2QFIA

Structure of the zinc transporter yiip
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
286
structure length
286
Chain Sequence
YGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrous-iron efflux pump fieF
publication title Structure of the zinc transporter YiiP.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01545 Cation_efflux Cation efflux family
A PF16916 ZT_dimer Dimerisation domain of Zinc Transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1510.10 Mainly Alpha Up-down Bundle Alpha-lytic protease prodomain-like Cation efflux protein transmembrane domain 2qfiA01
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 2qfiA02
3H90A 2QFIA 3W5XA 3W5ZA 3W8PA 3BYPA 3W65A 3W62A 3W8GA 5HSPA 3W5YA 3W60A 3BYRA 3W61A 3W63A 2ZZTA 3W66A 3W64A
chains in the Genus database with same CATH superfamily
2CVIA 1RDRA 3HZGA 3K5MA 4PG7A 3N9UC 2UV8A 1I3OB 1C1CA 3DU5A 5KFJA 2MKIA 4C8NA 5DQGA 3LTOA 4NZ6A 2R2TA 4HACA 3HKWA 1HNVA 2QZ8A 3ELHA 4DUYJ 2A3JA 2H9ZA 4M5MA 4JI0J 3GV7B 2I1RA 1PYOB 2VJVA 5A8RA 1HBNA 2EI5A 2RQ4A 1RTHA 3CD6S 3JTPA 2UUBF 4QWDA 1VQLS 4NLRA 2XMTA 3QO9A 3W5ZA 3MUVP 3FMBA 2YKAA 2B51A 4OYIA 4LIRA 2XY6A 3DDNA 2HPUA 1X5SA 1OY8A 1WHWA 4KGVB 3NGTA 2CQBA 5EHHA 1M5PC 2Z2YB 3BBCA 2O5DA 4WE1B 2NXNA 4B9SA 3KK3A 4E2FB 5HAOA 2XTJP 5A8KB 2IMOA 2YKQA 4RUAA 4IFYA 1YRXA 2QTWA 4QPXA 3ETMA 2ACMA 3ITHB 3K2YA 2AZ3A 3PRVA 4LF4F 2OPPA 3PKYA 3V81B 3NBPB 2LCWA 4AD6A 5B0GA 1XNRF 2DIVA 1EQMA 2HLUA 1IVZA 3ZTRA 5HL7Q 4Q8EA 4ZJOA 2VH7A 2W8LA 2MB0B 2MY8A 4JI2J 2RNEA 2NXUA 4NZ7A 3DXBA 3HHEA 5F8IA 3JSMA 3DRSA 2Q43A 3S01A 3QNWB 2MYFA 5LXYA 2KZZA 2HBYB 1JJHA 2B7CB 5DLFA 4LRBA 1IKVB 2NSCA 2OP5A 3LWMA 2X3GA 5IM0A 1ZYQA 4KPYA 4LF8F 5D4OA 3P6YC 1IQZA 4EBCA 2JVOA 2C2DA 2R8HA 2E5HA 1CVJA 4CCHA 3UD5A 3G6VA 4Q0BB 8AT1B 1V3ZA 1RAAB 2WVCA 2VPXB 5LL6d 3QZ7A 2VICA 4OJ3A 3R7NB 1HIYA 1R89A 3E01A 2XYGB 3C2PA 4IRCA 4ECUA 3CD7A 3TR5A 1DURA 1TKTA 4X65F 4EZ9A 1Y7PA 3TARA 2C2MB 1V5IB 3U1NA 3CCZA 2E1AA 3H5YA 3ZZ0A 2HG4A 3CCTA 4ZVEA 4MKVA 4OLPA 4B02A 3KK2B 4B3TF 5I3UB 5KFSA 2W7OA 3CCJS 3IMQJ 2ILZA 2H5EA 1IQTA 4NI2B 2ZNZA 3W63A 4JI8J 2P2CB 5IV3A 4K2JA 1SB6A 4ATNA 2DNOA 2JSXA 3GJRB 2EK1A 1CJUA 1OIAA 4ZP7A 1SV5B 2P5VA 4PQUB 1TKZA 3MOJB 2HFOA 3FBEA 2UVRA 4I6YA 2LQJA 5J2PA 3BV8A 1WI8A 4QW9A 4KHPJ 3SSSA 2MKYA 4IO1A 3I96A 3EPIA 3D3BJ 2XS5A 4NXMJ 4LFAF 4E0DA 1RLCL 1BQMA 1J5OA 4CLKA 4FPIA 1YLXA 2M5YA 3D0IE 3AA8A 3PDNA 1FWKA 4F8RA 5HATA 3DOLB 2LXFA 2ZHOA 3LP2A 1J2VA 3CT9A 5E7OB 4RW9B 5GADI 3QIPB 2FC9A 3RAXA 1ZBTA 2Z30B 4I67A 3O44A 5K8NA 3HMJG 2AX0A 3DFEA 4J9PA 3LWLA 1S1XA 2LDIA 2JEFA 2DR6A 2KL8A 4OI3A 4BC7A 1FFGB 2DD8S 1WOOA 3AJ2A 2K06A 3IC1A 5KG3A 4I6AA 4ZPBA 3C19A 3OFEA 1ZZNA 2XEXA 1SUQB 2NPIA 3EX7B 4C8KA 4V1Ak 1WC1A 4PXDA 3V4MA 2ZZMA 1F2HA 2G13A 3NNHA 4YDXA 3M6XA 1FVQA 3N4WA 3A12A 1PO6A 4C8ZA 1RT4A 4DG1A 4IDKB 1HNXJ 4WFAQ 3TUZC 4HHHA 5EWGA 3T19A 1MNEA 2VBXA 4U95A 3EGWB 4DV1J 3B54A 5E0OA 3K5OA 4W98A 4K5SA 3UWTA 4DR5J 4F3OA 3I9V9 1SJ3P 4ED8A 3M2VA 4DUTA 2W1BA 2FLOA 1CS4B 2J9DA 2AKWB 3W7BA 2GGPB 2LLZA 2C42A 4DZ6A 1EKSA 2DISA 4I6WA 2LQ8A 4U9RA 2Q79A 4DL6A 3KUHA 2VOPA 1H72C 1NKBA 2BJ9A 5H9EJ 4LVOP 1OWXA 2EFQA 5T14A 4IFVA 1VIXA 4C11A 3JAMU 1PC5A 3I4HX 4M5NA 2CQHA 1JXLA 2HFVA 4DSLA 5HVFA 2YNHB 5KFXA 4B3RJ 1UW9A 1NK0A 4K50A 4RBUA 4UOHA 4CLUA 3TA0A 2P9EA 1WKLA 1WF1A 1NDCA 1TVRB 3ILOA 3A3OB 1NUEA 3GTYX 2DR8A 3FFIA 3CDBA 3MM6A 1X31C 1RTIB 1S0VA 2E5LF 3POTB 3ZC4A 2CJXB 1VLOA 2A6OA 3MCMA 1ELOA 2KXFA 2RHQB 3WIUA 2AU0A 2HNZA 1S9FA 2UU9F 2B3TB 1HFEL 1L3VA 3KMSA 3TI0A 3JYTA 2D1CA 4LF7J 3D7SB 3T1HJ 4MMOA 3M8QA 3OL7A 4YHHJ 3PO4A 3TW0A 1SBRA 4AE5A 3QT6A 2VC1A 4LF2A 5LM7E 1X5TA 2E29A 5D0RA 3T3FA 2G0CA 3CJSA 3L9ZA 1VS3A 2BE2A 3PW7A 4OZ5A 2VA2A 4C3LA 2M88A 2E66A 2Y1RI 1ZH5A 2BJ1A 4I7FB 3H20A 3BBFA 3R5AA 1S0MA 3RB3A 1AW0A 5A6WA 1O5JA 4BS2A 5RUBA 1YJVA 1QUVA 1MW7A 1OY9A 1W2BR 3PKMA 3HFVA 5GAHU 1LWEB 1K44A 3PR5B 1REVB 1NHKL 3OV7A 4LQ9A 1AB8A 4U96A 4KH1B 4QU6A 3EUNA 3TJ8A 5BJRA 4OYWA 2HFUA 2IAJB 1RT3B 3A8KA 2C3PA 1T03A 3MI7X 1KEKA 1JLBB 4QWEA 2E7WA 1GXUA 1D09B 4C0BA 1HBOA 3VVUA 1YITS 4XAKA 2CQ2A 1CG2A 3RB4A 4S0MA 3X3UA 2BACA 2LFVA 3OFGA 2RS2A 3GWCA 3CJTA 1RWUA 1XNQF 4Y2CA 2Z58B 2MPUA 2R2UA 3JSBA 4ZOSA 2C2RA 1YBAA 4ZVPB 2XMMA 3IWNC 4C9DA 1CPZA 4KSEB 1RHUB 4DQIA 3TJ9A 4N56A 1FFWB 2F8HA 3HSDA 1WG5A 1ULRA 3BSOA 2HQ3A 1GMVA 2CNKB 4R8UB 1DFDA 3ZTOA 1HNIB 3PRDA 2AGQA 1FRJA 2QSWA 5J1EB 3MTKA 3G8QA 3E8OA 5JVGQ 3G96A 3H5SA 2V8GA 2W2PP 1WC3A 5F8LA 1T05B 1YJWS 1VQ7S 1JJCB 1FXDA 2DJWA 2IRYA 4KY3A 4WXWA 1FTCA 2H65B 5ADZA 4RW7B 4AL5A 3HFZB 2XWYA 3M8YA 3M9NB 2Z2LA 3HJFA 3DLBA 1A9NB 4JI4F 1FWPA 1PAEX 3Q2SC 5HVGA 1JMTA 1VBZA 1HBMA 4LF9J 4DFJA 3Q24A 1RAHB 1FX4A 5IWAJ 1U8SA 1W26A 4ES1A 4DU8A 2YWGA 4KGMA 2W2QP 2BW2A 4Y00A 3ZZRA 1Q8BA 1KHWA 1NJWA 2W2OP 5M2RA 3TX8A 2FJDB 3W64A 3IN5A 4DV3F 3IM8A 1JNZB 4CLYA 1M5KC 3TNVA 2B9YA 1FHTA 4O3QA 4PKDB 3CIZA 2IM3A 3RTVA 3OR1A 3U02A 1C0UB 3FBBA 2VQEF 4FF3A 2JC0A 1G6BA 4O3SA 4LSZB 4Q8FA 2O3DA 2XMUA 4DL3A 1EX8A 1LQ9A 4FS2A 4LR9A 1O6XA 4WIIA 4KKOA 1TL4A 3R2DJ 2KRBA 2JLFA 3Q0AA 3SSQA 2MZRA 2G1HA 4FF2A 4C3KA 3JAMY 1Y9OA 4TQRA 4EMDA 2L08A 1U1OA 2HNDA 1TU0B 4HT5A 2ZWOA 1RKJA 4OI0A 1B3TA 4LF1A 4Q2MA 2I9SA 2FVPA 5L39A 2ZBPA 4A4JA 5FLXU 1TQLA 3NWRA 1L3SA 3BQ0A 4ES3A 5DG7A 2PMWA 1Q8IA 2DNRA 3C6UB 4TYBA 2KJWA 1F5CA 3CJKB 2A10A 1LWFB 2DR5A 3W8PA 2HHXA 3H42A 4ANCA 5KG0A 5H9FJ 4AXJA 3BYRA 5LSLA 4DR1F 4LF6F 2MSTA 2GW8A 3KLVA 4FVCA 5EGYA 5C2GA 1S97A 1XMQJ 2P6TA 3BB5A 3K5NA 3CJ4A 1XEZA 3ZO7A 2QA4G 2VFUA 4FXVA 3NOCA 2EK6A 1BC6A 5HVHA 1CC8A 1YJUA 4J9KA 4NE9C 4P9SA 3QRRA 2QLJB 1EP4A 3MUMP 1P9YA 2GMHA 4OV1A 3J81U 1T7PA 4DN9A 2IM0A 5C2CA 1C1BA 2DBBA 2EFPA 4ZCIA 1P1TA 1FFSB 2EG2A 1U2CA 5BR8J 2B4UA 1UVNA 1A0OB 1FRHA 5F0UA 2W8KA 2NXJA 1O0PA 2AW0A 1KVJA 2YKOA 4U7UD 3PW0A 4ED0A 3IRXB 2BANA 1JB0C 4OYOA 1N36F 5KFFA 3W61A 2QLFB 1MLAA 4C98A 3BEGB 3I0SB 4DR7F 1VRUA 2C3MA 4WK1A 2HEKA 4P6QA 3HVTB 3IAS9 5HSPA 1TUVA 1VJWA 3CO0P 1U0HA 3KKFA 4GKJJ 1ZTTA 5IT0A 1SJ1A 3I0RA 3LP0B 3EPGA 1X5OA 3OW2R 3KK1B 2RDIA 2E1PA 3DNCA 4ECXA 2E7VA 1G2EA 3EGVA 2OTJS 2MKSA 2UV8G 1PYSB 3HHDA 2G2ZA 4WKRA 4NLXA 2OJ3A 2M52A 3DM2A 3LO3A 4GVLA 1SC4B 1M1HA 4O3NA 1RZMA 2KT5A 3N6LA 3KDNA 2Q66A 1TKXB 2LQ5A 4DDFA 3I9ZA 3M6UA 5FDLB 1IBKJ 3CCRS 1RWXB 4LRDA 4DCOB 1S12A 1IBLJ 3BYPA 2WONA 5ETOA 4CP5A 3OVBA 1F6TA 4YR3A 2XLJA 3VAFA 3RB6A 4U8VA 5AE2A 4PPZA 4M5DB 4LR7A 4G1QB 4C0HA 2GHPA 4RNFA 2W25A 1UEUA 3DYAB 5KOWA 1T02A 3AJDA 5KT5A 4DV2F 2BEFA 3A4TA 2GA7A 2E44A 2RHSB 1XQIA 3AXMA 5L1JA 4YS2A 4L76A 5A6PA 2H48B 4R0JA 1NU4A 4PYDA 2KH9A 4RUHA 3NEKA 3V6DA 2ZH9A 4UZCA 4FF1A 3IGVA 4FPRA 3TUIC 2HK2A 4B3OB 2IBKA 2DHHA 2AJ4A 3PACA 2JLGA 3AD9C 2VC0A 2OSRA 3FSYA 2KVIA 3M05A 3KHGA 3WHIA 4C4WA 1DHMA 1RCOB 2DK2A 4HDHA 1TL3B 3US5A 4QOTA 1IWGA 2OSQA 4ID5A 4B08A 4WPAA 2CG8A 3D5MA 2DTJA 2E1MC 4JV0A 4USKA 4KB7A 4CLSA 1LXNA 5ETVA 3HSZA 2V6AA 1S1VB 2P6SA 4KFBA 4LF5F 4QCLA 3FEYB 2DXEA 5C7PA 4WYLA 1RT7B 3PW2A 2U1AA 1Q4RA 2HWIA 2CADA 4EEYA 5FIIA 3MXHP 1KQGB 2ZE2B 3D2WA 4KO0A 5FLXY 4CYUB 3PEJA 1KKHA 2IHR1 1Q95G 5F9NA 4F4AA 4FYDA 4LBIA 2FY8A 2MZQA 3FK4A 5DETA 1HNWJ 2BE9B 4WTYA 2LP4A 2FHMA 1RWVB 3T5LA 3W60A 2B8PA 3DLKA 3P3DA 1S1WB 1TL7A 3L09A 3QIDA 1DQAA 2H1YA 5ETKA 3EJMA 4O3PA 3ET6B 3FNNA 2XGPA 2XS7A 2QN6B 4D3HA 1S6PA 2HHHF 3KUEA 4Q2LA 4A8XA 5T41A 4NLSA 3PR4A 4DL2A 4NEYA 3G71S 5L8RC 2E9TA 1G3OA 4NMXA 4NX9A 3VGSA 4JI6F 4LIWA 1KTQA 3GJQB 4OJ1A 1PYTA 1HPZB 1Q79A 1QJHA 3DRRB 1KHVA 4OZNA 2ZJRQ 3J81Y 4HH1A 2NREA 2XSJA 3MM8A 3QWUA 2WW8A 1LNQA 2LA4A 1SKSA 4RLEA 3ETOA 3R1LA 4OV6A 1P1LA 2V2QA 3HI9A 3NCRA 5LJ5Y 3MHYA 2M8DB 2RDDA 5DG8A 3T1YF 1S48A 2MKHA 4OLOA 4P73A 4JBCA 3SQGB 1Y5IB 4ILLA 4NL5A 5JJBA 2V4RA 2QMUB 2W9BA 5I3PA 3TJAA 3LGHA 4NLUA 3NMRA 4DR4F 2OEJA 3PCOB 3K17A 3AXKA 2Y8WA 5B0EA 4CZCA 1FXLA 1EJ7L 2R8KA 3I87A 3CJRA 3I5CA 2RQMA 3ILIA 4DSKA 4M5GA 1G4CA 3MCNA 4NZ0A 1LXJA 1RB0A 1JLGB 4HR2A 1VQMS 3PHTA 4UY8T 3RJMB 3FUYA 1JLCA 3I4PA 2KI2A 4O0IA 4FN5A 3C15B 2R7QA 3CDEA 3OUYA 4MIWA 4WK3A 2O1PA 3J7A1 3CC2S 3RR7A 4KRWA 2DH8A 3D3CJ 2B9WA 5DQHA 2UXCJ 2VQFF 3GFXA 5E3QA 5K9FA 1TUWA 2JHEA 3QFHA 1NPKA 4YP3A 2HHPA 3KWMA 3T9ZA 3KLGA 5HMWA 1C0TB 2N7YA 4JI5F 3TRGA 4PPDA 1X4AA 2R7OA 1YRUA 4FYYB 4USVA 1FRLA 5KFAA 2CPHA 2NZ4A 4L3KA 3BN7A 1KQSR 2LQ9A 4YFUA 1RWPB 3J7Z5 2IDEA 1ZM9A 1QE1A 3MMAA 1VHIA 4JV5J 4TKTA 3MMJA 3W2VA 1URRA 3S1TA 1PILA 2DGUA 1BQNB 4ED4A 3PRBA 4CNZA 2QL5B 4TU7A 4NYOA 2MLZA 4J37A 2YKMB 1PJ6A 1SKWA 1NSAA 1RAGB 4LREA 1EB0A 2R9LA 1LFWA 3DMJB 4J9VA 2FJBB 1SCJB 1HQUA 4YY3J 3IWXA 3ITHA 2R8IA 3K89A 1B64A 4JYAF 4CO4A 1SJQA 1P8GA 2NYHA 3KJNB 4EZ6A 4O3RA 4DUZJ 4JV2A 3HHNB 4B3MJ 5J2MA 3LAMA 1D9FA 1WTFA 3R7SB 4BC9A 1U1NA 2IJFA 2V9KA 4ED1A 1S49A 1ZM3A 2J0WA 3BGOP 2YNGA 5FD1A 4HL9A 3RU0A 1GXLA 1Q16B 4OJGA 1MROB 3GV8B 2ZBCA 1DQ8A 3MPVA 4K4WA 4HH0A 3DLGA 4K4TA 3FCHA 2RS8A 4MIBA 3LH2S 4P7VA 4DJBA 3KG1A 1R31A 2CWXA 1H2UX 2IRXA 2UXBJ 3MOZA 2J0XA 1T0TV 3MR2A 3RBZA 2VIHA 4BLGA 4GVBB 2EFVA 5KG4A 2W9AA 1PC4A 2QX0A 2PMZD 3PJ9A 3PFOA 2R7SA 3KNGA 5GAGI 1SI9A 4WXOA 5D4PA 1N34F 3OTBA 4F04B 2WB1D 1HHTP 2DNGA 3OVAA 4WIQA 3IG1B 3ENQA 3N5FA 3GSDA 2FJXA 2XI3A 1RK8A 2ZOMA 2NR0A 1AUDA 1NH8A 4PZVA 4I1TA 1K0VA 1LK7A 3Q8YA 3A8JA 3V4IB 2ZFHA 2ZM6F 3DRPB 3L3CA 1X0FA 1DBDA 1U2FA 2C2OB 2ZBQA 2NPFA 2ZOFA 2WOMA 3Q22A 3KK2A 3G2XA 3MAHA 3KJVB 1Q5VA 4TLRA 5I3UA 3CO9A 1YSJA 3MEDB 3C16A 1X4EA 3OLAA 3THPA 2PA8D 3SV3A 3GONA 3D6HB 4JB8B 4NI2A 2K7KA 4NWBA 4PG8A 1RTZA 2W7AA 4OI1A 3JXOA 3KLFB 5GAHI 4PCQA 2RU3A 4DV7J 1DARA 4F36A 1RYRA 2JFKA 3R3TA 1LKZA 2BM0A 5E33A 2F63A 2BKNA 2XI2A 3NCPA 3AB4B 2DGQA 2GC8A 2XYPB 4QPTA 2VJUA 2W9CB 4BDPA 2GQ2A 5KFYA 4DSJA 2HNYB 1EQ0A 2PGCA 4YDDB 1RQ0A 4CTAB 3M9MB 1HKAA 2OGUA 1XJWB 4DU7A 4X84A 3N6NA 1K8AT 2DCLA 4UUWA 3MPYA 2ZNYA 2X1BA 2C3UA 3DOLA 3PYFA 2UUTA 1F1BB 1WG4A 1P27B 5CYQB 4TY8A 4RW9A 7AT1B 3QIPA 5MAOA 4I0WA 4Y2IA 3KHLA 2CRLA 1FD8A 2KYXA 3LP1B 1HL6A 4X4QA 2EW9A 4PWDB 2VPYB 3SIPB 5GVQA 2VBYA 2F4VF 5LMUF 4DV6F 2YWWA 3R2CJ 2J5AA 2HVDA 1TL1A 2B5JB 4CLWA 3K58A 1KTVA 4IRKA 4E98A 