4P2MA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
169
Chain Sequence
RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Adenylate cyclase
total genus 36
structure length 169
sequence length 187
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2mA00
4USUA 4OZ2A 3MAAA 1CS4A 4CLYA 4CLKA 1CS4B 4OYPA 1WC0A 1YBUA 1FX2A 4USVA 3R5GA 1WC1A 5D0EA 4CLWA 4CM0A 4OYBA 1WC5A 4CLPA 4CLZA 1CJVB 2BW7A 5D15A 4P2XA 2GVDB 1CJTA 3C14B 1CJVA 1YBTA 1CJTB 3C14A 4NI2B 4OYOA 4WP8A 1CULA 3MAAB 3UVJA 3MR7A 4NI2A 1CULB 1Y11A 1CJUA 3UVJB 1WC4A 4OYMA 4CLUA 5D0RA 1U0HA 4P2FA 4OZ3A 4WP3A 5D0HA 1CJKB 1TL7A 3C16B 1U0HB 4CLLA 4WPAA 3C16A 4OYAA 4OYIA 4CM2A 2GVZA 4OYWA 5IV4A 2GVZB 4USTA 1WC6A 1WC3A 4CLFA 1Y10A 2W01A 3G82A 1FX4A 3G82B 4P2MA 4CLSA 3C15A 2GVDA 2QV6A 1YK9A 5D0GA 3C15B 5IV3A 4OYZA 1AZSA 4CLTA 1CJUB 4USWA 3ET6B 1AZSB 4WP9A 3ET6A 2WZ1A 1CJKA 4OYXA 1TL7B 1AB8A
chains in the Genus database with same CATH superfamily
3G8SA 5A8KB 3MF5A 4LF1A 5IOLA 4ZN1A 2HRYA 4U9RA 4OL8A 2GFFA 2DHGA 4UUWA 4ZP6A 1S76D 4Q44A 1T9TA 1VQSA 3PHTA 3OV7A 2E5LJ 2R7TA 1FRKA 2QA4G 3J7Z5 1U26A 4LBPA 4PEOA 3GIKA 5EX0A 1T95A 2B4VA 2ZBCA 3AOCA 3T19A 4UQGA 3SYZA 1ZTWA 2IJRA 3GV5B 1MLAA 3MUMP 3EX7B 3QRPA 1RHJB 1VHIA 5JXSA 3TRGA 1ZM9A 4IR9A 3HSDA 3PEHA 4O44A 3UQSA 3TZYA 4DV0F 4MYTA 3BO3A 2KKHA 1QSSA 2MB0B 1RDRA 2BKPA 5C25A 4CO4A 2V68A 3P3DA 2PSZA 5MAOA 2JDJA 3M8WA 2H4YB 4P75A 4X4RA 4DL4A 3VTIA 2CIMA 2E9TA 5KG2A 3U27A 3MXHP 4OYBA 5A0YA 2DR7A 2XZDB 4LVNP 2VQFF 3H42A 2FHOB 1TK5A 2BOPA 3M9NB 3HHKA 5F41A 3ZTOA 2QA1A 3QYYA 1DARA 1XMOJ 2UXCF 1B64A 2KTQA 4FKXA 1DLOB 1M5SA 2FPHX 1KLMA 2JC1A 4HL9A 3VF0B 3L7UA 3T6BA 3ZFVA 4C48A 5HBMB 2I5JA 2RB7A 5AJ3F 4ZLLA 2NPIA 2B3TB 1YBTA 1EP4B 3IWLA 2ILZA 4QW8A 1FD2A 1J5OB 2BBEA 1GXUA 3HHLB 1Y3KA 3NBPB 1F9EB 2QTWA 2XZTB 4IFYA 4L3NA 4NI2B 3M6UA 1OWXA 2OUGA 3BSCA 2R7UA 3HVTA 1N5YA 2XWYA 1S1XB 3AODA 1F1BB 3HDSA 4LFBF 4KGZB 3QZ7A 3BJYA 1GX6A 1DY3A 2F7VA 3ZO7A 2EK6A 3H0PA 4NYPA 4M1KA 2OPPB 1IKWB 3HLUA 4OYMA 2W24A 4NEYA 2FZGB 2V4JA 2VPZB 5D0RA 4PR6A 3EPIA 2HGLA 3LPYA 3BZQA 1RB0A 4PQAA 2DHAA 3CB4A 3M2RA 1NMEB 2OH2A 4EZ9A 3FBEA 2D3UA 3PFOA 3PW4A 2R8JA 3ZNJ1 4O44B 1S4FA 2YWHA 3DOLB 4CM2A 5KFKA 3QPIA 3E51A 2V9KA 1RTHB 3DOLA 1L3UA 2ZWPA 3R8YA 2V2ZA 3JTPA 4CT9A 1MMDA 4ED5A 3M8QB 5ETNA 1U47A 2Q66A 3KK2A 4M94A 2QL5B 2NXCA 3CMES 4X4QA 2Z2MA 1IKVB 1RT4A 4RW7B 2DGVA 5E3AA 1WDDA 4LSLA 4LRFA 4NLYA 4R0JA 5AE3A 4J9RA 4AL7A 4DV2J 3FEXB 2YTCA 1X9WA 3C46A 4K50A 5G0RA 4FS1A 2HNZB 4Q2MA 1J5OA 4NYZA 2G1HA 2H5JB 1JLQB 3FMBA 2V67A 4NLOA 2HMIA 5BR8J 3EGVA 5GAHU 2MXYA 4O0IA 2VBZA 4BC7A 2MKHA 1SKWA 9RUBA 2HIYA 2GW8A 2IM0A 3MM5A 1AZSB 1KOHA 3EXCX 5IQQA 5L39A 1A6LA 1RAHB 3IS9A 1WSRA 1EKRA 4WP9A 3MEGB 2MQOA 5HSPA 2EG1A 1XMQF 2UU9F 2M2BA 1QVGR 4ILMA 1RA6A 2HNDB 4ZVOB 4IQMA 4YFUA 2LKZA 3J81Y 1VBXA 4K5SA 1XWLA 2WSFC 3DCAA 3L95X 4F2RA 4ZPVR 3CTRA 2K1RB 3RTVA 3PV8A 2JH3A 1N32F 4QR2A 2D9OA 3IG1B 3O8WA 1H74A 1DJ0A 2OHDA 2R7OA 3HSGA 2CQHA 2K1RA 4OX7A 3U02A 2XO6A 3I96A 3NGDA 3SI8A 2ACMA 4QPTA 2E5HA 5IZHA 4KB7A 2Z2ZA 2MQQA 4CH0S 1BQNB 2ZD1A 4WE1B 4KRWA 4LRCA 4WKYA 4F0HA 3W7BA 1FDNA 1IXKA 2KXNB 2ZUAA 2YQ1A 4WWSA 3UN5A 1FWPA 1MMLA 2IRYA 2F9JA 4DPYA 4ZPTR 3VWSA 3L4BC 1SPBP 3MD3A 1HMVA 4IG3A 2B8QA 4MIWA 3T1HF 4B3MJ 4JV2A 2WW4A 1R0BG 1PYSB 1RT3B 2M7SA 2B9YA 4I6AA 2N7CA 2V4RA 4X4VA 2KZZA 3IM9A 3M8PB 2W2QP 4PWWA 2B4PA 2RDDA 2DGWA 2OMOA 4RPFA 4F67A 1T03B 3BQ0A 2KL8A 4DV4J 2YNFA 4ZN3A 4EYHB 1CJVB 4X66F 4DV3F 1NHKL 4M63A 4TU9A 1WG5A 3V4IB 2R7VA 3N79A 1CJVA 2HNDA 2LQ9A 4FS2A 5HMWA 2BQ3A 2FY1A 5FLXY 4JI5J 6FDRA 1M1GA 1G7CB 2BX6A 2VDIA 3ETOA 4FVCA 3MR5A 5J2MA 2XYPB 4LR7A 3LWLA 1REVA 1U25A 5DGAA 3VZHA 4DLGA 1VRTA 2CNOB 3K5PA 3R5CA 4KY3A 3HZEA 1NCLA 2RSQA 2W9BA 3QT6A 1X4DA 1C4AA 2CPHA 2HGMA 4N8NA 4E8UA 2ZDOA 4U7UD 4N41A 1I6JA 1YX2A 4YN3B 3M1VB 2XM3A 4GC7A 2C2OB 3ZZZA 1U45A 3TR5A 1UWBA 1ZA1B 3Q2SC 1ZH5A 2EK1A 2DR8A 2BKOA 4R8UB 4M95A 2MZRA 2IDEA 3VQTA 3TNVA 2R9LA 3M6XA 5ETOA 2HEKA 4K4VA 2W9AA 2QG9B 1NNDA 4S0MA 4ZCKA 2L9WA 2DK2A 5I3PA 1HQ2A 1WKJA 2RRBA 5KFGA 3OL9A 1X8DA 5CCLA 2CDQA 4K8RA 1NK6A 3FVYA 2DNMA 3MCMA 4WCEQ 4TYAA 1T03A 3CJ8A 3HD1A 2YVSA 4HTIA 5HP1A 1VI7A 3QATA 2J0QD 4ITSA 5HROA 2BR0A 1MMNA 2VKRA 2HFZA 5KG4A 1WI8A 3PKYA 3MURP 4QYRA 2C42A 5DGBA 1HPZA 3BGRB 2ZH3A 3RBXA 3QFWA 1SH3A 1XBWA 2BMBA 3JAMY 4C97A 4FF1A 1WG4A 2DKOB 2DPIA 2DH7A 2FVRA 3HFKA 2Q3PA 2CJQA 3ZZTA 1S9GB 3BV8A 1IWAA 4O0NA 4P6QA 3IGNA 5D78A 3TZXA 2IRUA 4NMXA 4XPCA 5I42A 2PD1A 4I69A 4WTYA 1PC4A 1TL4A 5HMZA 3D1QA 3FSIA 1T8EA 4OI3A 2ZHOA 2NS1B 4O4RA 4OZJA 5F9NA 1RAOA 2XHWA 4YUDA 3QT7A 3ET6B 4URGA 3RZAA 1HW8A 1X4BA 1OPZA 4X4UA 1AFIA 1HHTP 2JEGA 3K5MA 5L1LA 1ZA2B 2HAIA 2VA2A 1UVMA 1S0VA 2JEJA 2MKIA 4KPCA 4CO5A 2XMKA 1SUQA 3MMCA 2DNGA 4FBUA 2FQQB 5IQ6A 3HHLA 4IFYB 5A8KA 5K5MA 1NBEB 3SEOA 3ILIA 3HFVA 3UR0A 1Q7LB 2ALZA 1CEZA 2M52A 3M2VA 3NGRA 2ZKTA 4NE9C 4QWEA 4CO3A 4UY8T 2W2PP 2HLTA 1RU2A 4I1TA 5E3PA 1H2VZ 3M2VB 1FF2A 4DR4F 1RT7A 1KEKA 3FZBA 2V8PA 5HMYA 3V6DB 2KH9A 1N88A 4ELVA 3OXGA 1HQUB 2IDLA 3R7NB 2XMTA 3O6QA 4GVLA 1GAOA 4TY8B 3EVMA 4RU9A 4OYPA 2QYGA 2IY5B 2YKAA 3LAMA 2ZH5A 2NZ4A 4ES1A 3NGKA 2WONB 4H4KC 4PRFA 3D0GE 1N48A 2B0GA 6FD1A 2XLJA 3L09A 3ZZUA 3FEZA 4EBDA 3IFEA 3UD4P 1S1UB 1FX2A 2OPSB 1TVRB 2KHDA 1YRTA 5SUHA 1J27A 2E5GA 2BANB 4CLWA 4IDKA 1ZTTA 1T9VA 3B6BA 3H5YA 5EX3A 2F8EX 2P2CB 4LJMA 4CQ1A 5BJRA 1L3SA 2UVVA 2MSSA 2QC3A 3DNCA 1KQSR 2XO7A 2FVPA 1IKVA 2I5JB 1WI6A 1C1BB 3LP2B 1FVQA 1R27B 4YDXA 3HT3A 1M1KT 4Y0FA 3DLGA 4DR4J 3W8GA 4KHPJ 2AZ3A 4KR0B 4OI2A 4OYOA 8RUCA 3M8RA 2HNYA 3H2LA 1NSPA 3R97A 1HBNB 4A8XA 4DSKA 3MMAA 2OPRB 4Y28C 3UVJA 1G1XA 3DLEB 3AAWB 3O5TB 2X7IA 5E3CA 4RWXA 4UZCA 1R0AB 2FY8A 4GO5X 3SCLE 1MSWD 2AYMA 4URSA 2A2CA 2Z4PA 1XN9A 2IVYA 4RBUA 3JAMU 4PG5A 4IOAQ 3M2RB 1EQ0A 1JJ4A 2F4VF 1QTNB 5A76A 3FJ2A 3ITHB 1IKWA 2ZM6F 1JXVA 4DV3J 1YZ6A 3I55S 3CCMS 4O3PA 2JEFA 1FFGB 3FUYA 4LIWA 2R42A 1JLFB 4RO0A 2DO4A 5CYQA 4CNYA 1D1UA 3RR7A 3W61A 2NPFA 2HHHF 2GVZA 4WK3A 2AJQA 4TQRA 2ABYA 5DO2A 2WW8A 5KFAA 4EI2A 3QJPA 4CLFA 1LOUA 1QVFR 2W01A 3J7ZT 1K44A 5A0YB 3T5JA 4Q8FA 2GHPA 2G0IA 2RAQA 4GMKA 4F36A 2ZJPQ 4B9NA 1RK8A 3KK1A 2J0SD 1Q5YA 1NSQA 3QIPB 1FKOA 2YX4A 1DTQA 2O01C 3MECB 2JLEA 4LSLB 3J81j 2MGZA 3HSZA 4CI0B 2UUBJ 3DOKB 4I67A 1OSCA 2P8IA 2ZBRA 1YI2S 1DFDA 3CCWA 3CMQA 4WK1A 4DUZF 2ROEA 1W7WA 2ZHBA 3M8PA 2ERRA 2CPZA 3F0NA 4JB8B 2MQLA 3GONA 1XJWB 4F0MA 1UVKA 3EWGA 2FHMA 3FDSA 4IFVA 5C42B 4ZPBA 4O3NA 3MFIA 4J5OA 3AQOA 2C2EA 3UO0A 1LXJA 1RT6B 2GHWA 3OR1A 5G4DA 4K7QA 4ECSA 3AH6A 3MDFA 2ROPA 4NLXA 2XLKA 2IYIA 3H59A 3G6ES 5K9FA 2VA3A 3DOMB 1VJQA 3H90A 1AB8A 3GJRB 2D3O1 2HHQA 5F8MA 2RHSB 3DDIA 1JKHB 4C6AA 5LSRA 2DRAA 2WOMA 1C0UA 4AYBD 3Q83A 4ZVGA 5KFDA 4RUCA 2VG6A 3JSMA 4F4WA 2XCAA 2I8EA 1CS4A 1EHWA 1NDKA 2DGUA 2IRXA 3LP1A 4X65J 1K9MT 3JSMB 2H48B 4OJ1A 3RB4A 1VIOA 3KK2B 1UFWA 1RYRA 3L9ZA 1YITS 1OQ6A 4Z37A 2LP4A 3D54A 3J80U 1JK9B 2QLXA 2XSJB 3OPKA 2Q6CA 4J9VA 4K4YA 1QAIA 3MUVP 4FN5A 4TU7A 4A8YA 2DNQA 4LF2A 2HWTA 2OSRA 1IKXA 1S5ZA 1UCNA 4DSEA 1YBUA 4DG1A 1JLGB 3W2VA 3IM8A 2GIRA 2KYZA 4ANDA 2YKOA 2EKYA 3UNYA 2BJEA 3W2VB 2C3OA 2CYYA 2DJWA 3SDEB 1TUVA 1LKZA 2QE5A 2RRAA 4CLPA 1VRUB 2RDIA 1YZ7A 4Q0BB 3CW2C 4WKRA 3PJ9A 3IS9B 3G6VA 5AE1A 1DQ9A 5KT2A 3A8EA 3KTQA 3GFXA 3WC2A 4JV5J 2V9WA 2UXBF 1U1OA 3DRPB 2PT0A 1SC4B 1Q4RA 2CPJA 4U95A 2XLIA 3RB3A 2FC8A 3T5LA 3FCHA 5ETKA 3RRGA 2CJAA 3C6UA 4D3GA 2OP5A 4YB6A 1JKHA 4DQSA 1FJCA 3GMGA 3H98A 2CNNB 1S6OA 4KAIA 3PX4A 4RLEA 2YXLA 2WOMB 3FK4A 5KAKA 1CJUA 4F50A 2HFNA 4XO0A 2MY8A 2W9BB 4NXMF 4NLWA 1WC4A 4USMA 4ED1A 4WYWA 4CH7A 2VODA 4P2FA 3T5KA 4QOTA 1CJKB 4RNOA 3BSNA 1XNQF 4PWDB 2Y1LB 3KG1A 1HNIB 5ETSA 3I32A 3WIVA 4MJKA 1T05A 4K0KJ 3D1HA 2BJ8A 3UN2A 4MKBA 2JLFA 1FKAF 2QLBB 3DGPB 1W2IA 2C2DA 2QL9B 4K4UA 5KG7A 2QSWA 3PO4A 3OVAA 1E6YA 2AJ4A 5HQ8A 2DGTA 2VC1A 1U1QA 5KTQA 2MZSA 2U2FA 2VU5A 5DLGA 4KYZA 2WBRA 4DCOB 4F0KA 5CCMA 1CC7A 2CJXB 4ETZA 3IN5A 4DWIA 3C3LA 5HROB 2HFVA 1FX4A 4HHJA 1Q8KA 5GMEA 2AEJA 4ED8A 1R8BA 3NCRA 3QNWB 1S79A 1KVJA 2GO8A 2DR5A 2DNHA 4EUVA 1UFKA 1UETA 2MQPA 1IJFB 2E7WA 2HVZA 1X5PA 4I7FB 2Q6BA 2QV6A 4NA1A 4CLSA 2Q1LA 2NXJA 3MAHA 1RGVA 4ZHRA 5F8LA 5D0GA 1T11A 2BJDA 2ADBA 4JYAF 3CE8A 3C15B 3G2XA 3HCXA 3D0IE 1M5OC 4ZHRB 1S49A 2A3JA 3HMJG 4QIEA 1U2CA 3KNGA 2KT2A 3PRVA 3KJFB 1RTDA 1SB6A 1U8SA 4FNHA 4JI4J 1MW7A 1PIEA 5KOXA 3L7PA 2O1PA 3QJJA 1CJUB 3T1AA 2R8HA 2YWKA 3OBIA 2LECA 2EW9A 4PPZA 1F9HA 5CD4A 1TKTA 3KLFB 3T5HA 2XY6A 3VAJA 2B4UA 2DNZA 2P9GA 2VD3A 3K89A 1X9SA 4DFJA 2B5JB 3D9BA 5MLCV 1TKXB 2ASJA 2MYFA 2B5JA 3I9ZA 4YB1P 4B3RJ 3MM6A 1HYSB 3AB2B 2QN6B 1SXLA 1FRJA 1UEUA 3G9CA 3SZ2A 5J1PA 4FP9A 1FI4A 2VPXB 1RT5A 2AV5A 4LRAA 3PZPA 4L72B 2OPPA 4E98A 1RAEB 1ZBTA 2JNJA 1SQGA 5JJBA 1U2RA 1N36J 4DFKA 2XMUA 3JQJA 4FBTA 4M5KA 5CH7B 2YWWA 5B0EA 3DU6A 3VVUA 3F73A 4KTQA 3G86A 3K58A 1E6VB 1JIHA 1WF0A 4NLRA 3TWZA 5BR8F 4DR1F 1G6BA 4OIXA 4OJGA 3QLHA 3UDLA 1S9FA 2NZCA 1Q5VA 1R8CA 3QBCA 4G1QB 1H2TZ 2G9OA 5DM6Q 1PBUA 3DDNA 3R5GA 3EZUA 4WFYA 4ZP9A 1N34F 1TUWA 5D0EA 1Z2LA 3TUJC 2F9DA 3VR1A 2OPSA 4NPOA 1WC5A 3CJ2A 3AOBA 4NCGA 4YB5A 2BYCA 1K1SA 3NRBA 1TELA 1T9YA 3ILLA 5KFPA 1RT2B 8AT1B 1HNXJ 3DLGB 4M5MA 1X4CA 2M9KA 4ID5B 4F4XA 1YBAA 4ZIVA 2FLOA 4J9OA 3DOKA 2JFKA 4GKKF 4ENOA 1MN7A 3MM7B 3SIPB 3S8SA 4B3SJ 3A8KA 1ZPVA 2GO9A 5F9LA 3AA9A 4WP8A 1X7VA 2EFNA 2QX0A 3CCZA 3K2YA 3NBPA 3ENAA 5AXLA 1VBKA 4ECYA 1RISA 1V9OA 2K7JA 2RJZA 2ZDPA 1FXDA 2ZUGA 4NOHA 4M5LA 2NSBA 3MM5B 3UVJB 4YMEA 2Q43A 4CLUA 2L41A 1H6KX 2R7WA 4IRKA 3K5LA 3CJSA 2PMWA 3DKDA 5J2NA 4DR2F 1R8AA 2YKQA 3ISZA 2OI2A 3HKWA 4ID8A 3W5YA 2FZKB 4CTAB 4DV6J 4CP5A 3MR3A 2WBMA 3D3CJ 4ANCA 3V81A 1NHUA 2B8PA 1FWLA 3ZZYA 3O3LA 4N8OA 5HN0A 3TI0A 2EKNA 3CO9A 4WFAQ 3FQKA 1KVKA 3OLAA 3JTOA 5IV4A 5J2PB 2BE7D 4DUZJ 1OY9A 4GRSA 2EVZA 4FXDA 2VIHA 1DTTA 1RU1A 3G82A 3GFZA 1EZZB 2APOA 4RW7A 2KJWA 1Q0NA 2HFUA 1CLFA 1OY8A 5KFLA 2VFUA 2ZITA 3KLEB 4W4MA 2H1YA 2C1EB 2FTRA 2YQ3A 4TN2A 4B3TJ 3IBCB 3M6VA 4HACB 5FDLA 2ZBPA 2J8AA 3I5CA 2YNGA 4XK8C 3W63A 4Z2XA 2VQEF 1I94J 1IBLF 1T3OA 3OTCA 3NS5A 1JLQA 4HACA 4FYYB 3D6TB 1I5OB 3QIPA 1FKOB 3QWUA 3LTOA 1HBMA 1YSJA 4DV5F 3OW2R 5KFNA 3JSRA 2C3UA 3MMAB 5HQLA 4LRDA 1UZHA 3Q8QB 3T1HJ 1SQEA 2L9NA 2RKIA 1R89A 1IM6A 3DLJA 4J9NA 3FFIB 5KFSA 3WC0A 1ZM2A 3QO9A 5SZTA 2H9ZA 5KT5A 1VBYA 4NCBA 2KFZA 