1N36F

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n36F00
1N34F 1QJHA 1XMOF 4OX9F 2B7CB 4GKKF 4JI5F 4DR7F 1CQMA 1CQNA 1IBLF 4DUYF 1HNZF 2E5LF 4JI8F 2UUAF 2KJVA 2BXJA 4DR4F 4B3MF 4NXNF 1G7CB 1N36F 2UU9F 3OTOF 1G1XA 4DV5F 4B3TF 2J5AA 4YY3F 4KHPF 4X65F 4LF5F 3T1HF 4DV6F 4B3RF 3ZZPA 4DR1F 1IBMF 1HR0F 4DR2F 4X66F 3T1YF 2VQFF 5BR8F 1IJFB 4DV4F 1RISA 3R3TA 4K0KF 1GH8A 2HHHF 4DR3F 5AJ3F 1FJGF 4DR5F 1XNRF 4X64F 4JV5F 1XNQF 4DR6F 2KJWA 2YY3A 1IBKF 1J5EF 4LFAF 2ZM6F 1XMQF 4NXMF 1N32F 4LF9F 1HNXF 1N33F 4B3SF 1F60B 4JI7F 5LMUF 2UUBF 4LF8F 4JI1F 2UUCF 2VQEF 2BVZA 4X62F 4JI4F 4DV2F 4LFBF 4JI3F 4DV7F 4AQYF 5IWAF 4JYAF 1IJEB 4GKJF 4LF7F 4DV3F 5LMNF 4JI6F 4DV0F 4LF4F 4DUZF 1HNWF 1LOUA 2F4VF 4LF6F 2RJZA 1VMBA 1FKAF 4JI2F 2B7BB 1B64A 2UXDF 2UXBF 1I94F 4DV1F 4YHHF 4LFCF 4JI0F 2UXCF
chains in the Genus database with same CATH superfamily
1FHTA 5A2QU 3P4UB 4M95A 2W2NP 3R97A 2CZVC 1Y3KA 4WK3A 2M5YA 4C8ZA 3R5CA 2XSJA 1N5YA 4RX6A 3MM9A 2MZQA 3V6DA 2BE7D 5CYMA 2ZBCA 2KM8C 3IR5B 3L4BC 5BR8F 3KUGA 2HIYA 5C24A 3DKDA 3PO4A 4Q0BB 1TKTB 3CEDA 1F3FA 4OLPA 1X5TA 4U67Q 2LCWA 4CO4A 1FEEA 1RLDA 1HI8A 4PYDA 2AJ2A 2BA9A 4ZS6A 5LMUF 1W2IA 3G6ES 3QIDA 4K4WA 2WSFC 4DS4A 4X4PA 1SC6A 2PD1A 4PG6A 3SSRA 2DH7A 4WXOA 5LM7E 2DR7A 4Y2CA 5GADI 3TUZC 1TTHB 2MKSA 3CJQA 5L1LA 2MKKA 3KK1A 1Y7PA 5DQIA 2IBKA 5KT2A 1BQMA 3IC1A 4NYZA 2DGXA 2JZ5A 5A8RB 4QWDA 4TKTA 2CQ1A 1DZ5A 3AD9C 4JV0A 4JI4J 4C11B 2YVSA 3P96A 1GTHA 2GCFA 3ONQA 5K20B 3M8WA 1G6BA 4AQYJ 2G1HA 1F5BA 4NOHA 3HDSA 4RW9B 1RXOB 4DQSA 1T7PA 4DPWA 4L75A 4K4UA 3MEGA 1UWAA 1FFGB 5IV4A 2CJBA 4LFBJ 1X31C 2LLZA 4NLUA 4B17A 4EK2A 1VLOA 3MM5B 4G1PA 2KVIA 1DTTB 1BXNA 5IZHA 1JKHA 3HD2A 1RYRA 4IRCA 1WEXA 4DG1A 3H4DA 3D67A 3FDSA 1HLWA 2GHPA 4DV3F 4J9VA 3TR5A 4MIBA 1U47A 3ETOA 2QMWA 2B9XA 2PFFB 1H7WA 2UXBF 1X0FA 4PQUA 3RBZA 5FDLB 3O1LA 3J7YU 4DSLA 3TUJC 1FK9A 2PI4A 3KNAA 1XNRJ 3MURP 2VBYA 1QE1B 3Q24A 1FRJA 4NLQA 2RNEA 3K5LA 4ED0A 1M5PC 3M8YA 2WVCA 1C2PA 3QBCA 2W2QP 1RAAB 3MCMA 3JAMU 2XLKA 1RK8A 3CMES 2MY8A 2EFNA 2W2MP 1WD6A 2HRUA 1H7XA 1B0TA 2GJFA 4RW6B 3TAMB 1FESA 1M1GA 2DR6A 4HEA9 3IRWP 2FLNA 3GR0A 4WP8A 4LF8F 3PYFA 2G2OA 1J2VA 2HKEA 4WIIA 3MGJA 3K8VA 5ETRA 3BREA 5I42B 4EI2A 4DV0F 2DT9A 3DRYA 1HNWF 5ETQA 2DNGA 4MIAA 3GWCA 2GMLA 1SH2A 2FHJD 2AF6A 2BR0A 1Y0HA 2DO4A 4C3MA 3AXMA 4HHJA 4KQZA 1KS2A 3EGZA 2ACMA 2VZ9A 1CSJA 1T9XA 3U02A 3DYAB 4XPCA 4W92B 3LTOA 2MXYA 4JI1J 1F5CA 2J6SA 4L6V3 2G0CA 1Q5YA 2IRXA 2OPQB 3AB2B 3DOMA 4A4JA 1XK8A 2F5GA 4OYXA 4FYXB 5FJ4A 2KYXA 4MH8A 3K57A 4USKA 2KU7A 1A0OB 1D3WA 1N34J 4OZJA 1UW4A 2EBEA 3TO8A 2IAJB 4BLGA 1FNXH 4F0KA 4EZ6A 3R7BB 4C7QA 3G9CA 1EETB 2VPYB 1PSDA 4M63A 4YY3J 4KY3A 2V8HA 4XPEA 2CKWA 2VICA 1S1WB 3FEYB 3HMJG 4ZITA 1RBOB 5DGAA 9ATCB 1AFJA 1XC9A 1REGX 1Q79A 2BJDA 3H42A 3PFOA 4OYOA 4F36A 4DSKA 1GK8A 4K7QA 4YB1P 4LFCF 1N32J 2CJAA 2IDEA 1FNMA 2KXHA 5C42A 1H6KX 3FUYA 4J9LA 4KB7A 3VAKA 9RUBA 1FJ7A 3ZTRA 3P49B 1J5EJ 1N0UA 5IM0A 1WC1A 1NB7A 4IFVA 3BKFA 3M2RB 1HHTP 3I5AA 4GVBA 1LWFA 1RAHB 3ZTQA 5HP1A 3K58A 4KGVB 4EBDA 2IDLA 2YWWA 1HBNA 3UVJB 4LF9F 2HHWA 3ILLA 2JHEA 3ETMA 1A7GE 4J9NA 1HWIA 2RRAA 1VRUB 2R3VA 3OXLA 1KRPA 6FDRA 4OHYA 5A8KA 1RT2B 4DV7F 1LWCB 4A8QA 1JJ4A 4BHQA 5IQQA 4WPAA 2A6OA 4I56A 3I4PA 2XMAA 3AA9A 2Y1JA 1U8SA 5KTQA 2CQ4A 1LXJA 2AJ0A 2VONA 3US5A 3BH7B 3OLBA 3MOJB 2ZE2A 1TFYA 1R8PA 2XWXA 2H65B 4JOUA 2VBWA 1Q82T 2HFVA 2HHHJ 2BW7A 1H98A 3OV7A 5D4OA 1NJYA 1IBKJ 1WKLA 3A8EA 3SI8A 2E7WA 1NSPA 1WC6A 2QT7A 1UPMB 3RJMB 3CW2C 4K0KF 1HW9A 1S1VB 4DS5A 5D6GA 2VIHA 3T9NA 4GC7A 1R7IA 2R9LA 1RU1A 3DN9A 3MMAA 1WSRA 3K5OA 2ZH7A 3BO4A 2RDDA 1UJ6A 3QPIA 1Q8LA 4HTJA 1DJ0A 1W2BR 1OQ6A 3HHDA 2QFIA 1N6QA 2BV3A 1I5OB 2V4QA 4U9RA 2E66A 3TEGA 3V81A 1JXLA 1BQNA 4X4UA 4WTYA 4Y2AA 1VMBA 3LANA 1S5ZA 3VR1A 5D4LA 1P9QC 2LA6A 3DRPB 1XMOF 2C22A 4IO9Q 1RWUA 1IBMJ 4P2FA 3PO5A 2ZKUA 2JFDA 5A0YB 1W25A 3ZZOA 3IMQJ 2GV1A 2HNZB 2MLZA 1RAJA 1NK6A 2KXNB 2HW3A 3CIMA 4OHZA 1Z2ZA 1WI6A 2P8IA 1JQGA 5CA5A 2QJ3A 2VFTA 2DPJA 4ELVA 4KPCA 1CLFA 2PC6A 1XNQF 1PG5B 3GJSB 4U7CA 1JLCB 2IYGA 3W60A 3VAIA 2NXNA 4DFPA 1KOOA 2RIJA 3KKFA 3RG6A 2BRLA 4M5LA 3K7RA 2G2ZA 4FNIA 3QLHB 1U1KA 3ELHA 4X2BA 1FO1A 2DNOA 1R8CA 3BZQA 4U8VA 3LGNA 3LGMA 3GE9A 5T41A 5D0EA 3M05A 1TQLA 3HT3A 2HS4A 4WF9Q 4ECWA 1TKTA 2R8GA 2DHGA 3GV8B 2MZRA 2AZ3A 2HK3A 3QRQA 3RB4A 1VBKA 4LF1A 2JLFA 1S1UB 4ZPBA 5KT6A 3LW5C 4C8OA 1EIYB 3NGTA 1NJIT 1YDLA 2KM8B 1NM2A 1AZSA 2X1AA 3AOAA 2X1FA 1HNXJ 1NK0A 1JLEA 5JJBA 2PA3A 5K8MA 1K1QA 3QGPA 1TELA 2GA7A 5IT9U 1MWZA 4A8WA 1JXEA 2MHNA 2A3JA 2RQKA 1RT1B 1ZPWX 3IWXA 3GCWP 5A8RA 1VC6A 1SQGA 4KH0B 2GIQA 1RAGB 1LFPA 1T3OA 3KLHB 2KXFA 2VBXA 2ALZA 4FF4A 1Y00A 4C11A 2OEMA 2RU3A 3D66A 3HHLB 4DN9A 3M30B 2KRRA 2K2PA 1EX8A 2C42A 2CNLB 4HH0A 4TQSA 3FFIB 4G3IA 4WBFA 1YI2S 2QFJA 2D9OA 2J9EA 2JFKA 4CLFA 4F8RA 2FB0A 1D09B 3WC2A 1IQTA 3OTOJ 2OPSA 4PABA 1N5QA 5GAHU 2DIUA 4J5OA 4Q2LA 4C0OC 1FKPA 3KLEA 3NEKA 3DLJA 2ASJA 4I2PB 4R25A 4ZP9A 2RAQA 4J9KA 1UJ4A 2KH9A 3H5XA 1FXDA 4KC5A 3FEZA 2CQPA 2G9OA 1RWWB 1JLBA 2EG2A 3BO2A 