3UVJB 2EG1A 4DF8A 3K7RA 2XS2A 2MJNA 2W4DA 1F9HA 1UVMA 1FRKA 4J9MA 3W65A 1URNA 2V5HG 3DI6A 5D0GA 4FYVB 4AL7A 2JWNA 4X4OA 4OI6A 3R5JB 2I38A 3OSPA 2OD4A 4IDKA 3SDEB 4ETXA 3ZNUA 4HT7A 4EBEA 1TFYA 1KVKA 1WNEA 2EFNA 3U1LA 1U2RA 1KOOA 3BZQA 1X5PA 5D4LA 1UKUA 5A8WB 2HIYA 5DDQC 2XG8A 2D3OR 3BDPA 1KLMB 1T95A 4MAKA 1V5VA 2XY7A 2GGPA 2VG5B 1PBAA 4RNMA 1RT5B 3QMQA 5KFHA 3CC7S 9RUBA 4ZN3A 2I0XA 1RAIB 2V4JB 2QV6A 4RBTA 3M2UB 1YKWA 4H4OB 2AV5A 4G1PA 3KG0A 3MUTP 1KWMA 2KT3A 4DV4F 2VHGA 3NGSA 1G7CB 4MYUA 1UFWA 1N33J 1T94A 3CB4A 5IS2A 3F56A 3C8YA 4K5RA 4PWUA 2CQGA 1M5VC 3DLJA 4HI1A 2CUYA 2BVZA 2V0NA 1N0VC 3TA1A 2B6AA 1RT1A 1RTIA 2KFZA 2F1FA 3BO2A 2J8SA 4USIA 4QWBA 3RAMA 2BM1A 2BUNA 5C24B 2NXEA 3PFEA 3PYEA 1LW2A 2W2NP 1RADB 2B4VA 4CH1A 4K59A 3TP2A 2G2YA 4WYWA 2DVIA 1MG7A 3MPUB 4TXSA 3CJQA 3UN2A 2UUCJ 4USHA 3UDLA 1OPIA 3PIOQ 4K0KJ 5M2PA 1IN0A 2LXUA 4RW8B 1N5TA 1PSDA 3IR6B 4OX9F 1XMOF 1UPPA 2G0JA 2OO4A 4ZPAA 3UD3P 1KD1T 4DMZA 2ZDOA 3GFHA 2IIHA 4V19J 3GR1A 1KNZA 5L1LA 5IC4B 2K2PA 1RJJA 1CULB 3HHLC 4EFAC 5CD4H 4ERDA 1XC9A 5GMKa 2O67A 2JFDA 1TAQA 3PY8A 4Y2AA 4LSLB 3THVA 2SXLA 4UOFA 4A8KA 4JUZA 3KTQA 3HSGA 1N6QA 2MQQA 4YR2A 5KFEA 1Z2LA 3H4DA 9ATCB 5B08A 3KLIB 3FBCA 3H5XA 1RT3A 2K8GA 2KDOA 3SQOP 2OELA 1CJTB 2OI2A 3QAUA 1B4SA 4OYAA 2FJWA 2B8QA 4K2XA 4RKUC 4WF9Q 4HHUA 1TAUA 5C25B 4WFNQ 4ECSA 1D8ZA 4FS1A 3ZZTA 3PJWA 3BR9A 2V9WA 3BDEA 4GKKJ 2RQCA 4XDCA 3SFGA 1UEVA 2OPQA 1E6YA 5IXUA 3D6FB 4IR1A 3GLJA 3OHBA 1YGYA 2B4OA 4NLGA 4J9SA 2HGMA 4DSFA 2UVWA 2KM8C 1S1TA 2RIJA 3B78A 1KR4A 1LWXA 3W5YA 3D28A 2MQ8A 3PEHA 4B17A 2ZHAA 1B7FA 4Q45A 3FSIA 2M9KA 4AQYJ 1RAOA 1YWXA 4Y0FA 2KG0A 4PABA 2J6TA 3EYZA 3JTNA 3VAJA 1BLUA 3TQEA 1CJVA 4GO5X 1VK8A 3QBCA 4X64F 4USTA 2LU1A 1TK5A 3OD2A 5HQLA 1Q5YA 4AXIA 1C1CB 4MK7A 2VBZA 3HO1A 4HACB 2CA9A 5J1EA 1SL0A 2DR7A 1VR6A 3VVTA 1TELA 4RX6A 3PYGA 3ZNJ1 4ZPTR 4XTTA 1U1QA 1T05A 1HI1A 1IXKA 4NCGA 5D15A 5CYJA 2IVMA 2R7VA 4I2PA 5A8RB 1HBNB 2WVEA 4Q7AA 4ETZA 3ADAC 2H51B 4TU9A 2WAQD 4F67A 4MFBA 2MKKA 3HHLA 3R27A 4ZVTB 3QO9B 3AB2B 2DXDA 1GTHA 2JOQA 2XM3A 4KAIA 3VCDA 3QRQA 2FTRA 3SMZA 1RISA 4MK9A 4QZVB 1WC0A 4ELTA 4AUKA 2JVRA 2DITA 1UW4A 3E51A 2CYYA 1D8YA 3DXSX 3BSAA 2ZH7A 1VC5A 2YKNA 4DR2J 3VGVA 3M7VA 3AHPA 3T1AA 3OR2B 1U45A 2XHCA 2AGOA 3H4BA 4I69A 2D9PA 3P96A 2XCAA 2DH7A 5GMEA 3THTA 2VDHA 3QGHA 4RW4A 2EKNA 4DX5A 1VC0A 2XBPA 3LALA 5A76A 1KFSA 3EE3A 2VZ9A 2RUGA 1BGXT 2JNJA 1RGVA 1HWKA 3L7UA 2R8JA 3GPAA 1FRXA 2K3IA 4F50A 4CRJA 2E5JA 3JSMB 3C14A 1RKIA 1RBAA 3K0JA 5ETRA 1JQGA 5BYRA 1IKWB 1VQSA 2N3LA 3EMTA 2NQPA 2DNLA 2CXEA 1PKUA 2QL9B 3WDOA 4LFBF 2J9DE 2YQ0A 4ZVRB 3UDEA 2PD1A 3DOKA 3C6TA 4OMFG 4M63A 3HT0A 1NZ8A 2AJ2A 1H3DA 1KQKA 5IM0B 3HDSA 2R8GA 5KFGA 2GX8A 5LXRA 3TVYA 1PG5B 2UUAF 1H38A 1U1PA 3O3LA 1PCAA 2WB4A 2GZOA 4CLFA 2VG7A 4KV8A 5A2QY 3CJKA 5KT6A 1LWFA 1S7IA 1FEHA 4H4MB 1N8RT 4B3SJ 2GV1A 5DRKA 2VASA 2J0SD 2ALZA 2IVYA 1HWLA 1H73A 3B4DA 3QPIA 3QT7A 3K8WA 3Q83A 5LSRA 1TV6B 2H5IB 1W7WA 5HLFB 2MDAA 1WSVA 2YVSA 4QJVA 4N47A 2Z8QA 3UCZP 1S9GA 2UXDF 2KXNB 1TTHB 2YX1A 4QIGA 4OZ0A 2DO4A 4Z7YA 4YB5A 4IYQA 3QGIA 2MGZA 5L1IA 3EXCX 2DR9A 1MWYA 4Q5VA 3OL6A 4L74A 1NK5A 2KZMA 1OMSA 3KJQB 4F4WA 2PFFB 2FVRA 3I32A 3RRHA 5KFZA 5AJ3J 1LOUA 4V19X 3PVXA 1CJUB 4C8YA 1GMWA 5EDWA 1Y00A 5GAEU 3FRYA 3CCVS 4HI2A 2V8VA 1Q82T 1HMVA 1ZETA 3EGNA 5LMNJ 1A7GE 4WU3A 4DR6F 2WRMA 5H9FK 3BJYA 3HVTA 2AYGA 4ZVOB 3R1HA 3U27A 2IM1A 1U6FA 3PHEA 5ETTA 2YNFA 5DM7Q 3NGDA 4LRAA 1LWCA 2ZD1B 1BQMB 1J5OB 2JEJA 4ZPWR 3EDQB 3CW2C 3C3LA 5G0RB 1DQ9A 2XZWA 1D0EA 3MD1A 2CQPA 3N01A 1FRMA 1SL2A 4MKYA 2HFSA 2OTLS 1GFWB 2CG4A 3NGUA 1D9AA 5HO4A 2HQCA 1IBMJ 2AJFE 1VYAA 2IC3B 1I51B 4F3MA 3TAPA 1S1XB 1VBKA 1TKXA 5B0DA 7FD1A 4LQ3A 2QO3A 5FDLA 2HQIA 3IXQA 2CPEA 2EKYA 3MMBB 4JI7J 4HYKA 1GQEA 3MFIA 2BMBA 1VQ5S 1J5EF 3LQVA 1FK9B 3L7OA 2KYZA 2CPDA 4IO9Q 3IS9B 3CJ8A 1U4BA 4M5DA 4G1QA 4B9VA 3E3XA 4XK8C 1X60A 2Y1IA 3J7YI 2XMWA 2HQGA 4CQ1A 1YZ6A 1RHJB 4GC6A 4DPWA 1RT4B 2IDLA 2LXIA 3VWSA 3PZPA 5J2NB 3BS9A 2RKIA 2YX7A 2IA0A 2EPIA 4LFCJ 3BGRB 2HZCA 4HKQA 1S59A 1CJKA 1FVSA 4DPXA 2HZVA 1X9SA 2M4MA 3M2VB 2QMXA 3OTOF 2J6UA 2FGCA 2HGLA 2CJBA 2YXLA 3CIMA 4UZBA 4ZK7M 3DLEA 4OJHA 1FT8A 4DR3J 4B3OA 1QY7A 2MKCA 2QFIA 2DY9A 3H2VE 5F9LA 1SH3A 3DOMB 3CWJA 4N76A 1ZAVA 1ZOTA 3R5BA 5CH7B 4NLWA 2ROEA 4DQPA 3IWLA 1TL3A 1E6VB 4IFVB 4A8YA 1XMBA 1F9EB 4NMLA 4TNOA 2QYGA 4DZDA 5HBMA 1C4AA 2QL7B 3F41A 4ZN1A 3P8BB 1S1VA 1TK0A 4ZPDA 1YJRA 5JXSA 3FFIB 2EC0A 3MM6B 1WSRA 2I5JA 5K14B 1NSQA 3GMGA 2I2YA 3PXGa 4IOBA 3QZ8A 3EZOA 1HW8A 5KFMA 2FQQB 4NXNJ 3D0HE 3FEZA 4P2SA 1OJ4A 3EM1A 3BREA 4CYUA 4DFMA 2VKRA 1VRQC 5IT9U 2AZ1A 3JYTB 2YY3A 5ETQA 2VB6A 2ASDA 3AY0A 3M8QB 3LOUA 2IFXA 4Y6IA 1QSLA 4QQBA 3W62A 1V9OA 2FZCB 1NO8A 3D0GE 4WU2A 3ET6A 3CDAA 3MEEB 5JMNA 2RUSA 4WWSA 3KHHA 1NPRA 2CQIA 1N32F 3J81j 1RABB 1CSJA 1HNZJ 2RRNA 4DS5A 1HPZA 3P5BP 4QWAA 1Q8LA 2ROGA 1PGZA 4M95A 5HROB 3ENWA 3JB9k 2LEBA 3AAWB 2J0QD 3ZTSA 4C97A 5CCMA 2K1RA 3EZUA 3I82A 1I94F 4N5SA 2ZH3A 2HGNA 1EARA 1REGX 3PJXA 3T6BA 3LPEA 1HWJA 4O3OA 3ENAA 2XB2D 2HRTA 1FE4A 3V5RA 4LVNP 5GMDA 2CIMA 2OHDA 4YUDA 2AT1B 2F8EX 1NK9A 4USUA 5KFUA 2G0IA 3MGJA 1WC5A 3DRXA 4KIAA 3OL9A 1HR0F 1M1GA 4JI1F 1NK8A 3VAKA 2BW7A 3T5KA 4DV5F 1O51A 1AZSA 2HAIA 3MWBA 2M70A 4ZVHA 4KBIA 4XDDA 1S1UA 5ITHA 5E3AA 4BWJA 4OYZA 2XLIA 4O44B 2KT2A 4OX8A 4DSEA 1SJRA 2WVDA 4L75A 4F7VA 4KYZA 3C15A 5D8HB 1K73T 4TLQA 4ZVFA 2W01A 1OQ3A 1SIWB 3SYZA 4WP8A 4ZIWA 3QWPA 4DQQA 3T9NA 1Y0HA 5IZHA 2RH3A 4J9QA 2UUBJ 1BWVA 5AE3A 2FGOA 4OHXA 4X2BA 3DDIA 4X4VA 2WBRA 2GFFA 2P9CA 1SC6A 4TQSA 4FDFA 1KLNA 1WG1A 2P8IA 1LV5A 4FYWB 2RT3A 2NS1B 2ZBRA 2LYVA 2HBQB 4N8NA 3EVWA 3KNAA 2ZUGA 3CSKA 1HD0A 4USJC 2BX6A 4K4XA 2G9OA 3RRGA 5CZVA 1M5SA 2R42A 3MEKA 5J2QB 4USWA 2G1DA 1DLOA 3DDKA 4LF4J 4ELVA 2H5JB 1C2PA 3H2LA 1BQNA 2DHAA 1HQEA 1XNRJ 1VRTA 2VKZG 4M1KA 3UDVA 2XZDB 2OD6A 1XN9A 3CNQP 3EICA 4P2MA 1RTDB 3VV2B 3MCOA 4NLPA 1FJGF 2DB1A 2Z57B 4IOCQ 3PO5A 3DMJA 4IKAA 3M1VA 4DHVA 3BO4A 3OLBA 4MH8A 4OHVA 2MSSA 5E41A 2FVSA 1WC4A 2AEFA 1QD1A 1XBWA 1HWIA 4ZMMA 5G4DA 3QT8A 3N79A 5M2UA 1OSDA 1WELA 2HNDB 3SCKE 2XULA 3CDWA 3CCWA 5EWFA 3M30B 5THWA 3HVRA 4C2MA 1YJ7A 4LF8J 2QT7A 2PDAA 1HYSB 1Q78A 3F44A 1R8CA 1VQ4S 1FWLA 4DL5A 1FNXH 2RILA 1ICEB 5CYMB 2LMIA 3MM7B 3BBBA 3I6PA 1KFDA 2GJ2A 3MAAB 4PG4A 3R6GB 3WBZA 2ABYA 2D3ZA 2K7JA 3GZ7A 3QYYA 4WJBA 1BWEA 3DHXA 4H4KA 3OXGA 5IT9Y 3SFUA 2CDQA 4X65J 4EU0A 2E9ZA 4ED5A 2AEMA 4OYMA 4GVBA 2AYMA 3NG8A 4DL7A 4F3QA 4B3TJ 3J7AN 2RRBA 5K5MA 4A47A 3G82A 3D6MB 1FNOA 3TWZA 3FMWA 2BKPA 2M0GB 3PTWA 1EP4B 4C8OA 2ZDPA 3AT1B 3OJUA 3SBMA 2ASYA 2ZZTA 1Y4ZB 3WX4A 5KFPA 3M8ZA 3D1OA 1UL3A 2AHOB 1FKOA 2B43A 3Q8UA 4EI2A 3W1YC 3DRPA 2MY7A 4CO1A 3NXZA 2F4FA 1M5OC 4DF4A 1Y10A 3IFEA 4BWMA 5DG9A 1X7VA 3VR1A 4PQAA 1JWWA 2W7PA 2QA4S 4G6VB 3IA0A 4OYPA 5KFLA 1K9MT 1QAIA 1VRUB 2DNZA 2GIRA 4CO2A 2CPIA 1NKCA 4RL1A 5KT4A 2D7SA 2GCFA 1UJ4A 4ECZA 2KFNA 3H5UA 5CZXA 4O23A 1IKYB 1U0HB 3DC2A 1WWHA 4LFAJ 5F3TA 5B0CA 1Q53A 3AOAA 4HHJA 3I0RB 1N5SA 5BYSA 1ZA1B 1RLDA 5SUHA 4ITSA 2MLXA 2JJ4D 3KFWX 4X62F 2OEMA 3PX0A 5LMNF 1U09A 1N5YB 1HI0P 1NDPA 4FYXB 3DM2B 5KG6A 2CZ9A 2G2OA 3ZTPA 1WC6A 3S8SA 1UTAA 4CH0S 2YNIA 1VIOA 5CQGA 4C48A 4X66F 3GCWP 3R8YA 3H25A 2WONB 3Q8QB 2MMYA 2AQ4A 5CYQA 2R4FA 2W2MP 4JV1A 2HHUA 1AROP 1WDDA 2MQLA 3LP1A 4DV0F 2BV3A 4PWDA 2Q3PA 4A46A 2AD9A 3G6ES 3VTIA 1Q86T 3BR8A 2KKHA 5E3CA 4DPUA 2ZH6A 3ZFVA 5DGBA 2B5JA 3TAMB 2BQ3A 3J80U 3PG9A 4IQMA 4WFZA 2GVZA 2CQ4A 3FRZA 1XK8A 5BXIA 1RTJA 4G65A 2H4YB 4ZCKA 1CQNA 2UP1A 2KN4A 1QLNA 2MQPA 1U8WA 5HP1B 2L9NA 3V6DB 1JK9B 4F4YA 3QLHA 5E3PA 1RHMB 2PSZA 4OZ2A 2BQRA 3SDEA 4OHWA 4B9MA 4Y2KA 2OPRA 3DGVA 1FDAA 4IUFA 3CCSS 1UZHA 5HMYA 5ETSA 2HK3A 2CJQA 3CD0A 1DTQA 2YWHA 1W2IA 3A8EA 1X4HA 3I55S 5A8WA 4ZP9A 4ID5B 1R6VA 1T9XA 5T7LA 3TZXA 5D6GA 2ZH8A 1U1LA 3HF5A 3QAEA 4LBHA 3GP9A 3KJFB 1FTRA 4ELUA 1UEKA 3HT3A 1QUPA 1ROFA 4CO5A 4DUYF 2VG5A 4JI0F 4F4XA 1EIYB 4IRDA 2HIQA 1FO1A 4LR8A 4KFBB 4ILRA 1U02A 2WVFA 1B99A 2IA6A 4OYXA 2V4JA 2E5LJ 1SPBP 4DFKA 1WF0A 3OXFA 4H4OA 3BQ2A 1HLWA 4IH6A 5I42A 3M6VA 2MZSA 4A8WA 5EN1A 3IBCB 2NSBA 3FZ2A 2KHCA 1QTNB 1S4FA 2CPFA 4ZVUB 1FF2A 1NSPA 5KFRA 4KO0B 3R9LA 2UU9J 2ACYA 5L9NA 3QGPA 3G8SA 1S6QB 4F4KA 3H7HB 5J1NA 1KOHA 2DGTA 3E2EA 3UNYA 3DLKB 3DRYA 3VALA 2J9CA 3D1HA 1TL7B 3R7BB 4R5PA 4DPOA 4J90A 2Q6BA 2XGQA 3TX0A 5K8MA 5HMXA 1S6PB 1UETA 2LVWA 3GG1A 3MR5A 3A3PB 3OFFA 1R27B 4C0OC 1VBYA 3RG6A 4F26A 3V6JA 2Z56B 3M8WA 2BE7D 5F0WA 2CJ9A 4PWWA 1XTZA 1TP7A 3TEGA 4P74A 2XSJB 4JI2F 3EVMA 4FXWA 5B0FA 3WQPA 2XLKA 3OL8A 5KFCA 5D4NA 3I5BA 2FY1A 2VG6B 2J9EA 4RW6A 2DRBA 3AJ1A 2HMIA 2ZH4A 2HWHA 1VBXA 1S0OA 2QLBB 4J5OA 2G4BA 4X4PA 2X3DA 2W9BB 3VQSA 1YBUA 2DHSA 4U6PA 2HQDA 4ZDNA 3TZWA 5DDRC 3BKUA 4FKXA 3RBXA 1H2TZ 5KFTA 2E7XA 3VAHA 3QSIA 5HI7A 3UNGC 1D1UA 3KLIA 1XNQJ 4L72B 4UT4A 4ZS6A 1BMQB 1CJTA 1VQKS 4KR0B 4PUOA 5GAEI 3BO3A 4NA2A 5F8MA 2MHEA 2AP6A 5C25A 3CPWR 1DZ5A 3BF4A 4Q44A 4P71A 2A1BA 3M32B 1RACB 1Z2ZA 2PEHA 2DHGA 3PV8A 1JLCB 4B9TA 3HXMA 3GG0A 1FJ7A 4GC7A 1F9FA 5L38A 1YJNS 3OUYB 3K8VA 1S72S 1MU2A 1RE1B 2QGFB 4UW2A 5KFNA 3OQ2A 2IYGA 2RF2A 1QVGR 1N56A 3D54A 3TVZA 1H6KX 4D3GA 1U26A 1NK7A 2DXFA 1M0SA 1JLFB 4JI8F 5DQIA 2FC8A 3BPSP 1NH7A 3MURP 3KLGB 3CCUS 2ADCA 5IFMA 4QR1A 5E2QA 3QATA 1T9TA 4JI4J 1ZAWA 2HSEB 5DDPC 1HBUA 3IP0A 3TUPA 3MZIA 4AYBD 3FEXB 1N52B 2PC6A 2E9RX 1EZZB 3DHWC 1Z4UA 2MZJA 2QRRA 4DS4A 1IM6A 3UFCX 3NCQA 4RPFA 3TZZA 1QE1B 4KHPF 1U24A 3MMAB 1RHRB 3S6EA 2HHSA 2WSFC 1K1QA 4NXMF 1JLQB 3W2VB 3J80Y 1HWUA 1YJTA 3Q86A 2C3YA 2FHKA 1N5QA 4DV3J 2ZUAA 1SC3B 1VLYA 3M8PA 2AYBA 1NDLA 2CJAA 4WKYA 3ULHA 1T11A 1L3TA 2VQEJ 3HJVA 5B0AA 1NRKA 4RUBA 4X4UA 4KC5A 2DO0A 4OI4A 2DGSA 1QAYA 1LW0A 5I3QA 2BDPA 4PG6A 2HW3A 1HQUB 1QDUB 1XR5A 1D9DA 4F0HA 3K5LA 4M5LA 5EX3A 3OR2A 1EHWA 2IY5B 1RWOB 3S7RA 2MJUA 2WSEC 2RRAA 2EXUA 2ASJA 1UZDA 2JH3A 4K4ZA 3MMCA 5J2MB 4Z37A 1NB7A 3HULA 1RWWB 1SH2A 4I68A 4OL8A 3VF0B 3RGIA 3IGNA 2XMVA 4QYZK 2YNGB 3DCAA 3WC2A 1OS5A 2N82B 3HKZD 3NS5A 1IKWA 2BKOA 2NUHA 1GMUA 3DLGB 2F5GA 4JOUA 2RU9A 2HVEA 