3UCGA 2HFSA 3ZTPA 3GG1A 2BM1A 2IM2A 2PC6A 1KONA 4DU8A 4X66J 2GJ2A 1C4CA 3LO3A 3K5NA 2UUCF 3Q2TC 1T7PA 2NR0A 2XY5A 2V63A 4DMZA 5F8NA 1S1TB 2RH3A 2D74B 4NWBA 2BW2A 3UCZP 1IR1A 1SH2A 4JI6J 3MEDA 1P9YA 3WBZA 3ZC4A 4I68A 4JI7F 5HVFA 4ATNA 1S9EB 1Q8BA 3O2IA 3I6PA 2DVIA 4DFPA 4LUBA 1KN6A 2JOQA 5B0AA 3J7AN 1HR0F 3EGZA 2CQ1A 2N82B 4EEYA 3KLEA 1AW0A 2BXJA 3QSIA 1IM4A 2RS2A 3M4XA 1T05B 5L9NA 2CQPA 2VG7A 3GB0A 3J7A1 3W9HA 3DGPA 2ZNZA 3T41A 1HLWA 3GCWP 1N6QA 3N5FA 5DG9A 5M2UA 2K2PA 2Z2LA 3E01A 5CZXA 5HVHA 2VPWB 2W2MP 4RKUC 2JJ4D 1URRA 2LQ5A 5B0DA 4USVA 2NLWA 2ZHAA 2CNKB 4ELTA 4DUTA 1HWIA 3PX6A 4HKQA 1C0TA 3N4WA 1IR2A 2DYAA 4GVBA 3V2UC 4NEZA 4U6PA 1TL5A 3DLKB 4DQQA 2PE8A 1XNRJ 1N8RT 4QIWD 2EXUA 3TUZC 3DRPA 3I56S 2GVDB 1J5EF 4LREA 2WRMA 2C2RA 4PUOB 3PJWA 3TJ8A 4DFMA 2GMHA 4N56A 1G3OA 4C11A 1Q1KA 1UVIA 1H3DA 4ZPDA 3Q23A 4B3MF 3VAFA 4X2BA 1TUGB 2KRBA 3IBWA 2G0JA 3TVZA 3H2UB 1FXRA 3KG0A 4U7UK 5LJ5Y 1GMWD 2AQ4A 1VJWA 3JTNA 4F4YA 1KFSA 2BOAA 4F8RA 5IS2A 2JFDA 2YKNB 2P6SA 1AYEA 5AXMA 2RNEA 1S1VA 4NL5A 2C3YA 3OR2B 5LOQA 1JLCB 1RP5A 3MTKA 3OXFA 4YDDB 1TU0B 2L48A 1XTZA 3L7OA 3CPWR 4Z7CA 1U6BA 4AL5A 2NQPA 1ZS6A 3KMQA 3NEKA 1FRLA 1RLCL 3UWTA 4LBHA 1N5SA 1LWXA 1P27B 1WEYA 1SCJB 4OZNA 1F3FA 5CYJA 3RBZA 3BYPA 1RT3A 3TEGA 4IO1A 2FGCA 3EYZA 1LW0B 3UDVA 2VPYB 1TL3B 1ZAVA 2CKWA 2YX7A 5H9FK 5KOWA 4QCLA 4K0KF 1J2VA 2W4DA 1T94A 1UKUA 1OJ4A 2Z57B 2ZEJA 3EVWA 2VQEJ 3CDAA 2VJVA 2RMLA 2J6UA 1X5SA 3VAMA 3DLBA 4ECQA 3C15A 2VJUA 3V6JA 2HPUA 1XQIA 3SSRA 1U48A 3OJUA 3HHDA 3MAQA 3W3SA 4BBYA 4RX6A 3O44A 5C24A 1B7YB 3RRHA 2UV8A 5IWAJ 2CG8A 2A1BA 3NAIA 3A3PB 1YJNS 3DGVA 2K8GA 1NK0A 1WOOA 2HVHA 1KWMA 3KDNA 1FNMA 3PW2A 2BRLA 1HBOA 1IVZA 1M5PC 2NREA 4PKDB 1KHWA 3J7YI 1LWFA 1PAEX 3CNQP 3VV2B 2L3MA 4RW9B 1WHWA 2YNHB 3I5AA 1JB0C 2D1CA 1TV6B 1KHVA 3BKTA 3LGMA 4IH7A 5CABA 1LWFB 4XAKA 2XHCA 4CCHA 2B4OA 2H3EB 1QE1A 3CD0A 5DDPC 4QW9A 4O4GA 7AT1B 2AP6A 3BBFA 3F56A 5M2RA 4DBQA 3IXQA 4LFCJ 1VFJA 1FNOA 3P96A 1O6XA 2VH7A 2HNYB 1S59A 3ELHA 3PJXA 4WJBA 2LEBA 2UXDJ 1Y3JA 3MAAA 1GXLA 3CDBA 3QGPA 3VVTA 4CWBA 2KG0A 1FHTA 4RR5A 4LFAF 2CJ9A 5AT1B 4X62F 1TKDA 5AE2A 2FB0A 3H7HB 2E1MC 5D4PA 3GILA 3TARA 5IT4A 4UOCA 1X60A 2M70A 2H5IB 1ITPA 4NLUA 3AXKA 1VQLS 3JQMA 2CJYB 2CAJA 1NH7A 1SC1B 1Z1ZA 1XK8A 2XMMA 3JXOA 2CA9A 3K8VA 4P7TA 3RW7A 4ZMMA 4YY3J 1WACA 4K5RA 4WZQA 1JNRB 3IR7B 3BREA 3FBBA 3KJVA 2E5LF 3W66A 2HVIA 4DR7F 4EK2A 2KG1A 3EGNA 4QJVA 1Y7PA 1FEEA 1HIYA 2DH9A 2SXLA 1S72S 1TK0A 1F2GA 1CQNA 1WC1A 1L3KA 1RCOB 3RB0A 3DXSX 4IG0B 2ZH9A 3UDEA 3R7SB 3QRRA 1JMTA 3AJ1A 3BDEA 5LMUJ 4OHWA 2XMAA 4LQ9A 3W5ZA 4UOHA 2YNHA 2EG2A 4DR1J 1JJ2R 4OZ1A 3BO2A 2MDAA 2C3PA 2MKKA 1VQMS 1QE1B 1WOSA 3FNNA 3TYTA 4ES3A 4DX8H 1FTRA 4DSFA 3UD3P 1N4LA 5L38A 1JXLA 1VHFA 2VFTA 2VBWA 3DRXA 5HBMA 3RAQA 4P2SA 4E0DA 2AWZA 3LAKA 1YKWA 2KO1A 2CQ2A 2O5DA 2Y3YA 1D8ZA 2NXEA 4ZP7A 1GK8A 4ES2A 4TQSA 3KMSA 1F3VA 3SXLA 4JI8J 2EI5A 4DCJB 1IBKF 1K1QA 4LR9A 2IVFB 1Y9OA 2BUNA 2OEMA 4QIVA 4DN9A 5DETA 4DCPB 2W8LA 2MLYA 1RTJB 4JI2J 1S77D 4FXVA 3THTA 2AYGA 1HNXF 3SV3A 2ZM6J 1OYEA 3PR5B 1YDLA 2XNQA 1NK9A 2QO3A 3MCNA 1U0HB 3QIDA 3SFGA 2LVWA 1V3ZA 2CQ0A 1ROFA 2Q79A 3NXZA 3R5DA 4Y2KA 5DRKA 1T3NA 1DRZA 1I51B 4NXNJ 1AFJA 5F8HA 1PSDA 5B0GA 1H38A 3NNCA 3ZZPA 4U67Q 4GC6A 4B9VA 4Q7AA 3QSYB 1L5UA 1Q81T 1H2UX 1VK3A 3W5XA 3BR9A 1Y10A 1RJJA 3C19A 3ENVA 2GGPB 5HJXA 1S6UA 4RU2A 4A8SA 1RA7A 2HK3A 1QSYA 2MKJA 2WK4A 3PFEA 3PX0A 1TAUA 1YIJS 1UFLA 2DNPA 3B4MA 1RZMA 4KV8B 1WNEA 1IR0A 1PKUA 5E3QA 1YTYA 2PEBA 1TKZA 3KK1B 2E5IA 2DXDA 1HBMB 3GP9A 4B17A 3KJQB 1EP4A 3NNAA 1EARA 5G0RB 5THWA 2XMWA 2VHGA 3FCWA 5KT4A 4KQZA 2GNKA 4WXOA 4QQBA 1HBNA 3PEJA 3HJFA 1XR6A 5D4OA 3HZGA 5D77A 5CXTA 1ZZFA 4ED7A 1KBRA 1G4CA 2KJVA 2H51B 3TAMB 1T9UA 3ISND 4UQTA 3G71S 2G0CA 4ZCMA 1NDLA 1MU2B 4LF6F 2XY7A 4Y00A 2WSEC 1YWXA 4PABA 3T9ZA 3TO8A 5ADZA 4J9LA 1TR0A 2GJFA 3MHYA 1S1WB 2O3DA 3SCIE 4DV1J 1UAWA 2MY7A 1U6ZA 1B99A 2F40A 4BC9A 2WCXA 4LF5F 1QAXA 5EDWA 1GXTA 2R4FA 3IA0A 1D0EA 1N33J 4TLQA 2N4CA 5DQIA 1FVSA 3IR6B 2OGUA 2VB6A 4ZVRB 1UW4A 3UR3C 3HM9A 1RAIB 3TAQA 2UUAF 2XWXA 5T14A 3KXDA 3SCKE 2YPYA 2MLZA 3GFHA 4M8LA 2ATCB 3LP1B 5L1JA 2CJKA 1VLYA 3P5BP 5HAOA 1MWZA 3NMRA 4RBTA 2DO0A 3LW5C 1EETA 4HHHA 4UUXA 3GJSB 4KSEB 3HP6A 2FJVA 3SSSA 4Y34A 4J7CA 1D09B 2B7CB 4K2JA 2DGSA 4YR0A 2W8KA 1TFWA 1TZ0A 4PG6A 5B09A 3PYDA 2DR9A 5JMNA 4DZDA 4OJ3A 1V5VA 3DLKA 4LRBA 3NGSA 1VRUA 3EUNA 2PEHA 4YEAA 2V8DA 2IBOA 3POTB 5A8RA 5LSLA 3NKYA 3AD8C 1N5QA 2JWNA 1V6HA 1JWWA 1EKSA 2CPXA 5EGYA 1RWWB 1Y00A 3POTA 2P6TA 1FRHA 2XZWA 1MG7A 1R8PA 2DR6A 3FRYA 3R27A 2ZFHA 3LP0B 5K20B 2W9CB 4C0HA 1D8YA 1RQ0A 3FBFA 1URNA 2NCKL 3OFHA 2IM3A 2DNNA 2JVOA 2ZWOA 4OI4A 4WU2A 3QJLA 3HI9A 2V69A 2V0NA 5IM0B 4FF4A 3IWNC 4ERDA 1Q8LA 2POKA 1REVB 1N0VC 3FEYB 4NA2A 6AT1B 4ED0A 4DL2A 4YS2A 3KYLA 1T9WA 2K06A 3AA8A 4LBIA 3VHQA 4ETXA 5A8WA 3U1LA 5L1KA 4DV6F 4ZPAA 1F6TA 2H4WB 4PAAA 4DL0C 4DJBA 2XNRA 3IR5B 1S97A 2DT9A 3EJMA 4FYVB 4WTOB 2YKMB 2CPIA 3CIMA 4OZ0A 4DN0A 3PNIA 4ZVEA 2CWKA 5FJ4A 2AU0A 1WG1A 1FWKA 2R8GA 1JLCA 1WJ9A 2MQ8A 3RYLA 3DN9A 4PWUA 7FD1A 5A2QU 4QYZK 4Y65A 4DUYF 1RAAB 4I0WA 1OSDA 1S7HA 1VQYA 1RHUB 4A8QA 2F1FA 4O3OA 5AXNA 2UUAJ 3B82A 1TL3A 2NYHA 4Z7YA 3EE3A 1RUSA 3B4DA 3K5OA 1U09A 1LK5A 1REGX 2W2OP 1FD8A 3A13A 2PA3A 3T6JA 1Q16B 1BGXT 3MOJB 3CUNA 1HNVA 1VC0A 5GMDA 1KFDA 1NPPA 3BSAA 4N77A 3Q8UA 2ZH2A 1DZ5A 5I4MA 1HQUA 2A10A 2MZQA 3D6FB 3TUPA 3DRYA 4QIGA 2PI5A 2XGQA 5HP1B 5KFOA 3LPEA 4IOCQ 1HFEL 4HHUA 1KQGB 4ICLB 5KG6A 5IXUA 2GVDA 3V4IA 1TFYA 1P8GA 4C0OC 1FJ7A 5IFMA 3DLLQ 4J9SA 1HPZB 3BGRA 2RE1A 1FKPA 2G2ZA 2QMUB 1FDDA 1UMJA 2IMOA 3HXMA 1NU4A 2MMYA 1UJ4A 2GQQA 4ILRA 2MQMA 3ETMA 3B54A 2E5JA 5H9FJ 2PIIA 5IV3A 4MIAA 1UA1A 1TV6A 4ER8A 1I94F 4JI4F 2YBVA 2VOPA 2RU9A 4ECZA 2YKNA 1HW9A 2MZJA 4KHMA 5CYMB 1NK7A 1TMMA 2HBRB 3R5JB 1AROP 1TKXA 2VC0A 3ADAC 2QMXA 3OXLA 4R5PA 3OUYB 1D9DA 2Z56B 4HT7A 4Q43A 3M8YA 1CJKA 4DSIA 4N5SA 3IAM9 3DRRB 3LGNA 1YRXA 4KKOA 4L73A 5AXKA 2HWHA 3VAIA 4A8KA 5DG7A 2IJNA 3OUYA 1O0PA 1YJWS 2HHVA 3DRRA 3VAKA 1F0XA 1B7FA 4D3HA 2OKQA 2QMWA 4HI2A 4DLEA 4LQ3A 3AY0A 1TL1B 1IQZA 2RQ4A 2CG4A 3CCLS 1HYSA 3G8QA 3KJNB 1WSVA 4Y3CA 5HQMA 2FLLA 4OI1A 1S0OA 3P6YC 3MGJA 3CCVS 1N32J 4P7VA 4YR2A 4NLPA 2HQFA 1F60B 1RAJA 1E6VA 2CVIA 2X1GA 3JYTA 3CCRS 2E9ZA 2ZJQQ 1SV5A 2FJBB 2CZVC 4MFBA 4LF6J 3W2WA 5H1SV 1LQ9A 3KJVB 1RBLA 3U7JA 2DGQA 3Q8SB 3A3NB 3HK2A 5JUMA 3X3UA 1XMBA 4ED4A 4PCQA 2RQMA 1DURA 1FDAA 1V3RA 2HRTA 1RTHA 4O3QA 1FKPB 3W8PA 3GIIA 1HR0J 1MROA 3PY8A 1SC3B 1RWKB 4A48A 3TVKA 3LQVA 3S01A 2GJIA 4DXLA 1X31C 4B02A 2AGOA 1NJYA 1IBKJ 3M30B 4DV1F 1HBOB 3GV8B 3HHNB 1S57A 2VBXA 4L74A 4NYOA 2VV5A 4RZRA 2ZOMA 3M7VA 4USJC 1KR4A 5I3QA 4CLZA 2BW7A 2Y9HA 2AX1A 3KLFA 4P2XA 2OAUA 5AJ3J 4RW8A 1GTEA 2BABA 2BVZA 2KXHA 4NMLA 3TOQA 1X0FA 3ISNC 3W9JA 1CJTB 3C14A 5J1EB 2N3LA 4RW8B 3MCOA 4Y2CA 2QYCA 2NUUG 4DF4A 4DR6F 4JI3J 4EZ6A 3BKUA 3MAAB 3OVBA 2QLJB 2GQCA 3CCJS 4NI2A 4WZMA 3HKZD 1CULB 1Y11A 1KSPA 1RI7A 3UN3A 3NOCA 3RUBL 2AEMA 5C2CA 1RT5B 5GADI 2BJ9A 4PQUB 1RT6A 5T7LA 2GAGC 3FGVA 3R5AA 1TK8A 2H5EA 2E1CA 4IYQA 4ZVHA 1JLFA 5CYQB 3KHHA 2HHUA 3EVOA 4FPIA 4GO7X 2KRRA 1UJ5A 3I4HX 1LW2B 3NCQA 1X4EA 2JL9A 4YY3F 1VISA 3KLVA 4DQIA 4WPAA 3KLGB 3OJSA 3MTJA 1VQ4S 3JSYA 1NJZA 1JX4A 3HFZB 4OYWA 3RR8A 1GT8A 4C2MA 1S9EA 4KT0C 3NGUA 4V19X 4P74A 1S0MA 3I87A 4F3MA 2R2SA 1RTIB 3M05A 4I2QB 2XBPA 3VCDA 4HTJA 4WU3A 2RQKA 1HHQA 3G82B 3BQ2A 3C6TB 2DPJA 2DCLA 2NSCA 1DLOA 2XSJA 1R43A 4LFCF 1FE0A 2IC3B 2GX8A 5KFBA 2UUCJ 1NDCA 3OQ2A 4IG3B 5LMUF 3TZWA 2O66A 1C1CB 2AW0A 4KO0A 3D68A 4M5HA 4RBVA 4QR1A 2ADCA 1SJ3P 3NWGA 4H4MA 1RWVB 2BM0A 1SIWB 2MGZB 3GPAA 3VAGA 4ECVA 5CAAA 3Q24A 1IBMF 4DL3A 2JC0A 3VGSA 1KLNA 1C0TB 3PG9A 4NLGA 2Z8QA 1ACMB 5ETPA 4KHRA 4X4PA 3NY0A 1C2PA 4JP8A 3ZZ0A 3CCSS 3A12A 3Q89A 1VBZA 2RKIB 2WSCC 3AT1B 3D3BJ 1R0CB 5IWAF 4DS4A 1VQ8S 4ZVSB 4ECRA 5C42A 4B3SF 1X4GA 2E66A 2F63A 2MJNA 2VBYA 3M32B 4TY9A 3VALA 2HHWA 4YHHF 1OO0B 1RWUA 5KFCA 1B70B 2VQFJ 3R1HA 4ZOSA 5DM7Q 2QA2A 1X9MA 4LR8A 4MK9A 3P4UB 2BKNA 5ETMA 2R8IA 5LMNJ 1KQFB 1X5TA 4DR5J 4PXBA 4I6WA 2AF6A 2WB1D 2QIFA 4P73A 1N5TA 3LGHA 2KT3A 3RAXA 1GTHA 1RACB 2UXDF 2EFQA 4TU8A 2KU7A 3IGVA 4FNIA 3TJ9A 1XEZA 3TW0A 4CLYA 1DTTB 4DEZA 1QUVA 2MJUA 3HPOA 1KKHA 2B7BB 3AD9C 2HHHJ 1CS4B 3BGOP 4ZPCA 1BQNA 2HHPA 2XYGB 4RW4B 1RWOB 2ASDA 3MEEB 2OPQB 4G1IA 2A6MA 4KV8A 5CHCB 4F3QA 2WVDA 1UPMB 4OI0A 2AIRB 1HKAA 2M3DA 2QRRA 5DDRC 2J0XA 1C1CA 1RWMB 1WORA 4F25A 2RHQB 1VQOS 4ZP8A 4OV6A 1EQMA 5EWGA 5FIIA 4ELUA 4EFAC 1UEVA 4KBIA 2KM8C 3FFIA 3PRDA 5HLFA 4J9QA 2CJBA 1SC6A 1CSJA 2DEJA 3EXYA 4KH0B 4WIIA 1NK4A 2W7OA 5H9EK 2HS3A 2OLWA 3KOAA 2HRUA 3RU0A 3D5MA 3QMQA 4KE5A 3A3OB 5F8GA 3N6NA 1J5EJ 5LL6d 1WF1A 2KVQE 1RT1B 3NG8A 1BHNA 4X64F 2X51A 1LWCB 4G65A 2AGQA 1RTZA 3A8JA 1VC5A 2R8KA 3OLBA 2UVRA 1U24A 2E7VA 2W9CA 4B9UA 1AUSL 2G13A 4F2SA 4JUZA 4Q0BA 3I0SA 3ILJA 1NKCA 1HARA 4C11B 4IH6A 3LH2S 4OFZA 5JVHQ 3A4TA 1VK8A 3JSBA 1U1LA 4GKJF 1UTAA 5A2QY 2B6AB 1PO6A 2QT7A 1ZAWA 4MYUA 3EM1A 3KLHB 4NA3A 3UPFA 4R8UA 4OZ5A 4A46A 5A8WB 5HI7A 7FDRA 3DMJB 4LF7F 2HHSA 1FNXH 4OQJA 1WELA 2M4MA 3KLHA 4J9PA 1K73T 3V6HA 2L08A 4HDHA 4ZVFA 2Y1IA 4LF8J 1NEEA 4R5PB 3BM7A 3HD2A 4C3KA 5EUHA 5I3UB 3VQSA 2BDPA 1EETB 4IRDA 3R7BB 1VYAA 4OYAA 1BQMA 1EB0A 3GE9A 1S7IA 4ZJQA 1VQKS 4DSLA 4KGMA 1IQTA 1HWUA 5KFWA 4KFBB 3H5XA 4EBEA 1WKLA 1WWHA 3MPYA 1FDBA 1S12A 2B9WA 1MWQA 3W1YC 3C8YA 3P49B 2OTJS 3WX4A 2RD5C 3VZIA 2COLA 1RKIA 4CH1A 1S10A 1NXIA 3FCVA 4DL7A 4DSJA 3G6XA 2DY9A 4K4SA 4E2FB 3SSQA 3JYTB 3W9IA 4CO2A 5D3GB 4DR3J 4MIBA 3M2UB 1Q86T 1GNKA 2QL7B 3GJTB 2LA4A 3IP0A 3KLIB 2MKCA 2XQCA 3GG0A 2W2NP 2YPZA 4RW6B 5T41A 5C2GA 5HANA 1BD6A 2LU2A 3Q86A 4ICLA 4CRJA 3MEKA 3GZ7A 2LQJA 3NS7B 4TNOA 4ZVUB 4N7TA 2N4DA 2YH0A 1YQHA 2QZ8A 4ECXA 4F04B 4AFFA 2HFOA 4I6YA 2ZBQA 1U2FA 2DHSA 2RUGA 1JJCB 3K8WA 3IAS9 4DL6A 1JLAB 3T1YJ 3RB6A 1KTQA 3M1VA 3ZXWA 1R3NA 1Q7YT 1SUQB 2ROGA 2LEAA 3D0HE 3HSJA 1TQLA 3ZTSA 2FZCB 4TYBA 2DISA 1GMUA 3CC2S 2BV3A 2DNOA 2MKYA 4I64A 5KG1A 3OHBA 3G8TA 4JI6F 2IM1A 2QEXS 5D6GA 4OZ2A 1WTBA 3HO1A 1LEOA 3LUYA 5DZ7A 1SKUB 2E44A 3OFEA 3RRKA 5A6WA 2C22A 3KK3B 2FLNA 3DLEA 5D4LA 8ATCB 4ZLJA 2ZOGA 3NAHA 3MM6B 4CNZA 2BQUA 3D28A 5EN1A 2LFVA 3GYGA 1GFWB 4CT8A 4PZVA 1LW0A 1NZAA 2AKWB 2J9DE 4MTPA 3EPGA 4C8KA 2JRSA 5T7LB 3KKFA 3J7YU 3W2WB 1RT7B 4RUAA 3BBBA 