4P2MA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
169
Chain Sequence
RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Adenylate cyclase
total genus 36
structure length 169
sequence length 187
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2mA00
2GVZA 2GVZB 1WC4A 1CULA 4OYOA 1WC1A 3C14A 1CJKA 4CLKA 3C16B 3UVJB 1CJUB 4CLLA 1AB8A 1WC6A 4CLYA 5D0HA 4OZ3A 5D15A 5D0GA 5D0RA 1CJTB 1FX4A 2QV6A 1U0HA 2W01A 4OYMA 4P2MA 1AZSA 4OYWA 4OYIA 1CJVA 4WP3A 1Y10A 4USWA 5IV4A 1U0HB 1CS4B 4NI2A 4CLWA 1CULB 4CLTA 4OZ2A 1WC0A 4OYAA 2BW7A 1CJTA 3ET6B 4WP8A 3C15B 4OYPA 4OYBA 1YBUA 4CLFA 4OYZA 4CLPA 4CM2A 3MAAA 4USUA 1YBTA 1WC3A 4CLUA 1AZSB 4USVA 4WP9A 1Y11A 1TL7A 3MAAB 2WZ1A 4CLZA 1CJVB 1CJUA 3R5GA 3C16A 1FX2A 3C15A 1CS4A 1TL7B 5IV3A 4P2FA 4CM0A 1WC5A 3UVJA 3ET6A 3MR7A 3G82B 4CLSA 3C14B 4OYXA 1YK9A 4NI2B 4USTA 3G82A 1CJKB 2GVDB 2GVDA 4WPAA 4P2XA 5D0EA
chains in the Genus database with same CATH superfamily
3U7JA 2PIIA 1VS3A 5GAEI 1GEHA 4Q5VA 1FFGB 4Z37A 1XC9A 3AOBA 3OSNA 2Y3YA 4UOFA 2MLYA 2XLJA 3EX7B 4UW2A 2CQ3A 1KP6A 2FJDB 1S99A 4LF7J 3MPDA 4AL5A 2V2ZA 3OL7A 3KK2A 4DV7J 5J2PA 4WZQA 3HCXA 1SI9A 2ZD1B 1FVQA 1IKXB 4OHVA 4ZITA 1H2TZ 4QWEA 4TN2A 4J9QA 4GRSA 1NK5A 5D15A 4WXWA 3W5YA 5B0EA 4BLGA 1DRZA 1VQPS 2A6OA 1ZM9A 2OPPB 1TK8A 2NSCA 2FLLA 3LAKA 3C6UB 4WCEQ 3KLGA 2IMWP 2OD6A 1FA0A 1U0HA 4RLEA 4CO5A 3HP6A 2ZH9A 4J9KA 3RB4A 3MM7A 4ZJOA 4KGZB 2CJYB 5J2NB 3MMBB 2KRRA 3PKYA 3Q8SB 1OO0B 1JLEA 1I3OB 1CC8A 4N8NA 3W2WB 1YJWS 2AX1A 8RUCA 1IVZA 3MEGB 3UDEA 2P6SA 3HF5A 1IWAA 2NCKL 5A8WA 1UWAA 2ZNZA 2N3LA 3P96A 3PIOQ 4DOZA 3LOUA 5LXRA 2YKNB 3MDFA 1UA0A 1IR2A 3LALA 4F04B 1T11A 4DFMA 5KT2A 5KFLA 5B0BA 4B9SA 3CJ0A 1BLUA 1GQEA 1U6FA 2YXLA 3B82A 3QIPA 4N7TA 4MH8A 2DITA 4RPFA 5HATA 1RI7A 5F0UA 1IKWB 2B3TB 4X64J 2JFDA 4C8KA 3TVZA 3MM5B 5A8RB 1FXLA 1TR0A 5HQ8A 3I82A 4WJBA 1JJ2R 2GFFA 2XMUA 3FVYA 4NEYA 2CRLA 3GWCA 2GV1A 5E0OA 1D8YA 2X51A 4CLFA 2PSZA 4CM2A 3M6VA 1ZA2B 2DHAA 5L1LA 1Q7LB 1SIZA 4A48A 1RYSA 2IRUA 2HS4A 2C2OB 1YRXA 2YKOA 4J9SA 3NS6A 1NMEB 4M5JA 2VV5A 2YWWA 2E5LF 2MZ1A 2D3O1 3MAAB 1S6QA 3KLIA 3ITHA 3NAIA 1MROB 2OMOA 4UUXA 2EG2A 3QT8A 4MYTA 2DYAA 1RWOB 2XZWA 3IR6B 2HIQA 3I9ZA 1OSDA 3IS9B 4ECUA 1DTTB 1IWGA 2FHKA 5CABA 3MEDA 2HIYA 1TKXB 5EUHA 3D28A 3H8YA 5ETKA 2HNDA 3PXGa 5KFNA 1KQKA 3L7OA 3KK1A 3V81B 1LWFA 4IRKA 4LF4F 5CD4A 4Q0BA 4C97A 5ETTA 1AUSL 3H0PA 4X4TA 3GJQB 2IIHA 1E6YA 4UOHA 1HR0F 4ID8A 4F50A 4J9OA 2CJBA 1WOPA 1PAEX 2WVBA 5J2QB 2WBRA 2FJEB 3VQSA 1U2CA 1OMSA 1S1UA 3D67A 3GU0A 4RW7A 2NZ4A 1LOUA 2HHXA 3WHIA 4CT9A 3PACA 2DR5A 4PWDA 2H3EB 2CNLB 1U1PA 2NZCA 4JI5F 1AFIA 3R6LB 2LQJA 1Y5NB 2CPFA 4M5LA 4LRBA 2MXYA 2XEXA 4KPCA 1G1XA 3CDBA 4DFPA 3IP0A 5ETPA 2BBEA 2OPQA 2FD2A 2R4FA 3R1HA 1Q86T 1YJRA 3J7YU 2CPXA 5E3AA 5HQMA 4B3RF 3V4MA 1BC6A 3CD0A 5IC6B 1KQGB 3AA9A 3DCAA 1NDCA 1WC4A 3ENAA 5AE2A 5J2MB 2VBZA 3M9NB 3IFEA 3GLJA 3N0VA 1RADB 3NWGA 5M2PA 4NWBA 3L3CA 4ED8A 3HJFA 5JJBA 1HFEL 1SL0A 2JH3A 4CTAA 3UNGC 3G9CA 1MNEA 2L9WA 4U7UD 1EARA 5LJ3Y 5ETQA 4ED7A 4IR1A 5GMDA 2BM1A 1T9XA 3HVAA 1IKXA 1RAIB 2XULA 1O5JA 1Q7YT 1PC4A 1LK7A 1RHMB 3D54A 3N5FA 4Y28C 4NLXA 1Z1ZA 4CH1A 5KFGA 2XMVA 2HPUA 2FGCA 2JSXA 3G6XA 3DI6A 4H4MA 2DGSA 2MY7A 5KFBA 4GKJJ 2DXFA 4YB6A 4ECVA 2RQKA 4QR0A 2NQPA 2VG7B 5HBMB 1LW2A 4WU2A 2DIUA 5K8OA 3KYLA 1NRKA 2V8GA 4HHJA 1JLEB 4ECTA 4JOUA 4NL5A 2OSQA 1RTIB 1LV5A 1C0UA 5C24B 5KT3A 4G1IA 3AD8C 1S76D 1L3UA 3T5JA 2AYMA 2IM3A 3HK2A 4Y00A 2ADBA 1RLDA 1UMJA 3EZ5A 3R9LA 3RGIA 3DHXA 1RK8A 4AE5A 4DSJA 2E7VA 2JRSA 4JP8A 3HZEA 1HW9A 2V9KA 5D4LA 2K06A 5IWAF 1WELA 3G86A 3KLIB 3ONQA 3R2CJ 3KK3B 3HHLB 2PFDA 1CEZA 4WKRA 1YJ9S 2J76E 5HROA 1X4DA 4MT1A 3TEHB 2COLA 5AE3A 2CKWA 1RHJB 1PJ7A 3SFUA 3VCDA 2W2NP 4UT4A 1LWFB 4X4RA 1FNMA 4Q0BB 1NM2A 3GR1A 3ZO7A 4M63A 4OYPA 1TUWA 3FMWA 3A1YG 3G96A 2HHUA 4UQGA 2RHQB 2XS5A 2UV8G 1IJFB 2PD1A 1HBMB 1X31C 2CWKA 2B51A 2CFXA 1YRUA 1AXQA 2Y0BB 4RW7B 2A2CA 1RAAB 3SCIE 2HFUA 1XEZA 2J9DE 4A4JA 4RUCA 3CCSS 4I1TA 4DSLA 3VGTA 2KO1A 3IM9A 3QFHA 5AE1A 2MDAA 5CYJA 4CLUA 3JYTA 1RB0A 1AYEA 1ZETA 5DDPC 2XY5A 4B9LA 1F9EB 3T6BA 4WTYA 4LBPA 1R6YA 3M6XA 1OSCA 1VHFA 3KG0A 4Y2KA 4ED4A 3MMAB 1U1KA 4NXMF 2V8PA 1HYSB 3PW4A 1CSJA 4KHMA 5EHHA 2KG0A 2R7OA 3MZIA 2V9WA 3FMBA 1HR0J 4W4MA 3SCKE 2UXDJ 5GADU 4TVAB 2XZDB 5KFYA 4ZJQA 3DYAA 1FJGF 1WI8A 1RABB 1S4EA 2FGOA 3CJ4A 4A8SA 3RR7A 2R7VA 4HEA9 2FHJA 4Z7CA 2IYIA 5KG1A 2GHWA 4P9SA 5H1SV 4B3OA 2RUSA 5KFTA 2HNZB 2AP6A 1SKUB 1YJTA 4ECQA 3DDKA 3RUBL 3UI3A 2EXUA 4JI3J 2R3VA 1FRXA 3Q8YA 4O4RA 4DQPA 3OSPA 2MKSA 4LFBF 3VV2B 2BQUA 1R0AB 3NNCA 3HHLC 3GSDA 3PYEA 3W66A 5LMNF 1NXIA 1GAOA 3T9NA 2MQQA 3MM9A 1NZ8A 1YRTA 1WUUA 4C8NA 3O8WA 1SH0A 4OI0A 1FKOA 2WB4A 3I0SA 3N4WA 4X65F 2HLUA 3M4XA 3DDIA 1VISA 4F0MA 4K4UA 2PT0A 4P2XA 4P75A 3GIMA 3IN5A 1NK6A 5D0EA 3C8YA 4QWCA 3F56A 5HQLA 1SKSA 1NHUA 3PJ9A 2AYBA 1OYEA 2KFNA 2EEYA 1NHKL 1X4AA 2UZAA 3IXQA 1S0VA 3RW7A 3G4SS 1WG4A 4FXDA 2XLKA 2DEJA 4F3OA 7AT1B 5KFQA 1IBLF 3ZZZA 3QJLA 3GYNA 4KBIA 3I5CA 4RU2A 2YNFB 5KAKA 4JI7F 2A2DA 4H4KC 2HZAA 2JWNA 2YX1A 4Y6IA 3UE2A 2V4JB 1IR1A 2M52A 2MQPA 2RB7A 3K57A 5IT9U 1IKYB 1GXTA 3H98A 3Q8QB 3LUYA 4CRJA 1ITPA 2K8GA 3GG0A 3TJ8A 1LWCB 3QGPA 1RT5A 2F8HA 3CMES 2MPUA 2W4PA 2AIRB 1UVNA 1SVDA 1RAFB 2FIUA 1NCLA 5LMUF 3PYDA 3K5NA 3H5UA 5J2QA 1N32J 3QT6A 2VPXB 1KD1T 1M0SA 4K4ZA 4QIGA 3TJAA 5KFPA 2FJVA 1JLQA 3MD1A 4F02A 1KHWA 5BJRA 1S9FA 1S49A 2E29A 1VRTB 2XMKA 3OR2A 4CNZA 3MM6A 2EFNA 4Z2XA 2WB1D 3UW1A 4MIAA 4WFBQ 3A8IA 2VF3A 3CTRA 4K7QA 4DXLA 2NXUA 2UXBF 4KAIA 1UJ4A 3PHEA 4DSEA 1IXKA 2R8JA 5ETNA 1MROA 1WC0A 2MY8A 2AEJA 4RNFA 1RBAA 1QD1A 1H6KX 3PW2A 2D1CA 1PKUA 1X5OA 1R0CB 1TMMA 2EK1A 2F4FA 5FJ4A 1HNVA 2YWHA 4Q8EA 2IA0A 2B7CB 2J7KA 4JUZA 1XMQF 1WF2A 1OPIA 2MMYA 1HI8A 2HBYB 4NYOA 3BGRA 3TA0A 4KJIA 2DHHA 2QE5A 3R7SB 1I51B 5LT5A 3RAXA 1E6YB 4I69A 1B0PA 4A8FA 3BM7A 4OYZA 2DHXA 3GMGA 5CQGA 3AODA 4WTOB 1XNRF 4M5DA 1VJWA 1K73T 3S7RA 3D5MA 3R5AA 5E3CA 4TYAA 3W7BA 3CXCR 1LFPA 1CPZA 5KT4A 3HVWA 4HI1A 2CQHA 1N33F 1T0TV 2CVIA 4PG7A 3DRSB 3DXBA 3H25A 1WOSA 4QYZJ 4FYVB 2DVIA 1U1QA 4B3SF 4LF9J 1UVIA 1FNOA 2DGVA 3ENVA 1VCTA 4RBTA 3FZ2A 1Q82T 3QGHA 1T02A 3CCZA 1HI0P 5THWA 2YNHA 3Q83A 4AFFA 2VOOA 5KT6A 4H54A 3EVWA 5A2QU 1K0TA 1DHMA 3Q8UA 1D0EA 5CZXA 3GCXP 2FZKB 5EX0A 3MEGA 2BKOA 3FRYA 1DAXA 1GXUA 3PRVA 4NEZA 4DPUA 1RTHB 4WKYA 3OVBA 4K2XA 2HW3A 2NS1B 1JLFB 4V19J 2MZJA 3MUTP 2YNIB 2I2YA 2OH2A 1RKJA 2W2QP 5I3UB 1IN0A 2B9XA 3G6VA 2J0XA 1RT7A 2XZTB 4CTAB 5J1PA 3LPEA 5HI7A 4CQ1A 3AJDA 1FTCA 2DH8A 3MM8A 2CQIA 4HT5A 2E66A 4F26A 5D6GA 1HNIA 3GIJA 3BQ2A 1N6QA 2JFKA 3OLAA 2OI2A 1DZ5A 2E5IA 2R2RA 5SUHA 4CO4A 2NXNA 3CJRA 4X65J 3MM9B 3L4BC 3QLHA 4TU9A 4JV0A 2AGPA 4Q2LA 4ZN1A 1ACMB 2BJDA 1U1NA 1NK9A 4F4KA 1APSA 4IO9Q 1UVKA 2Q3PA 2VC1A 2R7RA 1SQFA 2Z2ZA 3ZZYA 2CJKA 2BQRA 2AJ4A 5ITHA 3PY8A 2HHHF 4FP9A 1K47A 1U1RA 4OX6A 2GVZB 4UY8T 3L9ZA 2CQBA 3QNWB 1T9VA 4JI0F 5HLFA 2VOPA 3M2VB 1N4LA 3KUHA 1L5UA 4NLYA 3CC2S 3IRXA 1NJYA 2BX6A 1FESA 2HFNA 2R8HA 3CCTA 1IBMJ 2OJ3A 2HGNA 4IR9A 3VF0B 5E2QA 3FQKA 2M88A 2LU1A 3IG1B 4CLLA 3DLGB 2DCUB 3DRXA 3KLFB 2YNFA 1S1VA 1X4GA 3NNAA 3ETOA 2HBQB 3T9ZA 3BSCA 1S1XB 2OHDA 4HHHA 2VFSA 5B0FA 2VHGA 5D0GA 3LA0A 1REVB 3M6WA 4DL6A 1DLOB 2QZ8A 2AHOB 1FRMA 1JWWA 3A13A 4ZCKA 3F73A 3C2PA 3OTDA 2FVPA 2ERRA 3KNGA 4L6V3 2HVEA 3CCUS 3PTWA 2GIRA 4FZVA 4B3OB 5KFAA 2DGOA 4ZMMA 1C4CA 2OO4A 1Q8BA 1PILA 2LQ8A 4P2MA 4DL0C 1DQ9A 3M8PA 2ACMA 2I8EA 5AT1B 4DV0F 1PJ5A 1YZ6A 4C11A 4EU0A 3A8JA 3BBBA 2CXEA 3GB0A 3RBXA 3H90A 2XCPA 4DV3J 2J9DA 4O3QA 5KFUA 2XS7A 1VBKA 2ZOGA 1X0FA 1WORA 4PABA 2M2BA 1X8DA 2BA9A 3AXKA 3LP1A 3MUVP 3BQ0A 5I42A 4F8RA 2YWEA 3W3SA 3DM2B 3PIPQ 4CLTA 5J2MA 4JV2A 4ICLB 4O0IA 2MJNA 2ILZA 2VFRA 2BANB 3NCQA 5MAOA 4DLEA 1M1KT 1Q8KA 1U6BA 2AGQA 4B3MJ 1GMWD 2E7WA 2GC8A 3GFYA 2G2ZA 2XO6A 3ZZOA 5IWAJ 4GVBB 2XM3A 3MD3A 3VVTA 1JK9B 4NLPA 2HHHJ 1RCXB 4KC5A 3EGZA 2YKNA 3PW5A 5T14A 1SC4B 4X66F 4DR6F 1UVJA 2CUYA 2C2RA 3KUGA 2BJ7A 3CD7A 4QW8A 2FVCA 4ZA1A 1EP4A 5KG6A 3Q22A 4DV6F 3UD5A 2QSFA 3PO5A 2J7WA 2HQIA 4KY3A 2E9ZA 1AFJA 4LF6F 2HWTA 5A8RA 2ZH3A 1VIOA 5A6PA 4ANDA 4WP9A 4QYRA 4B9VA 1HQ2A 4ERDA 5DQGA 2L3MA 3HSZA 1NB2A 4KHRA 2ZZNA 4RO0A 1DQ8A 1QUPA 4IG3B 1SUQB 1C1CA 2BM0A 3LP0B 4BWMA 3R1LA 4FS2A 3DHWC 4G6VB 5C2GA 4FDFA 2ROPA 3H42A 3TX0A 3K2YA 1R43A 3PX0A 1XR5A 2FUG9 3NGTA 4OZNA 1LWEB 4KE5A 4ANEA 5AXMA 3UPFA 4KV8A 5KFFA 3T3FA 3NNHA 1EETB 1RKIA 1SPBP 4PWUA 1ZAWA 2D7SA 2B4PA 1U02A 2EG1A 2V4JA 2RMLA 2Z58B 3M8WA 4NLSA 3D7SB 1MMLA 3KLEA 3CIMA 5IT9Y 1JXEA 2LP4A 3Q24A 3HHNB 2AF6A 3DLGA 1J5EJ 4I67A 1LWCA 3SSSA 2H4WB 4LF9F 1CQNA 2BV3A 3ZTOA 1KQSR 4MMOA 4DPXA 2YH0A 2CDRB 2W2OP 4IOBA 4WE1A 4EI2A 1S6UA 4NI2B 1UWBA 1AUDA 2UVVA 4K4TA 4LFAF 4C8YA 4DV5J 1FDNA 2C22A 2WOMB 3MCSA 2ATLA 4RW8A 1FCAA 4LF6J 5T7LA 4KGXB 3TA2A 4JI6F 4CYUB 5K20B 3CJTA 2L9DA 4NA1A 2G9OA 3G8QA 4Y0FA 1PGZA 2B56A 5D4PA 4X66J 4K4WA 1HWIA 4F3MA 1NK4A 2P9EA 3W8PA 2OPSB 4XK8C 1U26A 3WIUA 5B0DA 4OFZA 2OPRA 2AJ0A 3WX4A 2VPWB 1U2RA 2Y1JA 4BHQA 1CJUB 1B64A 1SBRA 3DLKA 2DNPA 1HMVA 4LF5F 3Q89A 4MIWA 1AA1B 1JLGB 2BKNA 3ETMA 5IM0A 3SCLE 3G8TA 1HWJA 1HL6A 5J2NA 4I6AA 3D1QA 4N56A 4HYKA 4G1QA 3UN2A 4DG1B 4ELTA 2VFTA 4JI8J 2G1DA 3JSMB 4F0HA 3I96A 2M4MA 1YDLA 2IVFB 5L1JA 2RE1A 3BV8A 4JYAJ 2QRRA 3P49B 3DOMA 1PYTA 3JTNA 1NO8A 3TR5A 3V4IA 3H5XA 3D4JA 5A8WB 1KOHA 2HFOA 2VPYB 1QAIA 1REGX 1RWMB 2KJWA 2RRNA 2A3JA 2J0WA 2WAQD 1RWVB 4HT7A 4I7FB 4RWXA 4TLQA 2CZ9A 5HMZA 2WONA 2WVCA 1Q95G 3EXYA 3HDSA 3KG1A 4G65A 4LRAA 4QZVB 2I38A 5K8PA 4B3MF 3J81Y 3FEYB 1RWNB 2KYXA 3OD2A 4USWA 4JI4J 1X7VA 2LDYA 3DNCA 3VHQA 1LKZA 3MM5A 5SZTA 2UUCJ 1RT4A 2CIMA 3RU0A 4U6PA 5BXIA 2MB0B 2RAQA 2DTJA 4J90A 2YNHB 4ZVTB 2Q6BA 2C2NA 9ATCB 1RYRA 3SDEB 2DH9A 1KS2A 4DZ6A 1TKTB 2QMUB 2VPZB 4L3NA 4EMDA 3E3XA 4HI2A 1JLAA 3MR2A 3BBFA 2CWXA 3V6HA 4B3TF 1MMDA 3RR8A 3ZTSA 2AX0A 2VU5A 1IBMF 4N76A 5CYQB 3MMJA 3NS5A 9RUBA 3J80Y 3VAHA 3GIKA 2CJXB 3CJ3A 2AKWB 5LL6d 3MAAA 1SQEA 2BEFA 3M8QA 1GMWA 3R3TA 3FFIB 2BE2B 5K14A 2E5HA 1VQNS 1W2BR 2DRDA 3K58A 2LKZA 2RILA 2ROGA 3D1HA 1U1LA 2HMIB 2PI5A 1VHIA 2DR6A 1N8RT 1UP1A 1Y11A 3MWBA 1NJIT 4YS2A 1T03A 1FXRA 4HTJA 3T1HJ 2PO4A 4K0KJ 1NSKL 3RB0A 1WDTA 3OVSA 3SSRA 1CJVB 2CG4A 1HBNB 1N52B 2H54B 2OD4A 1VQLS 3R5CA 3B4DA 2WVFA 1GK8A 2ILYA 4YQWA 1TL3A 1S6QB 2U2FA 2GW8A 3HHKA 1NJWA 4TKTA 3QFWA 