1FD8A

Solution structure of the cu(i) form of the yeast metallochaperone, atx1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords ATX1 COPPER CHAPERONE
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fd8A00
3LO3A 2N4CA 2RSQA 3CJKA 4QOTA 2GGPA 1Y3KA 2HQIA 3DXSX 1Q4RA 2QLXA 2XMKA 4YEAA 3HDSA 5T7LA 1FE0A 2GFFA 1CC8A 4Y2MA 2VV5A 5B0AA 1W2IA 4DPOA 4Y2KA 5A6WA 3HFKA 3HX9A 2LQ9A 1YJVA 4ZOSA 1AFIA 5F0UA 2RILA 3I9ZA 4NL5A 1SB6A 2BUNA 2OAUA 4OIXA 1IUJA 3WDOA 1OPZA 3FGVA 2N4DA 2KT2A 2LDIA 2W4PA 4OJGA 2ACYA 1Y3JA 4Q2LA 2OFGX 3TOQA 4OJ3A 3HF5A 1K0VA 4A47A 1VQSA 3BR8A 4U9RA 2GA7A 2AJ1A 1N5QA 1R6YA 1FVSA 1N5SA 1FE4A 1YG0A 2OP5A 2L3MA 2QLWA 3F44A 1RJJA 1MWZA 4DN9A 4HH0A 3BM7A 1N5VA 2PGCA 1P6TA 1URRA 3FRYA 2N7YA 2HIQA 1S6UA 2ASYA 2VH7A 1WD6A 5B0GA 1APSA 4OJ1A 4DL0C 1KVJA 2HLTA 3GZ7A 2CRLA 1Y0HA 4FNHA 1TL4A 2FTRA 1VQYA 2JDJA 3LGMA 3VTIA 2KKHA 4A48A 1CPZA 1QUPA 1X7VA 3IWXA 3HHLB 3BF4A 1MWYA 2BJDA 2RMLA 3T9NA 2ZDOA 3MCSA 1P8GA 2XMVA 3QGPA 5B08A 2W4DA 1YJUA 1Q8BA 1V3ZA 2GO8A 2HFOA 2G9OA 2GCFA 1FESA 3QMQA 1Q8LA 3TNVA 2GGPB 2AP6A 2K1RB 3HHLD 4A4JA 1AFJA 3KKFA 2KYZA 2RU9A 1LQ9A 2XMJA 4HL9A 5T7LB 1TUVA 1KVIA 2LXFA 5F0WA 4ZA1A 1YJRA 1FD8A 2BYCA 1FEEA 2ROEA 3KG1A 4FNIA 1X0PA 2IYGA 4YDXA 2FHMA 2IFXA 2BJEA 1JK9B 1XBWA 2K7KA 2ROGA 3HHLA 3KG0A 3BDEA 1TR0A 2W4CA 3BGUA 3FMBA 4HI2A 3BB5A 4Y2IA 2QYCA 2OMOA 1KQKA 1X8DA 1JWWA 2KT3A 2LQBA 1AW0A 3MZIA 1TL5A 4A46A 3DCAA 5B0EA 2OD6A 1GXUA 3CJKB 1U7LA 2EW9A 1OSDA 1TZ0A 5IXUA 2AW0A 2K1RA 4EFAC 3K7RA 2K7JA 4NPOA 1YRXA 3IWLA 1N5TA 1YJTA 2Q3PA 5KAKA 2OFHX 2XMUA 2AJ0A 2HLUA 2ROPA 1Q53A 2XMTA 1Y9OA 3KNGA 2K2PA 1ULRA 5A6PA 1FVQA 3BN7A 5K9FA 1CC7A 4HI1A 1OQ6A 5B0CA 4OJHA 5B0FA 2FIUA 3E8OA 2BBEA 2FB0A 5B0BA 1GXTA 2XMMA 4Q2MA 2ZDPA 1S6OA 1SQEA 3HHLC 4HH1A 2QIFA 3LGNA 2HFNA 1OQ3A 5B09A 5B0DA 2IYIA 3TRGA 3UDCA 2PD1A 2GV1A 2OD4A 2XMWA 4F67A 1SI9A 2OKQA
chains in the Genus database with same CATH superfamily
4JI1J 3C2PA 4KFBB 4DPXA 2ZITA 2HS3A 1UTAA 1YJNS 4M8LA 3US5A 3G82A 3LP1A 4DR1J 5I3PA 1BWVA 1T3NA 4FBTA 2BVZA 4OI3A 3GV7B 1KS2A 2WOMB 1QE1B 1FE0A 2XI3A 2ZD1A 4UTGA 1T7PA 1NK5A 1XERA 4Y2MA 3ONQA 2BV3A 1WHWA 3OTBA 4Y3CA 4ZPDA 2DITA 5HROB 4JI6J 2HVDA 2YNIB 3TZZA 1GMWD 5ETVA 3THTA 1GX5A 1SKWA 2JLFA 1N0UA 5AXMA 1RT4A 8AT1B 3EZUA 3FVYA 5F3TA 2ZHBA 1OYDA 1N54B 3BEGB 3HMJG 3D28A 1KC8T 2E5LJ 1P1LA 4K8RA 2ASDA 2GIRA 3CCUS 3V4IA 4NA2A 4USWA 3R1HA 4ECRA 1Y4ZB 1A7GE 3QNWB 4B9TA 3M2UA 4ZVUB 2QMUB 3BZQA 2V2QA 2RT3A 2P6SA 2BA9A 3ZZPA 2BR0A 3PV8A 1OWXA 2WSFC 1R0CB 4DR1F 4P2MA 2NPFA 3VCDA 5A8KB 3HVRA 3PIPQ 3DLBA 6FD1A 3ENWA 1DTTB 2X1BA 3FUYA 5GVQA 4EU0A 3SBMA 4S0MA 1X9MA 2Z0GA 1RTDB 1VQOS 1S6QA 1V3SA 5B0GA 1V9OA 4KHPJ 3MPUB 4FNHA 4RWXA 2FTRA 4WBFA 5A8WA 2DRBA 3GYXB 1TELA 1RT3B 4X4QA 4FYDA 5A2QY 4LF6J 3PYDA 3R6GB 3UPFA 2RH3A 3C6UA 2BANB 2XSFA 3CMAS 3KMQA 4Y65A 2OO4A 3EWGA 2QL9B 4PXBA 4WE1B 5BXIA 3KLIB 3RRHA 2J6SA 1R3NA 1M5VC 1SL1A 5KFMA 2M70A 4P75A 3OJSA 1S99A 5L1KA 3M2RA 1YBUA 3PJWA 4WIIA 2JFKA 4WFAQ 3CXCR 4NWBA 4IDKA 1MSWD 4GVBB 1S1UB 4DV7F 1KHWA 1Y5IB 3DHWC 3KG1A 2APOA 2BDPA 1EP4A 3PR4A 3PEHA 4JI6F 3V2UC 4F3QA 1TR0A 1U0SA 3BGUA 3BV8A 1MU2B 4JI0F 3KK3B 2KFZA 1Q78A 1ZAVA 2CJYB 1N48A 2I5JB 1O0PA 5D4NA 3GB0A 1NHUA 2VKRA 4WKYA 3CUNA 1CSJA 3ISND 5K8MA 3PW4A 3CDBA 2XNRA 1H2VZ 3FCHA 4ZJQA 2LA6A 2X51A 4RUAA 4ZP8A 3QRPA 1RWPB 4KAIA 1GXUA 2BEFA 3T5JA 1HYSB 1RB0A 1RWWB 3WX4A 3GP9A 4RW8B 5KFSA 1JLFA 2HAIA 3PRBA 4NPOA 4X64F 2ZJQQ 1U2CA 3IWLA 3SCIE 5LMNF 3GYGA 3R6LB 4B3TF 2U2FA 5BJRA 1YVFA 2Y0SD 2P8IA 1YJWS 5BR8F 1J2VA 3RRGA 3RAMA 5FJ4A 3I0SA 2Y1LB 5BYSA 4RX6A 5IZHA 2XMTA 4M5JA 4TN2A 1LWFA 2YKOA 4MK7A 2GC8A 1ULRA 5D4PA 1NPKA 4C3MA 4B9LA 3OVSA 2YH0A 3DOMB 1LWCA 2HHUA 5B0CA 1FJ7A 1RT6B 2BKNA 2HFVA 2ZOMA 3D2WA 2BW2A 4ZIVA 2DO0A 3WX8A 2RU3A 2BE2A 4XPCA 1S1XB 3A3PB 5LT5A 1AUDA 3PO5A 1R8PA 4V19J 1TAUA 1JNRB 2HS0A 2XWXA 4H4KC 2VC1A 2AKWB 5B09A 1Y5NB 2IYIA 3GFXA 3V6KA 3UDCA 5IT9Y 2G0JA 3ZTRA 2XMWA 2DGQA 2GVZA 3SQGA 1RTHA 1UJ5A 3CCWA 3TW0A 2B9EA 3CJKA 4J9MA 4FYYB 4I2PB 4CLLA 1WG1A 2WW4A 3ULHA 4CT9A 1KN6A 2D3OR 1KRPA 3IS9A 3L3CA 1M1KT 2GX8A 4OX9J 5KT3A 3DDIA 3G96A 1B0VA 3D3BJ 2B6AB 3QAUA 3H2UB 1C0TB 2J0SD 3BO2A 4YN3B 2BW7A 2QA1A 1KDNA 2Z30B 2E7WA 3B4MA 3IGNA 3VQTA 5KFKA 1UWBA 4DFMA 5H9FJ 3W9JA 3JSBA 3KDNA 3MECA 1RT7A 3MM5A 4EO8A 1J27A 3GONA 1IBCB 3T6BA 5IV4A 4C0HA 3UNYA 1Q8KA 4U9RA 2DGOA 1TKZB 2IM3A 4RBTA 2BKOA 1RWVB 5IWAJ 3CC7S 1SC4B 2XYHB 2KO1A 3DLLQ 2AMCB 4J9SA 3F44A 4C97A 2CQ4A 3H25A 3CWJA 1NPPA 1P6TA 2PEHA 3SFUA 1NK4A 3TAMB 4KT0C 4PEOA 4EO6A 3V6DA 3VZHA 1MWQA 1P9YA 3IP0A 3ZZTA 3SYZA 2AQ4A 2X7IA 