4P2MA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
169
Chain Sequence
RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Adenylate cyclase
total genus 36
structure length 169
sequence length 187
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2mA00
1CJTB 5IV3A 3C16B 1AZSB 2BW7A 4OYPA 1YK9A 3MAAB 4CLPA 1CJUB 4OZ3A 4CLWA 2QV6A 4OYXA 2GVZB 1WC5A 4USVA 1U0HB 1Y10A 3C15B 3G82A 3R5GA 3ET6B 1CS4A 3MR7A 2WZ1A 4NI2B 1CJVA 5IV4A 1CJKA 1WC1A 4CLFA 5D15A 4P2XA 5D0GA 1CULA 3C16A 4USWA 4CLYA 1CULB 1FX4A 4P2FA 4CLKA 1CJTA 1Y11A 3C14B 1TL7B 3UVJB 1YBUA 2GVDA 2GVZA 4OYOA 5D0HA 4OYWA 1WC6A 3UVJA 1TL7A 4OYAA 5D0RA 3C14A 4CM0A 1WC4A 4USTA 4CM2A 3C15A 1YBTA 1AZSA 4OYIA 4OYMA 3ET6A 4CLLA 4CLSA 4CLUA 1AB8A 1U0HA 4USUA 5D0EA 4P2MA 1CJKB 1CJVB 1CJUA 2GVDB 3MAAA 4OYZA 1FX2A 1WC0A 4WPAA 4NI2A 1WC3A 4OZ2A 4WP3A 4CLZA 2W01A 4WP8A 4CLTA 4OYBA 4WP9A 3G82B 1CS4B
chains in the Genus database with same CATH superfamily
1CJTB 2O3DA 4ECRA 2JL9A 2HWHA 3NGTA 3UQSA 4QIGA 1NJWA 1NK5A 2W7AA 2K8GA 3DRSA 3CCES 2N7CA 1D09B 3EMTA 1GEHA 1LQ9A 3KWMA 4TU9A 3AJ2A 2XMUA 3AQOA 3ZZYA 4FYVB 3UCZP 3PO4A 1JJCB 1NHUA 3BSNA 1RBLA 2RHQB 3DMJB 2NSCA 2L41A 1U1NA 1NPKA 1R8CA 1SJQA 2G13A 2ZBQA 1RAEB 3HSGA 4B17A 4ECWA 4FXDA 3WBZA 4LF7J 2LQ8A 2Y1LB 5G0RA 3OTOJ 2PI5A 1TK8A 5C24B 2E5GA 3UN3A 2BEFA 2AEFA 2C3OA 4H4OA 2IA0A 3HHLD 3SZ2A 5E3QA 2QT7A 1PYTA 2VPZB 1D8ZA 3D3CJ 4GVLA 1C0TA 2HWTA 3BGFA 3FUYA 4I6YA 5IZHA 2R8IA 1X0FA 2OSRA 4QWCA 1SH0A 3W9IA 4EUVA 5KG2A 2RJZA 1CC8A 4R25A 3CEDA 4P72A 4EBEA 4HACA 5KFRA 5IT9U 2BM1A 3FCWA 2CQGA 3ELHA 3HSZA 3ZZRA 2I5JA 2UXBJ 2DNPA 1KR4A 1HHSA 2RH3A 4H4OB 2NUUG 1B0VA 2MY7A 2ZVSA 3DLJA 4DR2F 1RTDA 1RWPB 3WC0A 2Q43A 2CRLA 4ED5A 3EGWB 3DU5A 1BQNB 3IRXA 4DFKA 2HWIA 5F8MA 1JXLA 4C0BA 4F2RA 5D4PA 2ALZA 1ZZFA 4DR5F 2X1GA 3M8PB 1XEZA 2F8HA 2QL9B 1RT6B 3GFZA 4WBFA 4L6V3 2HGLA 4ZP8A 3UR3C 4FF4A 2IVMA 1NDPA 3QGIA 2AYGA 5D0GA 4U7UD 4I7FA 3VAHA 1TELA 3C46A 3CD0A 1RYRA 3MXHP 2UVWA 1KQGB 3UPFA 4MKVA 1D9FA 1FXRA 1Q8KA 2AU0A 3HKWA 2QMWA 5IXUA 5DGAA 1FE0A 4MYUA 2FJWA 3OSNA 2UXBF 4G1QB 1VQMS 4DUYJ 3DC2A 3TA1A 3PVXA 2R7TA 4CH0S 2MYFA 2BKOA 3NKYA 3P5TL 2GNKA 3BR8A 4DWIA 4LF8F 1VC6A 4DR5J 2FVRA 1QAXA 1HKAA 1NZ8A 2GVZA 1LKZA 4QIVA 2DVIA 4WYWA 4B3TF 1A9NB 2PT0A 1MSWD 2MPUA 4IG0B 4DV4J 1SL2A 2CIMA 4PWDA 4QR1A 3M8RA 3BO2A 3PJ9A 5DLGA 2LFVA 3QAEA 4U95A 1XERA 2IM3A 4CO5A 2ADCA 2IJRA 2CQPA 1V3SA 2QYGA 1I5OB 2HBYB 5E33A 3J80U 1U1QA 5CYMA 4RW9A 1Y7PA 2GMLA 3S1TA 4PZVA 2HQCA 2IM1A 1TVRA 2EK1A 2OH2A 4QOTA 2LEBA 3C3LA 3TZYA 1UPPA 3M9NB 2CJKA 2GS8A 2H54B 2DRBA 1RT3A 2DY1A 4DV4F 4RW4B 3BH6B 2RS2A 5FIIA 3MGJA 2RF2A 3M8WA 4WFYA 1VBXA 3E51A 4DHVA 4DSIA 1BE4A 1FO1A 2A3JA 3QQCD 4OZ0A 3RGIA 4F26A 6FDRA 2N7YA 4F7VA 4B3RF 3MEKA 2KJWA 2R8GA 1YJ9S 3T6JA 2FC8A 2B51A 3RRKA 4ECZA 1S6QA 4QWEA 1IBLF 4H54A 4F8RA 4PQAA 1JLAA 3AJ1A 1TL1B 2HSEB 2ATLA 1S9GA 3OTOF 3IR6B 3QT6A 1F0XA 3ZXWA 1SPBP 3J7ZT 3KJFB 2LU1A 3UDLA 2AGQA 1XNQF 1CSJA 4C8ZA 1GXTA 4PAAA 3IG1B 3WQPA 2CDRB 2HMIB 5CCLA 1ZETA 1I51B 2DNHA 1DLOA 2ZH6A 1NK9A 2Y8WA 2DKOB 4Y00A 3KLHA 4DR4J 1CLFA 4A47A 3NAHA 3V6DA 1XJWB 3CWJA 3ENQA 4OX6A 4HDGA 4I67A 2DH7A 4Q7AA 4DV2J 2VUGA 4NPOA 3TUZC 1VQ9S 3DFEA 1Y9OA 4J5OA 4PKDB 4U8YA 2AF6A 1R3NA 1FRHA 3DOLB 4HACB 3G9CA 1SB6A 4JP8A 4RO0A 3HVTA 1O0PA 3OVBA 1MMLA 3CCRS 2C3YA 2PEHA 1TL5A 3MPWA 1KTVA 4K4YA 1Y10A 3UNGC 1IKXB 3VGTA 3CPWR 3CCLS 2MQ8A 3BO4A 5LMUJ 5G4DA 2FVCA 3G86A 2MZTA 5ETLA 3V81B 3TI0A 1CS4A 5F3ZA 3W2WB 1RT4A 1MW7A 1RLCL 4J91A 2C2OB 3HO1A 1PJ5A 3VQSA 2DR9A 3QZ8A 1BWEA 2HHTA 3A3OB 5L39A 1RU1A 1CJVA 2DGWA 4QWAA 2Q3PA 4TNOA 2XHCA 3US5A 2YX7A 3R1LA 3C6TA 1LWFA 4PG4A 4DPYA 2AD9A 2HYIB 1SJ4P 4LF4F 4WTOB 5J2QB 1TP7A 2WSCC 3OV7A 3KTQA 4X4PA 1AUSL 2B6AA 2MJUA 1C1CA 3HZEA 3UO0A 4HDHA 1BC6A 3GWCA 1T05B 4HTJA 5ETPA 1LW0B 4AD6A 4CLKA 1UVKA 4PEOA 4OI1A 4TYAA 1RGVA 1VRUB 2XMVA 2YNFA 2K7JA 3ZZOA 3AXKA 1ULRA 3UW1A 4ZHRA 2ZH8A 1RT1A 3AXMA 3QT8A 3CCQS 1F3FA 1SKWA 4NMXA 1X5TA 4DZ6A 2BE7D 2KYXA 2WW4A 1RE1B 2Q6CA 3BREA 4O4RA 2KFZA 4OYAA 1QUPA 4K4VA 3PX4A 4X4VA 1FFSB 4DL7A 1FERA 4MJKA 3ZO7A 4UT4A 3P96A 2BE2B 2G1DA 4CM2A 1TAUA 3D4JA 4LT6A 4KFBA 3I96A 4MTPA 2HHHJ 1DZ5A 3DKDA 1BUXA 2CAJA 2LXIA 3P3DA 3DRRA 3J81Y 4CLSA 2R9LA 3UD3P 1IBMJ 4NLDA 1YWXA 3HHDA 4JI3J 4WWSA 3JSRA 3PW5A 2E9ZA 4B3RJ 5H9FK 4Q44A 3W62A 1U0HA 4F0HA 1JLGB 2HHWA 1JLBB 2M70A 4I4BA 3GJQB 3D1QA 2JFKA 1VQ7S 1LWFB 4IRKA 2NZCA 3M2RB 2BW2A 2HLUA 4WZQA 2GIFA 1LWCA 1OQ6A 3CO9A 2FZGB 4MFBB 2RRBA 1VDHA 1RT6A 1HWUA 5B0EA 1Y00A 4CNZA 1XNQJ 2VH7A 2HPUA 5E41A 3KHGA 3OR2A 2HZAA 2KHCA 5EWGA 1X60A 3MR2A 5HVGA 3FSIA 5L1JA 1KVIA 2D3ZA 2HMIA 3EICA 5DQGA 2JVOA 3R7NB 3D6TB 3CD5A 2I5JB 1ZTWA 1S9GB 3EM1A 4HHJA 1N0VC 4ZVEA 2KDOA 4K4UA 4HHUA 2AJ0A 1FA0A 2R2SA 3JB9k 1YRUA 2YKQA 2XB2D 2BJDA 2U1AA 2V8HA 3E01A 3MHYA 3O6QA 4PXEA 3W5XA 2J7WA 1IKYA 2MKKA 5J2NA 4F0KA 2CPHA 1RT7B 1UP1A 2XO7A 5LMNJ 4DL4A 3PW2A 4UZCA 5DZ6A 4OX9F 4ES1A 1TFYA 3HK2A 4OHXA 4DV0F 2WAQD 1CQNA 1X4DA 3DU6A 4OLPA 4F2SA 1REVA 2FHKA 2FJBB 1SV5B 2RVJA 4J9VA 3W61A 1IR1A 1Q16B 4RW4A 4QWDA 2FJAB 2KB2A 2QL5B 4U9RA 2VQFF 3OSPA 5D8HB 4ZP7A 3SCJE 2V2ZA 5L1LA 3WIUA 4EMDA 1S1WA 4J9MA 4O44A 3ILLA 2MEWA 1SQEA 2YQ1A 3EGNA 2DXDA 1FRJA 1GXLA 2IC3B 4K0KF 1FT8A 4RW9B 3MM5B 4ZCKA 3JSMA 4PWUA 1F6TA 1M1HA 1BQMA 2DD8S 2VC0A 3BKFA 4BWJA 1YIJS 4AQYF 4PG6A 4CO2A 5CYQB 2AHOB 1LNQA 1LWEA 4MMOA 1YRTA 2DNGA 2A1BA 5DQHA 4NLVA 2E1MC 1GXUA 1LEOA 3MOZA 3TANA 2HNDA 3H2UB 3OR1A 4JI8J 1O5JA 3LAKA 4GRSA 3UCGA 4EBCA 2APOA 1SC3B 2D41A 1L3TA 1K1QA 3MZIA 2AYEA 3TEGA 2UVVA 2NXCA 2DNLA 1HNIB 4CTAB 1AYEA 4C0HA 1PC4A 4LF2A 4NI2B 4ZIWA 1UFWA 1XTZA 2ZHBA 2AJ4A 2QGFB 1CJKA 1NO8A 1N33J 1KHWA 1XR7A 2HVIA 1YDLA 1JLEA 4OV6A 4OZJA 4O3SA 1E6YA 1TL4A 2ZD1A 2R7WA 4O3RA 3EGZA 2JC1A 5J2NB 5A6WA 2N82B 1QE1B 1RACB 4DL0C 1I6JA 1HBUA 2BJEA 2ROEA 4ED3A 2IRUA 2KJVA 4LRFA 1JLFA 2HAFA 4ZVPB 2MLXA 1FNMA 5K14A 5L9NA 4PXCA 5BYSA 4Q0BB 4JUZA 2Z2YB 2CQCA 1X31C 4P7VA 4EFAC 3NOGA 4DR7J 1X8DA 1FJ7A 1HQEA 1ZAXA 2IPOB 1B3TA 2DGOA 3MUVP 3H42A 5KG1A 4QU6A 2EBGA 4M5GA 4CO0A 5GVQA 4A8OA 2FIUA 3M6WA 3FSYA 4IDKA 4DQQA 3RAXA 4B08A 4RU2A 2FY1A 3C14A 2AMCB 4E98A 1RTJB 3MMBB 3T1HF 4Y65A 2EWHA 4ZJQA 3TX8A 4JI0F 1OY9A 2EG2A 4WFNQ 1RAFB 1ZAWA 2BM0A 2GO9A 3C19A 3W65A 5KFKA 2FLLA 3C66A 1YJRA 3MEGB 1U4BA 4KGMA 4QYZJ 4M5JA 3PYFA 4DR7F 2VF3A 4IUFA 3IMQJ 4TY9A 4CLUA 2ZFHA 3ILIA 1OSCA 5M2UA 1XNRJ 3I31A 4KC5A 4DFMA 1R8BA 2QYCA 3MMJA 5D0EA 4AL5A 3NGKA 3FQKA 2PFFB 4LRDA 5IM0B 2GQCA 5KT3A 3OL6A 2UV8G 1GFWB 4ECQA 3HPOA 5HQMA 2J6TA 1SCJB 1FKOB 3R5AA 4ZVFA 3MMCA 4DR3F 3PW4A 3KOAA 4P6QA 5F8LA 3M1VB 2EC0A 1N88A 5DG9A 1MROB 4NCAA 4JYAF 1UEUA 4MFBA 3OW2R 4MKAA 1C0UB 3UWTA 3VVTA 3TQEA 3AFGA 3H4BA 2GO8A 3DLGA 1XNRF 3CCVS 1RAGB 5CYMB 3DCAA 4F4WA 1FJCA 3Q89A 1KFDA 3D1OA 5A8RA 4CT9A 3QYYA 1V9OA 1BLUA 3C6UB 1TZ0A 3KLIB 1MU2B 1ZM3A 3ETMA 3NCQA 4NLSA 3U27A 3JSMB 1RAHB 1KQKA 2IBOA 1K0VA 3B6BA 3MI7X 2IC3A 2KG0A 5LSLA 2KRBA 3VAFA 4QWBA 1KQSR 2OPSB 1HR0J 2F8EX 3DLHA 2E7VA 1RWVB 2XMTA 3DOMA 1MWQA 3IFEA 4B9UA 4L75A 5KFFA 5I42A 4P2SA 4Y3CA 2GVZB 1W25A 2HBQB 2HG4A 2FQQB 4M5NA 4WIQA 3FQLA 4U7UK 3GV7B 1IBKF 2UXDJ 1N34J 4N41A 4C8YA 2BVZA 1S5ZA 2H9ZA 3D1HA 5A8KB 1IKXA 1DARA 1VRUA 2YNFB 3LAMA 3GYXB 3GG0A 1HNVA 2OP5A 2WVEA 5J2PB 2Y9HA 3GIIA 4WF9Q 2MKIA 4ED1A 2BMBA 2HK3A 5J1NA 4ECUA 1JKHA 2RS8A 3E01B 1UVIA 1VK3A 3C15B 3T6BA 2HNZB 2K1RB 4JI1F 3W2VB 2EFVA 3VQTA 3MR7A 1RLDA 2CNKB 3RBDA 5GAHI 1IQZA 5A8WB 4B3OB 1KN6A 1DHMA 2J9EA 4R5PA 1Q0NA 5EUHA 2B7CB 2Z56B 3M8PA 3V6DB 1XMBA 2YPZA 2I2YA 3DGPA 1URRA 2AIRB 3D9BA 3R7BB 3Q2SC 4OZ5A 2CKWA 5KFXA 1WC1A 3O3LA 4PWWA 1FK9A 3F44A 4DUZF 1NB2A 3IG1A 4FS1A 5EN1A 2OPQB 1EHWA 3CJSA 2FTRA 1VQ4S 3CJRA 5H1SV 1HWJA 4B9NA 2C2RA 2BKNA 1TL1A 1T02A 2F8MA 1WOPA 3EPGA 3MMAB 4NE9C 1V5IB 1L5UA 5DM7Q 3CDUA 3KJVA 1ZM2A 4ZLLA 3HM9A 1XR6A 2XZWA 3CF5Q 3HI9A 2EFGA 1RAAB 3HFVA 4OI0A 2V4JB 4B9LA 3D0HE 2C1EB 2VG7A 2YNHA 3PFEA 3T41A 3Q8QB 2ILYA 3C14B 3M8YA 2B4UA 4LBIA 1KWMA 2MKYA 2FJVA 2V50A 3BM7A 3QJLA 5SUHA 4YFUA 1SVDA 4RNHA 4U6PA 3KLHB 2C2EA 1WHVA 2PMZD 1UEVA 3RAMA 1HNXF 3OTBA 4NLTA 5D0RA 1RT5A 3T19A 2VC1A 3PG9A 4BC7A 4FF2A 1D8YA 3VGVA 4DU7A 4HVZA 4CDIA 1RB0A 3MTKA 2JLFA 4KE5A 4UQTA 3TR5A 2G0JA 2LQBA 3BEGB 3FMBA 3OL7A 2CQ2A 5CCMA 4PG5A 1M5SA 4C11B 1SL0A 3GCWP 1JJ2R 4E0DA 3S7RA 1RWNB 1OY6A 1YJ7A 1RTHA 2DNQA 3ETOA 2VKZG 4I2QB 5T7LA 1T05A 2UXCJ 2J6UA 2VOPA 4USIA 3NGDA 1X0PA 1NKEA 4EZ9A 1VRQC 3HJVA 4FS2A 1NSAA 4R0JA 2DNYA 5E3RA 1LFPA 4DV6F 4Q8EA 3QNWB 2ZKTA 2M8DB 4NASA 3LP0A 5J1PA 4GC7A 3TVKA 4DS4A 4AYBD 4QPXA 2WW8A 4KH0B 5KFWA 1JLEB 3V4IB 4J9KA 3C6TB 3M2UB 1S4EA 5D3GB 4DR4F 4URQU 3KLGB 4DX7A 3QRRA 1U8SA 1VK8A 2XI2A 2XSJB 4NMLA 4N47A 4CLZA 1IKVA 5IFMA 4KGZB 3CVKA 4A8YA 2XMKA 3ZTPA 3PZPA 5HN0A 5IC6B 4QPTA 2EG1A 2NZ4A 1VGYA 2WCXA 5KFYA 5KT5A 5KFSA 4LF8J 1H98A 2LXFA 3LP1B 3OT9A 1F9FA 4OJHA 1PC5A 3QGGA 8ATCB 3MAHA 1ZA1B 4C7QA 2MZ1A 4ED2A 1S6PB 4I0WA 4P9SA 3MM7A 1RU2A 2AZ1A 4USJC 5AXLA 4O3PA 3BQ0A 2VG5A 5DM6Q 2Y1IA 1YJWS 4GKKF 2NSBA 3P4UB 5FDLA 1PYOB 1K44A 1NMEB 3RJMB 2OPPA 1PJ6A 1DY3A 2CJ9A 5DDOC 3VAGA 4IOCQ 2GAGC 5FLXU 2R2RA 3LGMA 4I56A 2GQ2A 2Z57B 2CWXA 3VHQA 4DPTA 3GZ7A 4PXBA 3VCDA 4JV0A 1PBUA 1U1KA 3GJRB 3G6YA 4UY85 4B9VA 5ETMA 3SDEA 4A8XA 5KOXA 1JXVA 2DXFA 4FYWB 4KRWA 4X62F 2HNYA 4PQUB 3CJQA 3IBWA 4HT7A 4YOEA 4DPUA 3KJVB 4KKOA 2CPEA 1Q81T 1U0SA 1YVFA 3I4PA 3PYDA 5KFGA 1W2BR 1VHFA 3NGUA 1S1VB 1X4CA 2EFQA 3H0PA 2OPQA 3M30B 4EBDA 1XMQF 1WHYA 4OZLA 4DEZA 5M2PA 1RKIA 2SXLA 1WUUA 1UA1A 4OJ3A 3MMCB 3PKYA 4FN5A 3PX6A 2L48A 4WK1A 3J7YU 2EI5A 4S0MA 1KFSA 4C9DA 5KFZA 1OO0B 4B3OA 1WJ9A 2CJQA 3QBCA 4NYPA 2RUSA 4ZPBA 4TY8A 1J5OA 4YHHF 2E5LJ 4JV2A 1RJJA 1P9QC 2E1AA 2FHJA 2JC0A 3BDEA 3TYTA 4X65J 4LRAA 3NY0A 1FRKA 3W2VA 5A2QU 4P2XA 5B7WA 3QFWA 4QU7A 3A1YG 3MAQA 4EK2A 3GV5B 2VQEJ 4RW7A 3VAMA 2HKEA 2ZC4A 2ZKUA 2Y0SD 1VIOA 3V6KA 2C28A 2ZZMA 1FF2A 4PG8A 3P5BP 1XK8A 1SKRA 2EKNA 4KPYA 3RB3A 2BJ9A 4P2FA 1AROP 1M90T 1RA7A 5HVFA 4JI3F 5ADZA 3VZIA 1RHKB 3SSRA 4ERDA 1VJQA 1WF2A 3B8HA 1EKRA 3FSXA 1F5AA 5F8GA 1NPPA 1RHUB 3D54A 2O66A 2YPYA 4DXLA 4IDKB 4ICLA 5DS7A 1TMJA 3S01A 3PR5B 1S79A 1X4BA 2E5LF 1GX6A 1DQ9A 2DGQA 2F40A 3L4BC 2Z2LA 1UL3A 4OYWA 1TL7A 2E44A 3L7OA 5FDLB 2MXYA 3TAQA 3BGUA 4NLPA 1FVQA 1ELOA 1NU4A 5A6PA 1HWLA 4OMFG 4ZN1A 2EXUA 4ZCMA 1IJEB 5LMUF 1NK7A 1SL1A 1D0EA 4USTA 