1FO1A 3MEEB 3SQGA 2UXDF 3J80U 4V19X 3M2VA 1WD6A 1LXJA 3FSIA 1QDUB 4KFBB 2QA4S 1V3RA 1ULRA 4LSNB 5K8NA 3T41A 1HQEB 4NCAA 2CQ1A 2BJ8A 2YKQA 3TX8A 3UDCA 1TL5A 4DU8A 1T05A 2D74B 2KXFA 1P8GA 3VALA 1DQAA 2ZOMA 1B4SA 3V5RA 5JVHQ 3MECB 1Q81T 4JI1J 2D3ZA 2WSEC 4RW6B 5DDQC 4NCBA 2V8DA 1GTHA 1K1SA 2HNZA 3KJQB 1V9OA 4I2QB 3C46A 3RRGA 1S7IA 3DLHA 1VQ6S 1S1TB 2J9EA 2OLWA 3DLJA 5AJ3F 4NZ0A 1YTYA 2HVZA 3PYGA 4B9UA 3GFXA 1SL1A 1NEEA 3BGLA 2H1YA 2XTJP 3W9HA 1J5EF 2QO3A 3DM2A 2DH7A 2QMXA 3C6UA 2HRUA 3PKMA 3BREA 2Y1LB 4OLOA 2ZH5A 3C16B 4MK7A 3UVJB 3DLKB 1VC6A 4OLPA 5E41A 2OTJS 3MMCA 2AU0A 4DU7A 1ZZNA 1X4CA 4YB1P 4LF8F 4OIXA 2QC3A 2ZC4A 4ICLA 2J6UA 2AW0A 5HMXA 1KR4A 2OEJA 1BQMB 3CD5A 4DX6A 1K1QA 4NLVA 2X1FA 2YKMA 4UF4A 4ZJLA 4H4OA 1XMQJ 1P6TA 3G6ES 3NBPB 4RZRA 2Q79A 2M8DB 4DUZF 2V8VA 4USHA 5JXSA 4I2PA 2D3OR 2J0QD 5HROB 1C1CB 5E3RA 2F40A 2K2PA 4C98A 2QL5B 2W4DA 3CSKA 4CI0B 4RNMA 1PJ6A 4NLGA 4JBCA 1HBUB 1K44A 1IM6A 2V69A 3BO4A 3UCGA 3EGWB 4NRTA 4NI2A 5ETOA 3UR3C 4CLWA 2LFVA 3H2VE 1CULB 3V6KA 1URNA 2NPFA 1NDKA 1RXOB 1SXLA 1HBNA 1Y9OA 1NNDA 2OEKA 2OELA 3W64A 3OHAA 4ZOSA 3SFGA 5B0AA 3UDLA 4IG3A 1CJTA 3B8HA 3DFEA 2N7YA 3DN9A 3HVTA 3IC1A 4URGA 4JV5J 3AY0A 5E3PA 5IT4A 1NZAA 3VGVA 3I5BA 4ZPAA 3WC0A 4I64A 3NY0A 3PDNA 3JYTB 1IBCB 1U7LA 1VBXA 2MKYA 1WEXA 2RSQA 3IR7B 2KI2A 1SIWB 2CPHA 2IJRA 2GMLA 3IR5B 4KB7A 5E33A 1SB6A 3TVKA 2K3IA 1VK3A 3I32A 4RU9A 4WIQA 3M8QB 1KLNA 3DU6A 3O6QA 5HO4A 3TA1A 3KK1B 5JVGQ 3V81A 1JLGA 1FERA 2C2KB 1NPRA 2H51B 3QO9B 1UEVA 2O01C 4PR6A 4F4WA 5DM7Q 1RGVA 1ZYQA 4USVA 4E2FB 1HHTP 2W2MP 4X62J 1RT6B 4XAKA 1HPZB 4CO1A 3W2VB 1VQ9S 4NA2A 1H38A 4A8XA 4DWIA 5LM7E 2AT1B 5D77A 4ES1A 2MKIA 4DR2J 2XB2D 2Z4PA 4RL1A 2LEPA 4RW8B 2ZE2B 4DR5J 3V6DB 2XSJA 2V6AA 1MU2A 3BGFA 3O44A 5DQIA 1NKBA 3QIDA 2RU3A 4TY9A 1C1BB 2VL1A 2AMCB 3DGPA 4OV1A 4AQYF 2LXIA 1S0NA 4RR5A 1CLFA 2OPQB 2C1EB 2OAUA 3JSYA 3W9IA 3NKYA 5KFDA 3CDEA 2EFPA 4J9UE 2LYVA 4LFCJ 4WBFA 2F63A 2YKAA 1PBUA 5LMNJ 4A8KA 1T05B 1VK8A 4FBTA 2XWXA 4AXJA 2Z57B 1T9UA 3K17A 1Y0HA 1OJ4A 1Z2ZA 4CLSA 4ZDNA 2BZ2A 2RKIA 5C2CA 2NSBA 3GCWP 3AD9C 2DO0A 3G71S 2MHEA 2ASLA 3DKDA 4F36A 2VC0A 2Y8WA 4PWWA 4Q45A 1RTDB 1CG2A 2A0FB 2XHWA 2M0GB 2XYHB 1GT8A 1FDBA 1N33J 3A8KA 3EDRB 3SSQA 2B5JB 3CGIA 2PGCA 3MPUB 2QTWA 1A6LA 3VZHA 1SJQA 4DV2J 2V94A 3POTB 2RS2A 2GS8A 3H2UB 4ENOA 4ETZA 4USKA 4ZCIA 4YY3J 2VIHA 4X4PA 4EYHB 1HD1A 3FFIA 2DY9A 3NOCA 5JMNA 1Q53A 1NHVA 3SEOA 2HQ3A 1IKYA 1QTMA 1U24A 1FDAA 3DMJB 4JI2F 1RHKB 2PMHA 1AB8A 1RACB 2DD8S 2GQQA 2WW4A 3B6BA 3QT7A 3IGVA 1EAYC 1SH2A 3SV3A 4C8MA 4DN0A 5H9EJ 1KNZA 1EETA 2K3KA 1VLOA 3TARA 4X4VA 5IT0A 2J6SA 1TKZB 4I68A 2QV6A 2E1AA 1UVLA 3PW0A 1OS5A 5B7WA 2XQCA 3R5JB 2CQ4A 1WTBA 2BE2A 3MEKA 4HDHA 4R0JA 5HANA 5K14B 2NYIA 5DDRC 1RCOB 4QOTA 3RJMB 4EWTA 4XO0A 2FHJD 3HD1A 6FD1A 1RAJA 5DDOC 5D3GB 1G3OA 3VZIA 5CXTA 2W8LA 3KLHB 3ITHB 1YLXA 1YX2A 2JVRA 5LOQA 3J81j 3HT3A 1TP7A 4RW9B 4C4WA 4R8UB 2QL7B 2FZCB 1WSRA 1V6HA 4LF2A 2FZGB 3FSXA 4WP3A 1RHRB 1OQ6A 2C3MA 4EK2A 2ZH8A 4DV4J 3Q8RB 5DG9A 1VQYA 3QAUA 1D9AA 4KGMA 3TW0A 3LPYA 4B17A 1J2VA 3A3PB 3BPDA 1FTRA 3OR1B 5KFMA 1FK9B 1Q78A 2QA2A 5FDLA 4ED3A 4GKKJ 3DOLA 3S1TA 2AD9A 1R8BA 1KVKA 5CH7B 1FKPB 3JTOA 5DZ6A 5GVQA 3K8WA 1TUGB 3PFEA 2IM0A 3KJVA 1N5YA 4LSNA 3MTKA 5HVHA 1ROFA 4J9VA 1NLKL 2HK3A 2NUUG 4M5DB 1S10A 1H2UX 5K8MA 2H4YB 4HH0A 4IG0B 4NOHA 5G4DA 4DFKA 2KTQA 3MMBA 2IM1A 3BQ1A 4OYBA 3AAWB 2DNGA 2K1RA 1X4EA 5DM6Q 2PMZD 3IA0A 1VRQC 4J9MA 1WEYA 1WHWA 3I4HX 3I6PA 2FQQB 5KFXA 2ZUGA 1Q4RA 1KQFB 2KM8C 4E0DA 2YY3A 3EVOA 3GTYX 4DZDA 3HSJA 1HNWF 2R7SA 3TZXA 3CCJS 5DG7A 2HHQA 3Q8VA 3EZOA 3OVAA 2RIJA 2V4QA 2VQEJ 2Q6CA 3I9V9 2BDPA 1RT6A 5HJYA 2KT5A 4MYUA 3RBDA 5K5MA 4N47A 4XPEA 3OTOF 3HKZD 4CWBA 3A4TA 4WYLA 4DR5F 1N34F 2CQ2A 4Y2CA 2P5VA 4JI5J 2AZ3A 3K7RA 3MUMP 2RNEA 3DRSA 4HH1A 4CLZA 2BOPA 3LGHA 4DV0J 1U8WA 3OXGA 4FYWB 2HRTA 1TL7B 5IV3A 3O2IA 3PRBA 1RTJA 4NCGA 4KGKA 4C8OA 1FWLA 4C9DA 1RDRA 3BPSP 1LW0B 2IAJA 3PR4A 3T1YJ 3D3CJ 1ZS6A 1QLNA 2D41A 1KWMA 3RW6A 1NAQA 2FJBB 2KDOA 5KFZA 1V5IB 5F8MA 4J9LA 1VJQA 4ZVEA 5JUMA 4BC9A 1A0OB 1X9SA 1WSVA 3G82B 1RISA 1S6PB 5HSPA 4ER8A 3F41A 2XY7A 1M5OC 1XN9A 3PO4A 2X7IA 3C14B 4G1PA 4HVZA 2W24A 4NYZA 2YWKA 4C7QA 3NBPA 4TLRA 1N34J 3I31A 3PR5B 2HZVA 3J7Z5 1TK0A 3BB5A 2VB6A 2HAIA 1F5BA 1C0TA 2DISA 2V0NA 4OZLA 5FD1A 1FVSA 5C42B 1TQLA 2GVDA 5GAHI 5DG8A 4DR7F 1TKXA 3ISZA 3NCPA 2QA1A 1P1TA 2R7WA 1XJWB 2J5AA 3GONA 3L7UA 2VBYA 2B6AA 3LGMA 3NGRA 1RAHB 3KWMA 5FLXY 2G2OA 2VJVA 2AJQA 3ZC4A 2LECA 2KVIA 2IJFA 3PW7A 2IMOA 2EK6A 1S1WA 2GMHA 4YB5A 4X4QA 2CQPA 3CJKA 4OHWA 1FRKA 4PG6A 2ZJQQ 3T5LA 3MEDB 4F4YA 1RHUB 1NUEA 2UVWA 1FWKA 1RU2A 1S4FA 2ASYA 2EFQA 4QR1A 3DLBA 1EHWA 5D0HA 3ILOA 2ZDOA 4FKYA 2QYGA 2ZBRA 4ZPVR 4DX7A 1TELA 2AYEA 2R42A 4J5OA 4NX9A 4EFAC 4LRDA 4O3NA 3CD6S 2F9JA 3N5BA 5DGAA 3FQLA 3RAQA 2LA6A 1BQNB 2W01A 3KDOA 2R8KA 2Q43A 3OUYB 2R8GA 3MI7X 4C0OC 4HR2A 3MOJB 1W7WA 4AUKA 2AZ1A 2X3DA 3AJ2A 2ASJA 1HPZA 1X4BA 2CJAA 2KU7A 2PMWA 1HMVB 4OYMA 2I6WA 2EKYA 1LXNA 2HNDB 3EYZA 4QWBA 2FTRA 1AROP 1HHSA 2GHPA 3GSIA 4ILRA 4IFVA 4OYWA 2NLWA 3VAJA 2GJFA 4K4YA 3C3LA 4GC6A 5IQ6A 3TZZA 4NMLA 1SQGA 4ED1A 1PAUB 1UAWA 1Y10A 3FBEA 4NYPA 1KKHA 2A1BA 4P74A 3Q8PB 3OR1A 2DHGA 3B78A 1MU2B 1FRJA 4RKUC 1S77D 2DJWA 3V4IB 1VMBA 4U9RA 4C11B 2VONA 2ZEJA 1UPPA 1VQ5S 2V67A 1YI2S 2W1BA 2OTLS 2BUNA 1F2HA 4Z7YA 4NLRA 2B0GA 1FF2A 1S97A 4M94A 2FC9A 1UA1A 1IQZA 2LLZA 3R5DA 4OI4A 2XS2A 4HDGA 2DGWA 3KLGB 5LMUJ 2CZ4A 2ADCA 1JKHB 4R5PB 2B8QA 1FJEB 1S57A 2GNKA 3KJNB 4PXBA 4DR3F 2BACA 2ABYA 5M2RA 3BN7A 1I5OB 1UKUA 3QPIA 4ID5B 2V4RA 2W9AA 1YHQS 2BXJA 3R6GB 3KTQA 2ATCB 4WK1A 4OX9F 2JZ5A 1Y4ZB 1KEKA 3FNNA 4W98A 3R7NB 1V5VA 2HFVA 3M30A 3QT5A 2DRBA 2KXNB 5A76A 1JLAB 4GKJF 4NZ7A 5DQHA 4EUVA 4EBEA 1MWQA 2P6TA 3I87A 1N36J 3E2EA 2APOA 2CAJA 3WIVA 2ZC3A 3B54A 3RYLA 4C48A 3J81U 4MIBA 4KT0C 3HSDA 4IYQA 1DTTA 2XMTA 1SJ1A 3Q86A 4QQBA 3T1AA 1NB7A 2F1FA 3U1LA 1DY3A 1ZPWX 2DPIA 3LTOA 5A8KB 4IFYB 1F0XA 4CM0A 3JXOA 3KLVA 5KG7A 1B70B 4FNHA 2B9YA 1XMOJ 3FGVA 3SQOP 1UETA 2L9NA 1JLBA 4YMEA 3TI0A 2FLPA 2ZBIA 4K0KF 3P3DA 1H2VZ 4BBYA 4XTTA 1NKCA 1H3DA 4B3RJ 1ZTTA 1O0PA 5GAEU 2ZJPQ 3MR7A 3QSIA 4KV8B 4X84A 2XMAA 3IWLA 1U1MA 4M5NA 3MAQA 2FJWA 1G7CB 3WQPA 5HMWA 3PJWA 5BR8J 2FY8A 5G0RA 1N5YB 4PQAA 4ZIVA 3DU5A 3E01A 3CCRS 1VC0A 2UU9J 1S6OA 1RAOA 1WG5A 4DLGA 3CUNA 4JI3F 4TQRA 2WBMA 4WIIA 2B4VA 2QLXA 5KFSA 2V68A 3QGIA 3I56S 4ZCLA 3R7BB 4ED6A 2AEMA 2ZH6A 1HNXF 2VG5B 3OXLA 3MCNA 5IOLA 5I3PA 1RA6A 2AV5A 4ITSA 1X5SA 1T9YA 1YJ7A 2B6AB 4IFVB 4ZPCA 4EO8A 5FLXU 1DLOA 1PBAA 1FE4A 2ZFHA 2G4BA 2BYCA 3DOLB 3HM9A 4LR8A 3CCVS 3DDNA 1U45A 1OPZA 1VGYA 7FDRA 1UJ6A 4W90B 4IQMA 2VKRA 4DG1A 1HWLA 2M7SA 4UUWA 3HD2A 1R0AA 2FDNA 2DNLA 3BDEA 4XDCA 1S7HA 2B7BB 3NGKA 3CW2C 4USMA 1K9MT 3MXHP 4O44A 2ZZTA 4QWDA 1RTZA 3DLEA 1Q5VA 2VDHA 3OJSA 3H4DA 4C0HA 4AL7A 2FJXA 3H5YA 5KFEA 4OL8A 1NSPA 3HLUA 3OPKA 3MFHA 3M2UB 2CJ9A 1SJ4P 2B9EA 2Z2YB 3TAQA 1FKOB 2HKEA 3QAEA 2HVIA 1IQTA 4MK9A 2MKHA 3PCOB 3S6EA 1RA7A 2HNYB 5IS2A 1K8AT 5I42B 3OW2R 1S59A 1WHVA 3CWJA 3UD4P 2YQ1A 1R8PA 4URQU 3NL0A 3JQJA 1Q5YA 2RUGA 1F5CA 3DRPB 1PG5B 1D8ZA 1U6ZA 3D6MB 3LP2A 4P71A 5DZ7A 1E6VB 3MOZA 1UTAA 1HIYA 2HWIA 5KFOA 1EIYB 1JLCA 4ZHRA 2EI5A 3QBCA 3BSAA 3W8GA 4DX8H 2DB1A 5GADI 4LF7F 2E44A 1S0OA 3PG9A 4PEOA 2LU2A 4KHPJ 3KK3A 3H40A 2Y8YA 2HHWA 3GJRB 4OI2A 4ECSA 1KONA 1EZZB 1R7IA 2YNGA 1TFYA 5ETRA 4DUZJ 1BHNA 3QQCD 4OX8A 3FEXB 4ZVFA 4GKKF 5EWGA 4ILLA 1NPKA 1Q79A 1YGYA 4DBQA 4ZN3A 4DV4F 4NCGB 1LK5A 2HGMA 2ZM6F 2CJQA 3QLHB 2CQ0A 4NLWA 2IAJB 5EX3A 3R8YA 1FD2A 4M8LA 3W9JA 2A10A 4PG8A 4ECXA 4TYBA 1RT1A 2RT3A 4P6QA 2GA7A 4TXSA 3GFHA 1JMTA 1UEKA 2UU9F 3CULA 2IC3B 2GAGC 3GV7B 2EKNA 1IKVA 3OQ2A 1U0SA 3CJ8A 1IM4A 1EB0A 1Y7PA 2VDIA 4FVMA 1PO6A 4JI7J 2M5YA 2LEAA 4I6WA 2MQMA 3MPYA 2IFXA 1SJFA 1X9MA 2E7XA 5KOXA 4Q43A 1SV5A 1VLYA 3TJ9A 4RJVA 5L39A 2SXLA 3W1YC 4A47A 1X9WA 2DPJA 1S1WB 1HNZF 1ZZFA 4DJBA 1FJ7A 1XMOF 2DNRA 4Q2MA 3EMTA 3T6JA 1GMVA 3JSRA 2DK2A 4DR4F 3ZNJ1 5HLFB 1N32F 4ZVUB 4JI2J 3NMAA 1N56A 4IFYA 4WU3A 2KL8A 2Z2LA 1S0MA 2NPIA 4J9RA 1RT3B 1Z4UA 2DXEA 4NPOA 4ZIWA 4ZP6A 1T8EA 1UJ5A 3M8ZA 3WX8A 4B9NA 3CO0P 4I56A 5DGBA 1N0VC 2P9GA 3MEEA 1BQNA 3M8RA 2E1CA 3GPAA 1GX5A 1ZBTA 4URSA 4PAAA 1T7PA 2EFVA 1OYDA 3N6MA 2HK2A 3M8SA 1S1TA 3G6YA 4OX9J 1YK9A 3LQVA 4NLQA 4FYXB 5KFHA 3TUIC 2WVEA 2U1AA 1SH3A 5DJBA 3TO8A 2KM8B 2AJ1A 3MURP 5H9FK 2H65B 2RRBA 4X4NA 1M5KC 2P2CB 5J1EA 4LT6A 4NASA 5KFVA 2AEFA 5RUBA 4F2SA 3C6TA 4QR2A 2PE8A 3TUPA 1GNKA 2YKPA 5ETLA 5K9FA 1SJRA 1FEHA 1WC1A 2LDIA 2Z56B 4CO3A 1CJKA 3NMRA 3AB2B 3MCOA 4KQZA 1QSYA 1SC3B 1U48A 1Y00A 1F3VA 2IM2A 2D9OA 3UNYA 2AJ2A 4FVCA 4PRFA 5A0YA 2BJ3A 2QMWA 2VG6B 3RRKA 2KT3A 4IH5A 3X3UA 3UCUP 1RTJB 1KTQA 2XNRA 1OIAA 2ZBCA 2MQNA 3PX6A 1RZMA 1X4FA 3NXZA 4YDDB 4DSIA 2PEBA 4MKAA 1MLAA 5BYQA 1CC7A 4ID5A 3TZWA 3Q2SC 1FD8A 2K7JA 2HWHA 8ATCB 4KHPF 4DV1J 2BRKA 4ZPDA 1YJNS 3HULA 2HS3A 1VQOS 2CPJA 4DR1J 3KFWX 3SBMA 4DEZA 4DN9A 2MSSA 2O67A 1RP5A 2OKQA 3KUEA 2EFOA 3FCWA 2ZHAA 2MGZB 1IR0A 4LIRA 2HGLA 2QX0A 2XLIA 3JTPA 3NAHA 1X5TA 4ZPTR 1JLCB 3BZQA 3VAFA 1S9EB 4ECZA 2ZUAA 3FBBA 1KVIA 4AD6A 4A46A 2MZTA 2V8HA 3IAS9 4DPOA 5IV4A 4WK3A 4K50A 1R8HA 1LWEA 2HBZB 4D3HA 3LWMA 5L1KA 2F4VJ 4X2BA 3MM8B 4Y3CA 3M7VA 2BMBA 4OZ2A 2C3UA 2Y0SD 1WHYA 1HW8A 3NWRA 4NLOA 4TNOA 1QM9A 1HI1A 4Q7AA 3BYPA 2F4VF 4R8UA 1PSDA 3CJKB 1NBEB 2NR0A 1TMJA 1TL1B 2GMJA 4K4VA 1BGXT 4MTPA 4P10A 1HA1A 5KFCA 3GV5B 1KSPA 1IJEB 2WW8A 3M32A 4DR7J 3DRYA 3MHYA 1KLMA 3TVYA 5G0RB 5IFMA 1QVFR 2PFFB 1JB0C 3BSOA 1YSJA 4F0KA 4B3SJ 4USUA 3ZXWA 1Y3JA 3QMQA 4MK8A 1WC3A 4YHHJ 5IQQA 3THTA 3OL6A 1AZSB 4H4KA 1DJ0A 3IBWA 3GE9A 3GFZA 4Y65A 4LF5J 3GJSB 4RBUA 2VA3A 1N54B 4IG0A 1NJXA 3NG8A 2VICA 3M8PB 3D1OA 2FY1A 3HO1A 3J7AN 4C0BA 1WI6A 3P5TL 1X4HA 1XTZA 3RRHA 2OPSA 1VIXA 2GAHC 2MEWA 3IAM9 5U47A 2J6TA 2CVEA 1CJUA 1N5VA 3K59A 1Q8LA 1REVA 2MKCA 3R5GA 4QU6A 4PPZA 3U27A 2CQCA 1Q0NA 2LXUA 2O5DA 4E8UA 5IM0B 2CNNB 3F0NA 4B08A 1B0VA 1R27B 3CVKA 4WWSA 1TTHB 5L38A 3VQTA 2MKKA 3CJSA 2F7VA 3D0HE 1RWWB 4DV5F 2H48B 1RBOB 2LQBA 5F3TA 4ED0A 4LFAJ 2RDIA 3EWGA 5A0YB 2NXEA 5ETVA 2GCFA 4LRCA 4ZP9A 3AQOA 1PIEA 4MFBA 5KFJA 1NU4A 2KKHA 2YX7A 2J8AA 3ZTRA 4I6YA 4U7CA 2XO7A 2B8PA 1KBRA 4L3KA 4ZLPA 5KT7A 3RTVA 2AQ4A 3SV4A 5F8JA 1ZOTA 2QFIA 4FYDA 3R5BA 1F2GA 3CCES 2UXCJ 2BRLA 3LP2B 3TOQA 