3JTPA 4DZ6A 4O44A 2VDIA 1NJYA 2FVRA 4ZPTR 3MR2A 4FKYA 1PGZA 3MM8B 4DWIA 2CDRB 2LQ5A 2RS8A 4LRAA 3NBPA 1FDAA 1VCTA 3D3CJ 2XEXA 4OV1A 2MGZA 4DV2F 2KYXA 3M6VA 2DR6A 4KV8B 4M95A 3G2XA 4RWWA 3HHLB 3OV7A 5DQGA 4NI2B 2XMVA 2E9RX 3H59A 1PYOB 3Q8UA 2M7SA 5KFHA 1U25A 2JZ5A 5H9FK 4KTQA 4E0DA 2MB0B 2GMJA 2MLXA 2KYZA 1LQ9A 1TKTA 2QMWA 1MMLA 5MLCV 1RTHB 2N3LA 3J7Z5 3BS9A 3OTCA 4ZLNA 1B4SA 4DBQA 4UW2A 1CVJA 3D5MA 2VFSA 1TV6A 2VFTA 4HLBA 2QG9B 4CLYA 2VICA 2FHMA 2Z4PA 3MD3A 4OYOA 3KJVA 2XS2A 3FNNA 2W4CA 4DR6F 5ETTA 3C15A 4D3HA 1GAOA 1KFDA 2HNYA 3ET6B 1KQKA 4IH5A 4OFZA 2QRRA 2YX7A 3CIMA 4E98A 4JI7J 5B0EA 4AQYF 2DY9A 3ZTSA 3Q24A 3TARA 3U1MA 1U49A 2W9AA 4IR9A 4QWDA 1RP5A 4MYUA 4PXEA 4FXDA 3FCWA 3NGUA 4WP8A 2LA4A 2HVZA 4U8VA 1D8ZA 1T11A 1IKVA 2J9CA 2K8GA 3B82A 4HVZA 1BQMB 3KJFB 4CLWA 4A8FA 4ZJOA 1X9SA 4GKJJ 2Q6BA 4BHQA 2AJ0A 3QJPA 1VLYA 2HNDB 3CULA 5L9XA 4DUZJ 1ZOTA 2GW8A 2WONB 1S4FA 2ZBPA 4TU8A 3VAHA 4F50A 4FF2A 1F3VA 2K2PA 5K8NA 2CPYA 2HQCA 3QWPA 3SV4A 1L5UA 3SCLE 5DO2A 2WB4A 4KQZA 2R7QA 3LW5C 2HIYA 4N41A 4UQGA 4DX7A 1D0EA 2B56A 2NYIA 4IR1A 5EHHA 2JX2A 2PA8D 3FEXB 2XLJA 4IRKA 1S49A 4GKJF 4DSLA 3M8WA 1VDHA 4ZITA 1M1GA 5HLFA 2L9NA 3HD1A 5E3CA 1HNIA 1BD6A 4QYRA 1UPPA 4C8NA 4CNYA 4NLTA 1KWMA 3ENVA 1RHKB 2R8GA 1KKHA 2ATCB 2E66A 4WXOA 3I96A 1MN7A 3FFIB 3GSDA 1W7WA 3CD5A 5K5MA 4X65J 4O23A 2BM1A 2R8IA 1SJ1A 2FJEB 3N5FA 1X9WA 3KHHA 2G2ZA 5KFUA 3CO0P 1PSDA 3VAFA 1C0UB 2JVOA 5IS2A 2QL7B 2KHCA 3PX0A 2F1FA 2UUWA 3CTRA 4QIVA 5ETLA 5D0EA 5IQ6A 2F4VJ 3NOGA 3HO1A 3KK3A 1JKHA 2V50A 2LDYA 2R4FA 4KH0B 1IUJA 4UZCA 1HMVB 1FDDA 2BRLA 5D4LA 3CDWA 3FK4A 4OJGA 1EHWA 3QATA 3FDSA 4ZPBA 3HF5A 5KG7A 4NLOA 4IDKB 4OI1A 3D6HB 1CS4B 4N47A 4K2JA 1NJXA 1X31C 3MCOA 1FXRA 3DDNA 4K5SA 4XTTA 2OP5A 4ITSA 2ILZA 2RHQB 2DCUB 4J9KA 2OMLA 2F4VF 2ZBQA 4L73A 4NXNF 3GTYX 1RTZA 2MLYA 4OL8A 4WCEQ 3S8SA 2R2UA 2KVQE 1PAUB 3MMJA 1FF2A 1W25A 4DR2J 1XTZA 4OYIA 1SQFA 1SC3B 4C9DA 4RW7A 4ZVOB 3N01A 1OYEA 2VG6A 2EG2A 3QGIA 4I0WA 4IRDA 1OY8A 2P6TA 2ZNZA 1CULA 2KRBA 2YNIA 2KDOA 1MNEA 3PEJA 4KR0B 3C8YA 4LRFA 5CXTA 1QAXA 2RHSB 1U1KA 1URNA 3TX0A 2VPZB 2OPQA 2XHCA 1JLEA 1ITPA 2WONA 1V3ZA 4ZVPB 2G9OA 3LP1B 3MMAB 4DLEA 1NKBA 4F2SA 4I4BA 4P72A 2JOQA 1QUVA 2KTQA 4IO1A 4EWTA 1FNOA 1X4DA 4J9LA 4F4ZA 3GR0A 4CO3A 5KFEA 2MQQA 3BO4A 2HGLA 1FEEA 2P9CA 5DDOC 4MTPA 3UI3A 4M5MA 2MKCA 2B5JA 4USUA 3NGRA 4USMA 4BDPA 3Q0AA 2LQJA 4Z7YA 2JH3A 2AV5A 4TLRA 1BLUA 4ZP7A 4I6YA 3TJ8A 3R5BA 3U27A 1WI8A 4DEZA 1DTQA 3BH6B 3HCXA 2LQBA 1HD0A 3W66A 1AW0A 1JWWA 5I3UB 4ELUA 5M2RA 5KFVA 1RKJA 3AJ1A 3H0PA 3SXLA 2J6UA 2BM0A 1ACMB 2WB1D 1RAFB 1WC3A 1WORA 3CVKA 4WFYA 4C11B 2AHOB 5DG9A 3P49B 2AZ3A 3BPDA 3M8RA 2YBVA 3GCWP 4USVA 4IFVB 4KFBA 3PW0A 3HI9A 3LP0B 2BJ1A 3BSCA 4UOHA 3VAGA 3H7HB 1NMEB 4AL5A 2DKOB 3DYAB 3AD7C 3LGHA 4C98A 3PW7A 4FN5A 1ZM3A 4NXMJ 3M1VB 3OHBA 1T9TA 4KO0B 4K50A 3QT7A 1SBRA 4DV7J 1NKCA 1ELOA 4H4OA 3OFFA 3VAIA 1B99A 1S1TB 2I0XA 2RJZA 1N4LA 5GAEU 2DNPA 3GFYA 1KOHA 1LWEB 4HH1A 1TUGB 4QQBA 2XY5A 3TRGA 2RF2A 2W9BA 4UY8T 2PD1A 2IA6A 4NXMF 1UVMA 1RYRA 2UP1A 1LFPA 1T95A 3TZYA 4NX9A 1IM6A 2CZ4A 4DN0A 4KB7A 4DCJB 4LF9F 4MK9A 4YDDB 2QT7A 1ZAWA 1FFWB 5KFPA 3D6TB 3DXSX 4TNOA 4YS2A 1RCOB 2BMBA 3QFWA 1TKTB 3W65A 2BJ8A 3OJUA 4UOFA 4PPZA 5J2MA 2GFFA 3K59A 4YOEA 3PFOA 4K4YA 4MKVA 1FJGF 1W2IA 3VVUA 3ILOA 3M32B 3RYLA 4R0EA 4CQ1A 1HWUA 5AE2A 4ER8A 1WDTA 4CLPA 4X66F 2LQ9A 1YJVA 2FGCA 2RF2B 4DV3F 4DR2F 2Z2ZA 3C15B 3I9ZA 3CCES 2D3O1 4PWDA 2XZWA 4G6VB 2B6AA 4ZVHA 4MIBA 1UJ6A 3W2WA 4USHA 1J5EF 3OL7A 3RAQA 1XMQJ 3V5RA 2OUGA 2WAQD 4WWSA 1R6VA 3VV2B 1NLKL 1VQSA 5I4MA 2D7SA 3BYRA 3H5SA 2YY3A 3R7SB 5KG6A 4B17A 3LWLA 1FVSA 1KLMA 1HNVA 1TAQA 5D77A 4OYPA 3POTA 3EGNA 3AAWB 3ENAA 3P45B 4IH7A 4TY8A 4WP9A 1VQ9S 2AEMA 2YNGA 4L75A 4M5DA 3FRZA 3SQGB 2V9WA 3JTNA 4WU2A 4WIQA 5I3QA 2FVCA 4OZJA 3DRSB 4LT6A 4ED7A 4EEYA 4DL4A 4LF8J 4Y2CA 4Z7CA 3N9UC 3EX7B 1IKWB 1S1XA 4OI6A 3KNAA 3ZTQA 2HNZA 4JI3F 2HW3A 4WTYA 2RIJA 3NS5A 5J2QB 2DPJA 3K5MA 5KFGA 1PILA 3M05A 1DBDA 1CG2A 3UNGC 4CO5A 5GAGU 5GAHI 1IBMF 3IN5A 3NMRA 1UWAA 1CPZA 4FYXB 5D4OA 4TY8B 4HACB 3UD5A 3I5AA 1GFWB 3CO9A 2HHPA 2HQDA 3GR1A 1VRUA 3TNVA 3P5TL 4QWCA 3KHRA 3P8BB 2FLNA 4A4JA 1VOMA 4L3NA 2QO3A 3Q83A 4O3PA 4DR7F 2POKA 1M1HA 3GFHA 2QFIA 4NLPA 4GKKJ 5HMXA 3LPYA 4WYWA 5C2CA 1KFSA 1NHKL 1NK7A 4R5PA 4NASA 1BY9A 2HPUA 4O3OA 1UJ4A 1LFWA 3R27A 4LF7F 1XBWA 2B4OA 2NLWA 3BDEA 3IAM9 1WHVA 3PHEA 4LSNB 1SQGA 4TKTA 4WFZA 5HANA 2XCPA 2ASLA 1RU1A 3BREA 2RS2A 2IAJA 4DV4F 1C0TA 3UN5A 3TANA 3RBDA 3BKUA 1TL5A 1WHYA 2F40A 3DCAA 3H4DA 4FKXA 2L9DA 4F04B 4DCPB 2ZOFA 1JXEA 4ENOA 2GJ2A 4EFAC 