1HNXF 1TMJA 2VODA 1BHNA 2C3OA 5A0YA 3UQSA 4DR1J 4LF6J 3SEOA 2DNPA 2ATLA 1UWBA 3OXLA 4U7CA 2MKJA 3M2RA 2HVZA 3AQPA 4FVMA 1UMJA 4KT0C 2FDNA 4DV1F 2GO8A 1S57A 5KG5A 1Y3KA 1IKXB 5DM6Q 4IG3B 2IVFB 2BRKA 3P4UB 4DR5F 3W2WA 5ETPA 4LRCA 3EDRB 2LDYA 4DI6A 2BXJA 1R0CB 1Q7LB 1RAFB 3MEGB 1SQEA 3HVAA 1EETA 5KOXA 4X4TA 1GX6A 2J7WA 1JKHB 2E1CA 1ITPA 4H4MA 1VFJA 3CD5A 4ZLLA 4ED2A 2HRUA 2BJEA 1WKJA 2CKWA 5D0EA 3G4SS 5KG2A 1VQ9S 2FPHX 1RA6A 1OO0B 1TV6A 1WORA 2O66A 2XNRA 5HLFA 1SQFA 3FDSA 1FERA 2XY5A 2WOMB 1T9YA 1N36J 2DPJA 5D3GA 2FUG9 4B3RF 4CI0B 2UUWA 3NP5A 1G1XA 2CAJA 2QYCA 3C16B 1B0PA 2H4WB 3GJTB 4NRTA 1CC7A 1PAUB 4DR7J 2BOPA 1OYEA 2IYIA 3VQTA 3KG4A 3MDFA 4MIAA 4BHQA 2I6WA 2NLWA 3CXCR 3AA9A 4H54A 3FBFA 2AIRB 2HHTA 2PA3A 4LF7F 5DS7A 1R8AA 1NCLA 3T1HF 4YHHF 1UCNA 3CCMS 1VDHA 4GO7X 3ZZYA 2CPXA 4RNOA 1U0SA 1F5BA 1TFWA 1ZM2A 4URGA 3GYGA 4F02A 2OLWA 2X7IA 1U49A 4ES2A 4RWWA 5DLGA 1B0VA 3P5TL 1RT2B 4ICLB 2ZD1A 1KQFB 2GIQA 3JQKA 3W9HA 1JJ4A 4DPTA 2BJ8A 1YI2S 1I5OB 5IOLA 1NEEA 2GVDB 1KC8T 5G0RA 1RT6A 3MM5B 3D1QA 1X9MA 2V67A 1UAWA 4TY8B 4PXEA 1U6BA 4YMEA 2H54B 3OBIA 3KLHA 4N77A 2DNQA 4XPEA 4FP9A 1S9EA 1WOSA 2IC3A 1QSYA 5CHCB 4DV2J 4C3MA 2B0GA 4HVZA 1AYEA 3MMBA 1JLAA 1AUSL 2I8EA 2R3VA 2W4PA 1IR1A 3Q8PB 4NLVA 1TL1B 1UA0A 4M5KA 2Q6CA 5LJ3Y 2B7BB 4B9NA 1N54B 4IG0B 1FK9A 3TEHB 1NXIA 3H59A 1WJ9A 2BRLA 1TMMA 1WOPA 3IS9A 4J9OA 5D77A 3QJLA 3DLLQ 3D68A 2QA2A 3JQJA 2EC2A 3DI6B 1S7HA 4ZHRA 2POKA 4CT9A 2ZKTA 2IJRA 4ZP8A 4LSNB 2D3O1 1TUGB 3SI8A 3B4MA 4HEA9 5J2NA 4NLTA 1KN6A 5AE1A 2AJQA 3BGRA 1Q7YT 4CO0A 1YTYA 2BZ2A 5I4MA 2V63A 2VPZB 5KT7A 3UR3C 4DPYA 2ZJQQ 4YQWA 4CLZA 2FHJA 1A6LA 5HN0A 4EYIB 2ZBIA 3CMAS 4LF5J 1SH0A 2PT0A 4KJIA 4URSA 1JX4A 3DOMA 5KFWA 3EGZA 1VGYA 2FIUA 1E6VA 2PO4A 3CEDA 1GH8A 4DL4A 1VMBA 4HTIA 3LUYA 1UVJA 3MPDA 4R25A 2E5GA 4ED6A 4LF9F 1WACA 4WE1A 1RCXB 4K8RA 4X4SA 2Y0BB 2JRSA 2GQQA 3GYNA 5IWAF 2X1FA 2B6AB 5A8KA 1RT1B 2DNNA 2L9WA 5K14A 2WBMA 4RO0A 5LOQA 2Y1JA 3JSYA 4ED7A 1AT1B 5GAGU 1NBEB 1SXLA 3CC4S 2ERRA 3QRPA 2OH2A 1RI7A 2HHHJ 3V81A 2QSFA 3NBPA 3W9JA 1H74A 1LW2B 2YX4A 4X4NA 1UWAA 1JIHA 2X1GA 4JI6J 1LFPA 4NEZA 3LF0A 2BJDA 4O4GB 4CO3A 4NLOA 3HVWA 1M5HA 3P45B 4QU7A 1KONA 3D9BA 5KFOA 4ZA1A 4I4BA 4G1IA 4DLEA 2GNKA 3KLEB 4A8QA 3MEEA 3T5HA 3T1YJ 3IAM9 4DOZA 3EWGA 1IKVA 1B0TA 1HHQA 1R8PA 3H40A 1ZS6A 2FZGB 2R7XA 4ANEA 2HHQA 3HP6A 2GJIA 3NNCA 5KFDA 1T8EA 3D67A 4DR4J 1N6QB 1I1GA 3OVSA 5HROA 1SJ4P 3HHLD 2GHVC 3GFYA 2COLA 4Q0BA 4RNNA 5BYQA 1SVDA 2HS0A 3Q8SB 4CNYA 5ETLA 1IR0A 1H0HB 2D41A 2F9DA 2F3JA 1R0AB 2OEKA 1HA1A 1ZA2B 3K59A 4UY85 2DH9A 2CJYB 1XMQF 2CNOB 5EX0A 4RU2A 2OPQB 1E6YB 4CT8A 3WZ0A 3GJSB 5B7WA 4YOEA 1S1TB 2F8MA 1F2GA 3ZTQA 1L5UA 2VV5A 1H7WA 5HANA 2YWEA 3FCWA 3RUBL 2VQFJ 1NLKL 3TA2A 1JLEB 4I64A 2PIIA 3JSRA 1BY9A 3MCSA 2R2RA 1FEEA 4NA3A 1JNRB 1RWKB 5DGAA 4DFPA 3CCQS 1CEZA 5BR8F 1VQPS 3ISZA 2B4PA 4O44A 4JI5J 4IH5A 4CDIA 2Y8YA 5KFIA 1CJVB 4NPOA 4ZVSB 2CPJA 3PW5A 3TOQA 1SV5A 1ZTWA 3GIKA 3GB0A 4WZQA 4PQUA 1NB2A 1FD2A 3FZBA 2GAHC 1DY3A 2QLWA 4UOGA 4P7TA 2NXCA 2KFYA 3DU6A 4NCGB 4ZJLA 3CF5Q 1NMEB 4I2PB 4U67Q 1MMDA 2VL1A 3WC0A 4IR9A 4GKJF 2VU5A 1IUJA 2IMWP 3RW7A 4MFBB 1RWNB 3HHLB 4QR2A 4X4RA 1FDNA 1VQNS 2WZ1A 2Z4PA 4ZLJA 1RSCA 2DGWA 3MAQA 4QIEA 3L7PA 5D78A 2CPYA 4PYAA 1VK3A 2KHDA 1SJFA 3CJ2A 2X51A 2DKOB 1MWZA 5DZ6A 5J2QA 3RBEA 2YKNB 1NKEA 2XO7A 2AF6A 4JYAJ 3LA0A 4DCJB 2ZVIA 5FJ4A 1RYSA 3A3NB 3BGUA 1NPPA 4ECTA 1IBKF 2ZC3A 3HCXA 2PI4A 3C46A 3MM9B 3T6JA 1IBLF 1T3OA 1OQ6A 1SUQA 2C2NA 2NZCA 1RTDA 4RW4B 1NK4A 4IOAQ 4YB6A 5AT1B 2N4CA 3BH7B 3DLHA 4W92B 4EWTA 3Q23A 3T5JA 2HBZB 4M94A 2VFTA 3KUGA 2KM8B 1NJYA 5KT3A 1GMWD 4BBYA 2RMLA 4K4VA 3C14B 2LKZA 2PFDA 4P75A 2UVUA 4UQGA 3KDOA 4ZCMA 4MKAA 1V6HA 4DBQA 1JXEA 3DOKB 3C6TB 4U8YA 3M30A 3D66A 2V2KA 3G6XA 1FKPB 2HKEA 3CJ5A 3IRWP 1WEYA 1HYSA 1SC1B 3QGGA 3DKDA 4I56A 2E1RA 4UQTA 3VGUA 4DWIA 5ETNA 3O2IA 5CYMA 2YBVA 1CS4A 3QQCD 3MM7A 1M90T 1N34J 4WCEQ 2BBEA 3MAAA 2VG7B 4KV8B 5CA5A 1N0UA 4WFYA 5AXNA 1S10A 4F4ZA 1GEHA 1QSSA 3GSIA 1Q8KA 1ACMB 1WHVA 3VZIA 1GXTA 3UI3A 2ZM6J 4Y65A 8RUCA 1QTMA 1V3RA 3GQCA 5E5NA 2OIHA 2PE8A 2OPSB 2YNHA 2KO1A 3HX9A 1S9GB 1N4LA 1RAJA 2FLPA 1R8BA 3OPKA 3LAKA 1TVRA 1QAJA 4FZVA 3SZ2A 4BCAA 2MGZB 4UUXA 4ZLPA 3POTA 3CGIA 4A8MP 1LEOA 1DRZA 1FX2A 3NOGA 3P49B 1LK5A 2AWZA 2V34A 5F3ZA 2YWKA 4WFXA 1FESA 3HD1A 2RB7A 4OYBA 3AODA 1HNWF 2DPIA 5IV4A 2DT9A 1HMVB 1WEZA 1HARA 5KT2A 2UZAA 3N6MA 4J9UE 2AJ0A 1IKYA 3B6BA 3H0PA 3KHRA 4DX6A 2BR0A 2WHOA 3IBFB 1H7XA 2YNFB 5KAKA 2Y1LB 4NOHA 5L1KA 2YH1A 4YR0A 2DNHA 1LWCB 4I7FA 5C42B 4U7UK 2ZVSA 2OFGX 3MECB 4XO0A 2MHNA 1DTTB 1ZPVA 4TVAB 2V8DA 3TUJC 1LWEA 3AQOA 3T41A 2WK4A 4NLDA 2RVJA 2ZH1A 1N5YA 1REVA 5H1SV 2HBRB 1PJ5A 2J7KA 1N5VA 2ILYA 1K1SA 2W24A 2F4VJ 1NZAA 2IAJA 5LMUJ 2AJ1A 1KDNA 5DJBA 4DV6J 3AD7C 4KH0B 2JX2A 1YK9A 2OKQA 1JLBA 4HTJA 4P2FA 3UPFA 3G8TA 3AD8C 4K7QA 5DZ7A 4DN0A 2GIFA 1FNMA 1OY6A 4TY9A 1RAEB 1IM4A 1NK6A 3DGPB 1S6UA 3CDUA 1PIEA 3FQKA 2HS3A 1ZPWX 3HSJA 1UP1A 3KYLA 2PEBA 1QM9A 2HWTA 5HJYA 4NRUA 4J9LA 4FNHA 1EAYC 3NWGA 3N5BA 4EGLA 2QJ3A 2V2ZA 2V8PA 4AT1B 2VFRA 3Q2TC 4GRSA 3W3SA 2QE5A 4I2QB 1B70B 4QWCA 2J6SA 1UFKA 3TAMA 3HM9A 2RKIB 3GFZA 2AEJA 3CCES 3CE8A 3OHAA 3VAIA 4KE5A 2M8HA 4DCPB 3ONQA 4N8OA 4R8UA 3D6TB 3H90A 1HNIA 1CJKB 2LQBA 3N0VA 1S6OA 1L3UA 2F9JA 2JEIA 5HP1A 1HNVB 1DJ0A 1F60B 2A0FB 3DLEB 4QYZJ 3NY0A 2UXCF 3QSYB 4OZ1A 3HLUA 1NSKL 1RTHB 2F7VA 4UF4A 3R5DA 4RW7A 1R7IA 4DV4J 4PG5A 2XCPA 1BUXA 3MD3A 3ZZZA 3HFKA 3FVYA 1SIZA 3WX8A 2RD5C 5HBMB 1DAXA 3PX4A 2R7TA 1CLFA 3ISND 3TQ1A 4ID8A 5K20B 4K4YA 2DGVA 4EK2A 1NJZA 2X1AA 3J7ZT 3KK3B 2J76E 3MTJA 3GU0A 2VD3A 5IQQA 4JV5F 2I5JB 2C1EB 4IFYB 3FQLA 3NKYA 2HZAA 5AXMA 1RBLA 2HVIA 1ZAXA 3G86A 4ZPCA 2OPPB 1TKDA 1X4DA 4MK8A 2ZITA 4M5HA 1Y5NB 3U1MA 1S6QA 1UPMB 1RP5A 1C0UA 2AMCB 3AOBA 2CQ3A 1KRPA 4RWXA 4OX9J 3R5CA 2CZVC 4L73A 1XMOJ 4ZPVR 2OMOA 3EVOA 4OHYA 4YY3F 3DRSB 3JQMA 2QFJA 4F25A 3ENVA 3LPYA 2J8AA 2Y3YA 4M5JA 3FC9A 4DUZF 4EYHB 2CJKA 4B3MF 5CCLA 3NGRA 3MPWA 3SCLE 2VOOA 1HQ2A 4ALZA 4Q43A 4PEOA 2NYIA 2K3KA 3B8HA 4ILMA 4FBUA 1RHKB 3C6UA 1MSWD 1T3NA 1JXVA 3VAMA 2XMJA 2A2DA 2VG6A 3PW4A 3IR5B 3CTRA 2JZ5A 2V8HA 3G6YA 1M1KT 3IM9A 2LEPA 3KMQA 3F73A 2B9XA 2K1RB 1MWQA 3E01B 6FDRA 2AX1A 1BD6A 1W25A 1N48A 4ZKAA 1TKTB 2UXBF 2EVZA 4QBUA 4M5IA 2XNQA 2Z2MA 2DNMA 3GIMA 3SV4A 4AFFA 2DYAA 4DXLA 3Q8RB 4FXDA 1FKAF 1U6ZA 1AA1B 4DSIA 2BOAA 2DNKA 4DLGA 3M4XA 4PR6A 2IRUA 4TU8A 4QW8A 1AZSB 3M32A 3OTCA 3LGNA 1S1UB 2KVQE 2M3DA 2MLYA 4X64J 1RU2A 4C7QA 2DCUB 1YQHA 2CFXA 2UVVA 1NHVA 3IRXA 4EBDA 3RRKA 2MXYA 1TKZB 5EUHA 4P52A 4UOCA 4MJKA 4OZ3A 4MTPA 4RNHA 5J2PB 1H98A 3I0SA 1NM2A 3QFWA 2HAFA 1GAOA 4L6V3 4Y2MA 2C2KB 2CPZA 8ATCB 2D74B 3GIJA 1U25A 1JLFA 2FLLA 4RUCA 3W66A 3J7YU 1Q1KA 3QT5A 5KFQA 1U1MA 3LP0A 1XWLA 3RBDA 3UO0A 1GK8A 3HK2A 4DV7F 1UFLA 3KK1A 1SQGA 2XYHB 3VAGA 2L3MA 4NASA 2B9EA 5E3RA 2ATCB 3LP2B 3V2UC 2JC1A 3HHKA 1FA0A 3OTEA 2FVCA 5B09A 1FJCA 2FB0A 2V50A 1XR7A 4CM0A 4ZIVA 2Y0SD 3AH6A 1J27A 2A2CA 1RXOB 1JLQA 2HYIB 5IC6B 1VOMA 5HK4A 2D69A 2ZJPQ 3GE9A 2HHVA 3LW5C 1TR0A 2PMHA 1DLOB 1WHXA 3BN4A 3R97A 3FJ2A 5CAAA 4NYPA 1HQEB 2J7UA 1VRTB 1YX2A 4ED3A 5KFVA 2Y9HA 2ZOGA 4O4RA 1Y11A 4MYTA 4C6AA 5HMZA 5MLCV 4ZLNA 4KGKA 2HRYA 3G9CA 3M1VB 2RAQA 3Q8VA 2IJNA 1VJQA 3DYAA 2L9DA 3NRBA 3M9OB 2P9GA 1D3WA 3G87A 4DG1B 5C5JA 3LGMA 1CQMA 3RB0A 1HI8A 4LFBJ 3V6HA 3SSRA 1U48A 2JL9A 2KRRA 1IBCB 3ZXWA 4OFZA 4QIFA 4KHRA 4ZP6A 4Z2XA 5EWEA 1IWAA 1X8DA 4JI3J 2UUAJ 3F0NA 3PM9A 2CNLB 2B56A 5D0HA 3K57A 4F2SA 2HFNA 3VGTA 5AXKA 2FLNA 2QEXS 2FJAB 3BKTA 3O5TB 2IM2A 2ROPA 2WCXA 1U1KA 1BQXA 4EO6A 3ISNC 4Z7CA 2BQUA 1TL5A 3AFGA 5KG7A 1RUSA 2V4QA 1IKXA 1X4GA 4IG3A 4C11B 1C4CA 2WW4A 2KB2A 4DX8H 2UXDJ 3G82B 2DGXA 3MEGA 3ZZUA 1X4BA 1JKHA 2N3OA 3JTOA 1RT7A 1YDLA 2PN6A 2CDRB 3NNAA 1FKOB 2HQFA 3UR0A 1T9VA 2ZE2A 4DEZA 4OQJA 2N7CA 2XZTB 3BSNA 2ZH2A 3H8YA 2MQMA 1U47A 2HNZB 3M6WA 1N33F 4KQZA 4LMZA 4DL0C 2EWHA 6AT1B 3NAIA 3X1LB 1WUUA 1OPZA 4DR6J 4KTQA 3HZEA 1MN7A 5ETMA 3MR3A 2DRDA 2V2VA 1S1WA 1NHUA 2VFVA 1SL1A 2GMJA 2BE2B 4M8LA 1T9UA 1NNDA 1F3VA 2KXHA 3RR8A 4CH7A 4FF4A 1MMLA 2ZH5A 1WI6A 1VI7A 4CIOA 2XHWA 4ANDA 2QG9B 5DO2A 2UUCF 4K0KF 3DRRA 5L46A 4E8UA 5L9XA 2RE1A 3ZZOA 2R7UA 3GILA 4KHMA 4OX6A 2IBOA 4KPCA 5HQ8A 3CJ0A 1YVFA 3A1YG 1KP6A 4HDGA 4FKYA 5SZTA 1T03B 1RT2A 4ZCLA 4ICLA 4LUBA 2YNIB 3SQGA 3MR6A 1S4EA 1AFIA 1S77D 3GR0A 2GVDA 3FSXA 2V68A 1J5EJ 4RJVA 3MM5A 3RYLA 3FCVA 2EBEA 1HBOB 2WVBA 1KS2A 5F41A 1F5AA 4W90B 2YPZA 4OZLA 2EFOA 1YJ9S 4LT6A 3I56S 5LT5A 4AL6A 3BM7A 5GADU 4WTOB 1WKKA 4NA1A 2DEJA 2HS4A 1NAQA 3EXYA 1JLGA 2QIFA 2EFGA 2AGPA 4K4UA 4O0NA 4IG0A 4UTGA 2DNYA 2GVZB 4GKKF 4ECQA 3QJJA 5F8HA 7FDRA 1RTJB 4C8LA 2APOA 4F2RA 3OTOJ 3CMES 1O8BA 4K4SA 3QLHB 2RDJA 1YIJS 4LSNA 2MQOA 3OT9A 3MR7A 2XWXA 3W9IA 2OPRB 1S5ZA 4H4KC 4AQYF 1MN9A 4IH7A 3WIVA 4NLYA 3UD4P 3UCUP 1C0TA 1OSCA 4P10A 1B7YB 2C2ZB 4XIUA 1DTQB 3SCJE 3TO8A 1HD1A 4ENOA 5T7LB 2CVEA 2A6MA 3CULA 1HW9A 2AYEA 2O01C 1HBMB 3O1LA 4KGXB 1S79A 3UE2A 2BABA 2RSQA 1I6JA 5KG1A 2YH0A 4A48A 3NS6A 2MEWA 1BXNA 5I42B 3ZZPA 2Q1LA 3B82A 4N41A 1F3FA 2KG1A 4QR0A 2CNNB 3ILLA 5F8JA 2CQ0A 5JUMA 2YKMA 2FD2A 1VQOS 4TYAA 5CABA 3OR1B 1VC6A 4FBTA 2VONA 3A13A 1FE0A 2L48A 4Y34A 4CLLA 4R5PB 1R6YA 4KKOB 2OMLA 4ECWA 5A2QU 3KXDA 4DR2F 4J7CA 3DN9A 3I31A 1P6TA 5HQMA 3PX6A 1NJXA 1WDTA 1N88A 1N32J 4N7TA 3IO1A 5F8NA 2GMLA 2PI5A 4O4GA 1RWMB 5CD4A 1YZ7A 1MROA 3BGFA 4ZJQA 1GX5A 4CLPA 5H9EK 4PRFA 1UJ6A 3KLEA 2H3EB 1WHYA 2LEAA 4RW6B 2HMIB 1I94J 1X9WA 4OIXA 4GMKA 4LJMA 2HFZA 5KFBA 3HD2A 4ZVGA 2C2EA 3SCIE 1Q0NA 1V3SA 4ECRA 3OJSA 4OX7A 2XMAA 3CJ3A 4LRFA 4QIVA 1S0NA 2ZEJA 1OYDA 3NS7B 3NGKA 4C8MA 2HHWA 1HR0J 2N4DA 4JI1J 2C22A 3IG1A 3RZAA 2XC9A 2ZHBA 1YHQS 4A8OA 4PUOB 4DQRA 4DV5J 4B3SF 1C1BB 3GIRA 1R0AA 2VFSA 2YTCA 5DDOC 3V4IA 1AFJA 4NYZA 1T9WA 5J1PA 2CQ1A 1RBOB 3D4JA 1Z1ZA 2CQCA 4EO8A 4PAAA 3SXLA 1JJ2R 2V69A 4YB1P 2DGOA 2F40A 3KJVA 2BANB 2OUGA 2VA3A 3MEDA 2NCKL 1MU2B 1P9QC 2EEYA 3MFHA 3U7JA 1JLEA 2R7WA 1K0TA 3CMQA 4ZVQB 2RF2B 2WTFA 4ECVA 2GO9A 1VQYA 3KLFA 2ZC4A 1NDKA 3TANA 2JDJA 1UVIA 