3LP1B 2OFHX 4CT8A 3HVRA 4MKBA 4USTA 3AQPA 3E8OA 1NK0A 4O4GB 4DQQA 2YVSA 5L46A 4J9NA 3C66A 2XHCA 3N28A 2WVDA 5CHCB 2JEJA 3M30B 3HHEA 4DV6J 1YITS 2IBKA 4AXIA 2R2TA 1OY8A 3DRPA 4HLBA 4GVBA 5B08A 5MLCV 1SC6A 3C14A 2EC2A 3LP0A 1K0VA 1U09A 1IBKF 4ZHRB 1R3NA 4QIEA 3US5A 1XERA 3VAKA 4A8OA 1WF1A 3BH6B 3FDSA 4Y2MA 1RT7B 3W65A 1YQHA 3TUZC 3T5KA 2UXBJ 4CLYA 1R0BG 1JQGA 2XBPA 3IO1A 1QSSA 1S79A 1QVGR 3PNIA 2DO4A 4DL4A 2GO9A 4OZ3A 2JOQA 3FRZA 3T1HF 4YR2A 3QIPB 2LQ9A 2N4DA 2RF2A 4QW9A 2KFYA 1OWXA 2G1HA 3OFGA 3HHLD 4UTGA 3RAMA 4XPCA 3UR0A 4ES3A 4FF2A 3EPIA 2PI4A 2WRMA 2PDAA 2KHDA 2I0XA 3TUJC 4YUDA 3ULHA 4CYUA 2W9CB 4DSFA 2BVZA 4NRUA 2RU9A 3D0IE 3ELHA 5LSOA 1T3NA 4WE1B 2ZZMA 3CDUA 3KG4A 3E01B 1AZSA 2JNJA 4A8YA 4RWWA 2HAFA 1CJVA 2QGFB 4U8YA 2G0IA 4USJC 4N5SA 4XIUA 3BDPA 1FJCA 3QJPA 1WKKA 4M95A 3ZZRA 2DNYA 2POKA 3U02A 2NYHA 4LBIA 2XI3A 1UFLA 5F8HA 3J7YI 3MFIA 3DLLQ 2W25A 1RJJA 2WSCC 2AGOA 3EE3A 4DR4J 1IBLJ 2VFUA 2DKOB 1LEOA 3LO3A 4KFBA 4G1QB 5IXUA 2K1RB 1VQKS 1ZM2A 3G8SA 2MSTA 3AA8A 4KKOA 4R0EA 3JSMA 2KJVA 3K8VA 4AL6A 2DEIA 1L3KA 3KXDA 5AXKA 5F8LA 4CP5A 3WC2A 1EJ7L 4UOGA 2UP1A 2V2KA 5CYMA 4ELVA 5HL7Q 1Y5IB 2BW2A 2RH3A 3QWUA 2WCXA 4JI4F 2L48A 3HJVA 4KGVB 2ZHOA 3W61A 2UV8A 2ZITA 2E5GA 1TV6A 3PYFA 3SIPB 4F67A 3H20A 3P45B 4IKAA 3U1NA 3W62A 4BS2A 2R2SA 5DRKA 3DC2A 2PC6A 3I4PA 4E98A 3NCRA 2FVQA 1S1UB 3EXCX 3VGSA 3AFGA 2BE9B 4DV1F 1QAYA 2N3OA 1VYAA 5KOWA 1YVFA 2C2EA 1I6JA 2RQMA 1TL7A 4A8WA 2IY5B 3TAMA 4JI8F 4PUOB 1FNXH 1OQ3A 4DCPB 3OTBA 4HL9A 2Z2MA 3N79A 3BSNA 1RT2A 2E5JA 2LQ5A 2Z0GA 1HD0A 4JI0J 4EZ6A 1XBWA 3A3NB 2XCAA 1FI4A 4F4XA 1H0HB 2V5HG 1CS4A 6FDRA 2G0CA 2IDLA 1XR7A 4ZLNA 2WTFA 2V63A 3K5PA 4IH7A 1D09B 2B4UA 2RVJA 2XGPA 5CYQA 4ZPBA 1YZ7A 4K5RA 1GXLA 5GAHU 3CC7S 3SZ2A 4OJ3A 3SDEA 2OSRA 2FVSA 4P2SA 3N6LA 4OZ5A 3R97A 1N48A 1F6TA 1UVMA 3HHLA 2H5JB 3CEDA 4LIWA 3KJFB 4UZCA 2ZH4A 4C8ZA 1DTQB 2JEGA 4J7CA 2JL9A 1B7YB 3LH2S 1UW4A 5HBMA 3TRGA 4IOCQ 1S12A 4OYXA 3ISND 3NGSA 5HAOA 2HURA 2FC8A 4M5IA 4QIWD 5IC4B 2B43A 4F4AA 3BO3A 4OZJA 3AOCA 3OLBA 1C0UB 1TL1A 1QSLA 4PQUA 1ZM3A 3ENWA 3N6NA 5BR8F 4WZMA 2HFSA 3G82A 1KHVA 2W9CA 3H5SA 1XR6A 1TK5A 4FNIA 4A8MP 4Q8FA 1WF0A 5D4OA 1KLMB 1MN7A 2M70A 5D78A 2MQLA 4LJMA 3VAIA 1PCAA 2OUGA 5C25A 4RX6A 1M90T 4NXNF 1F9HA 3GIRA 3UN3A 3ENQA 2GZOA 3O5TB 4LUBA 2JLGA 4JV5F 2CA9A 4QCLA 4YOEA 3FCVA 1Y3KA 1S9GB 1QE1B 2D3UA 3GZ7A 2CG8A 2PEHA 4FKXA 4L76A 4PXCA 5CAAA 1UFKA 5LSLA 2R2UA 4PPDA 3QRQA 5F8IA 4ZP8A 4LR9A 4OX7A 2KVQE 1JNRB 3GJTB 2KRBA 3SQGB 2VG5A 3LF0A 5L1IA 2G0JA 2QSWA 2DRAA 1C4AA 2BJ1A 2OP5A 2O3DA 1G4CA 1UPMB 1VI7A 2RD5C 3BN4A 3CMQA 4KIAA 4HKQA 5D0RA 3UFCX 4HACB 3OFFA 2LCWA 4FYYB 4HHUA 2LMIA 5DLFA 1KC8T 3N9UC 1NKEA 4DF8A 3E51A 1T03B 3THPA 1C2PA 4ECYA 4CO2A 2ZM6J 3W2VA 5E5NA 1PC5A 3OTCA 1H98A 4WF9Q 3PEHA 2ZKTA 4P52A 4TY8A 3ZZ0A 2N7CA 2XNQA 4LRFA 1GFWB 1V3ZA 3I55S 4DPWA 1T94A 5BYSA 5KTQA 2XGQA 1FE0A 4Y34A 1OY6A 3RBZA 1N0UA 3OXFA 1H74A 4DCJB 2R7QA 4DS5A 1U0HB 3A8EA 2RRAA 2HYIB 4AT1B 2QIFA 3MMCB 4RW4B 3BR8A 3MM7B 1XQIA 5J1EB 2V2QA 4ZVRB 3RB6A 2BOAA 3C6TB 4OYAA 2CPZA 4LQ9A 4YR3A 2R9LA 4YR0A 1HYSA 1JJHA 1RE1B 2UUBJ 1R8AA 3K0JA 1JLFA 2YBVA 3UQSA 4QWAA 4NLTA 5CYMB 1DFDA 4L73A 1UW9A 5H9FJ 2ZJRQ 4DV7F 4OJ1A 3OJUA 1U4BA 2ZVSA 2AYGA 3P6YC 3FUYA 3GR0A 1YWXA 4PG5A 3ZTPA 4C6AA 3SMZA 3HMJG 4WFNQ 2J0SD 4C3LA 1P1LA 1RHQB 5D8HB 4CLPA 2M8HA 1HNIB 4I2PB 5L8RC 1WEZA 1DARA 3OFHA 4MFBB 2F8MA 4U67Q 2B5JA 4JI1F 4ZP7A 1JKHA 1QTNB 2YWGA 1YJUA 4GO5X 3PRDA 1F1BB 2VZ9A 2G13A 3BGUA 1YBAA 3ZTQA 2HHPA 1VOMA 4OHZA 3GP9A 2FVRA 1MN9A 1TVRB 3MAHA 2MYFA 3NOGA 4X4SA 3GV8B 1PYOB 1ZPVA 2PA3A 3I0SB 4LVOP 2VBXA 3EUNA 4DUTA 4F7VA 2VKZG 1OY9A 4ETXA 2J8SA 2QYCA 4EYIB 4EBDA 3RB3A 1ZH5A 5L9XA 3JQKA 3QSYB 1M5VC 1VRUB 2F5GA 3C15A 2NXCA 3ZZPA 4TQSA 3THVA 1VC5A 3IRXB 2CQGA 4QU7A 3IBCB 4LFBJ 1QY7A 5KFRA 2HZCA 1P27B 4IH6A 1F5AA 2YQ3A 2I9SA 2VBWA 2L41A 2V2VA 1NH8A 3KOAA 3KNAA 2KZMA 4AQYJ 1M5SA 1WNEA 2VD3A 5HP1B 1URRA 3H59A 2D69A 3QO9A 1WOOA 2N82B 1SJ3P 1DTQA 2IVMA 1CQMA 4M5MA 2DBBA 1S1XA 2NUHA 1NSAA 2ZBPA 3D3BJ 3D66A 1TUVA 1XWLA 4LREA 5F41A 4ECRA 4FF4A 3TQEA 2DR8A 3MECA 1BE4A 3W60A 4NLUA 4BDPA 5KG5A 2JHEA 1NK8A 4AYBD 1I94F 4KRWA 2X1BA 3DGVA 3TQ1A 4QIFA 4I2QA 2KB2A 4DCOB 4PCQA 1TAQA 1ZAXA 1TV6B 1RAEB 3HVTB 4RNNA 3I5AA 2GVZA 5J2PB 3P4UB 1FKPA 3UCZP 4PWDB 3FKBA 4X4UA 4C2MA 5KG4A 1R89A 2EW9A 3RZAA 2KT2A 2MLZA 2QLJB 4NXMJ 3ILIA 3MM6B 4X64F 3MGJA 4C3KA 3OTEA 5EN1A 1X5PA 4LMZA 3SI8A 1KOOA 2C3YA 3KHGA 1VQ4S 1WC6A 1VQ7S 1HQUB 3Q23A 3WZ0A 1HNZJ 2GHVC 5F0WA 1SKWA 3AHPA 1FXDA 3SYZA 1U47A 4QBUA 3A3OB 2CPEA 1M1HA 4IRDA 2WSFC 1FX4A 1GX6A 3TWZA 4EZ9A 2DXDA 1BY9A 2YNIA 4DL3A 1TL4A 2HHSA 2XG8A 1EQ0A 2BR0A 2J9CA 2JC1A 2WK4A 3HFZB 4ZPWR 3G2XA 1VDHA 2XSJB 3W63A 4DX5A 3CCQS 4DL5A 2OFGX 2Y1RI 3VAGA 2UUBF 4MKYA 1BWVA 1AW0A 1WTFA 3TYTA 2C2MB 2E9RX 2ZOFA 1QAXA 4DSKA 2HLTA 3DOKB 1D3WA 5DLGA 2W9BA 3DMJA 2ALYB 2GX8A 2QN6B 3JSBA 2BE7D 4MAKA 2JVOA 3LW5C 2FLNA 1CS4B 3ADAC 2X3GA 3TNVA 1WG1A 3TAPA 1SUQA 2K7KA 2XMMA 4OHYA 4KO0A 1HARA 1J27A 4K59A 3TAMB 1RQ0A 2BW7A 2D9PA 2KH9A 4K4XA 1RTIA 3BF4A 3FJ2A 3ZFVA 2Z8QA 3R27A 4PG4A 4QIVA 2DGQA 5I4MA 5EWFA 3UD3P 2W7AA 2C2ZB 5KFWA 3AD7C 5LJ5Y 4PUOA 2W7PA 5DS7A 4DV2F 3CDWA 3BJYA 3EZUA 2EFGA 4JI6J 1JNZB 4G3IA 4EO6A 1T3OA 2EPIA 4ES2A 4ELUA 3ILLA 1S9GA 3GG1A 4H4OB 5LSRA 3LWLA 4O3RA 2X1AA 1C0TB 3OL8A 4LBHA 3CCLS 4K5SA 4DF4A 4UZBA 4P7VA 1UCNA 3FK4A 4RUHA 4NE9C 5HVFA 3PJXA 3IS9A 2C28A 2CADA 3QYYA 4NZ6A 3S01A 1VR6A 2Z30B 4K8RA 8AT1B 3NP5A 2AWZA 4FN5A 1RT1B 4RW9A 1NDLA 1WJ9A 1HBUA 3MF5A 4YEAA 2HSEB 2WZ1A 2E1PA 4LSZB 3UN5A 3FCHA 1UL3A 5AXNA 3QRPA 2ZVIA 2UUAJ 1VRTA 2IRXA 3OR2B 3P8BB 4KSEB 4WYWA 5C7PA 1QE1A 2DHSA 3HHDA 4CNYA 4UY85 2YTCA 4RUAA 3FSYA 2RHSB 2RDDA 4P2FA 1SV5B 2QLWA 1S1VB 4YFUA 1B0TA 3GIIA 2H9ZA 2JDJA 2HQCA 3JAMY 2R7TA 1NPPA 4ZVSB 3BBCA 2GGPB 3ET6A 2PA8D 2RQ4A 4HACA 4OI3A 1WACA 4ALZA 5B0GA 2P8IA 3W5ZA 4DS4A 1SL2A 1HNXJ 2O1PA 3M9MB 3O1LA 4QJVA 2IPOB 2BANA 2DNHA 3RBEA 3BGRB 2CNKB 4IDKA 2W9BB 2VUGA 1I94J 4B9MA 3M1VB 4V1Ak 3U1MA 4YHHF 1W25A 2QG9B 3IGNA 5HK4A 3AJ1A 4OI6A 1FK9A 5FDLB 5BYRA 4DPYA 4QPXA 3A12A 4O0NA 1NSQA 2GIQA 4B02A 2E5LJ 2FB0A 1RWXB 2ZD1A 1CJKB 2DGTA 3HZGA 4WXOA 2HG4A 4YN3B 3PEJA 1YG0A 3SCJE 2F9DA 3OV7A 4KPYA 4YB7A 4L72B 1A7GE 5HVGA 3KHRA 1SCJB 4BCAA 3M2RA 3BH7B 1LW0A 3D68A 3JS9A 4OYOA 2DNOA 4FPRA 5KG3A 4DL7A 3T19A 1BD6A 5CD4H 3C19A 4GO7X 1CVJA 3EGVA 2LXFA 5CZVA 3HSGA 1QAJA 3OTOJ 1RT2B 1WWHA 2F8EX 3TZYA 3VTIA 1FJGJ 4PXEA 1RSCA 4O4GA 5DO2A 4Q44A 1ICEB 4DR2F 1M5HA 2JLEA 2GIFA 1E6VA 4P73A 1N5SA 3PX4A 4LQ3A 2GJ2A 2BABA 1LW2B 4DV3F 4NA3A 4N77A 1TKTA 4RNHA 1P9QC 4J91A 2XI2A 1JXLA 1JJ4A 3CO9A 4PZVA 4LSLB 2VJUA 2ASDA 1UFWA 2FHOB 2MZRA 4ILMA 1P9YA 3DOMB 1HWUA 1S6PA 2HS0A 5E3QA 3JQMA 5KFIA 1L3SA 2MQ8A 1D1UA 4C8LA 4F2RA 3MR3A 1JIHA 3BKUA 4OJHA 5D3GA 3EDQB 1IKWA 4CH7A 1HWKA 3NS7B 3MPVA 4HTIA 5KFKA 3QJJA 1MG7A 2XWYA 1ZA1B 2W4CA 5FIIA 2YH1A 4IUFA 2FLOA 5IZHA 2GQCA 3OFEA 1TAUA 3V2UC 1H7WA 2MQOA 5C25B 3KMSA 3BKFA 1KDNA 4F25A 3M32B 3V6JA 2AJFE 2UUWA 2E9TA 2UVRA 3L95X 4WFXA 5KG0A 4PYDA 5T7LB 1XNRJ 1RLCL 1JLQB 4FF3A 2Y9HA 2QLFB 3H7HB 3OL9A 2CDQA 1D9DA 3HPOA 2W8KA 1VRUA 3C15B 3NRBA 7FD1A 4X4OA 2ZDPA 5AJ3J 1F3FA 2E1MC 4FS1A 4OV6A 2QA4G 3B4MA 4F3QA 2ZKUA 1T95A 5ETMA 3MPWA 2DCLA 1EKRA 2JLFA 1B3TA 2DNMA 2ZH1A 3QGGA 4RUBA 4KKOB 1WKJA 3VGUA 5ETSA 4JV1A 4IOAQ 3IWXA 2HEKA 1HNVB 1RBLA 3CJ2A 3M8YA 3W5XA 3AXMA 3PVXA 3D9BA 4DQRA 2I1RA 4WFAQ 1SKRA 1LQ9A 3KDNA 2HFZA 4EGLA 2NREA 3UWTA 5T41A 2J7UA 4N8OA 5GMKa 2CPIA 3LANA 1F9FA 4YY3F 2OPRB 3AB4B 1LFWA 3M2RB 2XYPB 1V3SA 2WONB 5DETA 4USIA 2F3JA 2ZHBA 4DUYF 2DNNA 1MSWD 1N88A 1HQUA 2GJIA 2ACYA 1ELOA 2KXHA 4MKVA 4UQTA 1R6VA 5D4NA 3DOKA 3FC9A 1R31A 3OUYA 1WC5A 2QJ3A 3TEGA 2DY1A 3UVJA 4PYAA 2JJ4D 4FF1A 4WFYA 3N01A 3KHLA 2UXCF 3FBCA 2IJNA 3D6FB 1FEEA 2PN6A 2HBRB 4R5PA 1WDDA 4FBUA 1BQMA 2EBGA 4ZKAA 4GC7A 5EWEA 3M1VA 1KRPA 1AT1B 2GO8A 2RS8A 4LFCF 3EICA 3JAMU 1F60B 4P7TA 1L3TA 1HBOB 2H5EA 2VG6A 1MMNA 1FWPA 2C2DA 4WFZA 2KYZA 4GVLA 1ZTWA 2CYYA 2DNQA 4IO1A 2UVUA 4B3TJ 2ZNYA 1NH7A 2VQFJ 4W92B 3DI6B 4H4MB 3CT9A 3VVUA 1U49A 5F3ZA 1N6QB 4DI6A 1RWPB 4DR6J 4ZVPB 3AH6A 3T1YF 2VODA 3CCWA 3WBZA 2RF2B 4B9TA 2C3PA 4LF4J 2CNOB 4Y2AA 2VH7A 1H73A 4M1KA 3I0RA 4RBVA 2HVHA 1RWUA 1U2FA 1UZHA 2MZQA 4ZVGA 4CZCA 4X62F 2LA4A 5F9LA 1XNQF 2EC0A 1TU0B 1W2IA 5GAGU 3KHHA 2VASA 2V34A 3K89A 2NXJA 2QFJA 2DNZA 3UO0A 4CIOA 2X1GA 2XYGB 3CJQA 4RNOA 4K4SA 1FT8A 2OEMA 3R2DJ 2R7UA 2P9CA 1Q16B 3F44A 4EBCA 4IQXA 2VQEF 4C3MA 1X60A 2OGUA 1T9WA 2B4OA 5C42A 3TANA 1HNWJ 2HHTA 1I1GA 4QYZK 1N5TA 4M5HA 3OBIA 4JYAF 3QRRA 2DGXA 5H9EK 1UZDA 3ICLA 4Y2IA 4CH0S 2EWHA 4EEYA 2WOMA 4IDKB 3FEZA 1TL3B 3BYRA 4DL2A 4O44B 1W26A 4P72A 3ILJA 4R25A 1RUSA 1A9NB 1GTEA 2G2YA 1B7FA 3GYXB 5CA5A 4FXWA 2LEBA 1WHXA 2OPPA 1TZ0A 1XIQA 2GGPA 3ET6B 1MWZA 1HKAA 3OT9A 4MJKA 2BJEA 4TY8B 2R7XA 2CZVC 1B99A 4ZVOB 4LR7A 4O3SA 2I5JA 4TU8A 1EQMA 3LGNA 3JB9k 3O3LA 1DBDA 1LNQA 2IRYA 4O3PA 1FRIA 3OHBA 1JJCB 1Z2LA 3CPWR 4DR1F 4ANCA 3CNQP 2V50A 3QZ8A 3HX9A 3IBFB 1VQMS 3ZZUA 3W2WA 2KG1A 4DPTA 4ED2A 2VFVA 2KN4A 4RW4A 5EGYA 1L3VA 3EVMA 5CCMA 1UEUA 3FZBA 4FXVA 4ZVQB 1NK7A 2JX2A 3DYAB 4RW6A 5A2QY 2YWFA 3D2WA 3LAMA 4OI1A 4LF8J 4LF1A 2DGUA 4L75A 2C3OA 1BQXA 5AXLA 4N41A 1XK8A 3PFOA 3QATA 2XMWA 2DNKA 1RTDA 2DR9A 3MR5A 3J7ZT 4O23A 3D6TB 4I7FA 3RG6A 2YNGB 2R8IA 1U8SA 5B0CA 3GYGA 2KHCA 2CQDA 4OJGA 3K5LA 3M2UA 1FRHA 1Q8IA 3C16A 1FX2A 4S0MA 5E7OB 1EP4B 3NGDA 2KZZA 1O8BA 1J5OA 5C5JA 3CMAS 1C1BA 2IYGA 3DGPB 3CE8A 5A8KA 4OZ1A 2DR7A 1SC1B 1JXVA 3G87A 3ZNUA 3K5MA 3ZZTA 1RU1A 3CB4A 1EX8A 4KO0B 5HN0A 4FPIA 3FBFA 3I0RB 1N36F 2DIVA 1LWXA 4LSLA 2HRYA 4OHXA 1IKVB 5B09A 2VG7A 3QZ7A 3CF5Q 1VFJA 2OMLA 3NLCA 2Y1IA 2JC0A 2YKMB 3CDAA 4ZCMA 1N5QA 2JEFA 2UUAF 3VAMA 2HQFA 4BC7A 4YDXA 3DRRA 2HHVA 4LVNP 4KH1B 1YKWA 1D9FA 1BXNA 1S9EA 3HT0A 4CO0A 4U95A 2XC9A 2RDJA 3CCMS 2QLBB 4J9PA 2HQGA 1HBOA 1BWEA 1KFDA 4OZ0A 1FFWB 4DR3J 1IUJA 4KH0B 3KLHA 3BO2A 3VR1A 3K5OA 2ZH2A 1GMUA 5HP1A 1VQ8S 1FDDA 1Y5LB 4PXDA 2FPHX 2O66A 3POTA 2LVWA 3EGNA 1RAGB 1JX4A 3BGOP 5J1NA 4NXNJ 2Q66A 4PQUB 2IVYA 1CULA 4J37A 4U96A 2W7OA 1O51A 3Q2TC 2MTLA 4QPTA 4ATNA 1TFWA 4CLKA 4F4ZA 1YIJS 2XY6A 1UWBB 3P5BP 2DT9A 1JLBB 5ADZA 3QWPA 3BEGB 4D3GA 3KK2B 5HMYA 1VBYA 2MKJA 2IC3A 4I0WA 1KFSA 2UUTA 2A18A 2BJ9A 4XDDA 4ECWA 2HMIA 3KJVB 4ED5A 2ZH7A 2YQ0A 4M5KA 3BS9A 3D6HB 5L9NA 1FKAF 1CJTB 2RJZA 3EM1A 1MW7A 4GMKA 4U8VA 5LXYA 2A6MA 3IG1A 5F8GA 2YPYA 5F9NA 3KLFA 4UOCA 4CCHA 2HNYA 2E1RA 2Q1LA 2QT7A 5KT5A 2ZBQA 3IRWP 3GQCA 2KFZA 3CIZA 3PV8A 1TKDA 2MLXA 2L08A 3KMQA 4DFJA 1X0PA 3PM9A 1HLWA 2B9WA 4OYIA 4L74A 2ROEA 5KG2A 3BKTA 2W2PP 2M9KA 2EVZA 2C42A 3DXSX 1T9TA 1O6XA 4DHVA 1H72C 1U1OA 2YPZA 2FJAB 1Q1KA 3M9OB 3H4BA 3MCMA 5HJXA 2UUCF 1PYSB 1H7XA 1FRLA 3NEKA 4IRCA 3HFKA 3H2LA 1ZM4A 1WKLA 4U7UK 3L7PA 3DLEB 2QL9B 4ZLJA 1G6BA 1XNQJ 3M05A 1J5OB 1EKSA 4WP8A 5CCLA 1S5ZA 5F8NA 2ZE2A 3V6DA 1YJVA 2YX4A 2ZWPA 4KTQA 3Q0AA 4DDFA 1M5PC 1MWYA 3KLEB 2JEIA 4M5GA 1YBUA 4NMXA 3VWSA 1NDPA 1RT4B 2CPYA 1KVJA 4ZS6A 2RKIB 5GAGI 3IWNC 2IA6A 4JB8B 4CDIA 6AT1B 2CPDA 3UDVA 3EPGA 3ISNC 2RQCA 1YBTA 4KR0B 5A6WA 3CC4S 1RTHA 2VQFF 1U25A 4DQSA 3X1LB 3PHTA 1VQSA 3HXMA 1VBZA 3T5HA 2XSFA 4I4BA 5GMEA 1R8CA 3MR6A 2IDEA 3HFVA 3S8SA 5I3UA 5C24A 4TU7A 2FYXA 2EBEA 3AOAA 2HQDA 1FHTA 2OIHA 1IBKJ 3IMQJ 3KKFA 3M6UA 3IM8A 1DURA 2XMJA 4KYZA 2BQ3A 2HVDA 1KN6A 3MTJA 1ZAVA 4DQIA 2MHNA 1XMBA 3TP2A 1G2EA 2WHOA 1M1GA 1NJZA 2F65A 4YP3A 3J7A1 2VA2A 1QUVA 4BWJA 1TVRA 3HKWA 2IBOA 3HI9A 2H5IB 4A8QA 1RT3A 3D0GE 3EJMA 3BR9A 1QJHA 3CJ5A 1RT5B 4NLDA 2ZWOA 5I3QA 2MGZA 3PZPA 2MZSA 1TKZA 4DUYJ 2ALZA 2QEXS 4ZK7M 4DMZA 1S72S 2MJUA 1RWKB 3L09A 4ZLLA 2GQ2A 5M2UA 5EDWA 1BMQB 1S48A 4K2JA 1HBMA 1CBKA 1FFSB 2N4CA 3DRRB 4O3OA 2FHMA 3WDOA 1GH8A 1HHQA 3MMAA 4PKDB 2I5JB 1BUXA 3NGUA 3SXLA 2M3DA 4ZVHA 4OMFG 3AT1B 2GVDB 3GILA 1KTVA 4WPAA 2IHR1 1HQEA 4OQJA 2BKPA