5C7PA 3RB6A 4EK2A 5HQMA 1YJTA 3KJVB 4KC5A 3RW7A 3MEEA 2HFSA 2ZNYA 1REVB 1JJCB 3EVWA 1U6BA 2WCXA 4RUCA 1IR2A 2MPUA 1JX4A 1KQGB 1D9DA 1XEZA 4IG3B 3TEHB 1NRKA 4DQQA 1UVNA 2DBBA 3ITHB 1U6ZA 3MM8A 2DHXA 4RPFA 2V2VA 4KHMA 4FYWB 2B7BB 4WYLA 1S77D 3T1HF 4OYZA 1H73A 3KTQA 4DG1A 4GVLA 3TVZA 1IWGA 1L3KA 2ZDPA 4KGZB 4OX6A 4X62J 1SKRA 1HPZB 3TYTA 3TA2A 5F8HA 3IGVA 3BBFA 3KLFA 2DR5A 4PG5A 5B0DA 4IFVA 2RQCA 2NSBA 2WSCC 3K5LA 1YJ7A 3A3NB 5C24A 2ZZMA 4QU7A 5E41A 4QIFA 2OKQA 3BPSP 4PABA 1TVRA 1C4AA 3MTJA 3NGKA 3OXFA 5EX0A 1MROA 4LIRA 4ZCMA 2ZHAA 1ZTTA 1SL2A 1SXLA 2RSQA 2NXUA 2AJFE 2HWTA 2V4JB 3AXKA 1R27B 3Q8RB 1N33J 2R7UA 4YEAA 2EK1A 2H4WB 5GADU 3H8YA 3DMJA 5T7LA 1N6QB 3H42A 3H5YA 2COLA 1FKPB 4LSLA 4RBVA 3UR0A 1TKXA 4CLKA 1LWEA 3H2LA 2DRDA 4U8YA 5A6WA 1N56A 1T03A 1HNIB 1RBLA 1R89A 2VQFJ 2B5JB 2QA4G 1REGX 5LXRA 2MKIA 3DRRA 1YX2A 4DPUA 3ENQA 2Z8QA 1F3FA 1IXKA 4KO0A 3RUBL 1YIJS 3TOQA 3OSNA 3CSKA 5LM7E 1S10A 2B3TB 2NXCA 2DR7A 1HQEB 3QWUA 1X5OA 3AOAA 3AB2B 2AJ1A 3RR7A 5CD4A 1FDNA 4O3RA 3LP0A 3O6QA 5H9EJ 1WC0A 2I9SA 3S6EA 2W9BB 1M5PC 2UVRA 3BM7A 2CYYA 1YTYA 3HHNB 2MKHA 2CQ3A 4PUOB 3L95X 3FRYA 3K58A 2CPIA 3QFHA 2PFDA 4OHXA 3PW5A 2LEBA 3ZZUA 4JV1A 1K1QA 3D6MB 2H9ZA 2YPYA 2CDQA 1RI7A 4I64A 2PMZD 4F0HA 3MM9A 1TL4A 4XDDA 2HEKA 3J7YI 4PR6A 3AA9A 4ZS6A 4C0BA 4DSEA 2V4QA 3PNIA 1FKOB 5CD4H 4JI0J 2CQ1A 4CDIA 1P8GA 1H74A 3M8PB 2DHHA 4PWWA 4DLGA 1YZ6A 2FY1A 2QA2A 2A0FB 1FX2A 1VYAA 2AD9A 1WF1A 3KUHA 2C28A 3HPOA 3M7VA 3OT9A 1S12A 3TA0A 2KXNB 4J9OA 1B7YB 4QCLA 1KVIA 3MPDA 4ZA1A 4ECWA 2IM0A 1JLEB 3ILIA 5LJ3Y 3NL0A 2QX0A 4XDCA 1OS5A 4KY3A 3CGIA 1JK9B 3SDEB 1NH8A 4N56A 2J0WA 3EXCX 5HN0A 2Q79A 1H7WA 2LECA 1HBMB 3PR5B 3G8SA 2G0CA 4ZPWR 1VBZA 5DETA 1VIXA 4CLTA 2PDAA 5GAGI 2VPWB 2V2ZA 4U7UD 2UUCF 4F0MA 1JB0C 3QJLA 4LF5J 2HNZB 3OTEA 1SKUB 1EETA 2KJWA 2AW0A 3JYTA 1VGYA 2PC6A 4C8MA 3CC2S 2ZE2A 4DV1J 4PUOA 2IA0A 2D41A 3ZXWA 2YWGA 2VL1A 3M9NB 3K0JA 2VOOA 5JVHQ 2RUGA 1NB7A 2R9LA 2OJ3A 1VISA 2MZJA 5IM0A 2J6TA 4BC7A 2XI2A 4IOBA 4PZVA 1PJ6A 2CUYA 9RUBA 3OUYB 2M0GB 2VG6B 4WK3A 3MEGB 4OLOA 5D0RA 2F63A 2VB6A 2VQEF 3IWNC 2X1FA 1PKUA 2YWFA 2BJ7A 4OX7A 2AJ4A 3R7BB 2KH9A 4QW8A 1JLAB 1S0OA 3KG4A 4WJBA 3QRRA 2A10A 5J1EA 3VALA 3IXQA 2DVIA 2HYIB 2VF3A 2YX1A 3KHGA 1TKXB 1OQ3A 1TTHB 2DHAA 3W5XA 4WK1A 5J1NA 2I2YA 5J2NB 4IUFA 3DU6A 4ZHRA 4I2QB 2PIIA 3FBCA 1T9XA 2HZCA 1QLNA 3CEDA 5HAOA 4OHZA 3QGGA 1ZZFA 2DNYA 2Q66A 4ECUA 4HHHA 1S72S 1NJZA 4KKOA 3RRKA 2ZH9A 1K8AT 1T3OA 1E6YA 2GVDB 1H3DA 2LKZA 2V8PA 2V94A 3KJNB 4FPRA 3VZIA 4DOZA 4QZVB 2V4RA 2DXEA 2R7TA 1HI8A 2ZH3A 5A8RB 2OEJA 4DPOA 1QAYA 5L8RC 2V68A 4CNZA 3KLFB 1G3OA 2A6OA 2HHVA 3OVBA 4DV3J 3FSXA 2NCKL 5U47A 3W61A 1NHVA 4DUYF 1RAGB 2F4FA 2KI2A 4BBYA 2WOMA 3LALA 4JI4F 3C3LA 4UUXA 1QSYA 5HBMB 4RUBA 2FC9A 1NSPA 5JUMA 4H4OB 1VC6A 2UXDJ 2UUBF 4G1PA 4ANDA 5KT6A 1AT1B 1DLOA 2OSRA 4OZ1A 1IKYB 2IRUA 4ANCA 2PT0A 1REVA 1RQ0A 4LJMA 3MEEB 2J76E 3M8ZA 3NXZA 3TUZC 4CIOA 3DYAA 4ES2A 3GJTB 3K8VA 1H2TZ 4K59A 2QLWA 4F4XA 2R7SA 2GVZB 2XY7A 2FUG9 1TL7A 4TYBA 4YB5A 1YDLA 3BBBA 1HBOB 2RUSA 2WZ1A 5DRKA 4DSIA 2MQOA 3A8IA 1X4GA 2DNNA 3HHDA 4NLYA 5IC6B 2G1HA 2AGOA 2CVEA 2CQHA 1WD6A 2VH7A 5HMWA 2DD8S 2HMIA 1X5TA 4NCGB 3KJQB 2CRLA 1Y0HA 2DNOA 3A1YG 1JLQA 5KFYA 3TP2A 3MR3A 4JI8J 5GAEI 2M2BA 1S5ZA 3FBBA 4TLQA 1RTJB 3MD1A 1M5HA 1WOPA 3KXDA 4DR4J 2YNGB 1OSCA 4M5DB 2ZH6A 3MGJA 4HDGA 1I6JA 3PRDA 3J7AN 1S57A 2J9DE 3MCMA 2KHDA 2PEBA 2VFVA 1D3WA 3CCRS 4K4XA 1FXLA 3QMQA 2E5IA 2OSQA 2Y9HA 3UQSA 3TJ9A 4ED6A 3MMBB 4KGKA 4X64J 3NMAA 1WELA 4B08A 1VQ6S 3OHAA 5HO4A 1ZM2A 4RL1A 2HHQA 2G4BA 2HBRB 1JXLA 3W1YC 2PI4A 2IYGA 3KUGA 2IDEA 4PPDA 4UUWA 3ZZYA 4RNMA 1IQZA 2B9XA 2K7KA 3GFZA 5KFZA 1S7HA 4FS2A 2H3EB 4A8MP 1KQSR 2OHDA 2VA2A 1LNQA 2P2CB 1U47A 2VQEJ 4EMDA 5LMUF 3T5LA 2JL9A 2W01A 2JEGA 1FJEB 2YWKA 3MZIA 3ADAC 4Y00A 1Y11A 4Q43A 1IKWA 4YR3A 1RWMB 3CCQS 1U0HA 3QIDA 3BSAA 2BE2B 4EBEA 1FA0A 2C3UA 1H98A 2HRYA 4LREA 4ECQA 1U1QA 3PY8A 3DRPA 1TZ0A 1KNZA 2QE5A 1FJGJ 4DUTA 3P5BP 2OPSA 3I5CA 4ZPVR 5E7OB 1IQTA 2WBRA 3AODA 2BE7D 2OFHX 4RW4A 4EI2A 5KAKA 3T1YJ 3RB0A 1KLMB 4MH8A 2H5JB 4DX8H 2Q43A 1GX6A 2RE1A 3OR1B 2GZOA 2MLZA 1VQ7S 1SV5B 3VHQA 3NCRA 4FZVA 3O1LA 4LRCA 1S1VA 3T3FA 2Y8WA 1XJWB 2VJVA 2UVVA 3GJSB 4P71A 4QBUA 1UVJA 2HWHA 1G6BA 1FRHA 1NU4A 1PYTA 2NYHA 4ANEA 3TZWA 3S1TA 4CO1A 3VGVA 4O4GA 1FERA 4USTA 4ZVTB 5KOWA 1NK6A 3KFWX 5E2QA 1D1UA 1TP7A 3HHLC 4AXJA 2AYGA 3CC4S 4ETZA 1F2HA 1L3VA 3GG1A 3HLUA 4U7CA 1Q5VA 2XHWA 3TEGA 3HX9A 4DV4J 4QYZK 2EXUA 3DRXA 3DKDA 5CCLA 5HQLA 2P9GA 5GMKa 4DL6A 3W9IA 3MAHA 3ICLA 3FC9A 4J9NA 1ZZNA 1M5KC 2ZOGA 3DLGA 2VONA 1Y3KA 