1NDLA 4KPYA 1FI4A 2LXFA 2XLJA 1QM9A 1V3ZA 3AB4B 3J7Z5 1KQKA 1H72C 1K44A 4RNHA 5ETOA 3RBXA 3Q8RB 1V9OA 2OD4A 1X4AA 1KVKA 2FD2A 3HX9A 4LRDA 1HQEB 4RUHA 4J9PA 3LPEA 2HGLA 1F60B 1S1XA 2V63A 4OV1A 1DTQA 3E3XA 1NSQA 2Y1RI 4ZPTR 1D8ZA 3LP0B 3OXFA 3Q8YA 3K2YA 3CXCR 3WDOA 1PILA 3R6LB 3EGWB 3S1TA 1BWEA 4DUZF 2MZ1A 2YX4A 3IGVA 4CO3A 5HLFA 4QWBA 3M6XA 5LJ3Y 4I64A 3SDEB 2D9PA 3BGRB 2LU1A 1Q4RA 3L95X 3OSNA 3PRBA 2ZJRQ 4MYTA 2KYZA 4XK8C 1N52B 3DMJA 1RT4B 3W8PA 5BR8J 2HPUA 1PAUB 4EO8A 1IXKA 4DWIA 5GAEI 4DPOA 1BC6A 3R7SB 4V19X 2HHXA 4TYBA 4PYAA 4JV2A 1NK8A 2CNOB 1DQ9A 5LMUJ 1O0PA 2VG5B 1Q1KA 2VQFF 5IS2A 3TA1A 3UDEA 2V4JA 1OY6A 3DYAA 3SCJE 4O0IA 2WBMA 3ISND 3VAFA 2OSRA 4C0BA 2XMMA 2D3O1 2BOPA 4J37A 2IVYA 1SKRA 1L3KA 2NYHA 3QJLA 2HAIA 3TI0A 2AJ4A 4LSNA 1U49A 3KLFB 3T5JA 2HLUA 1LOUA 4TU8A 2BBEA 2XCAA 2XMKA 1IWGA 5E3QA 2B0GA 1ZBTA 4ENOA 1XMQJ 5ETLA 4ZP6A 2GNKA 3JS9A 2BM1A 1SQEA 3GONA 3MAAA 2IMWP 3DLHA 5J1NA 2RS2A 3IAM9 2UP1A 2OIHA 1NLKL 2M88A 3NG8A 3BSCA 5E3RA 2V67A 4CLLA 3TVYA 3AQOA 4P7VA 3MR5A 1NNDA 2D74B 2DNLA 3MWBA 3HVTB 2W9BA 3K17A 2ZH4A 4QQBA 1XTZA 1RSCA 4DV3J 4I67A 1TL1A 4W4MA 4UZCA 2C2RA 3OW2R 1EHWA 2Z8QA 3KLGB 1LW2A 2C3UA 3HZEA 2UXBJ 2VQEF 3UDCA 1OYEA 1WOPA 1RHRB 3S01A 4K4TA 2XGQA 2VKRA 7FD1A 3H7HB 5AXLA 4DCJB 4JI2F 4PZVA 2MQOA 4M5NA 7AT1B 1NKCA 3A1YG 4IR9A 1RWNB 1CEZA 4JI8F 2XCPA 1V3SA 1OIAA 5ETPA 2UVUA 2GS8A 1RT2A 3AH6A 1FCAA 4ID8A 2YKMA 1YBAA 2AGPA 4CH0S 2JL9A 1OS5A 2R7OA 3UQSA 3J80U 3K8WA 4DU8A 1RLCL 2FJXA 2HAFA 1CJUA 4LF8J 2U2FA 4X66F 1BWVA 1FRXA 3P6YC 3KK2B 1S6PB 1ZZFA 1U24A 2YWHA 1MWQA 3OR2A 4F2SA 3G8SA 4HDHA 2NZ4A 4DV0J 4FKYA 2XI2A 1R0CB 1HNWJ 4AD6A 1S79A 3PHEA 4KGMA 1Y5LB 3CB4A 3M9NB 2D69A 1VQ5S 1YVFA 3GB0A 3SCKE 3CCLS 3O44A 4Z37A 2RDJA 3MM6B 2HVIA 3BGUA 4DL6A 2EKYA 2R2TA 2RJZA 1B64A 1BGXT 4K4VA 5HATA 4QIWD 2HGMA 5DG8A 5DDPC 1C0TA 4NLGA 2RKIB 4CWBA 3OLAA 3JSMB 1SIZA 1G7CB 1R0BG 3H5SA 3ENAA 4L74A 1IKXB 2BJEA 4UY85 4N76A 4BS2A 4PWDB 4B3RF 1S1TB 4IRDA 3PJXA 4NYPA 3TZZA 4ETZA 1PYOB 5AJ3F 1VRTA 2DBBA 2W2PP 1TKDA 2ZC3A 4IUFA 3DLEB 2B6AA 2F40A 3OTDA 3IBFB 2EVZA 3HULA 1NK5A 1QSLA 4P74A 4B3TJ 3AAWB 1NPRA 3D6HB 3BDEA 3HHLD 1C1BA 2XNQA 2K3KA 2ASLA 1ELOA 3FSYA 3HLUA 1HNIA 1Q7LB 1PC5A 1BD6A 1M1HA 3P5BP 4O3PA 3MPYA 2ILZA 2VA3A 2XY5A 5ADZA 2W9AA 4JUZA 2CQ3A 1KC8T 4I6AA 2D7SA 3VQSA 4CM2A 4QWEA 1ROFA 5IV3A 4MFBA 3OL6A 3FQKA 3QGIA 2RE1A 4NCGB 2XG8A 1HQUA 4GVLA 3TZWA 2DR8A 1RWOB 3C16A 1SPBP 1HMVA 2PMHA 3V4IB 2OO4A 4LF9J 1APSA 3A8KA 3MMBB 4F4YA 3OPKA 2NYIA 5EX3A 1SL1A 3WIUA 5T14A 2I5JB 3OL9A 2XS5A 3IS9B 2IJNA 3NCRA 4TN2A 1RE1B 4FZVA 5FIIA 4X4TA 3T9ZA 3PX0A 1X4CA 3AQPA 3VHQA 4WCEQ 2HQCA 2JX2A 3PEJA 4ECVA 4ZCLA 4X84A 2A18A 3EVMA 5KOWA 2DR9A 1JWWA 1IWAA 1UJ5A 4LF7F 2AEMA 3JQJA 3CNQP 5IT9Y 4F67A 1FWPA 2OFHX 3UWTA 2KT2A 2YNGB 2MSTA 2RQCA 3J7YI 3M30A 4RPFA 5HQ8A 3POTA 3C6TB 4DL7A 4NLSA 5A8WA 2CQGA 4B02A 4O0NA 5KG4A 3QATA 3V6KA 5KT3A 1DFDA 3DHXA 3N0VA 5HO4A 3FNNA 4OHVA 4USUA 3BSNA 2EFVA 2Y9HA 3PRDA 2BJ8A 1FFWB 1KD1T 4QW9A 3PJWA 1TK0A 2HMIA 3NBPB 1TK8A 3C3LA 5BYQA 4P73A 5L1IA 3VTIA 2YNIA 4NYOA 2MGZB 4PXEA 4B9VA 2K7JA 2XZTB 1B7YB 3GQCA 1I3OB 4UOFA 2QLFB 1FJEB 4Y34A 3GYNA 2LXIA 4ED2A 2O66A 4OZNA 3BEGB 3W9JA 4DR6J 2HG4A 2I38A 4IDKA 1HQEA 5J2MB 4QR2A 3H0PA 4FVCA 1MLAA 3GSDA 1CQNA 2ZITA 2XB2D 4EEYA 3LP0A 1XNQJ 1RTHB 3KG0A 3UN2A 1KONA 2L48A 2RD5C 4PPDA 5D78A 3N01A 3MR7A 4ELUA 5DETA 3B82A 4LSLA 4QZVB 4DFJA 1FT8A 3QRPA 1HR0F 1FX4A 2Y8YA 2MEWA 3BGRA 2PT0A 1RB0A 2HBZB 4AYBD 2OTLS 5EN1A 3R1HA 3R8YA 1VQMS 1U2FA 1RT3B 1RU2A 2CWKA 2HVEA 1NU4A 3DOLA 4M5GA 4KR0B 5F8JA 2L3MA 2IM0A 3QZ8A 2AJQA 4NRUA 1KN6A 1LK5A 3MMJA 3CJSA 5KFXA 4DX7A 4DJBA 2YPZA 1MU2B 2KT3A 2BX6A 4KHRA 2OH2A 4DXLA 1UZHA 4ZJOA 2ACYA 2W24A 2Z30B 4GKKF 1CVJA 1FA0A 2B5JB 1CQMA 3C14A 1CJKB 4JI7J 5KFVA 2FVSA 4M5KA 3RUBL 3GSIA 2XHCA 5HBMA 4NMLA 4O3RA 1RT7B 2I9SA 2BQ3A 3BS9A 4KHPF 1CULB 4FYVB 2N3LA 1RAOA 4DN0A 1KTQA 4DR1F 3LAKA 2A6MA 5KG5A 4OI2A 5LSLA 4DF4A 3Q23A 4TVAB 2DNRA 3F56A 1FDBA 2LFVA 1WHWA 3CCQS 3MCNA 1C1CB 5DRKA 4WJBA 3QT6A 3TAQA 1FNOA 7FDRA 4A47A 2IRUA 1TL5A 3KJQB 3M1VB 4LR9A 2JNJA 4JP8A 4LBPA 4F4ZA 4S0MA 3GMGA 1RAFB 3JTOA 1XIQA 1S4EA 3HVTA 2YKNA 5CH7B 4QYRA 3Q89A 1YJTA 2AYGA 2DEIA 1EAYC 3UD3P 5JVGQ 4C4WA 1LV5A 2XMVA 8RUCA 1DLOA 3NCPA 3KLGA 3G82A 4N41A 3IWLA 2XMJA 1WI8A 3M2VA 1Q95G 4USWA 3BKTA 4C3LA 3UD4P 4F2RA 4XAKA 3HFZB 2AW0A 5I3QA 3A13A 4I2QB 1SI9A 3DLKB 3U1MA 1R31A 3MR3A 3Q83A 1U1PA 1YKWA 4ED3A 1UETA 5F8GA 2FY1A 5EUHA 2JLGA 4OJ1A 2ZHBA 3LALA 3M4XA 3CJ3A 4QIGA 5E2QA 3DLGB 2OSQA 4YEAA 2YWKA 2C2EA 1CJTB 3W61A 3AOCA 1CS4B 2MQNA 1VHFA 4DBQA 4CI0B 1LFWA 1WHXA 2R8KA 3GZ7A 2VG7B 3KK2A 1WEZA 3DDNA 4MK7A 2J7KA 2R7WA 4ZN1A 2ZOFA 3SIPB 3KUHA 1LWEA 1YRTA 5K14B 4NZ7A 2WTFA 2M9KA 4DQPA 4KGZB 3R7NB 4TXSA 1T05B 2VQFJ 4LIWA 3C15A 1ZZNA 2RH3A 2FC8A 4DV5F 3D6MB 4MKBA 5L9XA 1CG2A 2PN6A 4NLDA 1SCJB 4ZIWA 1ZAWA 3QYYA 4LR7A 3EJMA 4USJC 2HURA 4ECXA 4DQQA 4DL4A 3ICLA 1GMUA 5L39A 1FWKA 2VJUA 1YJWS 2K1RA 1K73T 1QSSA 3F73A 5C2GA 3U1LA 1JK9B 2KN4A 2ZVSA 4BDPA 2AYMA 4C8YA 4PWDA 1S1TA 