2G2YA 3EZ5A 2DB1A 1FCAA 5KFVA 5L9XA 4OLPA 1HNZJ 1VQNS 2KB2A 3TA1A 1SJ1A 5KFZA 1SV5B 4UOGA 5LXYA 1FJGF 3NWRA 3RAMA 5DDQC 2PFDA 1NKEA 4TVAB 2HQDA 3BQ1A 3BGLA 4P9SA 4EO6A 1DBDA 3WDOA 3CC4S 2K7KA 5LT5A 1RLDA 4NASA 4I2PA 2BJ3A 1TTHB 2MEWA 4URQU 4RUHA 5EHHA 3PR4A 1OY6A 2CADA 2E29A 3HULA 3FRZA 1KD1T 1KVIA 4IDKB 5GAGU 4L76A 5DG8A 3Q22A 4KH1B 2R7XA 1VMBA 3BS9A 3H5UA 3OD2A 1HL6A 3ZZRA 4DPOA 4QU7A 2DNYA 3DC2A 5F0UA 1U1RA 2B9EA 3PO5A 2OD4A 3MPVA 3CDUA 3MUTP 3MPWA 2HGNA 3HF5A 4F7VA 1P9QC 3CJ5A 4OX6A 1H7WA 1X5OA 2EFOA 5ETQA 4JI8F 1RXOB 1UA0A 4A8FA 3KNAA 2V8VA 3H20A 3TQEA 2XGPA 2VONA 1X4FA 2LQBA 4PQUA 5F3ZA 3N9UC 1UJ6A 3CJRA 1F9FA 4WIQA 3FSYA 2WTFA 1KQKA 3V6DA 5DQHA 3AB4B 3GR1A 3CD6S 2FJEB 4NRTA 4FPRA 5D0HA 1NKBA 2C3MA 3KHRA 4B3TF 1VS3A 2HURA 3H5SA 2B9XA 5HK4A 5KFEA 2V8HA 3QAEA 4XDCA 4HI1A 3PACA 5E0OA 2DRBA 3F41A 3H2VE 4RNMA 4ZIWA 1LWEA 3MM9B 3HVRA 2HQCA 2UV8G 1EX8A 2MSTA 3I9V9 4PYAA 3OHAA 3V81B 4NZ6A 4MKYA 4B3OB 4CIOA 1C0UB 1RTIA 4I2QA 3DM2A 5ETVA 4G1PA 4USTA 4CO0A 5RUBA 3GQCA 1ZM3A 5H9EJ 2IBKA 3CT9A 4DV0J 2VL1A 1WF2A 2WB4A 2OELA 3GJQB 2LLZA 4M5DA 3N5BA 4NLSA 1YG0A 3QFHA 1YGYA 4ZJLA 2VG7B 4C9DA 2EC2A 3ILOA 1RT4B 3F44A 1YJ9S 2FUG9 1FK9A 1YK9A 4JOUA 3PXGa 4DV4F 3G87A 1O5JA 3HVAA 1YJ7A 2CQ3A 3OL6A 2OSQA 3IO1A 1FK9B 1JLGA 4AXIA 3UDCA 2MTLA 4DI6A 5LMNF 1VDHA 2ZNYA 4USKA 4IO9Q 1QM9A 1HNZF 2DNKA 1FJGJ 1HNWJ 4DPTA 2ZJRQ 2HQGA 4WFXA 3GYXB 5KFFA 2HBQB 2RQCA 1A0OB 3PRBA 2FD2A 1U8WA 5IC4B 4NXNF 3DYAA 4GKKJ 3ONQA 3MR2A 3NGTA 3BH6B 4Q45A 3K7RA 3N01A 3ENWA 1P6TA 3I31A 3CIZA 4X4OA 4KHPF 1UZDA 1Z4UA 3LP0A 2ZOFA 1QDUB 2HIQA 2PMHA 2IJFA 4U8YA 1W26A 3TEHB 1LWCA 2B56A 4C8LA 5J2QB 3OFGA 2E7XA 3GSIA 1LWEB 4MK7A 2IPOB 3FMWA 5KG3A 1S1WA 1F5BA 4PXEA 4DPUA 2V2VA 1NB7A 1LXNA 1OYDA 1KOOA 3K17A 4DV7F 2F8MA 4RJVA 4NLTA 3SBMA 1UVLA 4B3RF 2R2UA 4LF4F 2X1AA 2VG6B 1UWBB 4OMFG 1NJIT 4IOBA 2CZ4A 2IFXA 2LU1A 1L3VA 2VICA 4UY85 3KWMA 4B08A 3K0JA 2CRLA 2YNIA 1FERA 1T0TV 2J9DA 3P45B 3GR0A 3QT8A 2KN4A 2KYXA 2YNGB 4I4BA 4AT1B 3OTOF 2G4BA 2LYVA 3UFCX 3QGGA 2E9RX 2KT5A 3UI3A 4DG1B 1SIZA 2OPQA 2WAQD 3EDQB 1Y5LB 4DR6J 2Y1JA 2FVSA 3W62A 1NK5A 1RSCA 1UPPA 2J9CA 2RILA 1K8AT 2ZZNA 4X4NA 1F5AA 2XEXA 1D3WA 1FRXA 5DZ6A 2ASYA 1ZETA 2YNFB 5DQGA 2WVFA 2IIHA 4O3SA 2J9EA 1HNVB 1B0VA 4G6VB 4J9KA 1PJ6A 3ENQA 4L3KA 4PXDA 2HZVA 4XPEA 2ASLA 1IWGA 2AMCB 4PUOA 3MEGA 1MU2A 2ATLA 5HLFB 1CQMA 3GIRA 4H4OB 1CPZA 1ZOTA 4QU6A 4FDFA 4JV5F 1SVDA 2GMLA 2V4QA 4UF4A 4DQPA 4KJIA 4H4OA 4ED2A 4V19J 2EPIA 2OD6A 1U1PA 3B8HA 1JLEA 2CPEA 3MR7A 5DDOC 2ZH1A 3MMJA 2X3GA 3IRXB 1BMQB 1G2EA 2PA8D 3MD1A 1S6QA 2ZVSA 3FBCA 3TA0A 2YKMA 5HATA 4CO1A 3DHXA 1NSAA 1S0NA 4DX5A 1SL2A 4WBFA 1AXQA 4O4GB 2LMIA 3CCQS 3ZTQA 1APSA 1XNQJ 1U02A 4B9MA 4BS2A 3C66A 2R2RA 2YWFA 1TL7A 4W90B 2A18A 2X1BA 2YY3A 1VRQC 4DR2J 1XR7A 1ICEB 3I4PA 4RNNA 3CD7A 2D69A 2VFVA 4OYIA 1V5IB 2EBEA 3BN7A 5B0CA 3DI6A 3H4BA 1ZM4A 3I82A 1T9XA 2FJAB 4X65F 5IT9U 2G2OA 2QLWA 4X62J 1WC6A 2VG5A 3MWBA 4QWCA 1HI0P 3AJDA 2HG4A 2YKPA 3JQKA 4EYIB 2UZAA 2I1RA 3IMQJ 2H65B 4CDIA 2KZMA 2HBYB 4USHA 1YJTA 1NB2A 2GZOA 2VG5B 1M90T 4QR0A 4BCAA 2FVQA 2FDNA 4EO8A 3V6KA 2FLPA 2BZ2A 5F8JA 2UXBJ 2JVRA 9ATCB 4MFBB 3HHLD 2Y1RI 4BWJA 1HQEA 3QZ8A 2FJXA 4B9LA 3ICLA 2RF2A 1RHQB 2VASA 1HNWF 4IH5A 2CQCA 3QLHB 3QGHA 3LWMA 4YB7A 2WONA 3SCJE 1U1KA 3EICA 3E3XA 1NK8A 2WVCA 4O23A 4MT1A 1SKRA 4DR7J 1S1UA 4F3OA 3MR6A 4ZLNA 1JLEB 1FEHA 1BUXA 1SI9A 2ZC4A 4HH0A 2AT1B 3GV7B 4F4AA 5KFQA 4USWA 4FXWA 1HD0A 2D9PA 3OL8A 1KC8T 4C8YA 1U1MA 4C8MA 3MOZA 4KKOB 1KLMB 2Z30B 5CA5A 2X1FA 1Y0HA 2GA7A 5HO4A 3FSXA 3R3TA 4J90A 3RJMB 4F4ZA 1JLAA 1XIQA 1QTMA 1OMSA 3TX0A 5A6PA 3D6HB 1UP1A 4JI1F 5KFIA 5GMKa 1SBRA 5JVGQ 2BACA 3RGIA 3C2PA 4LVOP 4YQWA 1SL0A 2F4FA 3MMCB 2EFVA 3CJKA 4OHYA 1VIXA 2OPRA 1BQXA 4DZ6A 2HWIA 4NCAA 2DHXA 1E6YB 4DU7A 3Q8VA 2NYIA 5GAEU 4FZVA 3AFGA 4J37A 4ZDNA 4PG7A 1R7IA 3BPSP 4UT4A 4ANEA 3BN4A 2MQNA 3HX9A 1U7LA 1AT1B 3NCPA 1QAYA 4Y2AA 3W64A 2J7KA 3LA0A 3JB9k 5FLXU 1RE1B 5D3GA 4CTAA 2V6AA 2I2YA 4ECWA 1A7GE 1HHSA 2FYXA 2YWEA 3GSDA 4JBCA 4K4WA 2KDOA 4PXCA 1WKKA 5B0BA 1ZYQA 2VOOA 3PKMA 1WC0A 2RIJA 4G1QA 2DBBA 3H8YA 1R6YA 1WTFA 3TX8A 3LALA 3CCES 2BANA 4DPXA 2U1AA 2F8HA 4ZVPB 5C24B 1VQ7S 2K3KA 4HLBA 2A6OA 5GADU 3WHIA 4C3MA 1BXNA 3US5A 1RTDB 2GIFA 1NM2A 3D2WA 2GGPA 1BC6A 1AA1B 5KFUA 3OSNA 2JEIA 2F3JA 5E5NA 1PGZA 4C0BA 3M30A 1Q82T 5CZVA 5IT0A 1XMOF 4X84A 5E2QA 4AQYJ 4OV1A 5CYMA 1UEKA 4DHVA 1O8BA 1SJQA 4J9MA 1F2HA 2I9SA 3MMBB 3TUIC 1JXEA 4W98A 5KT6A 3HVWA 4ALZA 5BYRA 4UW2A 4HYKA 3QAUA 4A8MP 1KS2A 5BYSA 2MHEA 5LXRA 2UU9J 5F3TA 5K8OA 2RUSA 2ACYA 1ZPWX 2DGOA 2GC8A 5K14B 4ZVTB 4DOZA 3Q8RB 2ZH4A 2MHNA 4KIAA 3CC7S 3FQLA 1S1XA 1WHYA 2RRNA 3R2DJ 1S6PB 1Q53A 3RBDA 1FFWB 2IAJA 4HVZA 1DAXA 5DJBA 4XDDA 1RWNB 1U0HA 2B51A 4KGVB 3MFHA 1BWEA 2GAHC 2DEIA 2XI2A 3P8BB 2FJDB 2BJ7A 1PILA 3C16B 4LSNA 4QPXA 4ZKAA 3J81U 4LF7J 4CLLA 4EMDA 3C16A 4LSNB 2M88A 5KFXA 5J2PA 3BYRA 2UVWA 4B9SA 3KUEA 2BRKA 3MZIA 1WHVA 3AJ2A 1CVJA 2QGFB 2VFRA 2W4CA 1HI1A 2I6WA 5C25B 3K57A 2EBGA 2GVZB 4A8WA 1TVRA 4LF9F 1XERA 2BA9A 4I2PB 4FYXB 4JI7J 2ZD1B 1PJ7A 4FVMA 2J76E 2IYGA 2Z2YB 2RVJA 3BEGB 3C6TA 2XI3A 2GQ2A 3DRSB 4EGLA 4F4KA 1RHMB 2V50A 4WXWA 1XNRF 3M8QA 4RW4A 4HR2A 4LMZA 2HKEA 3THPA 1TKZB 2DGXA 3UE2A 1O51A 1S99A 3NL0A 1RT2A 3D66A 2DTJA 4AXJA 1RCXB 3QGIA 1KP6A 1RWPB 2CQGA 3CWJA 3MM8B 1B0PA 1HWKA 3E01B 3CO0P 3EZOA 1TMJA 1IJEB 2J7WA 1A9NB 2AGPA 2WVBA 5BXIA 2N3OA 5K14A 4DX6A 2BQRA 4C7QA 2R2TA 4H4MB 2NXNA 4P71A 1EAYC 1AZSA 3CVKA 3GCXP 2XG8A 4ILLA 1HBUA 2LDYA 2J6TA 1WDTA 3I0RB 1FFSB 1NH8A 4OZLA 4IUFA 4QIFA 4MKVA 4WF9Q 4LF4J 3TAMA 2DIUA 1QSLA 1RHRB 3BB5A 5KFHA 4DV7J 1NHVA 3ITHA 4RNFA 1M5HA 2KXFA 1RADB 4NZ7A 2QA4S 1QD1A 1ULRA 2AJ0A 2CQIA 1PBAA 2DHHA 3KLGA 2UXCJ 2PGCA 1PYOB 5IC6B 2FC9A 1NDPA 4BHQA 1S1TA 5C7PA 3BPDA 3T3FA 1FRMA 2LDIA 4YR3A 3H4DA 3LF0A 1BY9A 1JQGA 2FHJA 4MMOA 4AUKA 4OLOA 5FD1A 4CLKA 1PC5A 2XCPA 3GYNA 2MZ1A 4QBUA 2YX1A 1FJEB 1UL3A 2A2DA 2EEYA 4WYLA 2L9DA 5LSOA 5L1IA 4DV2F 4IQXA 1N0UA 2Z58B 4H54A 4R0EA 1HNIA 2ZZTA 4WFNQ 3TANA 3D1OA 4ZVQB 3GIMA 2BEFA 4J9UE 2V5HG 1LV5A 1EIYB 3W65A 5E7OB 4OJHA 1DTQB 2AYEA 3MECA 2XC9A 4DV5J 3AD7C 2HNZA 4K4TA 2IMWP 2JHEA 1RBOB 3HHLC 3PCOB 5KFJA 3R9LA 3O1LA 3S7RA 2HQIA 1X0PA 4OHVA 1VGYA 1U1NA 2GMJA 2D3OR 1KRPA 1I1GA 5HL7Q 2CDRB 1RHKB 1PAUB 5M2PA 1JNZB 4LT6A 4YHHJ 4IKAA 2ZE2A 3SFUA 5ITHA 1N52B 3BKFA 1OS5A 2W4PA 3D4JA 4GVBB 2HQ3A 5KFMA 1OPIA 3N0VA 1MWYA 3NOGA 4U8VA 2YQ0A 3OFFA 2OMLA 1QLNA 2VZ9A 1WOPA 2VDHA 3GLJA 1TAQA 5BYQA 1N54B 3CJ3A 4N76A 3D67A 4DUYJ 2XS5A 4MKAA 1RAFB 2ZH6A 1Y4ZB 4LF5J 2B6AA 3JS9A 1VQPS 1F5CA 2XYHB 2LA6A 1N34J 3GU0A 3M8SA 2CQDA 5E41A 3DFEA 1VCTA 4WE1A 4C8ZA 1NPRA 3ZZOA 4RUBA 1K47A 5B7WA 1GH8A 2V2KA 4OX8A 3PTWA 4HEA9 2Y0SD 4BWMA 1NPKA 2R3VA 2UUBF 1S1VB 1PG5B 2FHJD 2YNIB 3OTOJ 1YLXA 2EFPA 4XIUA 2IA6A 3V5RA 4KFBA 4KC5A 4ZPWR 1K0VA 4P10A 3KK3A 1Q79A 3MCSA 2NXUA 4M5NA 4HT5A 2AX0A 4NLDA 1TP7A 3DI6B 1LFWA 4LIRA 1Q78A 4OX9F 3KHGA 3OTEA 1U4BA 4JI3F 1UVJA 2V34A 2Y0BB 3DHWC 4Y2MA 1DHMA 2M8HA 3SQGA 3Q8PB 2HLUA 2I38A 4JV1A 2MLXA 5E33A 3SDEA 1HQEB 5LM7E 3PW7A 1L3TA 4JI5F 4I7FA 3NLCA 5DS7A 2BE2B 2CPFA 4I56A 1HA1A 4DR3F 4P2MA 2AJFE 4PG8A 4TY8A 2DNLA 4ZK7M 2EFGA 4PPDA 4OHZA 1FTCA 2M0GB 4K4ZA 1HI8A 1HWJA 1B4SA 2DD8S 4RW6A 4USIA 5J2MB 2DXFA 4V1Ak 3CJ0A 2IVMA 1M5VC 3C6UB 4P72A 1IKYB 3QWPA 1IN0A 5F8IA 1VRTB 1I3OB 5B0FA 2JZ5A 2YH1A 1FA0A 4PYDA 2ALYB 4OYZA 2XMVA 5I42B 4DX7A 1VQ5S 4IRCA 1RWXB 4NRUA 5E3RA 2QJ3A 1GX5A 4QWAA 4KPYA 3AQPA 4IR1A 3L3CA 1H72C 2AYBA 2Y8WA 4U7CA 3J80Y 5CD4H 1HD1A 4RW9A 1JLBA 4JYAJ 5GVQA 1WEXA 2KI2A 3CCTA 3EGWB 3MMBA 4OI6A 2UVUA 1ZZNA 2XTJP 1TL7B 4JI2F 2CZ9A 5KT7A 2JSXA 3MM7A 3TVYA 1XR5A 3BO4A 3BDPA 5I3UA 4USUA 3WIUA 2M5YA 4UTGA 4GKJJ 4DQRA 2EWHA 3EMTA 3PIOQ 4K4XA 2PO4A 3AHPA 1Z2ZA 1UW9A 3LANA 4QZVB 3ULHA 3CF5Q 1N5YB 4MAKA 1DQ8A 3R2CJ 3BGUA 3M8ZA 4U96A 3K59A 5GAGI 4NX9A 2HVDA 1W2BR 1VC6A 4FF2A 3N6MA 1RTJA 2IAJB 4AE5A 3S1TA 4G3IA 2V4JB 3SQOP 3PYEA 2ZVIA 2GIQA 3DDKA 2LCWA 3DU5A 3TA2A 3VGVA 2AD9A 1SJFA 3CDEA 2LXFA 2CPYA 2DCUB 3OT9A 2R7SA 1QUPA 1ZAXA 1XMQJ 2RF2B 3OSPA 2OFHX 2GS8A 2AEFA 4PG4A 4DR5F 1B3TA 2WHOA 4A47A 1M1HA 4DS5A 2Z0GA 2CXEA 2ZH8A 1D9AA 3SV4A 1S9GA 2D7SA 2FGOA 4NXMJ 1IKYA 3E2EA 3IWXA 3I5BA 4LFBJ 1WUUA 4F26A 1H0HB 4C8NA 3WX8A 4MH8A 1GMVA 4RNHA 3IBFB 2JX2A 3U1MA 2HS0A 2HK2A 3CD5A 4IG0A 2V2QA 4ID5A 1NLKL 3MPDA 3UCUP 2WVEA 2DXEA 1GEHA 2CWXA 5FDLB 3OL7A 1JLBB 4ZCIA 1D9FA 1CJTA 2DIVA 3C14B 5J1EA 4JV0A 5HMXA 5K8PA 4JI1J 3HHEA 5LJ3Y 4OHXA 1PCAA 2OEJA 2P9EA 5KFYA 1FESA 2BJ1A 2CQ4A 1M5KC 2R7QA 3G96A 1CULA 1PJ5A 3BH7B 1JJHA 4X4TA 3M6WA 1IBCB 2HSEB 1PYTA 2ZKUA 2XULA 4KGKA 2IHR1 1RBAA 4O3RA 4C4WA 1YHQS 1HBUB 1ELOA 4JI0F 4NZ0A 2K3IA 2E1AA 4LSZB 4N47A 1R0AA 4UOFA 5DLFA 3M9OB 2GHVC 3PIPQ 1S6PA 3SMZA 4WP3A 1RYSA 1T02A 3GWCA 1WEZA 4CZCA 3MM9A 5J2NB 2HBZB 3RBEA 1IBLJ 2E1RA 4R25A 2B43A 3NP5A 4NLVA 4DDFA 1KTVA 2LXUA 3R6GB 3G6YA 4DL5A 2CNLB 3R5BA 2YWGA 1LW2A 3TAPA 3DM2B 1BE4A 4OX9J 4A4JA 4C98A 2PI4A 3H40A 2EC0A 2JLGA 1IBMJ 2HYIB 1MROB 5ETLA 1NO8A 2J6SA 2FHKA 3UD5A 2FIUA 3GIJA 4UZBA 1YVFA 3GFYA 4RWWA 1Y5IB 2AJ1A 3CXCR 3NNHA 4C3LA 3NS6A 3VGTA 4X4SA 3MPUB 1U0SA 3ZNUA 1VQ6S 1BLUA 3LP2A 4FYWB 2F65A 3A1YG 5ETTA 2HHTA 5KFTA 2R7RA 2HW3A 1IKXB 4ZCLA 1SKSA 2PDAA 4EBCA 2C2ZB 5CQGA 3MM8A 3V4MA 4FF3A 2QSFA 3G4SS 5D8HB 3HVTB 3FC9A 3OTDA 4J91A 5IT9Y 4JI0J 2HVEA 2W7PA 4M5IA 1YRUA 3D6MB 2BE9B 3UNGC 5A8RB 2QFJA 2PFFB 1NZ8A 4ZS6A 1FRIA 2ZE2B 3W60A 2W25A 3S6EA 1KNZA 5GAEI 4RL1A 2DH8A 4QWBA 2LXIA 2QLFB 3TQ1A 3QO9B 5EWEA 3DXBA 4IFVB 2MPUA 2VUGA 2C28A 1R31A 5U47A 2GCFA 4KGXB 4OYXA 1Q95G 2MZTA 2W1BA 3IG1A 3CJQA 4LFAJ 1SH0A 1B0TA 2IA0A 3CCUS 4FYDA 2MKSA 1VR6A 1MN9A 3M32A 1MNEA 2CVEA 2ZBIA 2OJ3A 1YJVA 3CEDA 1FE4A 4Y6IA 3PW0A 1VOMA 1N33F 5KG0A 4XTTA 5J2QA 3HJVA 3DOMA 2V8GA 1SL1A 5HJYA 5L46A 1SJ4P 2QFIA 3BBCA 4P52A 1LNQA 3U1NA 4LF9J 2J0WA 3MEDB 3EDRB 1CC8A 2CPDA 3OVSA 1S48A 1AUDA 5B08A 4YOEA 2N7YA 1H98A 1X4AA 3MI7X 2C2NA 3VAHA 4K2XA 4DF8A 1SQFA 3DRSA 1DQAA 4PWDA 1W25A 2C2KB 3CSKA 3P5TL 3IC1A 4M5DB 4TXSA 1S4EA 4NLQA 4ED3A 2VFSA 5C5JA 1GMWA 3BGFA 3IRWP 1N6QB 4LF8F 1UVNA 2IC3A 3T1YF 1NAQA 1BQMB 3PYGA 1WHXA 3R6LB 2V94A 3KDOA 3R1LA 2O67A 2HZAA 1P1LA 1WD6A 4KO0B 2J8SA 5K8NA 1NSKL 3WZ0A 4AL6A 2J7UA 4M5GA 4CYUA 4WFZA 3TP2A 1LFPA 2AJ2A 4CM0A 1SJRA 2HMIB 3CULA 2ZZMA 5L8RC 4MK8A 2UUTA 2HZCA 2RS8A 3UW1A 4HH1A 2ZH7A 3THVA 1XC9A 1R8HA 3PHEA 2LEPA 4B9TA 1OQ3A 3I0RA 2CUYA 1VLOA 1Q8IA 1H7XA 2CQBA 3AOAA 1EJ7L 3BF4A 3DYAB 4AD6A 2DRDA 1HWLA 2XMJA 3A8IA 3KLIA 5D15A 1RT1A 1N5VA 1V3SA 3OR1B 3TJAA 2KM8B 4YP3A 3QT5A 3T9NA 1U49A 2CFXA 1QAJA 2W7AA 3PM9A 1NRKA 3RG6A 3Q8YA 3Q0AA 1CBKA 2KVIA 2DITA 4K59A 5K8MA 3PVXA 3CMAS 1X4HA 3TZZA 4QWDA 3AXMA 2PN6A 5EWFA 3WQPA 1P1TA 4ED6A 3KUGA 3BR8A 2KFNA 3OR2A 2GV1A 2F4VJ 2J5AA 2FVCA 1FXLA 2HS4A 4ECTA 1U6FA 4EWTA 4B3OA 3KFWX 1S6QB 3N6LA 2C2MB 4OZ3A 5KG5A 1NJWA 2FJWA 4W92B 4Q2LA 3DMJA 3MEEA 4DPWA 4H4KA 1R6VA 1VQ9S 3KUHA 4Y2IA 2VKZG 2XS7A 2OTLS 3CJKB 2DY1A 2VF3A 4ZJOA 2LQ8A 1HMVB 1CG2A 3B78A 3LOUA 1TL1A 4M5JA 2ILYA 3PW5A 2XS2A 2XSFA 1RAGB 4TLRA 3KG4A 5D4NA 2OFGX 1K0TA 4CYUB 1GQEA 1WC3A 3PDNA 2PMZD 3CDWA 3M9MB 2BE2A 2UP1A 1YJRA 3E8OA 2ZC3A 4L75A 3NMAA 2OEKA 4Q5VA 2D3ZA 2H54B 3GTYX 5GAHI 3BSOA 2P5VA 1KDNA 1M0SA 3SQGB 5KFRA 3OTBA 4TKTA 2HHXA 3CGIA 3CJTA 1UWAA 1YJUA 3PYFA 4A8OA 3DLHA 1QJHA 4ECUA 2M8DB 3D7SB 4BDPA 4QYZJ 3H25A 3X1LB 2AZ1A 1LK7A 3M2UA 1IUJA 1RKJA 1N36F 3QQCD 5ETRA 4WFBQ 4BLGA 2I0XA 2G1DA 1BWVA 2A0FB 2AHOB 1FT8A 1RABB 1FO1A 2NUHA 4FKYA 5F0WA 4EU0A 2D41A 2E1PA 2XB2D 2KFYA 2OIHA 3N28A 3I0SB 1NJXA 1N56A 3RW6A 4F02A 4Q8EA 3FZ2A 3HT0A 1NUEA 1QY7A 4HDGA 2OO4A 4ZA1A 3KHLA 4CLTA 4NCGB 3IRXA 1TKTB 5J1NA 2DNRA 4X64J 3VGUA 2RDJA 5KT3A 2P9CA 5HVGA 3FKBA 2Y8YA 1C1BA 3QRQA 2X3DA 3ET6A 1OIAA 2WZ1A 1Y5NB 2HAFA 4ZLPA 4AQYF 5IM0A 2RU3A 2UUWA 3ZTRA 3CJ4A 2F5GA 2RT3A 4L6V3 2KHCA 4ZITA 1H73A 4C8OA