2CJBA 1DAXA 1UAWA 2VHGA 5DM7Q 2V34A 1XNRJ 3AB4B 4YQWA 4WZMA 4UT4A 1V3RA 1DQAA 4P7VA 1O8BA 1M90T 2FJXA 2MSTA 5HMYA 1DTQB 1QM9A 1Y7PA 3OBIA 3VAMA 4Y2KA 4LFBJ 5IQQA 2MQLA 1A6LA 3W9HA 2IPOB 4CLZA 4AQYJ 1RSCA 1S9GA 4DCOB 1KP6A 5MAOA 4JBCA 1X5PA 1SJQA 1RAAB 4PG7A 3PO4A 3WDOA 2V8VA 3DXBA 4L74A 5KT2A 2CZ9A 1VIOA 3MFIA 4G65A 3T1HJ 1KHVA 4MAKA 3C16A 4F3OA 2ZJRQ 2C2ZB 1U09A 2H4YB 4QIGA 1Q86T 1F9EB 3QSYB 1IM4A 1U1OA 4ZPCA 4EZ9A 3CIZA 3HZGA 5K8OA 2C2MB 2XS5A 4HDHA 3L7OA 2PGCA 3PXGa 3OW2R 4HEA9 4RW8A 1RLDA 3EZ5A 4LFCJ 1LKZA 2HBQB 4LF1A 3UCZP 3NNAA 1GNKA 3K8WA 3JQKA 3PACA 3PJ9A 4AFFA 2LVWA 4DL0C 4CH7A 2IVMA 4QWBA 5AE3A 2H5EA 8RUCA 3J80Y 3PVXA 4ZLPA 4ZLJA 2XNQA 4LQ3A 2JDJA 3G8QA 1T03B 3VTIA 4K7QA 5F8LA 1ZM9A 1RT4B 3VF0B 1HL6A 2BJDA 1PC4A 2I38A 1R0AB 2CQCA 2D9OA 2ZDOA 3CNQP 1T8EA 1QAIA 4ERDA 5CZVA 2CJQA 1N88A 2HVEA 3UDLA 3OXLA 5DJBA 4R8UB 3N6LA 4J9RA 1IWAA 4H4KA 3EGZA 4HL9A 1S6PB 1GMWA 2CQGA 3T19A 4OI2A 5F0WA 3CJ0A 5DGBA 2XZDB 3MAAA 5DS7A 4RW9A 3CJ2A 4NCAA 1SJ4P 1I51B 5F8MA 1VJWA 4PQAA 5E0OA 3JAMU 1ZTWA 2R7OA 2OELA 5DGAA 1KD1T 4NI2A 2IRYA 2DTJA 3Q8PB 2YKQA 2F8EX 2KT3A 3I5BA 4YFUA 1CJKA 1VQPS 5KFAA 4N8NA 4KHPF 3FJ2A 5A0YA 5M2UA 3VGTA 1FKPA 1NPRA 4LSLB 3TUJC 2ZH4A 3MEDA 4B9SA 4OYMA 1U7LA 1WTFA 1VHIA 1K0TA 1UVKA 3EPGA 2DH9A 1AB8A 2OPRA 2V69A 1Q8IA 3C6TA 1UEVA 4B3TJ 1TL3A 4AD6A 2V2KA 1N5TA 4URQU 1VQKS 4P6QA 2C2EA 2XMUA 2A1BA 5A2QU 2XGQA 3V81B 3QSIA 3KNGA 1RT5B 5G4DA 5I42B 4X65F 2B4VA 3A13A 4E8UA 4OZLA 3I4HX 2KFNA 5AJ3J 3M9OB 1IKXA 3E8OA 4NLRA 3DRPB 3UN3A 3GLJA 4F25A 2BQUA 4LBPA 2J8SA 5AXLA 4PG8A 4PXCA 5A8KA 4ZVEA 1CQMA 1HQUB 4V19X 4PWUA 3GV5B 3MCNA 3TI0A 1P27B 1FWPA 4U6PA 3NP5A 3HFZB 3RBXA 2DH8A 1EJ7L 3P6YC 5HP1A 5F9NA 4UOGA 1KEKA 3H40A 1FFGB 1VFJA 3CW2C 3WQPA 1Q4RA 4C8ZA 3A8JA 3GILA 1BE4A 1S7IA 4FDFA 4YY3F 2HS4A 2GAHC 3EGVA 5CH7B 4MIWA 5SZTA 3A8KA 4F7VA 2CA9A 2EFOA 2NUHA 2IC3A 3D66A 4NZ7A 3KLGB 2P5VA 2F65A 2J9DA 4J37A 2HHSA 1MW7A 1HNWJ 1FRLA 1PO6A 4IFYB 4Q5VA 2IDLA 2HWIA 1CJVA 4ILRA 4O3NA 2RILA 1YITS 1AFIA 4QIEA 1SB6A 2BUNA 2OAUA 1UL3A 4A8QA 5A8RA 1O5JA 3FZBA 5F3ZA 4J91A 1JXVA 2KT2A 2LDIA 2MJNA 3DLGB 3EICA 2C2NA 4NLDA 4OZ5A 1E6YB 4DHVA 2HMIB 4IRCA 1YBAA 1IJEB 1NDLA 2KXHA 1NK8A 2DK2A 2JRSA 3DOMA 2FYXA 2R2RA 2HK2A 2LXUA 4GC7A 4ED1A 5T14A 2C42A 1F0XA 1RBOB 3NGSA 2JEJA 1RJJA 3BKFA 5KFDA 2AGQA 4NEYA 3HJVA 5CQGA 1B0PA 4DF8A 5KFCA 1ZM4A 3H98A 4Q7AA 1VQMS 1LWXA 2XSJB 4K5RA 2MKKA 1GH8A 2BRKA 2IJFA 1SJRA 2HIQA 1BXNA 1DQ9A 1JLAA 2HFUA 4F26A 3TZXA 1NSKL 1S1VB 2Z2YB 3GZ7A 5HK4A 4F4YA 2HK3A 1OPIA 1RE1B 1LXNA 2JSXA 5RUBA 4OI4A 4DSKA 1QUPA 1SC1B 3DOLA 3IBCB 4DXLA 1MWYA 2RMLA 3L09A 3MCSA 4RW4B 4FBUA 5DLFA 3NOCA 2W4DA 1YJUA 2Z56B 3U1NA 1Q8BA 2WRMA 3NG8A 4LF8F 3K57A 1RWNB 1U8WA 2A2DA 3JAMY 1IBLJ 1Z2ZA 2HHWA 2XMJA 3AQOA 3IAS9 5E3RA 2B7CB 2AYBA 3MOJB 1TUVA 2RB7A 1IKYA 1DQ8A 2LXFA 2V63A 3NLCA 3ZZZA 3T1YF 1VQ5S 3CCZA 3CJRA 4WTOB 4HHUA 5G0RA 5HL7Q 1TL1A 1MG7A 4YR2A 4NLSA 3HHLA 2E1AA 2ROGA 3KG0A 5D15A 3KDOA 3I32A 4M5NA 2DNZA 2J5AA 2OMOA 4ZN1A 4CO2A 1FD2A 4U67Q 2V9KA 4IG0A 1A0OB 3IS9B 4HT7A 4C8YA 4G1IA 2V8HA 2YWHA 1H0HB 2D3UA 1KQFB 3KLHB 1U2RA 2ZH1A 1T9UA 4CH0S 3M6UA 2VBZA 3BGRB 2EW9A 3JS9A 3W62A 1IKXB 2K1RA 2MKYA 3MR6A 3BQ1A 4DV6J 1QTMA 2FZCB 2YQ0A 1HBNB 3G86A 2CZVC 3OL8A 2BZ2A 4M5IA 3QGHA 3H5UA 2KRRA 4I2QA 2ASJA 3RU0A 2ADBA 1UW4A 2VFUA 4C3KA 1YLXA 4TU7A 4FS1A 1BQNA 1RA7A 4Q8FA 3BSOA 3JSMA 4DL2A 4DFKA 5KG3A 2O1PA 3JQMA 3NAIA 1ZYQA 1FDBA 4DR5F 2M8DB 2GHWA 3RG6A 5JXSA 1C1BA 1HHSA 4RW6A 1VBYA 2LLZA 2XG8A 2N3OA 3OL6A 4AT1B 3A3OB 3RR8A 1EB0A 2ZUGA 1K9MT 1WC5A 2B9YA 2HHTA 5EWGA 2LP4A 2K3IA 3KYLA 1HIYA 3QT5A 3QRQA 1GMVA 3JSRA 4ID5A 3EMTA 2CQ2A 3KWMA 2IC3B 4B9VA 1WUUA 1D09B 1YKWA 2R3VA 3B54A 3X3UA 1PG5B 4DR5J 4USKA 1RT2B 1SI9A 3QT8A 1S1UA 5ETSA 1OIAA 2LYVA 4DU8A 3DLJA 1XWLA 4WFNQ 1J5OB 2ADCA 2YPZA 1QE1A 2M52A 2ZD1B 4HKQA 4RW9B 3CCVS 2VG5B 3MAAB 3GIJA 4ELVA 3ZO7A 4DQRA 1RXOB 2EWHA 4KSEB 3UCGA 4DR3F 3R1LA 3N6MA 2JLEA 4HYKA 4DR4F 2OPQB 2CNLB 3TUIC 1K73T 3DOKB 1CC8A 1HNZF 3MXHP 1BQXA 1HR0J 4ILLA 4OZ0A 3LUYA 4ED4A 3N5BA 1X4EA 4FVMA 3T9ZA 2VD3A 3BGOP 5J2PA 3G87A 3PX4A 2YNFA 3P3DA 4PYDA 4RW7B 3M6XA 1S9EB 1U1MA 2IRXA 2CPFA 1X5SA 2HQ3A 2QLJB 3LH2S 4J90A 4O4GB 1Y3JA 1R43A 3D0GE 3M2RB 5FLXY 4QWAA 2XQCA 1WG4A 3KK2A 2R2TA 4NMXA 1AA1B 5FDLA 5EDWA 1I94F 4FF1A 2IVYA 4JV0A 1RBAA 2B4UA 3VGUA 5KFBA 3JSMB 1FNXH 1XNQJ 1FRXA 2JJ4D 5IFMA 3OR1A 2XB2D 4DR6J 3RB3A 4QWEA 4LR8A 1NXIA 4KGVB 3JXOA 2E29A 2XBPA 5GAHU 3M2UB 6FDRA 3GIRA 1RZMA 5CYQB 1URRA 4F8RA 1TK0A 2XYPB 1HFEL 4BWMA 3ZZRA 2N7YA 5C25A 3KLGA 2DIUA 4DF4A 1CULB 1HPZA 1S6UA 2ASYA 2O5DA 4NYOA 