A 2R42A 1U1QA 1TTHB 2J5AA 4ICLA 3RRKA 4U7CA 4DUZF 3Q8QB 2ZBQA 2JH3A 5LJ3Y 1VRTB 1TP7A 4FYVB 5FDLB 4F0KA 1MWZA 4TU7A 2ZH4A 2QV6A 1G4CA 2ZDOA 3CDAA 2F8EX 3LA0A 2Z30B 3PCOB 2ACMA 3ENAA 1KQSR 5M2PA 2C3MA 1IWAA 2EFOA 2H3EB 2QFJA 5M2UA 2XTJP 2I6WA 2UU9F 5KFDA 4LSLB 3MCSA 3TJ9A 3AXMA 2IAJB 3UVJB 4OYPA 1VI7A 3EZUA 2OAUA 2ZKTA 3QT8A 3QT5A 3U7JA 5KFIA 1MG7A 1S7IA 1V5VA 1YKWA 2R9LA 2ZWPA 3KK2A 4MAKA 1EP4B 3M32A 3BDEA 1NPKA 2B5JB 1DQAA 4CLFA 3CXCR 1ZZNA 4DSEA 5EN1A 2N82B 5KG2A 3PW2A 3VHQA 3IP0A 4NLVA 2E7VA 2C28A 5KFEA 4DS4A 5GAHI 1FE0A 2ASLA 1T03A 3ZNUA 4ES1A 2VQFJ 4ZVTB 5J1EB 3MM6B 3T1YJ 4QIWD 3VGVA 4JI0F 4K4WA 1YRTA 4DV2F 4DSJA 4NLUA 2GCFA 2J8AA 4USMA 2Z2LA 4DFJA 2G2ZA 1Q78A 3I32A 3Q8SB 4NWBA 2ASJA 1RP5A 3QIPA 1BY9A 1TKTB 4HTIA 2QA2A 4CZCA 3EJMA 3NGKA 1TK5A 4IFVA 5JJBA 5ETTA 2JEGA 5LXRA 5HBMA 4K2JA 2AKWB 4ED5A 3A8JA 2BA9A 4I1TA 3G6VA 1S1WB 3IGNA 1F60B 3NOCA 2CPXA 4A47A 4IRDA 2Z0GA 3DM2A 4LMZA 1WDTA 3KG4A 3W9HA 3FK4A 1YJUA 3CDEA 3CCVS 2P9EA 3D6MB 3JYTB 2CJQA 2BABA 1O6XA 1KTVA 4G3IA 2RIJA 4QQBA 1RTIA 3HVRA 2L9DA 4YB5A 5CZVA 3K2YA 3C19A 4LFAF 1T94A 2NXJA 4Q8FA 1T9UA 3HJVA 1SIZA 3MD1A 4ZN3A 2GV1A 1MWYA 3FZ2A 1KFSA 5KG1A 2K8GA 1Y11A 4DV3F 2D7SA 4J9KA 4CM0A 1TVRB 3KHRA 4WP8A 4O0IA 3HHLD 3N5BA 4XTTA 4HKQA 3TR5A 2ZH3A 2OPQA 2WBMA 2AYBA 5E33A 2V69A 4FXWA 1FESA 2XS7A 3TZXA 1RWOB 4F8RA 1HD1A 3D28A 3QJPA 2OPSA 4E8UA 4IO9Q 4DX6A 5IC6B 5B08A 2ZH8A 4DLGA 2EEYA 3WIVA 4RW9A 3ET6B 4HH1A 1WHXA 5HLFB 2MGZB 5A8RB 4MKVA 1N5YA 1CULB 1KLMA 3AODA 4R0EA 4WFZA 1V6HA 3QMQA 1XR7A 3NAHA 1SKUB 4X62F 3CCSS 1IXKA 2XWYA 1HYSB 4J9NA 4LFBF 3EXYA 4Q7AA 4F04B 1ACMB 3VVUA 2A2CA 3N4WA 3M6XA 4JYAJ 4C3MA 2CQHA 3TA0A 1X31C 1ULRA 4ZJLA 2C2MB 2Z57B 2CPEA 3NWRA 2CADA 3P8BB 3M05A 2GQQA 4J5OA 1N32F 1NJZA 4KR0B 2RRBA 5LMUJ 4QWAA 2BOPA 4P6QA 1UEKA 1SQFA 4M5MA 4G65A 2L9NA 3DLKA 2O5DA 4KFBB 3CDBA 1HNXJ 1R8PA 1X0PA 1RKIA 4IUFA 4X66J 1YVFA 5L1IA 3PRBA 1RTHA 1NK7A 5KFLA 4OL8A 1C1CA 2PSZA 2JLGA 4AL7A 2KFZA 5JXSA 2X3GA 4KAIA 3BQ2A 1NK9A 2QLJB 3MCMA 4NMXA 4LF4J 3MPWA 1L3SA 3HHKA 2XI3A 4U7UD 4IR9A 1GTHA 3VAHA 3DC2A 4C4WA 4JI1J 1N34J 3OTOF 1VBKA 4B3OB 4QYRA 3TWZA 3HDSA 3HHDA 2OH2A 1X9SA 3LPYA 3C14B 4K4VA 3QLHA 3HXMA 3BBFA 2HVZA 3OFFA 3FC9A 2GQ2A 1UW9A 1L3TA 1IKWB 2I5JB 1JLBA 1HQ2A 3NGUA 3CCLS 2DTJA 2B51A 4QIFA 3VV2B 4TQRA 2HVDA 6AT1B 1TV6B 1RTDA 2YX7A 3GIJA 2R7TA 3IBCB 4GVBB 4RU2A 3CDWA 1IKYB 4WK1A 2P5VA 1R6YA 1M5PC 2FVCA 5EX3A 2IJNA 4B9MA 2P6TA 3RAQA 5H9FK 2DHSA 1F0XA 1PKUA 1LFPA 4IG0B 3THTA 3UR0A 1HKAA 1IJFB 3DLEA 2IJFA 2KT3A 4OYZA 3EGWB 4ED1A 1PAEX 2G0JA 1PAUB 2YY3A 4F2SA 1YBAA 2XCPA 4YP3A 2CG4A 4NCAA 4YN3B 1UTAA 1JLFB 3MMCA 2IFXA 5KAKA 1PIEA 4PKDB 2CNLB 2V4QA 1RA6A 2P9CA 3PW0A 1QD1A 2C2NA 3IR5B 3T5JA 2ALYB 2Z2ZA 2BV3A 1RT6B 5F41A 3KLHB 1JLCB 3IAS9 3ULHA 1NK4A 2HURA 4PWDA 4UUWA 4M5JA 4Y6IA 4OI1A 2A10A 1FTCA 4YB6A 3LF0A 1RWPB 4WTOB 1ZS6A 3BQ1A 3HZGA 2GHWA 4N76A 3M1VB 3P5TL 1NKBA 4MKBA 3W2VA 3DOLA 4F25A 2KTQA 2XY7A 2F63A 4LRAA 3K17A 2JC1A 1H7XA 1OWXA 4K2XA 3ZZUA 4E0DA 3TX8A 4GVLA 1A7GE 3QWUA 4UTGA 1OYDA 1LXJA 3HVTA 3BSCA 3KJFB 1S9GB 5I3UB 4LQ9A 4KV8B 3DRPB 3SQOP 3F44A 1S6PB 2KVIA 4MYUA 2VBXA 3UI3A 4JI5J 2DNZA 4F3OA 3QNWB 4OZ2A 2HFSA 4DR3F 2O67A 4ZVGA 2HYIB 2BJ3A 3HD1A 4O3NA 2PT0A 3K7RA 3P49B 1VRTA 4OX8A 4QWDA 3Q24A 3POTB 1JWWA 5FDLA 2B7BB 4O3PA 2O1PA 4ILRA 1D09B 3TAQA 4OJHA 4HACB 1S6OA 2RNEA 4ALZA 3CCJS 1FX2A 5KG5A 3AJ1A 4A8YA 1KQKA 5C42B 1ZPVA 1FWPA 5GADI 3CJ2A 1OYEA 2FHMA 4IKAA 4LSLA 1KBRA 2JJ4D 2IAJA 2D1CA 1N48A 4FYXB 4DUZJ 4YS2A 2I9SA 3I4PA 1XMQJ 1KVKA 1ZM4A 2LECA 1VC0A 1EP4A 2GIFA 2B5JA 5IQQA 1XN9A 2OPRB 1HQEB 2YWHA 2XGQA 3R5JB 1CBKA 3D0IE 1H7WA 5HSPA 4LF7F 1X60A 1QSYA 2KH9A 1U8SA 4J9RA 3GONA 4BHQA 5J1EA 3K5OA 3MM6A 5LSLA 2HNYB 5KFQA 2OPPB 4LF5F 1NB7A 4H4KC 2HBRB 4DR2J 3L3CA 1SBRA 2EI5A 5MAOA 2V8VA 3A8EA 3UO0A 2H1YA 5C25B 5HAOA
chains in the Genus database with same CATH topology
5D15A 3UVJB 4WP9A 3G82A 4OYMA 4OYWA 4OYPA 5D0GA 5D0RA 1WC3A 1CJKA 1FX4A 1U0HA 3R5GA 1CJUB 4P2MA 4USWA 1CJVB 4USTA 3ET6B 3C16B 4P2XA 4NI2B 2BW7A 2GVDB 4CLFA 1CJUA 4OYOA 4CM2A 4USVA 1CULB 1Y10A 1TL7B 4WP3A 1CJVA 4CLPA 1CS4B 4CLTA 4CLLA 1YK9A 2GVZB 4CLUA 3ET6A 1WC4A 5D0EA 3C16A 1WC6A 1YBUA 4NI2A 4OYZA 3C15B 1WC1A 4USUA 2GVDA 2WZ1A 4OYXA 4WPAA 3UVJA 3MAAB 5IV4A 1CULA 1TL7A 1WC0A 4OZ2A 1CS4A 4CLWA 2GVZA 4CLKA 2QV6A 3C15A 4CLYA 1Y11A 3C14B 3MAAA 4OZ3A 1AZSB 4CLSA 1CJTB 4OYBA 4CM0A 5IV3A 4P2FA 2W01A 4WP8A 1AB8A 3G82B 4CLZA 3C14A 4OYAA 4OYIA 1AZSA 1WC5A 1CJKB 1CJTA 1U0HB 1FX2A 3MR7A 5D0HA 1YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D15 A;  3UVJ B;  4WP9 A;  3G82 A;  4OYM A;  4OYW A;  4OYP A;  5D0G A;  5D0R A;  1WC3 A;  1CJK A;  1FX4 A;  1U0H A;  3R5G A;  1CJU B;  4P2M A;  4USW A;  1CJV B;  4UST A;  3ET6 B;  3C16 B;  4P2X A;  4NI2 B;  2BW7 A;  2GVD B;  4CLF A;  1CJU A;  4OYO A;  4CM2 A;  4USV A;  1CUL B;  1Y10 A;  1TL7 B;  4WP3 A;  1CJV A;  4CLP A;  1CS4 B;  4CLT A;  4CLL A;  1YK9 A;  2GVZ B;  4CLU A;  3ET6 A;  1WC4 A;  5D0E A;  3C16 A;  1WC6 A;  1YBU A;  4NI2 A;  4OYZ A;  3C15 B;  1WC1 A;  4USU A;  2GVD A;  2WZ1 A;  4OYX A;  4WPA A;  3UVJ A;  3MAA B;  5IV4 A;  1CUL A;  1TL7 A;  1WC0 A;  4OZ2 A;  1CS4 A;  4CLW A;  2GVZ A;  4CLK A;  2QV6 A;  3C15 A;  4CLY A;  1Y11 A;  3C14 B;  3MAA A;  4OZ3 A;  1AZS B;  4CLS A;  1CJT B;  4OYB A;  4CM0 A;  5IV3 A;  4P2F A;  2W01 A;  4WP8 A;  1AB8 A;  3G82 B;  4CLZ A;  3C14 A;  4OYA A;  4OYI A;  1AZS A;  1WC5 A;  1CJK B;  1CJT A;  1U0H B;  1FX2 A;  3MR7 A;  5D0H A;  1YBT A; 
#chains in the Genus database with same CATH topology
 1UA0 A;  4ZLL A;  1TKT A;  1XMO F;  4Q8E A;  2HS0 A;  3Q22 A;  4CDI A;  3FEZ A;  2VD3 A;  4AQY J;  2NYI A;  1FCA A;  5AXN A;  2AQ4 A;  1S1W A;  2ZUA A;  2ILY A;  5DLF A;  1DY3 A;  3LPE A;  2EG1 A;  2L41 A;  4U7U K;  1EJ7 L;  3TAR A;  3JYT A;  1F5A A;  3O8W A;  1UJ6 A;  2FHJ A;  1Q8L A;  4DF8 A;  2HQD A;  2HG4 A;  1B0V A;  5K8P A;  3VAJ A;  3GII A;  1WSV A;  2MPU A;  4I6Y A;  4CCH A;  3QYY A;  3K5N A;  3TQE A;  3PKM A;  2Q3P A;  2XMT A;  2DYA A;  3MEG B;  4HHJ A;  2ZVI A;  2DXF A;  2M0G B;  5KT7 A;  2VKR A;  3D6H B;  2HFV A;  1DHM A;  1RHU B;  4NOH A;  1RCX B;  1M1K T;  1RT4 B;  3UPF A;  2DH9 A;  3HM9 A;  2ZBC A;  1TVR A;  3K0J A;  3D3C J;  3KWM A;  1YGY A;  1U1M A;  4NA1 A;  2CG8 A;  2CJA A;  5HP1 B;  2N7C A;  1HBO B;  3DOK B;  4NCG B;  4HYK A;  3I6P A;  3KKF A;  4K4U A;  4ZPC A;  1LWE B;  3P45 B;  1UW4 A;  4I69 A;  3G96 A;  1RDR A;  4LSZ B;  2EW9 A;  3GJS B;  5LSR A;  2ZJQ Q;  1QDU B;  1FK9 B;  4JBC A;  1Q82 T;  4ID8 A;  5E7O B;  4OV6 A;  3ET6 A;  3MM5 B;  1RBL A;  4DV3 J;  2AGP A;  1B0P A;  2EBE A;  5HLF A;  3I5A A;  3OLB A;  2MGZ A;  5A8R A;  3IRW P;  4DUY J;  