1HFEL 4TQSA 5K8PA 3H2LA 1YBTA 3ZZPA 1ZPVA 1MN9A 4WJBA 1K1SA 2CFXA 2X1BA 3MEDA 4RW6A 5B0AA 3JYTA 1RCOB 1OPIA 3CJ4A 2VV5A 3EVOA 3FBEA 5AE1A 5KFCA 1XN9A 2KKHA 1RT2A 1IKVB 3H5UA 2QA4S 1U6FA 1QJHA 1VIXA 1VQYA 5I3PA 4AUKA 5HJYA 4I7FB 5IS2A 2DHAA 4LQ9A 2XSJA 3MR5A 2W9AA 2EFPA 1CJKB 2XYPB 4P2MA 5C42A 2YY3A 1H38A 1CJVB 2CPDA 3MM9B 1QAJA 3CJ3A 3H20A 4M5MA 4AFFA 3QWUA 4LFAF 1UJ4A 2OUGA 2H3EB 1XR5A 4PCQA 1KDNA 1W2IA 4WPAA 3G96A 4ANDA 1RISA 4DQRA 1R8PA 4O3QA 1KVJA 3MURP 1G6BA 4O4GB 3T9NA 1M5PC 2IAJB 4DQIA 2FLOA 1X4AA 2KN4A 4WP8A 1U1LA 1FE4A 1KEKA 1IBKJ 4CZCA 2UXDF 1YHQS 2H5EA 3QRPA 2KZMA 3VGUA 1YZ6A 1CS4B 3HVAA 4ZIVA 5CYJA 3SSSA 4J9UE 1DURA 4B3SF 1B0TA 1O51A 4CWBA 4WKYA 4QR0A 2EFNA 4ELUA 4KHPF 1W7WA 5JXSA 2QMUB 2W2PP 3QPIA 4NEZA 4PRFA 1HHQA 3FC9A 4DQPA 1FCAA 4IH7A 1U1OA 2UV8A 1RYSA 2BRKA 3SDEB 1REGX 2I8EA 4K8RA 2ZM6J 4O3NA 1ZM9A 3V2UC 3DDKA 3GV8B 4R8UB 1KTQA 1EJ7L 2W9BA 3OVAA 3K5NA 3P8BB 4PUOA 4Y6IA 3DLKA 3W9HA 1DAXA 2HZCA 2X51A 3K17A 3IWNC 1RXOB 2LQ9A 3POTB 2F65A 2KM8C 2VASA 2LEAA 4JI6F 4AL7A 3E3XA 1H3DA 4HH1A 2OAUA 3M9OB 2R8KA 4OJGA 2H5JB 2QLXA 3I9ZA 1HQEB 2QE5A 1FD8A 3HSDA 3RU0A 4YR2A 3BO3A 1JLAB 2PSZA 4K2JA 4YB7A 5ETTA 2DEJA 5B0GA 4QW8A 4DPXA 4YHHJ 2QEXS 3SV4A 2DXEA 1P1LA 3R3TA 4E8UA 4EGLA 2CZVC 4ID5B 3HT3A 3AOAA 4OJ1A 1WG5A 5DZ7A 3J81j 2VQEF 2R8HA 2IJFA 2WBRA 3NXZA 4DZDA 3DLBA 2V2QA 3DGPB 1JLCA 2AX0A 2RB7A 2JNJA 3OR2B 2QIFA 3VZHA 1RDRA 1RP5A 3N0VA 1H7WA 3N79A 1R0AA 2QLWA 4NXNF 1HIYA 4C48A 1S6UA 1X5PA 1RT3B 1T94A 3OFHA 3W60A 3CC7S 5C42B 3R2DJ 2CNLB 1GTEA 2HVZA 3ENVA 3HHLB 4TVAB 1U09A 3I5BA 4RNMA 2V8DA 2NPIA 3ZFVA 3IM9A 1EB0A 2DEIA 4NZ6A 5F3TA 3CCZA 3TVZA 1F5CA 5HATA 3W64A 3TWZA 2W4DA 5HQLA 3R7SB 2PDAA 1SJFA 1RWKB 4ECVA 4HTIA 1OYEA 3BKUA 4P74A 2KFYA 3MM7B 4KYZA 1R0AB 1SIWB 5KFVA 4CLYA 3JSBA 4B9SA 5K5MA 2RSQA 4ECTA 3IM8A 2VQFJ 1HBOB 1H73A 3KMSA 2FLNA 3AH6A 4AE5A 5C2CA 2LA4A 2W2OP 4DV7F 1Q7YT 2J8AA 2HHHF 2MGZA 5CHCB 2NREA 1RI7A 2PN6A 2JDJA 4X4QA 3Q83A 1ZZNA 2F7VA 3M05A 4ELVA 2IMOA 4L74A 3AJDA 2NPFA 2MQPA 2M5YA 4K0KJ 1PJ7A 5IT9Y 5MAOA 4NCGA 4OX8A 5LL6d 1J5EF 4J37A 1RT1B 2PMHA 3QJJA 4ES3A 3TA0A 4ZKAA 1NB7A 2UVUA 3OFGA 2BE9B 3GTYX 5B0DA 3GFXA 3LP2A 4EYHB 1FJGJ 1C2PA 5JVHQ 4OYMA 1NJYA 1C1CB 2CG4A 1FTRA 4FYXB 4LFBJ 2BJ7A 3N5BA 2B3TB 1RBAA 1XC9A 1HBMB 3UD4P 4KHRA 1EIYB 2OD6A 1GT8A 4ZVRB 3B54A 2YKPA 2NXUA 2GGPB 2DR8A 3JXOA 3E2EA 2B9WA 2EW9A 1MNEA 3MEEB 1TKDA 4DSJA 1JWWA 1F60B 3SQOP 1N56A 1SC4B 1JNRB 2GVDB 3FCVA 2PC6A 3RRHA 3DNCA 3O5TB 2P6TA 3LF0A 1F2GA 3M8QB 4GKJJ 4YS2A 5B0BA 1S9EB 5GMDA 2ZITA 2EBEA 5I3QA 3H5YA 1WC3A 3TQ1A 1N5YA 2BOPA 2FVPA 2DHSA 3H25A 4M5DB 4ETXA 4WP9A 1KBRA 1Q7LB 4L3NA 1TKZA 5KT2A 3G6XA 3WHIA 1N34F 1E6VB 4DX6A 2VG7B 2YNHB 4KSEB 2B5JA 1M1GA 4F3MA 3TARA 3GJSB 4QIFA 2RIJA 2HNZA 3FJ2A 3BGOP 2DBBA 4DFJA 2RAQA 4NOHA 3UR0A 2Z8QA 1OY8A 1VYAA 1BHNA 1C0TB 2D1CA 1TQLA 3PEJA 1HBNB 2M88A 1UAWA 2IRYA 3I55S 4PG7A 4JI1J 2DH8A 2DRAA 2VODA 5IOLA 2DIUA 4H4MB 5IT4A 1KD1T 1DQAA 2V94A 3CDWA 2MQQA 2ZE2A 1HHTP 4LR9A 2GCFA 2ILZA 5DO2A 1RWMB 3MCSA 3OFFA 1QAYA 3IBCB 4LSZB 4LF7F 1OIAA 2JZ5A 2LCWA 2DHHA 4EI2A 3BR9A 2OJ3A 1UVJA 4HL9A 4MIWA 3B78A 3DMJA 2QA4G 2ZDPA 5IC4B 3D5MA 4CO4A 1U1MA 3VR1A 1M1KT 5AT1B 2A10A 2ZUGA 1HBMA 1WKJA 3CD7A 2FDNA 1QUVA 3K5PA 5BR8J 1FEHA 2GHPA 2HFSA 3SSQA 3U02A 1AW0A 2OPRA 3QT5A 2BANA 5EWEA 1TV6B 3GIKA 2FB0A 1K8AT 1VQ5S 4JI7F 3G8SA 2J9DE 2OKQA 4NLOA 4FZVA 4DR3J 3TAPA 2NYHA 2RMLA 3HHLA 2DCLA 3R97A 3UFCX 5B09A 5LJ3Y 5HROB 2XMAA 3CCMS 4ZLJA 2QFJA 2Y8YA 4ZPVR 3KLFA 2V6AA 3TZWA 1H2UX 3G2XA 4UW2A 2FGCA 2BBEA 4TXSA 5C2GA 1UVMA 1U8WA 1Q86T 4C98A 4DV7J 3FK4A 5U47A 3N6MA 1T9WA 5D15A 4BC9A 2JLEA 3BB5A 2XZTB 3HVRA 2F63A 3DI6A 3NP5A 3KK2B 1HNXJ 2J0SD 1KS2A 2GX8A 2YNIB 1HLWA 4LRBA 4WCEQ 2HQGA 1UA0A 3Q86A 2G0CA 4WKRA 4ZVSB 2OO4A 2ZBIA 2UP1A 1RTHB 1U6BA 5ETKA 1UEKA 5CYQA 4ZJOA 2GJ2A 3EGVA 3HF5A 1FX4A 3I87A 3BGRA 1MWYA 3NS5A 5DG8A 4MK8A 2CNNB 2DGVA 1BMQB 4C3MA 1I94F 4HI1A 4DI6A 2B5JB 1ZTTA 1FJGF 3MECA 2HHVA 4FXWA 2OEKA 2PEBA 3RTVA 1FNXH 3TUPA 3ITHB 3SIPB 1CC7A 1RWXB 1T9VA 2UU9F 4E2FB 4B02A 2M2BA 4C6AA 1RA6A 1U7LA 1TKTA 2QRRA 4OYOA 3V6JA 2CWKA 4TY8B 4RR5A 3CT9A 5HL7Q 2NYIA 3OD2A 1K47A 4CT8A 1T7PA 1NDKA 2A18A 3PNIA 4NL5A 2CQ1A 3FZBA 2G4BA 1GQEA 4ID8A 2KO1A 5C25A 1HNZJ 2J6SA 5KG6A 2C3MA 2PFDA 4ZVGA 2I6WA 2HZVA 4K4SA 1S0OA 2RRAA 3OL8A 3J80Y 3KLEB 1TFWA 2P5VA 4FVMA 3ISND 3I6PA 3MMAA 5KFJA 2VONA 4ZLPA 1VQOS 1S1VA 3L09A 1YG0A 3H90A 4KY3A 5D4NA 2J8SA 1Q53A 2IM0A 5D4OA 3DOKB 1AB8A 3MEGA 3G6VA 3N28A 4KV8B 2F9JA 1QE1A 1ZS6A 1WEZA 2IM2A 4OL8A 1TL3A 2FC9A 4F4AA 1GMWA 2RQCA 4K4ZA 2WOMA 4ED6A 2V9WA 3NBPB 4XO0A 1RTJA 4DOZA 2QN6B 3NCRA 2OEJA 3MAAA 2V4QA 2PI4A 2DNKA 2G2OA 4N8OA 5IQQA 4UY8T 3KUEA 1YJNS 1LWCB 1IM4A 3CO0P 2ABYA 2YVSA 1YZ7A 5JVGQ 5CQGA 3DRPB 1VFJA 3G87A 1Q82T 2W01A 3GR0A 2GA7A 1X5OA 4DPWA 4DBQA 2KL8A 3MM6B 4ZLNA 4CCHA 3P45B 1WG4A 3ITHA 4LBHA 3TAMB 2R7XA 3HHKA 2ZBRA 5E2QA 3Q8SB 4ELTA 1N6QB 3MECB 3F73A 3SQGA 4X62J 2KXNB 2QFIA 1RBOB 2ALYB 4XDCA 2KVIA 3SFUA 4YUDA 1EETB 2HVHA 2IVYA 4F4YA 2WB1D 2IVFB 3UE2A 1B64A 5A8KA 2B4PA 2JEFA 4B3TJ 5L46A 4XPEA 4XDDA 5F0WA 2HRYA 5LOQA 1VHIA 4M8LA 1IWAA 4ATNA 2DNNA 1SQGA 5K20B 2ZOGA 3BPSP 4Y34A 3KK1B 1TU0B 2AJQA 3FGVA 3KK2A 1TUVA 2OD4A 2XGPA 2K3KA 4W90B 1JB0C 3BJYA 2W2NP 2CPXA 4L73A 1RCXB 1N36J 2IY5B 1NSKL 4AXIA 1LFWA 1DTQB 1UCNA 2HVDA 1D3WA 3Q8YA 1HI1A 2C2DA 1NKBA 2CJYB 4LVOP 1VQSA 4I2PA 1P27B 4NLYA 3GMGA 2FZKB 2AT1B 5JUMA 4DJBA 2L9NA 2RKIA 2BKPA 3DLGB 3HHLC 4MT1A 4PABA 5KOWA 4F02A 1LW2B 3GIJA 3AD8C 1YI2S 1VR6A 2LMIA 2O01C 2UUCF 1S12A 2JSXA 3G82A 1WEXA 3H59A 3R5GA 4DFPA 2LECA 1YRXA 1T9UA 3A3PB 2MZSA 3R8YA 4DR1J 2XLIA 2AGOA 2JEJA 3LH2S 2QMXA 1DJ0A 5KFTA 4AT1B 4FYDA 1N54B 2M7SA 2JEIA 3GJTB 2UVRA 4DS5A 5KT7A 3G4SS 1H2TZ 3HVWA 3LQVA 4Y2AA 5KFMA 1I94J 4PUOB 4JV5F 5LSRA 2V67A 2R2TA 4LF4J 1BQNA 1UWAA 4CLFA 1B99A 4M5KA 4A8QA 1NM2A 1F2HA 3L9ZA 2J5AA 1SV5A 4MKBA 3LPYA 2G1HA 3L3CA 1SJ3P 4EU0A 3PKMA 3OTDA 4J7CA 3W3SA 4C8MA 4UZBA 2WTFA 1FWPA 2FHJD 5AXKA 3SMZA 1LWXA 1RTZA 2LVWA 4DF4A 4ZMMA 1IKYB 3AQPA 1CULB 2KG1A 1G1XA 5F8IA 4I6WA 2OI2A 3ZNUA 1SI9A 4OZNA 1FTCA 5KT4A 4FKYA 4YDXA 3FFIB 3OLBA 2VJVA 4DUYF 4DV5J 1U2RA 4RUBA 5KFNA 1FHTA 3LUYA 3JTNA 3NS7B 4ZVQB 4QQBA 1HYSB 2GMJA 5G0RB 1OPZA 3VGSA 4RU9A 3I0RB 1FNOA 2COLA 1U45A 5KG4A 4DL5A 3LPEA 1WSVA 2V8PA 4ECSA 4KHMA 4LFCF 1UWBB 2R7SA 1NRKA 3U7JA 4ZK7M 1SUQA 3LALA 3SYZA 1NSQA 3CB4A 4IRDA 1GK8A 1S57A 2HHPA 2HS4A 2OELA 2WB4A 3M2VA 8AT1B 2OTLS 2DGSA 2KU7A 3GU0A 4KKOB 3KNGA 1NDCA 2ADBA 4XK8C 1NK8A 5DG7A 1SKUB 1KOOA 1PAUB 1IM6A 2F4FA 2VIHA 2V4RA 2ZNYA 1S1UB 3WDOA 2ZDOA 2RKIB 4USUA 4X4UA 3GB0A 2H1YA 4FBTA 3AODA 1X5SA 2G0IA 3DM2B 5KFHA 2DT9A 5D4LA 2L9WA 1KLNA 2OSQA 4LUBA 2I0XA 5IWAF 2W7PA 2GV1A 3DDIA 1S77D 2KVQE 1Y5LB 3UCUP 2CQ3A 3IXQA 4DR6J 1OJ4A 2HAIA 2DGXA 2HBRB 4N77A 4JI6J 5E3AA 1HQUB 1Z4UA 5E5NA 4CO1A 3DXBA 2XI3A 2FD2A 2DR5A 1IBLJ 2V34A 1XBWA 4P7TA 5KTQA 4OHYA 2FJXA 2ZBCA 2R7OA 4NA2A 1T9XA 3OHBA 4NXMJ 4LF5J 5HAOA 2XTJP 3K5MA 4J9QA 2XSFA 1HMVA 2NXNA 4LSNB 3PO5A 2OGUA 1NPRA 3DYAA 1PAEX 3IAM9 2PMWA 3MM6A 3PYGA 1YK9A 3KLGA 2M8HA 1FVSA 3RRGA 2Q66A 3MAAB 2XG8A 2A6MA 1CJUB 1GMUA 1RQ0A 2QX0A 2YWHA 4OZ3A 3PJWA 4DR6F 2QV6A 2XLJA 4K50A 1NLKL 3IS9B 2MKHA 2ZOFA 3JSYA 3O44A 2DK2A 1Y3KA 3Q8RB 1G2EA 4BWMA 1GAOA 1H72C 5F9LA 3OL9A 1QTNB 1DTTB 1WC5A 5HLFA 2HHQA 2KT5A 4FPRA 3ZC4A 1X4EA 1KONA 2CG8A 2VG6B 1FDBA 4M63A 4DV3F 2V5HG 2YQ3A 2DR7A 2Z2ZA 4ID5A 4ZPTR 1S1TA 2D7SA 3KUHA 3KG4A 4Z2XA 5L1IA 1QD1A 3ICLA 2XGQA 3MUMP 1QVFR 4WYLA 1M5KC 4I68A 4IKAA 1Q4RA 2CPFA 3O2IA 4G1IA 4M1KA 5K8OA 4Q2MA 3KHRA 2QLBB 3TEHB 5C25B 3A12A 1MG7A 2KM8B 5THWA 3VAKA 2JEGA 4R8UA 3C2PA 2IRXA 1FFGB 3GP9A 1WTBA 2QSWA 4GO7X 4ETZA 2B0GA 2G2YA 3GR1A 3L7UA 4G1PA 5A8WA 2D9OA 3M2RA 3UI3A 3B82A 5IV4A 1Z1ZA 3NGRA 4YY3F 1EAYC 2DNZA 3ILOA 1YKWA 3M4XA 2ACMA 3BF4A 1N4LA 4KO0A 3L7PA 4OX9J 2WBMA 1CULA 1CBKA 3D7SB 4IYQA 1GX5A 4KPCA 4ZPDA 9ATCB 1A6LA 4F0MA 4X66J 3CMES 2KZZA 5HQ8A 2WSFC 2V68A 4DV1F 2MLZA 1BXNA 1S10A 4F67A 3OLAA 2FJDB 1F9EB 1Y11A 2YQ0A 1PYSB 5C7PA 1T3OA 4Z7CA 1IR2A 1DTTA 1GNKA 1SC1B 5HLFB 4LQ3A 5F8NA 2VZ9A 3CULA 1KKHA 1YBUA 2MJNA 4HHHA 4U8VA 5B0CA 5GADI 2ZJQQ 2AGPA 4OI2A 4YY3J 4DF8A 2DNOA 2W7OA 4DL3A 3HMJG 4M94A 2KXFA 2AEMA 3JQJA 3NNCA 5IWAJ 2EK6A 2MB0B 1MWZA 2HHUA 2MMYA 2A0FB 4M5IA 1GMWD 1KC8T 1QSLA 1EP4B 3J7YI 4JI8F 1TAQA 5HROA 2ZVIA 3BS9A 4RW8A 3GQCA 4G6VB 2DH9A 4RWXA 1HNWF 1BWVA 2VD3A 3WC2A 2BANB 4RX6A 1EX8A 3NEKA 1RT2B 4JOUA 4O0NA 3RYLA 4L76A 3TRGA 2AEJA 2ZH4A 1U1PA 2F5GA 1X9WA 2ZNZA 1KNZA 1M5HA 1WHXA 1C0UA 3FVYA 5JMNA 2ZH3A 2OPRB 2XS2A 2H4YB 2HS0A 3MEDB 2XY5A 1ZA2B 5KT6A 2HIQA 2RRNA 4HKQA 2JHEA 2W8LA 1NHVA 5AXNA 2ZEJA 1LK5A 3NCPA 4F4XA 3PCOB 1EQMA 1IKWA 3R6GB 2DHXA 1SBRA 3HULA 4UOCA 2ZH9A 4X64F 5D6GA 2O5DA 5DGBA 4JV1A 1S72S 1EQ0A 3BBFA 7FD1A 4ICLB 4OYBA 4YB1P 1GTHA 4FP9A 3M6VA 1VQLS 5I3UA 3FEYB 3IRWP 4WU3A 3IA0A 2CQ4A 3QT7A 1S4FA 2D69A 3CNQP 4DCJB 3MM8B 1U25A 5D77A 4LSLB 1DQ8A 4NLWA 1ACMB 3D3BJ 1W26A 5L1KA 1QDUB 3K8VA 4X84A 1VRTB 2VFSA 2WK4A 2JVRA 3MDFA 2DO4A 1UZDA 4DG1A 1RTIA 4UUXA 3T1HJ 4IO9Q 4LVNP 4F36A 5CD4H 2YWWA 1J27A 4RZRA 1SXLA 3LO3A 2MKCA 4O4GA 1UWBA 1UJ6A 1B70B 2DO0A 2V8GA 3W7BA 5AE2A 4USKA 1FRXA 3HLUA 3CCTA 3M8QA 5HP1B 3TZZA 4NLRA 4LFBF 2MZJA 1M0SA 4DU8A 2VFRA 2BJ8A 4R5PB 3HFKA 1Z2LA 1FKAF 4ECXA 1R6YA 3CIZA 1RTDB 2AZ3A 2J9CA 3PHEA 1RTIB 4USVA 2QL7B 3I9V9 1VBKA 1R31A 5HMYA 3VTIA 2BA9A 2HQFA 5LXYA 2HFZA 3T9ZA 5J2MB 1U0HB 2Z2MA 4YQWA 1VC0A 2HGNA 3OUYB 2VBWA 2B8PA 3KLEA 2VHGA 4CYUB 2PD1A 3OXFA 3R5CA 3SCIE 4HLBA 2CQBA 2LDIA 1FDNA 1NH8A 3CDAA 1NK0A 2UZAA 4J9OA 3IS9A 2K06A 3FRYA 5GAEU 2AX1A 4FPIA 1RHQB 1G3OA 1PGZA 1D9DA 1WDDA 3HXMA 4NWBA 2UU9J 1RK8A 1N48A 2P9EA 2VFUA 1X4FA 2YKAA 2YNGA 1XWLA 5DQIA 4F4KA 3RB0A 4CIOA 2BACA 2OPPB 1WG1A 4YR0A 2MQLA 3PR4A 3KK1A 1FXDA 1S7HA 2YKOA 2PA3A 3K2YA 1D1UA 3LP1A 3Q8VA 3DRSB 5E3CA 2FHMA 3CJ8A 5EX3A 1S6PA 4IRCA 1X4GA 1BQMB 2HEKA 2R7VA 1UVNA 4J9SA 2B43A 5L8RC 1P9YA 3NLCA 2RDJA 1JJHA 2CADA 2YH0A 2B7BB 4HEA9 4I2PB 4UOGA 1N0UA 4Y2IA 5J2QA 5ETRA 2WRMA 1DTQA 4KGVB 2ZC3A 3BN7A 2K7KA 3TX0A 2EEYA 3I5CA 3ULHA 2PO4A 2C42A 5DDQC 3MUTP 3KLVA 4MKYA 2PIIA 2RQMA 3HX9A 1FKOA 8RUCA 3UVJA 1JJ4A 4V1Ak 5EWFA 1RAJA 2E7WA 3K0JA 1UETA 5HO4A 2ZZNA 2Y1JA 4ZITA 1WF1A 4DSKA 2VA3A 3B4MA 4Y2MA 4CM0A 5IM0A 1S0MA 2QA1A 3LP0B 2M3DA 3ADAC 2CVEA 2GZOA 