2DNRA 1WOSA 1KVJA 2HLTA 1JKHB 3CD0A 1Q81T 4K0KJ 3RBZA 4J9PA 1FEHA 2ZWOA 3J7ZT 1FKAF 1DARA 3LOUA 1OMSA 3UO0A 1TFYA 3CD6S 2C2OB 2GHVC 2M8HA 2PN6A 4YUDA 4Q45A 4B9UA 1UVLA 3BF4A 3BGFA 1S9GB 3T6JA 2E5JA 4U7UK 4YMEA 1MLAA 2FZGB 3AH6A 1SH0A 2RKIA 1C1CA 2D74B 4USJC 2WHOA 4GMKA 3ZFVA 1UPMB 4DV5F 1G2EA 2JNJA 4GVBA 2W25A 3L4BC 3UVJB 4LQ9A 4DL3A 3H2VE 1HBUA 4URSA 1N6QA 1NDPA 3A4TA 3QAEA 3MEDB 3O44A 4X4TA 1RHUB 8ATCB 4K4ZA 2VBXA 4CH1A 3TQEA 3BDPA 5LOQA 2OIHA 2GS8A 3IG1A 2FLLA 2LMIA 2NZCA 6AT1B 2YNFB 5KG5A 1NM2A 3AFGA 3KMSA 2CWXA 3LQVA 5ETKA 1X4AA 1ZAXA 2C2RA 4JYAF 4K4UA 5SUHA 4X4UA 2E5LF 5FLXU 2UVUA 2EBGA 1O51A 4W90B 4DV2J 3RJMB 3WIUA 4MKBA 3OR2A 4RZRA 2DEJA 4OZNA 2LFVA 3KHLA 2VU5A 3A12A 2R8HA 1VS3A 4M5LA 3G6ES 3DM2B 1FK9B 5CA5A 3T1AA 5L9NA 4JB8B 4ZCLA 3Q8SB 4E2FB 2MZRA 2MY8A 2ZM6F 3QLHB 1YRXA 2RQ4A 1N36J 2DNHA 3PJXA 4OQJA 1NUEA 3IR7B 4M63A 2Q3PA 5E5NA 3O2IA 3PDNA 2J0QD 1S0VA 2V0NA 1H7XA 4KIAA 4WFXA 4A8OA 5EN1A 5KFTA 4ZKAA 2EFQA 1M0SA 2MQNA 4YHHF 3DLKA 5HVFA 3ISZA 1C4CA 2RQMA 4D3GA 1H38A 5C42B 1N5YA 3OFHA 4I68A 5B0BA 2NZ4A 2M4MA 2AYEA 2YKMB 2XMMA 1SV5A 2AWZA 2X3DA 3AJ2A 2D9PA 4ED5A 1KVKA 4DS5A 2R42A 2YNHB 1RYSA 2BACA 5DQHA 1CJVB 4JI7F 1IBKF 4PRFA 4AE5A 4RKUC 1KSPA 4JV5F 1Z2LA 1HWJA 2GIFA 2HVIA 3CT9A 3H4BA 3GPAA 1SL0A 3M30A 3H20A 3BGRA 4R5PB 4DUZF 2V5HG 2GGPA 2HQIA 2UUBJ 2QGFB 2XMKA 3NRBA 1VRTB 3TX8A 2X3GA 1ZPVA 3HDSA 2JEIA 1U1PA 5ADZA 3EVOA 4X4VA 3M4XA 3HULA 3KK1A 4B3SF 4KV8A 2QLFB 2C3YA 4LBIA 1RAJA 3SV3A 2UUCJ 3VGSA 3MM6A 3EPIA 3NS6A 5DLGA 3CJ5A 4J9VA 3TVKA 4NLQA 4F3MA 1PCAA 1OPZA 1RHQB 3D1OA 2BABA 4Q2LA 5L38A 2CXEA 5J2MB 3T5HA 5LXYA 4M5GA 4NLXA 5DQIA 4DV0J 5D8HB 3PFEA 2JC1A 5E3PA 2KFYA 4DJBA 2ZC3A 3SIPB 1WKKA 3HP6A 1LXJA 3C19A 1RT5A 2CKWA 2DGXA 4F36A 3T5KA 4HH0A 4F4AA 4DUYJ 5J2NA 5F9LA 2WVBA 5GMEA 2C2DA 1FWKA 4CO4A 1NK0A 3JSYA 4NEZA 4CRJA 5LJ5Y 1L3UA 4A8YA 4F2RA 2UXBF 1IVZA 3DI6A 5HI7A 4HHJA 1BHNA 1RWUA 4OJ1A 4P10A 1TK5A 4Q0BA 3N0VA 4IQMA 4PQUB 2W24A 2ZUAA 4XAKA 2ABYA 1I5OB 1B3TA 1SIWB 2D69A 5KG4A 2ZVIA 3K89A 5EGYA 1HBMA 1D8YA 4C8OA 4QPXA 1HW9A 2HURA 2RD5C 3MPYA 3W7BA 4OYAA 2OI2A 1QSSA 4DDFA 5IM0B 3J81U 5KFJA 2BE9B 1Q8LA 1WDDA 2GGPB 4OHWA 5CYMA 3VAKA 2PA3A 4ZDNA 4KGMA 4ZVFA 2XC9A 2YXLA 2GVDA 1B64A 2A6MA 4J7CA 2NUUG 4N76A 3TR5A 3SZ2A 2A3JA 4GO7X 4FF3A 2G13A 4DX6A 4NXNJ 2FHKA 1WOOA 3MMCA 1X0PA 2RVJA 2Y8YA 2EVZA 3W2WB 2IBKA 1XMOF 1T0TV 1U8SA 1EARA 3DOLB 2WVEA 3EXYA 2RDDA 3Q8QB 1RU2A 1EIYB 2XS7A 3Q23A 4P74A 1FRKA 1XR7A 2BJ9A 3UN2A 2ERRA 1HW8A 3JTOA 4KBIA 4JI3J 5T41A 4LVOP 3SDEA 4O3SA 1RDRA 3F73A 2YQ1A 2QYGA 5E33A 1YWXA 1OSDA 3FZ2A 5IXUA 3J81Y 3ETOA 2NXNA 4K2XA 4ZJLA 4QU6A 2IY5B 1LWFB 1IBKJ 4P52A 1WNEA 5AT1B 5HMZA 1HNWF 3A8EA 3U7JA 2VPXB 2DNKA 2DGUA 2NS1B 3PKYA 1KTQA 3DLEA 2ROPA 2CFXA 3LP2A 1JLGB 4PCQA 1GMUA 2KU7A 1B7FA 4ATNA 1JLFB 1G4CA 3G6VA 2RRBA 5K9FA 2EG1A 1OQ6A 1TU0B 4MMOA 1U4BA 1EZZB 3FSYA 4FF4A 2MQMA 1XMQF 2CPJA 2FIUA 2QFJA 2AYMA 3G8TA 3FSIA 4OZ2A 2JVRA 3HHKA 3PG9A 4G1QB 4QR2A 3U1LA 3QYYA 4CYUA 2I8EA 2VG7A 2W9CA 4JI4J 3CMQA 3SSQA 1RLCL 5EWFA 3BO3A 1MU2A 1S6OA 2HKEA 2MKSA 3WIVA 2X1AA 3EGWB 3DRRB 3QQCD 4JI5F 4JV2A 5ETOA 5HVGA 4OX8A 5KG1A 4I7FA 3I82A 4KKOB 1RWXB 2DNGA 5IWAF 4Y0FA 2W7PA 5L1IA 4RU2A 4ES3A 2W2OP 3MUMP 1EETB 1JLBB 3GMGA 4I56A 1T9VA 2B8QA 3NGTA 2MQPA 1S4EA 1W2BR 3N28A 1I3OB 2LEPA 4R0JA 3R2CJ 1S97A 1Y10A 5HSPA 3I0RA 4FVCA 3W5YA 3CB4A 5KTQA 5B0AA 1NO8A 4ZLLA 3AOCA 2UXBJ 2YTCA 1RT3A 3NGDA 2Q6CA 3HZEA 2C2KB 4RNHA 4WP3A 2K3KA 3ZNUA 1FXDA 4HTIA 3GIIA 4TYAA 4NYPA 2ZH7A 2EKNA 1BC6A 2HHHF 4NCBA 3GCXP 4Z2XA 2ZEJA 4OX9F 2IVFB 2OGUA 5ETRA 2DGWA 5DZ7A 5KFQA 4KYZA 4OJ3A 1XR5A 2E1PA 5ETPA 2NR0A 2RNEA 1HHTP 3W5ZA 1TUWA 1F5AA 2FJDB 5C2GA 2WTFA 4MFBB 4L6V3 4HR2A 4ETXA 2GJIA 3QPIA 3D0IE 2FQQB 4M1KA 2CG8A 3UVJA 2XO7A 1N5VA 3D1HA 3W8PA 1C1CB 3N4WA 2HRTA 4N7TA 1N52B 1WG5A 2JEFA 3JYTB 3SCKE 1C2PA 2DXDA 3ZZ0A 5D78A 2UU9F 1NAQA 5K20B 2BKPA 1IN0A 3UDVA 2L08A 4L72B 4URGA 3I4PA 4ECTA 2AEFA 1IBMJ 1F5BA 2HRUA 2KJVA 3DGPA 3LANA 5THWA 2C22A 2DH7A 2DIVA 2HSEB 1ZA1B 2XCAA 3GIKA 5K14B 5DM6Q 1SH3A 3CCLS 3Q2TC 2EKYA 4LF4J 4NE9C 3LA0A 3IWXA 4LF2A 4TXSA 2N7CA 3W2VB 4Y2AA 4ZVRB 4IH6A 2ACMA 2PMHA 5CYQA 2F3JA 1LV5A 1JLGA 4OLPA 2MXYA 2QZ8A 4N77A 3G6XA 4LFCF 1FESA 1NK9A 2R8JA 2VKZG 4OI0A 1O6XA 3BBCA 4ALZA 1XR6A 1R8AA 5T7LB 1XNRF 2LU1A 3MHYA 5KOXA 2YWEA 4MJKA 1R7IA 2CPDA 1JLBA 5KG2A 4XO0A 1FKOA 3ZZOA 4TU9A 4FP9A 2UXDF 1CQNA 3NCPA 4BC9A 1Q95G 2J8AA 2QYCA 4BWJA 1K44A 2AF6A 4EZ6A 1NCLA 3JQJA 2JFDA 2DEIA 2CJKA 4LSNA 3LF0A 4A46A 2LEAA 4WFBQ 3QT6A 2EFPA 1C1BB 2MDAA 3DOKA 4RW6B 2ZFHA 4OMFG 3MWBA 4X66J 4HT5A 1PJ5A 4KJIA 