chains in the Genus database with same CATH topology
4USUA 4OZ2A 3MAAA 1CS4A 4CLYA 4CLKA 1CS4B 4OYPA 1WC0A 1YBUA 1FX2A 4USVA 3R5GA 1WC1A 5D0EA 4CLWA 4CM0A 4OYBA 1WC5A 4CLPA 4CLZA 1CJVB 2BW7A 5D15A 4P2XA 2GVDB 1CJTA 3C14B 1CJVA 1YBTA 1CJTB 3C14A 4NI2B 4OYOA 4WP8A 1CULA 3MAAB 3UVJA 3MR7A 4NI2A 1CULB 1Y11A 1CJUA 3UVJB 1WC4A 4OYMA 4CLUA 5D0RA 1U0HA 4P2FA 4OZ3A 4WP3A 5D0HA 1CJKB 1TL7A 3C16B 1U0HB 4CLLA 4WPAA 3C16A 4OYAA 4OYIA 4CM2A 2GVZA 4OYWA 5IV4A 2GVZB 4USTA 1WC6A 1WC3A 4CLFA 1Y10A 2W01A 3G82A 1FX4A 3G82B 4P2MA 4CLSA 3C15A 2GVDA 2QV6A 1YK9A 5D0GA 3C15B 5IV3A 4OYZA 1AZSA 4CLTA 1CJUB 4USWA 3ET6B 1AZSB 4WP9A 3ET6A 2WZ1A 1CJKA 4OYXA 1TL7B 1AB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USU A;  4OZ2 A;  3MAA A;  1CS4 A;  4CLY A;  4CLK A;  1CS4 B;  4OYP A;  1WC0 A;  1YBU A;  1FX2 A;  4USV A;  3R5G A;  1WC1 A;  5D0E A;  4CLW A;  4CM0 A;  4OYB A;  1WC5 A;  4CLP A;  4CLZ A;  1CJV B;  2BW7 A;  5D15 A;  4P2X A;  2GVD B;  1CJT A;  3C14 B;  1CJV A;  1YBT A;  1CJT B;  3C14 A;  4NI2 B;  4OYO A;  4WP8 A;  1CUL A;  3MAA B;  3UVJ A;  3MR7 A;  4NI2 A;  1CUL B;  1Y11 A;  1CJU A;  3UVJ B;  1WC4 A;  4OYM A;  4CLU A;  5D0R A;  1U0H A;  4P2F A;  4OZ3 A;  4WP3 A;  5D0H A;  1CJK B;  1TL7 A;  3C16 B;  1U0H B;  4CLL A;  4WPA A;  3C16 A;  4OYA A;  4OYI A;  4CM2 A;  2GVZ A;  4OYW A;  5IV4 A;  2GVZ B;  4UST A;  1WC6 A;  1WC3 A;  4CLF A;  1Y10 A;  2W01 A;  3G82 A;  1FX4 A;  3G82 B;  4P2M A;  4CLS A;  3C15 A;  2GVD A;  2QV6 A;  1YK9 A;  5D0G A;  3C15 B;  5IV3 A;  4OYZ A;  1AZS A;  4CLT A;  1CJU B;  4USW A;  3ET6 B;  1AZS B;  4WP9 A;  3ET6 A;  2WZ1 A;  1CJK A;  4OYX A;  1TL7 B;  1AB8 A; 
#chains in the Genus database with same CATH topology
 3G8S A;  5A8K B;  3MF5 A;  4LF1 A;  5IOL A;  4ZN1 A;  2HRY A;  4U9R A;  4OL8 A;  2GFF A;  2DHG A;  4UUW A;  4ZP6 A;  1S76 D;  4Q44 A;  1T9T A;  1VQS A;  3PHT A;  3OV7 A;  2E5L J;  2R7T A;  1FRK A;  2QA4 G;  3J7Z 5;  1U26 A;  4LBP A;  4PEO A;  3GIK A;  5EX0 A;  1T95 A;  2B4V A;  2ZBC A;  3AOC A;  3T19 A;  4UQG A;  3SYZ A;  1ZTW A;  2IJR A;  3GV5 B;  1MLA A;  3MUM P;  3EX7 B;  3QRP A;  1RHJ B;  1VHI A;  5JXS A;  3TRG A;  1ZM9 A;  4IR9 A;  3HSD A;  3PEH A;  4O44 A;  3UQS A;  3TZY A;  4DV0 F;  4MYT A;  3BO3 A;  2KKH A;  1QSS A;  2MB0 B;  1RDR A;  2BKP A;  5C25 A;  4CO4 A;  2V68 A;  3P3D A;  2PSZ A;  5MAO A;  2JDJ A;  3M8W A;  2H4Y B;  4P75 A;  4X4R A;  4DL4 A;  3VTI A;  2CIM A;  2E9T A;  5KG2 A;  3U27 A;  3MXH P;  4OYB A;  5A0Y A;  2DR7 A;  2XZD B;  4LVN P;  2VQF F;  3H42 A;  2FHO B;  1TK5 A;  2BOP A;  3M9N B;  3HHK A;  5F41 A;  3ZTO A;  2QA1 A;  3QYY A;  1DAR A;  1XMO J;  2UXC F;  1B64 A;  2KTQ A;  4FKX A;  1DLO B;  1M5S A;  2FPH X;  1KLM A;  2JC1 A;  4HL9 A;  3VF0 B;  3L7U A;  3T6B A;  3ZFV A;  4C48 A;  5HBM B;  2I5J A;  2RB7 A;  5AJ3 F;  4ZLL A;  2NPI A;  2B3T B;  1YBT A;  1EP4 B;  3IWL A;  2ILZ A;  4QW8 A;  1FD2 A;  1J5O B;  2BBE A;  1GXU A;  3HHL B;  1Y3K A;  3NBP B;  1F9E B;  2QTW A;  2XZT B;  4IFY A;  4L3N A;  4NI2 B;  3M6U A;  1OWX A;  2OUG A;  3BSC A;  2R7U A;  3HVT A;  1N5Y A;  2XWY A;  1S1X B;  3AOD A;  1F1B B;  3HDS A;  4LFB F;  4KGZ B;  3QZ7 A;  3BJY A;  1GX6 A;  1DY3 A;  2F7V A;  3ZO7 A;  2EK6 A;  3H0P A;  4NYP A;  4M1K A;  2OPP B;  1IKW B;  3HLU A;  4OYM A;  2W24 A;  4NEY A;  2FZG B;  2V4J A;  2VPZ B;  5D0R A;  4PR6 A;  3EPI A;  2HGL A;  3LPY A;  3BZQ A;  1RB0 A;  4PQA A;  2DHA A;  3CB4 A;  3M2R A;  1NME B;  2OH2 A;  4EZ9 A;  3FBE A;  2D3U A;  3PFO A;  3PW4 A;  2R8J A;  3ZNJ 1;  4O44 B;  1S4F A;  2YWH A;  3DOL B;  4CM2 A;  5KFK A;  3QPI A;  3E51 A;  2V9K A;  1RTH B;  3DOL A;  1L3U A;  2ZWP A;  3R8Y A;  2V2Z A;  3JTP A;  4CT9 A;  1MMD A;  4ED5 A;  3M8Q B;  5ETN A;  1U47 A;  2Q66 A;  3KK2 A;  4M94 A;  2QL5 B;  2NXC A;  3CME S;  4X4Q A;  2Z2M A;  1IKV B;  1RT4 A;  4RW7 B;  2DGV A;  5E3A A;  1WDD A;  4LSL A;  4LRF A;  4NLY A;  4R0J A;  5AE3 A;  4J9R A;  4AL7 A;  4DV2 J;  3FEX B;  2YTC A;  1X9W A;  3C46 A;  4K50 A;  5G0R A;  4FS1 A;  2HNZ B;  4Q2M A;  1J5O A;  4NYZ A;  2G1H A;  2H5J B;  1JLQ B;  3FMB A;  2V67 A;  4NLO A;  2HMI A;  5BR8 J;  3EGV A;  5GAH U;  2MXY A;  4O0I A;  2VBZ A;  4BC7 A;  2MKH A;  1SKW A;  9RUB A;  2HIY A;  2GW8 A;  2IM0 A;  3MM5 A;  1AZS B;  1KOH A;  3EXC X;  5IQQ A;  5L39 A;  1A6L A;  1RAH B;  3IS9 A;  1WSR A;  1EKR A;  4WP9 A;  3MEG B;  2MQO A;  5HSP A;  2EG1 A;  1XMQ F;  2UU9 F;  2M2B A;  1QVG R;  4ILM A;  1RA6 A;  2HND B;  4ZVO B;  4IQM A;  4YFU A;  2LKZ A;  3J81 Y;  1VBX A;  4K5S A;  1XWL A;  2WSF C;  3DCA A;  3L95 X;  4F2R A;  4ZPV R;  3CTR A;  2K1R B;  3RTV A;  3PV8 A;  2JH3 A;  1N32 F;  4QR2 A;  2D9O A;  3IG1 B;  3O8W A;  1H74 A;  1DJ0 A;  2OHD A;  2R7O A;  3HSG A;  2CQH A;  2K1R A;  4OX7 A;  3U02 A;  2XO6 A;  3I96 A;  3NGD A;  3SI8 A;  2ACM A;  4QPT A;  2E5H A;  5IZH A;  4KB7 A;  2Z2Z A;  2MQQ A;  4CH0 S;  1BQN B;  2ZD1 A;  4WE1 B;  4KRW A;  4LRC A;  4WKY A;  4F0H A;  3W7B A;  1FDN A;  1IXK A;  2KXN B;  2ZUA A;  2YQ1 A;  4WWS A;  3UN5 A;  1FWP A;  1MML A;  2IRY A;  2F9J A;  4DPY A;  4ZPT R;  3VWS A;  3L4B C;  1SPB P;  3MD3 A;  1HMV A;  4IG3 A;  2B8Q A;  4MIW A;  3T1H F;  4B3M J;  4JV2 A;  2WW4 A;  1R0B G;  1PYS B;  1RT3 B;  2M7S A;  2B9Y A;  4I6A A;  2N7C A;  2V4R A;  4X4V A;  2KZZ A;  3IM9 A;  3M8P B;  2W2Q P;  4PWW A;  2B4P A;  2RDD A;  2DGW A;  2OMO A;  4RPF A;  4F67 A;  1T03 B;  3BQ0 A;  2KL8 A;  4DV4 J;  2YNF A;  4ZN3 A;  4EYH B;  1CJV B;  4X66 F;  4DV3 F;  1NHK L;  4M63 A;  4TU9 A;  1WG5 A;  3V4I B;  2R7V A;  3N79 A;  1CJV A;  2HND A;  2LQ9 A;  4FS2 A;  5HMW A;  2BQ3 A;  2FY1 A;  5FLX Y;  4JI5 J;  6FDR A;  1M1G A;  1G7C B;  2BX6 A;  2VDI A;  3ETO A;  4FVC A;  3MR5 A;  5J2M A;  2XYP B;  4LR7 A;  3LWL A;  1REV A;  1U25 A;  5DGA A;  3VZH A;  4DLG A;  1VRT A;  2CNO B;  3K5P A;  3R5C A;  4KY3 A;  3HZE A;  1NCL A;  2RSQ A;  2W9B A;  3QT6 A;  1X4D A;  1C4A A;  2CPH A;  2HGM A;  4N8N A;  4E8U A;  2ZDO A;  4U7U D;  4N41 A;  1I6J A;  1YX2 A;  4YN3 B;  3M1V B;  2XM3 A;  4GC7 A;  2C2O B;  3ZZZ A;  1U45 A;  3TR5 A;  1UWB A;  1ZA1 B;  3Q2S C;  1ZH5 A;  2EK1 A;  2DR8 A;  2BKO A;  4R8U B;  4M95 A;  2MZR A;  2IDE A;  3VQT A;  3TNV A;  2R9L A;  3M6X A;  5ETO A;  2HEK A;  4K4V A;  2W9A A;  2QG9 B;  1NND A;  4S0M A;  4ZCK A;  2L9W A;  2DK2 A;  5I3P A;  1HQ2 A;  1WKJ A;  2RRB A;  5KFG A;  3OL9 A;  1X8D A;  5CCL A;  2CDQ A;  4K8R A;  1NK6 A;  3FVY A;  2DNM A;  3MCM A;  4WCE Q;  4TYA A;  1T03 A;  3CJ8 A;  3HD1 A;  2YVS A;  4HTI A;  5HP1 A;  1VI7 A;  3QAT A;  2J0Q D;  4ITS A;  5HRO A;  2BR0 A;  1MMN A;  2VKR A;  2HFZ A;  5KG4 A;  1WI8 A;  3PKY A;  3MUR P;  4QYR A;  2C42 A;  5DGB A;  1HPZ A;  3BGR B;  2ZH3 A;  3RBX A;  3QFW A;  1SH3 A;  1XBW A;  2BMB A;  3JAM Y;  4C97 A;  4FF1 A;  1WG4 A;  2DKO B;  2DPI A;  2DH7 A;  2FVR A;  3HFK A;  2Q3P A;  2CJQ A;  3ZZT A;  1S9G B;  3BV8 A;  1IWA A;  4O0N A;  4P6Q A;  3IGN A;  5D78 A;  3TZX A;  2IRU A;  4NMX A;  4XPC A;  5I42 A;  2PD1 A;  4I69 A;  4WTY A;  1PC4 A;  1TL4 A;  5HMZ A;  3D1Q A;  3FSI A;  1T8E A;  4OI3 A;  2ZHO A;  2NS1 B;  4O4R A;  4OZJ A;  5F9N A;  1RAO A;  2XHW A;  4YUD A;  3QT7 A;  3ET6 B;  4URG A;  3RZA A;  1HW8 A;  1X4B A;  1OPZ A;  4X4U A;  1AFI A;  1HHT P;  2JEG A;  3K5M A;  5L1L A;  1ZA2 B;  2HAI A;  2VA2 A;  1UVM A;  1S0V A;  2JEJ A;  2MKI A;  4KPC A;  4CO5 A;  2XMK A;  1SUQ A;  3MMC A;  2DNG A;  4FBU A;  2FQQ B;  5IQ6 A;  3HHL A;  4IFY B;  5A8K A;  5K5M A;  1NBE B;  3SEO A;  3ILI A;  3HFV A;  3UR0 A;  1Q7L B;  2ALZ A;  1CEZ A;  2M52 A;  3M2V A;  3NGR A;  2ZKT A;  4NE9 C;  4QWE A;  4CO3 A;  4UY8 T;  2W2P P;  2HLT A;  1RU2 A;  4I1T A;  5E3P A;  1H2V Z;  3M2V B;  1FF2 A;  4DR4 F;  1RT7 A;  1KEK A;  3FZB A;  2V8P A;  5HMY A;  3V6D B;  2KH9 A;  1N88 A;  4ELV A;  3OXG A;  1HQU B;  2IDL A;  3R7N B;  2XMT A;  3O6Q A;  4GVL A;  1GAO A;  4TY8 B;  3EVM A;  4RU9 A;  4OYP A;  2QYG A;  2IY5 B;  2YKA A;  3LAM A;  2ZH5 A;  2NZ4 A;  4ES1 A;  3NGK A;  2WON B;  4H4K C;  4PRF A;  3D0G E;  1N48 A;  2B0G A;  6FD1 A;  2XLJ A;  3L09 A;  3ZZU A;  3FEZ A;  4EBD A;  3IFE A;  3UD4 P;  1S1U B;  1FX2 A;  2OPS B;  1TVR B;  2KHD A;  1YRT A;  5SUH A;  1J27 A;  2E5G A;  2BAN B;  4CLW A;  4IDK A;  1ZTT A;  1T9V A;  3B6B A;  3H5Y A;  5EX3 A;  2F8E X;  2P2C B;  4LJM A;  4CQ1 A;  5BJR A;  1L3S A;  2UVV A;  2MSS A;  2QC3 A;  3DNC A;  1KQS R;  2XO7 A;  2FVP A;  1IKV A;  2I5J B;  1WI6 A;  1C1B B;  3LP2 B;  1FVQ A;  1R27 B;  4YDX A;  3HT3 A;  1M1K T;  4Y0F A;  3DLG A;  4DR4 J;  3W8G A;  4KHP J;  2AZ3 A;  4KR0 B;  4OI2 A;  4OYO A;  8RUC A;  3M8R A;  2HNY A;  3H2L A;  1NSP A;  3R97 A;  1HBN B;  4A8X A;  4DSK A;  3MMA A;  2OPR B;  4Y28 C;  3UVJ A;  1G1X A;  3DLE B;  3AAW B;  3O5T B;  