4OZJA 1XIQA 4MT1A 5AJ3F 2YPYA 1S99A 3W8GA 2M2BA 3O6QA 3NL0A 4OI2A 4WP3A 1HBUB 1IJEB 2LU2A 1R8HA 2FJVA 3AOCA 3V6KA 2YQ1A 3JS9A 5JVHQ 1S76D 1EKRA 2W9CA 2RQKA 3BH6B 4RU9A 3M8SA 2XQCA 2ASLA 1HHSA 3VZHA 1KSPA 3A8IA 1FCAA 5AXLA 5HJXA 2HNYA 2EBGA 3GV5B 3UN5A 1YRTA 1GTEA 1H2VZ 4CTAA 5K8PA 5CXTA 1U7LA 4R0EA 1KVIA 1ZM4A 3UN3A 1BE4A 4L3NA 3M8PB 1WEXA 2CWKA 2FVQA 1FXRA 1SKUB 2FJEB 3TYTA 1VCTA 1UJ5A 1FJGJ 2DRAA 3K5PA 3Q89A 2VF3A 2V94A 2XO6A 4A8FA 3R6LB 4G3IA 2VPWB 2Z2ZA 1LW0B 4IQXA 4NCAA 2GAGC 1IBMF 3R5GA 4LBPA 2DIUA 3IR7B 3I5AA 3CUNA 2F65A 1PJ7A 4ZITA 3NLCA 2MQNA 5K8OA 2D9OA 2U2FA 4JI7F 1WF2A 1QVFR 1MMNA 3OTDA 3MM9A 2NUUG 1VISA 3MMCB 3BQ1A 3UVJA 3CCLS 3PNIA 1UA1A 4JP8A 5KTQA 3GYXB 5B0BA 4RZRA 1YBTA 4EUVA 4P2XA 5U47A 4OHZA 2OFHX 1Y5LB 2GS8A 2XSFA 4QYRA 3BSCA 2M7SA 1WTBA 5LSOA 4TN2A 5A0YB 3VHQA 3GIIA 1R0BG 3TZYA 3UDCA 1UWBB 4LFCF 3M2RB 4RR5A 1SKRA 1FKPA 4HLBA 2VBWA 4P72A 4B9LA 3W2WB 4JI3F 1GNKA 1XR6A 2BA9A 1KLMA 2KJVA 2JEGA 1RHQB 1K47A 1EETB 3M8RA 1RT5A 2MZ1A 4DR3F 3UCGA 1KBRA 4Y3CA 3BPDA 1IR2A 4ECYA 3M2UA 2ALYB 2FZKB 4W4MA 4J9NA 2GJFA 1RU1A 3N28A 1FJEB 1CBKA 2ADBA 2WSCC 2MZTA 3MF5A 1XERA 2OPSA 1TZ0A 1PBUA 4CLTA 4KGZB 1VHFA 2R2SA 4WZMA 1R43A 3GCXP 2OAUA 1NJIT 5D3GB 2D3UA 1AXQA 2MTLA 2CZ4A 2BYCA 4A8SA 3ILJA 2VUGA 4YN3B 3L4BC 1YG0A 2LECA 4B9UA 1FDBA 3W5XA 1Q81T 5C24A 2YWFA 3HPOA 2JLEA 3QJPA 1FI4A 4NXNF 3H98A 3C66A 3RW6A 5IQ6A 2ZZNA 3PYDA 2A18A 4PXBA 2DY1A 2C28A 2QC3A 2ZKUA 2FHOB 4X62J 1APSA 4Y28C 1Y3JA 1U1RA 4RW8A 2RJZA 5F8GA 3BKFA 2KTQA 4J91A 3UW1A 3EZ5A 4USMA 3PIPQ 3MM8B 4F0MA 4NLQA 1F0XA 3TVKA 2DHXA 4J9RA 1CULA 1R3NA 4CM2A 5C42A 4DQSA 2FHJD 4CWBA 2QMWA 2HVHA 3MECA 4XPCA 3TAQA 1QAXA 1DTTA 4YB7A 4X66J 1X4FA 3LANA 1RT6B 1WD6A 2XMKA 2Z0GA 4LSLA 2GHWA 1IJFB 2VDIA 1HNZF 2W4CA 1RA7A 4YEAA 2HURA 2ZWPA 4ER8A 2CQDA 3KLHB 1ZZFA 4QIWD 4DV0J 3CVKA 1TK8A 3OFHA 1GT8A 1S9EB 3FKBA 2GQCA 3OSNA 2QA1A 3NMAA 4WFBQ 4URQU 4NCBA 1VQ8S 3H2UB 2L41A 1JLAB 2HLTA 2QLXA 3RAQA 2BJ3A 4FNIA 2IPOB 4WP9A 2LA6A 5KFKA 2YKPA 1VQ6S 1L3KA 1FRIA 1X4CA 1FDDA 2E5IA 3DGPA 1UVKA 3O8WA 2R7RA 2FYXA 6FD1A 4MKBA 3L95X 3NAHA 2KU7A 5IT4A 3ICLA 3IBWA 4ZHRB 4DX7A 2BJ7A 4RBVA 2YQ3A 3BGLA 1X0PA 4I2QA 4F0KA 1UVLA 2DEIA 3FGVA 4WBFA 4PXCA 3KOAA
chains in the Genus database with same CATH topology
3H90A 2QFIA 3W5XA 3W5ZA 3W8PA 3BYPA 3W65A 3W62A 3W8GA 5HSPA 3W5YA 3W60A 3BYRA 3W61A 3W63A 2ZZTA 3W66A 3W64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H90 A;  2QFI A;  3W5X A;  3W5Z A;  3W8P A;  3BYP A;  3W65 A;  3W62 A;  3W8G A;  5HSP A;  3W5Y A;  3W60 A;  3BYR A;  3W61 A;  3W63 A;  2ZZT A;  3W66 A;  3W64 A; 
#chains in the Genus database with same CATH topology
 2CVI A;  1RDR A;  3HZG A;  3K5M A;  4PG7 A;  3N9U C;  2UV8 A;  1I3O B;  1C1C A;  3DU5 A;  5KFJ A;  2MKI A;  4C8N A;  5DQG A;  3LTO A;  4NZ6 A;  2R2T A;  4HAC A;  3HKW A;  1HNV A;  2QZ8 A;  3ELH A;  4DUY J;  2A3J A;  2H9Z A;  4M5M A;  4JI0 J;  3GV7 B;  2I1R A;  1PYO B;  2VJV A;  5A8R A;  1HBN A;  2EI5 A;  2RQ4 A;  1RTH A;  3CD6 S;  3JTP A;  2UUB F;  4QWD A;  1VQL S;  4NLR A;  2XMT A;  3QO9 A;  3W5Z A;  3MUV P;  3FMB A;  2YKA A;  2B51 A;  4OYI A;  4LIR A;  2XY6 A;  3DDN A;  2HPU A;  1X5S A;  1OY8 A;  1WHW A;  4KGV B;  3NGT A;  2CQB A;  5EHH A;  1M5P C;  2Z2Y B;  3BBC A;  2O5D A;  4WE1 B;  2NXN A;  4B9S A;  3KK3 A;  4E2F B;  5HAO A;  2XTJ P;  5A8K B;  2IMO A;  2YKQ A;  4RUA A;  4IFY A;  1YRX A;  2QTW A;  4QPX A;  3ETM A;  2ACM A;  3ITH B;  3K2Y A;  2AZ3 A;  3PRV A;  4LF4 F;  2OPP A;  3PKY A;  3V81 B;  3NBP B;  2LCW A;  4AD6 A;  5B0G A;  1XNR F;  2DIV A;  1EQM A;  2HLU A;  1IVZ A;  3ZTR A;  5HL7 Q;  4Q8E A;  4ZJO A;  2VH7 A;  2W8L A;  2MB0 B;  2MY8 A;  4JI2 J;  2RNE A;  2NXU A;  4NZ7 A;  3DXB A;  3HHE A;  5F8I A;  3JSM A;  3DRS A;  2Q43 A;  3S01 A;  3QNW B;  2MYF A;  5LXY A;  2KZZ A;  2HBY B;  1JJH A;  2B7C B;  5DLF A;  4LRB A;  1IKV B;  2NSC A;  2OP5 A;  3LWM A;  2X3G A;  5IM0 A;  1ZYQ A;  4KPY A;  4LF8 F;  5D4O A;  3P6Y C;  1IQZ A;  4EBC A;  2JVO A;  2C2D A;  2R8H A;  2E5H A;  1CVJ A;  4CCH A;  3UD5 A;  3G6V A;  4Q0B B;  8AT1 B;  1V3Z A;  1RAA B;  2WVC A;  2VPX B;  5LL6 d;  3QZ7 A;  2VIC A;  4OJ3 A;  3R7N B;  1HIY A;  1R89 A;  3E01 A;  2XYG B;  3C2P A;  4IRC A;  4ECU A;  3CD7 A;  3TR5 A;  1DUR A;  1TKT A;  4X65 F;  4EZ9 A;  1Y7P A;  3TAR A;  2C2M B;  1V5I B;  3U1N A;  3CCZ A;  2E1A A;  3H5Y A;  3ZZ0 A;  2HG4 A;  3CCT A;  4ZVE A;  4MKV A;  4OLP A;  4B02 A;  3KK2 B;  4B3T F;  5I3U B;  5KFS A;  2W7O A;  3CCJ S;  3IMQ J;  2ILZ A;  2H5E A;  1IQT A;  4NI2 B;  2ZNZ A;  3W63 A;  4JI8 J;  2P2C B;  5IV3 A;  4K2J A;  1SB6 A;  4ATN A;  2DNO A;  2JSX A;  3GJR B;  2EK1 A;  1CJU A;  1OIA A;  4ZP7 A;  1SV5 B;  2P5V A;  4PQU B;  1TKZ A;  3MOJ B;  2HFO A;  3FBE A;  2UVR A;  4I6Y A;  2LQJ A;  5J2P A;  3BV8 A;  1WI8 A;  4QW9 A;  4KHP J;  3SSS A;  2MKY A;  4IO1 A;  3I96 A;  3EPI A;  3D3B J;  2XS5 A;  4NXM J;  4LFA F;  4E0D A;  1RLC L;  1BQM A;  1J5O A;  4CLK A;  4FPI A;  1YLX A;  2M5Y A;  3D0I E;  3AA8 A;  3PDN A;  1FWK A;  4F8R A;  5HAT A;  3DOL B;  2LXF A;  2ZHO A;  3LP2 A;  1J2V A;  3CT9 A;  5E7O B;  4RW9 B;  5GAD I;  3QIP B;  2FC9 A;  3RAX A;  1ZBT A;  2Z30 B;  4I67 A;  3O44 A;  5K8N A;  3HMJ G;  2AX0 A;  3DFE A;  4J9P A;  3LWL A;  1S1X A;  2LDI A;  2JEF A;  2DR6 A;  2KL8 A;  4OI3 A;  4BC7 A;  1FFG B;  2DD8 S;  1WOO A;  3AJ2 A;  2K06 A;  3IC1 A;  5KG3 A;  4I6A A;  4ZPB A;  3C19 A;  3OFE A;  1ZZN A;  2XEX A;  1SUQ B;  2NPI A;  3EX7 B;  4C8K A;  4V1A k;  1WC1 A;  4PXD A;  3V4M A;  2ZZM A;  1F2H A;  2G13 A;  3NNH A;  4YDX A;  3M6X A;  1FVQ A;  3N4W A;  3A12 A;  1PO6 A;  4C8Z A;  1RT4 A;  4DG1 A;  4IDK B;  1HNX J;  4WFA Q;  3TUZ C;  4HHH A;  5EWG A;  3T19 A;  1MNE A;  2VBX A;  4U95 A;  3EGW B;  4DV1 J;  3B54 A;  5E0O A;  3K5O A;  4W98 A;  4K5S A;  3UWT A;  4DR5 J;  4F3O A;  3I9V 9;  1SJ3 P;  4ED8 A;  3M2V A;  4DUT A;  2W1B A;  2FLO A;  1CS4 B;  2J9D A;  2AKW B;  3W7B A;  2GGP B;  2LLZ A;  2C42 A;  4DZ6 A;  1EKS A;  2DIS A;  4I6W A;  2LQ8 A;  4U9R A;  2Q79 A;  4DL6 A;  3KUH A;  2VOP A;  1H72 C;  1NKB A;  2BJ9 A;  5H9E J;  4LVO P;  1OWX A;  2EFQ A;  5T14 A;  4IFV A;  1VIX A;  4C11 A;  3JAM U;  1PC5 A;  3I4H X;  4M5N A;  2CQH A;  1JXL A;  2HFV A;  4DSL A;  5HVF A;  2YNH B;  5KFX A;  4B3R J;  1UW9 A;  1NK0 A;  4K50 A;  4RBU A;  4UOH A;  4CLU A;  3TA0 A;  2P9E A;  1WKL A;  1WF1 A;  1NDC A;  1TVR B;  3ILO A;  3A3O B;  1NUE A;  3GTY X;  2DR8 A;  3FFI A;  3CDB A;  3MM6 A;  1X31 C;  1RTI B;  1S0V A;  2E5L F;  3POT B;  3ZC4 A;  2CJX B;  1VLO A;  2A6O A;  3MCM A;  1ELO A;  2KXF A;  2RHQ B;  3WIU A;  2AU0 A;  2HNZ A;  1S9F A;  2UU9 F;  2B3T B;  1HFE L;  1L3V A;  3KMS A;  3TI0 A;  3JYT A;  2D1C A;  4LF7 J;  3D7S B;  3T1H J;  4MMO A;  3M8Q A;  3OL7 A;  4YHH J;  3PO4 A;  3TW0 A;  1SBR A;  4AE5 A;  3QT6 A;  2VC1 A;  4LF2 A;  5LM7 E;  1X5T A;  2E29 A;  5D0R A;  3T3F A;  2G0C A;  3CJS A;  3L9Z A;  1VS3 A;  2BE2 A;  3PW7 A;  4OZ5 A;  2VA2 A;  4C3L A;  2M88 A;  2E66 A;  2Y1R I;  1ZH5 A;  2BJ1 A;  4I7F B;  3H20 A;  3BBF A;  3R5A A;  1S0M A;  3RB3 A;  1AW0 A;  5A6W A;  1O5J A;  4BS2 A;  5RUB A;  1YJV A;  1QUV A;  1MW7 A;  1OY9 A;  1W2B R;  3PKM A;  3HFV A;  5GAH U;  1LWE B;  1K44 A;  3PR5 B;  1REV B;  1NHK L;  3OV7 A;  4LQ9 A;  1AB8 A;  4U96 A;  4KH1 B;  4QU6 A;  3EUN A;  3TJ8 A;  5BJR A;  4OYW A;  2HFU A;  2IAJ B;  1RT3 B;  3A8K A;  2C3P A;  1T03 A;  3MI7 X;  1KEK A;  1JLB B;  4QWE A;  2E7W A;  1GXU A;  1D09 B;  4C0B A;  1HBO A;  3VVU A;  1YIT S;  4XAK A;  2CQ2 A;  1CG2 A;  3RB4 A;  4S0M A;  3X3U A;  2BAC A;  2LFV A;  3OFG A;  2RS2 A;  3GWC A;  3CJT A;  1RWU A;  1XNQ F;  4Y2C A;  2Z58 B;  2MPU A;  2R2U A;  3JSB A;  4ZOS A;  2C2R A;  1YBA A;  4ZVP B;  2XMM A;  3IWN C;  4C9D A;  1CPZ A;  4KSE B;  1RHU B;  4DQI A;  3TJ9 A;  4N56 A;  1FFW B;  2F8H A;  3HSD A;  1WG5 A;  1ULR A;  3BSO A;  2HQ3 A;  1GMV A;  2CNK B;  4R8U B;  1DFD A;  3ZTO A;  1HNI B;  3PRD A;  2AGQ A;  1FRJ A;  2QSW A;  5J1E B;  3MTK A;  3G8Q A;  3E8O A;  5JVG Q;  3G96 A;  3H5S A;  2V8G A;  2W2P P;  1WC3 A;  5F8L A;  1T05 B;  1YJW S;  1VQ7 S;  1JJC B;  1FXD A;  2DJW A;  2IRY A;  4KY3 A;  4WXW A;  1FTC A;  2H65 B;  5ADZ A;  4RW7 B;  4AL5 A;  3HFZ B;  2XWY A;  3M8Y A;  3M9N B;  2Z2L A;  3HJF A;  3DLB A;  1A9N B;  4JI4 F;  1FWP A;  1PAE X;  3Q2S C;  5HVG A;  1JMT A;  1VBZ A;  1HBM A;  4LF9 J;  4DFJ A;  3Q24 A;  1RAH B;  1FX4 A;  5IWA J;  1U8S A;  1W26 A;  4ES1 A;  4DU8 A;  2YWG A;  4KGM A;  2W2Q P;  2BW2 A;  4Y00 A;  3ZZR A;  1Q8B A;  1KHW A;  1NJW A;  2W2O P;  5M2R A;  3TX8 A;  2FJD B;  3W64 A;  3IN5 A;  4DV3 F;  3IM8 A;  1JNZ B;  4CLY A;  1M5K C;  3TNV A;  2B9Y A;  1FHT A;  4O3Q A;  4PKD B;  3CIZ A;  2IM3 A;  3RTV A;  3OR1 A;  3U02 A;  1C0U B;  3FBB A;  2VQE F;  4FF3 A;  2JC0 A;  1G6B A;  4O3S A;  4LSZ B;  4Q8F A;  2O3D A;  2XMU A;  4DL3 A;  1EX8 A;  1LQ9 A;  4FS2 A;  4LR9 A;  1O6X A;  4WII A;  4KKO A;  1TL4 A;  3R2D J;  2KRB A;  2JLF A;  3Q0A A;  3SSQ A;  2MZR A;  2G1H A;  4FF2 A;  4C3K A;  3JAM Y;  1Y9O A;  4TQR A;  4EMD A;  2L08 A;  1U1O A;  2HND A;  1TU0 B;  4HT5 A;  2ZWO A;  1RKJ A;  4OI0 A;  1B3T A;  4LF1 A;  4Q2M A;  2I9S A;  2FVP A;  5L39 A;  2ZBP A;  4A4J A;  5FLX U;  1TQL A;  3NWR A;  1L3S A;  3BQ0 A;  4ES3 A;  5DG7 A;  2PMW A;  1Q8I A;  2DNR A;  3C6U B;  4TYB A;  2KJW A;  1F5C A;  3CJK B;  2A10 A;  1LWF B;  2DR5 A;  3W8P A;  2HHX A;  3H42 A;  4ANC A;  5KG0 A;  5H9F J;  4AXJ A;  3BYR A;  5LSL A;  4DR1 F;  4LF6 F;  2MST A;  2GW8 A;  3KLV A;  4FVC A;  5EGY A;  5C2G A;  1S97 A;  1XMQ J;  2P6T A;  3BB5 A;  3K5N A;  3CJ4 A;  1XEZ A;  3ZO7 A;  2QA4 G;  2VFU A;  4FXV A;  3NOC A;  2EK6 A;  1BC6 A;  5HVH A;  1CC8 A;  1YJU A;  4J9K A;  4NE9 C;  4P9S A;  3QRR A;  2QLJ B;  1EP4 A;  3MUM P;  1P9Y A;  2GMH A;  4OV1 A;  3J81 U;  1T7P A;  4DN9 A;  2IM0 A;  5C2C A;  1C1B A;  2DBB A;  2EFP A;  4ZCI A;  1P1T A;  1FFS B;  2EG2 A;  1U2C A;  5BR8 J;  2B4U A;  1UVN A;  1A0O B;  1FRH A;  5F0U A;  