3PFE A;  1PC4 A;  3K5L A;  1QSS A;  1CUL A;  2D9O A;  3Q2T C;  4KY3 A;  1JJH A;  4AE5 A;  3D6F B;  1KFD A;  3J7Z T;  1NK0 A;  3FGV A;  4JI6 F;  4Y2K A;  1HYS A;  1BWV A;  2AJ4 A;  2KZM A;  1X4G A;  2YPZ A;  2UVR A;  4YDD B;  1ZH5 A;  1MRO B;  3MAQ A;  1GK8 A;  1YG0 A;  5K5M A;  4J9O A;  4C8Y A;  1RAD B;  4WKR A;  2IIH A;  3ITH A;  3UD4 P;  3O44 A;  1Q16 B;  5KFH A;  3DU5 A;  2IA0 A;  2H48 B;  2OHD A;  1NJW A;  2V9K A;  1HL6 A;  4HT5 A;  2AYE A;  4LVO P;  5LJ5 Y;  2RQC A;  2XSF A;  2LEB A;  4KFB A;  4QWE A;  1V3S A;  1YJV A;  4DCJ B;  5E3A A;  3ILO A;  4WFB Q;  2W2Q P;  4DV1 J;  3D5M A;  2NXU A;  2WZ1 A;  2K2P A;  3RAX A;  2RT3 A;  3JSB A;  2MYF A;  1JXE A;  1TAQ A;  2C42 A;  3IM9 A;  2HZC A;  2O3D A;  4OZL A;  5GAE U;  2G2Y A;  1F2G A;  4NA3 A;  3R9L A;  2UXB J;  2ZH1 A;  3DXB A;  3M8Q B;  4B3O A;  3SYZ A;  2CQ4 A;  1K44 A;  4F3M A;  2KL8 A;  3C14 A;  4OZ0 A;  3RR8 A;  4P73 A;  4CP5 A;  1DAX A;  4A8X A;  5D0H A;  3EM1 A;  1RT2 B;  2XG8 A;  3IS9 B;  4G1Q B;  2DH7 A;  1QJH A;  2HIQ A;  2CNK B;  2IBK A;  1IKW A;  2I5J A;  4DX7 A;  2BJE A;  5HK4 A;  3ETM A;  3T19 A;  2EKY A;  2VUG A;  1TV6 A;  2QRR A;  4EEY A;  1IBK J;  4DHV A;  4GVB A;  4DL2 A;  1IKY A;  3PR5 B;  3OTO J;  3MXH P;  2HVH A;  3V4I B;  1RBA A;  2CVE A;  2JLE A;  2DBB A;  1VIO A;  3R3T A;  4IG0 A;  1HNZ F;  3FNN A;  3H90 A;  4MT1 A;  3E51 A;  3D3B J;  4B3R J;  3PM9 A;  2F5G A;  2VH7 A;  2JL9 A;  2CJ9 A;  1RT1 B;  4UOG A;  1RT7 B;  2ZC4 A;  1FT8 A;  1JLF A;  5D4N A;  4DBQ A;  1IN0 A;  2W01 A;  4J9Q A;  4NL5 A;  4TLQ A;  2R7Q A;  4NPO A;  1XNR F;  1JX4 A;  3RGI A;  3RB3 A;  4IQM A;  3OFG A;  1U09 A;  1RT6 A;  3KLH A;  1JLC A;  5B0D A;  5F8N A;  3PW7 A;  3GZ7 A;  3ISN C;  1OMS A;  2XLI A;  3TOQ A;  3EVM A;  2AYG A;  4PXC A;  3V4M A;  1X9M A;  1RXO B;  3M1V A;  5KFB A;  3I5B A;  1WEZ A;  2OML A;  2ZNY A;  4DWI A;  4FYW B;  1HLW A;  2HWT A;  1SC6 A;  1FA0 A;  3A8I A;  3EGN A;  4JI2 F;  3MOJ B;  4DR7 J;  2ERR A;  1BQX A;  3O6Q A;  3MM7 B;  1VBZ A;  1W7W A;  5KOW A;  4X84 A;  3MR2 A;  1S9G A;  3TAM B;  5I3U A;  4K4Z A;  1N36 F;  1Y7P A;  4KV8 A;  3FMW A;  3DRP A;  4HH0 A;  1S6P A;  3MDF A;  3Q86 A;  4KQZ A;  2H5E A;  2Q43 A;  4FP9 A;  3L4B C;  3VAL A;  1FD8 A;  1MMD A;  2LVW A;  2XS2 A;  3T9N A;  1P9Q C;  2WSC C;  3E2E A;  3D54 A;  3CJ3 A;  5DG8 A;  4DZD A;  4EWT A;  1W26 A;  3BGU A;  2CQG A;  4Z37 A;  3RBD A;  4HAC A;  2LKZ A;  1HWU A;  4JV5 J;  3JTO A;  4O3O A;  2HGN A;  1RWU A;  4TU9 A;  3M7V A;  3CO9 A;  1GQE A;  5C42 A;  3S1T A;  3OT9 A;  2R2T A;  3R8Y A;  2BX6 A;  4GO7 X;  1N52 B;  4LVN P;  1CC7 A;  2A6O A;  1C0U B;  1TL7 B;  4DR3 J;  3G8S A;  3TVZ A;  2HHS A;  1HNI B;  4AXJ A;  4IH7 A;  1KOH A;  2V94 A;  4NZ0 A;  2XMU A;  2MLZ A;  3FBB A;  3ELH A;  3PYG A;  2BM0 A;  4F4Y A;  1V3R A;  1EKR A;  5IS2 A;  4W98 A;  3PYE A;  4FS2 A;  4ECU A;  2OPR A;  1HQE A;  5CCM A;  2EBG A;  3BPD A;  4I2P B;  2WCX A;  3PHT A;  2FPH X;  3OVA A;  4ZVH A;  4A8Q A;  1Q7Y T;  4DSF A;  3NL0 A;  2HNY A;  2OPP A;  3OR2 B;  4RLE A;  2XZD B;  5LMN F;  4ED7 A;  3K5M A;  3OPK A;  3SZ2 A;  5J1P A;  2QA1 A;  4DFK A;  2Q66 A;  4AL5 A;  5C25 A;  4PEO A;  2CQC A;  5RUB A;  4V19 X;  5KFT A;  2B9Y A;  2PC6 A;  3CCQ S;  2YBV A;  4ZVO B;  2D69 A;  3Q0A A;  2UXD F;  5D78 A;  4QPX A;  1X5O A;  4OX6 A;  4C8N A;  4OZ1 A;  3IRX B;  3WQP A;  2EKN A;  5CQG A;  4M5N A;  2QIF A;  4K4Y A;  4RU9 A;  4OYX A;  3OHA A;  4ZP9 A;  2DT9 A;  3FUY A;  5LSO A;  1F3F A;  1ZTW A;  2HBZ B;  2XYG B;  1VLO A;  3MMB B;  4DZ6 A;  3IGV A;  5HVF A;  5BYR A;  1VGY A;  5HVH A;  2XZT B;  4DL6 A;  5LXY A;  2FGC A;  4IG3 B;  2V63 A;  3ENW A;  2LEP A;  4WCE Q;  5IV3 A;  1KQG B;  1RAI B;  3UNG C;  3VVT A;  4K4T A;  2H4W B;  4J9L A;  2KRR A;  1IVZ A;  5DZ6 A;  1WTF A;  3MEG A;  4PAA A;  2F65 A;  4HLB A;  2UXC F;  3IBF B;  1QTN B;  2JWN A;  2DCU B;  3DYA B;  3V5R A;  4QR0 A;  1RT4 A;  1S9E B;  5D3G B;  1Y4Z B;  2AMC B;  2BKP A;  2DGQ A;  4MK9 A;  1SJ3 P;  4YDX A;  3V6D B;  1NHU A;  3CCM S;  1F1B B;  1SC1 B;  5HP1 A;  4CO1 A;  4QYZ J;  1HBO A;  3CIM A;  2X7I A;  3DOK A;  3W3S A;  4NCG A;  1KDN A;  1LNQ A;  2OTL S;  4WP3 A;  1HFE L;  2AGO A;  2BKO A;  2RQK A;  3CIZ A;  1NK5 A;  4ANE A;  1LWE A;  1QY7 A;  1G7C B;  3DCA A;  5CYM B;  4PPD A;  4NAS A;  4F36 A;  1B4S A;  3GP9 A;  5AT1 B;  1FK9 A;  3HT0 A;  3MM5 A;  3NP5 A;  3EXC X;  2KHC A;  4Y3C A;  3FCW A;  1T05 B;  1U1N A;  8ATC B;  2WAQ D;  1TUW A;  2DHH A;  2IM0 A;  1RHK B;  3LOU A;  2R7O A;  3TI0 A;  4OI0 A;  2ZH7 A;  3BBC A;  2E5L J;  1W2I A;  4FYD A;  3E3X A;  5G0R B;  2DVI A;  1KEK A;  4Q43 A;  4MIB A;  4LQ3 A;  1Y5N B;  1H74 A;  1JJ4 A;  1FF2 A;  1MRO A;  4UF4 A;  1U1K A;  1FX4 A;  2ZOF A;  2HHT A;  5HVG A;  2YWK A;  1ELO A;  2R2R A;  2HS4 A;  2LU2 A;  5KFV A;  3ILL A;  3KDN A;  1FRM A;  2J9D E;  3GU0 A;  4A8K A;  3RTV A;  3D9B A;  2YWE A;  3GG0 A;  1XJW B;  4KT0 C;  1IWG A;  2MKY A;  2NXC A;  1Y10 A;  1NK8 A;  4LIR A;  1IM6 A;  4DSL A;  4U6P A;  3CJS A;  1WOS A;  3QWP A;  3Q2S C;  1RZM A;  2CPI A;  2BE2 B;  4JI6 J;  1HI1 A;  4ECV A;  3JQJ A;  1VC5 A;  3D66 A;  1ZPW X;  5KT4 A;  4FYY B;  3CJ8 A;  2R8H A;  2F4V F;  3HMJ G;  3OL6 A;  4XAK A;  1WD6 A;  4DDF A;  4ZPV R;  1YDL A;  1VYA A;  2C3O A;  3WZ0 A;  2EFV A;  1X8D A;  2MZ1 A;  2DY1 A;  4JI8 J;  1ROF A;  4MKY A;  3M8Q A;  4M5G A;  3FCV A;  3JTN A;  3N9U C;  3TRG A;  5B0F A;  2HW3 A;  3LUY A;  1QVF R;  4B17 A;  1RT2 A;  1Z1Z A;  3NAI A;  3IS9 A;  4G1Q A;  2QLB B;  2XNQ A;  4PXD A;  2KXH A;  3HHE A;  2UVW A;  1UPM B;  2E1P A;  4BWJ A;  3IO1 A;  5EHH A;  2QYC A;  2HHH J;  3DRS B;  1FNM A;  2KM8 B;  4JI4 J;  4MFB B;  1DQ9 A;  3DI6 B;  3M2R B;  3QQC D;  1SJR A;  1WC0 A;  3V4I A;  3GV8 B;  4CH1 A;  1R0C B;  2XMK A;  3G6X A;  2DR5 A;  3PDN A;  1NU4 A;  1R6V A;  1UP1 A;  2H51 B;  5MLC V;  1IBL F;  1TKZ B;  2Q79 A;  2XHW A;  1EIY B;  3VAF A;  3OLA A;  1UWB B;  5JVG Q;  4B08 A;  2YKN B;  1QTM A;  2XS5 A;  1RT1 A;  1RT7 A;  3NOG A;  4B3T F;  5L9N A;  5C2C A;  1U2F A;  4CYU B;  3P4U B;  3PO4 A;  2FVS A;  2B6A B;  3R97 A;  1BLU A;  1FNX H;  4K4X A;  3M6V A;  3VAK A;  4LF2 A;  2LDY A;  1VK8 A;  2ASD A;  1SJF A;  5CHC B;  3UCU P;  5KT3 A;  3CCE S;  1PJ5 A;  4M5I A;  2FY8 A;  2MKH A;  3CUL A;  3J7Z 5;  4USH A;  4ECR A;  4QCL A;  5F3Z A;  4DU7 A;  5HAT A;  5KFN A;  2CUY A;  2Q6B A;  4WU3 A;  1T02 A;  3W5Y A;  5DDO C;  1NPR A;  2GVZ B;  2R8J A;  1BQM B;  3W5Z A;  1AUD A;  5BXI A;  2R4F A;  3DLL Q;  3GFY A;  3B78 A;  1AFJ A;  4J9P A;  2HS3 A;  3GJT B;  4BBY A;  4PUO B;  5F8G A;  2Y9H A;  1WHV A;  1RLD A;  3MM7 A;  1WI8 A;  3FKB A;  3G87 A;  2ATC B;  5L46 A;  3ZZ0 