2X7I A;  5E3C A;  4RWX A;  4UZC A;  1R0A B;  2FY8 A;  4GO5 X;  3SCL E;  1MSW D;  2AYM A;  4URS A;  2A2C A;  2Z4P A;  1XN9 A;  2IVY A;  4RBU A;  3JAM U;  4PG5 A;  4IOA Q;  3M2R B;  1EQ0 A;  1JJ4 A;  2F4V F;  1QTN B;  5A76 A;  3FJ2 A;  3ITH B;  1IKW A;  2ZM6 F;  1JXV A;  4DV3 J;  1YZ6 A;  3I55 S;  3CCM S;  4O3P A;  2JEF A;  1FFG B;  3FUY A;  4LIW A;  2R42 A;  1JLF B;  4RO0 A;  2DO4 A;  5CYQ A;  4CNY A;  1D1U A;  3RR7 A;  3W61 A;  2NPF A;  2HHH F;  2GVZ A;  4WK3 A;  2AJQ A;  4TQR A;  2ABY A;  5DO2 A;  2WW8 A;  5KFA A;  4EI2 A;  3QJP A;  4CLF A;  1LOU A;  1QVF R;  2W01 A;  3J7Z T;  1K44 A;  5A0Y B;  3T5J A;  4Q8F A;  2GHP A;  2G0I A;  2RAQ A;  4GMK A;  4F36 A;  2ZJP Q;  4B9N A;  1RK8 A;  3KK1 A;  2J0S D;  1Q5Y A;  1NSQ A;  3QIP B;  1FKO A;  2YX4 A;  1DTQ A;  2O01 C;  3MEC B;  2JLE A;  4LSL B;  3J81 j;  2MGZ A;  3HSZ A;  4CI0 B;  2UUB J;  3DOK B;  4I67 A;  1OSC A;  2P8I A;  2ZBR A;  1YI2 S;  1DFD A;  3CCW A;  3CMQ A;  4WK1 A;  4DUZ F;  2ROE A;  1W7W A;  2ZHB A;  3M8P A;  2ERR A;  2CPZ A;  3F0N A;  4JB8 B;  2MQL A;  3GON A;  1XJW B;  4F0M A;  1UVK A;  3EWG A;  2FHM A;  3FDS A;  4IFV A;  5C42 B;  4ZPB A;  4O3N A;  3MFI A;  4J5O A;  3AQO A;  2C2E A;  3UO0 A;  1LXJ A;  1RT6 B;  2GHW A;  3OR1 A;  5G4D A;  4K7Q A;  4ECS A;  3AH6 A;  3MDF A;  2ROP A;  4NLX A;  2XLK A;  2IYI A;  3H59 A;  3G6E S;  5K9F A;  2VA3 A;  3DOM B;  1VJQ A;  3H90 A;  1AB8 A;  3GJR B;  2D3O 1;  2HHQ A;  5F8M A;  2RHS B;  3DDI A;  1JKH B;  4C6A A;  5LSR A;  2DRA A;  2WOM A;  1C0U A;  4AYB D;  3Q83 A;  4ZVG A;  5KFD A;  4RUC A;  2VG6 A;  3JSM A;  4F4W A;  2XCA A;  2I8E A;  1CS4 A;  1EHW A;  1NDK A;  2DGU A;  2IRX A;  3LP1 A;  4X65 J;  1K9M T;  3JSM B;  2H48 B;  4OJ1 A;  3RB4 A;  1VIO A;  3KK2 B;  1UFW A;  1RYR A;  3L9Z A;  1YIT S;  1OQ6 A;  4Z37 A;  2LP4 A;  3D54 A;  3J80 U;  1JK9 B;  2QLX A;  2XSJ B;  3OPK A;  2Q6C A;  4J9V A;  4K4Y A;  1QAI A;  3MUV P;  4FN5 A;  4TU7 A;  4A8Y A;  2DNQ A;  4LF2 A;  2HWT A;  2OSR A;  1IKX A;  1S5Z A;  1UCN A;  4DSE A;  1YBU A;  4DG1 A;  1JLG B;  3W2V A;  3IM8 A;  2GIR A;  2KYZ A;  4AND A;  2YKO A;  2EKY A;  3UNY A;  2BJE A;  3W2V B;  2C3O A;  2CYY A;  2DJW A;  3SDE B;  1TUV A;  1LKZ A;  2QE5 A;  2RRA A;  4CLP A;  1VRU B;  2RDI A;  1YZ7 A;  4Q0B B;  3CW2 C;  4WKR A;  3PJ9 A;  3IS9 B;  3G6V A;  5AE1 A;  1DQ9 A;  5KT2 A;  3A8E A;  3KTQ A;  3GFX A;  3WC2 A;  4JV5 J;  2V9W A;  2UXB F;  1U1O A;  3DRP B;  2PT0 A;  1SC4 B;  1Q4R A;  2CPJ A;  4U95 A;  2XLI A;  3RB3 A;  2FC8 A;  3T5L A;  3FCH A;  5ETK A;  3RRG A;  2CJA A;  3C6U A;  4D3G A;  2OP5 A;  4YB6 A;  1JKH A;  4DQS A;  1FJC A;  3GMG A;  3H98 A;  2CNN B;  1S6O A;  4KAI A;  3PX4 A;  4RLE A;  2YXL A;  2WOM B;  3FK4 A;  5KAK A;  1CJU A;  4F50 A;  2HFN A;  4XO0 A;  2MY8 A;  2W9B B;  4NXM F;  4NLW A;  1WC4 A;  4USM A;  4ED1 A;  4WYW A;  4CH7 A;  2VOD A;  4P2F A;  3T5K A;  4QOT A;  1CJK B;  4RNO A;  3BSN A;  1XNQ F;  4PWD B;  2Y1L B;  3KG1 A;  1HNI B;  5ETS A;  3I32 A;  3WIV A;  4MJK A;  1T05 A;  4K0K J;  3D1H A;  2BJ8 A;  3UN2 A;  4MKB A;  2JLF A;  1FKA F;  2QLB B;  3DGP B;  1W2I A;  2C2D A;  2QL9 B;  4K4U A;  5KG7 A;  2QSW A;  3PO4 A;  3OVA A;  1E6Y A;  2AJ4 A;  5HQ8 A;  2DGT A;  2VC1 A;  1U1Q A;  5KTQ A;  2MZS A;  2U2F A;  2VU5 A;  5DLG A;  4KYZ A;  2WBR A;  4DCO B;  4F0K A;  5CCM A;  1CC7 A;  2CJX B;  4ETZ A;  3IN5 A;  4DWI A;  3C3L A;  5HRO B;  2HFV A;  1FX4 A;  4HHJ A;  1Q8K A;  5GME A;  2AEJ A;  4ED8 A;  1R8B A;  3NCR A;  3QNW B;  1S79 A;  1KVJ A;  2GO8 A;  2DR5 A;  2DNH A;  4EUV A;  1UFK A;  1UET A;  2MQP A;  1IJF B;  2E7W A;  2HVZ A;  1X5P A;  4I7F B;  2Q6B A;  2QV6 A;  4NA1 A;  4CLS A;  2Q1L A;  2NXJ A;  3MAH A;  1RGV A;  4ZHR A;  5F8L A;  5D0G A;  1T11 A;  2BJD A;  2ADB A;  4JYA F;  3CE8 A;  3C15 B;  3G2X A;  3HCX A;  3D0I E;  1M5O C;  4ZHR B;  1S49 A;  2A3J A;  3HMJ G;  4QIE A;  1U2C A;  3KNG A;  2KT2 A;  3PRV A;  3KJF B;  1RTD A;  1SB6 A;  1U8S A;  4FNH A;  4JI4 J;  1MW7 A;  1PIE A;  5KOX A;  3L7P A;  2O1P A;  3QJJ A;  1CJU B;  3T1A A;  2R8H A;  2YWK A;  3OBI A;  2LEC A;  2EW9 A;  4PPZ A;  1F9H A;  5CD4 A;  1TKT A;  3KLF B;  3T5H A;  2XY6 A;  3VAJ A;  2B4U A;  2DNZ A;  2P9G A;  2VD3 A;  3K89 A;  1X9S A;  4DFJ A;  2B5J B;  3D9B A;  5MLC V;  1TKX B;  2ASJ A;  2MYF A;  2B5J A;  3I9Z A;  4YB1 P;  4B3R J;  3MM6 A;  1HYS B;  3AB2 B;  2QN6 B;  1SXL A;  1FRJ A;  1UEU A;  3G9C A;  3SZ2 A;  5J1P A;  4FP9 A;  1FI4 A;  2VPX B;  1RT5 A;  2AV5 A;  4LRA A;  3PZP A;  4L72 B;  2OPP A;  4E98 A;  1RAE B;  1ZBT A;  2JNJ A;  1SQG A;  5JJB A;  1U2R A;  1N36 J;  4DFK A;  2XMU A;  3JQJ A;  4FBT A;  4M5K A;  5CH7 B;  2YWW A;  5B0E A;  3DU6 A;  3VVU A;  3F73 A;  4KTQ A;  3G86 A;  3K58 A;  1E6V B;  1JIH A;  1WF0 A;  4NLR A;  3TWZ A;  5BR8 F;  4DR1 F;  1G6B A;  4OIX A;  4OJG A;  3QLH A;  3UDL A;  1S9F A;  2NZC A;  1Q5V A;  1R8C A;  3QBC A;  4G1Q B;  1H2T Z;  2G9O A;  5DM6 Q;  1PBU A;  3DDN A;  3R5G A;  3EZU A;  4WFY A;  4ZP9 A;  1N34 F;  1TUW A;  5D0E A;  1Z2L A;  3TUJ C;  2F9D A;  3VR1 A;  2OPS A;  4NPO A;  1WC5 A;  3CJ2 A;  3AOB A;  4NCG A;  4YB5 A;  2BYC A;  1K1S A;  3NRB A;  1TEL A;  1T9Y A;  3ILL A;  5KFP A;  1RT2 B;  8AT1 B;  1HNX J;  3DLG B;  4M5M A;  1X4C A;  2M9K A;  4ID5 B;  4F4X A;  1YBA A;  4ZIV A;  2FLO A;  4J9O A;  3DOK A;  2JFK A;  4GKK F;  4ENO A;  1MN7 A;  3MM7 B;  3SIP B;  3S8S A;  4B3S J;  3A8K A;  1ZPV A;  2GO9 A;  5F9L A;  3AA9 A;  4WP8 A;  1X7V A;  2EFN A;  2QX0 A;  3CCZ A;  3K2Y A;  3NBP A;  3ENA A;  5AXL A;  1VBK A;  4ECY A;  1RIS A;  1V9O A;  2K7J A;  2RJZ A;  2ZDP A;  1FXD A;  2ZUG A;  4NOH A;  4M5L A;  2NSB A;  3MM5 B;  3UVJ B;  4YME A;  2Q43 A;  4CLU A;  2L41 A;  1H6K X;  2R7W A;  4IRK A;  3K5L A;  3CJS A;  2PMW A;  3DKD A;  5J2N A;  4DR2 F;  1R8A A;  2YKQ A;  3ISZ A;  2OI2 A;  3HKW A;  4ID8 A;  3W5Y A;  2FZK B;  4CTA B;  4DV6 J;  4CP5 A;  3MR3 A;  2WBM A;  3D3C J;  4ANC A;  3V81 A;  1NHU A;  2B8P A;  1FWL A;  3ZZY A;  3O3L A;  4N8O A;  5HN0 A;  3TI0 A;  2EKN A;  3CO9 A;  4WFA Q;  3FQK A;  1KVK A;  3OLA A;  3JTO A;  5IV4 A;  5J2P B;  2BE7 D;  4DUZ J;  1OY9 A;  4GRS A;  2EVZ A;  4FXD A;  2VIH A;  1DTT A;  1RU1 A;  3G82 A;  3GFZ A;  1EZZ B;  2APO A;  4RW7 A;  2KJW A;  1Q0N A;  2HFU A;  1CLF A;  1OY8 A;  5KFL A;  2VFU A;  2ZIT A;  3KLE B;  4W4M A;  2H1Y A;  2C1E B;  2FTR A;  2YQ3 A;  4TN2 A;  4B3T J;  3IBC B;  3M6V A;  4HAC B;  5FDL A;  2ZBP A;  2J8A A;  3I5C A;  2YNG A;  4XK8 C;  3W63 A;  4Z2X A;  2VQE F;  1I94 J;  1IBL F;  1T3O A;  3OTC A;  3NS5 A;  1JLQ A;  4HAC A;  4FYY B;  3D6T B;  1I5O B;  3QIP A;  1FKO B;  3QWU A;  3LTO A;  1HBM A;  1YSJ A;  4DV5 F;  3OW2 R;  5KFN A;  3JSR A;  2C3U A;  3MMA B;  5HQL A;  4LRD A;  1UZH A;  3Q8Q B;  3T1H J;  1SQE A;  2L9N A;  2RKI A;  1R89 A;  1IM6 A;  3DLJ A;  4J9N A;  3FFI B;  5KFS A;  3WC0 A;  1ZM2 A;  3QO9 A;  5SZT A;  2H9Z A;  5KT5 A;  1VBY A;  4NCB A;  2KFZ A;  3UCG A;  2HFS A;  3ZTP A;  3GG1 A;  2BM1 A;  2IM2 A;  2PC6 A;  1KON A;  4DU8 A;  4X66 J;  2GJ2 A;  1C4C A;  3LO3 A;  3K5N A;  2UUC F;  3Q2T C;  1T7P A;  2NR0 A;  2XY5 A;  2V63 A;  4DMZ A;  5F8N A;  1S1T B;  2RH3 A;  2D74 B;  4NWB A;  2BW2 A;  3UCZ P;  1IR1 A;  1SH2 A;  4JI6 J;  3MED A;  1P9Y A;  3WBZ A;  3ZC4 A;  4I68 A;  4JI7 F;  5HVF A;  4ATN A;  1S9E B;  1Q8B A;  3O2I A;  3I6P A;  2DVI A;  4DFP A;  4LUB A;  1KN6 A;  2JOQ A;  5B0A A;  3J7A N;  1HR0 F;  3EGZ A;  2CQ1 A;  2N82 B;  4EEY A;  3KLE A;  1AW0 A;  2BXJ A;  3QSI A;  1IM4 A;  2RS2 A;  3M4X A;  1T05 B;  5L9N A;  2CQP A;  2VG7 A;  3GB0 A;  3J7A 1;  3W9H A;  3DGP A;  2ZNZ A;  3T41 A;  1HLW A;  3GCW P;  1N6Q A;  3N5F A;  5DG9 A;  5M2U A;  2K2P A;  2Z2L A;  3E01 A;  5CZX A;  5HVH A;  2VPW B;  2W2M P;  4RKU C;  2JJ4 D;  1URR A;  2LQ5 A;  5B0D A;  4USV A;  2NLW A;  2ZHA A;  2CNK B;  4ELT A;  4DUT A;  1HWI A;  3PX6 A;  4HKQ A;  1C0T A;  3N4W A;  1IR2 A;  2DYA A;  4GVB A;  3V2U C;  4NEZ A;  4U6P A;  1TL5 A;  3DLK B;  4DQQ A;  2PE8 A;  1XNR J;  1N8R T;  4QIW D;  2EXU A;  3TUZ C;  3DRP A;  3I56 S;  2GVD B;  1J5E F;  4LRE A;  2WRM A;  2C2R A;  4PUO B;  3PJW A;  3TJ8 A;  4DFM A;  2GMH A;  4N56 A;  1G3O A;  4C11 A;  1Q1K A;  1UVI A;  1H3D A;  4ZPD A;  3Q23 A;  4B3M F;  3VAF A;  4X2B A;  1TUG B;  2KRB A;  3IBW A;  2G0J A;  3TVZ A;  3H2U B;  1FXR A;  3KG0 A;  4U7U K;  5LJ5 Y;  1GMW D;  2AQ4 A;  1VJW A;  3JTN A;  4F4Y A;  1KFS A;  2BOA A;  4F8R A;  5IS2 A;  2JFD A;  2YKN B;  2P6S A;  1AYE A;  5AXM A;  2RNE A;  1S1V A;  4NL5 A;  2C3Y A;  3OR2 B;  5LOQ A;  1JLC B;  1RP5 A;  3MTK A;  3OXF A;  4YDD B;  1TU0 B;  2L48 A;  1XTZ A;  3L7O A;  3CPW R;  4Z7C A;  1U6B A;  4AL5 A;  2NQP A;  1ZS6 A;  3KMQ A;  3NEK A;  1FRL A;  1RLC L;  3UWT A;  4LBH A;  1N5S A;  1LWX A;  1P27 B;  1WEY A;  1SCJ B;  4OZN A;  1F3F A;  5CYJ A;  3RBZ A;  3BYP A;  1RT3 A;  3TEG A;  4IO1 A;  2FGC A;  3EYZ A;  1LW0 B;  3UDV A;  2VPY B;  1TL3 B;  1ZAV A;  2CKW A;  2YX7 A;  5H9F K;  5KOW A;  4QCL A;  4K0K F;  1J2V A;  2W4D A;  1T94 A;  1UKU A;  1OJ4 A;  2Z57 B;  2ZEJ A;  3EVW A;  2VQE J;  3CDA A;  2VJV A;  2RML A;  2J6U A;  1X5S A;  3VAM A;  3DLB A;  4ECQ A;  3C15 A;  2VJU A;  3V6J A;  2HPU A;  1XQI A;  3SSR A;  1U48 A;  3OJU A;  3HHD A;  3MAQ A;  3W3S A;  4BBY A;  4RX6 A;  3O44 A;  5C24 A;  1B7Y B;  3RRH A;  2UV8 A;  5IWA J;  2CG8 A;  2A1B A;  3NAI A;  3A3P B;  1YJN S;  3DGV A;  2K8G A;  1NK0 A;  1WOO A;  2HVH A;  1KWM A;  3KDN A;  1FNM A;  3PW2 A;  2BRL A;  1HBO A;  1IVZ A;  1M5P C;  2NRE A;  4PKD B;  1KHW A;  3J7Y I;  1LWF A;  1PAE X;  3CNQ P;  3VV2 B;  2L3M A;  4RW9 B;  1WHW A;  2YNH B;  3I5A A;  1JB0 C;  2D1C A;  1TV6 B;  1KHV A;  3BKT A;  3LGM A;  4IH7 A;  5CAB A;  1LWF B;  4XAK A;  2XHC A;  4CCH A;  2B4O A;  2H3E B;  1QE1 A;  3CD0 A;  5DDP C;  4QW9 A;  4O4G A;  7AT1 B;  2AP6 A;  3BBF A;  3F56 A;  5M2R A;  4DBQ A;  3IXQ A;  4LFC J;  1VFJ A;  1FNO A;  3P96 A;  1O6X A;  2VH7 A;  2HNY B;  1S59 A;  3ELH A;  3PJX A;  4WJB A;  2LEB A;  2UXD J;  1Y3J A;  3MAA A;  1GXL A;  3CDB A;  3QGP A;  3VVT A;  4CWB A;  2KG0 A;  1FHT A;  4RR5 A;  4LFA F;  2CJ9 A;  5AT1 B;  4X62 F;  1TKD A;  5AE2 A;  2FB0 A;  3H7H B;  2E1M C;  5D4P A;  3GIL A;  3TAR A;  5IT4 A;  4UOC A;  1X60 A;  2M70 A;  2H5I B;  1ITP A;  4NLU A;  