1M5OC 3T5LA 4GKJF 4NA3A 3P6YC 1B7YB 1LXJA 2MZRA 4EO8A 4QBUA 3HD1A 4X4RA 2KFNA 1UMJA 1FI4A 3IR7B 3EXCX 3LW5C 1Q8BA 3TVYA 2KRRA 2MQNA 1S97A 2AW0A 1WI8A 4WIIA 2QG9B 3BSCA 2VA2A 3THTA 1F5BA 1YTYA 3BQ1A 3I0RA 3RR7A 3DRPA 2MY8A 4MH8A 2DPIA 5H9EK 1EKSA 1WWHA 4WTYA 3JAMY 4XPCA 5GMEA 4UOFA 2QJ3A 3J7Z5 1HPZA 4LIRA 1ZOTA 4OHVA 1PILA 4GVBB 2FUG9 4CNYA 1JLGA 2NXJA 4OI6A 4DR2J 1DLOB 3G71S 3T5HA 2D74B 2HFVA 4TLRA 1BQXA 2P9GA 1VC5A 2R8JA 3OUYA 2VICA 3FDSA 1U6ZA 2IJNA 2RT3A 2XULA 2LDYA 4ZP6A 1YLXA 2ROGA 5ETNA 2ASYA 2V9KA 2XNRA 3D68A 2RE1A 1T03B 5I4MA 2DITA 1AFJA 1TUGB 1O8BA 1AZSB 1S6QB 4IFVB 1RAOA 3K8WA 1HL6A 2MLYA 1R6VA 1S9EA 4QR2A 5BXIA 4X4OA 3OXGA 2XY7A 3X1LB 3IR5B 2MQOA 4LF6F 2QLJB 5JJBA 4PYDA 4JI7J 2OFHX 1PSDA 2MQMA 2E5HA 3MM9A 4I6AA 3MD3A 2RQKA 3KYLA 4KAIA 4CLWA 3W8PA 1VQNS 1IVZA 4F3OA 3ZNJ1 2GGPA 2Z4PA 3BPDA 5ETVA 1JLBA 2F4VF 4USMA 3BGLA 1TUWA 3TA2A 1LW0A 2W4CA 3KJNB 2GC8A 3T5JA 1Q1KA 1TV6A 3T1YF 1KRPA 3FBBA 5BYQA 3GSIA 2DRDA 1VQPS 2XY6A 2D3UA 1IR0A 3KXDA 1H0HB 1YBAA 1OWXA 5C5JA 3A3NB 3R27A 5KG0A 3PIPQ 3D2WA 4ER8A 4KTQA 5J2PA 1C4AA 1JNZB 2B9XA 1ICEB 3H7HB 4PXDA 2XQCA 3CUNA 2AYBA 2CNOB 2DR6A 2P2CB 2W4PA 2WONB 2FVSA 2IA6A 4NYZA 4BCAA 2VPXB 3GFYA 2CPIA 1FD2A 1FRIA 4F04B 1HI0P 2ASLA 1QY7A 3N6LA 2E5IA 2RU3A 5E7OB 1FDAA 4KBIA 4ZN3A 4IFYB 2HURA 4MIBA 2F4VJ 2BUNA 3AY0A 2RD5C 3NWRA 5K8NA 3W2WA 2CZ9A 2DHGA 1N5VA 4FVCA 1V6HA 1L3UA 2KXHA 1EETA 3OJUA 3HP6A 4DQSA 1M5VC 3DRYA 3D0GE 4PPZA 4RUAA 5KFBA 5AJ3F 4G65A 2HW3A 2KH9A 3HD2A 1WORA 2V2VA 4NLXA 3H5SA 2HGMA 1FFWB 1U2CA 2GMHA 4LR7A 2JWNA 4UF4A 4LJMA 3HFZB 3OTEA 1T8EA 1RHRB 4I69A 1N32J 3N4WA 4ZCIA 3DLLQ 1H6KX 2JX2A 5DDRC 1QSSA 3MWBA 5LM7E 1WELA 1NHKL 3J7A1 4N5SA 3JS9A 1WI6A 2E1PA 3JTOA 4Z37A 1WC4A 3N9UC 4CH1A 4ZJLA 5KG7A 4LRCA 3FMWA 3K57A 1XMQJ 2VB6A 2WHOA 4DG1B 1UFKA 6FD1A 4F4ZA 3TJAA 2CQHA 4ILRA 2OFGX 5K8MA 3PW0A 2OIHA 2CPZA 4KIAA 4ANCA 4RUHA 1T03A 2HNYB 1NEEA 2ZH7A 3I56S 3ZZZA 2E9TA 1HNVB 3MMBA 1Q8LA 3O8WA 5KFAA 4LF5F 2XM3A 1JIHA 2MSTA 3GIMA 3UDEA 4DX5A 3NWGA 1MMNA 1N32F 2ZJRQ 3DDNA 4X64J 2VBYA 1CJUA 4OQJA 4CI0B 2O1PA 3QGPA 4J9PA 1HPZB 4IQXA 2OLWA 5HVHA 2U2FA 9RUBA 3G6ES 1JMTA 3Q23A 1IXKA 4PYAA 1VCTA 2H5IB 3HHNB 3QO9A 4Z7YA 5A0YA 3AOCA 2CJXB 1APSA 1NJIT 2HRUA 2X1FA 3H5XA 3NRBA 1RSCA 2XZDB 3CMAS 2HIYA 2ZHOA 3DHXA 5KFQA 5KFPA 2Z30B 1SJ1A 4DX8H 3M6UA 1XIQA 4X4SA 3G8TA 2M9KA 3BDPA 3PM9A 4V19X 1K9MT 1T0TV 3W1YC 3CDBA 2YX1A 1KLMA 3R1HA 3AA9A 4OHZA 4DN9A 4LF9F 3LTOA 3R5DA 1FEEA 5BJRA 3BYPA 1DRZA 2RF2B 2R2UA 2KTQA 2ZWPA 1E6YB 2J7KA 3KUGA 4GKKJ 4DUTA 1HA1A 4IO1A 2MDAA 2XMWA 5J1EB 4D3GA 3Q8UA 4NCGB 1ZPWX 3MF5A 3GE9A 1AXQA 2M4MA 3A4TA 3OR1B 1BGXT 2MGZB 1NK4A 1ROFA 1VLOA 3WX8A 3CTRA 2HS3A 1FESA 2PGCA 4IFVA 3TP2A 4CYUA 1U49A 4DSLA 4JI5F 1HWKA 2QC3A 3M2VB 2ZH2A 3DLEA 3DN9A 4TN2A 1L3SA 1HW8A 2CQDA 5KFUA 3GONA 1WOSA 3H8YA 2W9CB 3A8KA 4LMZA 3IGNA 1O6XA 2RILA 2CPJA 2I38A 2IHR1 2GW8A 4N8NA 4JI2F 3VALA 3THPA 3T1AA 1YX2A 3I82A 2L08A 2B4OA 4A8SA 3PX0A 1EZZB 2ZE2B 4FKXA 4B3MJ 3IAS9 3PY8A 4Y28C 4DV5F 2BQUA 4NXMF 1S1XA 4N56A 3BQ2A 4Q8FA 1S1UA 5D78A 1NZAA 2EKYA 1Q79A 3GYNA 5KFEA 3ENWA 3J81U 2BX6A 3EZOA 4ITSA 3MFHA 3KFWX 2E1RA 4ZDNA 2FGOA 5B08A 3QSYB 2PA8D 3ZTSA 1RABB 5HANA 2OMLA 1VBYA 1BD6A 5KAKA 4RW7B 4JI4F 4OI3A 3LWMA 3KNAA 1TKZB 4C3LA 5IT0A 2YKMB 4M5DA 1Q5VA 1URNA 2J7UA 4WFBQ 1EARA 1H2VZ 2B56A 4OZ1A 3CJKB 4ILMA 4KGKA 2DIVA 1V3RA 3FKBA 3I4HX 1IKWB 3AD9C 3CCWA 2X3DA 3IRXB 3MPDA 2GVDA 4K59A 3U1NA 4HH0A 2ASDA 3FEZA 2C2NA 1YJTA 3MEEA 1TMMA 3QATA 4OFZA 4NCBA 1TKTB 1NDLA 4L3KA 5HSPA 4JI0J 3CC2S 5DDPC 3UDCA 2DGTA 1S76D 2XYGB 4GC6A 3W9JA 4BLGA 3ZZ0A 3PW7A 1JX4A 4FBUA 3AD7C 3GFHA 1V5VA 4ALZA 1HMVB 1G7CB 1VRTA 2DNMA 2NR0A 2BR0A 1NKCA 2XMMA 1U1RA 3KMQA 2VFTA 4K4WA 4F50A 3JQMA 4LSLA 2OTJS 2GIQA 3F0NA 3F56A 3M7VA 1R89A 4C8OA 3PJXA 4X4TA 2P9CA 3CW2C 4PQUA 2ERRA 1FDDA 2NXEA 4FYYB 1IUJA 5F41A 5HBMB 3H40A 4J9RA 2CJBA 1OMSA 2BXJA 3EUNA 5BYRA 2A2CA 1SH3A 3KG0A 2BE2A 4C3KA 3SV3A 2LXUA 2AJ1A 2KYZA 3I0SB 4IH5A 4JB8B 4Q2LA 2H4WB 3RZAA 5LJ5Y 4EYIB 1X9SA 4RUCA 2L9DA 1S7IA 3BV8A 3DHWC 1FX2A 3FCHA 4G3IA 3TOQA 2H65B 4BBYA 1VQ6S 3EXYA 2N3LA 4OX7A 4DCOB 4X66F 2XO6A 1MU2A 4KT0C 2VG5B 3KLFB 1BY9A 5HBMA 2E9RX 2MKSA 4WE1A 5A8RB 3F41A 1T9YA 4U96A 1IJFB 3W63A 3X3UA 3TUIC 4QJVA 2WONA 3KLIA 3FEXB 3J7AN 3DLEB 1MLAA 2V63A 1RT7A 3MOJB 3U1MA 1AUDA 3LGNA 1TKXB 5KG5A 4Y2CA 3L95X 4A8WA 4B3SJ 4TLQA 2ZH1A 4FNIA 4DMZA 2C22A 2AWZA 5IV3A 1VLYA 3RB6A 2UXCF 1KP6A 3NGSA 2YWKA 4DV3J 3R5BA 3ZZUA 1FXLA 4JI5J 3BKTA 5LMNF 1AFIA 3HDSA 3ISNC 3G8QA 2LKZA 1IN0A 2WVDA 5HI7A 2NS1B 4DLEA 2AYMA 4TKTA 3AHPA 1HNWJ 4RLEA 3NBPA 1FRMA 1Z2ZA 1UPMB 3CCJS 4OYXA 5H9FJ 2CQ0A 1WACA 2WVCA 1R8AA 2EC2A 1HWIA 1U24A 2LEPA 3IN5A 3RG6A 5GMKa 3PRBA 1UW9A 5MLCV 2NLWA 4U67Q 1X4HA 2LP4A 4EO6A 4K4TA 3I32A 4WXOA 4RNFA 2YKNB 5F8JA 3OPKA 1SH2A 1KHVA 1VISA 4KO0B 5L9XA 2XYHB 1YSJA 2L3MA 3S8SA 2C2MB 1C1BA 2XMJA 3IWLA 2Z58B 3PACA 4K5SA 3D28A 3POTA 3HCXA 4RNOA 2Q1LA 4R0EA 2POKA 1Q8IA 2WVBA 1N52B 1LOUA 1I3OB 2B9EA 2C2ZB 3DGVA 1S1XB 2R4FA 1S48A 2ZZTA 4WFZA 4GVBA 4DPOA 5HMWA 2WZ1A 3TJ8A 3FBFA 4HI2A 3OHAA 2LU2A 2X7IA 1KQFB 3LOUA 4C8KA 1FKPB 2F3JA 2GQQA 2LQJA 4KJIA 4LSNA 2YTCA 4EZ6A 1UFLA 3R6LB 4BS2A 1C1BB 1KVKA 1N33F 5AE3A 1T3NA 2N4CA 2V4JA 4DL2A 3SXLA 2BV3A 3KDNA 4A48A 2N3OA 3KHLA 3A8IA 3M32A 2DISA 2DCUB 4X4NA 1HQUA 2JOQA 2IYIA 4CP5A 4PR6A 1X7VA 4USHA 1LW2A 1U47A 3MD1A 4LF1A 2IAJA 3NNHA 1SJRA 4RWWA 1FK9B 2FPHX 2RNEA 1RKJA 4KH1B 2G9OA 4KB7A 2DTJA 2A2DA 3UD5A 2KHDA 3M2UA 4DN0A 4RJVA 1IBCB 3QWPA 5CH7B 1VQ8S 1QSYA 2HVEA 3NAIA 1HNZF 3A13A 3KG1A 1B0PA 2E66A 2N4DA 5KFOA 5SZTA 2DB1A 2JH3A 1RHJB 4U7CA 4ED7A 4NLGA 2J0XA 1KLMB 3BBCA 3H98A 5L38A 1RHMB 4ED0A 2HNDB 3C15A 2ZWOA 2HQ3A 2LYVA 2ZH5A 1PG5B 1TKXA 1LWEB 3BYRA 3NNAA 1TVRB 1YJVA 2HFUA 3K5OA 3EX7B 5LT5A 2B9YA 2QSFA 1ZBTA 2ZHAA 1R7IA 2XNQA 2YNIA 4WE1B 3SQGB 4CRJA 4X2BA 5CXTA 2M0GB 3GSDA 4O44B 2MHNA 3VWSA 2LLZA 1I1GA 3Q22A 2XS7A 3DOLA 1HI8A 4LREA 2YNGB 1UVLA 5A2QY 5KFDA 1A7GE 1HQ2A 2A6OA 2K2PA 2J0QD 1S1WB 2WVFA 1WC0A 2XWXA 3A8JA 4IG0A 1N8RT 3QIPA 3QLHB 3CJ5A 4B9TA 4LF6J 4UQGA 7FDRA 3FFIA 1PBAA 4OZ2A 2BJ1A 4QZVB 2IIHA 2GHWA 3VV2B 3CGIA 5GADU 3M9MB 4RBTA 2XBPA 4ED8A 2GAHC 4MAKA 3U1LA 4Y0FA 2BABA 2ZOMA 4F25A 4K2XA 4NZ7A 1ITPA 2BYCA 1E6VA 4MYTA 4I2QA 5T7LB 3W5ZA 2FHOB 4B3MF 5DLFA 3MPVA 3S6EA 2RU9A 3M32B 5J2MA 2IMWP 4O0IA 1MROA 1B4SA 3BSOA 1UZHA 2LA6A 4NRTA 3RBZA 1WNEA 3CJ0A 4LBPA 2UUBF 2XC9A 4BHQA 2K3IA 3QGHA 1XQIA 4CLPA 3EPIA 2X1AA 3BSAA 1Y0HA 3OVSA 2ZBPA 3QZ7A 2HHSA 4P10A 4YP3A 2CPYA 3N01A 4FNHA 3KJQB 3I5AA 1JLQA 1U02A 5EX0A 3D6MB 4QIEA 3MM8A 3EDQB 2Q6BA 2E7XA 2HQDA 3VAJA 2MZQA 4NRUA 3LGHA 1WDTA 4NX9A 5BR8F 1F9HA 3BGRB 2EPIA 3HJFA 3K7RA 3LP2B 1VBZA 2F9DA 5AJ3J 4OV1A 2VFVA 1V3ZA 4RW6B 3JAMU 1PIEA 3OJSA 3JYTB 1WKKA 3IP0A 5KFLA 3UN5A 5I3UB 1WD6A 3N5FA 2UUBJ 3NMRA 4I1TA 4MK7A 3M8ZA 2P8IA 4IFYA 3EZUA 1Q5YA 2BQ3A 1OQ3A 3O1LA 1TK0A 2E1CA 2R7UA 1QAIA 2LQ5A 4NLQA 5GAGU 3PDNA 5HK4A 3AOBA 2J9DA 2DJWA 5HMXA 1VJWA 3GIRA 4CH7A 2GFFA 4OHWA 1F3VA 4TU8A 2DPJA 1RADB 3Q2TC 2YWFA 5K14B 4ZPWR 1MMDA 3QMQA 4USWA 2XCAA 3CCSS 3LWLA 4LFCJ 2CQIA 4FXVA 2X3GA 4ZVOB 2OEMA 4OIXA 4C8NA 2BOAA 2D3OR 3JQKA 4K4XA 1N36F 1CJTA 4WXWA 3EDRB 1NH7A 3GCXP 3OBIA 4IQMA 4L72B 3W8GA 2I9SA 2FLPA 3ENAA 3RBXA 2AQ4A 2RDDA 1T11A 4KGXB 3UVJB 1CPZA 1OSDA 3V5RA 1HD0A 4WU2A 2C3UA 4UUWA 4CTAA 3QFHA 5D0HA 3PTWA 4Q43A 4DDFA 3BN4A 2VL1A 2DYAA 3MPUB 1ZYQA 2W2MP 3DOMB 1HD1A 3UN2A 1S0NA 1U2FA 4M5LA 3ZTQA 2BDPA 1Y5NB 4C8LA 4CO3A 3PRDA 3DOKA 4QIWD 4KQZA 3CJKA 4IG3A 4F3QA 2GJIA 1AZSA 2HK2A 3RB4A 3C6UA 4N76A 4P52A 3R2CJ 1QTMA 3NG8A 2H51B 2B4VA 1NSPA 3M30A 3OQ2A 3PXGa 3SFGA 1NK6A 2XEXA 3EJMA 2YXLA 2OMOA 3CMQA 4NLUA 2DNRA 3TJ9A 4JV5J 1TR0A 4TU7A 4A8MP 3NL0A 3PV8A 2VKRA 3RAQA 4Q5VA 5CD4A 2NUHA 4JBCA 1J2VA 1JLQB 2V69A 2BJ3A 5CAAA 4DLGA 1NNDA 2HHXA 4YB6A 3QAUA 4GO5X 3M1VA 4IR1A 1WHWA 3FBCA 4IH6A 2WSEC 1R0BG 2JRSA 3DRXA 2HBZB 1RWUA 2CVIA 2V0NA 3V4MA 4QYZK 1ZH5A 4C2MA 1UJ5A 2W1BA 3CXCR 2YBVA 2WOMB 3RW6A 1WKLA 1VMBA 1S6OA 2AV5A 1L3VA 2JLGA 4XAKA 1R27B 4BDPA 1S59A 3W5YA 4Q0BA 1F1BB 4TQRA 4OLOA 3AA8A 3CCUS 2MKJA 4KHPJ 1HBUB 4P71A 3VVUA 1XMOJ 5CZVA 4HYKA 1JLFB 1VI7A 3EVMA 3TW0A 1KOHA 3SEOA 1FWKA 2QLFB 4B9MA 3C16B 4QCLA 3DI6B 2FJEB 3BH7B 3N6NA 5F9NA 3T1YJ 4WFXA 3CC4S 1Y4ZB 2VPWB 4ILLA 2ZD1B 2CA9A 4QYRA 4WFAQ 1TK5A 3R9LA 3W66A 3CE8A 1PKUA 3OFEA 1HNIA 4ZVUB 1X9MA 3H4DA 4JYAJ 1Q78A 1Y5IB 2MTLA 3QSIA 3QIPB 3QLHA 3SBMA 4ECYA 2I1RA 1NXIA 4RKUC 3MR6A 5HP1A 2IBKA 3P49B 4ZS6A 2DGUA 4DSFA 1L3KA 3D6HB 4V19J 2MHEA 3D67A 3R5JB 1Y3JA 4ZA1A 3MR3A 1JKHB 3V6HA 4C4WA 4TYBA 2C2KB 6AT1B 5LSOA 1XMOF 2W9CA 2W24A 1HBOA 4FF3A 4YDDB 3Q0AA 4KFBB 4ZPCA 3SCLE 5EHHA 2BZ2A 3E8OA 3MM5A 4IG3B 3QJPA 1N5TA 1PO6A 1VS3A 1U48A 2J0WA 4KR0B 3NOCA 2ACYA 5KFIA 3UDVA 1N6QA 4PWDB 3RBEA 3QRQA 1YJUA 5E0OA 1IBMF 4DR1F 2FVQA 3WX4A 1S0VA 4RNNA 1N5QA 1WOOA 3DXSX 2E5JA 3VAIA 2R7RA 4DV2F 1NUEA 4NEYA 5CABA 5J1EA 2XWYA 3TZXA 4A8FA 4MIAA 1OS5A 2GHVC 3MCOA 2XLKA 2KI2A 4QW9A 2GJFA 1JLCB 1REVB 4D3HA 4X65F 1TL3B 3AT1B 2J76E 5KG3A 1J5OB 1R43A 3C16A 3M6XA 4HR2A 2FZCB 5LXRA 3IGVA 4M95A 1QVGR 2R3VA 4RBUA 1RWWB 4RW8B 2YWEA 3H2VE 3KK3B 3NMAA 5HMZA 3RUBL 1NJZA 2B8QA 1CEZA 1JXEA 1EP4A 1MN7A 3Q8PB 2V2KA 4J90A 1LXNA 1TL7B 2AP6A 2EFOA 2PE8A 2QZ8A 2VDHA 3QO9B 2RUGA 4H4KA 4ZCLA 2XHWA 4XIUA 2KT2A 4FDFA 4AQYJ 2JFDA 2M52A 3EVWA 4AL6A 1HYSA 3T5KA 2IDLA 4H4MA 2UUTA 5M2RA 3WZ0A 1RT4B 1SQFA 4DV0J 3TUJC 4W98A 4ES2A 1T95A 2O67A 1QM9A 2CZ4A 1JK9B 3OXLA 1FWLA 3IWXA 3JTPA 4RBVA 1HBNA 2F1FA 3LA0A 4OYIA 3CIMA 3ET6A 4JI2J 4CLLA 2K1RA 1WEYA 2IYGA 4ZVHA 3K58A 4ZVTB 3AAWB 4WZMA 2Z0GA 3DRRB 4ED4A 1AA1B 1RAIB 4WK3A 5HJXA 5T14A 5CZXA 3ISZA 4P73A 4URSA 4YB5A 3SI8A 1H7XA 3HHEA 2QTWA 2ATCB 2D9PA 3IO1A 3ONQA 2BQRA 1S49A 2CDQA 2RHSB 3D0IE 1N5YB 4YN3B 3D6FB 1YITS 1NBEB 3PFOA 5I42B 4LF9J 4LFAJ 1GMVA 3HSJA 4XTTA 4C0OC 4DSEA 4NXNJ 2OPSA 4GMKA 3RR8A 1K0TA 4DV1J 4CLTA 2AJ2A 3CJTA 5AXMA 2Y0BB 3KK3A 5H9EJ 4H4KC 3Q24A 4EEYA 3MCMA 3C8YA 5B0FA 1TTHB 3M8SA 5GAHU 2R7QA 1B7FA 3ZZTA 3NS6A 4I64A 1S99A 4NZ0A 5DETA 3B4DA 1VOMA 4IOBA 1YGYA 4ZPAA 3TO8A 2B6AB 1CG2A 3KDOA 1P1TA 3EYZA 2BW7A 5DRKA 3IC1A 4A46A 5RUBA 1SIZA 1SC6A 4OYPA 2ROPA 4J9NA 4IR9A 5ETQA 4ANEA 1Q95G 2XS5A 2CYYA 2W2QP 2FYXA 3V4IA 1DBDA 2YX4A 1VQKS 2ZM6F 3SCKE 1R0CB 2ZUAA 4Y2KA 1K73T 4CQ1A 2P6SA 5GAEI 3EZ5A 1HW9A 1NCLA 2QA2A 3V81A 1N5SA 4W4MA 1UTAA 2FY8A 2Q79A 5E3PA 2JJ4D 3UNYA 4AXJA 4ENOA 2IFXA 1PCAA 1WSRA 4C97A 5IQ6A 4FF1A 1J5EJ 1UKUA 1WF0A 4A4JA 3ZTRA 5GAGI 3A8EA 4C11A 1NJXA 1HR0F 3PEHA 3HVTB 4UTGA 4A8KA 4IOAQ 1T9TA 1ZM4A 3HT0A 1ZAVA 5A0YB 3ET6B 2HQIA 5FJ4A 1RZMA 2IDEA 2AKWB 2HFOA 1RT5B 2G2ZA 2CXEA 4HT5A 2E29A 4K5RA 4PPDA 3DLKB 4RPFA 3TAMA 2VJUA 3ZTOA 2UUCJ 1FKPA 2NQPA 4YMEA 5D3GA 3ILJA 2W8KA 2UUWA 2W25A 4K7QA 4JI4J 2HLTA 5CA5A 4OI4A 3TNVA 1IQTA 4YR3A 3EE3A 1S9FA 2UUAF 2NCKL 3DM2A 2GIRA 2KT3A 4LIWA 2XCPA 1KSPA 2Y3YA 3PRVA 2YWGA 3GLJA 1P8GA 2YH1A 3AB2B 4G1QA 3PHTA 3CJ2A 5F8HA 5ETOA 3FZ2A 2D3O1 4UOHA 4KV8A 3WIVA 2ASJA 1JQGA 2YKMA 5EGYA 4DL6A 1AT1B 3EWGA 2ZJPQ 4N7TA 1LK7A 1H74A 1R8HA 1OYDA 1S1TB 1D9AA 2CUYA 7AT1B 3GILA 1FRLA 1RUSA 1CQMA 3OTCA 1SUQB 2VPYB 4MK9A 5DJBA 2VG6A 4LR8A 4O3OA 5EDWA 5ETSA 4RL1A 3MCNA 4DUZJ 2VBZA 4ZOSA 4W92B 2HRTA 2R42A 4NYOA 1G4CA 2UUAJ 3GG1A 5FD1A 3K59A 1P6TA 2VDIA 1WC6A 3BZQA 3K89A 4P75A 3KHHA 3K5LA 1LV5A 2VBXA 3DYAB 3LANA 3GYGA 3MTJA 2W9BB 1FJEB 2VOOA 1NAQA 2H48B 3GPAA 3MPYA 2CJAA 1CVJA 2RDIA 4EWTA 3HKZD 1YQHA 3FNNA 3PYEA 5K9FA 4URGA 2EVZA 2MSSA 2AJFE 4YEAA 2YKNA 2RQ4A 4NA1A 1C4CA 2DY9A 2QO3A 2HFNA 1A0OB 1GH8A 1RWOB 1WTFA 1HARA 3FRZA 5ITHA 1QLNA 5C24A 3THVA 3CD6S 5F0UA 3KKFA 4J9LA 1SKSA 2V8VA 3BBBA 3PIOQ 2C3PA 1UW4A 3IBFB 1DFDA 1IWGA 3HZGA 1U26A 2Y1RI 3D66A 3CDEA 4OYZA 3QIDA 5A76A 3I0SA 3T3FA 5T41A 2VU5A 4NI2A 3RW7A 3VF0B 4DCPB 4ZHRB 2BRLA 4WP3A 4ZP9A 2OHDA 4Q45A 4O23A 3MFIA 3AB4B 3G82B 5FLXY 4DV6J 3CSKA 4M5HA
chains in the Genus database with same CATH topology
1CJTB 5IV3A 3C16B 1AZSB 2BW7A 4OYPA 1YK9A 3MAAB 4CLPA 1CJUB 4OZ3A 4CLWA 2QV6A 4OYXA 2GVZB 1WC5A 4USVA 1U0HB 1Y10A 3C15B 3G82A 3R5GA 3ET6B 1CS4A 3MR7A 2WZ1A 4NI2B 1CJVA 5IV4A 1CJKA 1WC1A 4CLFA 5D15A 4P2XA 5D0GA 1CULA 3C16A 4USWA 4CLYA 1CULB 1FX4A 4P2FA 4CLKA 1CJTA 1Y11A 3C14B 1TL7B 3UVJB 1YBUA 2GVDA 2GVZA 4OYOA 5D0HA 4OYWA 1WC6A 3UVJA 1TL7A 4OYAA 5D0RA 3C14A 4CM0A 1WC4A 4USTA 4CM2A 3C15A 1YBTA 1AZSA 4OYIA 4OYMA 3ET6A 4CLLA 4CLSA 4CLUA 1AB8A 1U0HA 4USUA 5D0EA 4P2MA 1CJKB 1CJVB 1CJUA 2GVDB 3MAAA 4OYZA 1FX2A 1WC0A 4WPAA 4NI2A 1WC3A 4OZ2A 4WP3A 4CLZA 2W01A 4WP8A 4CLTA 4OYBA 4WP9A 3G82B 1CS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJT B;  5IV3 A;  3C16 B;  1AZS B;  2BW7 A;  4OYP A;  1YK9 A;  3MAA B;  4CLP A;  1CJU B;  4OZ3 A;  4CLW A;  2QV6 A;  4OYX A;  2GVZ B;  1WC5 A;  4USV A;  1U0H B;  1Y10 A;  3C15 B;  3G82 A;  3R5G A;  3ET6 B;  1CS4 A;  3MR7 A;  2WZ1 A;  4NI2 B;  1CJV A;  5IV4 A;  1CJK A;  1WC1 A;  4CLF A;  5D15 A;  4P2X A;  5D0G A;  1CUL A;  3C16 A;  4USW A;  4CLY A;  1CUL B;  1FX4 A;  4P2F A;  4CLK A;  1CJT A;  1Y11 A;  3C14 B;  1TL7 B;  3UVJ B;  1YBU A;  2GVD A;  2GVZ A;  4OYO A;  5D0H A;  4OYW A;  1WC6 A;  3UVJ A;  1TL7 A;  4OYA A;  5D0R A;  3C14 A;  4CM0 A;  1WC4 A;  4UST A;  4CM2 A;  3C15 A;  1YBT A;  1AZS A;  4OYI A;  4OYM A;  3ET6 A;  4CLL A;  4CLS A;  4CLU A;  1AB8 A;  1U0H A;  4USU A;  5D0E A;  4P2M A;  1CJK B;  1CJV B;  1CJU A;  2GVD B;  3MAA A;  4OYZ A;  1FX2 A;  1WC0 A;  4WPA A;  4NI2 A;  1WC3 A;  4OZ2 A;  4WP3 A;  4CLZ A;  2W01 A;  4WP8 A;  4CLT A;  4OYB A;  4WP9 A;  3G82 B;  1CS4 B; 
#chains in the Genus database with same CATH topology
 1CJT B;  2O3D A;  4ECR A;  2JL9 A;  2HWH A;  3NGT A;  3UQS A;  4QIG A;  1NJW A;  1NK5 A;  2W7A A;  2K8G A;  3DRS A;  3CCE S;  2N7C A;  1D09 B;  3EMT A;  1GEH A;  1LQ9 A;  3KWM A;  4TU9 A;  3AJ2 A;  2XMU A;  3AQO A;  3ZZY A;  4FYV B;  3UCZ P;  3PO4 A;  1JJC B;  1NHU A;  3BSN A;  1RBL A;  2RHQ B;  3DMJ B;  2NSC A;  2L41 A;  1U1N A;  1NPK A;  1R8C A;  1SJQ A;  2G13 A;  2ZBQ A;  1RAE B;  3HSG A;  4B17 A;  4ECW A;  4FXD A;  3WBZ A;  4LF7 J;  2LQ8 A;  2Y1L B;  5G0R A;  3OTO J;  2PI5 A;  1TK8 A;  5C24 B;  2E5G A;  3UN3 A;  2BEF A;  2AEF A;  2C3O A;  4H4O A;  2IA0 A;  3HHL D;  3SZ2 A;  5E3Q A;  2QT7 A;  1PYT A;  2VPZ B;  1D8Z A;  3D3C J;  4GVL A;  1C0T A;  2HWT A;  3BGF A;  3FUY A;  4I6Y A;  5IZH A;  2R8I A;  1X0F A;  2OSR A;  4QWC A;  1SH0 A;  3W9I A;  4EUV A;  5KG2 A;  2RJZ A;  1CC8 A;  4R25 A;  3CED A;  4P72 A;  4EBE A;  4HAC A;  5KFR A;  5IT9 U;  2BM1 A;  3FCW A;  2CQG A;  3ELH A;  3HSZ A;  3ZZR A;  2I5J A;  2UXB J;  2DNP A;  1KR4 A;  1HHS A;  2RH3 A;  4H4O B;  2NUU G;  1B0V A;  2MY7 A;  2ZVS A;  3DLJ A;  4DR2 F;  1RTD A;  1RWP B;  3WC0 A;  2Q43 A;  2CRL A;  4ED5 A;  3EGW B;  3DU5 A;  1BQN B;  3IRX A;  4DFK A;  2HWI A;  5F8M A;  1JXL A;  4C0B A;  4F2R A;  5D4P A;  2ALZ A;  1ZZF A;  4DR5 F;  2X1G A;  3M8P B;  1XEZ A;  2F8H A;  2QL9 B;  1RT6 B;  3GFZ A;  4WBF A;  4L6V 3;  2HGL A;  4ZP8 A;  3UR3 C;  4FF4 A;  2IVM A;  1NDP A;  3QGI A;  2AYG A;  5D0G A;  4U7U D;  4I7F A;  3VAH A;  1TEL A;  3C46 A;  3CD0 A;  1RYR A;  3MXH P;  2UVW A;  1KQG B;  3UPF A;  4MKV A;  1D9F A;  1FXR A;  1Q8K A;  2AU0 A;  3HKW A;  2QMW A;  5IXU A;  5DGA A;  1FE0 A;  4MYU A;  2FJW A;  3OSN A;  2UXB F;  4G1Q B;  1VQM S;  4DUY J;  3DC2 A;  3TA1 A;  3PVX A;  2R7T A;  4CH0 S;  2MYF A;  2BKO A;  3NKY A;  3P5T L;  2GNK A;  3BR8 A;  4DWI A;  4LF8 F;  1VC6 A;  4DR5 J;  2FVR A;  1QAX A;  1HKA A;  1NZ8 A;  2GVZ A;  1LKZ A;  4QIV A;  2DVI A;  4WYW A;  4B3T F;  1A9N B;  2PT0 A;  1MSW D;  2MPU A;  4IG0 B;  4DV4 J;  1SL2 A;  2CIM A;  4PWD A;  4QR1 A;  3M8R A;  3BO2 A;  3PJ9 A;  5DLG A;  2LFV A;  3QAE A;  4U95 A;  1XER A;  2IM3 A;  4CO5 A;  2ADC A;  2IJR A;  2CQP A;  1V3S A;  2QYG A;  1I5O B;  2HBY B;  5E33 A;  3J80 U;  1U1Q A;  5CYM A;  4RW9 A;  1Y7P A;  2GML A;  3S1T A;  4PZV A;  2HQC A;  2IM1 A;  1TVR A;  2EK1 A;  2OH2 A;  4QOT A;  2LEB A;  3C3L A;  3TZY A;  1UPP A;  3M9N B;  2CJK A;  2GS8 A;  2H54 B;  2DRB A;  1RT3 A;  2DY1 A;  4DV4 F;  4RW4 B;  3BH6 B;  2RS2 A;  5FII A;  3MGJ A;  2RF2 A;  3M8W A;  4WFY A;  1VBX A;  3E51 A;  4DHV A;  4DSI A;  1BE4 A;  1FO1 A;  2A3J A;  3QQC D;  4OZ0 A;  3RGI A;  4F26 A;  6FDR A;  2N7Y A;  4F7V A;  4B3R F;  3MEK A;  2KJW A;  2R8G A;  1YJ9 S;  3T6J A;  2FC8 A;  2B51 A;  3RRK A;  4ECZ A;  1S6Q A;  4QWE A;  1IBL F;  4H54 A;  4F8R A;  4PQA A;  1JLA A;  3AJ1 A;  1TL1 B;  2HSE B;  2ATL A;  1S9G A;  3OTO F;  3IR6 B;  3QT6 A;  1F0X A;  3ZXW A;  1SPB P;  3J7Z T;  3KJF B;  2LU1 A;  3UDL A;  2AGQ A;  1XNQ F;  1CSJ A;  4C8Z A;  1GXT A;  4PAA A;  3IG1 B;  3WQP A;  2CDR B;  2HMI B;  5CCL A;  1ZET A;  1I51 B;  2DNH A;  1DLO A;  2ZH6 A;  1NK9 A;  2Y8W A;  2DKO B;  4Y00 A;  3KLH A;  4DR4 J;  1CLF A;  4A47 A;  3NAH A;  3V6D A;  1XJW B;  3CWJ A;  3ENQ A;  4OX6 A;  4HDG A;  4I67 A;  2DH7 A;  4Q7A A;  4DV2 J;  2VUG A;  4NPO A;  3TUZ C;  1VQ9 S;  3DFE A;  1Y9O A;  4J5O A;  4PKD B;  4U8Y A;  2AF6 A;  1R3N A;  1FRH A;  3DOL B;  4HAC B;  3G9C A;  1SB6 A;  4JP8 A;  4RO0 A;  3HVT A;  1O0P A;  3OVB A;  1MML A;  3CCR S;  2C3Y A;  2PEH A;  1TL5 A;  3MPW A;  1KTV A;  4K4Y A;  1Y10 A;  3UNG C;  1IKX B;  3VGT A;  3CPW R;  3CCL S;  2MQ8 A;  3BO4 A;  5LMU J;  5G4D A;  2FVC A;  3G86 A;  2MZT A;  5ETL A;  3V81 B;  3TI0 A;  1CS4 A;  5F3Z A;  3W2W B;  1RT4 A;  1MW7 A;  1RLC L;  4J91 A;  2C2O B;  3HO1 A;  1PJ5 A;  3VQS A;  2DR9 A;  3QZ8 A;  1BWE A;  2HHT A;  3A3O B;  5L39 A;  1RU1 A;  1CJV A;  2DGW A;  4QWA A;  2Q3P A;  4TNO A;  2XHC A;  3US5 A;  2YX7 A;  3R1L A;  3C6T A;  1LWF A;  4PG4 A;  4DPY A;  2AD9 A;  2HYI B;  1SJ4 P;  4LF4 F;  4WTO B;  5J2Q B;  1TP7 A;  2WSC C;  3OV7 A;  3KTQ A;  4X4P A;  1AUS L;  2B6A A;  2MJU A;  1C1C A;  3HZE A;  3UO0 A;  4HDH A;  1BC6 A;  3GWC A;  1T05 B;  4HTJ A;  5ETP A;  1LW0 B;  4AD6 A;  4CLK A;  1UVK A;  4PEO A;  4OI1 A;  4TYA A;  1RGV A;  1VRU B;  2XMV A;  2YNF A;  2K7J A;  3ZZO A;  3AXK A;  1ULR A;  3UW1 A;  4ZHR A;  2ZH8 A;  1RT1 A;  3AXM A;  3QT8 A;  3CCQ S;  1F3F A;  1SKW A;  4NMX A;  1X5T A;  4DZ6 A;  2BE7 D;  2KYX A;  2WW4 A;  1RE1 B;  2Q6C A;  3BRE A;  4O4R A;  2KFZ A;  4OYA A;  1QUP A;  4K4V A;  3PX4 A;  4X4V A;  1FFS B;  4DL7 A;  1FER A;  4MJK A;  3ZO7 A;  4UT4 A;  3P96 A;  2BE2 B;  2G1D A;  4CM2 A;  1TAU A;  3D4J A;  4LT6 A;  4KFB A;  3I96 A;  4MTP A;  2HHH J;  1DZ5 A;  3DKD A;  1BUX A;  2CAJ A;  2LXI A;  3P3D A;  3DRR A;  3J81 Y;  4CLS A;  2R9L A;  3UD3 P;  1IBM J;  4NLD A;  1YWX A;  3HHD A;  4JI3 J;  4WWS A;  3JSR A;  3PW5 A;  2E9Z A;  4B3R J;  5H9F K;  4Q44 A;  3W62 A;  1U0H A;  4F0H A;  1JLG B;  2HHW A;  1JLB B;  2M70 A;  4I4B A;  3GJQ B;  3D1Q A;  2JFK A;  1VQ7 S;  1LWF B;  4IRK A;  2NZC A;  3M2R B;  2BW2 A;  2HLU A;  4WZQ A;  2GIF A;  1LWC A;  1OQ6 A;  3CO9 A;  2FZG B;  4MFB B;  2RRB A;  1VDH A;  1RT6 A;  1HWU A;  5B0E A;  1Y00 A;  4CNZ A;  1XNQ J;  2VH7 A;  2HPU A;  5E41 A;  3KHG A;  3OR2 A;  2HZA A;  2KHC A;  5EWG A;  1X60 A;  3MR2 A;  5HVG A;  3FSI A;  5L1J A;  1KVI A;  2D3Z A;  2HMI A;  3EIC A;  5DQG A;  2JVO A;  3R7N B;  3D6T B;  3CD5 A;  2I5J B;  1ZTW A;  1S9G B;  3EM1 A;  4HHJ A;  1N0V C;  4ZVE A;  2KDO A;  4K4U A;  4HHU A;  2AJ0 A;  1FA0 A;  2R2S A;  3JB9 k;  1YRU A;  2YKQ A;  2XB2 D;  2BJD A;  2U1A A;  2V8H A;  3E01 A;  3MHY A;  3O6Q A;  4PXE A;  3W5X A;  2J7W A;  1IKY A;  2MKK A;  5J2N A;  4F0K A;  2CPH A;  1RT7 B;  1UP1 A;  2XO7 A;  5LMN J;  4DL4 A;  3PW2 A;  4UZC A;  5DZ6 A;  4OX9 F;  4ES1 A;  1TFY A;  3HK2 A;  4OHX A;  4DV0 F;  2WAQ D;  1CQN A;  1X4D A;  3DU6 A;  4OLP A;  4F2S A;  1REV A;  2FHK A;  2FJB B;  1SV5 B;  2RVJ A;  4J9V A;  3W61 A;  1IR1 A;  1Q16 B;  4RW4 A;  4QWD A;  2FJA B;  2KB2 A;  2QL5 B;  4U9R A;  2VQF F;  3OSP A;  5D8H B;  4ZP7 A;  3SCJ E;  2V2Z A;  5L1L A;  3WIU A;  4EMD A;  1S1W A;  4J9M A;  4O44 A;  3ILL A;  2MEW A;  1SQE A;  2YQ1 A;  3EGN A;  2DXD A;  1FRJ A;  1GXL A;  2IC3 B;  4K0K F;  1FT8 A;  4RW9 B;  3MM5 B;  4ZCK A;  3JSM A;  4PWU A;  1F6T A;  1M1H A;  1BQM A;  2DD8 S;  2VC0 A;  3BKF A;  4BWJ A;  1YIJ S;  4AQY F;  4PG6 A;  4CO2 A;  5CYQ B;  2AHO B;  1LNQ A;  1LWE A;  4MMO A;  1YRT A;  2DNG A;  2A1B A;  5DQH A;  4NLV A;  2E1M C;  1GXU A;  1LEO A;  3MOZ A;  3TAN A;  2HND A;  3H2U B;  3OR1 A;  4JI8 J;  1O5J A;  3LAK A;  4GRS A;  3UCG A;  4EBC A;  2APO A;  1SC3 B;  2D41 A;  1L3T A;  1K1Q A;  3MZI A;  2AYE A;  3TEG A;  2UVV A;  2NXC A;  2DNL A;  1HNI B;  4CTA B;  1AYE A;  4C0H A;  1PC4 A;  4LF2 A;  4NI2 B;  4ZIW A;  1UFW A;  1XTZ A;  2ZHB A;  2AJ4 A;  2QGF B;  1CJK A;  1NO8 A;  1N33 J;  1KHW