A;  5CYJ A;  4ED2 A;  3BV8 A;  3IWX A;  3MUM P;  1NSP A;  3OXL A;  3TAM A;  1T9T A;  4DX5 A;  2HIY A;  4K7Q A;  4RJV A;  5F8J A;  3QGG A;  1L3U A;  2HZV A;  2ZZM A;  1VQY A;  1D0E A;  3PNI A;  4QIV A;  4I56 A;  2PN6 A;  3VAM A;  5B7W A;  3MAH A;  1PCA A;  2Z2Y B;  4Y28 C;  1RKJ A;  3IR7 B;  4LT6 A;  2VPW B;  1R0B G;  2QZ8 A;  4UST A;  1RI7 A;  4EYH B;  4PWW A;  4HDH A;  1U7L A;  4OX7 A;  5D4P A;  3NNH A;  4TN2 A;  1RYS A;  3VGT A;  2XBP A;  1D9D A;  3CE8 A;  1N36 J;  2IM3 A;  1VQM S;  2Q6C A;  3BZQ A;  2UV8 G;  3G9C A;  5B0B A;  3LP1 B;  4ELV A;  5C7P A;  4TKT A;  1C0U A;  1S59 A;  1TL7 A;  3KMQ A;  3TA2 A;  3G6Y A;  1TL4 A;  1MWQ A;  1HNI A;  4LR7 A;  2K3I A;  2BVZ A;  2B3T B;  1Z4U A;  2NSB A;  2HND B;  1F5C A;  2L9W A;  4DL5 A;  2M88 A;  1EQM A;  3A8K A;  1RGV A;  3EIC A;  5AE1 A;  1HBN B;  3OW2 R;  2VON A;  1YJN S;  5B0G A;  3RR7 A;  4DQI A;  2J0W A;  5BR8 J;  2MHE A;  2DPJ A;  3KLV A;  4I2P A;  3RW7 A;  2WOM B;  2RQM A;  2RB7 A;  4ENO A;  2COL A;  5D0G A;  3K8V A;  4K0K F;  2E5J A;  2HHP A;  4CO5 A;  1M5O C;  2HRY A;  1EB0 A;  4DS5 A;  4LSN B;  4J9U E;  3OR2 A;  4WBF A;  2QFI A;  3HVA A;  1I5O B;  2LQ5 A;  3HHN B;  4EZ9 A;  4FNH A;  5E2Q A;  2ADC A;  4J91 A;  1NO8 A;  1WKJ A;  2JDJ A;  2GS8 A;  1QAY A;  1C1B B;  2HVE A;  1C4A A;  3I5C A;  4C8O A;  1WC6 A;  4X4T A;  1NDK A;  3MAA B;  3PJX A;  3KNA A;  3CTR A;  5ETQ A;  3WDO A;  1KON A;  1TU0 B;  3IRX A;  2FGO A;  2BQ3 A;  1TQL A;  3I56 S;  3CME S;  1DTT B;  3G71 S;  3V81 B;  3MMB A;  2GFF A;  4IFY B;  3UNY A;  1S76 D;  4MMO A;  2DNY A;  4IG3 A;  4B9U A;  5K8M A;  1FO1 A;  4OYI A;  3TUZ C;  4C0O C;  3MEE B;  1UA1 A;  2QLW A;  1I3O B;  1YJW S;  1HW8 A;  2C3U A;  1B7F A;  1M5S A;  2XNR A;  1AT1 B;  5HMX A;  1T8E A;  4USW A;  4WFY A;  1J5O B;  5GAE I;  5ETN A;  4C7Q A;  3EDR B;  3QRR A;  1KLN A;  2VQE J;  3MGJ A;  2RDI A;  4DR4 F;  4DV5 F;  3L7U A;  1S9E A;  3KFW X;  3R5D A;  5D3G A;  4U96 A;  3KHH A;  1SV5 B;  1WF0 A;  2W9C B;  1VQ7 S;  1HA1 A;  4BC7 A;  3J81 j;  3V6D A;  3UFC X;  4WWS A;  3PTW A;  2RF2 B;  2PFF B;  3EE3 A;  2AYM A;  4DR6 F;  3RZA A;  5KFZ A;  2YWW A;  1SCJ B;  1ZM2 A;  4I7F B;  2R8K A;  2W2P P;  3ZC4 A;  1H38 A;  4CLW A;  1PJ6 A;  2MQ8 A;  2OI2 A;  1X4F A;  3HKW A;  5CYM A;  1V3Z A;  2ILZ A;  1GAO A;  1FJ7 A;  4DV4 J;  3H98 A;  1X4D A;  4ED6 A;  4NEZ A;  1GTE A;  2CQ2 A;  1FDA A;  1QUV A;  3CO0 P;  1V5I B;  3I31 A;  3J80 Y;  1IR0 A;  3I9V 9;  3U02 A;  1LQ9 A;  4P52 A;  1B99 A;  2DNG A;  1T05 A;  1U25 A;  1TEL A;  2PMH A;  5LL6 d;  2IHR 1;  3I0S B;  5D0R A;  1OSD A;  4FF4 A;  2J0S D;  3GJQ B;  5G0R A;  4ZPD A;  2FHO B;  3HSJ A;  5KT5 A;  2LEA A;  1B70 B;  2KO1 A;  3T1A A;  1PBA A;  1WG1 A;  2D9P A;  5IZH A;  1FTR A;  3B6B A;  1HPZ A;  1ZM9 A;  2ZJP Q;  4FKY A;  3OVB A;  3HSD A;  2ZNZ A;  2KXF A;  3IC1 A;  4FF1 A;  3AY0 A;  2V4J B;  5H9F J;  4P10 A;  4R25 A;  3DU6 A;  4KYZ A;  4EO6 A;  4K50 A;  1SC3 B;  1PBU A;  2XC9 A;  2DGW A;  4IO1 A;  3UQS A;  5LM7 E;  1Y0H A;  4DJB A;  2BE2 A;  3VQS A;  3EPI A;  4Q5V A;  1LKZ A;  3BYR A;  1DJ0 A;  4TY9 A;  3ILJ A;  4I64 A;  1UEV A;  2HNZ B;  3JSR A;  3PAC A;  3SBM A;  1MW7 A;  4DLE A;  3SFG A;  4H4K A;  4F4X A;  4DL3 A;  4A8F A;  2UUB F;  3TEH B;  4FZV A;  3MUV P;  3RJM B;  4OYW A;  4M95 A;  2VG7 B;  4R0J A;  1HI0 P;  3N6M A;  4DOZ A;  4NA2 A;  2R7U A;  4ZCL A;  3H5S A;  4K59 A;  2VFT A;  3MTK A;  4RBV A;  1P1L A;  2YKM B;  2CQ0 A;  3OL8 A;  2CIM A;  1RT5 B;  1T11 A;  3C46 A;  3SI8 A;  3MEK A;  5DQG A;  1S49 A;  1GH8 A;  2GML A;  2L08 A;  2IM1 A;  2BM1 A;  1KHV A;  1S0N A;  3GIR A;  4Y0F A;  4RO0 A;  2ZM6 J;  5A2Q Y;  2CPZ A;  4WFA Q;  2R3V A;  2XM3 A;  4XDD A;  4KTQ A;  3LAK A;  3CUN A;  2YH0 A;  1P9Y A;  1MU2 B;  3DRS A;  4F26 A;  3ISZ A;  2ZJR Q;  4UY8 T;  4MFB A;  4ZK7 M;  1VFJ A;  3DI6 A;  3M2R A;  2DY9 A;  4XDC A;  1RT3 B;  4OYB A;  1NSA A;  4EO8 A;  5GVQ A;  3QBC A;  4PAB A;  3GE9 A;  1VJQ A;  5HMZ A;  3VR1 A;  5E5N A;  4C11 B;  4I67 A;  3JXO A;  3J80 U;  4IRC A;  3ZTO A;  3HO1 A;  3CCT A;  4TQS A;  1PYO B;  1TKZ A;  2NPI A;  3EPG A;  2DIV A;  3H40 A;  4LRB A;  2EFQ A;  1NB2 A;  1UWB A;  2HWH A;  3MFH A;  4WFX A;  2YKN A;  1FXR A;  3UD5 A;  3ZTP A;  5DQI A;  2XEX A;  1KC8 T;  3Q23 A;  1N5T A;  2YNH B;  1U2C A;  4CYU A;  2B6A A;  4PG4 A;  4AUK A;  1Q79 A;  2HHW A;  4AYB D;  2QLX A;  2GX8 A;  2C1E B;  4DFP A;  1URN A;  2V50 A;  3FBE A;  1RHR B;  4JV1 A;  4RNF A;  4YY3 J;  3ISN D;  4Y2I A;  4ZPB A;  4YFU A;  3IBW A;  4MK7 A;  1YK9 A;  4CQ1 A;  3PW4 A;  2YVS A;  1VQL S;  1K9M T;  3OSN A;  1N33 F;  3P96 A;  3RB6 A;  2MB0 B;  1SQG A;  3AD8 C;  2GVZ A;  1UET A;  1BQM A;  3FSY A;  4PYA A;  4DQR A;  1NHV A;  4X65 F;  4B3T J;  1S10 A;  3U1M A;  5IC4 B;  5GMD A;  5B0E A;  3GCX P;  2RHQ B;  1WF1 A;  4WYW A;  4PUO A;  1KVI A;  3OUY B;  1RTJ B;  1RJJ A;  3OR1 B;  5KG3 A;  2G1H A;  4ZVF A;  1DTQ A;  2WSF C;  3M8R A;  2DR7 A;  1NHK L;  1KD1 T;  3VQT A;  3KJV B;  2AV5 A;  2VOD A;  4WII A;  3V6J A;  4ITS A;  1YJ7 A;  1RAG B;  2YQ0 A;  2CQD A;  3BO4 A;  3MUT P;  2CQB A;  2VFS A;  5DS7 A;  1X4A A;  4BCA A;  3UR3 C;  1I94 F;  2V68 A;  1VCT A;  3NXZ A;  2CQ1 A;  2XGP A;  1M5H A;  1YZ7 A;  3PXG a;  3DDN A;  5BYS A;  4XO0 A;  2QMX A;  4JI3 F;  3BGF A;  1X9W A;  5KG6 A;  5A2Q U;  4B9T A;  4BWM A;  3KK1 B;  3W9I A;  3FBF A;  1NKE A;  3GR0 A;  3LH2 S;  2WVF A;  4OI2 A;  4RZR A;  3H4D A;  2VKZ G;  2Z8Q A;  4DI6 A;  4ELU A;  1UPP A;  4X4Q A;  2FYX A;  3LP1 A;  2VBW A;  2HK2 A;  3F73 A;  5FD1 A;  5F8I A;  1ZET A;  1XTZ A;  1U47 A;  4YHH F;  3OTC A;  4CRJ A;  4WE1 B;  3IWL A;  4LFC J;  2HKE A;  2KI2 A;  2QL9 B;  3DGV A;  3OFH A;  8RUC A;  1ZBT A;  6FDR A;  4KGZ B;  4MK8 A;  2HND A;  1GFW B;  4GKK F;  1FRK A;  3KYL A;  4RW7 B;  2HGM A;  1HBN A;  1WC3 A;  2V0N A;  3UDV A;  4I4B A;  2RSQ A;  1DBD A;  4TNO A;  1CJV B;  2WOM A;  1U1P A;  5CA5 A;  3HSG A;  2XQC A;  2HBY B;  4R5P B;  1WI6 A;  1NEE A;  2C2R A;  3C16 B;  3KOA A;  1T3N A;  4RUH A;  2RRA A;  2FC8 A;  3E8O A;  2JZ5 A;  4LSN A;  1NZ8 A;  1HMV B;  4CNY A;  2F9J A;  4Y65 A;  4ZVU B;  3BQ0 A;  3RB0 A;  4B02 A;  4DMZ A;  2NLW A;  4RPF A;  4IH5 A;  3UDE A;  1VMB A;  3BDP A;  5IV4 A;  6FD1 A;  1U6F A;  1RSC A;  1UJ4 A;  3BH6 B;  1C1B A;  2IDE A;  5SUH A;  2VAS A;  2DR6 A;  4OHV A;  4M94 A;  3MAA A;  1FRX A;  3DRX A;  2VIH A;  2LLZ A;  4IH6 A;  2VC0 A;  2AJQ A;  1JJC B;  5HL7 Q;  1YTY A;  2FZC B;  1DTT A;  1BHN A;  3MCO A;  3DLJ A;  3V81 A;  4IFY A;  4FVM A;  3R5C A;  2BEF A;  3LGM A;  5D6G A;  2FJD B;  1FJG J;  4DPW A;  2F9D A;  1I51 B;  4NRT A;  1S57 A;  3I87 A;  3RBX A;  1GT8 A;  2UUW A;  2ROP A;  4X4S