1N36F

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n36F00
2KJWA 4LF4F 4B3TF 1G1XA 4B3MF 3T1HF 4AQYF 5IWAF 4DUYF 2B7BB 2VQFF 1XNRF 4DR4F 4JV5F 4JI2F 3OTOF 2KJVA 2F4VF 1N36F 4DV2F 5BR8F 4DR2F 4K0KF 1N34F 4OX9F 2UUBF 1IBMF 4LF6F 4DV0F 2B7CB 4YHHF 4JI1F 1N32F 4NXNF 1HNXF 4JYAF 4GKJF 1GH8A 4JI0F 4DR3F 4DV6F 2E5LF 1LOUA 5LMUF 2BXJA 1F60B 1B64A 4LF9F 4DV5F 4JI3F 4JI6F 1FKAF 2RJZA 2YY3A 3ZZPA 4DV3F 1G7CB 1I94F 2HHHF 4X65F 1IJEB 5AJ3F 4DV4F 2UUAF 5LMNF 4DV7F 1XMQF 1XNQF 1FJGF 1IJFB 1RISA 2ZM6F 4DUZF 4LFCF 2VQEF 4KHPF 4DR5F 1VMBA 4X62F 2BVZA 4LF5F 1HNWF 4GKKF 1N33F 1QJHA 1HNZF 4JI8F 2UXBF 1IBLF 4DR7F 4LF7F 3T1YF 1XMOF 4LF8F 4LFAF 4JI5F 4B3SF 4X66F 4DR1F 4LFBF 3R3TA 4DR6F 2UXCF 2UU9F 4DV1F 1J5EF 1IBKF 4JI7F 1CQNA 4YY3F 1HR0F 4X64F 4NXMF 1CQMA 4B3RF 2J5AA 2UXDF 2UUCF 4JI4F
chains in the Genus database with same CATH superfamily
4HR2A 2F1FA 3MEGB 1L3VA 5IWAF 4ED5A 4M5HA 2C1EB 3M1VB 1NSPA 5F3TA 3S7RA 4WTYA 3H20A 2VIHA 2XWYA 1NKBA 3GP9A 1R0CB 4ZLPA 3HHLB 4DV0F 2J7KA 2VH7A 3HKZD 2F4FA 3MM7B 2B6AB 3B82A 4DN9A 2EFGA 2QC3A 2JEJA 2PN6A 1KN6A 3NGSA 5H1SV 2K1RB 1YTYA 2HNZB 3HSJA 2D1CA 3J81j 4DMZA 2Y1IA 1DTQB 2B4UA 3MM8B 5A2QU 2Y1JA 2OPRA 3EGVA 2FLNA 2QJ3A 2FHJA 3M9NB 5KFGA 2LQJA 2KYXA 1CJUB 5ETSA 1VQ6S 2K7KA 4ED4A 4J9OA 5HVFA 4ELUA 2V8PA 2QL5B 4NXMJ 3DM2A 3PW2A 3M8QB 4W90B 3M2RB 4DV1F 4IOCQ 2ATLA 2C3PA 1Y4ZB 3IWLA 4CT8A 3PTWA 4EZ9A 1R0AA 4OI1A 3H5XA 4LBHA 1PO6A 2C42A 3P3DA 5EX0A 2OD6A 4HHJA 3D7SB 5JMNA 2I2YA 2DR6A 3LA0A 4ELTA 4WP3A 1LWEB 4YHHF 1N32F 1YK9A 1UCNA 4HYKA 1JLBB 3FJ2A 2MHEA 5BYRA 3CDEA 1Q79A 3OV7A 4UW2A 1VQ7S 4KR0B 2AEFA 2HNYA 2Q3PA 1UW9A 2ZZTA 2CJQA 3WX4A 2E1PA 1IWGA 3I0RB 4MH8A 3GWCA 1UEVA 4NPOA 1FD2A 1JIHA 4NLGA 2HQCA 3SCLE 3C19A 2OKQA 4I2QB 4R0EA 2I5JB 1NDLA 2MYFA 1GFWB 5J1EA 1FEEA 3HX9A 2WRMA 3I87A 3FRYA 3AJ1A 5HQ8A 4KHMA 4UT4A 1U2RA 4X4TA 3PXGa 2IDLA 3KFWX 3CJQA 3A3NB 3NWRA 2XMKA 2UUBF 4LF6F 3DLKB 1F3VA 4DWIA 3QWUA 3HKWA 1ACMB 3TUJC 2HWIA 2ALZA 2RH3A 3VWSA 2BJ7A 4M63A 4C8ZA 4B9NA 1KHVA 1NRKA 3M6XA 4OYIA 2QMWA 4IRDA 2YY3A 1IKYA 4X84A 1CJTB 3QYYA 4C8MA 1Y3JA 5D4OA 1XMQF 3KXDA 1S6OA 2ACMA 2ZJQQ 2XMAA 2ERRA 1VBXA 1CBKA 2F3JA 4J9RA 3NL0A 2ZE2B 3NAIA 4H54A 5KFZA 2FGCA 1RHJB 4NCBA 3GJSB 1YJ9S 3PKMA 3PHTA 4URSA 2N7YA 4ZLJA 1H3DA 4Q2LA 4LFBJ 3MWBA 3CW2C 3MCOA 3UFCX 4YR2A 3KLGA 1IR2A 1V5VA 1SI9A 2FYXA 3I0SB 4K4YA 1IKVB 3W2VA 3IN5A 1EKRA 3HHLC 4RBTA 4IRKA 4EU0A 1K9MT 2JEIA 4FYVB 5ETKA 2V2QA 4UUXA 2OGUA 2JC1A 5K8NA 1PYTA 1VBYA 1U48A 3D5MA 1VQKS 2GHPA 2NYHA 4KGVB 2FPHX 2ASYA 3TQ1A 1OS5A 3VAGA 5DM7Q 4P75A 1NLKL 4PXDA 2EXUA 4N56A 1KHWA 2U1AA 2AD9A 3C66A 3TP2A 1G7CB 2L41A 4DR5J 4PRFA 1RTDB 1R27B 4CO0A 3H4BA 2WVDA 3PM9A 2FC8A 3ZNJ1 4PQUB 1ROFA 3IM9A 3IGVA 3ILJA 2DRDA 5C24A 3DLEA 2EKYA 3K5OA 1IXKA 1KBRA 2CZ4A 1F9EB 1EZZB 1WKKA 1I5OB 3DKDA 1OPIA 3GSIA 1WKLA 3KK2A 2OEMA 4GVBA 2OMOA 3IBWA 1HQEA 2HQDA 4OZ1A 2JOQA 1TKTA 1WHVA 3R7NB 4C8YA 1CJVB 1YLXA 2MQLA 4WIQA 1HPZB 1K47A 3V81A 2BBEA 1JK9B 1O51A 3M05A 4NXNF 4KKOB 2E7WA 3SMZA 4DS5A 2B56A 1NDKA 2MQOA 3G6VA 3TR5A 1SJFA 2MZQA 4F8RA 3M2VB 4BBYA 2YKOA 3US5A 4ID8A 2W8LA 3AQPA 4QIFA 1TKXA 3QGGA 4MYTA 1FDBA 1KLMB 2ZBPA 2IJRA 4KHPJ 4N8NA 1T95A 4I6YA 2R8HA 2DXFA 2BW2A 5CYQB 2LLZA 2YKMA 2MQ8A 1NDPA 3ZXWA 3V4IB 4Y00A 2MLYA 3KLFA 5G4DA 3CTRA 2R7RA 3HMJG 4J9PA 1S0NA 1SUQB 2KT3A 4AUKA 4O0IA 3AT1B 4LF1A 3QNWB 2AV5A 1KTQA 1HWLA 1IBKF 1S6QA 3MD3A 2VU5A 1HQUA 1TL1A 2GIFA 4NRUA 5KG0A 3TJ8A 4O44B 2R9LA 3OJSA 1GNKA 1RA6A 2A3JA 1VQSA 4ELVA 5KOWA 2VQFJ 5KFDA 3PJXA 3VGUA 3D1HA 3RZAA 5KFWA 4P72A 2G1DA 5M2UA 3ICLA 1YX2A 2M88A 3D66A 2PI5A 2HS0A 3NP5A 4DL3A 4M5DB 2GQ2A 3V6DB 3GJRB 2YKPA 2LECA 2B9YA 1RHUB 1UZDA 4CLTA 1IBLJ 3NGTA 2VFSA 2GQQA 1KVKA 5IT0A 5HJYA 3BH7B 1AT1B 1HNWF 2W7OA 1SJ3P 2DGVA 3NNCA 1VQNS 3SQGA 1JLEA 2VG5A 2EI5A 3ZZTA 3ZTRA 1TVRA 4DQIA 1BQMA 3QATA 2AMCB 3L7OA 2D9PA 1B99A 1X4BA 1WF0A 2DNQA 1HYSB 3H42A 1DRZA 1LXJA 4A4JA 3H40A 3VVUA 3C15A 2Y3YA 2OPQB 1QAYA 4GC6A 1WDTA 3BZQA 1A6LA 2RILA 4NLVA 1VBKA 4QWEA 2C2RA 2EVZA 2QA1A 3EGWB 3L7PA 4K4VA 3I4PA 1X4DA 3HCXA 1FJCA 2OTLS 4FDFA 5KT3A 4ZP7A 2ASJA 2W9CA 2BRLA 1FJGJ 3M6UA 4HACB 1R89A 1L3SA 5AXLA 5ETQA 4DFMA 5EHHA 4RNNA 1SH0A 2J9DA 1Q95G 3PYEA 2V67A 2B5JA 1AYEA 1TR0A 1SL1A 3EVWA 2N3OA 4F4XA 2PMZD 1FD8A 4C3KA 4HHHA 1JLGB 3DHXA 2VB6A 4HLBA 2M7SA 3U27A 1X7VA 4QQBA 3ENAA 1NZ8A 4RBVA 2GGPA 2HQFA 3GFHA 1M5KC 5IXUA 3NGKA 1HBUA 3DRSB 4DPTA 2CQBA 1T9YA 1QLNA 2R8IA 3VAFA 4MAKA 1H2VZ 4Y2CA 4DR3F 3FSYA 4H4OB 2COLA 2ZH4A 3OVBA 1UL3A 2EFNA 4YFUA 1NK8A 3N28A 4NEYA 4G3IA 3CCJS 4USKA 4LFCJ 1FX4A 2XC9A 2VOPA 1K8AT 1PKUA 5KFJA 2DNLA 3IS9B 1H0HB 4J9KA 2YKNA 1VRTB 3G6ES 3ILIA 1Q7LB 3DDNA 1EB0A 5HROB 2XSJB 1U1QA 5K8PA 5KT6A 3M32A 1A7GE 4F7VA 1FT8A 1H7XA 4E8UA 5HMYA 3DHWC 2ZITA 3R1LA 5LSOA 2ZC4A 2UXCF 1QM9A 3EE3A 4K2JA 2BQ3A 1JJHA 4JI7F 3G6YA 3KOAA 4Y34A 2NCKL 3MR7A 3UD5A 1XERA 2V68A 4MMOA 1JLAA 2XNQA 2GVDA 3FC9A 1XTZA 2MKHA 5KG6A 2CWXA 3KYLA 2R4FA 3Q8SB 1WNEA 1FRXA 4K4UA 4OI6A 3B78A 4I64A 1GMVA 3DYAB 2OEKA 1PIEA 3M2UB 4ZS6A 4I7FB 2UP1A 1P27B 