A;  1XR7 A;  2HVI A;  1YDL A;  1JLE A;  4OV6 A;  4OZJ A;  4O3S A;  1E6Y A;  1TL4 A;  2ZD1 A;  2R7W A;  4O3R A;  3EGZ A;  2JC1 A;  5J2N B;  5A6W A;  2N82 B;  1QE1 B;  1RAC B;  4DL0 C;  1I6J A;  1HBU A;  2BJE A;  2ROE A;  4ED3 A;  2IRU A;  2KJV A;  4LRF A;  1JLF A;  2HAF A;  4ZVP B;  2MLX A;  1FNM A;  5K14 A;  5L9N A;  4PXC A;  5BYS A;  4Q0B B;  4JUZ A;  2Z2Y B;  2CQC A;  1X31 C;  4P7V A;  4EFA C;  3NOG A;  4DR7 J;  1X8D A;  1FJ7 A;  1HQE A;  1ZAX A;  2IPO B;  1B3T A;  2DGO A;  3MUV P;  3H42 A;  5KG1 A;  4QU6 A;  2EBG A;  4M5G A;  4CO0 A;  5GVQ A;  4A8O A;  2FIU A;  3M6W A;  3FSY A;  4IDK A;  4DQQ A;  3RAX A;  4B08 A;  4RU2 A;  2FY1 A;  3C14 A;  2AMC B;  4E98 A;  1RTJ B;  3MMB B;  3T1H F;  4Y65 A;  2EWH A;  4ZJQ A;  3TX8 A;  4JI0 F;  1OY9 A;  2EG2 A;  4WFN Q;  1RAF B;  1ZAW A;  2BM0 A;  2GO9 A;  3C19 A;  3W65 A;  5KFK A;  2FLL A;  3C66 A;  1YJR A;  3MEG B;  1U4B A;  4KGM A;  4QYZ J;  4M5J A;  3PYF A;  4DR7 F;  2VF3 A;  4IUF A;  3IMQ J;  4TY9 A;  4CLU A;  2ZFH A;  3ILI A;  1OSC A;  5M2U A;  1XNR J;  3I31 A;  4KC5 A;  4DFM A;  1R8B A;  2QYC A;  3MMJ A;  5D0E A;  4AL5 A;  3NGK A;  3FQK A;  2PFF B;  4LRD A;  5IM0 B;  2GQC A;  5KT3 A;  3OL6 A;  2UV8 G;  1GFW B;  4ECQ A;  3HPO A;  5HQM A;  2J6T A;  1SCJ B;  1FKO B;  3R5A A;  4ZVF A;  3MMC A;  4DR3 F;  3PW4 A;  3KOA A;  4P6Q A;  5F8L A;  3M1V B;  2EC0 A;  1N88 A;  5DG9 A;  1MRO B;  4NCA A;  4JYA F;  1UEU A;  4MFB A;  3OW2 R;  4MKA A;  1C0U B;  3UWT A;  3VVT A;  3TQE A;  3AFG A;  3H4B A;  2GO8 A;  3DLG A;  1XNR F;  3CCV S;  1RAG B;  5CYM B;  3DCA A;  4F4W A;  1FJC A;  3Q89 A;  1KFD A;  3D1O A;  5A8R A;  4CT9 A;  3QYY A;  1V9O A;  1BLU A;  3C6U B;  1TZ0 A;  3KLI B;  1MU2 B;  1ZM3 A;  3ETM A;  3NCQ A;  4NLS A;  3U27 A;  3JSM B;  1RAH B;  1KQK A;  2IBO A;  1K0V A;  3B6B A;  3MI7 X;  2IC3 A;  2KG0 A;  5LSL A;  2KRB A;  3VAF A;  4QWB A;  1KQS R;  2OPS B;  1HR0 J;  2F8E X;  3DLH A;  2E7V A;  1RWV B;  2XMT A;  3DOM A;  1MWQ A;  3IFE A;  4B9U A;  4L75 A;  5KFF A;  5I42 A;  4P2S A;  4Y3C A;  2GVZ B;  1W25 A;  2HBQ B;  2HG4 A;  2FQQ B;  4M5N A;  4WIQ A;  3FQL A;  4U7U K;  3GV7 B;  1IBK F;  2UXD J;  1N34 J;  4N41 A;  4C8Y A;  2BVZ A;  1S5Z A;  2H9Z A;  3D1H A;  5A8K B;  1IKX A;  1DAR A;  1VRU A;  2YNF B;  3LAM A;  3GYX B;  3GG0 A;  1HNV A;  2OP5 A;  2WVE A;  5J2P B;  2Y9H A;  3GII A;  4WF9 Q;  2MKI A;  4ED1 A;  2BMB A;  2HK3 A;  5J1N A;  4ECU A;  1JKH A;  2RS8 A;  3E01 B;  1UVI A;  1VK3 A;  3C15 B;  3T6B A;  2HNZ B;  2K1R B;  4JI1 F;  3W2V B;  2EFV A;  3VQT A;  3MR7 A;  1RLD A;  2CNK B;  3RBD A;  5GAH I;  1IQZ A;  5A8W B;  4B3O B;  1KN6 A;  1DHM A;  2J9E A;  4R5P A;  1Q0N A;  5EUH A;  2B7C B;  2Z56 B;  3M8P A;  3V6D B;  1XMB A;  2YPZ A;  2I2Y A;  3DGP A;  1URR A;  2AIR B;  3D9B A;  3R7B B;  3Q2S C;  4OZ5 A;  2CKW A;  5KFX A;  1WC1 A;  3O3L A;  4PWW A;  1FK9 A;  3F44 A;  4DUZ F;  1NB2 A;  3IG1 A;  4FS1 A;  5EN1 A;  2OPQ B;  1EHW A;  3CJS A;  2FTR A;  1VQ4 S;  3CJR A;  5H1S V;  1HWJ A;  4B9N A;  2C2R A;  2BKN A;  1TL1 A;  1T02 A;  2F8M A;  1WOP A;  3EPG A;  3MMA B;  4NE9 C;  1V5I B;  1L5U A;  5DM7 Q;  3CDU A;  3KJV A;  1ZM2 A;  4ZLL A;  3HM9 A;  1XR6 A;  2XZW A;  3CF5 Q;  3HI9 A;  2EFG A;  1RAA B;  3HFV A;  4OI0 A;  2V4J B;  4B9L A;  3D0H E;  2C1E B;  2VG7 A;  2YNH A;  3PFE A;  3T41 A;  3Q8Q B;  2ILY A;  3C14 B;  3M8Y A;  2B4U A;  4LBI A;  1KWM A;  2MKY A;  2FJV A;  2V50 A;  3BM7 A;  3QJL A;  5SUH A;  4YFU A;  1SVD A;  4RNH A;  4U6P A;  3KLH B;  2C2E A;  1WHV A;  2PMZ D;  1UEV A;  3RAM A;  1HNX F;  3OTB A;  4NLT A;  5D0R A;  1RT5 A;  3T19 A;  2VC1 A;  3PG9 A;  4BC7 A;  4FF2 A;  1D8Y A;  3VGV A;  4DU7 A;  4HVZ A;  4CDI A;  1RB0 A;  3MTK A;  2JLF A;  4KE5 A;  4UQT A;  3TR5 A;  2G0J A;  2LQB A;  3BEG B;  3FMB A;  3OL7 A;  2CQ2 A;  5CCM A;  4PG5 A;  1M5S A;  4C11 B;  1SL0 A;  3GCW P;  1JJ2 R;  4E0D A;  3S7R A;  1RWN B;  1OY6 A;  1YJ7 A;  1RTH A;  2DNQ A;  3ETO A;  2VKZ G;  4I2Q B;  5T7L A;  1T05 A;  2UXC J;  2J6U A;  2VOP A;  4USI A;  3NGD A;  1X0P A;  1NKE A;  4EZ9 A;  1VRQ C;  3HJV A;  4FS2 A;  1NSA A;  4R0J A;  2DNY A;  5E3R A;  1LFP A;  4DV6 F;  4Q8E A;  3QNW B;  2ZKT A;  2M8D B;  4NAS A;  3LP0 A;  5J1P A;  4GC7 A;  3TVK A;  4DS4 A;  4AYB D;  4QPX A;  2WW8 A;  4KH0 B;  5KFW A;  1JLE B;  3V4I B;  4J9K A;  3C6T B;  3M2U B;  1S4E A;  5D3G B;  4DR4 F;  4URQ U;  3KLG B;  4DX7 A;  3QRR A;  1U8S A;  1VK8 A;  2XI2 A;  2XSJ B;  4NML A;  4N47 A;  4CLZ A;  1IKV A;  5IFM A;  4KGZ B;  3CVK A;  4A8Y A;  2XMK A;  3ZTP A;  3PZP A;  5HN0 A;  5IC6 B;  4QPT A;  2EG1 A;  2NZ4 A;  1VGY A;  2WCX A;  5KFY A;  5KT5 A;  5KFS A;  4LF8 J;  1H98 A;  2LXF A;  3LP1 B;  3OT9 A;  1F9F A;  4OJH A;  1PC5 A;  3QGG A;  8ATC B;  3MAH A;  1ZA1 B;  4C7Q A;  2MZ1 A;  4ED2 A;  1S6P B;  4I0W A;  4P9S A;  3MM7 A;  1RU2 A;  2AZ1 A;  4USJ C;  5AXL A;  4O3P A;  3BQ0 A;  2VG5 A;  5DM6 Q;  2Y1I A;  1YJW S;  4GKK F;  2NSB A;  3P4U B;  5FDL A;  1PYO B;  1K44 A;  1NME B;  3RJM B;  2OPP A;  1PJ6 A;  1DY3 A;  2CJ9 A;  5DDO C;  3VAG A;  4IOC Q;  2GAG C;  5FLX U;  2R2R A;  3LGM A;  4I56 A;  2GQ2 A;  2Z57 B;  2CWX A;  3VHQ A;  4DPT A;  3GZ7 A;  4PXB A;  3VCD A;  4JV0 A;  1PBU A;  1U1K A;  3GJR B;  3G6Y A;  4UY8 5;  4B9V A;  5ETM A;  3SDE A;  4A8X A;  5KOX A;  1JXV A;  2DXF A;  4FYW B;  4KRW A;  4X62 F;  2HNY A;  4PQU B;  3CJQ A;  3IBW A;  4HT7 A;  4YOE A;  4DPU A;  3KJV B;  4KKO A;  2CPE A;  1Q81 T;  1U0S A;  1YVF A;  3I4P A;  3PYD A;  5KFG A;  1W2B R;  1VHF A;  3NGU A;  1S1V B;  1X4C A;  2EFQ A;  3H0P A;  2OPQ A;  3M30 B;  4EBD A;  1XMQ F;  1WHY A;  4OZL A;  4DEZ A;  5M2P A;  1RKI A;  2SXL A;  1WUU A;  1UA1 A;  4OJ3 A;  3MMC B;  3PKY A;  4FN5 A;  3PX6 A;  2L48 A;  4WK1 A;  3J7Y U;  2EI5 A;  4S0M A;  1KFS A;  4C9D A;  5KFZ A;  1OO0 B;  4B3O A;  1WJ9 A;  2CJQ A;  3QBC A;  4NYP A;  2RUS A;  4ZPB A;  4TY8 A;  1J5O A;  4YHH F;  2E5L J;  4JV2 A;  1RJJ A;  1P9Q C;  2E1A A;  2FHJ A;  2JC0 A;  3BDE A;  3TYT A;  4X65 J;  4LRA A;  3NY0 A;  1FRK A;  3W2V A;  5A2Q U;  4P2X A;  5B7W A;  3QFW A;  4QU7 A;  3A1Y G;  3MAQ A;  4EK2 A;  3GV5 B;  2VQE J;  4RW7 A;  3VAM A;  2HKE A;  2ZC4 A;  2ZKU A;  2Y0S D;  1VIO A;  3V6K A;  2C28 A;  2ZZM A;  1FF2 A;  4PG8 A;  3P5B P;  1XK8 A;  1SKR A;  2EKN A;  4KPY A;  3RB3 A;  2BJ9 A;  4P2F A;  1ARO P;  1M90 T;  1RA7 A;  5HVF A;  4JI3 F;  5ADZ A;  3VZI A;  1RHK B;  3SSR A;  4ERD A;  1VJQ A;  1WF2 A;  3B8H A;  1EKR A;  3FSX A;  1F5A A;  5F8G A;  1NPP A;  1RHU B;  3D54 A;  2O66 A;  2YPY A;  4DXL A;  4IDK B;  4ICL A;  5DS7 A;  1TMJ A;  3S01 A;  3PR5 B;  1S79 A;  1X4B A;  2E5L F;  1GX6 A;  1DQ9 A;  2DGQ A;  2F40 A;  3L4B C;  2Z2L A;  1UL3 A;  4OYW A;  1TL7 A;  2E44 A;  3L7O A;  5FDL B;  2MXY A;  3TAQ A;  3BGU A;  4NLP A;  1FVQ A;  1ELO A;  1NU4 A;  5A6P A;  1HWL A;  4OMF G;  4ZN1 A;  2EXU A;  4ZCM A;  1IJE B;  5LMU F;  1NK7 A;  1SL1 A;  1D0E A;  4UST A;  1HFE L;  4TQS A;  5K8P A;  3H2L A;  1YBT A;  3ZZP A;  1ZPV A;  1MN9 A;  4WJB A;  1K1S A;  2CFX A;  2X1B A;  3MED A;  4RW6 A;  5B0A A;  3JYT A;  1RCO B;  1OPI A;  3CJ4 A;  2VV5 A;  3EVO A;  3FBE A;  5AE1 A;  5KFC A;  1XN9 A;  2KKH A;  1RT2 A;  1IKV B;  3H5U A;  2QA4 S;  1U6F A;  1QJH A;  1VIX A;  1VQY A;  5I3P A;  4AUK A;  5HJY A;  4I7F B;  5IS2 A;  2DHA A;  4LQ9 A;  2XSJ A;  3MR5 A;  2W9A A;  2EFP A;  1CJK B;  2XYP B;  4P2M A;  5C42 A;  2YY3 A;  1H38 A;  1CJV B;  2CPD A;  3MM9 B;  1QAJ A;  3CJ3 A;  3H20 A;  4M5M A;  4AFF A;  3QWU A;  4LFA F;  1UJ4 A;  2OUG A;  2H3E B;  1XR5 A;  4PCQ A;  1KDN A;  1W2I A;  4WPA A;  3G96 A;  4AND A;  1RIS A;  4DQR A;  1R8P A;  4O3Q A;  1KVJ A;  3MUR P;  1G6B A;  4O4G B;  3T9N A;  1M5P C;  2IAJ B;  4DQI A;  2FLO A;  1X4A A;  2KN4 A;  4WP8 A;  1U1L A;  1FE4 A;  1KEK A;  1IBK J;  4CZC A;  2UXD F;  1YHQ S;  2H5E A;  3QRP A;  2KZM A;  3VGU A;  1YZ6 A;  1CS4 B;  3HVA A;  4ZIV A;  5CYJ A;  3SSS A;  4J9U E;  1DUR A;  4B3S F;  1B0T A;  1O51 A;  4CWB A;  4WKY A;  4QR0 A;  2EFN A;  4ELU A;  4KHP F;  1W7W A;  5JXS A;  2QMU B;  2W2P P;  3QPI A;  4NEZ A;  4PRF A;  1HHQ A;  3FC9 A;  4DQP A;  1FCA A;  4IH7 A;  1U1O A;  2UV8 A;  1RYS A;  2BRK A;  3SDE B;  1REG X;  2I8E A;  4K8R A;  2ZM6 J;  4O3N A;  1ZM9 A;  3V2U C;  3DDK A;  3GV8 B;  4R8U B;  1KTQ A;  1EJ7 L;  2W9B A;  3OVA A;  3K5N A;  3P8B B;  4PUO A;  4Y6I A;  3DLK A;  3W9H A;  1DAX A;  2HZC A;  2X51 A;  3K17 A;  3IWN C;  1RXO B;  2LQ9 A;  3POT B;  2F65 A;  2KM8 C;  2VAS A;  2LEA A;  4JI6 F;  4AL7 A;  3E3X A;  1H3D A;  4HH1 A;  2OAU A;  3M9O B;  2R8K A;  4OJG A;  2H5J B;  2QLX A;  3I9Z A;  1HQE B;  2QE5 A;  1FD8 A;  3HSD A;  3RU0 A;  4YR2 A;  3BO3 A;  1JLA B;  2PSZ A;  4K2J A;  4YB7 A;  5ETT A;  2DEJ A;  5B0G A;  4QW8 A;  4DPX A;  4YHH J;  2QEX S;  3SV4 A;  2DXE A;  1P1L A;  3R3T A;  4E8U A;  4EGL A;  2CZV C;  4ID5 B;  3HT3 A;  3AOA A;  4OJ1 A;  1WG5 A;  5DZ7 A;  3J81 j;  2VQE F;  2R8H A;  2IJF A;  2WBR A;  3NXZ A;  4DZD A;  3DLB A;  2V2Q A;  3DGP B;  1JLC A;  2AX0 A;  2RB7 A;  2JNJ A;  3OR2 B;  2QIF A;  3VZH A;  1RDR A;  1RP5 A;  3N0V A;  1H7W A;  3N79 A;  1R0A A;  2QLW A;  4NXN F;  1HIY A;  4C48 A;  1S6U A;  1X5P A;  1RT3 B;  1T94 A;  3OFH A;  3W60 A;  3CC7 S;  5C42 B;  3R2D J;  2CNL B;  1GTE A;  2HVZ A;  3ENV A;  3HHL B;  4TVA B;  1U09 A;  3I5B A;  4RNM A;  2V8D A;  2NPI A;  3ZFV A;  3IM9 A;  1EB0 A;  2DEI A;  4NZ6 A;  5F3T A;  3CCZ A;  3TVZ A;  1F5C A;  5HAT A;  3W64 A;  3TWZ A;  2W4D A;  5HQL A;  3R7S B;  2PDA A;  1SJF A;  1RWK B;  4ECV A;  4HTI A;  1OYE A;  3BKU A;  4P74 A;  2KFY A;  3MM7 B;  4KYZ A;  1R0A B;  1SIW B;  5KFV A;  4CLY A;  3JSB A;  4B9S A;  5K5M A;  2RSQ A;  4ECT A;  3IM8 A;  2VQF J;  1HBO B;  1H73 A;  3KMS A;  2FLN A;  3AH6 A;  4AE5 A;  5C2C A;  2LA4 A;  2W2O P;  4DV7 F;  1Q7Y T;  2J8A A;  2HHH F;  2MGZ A;  5CHC B;  2NRE A;  1RI7 A;  2PN6 A;  2JDJ A;  4X4Q A;  3Q83 A;  1ZZN A;  2F7V A;  3M05 A;  4ELV A;  2IMO A;  4L74 A;  3AJD A;  2NPF A;  2MQP A;  2M5Y A;  4K0K J;  1PJ7 A;  5IT9 Y;  5MAO A;  4NCG A;  4OX8 A;  5LL6 d;  1J5E F;  4J37 A;  1RT1 B;  2PMH A;  3QJJ A;  4ES3 A;  3TA0 A;  4ZKA A;  1NB7 A;  2UVU A;  3OFG A;  2BE9 B;  3GTY X;  5B0D A;  3GFX A;  3LP2 A;  4EYH B;  1FJG J;  1C2P A;  5JVH Q;  4OYM A;  1NJY A;  