A;  4ZDN A;  4C8L A;  1X5S A;  1VBY A;  3LAM A;  3M6U A;  7FDR A;  5EDW A;  3MEE A;  2V9W A;  2VF3 A;  2H65 B;  3ICL A;  3ADA C;  3MF5 A;  3VAI A;  2G0C A;  2PEH A;  2RU9 A;  4P75 A;  4JB8 B;  2DNP A;  1J5O A;  5H1S V;  1WWH A;  1YWX A;  1OY6 A;  4DV7 F;  2ZWO A;  4WXW A;  2D3U A;  4FS1 A;  3NBP B;  4NML A;  1SV5 A;  1HR0 F;  4DSI A;  2PI5 A;  2W9C A;  3MFI A;  3QAE A;  3UE2 A;  4A4J A;  2RF2 A;  3PW5 A;  4PYD A;  2C2K B;  1GXL A;  3CW2 C;  4DR1 F;  3CCR S;  1ZYQ A;  1TAU A;  1N5S A;  1XNQ F;  1BMQ B;  4I7F A;  4DPU A;  2QO3 A;  4F4W A;  4OI3 A;  3X3U A;  4DUT A;  2MKC A;  1KHW A;  2FIU A;  4OX9 F;  2VC1 A;  4P9S A;  3QAT A;  1D3W A;  1U0H B;  3A1Y G;  4YR0 A;  4M1K A;  3CMA S;  1APS A;  4Y00 A;  5J2M B;  1TMJ A;  4LF6 F;  3CDU A;  2DCL A;  3OXF A;  2GJI A;  3G8Q A;  4DV5 J;  2RAQ A;  4Y2C A;  4ZA1 A;  5IFM A;  2J6U A;  3IFE A;  2PO4 A;  1M0S A;  2WVC A;  1NSK L;  5AJ3 F;  5GAH U;  4B9L A;  2VPY B;  3MPV A;  3I0S A;  5EGY A;  2UUA J;  5K8N A;  2V5H G;  1K0V A;  4N41 A;  2YKO A;  4OHZ A;  3BO3 A;  2BAN B;  4URQ U;  1UVI A;  3PYD A;  2RH3 A;  1JK9 B;  2RML A;  4WPA A;  4WKY A;  1QAJ A;  2QJ3 A;  2IY5 B;  1TUV A;  2BZ2 A;  1YZ6 A;  2AJF E;  4RX6 A;  3GV5 B;  4KHP J;  4X4P A;  3TVK A;  3HFK A;  2YNI B;  2R8I A;  2W7O A;  2V4J A;  2IM2 A;  3DLG B;  5D4O A;  4MH8 A;  3GQC A;  4F2R A;  1Y3K A;  2J0Q D;  2G9O A;  1T9V A;  2BBE A;  1VBX A;  1JMT A;  2ZH5 A;  3W62 A;  3JS9 A;  1U1R A;  3H20 A;  1NH8 A;  2GHP A;  1U02 A;  3CD6 S;  1A9N B;  2HNZ A;  1S0M A;  3FSX A;  2NUU G;  2FJB B;  1ZOT A;  2UVU A;  5JVH Q;  5ETS A;  4QW9 A;  4ETX A;  3SV4 A;  4FBT A;  1RAC B;  1XIQ A;  3OTB A;  3TUJ C;  1UVK A;  2KYZ A;  1FI4 A;  3GSI A;  2VG7 A;  2QMW A;  5T7L B;  5ITH A;  2W9A A;  1UKU A;  3C66 A;  4ES2 A;  3HSZ A;  3CJ5 A;  2AZ3 A;  5EUH A;  1YHQ S;  5GAG U;  4NYO A;  1OSC A;  1N0V C;  1J5E F;  3D0H E;  2W2M P;  2YKM A;  1RT5 A;  2PFD A;  5EX0 A;  2HGL A;  3HJF A;  4ILM A;  1A0O B;  1NKC A;  1HIY A;  2KXN B;  2OEL A;  1ZA2 B;  3GV7 B;  2ZFH A;  3DKD A;  1IQT A;  2UUB J;  1TL5 A;  3QRQ A;  1LWX A;  5A6P A;  1RIS A;  4DL7 A;  1MU2 A;  2MEW A;  1KKH A;  2NSC A;  4OJG A;  1LXN A;  2I38 A;  3D6T B;  4FBU A;  1RT3 A;  2ACY A;  4D3H A;  1X4C A;  2XMJ A;  1WOO A;  4C11 A;  4DL0 C;  3PX0 A;  4ED0 A;  3AB4 B;  3A3P B;  5A6W A;  3IXQ A;  2CJX B;  2XWX A;  3KLG B;  1H3D A;  3GB0 A;  4Z7C A;  2FY1 A;  1IQZ A;  2YNH A;  4ZP6 A;  2IPO B;  1RAH B;  1IBM F;  4ECX A;  1M5V C;  2LDI A;  1FVS A;  2J0X A;  4NXM J;  4TYB A;  1MML A;  2VBY A;  3QZ8 A;  2ZKU A;  4JI7 F;  4B9N A;  1S4E A;  3MM8 B;  1HD0 A;  3UN2 A;  1NCL A;  3T9Z A;  4EI2 A;  3ITH B;  2F8M A;  1WUU A;  1FJC A;  1EAY C;  3WC2 A;  4DX8 H;  3BF4 A;  2ZH6 A;  1AB8 A;  1T7P A;  1S99 A;  4PG7 A;  2W4P A;  5D77 A;  2XMA A;  4ATN A;  2BJ1 A;  1SPB P;  4P72 A;  4KGV B;  1WOP A;  3HUL A;  4X4R A;  2I8E A;  3S6E A;  3OVS A;  1VHI A;  3KLI B;  3PZP A;  4LBH A;  3OUY A;  1RTJ A;  4ZMM A;  4F4Z A;  3OR1 A;  3LTO A;  2RHS B;  3Q89 A;  4XK8 C;  3KJV A;  1PO6 A;  2U2F A;  3PV8 A;  4WFN Q;  3PVX A;  4GKJ F;  5KT2 A;  2GC8 A;  3L09 A;  4W92 B;  4DFM A;  5FII A;  1RE1 B;  1S9F A;  2E1A A;  2XO7 A;  1FE4 A;  2KRB A;  1VQO S;  1OO0 B;  4X65 J;  2KG0 A;  2WTF A;  4USU A;  3PRV A;  3PIO Q;  2NXE A;  3U1L A;  1L5U A;  4JV2 A;  4NLW A;  5ETP A;  4JUZ A;  2B8P A;  1Q53 A;  1UEU A;  1F5B A;  2B8Q A;  3SCL E;  3AOB A;  3UN3 A;  3EDQ B;  2Y1J A;  2BJD A;  4ECY A;  3W63 A;  3KK1 A;  1FJE B;  4CLS A;  4YR3 A;  3N79 A;  1R0A B;  3PKY A;  1HNW F;  2DJW A;  3RB4 A;  1RAF B;  4OLP A;  3V2U C;  3GJR B;  1LW0 B;  3NS7 B;  3W61 A;  3W8P A;  4WE1 A;  4XPE A;  3T1H J;  4U67 Q;  3VAG A;  4RL1 A;  2AHO B;  1VQP S;  2BQR A;  5F8M A;  3T1Y F;  2JFK A;  1TL3 B;  2W8L A;  3PIP Q;  4X64 F;  1M90 T;  4UY8 5;  5CH7 B;  2ADB A;  4RW7 A;  3TW0 A;  5A8W B;  4NXN J;  3CJ0 A;  4X4O A;  1D9F A;  5CCL A;  2FJE B;  2V67 A;  1YX2 A;  4WXO A;  3CCZ A;  3W64 A;  1YRX A;  2C3Y A;  3VWS A;  3TAP A;  2DHX A;  1WAC A;  1CJV A;  4R5P A;  1CC8 A;  3C16 A;  3HK2 A;  1WC1 A;  2EC2 A;  2Y1L B;  2B7C B;  1AXQ A;  2QL5 B;  3SCJ E;  2CRL A;  2FHJ D;  2MQN A;  2V8G A;  2Z56 B;  1N88 A;  5CXT A;  1JLA B;  3AT1 B;  1HMV A;  4AXI A;  9ATC B;  3M8P B;  5I3Q A;  3O2I A;  2R8G A;  3FDS A;  3BRE A;  2N3L A;  4EBE A;  4GKK J;  2UV8 A;  2Z58 B;  2MSS A;  1RWN B;  1M1G A;  4DPO A;  5I42 B;  3UDC A;  1DLO B;  3D67 A;  4EBC A;  4ZVE A;  4LF8 J;  2YXL A;  2HSE B;  4EFA C;  1REV B;  2GJF A;  4B3M J;  3OQ2 A;  1H6K X;  4C48 A;  2JEJ A;  3UDL A;  2MJN A;  4OHY A;  2CDQ A;  1BUX A;  5ETK A;  2PDA A;  5HO4 A;  3RYL A;  2HHQ A;  4NLO A;  5DDQ C;  3ONQ A;  1XK8 A;  3CT9 A;  3CJR A;  1FFW B;  1AA1 B;  2HFZ A;  5DDP C;  4ZS6 A;  2RQ4 A;  5FLX Y;  1PYS B;  4B9S A;  2W4C A;  4O0N A;  1VQ8 S;  1H0H B;  1SJQ A;  3FMB A;  4P2S A;  3BGO P;  2EFN A;  4RW6 B;  1GX6 A;  1W25 A;  1UJ5 A;  2WSE C;  3NNA A;  3NBP A;  4RUA A;  2ZDP A;  4KKO B;  2DRB A;  1RUS A;  2VA3 A;  3BKF A;  2LCW A;  4KSE B;  2L3M A;  3EZO A;  1N0U A;  2FD2 A;  1OIA A;  3B54 A;  2E7X A;  2RE1 A;  3OTD A;  1ZAX A;  5KFO A;  2JEF A;  1H72 C;  3W2W B;  1KOO A;  4J90 A;  3VCD A;  2WB1 D;  2E9T A;  4I6W A;  3O3L A;  2QC3 A;  4PZV A;  3FQK A;  5HJX A;  1U0H A;  4P71 A;  4ETZ A;  3TO8 A;  2IRX A;  2AEM A;  5J2M A;  2K1R A;  4DV7 J;  4JYA F;  3EX7 B;  1DZ5 A;  4ILL A;  2V34 A;  2AX0 A;  2RS8 A;  2C22 A;  4RR5 A;  1HR0 J;  4RKU C;  3PG9 A;  3CJ4 A;  4NLT A;  4OFZ A;  2BE7 D;  4D3G A;  2UU9 J;  1PJ7 A;  2ZOG A;  5LMU F;  1C0T B;  2D74 B;  1S0O A;  2E1R A;  3F0N A;  3OXG A;  1LWF B;  1FXD A;  3ZZO A;  2ZOM A;  1GNK A;  1HNX F;  2BAN A;  4OX9 J;  4X66 F;  2M5Y A;  1OPZ A;  1HWK A;  2R2U A;  1T9Y A;  4L74 A;  1YI2 S;  3KLE B;  4LF6 J;  4OJ1 A;  2YNI A;  2YWG A;  4KIA A;  4HVZ A;  1NBE B;  3EVO A;  2HBQ B;  4L72 B;  4RUC A;  4LF4 F;  3NEK A;  3DLG A;  3KJN B;  1WSR A;  5AJ3 J;  5KG7 A;  1PGZ A;  4KB7 A;  2HWI A;  1VS3 A;  5J2Q B;  2MJU A;  2QSW A;  3FQL A;  3OJS A;  4PXE A;  2E7W A;  4JI1 F;  4HI2 A;  2F7V A;  5HAN A;  2RRN A;  4ZLJ A;  4JI0 J;  1BC6 A;  4DV2 J;  1BWE A;  3DMJ B;  4ED8 A;  1P6T A;  2DEI A;  4DU8 A;  3R6L B;  3T6J A;  2K06 A;  2HFU A;  2GMJ A;  3KUH A;  5IM0 B;  1WKL A;  4QYZ K;  1XWL A;  2KM8 C;  5FLX U;  5L1J A;  2IVY A;  4C2M A;  5T7L A;  2DIU A;  1NJX A;  1EAR A;  2HQ3 A;  5IOL A;  5EWE A;  1UVJ A;  3RW6 A;  4FNI A;  3UD3 P;  1JKH B;  2EFP A;  1R43 A;  2CPF A;  4PG5 A;  2KU7 A;  1KSP A;  4IYQ A;  1VIX A;  4EYI B;  1L3K A;  4U8Y A;  1P8G A;  1CVJ A;  1AFI A;  2WHO A;  4LFA J;  1L3V A;  3MM9 B;  2MLX A;  2FJA B;  2IC3 B;  5HMY A;  4ZOS A;  2VOP