1G1XA 3DNCA 3MF5A 4JOUA 4ZCKA 1HNZJ 2WVCA 3G82B 1FTRA 1HHQA 1IR0A 4BLGA 1T94A 3IA0A 5C5JA 2DT9A 3D9BA 3LWMA 4IOAQ 3DRSA 2MZQA 1SUQA 3CDEA 1FT8A 1HBOA 5HATA 4CTAA 2CVIA 3EUNA 1E6VB 1NDCA 1RT2A 3GWCA 2GMLA 1HBNA 2QLBB 1M5SA 3WZ0A 5M2PA 2AEJA 3CCMS 2YQ3A 1X60A 5HJYA 4ECYA 3MM9B 4O4RA 3TWZA 1NSQA 1N32J 2H51B 2BOAA 2FLOA 5JVGQ 3D6FB 3E51A 3GE9A 3ETMA 3EVMA 4GO5X 1GXTA 3HSDA 3ITHA 3TQ1A 4KPYA 1ZH5A 1R8BA 2EBEA 4O44B 1CBKA 4Y34A 5D0GA 2IJNA 5D0HA 4NLVA 2JC0A 3SSRA 4OHYA 2QIFA 4X2BA 2B8PA 1MMNA 2CIMA 3OQ2A 4B3OB 4MFBA 3MEKA 4DS4A 2B43A 5IT9U 1WEXA 2WBMA 3Q89A 2L3MA 4DN9A 4B9MA 3AA8A 3IRXB 4F4WA 2HNDA 2DGVA 3LPEA 1HQEA 2WSEC 4IKAA 4Q44A 2E7XA 4ES1A 1HWIA 3OTOF 2FHOB 2N4CA 4ZVQB 2K06A 3CF5Q 2XMAA 2HGMA 3D67A 1JLCA 3Q2SC 2V67A 3M2VB 2EFVA 1J5EJ 3H90A 3W63A 1OO0B 3D4JA 2IAJB 4LUBA 4C8LA 2BQRA 1AYEA 3ZNJ1 4EUVA 3UW1A 4A8KA 5F41A 1UZHA 3R5CA 5CZXA 1QVGR 3SI8A 3I6PA 3NCQA 2OH2A 3IM9A 1R8HA 2VDHA 2DB1A 3THVA 2A2CA 2MZTA 5F0UA 3NS7B 4NCGA 4ILMA 1RABB 4DQPA 1EX8A 3NBPB 1S0NA 4DX5A 3CDUA 2ACYA 1FI4A 1K0VA 4Q0BB 1HARA 1VRTA 2M5YA 3BR8A 4M5HA 3KLEB 4ID8A 3P4UB 2CNKB 4I2PA 1NZ8A 3MPWA 3HKWA 1VJQA 3SFGA 2FJWA 3MM7B 3RGIA 1HI1A 1SJFA 1RHRB 4U96A 2WW8A 1D9AA 2FZKB 1X4FA 2MYFA 1DLOB 4LR9A 4YR0A 1VI7A 2VA3A 2LXIA 1JLQB 4DV1F 1HNXF 2PO4A 4NLUA 5LL6d 4CYUB 1V5VA 3E01A 4DR7J 3QO9B 1APSA 2J7WA 4LRBA 2Q1LA 4CWBA 1RWKB 4MT1A 4B3SJ 2B4PA 2DHGA 4X4NA 5CYJA 1RT7B 4ZIWA 1YSJA 2XGPA 4DV5J 1WJ9A 3FMWA 4CT8A 3LGMA 2I6WA 3RAXA 1IJFB 2DY1A 2NXEA 3MM6B 3PRVA 1I94J 2B0GA 3FBFA 3BSNA 2FPHX 2MZSA 5CAAA 3JB9k 4ECSA 3CJTA 2ZH2A 1ROFA 3KKFA 2VBYA 1Q5YA 3C66A 1SC6A 2KXFA 4DV6F 4DQSA 3C14B 5D3GA 1ZA2B 1N34F 2HG4A 4YDXA 3S01A 2XLIA 1Y5LB 2HGNA 3MM5B 3O3LA 5KT7A 4XPEA 1ZETA 4DZDA 4P73A 1PBAA 4AL7A 5I3UA 1U1NA 4F02A 2AT1B 1QAJA 1HD1A 2GNKA 4P2XA 2ZVSA 4Y2IA 3OVAA 1EKRA 2CAJA 3EDQB 1X8DA 3TO8A 1TV6B 5AJ3F 2VZ9A 4I6AA 3OLBA 1VC0A 1SKSA 5BR8J 3PIOQ 2X1GA 5EWEA 1YZ7A 4K4SA 2ZC4A 2VQFF 2ALYB 3FEZA 3DDKA 4QPTA 3RBEA 3G9CA 4LFAJ 3PM9A 2KM8C 3HSGA 5KT4A 1RAOA 1PBUA 3IC1A 2JLGA 4J5OA 4HACA 1U45A 3VQSA 5HP1B 3CJ8A 1WC1A 2CQBA 2FHJD 5ETNA 2ZE2B 1OJ4A 1Q7LB 2OPRB 5KFWA 4I6WA 2MGZB 3LAKA 3OL9A 1FVQA 2AJ2A 1FNMA 3CJ4A 5F8NA 4RUHA 4PQUA 2F5GA 1CEZA 1HQUA 3PTWA 5KG0A 1R31A 5K14A 1BMQB 2C3MA 2QSWA 1CJTA 3DI6B 4WU3A 3TJAA 2HHXA 3OUYA 3O5TB 4RNFA 3H5XA 1VRQC 2RRNA 2Y0BB 1VC5A 5C42A 1UZDA 4PXDA 1LW0A 2BXJA 2I5JA 1UFKA 2CJXB 4X84A 4ZP9A 1T02A 3L9ZA 2OD4A 2J7UA 1XN9A 2D3ZA 4P7TA 2BX6A 3I0SB 3QIPB 1UW9A 2E7VA 2WVDA 2Y1RI 4QR0A 1QDUB 3PYFA 4TVAB 2BJ3A 3BYPA 1U24A 1S9FA 3UDEA 4DPTA 3C6TB 4X4RA 4TQSA 2E9ZA 4QYZJ 2O3DA 3FQLA 1QJHA 1UWBB 2NSCA 3D0HE 3PHTA 3I9V9 2ATLA 3F56A 3HK2A 1FTCA 2PE8A 2W7AA 1HMVA 2VASA 3MMAA 4PAAA 2W7OA 3J7A1 4JI2F 1KBRA 4Y28C 1CJKB 3WC0A 4B3RJ 4KPCA 4U95A 2DCLA 3TVYA 1Q16B 3G71S 1EQ0A 4NMLA 1S1WA 4OIXA 2B51A 1UCNA 1S59A 1KTVA 3BH7B 3FGVA 1T05B 1F9FA 1XQIA 4G1QA 2W9CB 1F5CA 2SXLA 1WTBA 2BQ3A 1XMOJ 4GC6A 1N32F 3PW2A 3LTOA 2GA7A 3K5OA 3ISNC 1YBTA 3FFIA 3CE8A 3UFCX 4CTAB 5J1PA 3CJQA 3BJYA 4IO9Q 4F4KA 2RQKA 3W2VA 1MWZA 4I7FB 1H2UX 1VMBA 2H5IB 1U2FA 3AHPA 3DLEB 3KLIA 3C16B 3G6YA 4C11A 1T9WA 1UETA 2EEYA 1SJ3P 1SIZA 2MHNA 2AX1A 3MTKA 4X62F 2YKNB 3MFHA 3BQ2A 4OZ3A 4C2MA 5IT0A 5AXKA 4C4WA 3DU5A 1LK5A 2U1AA 1WEZA 5D6GA 4C6AA 4A8WA 4B3MF 2RRAA 4NZ0A 1WEYA 3NY0A 4P2SA 1X7VA 2CPEA 3NWGA 2WK4A 1U1LA 3T9NA 1SUQB 2HNYB 3R5GA 4DV0F 4NRTA 2D1CA 5ETQA 1YI2S 5B7WA 1S0MA 2V8DA 3DLHA 2IBOA 2M88A 3ELHA 1C0UA 3EZOA 3CCTA 2R2SA 4X4OA 2AP6A 2MHEA 2H54B 2RU9A 5L46A 1HYSA 1FHTA 1X4CA 4FPIA 3QIPA 4KHRA 2MJUA 1TVRB 1VLOA 4M5KA 5FDLB 1RT1A 3LAMA 1U26A 1PIEA 1DHMA 4FNIA 5CYMB 3W64A 4AUKA 2DR9A 5DG7A 1YRTA 3HFVA 3N79A 3M9MB 4P9SA 4HI2A 2W8LA 2R7WA 4MYTA 3B78A 4CLFA 1NKEA 3UWTA 3PCOB 1Z1ZA 5DG8A 5GADI 1I1GA 4JI8F 5FIIA 5HROA 3M8SA 1VBKA 1D9FA 2VG7B 1AROP 4G3IA 3SMZA 3WBZA 2CQIA 1SVDA 1X4BA 1M5OC 2ZKTA 3D68A 4LFBF 5JMNA 3ILJA 2XYGB 4RBUA 2KZMA 3FBEA 2HFZA 4NA3A 2YH1A 1AZSA 1LW2A 2GIQA 2MEWA 5C24B 2KN4A 2DRAA 1X4HA 2UUAJ 2HLUA 5HLFB 2R8KA 5IV3A 3NEKA 4MK8A 1HWLA 1RGVA 1YRUA 1HA1A 1P9QC 2OPSB 3MM7A 3POTB 5IC4B 4Z37A 1RKIA 4DG1B 1PJ7A 4OYWA 4ZN3A 4LSZB 1LEOA 5A6PA 3J80U 3DGPB 1TQLA 3J81j 3IRWP 2NXJA 2QA4S 4ECXA 2VODA 2I1RA 1NBEB 1P1TA 4OYBA 4DU7A 3MR5A 1L3TA 2L48A 1UKUA 3HT0A 3NWRA 1DTTA 4ED2A 3IR6B 2GQCA 3HVAA 2DNLA 2PI5A 3FEYB 1QY7A 1SQEA 3D7SB 1YK9A 3OPKA 1WC4A 3ET6A 2ZH8A 5BYQA 1L3SA 1UFWA 4FXWA 3CCJS 1EAYC 3I87A 3IFEA 3MAQA 3AY0A 2HBYB 4MKYA 2KT5A 3OD2A 3BN4A 4ICLA 2W2MP 4DSJA 1XNQF 2V6AA 4CO0A 4DL7A 3KK2B 3MMCB 2HBZB 1HLWA 1RUSA 2C3PA 3PZPA 1UA0A 4QOTA 4A8SA 