3AXK A;  1VQL S;  3JQM A;  2CJY B;  2CAJ A;  1NH7 A;  1SC1 B;  1Z1Z A;  1XK8 A;  2XMM A;  3JXO A;  2CA9 A;  3K8V A;  4P7T A;  3RW7 A;  4ZMM A;  4YY3 J;  1WAC A;  4K5R A;  4WZQ A;  1JNR B;  3IR7 B;  3BRE A;  3FBB A;  3KJV A;  2E5L F;  3W66 A;  2HVI A;  4DR7 F;  4EK2 A;  2KG1 A;  3EGN A;  4QJV A;  1Y7P A;  1FEE A;  1HIY A;  2DH9 A;  2SXL A;  1S72 S;  1TK0 A;  1F2G A;  1CQN A;  1WC1 A;  1L3K A;  1RCO B;  3RB0 A;  3DXS X;  4IG0 B;  2ZH9 A;  3UDE A;  3R7S B;  3QRR A;  1JMT A;  3AJ1 A;  3BDE A;  5LMU J;  4OHW A;  2XMA A;  4LQ9 A;  3W5Z A;  4UOH A;  2YNH A;  2EG2 A;  4DR1 J;  1JJ2 R;  4OZ1 A;  3BO2 A;  2MDA A;  2C3P A;  2MKK A;  1VQM S;  1QE1 B;  1WOS A;  3FNN A;  3TYT A;  4ES3 A;  4DX8 H;  1FTR A;  4DSF A;  3UD3 P;  1N4L A;  5L38 A;  1JXL A;  1VHF A;  2VFT A;  2VBW A;  3DRX A;  5HBM A;  3RAQ A;  4P2S A;  4E0D A;  2AWZ A;  3LAK A;  1YKW A;  2KO1 A;  2CQ2 A;  2O5D A;  2Y3Y A;  1D8Z A;  2NXE A;  4ZP7 A;  1GK8 A;  4ES2 A;  4TQS A;  3KMS A;  1F3V A;  3SXL A;  4JI8 J;  2EI5 A;  4DCJ B;  1IBK F;  1K1Q A;  4LR9 A;  2IVF B;  1Y9O A;  2BUN A;  2OEM A;  4QIV A;  4DN9 A;  5DET A;  4DCP B;  2W8L A;  2MLY A;  1RTJ B;  4JI2 J;  1S77 D;  4FXV A;  3THT A;  2AYG A;  1HNX F;  3SV3 A;  2ZM6 J;  1OYE A;  3PR5 B;  1YDL A;  2XNQ A;  1NK9 A;  2QO3 A;  3MCN A;  1U0H B;  3QID A;  3SFG A;  2LVW A;  1V3Z A;  2CQ0 A;  1ROF A;  2Q79 A;  3NXZ A;  3R5D A;  4Y2K A;  5DRK A;  1T3N A;  1DRZ A;  1I51 B;  4NXN J;  1AFJ A;  5F8H A;  1PSD A;  5B0G A;  1H38 A;  3NNC A;  3ZZP A;  4U67 Q;  4GC6 A;  4B9V A;  4Q7A A;  3QSY B;  1L5U A;  1Q81 T;  1H2U X;  1VK3 A;  3W5X A;  3BR9 A;  1Y10 A;  1RJJ A;  3C19 A;  3ENV A;  2GGP B;  5HJX A;  1S6U A;  4RU2 A;  4A8S A;  1RA7 A;  2HK3 A;  1QSY A;  2MKJ A;  2WK4 A;  3PFE A;  3PX0 A;  1TAU A;  1YIJ S;  1UFL A;  2DNP A;  3B4M A;  1RZM A;  4KV8 B;  1WNE A;  1IR0 A;  1PKU A;  5E3Q A;  1YTY A;  2PEB A;  1TKZ A;  3KK1 B;  2E5I A;  2DXD A;  1HBM B;  3GP9 A;  4B17 A;  3KJQ B;  1EP4 A;  3NNA A;  1EAR A;  5G0R B;  5THW A;  2XMW A;  2VHG A;  3FCW A;  5KT4 A;  4KQZ A;  2GNK A;  4WXO A;  4QQB A;  1HBN A;  3PEJ A;  3HJF A;  1XR6 A;  5D4O A;  3HZG A;  5D77 A;  5CXT A;  1ZZF A;  4ED7 A;  1KBR A;  1G4C A;  2KJV A;  2H51 B;  3TAM B;  1T9U A;  3ISN D;  4UQT A;  3G71 S;  2G0C A;  4ZCM A;  1NDL A;  1MU2 B;  4LF6 F;  2XY7 A;  4Y00 A;  2WSE C;  1YWX A;  4PAB A;  3T9Z A;  3TO8 A;  5ADZ A;  4J9L A;  1TR0 A;  2GJF A;  3MHY A;  1S1W B;  2O3D A;  3SCI E;  4DV1 J;  1UAW A;  2MY7 A;  1U6Z A;  1B99 A;  2F40 A;  4BC9 A;  2WCX A;  4LF5 F;  1QAX A;  5EDW A;  1GXT A;  2R4F A;  3IA0 A;  1D0E A;  1N33 J;  4TLQ A;  2N4C A;  5DQI A;  1FVS A;  3IR6 B;  2OGU A;  2VB6 A;  4ZVR B;  1UW4 A;  3UR3 C;  3HM9 A;  1RAI B;  3TAQ A;  2UUA F;  2XWX A;  5T14 A;  3KXD A;  3SCK E;  2YPY A;  2MLZ A;  3GFH A;  4M8L A;  2ATC B;  3LP1 B;  5L1J A;  2CJK A;  1VLY A;  3P5B P;  5HAO A;  1MWZ A;  3NMR A;  4RBT A;  2DO0 A;  3LW5 C;  1EET A;  4HHH A;  4UUX A;  3GJS B;  4KSE B;  3HP6 A;  2FJV A;  3SSS A;  4Y34 A;  4J7C A;  1D09 B;  2B7C B;  4K2J A;  2DGS A;  4YR0 A;  2W8K A;  1TFW A;  1TZ0 A;  4PG6 A;  5B09 A;  3PYD A;  2DR9 A;  5JMN A;  4DZD A;  4OJ3 A;  1V5V A;  3DLK A;  4LRB A;  3NGS A;  1VRU A;  3EUN A;  2PEH A;  4YEA A;  2V8D A;  2IBO A;  3POT B;  5A8R A;  5LSL A;  3NKY A;  3AD8 C;  1N5Q A;  2JWN A;  1V6H A;  1JWW A;  1EKS A;  2CPX A;  5EGY A;  1RWW B;  1Y00 A;  3POT A;  2P6T A;  1FRH A;  2XZW A;  1MG7 A;  1R8P A;  2DR6 A;  3FRY A;  3R27 A;  2ZFH A;  3LP0 B;  5K20 B;  2W9C B;  4C0H A;  1D8Y A;  1RQ0 A;  3FBF A;  1URN A;  2NCK L;  3OFH A;  2IM3 A;  2DNN A;  2JVO A;  2ZWO A;  4OI4 A;  4WU2 A;  3QJL A;  3HI9 A;  2V69 A;  2V0N A;  5IM0 B;  4FF4 A;  3IWN C;  4ERD A;  1Q8L A;  2POK A;  1REV B;  1N0V C;  3FEY B;  4NA2 A;  6AT1 B;  4ED0 A;  4DL2 A;  4YS2 A;  3KYL A;  1T9W A;  2K06 A;  3AA8 A;  4LBI A;  3VHQ A;  4ETX A;  5A8W A;  3U1L A;  5L1K A;  4DV6 F;  4ZPA A;  1F6T A;  2H4W B;  4PAA A;  4DL0 C;  4DJB A;  2XNR A;  3IR5 B;  1S97 A;  2DT9 A;  3EJM A;  4FYV B;  4WTO B;  2YKM B;  2CPI A;  3CIM A;  4OZ0 A;  4DN0 A;  3PNI A;  4ZVE A;  2CWK A;  5FJ4 A;  2AU0 A;  1WG1 A;  1FWK A;  2R8G A;  1JLC A;  1WJ9 A;  2MQ8 A;  3RYL A;  3DN9 A;  4PWU A;  7FD1 A;  5A2Q U;  4QYZ K;  4Y65 A;  4DUY F;  1RAA B;  4I0W A;  1OSD A;  1S7H A;  1VQY A;  1RHU B;  4A8Q A;  2F1F A;  4O3O A;  5AXN A;  2UUA J;  3B82 A;  1TL3 A;  2NYH A;  4Z7Y A;  3EE3 A;  1RUS A;  3B4D A;  3K5O A;  1U09 A;  1LK5 A;  1REG X;  2W2O P;  1FD8 A;  3A13 A;  2PA3 A;  3T6J A;  1Q16 B;  1BGX T;  3MOJ B;  3CUN A;  1HNV A;  1VC0 A;  5GMD A;  1KFD A;  1NPP A;  3BSA A;  4N77 A;  3Q8U A;  2ZH2 A;  1DZ5 A;  5I4M A;  1HQU A;  2A10 A;  2MZQ A;  3D6F B;  3TUP A;  3DRY A;  4QIG A;  2PI5 A;  2XGQ A;  5HP1 B;  5KFO A;  3LPE A;  4IOC Q;  1HFE L;  4HHU A;  1KQG B;  4ICL B;  5KG6 A;  5IXU A;  2GVD A;  3V4I A;  1TFY A;  1P8G A;  4C0O C;  1FJ7 A;  5IFM A;  3DLL Q;  4J9S A;  1HPZ B;  3BGR A;  2RE1 A;  1FKP A;  2G2Z A;  2QMU B;  1FDD A;  1UMJ A;  2IMO A;  3HXM A;  1NU4 A;  2MMY A;  1UJ4 A;  2GQQ A;  4ILR A;  2MQM A;  3ETM A;  3B54 A;  2E5J A;  5H9F J;  2PII A;  5IV3 A;  4MIA A;  1UA1 A;  1TV6 A;  4ER8 A;  1I94 F;  4JI4 F;  2YBV A;  2VOP A;  2RU9 A;  4ECZ A;  2YKN A;  1HW9 A;  2MZJ A;  4KHM A;  5CYM B;  1NK7 A;  1TMM A;  2HBR B;  3R5J B;  1ARO P;  1TKX A;  2VC0 A;  3ADA C;  2QMX A;  3OXL A;  4R5P A;  3OUY B;  1D9D A;  2Z56 B;  4HT7 A;  4Q43 A;  3M8Y A;  1CJK A;  4DSI A;  4N5S A;  3IAM 9;  3DRR B;  3LGN A;  1YRX A;  4KKO A;  4L73 A;  5AXK A;  2HWH A;  3VAI A;  4A8K A;  5DG7 A;  2IJN A;  3OUY A;  1O0P A;  1YJW S;  2HHV A;  3DRR A;  3VAK A;  1F0X A;  1B7F A;  4D3H A;  2OKQ A;  2QMW A;  4HI2 A;  4DLE A;  4LQ3 A;  3AY0 A;  1TL1 B;  1IQZ A;  2RQ4 A;  2CG4 A;  3CCL S;  1HYS A;  3G8Q A;  3KJN B;  1WSV A;  4Y3C A;  5HQM A;  2FLL A;  4OI1 A;  1S0O A;  3P6Y C;  3MGJ A;  3CCV S;  1N32 J;  4P7V A;  4YR2 A;  4NLP A;  2HQF A;  1F60 B;  1RAJ A;  1E6V A;  2CVI A;  2X1G A;  3JYT A;  3CCR S;  2E9Z A;  2ZJQ Q;  1SV5 A;  2FJB B;  2CZV C;  4MFB A;  4LF6 J;  3W2W A;  5H1S V;  1LQ9 A;  3KJV B;  1RBL A;  3U7J A;  2DGQ A;  3Q8S B;  3A3N B;  3HK2 A;  5JUM A;  3X3U A;  1XMB A;  4ED4 A;  4PCQ A;  2RQM A;  1DUR A;  1FDA A;  1V3R A;  2HRT A;  1RTH A;  4O3Q A;  1FKP B;  3W8P A;  3GII A;  1HR0 J;  1MRO A;  3PY8 A;  1SC3 B;  1RWK B;  4A48 A;  3TVK A;  3LQV A;  3S01 A;  2GJI A;  4DXL A;  1X31 C;  4B02 A;  2AGO A;  1NJY A;  1IBK J;  3M30 B;  4DV1 F;  1HBO B;  3GV8 B;  3HHN B;  1S57 A;  2VBX A;  4L74 A;  4NYO A;  2VV5 A;  4RZR A;  2ZOM A;  3M7V A;  4USJ C;  1KR4 A;  5I3Q A;  4CLZ A;  2BW7 A;  2Y9H A;  2AX1 A;  3KLF A;  4P2X A;  2OAU A;  5AJ3 J;  4RW8 A;  1GTE A;  2BAB A;  2BVZ A;  2KXH A;  4NML A;  3TOQ A;  1X0F A;  3ISN C;  3W9J A;  1CJT B;  3C14 A;  5J1E B;  2N3L A;  4RW8 B;  3MCO A;  4Y2C A;  2QYC A;  2NUU G;  4DF4 A;  4DR6 F;  4JI3 J;  4EZ6 A;  3BKU A;  3MAA B;  3OVB A;  2QLJ B;  2GQC A;  3CCJ S;  4NI2 A;  4WZM A;  3HKZ D;  1CUL B;  1Y11 A;  1KSP A;  1RI7 A;  3UN3 A;  3NOC A;  3RUB L;  2AEM A;  5C2C A;  1RT5 B;  5GAD I;  2BJ9 A;  4PQU B;  1RT6 A;  5T7L A;  2GAG C;  3FGV A;  3R5A A;  1TK8 A;  2H5E A;  2E1C A;  4IYQ A;  4ZVH A;  1JLF A;  5CYQ B;  3KHH A;  2HHU A;  3EVO A;  4FPI A;  4GO7 X;  2KRR A;  1UJ5 A;  3I4H X;  1LW2 B;  3NCQ A;  1X4E A;  2JL9 A;  4YY3 F;  1VIS A;  3KLV A;  4DQI A;  4WPA A;  3KLG B;  3OJS A;  3MTJ A;  1VQ4 S;  3JSY A;  1NJZ A;  1JX4 A;  3HFZ B;  4OYW A;  3RR8 A;  1GT8 A;  4C2M A;  1S9E A;  4KT0 C;  3NGU A;  4V19 X;  4P74 A;  1S0M A;  3I87 A;  4F3M A;  2R2S A;  1RTI B;  3M05 A;  4I2Q B;  2XBP A;  3VCD A;  4HTJ A;  4WU3 A;  2RQK A;  1HHQ A;  3G82 B;  3BQ2 A;  3C6T B;  2DPJ A;  2DCL A;  2NSC A;  1DLO A;  2XSJ A;  1R43 A;  4LFC F;  1FE0 A;  2IC3 B;  2GX8 A;  5KFB A;  2UUC J;  1NDC A;  3OQ2 A;  4IG3 B;  5LMU F;  3TZW A;  2O66 A;  1C1C B;  2AW0 A;  4KO0 A;  3D68 A;  4M5H A;  4RBV A;  4QR1 A;  2ADC A;  1SJ3 P;  3NWG A;  4H4M A;  1RWV B;  2BM0 A;  1SIW B;  2MGZ B;  3GPA A;  3VAG A;  4ECV A;  5CAA A;  3Q24 A;  1IBM F;  4DL3 A;  2JC0 A;  3VGS A;  1KLN A;  1C0T B;  3PG9 A;  4NLG A;  2Z8Q A;  1ACM B;  5ETP A;  4KHR A;  4X4P A;  3NY0 A;  1C2P A;  4JP8 A;  3ZZ0 A;  3CCS S;  3A12 A;  3Q89 A;  1VBZ A;  2RKI B;  2WSC C;  3AT1 B;  3D3B J;  1R0C B;  5IWA F;  4DS4 A;  1VQ8 S;  4ZVS B;  4ECR A;  5C42 A;  4B3S F;  1X4G A;  2E66 A;  2F63 A;  2MJN A;  2VBY A;  3M32 B;  4TY9 A;  3VAL A;  2HHW A;  4YHH F;  1OO0 B;  1RWU A;  5KFC A;  1B70 B;  2VQF J;  3R1H A;  4ZOS A;  5DM7 Q;  2QA2 A;  1X9M A;  4LR8 A;  4MK9 A;  3P4U B;  2BKN A;  5ETM A;  2R8I A;  5LMN J;  1KQF B;  1X5T A;  4DR5 J;  4PXB A;  4I6W A;  2AF6 A;  2WB1 D;  2QIF A;  4P73 A;  1N5T A;  3LGH A;  2KT3 A;  3RAX A;  1GTH A;  1RAC B;  2UXD F;  2EFQ A;  4TU8 A;  2KU7 A;  3IGV A;  4FNI A;  3TJ9 A;  1XEZ A;  3TW0 A;  4CLY A;  1DTT B;  4DEZ A;  1QUV A;  2MJU A;  3HPO A;  1KKH A;  2B7B B;  3AD9 C;  2HHH J;  1CS4 B;  3BGO P;  4ZPC A;  1BQN A;  2HHP A;  2XYG B;  4RW4 B;  1RWO B;  2ASD A;  3MEE B;  2OPQ B;  4G1I A;  2A6M A;  4KV8 A;  5CHC B;  4F3Q A;  2WVD A;  1UPM B;  4OI0 A;  2AIR B;  1HKA A;  2M3D A;  2QRR A;  5DDR C;  2J0X A;  1C1C A;  1RWM B;  1WOR A;  4F25 A;  2RHQ B;  1VQO S;  4ZP8 A;  4OV6 A;  1EQM A;  5EWG A;  5FII A;  4ELU A;  4EFA C;  1UEV A;  4KBI A;  2KM8 C;  3FFI A;  3PRD A;  5HLF A;  4J9Q A;  2CJB A;  1SC6 A;  1CSJ A;  2DEJ A;  3EXY A;  4KH0 B;  4WII A;  1NK4 A;  2W7O A;  5H9E K;  2HS3 A;  2OLW A;  3KOA A;  2HRU A;  3RU0 A;  3D5M A;  3QMQ A;  4KE5 A;  3A3O B;  5F8G A;  3N6N A;  1J5E J;  5LL6 d;  1WF1 A;  2KVQ E;  1RT1 B;  3NG8 A;  1BHN A;  4X64 F;  2X51 A;  1LWC B;  4G65 A;  2AGQ A;  1RTZ A;  3A8J A;  1VC5 A;  2R8K A;  3OLB A;  2UVR A;  1U24 A;  2E7V A;  2W9C A;  4B9U A;  1AUS L;  2G13 A;  4F2S A;  4JUZ A;  4Q0B A;  3I0S A;  3ILJ A;  1NKC A;  1HAR A;  4C11 B;  4IH6 A;  3LH2 S;  4OFZ A;  5JVH Q;  3A4T A;  1VK8 A;  3JSB A;  1U1L A;  4GKJ F;  1UTA A;  5A2Q Y;  2B6A B;  1PO6 A;  2QT7 A;  1ZAW A;  4MYU A;  3EM1 A;  3KLH B;  4NA3 A;  3UPF A;  4R8U A;  4OZ5 A;  4A46 A;  5A8W B;  5HI7 A;  7FDR A;  3DMJ B;  4LF7 F;  2HHS A;  1FNX H;  4OQJ A;  1WEL A;  2M4M A;  3KLH A;  4J9P A;  1K73 