A;  5IXU A;  3B82 A;  2B4U A;  3VGU A;  1OQ3 A;  1EZZ B;  4P2M A;  5IT4 A;  1J5E J;  3H25 A;  4URG A;  2AIR B;  3SV3 A;  1MMN A;  5KFK A;  5KFS A;  1SKW A;  2BMB A;  1Y9O A;  3TAN A;  3KLG A;  3OHB A;  3ZTR A;  3OL7 A;  3C15 B;  4RBT A;  5E41 A;  4CO0 A;  1VQS A;  2H5J B;  3HHL B;  1FD2 A;  2ZVS A;  4QR1 A;  4H54 A;  4X4U A;  3MM8 A;  1F6T A;  1D8Y A;  3PJ9 A;  4LR9 A;  5J2N B;  2CNO B;  4ZIT A;  4Q2M A;  4ZHR B;  1IR2 A;  5KFP A;  3NMA A;  4UOF A;  1IBC B;  4HHH A;  2GHV C;  2XY5 A;  4X62 J;  2AEJ A;  2HHX A;  4C8M A;  1TK8 A;  4LFB J;  2HRU A;  5C24 B;  3DGP B;  3KLI A;  3SMZ A;  1DRZ A;  4C8K A;  3BEG B;  4JI7 J;  4E2F B;  3M2V B;  4J9S A;  2OGU A;  1YRU A;  1XR5 A;  4CM2 A;  3K89 A;  5C2G A;  1SUQ B;  1CSJ A;  4F7V A;  1N32 J;  2LQ8 A;  3W1Y C;  4NCB A;  2LQB A;  4QPT A;  2ZZT A;  3EMT A;  4YUD A;  5KOX A;  1HHS A;  1TKD A;  3EWG A;  2X51 A;  3ZXW A;  2MQQ A;  4A8M P;  2Y1I A;  1OPI A;  3QSI A;  3FRZ A;  5ETM A;  4LF9 F;  1WF2 A;  5DM6 Q;  1VR6 A;  3ZZZ A;  2W7A A;  3HI9 A;  4WU2 A;  1S0V A;  1WKK A;  4PRF A;  1Y5I B;  2LFV A;  5AXK A;  1XMQ F;  2IYI A;  1DQ8 A;  2POK A;  2CNN B;  3OJU A;  1P1T A;  4GKJ J;  1R0A A;  3MOZ A;  1U49 A;  3P6Y C;  1Q81 T;  3C3L A;  1LW0 A;  4KPC A;  1ZAV A;  2A18 A;  2D3O 1;  4EU0 A;  3PJW A;  1U1O A;  4X2B A;  3ZNJ 1;  2W2O P;  1GMW A;  2OO4 A;  1TL3 A;  3FSI A;  2W8K A;  1Q0N A;  3GG1 A;  4DR2 F;  3IMQ J;  4WZM A;  5A8W A;  2AJ1 A;  2DR9 A;  3H42 A;  1XMB A;  2JSX A;  3G6E S;  2R2S A;  4KHM A;  4NLG A;  2QN6 B;  4RWX A;  1HNW J;  4AQY F;  3J81 Y;  2QL7 B;  1Q8I A;  4I68 A;  4LRD A;  3KDO A;  3NWG A;  2DXE A;  1JLA A;  1QUP A;  1I1G A;  3M8P A;  3BKU A;  1Z2Z A;  2VDI A;  4MJK A;  4RW4 B;  1U2R A;  3KTQ A;  2LA4 A;  3BYP A;  4X64 J;  2FVP A;  3IAM 9;  4ZVS B;  2YNF B;  2UUC F;  1GMU A;  3AH6 A;  4N5S A;  3TJ8 A;  4RNM A;  5IT9 Y;  5I42 A;  4DPT A;  3TZZ A;  2FZG B;  3JQK A;  1DLO A;  3PEH A;  2F8H A;  5J1N A;  2BDP A;  2CPH A;  3DDK A;  3BR8 A;  3R7B B;  4P2X A;  1REV A;  2PD1 A;  3G86 A;  1SIW B;  2WON B;  4CWB A;  2ZHA A;  4USV A;  2JLF A;  2NS1 B;  5IWA F;  3RU0 A;  4Z2X A;  3ZZY A;  4H4M B;  1RBO B;  4QBU A;  2OTJ S;  2MMY A;  4QZV B;  3G4S S;  3TZY A;  3DOM B;  2D3Z A;  5ETO A;  3AAW B;  3BSO A;  3KJQ B;  2VJV A;  5HQM A;  3TA1 A;  3IM8 A;  4RW6 A;  4USK A;  3UCG A;  1WOR A;  2K3K A;  2MZQ A;  2J6T A;  5L9X A;  4OZJ A;  1SKR A;  4HTJ A;  3QGH A;  5GAG I;  4KKO A;  1CJK B;  4FF3 A;  2JVO A;  3JB9 k;  1TKX B;  5J2P B;  4DUY F;  5DG7 A;  3Q8V A;  2CXE A;  4DSK A;  2VA2 A;  1N5V A;  5HN0 A;  4KH1 B;  2AP6 A;  4B9V A;  2Z2M A;  2EXU A;  4G1I A;  3W2W A;  3TP2 A;  1D1U A;  3IR6 B;  2PEB A;  2FVR A;  2FC9 A;  4KJI A;  1AW0 A;  4FN5 A;  5F9L A;  5KFM A;  2ZIT A;  4CH0 S;  2DNH A;  2WW4 A;  2OIH A;  4PWU A;  5AXM A;  3V6H A;  4GRS A;  3WX8 A;  1NSQ A;  3W8G A;  2U1A A;  4K5R A;  3J81 U;  1C0T A;  1DAR A;  2N4D A;  1LWF A;  4KHR A;  1CJT B;  3NCP A;  1C2P A;  2DXD A;  1RWW B;  2MY7 A;  3GPA A;  1QSL A;  3CC4 S;  2V8H A;  2PII A;  4CLZ A;  3SCI E;  2XMV A;  3KLE A;  4ECW A;  2PMW A;  2MKK A;  3FEY B;  4DV1 F;  1T0T V;  4QOT A;  2VOO A;  1T9X A;  3JSM A;  5DRK A;  3SQG B;  3TX0 A;  4OYM A;  1FRJ A;  3RRG A;  2BYC A;  2CJB A;  1VQK S;  4ZCM A;  2MKS A;  5IT9 U;  1REG X;  3I4H X;  4DQP A;  4ZPA A;  1S1T B;  2XYH B;  5J2Q A;  4LF7 J;  4OIX A;  2UXB F;  3M9N B;  1FDD A;  1S6U A;  1NME B;  1H2U X;  4K5S A;  3FBC A;  4U9R A;  2BRK A;  4LF5 J;  3DMJ A;  2R7W A;  3GCW P;  2QTW A;  2HLT A;  1CS4 B;  1C4C A;  2PA8 D;  5DGB A;  2OD6 A;  1F2H A;  4L75 A;  1RWX B;  2VV5 A;  4F3Q A;  2B9W A;  2WRM A;  4RBU A;  3M8S A;  5IM0 A;  1Y5L B;  1XMO J;  5LT5 A;  2ZD1 B;  4OI4 A;  1X7V A;  2DNQ A;  2QMU B;  4UUX A;  3BGR B;  3ZZP A;  1Q1K A;  1HWJ A;  1X5P A;  1VDH A;  1IBK F;  1JNR B;  1S7H A;  2FJW A;  4I0W A;  5SZT A;  3LP2 B;  1SI9 A;  1JKH A;  2OEJ A;  3BBB A;  4J9V A;  1SL1 A;  4N8O A;  3M6W A;  3OFE A;  3NNC A;  3QZ7 A;  5D15 A;  4ZCK A;  4DCO B;  3W9J A;  3H5Y A;  4B3R F;  3MM9 A;  1LW2 B;  2I1R A;  2IC3 A;  1RQ0 A;  3QJL A;  1MN7 A;  1S79 A;  3KK3 B;  2ZBP A;  1TR0 A;  2QEX S;  3H5U A;  1RU2 A;  1NDL A;  5H9E J;  3NG8 A;  4WTY A;  1RAJ A;  1RU1 A;  3OSP A;  3RG6 A;  3IWN C;  5D0E A;  3DRR B;  3QO9 B;  1K73 T;  1XEZ A;  2VFV A;  2KJW A;  3GIM A;  2QGF B;  4ERD A;  5EWG A;  5DG9 A;  2FZK B;  4TYA A;  1UZD A;  5KT6 A;  4C3L A;  3C15 A;  5I3P A;  4C97 A;  3PYF A;  4K8R A;  1XER A;  2OEK A;  4F0M A;  1U1L A;  3HHL A;  3D2W A;  1YIJ S;  4PG6 A;  2I0X A;  1BE4 A;  1HPZ B;  4DR7 F;  2F3J A;  3PX6 A;  4YEA A;  1SXL A;  2DIT A;  3BM7 A;  1XQI A;  2MLY A;  1SKS A;  2GO9 A;  3K5P A;  5J2N A;  4HT7 A;  4IDK B;  1EET B;  3LO3 A;  4ZHR A;  2L48 A;  1JQG A;  3H7H B;  4Z7Y A;  3VZI A;  2BOA A;  2IDL A;  1JJ2 R;  4W4M A;  3CD0 A;  3GYG A;  4LF1 A;  3TZW A;  1U26 A;  1WTB A;  2HVI A;  5C24 A;  3DGP A;  3MI7 X;  2P2C B;  1O8B A;  4CLU A;  1CLF A;  3CB4 A;  2OEM A;  3GTY X;  3M2V A;  5KTQ A;  3M9M B;  4DCP B;  2Z4P A;  4AFF A;  5G4D A;  3MED B;  1WJ9 A;  3GLJ A;  1SUQ A;  1X0F A;  1CG2 A;  1O51 A;  4JV5 F;  1FDB A;  3B8H A;  3T41 A;  3JTP A;  1NUE A;  2FTR A;  3CCW A;  2YNG B;  3ENV A;  3MEC B;  1OQ6 A;  4CO2 A;  4W90 B;  2GO8 A;  2VG5 B;  3AD7 C;  4LRE A;  3MR6 A;  2XMW A;  2NRE A;  1H73 A;  2ZE2 B;  2MHN A;  4LRF A;  3N6N A;  5D8H B;  2KJV A;  2DNL A;  2X3D A;  1LV5 A;  2DNK A;  4RNH A;  3R1H A;  3DLH A;  3US5 A;  2CZV C;  4LR8 A;  1R8A A;  1JLG B;  5KFU A;  3PX4 A;  2W2N P;  2XI2 A;  4FPI A;  2QX0 A;  2MKI A;  2FHK A;  3D0G E;  2JEI A;  4LRC A;  3SFU A;  2DGO A;  3BGL A;  4O23 A;  2AGQ A;  1KTQ A;  4LF9 J;  3L95 X;  3UVJ A;  3O5T B;  2KB2 A;  1NJI T;  3HLU A;  4KBI A;  3AFG A;  5E3R A;  1WEX A;  2V2K A;  2E1M C;  1G1X A;  4I2Q B;  3RBZ A;  4L3K A;  4P7V A;  4MTP A;  2BAC A;  3PHE A;  1FRL A;  9RUB A;  4M5H A;  4KO0 B;  2XSJ B;  4ZN1 A;  5AE2 A;  1S72 S;  4Q0B B;  1K8A T;  2AD9 A;  5CAB A;  1HNZ J;  4RW4 A;  4EUV A;  2BE9 B;  4ECS A;  4XIU A;  2V6A A;  5B0A A;  2Y3Y A;  1RWK B;  1U4B A;  2YNF A;  2QG9 B;  3KNG A;  3L7O A;  3NGT A;  3Q8P B;  2O66 A;  3IA0 A;  2GVD B;  2IVM A;  2J7W A;  3M8W A;  4OZ5 A;  3DNC A;  1XNR J;  2RVJ A;  1VQ4 S;  1DTQ B;  2W4D A;  4Q44 A;  1IKV B;  2WON A;  4UQT A;  2JHE A;  1UFL A;  4H4M A;  3NCQ A;  3J7Y U;  4ZP8 A;  5E3P A;  4N47 A;  3PFO A;  2FVQ A;  4CLY A;  4ID5 B;  3NY0 A;  1TUG B;  2EFG A;  4NLR A;  4FVC A;  4HI1 A;  1UAW A;  4F0H A;  2NQP A;  3DOM A;  3GYX B;  4EGL A;  2UUC J;  2FJV A;  3QID A;  4JI2 J;  1BXN A;  2IYG A;  3Q8R B;  1WDD A;  1H2V Z;  1B64 A;  3FVY A;  4HHU A;  2YWF A;  1CJK A;  4DN9 A;  