3OXFA 3K89A 4HDHA 1CJKB 4JUZA 3EWGA 3MR5A 5LM7E 2PMHA 4CDIA 3N6LA 3GFYA 2VHGA 3OXGA 2YQ1A 4DG1A 4B3SJ 3ZZ0A 1N52B 1FK9B 3N5FA 3MM6A 2J9EA 4BWJA 5K9FA 4X66F 1L3UA 1RAAB 4ZJQA 3D4JA 9RUBA 2IHR1 2CDQA 3LGNA 1T9TA 2YNGB 1AUDA 5H9EJ 1VQPS 1EX8A 1UMJA 1RXOB 4JYAJ 1DJ0A 1N56A 2MZJA 2XTJP 8AT1B 2MQMA 4OX9F 2PFFB 3V2UC 4RUHA 3OFFA 2FVCA 4Q45A 5L9NA 1Q86T 4HI2A 4RNHA 4U96A 4Q7AA 3TYTA 4LRAA 2I9SA 3CMAS 2ZUAA 1WC6A 4X4NA 4DV3J 3BEGB 4J37A 3M6VA 3EUNA 1YJUA 3VV2B 5LMNJ 2QFJA 4CZCA 2P5VA 4WU3A 4Y2IA 2OTJS 4DX6A 3QIDA 3A3PB 3PO5A 1FERA 3GFXA 2ZH9A 5IT4A 3G8QA 1LK5A 1LEOA 3R5JB 4LF7F 2B3TB 1RAFB 2R7UA 3D6FB 2RHSB 2HQIA 2EFQA 1Y5IB 1O0PA 4Q8EA 3W2WA 5HQLA 4B08A 2MKKA 4DHVA 4LQ9A 4LVOP 1BY9A 4LF4F 3MAHA 2LXIA 1F2GA 3GTYX 4B9UA 5A0YA 1UVJA 1VRUB 1WC1A 1Y5LB 3ETOA 5D4NA 4OL8A 2HWHA 3OFHA 3F44A 4X4OA 2CJXB 3JSMB 3RBZA 2DK2A 3C6TA 4B3OA 3UDLA 2R2RA 4FS1A 2RNEA 4OYXA 3T9NA 4NI2A 1V3ZA 1TKZB 2BJEA 4MFBB 4HTJA 3GIJA 1PYSB 2YH0A 1CS4B 1F9FA 2OAUA 4F4YA 2KZMA 5B7WA 4KGXB 1M5HA 2GVZA 2BE2A 3M8YA 5HL7Q 1Q4RA 4OZ0A 2QRRA 4O3PA 4LFAJ 1TU0B 4DF8A 3U1MA 1S1XA 3RYLA 3G4SS 2PE8A 1NJYA 2LXFA 4KBIA 2KB2A 2OPPA 2X1FA 3D6TB 2NUUG 4DX7A 3CJSA 1VS3A 4NXMF 4DR4J 2UXDF 5J2PB 4MYUA 2C3YA 7FD1A 4WKRA 3GIMA 2IRUA 2ZH7A 4K4WA 5E0OA 1T8EA 3H98A 1PBUA 1JQGA 2ASDA 1PBAA 2CWKA 1GT8A 1ZOTA 2FC9A 4M5GA 1RT6B 1K73T 4YB7A 3PR5B 3GV7B 2GIQA 5AXNA 4UQTA 4TU9A 2IM1A 5F8HA 2CQPA 1H73A 3PRDA 3NWGA 4QR0A 5I3UA 1T03B 4K8RA 3L4BC 1ZZFA 3ULHA 5T14A 3KHLA 1S4FA 5K20B 1OPZA 4DV4J 2F8MA 4NLTA 3LANA 4ED3A 1WOPA 1ZPVA 3AFGA 4EO8A 4ECTA 4X64F 5EDWA 4P74A 4ZVPB 3QT5A 2XLIA 2YX7A 2F4VJ 4QU7A 3MM5A 4LMZA 4QYRA 1BUXA 1RE1B 3BKTA 1N5YA 2XWXA 1HHSA 5ETOA 4FXDA 3CCRS 2D69A 4RR5A 4OHWA 2JEGA 2GAHC 2QV6A 2DNHA 4OZ2A 4TQSA 3H8YA 2GC8A 2H51B 4PPDA 5J1EB 4NOHA 3TAPA 2L9DA 2RU9A 4QZVB 2A6OA 5KFNA 2A1BA 2HLUA 5GMDA 1NK7A 3FBBA 4LF5J 3R6LB 4DR7J 1K0TA 3LW5C 4ECQA 2FTRA 4NYOA 1J27A 3GV8B 1VK8A 3D3CJ 3EZUA 3MM9B 5KG2A 1R8PA 4F3QA 2I0XA 5L9XA 3HZGA 4YOEA 1GXUA 1M5OC 3DRXA 2DITA 3C14B 3V6HA 4C0OC 1K44A 4Y2AA 5D3GA 3LPEA 3LTOA 4J91A 1IKYB 2OO4A 4WWSA 2VG6A 3R5BA 2LP4A 5KFMA 1CVJA 4OLPA 1WHXA 1RT7A 1VIXA 4ZJLA 2YPYA 5HP1A 5LJ5Y 3C16B 2NS1B 4OJ1A 4DN0A 3LP1A 3VQSA 2FZGB 4PZVA 5D15A 3FSIA 1A9NB 3OLAA 1F6TA 4ED7A 4IRCA 5E3RA 2HPUA 2ZUGA 3KLGB 3ZZYA 3FFIA 4OV6A 1VIOA 1VRQC 3W2VB 2C2KB 5E5NA 1RT2A 1S1VB 4RW8A 1GXTA 4DR5F 4ZCKA 1QSYA 2BVZA 4ZA1A 2C3MA 1WOOA 4UTGA 4X4QA 1LNQA 2QEXS 2X1AA 2JSXA 1FO1A 2IYIA 3TX0A 2ROPA 2XLJA 3DLGA 1MROB 1HNIB 1H2TZ 1RTHA 3RBDA 1XWLA 4YR3A 4QBUA 3TVYA 3WHIA 1ZZNA 1BWVA 2E9TA 4KY3A 1XNRF 1LXNA 3WQPA 2BQRA 4CP5A 5JJBA 1KS2A 1UVIA 3WIUA 3MTKA 5C24B 3QO9A 1YJTA 3T6JA 3GYNA 1WHYA 1LWCA 1S7HA 1R3NA 1HQEB 1Y0HA 1TKTB 1FKOA 4NLQA 2ZM6J 3QAUA 3MEEA 1EETA 1A0OB 3M9MB 1N33J 2EFPA 4IQXA 3OR1A 4I0WA 3MMCB 1UEUA 4DL5A 4KHPF 1REVB 2P6SA 3FMWA 3FCHA 1JWWA 2QFIA 2KG1A 1H7WA 4F02A 5KT2A 3BR9A 5DG7A 4ECWA 1Q1KA 1YZ7A 5CXTA 4EBCA 2Z30B 4XTTA 2JLGA 4EEYA 2HS3A 1CQMA 1TUVA 2ZH1A 1NEEA 3W63A 1TKXB 1HI1A 2WONB 3FKBA 1UVLA 3RJMB 1KWMA 4DUYF 2CQIA 1IBMJ 2RS8A 4RLEA 2ZNYA 4DPXA 2CPIA 1U24A 1S5ZA 3UN5A 2CQ0A 2AEJA 2MSSA 4P2MA 2YKMB 4WE1A 2RU3A 3MCMA 3TJAA 2DNYA 3LAKA 3Q86A 5LXRA 3TARA 2CPEA 2ZKUA 3QMQA 3VTIA 3I82A 4IH6A 3ZTPA 4OYWA 1U45A 2LEAA 4DL6A 4DUZJ 4TKTA 4V19X 1WC0A 3PCOB 4X62J 1AXQA 3D9BA 3Q8VA 5IOLA 3OTEA 1I51B 3O6QA 2RE1A 3FCWA 4CLZA 2GX8A 1SIWB 4X4UA 2GIRA 1IBLF 5AE1A 3IWXA 4DX8H 4B3RJ 5CA5A 3E8OA 5C7PA 2Q79A 5KFSA 4NLOA 1Z2LA 3MEDA 2MKSA 1OSCA 3W64A 1NAQA 2UV8G 2XO7A 3E51A 3OHBA 1EP4B 3O3LA 4HI1A 3BGUA 5D4PA 1T9VA 3SQGB 3VZHA 3QRRA 4EYIB 3THVA 1UKUA 1TELA 3GCXP 1DLOB 3MAAA 3MZIA 1X4FA 3L3CA 1T11A 1X5PA 2AIRB 2WSEC 4WXWA 4HT5A 1B0PA 5B0FA 3CO9A 2FVPA 4TU8A 1U8SA 1FJGF 3N6MA 1RISA 5ETTA 4U7UD 4QPXA 1MWQA 3BO4A 3BPDA 3IP0A 3I56S 2AGOA 1C0TA 4DCJB 3MMAB 3JYTA 3PYFA 2K8GA 1TL7A 4DFJA 4FF2A 3ET6B 5KG7A 2EBEA 2V0NA 7FDRA 1LW0A 4PXEA 3MUTP 2PD1A 3KUHA 3KDNA 1NMEB 4QYZJ 1TK5A 5HLFB 2W7AA 4QPTA 2IRXA 3NBPB 1P9YA 3QBCA 4AL6A 4OJHA 5B09A 3BV8A 4ZJOA 1G4CA 3CJ2A 2B5JB 5K5MA 4DQQA 3EYZA 2PEBA 2Z56B 5LMUJ 2HGNA 3UR0A 1RT3A 1KNZA 4E0DA 1N34J 4JI3J 2UUWA 2AT1B 3I9V9 4NMXA 1JMTA 3HLUA 3FQLA 2V2ZA 3MD1A 2QL9B 3DMJA 3B6BA 4C0BA 2GGPB 4FF4A 1F2HA 1HBMA 3UNYA 3CVKA 3WBZA 3ZZPA 3ELHA 2JWNA 2HHQA 2NSBA 1GAOA 1NB7A 2HAFA 2YWFA 4USMA 2ZH6A 1FRMA 2DGUA 3V6KA 1HBUB 4LFCF 3WC2A 1GTHA 1X0PA 3QZ8A 2DHSA 3SBMA 2CNLB 1S4EA 2E5IA 3DU6A 3DOLB 1UZHA 1NJXA 2I38A 3ZZZA 1SB6A 4NZ7A 4LVNP 3FNNA 3NKYA 5M2PA 1B3TA 1YJRA 4OHYA 3KK3A 4Y6IA 1RACB 1NNDA 2AYEA 4IR1A 3EPGA 5K14A 1Q0NA 2YKNB 2CPZA 3RR8A 4C98A 2DNGA 3I6PA 4ZLNA 2D9OA 2YKAA 4KV8A 2GAGC 4IOBA 3M32B 2CG4A 4ZHRB 4OYMA 1LK7A 1FF2A 1NKEA 1KOOA 4Z7YA 4HL9A 4CLUA 3IG1A 3BO3A 2KHCA 2PA3A 2FHMA 5DG9A 4TYBA 3MDFA 1PAUB 2GVDB 2WOMB 4DL2A 1FVSA 1R6YA 1FNOA 2HHSA 3QAEA 4OYZA 2FUG9 3CC4S 2LYVA 1UJ4A 4O23A 2OMLA 2LU2A 1SH2A 4EWTA 3OTCA 5F3ZA 1RLDA 2KZZA 4B3SF 5IFMA 4F4KA 3BKFA 2E1AA 5D0RA 3X3UA 3J80U 4ER8A 3FDSA 2X3DA 1S1UA 2IVYA 5CD4A 1VGYA 3D67A 2Z58B 2C2MB 