2DEJA 2DH9A 4TY8B 1E6YA 1U0HA 2A1BA 2QYCA 2WB4A 3MXHP 1EQMA 3T6JA 3TQEA 1F9FA 2B7BB 2WCXA 3DLEA 1NK4A 2R7TA 5J2PB 3BF4A 2F4FA 1WACA 4QU7A 4OX9F 1KP6A 1T9TA 2DR5A 4NLVA 4YS2A 1UPPA 4O3QA 4UQTA 1SUQB 1ZM4A 2RQMA 3CWJA 4ZLPA 1SKUB 4ER8A 1XBWA 5J2QA 4X65F 2XYPB 3CCMS 1H73A 3HP6A 3NS7B 3OUYB 5L1JA 3ENQA 4KGKA 4DR2F 3I4HX 2CNNB 2VQEJ 2MY7A 2YBVA 3PDNA 5IXUA 2Z2LA 3DRSA 1DY3A 3BM7A 1SL2A 4OMFG 1N5SA 4M5IA 2XBPA 4IKAA 3NRBA 2RF2B 3CCTA 3RW7A 4C97A 2W01A 2GQQA 1M1KT 3O3LA 2WZ1A 2EFPA 4NXNJ 4JI2J 3TOQA 1WJ9A 2NPIA 2UUBF 3EE3A 5KT5A 4PUOA 3QT8A 4OI0A 2FJBB 3GYGA 1IJEB 3J81j 2CRLA 2GO8A 2XM3A 4ZVHA 4J9SA 1UEVA 2ZWOA 4IQXA 4QYZK 1RHKB 4X4QA 3HSGA 4X64J 2NZCA 1R0AB 4B9MA 2MQ8A 5GAHI 1DARA 3DU5A 4Q5VA 2B7CB 3CD0A 1U6BA 2CPEA 2B8PA 4U7UD 1PJ5A 4X66J 4F4XA 2HNYA 3RW6A 3DFEA 1NB2A 3NLCA 4N56A 2GX8A 3U1NA 3MD3A 4OZ3A 4F0HA 2Q6BA 3IRXB 1TVRA 2E44A 4OIXA 1IQZA 4O4RA 5AE3A 3M8RA 2ZBPA 2LQBA 4HDGA 2CA9A 1GH8A 1P6TA 4UW2A 1YSJA 1D8YA 2FLPA 5LL6d 1FE0A 4ZVEA 2ZDPA 4LFAF 4QCLA 4M5JA 2RHSB 2CADA 2YKPA 4YFUA 4AFFA 2BJ1A 5HMXA 4DV2F 1DAXA 2VUGA 2KO1A 3DI6A 3N5BA 4OYAA 3BYRA 4GMKA 2CDRB 1YRXA 3JTPA 1RACB 3CD6S 3QJPA 3NBPA 3PX4A 4N8NA 2CQ0A 2XS7A 4DSEA 3V5RA 1R8HA 1RT6B 3DC2A 3A3OB 3PEHA 1RKJA 3SBMA 1X9WA 4B3RJ 1CJVA 4A8FA 5MAOA 3M6VA 4U96A 2M3DA 3M8QA 2XGPA 5KFCA 3MECB 2V2ZA 5AJ3J 2HS3A 1RTDB 3IG1B 2V4RA 5IT0A 3PZPA 3CMAS 4MIWA 3C6UA 1VQ8S 1NDCA 3NNCA 4PG5A 2V2QA 4QPTA 4J7CA 4Y0FA 3M32A 2HNDA 4HTIA 4EWTA 5J2MA 2DYAA 2I2YA 1VQSA 2VKZG 4EYHB 2WK4A 3M9OB 2OMOA 3WHIA 2KHDA 2HRTA 2BKNA 2EFQA 4LVNP 2ROEA 4JBCA 2KDOA 1K1SA 1YWXA 2R7QA 3GJQB 4WFYA 2E5JA 2A2CA 3FSXA 1GMWA 1R6VA 3D1HA 5I3PA 5KFWA 2L9NA 1NO8A 4DDFA 2FZCB 1J5OB 1B3TA 3OT9A 2FQQB 1IKYA 2QA2A 3KG1A 3VQTA 4UUWA 4H4OB 4UOGA 2FY8A 2HHSA 2F9JA 1IN0A 1WKJA 4HL9A 4L3NA 3OTEA 1M5OC 2E9TA 3HSJA 4IH6A 4ZLJA 4RNOA 4B3OA 1RISA 3CCZA 5LJ5Y 2GVDA 4M5DA 2B5JA 3I5CA 4LQ3A 4ZLNA 2OMLA 3G2XA 3ET6A 4IFYA 4LF7J 4NLXA 3OFGA 4Y28C 4ZVOB 3FMBA 1N36J 1CULA 2V8PA 1HWKA 2BKPA 3HO1A 3ISZA 2YTCA 2ZBQA 5J1EA 5L38A 1P9YA 3OR1B 4CLKA 2PEBA 3H2UB 1FDAA 3IO1A 1YJ7A 2VFUA 1GQEA 1HWUA 1HPZA 3OJSA 3DM2B 1Q53A 2W8KA 5L9NA 3FC9A 1S0NA 2LEPA 2VU5A 3M2UA 1RA6A 3FVYA 5L1KA 3DOKB 5DLGA 1JLGA 2W7AA 1K0VA 2CUYA 2KL8A 2C2OB 1FKOB 2DPIA 4OV6A 2BRKA 1GFWB 5B09A 2BJ7A 2VDHA 1RTIB 3ENWA 1VQLS 3DGPB 4OYPA 4ANEA 1KQFB 2OHDA 2W1BA 3EZOA 4JV5F 1L3UA 4ANDA 2ZZNA 2RU9A 3TEHB 2DGWA 1B99A 1ZTWA 3AJ1A 4A8XA 4YUDA 5IWAF 4J9QA 4LBIA 5LMNF 3KJVA 3G8QA 1S9GB 3I96A 4WTOB 2F4VF 4CQ1A 4FDFA 2XULA 5F8MA 2UXDF 2VB6A 4ATNA 4TYAA 1R43A 4JI0F 3TVZA 4N5SA 3RR8A 1SC3B 2V94A 1S72S 1FRHA 1IVZA 2YNFB 3JXOA 2DK2A 2O5DA 1MN9A 2BOAA 3EWGA 2AV5A 3OBIA 1YITS 5T7LA 1TL3B 1U45A 3ISNC 4WK1A 4J9UE 3BSAA 1F2HA 2VPXB 1SQFA 3N6LA 1A6LA 3BBCA 1TAQA 5K14A 2BANA 5IT4A 3SQGB 1HBMA 2PDAA 1KLNA 3NOCA 1M0SA 1PYTA 2YPYA 3EPGA 3QNWB 1NDPA 3H2VE 4F4KA 3Q8PB 3PYDA 3LH2S 2XQCA 4JI3F 4GKKJ 5F8NA 2ATLA 4U7UK 2ZD1B 1HARA 2ZHAA 3SXLA 5G0RA 2ALYB 1RABB 4OYZA 3VF0B 5F3TA 1AFIA 3AJDA 2IM3A 4P6QA 2EBGA 1FKAF 4KHPJ 5EWGA 4FP9A 1WEYA 3PG9A 4DL0C 4ED7A 5L46A 3UI3A 3LQVA 2AWZA 4DR1J 4DLGA 1FXLA 1W7WA 3CIZA 1YRUA 4WFXA 2C2MB 5JVHQ 3HCXA 2ZWPA 3BSOA 2L9DA 4TY8A 3P8BB 1YJNS 2CIMA 3D0HE 3U27A 3I9V9 3W7BA 2Y0BB 4KKOB 5AT1B 2CDQA 4DV4F 1Q8KA 1SJFA 3T5HA 1UEUA 3MEEA 5LXYA 3G96A 4YDDB 1WDTA 2BZ2A 1BUXA 1HBOA 1KEKA 4ED8A 1XWLA 5E3PA 5IC4B 2IJFA 3UE2A 1KKHA 2NSCA 3C46A 2XC9A 3OUYA 4UF4A 4C0HA 2HBRB 1RJJA 2L9WA 2M8HA 2VOOA 1MROA 4IG0A 2U1AA 3PJ9A 3VCDA 1PO6A 2YNHA 1NXIA 2GC8A 5DQHA 2RF2A 1SH3A 1RBLA 2DNHA 1WG1A 4DR7F 2HQIA 3PCOB 5KFSA 1PBAA 4EFAC 5HVFA 2VBZA 3MTKA 3CGIA 1HNVB 3Q22A 1KLMA 4CLWA 3QAUA 1U26A 4QJVA 3VAMA 4L72B 3MMCB 3UD5A 1TUVA 1RBAA 2B4VA 3H5UA 1UAWA 3MF5A 1JLAB 2DKOB 3IBCB 1YBUA 4K5SA 4NZ0A 5KFBA 1X9MA 4E2FB 2V9KA 3AA8A 4ECUA 1UFLA 1QTMA 2EXUA 1U7LA 2KG1A 1AROP 4ILRA 4EZ9A 3Q86A 4DQRA 1U09A 3MEKA 1LW0B 3W62A 2J7WA 2MMYA 1PIEA 3PW5A 2QMXA 3RAQA 4ECYA 2WOMA 2LKZA 4CNYA 3MM8B 3C2PA 1AB8A 1NK9A 3DRRB 4DOZA 1QDUB 1FERA 4LVOP 1TU0B 1XN9A 3KK3B 2L41A 2J9CA 3GG1A 3Q2SC 1PAEX 1ZAXA 2E1CA 4YR2A 1FRKA 4H54A 5E7OB 4LR8A 2CJQA 2E1RA 3T1HF 3NNHA 1RCOB 4CO0A 3EICA 1SXLA 1UFWA 1MN7A 4BWMA 4PKDB 2EC2A 4RW4B 3BV8A 4WIQA 3HHLC 4URGA 1V6HA 4JV1A 3I31A 3K5MA 4F3QA 2JVRA 1RTDA 1OO0B 2AT1B 3UCZP 3ZTPA 2DY1A 1IKVA 4AE5A 2WONB 2Z56B 2HHVA 3FGVA 4UTGA 4OX9J 5CD4H 1T0TV 4DSFA 1HD1A 4GKJF 3I0RA 3SZ2A 4CZCA 4Q7AA 1T95A 2XTJP 3PR5B 4X65J 1HHSA 3W2VA 1FVQA 1VIOA 4DR2J 3QSIA 1QUPA 4J90A 5CAAA 4DQIA 2WSEC 3GTYX 3I32A 1P1TA 2B9EA 2CQ2A 3GYXB 1GXUA 2R4FA 1WC4A 5DZ7A 3RBDA 2ZKTA 3CDWA 1IR0A 4DL5A 1GAOA 2V6AA 1N5VA 2CPIA 1PJ6A 4BC7A 2EG1A 1P8GA 2AU0A 4FVMA 2UUBJ 2YKOA 3CO9A 2MB0B 1VQ7S 2EKNA 3CC2S 1UVKA 1HL6A 3BBFA 2MZJA 4ZPWR 2DGQA 1S97A 1S57A 4J9OA 3TP2A 4RW7B 5K9FA 1NDKA 4A46A 4B3SF 5CYJA 2PMWA 4B3MJ 3X3UA 3NXZA 5DDQC 2UVWA 2CQBA 4AXJA 3PFEA 1ZA1B 3MEDA 4U95A 3MPUB 5KFJA 4HACA 3MPWA 4P52A 4ZVFA 3FBCA 3R5BA 3FCVA 3LPYA 4NPOA 3NGRA 1OY8A 1YK9A 1S6UA 4YHHF 4KFBA 1U8WA 2C2NA 2J0SD 3CJ8A 1UWBA 