T;  3V6H A;  2L08 A;  4HDH A;  4ZVF A;  2Y1I A;  4LF8 J;  1NEE A;  4R5P B;  3BM7 A;  3HD2 A;  4C3K A;  5EUH A;  5I3U B;  3VQS A;  2BDP A;  1EET B;  4IRD A;  3R7B B;  1VYA A;  4OYA A;  1BQM A;  1EB0 A;  3GE9 A;  1S7I A;  4ZJQ A;  1VQK S;  4DSL A;  4KGM A;  1IQT A;  1HWU A;  5KFW A;  4KFB B;  3H5X A;  4EBE A;  1WKL A;  1WWH A;  3MPY A;  1FDB A;  1S12 A;  2B9W A;  1MWQ A;  3W1Y C;  3C8Y A;  3P49 B;  2OTJ S;  3WX4 A;  2RD5 C;  3VZI A;  2COL A;  1RKI A;  4CH1 A;  1S10 A;  1NXI A;  3FCV A;  4DL7 A;  4DSJ A;  3G6X A;  2DY9 A;  4K4S A;  4E2F B;  3SSQ A;  3JYT B;  3W9I A;  4CO2 A;  5D3G B;  4DR3 J;  4MIB A;  3M2U B;  1Q86 T;  1GNK A;  2QL7 B;  3GJT B;  2LA4 A;  3IP0 A;  3KLI B;  2MKC A;  2XQC A;  3GG0 A;  2W2N P;  2YPZ A;  4RW6 B;  5T41 A;  5C2G A;  5HAN A;  1BD6 A;  2LU2 A;  3Q86 A;  4ICL A;  4CRJ A;  3MEK A;  3GZ7 A;  2LQJ A;  3NS7 B;  4TNO A;  4ZVU B;  4N7T A;  2N4D A;  2YH0 A;  1YQH A;  2QZ8 A;  4ECX A;  4F04 B;  4AFF A;  2HFO A;  4I6Y A;  2ZBQ A;  1U2F A;  2DHS A;  2RUG A;  1JJC B;  3K8W A;  3IAS 9;  4DL6 A;  1JLA B;  3T1Y J;  3RB6 A;  1KTQ A;  3M1V A;  3ZXW A;  1R3N A;  1Q7Y T;  1SUQ B;  2ROG A;  2LEA A;  3D0H E;  3HSJ A;  1TQL A;  3ZTS A;  2FZC B;  4TYB A;  2DIS A;  1GMU A;  3CC2 S;  2BV3 A;  2DNO A;  2MKY A;  4I64 A;  5KG1 A;  3OHB A;  3G8T A;  4JI6 F;  2IM1 A;  2QEX S;  5D6G A;  4OZ2 A;  1WTB A;  3HO1 A;  1LEO A;  3LUY A;  5DZ7 A;  1SKU B;  2E44 A;  3OFE A;  3RRK A;  5A6W A;  2C22 A;  3KK3 B;  2FLN A;  3DLE A;  5D4L A;  8ATC B;  4ZLJ A;  2ZOG A;  3NAH A;  3MM6 B;  4CNZ A;  2BQU A;  3D28 A;  5EN1 A;  2LFV A;  3GYG A;  1GFW B;  4CT8 A;  4PZV A;  1LW0 A;  1NZA A;  2AKW B;  2J9D E;  4MTP A;  3EPG A;  4C8K A;  2JRS A;  5T7L B;  3KKF A;  3J7Y U;  3W2W B;  1RT7 B;  4RUA A;  3BBB A;  2G2Y A;  3EZ5 A;  2DB1 A;  1FCA A;  5KFV A;  5L9X A;  4OLP A;  1HNZ J;  1VQN S;  2KB2 A;  3TA1 A;  1SJ1 A;  5KFZ A;  1SV5 B;  4UOG A;  5LXY A;  1FJG F;  3NWR A;  3RAM A;  5DDQ C;  2PFD A;  1NKE A;  4TVA B;  2HQD A;  3BQ1 A;  3BGL A;  4P9S A;  4EO6 A;  1DBD A;  3WDO A;  3CC4 S;  2K7K A;  5LT5 A;  1RLD A;  4NAS A;  4I2P A;  2BJ3 A;  1TTH B;  2MEW A;  4URQ U;  4RUH A;  5EHH A;  3PR4 A;  1OY6 A;  2CAD A;  2E29 A;  3HUL A;  3FRZ A;  1KD1 T;  1KVI A;  4IDK B;  5GAG U;  4L76 A;  5DG8 A;  3Q22 A;  4KH1 B;  2R7X A;  1VMB A;  3BS9 A;  3H5U A;  3OD2 A;  1HL6 A;  3ZZR A;  4DPO A;  4QU7 A;  2DNY A;  3DC2 A;  5F0U A;  1U1R A;  2B9E A;  3PO5 A;  2OD4 A;  3MPV A;  3CDU A;  3MUT P;  3MPW A;  2HGN A;  3HF5 A;  4F7V A;  1P9Q C;  3CJ5 A;  4OX6 A;  1H7W A;  1X5O A;  2EFO A;  5ETQ A;  4JI8 F;  1RXO B;  1UA0 A;  4A8F A;  3KNA A;  2V8V A;  3H20 A;  3TQE A;  2XGP A;  2VON A;  1X4F A;  2LQB A;  4PQU A;  5F3Z A;  3N9U C;  1UJ6 A;  3CJR A;  1F9F A;  4WIQ A;  3FSY A;  2WTF A;  1KQK A;  3V6D A;  5DQH A;  3AB4 B;  3GR1 A;  3CD6 S;  2FJE B;  4NRT A;  4FPR A;  5D0H A;  1NKB A;  2C3M A;  3KHR A;  4B3T F;  1VS3 A;  2HUR A;  3H5S A;  2B9X A;  5HK4 A;  5KFE A;  2V8H A;  3QAE A;  4XDC A;  4HI1 A;  3PAC A;  5E0O A;  2DRB A;  3F41 A;  3H2V E;  4RNM A;  4ZIW A;  1LWE A;  3MM9 B;  3HVR A;  2HQC A;  2UV8 G;  1EX8 A;  2MST A;  3I9V 9;  4PYA A;  3OHA A;  3V81 B;  4NZ6 A;  4MKY A;  4B3O B;  4CIO A;  1C0U B;  1RTI A;  4I2Q A;  3DM2 A;  5ETV A;  4G1P A;  4UST A;  4CO0 A;  5RUB A;  3GQC A;  1ZM3 A;  5H9E J;  2IBK A;  3CT9 A;  4DV0 J;  2VL1 A;  1WF2 A;  2WB4 A;  2OEL A;  3GJQ B;  2LLZ A;  4M5D A;  3N5B A;  4NLS A;  1YG0 A;  3QFH A;  1YGY A;  4ZJL A;  2VG7 B;  4C9D A;  2EC2 A;  3ILO A;  1RT4 B;  3F44 A;  1YJ9 S;  2FUG 9;  1FK9 A;  1YK9 A;  4JOU A;  3PXG a;  4DV4 F;  3G87 A;  1O5J A;  3HVA A;  1YJ7 A;  2CQ3 A;  3OL6 A;  2OSQ A;  3IO1 A;  1FK9 B;  1JLG A;  4AXI A;  3UDC A;  2MTL A;  4DI6 A;  5LMN F;  1VDH A;  2ZNY A;  4USK A;  4IO9 Q;  1QM9 A;  1HNZ F;  2DNK A;  1FJG J;  1HNW J;  4DPT A;  2ZJR Q;  2HQG A;  4WFX A;  3GYX B;  5KFF A;  2HBQ B;  2RQC A;  1A0O B;  3PRB A;  2FD2 A;  1U8W A;  5IC4 B;  4NXN F;  3DYA A;  4GKK J;  3ONQ A;  3MR2 A;  3NGT A;  3BH6 B;  4Q45 A;  3K7R A;  3N01 A;  3ENW A;  1P6T A;  3I31 A;  3CIZ A;  4X4O A;  4KHP F;  1UZD A;  1Z4U A;  3LP0 A;  2ZOF A;  1QDU B;  2HIQ A;  2PMH A;  2IJF A;  4U8Y A;  1W26 A;  3TEH B;  1LWC A;  2B56 A;  4C8L A;  5J2Q B;  3OFG A;  2E7X A;  3GSI A;  1LWE B;  4MK7 A;  2IPO B;  3FMW A;  5KG3 A;  1S1W A;  1F5B A;  4PXE A;  4DPU A;  2V2V A;  1NB7 A;  1LXN A;  1OYD A;  1KOO A;  3K17 A;  4DV7 F;  2F8M A;  4RJV A;  4NLT A;  3SBM A;  1UVL A;  4B3R F;  2R2U A;  4LF4 F;  2X1A A;  2VG6 B;  1UWB B;  4OMF G;  1NJI T;  4IOB A;  2CZ4 A;  2IFX A;  2LU1 A;  1L3V A;  2VIC A;  4UY8 5;  3KWM A;  4B08 A;  3K0J A;  2CRL A;  2YNI A;  1FER A;  1T0T V;  2J9D A;  3P45 B;  3GR0 A;  3QT8 A;  2KN4 A;  2KYX A;  2YNG B;  4I4B A;  4AT1 B;  3OTO F;  2G4B A;  2LYV A;  3UFC X;  3QGG A;  2E9R X;  2KT5 A;  3UI3 A;  4DG1 B;  1SIZ A;  2OPQ A;  2WAQ D;  3EDQ B;  1Y5L B;  4DR6 J;  2Y1J A;  2FVS A;  3W62 A;  1NK5 A;  1RSC A;  1UPP A;  2J9C A;  2RIL A;  1K8A T;  2ZZN A;  4X4N A;  1F5A A;  2XEX A;  1D3W A;  1FRX A;  5DZ6 A;  2ASY A;  1ZET A;  2YNF B;  5DQG A;  2WVF A;  2IIH A;  4O3S A;  2J9E A;  1HNV B;  1B0V A;  4G6V B;  4J9K A;  1PJ6 A;  3ENQ A;  4L3K A;  4PXD A;  2HZV A;  4XPE A;  2ASL A;  1IWG A;  2AMC B;  4PUO A;  3MEG A;  1MU2 A;  2ATL A;  5HLF B;  1CQM A;  3GIR A;  4H4O B;  1CPZ A;  1ZOT A;  4QU6 A;  4FDF A;  4JV5 F;  1SVD A;  2GML A;  2V4Q A;  4UF4 A;  4DQP A;  4KJI A;  4H4O A;  4ED2 A;  4V19 J;  2EPI A;  2OD6 A;  1U1P A;  3B8H A;  1JLE A;  2CPE A;  3MR7 A;  5DDO C;  2ZH1 A;  3MMJ A;  2X3G A;  3IRX B;  1BMQ B;  1G2E A;  2PA8 D;  3MD1 A;  1S6Q A;  2ZVS A;  3FBC A;  3TA0 A;  2YKM A;  5HAT A;  4CO1 A;  3DHX A;  1NSA A;  1S0N A;  4DX5 A;  1SL2 A;  4WBF A;  1AXQ A;  4O4G B;  2LMI A;  3CCQ S;  3ZTQ A;  1APS A;  1XNQ J;  1U02 A;  4B9M A;  4BS2 A;  3C66 A;  2R2R A;  2YWF A;  1TL7 A;  4W90 B;  2A18 A;  2X1B A;  2YY3 A;  1VRQ C;  4DR2 J;  1XR7 A;  1ICE B;  3I4P A;  4RNN A;  3CD7 A;  2D69 A;  2VFV A;  4OYI A;  1V5I B;  2EBE A;  3BN7 A;  5B0C A;  3DI6 A;  3H4B A;  1ZM4 A;  3I82 A;  1T9X A;  2FJA B;  4X65 F;  5IT9 U;  2G2O A;  2QLW A;  4X62 J;  1WC6 A;  2VG5 A;  3MWB A;  4QWC A;  1HI0 P;  3AJD A;  2HG4 A;  2YKP A;  3JQK A;  4EYI B;  2UZA A;  2I1R A;  3IMQ J;  2H65 B;  4CDI A;  2KZM A;  2HBY B;  4USH A;  1YJT A;  1NB2 A;  2GZO A;  2VG5 B;  1M90 T;  4QR0 A;  4BCA A;  2FVQ A;  2FDN A;  4EO8 A;  3V6K A;  2FLP A;  2BZ2 A;  5F8J A;  2UXB J;  2JVR A;  9ATC B;  4MFB B;  3HHL D;  2Y1R I;  4BWJ A;  1HQE A;  3QZ8 A;  2FJX A;  4B9L A;  3ICL A;  2RF2 A;  1RHQ B;  2VAS A;  1HNW F;  4IH5 A;  2CQC A;  3QLH B;  3QGH A;  3LWM A;  4YB7 A;  2WON A;  3SCJ E;  1U1K A;  3EIC A;  3E3X A;  1NK8 A;  2WVC A;  4O23 A;  4MT1 A;  1SKR A;  4DR7 J;  1S1U A;  4F3O A;  3MR6 A;  4ZLN A;  1JLE B;  1FEH A;  1BUX A;  1SI9 A;  2ZC4 A;  4HH0 A;  2AT1 B;  3GV7 B;  4F4A A;  5KFQ A;  4USW A;  4FXW A;  1HD0 A;  2D9P A;  3OL8 A;  1KC8 T;  4C8Y A;  1U1M A;  4C8M A;  3MOZ A;  4KKO B;  1KLM B;  2Z30 B;  5CA5 A;  2X1F A;  1Y0H A;  2GA7 A;  5HO4 A;  3FSX A;  3R3T A;  4J90 A;  3RJM B;  4F4Z A;  1JLA A;  1XIQ A;  1QTM A;  1OMS A;  3TX0 A;  5A6P A;  3D6H B;  1UP1 A;  4JI1 F;  5KFI A;  5GMK a;  1SBR A;  5JVG Q;  2BAC A;  3RGI A;  3C2P A;  4LVO P;  4YQW A;  1SL0 A;  2F4F A;  3MMC B;  2EFV A;  3CJK A;  4OHY A;  1VIX A;  2OPR A;  1BQX A;  4DZ6 A;  2HWI A;  4NCA A;  2DHX A;  1E6Y B;  4DU7 A;  3Q8V A;  2NYI A;  5GAE U;  4FZV A;  3AFG A;  4J37 A;  4ZDN A;  4PG7 A;  1R7I A;  3BPS P;  4UT4 A;  4ANE A;  3BN4 A;  2MQN A;  3HX9 A;  1U7L A;  1AT1 B;  3NCP A;  1QAY A;  4Y2A A;  3W64 A;  2J7K A;  3LA0 A;  3JB9 k;  5FLX U;  1RE1 B;  5D3G A;  4CTA A;  2V6A A;  2I2Y A;  4ECW A;  1A7G E;  1HHS A;  2FYX A;  2YWE A;  3GSD A;  4JBC A;  4K4W A;  2KDO A;  4PXC A;  1WKK A;  5B0B A;  1ZYQ A;  2VOO A;  3PKM A;  1WC0 A;  2RIJ A;  4G1Q A;  2DBB A;  3H8Y A;  1R6Y A;  1WTF A;  3TX8 A;  3LAL A;  3CCE S;  2BAN A;  4DPX A;  2U1A A;  2F8H A;  4ZVP B;  5C24 B;  1VQ7 S;  2K3K A;  4HLB A;  2A6O A;  5GAD U;  3WHI A;  4C3M A;  1BXN A;  3US5 A;  1RTD B;  2GIF A;  1NM2 A;  3D2W A;  2GGP A;  1BC6 A;  1AA1 B;  5KFU A;  3OSN A;  2JEI A;  2F3J A;  5E5N A;  1PGZ A;  4C0B A;  3M30 A;  1Q82 T;  5CZV A;  5IT0 A;  1XMO F;  4X84 A;  5E2Q A;  4AQY J;  4OV1 A;  5CYM A;  1UEK A;  4DHV A;  1O8B A;  1SJQ A;  4J9M A;  1F2H A;  2I9S A;  3MMB B;  3TUI C;  1JXE A;  4W98 A;  5KT6 A;  3HVW A;  4ALZ A;  5BYR A;  4UW2 A;  4HYK A;  3QAU A;  4A8M P;  1KS2 A;  5BYS A;  2MHE A;  5LXR A;  2UU9 J;  5F3T A;  5K8O A;  2RUS A;  2ACY A;  1ZPW X;  2DGO A;  2GC8 A;  5K14 B;  4ZVT B;  4DOZ A;  3Q8R B;  2ZH4 A;  2MHN A;  4KIA A;  3CC7 S;  3FQL A;  1S1X A;  1WHY A;  2RRN A;  3R2D J;  1S6P B;  1Q53 A;  3RBD A;  1FFW B;  2IAJ A;  4HVZ A;  1DAX A;  5DJB A;  4XDD A;  1RWN B;  1U0H A;  2B51 A;  4KGV B;  3MFH A;  1BWE A;  2GAH C;  2DEI A;  2XI2 A;  3P8B B;  2FJD B;  2BJ7 A;  1PIL A;  3C16 B;  4LSN A;  4QPX A;  4ZKA A;  3J81 U;  4LF7 J;  4CLL A;  4EMD A;  3C16 A;  4LSN B;  2M88 A;  5KFX A;  5J2P A;  3BYR A;  2UVW A;  4B9S A;  3KUE A;  2BRK A;  3MZI A;  1WHV A;  3AJ2 A;  1CVJ A;  2QGF B;  2VFR A;  2W4C A;  1HI1 A;  2I6W A;  5C25 B;  3K57 A;  2EBG A;  2GVZ B;  4A8W A;  1TVR A;  4LF9 F;  1XER A;  2BA9 A;  4I2P B;  4FYX B;  4JI7 J;  2ZD1 B;  1PJ7 A;  4FVM A;  2J76 E;  2IYG A;  2Z2Y B;  2RVJ A;  3BEG B;  3C6T A;  2XI3 A;  2GQ2 A;  3DRS B;  4EGL A;  4F4K A;  1RHM B;  2V50 A;  4WXW A;  1XNR F;  3M8Q A;  4RW4 A;  4HR2 A;  4LMZ A;  2HKE A;  3THP A;  1TKZ B;  2DGX A;  3UE2 A;  1O51 A;  1S99 A;  3NL0 A;  1RT2 A;  3D66 A;  2DTJ A;  4AXJ A;  1RCX B;  3QGI A;  1KP6 A;  1RWP B;  2CQG A;  3CWJ A;  3MM8 B;  1B0P A;  1HWK A;  3E01 B;  3CO0 P;  3EZO A;  1TMJ A;  1IJE B;  2J7W A;  1A9N B;  2AGP A;  2WVB A;  5BXI A;  2N3O A;  5K14 A;  4DX6 A;  2BQR A;  4C7Q A;  2R2T A;  4H4M B;  2NXN A;  4P71 A;  1EAY C;  1AZS A;  3CVK A;  3GCX P;  2XG8 A;  4ILL A;  1HBU A;  2LDY A;  2J6T A;  1WDT A;  3I0R B;  1FFS B;  1NH8 A;  4OZL A;  4IUF A;  4QIF A;  4MKV A;  4WF9 Q;  4LF4 J;  3TAM A;  2DIU A;  1QSL A;  1RHR B;  3BB5 A;  5KFH A;  4DV7 J;  1NHV A;  3ITH A;  4RNF A;  1M5H A;  2KXF A;  1RAD B;  