2JJ4D 1Q7YT 5T7LA 3R1HA 5KFIA 1SBRA 2CJYB 2H65B 4TLQA 4DG1B 4JI0J 4MT1A 1SXLA 2W7PA 4L6V3 5IV3A 2MZRA 3MM6B 2FHKA 5KFKA 1QAIA 5E7OB 5C42A 4JYAF 4DFPA 1DARA 3AD8C 3IBCB 2HFSA 3CCLS 3C3LA 2ZD1A 4KPCA 5J2MA 4JV2A 3O2IA 2AGQA 1U6FA 1RHMB 1MN9A 3BDEA 1IUJA 3EGNA 2HFZA 4DV3F 2RDDA 3EJMA 1S1WA 2HK3A 5LMNF 3UN3A 1NPKA 2YNIB 2LCWA 4CLPA 4ECVA 5HMWA 2FVRA 5JUMA 1AA1B 5D77A 4YUDA 4L74A 2DGOA 3MOZA 4USWA 5CHCB 2MLXA 4USHA 2BE9B 3I96A 3IAS9 5FDLA 1JJ4A 4K7QA 2ZH2A 2XLKA 3EMTA 1U2FA 2K3KA 1F1BB 3RGIA 4MJKA 1JLCA 3MTJA 1RWXB 3UNGC 2ZOFA 3Q24A 2G2YA 4DQPA 1UPMB 4ZKAA 1SKWA 3CMQA 4P73A 2OIHA 1R0BG 2V5HG 2DISA 3R5DA 4KAIA 1S97A 2QX0A 3BBCA 2XS2A 2V94A 3TWZA 5A2QY 2YQ0A 4C8LA 3ONQA 4ETXA 4Y0FA 2MZSA 1VHFA 5GAHU 5IV4A 1DTTB 4OI2A 2ZHBA 4CH0S 1NK4A 4LFAF 4JI5F 2JLEA 3GV5B 1UAWA 4KT0C 4IO9Q 2BDPA 4NI2B 3H2LA 4FF1A 2R42A 2R7QA 3AOCA 3LGHA 5DDOC 2UUCF 4QWDA 1N5TA 5KFCA 4R5PB 4RU9A 2BE2B 1I6JA 2VA2A 3I5BA 3P6YC 4DR4F 2G13A 1RT1A 1FKPA 4DSIA 2V2VA 1S1XB 3M8PA 1N0VC 2QSWA 4NCGA 3H59A 3AHPA 2LXUA 5D4LA 4G65A 2OPPB 1JXLA 2I8EA 3KUEA 1JNRB 1UWAA 2CJKA 3RG6A 2L9WA 2ZJPQ 1F60B 3G2XA 1YG0A 1B7YB 2YNHA 2B9WA 3K59A 3MCSA 3NOGA 3EXYA 2H5JB 2RIJA 4N8OA 4NLUA 1Z2ZA 2HHVA 1JXEA 4F4WA 2Y8WA 5B0GA 2DNMA 4Y65A 2HFNA 2CVIA 1X0FA 2IIHA 1C2PA 2NPFA 1BD6A 4AFFA 1NU4A 1YIJS 1H72C 4MK8A 3CT9A 2D3OR 4NLYA 1MWYA 2C28A 3T41A 1AFIA 4CI0B 4ZN1A 3K5LA 5C2CA 3MPVA 1VLOA 3SV4A 5I3UB 2QLXA 2G2ZA 3TUZC 4CLSA 2WVEA 5A8WA 3Q8PB 2IYGA 3HVRA 3IO1A 5EWEA 2F4VF 2EK6A 3FMBA 1GX5A 5D0EA 2ZBRA 5GADI 1G6BA 5KOXA 3MURP 4PXBA 1WJ9A 1QVFR 3CB4A 3SIPB 4YDDB 1YDLA 1H2UX 3CJKA 1NK0A 5L1LA 2G9OA 1YWXA 4ZPDA 3S6EA 2M0GB 3ENQA 1TAQA 3RB6A 1X4EA 2R8JA 5E3PA 3MM5B 1GTEA 2RKIB 3ZZRA 2F8HA 4W4MA 4CH1A 1G3OA 4HEA9 1U1KA 5M2RA 4DFKA 5KFAA 3L7UA 3OXLA 4LF5F 4DR6J 1KFDA 4A47A 2HHUA 4DR7F 3EDQB 2RSQA 2Y0BB 3DN9A 2E7XA 3W8PA 4P2SA 1C0UA 1EARA 1AZSA 3ZC4A 4P71A 4OI0A 2IFXA 3BPSP 3LOUA 2GMJA 3EICA 2R8GA 3BQ0A 2PSZA 4KB7A 1U02A 2ZBCA 2CJAA 3EZOA 4NWBA 4DSKA 5LL6d 1CULB 4LF2A 5GAGI 4QIWD 1U1NA 3DDKA 3S1TA 2CPHA 3CJ8A 2HHPA 2XEXA 1S72S 1PILA 1XR7A 4A8OA 4NX9A 2HGLA 3PFEA 2BJ1A 4FKYA 1UA0A 4I1TA 4LSLA 1ICEB 4OYPA 4F36A 3BN4A 3TUIC 3HHLD 1RKIA 2VKZG 3NY0A 5HMZA 1RWVB 4I67A 2BANA 5HP1B 1J5EJ 1YBTA 3GU0A 5GADU 3LP1B 3HD2A 4CTAA 1FI4A 4ETZA 5D8HB 5HMXA 4JI2J 1KR4A 4FF3A 2XCPA 4RW4A 3UO0A 1QDUB 5DM6Q 1VJWA 4NLSA 1Q78A 3GIRA 4RW6A 3A4TA 4JI1F 3CCVS 3GCWP 3MI7X 3DLJA 2HQGA 4O4RA 3VGSA 2IAJA 4F0HA 3A13A 5F41A 3DXSX 1D09B 2YX1A 3NNAA 1OIAA 2AJFE 1RTHB 4FYYB 4E2FB 5L1KA 2F8EX 3KWMA 1F5CA 1MMLA 3C8YA 1RYRA 3J81U 3I9ZA 1L3TA 3GG0A 1D9DA 2ZVSA 3NOCA 3VF0B 2ZM6F 2EK1A 2BQUA 4OZ5A 2PDAA 3QO9B 1N33F 2W24A 3HULA 1LWXA 4ZVSB 1N8RT 2O67A 1E6YA 1S10A 1RAGB 5HBMA 2B51A 5KAKA 3SEOA 5H9FJ 4NZ0A 4J7CA 3SDEA 3HDSA 3DXBA 3TVZA 2BJ9A 1Q8KA 2CADA 3MEEB 1EETB 5CCLA 1REGX 2FJBB 4NRTA 2DH8A 1HNXJ 2D7SA 2X1BA 4NASA 4W92B 4KH1B 2QA2A 3O8WA 4CLKA 1IBMF 5EUHA 2Z57B 3K5MA 2EG1A 3T5JA 1X4CA 2R7SA 2LFVA 4YN3B 5A6WA 2FDNA 1GK8A 4OIXA 4A8QA 3DGPA 4ZPBA 1HI8A 4F04B 3MR3A 4OJGA 2VFTA 5HJXA 1HWKA 5CABA 4X4VA 4DV7J 2DR5A 5DLFA 4HKQA 4K5SA 2QGFB 1RWUA 4H4MB 3KUGA 5CZXA 2V4QA 4TU7A 2OLWA 3GILA 4DUZF 1NCLA 3RBXA 4WE1B 1RTIA 1J5OA 2BKPA 4I6AA 2F7VA 4X62F 5KFFA 2MKYA 3F73A 4DSEA 2XG8A 2UU9J 1RB0A 5B0AA 3PACA 4PR6A 5AXKA 4C8KA 2WBRA 4NMLA 3T1HJ 4PUOB 1TUWA 3MR2A 4IG3A 4B3RF 4RU2A 1HL6A 1RU1A 1JLQB 4B3TF 4DU7A 4DV2J 5HVHA 3RRHA 2R7TA 5IS2A 5BXIA 3EPIA 3IWNC 4GKJJ 5FLXU 3SFUA 2RMLA 1S1TB 3U7JA 3H2VE 4C3MA 2MQNA 1S9GA 2BOPA 4P7TA 4U9RA 5CZVA 1RJJA 1GH8A 3TA2A 4WKYA 3TUPA 2GJFA 1YRXA 2KHDA 2HHHJ 3MEDB 3BSNA 2A2DA 4ITSA 1GXLA 2VJVA 2HBQB 1OQ6A 3NS7B 1ZTTA 4MKAA 4FYWB 3RTVA 2ILZA 1LFWA 4ECRA 1P9QC 1KKHA 3DRPB 3PW7A 5J2NA 1VQ5S 1IBCB 3CD6S 4CYUB 2Q66A 3NS6A 1KOHA 4K4SA 1OY9A 3MF5A 1TMMA 2M70A 3J7YU 3MEGA 1U1PA 2HVDA 2X3GA 1EHWA 3HO1A 4ZP9A 1UTAA 5GAEU 1W25A 2LQBA 5F8LA 3MAAB 4K4TA 3MFIA 3MPDA 3TZWA 2VBXA 3HJFA 1JKHB 2NR0A 4F3OA 3D2WA 5IM0A 3BB5A 1SC3B 2B6AA 5HO4A 1VQ4S 3QT7A 1X4HA 4QJVA 2J76E 1IQZA 3W9HA 3KLHA 1ZAXA 4PWWA 2K1RA 2AYBA 5F0WA 1ZAWA 1Q8LA 3JYTB 3CJ4A 4B9TA 2FJXA 2KFNA 2VBZA 3UD3P 5I42B 5B08A 1EQ0A 5LMUF 2SXLA 3E3XA 4ZMMA 3GIKA 4JI3F 2CFXA 2QMXA 4LSZB 4OLOA 5LJ3Y 3KK1A 3UW1A 2DIVA 3R7BB 1GEHA 3M8QA 1H6KX 3M2RA 2XMUA 4WZMA 3KHHA 2B0GA 4K59A 3ADAC 1FJ7A 1RT3B 5F8JA 3PX4A 4HH0A 5E41A 1ZETA 4NLXA 3C2PA 1KP6A 5FD1A 4MTPA 3R2DJ 1TTHB 4PEOA 5GMKa 3DMJB 1UJ6A 3LP2A 1LWEA 4DV1J 2FY8A 4QIVA 4LR9A 4F50A 2HBZB 2KFZA 3N6NA 4L76A 3V4MA 1OJ4A 4C9DA 1C1BB 1F5AA 4LF9J 3W5ZA 4IYQA 2IMOA 4OJ3A 1YJVA 4HVZA 2MKCA 2KN4A 2AX0A 2XHCA 1FJEB 1AFJA 1FTRA 3OJUA 2NXJA 4QOTA 1F3FA 3AXKA 3KK3B 4I2QA 2QMUB 4ECSA 2DPIA 3TANA 1YBAA 2J6SA 2I5JA 5K14B 4F0MA 1DFDA 3CIMA 3S8SA 2FJDB 1OMSA 4Q8FA 4KGZB 2M2BA 1URNA 4G1QA 4ANEA 1LW2B 2M52A 2XBPA 1O8BA 4A8XA 4WP8A 2YNFA 3D68A 2HHTA 4OHZA 2NZCA 4RWXA 2ZH5A 2VV5A 2DXEA 2GJ2A 3AB4B 2IDEA 4Q0BA 2BMBA 2R7VA 3LUYA 3JAMU 1T05A 4J9SA 3DOMA 2CJBA 3BSOA 5C5JA 3SSSA 1WF1A 3GR0A 5CD4H 3CJ5A 2DD8S 4RW9A 2V63A 3IFEA 