2I6WA 2KRBA 1T9UA 4ID5A 2ZZMA 1REVB 1WF2A 2G1DA 1B0VA 2ZEJA 5DDOC 4ILLA 1L3SA 1MMLA 1YGYA 2V2VA 2BQUA 2M8DB 1VR6A 1TUWA 1WNEA 3ZO7A 2RRNA 4OYWA 1VQ9S 3L3CA 2ZUGA 1S0MA 3C8YA 5IFMA 3PW4A 4DV2J 3LP1B 1VJQA 4I0WA 2N3OA 2V0NA 4FPRA 1B7FA 1HD0A 2B4UA 3PX6A 4ICLA 1VQPS 2FPHX 3B4MA 4PAAA 3HVAA 2AKWB 3O8WA 3GLJA 4QWAA 1TKZA 1TV6A 2DXEA 1K9MT 1FKOA 4HYKA 4F7VA 5D3GA 4JI4F 2W8LA 1U2CA 1Z1ZA 4CM0A 5JMNA 4Y2MA 3NGSA 1L3TA 4AQYF 3CD5A 2E7VA 4O3NA 1TL7B 4I6YA 3G6YA 5HQMA 4HH1A 2APOA 3JQMA 3W2WB 3QZ7A 2AX0A 3ZXWA 2UUTA 4ES2A 5DLFA 2N7YA 1VHIA 3IGNA 1JLQA 2YX7A 2MLXA 2Z58B 3K5NA 1U48A 4YP3A 3JSYA 4ZP7A 1DRZA 2ZH5A 1ZAVA 1S9GA 4DCOB 4HI1A 5SZTA 4DZ6A 2DXFA 3CMQA 3W65A 2D41A 4CLTA 1TKXB 5THWA 3FZ2A 2EEYA 5I3UA 1QAIA 4O4GA 3HHNB 5F9LA 2GGPB 4ZPAA 2BM0A 4Q2MA 4MMOA 2XY7A 4ZHRA 3V6HA 4OX7A 2YNFA 2K7KA 2W9CA 4DUTA 3PIOQ 2JC1A 5B0AA 2UUCF 1S6QB 3VAHA 1TL3A 1VBYA 3IR6B 4DU7A 3NAHA 2QL7B 1OJ4A 2E5IA 2K8GA 3VAJA 1N8RT 1VS3A 3KDOA 4PG4A 2LXUA 4A8YA 1KFDA 1V5VA 2P9GA 2XSJB 1N5YB 4ZOSA 1RHMB 4CLSA 2XZWA 2IMOA 1KVIA 3DU6A 3TA2A 4P72A 3V6DB 1U1MA 2NPFA 4ED4A 3H2LA 1FD2A 3KHGA 2CJKA 3N6MA 4ES1A 5C24B 1ZPVA 4FYYB 1VK8A 2ZUAA 1VCTA 3RBEA 2H5EA 4QR0A 1R8AA 1F9HA 1G2EA 4OQJA 3O5TB 4C9DA 2DNKA 4PR6A 3CPWR 1K47A 1CBKA 2RSQA 4OX8A 4ZVQB 3I0SB 4HHUA 1C4CA 2CG4A 4JI1F 1TUGB 1S9EA 2AMCB 3KK1B 1R6YA 1BQMB 2IC3A 4UT4A 3BPSP 2G2YA 3G6VA 3TAPA 4CIOA 5KG6A 1YJ9S 4WZQA 1IR1A 1XERA 1FX2A 1UKUA 4LMZA 3T19A 5KFUA 4ZPCA 3FZBA 3DNCA 1N34F 1T94A 2C1EB 3OVSA 2HZAA 2FJEB 4QOTA 1RHUB 3W64A 4QR1A 4JV5J 4YY3F 3MEGB 4DZDA 4GO7X 1HI1A 1KOHA 5J2NA 1RZMA 2LQ8A 2DGUA 5JUMA 1UVNA 3VWSA 2OPRB 3OJUA 3DLLQ 3MUMP 3QT7A 3R3TA 4TU9A 4DR3F 4N8OA 1JKHB 2ZDOA 4CO2A 2ZBRA 2WVEA 5CCLA 5IWAJ 4QIFA 4RW8A 3TARA 4DG1B 5LMNJ 1N32F 1U0SA 2F4VJ 2QRRA 1VJWA 2UXDJ 3R1LA 2MSSA 2O01C 4JI0J 1UCNA 3T1AA 1U2RA 2DITA 3Q8QB 4A8OA 1Q78A 2AJ1A 3TX8A 2V68A 2WHOA 2DHSA 5IQ6A 3M8PA 1VI7A 1ZH5A 4CTAB 3I9ZA 3HHEA 1SJ3P 4NLPA 1GEHA 1ZOTA 4RBVA 1NHVA 3FBEA 1EKSA 3Q2TC 2Q3PA 2LQ5A 4O44B 3D54A 4UOCA 2CQDA 2R2SA 3J7AN 3RRHA 3RB3A 2MKIA 1Q8IA 1UFKA 2YQ1A 1NPPA 2HWTA 4JI3J 2H4WB 3KK3A 1H0HB 1TMMA 4W98A 4KGXB 2CPYA 2CPZA 1H3DA 3DXSX 3JTNA 4X4NA 4Q0BA 3S8SA 4RNNA 2OEKA 1ACMB 3THVA 3FQLA 3EUNA 2LP4A 2OTJS 2NQPA 5HN0A 3QAEA 5D8HB 2WW4A 2N4CA 3NCQA 1Y3JA 5BJRA 1PC4A 2QL5B 1RWPB 4CLPA 1SBRA 3DOMB 3V2UC 1Y5NB 4RUAA 1R8BA 2WONA 2HVZA 3GG0A 4UZBA 2R8JA 2Q1LA 3TX0A 2HVHA 4FBUA 2QSFA 1PBUA 2VPWB 1R89A 4ZVPB 3J81U 4WU2A 2CPJA 4BCAA 1HBUB 3HJVA 2X3GA 2VFVA 2QN6B 2PEHA 4J9RA 4RW9A 2YWFA 2MJNA 2HSEB 2FIUA 5FD1A 1DQAA 2B43A 2EI5A 2UUAJ 1JX4A 2GQ2A 3QJJA 3MM5A 3H20A 3FRYA 3MFHA 1BLUA 1GX6A 4DR7J 1DTTA 2OD6A 2PO4A 4I1TA 4NASA 1ZA2B 2EC0A 2LECA 4C8NA 3R5JB 5C42B 2AEJA 3R5AA 2MKCA 8ATCB 3RAMA 1SC1B 3AT1B 3H98A 2FYXA 5KFNA 4LIRA 3ITHB 5IM0B 1NH7A 4FN5A 2HS0A 2MLYA 4IFVB 3ZNJ1 2HBQB 3FJ2A 2D1CA 5FDLA 2QZ8A 4GVBB 3UN3A 5IC6B 5HP1B 3D6TB 4V1Ak 3HXMA 5HAOA 1QE1A 5F3ZA 1HBNB 2R7UA 4OJ3A 4CCHA 2RB7A 2H51B 5A8KB 3NKYA 2LEAA 4ZJLA 2OEJA 3ILOA 4EGLA 4ZLLA 1B4SA 4CO5A 4RW6A 2XZDB 4E0DA 2AJFE 4OL8A 3TAMA 1F9EB 1X4FA 2HK2A 1KDNA 1S99A 1X4HA 4FF2A 1DURA 2FGOA 4ETXA 1SJ4P 2ZE2B 2UZAA 2BKOA 3VALA 2F8MA 2DISA 3D28A 2R2RA 4MTPA 4PXCA 2UVVA 2GJIA 5I42A 6FD1A 3B8HA 2BJ3A 3TJAA 1S10A 1DBDA 2GZOA 5D15A 3L9ZA 1D9DA 2HFZA 2ROPA 4TY9A 3CDBA 1NAQA 2YWEA 3VVTA 1LNQA 3D0GE 4ZVRB 2M2BA 4V19J 3NOGA 1V3RA 1SV5B 1TL7A 1OWXA 2CAJA 2OPQA 3CCWA 3DXBA 4UQGA 3G71S 2IPOB 2QLWA 2F9DA 2FLOA 3VGUA 3DHWC 1CC8A 3N79A 4GKJJ 4LRAA 3CTRA 2PA8D 1N6QB 1UL3A 4LRCA 3H5YA 2J8SA 2IAJA 4O3SA 1SC4B 3V81B 1BQNB 2QE5A 4PWUA 3I6PA 4KE5A 2IIHA 2F7VA 1EETA 1H2TZ 1UVJA 2L08A 3PHTA 1G3OA 5AE1A 1S1WA 2HQGA 3RU0A 3JB9k 2UXCF 1S7IA 5A6WA 3KDNA 3R27A 2A2DA 1S6QA 4C8MA 1HW8A 1N48A 3CF5Q 2J5AA 3EZUA 2RVJA 5E3AA 3KOAA 4CP5A 3I82A 5AE2A 4B3SJ 4DL3A 4PEOA 2KFNA 2PFDA 3T1YF 1IBCB 1IJFB 1NJXA 4Y6IA 2HBYB 2P6TA 5GVQA 1QSYA 1P27B 3MDFA 1T11A 2HRYA 5HL7Q 3M2RA 2ZM6F 4NXMF 3QGHA 4K5RA 3A3PB 4NA2A 3PTWA 1NH8A 3RR7A 1KNZA 4RU2A 3UVJA 5D4NA 4YHHJ 3Q8SB 3LA0A 4DHVA 2Z4PA 1VRUA 4Q8FA 2J0XA 4DSJA 2DCLA 3AD8C 5GMDA 4USMA 2B9YA 4LF6F 1CC7A 5F0UA 1AA1B 1LWCA 2LMIA 4DV1F 4RNMA 4OZ5A 4OLOA 3CULA 3I0SA 1U25A 4B9LA 5HROB 1AZSB 1RADB 1X5PA 4RNFA 5KG0A 3LF0A 2EW9A 2XYGB 1JLEB 1FF2A 5KFAA 3D3BJ 1PGZA 1S76D 2RUSA 2VC1A 4LF5F 4K50A 3KJNB 4CLUA 4FYDA 3KLVA 1RTJB 5ETSA 3J7A1 1Q86T 2B3TB 4F0MA 3CJRA 3QWUA 3V6JA 3N4WA 1RWMB 3DCAA 4FYWB 3GIRA 4MYUA 3WX8A 5LOQA 1XMQF 2PE8A 5HVHA 2J7UA 3O2IA 1S1VA 1KBRA 4BWJA 2GMJA 1WOSA 2OUGA 4IOAQ 1U1OA 3U7JA 1S0OA 3NL0A 3X1LB 3OVBA 2OPSB 2X1GA 2OPRA 3HKZD 3UFCX 2C28A 2WAQD 3WBZA 1HA1A 1FKPB 3PR4A 4R5PB 3KLEB 2V5HG 2DVIA 1NHUA 2HLTA 5F8LA 5GMKa 2V69A 4BBYA 2CQCA 3NMRA 2DRAA 1KWMA 4Y2KA 1QAYA 2V8DA 4N7TA 5E0OA 1HWLA 1JLBB 3DRPA 1WWHA 2DNQA 4DF8A 2VOPA 1F0XA 2W25A 5A0YA 5K8NA 2HNZA 2RHQB 3MAQA 1D9FA 4CTAA 2UUCJ 3FMWA 2J6UA 2FC9A 3BYPA 4LFCJ 1S1XB 4OYIA 3NWGA 4CRJA 1LKZA 3BQ0A 1DTQB 1X4BA 5HMWA 1HI0P 4WFZA 1SB6A 4ECSA 2FJVA 1VQKS 1KSPA 2E1MC 3S6EA 1FFSB 1D1UA 3NGDA 3CJ0A 