chains in the Genus database with same CATH topology
2GVZA 2GVZB 1WC4A 1CULA 4OYOA 1WC1A 3C14A 1CJKA 4CLKA 3C16B 3UVJB 1CJUB 4CLLA 1AB8A 1WC6A 4CLYA 5D0HA 4OZ3A 5D15A 5D0GA 5D0RA 1CJTB 1FX4A 2QV6A 1U0HA 2W01A 4OYMA 4P2MA 1AZSA 4OYWA 4OYIA 1CJVA 4WP3A 1Y10A 4USWA 5IV4A 1U0HB 1CS4B 4NI2A 4CLWA 1CULB 4CLTA 4OZ2A 1WC0A 4OYAA 2BW7A 1CJTA 3ET6B 4WP8A 3C15B 4OYPA 4OYBA 1YBUA 4CLFA 4OYZA 4CLPA 4CM2A 3MAAA 4USUA 1YBTA 1WC3A 4CLUA 1AZSB 4USVA 4WP9A 1Y11A 1TL7A 3MAAB 2WZ1A 4CLZA 1CJVB 1CJUA 3R5GA 3C16A 1FX2A 3C15A 1CS4A 1TL7B 5IV3A 4P2FA 4CM0A 1WC5A 3UVJA 3ET6A 3MR7A 3G82B 4CLSA 3C14B 4OYXA 1YK9A 4NI2B 4USTA 3G82A 1CJKB 2GVDB 2GVDA 4WPAA 4P2XA 5D0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GVZ A;  2GVZ B;  1WC4 A;  1CUL A;  4OYO A;  1WC1 A;  3C14 A;  1CJK A;  4CLK A;  3C16 B;  3UVJ B;  1CJU B;  4CLL A;  1AB8 A;  1WC6 A;  4CLY A;  5D0H A;  4OZ3 A;  5D15 A;  5D0G A;  5D0R A;  1CJT B;  1FX4 A;  2QV6 A;  1U0H A;  2W01 A;  4OYM A;  4P2M A;  1AZS A;  4OYW A;  4OYI A;  1CJV A;  4WP3 A;  1Y10 A;  4USW A;  5IV4 A;  1U0H B;  1CS4 B;  4NI2 A;  4CLW A;  1CUL B;  4CLT A;  4OZ2 A;  1WC0 A;  4OYA A;  2BW7 A;  1CJT A;  3ET6 B;  4WP8 A;  3C15 B;  4OYP A;  4OYB A;  1YBU A;  4CLF A;  4OYZ A;  4CLP A;  4CM2 A;  3MAA A;  4USU A;  1YBT A;  1WC3 A;  4CLU A;  1AZS B;  4USV A;  4WP9 A;  1Y11 A;  1TL7 A;  3MAA B;  2WZ1 A;  4CLZ A;  1CJV B;  1CJU A;  3R5G A;  3C16 A;  1FX2 A;  3C15 A;  1CS4 A;  1TL7 B;  5IV3 A;  4P2F A;  4CM0 A;  1WC5 A;  3UVJ A;  3ET6 A;  3MR7 A;  3G82 B;  4CLS A;  3C14 B;  4OYX A;  1YK9 A;  4NI2 B;  4UST A;  3G82 A;  1CJK B;  2GVD B;  2GVD A;  4WPA A;  4P2X A;  5D0E A; 
#chains in the Genus database with same CATH topology
 3U7J A;  2PII A;  1VS3 A;  5GAE I;  1GEH A;  4Q5V A;  1FFG B;  4Z37 A;  1XC9 A;  3AOB A;  3OSN A;  2Y3Y A;  4UOF A;  2MLY A;  2XLJ A;  3EX7 B;  4UW2 A;  2CQ3 A;  1KP6 A;  2FJD B;  1S99 A;  4LF7 J;  3MPD A;  4AL5 A;  2V2Z A;  3OL7 A;  3KK2 A;  4DV7 J;  5J2P A;  4WZQ A;  3HCX A;  1SI9 A;  2ZD1 B;  1FVQ A;  1IKX B;  4OHV A;  4ZIT A;  1H2T Z;  4QWE A;  4TN2 A;  4J9Q A;  4GRS A;  1NK5 A;  5D15 A;  4WXW A;  3W5Y A;  5B0E A;  4BLG A;  1DRZ A;  1VQP S;  2A6O A;  1ZM9 A;  2OPP B;  1TK8 A;  2NSC A;  2FLL A;  3LAK A;  3C6U B;  4WCE Q;  3KLG A;  2IMW P;  2OD6 A;  1FA0 A;  1U0H A;  4RLE A;  4CO5 A;  3HP6 A;  2ZH9 A;  4J9K A;  3RB4 A;  3MM7 A;  4ZJO A;  4KGZ B;  2CJY B;  5J2N B;  3MMB B;  2KRR A;  3PKY A;  3Q8S B;  1OO0 B;  1JLE A;  1I3O B;  1CC8 A;  4N8N A;  3W2W B;  1YJW S;  2AX1 A;  8RUC A;  1IVZ A;  3MEG B;  3UDE A;  2P6S A;  3HF5 A;  1IWA A;  2NCK L;  5A8W A;  1UWA A;  2ZNZ A;  2N3L A;  3P96 A;  3PIO Q;  4DOZ A;  3LOU A;  5LXR A;  2YKN B;  3MDF A;  1UA0 A;  1IR2 A;  3LAL A;  4F04 B;  1T11 A;  4DFM A;  5KT2 A;  5KFL A;  5B0B A;  4B9S A;  3CJ0 A;  1BLU A;  1GQE A;  1U6F A;  2YXL A;  3B82 A;  3QIP A;  4N7T A;  4MH8 A;  2DIT A;  4RPF A;  5HAT A;  1RI7 A;  5F0U A;  1IKW B;  2B3T B;  4X64 J;  2JFD A;  4C8K A;  3TVZ A;  3MM5 B;  5A8R B;  1FXL A;  1TR0 A;  5HQ8 A;  3I82 A;  4WJB A;  1JJ2 R;  2GFF A;  2XMU A;  3FVY A;  4NEY A;  2CRL A;  3GWC A;  2GV1 A;  5E0O A;  1D8Y A;  2X51 A;  4CLF A;  2PSZ A;  4CM2 A;  3M6V A;  1ZA2 B;  2DHA A;  5L1L A;  1Q7L B;  1SIZ A;  4A48 A;  1RYS A;  2IRU A;  2HS4 A;  2C2O B;  1YRX A;  2YKO A;  4J9S A;  3NS6 A;  1NME B;  4M5J A;  2VV5 A;  2YWW A;  2E5L F;  2MZ1 A;  2D3O 1;  3MAA B;  1S6Q A;  3KLI A;  3ITH A;  3NAI A;  1MRO B;  2OMO A;  4UUX A;  2EG2 A;  3QT8 A;  4MYT A;  2DYA A;  1RWO B;  2XZW A;  3IR6 B;  2HIQ A;  3I9Z A;  1OSD A;  3IS9 B;  4ECU A;  1DTT B;  1IWG A;  2FHK A;  5CAB A;  3MED A;  2HIY A;  1TKX B;  5EUH A;  3D28 A;  3H8Y A;  5ETK A;  2HND A;  3PXG a;  5KFN A;  1KQK A;  3L7O A;  3KK1 A;  3V81 B;  1LWF A;  4IRK A;  4LF4 F;  5CD4 A;  4Q0B A;  4C97 A;  5ETT A;  1AUS L;  3H0P A;  4X4T A;  3GJQ B;  2IIH A;  1E6Y A;  4UOH A;  1HR0 F;  4ID8 A;  4F50 A;  4J9O A;  2CJB A;  1WOP A;  1PAE X;  2WVB A;  5J2Q B;  2WBR A;  2FJE B;  3VQS A;  1U2C A;  1OMS A;  1S1U A;  3D67 A;  3GU0 A;  4RW7 A;  2NZ4 A;  1LOU A;  2HHX A;  3WHI A;  4CT9 A;  3PAC A;  2DR5 A;  4PWD A;  2H3E B;  2CNL B;  1U1P A;  2NZC A;  4JI5 F;  1AFI A;  3R6L B;  2LQJ A;  1Y5N B;  2CPF A;  4M5L A;  4LRB A;  2MXY A;  2XEX A;  4KPC A;  1G1X A;  3CDB A;  4DFP A;  3IP0 A;  5ETP A;  2BBE A;  2OPQ A;  2FD2 A;  2R4F A;  3R1H A;  1Q86 T;  1YJR A;  3J7Y U;  2CPX A;  5E3A A;  5HQM A;  4B3R F;  3V4M A;  1BC6 A;  3CD0 A;  5IC6 B;  1KQG B;  3AA9 A;  3DCA A;  1NDC A;  1WC4 A;  3ENA A;  5AE2 A;  5J2M B;  2VBZ A;  3M9N B;  3IFE A;  3GLJ A;  3N0V A;  1RAD B;  3NWG A;  5M2P A;  4NWB A;  3L3C A;  4ED8 A;  3HJF A;  5JJB A;  1HFE L;  1SL0 A;  2JH3 A;  4CTA A;  3UNG C;  3G9C A;  1MNE A;  2L9W A;  4U7U D;  1EAR A;  5LJ3 Y;  5ETQ A;  4ED7 A;  4IR1 A;  5GMD A;  2BM1 A;  1T9X A;  3HVA A;  1IKX A;  1RAI B;  2XUL A;  1O5J A;  1Q7Y T;  1PC4 A;  1LK7 A;  1RHM B;  3D54 A;  3N5F A;  4Y28 C;  4NLX A;  1Z1Z A;  4CH1 A;  5KFG A;  2XMV A;  2HPU A;  2FGC A;  2JSX A;  3G6X A;  3DI6 A;  4H4M A;  2DGS A;  2MY7 A;  5KFB A;  4GKJ J;  2DXF A;  4YB6 A;  4ECV A;  2RQK A;  4QR0 A;  2NQP A;  2VG7 B;  5HBM B;  1LW2 A;  4WU2 A;  2DIU A;  5K8O A;  3KYL A;  1NRK A;  2V8G A;  4HHJ A;  1JLE B;  4ECT A;  4JOU A;  4NL5 A;  2OSQ A;  1RTI B;  1LV5 A;  1C0U A;  5C24 B;  5KT3 A;  4G1I A;  3AD8 C;  1S76 D;  1L3U A;  3T5J A;  2AYM A;  2IM3 A;  3HK2 A;  4Y00 A;  2ADB A;  1RLD A;  1UMJ A;  3EZ5 A;  3R9L A;  3RGI A;  3DHX A;  1RK8 A;  4AE5 A;  4DSJ A;  2E7V A;  2JRS A;  4JP8 A;  3HZE A;  1HW9 A;  2V9K A;  5D4L A;  2K06 A;  5IWA F;  1WEL A;  3G86 A;  3KLI B;  3ONQ A;  3R2C J;  3KK3 B;  3HHL B;  2PFD A;  1CEZ A;  4WKR A;  1YJ9 S;  2J76 E;  5HRO A;  1X4D A;  4MT1 A;  3TEH B;  2COL A;  5AE3 A;  2CKW A;  1RHJ B;  1PJ7 A;  3SFU A;  3VCD A;  2W2N P;  4UT4 A;  1LWF B;  4X4R A;  1FNM A;  4Q0B B;  1NM2 A;  3GR1 A;  3ZO7 A;  4M63 A;  4OYP A;  1TUW A;  3FMW A;  3A1Y G;  3G96 A;  2HHU A;  4UQG A;  2RHQ B;  2XS5 A;  2UV8 G;  1IJF B;  2PD1 A;  1HBM B;  1X31 C;  2CWK A;  2B51 A;  2CFX A;  1YRU A;  1AXQ A;  2Y0B B;  4RW7 B;  2A2C A;  1RAA B;  3SCI E;  2HFU A;  1XEZ A;  2J9D E;  4A4J A;  4RUC A;  3CCS S;  4I1T A;  4DSL A;  3VGT A;  2KO1 A;  3IM9 A;  3QFH A;  5AE1 A;  2MDA A;  5CYJ A;  4CLU A;  3JYT A;  1RB0 A;  1AYE A;  1ZET A;  5DDP C;  2XY5 A;  4B9L A;  1F9E B;  3T6B A;  4WTY A;  4LBP A;  1R6Y A;  3M6X A;  1OSC A;  1VHF A;  3KG0 A;  4Y2K A;  4ED4 A;  3MMA B;  1U1K A;  4NXM F;  2V8P A;  1HYS B;  3PW4 A;  1CSJ A;  4KHM A;  5EHH A;  2KG0 A;  2R7O A;  3MZI A;  2V9W A;  3FMB A;  1HR0 J;  4W4M A;  3SCK E;  2UXD J;  5GAD U;  4TVA B;  2XZD B;  5KFY A;  4ZJQ A;  3DYA A;  1FJG F;  1WI8 A;  1RAB B;  1S4E A;  2FGO A;  3CJ4 A;  4A8S A;  3RR7 A;  2R7V A;  4HEA 9;  2FHJ A;  4Z7C A;  2IYI A;  5KG1 A;  2GHW A;  4P9S A;  5H1S V;  4B3O A;  2RUS A;  5KFT A;  2HNZ B;  2AP6 A;  1SKU B;  1YJT A;  4ECQ A;  3DDK A;  3RUB L;  3UI3 A;  2EXU A;  4JI3 J;  2R3V A;  1FRX A;  3Q8Y A;  4O4R A;  4DQP A;  3OSP A;  2MKS A;  4LFB F;  3VV2 B;  2BQU A;  1R0A B;  3NNC A;  3HHL C;  3GSD A;  3PYE A;  3W66 A;  5LMN F;  1NXI A;  1GAO A;  3T9N A;  2MQQ A;  3MM9 A;  1NZ8 A;  1YRT A;  1WUU A;  4C8N A;  3O8W A;  1SH0 A;  4OI0 A;  1FKO A;  2WB4 A;  3I0S A;  3N4W A;  4X65 F;  2HLU A;  3M4X A;  3DDI A;  1VIS A;  4F0M A;  4K4U A;  2PT0 A;  4P2X A;  4P75 A;  3GIM A;  3IN5 A;  1NK6 A;  5D0E A;  3C8Y A;  4QWC A;  3F56 A;  5HQL A;  1SKS A;  1NHU A;  3PJ9 A;  2AYB A;  1OYE A;  2KFN A;  2EEY A;  1NHK L;  1X4A A;  2UZA A;  3IXQ A;  1S0V A;  3RW7 A;  3G4S S;  1WG4 A;  4FXD A;  2XLK A;  2DEJ A;  4F3O A;  7AT1 B;  5KFQ A;  1IBL F;  3ZZZ A;  3QJL A;  3GYN A;  4KBI A;  3I5C A;  4RU2 A;  2YNF B;  5KAK A;  4JI7 F;  2A2D A;  4H4K C;  2HZA A;  2JWN A;  2YX1 A;  4Y6I A;  3UE2 A;  2V4J B;  1IR1 A;  2M52 A;  2MQP A;  2RB7 A;  3K57 A;  5IT9 U;  1IKY B;  1GXT A;  3H98 A;  3Q8Q B;  3LUY A;  4CRJ A;  1ITP A;  2K8G A;  3GG0 A;  3TJ8 A;  1LWC B;  3QGP A;  1RT5 A;  2F8H A;  3CME S;  2MPU A;  2W4P A;  2AIR B;  1UVN A;  1SVD A;  1RAF B;  2FIU A;  1NCL A;  5LMU F;  3PYD A;  3K5N A;  3H5U A;  5J2Q A;  1N32 J;  3QT6 A;  2VPX B;  1KD1 T;  1M0S A;  4K4Z A;  4QIG A;  3TJA A;  5KFP A;  2FJV A;  1JLQ A;  3MD1 A;  4F02 A;  1KHW A;  5BJR A;  1S9F A;  1S49 A;  2E29 A;  1VRT B;  2XMK A;  3OR2 A;  4CNZ A;  3MM6 A;  2EFN A;  4Z2X A;  2WB1 D;  3UW1 A;  4MIA A;  4WFB Q;  3A8I A;  2VF3 A;  3CTR A;  4K7Q A;  4DXL A;  2NXU A;  2UXB F;  4KAI A;  1UJ4 A;  3PHE A;  4DSE A;  1IXK A;  2R8J A;  5ETN A;  1MRO A;  1WC0 A;  2MY8 A;  2AEJ A;  4RNF A;  1RBA A;  1QD1 A;  1H6K X;  3PW2 A;  2D1C A;  1PKU A;  1X5O A;  1R0C B;  1TMM A;  2EK1 A;  2F4F A;  5FJ4 A;  1HNV A;  2YWH A;  4Q8E A;  2IA0 A;  2B7C B;  2J7K A;  4JUZ A;  1XMQ F;  1WF2 A;  1OPI A;  2MMY A;  1HI8 A;  2HBY B;  4NYO A;  3BGR A;  3TA0 A;  4KJI A;  2DHH A;  2QE5 A;  3R7S B;  1I51 B;  5LT5 A;  3RAX A;  1E6Y B;  4I69 A;  1B0P A;  4A8F A;  3BM7 A;  4OYZ A;  2DHX A;  3GMG A;  5CQG A;  3AOD A;  4WTO B;  1XNR F;  4M5D A;  1VJW A;  1K73 T;  3S7R A;  3D5M A;  3R5A A;  5E3C A;  4TYA A;  3W7B A;  3CXC R;  1LFP A;  1CPZ A;  5KT4 A;  3HVW A;  4HI1 A;  2CQH A;  1N33 F;  1T0T V;  2CVI A;  4PG7 A;  3DRS B;  3DXB A;  3H25 A;  1WOS A;  4QYZ J;  4FYV B;  2DVI A;  1U1Q A;  4B3S F;  4LF9 J;  1UVI A;  1FNO A;  2DGV A;  3ENV A;  1VCT A;  4RBT A;  3FZ2 A;  1Q82 T;  3QGH A;  1T02 A;  3CCZ A;  1HI0 P;  5THW A;  2YNH A;  3Q83 A;  4AFF A;  2VOO A;  5KT6 A;  4H54 A;  3EVW A;  5A2Q U;  1K0T A;  1DHM A;  3Q8U A;  1D0E A;  5CZX A;  3GCX P;  2FZK B;  5EX0 A;  3MEG A;  2BKO A;  3FRY A;  1DAX A;  1GXU A;  3PRV A;  4NEZ A;  4DPU A;  1RTH B;  4WKY A;  3OVB A;  4K2X A;  2HW3 A;  2NS1 B;  1JLF B;  4V19 J;  2MZJ A;  3MUT P;  2YNI B;  2I2Y A;  2OH2 A;  1RKJ A;  2W2Q P;  5I3U B;  1IN0 A;  2B9X A;  3G6V A;  2J0X A;  1RT7 A;  2XZT B;  4CTA B;  5J1P A;  3LPE A;  5HI7 A;  4CQ1 A;  3AJD A;  1FTC A;  2DH8 A;  3MM8 A;  2CQI A;  4HT5 A;  2E66 A;  4F26 A;  5D6G A;  1HNI A;  3GIJ A;  3BQ2 A;  1N6Q A;  2JFK A;  3OLA A;  2OI2 A;  1DZ5 A;  2E5I A;  2R2R A;  5SUH A;  4CO4 A;  2NXN A;  3CJR A;  4X65 J;  3MM9 B;  3L4B C;  3QLH A;  4TU9 A;  4JV0 A;  2AGP A;  4Q2L A;  4ZN1 A;  1ACM B;  2BJD A;  1U1N A;  1NK9 A;  4F4K A;  1APS A;  4IO9 Q;  1UVK A;  2Q3P A;  2VC1 A;  2R7R A;  1SQF A;  2Z2Z A;  3ZZY A;  2CJK A;  2BQR A;  2AJ4 A;  5ITH A;  3PY8 A;  2HHH F;  4FP9 A;  1K47 A;  1U1R A;  4OX6 A;  2GVZ B;  4UY8 T;  3L9Z A;  2CQB A;  3QNW B;  1T9V A;  4JI0 F;  5HLF A;  2VOP A;  3M2V B;  1N4L A;  3KUH A;  1L5U A;  4NLY A;  3CC2 S;  3IRX A;  1NJY A;  2BX6 A;  1FES A;  2HFN A;  2R8H A;  3CCT A;  1IBM J;  2OJ3 A;  2HGN A;  4IR9 A;  3VF0 B;  5E2Q A;  3FQK A;  2M88 A;  2LU1 A;  3IG1 B;  4CLL A;  3DLG B;  2DCU B;  3DRX A;  3KLF B;  2YNF A;  1S1V A;  1X4G A;  3NNA A;  3ETO A;  2HBQ B;  3T9Z A;  3BSC A;  1S1X B;  2OHD A;  4HHH A;  2VFS A;  5B0F A;  2VHG A;  5D0G A;  3LA0 A;  1REV B;  3M6W A;  4DL6 A;  1DLO B;  2QZ8 A;  2AHO B;  1FRM A;  1JWW A;  3A13 A;  4ZCK A;  3F73 A;  3C2P A;  3OTD A;  2FVP A;  2ERR A;  3KNG A;  4L6V 3;  2HVE A;  3CCU S;  3PTW A;  2GIR A;  4FZV A;  4B3O B;  5KFA A;  2DGO A;  4ZMM A;  1C4C A;  2OO4 A;  1Q8B A;  1PIL A;  2LQ8 A;  4P2M A;  4DL0 C;  1DQ9 A;  3M8P A;  2ACM A;  2I8E A;  5AT1 B;  4DV0 F;  1PJ5 A;  1YZ6 A;  4C11 A;  4EU0 A;  3A8J A;  3BBB A;  2CXE A;  3GB0 A;  3RBX A;  3H90 A;  2XCP A;  4DV3 J;  2J9D A;  4O3Q A;  5KFU A;  2XS7 A;  1VBK A;  2ZOG A;  1X0F A;  1WOR A;  4PAB A;  2M2B A;  1X8D A;  2BA9 A;  3AXK A;  3LP1 A;  3MUV P;  3BQ0 A;  5I42 A;  4F8R A;  2YWE A;  3W3S A;  3DM2 B;  3PIP Q;  4CLT A;  5J2M A;  4JV2 A;  4ICL B;  4O0I A;  2MJN A;  2ILZ A;  2VFR A;  2BAN B;  3NCQ A;  5MAO A;  4DLE A;  1M1K T;  1Q8K A;  1U6B A;  2AGQ A;  4B3M J;  1GMW D;  2E7W A;  2GC8 A;  3GFY A;  2G2Z A;  2XO6 A;  3ZZO A;  5IWA J;  4GVB B;  2XM3 A;  3MD3 A;  3VVT A;  1JK9 B;  4NLP A;  2HHH J;  1RCX B;  4KC5 A;  3EGZ A;  2YKN A;  3PW5 A;  5T14 A;  1SC4 B;  4X66 F;  4DR6 F;  1UVJ A;  2CUY A;  2C2R A;  3KUG A;  2BJ7 A;  3CD7 A;  4QW8 A;  2FVC A;  4ZA1 A;  1EP4 A;  5KG6 A;  3Q22 A;  4DV6 F;  3UD5 A;  2QSF A;  3PO5 A;  2J7W A;  2HQI A;  4KY3 A;  2E9Z A;  1AFJ A;  4LF6 F;  2HWT A;  5A8R A;  2ZH3 A;  1VIO A;  5A6P A;  4AND A;  4WP9 A;  4QYR A;  4B9V A;  1HQ2 A;  4ERD A;  5DQG A;  2L3M A;  3HSZ A;  1NB2 A;  4KHR A;  2ZZN A;  4RO0 A;  1DQ8 A;  1QUP A;  4IG3 B;  1SUQ B;  1C1C A;  2BM0 A;  3LP0 B;  4BWM A;  3R1L A;  4FS2 A;  3DHW C;  4G6V B;  5C2G A;  4FDF A;  2ROP A;  3H42 A;  3TX0 A;  3K2Y A;  1R43 A;  3PX0 A;  1XR5 A;  2FUG 9;  3NGT A;  4OZN A;  1LWE B;  4KE5 A;  4ANE A;  5AXM A;  3UPF A;  4KV8 A;  5KFF A;  3T3F A;  3NNH A;  1EET B;  1RKI A;  1SPB P;  4PWU A;  1ZAW A;  2D7S A;  2B4P A;  1U02 A;  2EG1 A;  2V4J A;  2RML A;  2Z58 B;  3M8W A;  4NLS A;  3D7S B;  1MML A;  3KLE A;  3CIM A;  5IT9 Y;  1JXE A;  2LP4 A;  3Q24 A;  3HHN B;  2AF6 A;  3DLG A;  1J5E J;  4I67 A;  1LWC A;  3SSS A;  2H4W B;  4LF9 F;  1CQN A;  2BV3 A;  3ZTO A;  1KQS R;  4MMO A;  4DPX A;  2YH0 A;  2CDR B;  2W2O P;  4IOB A;  4WE1 A;  4EI2 A;  1S6U A;  4NI2 B;  1UWB A;  1AUD A;  2UVV A;  4K4T A;  4LFA F;  4C8Y A;  4DV5 J;  1FDN A;  2C22 A;  2WOM B;  3MCS A;  2ATL A;  4RW8 A;  1FCA A;  4LF6 J;  5T7L A;  4KGX B;  3TA2 A;  4JI6 F;  4CYU B;  5K20 B;  3CJT A;  2L9D A;  4NA1 A;  2G9O A;  3G8Q A;  4Y0F A;  1PGZ A;  2B56 A;  5D4P A;  4X66 J;  4K4W A;  1HWI A;  4F3M A;  1NK4 A;  2P9E A;  3W8P A;  2OPS B;  4XK8 C;  1U26 A;  3WIU A;  5B0D A;  4OFZ A;  2OPR A;  2AJ0 A;  3WX4 A;  2VPW B;  1U2R A;  2Y1J A;  4BHQ A;  1CJU B;  1B64 A;  1SBR A;  3DLK A;  2DNP A;  1HMV A;  4LF5 F;  3Q89 A;  4MIW A;  1AA1 B;  1JLG B;  2BKN A;  3ETM A;  5IM0 A;  3SCL E;  3G8T A;  1HWJ A;  1HL6 A;  5J2N A;  4I6A A;  3D1Q A;  4N56 A;  4HYK A;  4G1Q A;  3UN2 A;  4DG1 B;  4ELT A;  2VFT A;  4JI8 J;  2G1D A;  3JSM B;  4F0H A;  3I96 A;  2M4M A;  1YDL A;  2IVF B;  5L1J A;  2RE1 A;  3BV8 A;  4JYA J;  2QRR A;  3P49 B;  3DOM A;  1PYT A;  3JTN A;  1NO8 A;  3TR5 A;  3V4I A;  3H5X A;  3D4J A;  5A8W B;  1KOH A;  2HFO A;  2VPY B;  1QAI A;  1REG X;  1RWM B;  2KJW A;  2RRN A;  2A3J A;  2J0W A;  2WAQ D;  1RWV B;  4HT7 A;  4I7F B;  4RWX A;  4TLQ A;  2CZ9 A;  5HMZ A;  2WON A;  2WVC A;  1Q95 G;  3EXY A;  3HDS A;  3KG1 A;  4G65 A;  4LRA A;  4QZV B;  2I38 A;  5K8P A;  4B3M F;  3J81 Y;  3FEY B;  1RWN B;  2KYX A;  3OD2 A;  4USW A;  4JI4 J;  1X7V A;  2LDY A;  3DNC A;  3VHQ A;  1LKZ A;  3MM5 A;  5SZT A;  2UUC J;  1RT4 A;  2CIM A;  3RU0 A;  4U6P A;  5BXI A;  2MB0 B;  2RAQ A;  2DTJ A;  4J90 A;  2YNH B;  4ZVT B;  2Q6B A;  2C2N A;  9ATC B;  1RYR A;  3SDE B;  2DH9 A;  1KS2 A;  4DZ6 A;  1TKT B;  2QMU B;  2VPZ B;  4L3N A;  4EMD A;  3E3X A;  4HI2 A;  1JLA A;  3MR2 A;  3BBF A;  2CWX A;  3V6H A;  4B3T F;  1MMD A;  3RR8 A;  3ZTS A;  2AX0 A;  2VU5 A;  1IBM F;  4N76 A;  5CYQ B;  3MMJ A;  3NS5 A;  9RUB A;  3J80 Y;  3VAH A;  3GIK A;  2CJX B;  3CJ3 A;  2AKW B;  5LL6 d;  3MAA A;  1SQE A;  2BEF A;  3M8Q A;  1GMW A;  3R3T A;  3FFI B;  2BE2 B;  5K14 A;  2E5H A;  1VQN S;  1W2B R;  2DRD A;  3K58 A;  2LKZ A;  2RIL A;  2ROG A;  3D1H A;  1U1L A;  2HMI B;  2PI5 A;  1VHI A;  2DR6 A;  1N8R T;  1UP1 A;  1Y11 A;  3MWB A;  1NJI T;  4YS2 A;  1T03 A;  1FXR A;  4HTJ A;  3T1H J;  2PO4 A;  4K0K J;  1NSK L;  3RB0 A;  1WDT A;  3OVS A;  3SSR A;  1CJV B;  2CG4 A;  1HBN B;  1N52 B;  2H54 B;  2OD4 A;  1VQL S;  3R5C A;  3B4D A;  2WVF A;  1GK8 A;  2ILY A;  4YQW A;  1TL3 A;  1S6Q B;  2U2F A;  2GW8 A;  3HHK A;  1NJW A;  4TKT A;  3QFW A;  1FO1 A;  3MEE B;  3SQG A;  2UXD F;  3J80 U;  4V19 X;  3M2V A;  1WD6 A;  1LXJ A;  3FSI A;  1QDU B;  4KFB B;  2QA4 S;  1V3R A;  1ULR A;  4LSN B;  5K8N A;  3T41 A;  1HQE B;  4NCA A;  2CQ1 A;  2BJ8 A;  2YKQ A;  3TX8 A;  3UDC A;  1TL5 A;  4DU8 A;  1T05 A;  2D74 B;  2KXF A;  1P8G A;  3VAL A;  1DQA A;  2ZOM A;  1B4S A;  3V5R A;  5JVH Q;  3MEC B;  1Q81 T;  4JI1 J;  2D3Z A;  2WSE C;  4RW6 B;  5DDQ C;  4NCB A;  2V8D A;  1GTH A;  1K1S A;  2HNZ A;  3KJQ B;  1V9O A;  4I2Q B;  3C46 A;  3RRG A;  1S7I A;  3DLH A;  1VQ6 S;  1S1T B;  2J9E A;  2OLW A;  3DLJ A;  5AJ3 F;  4NZ0 A;  1YTY A;  2HVZ A;  3PYG A;  4B9U A;  3GFX A;  1SL1 A;  1NEE A;  3BGL A;  2H1Y A;  2XTJ P;  3W9H A;  1J5E F;  2QO3 A;  3DM2 A;  2DH7 A;  2QMX A;  3C6U A;  2HRU A;  3PKM A;  3BRE A;  2Y1L B;  4OLO A;  2ZH5 A;  3C16 B;  4MK7 A;  3UVJ B;  3DLK B;  1VC6 A;  4OLP A;  5E41 A;  2OTJ S;  3MMC A;  2AU0 A;  4DU7 A;  1ZZN A;  1X4C A;  4YB1 P;  4LF8 F;  4OIX A;  2QC3 A;  2ZC4 A;  4ICL A;  2J6U A;  2AW0 A;  5HMX A;  1KR4 A;  2OEJ A;  1BQM B;  3CD5 A;  4DX6 A;  1K1Q A;  4NLV A;  2X1F A;  2YKM A;  4UF4 A;  4ZJL A;  4H4O A;  1XMQ J;  1P6T A;  3G6E S;  3NBP B;  4RZR A;  2Q79 A;  2M8D B;  4DUZ F;  2V8V A;  4USH A;  5JXS A;  4I2P A;  2D3O R;  2J0Q D;  5HRO B;  1C1C B;  5E3R A;  2F40 A;  2K2P A;  4C98 A;  2QL5 B;  2W4D A;  3CSK A;  4CI0 B;  4RNM A;  1PJ6 A;  4NLG A;  4JBC A;  1HBU B;  1K44 A;  1IM6 A;  2V69 A;  3BO4 A;  3UCG A;  3EGW B;  4NRT A;  4NI2 A;  5ETO A;  3UR3 C;  4CLW A;  2LFV A;  3H2V E;  1CUL B;  3V6K A;  1URN A;  2NPF A;  1NDK A;  1RXO B;  1SXL A;  1HBN A;  1Y9O A;  1NND A;  2OEK A;  2OEL A;  3W64 A;  3OHA A;  4ZOS A;  3SFG A;  5B0A A;  3UDL A;  4IG3 A;  1CJT A;  3B8H A;  3DFE A;  2N7Y A;  3DN9 A;  3HVT A;  3IC1 A;  4URG A;  4JV5 J;  3AY0 A;  5E3P A;  5IT4 A;  1NZA A;  3VGV A;  3I5B A;  4ZPA A;  3WC0 A;  4I64 A;  3NY0 A;  3PDN A;  3JYT B;  1IBC B;  1U7L A;  1VBX A;  2MKY A;  1WEX A;  2RSQ A;  3IR7 B;  2KI2 A;  1SIW B;  2CPH A;  2IJR A;  2GML A;  3IR5 B;  4KB7 A;  5E33 A;  1SB6 A;  3TVK A;  2K3I A;  1VK3 A;  3I32 A;  4RU9 A;  4WIQ A;  3M8Q B;  1KLN A;  3DU6 A;  3O6Q A;  5HO4 A;  3TA1 A;  3KK1 B;  5JVG Q;  3V81 A;  1JLG A;  1FER A;  2C2K B;  1NPR A;  2H51 B;  3QO9 B;  1UEV A;  2O01 C;  4PR6 A;  4F4W A;  5DM7 Q;  1RGV A;  1ZYQ A;  4USV A;  4E2F B;  1HHT P;  2W2M P;  4X62 J;  1RT6 B;  4XAK A;  1HPZ B;  4CO1 A;  3W2V B;  1VQ9 S;  4NA2 A;  1H38 A;  4A8X A;  4DWI A;  5LM7 E;  2AT1 B;  5D77 A;  4ES1 A;  2MKI A;  4DR2 J;  2XB2 D;  2Z4P A;  4RL1 A;  2LEP A;  4RW8 B;  2ZE2 B;  4DR5 J;  3V6D B;  2XSJ A;  2V6A A;  1MU2 A;  3BGF A;  3O44 A;  5DQI A;  1NKB A;  3QID A;  2RU3 A;  4TY9 A;  1C1B B;  2VL1 A;  2AMC B;  3DGP A;  4OV1 A;  4AQY F;  2LXI A;  1S0N A;  4RR5 A;  1CLF A;  2OPQ B;  2C1E B;  2OAU A;  3JSY A;  3W9I A;  3NKY A;  5KFD A;  3CDE A;  2EFP A;  4J9U E;  2LYV A;  4LFC J;  4WBF A;  2F63 A;  2YKA A;  1PBU A;  5LMN J;  4A8K A;  1T05 B;  1VK8 A;  4FBT A;  2XWX A;  4AXJ A;  2Z57 B;  1T9U A;  3K17 A;  1Y0H A;  1OJ4 A;  1Z2Z A;  4CLS A;  4ZDN A;  2BZ2 A;  2RKI A;  5C2C A;  2NSB A;  3GCW P;  3AD9 C;  2DO0 A;  3G71 S;  2MHE A;  2ASL A;  3DKD A;  4F36 A;  2VC0 A;  2Y8W A;  4PWW A;  4Q45 A;  1RTD B;  1CG2 A;  2A0F B;  2XHW A;  2M0G B;  2XYH B;  1GT8 A;  1FDB A;  1N33 J;  