2W8K A;  2NXJ A;  1O0P A;  2AW0 A;  1KVJ A;  2YKO A;  4U7U D;  3PW0 A;  4ED0 A;  3IRX B;  2BAN A;  1JB0 C;  4OYO A;  1N36 F;  5KFF A;  3W61 A;  2QLF B;  1MLA A;  4C98 A;  3BEG B;  3I0S B;  4DR7 F;  1VRU A;  2C3M A;  4WK1 A;  2HEK A;  4P6Q A;  3HVT B;  3IAS 9;  5HSP A;  1TUV A;  1VJW A;  3CO0 P;  1U0H A;  3KKF A;  4GKJ J;  1ZTT A;  5IT0 A;  1SJ1 A;  3I0R A;  3LP0 B;  3EPG A;  1X5O A;  3OW2 R;  3KK1 B;  2RDI A;  2E1P A;  3DNC A;  4ECX A;  2E7V A;  1G2E A;  3EGV A;  2OTJ S;  2MKS A;  2UV8 G;  1PYS B;  3HHD A;  2G2Z A;  4WKR A;  4NLX A;  2OJ3 A;  2M52 A;  3DM2 A;  3LO3 A;  4GVL A;  1SC4 B;  1M1H A;  4O3N A;  1RZM A;  2KT5 A;  3N6L A;  3KDN A;  2Q66 A;  1TKX B;  2LQ5 A;  4DDF A;  3I9Z A;  3M6U A;  5FDL B;  1IBK J;  3CCR S;  1RWX B;  4LRD A;  4DCO B;  1S12 A;  1IBL J;  3BYP A;  2WON A;  5ETO A;  4CP5 A;  3OVB A;  1F6T A;  4YR3 A;  2XLJ A;  3VAF A;  3RB6 A;  4U8V A;  5AE2 A;  4PPZ A;  4M5D B;  4LR7 A;  4G1Q B;  4C0H A;  2GHP A;  4RNF A;  2W25 A;  1UEU A;  3DYA B;  5KOW A;  1T02 A;  3AJD A;  5KT5 A;  4DV2 F;  2BEF A;  3A4T A;  2GA7 A;  2E44 A;  2RHS B;  1XQI A;  3AXM A;  5L1J A;  4YS2 A;  4L76 A;  5A6P A;  2H48 B;  4R0J A;  1NU4 A;  4PYD A;  2KH9 A;  4RUH A;  3NEK A;  3V6D A;  2ZH9 A;  4UZC A;  4FF1 A;  3IGV A;  4FPR A;  3TUI C;  2HK2 A;  4B3O B;  2IBK A;  2DHH A;  2AJ4 A;  3PAC A;  2JLG A;  3AD9 C;  2VC0 A;  2OSR A;  3FSY A;  2KVI A;  3M05 A;  3KHG A;  3WHI A;  4C4W A;  1DHM A;  1RCO B;  2DK2 A;  4HDH A;  1TL3 B;  3US5 A;  4QOT A;  1IWG A;  2OSQ A;  4ID5 A;  4B08 A;  4WPA A;  2CG8 A;  3D5M A;  2DTJ A;  2E1M C;  4JV0 A;  4USK A;  4KB7 A;  4CLS A;  1LXN A;  5ETV A;  3HSZ A;  2V6A A;  1S1V B;  2P6S A;  4KFB A;  4LF5 F;  4QCL A;  3FEY B;  2DXE A;  5C7P A;  4WYL A;  1RT7 B;  3PW2 A;  2U1A A;  1Q4R A;  2HWI A;  2CAD A;  4EEY A;  5FII A;  3MXH P;  1KQG B;  2ZE2 B;  3D2W A;  4KO0 A;  5FLX Y;  4CYU B;  3PEJ A;  1KKH A;  2IHR 1;  1Q95 G;  5F9N A;  4F4A A;  4FYD A;  4LBI A;  2FY8 A;  2MZQ A;  3FK4 A;  5DET A;  1HNW J;  2BE9 B;  4WTY A;  2LP4 A;  2FHM A;  1RWV B;  3T5L A;  3W60 A;  2B8P A;  3DLK A;  3P3D A;  1S1W B;  1TL7 A;  3L09 A;  3QID A;  1DQA A;  2H1Y A;  5ETK A;  3EJM A;  4O3P A;  3ET6 B;  3FNN A;  2XGP A;  2XS7 A;  2QN6 B;  4D3H A;  1S6P A;  2HHH F;  3KUE A;  4Q2L A;  4A8X A;  5T41 A;  4NLS A;  3PR4 A;  4DL2 A;  4NEY A;  3G71 S;  5L8R C;  2E9T A;  1G3O A;  4NMX A;  4NX9 A;  3VGS A;  4JI6 F;  4LIW A;  1KTQ A;  3GJQ B;  4OJ1 A;  1PYT A;  1HPZ B;  1Q79 A;  1QJH A;  3DRR B;  1KHV A;  4OZN A;  2ZJR Q;  3J81 Y;  4HH1 A;  2NRE A;  2XSJ A;  3MM8 A;  3QWU A;  2WW8 A;  1LNQ A;  2LA4 A;  1SKS A;  4RLE A;  3ETO A;  3R1L A;  4OV6 A;  1P1L A;  2V2Q A;  3HI9 A;  3NCR A;  5LJ5 Y;  3MHY A;  2M8D B;  2RDD A;  5DG8 A;  3T1Y F;  1S48 A;  2MKH A;  4OLO A;  4P73 A;  4JBC A;  3SQG B;  1Y5I B;  4ILL A;  4NL5 A;  5JJB A;  2V4R A;  2QMU B;  2W9B A;  5I3P A;  3TJA A;  3LGH A;  4NLU A;  3NMR A;  4DR4 F;  2OEJ A;  3PCO B;  3K17 A;  3AXK A;  2Y8W A;  5B0E A;  4CZC A;  1FXL A;  1EJ7 L;  2R8K A;  3I87 A;  3CJR A;  3I5C A;  2RQM A;  3ILI A;  4DSK A;  4M5G A;  1G4C A;  3MCN A;  4NZ0 A;  1LXJ A;  1RB0 A;  1JLG B;  4HR2 A;  1VQM S;  3PHT A;  4UY8 T;  3RJM B;  3FUY A;  1JLC A;  3I4P A;  2KI2 A;  4O0I A;  4FN5 A;  3C15 B;  2R7Q A;  3CDE A;  3OUY A;  4MIW A;  4WK3 A;  2O1P A;  3J7A 1;  3CC2 S;  3RR7 A;  4KRW A;  2DH8 A;  3D3C J;  2B9W A;  5DQH A;  2UXC J;  2VQF F;  3GFX A;  5E3Q A;  5K9F A;  1TUW A;  2JHE A;  3QFH A;  1NPK A;  4YP3 A;  2HHP A;  3KWM A;  3T9Z A;  3KLG A;  5HMW A;  1C0T B;  2N7Y A;  4JI5 F;  3TRG A;  4PPD A;  1X4A A;  2R7O A;  1YRU A;  4FYY B;  4USV A;  1FRL A;  5KFA A;  2CPH A;  2NZ4 A;  4L3K A;  3BN7 A;  1KQS R;  2LQ9 A;  4YFU A;  1RWP B;  3J7Z 5;  2IDE A;  1ZM9 A;  1QE1 A;  3MMA A;  1VHI A;  4JV5 J;  4TKT A;  3MMJ A;  3W2V A;  1URR A;  3S1T A;  1PIL A;  2DGU A;  1BQN B;  4ED4 A;  3PRB A;  4CNZ A;  2QL5 B;  4TU7 A;  4NYO A;  2MLZ A;  4J37 A;  2YKM B;  1PJ6 A;  1SKW A;  1NSA A;  1RAG B;  4LRE A;  1EB0 A;  2R9L A;  1LFW A;  3DMJ B;  4J9V A;  2FJB B;  1SCJ B;  1HQU A;  4YY3 J;  3IWX A;  3ITH A;  2R8I A;  3K89 A;  1B64 A;  4JYA F;  4CO4 A;  1SJQ A;  1P8G A;  2NYH A;  3KJN B;  4EZ6 A;  4O3R A;  4DUZ J;  4JV2 A;  3HHN B;  4B3M J;  5J2M A;  3LAM A;  1D9F A;  1WTF A;  3R7S B;  4BC9 A;  1U1N A;  2IJF A;  2V9K A;  4ED1 A;  1S49 A;  1ZM3 A;  2J0W A;  3BGO P;  2YNG A;  5FD1 A;  4HL9 A;  3RU0 A;  1GXL A;  1Q16 B;  4OJG A;  1MRO B;  3GV8 B;  2ZBC A;  1DQ8 A;  3MPV A;  4K4W A;  4HH0 A;  3DLG A;  4K4T A;  3FCH A;  2RS8 A;  4MIB A;  3LH2 S;  4P7V A;  4DJB A;  3KG1 A;  1R31 A;  2CWX A;  1H2U X;  2IRX A;  2UXB J;  3MOZ A;  2J0X A;  1T0T V;  3MR2 A;  3RBZ A;  2VIH A;  4BLG A;  4GVB B;  2EFV A;  5KG4 A;  2W9A A;  1PC4 A;  2QX0 A;  2PMZ D;  3PJ9 A;  3PFO A;  2R7S A;  3KNG A;  5GAG I;  1SI9 A;  4WXO A;  5D4P A;  1N34 F;  3OTB A;  4F04 B;  2WB1 D;  1HHT P;  2DNG A;  3OVA A;  4WIQ A;  3IG1 B;  3ENQ A;  3N5F A;  3GSD A;  2FJX A;  2XI3 A;  1RK8 A;  2ZOM A;  2NR0 A;  1AUD A;  1NH8 A;  4PZV A;  4I1T A;  1K0V A;  1LK7 A;  3Q8Y A;  3A8J A;  3V4I B;  2ZFH A;  2ZM6 F;  3DRP B;  3L3C A;  1X0F A;  1DBD A;  1U2F A;  2C2O B;  2ZBQ A;  2NPF A;  2ZOF A;  2WOM A;  3Q22 A;  3KK2 A;  3G2X A;  3MAH A;  3KJV B;  1Q5V A;  4TLR A;  5I3U A;  3CO9 A;  1YSJ A;  3MED B;  3C16 A;  1X4E A;  3OLA A;  3THP A;  2PA8 D;  3SV3 A;  3GON A;  3D6H B;  4JB8 B;  4NI2 A;  2K7K A;  4NWB A;  4PG8 A;  1RTZ A;  2W7A A;  4OI1 A;  3JXO A;  3KLF B;  5GAH I;  4PCQ A;  2RU3 A;  4DV7 J;  1DAR A;  4F36 A;  1RYR A;  2JFK A;  3R3T A;  1LKZ A;  2BM0 A;  5E33 A;  2F63 A;  2BKN A;  2XI2 A;  3NCP A;  3AB4 B;  2DGQ A;  2GC8 A;  2XYP B;  4QPT A;  2VJU A;  2W9C B;  4BDP A;  2GQ2 A;  5KFY A;  4DSJ A;  2HNY B;  1EQ0 A;  2PGC A;  4YDD B;  1RQ0 A;  4CTA B;  3M9M B;  1HKA A;  2OGU A;  1XJW B;  4DU7 A;  4X84 A;  3N6N A;  1K8A T;  2DCL A;  4UUW A;  3MPY A;  2ZNY A;  2X1B A;  2C3U A;  3DOL A;  3PYF A;  2UUT A;  1F1B B;  1WG4 A;  1P27 B;  5CYQ B;  4TY8 A;  4RW9 A;  7AT1 B;  3QIP A;  5MAO A;  4I0W A;  4Y2I A;  3KHL A;  2CRL A;  1FD8 A;  2KYX A;  3LP1 B;  1HL6 A;  4X4Q A;  2EW9 A;  4PWD B;  2VPY B;  3SIP B;  5GVQ A;  2VBY A;  2F4V F;  5LMU F;  4DV6 F;  2YWW A;  3R2C J;  2J5A A;  2HVD A;  1TL1 A;  2B5J B;  4CLW A;  3K58 A;  1KTV A;  4IRK A;  4E98 A;  3UVJ B;  2EG1 A;  4DF8 A;  3K7R A;  2XS2 A;  2MJN A;  2W4D A;  1F9H A;  1UVM A;  1FRK A;  4J9M A;  3W65 A;  1URN A;  2V5H G;  3DI6 A;  5D0G A;  4FYV B;  4AL7 A;  2JWN A;  4X4O A;  4OI6 A;  3R5J B;  2I38 A;  3OSP A;  2OD4 A;  4IDK A;  3SDE B;  4ETX A;  3ZNU A;  4HT7 A;  4EBE A;  1TFY A;  1KVK A;  1WNE A;  2EFN A;  3U1L A;  1U2R A;  1KOO A;  3BZQ A;  1X5P A;  5D4L A;  1UKU A;  5A8W B;  2HIY A;  5DDQ C;  2XG8 A;  2D3O R;  3BDP A;  1KLM B;  1T95 A;  4MAK A;  1V5V A;  2XY7 A;  2GGP A;  2VG5 B;  1PBA A;  4RNM A;  1RT5 B;  3QMQ A;  5KFH A;  3CC7 S;  9RUB A;  4ZN3 A;  2I0X A;  1RAI B;  2V4J B;  2QV6 A;  4RBT A;  3M2U B;  1YKW A;  4H4O B;  2AV5 A;  4G1P A;  3KG0 A;  3MUT P;  1KWM A;  2KT3 A;  4DV4 F;  2VHG A;  3NGS A;  1G7C B;  4MYU A;  1UFW A;  1N33 J;  1T94 A;  3CB4 A;  5IS2 A;  3F56 A;  3C8Y A;  4K5R A;  4PWU A;  2CQG A;  1M5V C;  3DLJ A;  4HI1 A;  2CUY A;  2BVZ A;  2V0N A;  1N0V C;  3TA1 A;  2B6A A;  1RT1 A;  1RTI A;  2KFZ A;  2F1F A;  3BO2 A;  2J8S A;  4USI A;  4QWB A;  3RAM A;  2BM1 A;  2BUN A;  5C24 B;  2NXE A;  3PFE A;  3PYE A;  1LW2 A;  2W2N P;  1RAD B;  2B4V A;  4CH1 A;  4K59 A;  3TP2 A;  2G2Y A;  4WYW A;  2DVI A;  1MG7 A;  3MPU B;  4TXS A;  3CJQ A;  3UN2 A;  2UUC J;  4USH A;  3UDL A;  1OPI A;  3PIO Q;  4K0K J;  5M2P A;  1IN0 A;  2LXU A;  4RW8 B;  1N5T A;  1PSD A;  3IR6 B;  4OX9 F;  1XMO F;  1UPP A;  2G0J A;  2OO4 A;  4ZPA A;  3UD3 P;  1KD1 T;  4DMZ A;  2ZDO A;  3GFH A;  2IIH A;  4V19 J;  3GR1 A;  1KNZ A;  5L1L A;  5IC4 B;  2K2P A;  1RJJ A;  1CUL B;  3HHL C;  4EFA C;  5CD4 H;  4ERD A;  1XC9 A;  5GMK a;  2O67 A;  2JFD A;  1TAQ A;  3PY8 A;  4Y2A A;  4LSL B;  3THV A;  2SXL A;  4UOF A;  4A8K A;  4JUZ A;  3KTQ A;  3HSG A;  1N6Q A;  2MQQ A;  4YR2 A;  5KFE A;  1Z2L A;  3H4D A;  9ATC B;  5B08 A;  3KLI B;  3FBC A;  3H5X A;  1RT3 A;  2K8G A;  2KDO A;  3SQO P;  2OEL A;  1CJT B;  2OI2 A;  3QAU A;  1B4S A;  4OYA A;  2FJW A;  2B8Q A;  4K2X A;  4RKU C;  4WF9 Q;  4HHU A;  1TAU A;  5C25 B;  4WFN Q;  4ECS A;  1D8Z A;  4FS1 A;  3ZZT A;  3PJW A;  3BR9 A;  2V9W A;  3BDE A;  4GKK J;  2RQC A;  4XDC A;  3SFG A;  1UEV A;  2OPQ A;  1E6Y A;  5IXU A;  3D6F B;  4IR1 A;  3GLJ A;  3OHB A;  1YGY A;  2B4O A;  4NLG A;  4J9S A;  2HGM A;  4DSF A;  2UVW A;  2KM8 C;  1S1T A;  2RIJ A;  3B78 A;  1KR4 A;  1LWX A;  3W5Y A;  3D28 A;  2MQ8 A;  3PEH A;  4B17 A;  2ZHA A;  1B7F A;  4Q45 A;  3FSI A;  2M9K A;  4AQY J;  1RAO A;  1YWX A;  4Y0F A;  2KG0 A;  4PAB A;  2J6T A;  3EYZ A;  3JTN A;  3VAJ A;  1BLU A;  3TQE A;  1CJV A;  4GO5 X;  1VK8 A;  3QBC A;  4X64 F;  4UST A;  2LU1 A;  1TK5 A;  3OD2 A;  5HQL A;  1Q5Y A;  4AXI A;  1C1C B;  4MK7 A;  2VBZ A;  3HO1 A;  4HAC B;  2CA9 A;  5J1E A;  1SL0 A;  2DR7 A;  1VR6 A;  3VVT A;  1TEL A;  4RX6 A;  3PYG A;  3ZNJ 1;  4ZPT R;  4XTT A;  1U1Q A;  1T05 A;  1HI1 A;  1IXK A;  4NCG A;  5D15 A;  5CYJ A;  2IVM A;  2R7V A;  4I2P A;  5A8R B;  1HBN B;  2WVE A;  4Q7A A;  4ETZ A;  3ADA C;  2H51 B;  4TU9 A;  2WAQ D;  4F67 A;  4MFB A;  2MKK A;  3HHL A;  3R27 A;  4ZVT B;  3QO9 B;  3AB2 B;  2DXD A;  1GTH A;  2JOQ A;  2XM3 A;  4KAI A;  3VCD A;  3QRQ A;  2FTR A;  3SMZ A;  1RIS A;  4MK9 A;  4QZV B;  1WC0 A;  4ELT A;  4AUK A;  2JVR A;  2DIT A;  1UW4 A;  3E51 A;  2CYY A;  1D8Y A;  3DXS X;  3BSA A;  2ZH7 A;  1VC5 A;  2YKN A;  4DR2 J;  3VGV A;  3M7V A;  3AHP A;  3T1A A;  3OR2 B;  1U45 A;  2XHC A;  2AGO A;  3H4B A;  4I69 A;  2D9P A;  3P96 A;  2XCA A;  2DH7 A;  5GME A;  3THT A;  2VDH A;  3QGH A;  4RW4 A;  2EKN A;  4DX5 A;  1VC0 A;  2XBP A;  3LAL A;  5A76 A;  1KFS A;  3EE3 A;  2VZ9 A;  2RUG A;  1BGX T;  2JNJ A;  1RGV A;  1HWK A;  3L7U A;  2R8J A;  3GPA A;  1FRX A;  2K3I A;  4F50 A;  4CRJ A;  2E5J A;  3JSM B;  3C14 A;  1RKI A;  1RBA A;  3K0J A;  5ETR A;  1JQG A;  5BYR A;  1IKW B;  1VQS A;  2N3L A;  3EMT A;  2NQP A;  2DNL A;  2CXE A;  1PKU A;  2QL9 B;  3WDO A;  4LFB F;  2J9D E;  2YQ0 A;  4ZVR B;  3UDE A;  2PD1 A;  3DOK A;  3C6T A;  4OMF G;  4M63 A;  3HT0 A;  1NZ8 A;  2AJ2 A;  1H3D A;  1KQK A;  5IM0 B;  3HDS A;  2R8G A;  5KFG A;  2GX8 A;  5LXR A;  3TVY A;  1PG5 B;  2UUA F;  1H38 A;  1U1P A;  3O3L A;  1PCA A;  2WB4 A;  2GZO A;  4CLF A;  2VG7 A;  4KV8 A;  5A2Q Y;  3CJK A;  5KT6 A;  1LWF A;  1S7I A;  1FEH A;  4H4M B;  1N8R T;  4B3S J;  2GV1 A;  5DRK A;  2VAS A;  2J0S D;  2ALZ A;  2IVY A;  1HWL A;  1H73 A;  3B4D A;  3QPI A;  3QT7 A;  3K8W A;  3Q83 A;  5LSR A;  1TV6 B;  2H5I B;  1W7W A;  5HLF B;  2MDA A;  1WSV A;  2YVS A;  4QJV A;  4N47 A;  2Z8Q A;  3UCZ P;  1S9G A;  2UXD F;  2KXN B;  1TTH B;  2YX1 A;  4QIG A;  4OZ0 A;  2DO4 A;  4Z7Y A;  4YB5 A;  4IYQ A;  3QGI A;  2MGZ A;  5L1I A;  3EXC X;  2DR9 A;  1MWY A;  4Q5V A;  3OL6 A;  4L74 A;  1NK5 A;  2KZM A;  1OMS A;  3KJQ B;  4F4W A;  2PFF B;  2FVR A;  3I32 A;  3RRH A;  5KFZ A;  5AJ3 J;  1LOU A;  4V19 X;  3PVX A;  1CJU B;  4C8Y A;  1GMW A;  5EDW A;  1Y00 A;  5GAE U;  3FRY A;  3CCV S;  4HI2 A;  2V8V A;  1Q82 T;  1HMV A;  1ZET A;  3EGN A;  5LMN J;  1A7G E;  4WU3 A;  4DR6 F;  2WRM A;  5H9F K;  3BJY A;  3HVT A;  2AYG A;  4ZVO B;  3R1H A;  3U27 A;  2IM1 A;  1U6F A;  3PHE A;  5ETT A;  2YNF A;  5DM7 Q;  3NGD A;  4LRA A;  1LWC A;  2ZD1 B;  1BQM B;  1J5O B;  2JEJ A;  4ZPW R;  3EDQ B;  3CW2 C;  3C3L A;  5G0R B;  1DQ9 A;  2XZW A;  1D0E A;  3MD1 A;  2CQP A;  3N01 A;  1FRM A;  1SL2 A;  4MKY A;  2HFS A;  2OTL S;  1GFW B;  2CG4 A;  3NGU A;  1D9A A;  5HO4 A;  2HQC A;  1IBM J;  2AJF E;  1VYA A;  2IC3 B;  1I51 B;  4F3M A;  3TAP A;  1S1X B;  1VBK A;  1TKX A;  5B0D A;  7FD1 A;  4LQ3 A;  2QO3 A;  5FDL A;  2HQI A;  3IXQ A;  2CPE A;  2EKY A;  3MMB B;  4JI7 J;  4HYK A;  1GQE A;  3MFI A;  2BMB A;  1VQ5 S;  1J5E F;  3LQV A;  1FK9 B;  3L7O A;  2KYZ A;  2CPD A;  4IO9 Q;  3IS9 B;  3CJ8 A;  1U4B A;  4M5D A;  4G1Q A;  4B9V A;  3E3X A;  4XK8 C;  1X60 A;  2Y1I A;  3J7Y I;  2XMW A;  2HQG A;  4CQ1 A;  1YZ6 A;  1RHJ B;  4GC6 A;  4DPW A;  1RT4 B;  2IDL A;  2LXI A;  3VWS A;  3PZP A;  5J2N B;  3BS9 A;  2RKI A;  2YX7 A;  2IA0 A;  2EPI A;  4LFC J;  3BGR B;  2HZC A;  4HKQ A;  1S59 A;  1CJK A;  1FVS A;  4DPX A;  2HZV A;  1X9S A;  2M4M A;  3M2V B;  2QMX A;  3OTO F;  2J6U A;  2FGC A;  2HGL A;  2CJB A;  2YXL A;  3CIM A;  4UZB A;  4ZK7 M;  3DLE A;  4OJH A;  1FT8 A;  4DR3 J;  4B3O A;  1QY7 A;  2MKC A;  2QFI A;  2DY9 A;  3H2V E;  5F9L A;  1SH3 A;  3DOM B;  3CWJ A;  4N76 A;  1ZAV A;  1ZOT A;  3R5B A;  5CH7 B;  4NLW A;  2ROE A;  4DQP A;  3IWL A;  1TL3 A;  1E6V B;  4IFV B;  4A8Y A;  1XMB A;  1F9E B;  4NML A;  4TNO A;  2QYG A;  4DZD A;  5HBM A;  1C4A A;  2QL7 B;  3F41 A;  4ZN1 A;  3P8B B;  1S1V A;  1TK0 A;  4ZPD A;  1YJR A;  5JXS A;  3FFI B;  2EC0 A;  3MM6 B;  1WSR A;  2I5J A;  5K14 B;  1NSQ A;  3GMG A;  2I2Y A;  3PXG a;  4IOB A;  3QZ8 A;  3EZO A;  1HW8 A;  5KFM A;  2FQQ B;  4NXN J;  3D0H E;  3FEZ A;  4P2S A;  1OJ4 A;  3EM1 A;  3BRE A;  4CYU A;  4DFM A;  2VKR A;  1VRQ C;  5IT9 U;  2AZ1 A;  3JYT B;  2YY3 A;  5ETQ A;  2VB6 A;  2ASD A;  3AY0 A;  3M8Q B;  3LOU A;  2IFX A;  4Y6I A;  1QSL A;  4QQB A;  3W62 A;  1V9O A;  2FZC B;  1NO8 A;  3D0G E;  4WU2 A;  3ET6 A;  3CDA A;  3MEE B;  5JMN A;  2RUS A;  4WWS A;  3KHH A;  1NPR A;  2CQI A;  1N32 F;  3J81 j;  1RAB B;  1CSJ A;  1HNZ J;  2RRN A;  4DS5 A;  1HPZ A;  3P5B P;  4QWA A;  1Q8L A;  2ROG A;  1PGZ A;  4M95 A;  5HRO B;  3ENW A;  3JB9 k;  2LEB A;  3AAW B;  2J0Q D;  3ZTS A;  4C97 A;  5CCM A;  2K1R A;  3EZU A;  3I82 A;  1I94 F;  4N5S A;  2ZH3 A;  2HGN A;  1EAR A;  1REG X;  3PJX A;  3T6B A;  3LPE A;  1HWJ A;  4O3O A;  3ENA A;  2XB2 D;  2HRT A;  1FE4 A;  3V5R A;  4LVN P;  5GMD A;  2CIM A;  2OHD A;  4YUD A;  2AT1 B;  2F8E X;  1NK9 A;  4USU A;  5KFU A;  2G0I A;  3MGJ A;  1WC5 A;  3DRX A;  4KIA A;  3OL9 A;  1HR0 F;  1M1G A;  4JI1 F;  1NK8 A;  3VAK A;  2BW7 A;  3T5K A;  4DV5 F;  1O51 A;  1AZS A;  2HAI A;  3MWB A;  2M70 A;  4ZVH A;  4KBI A;  4XDD A;  1S1U A;  5ITH A;  5E3A A;  4BWJ A;  4OYZ A;  2XLI A;  4O44 B;  2KT2 A;  4OX8 A;  4DSE A;  1SJR A;  2WVD A;  4L75 A;  4F7V A;  4KYZ A;  3C15 A;  5D8H B;  1K73 T;  4TLQ A;  4ZVF A;  2W01 A;  1OQ3 A;  1SIW B;  3SYZ A;  4WP8 A;  4ZIW A;  3QWP A;  4DQQ A;  3T9N A;  1Y0H A;  5IZH A;  2RH3 A;  4J9Q A;  2UUB J;  1BWV A;  5AE3 A;  2FGO A;  4OHX A;  4X2B A;  3DDI A;  4X4V A;  2WBR A;  2GFF A;  2P9C A;  1SC6 A;  4TQS A;  4FDF A;  1KLN A;  1WG1 A;  2P8I A;  1LV5 A;  4FYW B;  2RT3 A;  2NS1 B;  2ZBR A;  2LYV A;  2HBQ B;  4N8N A;  3EVW A;  3KNA A;  2ZUG A;  3CSK A;  1HD0 A;  4USJ C;  2BX6 A;  4K4X A;  2G9O A;  3RRG A;  5CZV A;  1M5S A;  2R42 A;  3MEK A;  5J2Q B;  4USW A;  2G1D A;  1DLO A;  3DDK A;  4LF4 J;  4ELV A;  2H5J B;  1C2P A;  3H2L A;  1BQN A;  2DHA A;  1HQE A;  1XNR J;  1VRT A;  2VKZ G;  4M1K A;  3UDV A;  2XZD B;  2OD6 A;  1XN9 A;  3CNQ P;  3EIC A;  4P2M A;  1RTD B;  3VV2 B;  3MCO A;  4NLP A;  1FJG F;  2DB1 A;  2Z57 B;  4IOC Q;  3PO5 A;  3DMJ A;  4IKA A;  3M1V A;  4DHV A;  3BO4 A;  3OLB A;  4MH8 A;  4OHV A;  2MSS A;  5E41 A;  2FVS A;  1WC4 A;  2AEF A;  1QD1 A;  1XBW A;  1HWI A;  4ZMM A;  5G4D A;  3QT8 A;  3N79 A;  5M2U A;  1OSD A;  1WEL A;  2HND B;  3SCK E;  2XUL A;  3CDW A;  3CCW A;  5EWF A;  3M30 B;  5THW A;  3HVR A;  4C2M A;  1YJ7 A;  4LF8 J;  2QT7 A;  2PDA A;  1HYS B;  1Q78 A;  3F44 A;  1R8C A;  1VQ4 S;  1FWL A;  4DL5 A;  1FNX H;  2RIL A;  1ICE B;  5CYM B;  2LMI A;  3MM7 B;  3BBB A;  3I6P A;  1KFD A;  2GJ2 A;  3MAA B;  4PG4 A;  3R6G B;  3WBZ A;  2ABY A;  2D3Z A;  2K7J A;  3GZ7 A;  3QYY A;  4WJB A;  1BWE A;  3DHX A;  4H4K A;  3OXG A;  5IT9 Y;  3SFU A;  2CDQ A;  4X65 J;  4EU0 A;  2E9Z A;  4ED5 A;  2AEM A;  4OYM A;  4GVB A;  2AYM A;  3NG8 A;  4DL7 A;  4F3Q A;  4B3T J;  3J7A N;  2RRB A;  5K5M A;  4A47 A;  3G82 A;  3D6M B;  1FNO A;  3TWZ A;  3FMW A;  2BKP A;  2M0G B;  3PTW A;  1EP4 B;  4C8O A;  2ZDP A;  3AT1 B;  3OJU A;  3SBM A;  2ASY A;  2ZZT A;  1Y4Z B;  3WX4 A;  5KFP A;  3M8Z A;  3D1O A;  1UL3 A;  2AHO B;  1FKO A;  2B43 A;  3Q8U A;  4EI2 A;  3W1Y C;  3DRP A;  2MY7 A;  4CO1 A;  3NXZ A;  2F4F A;  1M5O C;  4DF4 A;  1Y10 A;  3IFE A;  4BWM A;  5DG9 A;  1X7V A;  3VR1 A;  4PQA A;  1JWW A;  2W7P A;  2QA4 S;  4G6V B;  3IA0 A;  4OYP A;  5KFL A;  1K9M T;  1QAI A;  1VRU B;  2DNZ A;  2GIR A;  4CO2 A;  2CPI A;  1NKC A;  4RL1 A;  5KT4 A;  2D7S A;  2GCF A;  1UJ4 A;  4ECZ A;  2KFN A;  3H5U A;  5CZX A;  4O23 A;  1IKY B;  1U0H B;  3DC2 A;  1WWH A;  4LFA J;  5F3T A;  5B0C A;  1Q53 A;  3AOA A;  4HHJ A;  3I0R B;  1N5S A;  5BYS A;  1ZA1 B;  1RLD A;  5SUH A;  4ITS A;  2MLX A;  2JJ4 D;  3KFW X;  4X62 F;  2OEM A;  3PX0 A;  5LMN F;  1U09 A;  1N5Y B;  1HI0 P;  1NDP A;  4FYX B;  3DM2 B;  5KG6 A;  2CZ9 A;  2G2O A;  3ZTP A;  1WC6 A;  3S8S A;  1UTA A;  4CH0 S;  2YNI A;  1VIO A;  5CQG A;  4C48 A;  4X66 F;  3GCW P;  3R8Y A;  3H25 A;  2WON B;  3Q8Q B;  2MMY A;  2AQ4 A;  5CYQ A;  2R4F A;  2W2M P;  4JV1 A;  2HHU A;  1ARO P;  1WDD A;  2MQL A;  3LP1 A;  4DV0 F;  2BV3 A;  4PWD A;  2Q3P A;  4A46 A;  2AD9 A;  3G6E S;  3VTI A;  1Q86 T;  3BR8 A;  2KKH A;  5E3C A;  4DPU A;  2ZH6 A;  3ZFV A;  5DGB A;  2B5J A;  3TAM B;  2BQ3 A;  3J80 U;  3PG9 A;  4IQM A;  4WFZ A;  2GVZ A;  2CQ4 A;  3FRZ A;  1XK8 A;  5BXI A;  1RTJ A;  4G65 A;  2H4Y B;  4ZCK A;  1CQN A;  2UP1 A;  2KN4 A;  1QLN A;  2MQP A;  1U8W A;  5HP1 B;  2L9N A;  3V6D B;  1JK9 B;  4F4Y A;  3QLH A;  5E3P A;  1RHM B;  2PSZ A;  4OZ2 A;  2BQR A;  3SDE A;  4OHW A;  4B9M A;  4Y2K A;  2OPR A;  3DGV A;  1FDA A;  4IUF A;  3CCS S;  1UZH A;  5HMY A;  5ETS A;  2HK3 A;  2CJQ A;  3CD0 A;  1DTQ A;  2YWH A;  1W2I A;  3A8E A;  1X4H A;  3I55 S;  5A8W A;  4ZP9 A;  4ID5 B;  1R6V A;  1T9X A;  5T7L A;  3TZX A;  5D6G A;  2ZH8 A;  1U1L A;  3HF5 A;  3QAE A;  4LBH A;  3GP9 A;  3KJF B;  1FTR A;  4ELU A;  1UEK A;  3HT3 A;  1QUP A;  1ROF A;  4CO5 A;  4DUY F;  2VG5 A;  4JI0 F;  4F4X A;  1EIY B;  4IRD A;  2HIQ A;  1FO1 A;  4LR8 A;  4KFB B;  4ILR A;  1U02 A;  2WVF A;  1B99 A;  2IA6 A;  4OYX A;  2V4J A;  2E5L J;  1SPB P;  4DFK A;  1WF0 A;  3OXF A;  4H4O A;  3BQ2 A;  1HLW A;  4IH6 A;  5I42 A;  3M6V A;  2MZS A;  4A8W A;  5EN1 A;  3IBC B;  2NSB A;  3FZ2 A;  2KHC A;  1QTN B;  1S4F A;  2CPF A;  4ZVU B;  1FF2 A;  1NSP A;  5KFR A;  4KO0 B;  3R9L A;  2UU9 J;  2ACY A;  5L9N A;  3QGP A;  3G8S A;  1S6Q B;  4F4K A;  3H7H B;  5J1N A;  1KOH A;  2DGT A;  3E2E A;  3UNY A;  3DLK B;  3DRY A;  3VAL A;  2J9C A;  3D1H A;  1TL7 B;  3R7B B;  4R5P A;  4DPO A;  4J90 A;  2Q6B A;  2XGQ A;  3TX0 A;  5K8M A;  5HMX A;  1S6P B;  1UET A;  2LVW A;  3GG1 A;  3MR5 A;  3A3P B;  3OFF A;  1R27 B;  4C0O C;  1VBY A;  3RG6 A;  4F26 A;  3V6J A;  2Z56 B;  3M8W A;  2BE7 D;  5F0W A;  2CJ9 A;  4PWW A;  1XTZ A;  1TP7 A;  3TEG A;  4P74 A;  2XSJ B;  4JI2 F;  3EVM A;  4FXW A;  5B0F A;  3WQP A;  2XLK A;  3OL8 A;  5KFC A;  5D4N A;  3I5B A;  2FY1 A;  2VG6 B;  2J9E A;  4RW6 A;  2DRB A;  3AJ1 A;  2HMI A;  2ZH4 A;  2HWH A;  1VBX A;  1S0O A;  2QLB B;  4J5O A;  2G4B A;  4X4P A;  2X3D A;  2W9B B;  3VQS A;  1YBU A;  2DHS A;  4U6P A;  2HQD A;  4ZDN A;  3TZW A;  5DDR C;  3BKU A;  4FKX A;  3RBX A;  1H2T Z;  5KFT A;  2E7X A;  3VAH A;  3QSI A;  5HI7 A;  3UNG C;  1D1U A;  3KLI A;  1XNQ J;  4L72 B;  4UT4 A;  4ZS6 A;  1BMQ B;  1CJT A;  1VQK S;  4KR0 B;  4PUO A;  5GAE I;  3BO3 A;  4NA2 A;  5F8M A;  2MHE A;  2AP6 A;  5C25 A;  3CPW R;  1DZ5 A;  3BF4 A;  4Q44 A;  4P71 A;  2A1B A;  3M32 B;  1RAC B;  1Z2Z A;  2PEH A;  2DHG A;  3PV8 A;  1JLC B;  4B9T A;  3HXM A;  3GG0 A;  1FJ7 A;  4GC7 A;  1F9F A;  5L38 A;  1YJN S;  3OUY B;  3K8V A;  1S72 S;  1MU2 A;  1RE1 B;  2QGF B;  4UW2 A;  5KFN A;  3OQ2 A;  2IYG A;  2RF2 A;  1QVG R;  1N56 A;  3D54 A;  