2Q43A 2W2QP 3E2EA 4GVLA 1FWLA 1OYEA 1V6HA 1NBEB 2RDIA 4JI0F 1Y7PA 3UDEA 1LOUA 1HNVB 2UZAA 5G0RB 1BWEA 1Y9OA 5E3AA 1U25A 1T9XA 5KFUA 1S0MA 4YDXA 4BHQA 1NUEA 2ZE2A 3GIIA 2OH2A 1Q81T 2K7JA 3OUYB 5T7LB 3ZZUA 3D0IE 3ZTSA 1MNEA 1NB2A 1H38A 1IKWB 3MMJA 1BC6A 3N0VA 5C42B 4CQ1A 4UQGA 3I0SA 1IKVA 5RUBA 3VR1A 2YVSA 2ZD1B 2ZDPA 4EUVA 5J2MB 5DZ6A 1DURA 4E98A 2GCFA 1LWFA 1VC5A 4NA3A 4QWAA 3VAKA 1PYOB 1GMWD 3QIPB 1S1WB 5HQMA 4ED6A 2OSQA 2CPXA 4USJC 2APOA 4IFVA 2KL8A 3ITHA 4RW7B 3VHQA 1QY7A 5E3QA 2ABYA 4UOFA 4ZPWR 1NSAA 3P5TL 1I3OB 3QJJA 1X9SA 3K5NA 4WYWA 3Q89A 1Q82T 2PIIA 5FDLB 3GE9A 1XJWB 3FVYA 4J9QA 5KFOA 1IJEB 2GO8A 4D3HA 5F8GA 2O3DA 1S59A 4XPEA 3W9IA 3JQMA 3J7AN 5FJ4A 4ILLA 1VLYA 1M5VC 4K50A 2FLOA 4ILRA 4LRDA 3K8WA 1QJHA 1YJNS 2JHEA 2DBBA 1CJVA 3PJWA 1DZ5A 2D3ZA 3T3FA 1HHQA 1WEYA 1TL3A 1N5VA 4CWBA 5I3PA 2J7WA 4J9LA 4MIWA 3Q8UA 4KKOA 2DO4A 4DF4A 4XPCA 3M2VA 4FZVA 4IDKB 1Y00A 1RYSA 3RW7A 1AROP 3QSYB 2E5JA 2XY7A 3OL6A 2P6TA 1QVGR 1KLMA 3C46A 1X8DA 1P1LA 1UPPA 3AQOA 2R2TA 2IA0A 1KTVA 2ZOMA 2KKHA 3TX8A 4WCEQ 4JI6J 4LSNB 4ZVEA 1RHRB 1ITPA 4M5IA 2KVQE 2E66A 3EXCX 4ANCA 2MQQA 2DB1A 3R97A 4WFBQ 1SUQA 3KLIB 2PA8D 4JI8J 2AWZA 2DIUA 1RT1B 1FKPB 1ZS6A 5IQ6A 2KXHA 2RS2A 3M8PB 4YR0A 1MW7A 4KE5A 4WBFA 1TK0A 4NCGB 3OSPA 2CJ9A 2NQPA 3CCWA 2ROEA 1NK6A 4CIOA 1RDRA 2FVSA 1PAEX 3KKFA 3UR3C 4O44A 2YNHB 5E33A 2IVMA 1RWKB 4ECYA 3HFKA 5B0DA 3GYXB 1KLNA 3CNQP 3LP0B 5ETRA 2GO9A 2Z4PA 2H54B 5H9EK 2B7BB 2M8DB 1NH7A 3DOKA 1ZM4A 4CCHA 2B7CB 1W2BR 3JTPA 3V6DA 2OSRA 3LWLA 3MR6A 3FSXA 1HBNB 3TEGA 2XY6A 3OR2B 2KI2A 2RT3A 4TN2A 3CCSS 3JSYA 2OP5A 3BM7A 2IY5B 2IJNA 3VVTA 5EWGA 1Q53A 3CULA 3OD2A 4Y2MA 5A8WB 2JEFA 4GKKJ 1V9OA 2ZBIA 2HQ3A 3R5GA 3AD9C 1SL0A 1RCXB 4CLLA 2JFKA 3HK2A 1FRIA 1FFSB 4C8OA 1HYSA 2RUGA 4DLEA 1D8YA 4V1Ak 3W1YC 2X1GA 3VAHA 2DR8A 2KYZA 3CJKB 4DR6F 2OPQA 2DH7A 4H4KC 3AA9A 1LFPA 2L9NA 5HSPA 4AYBD 1B70B 1UWBB 2EPIA 3H4DA 3GFZA 2IBOA 4KPYA 3CCTA 4YP3A 4JV0A 5BYSA 4ZVFA 2L3MA 4DZDA 1FEHA 3GG1A 3T5HA 1HLWA 2YBVA 3Q8RB 4Y3CA 3QRPA 2QTWA 4C4WA 1XK8A 3KJQB 2JC0A 4HACA 4QR2A 3GR1A 1AZSB 2MZTA 4J9UE 4OZ3A 4ICLA 2JDJA 2Z2ZA 1M1KT 1JLFB 5L39A 4N7TA 2ZVIA 1IVZA 1N48A 5L1IA 2C3UA 3EM1A 4JOUA 4FVCA 4J9MA 3IR5B 1S6PB 4F3MA 2OELA 1UVNA 1FA0A 1WD6A 4ZLLA 1OYDA 2O1PA 1YJ7A 4PQAA 2CXEA 4NE9C 4EK2A 2ZFHA 1J5EF 4TY8B 3DRSA 3WDOA 4OI3A 4UOGA 1SQGA 4DSFA 2RRAA 5JVHQ 4R8UB 3AY0A 3R7SB 5BR8J 3CDUA 4F0KA 4ED1A 3CMES 2ZOGA 4H4OA 2WB1D 4JI2F 2RD5C 2XO6A 3OTOF 2CPFA 3AODA 3T5LA 1MG7A 3LAMA 2CPDA 3MUMP 4RKUC 1BGXT 4B9VA 3BDPA 1SKUB 1M0SA 3HVTA 3IS9A 5LSRA 2R2SA 3SSRA 3K2YA 4DI6A 4CTAB 2B4OA 2QIFA 2X7IA 5HROA 2H48B 2XSJA 5MAOA 5DO2A 4RW4B 5C25B 2VZ9A 2RRNA 1XIQA 2VD3A 7AT1B 3CDBA 1D3WA 3AB2B 1XMOJ 3SSQA 2FY1A 2ZNZA 3NLCA 1RTZA 2BE7D 4RW6B 1DQ9A 4WTOB 3DFEA 2F65A 4M95A 2R7OA 3CCES 2KTQA 3GMGA 4G1IA 4UF4A 5CYMA 5KFRA 2LDYA 2DGTA 4FN5A 4RNMA 2CNOB 1U09A 3G9CA 4PG8A 2QSFA 4USVA 3M2UA 1SQEA 5A6PA 1VI7A 4I7FA 5KFEA 1RZMA 4PYDA 4JV5F 3TW0A 3A8IA 2G0CA 1CJKA 2BJDA 2CQHA 3SZ2A 3X1LB 2CKWA 3QWPA 3QJLA 1HNXF 5J1PA 4N76A 1E6YB 1R43A 4LIRA 2WSFC 3SDEB 4AXJA 1VISA 2ZH8A 4C0HA 3D0GE 2DEJA 3T6BA 2W2OP 4O0NA 4AL7A 1N6QB 2CZ9A 4DV7F 1W2IA 1IJFB 4FXVA 4BDPA 3DNCA 1NJZA 1NSKL 1TUGB 2YNGA 3VQTA 4C11A 4WK3A 3BBBA 2IM0A 2UU9F 1LKZA 1O6XA 3DGPB 5CH7B 1B4SA 3HD1A 1TKDA 1VQ8S 2Y0SD 1B0VA 5L38A 5IC6B 4DX5A 1PSDA 3T1HF 2HVEA 3MFHA 4DCPB 2BR0A 1DHMA 2KXFA 3IRXA 4DV2F 4P10A 2HHXA 3M6WA 1RADB 2V4JB 2K2PA 2FZKB 4WP9A 3M8SA 4R25A 1H74A 4I2PB 1R8HA 4GKJF 2VPWB 4NEZA 4OX9J 3TJ9A 4DUTA 4KGKA 2C2NA 4AL5A 3FRZA 1I94J 2Y8YA 2OJ3A 1WI8A 3LH2S 2MGZB 1SQFA 2O5DA 2VG7B 1MU2B 3CCQS 1FRKA 2HHHF 1ZH5A 2C2OB 3RB0A 4LF8J 2V8GA 3Q22A 3PRBA 1F5BA 8RUCA 3E01B 3HPOA 3IR6B 4ZK7M 1NO8A 3THPA 1HHTP 4KFBA 3C6UA 4RNOA 2XYGB 3LO3A 4U7UK 2HVHA 4CO2A 2XY5A 1HMVA 4NA1A 3KLEB 4LF7J 2LA4A 3O5TB 1S9EB 4AQYJ 3QGHA 3R5AA 4UY85 1S99A 5A8KA 3MEKA 1FX2A 4QW8A 4FPIA 3OL8A 1U4BA 1TKZA 4MFBA 3I55S 3OW2R 3CC2S 2AJQA 4URQU 1CS4A 4EZ6A 3UCZP 1HBOA 2BX6A 3H2UB 4LUBA 2HGMA 2UUAJ 3Q0AA 3BYRA 1V5IB 2PEHA 2AJ1A 5KFTA 1XNQJ 2XSFA 5IM0B 1DQ8A 2GHVC 5KFYA 1NKCA 4D3GA 4KJIA 3N9UC 4EMDA 2OD4A 3KLHB 3CCMS 2XS5A 5GMEA 1S0OA 1FDNA 4DR1J 2BV3A 1M5PC 5J2PA 3KJNB 1KQFB 3Q8QB 3SCJE 2OPRB 2WVBA 3CXCR 3AD7C 2Z0GA 3R3TA 4Z37A 2RQCA 3ISZA 2MTLA 1RT6A 5DJBA 4FNHA 2RQ4A 4CT9A 4Q5VA 3KK1B 3DM2B 4BCAA 1NSQA 2UXDJ 1L3KA 1TFYA 2YWGA 4F67A 4XDCA 1NXIA 2EKNA 4USIA 1YVFA 3RAXA 1FE0A 1GQEA 1Q8BA 2MB0B 2YWKA 1T03A 2AJ4A 1R0AB 1X5SA 1HQ2A 1C1CA 4QW9A 1VC0A 2XHWA 1RK8A 2AF6A 4FYDA 2FIUA 3QT6A 2ZZNA 4LF9F 2ZEJA 3D54A 3NGUA 3PX6A 3VGTA 1T02A 3LP2B 2V8DA 2XMJA 2ZKTA 1C4AA 5CCMA 3KNAA 1WI6A 1X9MA 2HNYB 3PW4A 1WKJA 1WDDA 2GZOA 4UOHA 3CPWR 5ETLA 2AW0A 1RAJA 3ISNC 2MEWA 4QU6A 3UQSA 1CPZA 3J80Y 4M8LA 2FVQA 1BE4A 1W26A 1NK9A 1WOSA 2XI2A 1YKWA 4X64J 2EG2A 2HMIA 1U49A 3Q2TC 2PC6A 1RAEB 4OFZA 4G1QB 3TAMA 1UVKA 3PX0A 2G0JA 4IO1A 5L1JA 3NNHA 3QT8A 5EN1A 1OSDA 3BGFA 4ECZA 3PZPA 2QLFB 4ZVQB 2YNFB 3JB9k 4IFYA 4LBIA 3PKYA 1RLCL 1JJ2R 4HHUA 1VCTA 1VBZA 2V69A 2UVUA 1U1OA 