3A8K A;  3EDR B;  3SSQ A;  2B5J B;  3CGI A;  2PGC A;  3MPU B;  2QTW A;  1A6L A;  3VZH A;  1SJQ A;  4DV2 J;  2V94 A;  3POT B;  2RS2 A;  2GS8 A;  3H2U B;  4ENO A;  4ETZ A;  4USK A;  4ZCI A;  4YY3 J;  2VIH A;  4X4P A;  4EYH B;  1HD1 A;  3FFI A;  2DY9 A;  3NOC A;  5JMN A;  1Q53 A;  1NHV A;  3SEO A;  2HQ3 A;  1IKY A;  1QTM A;  1U24 A;  1FDA A;  3DMJ B;  4JI2 F;  1RHK B;  2PMH A;  1AB8 A;  1RAC B;  2DD8 S;  2GQQ A;  2WW4 A;  3B6B A;  3QT7 A;  3IGV A;  1EAY C;  1SH2 A;  3SV3 A;  4C8M A;  4DN0 A;  5H9E J;  1KNZ A;  1EET A;  2K3K A;  1VLO A;  3TAR A;  4X4V A;  5IT0 A;  2J6S A;  1TKZ B;  4I68 A;  2QV6 A;  2E1A A;  1UVL A;  3PW0 A;  1OS5 A;  5B7W A;  2XQC A;  3R5J B;  2CQ4 A;  1WTB A;  2BE2 A;  3MEK A;  4HDH A;  4R0J A;  5HAN A;  5K14 B;  2NYI A;  5DDR C;  1RCO B;  4QOT A;  3RJM B;  4EWT A;  4XO0 A;  2FHJ D;  3HD1 A;  6FD1 A;  1RAJ A;  5DDO C;  5D3G B;  1G3O A;  3VZI A;  5CXT A;  2W8L A;  3KLH B;  3ITH B;  1YLX A;  1YX2 A;  2JVR A;  5LOQ A;  3J81 j;  3HT3 A;  1TP7 A;  4RW9 B;  4C4W A;  4R8U B;  2QL7 B;  2FZC B;  1WSR A;  1V6H A;  4LF2 A;  2FZG B;  3FSX A;  4WP3 A;  1RHR B;  1OQ6 A;  2C3M A;  4EK2 A;  2ZH8 A;  4DV4 J;  3Q8R B;  5DG9 A;  1VQY A;  3QAU A;  1D9A A;  4KGM A;  3TW0 A;  3LPY A;  4B17 A;  1J2V A;  3A3P B;  3BPD A;  1FTR A;  3OR1 B;  5KFM A;  1FK9 B;  1Q78 A;  2QA2 A;  5FDL A;  4ED3 A;  4GKK J;  3DOL A;  3S1T A;  2AD9 A;  1R8B A;  1KVK A;  5CH7 B;  1FKP B;  3JTO A;  5DZ6 A;  5GVQ A;  3K8W A;  1TUG B;  3PFE A;  2IM0 A;  3KJV A;  1N5Y A;  4LSN A;  3MTK A;  5HVH A;  1ROF A;  4J9V A;  1NLK L;  2HK3 A;  2NUU G;  4M5D B;  1S10 A;  1H2U X;  5K8M A;  2H4Y B;  4HH0 A;  4IG0 B;  4NOH A;  5G4D A;  4DFK A;  2KTQ A;  3MMB A;  2IM1 A;  3BQ1 A;  4OYB A;  3AAW B;  2DNG A;  2K1R A;  1X4E A;  5DM6 Q;  2PMZ D;  3IA0 A;  1VRQ C;  4J9M A;  1WEY A;  1WHW A;  3I4H X;  3I6P A;  2FQQ B;  5KFX A;  2ZUG A;  1Q4R A;  1KQF B;  2KM8 C;  4E0D A;  2YY3 A;  3EVO A;  3GTY X;  4DZD A;  3HSJ A;  1HNW F;  2R7S A;  3TZX A;  3CCJ S;  5DG7 A;  2HHQ A;  3Q8V A;  3EZO A;  3OVA A;  2RIJ A;  2V4Q A;  2VQE J;  2Q6C A;  3I9V 9;  2BDP A;  1RT6 A;  5HJY A;  2KT5 A;  4MYU A;  3RBD A;  5K5M A;  4N47 A;  4XPE A;  3OTO F;  3HKZ D;  4CWB A;  3A4T A;  4WYL A;  4DR5 F;  1N34 F;  2CQ2 A;  4Y2C A;  2P5V A;  4JI5 J;  2AZ3 A;  3K7R A;  3MUM P;  2RNE A;  3DRS A;  4HH1 A;  4CLZ A;  2BOP A;  3LGH A;  4DV0 J;  1U8W A;  3OXG A;  4FYW B;  2HRT A;  1TL7 B;  5IV3 A;  3O2I A;  3PRB A;  1RTJ A;  4NCG A;  4KGK A;  4C8O A;  1FWL A;  4C9D A;  1RDR A;  3BPS P;  1LW0 B;  2IAJ A;  3PR4 A;  3T1Y J;  3D3C J;  1ZS6 A;  1QLN A;  2D41 A;  1KWM A;  3RW6 A;  1NAQ A;  2FJB B;  2KDO A;  5KFZ A;  1V5I B;  5F8M A;  4J9L A;  1VJQ A;  4ZVE A;  5JUM A;  4BC9 A;  1A0O B;  1X9S A;  1WSV A;  3G82 B;  1RIS A;  1S6P B;  5HSP A;  4ER8 A;  3F41 A;  2XY7 A;  1M5O C;  1XN9 A;  3PO4 A;  2X7I A;  3C14 B;  4G1P A;  4HVZ A;  2W24 A;  4NYZ A;  2YWK A;  4C7Q A;  3NBP A;  4TLR A;  1N34 J;  3I31 A;  3PR5 B;  2HZV A;  3J7Z 5;  1TK0 A;  3BB5 A;  2VB6 A;  2HAI A;  1F5B A;  1C0T A;  2DIS A;  2V0N A;  4OZL A;  5FD1 A;  1FVS A;  5C42 B;  1TQL A;  2GVD A;  5GAH I;  5DG8 A;  4DR7 F;  1TKX A;  3ISZ A;  3NCP A;  2QA1 A;  1P1T A;  2R7W A;  1XJW B;  2J5A A;  3GON A;  3L7U A;  2VBY A;  2B6A A;  3LGM A;  3NGR A;  1RAH B;  3KWM A;  5FLX Y;  2G2O A;  2VJV A;  2AJQ A;  3ZC4 A;  2LEC A;  2KVI A;  2IJF A;  3PW7 A;  2IMO A;  2EK6 A;  1S1W A;  2GMH A;  4YB5 A;  4X4Q A;  2CQP A;  3CJK A;  4OHW A;  1FRK A;  4PG6 A;  2ZJQ Q;  3T5L A;  3MED B;  4F4Y A;  1RHU B;  1NUE A;  2UVW A;  1FWK A;  1RU2 A;  1S4F A;  2ASY A;  2EFQ A;  4QR1 A;  3DLB A;  1EHW A;  5D0H A;  3ILO A;  2ZDO A;  4FKY A;  2QYG A;  2ZBR A;  4ZPV R;  4DX7 A;  1TEL A;  2AYE A;  2R42 A;  4J5O A;  4NX9 A;  4EFA C;  4LRD A;  4O3N A;  3CD6 S;  2F9J A;  3N5B A;  5DGA A;  3FQL A;  3RAQ A;  2LA6 A;  1BQN B;  2W01 A;  3KDO A;  2R8K A;  2Q43 A;  3OUY B;  2R8G A;  3MI7 X;  4C0O C;  4HR2 A;  3MOJ B;  1W7W A;  4AUK A;  2AZ1 A;  2X3D A;  3AJ2 A;  2ASJ A;  1HPZ A;  1X4B A;  2CJA A;  2KU7 A;  2PMW A;  1HMV B;  4OYM A;  2I6W A;  2EKY A;  1LXN A;  2HND B;  3EYZ A;  4QWB A;  2FTR A;  1ARO P;  1HHS A;  2GHP A;  3GSI A;  4ILR A;  4IFV A;  4OYW A;  2NLW A;  3VAJ A;  2GJF A;  4K4Y A;  3C3L A;  4GC6 A;  5IQ6 A;  3TZZ A;  4NML A;  1SQG A;  4ED1 A;  1PAU B;  1UAW A;  1Y10 A;  3FBE A;  4NYP A;  1KKH A;  2A1B A;  4P74 A;  3Q8P B;  3OR1 A;  2DHG A;  3B78 A;  1MU2 B;  1FRJ A;  4RKU C;  1S77 D;  2DJW A;  3V4I B;  1VMB A;  4U9R A;  4C11 B;  2VON A;  2ZEJ A;  1UPP A;  1VQ5 S;  2V67 A;  1YI2 S;  2W1B A;  2OTL S;  2BUN A;  1F2H A;  4Z7Y A;  4NLR A;  2B0G A;  1FF2 A;  1S97 A;  4M94 A;  2FC9 A;  1UA1 A;  1IQZ A;  2LLZ A;  3R5D A;  4OI4 A;  2XS2 A;  4HDG A;  2DGW A;  3KLG B;  5LMU J;  2CZ4 A;  2ADC A;  1JKH B;  4R5P B;  2B8Q A;  1FJE B;  1S57 A;  2GNK A;  3KJN B;  4PXB A;  4DR3 F;  2BAC A;  2ABY A;  5M2R A;  3BN7 A;  1I5O B;  1UKU A;  3QPI A;  4ID5 B;  2V4R A;  2W9A A;  1YHQ S;  2BXJ A;  3R6G B;  3KTQ A;  2ATC B;  4WK1 A;  4OX9 F;  2JZ5 A;  1Y4Z B;  1KEK A;  3FNN A;  4W98 A;  3R7N B;  1V5V A;  2HFV A;  3M30 A;  3QT5 A;  2DRB A;  2KXN B;  5A76 A;  1JLA B;  4GKJ F;  4NZ7 A;  5DQH A;  4EUV A;  4EBE A;  1MWQ A;  2P6T A;  3I87 A;  1N36 J;  3E2E A;  2APO A;  2CAJ A;  3WIV A;  2ZC3 A;  3B54 A;  3RYL A;  4C48 A;  3J81 U;  4MIB A;  4KT0 C;  3HSD A;  4IYQ A;  1DTT A;  2XMT A;  1SJ1 A;  3Q86 A;  4QQB A;  3T1A A;  1NB7 A;  2F1F A;  3U1L A;  1DY3 A;  1ZPW X;  2DPI A;  3LTO A;  5A8K B;  4IFY B;  1F0X A;  4CM0 A;  3JXO A;  3KLV A;  5KG7 A;  1B70 B;  4FNH A;  2B9Y A;  1XMO J;  3FGV A;  3SQO P;  1UET A;  2L9N A;  1JLB A;  4YME A;  3TI0 A;  2FLP A;  2ZBI A;  4K0K F;  3P3D A;  1H2V Z;  4BBY A;  4XTT A;  1NKC A;  1H3D A;  4B3R J;  1ZTT A;  1O0P A;  5GAE U;  2ZJP Q;  3MR7 A;  3QSI A;  4KV8 B;  4X84 A;  2XMA A;  3IWL A;  1U1M A;  4M5N A;  3MAQ A;  2FJW A;  1G7C B;  3WQP A;  5HMW A;  3PJW A;  5BR8 J;  2FY8 A;  5G0R A;  1N5Y B;  4PQA A;  4ZIV A;  3DU5 A;  3E01 A;  3CCR S;  1VC0 A;  2UU9 J;  1S6O A;  1RAO A;  1WG5 A;  4DLG A;  3CUN A;  4JI3 F;  4TQR A;  2WBM A;  4WII A;  2B4V A;  2QLX A;  5KFS A;  2V68 A;  3QGI A;  3I56 S;  4ZCL A;  3R7B B;  4ED6 A;  2AEM A;  2ZH6 A;  1HNX F;  2VG5 B;  3OXL A;  3MCN A;  5IOL A;  5I3P A;  1RA6 A;  2AV5 A;  4ITS A;  1X5S A;  1T9Y A;  1YJ7 A;  2B6A B;  4IFV B;  4ZPC A;  4EO8 A;  5FLX U;  1DLO A;  1PBA A;  1FE4 A;  2ZFH A;  2G4B A;  2BYC A;  3DOL B;  3HM9 A;  4LR8 A;  3CCV S;  3DDN A;  1U45 A;  1OPZ A;  1VGY A;  7FDR A;  1UJ6 A;  4W90 B;  4IQM A;  2VKR A;  4DG1 A;  1HWL A;  2M7S A;  4UUW A;  3HD2 A;  1R0A A;  2FDN A;  2DNL A;  3BDE A;  4XDC A;  1S7H A;  2B7B B;  3NGK A;  3CW2 C;  4USM A;  1K9M T;  3MXH P;  4O44 A;  2ZZT A;  4QWD A;  1RTZ A;  3DLE A;  1Q5V A;  2VDH A;  3OJS A;  3H4D A;  4C0H A;  4AL7 A;  2FJX A;  3H5Y A;  5KFE A;  4OL8 A;  1NSP A;  3HLU A;  3OPK A;  3MFH A;  3M2U B;  2CJ9 A;  1SJ4 P;  2B9E A;  2Z2Y B;  3TAQ A;  1FKO B;  2HKE A;  3QAE A;  2HVI A;  1IQT A;  4MK9 A;  2MKH A;  3PCO B;  3S6E A;  1RA7 A;  2HNY B;  5IS2 A;  1K8A T;  5I42 B;  3OW2 R;  1S59 A;  1WHV A;  3CWJ A;  3UD4 P;  2YQ1 A;  1R8P A;  4URQ U;  3NL0 A;  3JQJ A;  1Q5Y A;  2RUG A;  1F5C A;  3DRP B;  1PG5 B;  1D8Z A;  1U6Z A;  3D6M B;  3LP2 A;  4P71 A;  5DZ7 A;  1E6V B;  3MOZ A;  1UTA A;  1HIY A;  2HWI A;  5KFO A;  1EIY B;  1JLC A;  4ZHR A;  2EI5 A;  3QBC A;  3BSA A;  3W8G A;  4DX8 H;  2DB1 A;  5GAD I;  4LF7 F;  2E44 A;  1S0O A;  3PG9 A;  4PEO A;  2LU2 A;  4KHP J;  3KK3 A;  3H40 A;  2Y8Y A;  2HHW A;  3GJR B;  4OI2 A;  4ECS A;  1KON A;  1EZZ B;  1R7I A;  2YNG A;  1TFY A;  5ETR A;  4DUZ J;  1BHN A;  3QQC D;  4OX8 A;  3FEX B;  4ZVF A;  4GKK F;  5EWG A;  4ILL A;  1NPK A;  1Q79 A;  1YGY A;  4DBQ A;  4ZN3 A;  4DV4 F;  4NCG B;  1LK5 A;  2HGM A;  2ZM6 F;  2CJQ A;  3QLH B;  2CQ0 A;  4NLW A;  2IAJ B;  5EX3 A;  3R8Y A;  1FD2 A;  4M8L A;  3W9J A;  2A10 A;  4PG8 A;  4ECX A;  4TYB A;  1RT1 A;  2RT3 A;  4P6Q A;  2GA7 A;  4TXS A;  3GFH A;  1JMT A;  1UEK A;  2UU9 F;  3CUL A;  2IC3 B;  2GAG C;  3GV7 B;  2EKN A;  1IKV A;  3OQ2 A;  1U0S A;  3CJ8 A;  1IM4 A;  1EB0 A;  1Y7P A;  2VDI A;  4FVM A;  1PO6 A;  4JI7 J;  2M5Y A;  2LEA A;  4I6W A;  2MQM A;  3MPY A;  2IFX A;  1SJF A;  1X9M A;  2E7X A;  5KOX A;  4Q43 A;  1SV5 A;  1VLY A;  3TJ9 A;  4RJV A;  5L39 A;  2SXL A;  3W1Y C;  4A47 A;  1X9W A;  2DPJ A;  1S1W B;  1HNZ F;  1ZZF A;  4DJB A;  1FJ7 A;  1XMO F;  2DNR A;  4Q2M A;  3EMT A;  3T6J A;  1GMV A;  3JSR A;  2DK2 A;  4DR4 F;  3ZNJ 1;  5HLF B;  1N32 F;  4ZVU B;  4JI2 J;  3NMA A;  1N56 A;  4IFY A;  4WU3 A;  2KL8 A;  2Z2L A;  1S0M A;  2NPI A;  4J9R A;  1RT3 B;  1Z4U A;  2DXE A;  4NPO A;  4ZIW A;  4ZP6 A;  1T8E A;  1UJ5 A;  3M8Z A;  3WX8 A;  4B9N A;  3CO0 P;  4I56 A;  5DGB A;  1N0V C;  2P9G A;  3MEE A;  1BQN A;  3M8R A;  2E1C A;  3GPA A;  1GX5 A;  1ZBT A;  4URS A;  4PAA A;  1T7P A;  2EFV A;  1OYD A;  3N6M A;  2HK2 A;  3M8S A;  1S1T A;  3G6Y A;  4OX9 J;  1YK9 A;  3LQV A;  4NLQ A;  4FYX B;  5KFH A;  3TUI C;  2WVE A;  2U1A A;  1SH3 A;  5DJB A;  3TO8 A;  2KM8 B;  2AJ1 A;  3MUR P;  5H9F K;  2H65 B;  2RRB A;  4X4N A;  1M5K C;  2P2C B;  5J1E A;  4LT6 A;  4NAS A;  5KFV A;  2AEF A;  5RUB A;  4F2S A;  3C6T A;  4QR2 A;  2PE8 A;  3TUP A;  1GNK A;  2YKP A;  5ETL A;  5K9F A;  1SJR A;  1FEH A;  1WC1 A;  2LDI A;  2Z56 B;  4CO3 A;  1CJK A;  3NMR A;  3AB2 B;  3MCO A;  4KQZ A;  1QSY A;  1SC3 B;  1U48 A;  1Y00 A;  1F3V A;  2IM2 A;  2D9O A;  3UNY A;  2AJ2 A;  4FVC A;  4PRF A;  5A0Y A;  2BJ3 A;  2QMW A;  2VG6 B;  3RRK A;  2KT3 A;  4IH5 A;  3X3U A;  3UCU P;  1RTJ B;  1KTQ A;  2XNR A;  1OIA A;  2ZBC A;  2MQN A;  3PX6 A;  1RZM A;  1X4F A;  3NXZ A;  4YDD B;  4DSI A;  2PEB A;  4MKA A;  1MLA A;  5BYQ A;  1CC7 A;  4ID5 A;  3TZW A;  3Q2S C;  1FD8 A;  2K7J A;  2HWH A;  8ATC B;  4KHP F;  4DV1 J;  2BRK A;  4ZPD A;  1YJN S;  3HUL A;  2HS3 A;  1VQO S;  2CPJ A;  4DR1 J;  3KFW X;  3SBM A;  4DEZ A;  4DN9 A;  2MSS A;  2O67 A;  1RP5 A;  2OKQ A;  3KUE A;  2EFO A;  3FCW A;  2ZHA A;  2MGZ B;  1IR0 A;  4LIR A;  2HGL A;  2QX0 A;  2XLI A;  3JTP A;  3NAH A;  1X5T A;  4ZPT R;  1JLC B;  3BZQ A;  3VAF A;  1S9E B;  4ECZ A;  2ZUA A;  3FBB A;  1KVI