4MK9A 4O44A 2CZ4A 3TZXA 1JLCA 3PNIA 3I5BA 5HLFB 2Y1IA 1SVDA 5C5JA 3QLHA 4WZMA 3N28A 1S12A 3VZHA 3DMJB 4D3HA 2VD3A 3EVOA 2RRBA 4KT0C 4F04B 2ILYA 1QUVA 4USHA 1NSKL 4QW8A 2JEIA 3A12A 1Q8BA 1HNZF 3L7UA 3UW1A 1PYSB 3FBFA 4DV7J 2JDJA 4RR5A 1Q16B 4KRWA 3FEXB 1S1UA 4USTA 2WRMA 2V4JB 5M2RA 4ILMA 2I0XA 2MPUA 3W63A 1L3VA 3OHAA 1IKWB 4QYZJ 4KIAA 1ZM9A 2DNZA 3AY0A 4O23A 2KB2A 1N33F 4MJKA 2G0IA 1WELA 1JLFB 1RT1A 4LSNB 1JNRB 3TQ1A 3MTJA 3H40A 2BE2B 3KLHA 4X62F 1U6FA 1HBUA 1D0EA 4PCQA 3J81Y 1U02A 4R0JA 3R6GB 3HHLA 1J27A 1U4BA 4K0KJ 1YG0A 3FFIA 5CZVA 2BACA 3W8GA 4FKXA 1NMEB 1NJWA 3MAAB 1VBXA 2DIVA 1NCLA 5CCMA 4DR3J 2DRDA 4RJVA 1PJ7A 3O6QA 1IUJA 4B3TF 3G8TA 4I2PA 4F3OA 1RYSA 4QWCA 4ANCA 2W9BB 1VGYA 1LWXA 1NRKA 1OSDA 3BKUA 4FXWA 5KG7A 1TL1B 1H74A 1ZS6A 1YZ7A 5EHHA 1TK5A 3N5FA 1LW2B 3ITHA 3MD1A 1XMOJ 4FF1A 2NS1B 2CPXA 2JOQA 3C66A 5CZXA 5K8OA 2HQ3A 3UNGC 1NKBA 3IR7B 1IM4A 2JWNA 5CYQB 1FXRA 2Y3YA 1RHQB 3QQCD 2XS2A 4NMXA 4ZPVR 1VC0A 1T9VA 4XTTA 1RKIA 2CQIA 5DO2A 4JI6F 3HHKA 2AX1A 1XMBA 4I7FB 3HT0A 4OZ1A 1P1LA 2NCKL 2IHR1 2QLJB 1R3NA 4C2MA 2YKMB 1VISA 1S48A 1WF0A 3PM9A 2DNYA 1KTVA 5H9EJ 3SDEA 2CVIA 2D3OR 4Y65A 3UPFA 4DR4F 3OHBA 1GNKA 4G1QB 1CJUB 5E33A 3KYLA 4ZVSB 1RT4A 3BR8A 3G6XA 4F02A 1AT1B 4X4VA 3KXDA 3OR2B 4LRBA 2A0FB 2AHOB 2JEGA 3K0JA 1YZ6A 3B6BA 4H4KC 3TRGA 1QVFR 2YY3A 1TAUA 4N77A 1UMJA 2OAUA 5DGBA 2VG5A 1UVIA 3QIPB 4KAIA 5F8HA 3GIMA 1E6VB 2KFZA 2RILA 1SV5A 4L76A 2DGVA 4ELTA 2PGCA 2YXLA 3MR6A 4F25A 4MKAA 5KFZA 2ZH8A 3ZFVA 4R8UB 1TMJA 2E5GA 2HIQA 1C0TB 3CJTA 2W4CA 3RB6A 1I94F 4OZLA 4J91A 5H9FK 3KLFA 2EK6A 2ABYA 1Q7YT 1O5JA 1GX5A 2B8QA 1HWJA 2WVFA 2KJVA 2AEFA 5DM7Q 1TL4A 3UN5A 1M5HA 3VGVA 1WTBA 4RU9A 2BUNA 2F3JA 2MKHA 1MWYA 2YKQA 4X4OA 5GAGU 2KG0A 1VRTB 4IOCQ 2RS8A 4OI4A 2KZMA 2OLWA 2B6AB 2MTLA 4FBTA 4Z7CA 1SJQA 1FJGF 3BPDA 4DR6F 2KJWA 1HIYA 2HWIA 2DNMA 4ECZA 4B08A 2WB1D 3CDAA 1C1BB 4M94A 2ASYA 4LT6A 1HNIB 2PMZD 1RUSA 2J0WA 3CJ4A 4HHHA 5KFGA 2HFSA 3M9MB 3CCSS 5A2QY 3SSSA 3WC0A 1X5SA 5I4MA 4LF4F 3QRRA 2V9WA 4MFBB 3VV2B 1SL0A 2ZH6A 1HQUB 3R5GA 3C16B 3DLBA 2W4PA 4AUKA 4YN3B 1HMVB 2DGOA 3G87A 3TUPA 4MK8A 4K4SA 1Z4UA 2HVDA 3CC7S 5DM6Q 2QLBB 2UU9F 4IG3B 4KYZA 1VYAA 1Q5VA 4E98A 3LOUA 2BABA 4YMEA 1GT8A 1KQGB 2KZZA 4DUZJ 2MKYA 2MDAA 3W5YA 4G65A 4NWBA 4NI2B 2CYYA 2MJUA 4CLZA 3ZC4A 3TJ9A 2X7IA 2FHKA 5HROA 3GR1A 4C98A 4W90B 3GFYA 1ZM2A 2Q6CA 1S6PA 5A76A 2ZBIA 3AD7C 4JI7F 2A10A 4LSZB 4MAKA 1X4DA 4XDCA 1YX2A 4P2XA 1RTJA 1AUSL 4Q43A 5FLXU 4FS2A 3I87A 3P5TL 1WHYA 2V50A 4AT1B 3DDKA 3MM6A 2DNNA 2E1PA 1X4EA 2SXLA 3JQKA 3POTB 3D0IE 5EDWA 5A8WB 5KFIA 3L09A 4MKVA 1SJ1A 1QAJA 3P3DA 4RUCA 2ASDA 1VRQC 2ERRA 5E41A 3D5MA 1SJRA 2RKIA 4R5PA 2HMIB 2MZTA 3JSMA 3VVUA 3B54A 5HVGA 3IAS9 4RBUA 1IKXA 2YNIB 2XMWA 3A8IA 1X5OA 2ZOGA 1H2UX 3ZNUA 3KLIB 2VG6B 3JYTB 1B70B 3M6WA 3T5LA 1YJRA 3AXKA 4Y3CA 2FVQA 1OPIA 2POKA 1VC5A 1TP7A 2UXCJ 5DG9A 3QT5A 2QEXS 4ES3A 2XLIA 2GHWA 1VIXA 4IDKB 4A8SA 1FJCA 2XO7A 1FRIA 2JSXA 3W9HA 2ZJPQ 4UUXA 3GIIA 1D9AA 3KUEA 3OVAA 3HJFA 3T1YJ 2E5LF 4LSLB 1OQ3A 1NK7A 2KHCA 3JAMY 2KFYA 2K3IA 2XYHB 2LDIA 2IJRA 2QMUB 3QGGA 2DHAA 2ZM6J 4NXMJ 3MOZA 4NCGA 4WU3A 4GC6A 4B9TA 4IR1A 5EGYA 2ROGA 3MHYA 3SFGA 3V4IA 2N82B 3DOLB 1VQ4S 3MMBA 4WYLA 4NEZA 2IFXA 3OFFA 2GVZB 4DPYA 2G0JA 2FJAB 2QA1A 4OI1A 4JI8J 2CXEA 1RT5B 5MLCV 4LF6J 3KHHA 1ZTTA 5M2PA 2I5JA 1X7VA 3JSBA 3IS9A 4DV1J 2JJ4D 2HHTA 3MR2A 2Y1LB 2Q43A 1UTAA 3BGFA 1WG5A 4KO0B 1HQ2A 2HGNA 4P9SA 3D4JA 1IKWA 3ULHA 1BE4A 2OGUA 3C14B 4F4WA 5LT5A 4LF5J 4WYWA 4AL7A 4MT1A 5HBMB 1S4FA 3EDRB 1QJHA 3BR9A 5KFLA 3W3SA 3IN5A 1JLFA 4JB8B 4N47A 2BE2A 2YNGA 3QWPA 4ZP8A 3UR3C 5B0GA 2LA4A 5KFYA 4NLTA 1ULRA 3MCOA 3IFEA 2KI2A 3C6TA 4DCPB 3ZZYA 1KHWA 3BN4A 1AUDA 4RL1A 3CE8A 4FNHA 3AODA 4EU0A 1Q0NA 1OY9A 5ETVA 3PVXA 4RWWA 5HSPA 2DH8A 5KT7A 3VGTA 3TJ8A 1S7HA 2DGSA 3PACA 2BVZA 2MKJA 2YKNB 2HFUA 1XQIA 4L73A 3EGNA 3WQPA 3R5DA 2MGZA 1ZYQA 1VK3A 3CUNA 3PW0A 2AQ4A 1NKEA 4CH1A 1UP1A 1DLOB 3G82B 4KJIA 5CABA 4OI6A 3M2VB 2HFOA 3J7ZT 2XMTA 4EUVA 2LQJA 1AYEA 3GPAA 5CYQA 1IBLF 4DUYF 3PW7A 2P6SA 5KFQA 2QTWA 4NXNF 2C3OA 1JJHA 4TLRA 5F41A 1EQ0A 5H9EK 2H5JB 4D3GA 4P7TA 4Y00A 1XEZA 4DV6F 4I7FA 1RP5A 2AGQA 4DPTA 1T8EA 1C0UB 1RTHA 3R9LA 2DHHA 1N54B 4DX6A 3CJ2A 4G1IA 1XR6A 4X64F 4LF2A 1WC5A 4MKYA 1QAXA 1U1QA 1JNZB 4ZK7M 1KFSA 5CQGA 4G1QA 3EX7B 2YKAA 3H59A 4AL5A 1RT3A 1EP4B 4CH7A 2Z2MA 3SCIE 2QIFA 1LWEB 2X51A 3F0NA 2OJ3A 1OPZA 3A4TA 2ZNZA 3PIPQ 4YR0A 1HNZJ 5F9NA 1UZDA 4DL2A 4RKUC 4PRFA 1ICEB 5LSOA 1VQNS 1T9YA 4ZKAA 2V34A 2XO6A 4EBEA 3C15B 1F6TA 1LEOA 3QIPA 3CJKB 3LWMA 2EPIA 1E6VA 5B0DA 1VDHA 1MU2A 5HMYA 2QLXA 4K2XA 3PXGa 1HKAA 4ED5A 3GIJA 4QIEA 4NEYA 3K89A 1CJKA 2HZCA 2NUUG 4CNZA 2NREA 4WP9A 2NXUA 4R8UA 3FCWA 1N33J 5KFKA 2RUGA 3D9BA 2GIRA 3RRGA 5ETTA 3SV4A 4I69A 1RT7A 3TWZA 3LP2B 3NGUA 2FZGB 3PKYA 2OPPB 1L5UA 3CD7A 4ITSA 2K1RB 4OHWA 4X62J 1NHKL 4DR5F 3CSKA 2AYBA 3MAHA 1Y9OA 1NSAA 1V5IB 1XJWB 3R2CJ 4ECQA 2Z57B 1E6YB 1U0HB 4RZRA 5B7WA 3CDUA 1GXTA 4U8YA 1C1CA 4A48A 1Z2LA 3CT9A 3M1VA 1FRMA 1QY7A 3GP9A 3CCUS 4ZCMA 1OSCA 2MQLA 4Z7YA 