4QIE A;  1HHQ A;  2R7R A;  5IWA J;  2E1C A;  1TKX A;  5J2P A;  2ZHB A;  1HBU B;  3CVK A;  1YQH A;  2NPF A;  4NX9 A;  2LQJ A;  3SXL A;  2E5L F;  2MZS A;  5K8O A;  1HHT P;  3SSR A;  1N56 A;  5CD4 A;  1YBU A;  2GW8 A;  3F56 A;  4EMD A;  3H2V E;  3BSA A;  4OV1 A;  4CLK A;  3A3N B;  1PC5 A;  3I9Z A;  3A3O B;  2ZC3 A;  1UZH A;  2LU1 A;  3NS5 A;  4HR2 A;  3O1L A;  1FKA F;  5KFF A;  2G13 A;  4ZVP B;  3QGI A;  1CJT A;  2BUN A;  3T6B A;  2J7U A;  2ZEJ A;  3IG1 B;  4IR1 A;  2IBO A;  3R5G A;  4JOU A;  3CC2 S;  2HFO A;  3QJJ A;  4FXD A;  4ECQ A;  3SQG A;  5F8H A;  5A0Y B;  2ZBI A;  2F4F A;  2WW8 A;  3D1H A;  4QU6 A;  4OYO A;  1JNZ B;  1G2E A;  2AZ1 A;  1S1T A;  1RHJ B;  5AXL A;  2D3O R;  1N6Q B;  2VFU A;  4JI8 F;  2EG2 A;  2DGT A;  1E6V B;  4QWB A;  1JB0 C;  4WZQ A;  4KGX B;  2FLO A;  1FEE A;  2K7K A;  2CPY A;  5LMN J;  1CS4 A;  2OFH X;  1O0P A;  4G1P A;  4O4R A;  3CC7 S;  1N54 B;  5HQL A;  4IQX A;  3W5X A;  2B4P A;  4OZ3 A;  4F67 A;  1UL3 A;  2VPX B;  2C2D A;  4UZC A;  3NGD A;  3A12 A;  4C98 A;  4N7T A;  2MZR A;  5GMK a;  2ZD1 A;  1SC4 B;  2UXD J;  3BGR A;  4GMK A;  1CEZ A;  1WNE A;  4P7T A;  2HHH F;  3CPW R;  2H5I B;  3LGH A;  5F0W A;  4QJV A;  2CQI A;  4O3R A;  4JI4 F;  7AT1 B;  3MMA B;  2XZW A;  3DXS X;  5THW A;  3AHP A;  3LP2 A;  1B3T A;  1S97 A;  3OBI A;  5IT0 A;  3Q8Y A;  3HKZ D;  4EZ6 A;  4S0M A;  1ZAW A;  3OTE A;  3WC0 A;  2AJ2 A;  2PE8 A;  1FRI A;  3H5X A;  5L1K A;  1VRU B;  2KHD A;  2BW7 A;  1HWL A;  1LW2 A;  2OSR A;  2YQ1 A;  2FDN A;  3KHL A;  3TUI C;  1KNZ A;  2UXC J;  1KQF B;  3KK3 A;  4NLP A;  4DPY A;  3R1L A;  2M9K A;  4DXL A;  3H4B A;  2HQI A;  2C2O B;  2WK4 A;  2BRL A;  1YJR A;  1FFS B;  3DRR A;  3QO9 A;  3C6U B;  3CSK A;  4GC7 A;  2RDD A;  4IOB A;  1MSW D;  2RIL A;  1DUR A;  1VQ6 S;  4DL4 A;  2GGP B;  3SIP B;  5GME A;  4RNN A;  2X1A A;  1W2B R;  2VBZ A;  2CJY B;  4MIW A;  3ZZT A;  2V2Q A;  2RUS A;  3LGN A;  4PG8 A;  2M2B A;  1ZM3 A;  2QT7 A;  3GIL A;  4M5K A;  3C6T B;  2ASY A;  2WVD A;  3CJT A;  3MR5 A;  2YQ3 A;  2JRS A;  2RS2 A;  1RTZ A;  2H54 B;  2AX1 A;  4QWC A;  1OJ4 A;  4IDK A;  3VF0 B;  1EET A;  4PQU B;  2I2Y A;  3I0R B;  3PEJ A;  4NZ6 A;  3TNV A;  4NYZ A;  2JFD A;  2KYX A;  3R27 A;  1WEL A;  1NND A;  5BYQ A;  3J7A N;  4P74 A;  2W9B B;  1F9H A;  2KDO A;  2WVB A;  2DHA A;  2C3P A;  3AA8 A;  4CT9 A;  3R5A A;  4MKA A;  3U1N A;  2M70 A;  2V8D A;  3MED A;  4H4O B;  4DR5 F;  2XMM A;  3TJA A;  3FRY A;  2GNK A;  2Q1L A;  2OFG X;  4M63 A;  1FFG B;  2CAJ A;  4J37 A;  3JSY A;  2DRD A;  2YNG A;  4NLY A;  4MYT A;  4OYA A;  3MEC A;  1N8R T;  2E9R X;  2B43 A;  3DFE A;  2YPY A;  1ZTT A;  2KFY A;  2DGS A;  2VG5 A;  3QFH A;  1HBM B;  1YBT A;  4WP9 A;  1X4E A;  2ZE2 A;  1GX5 A;  3ENQ A;  2FQQ B;  3GR1 A;  2KT2 A;  3LWL A;  4DV6 F;  3POT A;  2F4V J;  4OI6 A;  1UCN A;  1KS2 A;  4JV0 A;  1JLG A;  4E98 A;  4WIQ A;  4ZLN A;  4LUB A;  3SSS A;  1RHM B;  1S77 D;  2HQF A;  2RKI B;  1YSJ A;  4DPX A;  2CJK A;  3C2P A;  4CNZ A;  4A8S A;  1WG4 A;  2QLF B;  4RUB A;  5HQ8 A;  5BR8 F;  4F02 A;  2JVR A;  1IJE B;  2RD5 C;  5DO2 A;  3NGS A;  1Z2L A;  3D4J A;  4LBP A;  3GIK A;  2CZ9 A;  2LXI A;  4UOH A;  3W7B A;  4TVA B;  2ZUG A;  3QPI A;  4TXS A;  1X4H A;  2E5H A;  4KH0 B;  3ETO A;  1XC9 A;  4NZ7 A;  2D41 A;  4ELT A;  5KG0 A;  2VU5 A;  2VJU A;  2W25 A;  2XCA A;  2J8S A;  1R3N A;  2AJ0 A;  4N8N A;  2HHU A;  4OJ3 A;  3OV7 A;  1VQ5 S;  2HAF A;  3X1L B;  5BJR A;  3TVY A;  3AQO A;  1X4B A;  4I2Q A;  3KLF B;  4OQJ A;  1NRK A;  2XLJ A;  4A46 A;  1S4F A;  4IOC Q;  4KO0 A;  2XSJ A;  2M4M A;  1UVL A;  3MHY A;  2DGU A;  3Q8U A;  4N56 A;  3A13 A;  3GSD A;  1U48 A;  1U8W A;  4Q0B A;  3M2U B;  1KVJ A;  2OKQ A;  1CQM A;  3D1O A;  2CQ3 A;  1IBL J;  2XY6 A;  1NDC A;  4UT4 A;  2Y8Y A;  4Q45 A;  1OY9 A;  2EPI A;  3NGR A;  3BB5 A;  1PYT A;  3KUE A;  3M9O B;  5DQH A;  5HI7 A;  3N28 A;  3N6L A;  1J2V A;  5CAA A;  3T5L A;  1RWM B;  2R7S A;  1R31 A;  2AEF A;  2GVD A;  3B4D A;  4BC9 A;  4I6A A;  1Q8K A;  1FDN A;  2FB0 A;  2E5I A;  4NEY A;  1S5Z A;  4A48 A;  1VQN S;  1IKV A;  1UVN A;  2V8P A;  1WEY A;  2B4V A;  2IMO A;  2VQE F;  4FPR A;  2LMI A;  4RWW A;  1RYR A;  4OMF G;  3QFW A;  2AT1 B;  4ID5 A;  4F4A A;  1V9O A;  4NYP A;  3CD5 A;  2V2Z A;  2HLU A;  2VL1 A;  1S1V B;  3C8Y A;  3MWB A;  2HK3 A;  5K14 B;  2M3D A;  4FF2 A;  4PQA A;  3ZFV A;  2CWX A;  1TK0 A;  2G1D A;  4DV4 F;  4NRU A;  3ILI A;  4O4G B;  1NH7 A;  2BJ8 A;  1QAX A;  2BXJ A;  1YJ9 S;  2AWZ A;  3RRH A;  3A4T A;  2HAI A;  5A8K B;  1HBU A;  3TEG A;  1S48 A;  3HFZ B;  2VPZ B;  4CTA B;  4ER8 A;  4Y34 A;  3NMR A;  3BH7 B;  4DG1 B;  5AE3 A;  1PSD A;  3DN9 A;  1CQN A;  2MZT A;  2J76 E;  3R2C J;  2B4O A;  4L76 A;  2QA4 G;  4FKX A;  3DHX A;  4WF9 Q;  4KGK A;  1E6Y B;  1TMM A;  3AA9 A;  2VIC A;  3HX9 A;  5KFW A;  5LOQ A;  1EHW A;  1RB0 A;  1EX8 A;  3TYT A;  2IRY A;  1RAE B;  1OS5 A;  2UVV A;  1Y3J A;  1IR1 A;  4LIW A;  3EZ5 A;  1FKO B;  2MTL A;  2PMZ D;  4KC5 A;  1NK6 A;  4ECT A;  2H4Y B;  3IG1 A;  5KFG A;  2DRA A;  2KT5 A;  4ED3 A;  3L9Z A;  3ZZR A;  1RAA B;  3UCZ P;  1S1X B;  3I82 A;  4YB7 A;  3AJD A;  4XPC A;  2CPJ A;  5A0Y A;  1SB6 A;  3P3D A;  3BPS P;  3VZH A;  1Q86 T;  4O44 B;  3AOC A;  4K0K J;  4M5D B;  1N6Q A;  2IRU A;  2DKO B;  2B9E A;  1S6Q B;  2X1F A;  1E6V A;  2BKN A;  3HPO A;  4L3N A;  3GFZ A;  1RHQ B;  4DQQ A;  3K8W A;  5DM7 Q;  2ROG A;  1BQN B;  3NS6 A;  4AD6 A;  1ARO P;  2ZH2 A;  1FKP B;  2ZM6 F;  1VK3 A;  5JMN A;  3F41 A;  2GIQ A;  1XBW A;  3K59 A;  3AJ2 A;  3H0P A;  3MD3 A;  4QW8 A;  4C3K A;  2QA4 S;  2Y8W A;  2PI4 A;  1MLA A;  3ZTQ A;  2NUH A;  3R6G B;  1VHF A;  2N4C A;  4C8Z A;  1FRH A;  2GAG C;  4KRW A;  4G6V B;  1B7Y B;  3MMA A;  1HAR A;  3LQV A;  4NLD A;  4V19 J;  1RA7 A;  1K47 A;  1O5J A;  3CJK B;  2MY8 A;  3W60 A;  1KN6 A;  1K1Q A;  2VG6 B;  4UW2 A;  1YLX A;  3E01 B;  3FCH A;  1JLE B;  2CWK A;  4ZPW R;  1R8C A;  5DGA A;  2HQG A;  1VRU A;  1KRP A;  1JLQ B;  3HHL C;  3U27 A;  2O01 C;  2NXN A;  2DGX A;  3M30 B;  4B3S F;  2MZJ A;  2CQP A;  1M1H A;  4Y2A A;  2E9Z A;  3KHG A;  1IUJ A;  1VC6 A;  2C2E A;  1PG5 B;  2ZBR A;  4PPZ A;  3WBZ A;  2CA9 A;  2K1R B;  4DR4 J;  3S8S A;  5L8R C;  4DF4 A;  3EUN A;  3TUP A;  2P8I A;  1QE1 B;  2JNJ A;  4YY3 F;  3C6U A;  5CYQ B;  2VHG A;  3FJ2 A;  4PCQ A;  2A0F B;  2EVZ A;  1R7I A;  2GGP A;  4EK2 A;  4DR6 J;  3EGV A;  1GMV A;  5KFA A;  2DO4 A;  2VDH A;  2NYH A;  5F0U A;  1CJU B;  3CED A;  4ES3 A;  1LK7 A;  4ZVQ B;  2YKA A;  1QM9 A;  1Y00 A;  1U24 A;  4Q2L A;  3C6T A;  2LQ9 A;  4RNO A;  4LBI A;  4BS2 A;  2P6S A;  3MUR P;  2QSF A;  2XUL A;  4GC6 A;  4CLP A;  5HMW A;  5ETR A;  4PQU A;  