4Q0BB 1VHIA 2CA9A 1T05B 3DOMB 3G6XA 1UW4A 3MM9A 1OQ3A 4RUAA 3QFWA 1HARA 4Y2KA 2YX4A 3OHAA 3T1YJ 2VFVA 3FBEA 3C14A 4RW9B 3PW5A 4LR7A 1KFSA 3K58A 1RI7A 1DQAA 3DLBA 2FJWA 3R9LA 5HANA 2VKRA 5DRKA 4LFBF 2QE5A 2DTJA 5KT7A 2HYIB 2DEIA 4I4BA 2VONA 4QYZK 3EZ5A 3C16A 4LBPA 4DEZA 2CVEA 3W65A 2GMLA 3AJ2A 5KG4A 2J6UA 2VFUA 3KG4A 3K8VA 1RA7A 3OL7A 3B4MA 3GJQB 4RZRA 1RWMB 1B7FA 5KT4A 1S48A 4Z7CA 3MPWA 1S1VA 1KSPA 3TO8A 3A8EA 2D3UA 1YBUA 2B8PA 3P45B 2XYPB 4DPUA 1LWFB 4MKBA 1KQGB 2FZCB 2P2CB 1FVQA 3QGIA 1CEZA 3DU5A 1YRUA 2DNZA 3DI6A 4O4GA 5IQQA 1WSRA 1X9WA 2MMYA 3SXLA 3B4DA 2NXNA 4PWUA 4ID5A 5J2QA 3M7VA 2YQ3A 1MROA 1I1GA 4IFVB 1HNIA 1PJ6A 2V9WA 4NLDA 3ITHB 4PPZA 1RT5A 1HR0J 3TI0A 2DVIA 1RAOA 4RL1A 3DLEB 4A8MP 1AW0A 2W4PA 1VQYA 2RUSA 3KK2B 2HHWA 3L9ZA 4GVBB 1ULRA 1SC4B 2VJUA 1R7IA 2UVWA 4EBEA 2Q6BA 3KMQA 1XNRJ 4ED8A 4DBQA 3WC0A 3RAQA 4ZCMA 1Y5NB 5E2QA 5DGBA 3W3SA 4ZVGA 2E7VA 2ATCB 2FLPA 4P7VA 1ZPWX 1TL3B 3R2CJ 3MECA 2BXJA 3BO2A 3V81B 3MMCA 2HVIA 4FVMA 4KHRA 3T19A 1REVA 3W61A 4DSLA 4JI6F 2I6WA 2P9EA 1E6VA 5A76A 1DBDA 2JZ5A 2F5GA 2HIYA 4WPAA 1Y3KA 2XZDB 2UXBJ 3CCUS 3DDIA 2WAQD 1ZA2B 2HRUA 3UDCA 2CDRB 3TAQA 1MMDA 5THWA 4JI8F 2WONA 3SFGA 3PHEA 4M5NA 1FRJA 4WFZA 1Y11A 4FNIA 5LSLA 2RQMA 5LOQA 2RB7A 4PG4A 2VODA 3BS9A 3KLFB 1RWOB 3NRBA 4F4AA 5DG8A 2N3LA 2VQFF 3PYGA 3DGVA 1S6QB 4ENOA 4DUYJ 1F0XA 1HQUB 1TL1B 1OWXA 4URGA 1X31C 4R0JA 3VAIA 2XQCA 3EX7B 1P6TA 3H25A 4ZPCA 3GZ7A 2FJAB 3IAM9 2CUYA 4A8YA 3GYGA 2AJ2A 2HFOA 2LQ9A 1CC7A 1ZM3A 3DOKB 3UWTA 4DSJA 2IMWP 2HWTA 3A12A 1ZA1B 4GKKF 1IWAA 3OLBA 2DNKA 1WTBA 3CWJA 3IGNA 4RPFA 1EP4A 3U1NA 3CCZA 3IXQA 3W7BA 3P96A 4B9MA 4OV1A 1YHQS 1JLEB 2VG5B 1XR5A 2AYMA 2DCUB 1TVRB 1BQMB 2CQCA 4B9SA 3PR4A 1DLOA 2HRYA 2DGXA 3IC1A 5DDPC 1HA1A 2C2DA 3C15B 4DJBA 9ATCB 2H5EA 3J7ZT 3SI8A 3OQ2A 4C97A 1S77D 2KM8B 3JQKA 2C3OA 2WK4A 5DZ7A 1BQNA 3GB0A 4C2MA 3IR7B 2IPOB 2HK2A 3MMAA 3UCUP 4YB6A 1DAXA 2W9BA 2XZTB 2ASLA 2O66A 3ET6A 2EC2A 4WXOA 2W4DA 2GQCA 3N79A 2KO1A 1K0VA 2W9CB 1Q16B 4ZIWA 1TFWA 3FEYB 2HNDA 2YKQA 2R7XA 4X4PA 5HLFA 2DRAA 4EYHB 2LEPA 2DNNA 3G87A 5B0BA 1CQNA 4ICLB 3NBPA 2A18A 3FK4A 4WYLA 1WACA 2EBGA 4L73A 4ZITA 1T0TV 1YGYA 4M94A 1IQTA 2YPZA 3KDOA 4WF9Q 1QD1A 2KG0A 5DDQC 5BR8F 1UJ5A 1R31A 4NA2A 4TXSA 4AT1B 5ITHA 1VFJA 2BZ2A 1X5TA 3MHYA 4C7QA 2HIQA 1G2EA 4CLWA 1WELA 2Q1LA 4J9NA 1M1GA 3LPYA 3LGMA 5HATA 4HH1A 2XMTA 3W5YA 2IRYA 4JBCA 2E9ZA 2QL7B 3DOLA 3J81Y 1SKRA 2QYCA 2RQKA 1FFGB 3Q8YA 2B4PA 4XAKA 3LWMA 2VC1A 1XMOF 1AUSL 3G71S 1FHTA 4TNOA 3HVTB 4A46A 2XS7A 1U7LA 2V50A 2H3EB 3OFEA 1PC5A 3P49B 2YWEA 3GQCA 4ZCLA 3KJFB 2E44A 3N4WA 1UVMA 3KNGA 4Q44A 3EGZA 2XGQA 2DNOA 4ZHRA 3BGRA 2H1YA 1KDNA 2AGPA 1N5SA 2ZHOA 1M90T 2CNKB 2KJVA 3BH6B 1QE1A 3NEKA 1FWKA 2WW4A 5KT5A 4QIEA 2EEYA 1JLAB 4DLGA 4WFAQ 2WOMA 5CYMB 4M5KA 3M30A 3ZZOA 2KFYA 4A8FA 1FESA 3FGVA 1U6ZA 1WORA 1O5JA 3FZ2A 4YS2A 3K5PA 3TA0A 2BJ3A 4TQRA 1N5QA 2VFRA 3RAMA 1WWHA 4L72B 2W25A 5GAHI 2ROGA 3PIOQ 3OT9A 3KTQA 4G6VB 4RUBA 3ZTOA 2JX2A 3ZFVA 5IC4B 2W2MP 4ATNA 1NJWA 4B3MJ 1X60A 1Q8IA 4YEAA 1R8AA 1IR1A 1KEKA 2GMHA 5EWFA 4U8VA 3OVAA 2JVOA 2YXLA 2PGCA 2V4RA 4RNFA 4U8YA 4W98A 1ZYQA 3DRYA 2MKIA 5FLXY 2ZWOA 4FYXB 2M4MA 2J0XA 3V5RA 2WVFA 4L75A 5U47A 4JV1A 2DKOB 4C11B 1T3OA 2KM8C 3EVMA 2DH9A 5L46A 4P2FA 2YNIA 5AJ3J 5HK4A 2L48A 3O1LA 1RCOB 3MOJB 1TL5A 3PDNA 2AP6A 4FXWA 4OYBA 1I94F 2AEMA 1F9HA 4TYAA 5DGAA 1HNZJ 4O3SA 3IRXB 2YWHA 4AD6A 3RW6A 2CQ3A 4USTA 3G8SA 2D3O1 3TEHB 1PCAA 1KD1T 5KFLA 4C8NA 2BRKA 2RF2A 4LF8F 3PW0A 3K17A 3ENVA 2O01C 4I69A 4FBUA 1JXVA 2E1RA 3MXHP 1GMUA 1VC6A 2BW7A 4KIAA 4P6QA 2D74B 4ES1A 1N88A 3NXZA 2V9KA 4ES2A 2PI4A 4AQYF 4OYOA 4K0KJ 4UZBA 2CYYA 3HVWA 4IH5A 1UETA 2VPYB 3W2WB 5IT9Y 4IUFA 3O44A 3N01A 2PT0A 2JLFA 3BQ1A 2YH1A 4KFBB 3C6UB 1APSA 4IG0A 5A0YB 3T5KA 5A8RA 3TZXA 1HMVB 5BYQA 2J8SA 3UE2A 4B9LA 3KJVA 5C2GA 4FS2A 1EQMA 2NXEA 3DRRA 2EFVA 1DTTA 1FKAF 3C6TB 4B3OB 1NJIT 3BF4A 4CO4A 5A8KB 2VQEJ 2V8VA 1RWPB 2HS4A 2UUAF 3BSCA 3PY8A 1XNQF 1TP7A 1U0HA 3Q23A 1RAIB 1FFWB 2V2KA 2E5GA 2PFDA 3M8WA 2GVZB 1PJ5A 4R5PA 1HBOB 2A0FB 4DR1F 2G2OA 3IRWP 1HW8A 3MCNA 2XNRA 5H9FK 5AT1B 4JI5J 2J5AA 1PC4A 1U26A 2ADCA 2DGQA 1TV6A 4FPRA 3WZ0A 1D8ZA 2D41A 3F0NA 4DR2J 3CD7A 3BREA 4OMFG 1SIZA 2UUCJ 2MQPA 1RTJA 3JXOA 2NSCA 3CJ0A 1VQOS 1T9WA 3SQOP 2CQ4A 2YTCA 1HWUA 3GSDA 4A8KA 4ECXA 5F8IA 2WW8A 3D1QA 1V3RA 2UVVA 2OHDA 1BHNA 3KHRA 5J1NA 2MXYA 3A1YG 3U02A 3GJTB 3R5CA 4UUWA 2MLZA 3HSGA 3OL9A 3A8JA 2W8KA 4J9VA 1MSWD 4DV4F 4MK7A 1WG1A 4CM2A 1S7IA 2CG8A 2ZC3A 4WZQA 3MGJA 5KFHA 4NZ6A 1YZ6A 1Z1ZA 1QSSA 3GLJA 2EFOA 1U47A 1C1CB 4KYZA 3G82A 1VQLS 2DO0A 3K7RA 2XMWA 4I6WA 4OYAA 3JAMY 1RT4A 3CJRA 4DS4A 2C2EA 3AOBA 2N7CA 4EBDA 3AH6A 2Z8QA 4ES3A 2W01A 3P5BP 3W62A 1ZAVA 3H5SA 4IKAA 2E5LJ 2K06A 2DCLA 4ERDA 4NCAA 4ZVHA 3CD0A 3W60A 4DV5J 1N5YB 5F0UA 4L3NA 2AQ4A 2RKIA 1HI0P 1DY3A 4PAAA 4LJMA 5K8OA 3FBFA 2LMIA 3AA8A 1YITS 4NL5A 4EGLA 2LQ8A 2ZZMA 5F9NA 2XM3A 2HMIB 4NLPA 3QRQA 1XQIA 4K2XA 1RHKB 1P8GA 3TAMB 1WSVA 3K0JA 1XMBA 2J8AA 2V6AA 3I5CA 3R8YA 1SJ1A 1URRA 3T1YF 4IFYB 2DPJA 4ZIVA 2BJ8A 