1C1C B;  2CG4 A;  1FTR A;  4FYX B;  4LFB J;  2BJ7 A;  3N5B A;  2B3T B;  1RBA A;  1XC9 A;  1HBM B;  3UD4 P;  4KHR A;  1EIY B;  2OD6 A;  1GT8 A;  4ZVR B;  3B54 A;  2YKP A;  2NXU A;  2GGP B;  2DR8 A;  3JXO A;  3E2E A;  2B9W A;  2EW9 A;  1MNE A;  3MEE B;  1TKD A;  4DSJ A;  1JWW A;  1F60 B;  3SQO P;  1N56 A;  1SC4 B;  1JNR B;  2GVD B;  3FCV A;  2PC6 A;  3RRH A;  3DNC A;  3O5T B;  2P6T A;  3LF0 A;  1F2G A;  3M8Q B;  4GKJ J;  4YS2 A;  5B0B A;  1S9E B;  5GMD A;  2ZIT A;  2EBE A;  5I3Q A;  3H5Y A;  1WC3 A;  3TQ1 A;  1N5Y A;  2BOP A;  2FVP A;  2DHS A;  3H25 A;  4M5D B;  4ETX A;  4WP9 A;  1KBR A;  1Q7L B;  4L3N A;  1TKZ A;  5KT2 A;  3G6X A;  3WHI A;  1N34 F;  1E6V B;  4DX6 A;  2VG7 B;  2YNH B;  4KSE B;  2B5J A;  1M1G A;  4F3M A;  3TAR A;  3GJS B;  4QIF A;  2RIJ A;  2HNZ A;  3FJ2 A;  3BGO P;  2DBB A;  4DFJ A;  2RAQ A;  4NOH A;  3UR0 A;  2Z8Q A;  1OY8 A;  1VYA A;  1BHN A;  1C0T B;  2D1C A;  1TQL A;  3PEJ A;  1HBN B;  2M88 A;  1UAW A;  2IRY A;  3I55 S;  4PG7 A;  4JI1 J;  2DH8 A;  2DRA A;  2VOD A;  5IOL A;  2DIU A;  4H4M B;  5IT4 A;  1KD1 T;  1DQA A;  2V94 A;  3CDW A;  2MQQ A;  2ZE2 A;  1HHT P;  4LR9 A;  2GCF A;  2ILZ A;  5DO2 A;  1RWM B;  3MCS A;  3OFF A;  1QAY A;  3IBC B;  4LSZ B;  4LF7 F;  1OIA A;  2JZ5 A;  2LCW A;  2DHH A;  4EI2 A;  3BR9 A;  2OJ3 A;  1UVJ A;  4HL9 A;  4MIW A;  3B78 A;  3DMJ A;  2QA4 G;  2ZDP A;  5IC4 B;  3D5M A;  4CO4 A;  1U1M A;  3VR1 A;  1M1K T;  5AT1 B;  2A10 A;  2ZUG A;  1HBM A;  1WKJ A;  3CD7 A;  2FDN A;  1QUV A;  3K5P A;  5BR8 J;  1FEH A;  2GHP A;  2HFS A;  3SSQ A;  3U02 A;  1AW0 A;  2OPR A;  3QT5 A;  2BAN A;  5EWE A;  1TV6 B;  3GIK A;  2FB0 A;  1K8A T;  1VQ5 S;  4JI7 F;  3G8S A;  2J9D E;  2OKQ A;  4NLO A;  4FZV A;  4DR3 J;  3TAP A;  2NYH A;  2RML A;  3HHL A;  2DCL A;  3R97 A;  3UFC X;  5B09 A;  5LJ3 Y;  5HRO B;  2XMA A;  3CCM S;  4ZLJ A;  2QFJ A;  2Y8Y A;  4ZPV R;  3KLF A;  2V6A A;  3TZW A;  1H2U X;  3G2X A;  4UW2 A;  2FGC A;  2BBE A;  4TXS A;  5C2G A;  1UVM A;  1U8W A;  1Q86 T;  4C98 A;  4DV7 J;  3FK4 A;  5U47 A;  3N6M A;  1T9W A;  5D15 A;  4BC9 A;  2JLE A;  3BB5 A;  2XZT B;  3HVR A;  2F63 A;  3DI6 A;  3NP5 A;  3KK2 B;  1HNX J;  2J0S D;  1KS2 A;  2GX8 A;  2YNI B;  1HLW A;  4LRB A;  4WCE Q;  2HQG A;  1UA0 A;  3Q86 A;  2G0C A;  4WKR A;  4ZVS B;  2OO4 A;  2ZBI A;  2UP1 A;  1RTH B;  1U6B A;  5ETK A;  1UEK A;  5CYQ A;  4ZJO A;  2GJ2 A;  3EGV A;  3HF5 A;  1FX4 A;  3I87 A;  3BGR A;  1MWY A;  3NS5 A;  5DG8 A;  4MK8 A;  2CNN B;  2DGV A;  1BMQ B;  4C3M A;  1I94 F;  4HI1 A;  4DI6 A;  2B5J B;  1ZTT A;  1FJG F;  3MEC A;  2HHV A;  4FXW A;  2OEK A;  2PEB A;  3RTV A;  1FNX H;  3TUP A;  3ITH B;  3SIP B;  1CC7 A;  1RWX B;  1T9V A;  2UU9 F;  4E2F B;  4B02 A;  2M2B A;  4C6A A;  1RA6 A;  1U7L A;  1TKT A;  2QRR A;  4OYO A;  3V6J A;  2CWK A;  4TY8 B;  4RR5 A;  3CT9 A;  5HL7 Q;  2NYI A;  3OD2 A;  1K47 A;  4CT8 A;  1T7P A;  1NDK A;  2A18 A;  3PNI A;  4NL5 A;  2CQ1 A;  3FZB A;  2G4B A;  1GQE A;  4ID8 A;  2KO1 A;  5C25 A;  1HNZ J;  2J6S A;  5KG6 A;  2C3M A;  2PFD A;  4ZVG A;  2I6W A;  2HZV A;  4K4S A;  1S0O A;  2RRA A;  3OL8 A;  3J80 Y;  3KLE B;  1TFW A;  2P5V A;  4FVM A;  3ISN D;  3I6P A;  3MMA A;  5KFJ A;  2VON A;  4ZLP A;  1VQO S;  1S1V A;  3L09 A;  1YG0 A;  3H90 A;  4KY3 A;  5D4N A;  2J8S A;  1Q53 A;  2IM0 A;  5D4O A;  3DOK B;  1AB8 A;  3MEG A;  3G6V A;  3N28 A;  4KV8 B;  2F9J A;  1QE1 A;  1ZS6 A;  1WEZ A;  2IM2 A;  4OL8 A;  1TL3 A;  2FC9 A;  4F4A A;  1GMW A;  2RQC A;  4K4Z A;  2WOM A;  4ED6 A;  2V9W A;  3NBP B;  4XO0 A;  1RTJ A;  4DOZ A;  2QN6 B;  3NCR A;  2OEJ A;  3MAA A;  2V4Q A;  2PI4 A;  2DNK A;  2G2O A;  4N8O A;  5IQQ A;  4UY8 T;  3KUE A;  1YJN S;  1LWC B;  1IM4 A;  3CO0 P;  2ABY A;  2YVS A;  1YZ7 A;  5JVG Q;  5CQG A;  3DRP B;  1VFJ A;  3G87 A;  1Q82 T;  2W01 A;  3GR0 A;  2GA7 A;  1X5O A;  4DPW A;  4DBQ A;  2KL8 A;  3MM6 B;  4ZLN A;  4CCH A;  3P45 B;  1WG4 A;  3ITH A;  4LBH A;  3TAM B;  2R7X A;  3HHK A;  2ZBR A;  5E2Q A;  3Q8S B;  4ELT A;  1N6Q B;  3MEC B;  3F73 A;  3SQG A;  4X62 J;  2KXN B;  2QFI A;  1RBO B;  2ALY B;  4XDC A;  2KVI A;  3SFU A;  4YUD A;  1EET B;  2HVH A;  2IVY A;  4F4Y A;  2WB1 D;  2IVF B;  3UE2 A;  1B64 A;  5A8K A;  2B4P A;  2JEF A;  4B3T J;  5L46 A;  4XPE A;  4XDD A;  5F0W A;  2HRY A;  5LOQ A;  1VHI A;  4M8L A;  1IWA A;  4ATN A;  2DNN A;  1SQG A;  5K20 B;  2ZOG A;  3BPS P;  4Y34 A;  3KK1 B;  1TU0 B;  2AJQ A;  3FGV A;  3KK2 A;  1TUV A;  2OD4 A;  2XGP A;  2K3K A;  4W90 B;  1JB0 C;  3BJY A;  2W2N P;  2CPX A;  4L73 A;  1RCX B;  1N36 J;  2IY5 B;  1NSK L;  4AXI A;  1LFW A;  1DTQ B;  1UCN A;  2HVD A;  1D3W A;  3Q8Y A;  1HI1 A;  2C2D A;  1NKB A;  2CJY B;  4LVO P;  1VQS A;  4I2P A;  1P27 B;  4NLY A;  3GMG A;  2FZK B;  2AT1 B;  5JUM A;  4DJB A;  2L9N A;  2RKI A;  2BKP A;  3DLG B;  3HHL C;  4MT1 A;  4PAB A;  5KOW A;  4F02 A;  1LW2 B;  3GIJ A;  3AD8 C;  1YI2 S;  1VR6 A;  2LMI A;  2O01 C;  2UUC F;  1S12 A;  2JSX A;  3G82 A;  1WEX A;  3H59 A;  3R5G A;  4DFP A;  2LEC A;  1YRX A;  1T9U A;  3A3P B;  2MZS A;  3R8Y A;  4DR1 J;  2XLI A;  2AGO A;  2JEJ A;  3LH2 S;  2QMX A;  1DJ0 A;  5KFT A;  4AT1 B;  4FYD A;  1N54 B;  2M7S A;  2JEI A;  3GJT B;  2UVR A;  4DS5 A;  5KT7 A;  3G4S S;  1H2T Z;  3HVW A;  3LQV A;  4Y2A A;  5KFM A;  1I94 J;  4PUO B;  4JV5 F;  5LSR A;  2V67 A;  2R2T A;  4LF4 J;  1BQN A;  1UWA A;  4CLF A;  1B99 A;  4M5K A;  4A8Q A;  1NM2 A;  1F2H A;  3L9Z A;  2J5A A;  1SV5 A;  4MKB A;  3LPY A;  2G1H A;  3L3C A;  1SJ3 P;  4EU0 A;  3PKM A;  3OTD A;  4J7C A;  3W3S A;  4C8M A;  4UZB A;  2WTF A;  1FWP A;  2FHJ D;  5AXK A;  3SMZ A;  1LWX A;  1RTZ A;  2LVW A;  4DF4 A;  4ZMM A;  1IKY B;  3AQP A;  1CUL B;  2KG1 A;  1G1X A;  5F8I A;  4I6W A;  2OI2 A;  3ZNU A;  1SI9 A;  4OZN A;  1FTC A;  5KT4 A;  4FKY A;  4YDX A;  3FFI B;  3OLB A;  2VJV A;  4DUY F;  4DV5 J;  1U2R A;  4RUB A;  5KFN A;  1FHT A;  3LUY A;  3JTN A;  3NS7 B;  4ZVQ B;  4QQB A;  1HYS B;  2GMJ A;  5G0R B;  1OPZ A;  3VGS A;  4RU9 A;  3I0R B;  1FNO A;  2COL A;  1U45 A;  5KG4 A;  4DL5 A;  3LPE A;  1WSV A;  2V8P A;  4ECS A;  4KHM A;  4LFC F;  1UWB B;  2R7S A;  1NRK A;  3U7J A;  4ZK7 M;  1SUQ A;  3LAL A;  3SYZ A;  1NSQ A;  3CB4 A;  4IRD A;  1GK8 A;  1S57 A;  2HHP A;  2HS4 A;  2OEL A;  2WB4 A;  3M2V A;  8AT1 B;  2OTL S;  2DGS A;  2KU7 A;  3GU0 A;  4KKO B;  3KNG A;  1NDC A;  2ADB A;  4XK8 C;  1NK8 A;  5DG7 A;  1SKU B;  1KOO A;  1PAU B;  1IM6 A;  2F4F A;  2VIH A;  2V4R A;  2ZNY A;  1S1U B;  3WDO A;  2ZDO A;  2RKI B;  4USU A;  4X4U A;  3GB0 A;  2H1Y A;  4FBT A;  3AOD A;  1X5S A;  2G0I A;  3DM2 B;  5KFH A;  2DT9 A;  5D4L A;  2L9W A;  1KLN A;  2OSQ A;  4LUB A;  2I0X A;  5IWA F;  2W7P A;  2GV1 A;  3DDI A;  1S77 D;  2KVQ E;  1Y5L B;  3UCU P;  2CQ3 A;  3IXQ A;  4DR6 J;  1OJ4 A;  2HAI A;  2DGX A;  2HBR B;  4N77 A;  4JI6 J;  5E3A A;  1HQU B;  1Z4U A;  5E5N A;  4CO1 A;  3DXB A;  2XI3 A;  2FD2 A;  2DR5 A;  1IBL J;  2V34 A;  1XBW A;  4P7T A;  5KTQ A;  4OHY A;  2FJX A;  2ZBC A;  2R7O A;  4NA2 A;  1T9X A;  3OHB A;  4NXM J;  4LF5 J;  5HAO A;  2XTJ P;  3K5M A;  4J9Q A;  2XSF A;  1HMV A;  2NXN A;  4LSN B;  3PO5 A;  2OGU A;  1NPR A;  3DYA A;  1PAE X;  3IAM 9;  2PMW A;  3MM6 A;  3PYG A;  1YK9 A;  3KLG A;  2M8H A;  1FVS A;  3RRG A;  2Q66 A;  3MAA B;  2XG8 A;  2A6M A;  1CJU B;  1GMU A;  1RQ0 A;  2QX0 A;  2YWH A;  4OZ3 A;  3PJW A;  4DR6 F;  2QV6 A;  2XLJ A;  4K50 A;  1NLK L;  3IS9 B;  2MKH A;  2ZOF A;  3JSY A;  3O44 A;  2DK2 A;  1Y3K A;  3Q8R B;  1G2E A;  4BWM A;  1GAO A;  1H72 C;  5F9L A;  3OL9 A;  1QTN B;  1DTT B;  1WC5 A;  5HLF A;  2HHQ A;  2KT5 A;  4FPR A;  3ZC4 A;  1X4E A;  1KON A;  2CG8 A;  2VG6 B;  1FDB A;  4M63 A;  4DV3 F;  2V5H G;  2YQ3 A;  2DR7 A;  2Z2Z A;  4ID5 A;  4ZPT R;  1S1T A;  2D7S A;  3KUH A;  3KG4 A;  4Z2X A;  5L1I A;  1QD1 A;  3ICL A;  2XGQ A;  3MUM P;  1QVF R;  4WYL A;  1M5K C;  4I68 A;  4IKA A;  1Q4R A;  2CPF A;  3O2I A;  4G1I A;  4M1K A;  5K8O A;  4Q2M A;  3KHR A;  2QLB B;  3TEH B;  5C25 B;  3A12 A;  1MG7 A;  2KM8 B;  5THW A;  3VAK A;  2JEG A;  4R8U A;  3C2P A;  2IRX A;  1FFG B;  3GP9 A;  1WTB A;  2QSW A;  4GO7 X;  4ETZ A;  2B0G A;  2G2Y A;  3GR1 A;  3L7U A;  4G1P A;  5A8W A;  2D9O A;  3M2R A;  3UI3 A;  3B82 A;  5IV4 A;  1Z1Z A;  3NGR A;  4YY3 F;  1EAY C;  2DNZ A;  3ILO A;  1YKW A;  3M4X A;  2ACM A;  3BF4 A;  1N4L A;  4KO0 A;  3L7P A;  4OX9 J;  2WBM A;  1CUL A;  1CBK A;  3D7S B;  4IYQ A;  1GX5 A;  4KPC A;  4ZPD A;  9ATC B;  1A6L A;  4F0M A;  4X66 J;  3CME S;  2KZZ A;  5HQ8 A;  2WSF C;  2V68 A;  4DV1 F;  2MLZ A;  1BXN A;  1S10 A;  4F67 A;  3OLA A;  2FJD B;  1F9E B;  1Y11 A;  2YQ0 A;  1PYS B;  5C7P A;  1T3O A;  4Z7C A;  1IR2 A;  1DTT A;  1GNK A;  1SC1 B;  5HLF B;  4LQ3 A;  5F8N A;  2VZ9 A;  3CUL A;  1KKH A;  1YBU A;  2MJN A;  4HHH A;  4U8V A;  5B0C A;  5GAD I;  2ZJQ Q;  2AGP A;  4OI2 A;  4YY3 J;  4DF8 A;  2DNO A;  2W7O A;  4DL3 A;  3HMJ G;  4M94 A;  2KXF A;  2AEM A;  3JQJ A;  3NNC A;  5IWA J;  2EK6 A;  2MB0 B;  1MWZ A;  2HHU A;  2MMY A;  2A0F B;  4M5I A;  1GMW D;  1KC8 T;  1QSL A;  1EP4 B;  3J7Y I;  4JI8 F;  1TAQ A;  5HRO A;  2ZVI A;  3BS9 A;  4RW8 A;  3GQC A;  4G6V B;  2DH9 A;  4RWX A;  1HNW F;  1BWV A;  2VD3 A;  3WC2 A;  2BAN B;  4RX6 A;  1EX8 A;  3NEK A;  1RT2 B;  4JOU A;  4O0N A;  3RYL A;  4L76 A;  3TRG A;  2AEJ A;  2ZH4 A;  1U1P A;  2F5G A;  1X9W A;  2ZNZ A;  1KNZ A;  1M5H A;  1WHX A;  1C0U A;  3FVY A;  5JMN A;  2ZH3 A;  2OPR B;  2XS2 A;  2H4Y B;  2HS0 A;  3MED B;  2XY5 A;  1ZA2 B;  5KT6 A;  2HIQ A;  2RRN A;  4HKQ A;  2JHE A;  2W8L A;  1NHV A;  5AXN A;  2ZEJ A;  1LK5 A;  3NCP A;  4F4X A;  3PCO B;  1EQM A;  1IKW A;  3R6G B;  2DHX A;  1SBR A;  3HUL A;  4UOC A;  2ZH9 A;  4X64 F;  5D6G A;  2O5D A;  5DGB A;  4JV1 A;  1S72 S;  1EQ0 A;  3BBF A;  7FD1 A;  4ICL B;  4OYB A;  4YB1 P;  1GTH A;  4FP9 A;  3M6V A;  1VQL S;  5I3U A;  3FEY B;  3IRW P;  4WU3 A;  3IA0 A;  2CQ4 A;  3QT7 A;  1S4F A;  2D69 A;  3CNQ P;  4DCJ B;  3MM8 B;  1U25 A;  5D77 A;  4LSL B;  1DQ8 A;  4NLW A;  1ACM B;  3D3B J;  1W26 A;  5L1K A;  1QDU B;  3K8V A;  4X84 A;  1VRT B;  2VFS A;  2WK4 A;  2JVR A;  3MDF A;  2DO4 A;  1UZD A;  4DG1 A;  1RTI A;  4UUX A;  3T1H J;  4IO9 Q;  4LVN P;  4F36 A;  5CD4 H;  2YWW A;  1J27 A;  4RZR A;  1SXL A;  3LO3 