A;  4AD6 A;  4A46 A;  2MZT A;  2V8H A;  3IAS 9;  4DPO A;  5IV4 A;  4WK3 A;  4K50 A;  1R8H A;  1LWE A;  2HBZ B;  4D3H A;  3LWM A;  5L1K A;  2F4V J;  4X2B A;  3MM8 B;  4Y3C A;  3M7V A;  2BMB A;  4OZ2 A;  2C3U A;  2Y0S D;  1WHY A;  1HW8 A;  3NWR A;  4NLO A;  4TNO A;  1QM9 A;  1HI1 A;  4Q7A A;  3BYP A;  2F4V F;  4R8U A;  1PSD A;  3CJK B;  1NBE B;  2NR0 A;  1TMJ A;  1TL1 B;  2GMJ A;  4K4V A;  1BGX T;  4MTP A;  4P10 A;  1HA1 A;  5KFC A;  3GV5 B;  1KSP A;  1IJE B;  2WW8 A;  3M32 A;  4DR7 J;  3DRY A;  3MHY A;  1KLM A;  3TVY A;  5G0R B;  5IFM A;  1QVF R;  2PFF B;  1JB0 C;  3BSO A;  1YSJ A;  4F0K A;  4B3S J;  4USU A;  3ZXW A;  1Y3J A;  3QMQ A;  4MK8 A;  1WC3 A;  4YHH J;  5IQQ A;  3THT A;  3OL6 A;  1AZS B;  4H4K A;  1DJ0 A;  3IBW A;  3GE9 A;  3GFZ A;  4Y65 A;  4LF5 J;  3GJS B;  4RBU A;  2VA3 A;  1N54 B;  4IG0 A;  1NJX A;  3NG8 A;  2VIC A;  3M8P B;  3D1O A;  2FY1 A;  3HO1 A;  3J7A N;  4C0B A;  1WI6 A;  3P5T L;  1X4H A;  1XTZ A;  3RRH A;  2OPS A;  1VIX A;  2GAH C;  2MEW A;  3IAM 9;  5U47 A;  2J6T A;  2CVE A;  1CJU A;  1N5V A;  3K59 A;  1Q8L A;  1REV A;  2MKC A;  3R5G A;  4QU6 A;  4PPZ A;  3U27 A;  2CQC A;  1Q0N A;  2LXU A;  2O5D A;  4E8U A;  5IM0 B;  2CNN B;  3F0N A;  4B08 A;  1B0V A;  1R27 B;  3CVK A;  4WWS A;  1TTH B;  5L38 A;  3VQT A;  2MKK A;  3CJS A;  2F7V A;  3D0H E;  1RWW B;  4DV5 F;  2H48 B;  1RBO B;  2LQB A;  5F3T A;  4ED0 A;  4LFA J;  2RDI A;  3EWG A;  5A0Y B;  2NXE A;  5ETV A;  2GCF A;  4LRC A;  4ZP9 A;  3AQO A;  1PIE A;  4MFB A;  5KFJ A;  1NU4 A;  2KKH A;  2YX7 A;  2J8A A;  3ZTR A;  4I6Y A;  4U7C A;  2XO7 A;  2B8P A;  1KBR A;  4L3K A;  4ZLP A;  5KT7 A;  3RTV A;  2AQ4 A;  3SV4 A;  5F8J A;  1ZOT A;  2QFI A;  4FYD A;  3R5B A;  1F2G A;  3CCE S;  2UXC J;  2BRL A;  3LP2 B;  3TOQ A;  3LP1 B;  2OFH X;  4CT8 A;  3HVR A;  4MKB A;  4UST A;  3AQP A;  3E8O A;  1NK0 A;  4O4G B;  4DQQ A;  2YVS A;  5L46 A;  4J9N A;  3C66 A;  2XHC A;  3N28 A;  2WVD A;  5CHC B;  2JEJ A;  3M30 B;  3HHE A;  4DV6 J;  1YIT S;  2IBK A;  4AXI A;  2R2T A;  1OY8 A;  3DRP A;  4HLB A;  4GVB A;  5B08 A;  5MLC V;  1SC6 A;  3C14 A;  2EC2 A;  3LP0 A;  1K0V A;  1U09 A;  1IBK F;  4ZHR B;  1R3N A;  4QIE A;  3US5 A;  1XER A;  3VAK A;  4A8O A;  1WF1 A;  3BH6 B;  3FDS A;  4Y2M A;  1RT7 B;  3W65 A;  1YQH A;  3TUZ C;  3T5K A;  2UXB J;  4CLY A;  1R0B G;  1JQG A;  2XBP A;  3IO1 A;  1QSS A;  1S79 A;  1QVG R;  3PNI A;  2DO4 A;  4DL4 A;  2GO9 A;  4OZ3 A;  2JOQ A;  3FRZ A;  3T1H F;  4YR2 A;  3QIP B;  2LQ9 A;  2N4D A;  2RF2 A;  4QW9 A;  2KFY A;  1OWX A;  2G1H A;  3OFG A;  3HHL D;  4UTG A;  3RAM A;  4XPC A;  3UR0 A;  4ES3 A;  4FF2 A;  3EPI A;  2PI4 A;  2WRM A;  2PDA A;  2KHD A;  2I0X A;  3TUJ C;  4YUD A;  3ULH A;  4CYU A;  2W9C B;  4DSF A;  2BVZ A;  4NRU A;  2RU9 A;  3D0I E;  3ELH A;  5LSO A;  1T3N A;  4WE1 B;  2ZZM A;  3CDU A;  3KG4 A;  3E01 B;  1AZS A;  2JNJ A;  4A8Y A;  4RWW A;  2HAF A;  1CJV A;  2QGF B;  4U8Y A;  2G0I A;  4USJ C;  4N5S A;  4XIU A;  3BDP A;  1FJC A;  3QJP A;  1WKK A;  4M95 A;  3ZZR A;  2DNY A;  2POK A;  3U02 A;  2NYH A;  4LBI A;  2XI3 A;  1UFL A;  5F8H A;  3J7Y I;  3MFI A;  3DLL Q;  2W25 A;  1RJJ A;  2WSC C;  2AGO A;  3EE3 A;  4DR4 J;  1IBL J;  2VFU A;  2DKO B;  1LEO A;  3LO3 A;  4KFB A;  4G1Q B;  5IXU A;  2K1R B;  1VQK S;  1ZM2 A;  3G8S A;  2MST A;  3AA8 A;  4KKO A;  4R0E A;  3JSM A;  2KJV A;  3K8V A;  4AL6 A;  2DEI A;  1L3K A;  3KXD A;  5AXK A;  5F8L A;  4CP5 A;  3WC2 A;  1EJ7 L;  4UOG A;  2UP1 A;  2V2K A;  5CYM A;  4ELV A;  5HL7 Q;  1Y5I B;  2BW2 A;  2RH3 A;  3QWU A;  2WCX A;  4JI4 F;  2L48 A;  3HJV A;  4KGV B;  2ZHO A;  3W61 A;  2UV8 A;  2ZIT A;  2E5G A;  1TV6 A;  3PYF A;  3SIP B;  4F67 A;  3H20 A;  3P45 B;  4IKA A;  3U1N A;  3W62 A;  4BS2 A;  2R2S A;  5DRK A;  3DC2 A;  2PC6 A;  3I4P A;  4E98 A;  3NCR A;  2FVQ A;  1S1U B;  3EXC X;  3VGS A;  3AFG A;  2BE9 B;  4DV1 F;  1QAY A;  2N3O A;  1VYA A;  5KOW A;  1YVF A;  2C2E A;  1I6J A;  2RQM A;  1TL7 A;  4A8W A;  2IY5 B;  3TAM A;  4JI8 F;  4PUO B;  1FNX H;  1OQ3 A;  4DCP B;  3OTB A;  4HL9 A;  2Z2M A;  3N79 A;  3BSN A;  1RT2 A;  2E5J A;  2LQ5 A;  2Z0G A;  1HD0 A;  4JI0 J;  4EZ6 A;  1XBW A;  3A3N B;  2XCA A;  1FI4 A;  4F4X A;  1H0H B;  2V5H G;  1CS4 A;  6FDR A;  2G0C A;  2IDL A;  1XR7 A;  4ZLN A;  2WTF A;  2V63 A;  3K5P A;  4IH7 A;  1D09 B;  2B4U A;  2RVJ A;  2XGP A;  5CYQ A;  4ZPB A;  1YZ7 A;  4K5R A;  1GXL A;  5GAH U;  3CC7 S;  3SZ2 A;  4OJ3 A;  3SDE A;  2OSR A;  2FVS A;  4P2S A;  3N6L A;  4OZ5 A;  3R97 A;  1N48 A;  1F6T A;  1UVM A;  3HHL A;  2H5J B;  3CED A;  4LIW A;  3KJF B;  4UZC A;  2ZH4 A;  4C8Z A;  1DTQ B;  2JEG A;  4J7C A;  2JL9 A;  1B7Y B;  3LH2 S;  1UW4 A;  5HBM A;  3TRG A;  4IOC Q;  1S12 A;  4OYX A;  3ISN D;  3NGS A;  5HAO A;  2HUR A;  2FC8 A;  4M5I A;  4QIW D;  5IC4 B;  2B43 A;  4F4A A;  3BO3 A;  4OZJ A;  3AOC A;  3OLB A;  1C0U B;  1TL1 A;  1QSL A;  4PQU A;  1ZM3 A;  3ENW A;  3N6N A;  5BR8 F;  4WZM A;  2HFS A;  3G82 A;  1KHV A;  2W9C A;  3H5S A;  1XR6 A;  1TK5 A;  4FNI A;  4A8M P;  4Q8F A;  1WF0 A;  5D4O A;  1KLM B;  1MN7 A;  2M70 A;  5D78 A;  2MQL A;  4LJM A;  3VAI A;  1PCA A;  2OUG A;  5C25 A;  4RX6 A;  1M90 T;  4NXN F;  1F9H A;  3GIR A;  3UN3 A;  3ENQ A;  2GZO A;  3O5T B;  4LUB A;  2JLG A;  4JV5 F;  2CA9 A;  4QCL A;  4YOE A;  3FCV A;  1Y3K A;  1S9G B;  1QE1 B;  2D3U A;  3GZ7 A;  2CG8 A;  2PEH A;  4FKX A;  4L76 A;  4PXC A;  5CAA A;  1UFK A;  5LSL A;  2R2U A;  4PPD A;  3QRQ A;  5F8I A;  4ZP8 A;  4LR9 A;  4OX7 A;  2KVQ E;  1JNR B;  3GJT B;  2KRB A;  3SQG B;  2VG5 A;  3LF0 A;  5L1I A;  2G0J A;  2QSW A;  2DRA A;  1C4A A;  2BJ1 A;  2OP5 A;  2O3D A;  1G4C A;  1UPM B;  1VI7 A;  2RD5 C;  3BN4 A;  3CMQ A;  4KIA A;  4HKQ A;  5D0R A;  3UFC X;  4HAC B;  3OFF A;  2LCW A;  4FYY B;  4HHU A;  2LMI A;  5DLF A;  1KC8 T;  3N9U C;  1NKE A;  4DF8 A;  3E51 A;  1T03 B;  3THP A;  1C2P A;  4ECY A;  4CO2 A;  2ZM6 J;  3W2V A;  5E5N A;  1PC5 A;  3OTC A;  1H98 A;  4WF9 Q;  3PEH A;  2ZKT A;  4P52 A;  4TY8 A;  3ZZ0 A;  2N7C A;  2XNQ A;  4LRF A;  1GFW B;  1V3Z A;  3I55 S;  4DPW A;  1T94 A;  5BYS A;  5KTQ A;  2XGQ A;  1FE0 A;  4Y34 A;  1OY6 A;  3RBZ A;  1N0U A;  3OXF A;  1H74 A;  4DCJ B;  2R7Q A;  4DS5 A;  1U0H B;  3A8E A;  2RRA A;  2HYI B;  4AT1 B;  2QIF A;  3MMC B;  4RW4 B;  3BR8 A;  3MM7 B;  1XQI A;  5J1E B;  2V2Q A;  4ZVR B;  3RB6 A;  2BOA A;  3C6T B;  4OYA A;  2CPZ A;  4LQ9 A;  4YR3 A;  2R9L A;  4YR0 A;  1HYS A;  1JJH A;  1RE1 B;  2UUB J;  1R8A A;  3K0J A;  1JLF A;  2YBV A;  3UQS A;  4QWA A;  4NLT A;  5CYM B;  1DFD A;  4L73 A;  1UW9 A;  5H9F J;  2ZJR Q;  4DV7 F;  4OJ1 A;  3OJU A;  1U4B A;  2ZVS A;  2AYG A;  3P6Y C;  3FUY A;  3GR0 A;  1YWX A;  4PG5 A;  3ZTP A;  4C6A A;  3SMZ A;  3HMJ G;  4WFN Q;  2J0S D;  4C3L A;  1P1L A;  1RHQ B;  5D8H B;  4CLP A;  2M8H A;  1HNI B;  4I2P B;  5L8R C;  1WEZ A;  1DAR A;  3OFH A;  4MFB B;  2F8M A;  4U67 Q;  2B5J A;  4JI1 F;  4ZP7 A;  1JKH A;  1QTN B;  2YWG A;  1YJU A;  4GO5 X;  3PRD A;  1F1B B;  2VZ9 A;  2G13 A;  3BGU A;  1YBA A;  3ZTQ A;  2HHP A;  1VOM A;  4OHZ A;  3GP9 A;  2FVR A;  1MN9 A;  1TVR B;  3MAH A;  2MYF A;  3NOG A;  4X4S A;  3GV8 B;  1PYO B;  1ZPV A;  2PA3 A;  3I0S B;  4LVO P;  2VBX A;  3EUN A;  4DUT A;  4F7V A;  2VKZ G;  1OY9 A;  4ETX A;  2J8S A;  2QYC A;  4EYI B;  4EBD A;  3RB3 A;  1ZH5 A;  5L9X A;  3JQK A;  3QSY B;  1M5V C;  1VRU B;  2F5G A;  3C15 A;  2NXC A;  3ZZP A;  4TQS A;  3THV A;  1VC5 A;  3IRX B;  2CQG A;  4QU7 A;  3IBC B;  4LFB J;  1QY7 A;  5KFR A;  2HZC A;  1P27 B;  4IH6 A;  1F5A A;  2YQ3 A;  2I9S A;  2VBW A;  2L41 A;  2V2V A;  1NH8 A;  3KOA A;  3KNA A;  2KZM A;  4AQY J;  1M5S A;  1WNE A;  2VD3 A;  5HP1 B;  1URR A;  3H59 A;  2D69 A;  3QO9 A;  1WOO A;  2N82 B;  1SJ3 P;  1DTQ A;  2IVM A;  1CQM A;  4M5M A;  2DBB A;  1S1X A;  2NUH A;  1NSA A;  2ZBP A;  3D3B J;  3D66 A;  1TUV A;  1XWL A;  4LRE A;  5F41 A;  4ECR A;  4FF4 A;  3TQE A;  2DR8 A;  3MEC A;  1BE4 A;  3W60 A;  4NLU A;  4BDP A;  5KG5 A;  2JHE A;  1NK8 A;  4AYB D;  1I94 F;  4KRW A;  2X1B A;  3DGV A;  3TQ1 A;  4QIF A;  4I2Q A;  2KB2 A;  4DCO B;  4PCQ A;  1TAQ A;  1ZAX A;  1TV6 B;  1RAE B;  3HVT B;  4RNN A;  3I5A A;  2GVZ A;  5J2P B;  3P4U B;  1FKP A;  3UCZ P;  4PWD B;  3FKB A;  4X4U A;  4C2M A;  5KG4 A;  1R89 A;  2EW9 A;  3RZA A;  2KT2 A;  2MLZ A;  2QLJ B;  4NXM J;  3ILI A;  3MM6 B;  4X64 F;  3MGJ A;  4C3K A;  3OTE A;  5EN1 A;  1X5P A;  4LMZ A;  3SI8 A;  1KOO A;  2C3Y A;  3KHG A;  1VQ4 S;  1WC6 A;  1VQ7 S;  1HQU B;  3Q23 A;  3WZ0 A;  1HNZ J;  2GHV C;  5F0W A;  1SKW A;  3AHP A;  1FXD A;  3SYZ A;  1U47 A;  4QBU A;  3A3O B;  2CPE A;  1M1H A;  4IRD A;  2WSF C;  1FX4 A;  1GX6 A;  3TWZ A;  4EZ9 A;  2DXD A;  1BY9 A;  2YNI A;  4DL3 A;  1TL4 A;  2HHS A;  2XG8 A;  1EQ0 A;  2BR0 A;  2J9C A;  2JC1 A;  2WK4 A;  3HFZ B;  4ZPW R;  3G2X A;  1VDH A;  2XSJ B;  3W63 A;  4DX5 A;  3CCQ S;  4DL5 A;  2OFG X;  2Y1R I;  3VAG A;  2UUB F;  4MKY A;  1BWV A;  1AW0 A;  1WTF A;  3TYT A;  2C2M B;  2E9R X;  2ZOF A;  1QAX A;  4DSK A;  2HLT A;  3DOK B;  1D3W A;  5DLG A;  2W9B A;  3DMJ A;  2ALY B;  2GX8 A;  2QN6 B;  3JSB A;  2BE7 D;  4MAK A;  2JVO A;  3LW5 C;  2FLN A;  1CS4 B;  3ADA C;  2X3G A;  3TNV A;  1WG1 A;  3TAP A;  1SUQ A;  2K7K A;  2XMM A;  4OHY A;  4KO0 A;  1HAR A;  1J27 A;  4K59 A;  3TAM B;  1RQ0 A;  2BW7 A;  2D9P A;  2KH9 A;  4K4X A;  1RTI A;  3BF4 A;  3FJ2 A;  3ZFV A;  2Z8Q A;  3R27 A;  4PG4 A;  4QIV A;  2DGQ A;  5I4M A;  5EWF A;  3UD3 P;  2W7A A;  2C2Z B;  5KFW A;  3AD7 C;  5LJ5 Y;  4PUO A;  2W7P A;  5DS7 A;  4DV2 F;  3CDW A;  3BJY A;  3EZU A;  2EFG A;  4JI6 J;  1JNZ B;  4G3I A;  4EO6 A;  1T3O A;  2EPI A;  4ES2 A;  4ELU A;  3ILL A;  1S9G A;  3GG1 A;  4H4O B;  5LSR A;  3LWL A;  4O3R A;  2X1A A;  1C0T B;  3OL8 A;  4LBH A;  3CCL S;  4K5S A;  4DF4 A;  4UZB A;  4P7V A;  1UCN A;  3FK4 A;  4RUH A;  4NE9 C;  5HVF A;  3PJX A;  3IS9 A;  2C28 A;  2CAD A;  3QYY A;  4NZ6 A;  3S01 A;  1VR6 A;  2Z30 B;  4K8R A;  8AT1 B;  3NP5 A;  2AWZ A;  4FN5 A;  1RT1 B;  4RW9 A;  1NDL A;  1WJ9 A;  1HBU A;  3MF5 A;  4YEA A;  2HSE B;  2WZ1 A;  2E1P A;  4LSZ B;  3UN5 A;  3FCH A;  1UL3 A;  5AXN A;  3QRP A;  2ZVI A;  2UUA J;  1VRT A;  2IRX A;  3OR2 B;  3P8B B;  4KSE B;  4WYW A;  5C7P A;  1QE1 A;  2DHS A;  