5AE3A 3UD4P 4JI4J 2B9XA 1CULA 1WUUA 4BC9A 4GRSA 2WSCC 2B9EA 2IC3A 3JTOA 4PWDA 2UVRA 3UPFA 4DDFA 2V34A 2KXNB 4QIGA 6FDRA 2DGSA 2FHOB 4IR9A 4OI4A 5D3GB 5HAOA 4DV6J 3LF0A 5KFPA 1MLAA 2DY1A 1R6VA 2VG6B 3M8RA 4M5MA 3B54A 2PO4A 1SC6A 1PG5B 4ED0A 1RT7B 1HWJA 4A8SA 1WF2A 3H7HB 1S76D 2XGPA 2E1MC 1UFWA 2QLBB 3NGRA 3MMBA 2VA3A 3BKUA 3PYDA 1KVJA 2AKWB 3JTNA 2BUNA 3CDAA 1RKJA 3VALA 1RP5A 2DNRA 4XDDA 3FFIB 4DCOB 2DY9A 1YRTA 1NZAA 3FQKA 2MKJA 1RT2B 3TVKA 5JXSA 1Q5VA 1U0SA 4RW8B 3W9JA 2XZWA 1HR0F 1NPPA 2NZ4A 3Q2SC 2OEJA 3PEHA 3QLHA 3DLHA 3MAQA 3DI6B 3IMQJ 4O4GB 5D0GA 3KG1A 3ILLA 1SJ4P 4ID5B 5J2QB 3DLGB 3IM8A 4OX6A 2W2NP 3UI3A 4IOAQ 1RT5B 2VF3A 2AZ3A 5KG5A 4ZOSA 3CJ3A 4JI1J 5D6GA 1ZBTA 2XB2D 2IM3A 1FRLA 2QLJB 4ZPTR 2Z2MA 5SZTA 1B64A 1PGZA 4BLGA 1ZM2A 2EC0A 1OY8A 1SJRA 4OZNA 4ZVRB 2BABA 5F9LA 1LWCB 4YB5A 3JSBA 4WU2A 4CRJA 2OPSA 1RBAA 3GPAA 5LT5A 4GMKA 1XN9A 4DL4A 1SVDA 4KTQA 1FKOB 5CQGA 2EW9A 4S0MA 3BJYA 3RB3A 2UXBF 2EWHA 1T7PA 1TQLA 3J7YI 3UN2A 2OUGA 3D6MB 5I3QA 3BBFA 3OR1B 5AXMA 3MECB 1CLFA 5GAEI 2HZVA 1E6VB 1HW9A 4RUCA 2F63A 1N36J 3TA1A 4ZP6A 3D0HE 1UEKA 3QQCD 3UVJA 4GO5X 4J5OA 1ZTWA 1QUVA 2IJFA 4UZCA 2HZAA 2E1CA 3R6GB 1TAUA 2ALYB 2MJNA 3WIVA 1X4AA 3RUBL 2CQDA 3TZYA 3RBEA 4H4MA 1NHVA 2QA4S 3RR7A 1L5UA 1SV5A 4U7CA 1N4LA 2WCXA 1HKAA 4I68A 5MLCV 2KT2A 5DS7A 4O3QA 4UY8T 3CJTA 1XBWA 3M9OB 4K5RA 1MMNA 3ZNUA 1IKXA 3CSKA 2HSEB 4K4XA 1RHQB 5DQGA 1JNZB 1XC9A 2OFHX 3POTA 5ETMA 1T3NA 4PUOA 3EVOA 3V6JA 3JQJA 1JLQA 1KONA 4FBTA 1CSJA 3HXMA 4LRCA 4OQJA 1S1TA 2HURA 3NMAA 3LQVA 2M8HA 1N0UA 3BQ2A 2JFDA 3KG0A 1WEXA 4KO0A 4B3TJ 1SC1B 1FDDA 1S49A 2H4YB 2HAIA 1VDHA 2W2PP 2LA6A 4CH7A 1ELOA 2W4CA 1UFLA 2FJEB 2L08A 4QR1A 2VDIA 3DRPA 3QPIA 2DR9A 1HD0A 3VZIA 4X65J 4CYUA 2JNJA 4NLRA 2R3VA 5L8RC 2VL1A 1WG4A 2OI2A 4ZDNA 4G1PA 2JL9A 3QJPA 2FGOA 3QGPA 3M1VA 1WTFA 2RHQB 3HT0A 2DHXA 1JKHA 3HHLA 1C4CA 1WC5A 4YY3J 3MM7A 3PO4A 1WHWA 4X4SA 5IT9U 2WVCA 4CO5A 5IWAJ 2V8HA 1RU2A 2F9DA 2WZ1A 2HNZA 4DZ6A 1BQNB 1QAJA 3H5UA 1C0TB 2Q6CA 1DTQA 3MM8A 1RBLA 1TL7B 2B8QA 5F8MA 4DPWA 2W9BB 5HVGA 4DV0J 2BYCA 5B0EA 2GNKA 4CLFA 5I42A 1CJUA 1IM6A 1N34F 1LW0B 2KDOA 3F41A 2MY8A 1NHUA 2LU1A 1VOMA 2HNDB 1K1QA 1U1RA 5KFQA 3PRVA 2DYAA 3CEDA 3BGLA 2XMVA 1KVIA 2HG4A 4HDGA 2RDJA 1QUPA 3SCIE 1NDCA 2HKEA 3A8KA 1X5OA 3HP6A 3L95X 1Y10A 3J7Z5 4ZCIA 4XIUA 4Q2MA 1KQSR 1HBMB 4LT6A 1T94A 2WTFA 2VASA 1TL4A 3H0PA 2DHAA 2DHGA 2UV8A 1X4GA 3HHKA 3CF5Q 3D6HB 3W8GA 2KT5A 5FIIA 1JLBA 3P4UB 4BS2A 4Y28C 1KQKA 5EX3A 2GS8A 3DLLQ 1AB8A 4ZVOB 3SV3A 4DPOA 4U67Q 1FNMA 2H5IB 4EO6A 1C1BA 5D0HA 4YHHJ 1N32J 3I32A 2R8KA 3RRGA 4DOZA 4QWCA 3I0RA 5KG1A 3T1AA 1P1TA 2QT7A 2QYGA 4A48A 2ILYA 3NS5A 4GO7X 2NXCA 2CNNB 3MPUB 4OX8A 4C6AA 1LV5A 2J0WA 1LW2A 3CUNA 4KV8B 3HI9A 4CM0A 2GFFA 4YB1P 3W5XA 2HRTA 4LIWA 2BOAA 5DETA 3VAMA 2HBYB 3BGRB 4X2BA 1YI2S 4CO1A 2ACYA 3IG1B 3MPYA 2ZHAA 1QE1B 1RSCA 1TK8A 3DLKA 2WBMA 1D9AA 4MIBA 1GX6A 2Z2LA 3M30B 1TZ0A 5KTQA 4USUA 3QZ7A 2MY7A 3A3OB 3HSDA 2CIMA 4DXLA 3I5AA 2NYIA 4UOCA 4O3NA 4B3MF 1RWNB 2UUBJ 3RU0A 4LF6J 1CJTA 2KU7A 2AX1A 2E9RX 4P2XA 1HNVA 5K8MA 1WC3A 5G0RA 1IN0A 2HBRB 3M4XA 2XI3A 4KGMA 1S1UB 4QCLA 4GC7A 4DPYA 4DU8A 5LXYA 2G1HA 2VPZB 5CAAA 4KQZA 2DXDA 3OUYA 4LRBA 2VICA 1FNXH 1D0EA 2R7WA 3I31A 2M9KA 2CQ1A 3FBCA 3ZTQA 1FXLA 1XMQJ 1BXNA 1IKWA 5KFXA 3BR8A 1XR6A 1BMQB 1UP1A 2UUTA 5AJ3F 3PEJA 2KH9A 4MIAA 4KC5A 1VYAA 4K4ZA 4EFAC 2VPXB 1VMBA 2ZBQA 1HNZF 1JJCB 6FD1A 4H4KA 1RGVA 4YQWA 3QIPA 5DDRC 5B0CA 2Y1LB 1EIYB 3CC7S 2BEFA 2A2CA 4MKVA 3SYZA 4RW7A 2JVRA 2M5YA 3BYPA 1S0VA 1RTDA 2QLWA 3D1OA 4PQUA 4Z2XA 4K0KF 2E5HA 4NLWA 1HFEL 2W9AA 2RF2B 3BGOP 3HJVA 4DQSA 1HD1A 1R8BA 2AZ1A 2N4CA 2N4DA 1JLCB 3JSRA 4O3OA 4N41A 3L09A 4XK8C 1CG2A 4OZLA 2VOOA 2IA6A 3OBIA 2LEBA 3AOAA 2ZWPA 1HPZA 4F2SA 3NAHA 4J90A 2VQEF 3OPKA 1S57A 3KHGA 1T9UA 1Z4UA 2JH3A 4IG0B 2P9GA 4RJVA 2HLTA 5A8RB 2HFUA 2N82B 2AJ0A 4IDKA 3KJVB 1B0TA 2XCAA 4F2RA 4N5SA 2J6TA 3DRRB 2H9ZA 3NG8A 1K1SA 5GVQA 1U8WA 1NK5A 2K3IA 4ZN3A 4NXNJ 3HF5A 4LSNA 5BJRA 2HVZA 2GJIA 3AJDA 5CYQA 3H5YA 1U0HB 4DR2F 2DHHA 3V4IA 2NPIA 1WEZA 2CQGA 2C2ZB 4CNZA 4N47A 3FEXB 3W66A 1OY6A 1VR6A 3KLIA 3K57A 3QFHA 2FQQB 3M8ZA 4FKXA 5KFVA 3I4HX 3KLVA 4ZP8A 1QAXA 5EGYA 1TV6B 4MK9A 3HFZB 1S9FA 1HWIA 1RAHB 1LQ9A 2IM2A 1N54B 3VAJA 5F8NA 1RTJB 1VJQA 1V3SA 2E29A 2FLLA 1FDAA 1QSLA 3PIPQ 1YQHA 1IM4A 3LP0A 1IBKJ 4N77A 1SL2A 4O3RA 1UFKA 2AHOB 1S79A 3VGVA 3AXMA 2DRBA 1OO0B 2X51A 4M5DA 4LRFA 2KJWA 2F40A 3BN7A 4C48A 1HIYA 1VK3A 3G8TA 1HBNA 3OR2A 2DT9A 4WJBA 2DGWA 3NCRA 4AE5A 4EI2A 3FZBA 1NM2A 3AAWB 4M5LA 4FP9A 4XO0A 5ETNA 3ISND 3GONA 2E5LF 3TOQA 3G82B 2AU0A 1KC8T 2G4BA 2LQ5A 4WK1A 3EDRB 3THTA 4DV5F 3HFVA 1RT4B 1PJ7A 2C22A 2JRSA 1U1MA 1FCAA 2BACA 2Z2YB 1HNWJ 4ILMA 3TRGA 3HSZA 6AT1B 3LALA 1FE4A 1ZM9A 2CRLA 1UWBA 3CDWA 3HT3A 2NXUA 4QWBA 2HW3A 3H90A 4TY9A 2MDAA 1Q5YA 2I1RA 1EKSA 2CZVC 5CYJA 1NH8A 5ADZA 4B02A 3UCGA 3FUYA 4DL0C 4A8WA 2FB0A 3OFGA 4JI4F 2OFGX 3PNIA 2GA7A 2P9CA 2MSTA 1W7WA 2XULA 3FEZA 1C0UB 3HHDA 1GMWA 3P8BB 1EJ7L 3CD5A 5KFBA 2MHNA 2RRBA 4ZPAA 3WX8A 1CC8A 4TVAB 