3TVZ A;  1H6K X;  4D3G A;  1U26 A;  1NK7 A;  2DXF A;  1M0S A;  1JLF B;  4JI8 F;  5DQI A;  2FC8 A;  3BPS P;  1NH7 A;  3MUR P;  3KLG B;  3CCU S;  2ADC A;  5IFM A;  4QR1 A;  5E2Q A;  3QAT A;  1T9T A;  4JI4 J;  1ZAW A;  2HSE B;  5DDP C;  1HBU A;  3IP0 A;  3TUP A;  3MZI A;  4AYB D;  3FEX B;  1N52 B;  2PC6 A;  2E9R X;  1EZZ B;  3DHW C;  1Z4U A;  2MZJ A;  2QRR A;  4DS4 A;  1IM6 A;  3UFC X;  3NCQ A;  4RPF A;  3TZZ A;  1QE1 B;  4KHP F;  1U24 A;  3MMA B;  1RHR B;  3S6E A;  2HHS A;  2WSF C;  1K1Q A;  4NXM F;  1JLQ B;  3W2V B;  3J80 Y;  1HWU A;  1YJT A;  3Q86 A;  2C3Y A;  2FHK A;  1N5Q A;  4DV3 J;  2ZUA A;  1SC3 B;  1VLY A;  3M8P A;  2AYB A;  1NDL A;  2CJA A;  4WKY A;  3ULH A;  1T11 A;  1L3T A;  2VQE J;  3HJV A;  5B0A A;  1NRK A;  4RUB A;  4X4U A;  4KC5 A;  2DO0 A;  4OI4 A;  2DGS A;  1QAY A;  1LW0 A;  5I3Q A;  2BDP A;  4PG6 A;  2HW3 A;  1HQU B;  1QDU B;  1XR5 A;  1D9D A;  4F0H A;  3K5L A;  4M5L A;  5EX3 A;  3OR2 A;  1EHW A;  2IY5 B;  1RWO B;  3S7R A;  2MJU A;  2WSE C;  2RRA A;  2EXU A;  2ASJ A;  1UZD A;  2JH3 A;  4K4Z A;  3MMC A;  5J2M B;  4Z37 A;  1NB7 A;  3HUL A;  1RWW B;  1SH2 A;  4I68 A;  4OL8 A;  3VF0 B;  3RGI A;  3IGN A;  2XMV A;  4QYZ K;  2YNG B;  3DCA A;  3WC2 A;  1OS5 A;  2N82 B;  3HKZ D;  3NS5 A;  1IKW A;  2BKO A;  2NUH A;  1GMU A;  3DLG B;  2F5G A;  4JOU A;  2RU9 A;  2HVE A;  1HNX F;  1TMJ A;  2VOD A;  1BHN A;  2C3O A;  5A0Y A;  3UQS A;  4DR1 J;  4LF6 J;  3SEO A;  2DNP A;  2ATL A;  1UWB A;  3OXL A;  4U7C A;  2MKJ A;  3M2R A;  2HVZ A;  3AQP A;  4FVM A;  1UMJ A;  4KT0 C;  2FDN A;  4DV1 F;  2GO8 A;  1S57 A;  5KG5 A;  1Y3K A;  1IKX B;  5DM6 Q;  4IG3 B;  2IVF B;  2BRK A;  3P4U B;  4DR5 F;  3W2W A;  5ETP A;  4LRC A;  3EDR B;  2LDY A;  4DI6 A;  2BXJ A;  1R0C B;  1Q7L B;  1RAF B;  3MEG B;  1SQE A;  3HVA A;  1EET A;  5KOX A;  4X4T A;  1GX6 A;  2J7W A;  1JKH B;  2E1C A;  1ITP A;  4H4M A;  1VFJ A;  3CD5 A;  4ZLL A;  4ED2 A;  2HRU A;  2BJE A;  1WKJ A;  2CKW A;  5D0E A;  3G4S S;  5KG2 A;  1VQ9 S;  2FPH X;  1RA6 A;  1OO0 B;  1TV6 A;  1WOR A;  2O66 A;  2XNR A;  5HLF A;  1SQF A;  3FDS A;  1FER A;  2XY5 A;  2WOM B;  1T9Y A;  1N36 J;  2DPJ A;  5D3G A;  2FUG 9;  4B3R F;  4CI0 B;  2UUW A;  3NP5 A;  1G1X A;  2CAJ A;  2QYC A;  3C16 B;  1B0P A;  2H4W B;  3GJT B;  4NRT A;  1CC7 A;  1PAU B;  4DR7 J;  2BOP A;  1OYE A;  2IYI A;  3VQT A;  3KG4 A;  3MDF A;  4MIA A;  4BHQ A;  2I6W A;  2NLW A;  3CXC R;  3AA9 A;  4H54 A;  3FBF A;  2AIR B;  2HHT A;  2PA3 A;  4LF7 F;  5DS7 A;  1R8A A;  1NCL A;  3T1H F;  4YHH F;  1UCN A;  3CCM S;  1VDH A;  4GO7 X;  3ZZY A;  2CPX A;  4RNO A;  1U0S A;  1F5B A;  1TFW A;  1ZM2 A;  4URG A;  3GYG A;  4F02 A;  2OLW A;  2X7I A;  1U49 A;  4ES2 A;  4RWW A;  5DLG A;  1B0V A;  3P5T L;  1RT2 B;  4ICL B;  2ZD1 A;  1KQF B;  2GIQ A;  3JQK A;  3W9H A;  1JJ4 A;  4DPT A;  2BJ8 A;  1YI2 S;  1I5O B;  5IOL A;  1NEE A;  2GVD B;  1KC8 T;  5G0R A;  1RT6 A;  3MM5 B;  3D1Q A;  1X9M A;  2V67 A;  1UAW A;  4TY8 B;  4PXE A;  1U6B A;  4YME A;  2H54 B;  3OBI A;  3KLH A;  4N77 A;  2DNQ A;  4XPE A;  4FP9 A;  1S9E A;  1WOS A;  2IC3 A;  1QSY A;  5CHC B;  4DV2 J;  4C3M A;  2B0G A;  4HVZ A;  1AYE A;  3MMB A;  1JLA A;  1AUS L;  2I8E A;  2R3V A;  2W4P A;  1IR1 A;  3Q8P B;  4NLV A;  1TL1 B;  1UA0 A;  4M5K A;  2Q6C A;  5LJ3 Y;  2B7B B;  4B9N A;  1N54 B;  4IG0 B;  1FK9 A;  3TEH B;  1NXI A;  3H59 A;  1WJ9 A;  2BRL A;  1TMM A;  1WOP A;  3IS9 A;  4J9O A;  5D77 A;  3QJL A;  3DLL Q;  3D68 A;  2QA2 A;  3JQJ A;  2EC2 A;  3DI6 B;  1S7H A;  4ZHR A;  2POK A;  4CT9 A;  2ZKT A;  2IJR A;  4ZP8 A;  4LSN B;  2D3O 1;  1TUG B;  3SI8 A;  3B4M A;  4HEA 9;  5J2N A;  4NLT A;  1KN6 A;  5AE1 A;  2AJQ A;  3BGR A;  1Q7Y T;  4CO0 A;  1YTY A;  2BZ2 A;  5I4M A;  2V63 A;  2VPZ B;  5KT7 A;  3UR3 C;  4DPY A;  2ZJQ Q;  4YQW A;  4CLZ A;  2FHJ A;  1A6L A;  5HN0 A;  4EYI B;  2ZBI A;  3CMA S;  4LF5 J;  1SH0 A;  2PT0 A;  4KJI A;  4URS A;  1JX4 A;  3DOM A;  5KFW A;  3EGZ A;  1VGY A;  2FIU A;  1E6V A;  2PO4 A;  3CED A;  1GH8 A;  4DL4 A;  1VMB A;  4HTI A;  3LUY A;  1UVJ A;  3MPD A;  4R25 A;  2E5G A;  4ED6 A;  4LF9 F;  1WAC A;  4WE1 A;  1RCX B;  4K8R A;  4X4S A;  2Y0B B;  2JRS A;  2GQQ A;  3GYN A;  5IWA F;  2X1F A;  2B6A B;  5A8K A;  1RT1 B;  2DNN A;  2L9W A;  5K14 A;  2WBM A;  4RO0 A;  5LOQ A;  2Y1J A;  3JSY A;  4ED7 A;  1AT1 B;  5GAG U;  1NBE B;  1SXL A;  3CC4 S;  2ERR A;  3QRP A;  2OH2 A;  1RI7 A;  2HHH J;  3V81 A;  2QSF A;  3NBP A;  3W9J A;  1H74 A;  1LW2 B;  2YX4 A;  4X4N A;  1UWA A;  1JIH A;  2X1G A;  4JI6 J;  1LFP A;  4NEZ A;  3LF0 A;  2BJD A;  4O4G B;  4CO3 A;  4NLO A;  3HVW A;  1M5H A;  3P45 B;  4QU7 A;  1KON A;  3D9B A;  5KFO A;  4ZA1 A;  4I4B A;  4G1I A;  4DLE A;  2GNK A;  3KLE B;  4A8Q A;  3MEE A;  3T5H A;  3T1Y J;  3IAM 9;  4DOZ A;  3EWG A;  1IKV A;  1B0T A;  1HHQ A;  1R8P A;  3H40 A;  1ZS6 A;  2FZG B;  2R7X A;  4ANE A;  2HHQ A;  3HP6 A;  2GJI A;  3NNC A;  5KFD A;  1T8E A;  3D67 A;  4DR4 J;  1N6Q B;  1I1G A;  3OVS A;  5HRO A;  1SJ4 P;  3HHL D;  2GHV C;  3GFY A;  2COL A;  4Q0B A;  4RNN A;  5BYQ A;  1SVD A;  2HS0 A;  3Q8S B;  4CNY A;  5ETL A;  1IR0 A;  1H0H B;  2D41 A;  2F9D A;  2F3J A;  1R0A B;  2OEK A;  1HA1 A;  1ZA2 B;  3K59 A;  4UY8 5;  2DH9 A;  2CJY B;  1XMQ F;  2CNO B;  5EX0 A;  4RU2 A;  2OPQ B;  1E6Y B;  4CT8 A;  3WZ0 A;  3GJS B;  5B7W A;  4YOE A;  1S1T B;  2F8M A;  1F2G A;  3ZTQ A;  1L5U A;  2VV5 A;  1H7W A;  5HAN A;  2YWE A;  3FCW A;  3RUB L;  2VQF J;  1NLK L;  3TA2 A;  1JLE B;  4I64 A;  2PII A;  3JSR A;  1BY9 A;  3MCS A;  2R2R A;  1FEE A;  4NA3 A;  1JNR B;  1RWK B;  5DGA A;  4DFP A;  3CCQ S;  1CEZ A;  5BR8 F;  1VQP S;  3ISZ A;  2B4P A;  4O44 A;  4JI5 J;  4IH5 A;  4CDI A;  2Y8Y A;  5KFI A;  1CJV B;  4NPO A;  4ZVS B;  2CPJ A;  3PW5 A;  3TOQ A;  1SV5 A;  1ZTW A;  3GIK A;  3GB0 A;  4WZQ A;  4PQU A;  1NB2 A;  1FD2 A;  3FZB A;  2GAH C;  1DY3 A;  2QLW A;  4UOG A;  4P7T A;  2NXC A;  2KFY A;  3DU6 A;  4NCG B;  4ZJL A;  3CF5 Q;  1NME B;  4I2P B;  4U67 Q;  1MMD A;  2VL1 A;  3WC0 A;  4IR9 A;  4GKJ F;  2VU5 A;  1IUJ A;  2IMW P;  3RW7 A;  4MFB B;  1RWN B;  3HHL B;  4QR2 A;  4X4R A;  1FDN A;  1VQN S;  2WZ1 A;  2Z4P A;  4ZLJ A;  1RSC A;  2DGW A;  3MAQ A;  4QIE A;  3L7P A;  5D78 A;  2CPY A;  4PYA A;  1VK3 A;  2KHD A;  1SJF A;  3CJ2 A;  2X51 A;  2DKO B;  1MWZ A;  5DZ6 A;  5J2Q A;  3RBE A;  2YKN B;  1NKE A;  2XO7 A;  2AF6 A;  4JYA J;  3LA0 A;  4DCJ B;  2ZVI A;  5FJ4 A;  1RYS A;  3A3N B;  3BGU A;  1NPP A;  4ECT A;  1IBK F;  2ZC3 A;  3HCX A;  2PI4 A;  3C46 A;  3MM9 B;  3T6J A;  1IBL F;  1T3O A;  1OQ6 A;  1SUQ A;  2C2N A;  2NZC A;  1RTD A;  4RW4 B;  1NK4 A;  4IOA Q;  4YB6 A;  5AT1 B;  2N4C A;  3BH7 B;  3DLH A;  4W92 B;  4EWT A;  3Q23 A;  3T5J A;  2HBZ B;  4M94 A;  2VFT A;  3KUG A;  2KM8 B;  1NJY A;  5KT3 A;  1GMW D;  4BBY A;  2RML A;  4K4V A;  3C14 B;  2LKZ A;  2PFD A;  4P75 A;  2UVU A;  4UQG A;  3KDO A;  4ZCM A;  4MKA A;  1V6H A;  4DBQ A;  1JXE A;  3DOK B;  3C6T B;  4U8Y A;  3M30 A;  3D66 A;  2V2K A;  3G6X A;  1FKP B;  2HKE A;  3CJ5 A;  3IRW P;  1WEY A;  1HYS A;  1SC1 B;  3QGG A;  3DKD A;  4I56 A;  2E1R A;  4UQT A;  3VGU A;  4DWI A;  5ETN A;  3O2I A;  5CYM A;  2YBV A;  1CS4 A;  3QQC D;  3MM7 A;  1M90 T;  1N34 J;  4WCE Q;  2BBE A;  3MAA A;  2VG7 B;  4KV8 B;  5CA5 A;  1N0U A;  4WFY A;  5AXN A;  1S10 A;  4F4Z A;  1GEH A;  1QSS A;  3GSI A;  1Q8K A;  1ACM B;  1WHV A;  3VZI A;  1GXT A;  3UI3 A;  2ZM6 J;  4Y65 A;  8RUC A;  1QTM A;  1V3R A;  3GQC A;  5E5N A;  2OIH A;  2PE8 A;  2OPS B;  2YNH A;  2KO1 A;  3HX9 A;  1S9G B;  1N4L A;  1RAJ A;  2FLP A;  1R8B A;  3OPK A;  3LAK A;  1TVR A;  1QAJ A;  4FZV A;  3SZ2 A;  4BCA A;  2MGZ B;  4UUX A;  4ZLP A;  3POT A;  3CGI A;  4A8M P;  1LEO A;  1DRZ A;  1FX2 A;  3NOG A;  3P49 B;  1LK5 A;  2AWZ A;  2V34 A;  5F3Z A;  2YWK A;  4WFX A;  1FES A;  3HD1 A;  2RB7 A;  4OYB A;  3AOD A;  1HNW F;  2DPI A;  5IV4 A;  2DT9 A;  1HMV B;  1WEZ A;  1HAR A;  5KT2 A;  2UZA A;  3N6M A;  4J9U E;  2AJ0 A;  1IKY A;  3B6B A;  3H0P A;  3KHR A;  4DX6 A;  2BR0 A;  2WHO A;  3IBF B;  1H7X A;  2YNF B;  5KAK A;  2Y1L B;  4NOH A;  5L1K A;  2YH1 A;  4YR0 A;  2DNH A;  1LWC B;  4I7F A;  5C42 B;  4U7U K;  2ZVS A;  2OFG X;  3MEC B;  4XO0 A;  2MHN A;  1DTT B;  1ZPV A;  4TVA B;  2V8D A;  3TUJ C;  1LWE A;  3AQO A;  3T41 A;  2WK4 A;  4NLD A;  2RVJ A;  2ZH1 A;  1N5Y A;  1REV A;  5H1S V;  2HBR B;  1PJ5 A;  2J7K A;  1N5V A;  2ILY A;  1K1S A;  2W24 A;  2F4V J;  1NZA A;  2IAJ A;  5LMU J;  2AJ1 A;  1KDN A;  5DJB A;  4DV6 J;  3AD7 C;  4KH0 B;  2JX2 A;  1YK9 A;  2OKQ A;  1JLB A;  4HTJ A;  4P2F A;  3UPF A;  3G8T A;  3AD8 C;  4K7Q A;  5DZ7 A;  4DN0 A;  2GIF A;  1FNM A;  1OY6 A;  4TY9 A;  1RAE B;  1IM4 A;  1NK6 A;  3DGP B;  1S6U A;  3CDU A;  1PIE A;  3FQK A;  2HS3 A;  1ZPW X;  3HSJ A;  1UP1 A;  3KYL A;  2PEB A;  1QM9 A;  2HWT A;  5HJY A;  4NRU A;  4J9L A;  4FNH A;  1EAY C;  3NWG A;  3N5B A;  4EGL A;  2QJ3 A;  2V2Z A;  2V8P A;  4AT1 B;  2VFR A;  3Q2T C;  4GRS A;  3W3S A;  2QE5 A;  4I2Q B;  1B70 B;  4QWC A;  2J6S A;  1UFK A;  3TAM A;  3HM9 A;  2RKI B;  3GFZ A;  2AEJ A;  3CCE S;  3CE8 A;  3OHA A;  3VAI A;  4KE5 A;  2M8H A;  4DCP B;  3ONQ A;  4N8O A;  4R8U A;  3D6T B;  3H90 A;  1HNI A;  1CJK B;  2LQB A;  3N0V A;  1S6O A;  1L3U A;  2F9J A;  2JEI A;  5HP1 A;  1HNV B;  1DJ0 A;  1F60 B;  2A0F B;  3DLE B;  4QYZ J;  3NY0 A;  2UXC F;  3QSY B;  4OZ1 A;  3HLU A;  1NSK L;  1RTH B;  2F7V A;  4UF4 A;  3R5D A;  4RW7 A;  1R7I A;  4DV4 J;  4PG5 A;  2XCP A;  1BUX A;  3MD3 A;  3ZZZ A;  3HFK A;  3FVY A;  1SIZ A;  3WX8 A;  2RD5 C;  5HBM B;  1DAX A;  3PX4 A;  2R7T A;  1CLF A;  3ISN D;  3TQ1 A;  4ID8 A;  5K20 B;  4K4Y A;  2DGV A;  4EK2 A;  1NJZ A;  2X1A A;  3J7Z T;  3KK3 B;  2J76 E;  3MTJ A;  3GU0 A;  2VD3 A;  5IQQ A;  4JV5 F;  2I5J B;  2C1E B;  4IFY B;  3FQL A;  3NKY A;  2HZA A;  5AXM A;  1RBL A;  2HVI A;  1ZAX A;  3G86 A;  4ZPC A;  2OPP B;  1TKD A;  1X4D A;  4MK8 A;  2ZIT A;  4M5H A;  1Y5N B;  3U1M A;  1S6Q A;  1UPM B;  1RP5 