2V2KA 2ZHOA 2VFSA 1WTFA 4IH7A 3K59A 1VFJA 1S59A 5J2QB 3D68A 2FLLA 2D3ZA 5ITHA 1FDNA 2DGTA 1UW9A 1LXNA 4TLQA 1VOMA 4NX9A 5C25B 3DRSB 1I6JA 3L7PA 2B4OA 3B4DA 3QFWA 3A3NB 2K06A 3AOBA 1T9WA 1DHMA 1H38A 3EM1A 4GO5X 3NMAA 1YBTA 4I2QA 3DLKA 3OTCA 2ZJQQ 1URRA 2H4YB 5AXNA 2HFNA 4OI3A 2ZOMA 3GJRB 3BQ1A 1Y5IB 4OJHA 4PUOB 5DDRC 4JI6J 2DO0A 3GFXA 3TVKA 2AIRB 4IG3A 1I1GA 1VLYA 2Z0GA 1KQSR 2YWGA 2J8AA 4K4YA 4CT9A 4WWSA 3GILA 2NLWA 3DLGA 4NI2A 1TFWA 1SKSA 1HR0J 1HYSB 2MQQA 1CJTA 1CS4A 4WXWA 4DR4J 2VDIA 3TYTA 2W7PA 4A8KA 1EB0A 2CWXA 5HK4A 3FKBA 2JH3A 3OL7A 2HNYB 2HHPA 2JLEA 5G4DA 5D77A 2VG7A 1YJUA 2GJ2A 2IVFB 2FUG9 3OSPA 1WOOA 1M5VC 1S9FA 2M4MA 1X8DA 1N88A 1TVRB 4HT7A 3HM9A 2XSFA 4ED1A 1EZZB 3IP0A 1N36F 3HK2A 3KHLA 2DY9A 1LK7A 4NLRA 1T05A 1C4AA 1F1BB 3TW0A 3W1YC 5FLXY 2IVMA 1WG4A 3F44A 1M5KC 3LGHA 3QFHA 5CXTA 2C3MA 2JC0A 1RDRA 2D3UA 3VGSA 1S6OA 2H48B 1RHJB 2ZVIA 4QBUA 4IO1A 2VFRA 3DI6B 3W5ZA 4P2SA 1I94J 2CQHA 2R7XA 1O6XA 2WVDA 4YR3A 3CVKA 5F0WA 1WSVA 2HHQA 3RAXA 2RQ4A 3W66A 1IM6A 1NPKA 4UY8T 1MW7A 2VJVA 1CJVB 3IWNC 1EKRA 3NGKA 2GHVC 1F2GA 4USIA 3M8QB 4M1KA 5E3CA 2OELA 4FS1A 3KLIA 3KMQA 2VG6A 3JYTA 3MCSA 1I51B 4F4AA 1G4CA 4NRTA 3FBBA 3C6UB 3HF5A 3ZTOA 4K2JA 3UNYA 4B9UA 3B78A 5J2PA 1FJGJ 1WDDA 3M6UA 2XEXA 2AZ1A 3VZIA 4ZVTB 1JB0C 1Y4ZB 3M32B 3KMSA 2HNDB 4WFNQ 2QV6A 5DG7A 1NJZA 1KHVA 4QU6A 4OZ2A 1SUQA 5KFFA 5LXRA 2R7SA 5M2UA 2VC0A 2VH7A 1NEEA 1RA7A 1FWLA 2J9DA 5KT4A 3P45B 2QA4G 2EK1A 5HJXA 1WHVA 4CT8A 5EWFA 2MZSA 4C8KA 1RGVA 3UCGA 2MQMA 4LF4J 4WFBQ 4ED6A 2VHGA 3HFKA 2F65A 1RWVB 2CNKB 3EPIA 4B9SA 3T6BA 4F3MA 3BGLA 4PWWA 1FE4A 3HVRA 4DPUA 1FD8A 4QIVA 1JXVA 4URSA 5GADU 1T03B 3E51A 2UU9J 1IKYB 5L8RC 2GVZA 3D3CJ 3MPDA 4G6VB 1RT5A 2O67A 3AHPA 5SUHA 2M7SA 4JI5F 2J6TA 4H4MB 2NR0A 2ZH3A 1R0AA 4ALZA 2I8EA 5H1SV 4NCBA 1Q81T 1EJ7L 4AXIA 2RMLA 1KVJA 3GV7B 2UVRA 4KO0A 1YQHA 4DFKA 3RYLA 4B3OB 3IBWA 4KTQA 2GVDB 4NE9C 3DDIA 4Q44A 4M5DB 2OKQA 2GAGC 4WP3A 3ZZ0A 3ET6B 4IFYB 3MFIA 2QG9B 2VA2A 5K8PA 3NAIA 2CJYB 1N0VC 3IRXA 2OFGX 1X4GA 4P75A 1SKWA 1UA1A 3GCXP 1SH0A 4OZ0A 2IM2A 4C3KA 4IH5A 4K59A 4YDXA 4ECTA 4DV5J 2VODA 2Z2YB 5J1EB 3ILIA 1NZAA 4DPXA 2LDYA 4YOEA 1NUEA 3E8OA 1S77D 2BW2A 4NLYA 2AD9A 1HPZB 2VASA 1N56A 2FVPA 1B0PA 2FHOB 1JMTA 1GTEA 3WIVA 1RWKB 2QX0A 3H25A 3M2UB 3OTBA 1JLGB 4PXDA 1FTCA 1RT6A 4IOBA 3BDPA 4URQU 5B0BA 5KG2A 4HKQA 1M5SA 2UUWA 4WFAQ 3PW2A 2MHEA 4A8MP 1OMSA 3SFUA 4HI2A 2V8VA 3M8SA 4NCAA 3EDQB 3MECA 2DJWA 3TNVA 3IG1A 3SYZA 4ZA1A 3SEOA 2N7CA 1U1LA 3D2WA 3UCUP 3GV5B 2XI3A 3Q0AA 1UVMA 2FDNA 2WSCC 1YJVA 6AT1B 2ATCB 4DMZA 1W26A 3Q8UA 4ZMMA 2ZC4A 4Q45A 3BH6B 4L3KA 3KJVB 3D1OA 2COLA 3WZ0A 5D4PA 1WUUA 2XWYA 1QVGR 1WF1A 2HYIB 4JYAF 1C0UA 3D7SB 2AGOA 2E5LJ 1QTNB 2HZVA 3CC4S 2C2ZB 2VPZB 2G4BA 2QGFB 5C2CA 2FHMA 4HVZA 4M8LA 1DQ8A 2HQDA 4YB5A 3HSZA 4DLEA 5CD4A 1UA0A 4C8LA 2J0QD 3J80Y 2BQRA 5T7LB 4USVA 1EP4A 2BE9B 3DRXA 1J5OA 3IXQA 3ZZRA 2BANB 2WBRA 5GAGI 3LWLA 1HBMB 4B9NA 4H4OA 4HR2A 2GMHA 2BEFA 2W2OP 2C3PA 2W7OA 3CJKA 3KHRA 3LUYA 4OYBA 3JSRA 2H5IB 2E29A 5RUBA 2UV8G 3AFGA 2Z2ZA 3NNAA 5BYSA 3T5KA 5G0RB 1VQ6S 3I55S 1F3VA 4F50A 1MMDA 2HQFA 5LSRA 1VBZA 5HJYA 3HVWA 4WE1B 3LP2A 2OPPA 4H4KA 2B56A 4YB7A 4XO0A 3T3FA 1BHNA 4C6AA 2JEJA 4LFAJ 2X3DA 3M8ZA 4ZVUB 4P2MA 3OR1A 1XR7A 2IA6A 4UOHA 1IR2A 1MNEA 3EZ5A 4PPZA 3BN7A 4RUBA 1K8AT 1K0TA 3DM2A 3EYZA 3S7RA 4HLBA 5ETNA 3MEEB 3TZYA 4OHXA 2Q66A 2J9DE 3DOKA 4KHMA 2ZH1A 4KSEB 2P2CB 1HBOB 2VV5A 3M7VA 2HWHA 2GW8A 2LVWA 1TR0A 1RTIA 1PKUA 3DGPA 4X4SA 2NXJA 3F41A 3VAGA 2DNPA 4CYUB 4I68A 3IM9A 5HQLA 1MROB 4DI6A 4NLOA 4E8UA 4IG0B 5C25A 4LFBF 1N5TA 2VF3A 2YNHB 4ZPDA 1UEKA 2J76E 1WORA 1IBLJ 1X9SA 4DUYJ 5DZ6A 2E1AA 4IRKA 1N4LA 2ZFHA 4WKRA 4EYIB 3T41A 1KLMB 3OL8A 4NA3A 2LYVA 4DV6J 4LQ9A 2F1FA 2XMUA 4M5HA 3EXCX 4I6WA 3EXYA 3E01B 2B4PA 4B3MF 2GAHC 2NSBA 4OX6A 4RWXA 2KTQA 4KV8B 1HYSA 3QO9B 4EMDA 2W4DA 1NZ8A 3THPA 3PYEA 2PSZA 5BYRA 3OFHA 3NY0A 4ZN3A 4FXDA 3PRVA 2KT5A 1X60A 3KG4A 1XNRF 5KFMA 3HPOA 4Y2IA 5J1PA 4KBIA 1ZETA 2RDIA 3FCHA 3HFVA 3ILJA 3NS6A 3MM7B 4LBHA 3OXGA 1F5AA 5CHCB 3HZGA 3R2DJ 3EVWA 3RGIA 1FEHA 3SQGA 4FPIA 1RCXB 2CPDA 2FGCA 2WOMB 1U1NA 4CDIA 3MUTP 3OD2A 2ZNYA 2EFOA 2FZKB 5D0GA 2ZH2A 1GMWD 1QD1A 1T3NA 3MM9B 2FHJA 4YB6A 2KKHA 3THTA 3D1QA 3HI9A 3RB0A 5CYMB 5DQGA 1SIWB 3PKMA 2PI5A 1MG7A 2ZD1A 1TZ0A 2R42A 3V4MA 3QMQA 2WVBA 4RO0A 1BMQB 1MSWD 3MZIA 2H9ZA 3BB5A 1GMVA 3GFZA 5U47A 2CJXB 2YH1A 1U1RA 1BY9A 2BXJA 2DHXA 3N9UC 3ZZZA 4DR5J 4YQWA 2G13A 2DTJA 4C48A 2F8EX 2FJWA 2B9WA 2ADCA 5K5MA 1WC0A 4GRSA 2IM1A 2HHUA 3H8YA 4PG7A 1XR5A 1S0VA 2E9ZA 2IYIA 2MYFA 3SV3A 2YQ0A 2IBOA 4RLEA 1IKVB 4KKOA 5F8IA 3D6FB 2FJDB 4ZIVA 3MUVP 3I0RB 3OFEA 2JRSA 5KFHA 2C2KB 2IRYA 5DS7A 4IYQA 4P71A 2M52A 1X0PA 5KAKA 5KG1A 3MPVA 2NXCA 3ZZUA 1GXLA 3W2VB 4IQMA 5HI7A 2E7XA 2R8IA 2LU2A 4U6PA 4FXVA 2QSWA 2I1RA 2M70A 2WW8A 3LO3A 5DJBA 3LAMA 4WKYA 1BQXA 1H2VZ 1RAEB 1RQ0A 3NWRA 2R7RA 5E5NA 1MMNA 3SMZA 2EFGA 4TNOA 1NBEB 4ERDA 5KFEA 3FSIA 3Q8VA 3UO0A 4ZCKA 2JVOA 2QA4S 1HNVA 2QL9B 3UDVA 1T03A 3GIKA 4FF3A 2EWHA 3MMCA 2F8HA 4H4MA 1FDDA 