A;  2MKC A;  4O4G A;  1UWB A;  1UJ6 A;  1B70 B;  2DO0 A;  2V8G A;  3W7B A;  5AE2 A;  4USK A;  1FRX A;  3HLU A;  3CCT A;  3M8Q A;  5HP1 B;  3TZZ A;  4NLR A;  4LFB F;  2MZJ A;  1M0S A;  4DU8 A;  2VFR A;  2BJ8 A;  4R5P B;  3HFK A;  1Z2L A;  1FKA F;  4ECX A;  1R6Y A;  3CIZ A;  1RTD B;  2AZ3 A;  2J9C A;  3PHE A;  1RTI B;  4USV A;  2QL7 B;  3I9V 9;  1VBK A;  1R31 A;  5HMY A;  3VTI A;  2BA9 A;  2HQF A;  5LXY A;  2HFZ A;  3T9Z A;  5J2M B;  1U0H B;  2Z2M A;  4YQW A;  1VC0 A;  2HGN A;  3OUY B;  2VBW A;  2B8P A;  3KLE A;  2VHG A;  4CYU B;  2PD1 A;  3OXF A;  3R5C A;  3SCI E;  4HLB A;  2CQB A;  2LDI A;  1FDN A;  1NH8 A;  3CDA A;  1NK0 A;  2UZA A;  4J9O A;  3IS9 A;  2K06 A;  3FRY A;  5GAE U;  2AX1 A;  4FPI A;  1RHQ B;  1G3O A;  1PGZ A;  1D9D A;  1WDD A;  3HXM A;  4NWB A;  2UU9 J;  1RK8 A;  1N48 A;  2P9E A;  2VFU A;  1X4F A;  2YKA A;  2YNG A;  1XWL A;  5DQI A;  4F4K A;  3RB0 A;  4CIO A;  2BAC A;  2OPP B;  1WG1 A;  4YR0 A;  2MQL A;  3PR4 A;  3KK1 A;  1FXD A;  1S7H A;  2YKO A;  2PA3 A;  3K2Y A;  1D1U A;  3LP1 A;  3Q8V A;  3DRS B;  5E3C A;  2FHM A;  3CJ8 A;  5EX3 A;  1S6P A;  4IRC A;  1X4G A;  1BQM B;  2HEK A;  2R7V A;  1UVN A;  4J9S A;  2B43 A;  5L8R C;  1P9Y A;  3NLC A;  2RDJ A;  1JJH A;  2CAD A;  2YH0 A;  2B7B B;  4HEA 9;  4I2P B;  4UOG A;  1N0U A;  4Y2I A;  5J2Q A;  5ETR A;  2WRM A;  1DTQ A;  4KGV B;  2ZC3 A;  3BN7 A;  2K7K A;  3TX0 A;  2EEY A;  3I5C A;  3ULH A;  2PO4 A;  2C42 A;  5DDQ C;  3MUT P;  3KLV A;  4MKY A;  2PII A;  2RQM A;  3HX9 A;  1FKO A;  8RUC A;  3UVJ A;  1JJ4 A;  4V1A k;  5EWF A;  1RAJ A;  2E7W A;  3K0J A;  1UET A;  5HO4 A;  2ZZN A;  2Y1J A;  4ZIT A;  1WF1 A;  4DSK A;  2VA3 A;  3B4M A;  4Y2M A;  4CM0 A;  5IM0 A;  1S0M A;  2QA1 A;  3LP0 B;  2M3D A;  3ADA C;  2CVE A;  2GZO A;  1M5O C;  3T5L A;  4GKJ F;  4NA3 A;  3P6Y C;  1B7Y B;  1LXJ A;  2MZR A;  4EO8 A;  4QBU A;  3HD1 A;  4X4R A;  2KFN A;  1UMJ A;  1FI4 A;  3IR7 B;  3EXC X;  3LW5 C;  1Q8B A;  3TVY A;  2KRR A;  2MQN A;  1S97 A;  2AW0 A;  1WI8 A;  4WII A;  2QG9 B;  3BSC A;  2VA2 A;  3THT A;  1F5B A;  1YTY A;  3BQ1 A;  3I0R A;  3RR7 A;  3DRP A;  2MY8 A;  4MH8 A;  2DPI A;  5H9E K;  1EKS A;  1WWH A;  4WTY A;  3JAM Y;  4XPC A;  5GME A;  4UOF A;  2QJ3 A;  3J7Z 5;  1HPZ A;  4LIR A;  1ZOT A;  4OHV A;  1PIL A;  4GVB B;  2FUG 9;  4CNY A;  1JLG A;  2NXJ A;  4OI6 A;  4DR2 J;  1DLO B;  3G71 S;  3T5H A;  2D74 B;  2HFV A;  4TLR A;  1BQX A;  2P9G A;  1VC5 A;  2R8J A;  3OUY A;  2VIC A;  3FDS A;  1U6Z A;  2IJN A;  2RT3 A;  2XUL A;  2LDY A;  4ZP6 A;  1YLX A;  2ROG A;  5ETN A;  2ASY A;  2V9K A;  2XNR A;  3D68 A;  2RE1 A;  1T03 B;  5I4M A;  2DIT A;  1AFJ A;  1TUG B;  1O8B A;  1AZS B;  1S6Q B;  4IFV B;  1RAO A;  3K8W A;  1HL6 A;  2MLY A;  1R6V A;  1S9E A;  4QR2 A;  5BXI A;  4X4O A;  3OXG A;  2XY7 A;  3X1L B;  3IR5 B;  2MQO A;  4LF6 F;  2QLJ B;  5JJB A;  4PYD A;  4JI7 J;  2OFH X;  1PSD A;  2MQM A;  2E5H A;  3MM9 A;  4I6A A;  3MD3 A;  2RQK A;  3KYL A;  4KAI A;  4CLW A;  3W8P A;  1VQN S;  1IVZ A;  4F3O A;  3ZNJ 1;  2GGP A;  2Z4P A;  3BPD A;  5ETV A;  1JLB A;  2F4V F;  4USM A;  3BGL A;  1TUW A;  3TA2 A;  1LW0 A;  2W4C A;  3KJN B;  2GC8 A;  3T5J A;  1Q1K A;  1TV6 A;  3T1Y F;  1KRP A;  3FBB A;  5BYQ A;  3GSI A;  2DRD A;  1VQP S;  2XY6 A;  2D3U A;  1IR0 A;  3KXD A;  1H0H B;  1YBA A;  1OWX A;  5C5J A;  3A3N B;  3R27 A;  5KG0 A;  3PIP Q;  3D2W A;  4ER8 A;  4KTQ A;  5J2P A;  1C4A A;  1JNZ B;  2B9X A;  1ICE B;  3H7H B;  4PXD A;  2XQC A;  3CUN A;  2AYB A;  2CNO B;  2DR6 A;  2P2C B;  2W4P A;  2WON B;  2FVS A;  2IA6 A;  4NYZ A;  4BCA A;  2VPX B;  3GFY A;  2CPI A;  1FD2 A;  1FRI A;  4F04 B;  1HI0 P;  2ASL A;  1QY7 A;  3N6L A;  2E5I A;  2RU3 A;  5E7O B;  1FDA A;  4KBI A;  4ZN3 A;  4IFY B;  2HUR A;  4MIB A;  2F4V J;  2BUN A;  3AY0 A;  2RD5 C;  3NWR A;  5K8N A;  3W2W A;  2CZ9 A;  2DHG A;  1N5V A;  4FVC A;  1V6H A;  1L3U A;  2KXH A;  1EET A;  3OJU A;  3HP6 A;  4DQS A;  1M5V C;  3DRY A;  3D0G E;  4PPZ A;  4RUA A;  5KFB A;  5AJ3 F;  4G65 A;  2HW3 A;  2KH9 A;  3HD2 A;  1WOR A;  2V2V A;  4NLX A;  3H5S A;  2HGM A;  1FFW B;  1U2C A;  2GMH A;  4LR7 A;  2JWN A;  4UF4 A;  4LJM A;  3HFZ B;  3OTE A;  1T8E A;  1RHR B;  4I69 A;  1N32 J;  3N4W A;  4ZCI A;  3DLL Q;  1H6K X;  2JX2 A;  5DDR C;  1QSS A;  3MWB A;  5LM7 E;  1WEL A;  1NHK L;  3J7A 1;  4N5S A;  3JS9 A;  1WI6 A;  2E1P A;  3JTO A;  4Z37 A;  1WC4 A;  3N9U C;  4CH1 A;  4ZJL A;  5KG7 A;  4LRC A;  3FMW A;  3K57 A;  1XMQ J;  2VB6 A;  2WHO A;  4DG1 B;  1UFK A;  6FD1 A;  4F4Z A;  3TJA A;  2CQH A;  4ILR A;  2OFG X;  5K8M A;  3PW0 A;  2OIH A;  2CPZ A;  4KIA A;  4ANC A;  4RUH A;  1T03 A;  2HNY B;  1NEE A;  2ZH7 A;  3I56 S;  3ZZZ A;  2E9T A;  1HNV B;  3MMB A;  1Q8L A;  3O8W A;  5KFA A;  4LF5 F;  2XM3 A;  1JIH A;  2MST A;  3GIM A;  3UDE A;  4DX5 A;  3NWG A;  1MMN A;  1N32 F;  2ZJR Q;  3DDN A;  4X64 J;  2VBY A;  1CJU A;  4OQJ A;  4CI0 B;  2O1P A;  3QGP A;  4J9P A;  1HPZ B;  4IQX A;  2OLW A;  5HVH A;  2U2F A;  9RUB A;  3G6E S;  1JMT A;  3Q23 A;  1IXK A;  4PYA A;  1VCT A;  2H5I B;  3HHN B;  3QO9 A;  4Z7Y A;  5A0Y A;  3AOC A;  2CJX B;  1APS A;  1NJI T;  2HRU A;  2X1F A;  3H5X A;  3NRB A;  1RSC A;  2XZD B;  3CMA S;  2HIY A;  2ZHO A;  3DHX A;  5KFQ A;  5KFP A;  2Z30 B;  1SJ1 A;  4DX8 H;  3M6U A;  1XIQ A;  4X4S A;  3G8T A;  2M9K A;  3BDP A;  3PM9 A;  4V19 X;  1K9M T;  1T0T V;  3W1Y C;  3CDB A;  2YX1 A;  1KLM A;  3R1H A;  3AA9 A;  4OHZ A;  4DN9 A;  4LF9 F;  3LTO A;  3R5D A;  1FEE A;  5BJR A;  3BYP A;  1DRZ A;  2RF2 B;  2R2U A;  2KTQ A;  2ZWP A;  1E6Y B;  2J7K A;  3KUG A;  4GKK J;  4DUT A;  1HA1 A;  4IO1 A;  2MDA A;  2XMW A;  5J1E B;  4D3G A;  3Q8U A;  4NCG B;  1ZPW X;  3MF5 A;  3GE9 A;  1AXQ A;  2M4M A;  3A4T A;  3OR1 B;  1BGX T;  2MGZ B;  1NK4 A;  1ROF A;  1VLO A;  3WX8 A;  3CTR A;  2HS3 A;  1FES A;  2PGC A;  4IFV A;  3TP2 A;  4CYU A;  1U49 A;  4DSL A;  4JI5 F;  1HWK A;  2QC3 A;  3M2V B;  2ZH2 A;  3DLE A;  3DN9 A;  4TN2 A;  1L3S A;  1HW8 A;  2CQD A;  5KFU A;  3GON A;  1WOS A;  3H8Y A;  2W9C B;  3A8K A;  4LMZ A;  3IGN A;  1O6X A;  2RIL A;  2CPJ A;  2I38 A;  2IHR 1;  2GW8 A;  4N8N A;  4JI2 F;  3VAL A;  3THP A;  3T1A A;  1YX2 A;  3I82 A;  2L08 A;  2B4O A;  4A8S A;  3PX0 A;  1EZZ B;  2ZE2 B;  4FKX A;  4B3M J;  3IAS 9;  3PY8 A;  4Y28 C;  4DV5 F;  2BQU A;  4NXM F;  1S1X A;  4N56 A;  3BQ2 A;  4Q8F A;  1S1U A;  5D78 A;  1NZA A;  2EKY A;  1Q79 A;  3GYN A;  5KFE A;  3ENW A;  3J81 U;  2BX6 A;  3EZO A;  4ITS A;  3MFH A;  3KFW X;  2E1R A;  4ZDN A;  2FGO A;  5B08 A;  3QSY B;  2PA8 D;  3ZTS A;  1RAB B;  5HAN A;  2OML A;  1VBY A;  1BD6 A;  5KAK A;  4RW7 B;  4JI4 F;  4OI3 A;  3LWM A;  3KNA A;  1TKZ B;  4C3L A;  5IT0 A;  2YKM B;  4M5D A;  1Q5V A;  1URN A;  2J7U A;  4WFB Q;  1EAR A;  1H2V Z;  2B56 A;  4OZ1 A;  3CJK B;  4ILM A;  4KGK A;  2DIV A;  1V3R A;  3FKB A;  3I4H X;  1IKW B;  3AD9 C;  3CCW A;  2X3D A;  3IRX B;  3MPD A;  2GVD A;  4K59 A;  3U1N A;  4HH0 A;  2ASD A;  3FEZ A;  2C2N A;  1YJT A;  3MEE A;  1TMM A;  3QAT A;  4OFZ A;  4NCB A;  1TKT B;  1NDL A;  4L3K A;  5HSP A;  4JI0 J;  3CC2 S;  5DDP C;  3UDC A;  2DGT A;  1S76 D;  2XYG B;  4GC6 A;  3W9J A;  4BLG A;  3ZZ0 A;  3PW7 A;  1JX4 A;  4FBU A;  3AD7 C;  3GFH A;  1V5V A;  4ALZ A;  1HMV B;  1G7C B;  1VRT A;  2DNM A;  2NR0 A;  2BR0 A;  1NKC A;  2XMM A;  1U1R A;  3KMQ A;  2VFT A;  4K4W A;  4F50 A;  3JQM A;  4LSL A;  2OTJ S;  2GIQ A;  3F0N A;  3F56 A;  3M7V A;  1R89 A;  4C8O A;  3PJX A;  4X4T A;  2P9C A;  3CW2 C;  4PQU A;  2ERR A;  1FDD A;  2NXE A;  4FYY B;  1IUJ A;  5F41 A;  5HBM B;  3H40 A;  4J9R A;  2CJB A;  1OMS A;  2BXJ A;  3EUN A;  5BYR A;  2A2C A;  1SH3 A;  3KG0 A;  2BE2 A;  4C3K A;  3SV3 A;  2LXU A;  2AJ1 A;  2KYZ A;  3I0S B;  4IH5 A;  4JB8 B;  4Q2L A;  2H4W B;  3RZA A;  5LJ5 Y;  4EYI B;  1X9S A;  4RUC A;  2L9D A;  1S7I A;  3BV8 A;  3DHW C;  1FX2 A;  3FCH A;  4G3I A;  3TOQ A;  2H65 B;  4BBY A;  1VQ6 S;  3EXY A;  2N3L A;  4OX7 A;  4DCO B;  4X66 F;  2XO6 A;  1MU2 A;  4KT0 C;  2VG5 B;  3KLF B;  1BY9 A;  5HBM A;  2E9R X;  2MKS A;  4WE1 A;  5A8R B;  3F41 A;  1T9Y A;  4U96 A;  1IJF B;  3W63 A;  3X3U A;  3TUI C;  4QJV A;  2WON A;  3KLI A;  3FEX B;  3J7A N;  3DLE B;  1MLA A;  2V63 A;  1RT7 A;  3MOJ B;  3U1M A;  1AUD A;  3LGN A;  1TKX B;  5KG5 A;  4Y2C A;  3L95 X;  4A8W A;  4B3S J;  4TLQ A;  2ZH1 A;  4FNI A;  4DMZ A;  2C22 A;  2AWZ A;  5IV3 A;  1VLY A;  3RB6 A;  2UXC F;  1KP6 A;  3NGS A;  2YWK A;  4DV3 J;  3R5B A;  3ZZU A;  1FXL A;  4JI5 J;  3BKT A;  5LMN F;  1AFI A;  3HDS A;  3ISN C;  3G8Q A;  2LKZ A;  1IN0 A;  2WVD A;  5HI7 A;  2NS1 B;  4DLE A;  2AYM A;  4TKT A;  3AHP A;  1HNW J;  4RLE A;  3NBP A;  1FRM A;  1Z2Z A;  1UPM B;  3CCJ S;  4OYX A;  5H9F J;  2CQ0 A;  1WAC A;  2WVC A;  1R8A A;  2EC2 A;  1HWI A;  1U24 A;  2LEP A;  3IN5 A;  3RG6 A;  5GMK a;  3PRB A;  1UW9 A;  5MLC V;  2NLW A;  4U67 Q;  1X4H A;  2LP4 A;  4EO6 A;  4K4T A;  3I32 A;  4WXO A;  4RNF A;  2YKN B;  5F8J A;  3OPK A;  1SH2 A;  1KHV A;  1VIS A;  4KO0 B;  5L9X A;  2XYH B;  1YSJ A;  2L3M A;  3S8S A;  2C2M B;  1C1B A;  2XMJ A;  3IWL A;  2Z58 B;  3PAC A;  4K5S A;  3D28 A;  3POT A;  3HCX A;  4RNO A;  2Q1L A;  4R0E A;  2POK A;  1Q8I A;  2WVB A;  1N52 B;  1LOU A;  1I3O B;  2B9E A;  2C2Z B;  3DGV A;  1S1X B;  2R4F A;  1S48 A;  2ZZT A;  4WFZ A;  4GVB A;  4DPO A;  5HMW A;  2WZ1 A;  3TJ8 A;  3FBF A;  4HI2 A;  3OHA A;  2LU2 A;  2X7I A;  1KQF B;  3LOU A;  4C8K A;  1FKP B;  2F3J A;  2GQQ A;  2LQJ A;  4KJI A;  4LSN A;  2YTC A;  4EZ6 A;  1UFL A;  3R6L B;  4BS2 A;  1C1B B;  1KVK A;  1N33 F;  5AE3 A;  1T3N A;  2N4C A;  2V4J A;  4DL2 A;  3SXL A;  2BV3 A;  3KDN A;  4A48 A;  2N3O A;  3KHL A;  3A8I A;  3M32 A;  2DIS A;  2DCU B;  4X4N A;  1HQU A;  2JOQ A;  2IYI A;  4CP5 A;  4PR6 A;  1X7V A;  4USH A;  1LW2 A;  1U47 A;  3MD1 A;  4LF1 A;  2IAJ A;  3NNH A;  1SJR A;  4RWW A;  1FK9 B;  2FPH X;  2RNE A;  1RKJ A;  4KH1 B;  2G9O A;  4KB7 A;  2DTJ A;  2A2D A;  3UD5 A;  2KHD A;  3M2U A;  4DN0 A;  4RJV A;  1IBC B;  3QWP A;  5CH7 B;  1VQ8 S;  1QSY A;  2HVE A;  3NAI A;  1HNZ F;  3A13 A;  3KG1 A;  1B0P A;  2E66 A;  2N4D A;  5KFO A;  5SZT A;  2DB1 A;  2JH3 A;  1RHJ B;  4U7C A;  4ED7 A;  4NLG A;  2J0X A;  1KLM B;  3BBC A;  3H98 A;  5L38 A;  1RHM B;  