2PMWA 4AXIA 2R2UA 2B4VA 3CGIA 3CE8A 2QA4G 1JLFA 4PYAA 1FXRA 4DV6F 2A6MA 2WB4A 1JLGA 1R8CA 2LKZA 2IC3B 3CO0P 4PWDB 4F4ZA 1S6PA 1FTCA 4M5JA 4ZVUB 1M1HA 3TZZA 1RWWB 2NREA 5I4MA 2MZ1A 5AE2A 4L3KA 3HM9A 5JVGQ 4TY8A 4LSLB 3OVSA 4F26A 4PKDB 4R8UA 4CO3A 4C3LA 3Q83A 2IBKA 1RQ0A 1SPBP 1MN7A 4F25A 3HZEA 4MKYA 3VCDA 4IH7A 3RRKA 4RBUA 2XYHB 2A10A 2BANB 4JP8A 2VBWA 2KVIA 2LDIA 1G1XA 4PXCA 1UA1A 2DNPA 4RX6A 3MUVP 3MMBB 5KG3A 2QO3A 1RABB 1VRTA 2H4WB 3HVAA 4DR3J 4HTIA 3ENWA 2FHJD 2VUGA 3OTBA 3IBFB 3OTOJ 5C25A 2VDHA 2CPJA 3NCQA 4BC7A 1BQXA 3PG9A 2ZH3A 3BSAA 1VQ9S 2J9CA 2BKOA 2CPYA 3PFOA 4HT7A 4PG5A 3QLHB 2GHWA 1D9FA 1M5SA 2YWWA 2F9JA 2VBYA 4NYPA 2IAJB 4B17A 1U1LA 1YJWS 4M1KA 4DL7A 4WFXA 3HHEA 4U6PA 3J7A1 3NCPA 2J9DE 1FXDA 1U2CA 2NLWA 3DYAA 4BWMA 3DC2A 4Q43A 4WFYA 2ADBA 2UXCJ 4YMEA 4JI7J 5HI7A 2ZJRQ 1QTMA 4LQ3A 2BA9A 5T41A 4CNYA 2VC0A 3ILOA 1NHKL 4ED2A 3NGDA 2HEKA 2HFVA 3R27A 2G0IA 3NMRA 1NPRA 4WFNQ 1SKSA 2J7UA 4ZVTB 2WHOA 1VQMS 2GW8A 5GAGU 5HBMB 2OPSB 2RAQA 1N36F 3ZO7A 4OZJA 3HHNB 2FD2A 1FK9A 4JV5J 1EAYC 1J2VA 3QSIA 1RBOB 3JS9A 3KMSA 4PG7A 1U6BA 4LREA 5DLGA 4NYZA 3IA0A 1N6QA 4OHVA 1WG5A 2MJUA 2AYGA 2DJWA 2NUHA 2HZCA 2RJZA 5ETVA 2U2FA 4PG6A 3UVJB 2B43A 3F56A 2GV1A 1SH3A 4PCQA 4KH0B 2QZ8A 2ZDOA 4X66J 1JB0C 4RWWA 1YSJA 4TLRA 4U95A 4ECUA 1MWZA 2XMMA 3B8HA 5E3CA 1KRPA 3D3BJ 2BM1A 2BKNA 2DR7A 2J0SD 1SV5B 3S01A 1WC4A 5HN0A 1TMJA 2QN6B 8ATCB 2POKA 3DCAA 1JX4A 1J5OB 1RTIB 5DQHA 4P9SA 4JB8B 4CLYA 1SCJB 2V4JA 3PVXA 4X4RA 2QG9B 4PABA 2P8IA 2CQ2A 1SJQA 3FCVA 4I2PA 3T9ZA 2RVJA 1IKXB 1IR0A 2KRRA 3RB4A 2M3DA 2FJVA 1S12A 4WIIA 4ANDA 1RUSA 3POTB 4IG3B 4ZPVR 1S6UA 3SCKE 5IZHA 2MGZA 3OSNA 3TNVA 2IVFB 2VG7A 1MU2A 1FWPA 4I56A 4IQMA 3G96A 3ETMA 3OTDA 4LR8A 4P52A 5D78A 4OX7A 2KRBA 3UDVA 3E01A 1S9GB 1H98A 3G86A 2Y1RI 4X65F 2J0QD 3D28A 3U1LA 1VRUA 2BM0A 4KO0B 2W1BA 3KLEA 3N5BA 1S9EA 1D1UA 2Y9HA 4KRWA 4V19J 3JSMA 2LVWA 5ETPA 2CAJA 3PV8A 1QTNB 4OHXA 2MPUA 1BLUA 1FRHA 4LF4J 4KSEB 5J2NB 1XEZA 4ALZA 5SUHA 3TQEA 4DQRA 4YY3F 3PJ9A 4RO0A 3CIZA 5DQIA
chains in the Genus database with same CATH topology
3LP0B 3WZ0A 1D8ZA 2UV8G 2XO7A 3E51A 2GO9A 2Z4PA 2D41A 2F1FA 3OHBA 3MEGB 1L3VA 3CD7A 5IWAF 4ED5A 1EP4B 2B7BB 3BREA 3M1VB 4OMFG 3O3LA 1SIZA 2M8DB 4HI1A 2MQPA 1RTJA 3BGUA 5D4PA 2NSCA 5F3TA 3S7RA 1NH7A 3CJ0A 4WTYA 3DOKA 3H20A 1VQOS 1ZM4A 4CCHA 2XWYA 2CQ4A 1NKBA 4ZLPA 3HHLB 2B7CB 4DV0F 2YTCA 2J7KA 2VH7A 1W2BR 1HWUA 3GSDA 3HKZD 3SQGB 3JTPA 3VZHA 3V6DA 2OSRA 3LWLA 3MM7B 3MR6A 2B6AB 3B82A 4DN9A 3FSXA 4A8KA 1HBNB 4ECXA 2EFGA 5F8IA 2WW8A 4EYIB 3D1QA 1V3RA 2XY6A 3OR2B 2UVVA 2JEJA 2KI2A 2RT3A 3THVA 2PN6A 1UKUA 4TN2A 3CCSS 1KN6A 3JSYA 1DLOB 5H1SV 2OP5A 3BM7A 2K1RB 3MZIA 1X4FA 2IJNA 1YTYA 3KHRA 5J1NA 2HNZB 3A1YG 2D1CA 5EWGA 2MXYA 4DMZA 3L3CA 3U02A 1X5PA 1Q53A 3CULA 3R5CA 2Y1IA 4UUWA 1DTQB 2B4UA 3MM8B 3OL9A 2WSEC 2W8KA 2Y1JA 4WXWA 2OPRA 4HT5A 4Y2MA 1B0PA 5B0FA 5A8WB 3CO9A 2FLNA 4DV4F 2JEFA 1MSWD 4MK7A 1WG1A 2FHJA 2FVPA 3M9NB 5KFGA 4TU8A 1U8SA 2LQJA 1FJGF 1V9OA 2ZC3A 3N6MA 1RISA 2ZBIA 2KYXA 3MGJA 4WZQA 2HQ3A 5KFHA 4QPXA 1VQ6S 4NZ6A 1SL0A 2K7KA 3BO4A 2JFKA 4J9OA 3HK2A 1FRIA 1Z1ZA 3I56S 2AGOA 4C8OA 4ELUA 1C0TA 1HYSA 2RUGA 1QSSA 4DLEA 3MMAB 1D8YA 3JYTA 2EFOA 2K8GA 3DM2A 2X1GA 3VAHA 1U47A 4DFJA 3PW2A 3M8QB 2DR8A 4FF2A 4W90B 1C1CB 2KYZA 3CJKB 4DR6F 2OPQA 2DH7A 5KG7A 4H4KC 3M2RB 4DV1F 3AA9A 1VQLS 1LFPA 2DO0A 2EBEA 2L9NA 3K7RA 2XMWA 4I6WA 2V0NA 3JAMY 7FDRA 1LW0A 1RT4A 4PXEA 4IOCQ 2ATLA 4AYBD 3MUTP 2PD1A 1UWBB 4DS4A 2C3PA 2C2EA 2N7CA 1Y4ZB 2EPIA 3H4DA 3IWLA 4CT8A 3GFZA 2IBOA 4KPYA 4QYZJ 3CCTA 4YP3A 4EBDA 1TK5A 4EZ9A 1R0AA 4OI1A 3AH6A 3H5XA 4JV0A 2Z8QA 5HLFB 1PO6A 2C42A 3P3DA 4ES3A 2W7AA 4QPTA 5EX0A 5BYSA 2OD6A 2IRXA 4HHJA 4ZVFA 2L3MA 3NBPB 2I2YA 1FEHA 1ZAVA 4AL6A 3H5SA 4OJHA 5B09A 3GG1A 3T5HA 4IKAA 4ELTA 3CJ2A 2DCLA 1LWEB 3Q8RB 4YHHF 2B5JB 4Y3CA 5K5MA 3EYZA 4DQQA 1N32F 4C4WA 1XK8A 2HGNA 4ERDA 3UR0A 4NCAA 1RT3A 1KNZA 2JC0A 4ZVHA 4E0DA 3CD0A 1N5YB 5F0UA 4HYKA 2UUWA 4L3NA 1JLBB 2AQ4A 2RKIA 4QR2A 3I9V9 1HI0P 3FJ2A 2MHEA 5BYRA 3GR1A 4LJMA 2MZTA 1JMTA 3CDEA 3FQLA 3HLUA 1Q79A 3OV7A 4ICLA 4UW2A 1VQ7S 4KR0B 5K8OA 3MD1A 2JDJA 3DMJA 4C0BA 2GGPB 4FF4A 2HNYA 1HBMA 2LMIA 3AA8A 1YITS 3CVKA 4NL5A 3WBZA 3ZZPA 2Q3PA 1M1KT 2JWNA 2CJQA 2HHQA 3WX4A 2NSBA 1JLFB 4EGLA 1GAOA 5L39A 2ZZMA 5F9NA 2HMIB 4NLPA 1NB7A 4K2XA 2YWFA 3I0RB 1P8GA 3TAMB 2ZH6A 1FRMA 2DGUA 5L1IA 3V6KA 1HBUB 1N48A 4MH8A 4LFCF 3GWCA 1XMBA 3K0JA 1UEVA 4NPOA 1FD2A 1JIHA 1GTHA 1X0PA 2C3UA 3QZ8A 3WC2A 4NLGA 3SCLE 2J8AA 2OKQA 3I5CA 4JOUA 4FVCA 4I2QB 4J9MA 3IR5B 1S6PB 1SJ1A 2DHSA 1URRA 4R0EA 3T1YF 2I5JB 4F3MA 2MYFA 2E5IA 1UVNA 3DU6A 3DOLB 4IFYB 2DPJA 1FA0A 1WD6A 5AE3A 5J1EA 2O1PA 3UD4P 1NJXA 1FEEA 3HX9A 4PQAA 2I38A 2B9XA 2WRMA 3ZZZA 1SB6A 2ZFHA 4NZ7A 1J5EF 4TY8B 4LVNP 3FNNA 3NKYA 3DRSA 3I87A 3WDOA 4OI3A 5M2PA 4BC9A 3FRYA 2WSCC 4DSFA 1YJRA 2IC3A 4OHYA 2RRAA 3JTOA 5JVHQ 4R8UB 3KK3A 4Y6IA 4PWDA 3AY0A 2UVRA 1NNDA 3UPFA 4DDFA 2AYEA 4IR1A 3EPGA 2KXNB 5K14A 4QIGA 3CDUA 3AJ1A 6FDRA 4ED1A 3CMES 5HQ8A 2ZOGA 4KHMA 4H4OA 1U2RA 2DGSA 