2YKAA 1VRUB 2J7KA 1S76D 4RR5A 2F9JA 2ZKUA 3M30B 3CPWR 2NQPA 2M3DA 2FDNA 4DMZA 1BGXT 4PYAA 3HT3A 1LW0B 3L7UA 1VHFA 3IBWA 1RTJA 4RLEA 4K0KF 1GTEA 2XTJP 2ZHOA 5GMDA 2GQ2A 3I0RB 4ZPAA 1VK3A 2JHEA 2UXCF 3NKYA 5A76A 4C3LA 3KK1B 2KVIA 1Q82T 3BGLA 4J9UE 3GJRB 1NDKA 1TL1B 3E01B 4JP8A 2AZ1A 2F9DA 2N4DA 3OTDA 2OEKA 2ALZA 2OFGX 2EI5A 2FY8A 3UR3C 5LSLA 4IG3A 1VR6A 5DDPC 3R5DA 1TL7B 4C48A 1N34J 3IO1A 4O3QA 3TAMA 1JMTA 1FE4A 2XZTB 4EYIB 4IOCQ 2UVWA 2IMOA 2UU9J 2MTLA 3GJQB 2E5HA 4LF7J 2O67A 1K47A 1DJ0A 2FHJA 2PSZA 3AJDA 1LK7A 1RADB 3KLEA 2DHSA 4C8KA 4LVNP 3W3SA 1DY3A 5LSOA 1ICEB 4B02A 2ZJPQ 4NOHA 1EQMA 1SH2A 2NREA 1JQGA 1U48A 1RACB 4LF9J 3K17A 2QV6A 3K5NA 2DO4A 1FK9A 3W60A 2W8KA 1BQNB 1YQHA 1VQYA 1RT6A 3CMES 1K1SA 2P9EA 3U02A 4YB6A 3AOBA 1RHJB 2E1RA 4DR3J 4WZQA 3PYGA 1HNVB 3QGPA 7FD1A 3EDRB 3V81A 2HFOA 1S79A 3M2VA 1UEKA 3C46A 4L76A 2E5GA 1EP4B 2K1RB 2QN6B 4B3RF 1Q7YT 2ZM6J 4CZCA 1TL3B 2CQPA 3ZTOA 3HSZA 4ICLB 4WF9Q 1FD8A 1GXLA 1ZBTA 3SEOA 4ZHRB 2B9WA 2BYCA 2MZ1A 2ROEA 1TKDA 3E2EA 2R7XA 3MOZA 3O8WA 2YKPA 5DDQC 4HTJA 4ZMMA 2XO6A 1GT8A 2OLWA 5A0YB 5KFNA 4J9QA 2DPIA 1HNXJ 2EC0A 3N6NA 4NZ6A 4DPYA 3W8GA 2CPXA 2J0XA 2W2QP 3BB5A 3MPVA 3R5JB 4MKAA 5J2QA 2AU0A 1QVFR 4M94A 2ZBIA 1VQNS 3TUPA 3I56S 3QO9A 2IIHA 2N82B 3M1VA 4A8XA 5F8IA 1GK8A 1YJ9S 2OD6A 3Q8VA 3PX6A 1H6KX 3TAPA 2OPPB 4LFAF 4NA1A 2K7JA 3B4DA 2RAQA 1KR4A 2C1EB 2OTLS 3EM1A 1EKSA 1WF0A 1WF2A 4B3OA 1ZS6A 2Y3YA 1DRZA 2YX4A 1W26A 3BKTA 5LMUJ 5AXNA 2QJ3A 1TKZA 3HM9A 4LF5F 1BUXA 3R3TA 2M9KA 4DFJA 1S1TA 5IOLA 4K4WA 4WKRA 2CNNB 1CC7A 4NRUA 4O0NA 3BR9A 4OJHA 5J1EB 1RTIA 4CLSA 1DZ5A 2DNMA 1NSAA 4PWDB 1JNZB 1VK8A 1RK8A 1Q1KA 2DYAA 2FB0A 4ZCIA 1OY9A 5HVHA 4V1Ak 4Q2MA 4ZVGA 4ZVSB 5ITHA 4YB1P 3V6DB 2IMWP 1RTDA 4DQIA 4P2FA 4EGLA 3HJFA 3MEGA 1B0TA 3LGNA 2VIHA 4UF4A 3S7RA 3HVTB 4N5SA 1QTNB 3HD2A 4JUZA 9ATCB 1TMMA 1NB2A 5L1JA 2AGPA 1TK8A 2MQ8A 5EX3A 5CABA 1UEUA 2G2OA 4I1TA 1NJWA 2FJBB 4W98A 3GYNA 3ZTPA 4F0KA 3Q22A 2FVSA 2XM3A 3MR7A 2CWKA 1B70B 3FCVA 1FFSB 2EPIA 3R7NB 1RISA 1XC9A 3PKMA 3MUVP 2O01C 1XIQA 1F9HA 3J7YU 2CNOB 3F41A 1J5OA 5L1LA 3I31A 2YVSA 3OLAA 2QL5B 2VOPA 3P96A 3CJSA 2G0IA 1CJUA 2NPIA 1TMJA 1N36F 3C6UB 5E3QA 4B9NA 4ID5B 3NAHA 2CPHA 4NL5A 2HVHA 2H48B 3MI7X 1N5YB 3EJMA 3Q86A 2YKNA 1NZAA 4ECZA 4ED0A 2MSSA 2V8GA 3HSJA 3IMQJ 1SPBP 2YWWA 4A47A 2ZZNA 4AL6A 1E6VA 2HZAA 2VG5A 3G4SS 2W2NP 1N5SA 2RKIB 2HQFA 2VC0A 2ZBCA 4PG4A 4QJVA 1KLNA 2G2YA 2BANA 4IQXA 2MMYA 3CD7A 1N0VC 3M8PA 2DJWA 1NEEA 5A8WB 4DPWA 2PFFB 4LMZA 3OFEA 2QC3A 2VBWA 5KFXA 1T05A 3IBFB 3R2DJ 4AYBD 4ZK7M 4DFPA 2Z57B 2ZWPA 3K5PA 5CCMA 1LWCB 5H9EK 1FWLA 4PG6A 3VVTA 4JI2J 4UY85 2IJRA 5C25B 2DGTA 4B3MJ 1V6HA 2GMHA 1RTIB 1YGYA 1GQEA 1WACA 2H65B 1FRMA 2F8MA 1GTHA 1OY6A 2KKHA 2PMWA 3OXGA 4IG0B 3QZ8A 3L7PA 4LF6F 2CJAA 1S48A 3VAJA 3DMJB 5FD1A 7FDRA 1PAEX 4R25A 3DN9A 2GO8A 3V4MA 1RAIB 2GCFA 3RB4A 3OSPA 4OYXA 1AFJA 3UD4P 4Q8EA 1MMDA 1FX4A 2Y1JA 1MROB 1F6TA 1YJRA 3CDAA 3GG0A 4EBCA 1QSLA 1QD1A 3THPA 2IM1A 2ZH5A 4PKDB 3RZAA 5J2PB 3V4IB 2C3OA 2IFXA 4RO0A 2FC8A 1U02A 3FMBA 1A9NB 1S1WB 3GSIA 3TA1A 5F8GA 5LSRA 3BQ0A 1H72C 2FGOA 2Z58B 2VJUA 3HVTA 2KB2A 2FJAB 5K8PA 2F7VA 1N33F 1BWEA 2HHHJ 2IM2A 3IG1B 1CJTB 5HQ8A 3RTVA 3T41A 1S6QB 1WSRA 4I69A 2UV8G 3GIMA 3KUEA 1HQ2A 1R8CA 1WWHA 1FO1A 3Q8YA 4UOCA 1HBUB 2QSFA 1WHXA 4XIUA 2V4JA 1VQ8S 2CQ0A 1NNDA 2J9EA 4NYZA 2XSJA 1HR0F 2AX0A 4KRWA 2L9WA 5ETMA 2E44A 3SCJE 1R0AA 3V6JA 3QBCA 2HQGA 3HHEA 1G7CB 1CS4A 3AD8C 4YHHJ 2A18A 3DHXA 4ED3A 2F8HA 3B8HA 3F0NA 4X4PA 2VUGA 4HI1A 4Y6IA 1CLFA 1HWKA 4JV5J 1JJ2R 1HI0P 3EYZA 5B0FA 3R5AA 5DZ6A 1S9EA 4H4MA 4KE5A 2BBEA 2OTJS 4NLGA 5KFIA 2GO9A 2W1BA 4LBHA 3KLHA 1U0HB 1UMJA 2KG0A 3HVWA 4QIWD 5CHCB 1UFLA 2HFNA 1RWOB 3GV8B 1RAEB 3AT1B 5E3AA 1WSVA 1BQMA 3ILLA 2ZZTA 2FD2A 3V6HA 1Q0NA 2HZVA 1KONA 3K2YA 2E1CA 3C14A 5D3GB 4NLWA 3LO3A 2RDIA 7AT1B 1KOOA 3SSSA 4UZBA 1RAHB 2E9TA 1UA1A 3MUTP 2QLXA 1FRJA 2H1YA 2EK6A 3MMBA 5LMNJ 2RDJA 5JJBA 1Y00A 1VQ4S 2VV5A 2MY7A 3PYEA 5HBMA 4AXIA 2Z2MA 4YP3A 4EBDA 2XY6A 2UUAF 3TAQA 3WC2A 3HFKA 3DC2A 4USIA 3X1LB 1PYSB 4ZOSA 2DISA 4GRSA 3QJJA 3UD3P 4O0IA 2LU2A 3ZC4A 3NNCA 1GEHA 4IYQA 4C7QA 1R0BG 3R9LA 1AXQA 2YKMA 2W4PA 2O66A 2IHR1 1NH7A 1Z4UA 4TY9A 4LF4F 4JYAJ 2QMXA 4WXWA 4CI0B 2R7RA 2CJ9A 3DRYA 1T9YA 2DGSA 1N5QA 2GAGC 1R6YA 2JWNA 3OFGA 3GU0A 1FRIA 3LP2B 5HJXA 4LRDA 3UE2A 4CM0A 4ED8A 2BOPA 3RW6A 2CQDA 2HAFA 1YG0A 3M8QA 3SQOP 3B6BA 2ILYA 5KFRA 4EYHB 2FVQA 2DR8A 1IKVB 2L41A 1N8RT 3KLVA 1RCXB 3FKBA 4CLUA 5H1SV 2FLPA 1PC5A 1VQLS 4LR7A 3I55S 2GQQA 4RNNA 4KGXB 4ELTA 4LIWA 4RJVA 2CADA 5IT4A 2AIRB 1WC6A 1NJIT 1IBLF 4W4MA 5BYRA 2AJQA 