4ED0 A;  2HND B;  3C15 A;  2ZWO A;  2HQ3 A;  2LYV A;  2ZH5 A;  1PG5 B;  1TKX A;  1LWE B;  3BYR A;  3NNA A;  1TVR B;  1YJV A;  2HFU A;  3K5O A;  3EX7 B;  5LT5 A;  2B9Y A;  2QSF A;  1ZBT A;  2ZHA A;  1R7I A;  2XNQ A;  2YNI A;  4WE1 B;  3SQG B;  4CRJ A;  4X2B A;  5CXT A;  2M0G B;  3GSD A;  4O44 B;  2MHN A;  3VWS A;  2LLZ A;  1I1G A;  3Q22 A;  2XS7 A;  3DOL A;  1HI8 A;  4LRE A;  2YNG B;  1UVL A;  5A2Q Y;  5KFD A;  1A7G E;  1HQ2 A;  2A6O A;  2K2P A;  2J0Q D;  1S1W B;  2WVF A;  1WC0 A;  2XWX A;  3A8J A;  4IG0 A;  1N8R T;  3QIP A;  3QLH B;  3CJ5 A;  4B9T A;  4LF6 J;  4UQG A;  7FDR A;  3FFI A;  1PBA A;  4OZ2 A;  2BJ1 A;  4QZV B;  2IIH A;  2GHW A;  3VV2 B;  3CGI A;  5GAD U;  3M9M B;  4RBT A;  2XBP A;  4ED8 A;  2GAH C;  4MAK A;  3U1L A;  4Y0F A;  2BAB A;  2ZOM A;  4F25 A;  4K2X A;  4NZ7 A;  1ITP A;  2BYC A;  1E6V A;  4MYT A;  4I2Q A;  5T7L B;  3W5Z A;  2FHO B;  4B3M F;  5DLF A;  3MPV A;  3S6E A;  2RU9 A;  3M32 B;  5J2M A;  2IMW P;  4O0I A;  1MRO A;  1B4S A;  3BSO A;  1UZH A;  2LA6 A;  4NRT A;  3RBZ A;  1WNE A;  3CJ0 A;  4LBP A;  2UUB F;  2XC9 A;  4BHQ A;  2K3I A;  3QGH A;  1XQI A;  4CLP A;  3EPI A;  2X1A A;  3BSA A;  1Y0H A;  3OVS A;  2ZBP A;  3QZ7 A;  2HHS A;  4P10 A;  4YP3 A;  2CPY A;  3N01 A;  4FNH A;  3KJQ B;  3I5A A;  1JLQ A;  1U02 A;  5EX0 A;  3D6M B;  4QIE A;  3MM8 A;  3EDQ B;  2Q6B A;  2E7X A;  2HQD A;  3VAJ A;  2MZQ A;  4NRU A;  3LGH A;  1WDT A;  4NX9 A;  5BR8 F;  1F9H A;  3BGR B;  2EPI A;  3HJF A;  3K7R A;  3LP2 B;  1VBZ A;  2F9D A;  5AJ3 J;  4OV1 A;  2VFV A;  1V3Z A;  4RW6 B;  3JAM U;  1PIE A;  3OJS A;  3JYT B;  1WKK A;  3IP0 A;  5KFL A;  3UN5 A;  5I3U B;  1WD6 A;  3N5F A;  2UUB J;  3NMR A;  4I1T A;  4MK7 A;  3M8Z A;  2P8I A;  4IFY A;  3EZU A;  1Q5Y A;  2BQ3 A;  1OQ3 A;  3O1L A;  1TK0 A;  2E1C A;  2R7U A;  1QAI A;  2LQ5 A;  4NLQ A;  5GAG U;  3PDN A;  5HK4 A;  3AOB A;  2J9D A;  2DJW A;  5HMX A;  1VJW A;  3GIR A;  4CH7 A;  2GFF A;  4OHW A;  1F3V A;  4TU8 A;  2DPJ A;  1RAD B;  3Q2T C;  2YWF A;  5K14 B;  4ZPW R;  1MMD A;  3QMQ A;  4USW A;  2XCA A;  3CCS S;  3LWL A;  4LFC J;  2CQI A;  4FXV A;  2X3G A;  4ZVO B;  2OEM A;  4OIX A;  4C8N A;  2BOA A;  2D3O R;  3JQK A;  4K4X A;  1N36 F;  1CJT A;  4WXW A;  3EDR B;  1NH7 A;  3GCX P;  3OBI A;  4IQM A;  4L72 B;  3W8G A;  2I9S A;  2FLP A;  3ENA A;  3RBX A;  2AQ4 A;  2RDD A;  1T11 A;  4KGX B;  3UVJ B;  1CPZ A;  1OSD A;  3V5R A;  1HD0 A;  4WU2 A;  2C3U A;  4UUW A;  4CTA A;  3QFH A;  5D0H A;  3PTW A;  4Q43 A;  4DDF A;  3BN4 A;  2VL1 A;  2DYA A;  3MPU B;  1ZYQ A;  2W2M P;  3DOM B;  1HD1 A;  3UN2 A;  1S0N A;  1U2F A;  4M5L A;  3ZTQ A;  2BDP A;  1Y5N B;  4C8L A;  4CO3 A;  3PRD A;  3DOK A;  4QIW D;  4KQZ A;  3CJK A;  4IG3 A;  4F3Q A;  2GJI A;  1AZS A;  2HK2 A;  3RB4 A;  3C6U A;  4N76 A;  4P52 A;  3R2C J;  1QTM A;  3NG8 A;  2H51 B;  2B4V A;  1NSP A;  3M30 A;  3OQ2 A;  3PXG a;  3SFG A;  1NK6 A;  2XEX A;  3EJM A;  2YXL A;  2OMO A;  3CMQ A;  4NLU A;  2DNR A;  3TJ9 A;  4JV5 J;  1TR0 A;  4TU7 A;  4A8M P;  3NL0 A;  3PV8 A;  2VKR A;  3RAQ A;  4Q5V A;  5CD4 A;  2NUH A;  4JBC A;  1J2V A;  1JLQ B;  2V69 A;  2BJ3 A;  5CAA A;  4DLG A;  1NND A;  2HHX A;  4YB6 A;  3QAU A;  4GO5 X;  3M1V A;  4IR1 A;  1WHW A;  3FBC A;  4IH6 A;  2WSE C;  1R0B G;  2JRS A;  3DRX A;  2HBZ B;  1RWU A;  2CVI A;  2V0N A;  3V4M A;  4QYZ K;  1ZH5 A;  4C2M A;  1UJ5 A;  2W1B A;  3CXC R;  2YBV A;  2WOM B;  3RW6 A;  1WKL A;  1VMB A;  1S6O A;  2AV5 A;  1L3V A;  2JLG A;  4XAK A;  1R27 B;  4BDP A;  1S59 A;  3W5Y A;  4Q0B A;  1F1B B;  4TQR A;  4OLO A;  3AA8 A;  3CCU S;  2MKJ A;  4KHP J;  1HBU B;  4P71 A;  3VVU A;  1XMO J;  5CZV A;  4HYK A;  1JLF B;  1VI7 A;  3EVM A;  3TW0 A;  1KOH A;  3SEO A;  1FWK A;  2QLF B;  4B9M A;  3C16 B;  4QCL A;  3DI6 B;  2FJE B;  3BH7 B;  3N6N A;  5F9N A;  3T1Y J;  4WFX A;  3CC4 S;  1Y4Z B;  2VPW B;  4ILL A;  2ZD1 B;  2CA9 A;  4QYR A;  4WFA Q;  1TK5 A;  3R9L A;  3W66 A;  3CE8 A;  1PKU A;  3OFE A;  1HNI A;  4ZVU B;  1X9M A;  3H4D A;  4JYA J;  1Q78 A;  1Y5I B;  2MTL A;  3QSI A;  3QIP B;  3QLH A;  3SBM A;  4ECY A;  2I1R A;  1NXI A;  4RKU C;  3MR6 A;  5HP1 A;  2IBK A;  3P49 B;  4ZS6 A;  2DGU A;  4DSF A;  1L3K A;  3D6H B;  4V19 J;  2MHE A;  3D67 A;  3R5J B;  1Y3J A;  4ZA1 A;  3MR3 A;  1JKH B;  3V6H A;  4C4W A;  4TYB A;  2C2K B;  6AT1 B;  5LSO A;  1XMO F;  2W9C A;  2W24 A;  1HBO A;  4FF3 A;  4YDD B;  3Q0A A;  4KFB B;  4ZPC A;  3SCL E;  5EHH A;  2BZ2 A;  3E8O A;  3MM5 A;  4IG3 B;  3QJP A;  1N5T A;  1PO6 A;  1VS3 A;  1U48 A;  2J0W A;  4KR0 B;  3NOC A;  2ACY A;  5KFI A;  3UDV A;  1N6Q A;  4PWD B;  3RBE A;  3QRQ A;  1YJU A;  5E0O A;  1IBM F;  4DR1 F;  2FVQ A;  3WX4 A;  1S0V A;  4RNN A;  1N5Q A;  1WOO A;  3DXS X;  2E5J A;  3VAI A;  2R7R A;  4DV2 F;  1NUE A;  4NEY A;  5CAB A;  5J1E A;  2XWY A;  3TZX A;  4A8F A;  4MIA A;  1OS5 A;  2GHV C;  3MCO A;  2XLK A;  2KI2 A;  4QW9 A;  2GJF A;  1JLC B;  1REV B;  4D3H A;  4X65 F;  1TL3 B;  3AT1 B;  2J76 E;  5KG3 A;  1J5O B;  1R43 A;  3C16 A;  3M6X A;  4HR2 A;  2FZC B;  5LXR A;  3IGV A;  4M95 A;  1QVG R;  2R3V A;  4RBU A;  1RWW B;  4RW8 B;  2YWE A;  3H2V E;  3KK3 B;  3NMA A;  5HMZ A;  3RUB L;  1NJZ A;  2B8Q A;  1CEZ A;  1JXE A;  1EP4 A;  1MN7 A;  3Q8P B;  2V2K A;  4J90 A;  1LXN A;  1TL7 B;  2AP6 A;  2EFO A;  2PE8 A;  2QZ8 A;  2VDH A;  3QO9 B;  2RUG A;  4H4K A;  4ZCL A;  2XHW A;  4XIU A;  2KT2 A;  4FDF A;  4AQY J;  2JFD A;  2M52 A;  3EVW A;  4AL6 A;  1HYS A;  3T5K A;  2IDL A;  4H4M A;  2UUT A;  5M2R A;  3WZ0 A;  1RT4 B;  1SQF A;  4DV0 J;  3TUJ C;  4W98 A;  4ES2 A;  1T95 A;  2O67 A;  1QM9 A;  2CZ4 A;  1JK9 B;  3OXL A;  1FWL A;  3IWX A;  3JTP A;  4RBV A;  1HBN A;  2F1F A;  3LA0 A;  4OYI A;  3CIM A;  3ET6 A;  4JI2 J;  4CLL A;  2K1R A;  1WEY A;  2IYG A;  4ZVH A;  3K58 A;  4ZVT B;  3AAW B;  4WZM A;  2Z0G A;  3DRR B;  4ED4 A;  1AA1 B;  1RAI B;  4WK3 A;  5HJX A;  5T14 A;  5CZX A;  3ISZ A;  4P73 A;  4URS A;  4YB5 A;  3SI8 A;  1H7X A;  3HHE A;  2QTW A;  2ATC B;  2D9P A;  3IO1 A;  3ONQ A;  2BQR A;  1S49 A;  2CDQ A;  2RHS B;  3D0I E;  1N5Y B;  4YN3 B;  3D6F B;  1YIT S;  1NBE B;  3PFO A;  5I42 B;  4LF9 J;  4LFA J;  1GMV A;  3HSJ A;  4XTT A;  4C0O C;  4DSE A;  4NXN J;  2OPS A;  4GMK A;  3RR8 A;  1K0T A;  4DV1 J;  4CLT A;  2AJ2 A;  3CJT A;  5AXM A;  2Y0B B;  3KK3 A;  5H9E J;  4H4K C;  3Q24 A;  4EEY A;  3MCM A;  3C8Y A;  5B0F A;  1TTH B;  3M8S A;  5GAH U;  2R7Q A;  1B7F A;  3ZZT A;  3NS6 A;  4I64 A;  1S99 A;  4NZ0 A;  5DET A;  3B4D A;  1VOM A;  4IOB A;  1YGY A;  4ZPA A;  3TO8 A;  2B6A B;  1CG2 A;  3KDO A;  1P1T A;  3EYZ A;  2BW7 A;  5DRK A;  3IC1 A;  4A46 A;  5RUB A;  1SIZ A;  1SC6 A;  4OYP A;  2ROP A;  4J9N A;  4IR9 A;  5ETQ A;  4ANE A;  1Q95 G;  2XS5 A;  2CYY A;  2W2Q P;  2FYX A;  3V4I A;  1DBD A;  2YX4 A;  1VQK S;  2ZM6 F;  3SCK E;  1R0C B;  2ZUA A;  4Y2K A;  1K73 T;  4CQ1 A;  2P6S A;  5GAE I;  3EZ5 A;  1HW9 A;  1NCL A;  2QA2 A;  3V81 A;  1N5S A;  4W4M A;  1UTA A;  2FY8 A;  2Q79 A;  5E3P A;  2JJ4 D;  3UNY A;  4AXJ A;  4ENO A;  2IFX A;  1PCA A;  1WSR A;  4C97 A;  5IQ6 A;  4FF1 A;  1J5E J;  1UKU A;  1WF0 A;  4A4J A;  3ZTR A;  5GAG I;  3A8E A;  4C11 A;  1NJX A;  1HR0 F;  3PEH A;  3HVT B;  4UTG A;  4A8K A;  4IOA Q;  1T9T A;  1ZM4 A;  3HT0 A;  1ZAV A;  5A0Y B;  3ET6 B;  2HQI A;  5FJ4 A;  1RZM A;  2IDE A;  2AKW B;  2HFO A;  1RT5 B;  2G2Z A;  2CXE A;  4HT5 A;  2E29 A;  4K5R A;  4PPD A;  3DLK B;  4RPF A;  3TAM A;  2VJU A;  3ZTO A;  2UUC J;  1FKP A;  2NQP A;  4YME A;  5D3G A;  3ILJ A;  2W8K A;  2UUW A;  2W25 A;  4K7Q A;  4JI4 J;  2HLT A;  5CA5 A;  4OI4 A;  3TNV A;  1IQT A;  4YR3 A;  3EE3 A;  1S9F A;  2UUA F;  2NCK L;  3DM2 A;  2GIR A;  2KT3 A;  4LIW A;  2XCP A;  1KSP A;  2Y3Y A;  3PRV A;  2YWG A;  3GLJ A;  1P8G A;  2YH1 A;  3AB2 B;  4G1Q A;  3PHT A;  3CJ2 A;  5F8H A;  5ETO A;  3FZ2 A;  2D3O 1;  4UOH A;  4KV8 A;  3WIV A;  2ASJ A;  1JQG A;  2YKM A;  5EGY A;  4DL6 A;  1AT1 B;  3EWG A;  2ZJP Q;  4N7T A;  1LK7 A;  1H74 A;  1R8H A;  1OYD A;  1S1T B;  1D9A A;  2CUY A;  7AT1 B;  3GIL A;  1FRL A;  1RUS A;  1CQM A;  3OTC A;  1SUQ B;  2VPY B;  4MK9 A;  5DJB A;  2VG6 A;  4LR8 A;  4O3O A;  5EDW A;  5ETS A;  4RL1 A;  3MCN A;  4DUZ J;  2VBZ A;  4ZOS A;  4W92 B;  2HRT A;  2R42 A;  4NYO A;  1G4C A;  2UUA J;  3GG1 A;  5FD1 A;  3K59 A;  1P6T A;  2VDI A;  1WC6 A;  3BZQ A;  3K89 A;  4P75 A;  3KHH A;  3K5L A;  1LV5 A;  2VBX A;  3DYA B;  3LAN A;  3GYG A;  3MTJ A;  2W9B B;  1FJE B;  2VOO A;  1NAQ A;  2H48 B;  3GPA A;  3MPY A;  2CJA A;  1CVJ A;  2RDI A;  4EWT A;  3HKZ D;  1YQH A;  3FNN A;  3PYE A;  5K9F A;  4URG A;  2EVZ A;  2MSS A;  2AJF E;  4YEA A;  2YKN A;  2RQ4 A;  4NA1 A;  1C4C A;  2DY9 A;  2QO3 A;  2HFN A;  1A0O B;  1GH8 A;  1RWO B;  1WTF A;  1HAR A;  3FRZ A;  5ITH A;  1QLN A;  5C24 A;  3THV A;  3CD6 S;  5F0U A;  3KKF A;  4J9L A;  1SKS A;  2V8V A;  3BBB A;  3PIO Q;  2C3P A;  1UW4 A;  3IBF B;  1DFD A;  1IWG A;  3HZG A;  1U26 A;  2Y1R I;  3D66 A;  3CDE A;  4OYZ A;  3QID A;  5A76 A;  3I0S A;  3T3F A;  5T41 A;  2VU5 A;  4NI2 A;  3RW7 A;  3VF0 B;  4DCP B;  4ZHR B;  2BRL A;  4WP3 A;  4ZP9 A;  2OHD A;  4Q45 A;  4O23 A;  3MFI A;  3AB4 B;  3G82 B;  5FLX Y;  4DV6 J;  3CSK A;  4M5H A; 
#chains in the Genus database with same CATH homology
 1CJT B;  5IV3 A;  3C16 B;  1AZS B;  2BW7 A;  4OYP A;  1YK9 A;  3MAA B;  4CLP A;  1CJU B;  4OZ3 A;  4CLW A;  2QV6 A;  4OYX A;  2GVZ B;  1WC5 A;  4USV A;  1U0H B;  1Y10 A;  3C15 B;  3G82 A;  3R5G A;  3ET6 B;  1CS4 A;  3MR7 A;  2WZ1 A;  4NI2 B;  1CJV A;  5IV4 A;  1CJK A;  1WC1 A;  4CLF A;  5D15 A;  4P2X A;  5D0G A;  1CUL A;  3C16 A;  4USW A;  4CLY A;  1CUL B;  1FX4 A;  4P2F A;  4CLK A;  1CJT A;  1Y11 A;  3C14 B;  1TL7 B;  3UVJ B;  1YBU A;  2GVD A;  2GVZ A;  4OYO A;  5D0H A;  4OYW A;  1WC6 A;  3UVJ A;  1TL7 A;  4OYA A;  5D0R A;  3C14 A;  4CM0 A;  1WC4 A;  4UST A;  4CM2 A;  3C15 A;  1YBT A;  1AZS A;  4OYI A;  4OYM A;  3ET6 A;  4CLL A;  4CLS A;  4CLU A;  1AB8 A;  1U0H A;  4USU A;  5D0E A;  4P2M A;  1CJK B;  1CJV B;  1CJU A;  2GVD B;  3MAA A;  4OYZ A;  1FX2 A;  1WC0 A;  4WPA A;  4NI2 A;  1WC3 A;  4OZ2 A;  4WP3 A;  4CLZ A;  2W01 A;  4WP8 A;  4CLT A;  4OYB A;  4WP9 A;  3G82 B;  1CS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...