2WB1D 2RD5C 2YKNB 4JI2F 2CPZA 4X4TA 3RR8A 3PXGa 3KFWX 3OTOF 2FHOB 4C98A 4IR9A 2XMKA 4OI4A 5D3GB 2DNGA 3I6PA 2CPFA 2D9OA 2UUBF 2YKAA 4LF6F 4KV8A 3DLKB 3LF0A 4IOBA 3T5LA 3M32B 4DWIA 2CG4A 5KFPA 3QWUA 3LAMA 2CPDA 3HKWA 4ZHRB 3MUMP 1LK7A 1FF2A 4RKUC 1NKEA 3TUJC 1BGXT 4B9VA 3BDPA 1M0SA 2VG6B 3HVTA 3M8RA 3IS9A 1KOOA 5LSRA 2R2SA 4HL9A 3SSRA 2HWIA 2PO4A 3K2YA 1SC6A 2ALZA 3IG1A 3BO3A 4CTAB 4ED0A 2RH3A 3VWSA 1RT7B 2B4OA 2KHCA 2PA3A 2QIFA 1HWJA 5HROA 4A8SA 4M63A 2FHMA 2XSJA 5DG9A 4TYBA 4C8ZA 1WF2A 4B9NA 1KHVA 1NRKA 3M6XA 5MAOA 2QMWA 5DO2A 3MDFA 4RW4B 1S76D 4IRDA 2YY3A 5C25B 2VZ9A 1IKYA 2WOMB 4DL2A 4X84A 2XGPA 1FVSA 2RRNA 1R6YA 1FNOA 2E1MC 2HHSA 2VD3A 1UFWA 3QYYA 4C8MA 3MMBA 1Y3JA 2VA3A 5D4OA 3QAEA 3CDBA 1D3WA 3AB2B 1XMQF 1KVJA 3SSQA 2FY1A 2FUG9 2ZNZA 3JTNA 3NLCA 2BUNA 1S6OA 4RW6B 3CDAA 3CC4S 2LYVA 2ZJQQ 1DQ9A 1UJ4A 2ERRA 4O23A 1VBXA 2OMLA 2LU2A 1RKJA 1SH2A 3VALA 4EWTA 2F3JA 3DFEA 3OTCA 1RP5A 5F3ZA 2DNRA 2R7OA 4XDDA 4J9RA 3FFIB 4M95A 3NL0A 2ZE2B 3CCES 3NAIA 4H54A 1YRTA 2KTQA 5KFZA 1NZAA 2FGCA 2KZZA 4B3SF 3GMGA 5IFMA 4G1IA 4NCBA 3FQKA 5CYMA 2MKJA 5KFRA 1RT2B 2LDYA 1YJ9S 2DGTA 3TVKA 5JXSA 3PKMA 4FN5A 4RNMA 4F4KA 1U09A 2E1AA 4RW8B 4URSA 3G9CA 2N7YA 2XZWA 3X3UA 4PG8A 1HR0F 1H3DA 4Q2LA 2QSFA 3FDSA 2NZ4A 3Q2SC 3MWBA 3M2UA 1S1UA 1SQEA 2IVYA 3PEHA 5A6PA 1VI7A 3QLHA 4I7FA 3UFCX 4YR2A 5KFEA 3KLGA 3DLHA 3MAQA 1VGYA 3DI6B 4O4GB 1SI9A 3I0SB 4K4YA 1IKVB 2JJ4D 3KG1A 1Q7YT 5T7LA 3W2VA 4JV5F 3IN5A 3R1HA 5KFIA 3TW0A 3HHLC 1SBRA 1SJ4P 4RBTA 4IRKA 4ID5B 4EU0A 5J2QB 4TLQA 4DG1B 2G0CA 3DLGB 1K9MT 2JEIA 1SXLA 2W7PA 2BJDA 4L6V3 4OX6A 2CQHA 4UUXA 2MZRA 3MM6B 3SZ2A 2FHKA 2JC1A 5K8NA 5KFKA 1QAIA 3X1LB 3UI3A 4IOAQ 2CKWA 3QWPA 5E7OB 1RT5B 1VBYA 3QJLA 5C42A 1U48A 1HNXF 4JYAF 5J1PA 3D5MA 4DFPA 5KG5A 4N76A 1VQKS 1E6YB 1R43A 1DARA 2GHPA 4ZOSA 3CJ3A 4LIRA 5D6GA 1ZBTA 2FPHX 3CCLS 2ASYA 3C3LA 2XB2D 2IM3A 1FRLA 2ZD1A 3TQ1A 5J2MA 4ZPTR 2Z2MA 1OS5A 5SZTA 2WSFC 4JV2A 1B64A 3VAGA 3SDEB 5DM7Q 3O2IA 2AGQA 4AXJA 1PGZA 1U6FA 1ZM2A 3BDEA 4PXDA 4N56A 1KHWA 1IUJA 3EGNA 2HFZA 2ZH8A 2EC0A 2U1AA 1SJRA 2AD9A 4DV3F 3C66A 3TP2A 1G7CB 4OZNA 4C0HA 2L41A 2BABA 5F9LA 3D0GE 4PRFA 1RTDB 1R27B 1S1WA 4CO0A 3T6BA 1LWCB 4YB5A 3H4BA 3JSBA 5LMNF 4AL7A 4WU2A 1N6QB 2OPSA 4DV7F 1W2IA 1IJFB 3PM9A 2FC8A 5LT5A 2YNIB 2LCWA 1ROFA 4FXVA 4GMKA 4ECVA 1XN9A 3IGVA 4DL4A 4PQUB 4KTQA 5HMWA 4BDPA 5C24A 1FKOB 3DNCA 3DLEA 5CQGA 1NJZA 2EKYA 2EW9A 3K5OA 2FVRA 3BJYA 2YNGA 3RB3A 1IXKA 2UXBF 2CZ4A 5JUMA 2EWHA 5D77A 4YUDA 1T7PA 1TQLA 1OPIA 3VQTA 4C11A 3J7YI 2DGOA 4WK3A 3MOZA 3KK2A 5I3QA 2IM0A 3OR1B 2OMOA 5AXMA 5CHCB 3MECB 2UU9F 3IBWA 1HQEA 1LKZA 1CLFA 4OZ1A 5GAEI 5CH7B 4USHA 2JOQA 1TKTA 1TKDA 1VQ8S 2Y0SD 1E6VB 1HW9A 1WHVA 3I96A 1B0VA 5L38A 4RUCA 3IAS9 5FDLA 1JJ4A 4C8YA 3TA1A 2ZH2A 1PSDA 3T1HF 4ZP6A 3D0HE 2MQLA 3MFHA 4GO5X 2XLKA 1U2FA 4J5OA 1ZTWA 2K3KA 2BR0A 1DHMA 2KXFA 1HPZB 3IRXA 1QUVA 4MJKA 4DV2F 1JLCA 2IJFA 2HHXA 3V81A 3M6WA 2E1CA 2V4JB 2K2PA 3MTJA 2BBEA 3UNGC 1TAUA 2ZOFA 3Q24A 1JK9B 1O51A 3M05A 3M8SA 4NXNF 4DQPA 4KKOB 4R25A 2E7WA 4ZKAA 2MJNA 1SKWA 3SMZA 1X4AA 4I2PB 2CQDA 3RBEA 1R8HA 4DS5A 4GKJF 2VPWB 4H4MA 2B56A 2MQOA 3G6VA 3TR5A 1SJFA 2OIHA 1NHVA 2QA4S 4KGKA 2MZQA 2V5HG 3M2VB 1L5UA 3RR7A 4F8RA 1SV5A 4AL5A 4U7CA 4BBYA 1N4LA 2YKOA 3FRZA 2DISA 2WCXA 3R5DA 4I68A 4KAIA 3US5A 5MLCV 4ID8A 2OJ3A 1S97A 2KT2A 5DS7A 1WI8A 3LH2S 2MGZB 2W8LA 2O5DA 3AQPA 4QIFA 1TKXA 1MU2B 2VG7B 4O3QA 4UY8T 2XS2A 3QGGA 4MYTA 1FDBA 1KLMB 2V94A 5A2QY 3CCQS 1FRKA 1XBWA 4C8LA 3ONQA 2HHHF 3M9OB 4K5RA 4ETXA 1ZH5A 1MMNA 1IKXA 4N8NA 3CSKA 4K4XA 1T95A 4I6YA 4Y0FA 5DQGA 1JNZB 2R8HA 1XC9A 2BW2A 2OFHX 3RB0A 5CYQB 2LLZA 2MZSA 2V8GA 1VHFA 2YKMA 5GAHU 3POTA 3Q22A 3PRBA 1F5BA 3HPOA 3E01B 1T3NA 4PUOA 3IR6B 4Y00A 3V4IB 4ZK7M 3KLFA 1DTTB 4OI2A 5G4DA 1NO8A 2ZHBA 3V6JA 3CTRA 2R7RA 3THPA 1HHTP 3HMJG 4KFBA 3C6UA 4RNOA 4J9PA 1JLQA 1S0NA 1KONA 4CH0S 1NK4A 3LO3A 4LFAF 4U7UK 2JLEA 4FBTA 3GV5B 4JI5F 1SUQB 2HVHA 2KT3A 4CO2A 1UAWA 4AUKA 4O0IA 2XY5A 4KT0C 1CSJA 2AV5A 4IO9Q 3HXMA 2BDPA 1HMVA 3H2LA 4OQJA 4NA1A 3KLEB 1KTQA 1HWLA 2LA4A 3O5TB 1S9EB 4FF1A 1IBKF 1S6QA 3MD3A 1HQUA 1S1TA 1TL1A 2R7QA 5DDOC 3QGHA 2UUCF 4QWDA 1N5TA 3R5AA 4UY85 3LQVA 5KFCA 3NMAA 1S99A 2M8HA 4R5PB 5A8KA 4RU9A 2BE2B 4NRUA 1I6JA 2VA2A 5KG0A 3MEKA 1N0UA 3BQ2A 4QW8A 3I5BA 2JFDA 3P6YC 3OL8A 3KG0A 4DR4F 1WEXA 1U4BA 4KO0A 2G13A 1TKZA 4O44B 1FDDA 1RT1A 4MFBA 3I55S 1FKPA 1S49A 3OW2R 2R9LA 3OJSA 1GNKA 3CC2S 2AJQA 1RA6A 4URQU 2A3JA 4DSIA 1VQSA 4ELVA 2HAIA 5KOWA 1S1XB 5KFDA 3PJXA 3D1HA 2LA6A 3RZAA 4CH7A 5KFWA 3M8PA 1N0VC 2QSWA 4EZ6A 4NCGA 2G1DA 3H59A 3UCZP 3AHPA 2LXUA 1ELOA 2W4CA 1UFLA 2OPPB 2FJEB 2L08A 1HBOA 3ICLA 5D4LA 5M2UA 1JXLA 2I8EA 2M88A 4QR1A 1JNRB 3DRPA 3QPIA 2DR9A 2CJKA 2PI5A 2HS0A 3H2UB 2L9WA 1HD0A 3NP5A 2ZJPQ 1F60B 3VZIA 4LUBA 4DL3A 1YG0A 2HGMA 2YNHA 4M5DB 4NLRA 3Q0AA 2GQ2A 5L8RC 2B9WA 2VL1A 2PEHA 2AJ1A 1WG4A 5KFTA 3V6DB 2XSFA 3MCSA 3K59A 3EXYA 4ZDNA 1DQ8A 4G1PA 5IM0B 2GHVC 2RIJA 2JL9A 4N8OA 4NLUA 3QJPA 5KFYA 1NKCA 4D3GA 2FGOA 3QGPA 1Z2ZA 2YKPA 2LECA 2B9YA 1JXEA 3M1VA