3HHD A;  4CNY A;  4UY8 5;  2YTC A;  4RUA A;  3FSY A;  2RHS B;  2RDD A;  4P2F A;  1SV5 B;  2QLW A;  1S1V B;  4YFU A;  1B0T A;  3GII A;  2H9Z A;  2JDJ A;  2HQC A;  3JAM Y;  2R7T A;  1NPP A;  4ZVS B;  3BBC A;  2GGP B;  3ET6 A;  2PA8 D;  2RQ4 A;  4HAC A;  4OI3 A;  1WAC A;  4ALZ A;  5B0G A;  2P8I A;  3W5Z A;  4DS4 A;  1SL2 A;  1HNX J;  2O1P A;  3M9M B;  3O1L A;  4QJV A;  2IPO B;  2BAN A;  2DNH A;  3RBE A;  3BGR B;  2CNK B;  4IDK A;  2W9B B;  2VUG A;  1I94 J;  4B9M A;  3M1V B;  4V1A k;  3U1M A;  4YHH F;  1W25 A;  2QG9 B;  3IGN A;  5HK4 A;  3AJ1 A;  4OI6 A;  1FK9 A;  5FDL B;  5BYR A;  4DPY A;  4QPX A;  3A12 A;  4O0N A;  1NSQ A;  2GIQ A;  4B02 A;  2E5L J;  2FB0 A;  1RWX B;  2ZD1 A;  1CJK B;  2DGT A;  3HZG A;  4WXO A;  2HG4 A;  4YN3 B;  3PEJ A;  1YG0 A;  3SCJ E;  2F9D A;  3OV7 A;  4KPY A;  4YB7 A;  4L72 B;  1A7G E;  5HVG A;  3KHR A;  1SCJ B;  4BCA A;  3M2R A;  3BH7 B;  1LW0 A;  3D68 A;  3JS9 A;  4OYO A;  2DNO A;  4FPR A;  5KG3 A;  4DL7 A;  3T19 A;  1BD6 A;  5CD4 H;  3C19 A;  4GO7 X;  1CVJ A;  3EGV A;  2LXF A;  5CZV A;  3HSG A;  1QAJ A;  3OTO J;  1RT2 B;  1WWH A;  2F8E X;  3TZY A;  3VTI A;  1FJG J;  4PXE A;  1RSC A;  4O4G A;  5DO2 A;  4Q44 A;  1ICE B;  4DR2 F;  1M5H A;  2JLE A;  2GIF A;  1E6V A;  4P73 A;  1N5S A;  3PX4 A;  4LQ3 A;  2GJ2 A;  2BAB A;  1LW2 B;  4DV3 F;  4NA3 A;  4N77 A;  1TKT A;  4RNH A;  1P9Q C;  4J91 A;  2XI2 A;  1JXL A;  1JJ4 A;  3CO9 A;  4PZV A;  4LSL B;  2VJU A;  2ASD A;  1UFW A;  2FHO B;  2MZR A;  4ILM A;  1P9Y A;  3DOM B;  1HWU A;  1S6P A;  2HS0 A;  5E3Q A;  3JQM A;  5KFI A;  1L3S A;  2MQ8 A;  1D1U A;  4C8L A;  4F2R A;  3MR3 A;  1JIH A;  3BKU A;  4OJH A;  5D3G A;  3EDQ B;  1IKW A;  4CH7 A;  1HWK A;  3NS7 B;  3MPV A;  4HTI A;  5KFK A;  3QJJ A;  1MG7 A;  2XWY A;  1ZA1 B;  2W4C A;  5FII A;  2YH1 A;  4IUF A;  2FLO A;  5IZH A;  2GQC A;  3OFE A;  1TAU A;  3V2U C;  1H7W A;  2MQO A;  5C25 B;  3KMS A;  3BKF A;  1KDN A;  4F25 A;  3M32 B;  3V6J A;  2AJF E;  2UUW A;  2E9T A;  2UVR A;  3L95 X;  4WFX A;  5KG0 A;  4PYD A;  5T7L B;  1XNR J;  1RLC L;  1JLQ B;  4FF3 A;  2Y9H A;  2QLF B;  3H7H B;  3OL9 A;  2CDQ A;  1D9D A;  3HPO A;  2W8K A;  1VRU A;  3C15 B;  3NRB A;  7FD1 A;  4X4O A;  2ZDP A;  5AJ3 J;  1F3F A;  2E1M C;  4FS1 A;  4OV6 A;  2QA4 G;  3B4M A;  4F3Q A;  2ZKU A;  1T95 A;  5ETM A;  3MPW A;  2DCL A;  1EKR A;  2JLF A;  1B3T A;  2DNM A;  2ZH1 A;  3QGG A;  4RUB A;  4KKO B;  1WKJ A;  3VGU A;  5ETS A;  4JV1 A;  4IOA Q;  3IWX A;  2HEK A;  1HNV B;  1RBL A;  3CJ2 A;  3M8Y A;  3W5X A;  3AXM A;  3PVX A;  3D9B A;  4DQR A;  2I1R A;  4WFA Q;  1SKR A;  1LQ9 A;  3KDN A;  2HFZ A;  4EGL A;  2NRE A;  3UWT A;  5T41 A;  2J7U A;  4N8O A;  5GMK a;  2CPI A;  3LAN A;  1F9F A;  4YY3 F;  2OPR B;  3AB4 B;  1LFW A;  3M2R B;  2XYP B;  1V3S A;  2WON B;  5DET A;  4USI A;  2F3J A;  2ZHB A;  4DUY F;  2DNN A;  1MSW D;  1N88 A;  1HQU A;  2GJI A;  2ACY A;  1ELO A;  2KXH A;  4MKV A;  4UQT A;  1R6V A;  5D4N A;  3DOK A;  3FC9 A;  1R31 A;  3OUY A;  1WC5 A;  2QJ3 A;  3TEG A;  2DY1 A;  3UVJ A;  4PYA A;  2JJ4 D;  4FF1 A;  4WFY A;  3N01 A;  3KHL A;  2UXC F;  3FBC A;  2IJN A;  3D6F B;  1FEE A;  2PN6 A;  2HBR B;  4R5P A;  1WDD A;  4FBU A;  1BQM A;  2EBG A;  4ZKA A;  4GC7 A;  5EWE A;  3M1V A;  1KRP A;  1AT1 B;  2GO8 A;  2RS8 A;  4LFC F;  3EIC A;  3JAM U;  1F60 B;  4P7T A;  1L3T A;  1HBO B;  2H5E A;  2VG6 A;  1MMN A;  1FWP A;  2C2D A;  4WFZ A;  2KYZ A;  4GVL A;  1ZTW A;  2CYY A;  2DNQ A;  4IO1 A;  2UVU A;  4B3T J;  2ZNY A;  1NH7 A;  2VQF J;  4W92 B;  3DI6 B;  4H4M B;  3CT9 A;  3VVU A;  1U49 A;  5F3Z A;  1N6Q B;  4DI6 A;  1RWP B;  4DR6 J;  4ZVP B;  3AH6 A;  3T1Y F;  2VOD A;  3CCW A;  3WBZ A;  2RF2 B;  4B9T A;  2C3P A;  4LF4 J;  2CNO B;  4Y2A A;  2VH7 A;  1H73 A;  4M1K A;  3I0R A;  4RBV A;  2HVH A;  1RWU A;  1U2F A;  1UZH A;  2MZQ A;  4ZVG A;  4CZC A;  4X62 F;  2LA4 A;  5F9L A;  1XNQ F;  2EC0 A;  1TU0 B;  1W2I A;  5GAG U;  3KHH A;  2VAS A;  2V34 A;  3K89 A;  2NXJ A;  2QFJ A;  2DNZ A;  3UO0 A;  4CIO A;  2X1G A;  2XYG B;  3CJQ A;  4RNO A;  4K4S A;  1FT8 A;  2OEM A;  3R2D J;  2R7U A;  2P9C A;  1Q16 B;  3F44 A;  4EBC A;  4IQX A;  2VQE F;  4C3M A;  1X60 A;  2OGU A;  1T9W A;  2B4O A;  5C42 A;  3TAN A;  1HNW J;  2HHT A;  1I1G A;  4QYZ K;  1N5T A;  4M5H A;  3OBI A;  4JYA F;  3QRR A;  2DGX A;  5H9E K;  1UZD A;  3ICL A;  4Y2I A;  4CH0 S;  2EWH A;  4EEY A;  2WOM A;  4IDK B;  3FEZ A;  1TL3 B;  3BYR A;  4DL2 A;  4O44 B;  1W26 A;  4P72 A;  3ILJ A;  4R25 A;  1RUS A;  1A9N B;  1GTE A;  2G2Y A;  1B7F A;  3GYX B;  5CA5 A;  4FXW A;  2LEB A;  1WHX A;  2OPP A;  1TZ0 A;  1XIQ A;  2GGP A;  3ET6 B;  1MWZ A;  1HKA A;  3OT9 A;  4MJK A;  2BJE A;  4TY8 B;  2R7X A;  2CZV C;  1B99 A;  4ZVO B;  4LR7 A;  4O3S A;  2I5J A;  4TU8 A;  1EQM A;  3LGN A;  3JB9 k;  3O3L A;  1DBD A;  1LNQ A;  2IRY A;  4O3P A;  1FRI A;  3OHB A;  1JJC B;  1Z2L A;  3CPW R;  4DR1 F;  4ANC A;  3CNQ P;  2V50 A;  3QZ8 A;  3HX9 A;  3IBF B;  1VQM S;  3ZZU A;  3W2W A;  2KG1 A;  4DPT A;  4ED2 A;  2VFV A;  2KN4 A;  4RW4 A;  5EGY A;  1L3V A;  3EVM A;  5CCM A;  1UEU A;  3FZB A;  4FXV A;  4ZVQ B;  1NK7 A;  2JX2 A;  3DYA B;  4RW6 A;  5A2Q Y;  2YWF A;  3D2W A;  3LAM A;  4OI1 A;  4LF8 J;  4LF1 A;  2DGU A;  4L75 A;  2C3O A;  1BQX A;  5AXL A;  4N41 A;  1XK8 A;  3PFO A;  3QAT A;  2XMW A;  2DNK A;  1RTD A;  2DR9 A;  3MR5 A;  3J7Z T;  4O23 A;  3D6T B;  4I7F A;  3RG6 A;  2YNG B;  2R8I A;  1U8S A;  5B0C A;  3GYG A;  2KHC A;  2CQD A;  4OJG A;  3K5L A;  3M2U A;  1FRH A;  1Q8I A;  3C16 A;  1FX2 A;  4S0M A;  5E7O B;  1EP4 B;  3NGD A;  2KZZ A;  1O8B A;  1J5O A;  5C5J A;  3CMA S;  1C1B A;  2IYG A;  3DGP B;  3CE8 A;  5A8K A;  4OZ1 A;  2DR7 A;  1SC1 B;  1JXV A;  3G87 A;  3ZNU A;  3K5M A;  3ZZT A;  1RU1 A;  3CB4 A;  1EX8 A;  4KO0 B;  5HN0 A;  4FPI A;  3FBF A;  3I0R B;  1N36 F;  2DIV A;  1LWX A;  4LSL A;  2HRY A;  4OHX A;  1IKV B;  5B09 A;  2VG7 A;  3QZ7 A;  3CF5 Q;  1VFJ A;  2OML A;  3NLC A;  2Y1I A;  2JC0 A;  2YKM B;  3CDA A;  4ZCM A;  1N5Q A;  2JEF A;  2UUA F;  3VAM A;  2HQF A;  4BC7 A;  4YDX A;  3DRR A;  2HHV A;  4LVN P;  4KH1 B;  1YKW A;  1D9F A;  1BXN A;  1S9E A;  3HT0 A;  4CO0 A;  4U95 A;  2XC9 A;  2RDJ A;  3CCM S;  2QLB B;  4J9P A;  2HQG A;  1HBO A;  1BWE A;  1KFD A;  4OZ0 A;  1FFW B;  4DR3 J;  1IUJ A;  4KH0 B;  3KLH A;  3BO2 A;  3VR1 A;  3K5O A;  2ZH2 A;  1GMU A;  5HP1 A;  1VQ8 S;  1FDD A;  1Y5L B;  4PXD A;  2FPH X;  2O66 A;  3POT A;  2LVW A;  3EGN A;  1RAG B;  1JX4 A;  3BGO P;  5J1N A;  4NXN J;  2Q66 A;  4PQU B;  2IVY A;  1CUL A;  4J37 A;  4U96 A;  2W7O A;  1O51 A;  3Q2T C;  2MTL A;  4QPT A;  4ATN A;  1TFW A;  4CLK A;  4F4Z A;  1YIJ S;  2XY6 A;  1UWB B;  3P5B P;  2DT9 A;  1JLB B;  5ADZ A;  3QWP A;  3BEG B;  4D3G A;  3KK2 B;  5HMY A;  1VBY A;  2MKJ A;  2IC3 A;  4I0W A;  1KFS A;  2UUT A;  2A18 A;  2BJ9 A;  4XDD A;  4ECW A;  2HMI A;  3KJV B;  4ED5 A;  2ZH7 A;  2YQ0 A;  4M5K A;  3BS9 A;  3D6H B;  5L9N A;  1FKA F;  1CJT B;  2RJZ A;  3EM1 A;  1MW7 A;  4GMK A;  4U8V A;  5LXY A;  2A6M A;  3IG1 A;  5F8G A;  2YPY A;  5F9N A;  3KLF A;  4UOC A;  4CCH A;  2HNY A;  2E1R A;  2Q1L A;  2QT7 A;  5KT5 A;  2ZBQ A;  3IRW P;  3GQC A;  2KFZ A;  3CIZ A;  3PV8 A;  1TKD A;  2MLX A;  2L08 A;  3KMQ A;  4DFJ A;  1X0P A;  3PM9 A;  1HLW A;  2B9W A;  4OYI A;  4L74 A;  2ROE A;  5KG2 A;  3BKT A;  2W2P P;  2M9K A;  2EVZ A;  2C42 A;  3DXS X;  1T9T A;  1O6X A;  4DHV A;  1H72 C;  1U1O A;  2YPZ A;  2FJA B;  1Q1K A;  3M9O B;  3H4B A;  3MCM A;  5HJX A;  2UUC F;  1PYS B;  1H7X A;  1FRL A;  3NEK A;  4IRC A;  3HFK A;  3H2L A;  1ZM4 A;  1WKL A;  4U7U K;  3L7P A;  3DLE B;  2QL9 B;  4ZLJ A;  1G6B A;  1XNQ J;  3M05 A;  1J5O B;  1EKS A;  4WP8 A;  5CCL A;  1S5Z A;  5F8N A;  2ZE2 A;  3V6D A;  1YJV A;  2YX4 A;  2ZWP A;  4KTQ A;  3Q0A A;  4DDF A;  1M5P C;  1MWY A;  3KLE B;  2JEI A;  4M5G A;  1YBU A;  4NMX A;  3VWS A;  1NDP A;  1RT4 B;  2CPY A;  1KVJ A;  4ZS6 A;  2RKI B;  5GAG I;  3IWN C;  2IA6 A;  4JB8 B;  4CDI A;  6AT1 B;  2CPD A;  3UDV A;  3EPG A;  3ISN C;  2RQC A;  1YBT A;  4KR0 B;  5A6W A;  3CC4 S;  1RTH A;  2VQF F;  1U25 A;  4DQS A;  3X1L B;  3PHT A;  1VQS A;  3HXM A;  1VBZ A;  3T5H A;  2XSF A;  4I4B A;  5GME A;  1R8C A;  3MR6 A;  2IDE A;  3HFV A;  3S8S A;  5I3U A;  5C24 A;  4TU7 A;  2FYX A;  2EBE A;  3AOA A;  2HQD A;  1FHT A;  2OIH A;  1IBK J;  3IMQ J;  3KKF A;  3M6U A;  3IM8 A;  1DUR A;  2XMJ A;  4KYZ A;  2BQ3 A;  2HVD A;  1KN6 A;  3MTJ A;  1ZAV A;  4DQI A;  2MHN A;  1XMB A;  3TP2 A;  1G2E A;  2WHO A;  1M1G A;  1NJZ A;  2F65 A;  4YP3 A;  3J7A 1;  2VA2 A;  1QUV A;  4BWJ A;  1TVR A;  3HKW A;  2IBO A;  3HI9 A;  2H5I B;  4A8Q A;  1RT3 A;  3D0G E;  3EJM A;  3BR9 A;  1QJH A;  3CJ5 A;  1RT5 B;  4NLD A;  2ZWO A;  5I3Q A;  2MGZ A;  3PZP A;  2MZS A;  1TKZ A;  4DUY J;  2ALZ A;  2QEX S;  4ZK7 M;  4DMZ A;  1S72 S;  2MJU A;  1RWK B;  3L09 A;  4ZLL A;  2GQ2 A;  5M2U A;  5EDW A;  1BMQ B;  1S48 A;  4K2J A;  1HBM A;  1CBK A;  1FFS B;  2N4C A;  3DRR B;  4O3O A;  2FHM A;  3WDO A;  1GH8 A;  1HHQ A;  3MMA A;  4PKD B;  2I5J B;  1BUX A;  3NGU A;  3SXL A;  2M3D A;  4ZVH A;  4OMF G;  3AT1 B;  2GVD B;  3GIL A;  1KTV A;  4WPA A;  2IHR 1;  1HQE A;  4OQJ A;  2BKP A; 
#chains in the Genus database with same CATH homology
 2GVZ A;  2GVZ B;  1WC4 A;  1CUL A;  4OYO A;  1WC1 A;  3C14 A;  1CJK A;  4CLK A;  3C16 B;  3UVJ B;  1CJU B;  4CLL A;  1AB8 A;  1WC6 A;  4CLY A;  5D0H A;  4OZ3 A;  5D15 A;  5D0G A;  5D0R A;  1CJT B;  1FX4 A;  2QV6 A;  1U0H A;  2W01 A;  4OYM A;  4P2M A;  1AZS A;  4OYW A;  4OYI A;  1CJV A;  4WP3 A;  1Y10 A;  4USW A;  5IV4 A;  1U0H B;  1CS4 B;  4NI2 A;  4CLW A;  1CUL B;  4CLT A;  4OZ2 A;  1WC0 A;  4OYA A;  2BW7 A;  1CJT A;  3ET6 B;  4WP8 A;  3C15 B;  4OYP A;  4OYB A;  1YBU A;  4CLF A;  4OYZ A;  4CLP A;  4CM2 A;  3MAA A;  4USU A;  1YBT A;  1WC3 A;  4CLU A;  1AZS B;  4USV A;  4WP9 A;  1Y11 A;  1TL7 A;  3MAA B;  2WZ1 A;  4CLZ A;  1CJV B;  1CJU A;  3R5G A;  3C16 A;  1FX2 A;  3C15 A;  1CS4 A;  1TL7 B;  5IV3 A;  4P2F A;  4CM0 A;  1WC5 A;  3UVJ A;  3ET6 A;  3MR7 A;  3G82 B;  4CLS A;  3C14 B;  4OYX A;  1YK9 A;  4NI2 B;  4UST A;  3G82 A;  1CJK B;  2GVD B;  2GVD A;  4WPA A;  4P2X A;  5D0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...