1J5EF 3SCLE 1KR4A 4PQUB 2N4DA 5ETKA 1JLAA 3CCRS 1R27B 1EARA 3MEDB 2OP5A 1S49A 2OI2A 2FVRA 4ZJQA 4HACB 4F26A 3UR0A 1FK9B 3HKWA 2LEBA 2XNRA 3AJ2A 2CFXA 4DFMA 4BC9A 2DXDA 1URNA 3FRZA 1T02A 4QPXA 4KFBB 3BO3A 4ZDNA 1LW0A 3PV8A 1YTYA 4J9MA 2PIIA 1UWBB 2GIFA 1VQYA 2DB1A 2RT3A 3KFWX 3RZAA 3CJ5A 4ID5B 3ADAC 4PG8A 3OQ2A 3QSYB 3MM8A 1U6ZA 3K5PA 3DRRA 3W5XA 2E5HA 5KFDA 4AL6A 3ENVA 2X1BA 4LREA 2BMBA 1VQOS 3C19A 4KH1B 3H90A 3N6NA 4OYMA 2QYGA 2XHWA 4ICLB 2C3YA 2HHHF 1TKZB 2AYEA 4I4BA 1IBKF 2DCUB 2QO3A 1TV6B 4K4ZA 5D3GB 3GU0A 1YLXA 3SSQA 2ADBA 2FVCA 5KFPA 4RW4A 2C2DA 1RAIB 2IY5B 4M5MA 2R8HA 4LUBA 1FTRA 2VL1A 2GFFA 4K8RA 5HANA 3H4BA 5AXKA 3GFHA 4DV4J 4Z2XA 2DRBA 3TANA 4R0EA 1JLQB 1CPZA 8AT1B 3IA0A 1FVSA 3CO0P 5HMZA 2O3DA 4O3OA 3HSDA 2R7VA 5GAEU 1G1XA 5I3UB 4O4GB 3FK4A 1JIHA 2H54B 2NXEA 4OFZA 2BDPA 4ZHRB 1IBMF 5KG3A 2CZ9A 2CPFA 1PCAA 1QLNA 1FRLA 2W9CB 4NL5A 3RTVA 3TUIC 4EO6A 4TQRA 3I56S 4NZ6A 1OYDA 1JJCB 2R2UA 4CO1A 2F63A 4RW7A 4EBCA 4HT5A 2BJ9A 3CCJS 4JI5J 4NA1A 2XY6A 4XDDA 2P9EA 4LJMA 2AP6A 2P5VA 3MI7X 1HFEL 3IM8A 2YX1A 3PYGA 1LWFB 4XIUA 3KWMA 2LQ9A 1ITPA 2CVEA 5C7PA 2BYCA 3DGVA 2CPHA 3RRKA 3NP5A 5B0FA 4K4XA 1M90T 4WE1A 3PY8A 2E9RX 1AXQA 3CDEA 5EWEA 3KJFB 4X4RA 1Y10A 5B0CA 2DD8S 1REVA 3ZZPA 4Q8EA 2YQ3A 4P10A 5GMEA 1UVLA 2Q79A 1ZM3A 4CLYA 2ZZTA 1LQ9A 2FTRA 1S9EB 5D0RA 1HNXF 1RTZA 3LP1A 5KOXA 3WX4A 5B0EA 2H3EB 2IC3B 3G86A 2JEFA 4RBTA 3EGVA 3T1HJ 4DX8H 4DSIA 5IOLA 2GQCA 2V8GA 3TA0A 1HHQA 3G4SS 1A9NB 4DEZA 2QC3A 2NUHA 2GO9A 1YHQS 3GJTB 2CG8A 2H1YA 3L7OA 4ZCIA 2KVQE 1YIJS 1RWXB 1O51A 3W2WA 1AW0A 4CYUA 1RI7A 3SQOP 2UUAF 2B51A 5J2NB 4ZVGA 1WKKA 2P9CA 4TU7A 4OJGA 2YH0A 1WC3A 2UV8A 3OTOF 2Y0SD 3MMAB 3BGOP 1O8BA 5A6PA 2M0GB 1Y11A 4LRFA 4RW8B 3ZZTA 5BXIA 3HD1A 2HEKA 5EX0A 2Y8WA 2CJ9A 4JYAJ 2O1PA 3NS5A 1TKXA 2GGPA 3E01A 5D0HA 5B08A 1JJ2R 5H9FJ 5KFOA 2MQPA 5ETMA 2ZH9A 2IA0A 5KFRA 4KV8A 3BBBA 3BJYA 4PXBA 3E2EA 3QO9A 3M8PB 3KNGA 5AXMA 3BQ2A 4DX5A 3CCVS 3ZTSA 4NLWA 3A8JA 3W9IA 4PQAA 3CCES 3KTQA 5KFTA 4ECRA 3EMTA 5JXSA 3MM7A 3UDLA
chains in the Genus database with same CATH topology
3DNCA 1N34F 2ACYA 1FHTA 1T94A 2W24A 4GKKF 3OVSA 1CVJA 1FA0A 2B5JB 2LQJA 1CQMA 4M95A 5CYQA 1IBLF 4DUYF 2CZVC 1Y3KA 5KFVA 4WK3A 2FJEB 4QOTA 2FVSA 3PW7A 2P6SA 5KFQA 5HBMA 2M5YA 4C8ZA 4NXNF 4NMLA 3R5CA 2XSJA 4QR1A 1RT7B 1N5YA 2C3OA 4O3RA 1JJHA 4TLRA 5F41A 2I9SA 4YY3F 4RX6A 2BQ3A 3MEGB 3MM9A 3BS9A 4KHPF 2MZQA 3V6DA 2N3LA 4GO7X 1HI1A 4D3GA 4P7TA 1KOHA 4Y00A 5J2NA 1XEZA 5CYMA 4I7FA 2ZBCA 4DN0A 2KM8C 4DV6F 3IR5B 1RP5A 2AGQA 1KTQA 2DGUA 5JUMA 4DR1F 3LAKA 3VWSA 1UVNA 2OPRB 1T8EA 1C0UB 1RTHA 5KG5A 3OJUA 1N54B 3DLLQ 3MUMP 3CJ2A 5BR8F 3R3TA 4TU9A 4OI2A 4DR3F 4G1IA 1XR6A 5LSLA 4N8OA 5C24A 4X64F 3Q23A 4DF4A 3PO4A 1JKHB 2ZDOA 4MKYA 4CO2A 2DNRA 3F56A 1QAXA 1FDBA 5CCLA 4Q0BB 1WHWA 1U1QA 1TKTB 3CEDA 4QIFA 4RW8A 3TARA 4OLPA 4DG1B 3CCQS 1X5TA 1JNZB 4ZK7M 1N32F 4U67Q 1C1CB 2LCWA 4CO4A 5DRKA 4WJBA 1KFSA 5CQGA 4G1QA 1FEEA 3TAQA 1FNOA 7FDRA 3EX7B 1HI8A 2BA9A 4ZS6A 4A47A 2IRUA 5LMUF 2QRRA 1VJWA 2YKAA 1W2IA 3G6ES 3R1LA 1TL5A 3H59A 3M1VB 3QIDA 2MSSA 4K4WA 2O01C 2WSFC 4AL5A 4DS4A 1RT3A 1EP4B 4CH7A 4X4PA 3PZPA 2Z2MA 3SCIE 2QIFA 3T1AA 1SC6A 2PD1A 4PG6A 3SSRA 1U2RA 2DH7A 1LWEB 2DITA 2X51A 4WXOA 1OPZA 4F4ZA 2OJ3A 2ZNZA 3PIPQ 3Q8QB 4YR0A 4A8OA 1Q78A 3GMGA 2AJ1A 3TX8A 5F9NA 2DR7A 3JTOA 4Y2CA 2WHOA 4DL2A 3HVTA 4RKUC 2DHSA 2YKNA 3M8PA 5CH7B 5IQ6A 3TUZC 5GADI 4PRFA 2MKSA 4QYRA 5L1LA 2MKKA 1VI7A 5LSOA 3KK1A 1Y7PA 1VQNS 5DQIA 2IBKA 1ZH5A 1YJTA 5KT2A 4ZKAA 4CTAB 2AYGA 3I9ZA 4EBEA 1BQMA 3HHEA 3UD3P 3IC1A 5JVGQ 4C4WA 3QIPA 1LV5A 2XMVA 3CJKB 3LWMA 1SJ3P 4NYZA 2EPIA 1E6VA 5B0DA 4NLPA 2DGXA 2JZ5A 5A8RB 1DLOA 3NCPA 3KLGA 1MU2A 4QWDA 4N41A 5HMYA 4TKTA 2QLXA 4K2XA 2CQ1A 1DZ5A 4JV0A 3PXGa 3IWLA 2XMJA 1WI8A 3M2VA 4ED5A 1ZOTA 3GIJA 4RBVA 4QIEA 4C3LA 3UD4P 4C11B 4XAKA 4F2RA 1NHVA 2YVSA 3P96A 1GTHA 2GCFA 3ONQA 2XS7A 2AW0A 1G6BA 2HZCA 3Q2TC 2Q3PA 2LQ5A 2NUUG 4O44B 5I3QA 3D54A 4CNZA 1F5BA 2NREA 2NXUA 4I2QB 4R8UA 1SI9A 4UOCA 2CQDA 3DLKB 5KFKA 2RUGA 4NOHA 1R31A 3HDSA 3U1MA 3MR3A 4RW9B 2R2SA 1U1PA 2GIRA 4DQSA 3RRGA 3SV4A 4I69A 1RT7A 1T7PA 3LP2B 4ED3A 3RRHA 4K4UA 3RB3A 1UETA 3PKYA 3MEGA 2OPPB 1L5UA 3CD7A 4ITSA 1Q8IA 2MKIA 2CJBA 2K1RB 5F8GA 4OHWA 2FY1A 5EUHA 2JLGA 4DR5F 2HWTA 3CSKA 4OJ1A 2AYBA 2LLZA 4NLUA 4B17A 3MAHA 1Y9OA 2ZHBA 3LALA 3M4XA 3MM5B 4G1PA 3KK3A 1H0HB 3CJ3A 2KVIA 4QIGA 5E2QA 1DTTB 3DLGB 2OSQA 5IZHA 4YEAA 4ECQA 2YWKA 2CPYA 1JKHA 2CPZA 1H3DA 3DXSX 1E6YB 3JTNA 2C2EA 4X4NA 4RZRA 4Q0BA 3S8SA 1RYRA 4IRCA 1WEXA 4RNNA 5B7WA 2MQNA 4DG1A 1VHFA 3THVA 3H4DA 3CDUA 1GXTA 3FQLA 1C1CA 4DBQA 4CI0B 1LFWA 3EUNA 1WHXA 4A48A 1Z2LA 3CT9A 2R8KA 3FDSA 2OTJS 3GZ7A 2GHPA 2NQPA 4DV3F 3TR5A 3M1VA 3QAEA 5HN0A 4MIBA 2VG7B 1U47A 1FRMA 1QY7A 1WEZA 3KK2A 3DDNA 5D8HB 4MK7A 2J7KA 3ETOA 2R7WA 2N4CA 3CCUS 3NCQA 1Y3JA 2QMWA 2ZOFA 2B9XA 4ZCMA 1OSCA 2PFFB 1LWEA 5BJRA 2MQLA 1H7WA 1PC4A 1YRTA 2UXBF 1X0FA 4PQUA 2V2KA 5K14B 2ZHOA 4NZ7A 2WTFA 2M9KA 1SBRA 5FDLB 2VFSA 4DQPA 1WTFA 4IH7A 3V2UC 3O1LA 3K59A 3J7YU 4DSLA 1Y5NB 4TXSA 