3GFH A;  1F9E B;  3I0R A;  1RK8 A;  3W66 A;  3LAN A;  1RAB B;  4UOC A;  3BN4 A;  2DNR A;  4C0B A;  1AUS L;  3DDI A;  2W9B A;  3AQP A;  4U95 A;  2DNM A;  3CCU S;  2GMH A;  1TFY A;  2KFN A;  3NRB A;  3VGS A;  1FWL A;  2HHV A;  1UFW A;  1HNV B;  2A6M A;  5L38 A;  3VTI A;  4ZKA A;  4NLQ A;  4O3S A;  3N0V A;  3T3F A;  1NZA A;  4H4O A;  4F4K A;  4DN0 A;  1FVQ A;  2HMI B;  1LWC B;  2DR8 A;  4YQW A;  5F8L A;  1Q5V A;  1D8Z A;  2G0I A;  1HQU B;  1JIH A;  3S7R A;  1QAI A;  2KN4 A;  1MN9 A;  1NXI A;  4C9D A;  2OMO A;  5HRO B;  1R89 A;  3J7Y I;  3GFX A;  1HBM A;  3L7P A;  4CO3 A;  3DHW C;  2P9G A;  4ZJQ A;  2GJ2 A;  4IRK A;  4LFC F;  3BN7 A;  1LEO A;  4NLS A;  1D9A A;  5KG4 A;  2LA6 A;  3SDE B;  2HPU A;  2RDJ A;  4CLL A;  5CD4 H;  1UVM A;  1EKS A;  4DR5 J;  1VJW A;  3H2L A;  1NAQ A;  1IKX B;  1WHW A;  2RKI A;  2NCK L;  2UP1 A;  2PGC A;  2GZO A;  3QSY B;  2YX1 A;  2APO A;  2Y1R I;  1AZS B;  2UZA A;  1KWM A;  2ATL A;  2B56 A;  1SH2 A;  1IM4 A;  2A1B A;  3SSQ A;  4TY8 B;  3PR4 A;  2EC0 A;  3G82 B;  4UZB A;  5KFY A;  1TL1 B;  2NZ4 A;  4ANC A;  2A2D A;  1XR6 A;  4CI0 B;  4IOA Q;  3LAL A;  4DV0 F;  4DV6 J;  3HP6 A;  4DQS A;  2XB2 D;  1NM2 A;  2HFN A;  4C0H A;  1AYE A;  3BSN A;  3AD9 C;  4R8U B;  3N01 A;  1G3O A;  3T5K A;  4Y2M A;  3LP0 B;  3KLF A;  4AL6 A;  2R7X A;  1T95 A;  5L1L A;  2OSQ A;  3FFI B;  2E5G A;  4NI2 B;  5D4L A;  3R7N B;  1VRQ C;  4AND A;  4YB1 P;  5F9N A;  1BD6 A;  1SQE A;  4FXV A;  3J7A 1;  2JX2 A;  3M2U A;  1ZZF A;  1R8B A;  4CLT A;  3AXK A;  1WC4 A;  2AW0 A;  1P27 B;  3QT6 A;  1RCO B;  2DK2 A;  1FJG F;  2E44 A;  1RWV B;  4USJ C;  2OJ3 A;  4OZN A;  3CJQ A;  2PA3 A;  1B0T A;  5ADZ A;  5DDR C;  2XHC A;  2G4B A;  4FDF A;  1SH0 A;  1H98 A;  5KFR A;  1X5T A;  1SJ1 A;  3CGI A;  4WYL A;  3ZO7 A;  1NJY A;  3DLB A;  2RU3 A;  2FLN A;  3EGZ A;  3OD2 A;  3THP A;  4OLO A;  4RW8 B;  2HQC A;  2MQL A;  4M5L A;  2DHG A;  1N33 J;  4K4S A;  4WJB A;  5DJB A;  2ZH9 A;  3D68 A;  3HCX A;  2MST A;  4L73 A;  1F9F A;  1S1U B;  3G8T A;  1S1V A;  1TZ0 A;  1Q95 G;  3BO2 A;  3M8Y A;  2WBR A;  1PIL A;  5K14 A;  5B0C A;  2WVE A;  4ICL B;  3BJY A;  3KG1 A;  3M4X A;  5C5J A;  4HEA 9;  2W24 A;  4OHW A;  1HI8 A;  3QAU A;  2SXL A;  2G2O A;  2DGV A;  2GIR A;  4O4G A;  2DNN A;  5K9F A;  3DYA A;  5E3C A;  2MKJ A;  1Q5Y A;  2YTC A;  3RAM A;  2FUG 9;  2M8D B;  4L6V 3;  5A8K A;  1A6L A;  5KFJ A;  2XO6 A;  3SCK E;  3HFV A;  2RUG A;  3PO5 A;  1FWK A;  3QT7 A;  3BKT A;  3JQM A;  1U45 A;  4CTA A;  2J6S A;  1I94 J;  2VQF F;  1R27 B;  2EK1 A;  4AT1 B;  1VLY A;  2UUA F;  3LWM A;  2BW2 A;  4CIO A;  3W65 A;  1WC5 A;  4DG1 A;  3H2U B;  4JI3 J;  2DIS A;  3MR7 A;  2YH1 A;  3T5H A;  2CKW A;  3KK2 B;  1TFW A;  3M32 B;  2UUT A;  4KHP F;  1HW9 A;  1E6Y A;  4U8V A;  2VB6 A;  5DET A;  2HRT A;  2C2Z B;  3UN5 A;  4BLG A;  1K1S A;  3NCR A;  2KKH A;  2WB4 A;  1UFK A;  1SL0 A;  2LP4 A;  2LXU A;  1JXL A;  2FLL A;  3D1Q A;  1T03 B;  4YHH J;  4USI A;  2GA7 A;  3SEO A;  2EK6 A;  1WG5 A;  3CMQ A;  5HJY A;  1FKO A;  4A8W A;  2MQO A;  2M7S A;  3GWC A;  1CPZ A;  1SL2 A;  3THV A;  3NKY A;  2AF6 A;  2F40 A;  2KVQ E;  1I6J A;  2DD8 S;  4TU8 A;  3MPY A;  2DNO A;  1S1X A;  2V4R A;  1M5K C;  4CT8 A;  4CH7 A;  3K58 A;  3QIP B;  3ZTS A;  4ZIV A;  3I55 S;  4O44 A;  1Q4R A;  1R8H A;  4IFV B;  3PY8 A;  1URR A;  4V1A k;  4YME A;  4M5D A;  5HBM B;  3M8Z A;  4YOE A;  2R7V A;  1S6Q A;  5B09 A;  3MPU B;  4ZPT R;  1U6B A;  3DM2 B;  4KE5 A;  2W1B A;  1KR4 A;  4PR6 A;  2OUG A;  2K7J A;  2CFX A;  1BQN A;  2HZA A;  1QVG R;  3I96 A;  1RTI B;  1FKP A;  5CZX A;  1SVD A;  3RBE A;  3H59 A;  2JC0 A;  4A8O A;  4HDG A;  5I4M A;  1FEH A;  1RLC L;  2M8H A;  2BJ7 A;  2ALZ A;  3BR9 A;  2ABY A;  2KZZ A;  3KXD A;  4F50 A;  3R2D J;  1MNE A;  3CJK A;  1VIS A;  2OD4 A;  2VG6 A;  5GAD U;  3E01 A;  1JLE A;  3EYZ A;  2F1F A;  2DB1 A;  1Q8B A;  1NPP A;  1SJ4 P;  3FEX B;  1JLQ A;  2GQC A;  3EVW A;  4N77 A;  5KFX A;  2OPQ B;  3M30 A;  1YIT S;  3K57 A;  3KUG A;  1F3V A;  1VOM A;  2ROE A;  2J7K A;  4C6A A;  1JXV A;  1K0T A;  2Y0S D;  2IA6 A;  2JOQ A;  4GO5 X;  4ZIW A;  2BQU A;  3BS9 A;  4ECZ A;  3QRP A;  2OPS B;  5ETL A;  2NZC A;  4NXM F;  5KFC A;  1LK5 A;  1EQ0 A;  2J9C A;  3CWJ A;  3DRY A;  2W7P A;  2X1B A;  2J9E A;  1QE1 A;  2IVF B;  5CYQ A;  3JAM Y;  3IN5 A;  4RW9 B;  1WHY A;  2OP5 A;  2X1G A;  2XLK A;  2AU0 A;  5E3Q A;  1N5Y B;  5T14 A;  4ZJO A;  2VFR A;  2MXY A;  4DR1 J;  4BDP A;  1KLM B;  5L39 A;  1XNQ J;  1ZA1 B;  3S01 A;  1YJT A;  1CJU A;  4B3S J;  2Y0B B;  1G6B A;  5ETV A;  2CVI A;  1UWA A;  5E0O A;  1T3O A;  3MR3 A;  2BJ9 A;  3QGP A;  4HL9 A;  3WIU A;  1Q7L B;  4CO4 A;  3JSM B;  1GXT A;  2DEJ A;  2ZHO A;  2LXF A;  5JUM A;  1BGX T;  2LYV A;  1S12 A;  1FER A;  4J7C A;  2BR0 A;  4X4N A;  1UMJ A;  1HWI A;  5T41 A;  3CD7 A;  2QE5 A;  4WK3 A;  1OY8 A;  1N34 F;  3B4M A;  2ZZN A;  3HZE A;  3DLK B;  3KG0 A;  3NLC A;  2IMW P;  1RTH B;  1HNV A;  3R7S B;  4UQG A;  1U6Z A;  5FJ4 A;  4ZCI A;  1QLN A;  1ITP A;  2DH8 A;  1C1C B;  2N3O A;  2QYG A;  2HMI A;  1LWC A;  2E29 A;  2IJR A;  2V2V A;  1HQU A;  3MTJ A;  4X4V A;  2DPI A;  5HRO A;  3HF5 A;  1GMW D;  4KGM A;  2VZ9 A;  5M2R A;  3RUB L;  3CNQ P;  2EWH A;  1N4L A;  3HD2 A;  5H9E K;  3T1H F;  1U0S A;  3QLH B;  3SDE A;  1LFW A;  2MQP A;  1DFD A;  3UWT A;  3AOA A;  4MIA A;  1GEH A;  3GYN A;  1JLB B;  5K20 B;  1IKX A;  1KP6 A;  4NXN F;  4QR2 A;  2E66 A;  3MPD A;  1RTD B;  4DEZ A;  2FLP A;  1AZS A;  2CZ4 A;  2YKQ A;  3LW5 C;  4EBD A;  4OHX A;  2CDR B;  3KMS A;  4QIG A;  4ZLP A;  3PRD A;  3H8Y A;  4TY8 A;  3N5F A;  3TQ1 A;  3G82 A;  2B9X A;  3FZB A;  3JAM U;  2HEK A;  1TL1 A;  4J9M A;  3Q83 A;  3UW1 A;  1NDP A;  1N5Q A;  4NE9 C;  4M8L A;  2MQM A;  3DLE B;  5EWF A;  4R8U A;  1T9W A;  3LP0 A;  1ICE B;  2NR0 A;  2DO0 A;  3MMC B;  5U47 A;  2OLW A;  2RJZ A;  4O3Q A;  2YKP A;  3MMJ A;  3V6K A;  3FFI A;  1H2T Z;  4NI2 A;  3AB2 B;  1J27 A;  4LF8 F;  3MCN A;  5DLG A;  2GAH C;  3D7S B;  1FHT A;  2M52 A;  3OL9 A;  3G2X A;  2YX4 A;  5A76 A;  4B3M F;  4YR2 A;  2CPD A;  4NLX A;  4LJM A;  3MZI A;  4PWD B;  1SH3 A;  4KPY A;  4QU7 A;  4P2F A;  4DV0 J;  3CF5 Q;  4JI5 F;  4PXB A;  4JP8 A;  4ED4 A;  1LOU A;  1IBM J;  5IQ6 A;  3W2V B;  4ZP7 A;  3DOL B;  1FNO A;  8AT1 B;  2H9Z A;  5DZ7 A;  2FJX A;  1RAO A;  1NLK L;  2A3J A;  7FD1 A;  4TLR A;  3HVT B;  3R5B A;  3GMG A;  1VQ9 S;  3WX4 A;  4RW8 A;  3P5B P;  3WHI A;  5F3T A;  2CYY A;  2XYP B;  4URS A;  2N7Y A;  1FXL A;  2J9D A;  1GXU A;  1S1U A;  4ZVR B;  2B0G A;  3HVW A;  2MDA A;  2KG1 A;  3HT3 A;  2R42 A;  1U1Q A;  1TTH B;  2J5A A;  4ICL A;  3RRK A;  4U7C A;  4DUZ F;  3Q8Q B;  2ZBQ A;  2JH3 A;  5LJ3 Y;  1VRT B;  1TP7 A;  4FYV B;  5FDL B;  4F0K A;  1MWZ A;  4TU7 A;  2ZH4 A;  2QV6 A;  1G4C A;  2ZDO A;  3CDA A;  2F8E X;  3LA0 A;  2Z30 B;  3PCO B;  2ACM A;  3ENA A;  1KQS R;  5M2P A;  2C3M A;  1IWA A;  2EFO A;  2H3E B;  2QFJ A;  5M2U A;  2XTJ P;  2I6W A;  2UU9 F;  5KFD A;  4LSL B;  3MCS A;  3TJ9 A;  3AXM A;  2IAJ B;  3UVJ B;  4OYP A;  1VI7 A;  3EZU A;  2OAU A;  2ZKT A;  3QT8 A;  3QT5 A;  3U7J A;  5KFI A;  1MG7 A;  1S7I A;  1V5V A;  1YKW A;  2R9L A;  2ZWP A;  3KK2 A;  4MAK A;  1EP4 B;  3M32 A;  3BDE A;  1NPK A;  2B5J B;  1DQA A;  4CLF A;  3CXC R;  1ZZN A;  4DSE A;  5EN1 A;  2N82 B;  5KG2 A;  3PW2 A;  3VHQ A;  3IP0 A;  4NLV A;  2E7V A;  2C28 A;  5KFE A;  4DS4 A;  5GAH I;  1FE0 A;  2ASL A;  1T03 A;  3ZNU A;  4ES1 A;  2VQF J;  4ZVT B;  5J1E B;  3MM6 B;  3T1Y J;  4QIW D;  3VGV A;  4JI0 F;  4K4W A;  1YRT A;  4DV2 F;  4DSJ A;  4NLU A;  2GCF A;  2J8A A;  4USM A;  2Z2L A;  4DFJ A;  2G2Z A;  1Q78 A;  3I32 A;  3Q8S B;  4NWB A;  2ASJ A;  1RP5 A;  3QIP A;  1BY9 A;  1TKT B;  4HTI A;  2QA2 A;  4CZC A;  3EJM A;  3NGK A;  1TK5 A;  4IFV A;  5JJB A;  5ETT A;  2JEG A;  5LXR A;  5HBM A;  4K2J A;  2AKW B;  4ED5 A;  3A8J A;  2BA9 A;  4I1T A;  3G6V A;  1S1W B;  3IGN A;  1F60 B;  3NOC A;  2CPX A;  4A47 A;  4IRD A;  2Z0G A;  3DM2 A;  4LMZ A;  1WDT A;  3KG4 A;  3W9H A;  3FK4 A;  1YJU A;  3CDE A;  3CCV S;  2P9E A;  3D6M B;  3JYT B;  2CJQ A;  2BAB A;  1O6X A;  1KTV A;  4G3I A;  2RIJ A;  4QQB A;  1RTI A;  3HVR A;  2L9D A;  4YB5 A;  5CZV A;  3K2Y A;  3C19 A;  4LFA F;  1T94 A;  2NXJ A;  4Q8F A;  1T9U A;  3HJV A;  1SIZ A;  3MD1 A;  4ZN3 A;  2GV1 A;  1MWY A;  3FZ2 A;  1KFS A;  5KG1 A;  2K8G A;  1Y11 A;  4DV3 F;  2D7S A;  4J9K A;  4CM0 A;  1TVR B;  3KHR A;  4WP8 A;  4O0I A;  3HHL D;  3N5B A;  4XTT A;  4HKQ A;  3TR5 A;  2ZH3 A;  2OPQ A;  2WBM A;  2AYB A;  5E33 A;  2V69 A;  4FXW A;  1FES A;  2XS7 A;  3TZX A;  1RWO B;  4F8R A;  1HD1 A;  3D28 A;  3QJP A;  2OPS A;  4E8U A;  4IO9 Q;  4DX6 A;  5IC6 B;  5B08 A;  2ZH8 A;  4DLG A;  2EEY A;  3WIV A;  4RW9 A;  3ET6 B;  4HH1 A;  1WHX A;  5HLF B;  2MGZ B;  5A8R B;  4MKV A;  1N5Y A;  1CUL B;  1KLM A;  3AOD A;  4R0E A;  4WFZ A;  1V6H A;  3QMQ A;  1XR7 A;  3NAH A;  1SKU B;  4X62 F;  3CCS S;  1IXK A;  2XWY A;  1HYS B;  4J9N A;  4LFB F;  3EXY A;  4Q7A A;  4F04 B;  1ACM B;  3VVU A;  2A2C A;  3N4W A;  3M6X A;  4JYA J;  4C3M A;  2CQH A;  3TA0 A;  1X31 C;  1ULR A;  4ZJL A;  2C2M B;  2Z57 B;  2CPE A;  3NWR A;  2CAD A;  3P8B B;  3M05 A;  2GQQ A;  4J5O A;  1N32 F;  1NJZ A;  4KR0 B;  2RRB A;  5LMU J;  4QWA A;  2BOP A;  4P6Q A;  1UEK A;  1SQF A;  4M5M A;  4G65 A;  2L9N A;  3DLK A;  2O5D A;  4KFB B;  3CDB A;  1HNX J;  1R8P A;  1X0P A;  1RKI A;  4IUF A;  4X66 J;  1YVF A;  5L1I A;  3PRB A;  1RTH A;  1NK7 A;  5KFL A;  4OL8 A;  1C1C A;  2PSZ A;  2JLG A;  4AL7 A;  2KFZ A;  5JXS A;  2X3G A;  4KAI A;  3BQ2 A;  1NK9 A;  2QLJ B;  3MCM A;  4NMX A;  4LF4 J;  3MPW A;  1L3S A;  3HHK A;  2XI3 A;  4U7U D;  4IR9 A;  1GTH A;  3VAH A;  3DC2 A;  4C4W A;  4JI1 J;  1N34 J;  3OTO F;  1VBK A;  4B3O B;  4QYR A;  3TWZ A;  3HDS A;  3HHD A;  2OH2 A;  1X9S A;  3LPY A;  3C14 B;  4K4V A;  3QLH A;  3HXM A;  3BBF A;  2HVZ A;  3OFF A;  3FC9 A;  2GQ2 A;  1UW9 A;  1L3T A;  1IKW B;  2I5J B;  1JLB A;  1HQ2 A;  3NGU A;  3CCL S;  2DTJ A;  2B51 A;  4QIF A;  3VV2 B;  4TQR A;  2HVD A;  6AT1 B;  1TV6 B;  1RTD A;  2YX7 A;  3GIJ A;  2R7T A;  3IBC B;  4GVB B;  4RU2 A;  3CDW A;  1IKY B;  4WK1 A;  2P5V A;  1R6Y A;  1M5P C;  2FVC A;  5EX3 A;  2IJN A;  4B9M A;  2P6T A;  3RAQ A;  5H9F K;  2DHS A;  1F0X A;  1PKU A;  1LFP A;  4IG0 B;  3THT A;  3UR0 A;  1HKA A;  1IJF B;  3DLE A;  2IJF A;  2KT3 A;  4OYZ A;  3EGW B;  4ED1 A;  1PAE X;  2G0J A;  1PAU B;  2YY3 A;  4F2S A;  1YBA A;  2XCP A;  4YP3 A;  2CG4 A;  4NCA A;  4YN3 B;  1UTA A;  1JLF B;  3MMC A;  2IFX A;  5KAK A;  1PIE A;  4PKD B;  2CNL B;  2V4Q A;  1RA6 A;  2P9C A;  3PW0 A;  1QD1 A;  2C2N A;  3IR5 B;  3T5J A;  2ALY B;  2Z2Z A;  2BV3 A;  1RT6 B;  5F41 A;  3KLH B;  1JLC B;  3IAS 9;  3ULH A;  1NK4 A;  2HUR A;  4PWD A;  4UUW A;  4M5J A;  4Y6I A;  4OI1 A;  2A10 A;  1FTC A;  4YB6 A;  3LF0 A;  1RWP B;  4WTO B;  1ZS6 A;  3BQ1 A;  3HZG A;  2GHW A;  4N76 A;  3M1V B;  3P5T L;  1NKB A;  4MKB A;  3W2V A;  3DOL A;  4F25 A;  2KTQ A;  2XY7 A;  2F63 A;  4LRA A;  3K17 A;  2JC1 A;  1H7X A;  1OWX A;  4K2X A;  3ZZU A;  4E0D A;  3TX8 A;  4GVL A;  1A7G E;  3QWU A;  4UTG A;  1OYD A;  1LXJ A;  3HVT A;  3BSC A;  3KJF B;  1S9G B;  5I3U B;  4LQ9 A;  4KV8 B;  3DRP B;  3SQO P;  3F44 A;  1S6P B;  2KVI A;  4MYU A;  2VBX A;  3UI3 A;  4JI5 J;  2DNZ A;  4F3O A;  3QNW B;  4OZ2 A;  2HFS A;  4DR3 F;  2O67 A;  4ZVG A;  2HYI B;  2BJ3 A;  3HD1 A;  4O3N A;  2PT0 A;  3K7R A;  3P49 B;  1VRT A;  4OX8 A;  4QWD A;  3Q24 A;  3POT B;  1JWW A;  5FDL A;  2B7B B;  4O3P A;  2O1P A;  4ILR A;  1D09 B;  3TAQ A;  4OJH A;  4HAC B;  1S6O A;  2RNE A;  4ALZ A;  3CCJ S;  1FX2 A;  5KG5 A;  3AJ1 A;  4A8Y A;  1KQK A;  5C42 B;  1ZPV A;  1FWP A;  5GAD I;  3CJ2 A;  1OYE A;  2FHM A;  4IKA A;  4LSL A;  1KBR A;  2JJ4 D;  2IAJ A;  2D1C A;  1N48 A;  4FYX B;  4DUZ J;  4YS2 A;  2I9S A;  3I4P A;  1XMQ J;  1KVK A;  1ZM4 A;  2LEC A;  1VC0 A;  1EP4 A;  2GIF A;  2B5J A;  5IQQ A;  1XN9 A;  2OPR B;  1HQE B;  2YWH A;  2XGQ A;  3R5J B;  1CBK A;  3D0I E;  1H7W A;  5HSP A;  4LF7 F;  1X60 A;  1QSY A;  2KH9 A;  1U8S A;  4J9R A;  3GON A;  4BHQ A;  5J1E A;  3K5O A;  3MM6 A;  5LSL A;  2HNY B;  5KFQ A;  2OPP B;  4LF5 F;  1NB7 A;  4H4K C;  2HBR B;  4DR2 J;  3L3C A;  1SBR A;  2EI5 A;  5MAO A;  2V8V A;  3A8E A;  3UO0 A;  2H1Y A;  5C25 B;  5HAO A; 
#chains in the Genus database with same CATH homology
 5D15 A;  3UVJ B;  4WP9 A;  3G82 A;  4OYM A;  4OYW A;  4OYP A;  5D0G A;  5D0R A;  1WC3 A;  1CJK A;  1FX4 A;  1U0H A;  3R5G A;  1CJU B;  4P2M A;  4USW A;  1CJV B;  4UST A;  3ET6 B;  3C16 B;  4P2X A;  4NI2 B;  2BW7 A;  2GVD B;  4CLF A;  1CJU A;  4OYO A;  4CM2 A;  4USV A;  1CUL B;  1Y10 A;  1TL7 B;  4WP3 A;  1CJV A;  4CLP A;  1CS4 B;  4CLT A;  4CLL A;  1YK9 A;  2GVZ B;  4CLU A;  3ET6 A;  1WC4 A;  5D0E A;  3C16 A;  1WC6 A;  1YBU A;  4NI2 A;  4OYZ A;  3C15 B;  1WC1 A;  4USU A;  2GVD A;  2WZ1 A;  4OYX A;  4WPA A;  3UVJ A;  3MAA B;  5IV4 A;  1CUL A;  1TL7 A;  1WC0 A;  4OZ2 A;  1CS4 A;  4CLW A;  2GVZ A;  4CLK A;  2QV6 A;  3C15 A;  4CLY A;  1Y11 A;  3C14 B;  3MAA A;  4OZ3 A;  1AZS B;  4CLS A;  1CJT B;  4OYB A;  4CM0 A;  5IV3 A;  4P2F A;  2W01 A;  4WP8 A;  1AB8 A;  3G82 B;  4CLZ A;  3C14 A;  4OYA A;  4OYI A;  1AZS A;  1WC5 A;  1CJK B;  1CJT A;  1U0H B;  1FX2 A;  3MR7 A;  5D0H A;  1YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...