4NZ7 A;  2QA4 S;  1QD1 A;  1ULR A;  2AJ0 A;  2CQI A;  1PBA A;  2DHH A;  3KLG A;  2UXC J;  2PGC A;  1PYO B;  5IC6 B;  2FC9 A;  1NDP A;  4BHQ A;  1S1T A;  5C7P A;  3BPD A;  3T3F A;  1FRM A;  2LDI A;  4YR3 A;  3H4D A;  3LF0 A;  1BY9 A;  1JQG A;  2FHJ A;  4MMO A;  4AUK A;  4OLO A;  5FD1 A;  4CLK A;  1PC5 A;  2XCP A;  3GYN A;  2MZ1 A;  4QBU A;  2YX1 A;  1FJE B;  1UL3 A;  2A2D A;  2EEY A;  4WYL A;  2L9D A;  5LSO A;  5L1I A;  4DV2 F;  4IQX A;  1N0U A;  2Z58 B;  4H54 A;  4R0E A;  1HNI A;  2ZZT A;  4WFN Q;  3TAN A;  3D1O A;  4ZVQ B;  3GIM A;  2BEF A;  4J9U E;  2V5H G;  1LV5 A;  1EIY B;  3W65 A;  5E7O B;  4OJH A;  1DTQ B;  2AYE A;  3MEC A;  2XC9 A;  4DV5 J;  3AD7 C;  2HNZ A;  4K4T A;  2IMW P;  2JHE A;  1RBO B;  3HHL C;  3PCO B;  5KFJ A;  3R9L A;  3O1L A;  3S7R A;  2HQI A;  1X0P A;  4OHV A;  1VGY A;  1U1N A;  2GMJ A;  2D3O R;  1KRP A;  1I1G A;  5HL7 Q;  2CDR B;  1RHK B;  1PAU B;  5M2P A;  1JNZ B;  4LT6 A;  4YHH J;  4IKA A;  2ZE2 A;  3SFU A;  5ITH A;  1N52 B;  3BKF A;  1OS5 A;  2W4P A;  3D4J A;  4GVB B;  2HQ3 A;  5KFM A;  1OPI A;  3N0V A;  1MWY A;  3NOG A;  4U8V A;  2YQ0 A;  3OFF A;  2OML A;  1QLN A;  2VZ9 A;  1WOP A;  2VDH A;  3GLJ A;  1TAQ A;  5BYQ A;  1N54 B;  3CJ3 A;  4N76 A;  3D67 A;  4DUY J;  2XS5 A;  4MKA A;  1RAF B;  2ZH6 A;  1Y4Z B;  4LF5 J;  2B6A A;  3JS9 A;  1VQP S;  1F5C A;  2XYH B;  2LA6 A;  1N34 J;  3GU0 A;  3M8S A;  2CQD A;  5E41 A;  3DFE A;  1VCT A;  4WE1 A;  4C8Z A;  1NPR A;  3ZZO A;  4RUB A;  1K47 A;  5B7W A;  1GH8 A;  2V2K A;  4OX8 A;  3PTW A;  4HEA 9;  2Y0S D;  4BWM A;  1NPK A;  2R3V A;  2UUB F;  1S1V B;  1PG5 B;  2FHJ D;  2YNI B;  3OTO J;  1YLX A;  2EFP A;  4XIU A;  2IA6 A;  3V5R A;  4KFB A;  4KC5 A;  4ZPW R;  1K0V A;  4P10 A;  3KK3 A;  1Q79 A;  3MCS A;  2NXU A;  4M5N A;  4HT5 A;  2AX0 A;  4NLD A;  1TP7 A;  3DI6 B;  1LFW A;  4LIR A;  1Q78 A;  4OX9 F;  3KHG A;  3OTE A;  1U4B A;  4JI3 F;  1UVJ A;  2V34 A;  2Y0B B;  3DHW C;  4Y2M A;  1DHM A;  2M8H A;  3SQG A;  3Q8P B;  2HLU A;  2I38 A;  4JV1 A;  2MLX A;  5E33 A;  3SDE A;  1HQE B;  5LM7 E;  3PW7 A;  1L3T A;  4JI5 F;  4I7F A;  3NLC A;  5DS7 A;  2BE2 B;  2CPF A;  4I56 A;  1HA1 A;  4DR3 F;  4P2M A;  2AJF E;  4PG8 A;  4TY8 A;  2DNL A;  4ZK7 M;  2EFG A;  4PPD A;  4OHZ A;  1FTC A;  2M0G B;  4K4Z A;  1HI8 A;  1HWJ A;  1B4S A;  2DD8 S;  4RW6 A;  4USI A;  5J2M B;  2DXF A;  4V1A k;  3CJ0 A;  2IVM A;  1M5V C;  3C6U B;  4P72 A;  1IKY B;  3QWP A;  1IN0 A;  5F8I A;  1VRT B;  1I3O B;  5B0F A;  2JZ5 A;  2YH1 A;  1FA0 A;  4PYD A;  2ALY B;  4OYZ A;  2XMV A;  5I42 B;  4DX7 A;  1VQ5 S;  4IRC A;  1RWX B;  4NRU A;  5E3R A;  2QJ3 A;  1GX5 A;  4QWA A;  4KPY A;  3AQP A;  4IR1 A;  3L3C A;  1H72 C;  2AYB A;  2Y8W A;  4U7C A;  3J80 Y;  5CD4 H;  1HD1 A;  4RW9 A;  1JLB A;  4JYA J;  5GVQ A;  1WEX A;  2KI2 A;  3CCT A;  3EGW B;  3MMB A;  4OI6 A;  2UVU A;  1ZZN A;  2XTJ P;  1TL7 B;  4JI2 F;  2CZ9 A;  5KT7 A;  2JSX A;  3MM7 A;  3TVY A;  1XR5 A;  3BO4 A;  3BDP A;  5I3U A;  4USU A;  3WIU A;  2M5Y A;  4UTG A;  4GKJ J;  4DQR A;  2EWH A;  3EMT A;  3PIO Q;  4K4X A;  2PO4 A;  3AHP A;  1Z2Z A;  1UW9 A;  3LAN A;  4QZV B;  3ULH A;  3CF5 Q;  1N5Y B;  4MAK A;  1DQ8 A;  3R2C J;  3BGU A;  3M8Z A;  4U96 A;  3K59 A;  5GAG I;  4NX9 A;  2HVD A;  1W2B R;  1VC6 A;  4FF2 A;  3N6M A;  1RTJ A;  2IAJ B;  4AE5 A;  3S1T A;  4G3I A;  2V4J B;  3SQO P;  3PYE A;  2ZVI A;  2GIQ A;  3DDK A;  2LCW A;  3DU5 A;  3TA2 A;  3VGV A;  2AD9 A;  1SJF A;  3CDE A;  2LXF A;  2CPY A;  2DCU B;  3OT9 A;  2R7S A;  1QUP A;  1ZAX A;  1XMQ J;  2RF2 B;  3OSP A;  2OFH X;  2GS8 A;  2AEF A;  4PG4 A;  4DR5 F;  1B3T A;  2WHO A;  4A47 A;  1M1H A;  4DS5 A;  2Z0G A;  2CXE A;  2ZH8 A;  1D9A A;  3SV4 A;  1S9G A;  2D7S A;  2FGO A;  4NXM J;  1IKY A;  3E2E A;  3IWX A;  3I5B A;  4LFB J;  1WUU A;  4F26 A;  1H0H B;  4C8N A;  3WX8 A;  4MH8 A;  1GMV A;  4RNH A;  3IBF B;  2JX2 A;  3U1M A;  2HS0 A;  2HK2 A;  3CD5 A;  4IG0 A;  2V2Q A;  4ID5 A;  1NLK L;  3MPD A;  3UCU P;  2WVE A;  2DXE A;  1GEH A;  2CWX A;  5FDL B;  3OL7 A;  1JLB B;  4ZCI A;  1D9F A;  1CJT A;  2DIV A;  3C14 B;  5J1E A;  4JV0 A;  5HMX A;  5K8P A;  4JI1 J;  3HHE A;  5LJ3 Y;  4OHX A;  1PCA A;  2OEJ A;  2P9E A;  5KFY A;  1FES A;  2BJ1 A;  2CQ4 A;  1M5K C;  2R7Q A;  3G96 A;  1CUL A;  1PJ5 A;  3BH7 B;  1JJH A;  4X4T A;  3M6W A;  1IBC B;  2HSE B;  1PYT A;  2ZKU A;  2XUL A;  4KGK A;  2IHR 1;  1RBA A;  4O3R A;  4C4W A;  1YHQ S;  1HBU B;  1ELO A;  4JI0 F;  4NZ0 A;  2K3I A;  2E1A A;  4LSZ B;  4N47 A;  1R0A A;  4UOF A;  5DLF A;  3M9O B;  2GHV C;  3PIP Q;  1S6P A;  3SMZ A;  4WP3 A;  1RYS A;  1T02 A;  3GWC A;  1WEZ A;  4CZC A;  3MM9 A;  5J2N B;  2HBZ B;  3RBE A;  1IBL J;  2E1R A;  4R25 A;  2B43 A;  3NP5 A;  4NLV A;  4DDF A;  1KTV A;  2LXU A;  3R6G B;  3G6Y A;  4DL5 A;  2CNL B;  3R5B A;  2YWG A;  1LW2 A;  3TAP A;  3DM2 B;  1BE4 A;  4OX9 J;  4A4J A;  4C98 A;  2PI4 A;  3H40 A;  2EC0 A;  2JLG A;  1IBM J;  2HYI B;  1MRO B;  5ETL A;  1NO8 A;  2J6S A;  2FHK A;  3UD5 A;  2FIU A;  3GIJ A;  4UZB A;  1YVF A;  3GFY A;  4RWW A;  1Y5I B;  2AJ1 A;  3CXC R;  3NNH A;  4C3L A;  3NS6 A;  3VGT A;  4X4S A;  3MPU B;  1U0S A;  3ZNU A;  1VQ6 S;  1BLU A;  3LP2 A;  4FYW B;  2F65 A;  3A1Y G;  5ETT A;  2HHT A;  5KFT A;  2R7R A;  2HW3 A;  1IKX B;  4ZCL A;  1SKS A;  2PDA A;  4EBC A;  2C2Z B;  5CQG A;  3MM8 A;  3V4M A;  4FF3 A;  2QSF A;  3G4S S;  5D8H B;  3HVT B;  3FC9 A;  3OTD A;  4J91 A;  5IT9 Y;  4JI0 J;  2HVE A;  2W7P A;  4M5I A;  1YRU A;  3D6M B;  2BE9 B;  3UNG C;  5A8R B;  2QFJ A;  2PFF B;  1NZ8 A;  4ZS6 A;  1FRI A;  2ZE2 B;  3W60 A;  2W25 A;  3S6E A;  1KNZ A;  5GAE I;  4RL1 A;  2DH8 A;  4QWB A;  2LXI A;  2QLF B;  3TQ1 A;  3QO9 B;  5EWE A;  3DXB A;  4IFV B;  2MPU A;  2VUG A;  2C28 A;  1R31 A;  5U47 A;  2GCF A;  4KGX B;  4OYX A;  1Q95 G;  2MZT A;  2W1B A;  3IG1 A;  3CJQ A;  4LFA J;  1SH0 A;  1B0T A;  2IA0 A;  3CCU S;  4FYD A;  2MKS A;  1VR6 A;  1MN9 A;  3M32 A;  1MNE A;  2CVE A;  2ZBI A;  2OJ3 A;  1YJV A;  3CED A;  1FE4 A;  4Y6I A;  3PW0 A;  1VOM A;  1N33 F;  5KG0 A;  4XTT A;  5J2Q A;  3HJV A;  3DOM A;  2V8G A;  1SL1 A;  5HJY A;  5L46 A;  1SJ4 P;  2QFI A;  3BBC A;  4P52 A;  1LNQ A;  3U1N A;  4LF9 J;  2J0W A;  3MED B;  3EDR B;  1CC8 A;  2CPD A;  3OVS A;  1S48 A;  1AUD A;  5B08 A;  4YOE A;  2N7Y A;  1H98 A;  1X4A A;  3MI7 X;  2C2N A;  3VAH A;  4K2X A;  4DF8 A;  1SQF A;  3DRS A;  1DQA A;  4PWD A;  1W25 A;  2C2K B;  3CSK A;  3P5T L;  3IC1 A;  4M5D B;  4TXS A;  1S4E A;  4NLQ A;  4ED3 A;  2VFS A;  5C5J A;  1GMW A;  3BGF A;  3IRW P;  1N6Q B;  4LF8 F;  1UVN A;  2IC3 A;  3T1Y F;  1NAQ A;  1BQM B;  3PYG A;  1WHX A;  3R6L B;  2V94 A;  3KDO A;  3R1L A;  2O67 A;  2HZA A;  1P1L A;  1WD6 A;  4KO0 B;  2J8S A;  5K8N A;  1NSK L;  3WZ0 A;  4AL6 A;  2J7U A;  4M5G A;  4CYU A;  4WFZ A;  3TP2 A;  1LFP A;  2AJ2 A;  4CM0 A;  1SJR A;  2HMI B;  3CUL A;  2ZZM A;  5L8R C;  4MK8 A;  2UUT A;  2HZC A;  2RS8 A;  3UW1 A;  4HH1 A;  2ZH7 A;  3THV A;  1XC9 A;  1R8H A;  3PHE A;  2LEP A;  4B9T A;  1OQ3 A;  3I0R A;  2CUY A;  1VLO A;  1Q8I A;  1H7X A;  2CQB A;  3AOA A;  1EJ7 L;  3BF4 A;  3DYA B;  4AD6 A;  2DRD A;  1HWL A;  2XMJ A;  3A8I A;  3KLI A;  5D15 A;  1RT1 A;  1N5V A;  1V3S A;  3OR1 B;  3TJA A;  2KM8 B;  4YP3 A;  3QT5 A;  3T9N A;  1U49 A;  2CFX A;  1QAJ A;  2W7A A;  3PM9 A;  1NRK A;  3RG6 A;  3Q8Y A;  3Q0A A;  1CBK A;  2KVI A;  2DIT A;  4K59 A;  5K8M A;  3PVX A;  3CMA S;  1X4H A;  3TZZ A;  4QWD A;  3AXM A;  2PN6 A;  5EWF A;  3WQP A;  1P1T A;  4ED6 A;  3KUG A;  3BR8 A;  2KFN A;  3OR2 A;  2GV1 A;  2F4V J;  2J5A A;  2FVC A;  1FXL A;  2HS4 A;  4ECT A;  1U6F A;  4EWT A;  4B3O A;  3KFW X;  1S6Q B;  3N6L A;  2C2M B;  4OZ3 A;  5KG5 A;  1NJW A;  2FJW A;  4W92 B;  4Q2L A;  3DMJ A;  3MEE A;  4DPW A;  4H4K A;  1R6V A;  1VQ9 S;  3KUH A;  4Y2I A;  2VKZ G;  2XS7 A;  2OTL S;  3CJK B;  2DY1 A;  2VF3 A;  4ZJO A;  2LQ8 A;  1HMV B;  1CG2 A;  3B78 A;  3LOU A;  1TL1 A;  4M5J A;  2ILY A;  3PW5 A;  2XS2 A;  2XSF A;  1RAG B;  4TLR A;  3KG4 A;  5D4N A;  2OFG X;  1K0T A;  4CYU B;  1GQE A;  1WC3 A;  3PDN A;  2PMZ D;  3CDW A;  3M9M B;  2BE2 A;  2UP1 A;  1YJR A;  3E8O A;  2ZC3 A;  4L75 A;  3NMA A;  2OEK A;  4Q5V A;  2D3Z A;  2H54 B;  3GTY X;  5GAH I;  3BSO A;  2P5V A;  1KDN A;  1M0S A;  3SQG B;  5KFR A;  3OTB A;  4TKT A;  2HHX A;  3CGI A;  3CJT A;  1UWA A;  1YJU A;  3PYF A;  4A8O A;  3DLH A;  1QJH A;  4ECU A;  2M8D B;  3D7S B;  4BDP A;  4QYZ J;  3H25 A;  3X1L B;  2AZ1 A;  1LK7 A;  3M2U A;  1IUJ A;  1RKJ A;  1N36 F;  3QQC D;  5ETR A;  4WFB Q;  4BLG A;  2I0X A;  2G1D A;  1BWV A;  2A0F B;  2AHO B;  1FT8 A;  1RAB B;  1FO1 A;  2NUH A;  4FKY A;  5F0W A;  4EU0 A;  2D41 A;  2E1P A;  2XB2 D;  2KFY A;  2OIH A;  3N28 A;  3I0S B;  1NJX A;  1N56 A;  3RW6 A;  4F02 A;  4Q8E A;  3FZ2 A;  3HT0 A;  1NUE A;  1QY7 A;  4HDG A;  2OO4 A;  4ZA1 A;  3KHL A;  4CLT A;  4NCG B;  3IRX A;  1TKT B;  5J1N A;  2DNR A;  4X64 J;  3VGU A;  2RDJ A;  5KT3 A;  2P9C A;  5HVG A;  3FKB A;  2Y8Y A;  1C1B A;  3QRQ A;  2X3D A;  3ET6 A;  1OIA A;  2WZ1 A;  1Y5N B;  2HAF A;  4ZLP A;  4AQY F;  5IM0 A;  2RU3 A;  2UUW A;  3ZTR A;  3CJ4 A;  2F5G A;  2RT3 A;  4L6V 3;  2KHC A;  4ZIT A;  1H73 A;  4C8O A; 
#chains in the Genus database with same CATH homology
 4USU A;  4OZ2 A;  3MAA A;  1CS4 A;  4CLY A;  4CLK A;  1CS4 B;  4OYP A;  1WC0 A;  1YBU A;  1FX2 A;  4USV A;  3R5G A;  1WC1 A;  5D0E A;  4CLW A;  4CM0 A;  4OYB A;  1WC5 A;  4CLP A;  4CLZ A;  1CJV B;  2BW7 A;  5D15 A;  4P2X A;  2GVD B;  1CJT A;  3C14 B;  1CJV A;  1YBT A;  1CJT B;  3C14 A;  4NI2 B;  4OYO A;  4WP8 A;  1CUL A;  3MAA B;  3UVJ A;  3MR7 A;  4NI2 A;  1CUL B;  1Y11 A;  1CJU A;  3UVJ B;  1WC4 A;  4OYM A;  4CLU A;  5D0R A;  1U0H A;  4P2F A;  4OZ3 A;  4WP3 A;  5D0H A;  1CJK B;  1TL7 A;  3C16 B;  1U0H B;  4CLL A;  4WPA A;  3C16 A;  4OYA A;  4OYI A;  4CM2 A;  2GVZ A;  4OYW A;  5IV4 A;  2GVZ B;  4UST A;  1WC6 A;  1WC3 A;  4CLF A;  1Y10 A;  2W01 A;  3G82 A;  1FX4 A;  3G82 B;  4P2M A;  4CLS A;  3C15 A;  2GVD A;  2QV6 A;  1YK9 A;  5D0G A;  3C15 B;  5IV3 A;  4OYZ A;  1AZS A;  4CLT A;  1CJU B;  4USW A;  3ET6 B;  1AZS B;  4WP9 A;  3ET6 A;  2WZ1 A;  1CJK A;  4OYX A;  1TL7 B;  1AB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...