A;  1C0U A;  2AMC B;  3AOB A;  2CQ3 A;  1KRP A;  4RWX A;  4OX9 J;  3R5C A;  2CZV C;  4L73 A;  1XMO J;  4ZPV R;  2OMO A;  3EVO A;  4OHY A;  4YY3 F;  3DRS B;  3JQM A;  2QFJ A;  4F25 A;  3ENV A;  3LPY A;  2J8A A;  2Y3Y A;  4M5J A;  3FC9 A;  4DUZ F;  4EYH B;  2CJK A;  4B3M F;  5CCL A;  3NGR A;  3MPW A;  3SCL E;  2VOO A;  1HQ2 A;  4ALZ A;  4Q43 A;  4PEO A;  2NYI A;  2K3K A;  3B8H A;  4ILM A;  4FBU A;  1RHK B;  3C6U A;  1MSW D;  1T3N A;  1JXV A;  3VAM A;  2XMJ A;  2A2D A;  2VG6 A;  3PW4 A;  3IR5 B;  3CTR A;  2JZ5 A;  2V8H A;  3G6Y A;  1M1K T;  3IM9 A;  2LEP A;  3KMQ A;  3F73 A;  2B9X A;  2K1R B;  1MWQ A;  3E01 B;  6FDR A;  2AX1 A;  1BD6 A;  1W25 A;  1N48 A;  4ZKA A;  1TKT B;  2UXB F;  2EVZ A;  4QBU A;  4M5I A;  2XNQ A;  2Z2M A;  2DNM A;  3GIM A;  3SV4 A;  4AFF A;  2DYA A;  4DXL A;  3Q8R B;  4FXD A;  1FKA F;  1U6Z A;  1AA1 B;  4DSI A;  2BOA A;  2DNK A;  4DLG A;  3M4X A;  4PR6 A;  2IRU A;  4TU8 A;  4QW8 A;  1AZS B;  3M32 A;  3OTC A;  3LGN A;  1S1U B;  2KVQ E;  2M3D A;  2MLY A;  4X64 J;  1RU2 A;  4C7Q A;  2DCU B;  1YQH A;  2CFX A;  2UVV A;  1NHV A;  3IRX A;  4EBD A;  3RRK A;  2MXY A;  1TKZ B;  5EUH A;  4P52 A;  4UOC A;  4MJK A;  4OZ3 A;  4MTP A;  4RNH A;  5J2P B;  1H98 A;  3I0S A;  1NM2 A;  3QFW A;  2HAF A;  1GAO A;  4L6V 3;  4Y2M A;  2C2K B;  2CPZ A;  8ATC B;  2D74 B;  3GIJ A;  1U25 A;  1JLF A;  2FLL A;  4RUC A;  3W66 A;  3J7Y U;  1Q1K A;  3QT5 A;  5KFQ A;  1U1M A;  3LP0 A;  1XWL A;  3RBD A;  3UO0 A;  1GK8 A;  3HK2 A;  4DV7 F;  1UFL A;  3KK1 A;  1SQG A;  2XYH B;  3VAG A;  2L3M A;  4NAS A;  2B9E A;  5E3R A;  2ATC B;  3LP2 B;  3V2U C;  2JC1 A;  3HHK A;  1FA0 A;  3OTE A;  2FVC A;  5B09 A;  1FJC A;  2FB0 A;  2V50 A;  1XR7 A;  4CM0 A;  4ZIV A;  2Y0S D;  3AH6 A;  1J27 A;  2A2C A;  1RXO B;  1JLQ A;  2HYI B;  5IC6 B;  1VOM A;  5HK4 A;  2D69 A;  2ZJP Q;  3GE9 A;  2HHV A;  3LW5 C;  1TR0 A;  2PMH A;  1DLO B;  1WHX A;  3BN4 A;  3R97 A;  3FJ2 A;  5CAA A;  4NYP A;  1HQE B;  2J7U A;  1VRT B;  1YX2 A;  4ED3 A;  5KFV A;  2Y9H A;  2ZOG A;  4O4R A;  1Y11 A;  4MYT A;  4C6A A;  5HMZ A;  5MLC V;  4ZLN A;  4KGK A;  2HRY A;  3G9C A;  3M1V B;  2RAQ A;  3Q8V A;  2IJN A;  1VJQ A;  3DYA A;  2L9D A;  3NRB A;  3M9O B;  2P9G A;  1D3W A;  3G87 A;  4DG1 B;  5C5J A;  3LGM A;  1CQM A;  3RB0 A;  1HI8 A;  4LFB J;  3V6H A;  3SSR A;  1U48 A;  2JL9 A;  2KRR A;  1IBC B;  3ZXW A;  4OFZ A;  4QIF A;  4KHR A;  4ZP6 A;  4Z2X A;  5EWE A;  1IWA A;  1X8D A;  4JI3 J;  2UUA J;  3F0N A;  3PM9 A;  2CNL B;  2B56 A;  5D0H A;  3K57 A;  4F2S A;  2HFN A;  3VGT A;  5AXK A;  2FLN A;  2QEX S;  2FJA B;  3BKT A;  3O5T B;  2IM2 A;  2ROP A;  2WCX A;  1U1K A;  1BQX A;  4EO6 A;  3ISN C;  4Z7C A;  2BQU A;  1TL5 A;  3AFG A;  5KG7 A;  1RUS A;  2V4Q A;  1IKX A;  1X4G A;  4IG3 A;  4C11 B;  1C4C A;  2WW4 A;  2KB2 A;  4DX8 H;  2UXD J;  3G82 B;  2DGX A;  3MEG A;  3ZZU A;  1X4B A;  1JKH A;  2N3O A;  3JTO A;  1RT7 A;  1YDL A;  2PN6 A;  2CDR B;  3NNA A;  1FKO B;  2HQF A;  3UR0 A;  1T9V A;  2ZE2 A;  4DEZ A;  4OQJ A;  2N7C A;  2XZT B;  3BSN A;  2ZH2 A;  3H8Y A;  2MQM A;  1U47 A;  2HNZ B;  3M6W A;  1N33 F;  4KQZ A;  4LMZ A;  4DL0 C;  2EWH A;  6AT1 B;  3NAI A;  3X1L B;  1WUU A;  1OPZ A;  4DR6 J;  4KTQ A;  3HZE A;  1MN7 A;  5ETM A;  3MR3 A;  2DRD A;  2V2V A;  1S1W A;  1NHU A;  2VFV A;  1SL1 A;  2GMJ A;  2BE2 B;  4M8L A;  1T9U A;  1NND A;  1F3V A;  2KXH A;  3RR8 A;  4CH7 A;  4FF4 A;  1MML A;  2ZH5 A;  1WI6 A;  1VI7 A;  4CIO A;  2XHW A;  4AND A;  2QG9 B;  5DO2 A;  2UUC F;  4K0K F;  3DRR A;  5L46 A;  4E8U A;  5L9X A;  2RE1 A;  3ZZO A;  2R7U A;  3GIL A;  4KHM A;  4OX6 A;  2IBO A;  4KPC A;  5HQ8 A;  3CJ0 A;  1YVF A;  3A1Y G;  1KP6 A;  4HDG A;  4FKY A;  5SZT A;  1T03 B;  1RT2 A;  4ZCL A;  4ICL A;  4LUB A;  2YNI B;  3SQG A;  3MR6 A;  1S4E A;  1AFI A;  1S77 D;  3GR0 A;  2GVD A;  3FSX A;  2V68 A;  1J5E J;  4RJV A;  3MM5 A;  3RYL A;  3FCV A;  2EBE A;  1HBO B;  2WVB A;  1KS2 A;  5F41 A;  1F5A A;  4W90 B;  2YPZ A;  4OZL A;  2EFO A;  1YJ9 S;  4LT6 A;  3I56 S;  5LT5 A;  4AL6 A;  3BM7 A;  5GAD U;  4WTO B;  1WKK A;  4NA1 A;  2DEJ A;  2HS4 A;  1NAQ A;  3EXY A;  1JLG A;  2QIF A;  2EFG A;  2AGP A;  4K4U A;  4O0N A;  4IG0 A;  4UTG A;  2DNY A;  2GVZ B;  4GKK F;  4ECQ A;  3QJJ A;  5F8H A;  7FDR A;  1RTJ B;  4C8L A;  2APO A;  4F2R A;  3OTO J;  3CME S;  1O8B A;  4K4S A;  3QLH B;  2RDJ A;  1YIJ S;  4LSN A;  2MQO A;  3OT9 A;  3MR7 A;  2XWX A;  3W9I A;  2OPR B;  1S5Z A;  4H4K C;  4AQY F;  1MN9 A;  4IH7 A;  3WIV A;  4NLY A;  3UD4 P;  3UCU P;  1C0T A;  1OSC A;  4P10 A;  1B7Y B;  2C2Z B;  4XIU A;  1DTQ B;  3SCJ E;  3TO8 A;  1HD1 A;  4ENO A;  5T7L B;  2CVE A;  2A6M A;  3CUL A;  1HW9 A;  2AYE A;  2O01 C;  1HBM B;  3O1L A;  4KGX B;  1S79 A;  3UE2 A;  2BAB A;  2RSQ A;  1I6J A;  5KG1 A;  2YH0 A;  4A48 A;  3NS6 A;  2MEW A;  1BXN A;  5I42 B;  3ZZP A;  2Q1L A;  3B82 A;  4N41 A;  1F3F A;  2KG1 A;  4QR0 A;  2CNN B;  3ILL A;  5F8J A;  2CQ0 A;  5JUM A;  2YKM A;  2FD2 A;  1VQO S;  4TYA A;  5CAB A;  3OR1 B;  1VC6 A;  4FBT A;  2VON A;  3A13 A;  1FE0 A;  2L48 A;  4Y34 A;  4CLL A;  4R5P B;  1R6Y A;  4KKO B;  2OML A;  4ECW A;  5A2Q U;  3KXD A;  4DR2 F;  4J7C A;  3DN9 A;  3I31 A;  1P6T A;  5HQM A;  3PX6 A;  1NJX A;  1WDT A;  1N88 A;  1N32 J;  4N7T A;  3IO1 A;  5F8N A;  2GML A;  2PI5 A;  4O4G A;  1RWM B;  5CD4 A;  1YZ7 A;  1MRO A;  3BGF A;  4ZJQ A;  1GX5 A;  4CLP A;  5H9E K;  4PRF A;  1UJ6 A;  3KLE A;  2H3E B;  1WHY A;  2LEA A;  4RW6 B;  2HMI B;  1I94 J;  1X9W A;  4OIX A;  4GMK A;  4LJM A;  2HFZ A;  5KFB A;  3HD2 A;  4ZVG A;  2C2E A;  3SCI E;  1Q0N A;  1V3S A;  4ECR A;  3OJS A;  4OX7 A;  2XMA A;  3CJ3 A;  4LRF A;  4QIV A;  1S0N A;  2ZEJ A;  1OYD A;  3NS7 B;  3NGK A;  4C8M A;  2HHW A;  1HR0 J;  2N4D A;  4JI1 J;  2C22 A;  3IG1 A;  3RZA A;  2XC9 A;  2ZHB A;  1YHQ S;  4A8O A;  4PUO B;  4DQR A;  4DV5 J;  4B3S F;  1C1B B;  3GIR A;  1R0A A;  2VFS A;  2YTC A;  5DDO C;  3V4I A;  1AFJ A;  4NYZ A;  1T9W A;  5J1P A;  2CQ1 A;  1RBO B;  3D4J A;  1Z1Z A;  2CQC A;  4EO8 A;  4PAA A;  3SXL A;  1JJ2 R;  2V69 A;  4YB1 P;  2DGO A;  2F40 A;  3KJV A;  2BAN B;  2OUG A;  2VA3 A;  3MED A;  2NCK L;  1MU2 B;  1P9Q C;  2EEY A;  3MFH A;  3U7J A;  1JLE A;  2R7W A;  1K0T A;  3CMQ A;  4ZVQ B;  2RF2 B;  2WTF A;  4ECV A;  2GO9 A;  1VQY A;  3KLF A;  2ZC4 A;  1NDK A;  3TAN A;  2JDJ A;  1UVI A;  4OZJ A;  1XIQ A;  4MT1 A;  5AJ3 F;  2YPY A;  1S99 A;  3W8G A;  2M2B A;  3O6Q A;  3NL0 A;  4OI2 A;  4WP3 A;  1HBU B;  1IJE B;  2LU2 A;  1R8H A;  2FJV A;  3AOC A;  3V6K A;  2YQ1 A;  3JS9 A;  5JVH Q;  1S76 D;  1EKR A;  2W9C A;  2RQK A;  3BH6 B;  4RU9 A;  3M8S A;  2XQC A;  2ASL A;  1HHS A;  3VZH A;  1KSP A;  3A8I A;  1FCA A;  5AXL A;  5HJX A;  2HNY A;  2EBG A;  3GV5 B;  3UN5 A;  1YRT A;  1GTE A;  1H2V Z;  4CTA A;  5K8P A;  5CXT A;  1U7L A;  4R0E A;  1KVI A;  1ZM4 A;  3UN3 A;  1BE4 A;  4L3N A;  3M8P B;  1WEX A;  2CWK A;  2FVQ A;  1FXR A;  1SKU B;  2FJE B;  3TYT A;  1VCT A;  1UJ5 A;  1FJG J;  2DRA A;  3K5P A;  3Q89 A;  2VF3 A;  2V94 A;  2XO6 A;  4A8F A;  3R6L B;  4G3I A;  2VPW B;  2Z2Z A;  1LW0 B;  4IQX A;  4NCA A;  2GAG C;  1IBM F;  3R5G A;  4LBP A;  2DIU A;  3IR7 B;  3I5A A;  3CUN A;  2F65 A;  1PJ7 A;  4ZIT A;  3NLC A;  2MQN A;  5K8O A;  2D9O A;  2U2F A;  4JI7 F;  1WF2 A;  1QVF R;  1MMN A;  3OTD A;  3MM9 A;  2NUU G;  1VIS A;  3MMC B;  3BQ1 A;  3UVJ A;  3CCL S;  3PNI A;  1UA1 A;  4JP8 A;  5KTQ A;  3GYX B;  5B0B A;  4RZR A;  1YBT A;  4EUV A;  4P2X A;  5U47 A;  4OHZ A;  2OFH X;  1Y5L B;  2GS8 A;  2XSF A;  4QYR A;  3BSC A;  2M7S A;  1WTB A;  5LSO A;  4TN2 A;  5A0Y B;  3VHQ A;  3GII A;  1R0B G;  3TZY A;  3UDC A;  1UWB B;  4LFC F;  3M2R B;  4RR5 A;  1SKR A;  1FKP A;  4HLB A;  2VBW A;  4P72 A;  4B9L A;  3W2W B;  4JI3 F;  1GNK A;  1XR6 A;  2BA9 A;  1KLM A;  2KJV A;  2JEG A;  1RHQ B;  1K47 A;  1EET B;  3M8R A;  1RT5 A;  2MZ1 A;  4DR3 F;  3UCG A;  1KBR A;  4Y3C A;  3BPD A;  1IR2 A;  4ECY A;  3M2U A;  2ALY B;  2FZK B;  4W4M A;  4J9N A;  2GJF A;  1RU1 A;  3N28 A;  1FJE B;  1CBK A;  2ADB A;  2WSC C;  2MZT A;  3MF5 A;  1XER A;  2OPS A;  1TZ0 A;  1PBU A;  4CLT A;  4KGZ B;  1VHF A;  2R2S A;  4WZM A;  1R43 A;  3GCX P;  2OAU A;  1NJI T;  5D3G B;  2D3U A;  1AXQ A;  2MTL A;  2CZ4 A;  2BYC A;  4A8S A;  3ILJ A;  2VUG A;  4YN3 B;  3L4B C;  1YG0 A;  2LEC A;  4B9U A;  1FDB A;  3W5X A;  1Q81 T;  5C24 A;  2YWF A;  3HPO A;  2JLE A;  3QJP A;  1FI4 A;  4NXN F;  3H98 A;  3C66 A;  3RW6 A;  5IQ6 A;  2ZZN A;  3PYD A;  2A18 A;  4PXB A;  2DY1 A;  2C28 A;  2QC3 A;  2ZKU A;  2FHO B;  4X62 J;  1APS A;  4Y28 C;  1Y3J A;  1U1R A;  4RW8 A;  2RJZ A;  5F8G A;  3BKF A;  2KTQ A;  4J91 A;  3UW1 A;  3EZ5 A;  4USM A;  3PIP Q;  3MM8 B;  4F0M A;  4NLQ A;  1F0X A;  3TVK A;  2DHX A;  4J9R A;  1CUL A;  1R3N A;  4CM2 A;  5C42 A;  4DQS A;  2FHJ D;  4CWB A;  2QMW A;  2HVH A;  3MEC A;  4XPC A;  3TAQ A;  1QAX A;  1DTT A;  4YB7 A;  4X66 J;  1X4F A;  3LAN A;  1RT6 B;  1WD6 A;  2XMK A;  2Z0G A;  4LSL A;  2GHW A;  1IJF B;  2VDI A;  1HNZ F;  2W4C A;  1RA7 A;  4YEA A;  2HUR A;  2ZWP A;  4ER8 A;  2CQD A;  3KLH B;  1ZZF A;  4QIW D;  4DV0 J;  3CVK A;  1TK8 A;  3OFH A;  1GT8 A;  1S9E B;  3FKB A;  2GQC A;  3OSN A;  2QA1 A;  3NMA A;  4WFB Q;  4URQ U;  4NCB A;  1VQ8 S;  3H2U B;  2L41 A;  1JLA B;  2HLT A;  2QLX A;  3RAQ A;  2BJ3 A;  4FNI A;  2IPO B;  4WP9 A;  2LA6 A;  5KFK A;  2YKP A;  1VQ6 S;  1L3K A;  1FRI A;  1X4C A;  1FDD A;  2E5I A;  3DGP A;  1UVK A;  3O8W A;  2R7R A;  2FYX A;  6FD1 A;  4MKB A;  3L95 X;  3NAH A;  2KU7 A;  5IT4 A;  3ICL A;  3IBW A;  4ZHR B;  4DX7 A;  2BJ7 A;  4RBV A;  2YQ3 A;  3BGL A;  1X0P A;  4I2Q A;  4F0K A;  1UVL A;  2DEI A;  3FGV A;  4WBF A;  4PXC A;  3KOA A; 
#chains in the Genus database with same CATH homology
 3H90 A;  2QFI A;  3W5X A;  3W5Z A;  3W8P A;  3BYP A;  3W65 A;  3W62 A;  3W8G A;  5HSP A;  3W5Y A;  3W60 A;  3BYR A;  3W61 A;  3W63 A;  2ZZT A;  3W66 A;  3W64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...