1VFJA 4RUAA 1R8BA 5J2QB 1T05B 3TUJC 1FK9A 2WONA 2HVZA 3GG0A 2D3ZA 4LIWA 2FLLA 2R8JA 2PI4A 1ZZNA 2Q1LA 2RH3A 3KNAA 5ITHA 2VBYA 3MURP 1FDNA 1QE1B 2FC8A 3Q24A 2DGTA 1FRJA 4DV5F 4NLQA 2HVHA 4FBUA 2RNEA 3K5LA 4ED0A 2QSFA 1LXNA 4TLQA 1VOMA 2VPWB 4NX9A 5C25B 3DRSB 1M5PC 1I6JA 1R89A 4MKBA 4WU2A 3L7PA 2CPJA 5L9XA 4BCAA 1HBUB 1C2PA 1CG2A 2B4OA 3B4DA 2PN6A 4NLDA 1ZAWA 3QYYA 4DQQA 4USJC 4ECXA 1DHMA 1H38A 2XLKA 1RK8A 2X3GA 3CMES 2MY8A 2VFVA 4GO5X 4DL4A 3NMAA 2EFNA 4I2QA 1WD6A 2HRUA 3ICLA 3DLKA 3OTCA 2ZJQQ 2PEHA 1URRA 5L39A 4J9RA 5AXNA 2HFNA 4OI3A 2ZOMA 1H7XA 2YWFA 4RW9A 2MJNA 3BQ1A 2FIUA 1B0TA 5FD1A 1DQAA 1Y5IB 2B43A 4OJHA 4PUOB 4RW6B 5DDRC 2DO0A 2EI5A 1YJWS 2K1RA 3TAMB 1FESA 3GFXA 3TVKA 1JX4A 4HEA9 4IG3A 1K73T 1I1GA 2GQ2A 3IRWP 1VLYA 3GR0A 1QSSA 3F73A 2Z0GA 2FLNA 4LF8F 1KQSR 2YWGA 2J8AA 1J2VA 3QJJA 3MM5A 3U1LA 1JK9B 4K4YA 4CT9A 2KN4A 2ZVSA 3H20A 4BDPA 3FRYA 2AYMA 3MFHA 3GILA 4WIIA 4C8YA 4PWDA 1BLUA 2NLWA 1S1TA 1GX6A 2DH9A 3MGJA 1DTTA 3K8VA 3DLGA 2OD6A 1TFWA 1SKSA 3BREA 4TY8B 2PO4A 5I42B 1E6YA 2A1BA 2QYCA 4I1TA 1HYSB 2MQQA 2WB4A 4DV0F 2DT9A 3MXHP 3DRYA 4WXWA 1HNWF 2EC0A 2LECA 3T6JA 3TYTA 2W7PA 4A8KA 2DNGA 4C8NA 5C42B 4MIAA 3GWCA 2GMLA 1F9FA 2B7BB 1SH2A 3R5AA 2WCXA 3OL7A 2JH3A 3DLEA 2HNYB 2MKCA 2FHJD 3RAMA 2AF6A 1NK4A 3H98A 2HHPA 2JLEA 3BF4A 5J2PB 5KFNA 1Y0HA 2DO4A 4C3MA 2BR0A 4LIRA 4HHJA 4KQZA 1KS2A 2VG7A 5D77A 5G4DA 3EGZA 1WACA 4QU7A 4OX9F 1YJUA 2GJ2A 2IVFB 2FUG9 3ITHB 1CSJA 2VZ9A 3OSPA 3U02A 3DYAB 4XPCA 1M5VC 5IM0B 1S9FA 2DR5A 2M4MA 4NLVA 4W92B 1NH7A 4FN5A 2MXYA 2HS0A 1F5CA 1X8DA 4O3QA 1N88A 1TVRB 4HT7A 4L6V3 4UQTA 2G0CA 4IFVB 3HM9A 2J6SA 1SUQB 1ZM4A 2RQMA 2XSFA 3CWJA 4ED1A 2IRXA 2D1CA 2OPQB 3FJ2A 5FDLA 3AB2B 3KHLA 3DOMA 1N36F 2QZ8A 4ZLPA 3HK2A 4A4JA 1XK8A 1XBWA 1LK7A 4NLRA 5J2QA 4X65F 1T05A 1C4AA 3CCMS 3TW0A 5HP1B 5FLXY 2IVMA 3HP6A 5FJ4A 3OUYB 3HXMA 5L1JA 1WG4A 1QE1A 2KYXA 5F3ZA 1HBNB 3ENQA 3F44A 4KGKA 4DR2F 2R7UA 4MH8A 3K57A 3I4HX 1M5KC 2KU7A 2MY7A 3PDNA 1D3WA 4OJ3A 5IXUA 2Z2LA 3DRSA 3BM7A 1SL2A 4CCHA 5CXTA 4OMFG 1N5SA 2RB7A 2C3MA 2JC0A 1UW4A 2XBPA 4OZJA 1RDRA 4IKAA 2D3UA 3NRBA 2RF2B 1S6OA 3CCTA 2EBEA 3TO8A 2IAJB 4QBUA 3RW7A 5A8KB 4IO1A 1FNXH 4C97A 3NKYA 2VFRA 2GQQA 4EZ6A 1M1KT 3O3LA 2LEAA 4C7QA 2EFPA 3DI6B 3G9CA 3TOQA 1EETB 2VPYB 1PSDA 4M63A 2NPIA 4EGLA 2UUBF 4P2SA 2V8HA 4CO5A 5KT5A 4PUOA 4RW6A 4E0DA 2CQHA 2AJFE 4OI0A 4XPEA 4OL8A 2R7XA 2CKWA 3TAMA 4YR3A 3CVKA 2FJBB 1X4FA 5F0WA 2HHQA 1S1WB 3FEYB 3HMJG 3RAXA 2RQ4A 1IJEB 1S99A 1X4HA 2CRLA 2GO8A 4FF2A 4ZVHA 4J9SA 1UEVA 4IQXA 1DURA 4UY8T 1MW7A 5DGAA 2FGOA 4ETXA 3IWNC 1SJ4P 1AFJA 2ZE2B 3NGKA 2UZAA 2GHVC 4X4QA 1XC9A 1Q79A 1F2GA 1R0AB 4USIA 2BJDA 3M8QB 3VALA 2F8MA 3PFOA 2DISA 3D28A 4M1KA 5E3CA 2R2RA 4FS1A 4MTPA 4PXCA 2UVVA 4B9MA 4DSKA 3KLIA 2GJIA 3KMQA 2VG6A 5I42A 4YB1P 6FD1A 3JYTA 3MCSA 3B8HA 5GAHI 1DARA 4LFCF 1S10A 1DBDA 3DU5A 2CJAA 4Q5VA 1D9DA 2B7CB 3CD0A 1U6BA 2CPEA 2HFZA 1FNMA 4NRTA 2ROPA 2KXHA 5C42A 4TY9A 3C6UB 3CDBA 1NAQA 1H6KX 2YWEA 3HF5A 4F4XA 2HNYA 3RW6A 4J9LA 4B9UA 4KB7A 3D0GE 3DFEA 3B78A 3VAKA 5J2PA 1FJ7A 3NLCA 3M6UA 2XEXA 4N56A 2GX8A 2M2BA 4V19J 3VZIA 3P49B 3U1NA 1V3RA 1N0UA 1JB0C 1Y4ZB 3M32B 3KMSA 3MD3A 1SV5B 2HNDB 5IM0A 4WFNQ 2QV6A 5DG7A 1NJZA 2Q6BA 3IRXB 1NB7A 1TVRA 1KHVA 4QU6A 1OWXA 4IFVA 1SUQA 5KFFA 2E44A 4OIXA 5LXRA 1IQZA 2R7SA 5M2UA 4O4RA 2VC0A 2OPQA 2VH7A 3CCWA 3M2RB 5AE3A 3M8RA 1NEEA 3DXBA 1HHTP 3I5AA 4UQGA 3G71S 1RA7A 2LQBA 2QLWA 2F9DA 4HDGA 2FLOA 1LWFA 2J9DA 5KT4A 2QA4G 2EK1A 1GH8A 1P6TA 5HP1A 1WHVA 3K58A 3DHWC 4UW2A 1YSJA 4EBDA 1D8YA 4CT8A 1CC8A 2FLPA 3N79A 5LL6d 1FE0A 2MZSA 1HBNA 2ZDPA 4ZVEA 5EWFA 4C8KA 4LFAF 4QCLA 1RGVA 3UCGA 4LF9F 2MQMA 4WFBQ 4ED6A 3CTRA 2PA8D 2HHWA 3HFKA 1N6QB 2JHEA 2YKPA 1UL3A 1A7GE 4YFUA 4J9NA 1HWIA 2RRAA 1VRUB 4AFFA 3H5YA 3EPIA 4B9SA 3OXLA 1KRPA 6FDRA 2IAJA 5HMXA 3T6BA 4O3SA 4OHYA 3V81B 4F3MA 3BGLA 5A8KA 1FE4A 4DV2F 1DAXA 1BQNB 2VUGA 1RT2B 3HVRA 2QE5A 4PWUA 4DV7F 2KO1A 3I6PA 1LWCB 1FD8A 4KE5A 3DI6A 3N5BA 4A8QA 1JJ4A 2F7VA 4QIVA 1EETA 4GMKA 4BHQA 4URSA 1YRXA 5IQQA 1H2TZ 5GADU 3JTPA 1UVJA 2L08A 3CD6S 3QJPA 3NBPA 1G3OA 1T03B 3E51A 4I56A 3PX4A 3I4PA 4N8NA 2CQ0A 3AA9A 4DSEA 1IKYB 3V5RA 1R8HA 1RT6B 3DC2A 5AE1A 1U8SA 5L8RC 2Y1JA 5KTQA 1S1WA 2CQ4A 3RU0A 3JB9k 3PEHA 1LXJA 2AJ0A 1RKJA 4G6VB 2VONA 3US5A 2UXCF 1RT5A 2O67A 3AHPA 1X9WA 5SUHA 2M7SA 3OLBA 4A8FA 3MOJB 5MAOA 4JI5F 3M6VA 2J6TA 4H4MB 2ZE2A 1TFYA 2NR0A 1R8PA 2ZH3A 1R0AA 4ALZA 2XWXA 5A6WA 2M3DA 3M8QA 2XGPA 4JOUA 2I8EA 3R27A 2A2DA 5H1SV 1S6QA 5KFCA 1Q81T 2VBWA 1Q82T 3MECB 4C8MA 4AXIA 1HW8A 1N48A 2RMLA 1KVJA 1H98A 3OV7A 2HS3A 3GV7B 1RTDB 2UVRA 3IG1B 5D4OA 1NJYA 4KO0A 2V4RA 5IT0A 3CF5Q 2J5AA 1YQHA 3A8EA 2E7WA 3EZUA 4MIWA 3CMAS 2RVJA 5E3AA 3RYLA 4DFKA 3SI8A 3KOAA 3IBWA 4KTQA 4B3OB 3C6UA 2QT7A 3I82A 5AE2A 4Q44A 4M5DB 2OKQA 1VQ8S 4DL3A 3NNCA 3ZZ0A 2KFNA 4IFYB 4PG5A 3MFIA 4QPTA 4Y0FA 3T1YF 2VA2A 3M32A 5K8PA 3NAIA 2HNDA 1IJFB 4HTIA 4EWTA 1NJXA 4Y6IA 4K0KF 2P6TA 5GVQA 1HW9A 1N0VC 1S1VB 3IRXA 4DS5A 2OFGX 5J2MA 1X4GA 5D6GA 1QSYA 1SKWA 3T9NA 4GC7A 1P27B 2I2YA 3MDFA