1U6FA 5F8JA 3FQKA 5EUHA 4C0OC 1U1RA 3DM2A 4XK8C 2G1DA 2CG4A 1F1BB 2WVFA 3CJ3A 4BS2A 2XULA 4W92B 2LQ8A 1JIHA 1V5IB 3D1QA 4FXVA 4QW9A 2GJFA 1F2GA 4OV6A 2XWYA 4IFYA 2E1MC 5B08A 2LCWA 2UXCJ 2KM8B 1RA6A 2OEMA 3NNHA 3OTOJ 1X0FA 4DI6A 3HHLD 3MURP 1LOUA 2OPPA 4DSFA 2VPYB 3IR5B 1DURA 1AZSB 1LW2B 2R7VA 2EFNA 2Z2LA 4OHVA 3HKZD 4L3KA 1JJHA 4R8UA 2BJEA 2UV8A 1WKLA 3EE3A 2DXFA 1WKJA 3M6WA 2YNHA 4WE1A 4CM2A 4ECVA 1JJ4A 2ZBRA 3HXMA 2GHPA 1FCAA 1YHQS 1MN9A 3DFEA 5G0RB 4CCHA 2KZZA 2W2PP 2EFGA 3M32A 1UP1A 5KFLA 1AUSL 4RNOA 3E3XA 4RU9A 3UCUP 1VBXA 2CPZA 4QR1A 3CJKB 4BCAA 1RT1B 4H4MB 1UVIA 4GKKF 5KFOA 4K4VA 3K7RA 1JLCB 1SCJB 4H54A 1S6PA 3R8YA 3VR1A 3WHIA 5I42A 3VWSA 2DNQA 1IR1A 1F60B 2QTWA 3IRXA 4N8OA 4YB7A 3AXMA 4CP5A 1Q53A 5DDRC 2XLKA 3QLHA 4ZP6A 1Y9OA 3DGVA 4YY3J 3KOAA 3GQCA 2EC2A 2Y1IA 4WPAA 2FJVA 3AD9C 3BN7A 4TQRA 5L39A 3QZ7A 4JI1F 4K4TA 2MKJA 5KT5A 2VFRA 5KFFA 3MECB 2UZAA 3R97A 3D54A 2QEXS 3OR2B 1RHMB 1DFDA 3MDFA 1TFWA 3DLKB 2KG1A 3IM8A 4KH1B 4MIAA 5AE1A 4DL5A 2FVPA 4UQTA 1XMBA 1ZPWX 4JI5J 1WI6A 3CCSS 3M8QB 1CJUB 1XK8A 2UUTA 2GV1A 1Q79A 2KL8A 3AQPA 3M8YA 4X4SA 4F67A 4A48A 4I67A 4FYVB 1FJCA 1HKAA
chains in the Genus database with same CATH topology
3C2PA 4KFBB 2ZITA 2HS3A 1YJNS 4M8LA 3US5A 3LP1A 5I3PA 4FBTA 2BVZA 4OI3A 3GV7B 1KS2A 2WOMB 1QE1B 1FE0A 2XI3A 2ZD1A 1T7PA 1NK5A 1XERA 4Y2MA 3ONQA 2BV3A 1WHWA 3OTBA 4Y3CA 4ZPDA 2DITA 5HROB 2YNIB 3THTA 1GX5A 1SKWA 2JLFA 1N0UA 5AXMA 1RT4A 3EZUA 3FVYA 5F3TA 2ZHBA 1N54B 3BEGB 3HMJG 3D28A 1KC8T 1P1LA 2ASDA 2GIRA 3CCUS 3V4IA 4NA2A 3R1HA 4ECRA 1Y4ZB 1A7GE 4B9TA 3M2UA 3BZQA 2RT3A 2P6SA 2BA9A 3ZZPA 2BR0A 3PV8A 1OWXA 2WSFC 2NPFA 3VCDA 5A8KB 3HVRA 3PIPQ 3DLBA 6FD1A 3ENWA 1DTTB 2X1BA 5GVQA 1X9MA 4EU0A 2Z0GA 1RTDB 1VQOS 1S6QA 1V3SA 5B0GA 1V9OA 4FNHA 4RWXA 2FTRA 5A8WA 2DRBA 3GYXB 1RT3B 4X4QA 4FYDA 5A2QY 3UPFA 2RH3A 3C6UA 2BANB 2XSFA 3CMAS 3KMQA 4Y65A 2OO4A 4WE1B 3RRHA 4PXBA 3KLIB 2J6SA 1R3NA 1M5VC 1SL1A 5KFMA 2M70A 3OJSA 1S99A 5L1KA 3M2RA 4WIIA 3PJWA 4WFAQ 2JFKA 3CXCR 4NWBA 4IDKA 1MSWD 1S1UB 4DV7F 1KHWA 1Y5IB 3DHWC 3KG1A 2APOA 2BDPA 1EP4A 3PR4A 3PEHA 4JI6F 3V2UC 4F3QA 1TR0A 3BGUA 4JI0F 1MU2B 3KK3B 2KFZA 1Q78A 1ZAVA 1N48A 2I5JB 1O0PA 5D4NA 3GB0A 1NHUA 2VKRA 4WKYA 3CUNA 1CSJA 3ISND 5K8MA 3PW4A 3CDBA 2XNRA 1H2VZ 3FCHA 2LA6A 2X51A 4RUAA 4ZP8A 4KAIA 1GXUA 3T5JA 1HYSB 3WX4A 5KFSA 4RW8B 1JLFA 2HAIA 3PRBA 4NPOA 4X64F 2ZJQQ 3SCIE 3IWLA 5LMNF 4B3TF 2U2FA 5BJRA 1YVFA 2Y0SD 1YJWS 5BR8F 1J2VA 3RRGA 3RAMA 5FJ4A 3I0SA 5BYSA 4RX6A 5IZHA 2XMTA 4TN2A 1LWFA 2YKOA 4MK7A 2GC8A 1ULRA 5D4PA 4C3MA 4B9LA 3OVSA 2YH0A 2HHUA 1LWCA 5B0CA 1FJ7A 1RT6B 2ZOMA 3D2WA 2BW2A 2DO0A 2RU3A 2BE2A 4XPCA 1S1XB 5LT5A 1AUDA 3PO5A 1R8PA 4V19J 1TAUA 1JNRB 2HS0A 2XWXA 4H4KC 2VC1A 5B09A 3V6KA 1Y5NB 2IYIA 3GFXA 5IT9Y 3UDCA 2XMWA 2DGQA 3SQGA 1RTHA 1UJ5A 3CCWA 3TW0A 4J9MA 3CJKA 4I2PB 1WG1A 3ULHA 4CT9A 1KN6A 2D3OR 1KRPA 3IS9A 3L3CA 1M1KT 2GX8A 5KT3A 3G96A 1B0VA 2B6AB 3QAUA 3H2UB 1C0TB 2J0SD 3BO2A 2QA1A 3B4MA 3IGNA 2E7WA 3VQTA 4DFMA 5KFKA 1UWBA 5H9FJ 3JSBA 3MECA 1RT7A 3MM5A 4EO8A 3T6BA 4C0HA 4U9RA 2DGOA 1TKZB 2IM3A 4RBTA 3CC7S 2KO1A 3DLLQ 4J9SA 3F44A 4C97A 2CQ4A 3H25A 3CWJA 1P6TA 2PEHA 3SFUA 1NK4A 3TAMB 4KT0C 4EO6A 3V6DA 3VZHA 3ZZTA 3SYZA 2AQ4A 3JTPA 4O44A 1NJYA 4ZPTR 3MR2A 1PGZA 3MM8B 4DWIA 2LQ5A 2RS8A 3NBPA 1FDAA 4OV1A 2MGZA 2XEXA 4DV2F 2KYXA 3M6VA 4KV8B 4M95A 4RWWA 3HHLB 3OV7A 5DQGA 2XMVA 2E9RX 3H59A 2M7SA 5KFHA 1U25A 2JZ5A 4KTQA 4E0DA 2MB0B 2GMJA 2KYZA 1LQ9A 1TKTA 2QMWA 1MMLA 5MLCV 1RTHB 2N3LA 3J7Z5 3BS9A 3OTCA 4DBQA 1CVJA 4UW2A 3D5MA 2VFSA 1TV6A 2VFTA 4HLBA 2XS2A 2FHMA 2Z4PA 3MD3A 3KJVA 3FNNA 2W4CA 4DR6F 4D3HA 1GAOA 1KFDA 2HNYA 1KQKA 4IH5A 4OFZA 2QRRA 2YX7A 3CIMA 4E98A 5B0EA 4AQYF 3TARA 1U49A 3Q24A 3U1MA 2W9AA 4IR9A 4QWDA 1RP5A 4MYUA 4PXEA 4FXDA 2LA4A 2HVZA 1D8ZA 2K8GA 1IKVA 2J9CA 3B82A 4HVZA 4A8FA 1BQMB 1X9SA 2Q6BA 4BHQA 2AJ0A 3QJPA 1VLYA 2HNDB 3CULA 5L9XA 4F50A 1ZOTA 2GW8A 2WONB 1S4FA 4TU8A 3VAHA 4FF2A 2K2PA 5K8NA 2CPYA 3SV4A 3QWPA 1L5UA 3SCLE 5DO2A 2WB4A 4KQZA 2R7QA 3LW5C 4N41A 4UQGA 1D0EA 2B56A 2NYIA 4IR1A 5EHHA 2JX2A 2PA8D 3FEXB 2XLJA 4IRKA 1S49A 4GKJF 4DSLA 5HLFA 2L9NA 5E3CA 1HNIA 1BD6A 4QYRA 4C8NA 4CNYA 4NLTA 3ENVA 2R8GA 2E66A 4WXOA 3I96A 3FFIB 3GSDA 3CD5A 5K5MA 4O23A 2BM1A 2R8IA 1SJ1A 2FJEB 3N5FA 1X9WA 3KHHA 5KFUA 1PSDA 3VAFA 1C0UB 2JVOA 5IS2A 2KHCA 3PX0A 2F1FA 2UUWA 3CTRA 4QIVA 5IQ6A 3HO1A 3KK3A 1JKHA 2LDYA 2R4FA 1IUJA 1HMVB 1FDDA 2BRLA 5D4LA 3CDWA 4OJGA 3FDSA 4ZPBA 3HF5A 5KG7A 4NLOA 4IDKB 4OI1A 4N47A 1NJXA 1FXRA 3DDNA 4K5SA 2OP5A 4ITSA 2ILZA 2DCUB 4J9KA 2OMLA 2F4VF 4NXNF 4OL8A 4WCEQ 3S8SA 2R2UA 3MMJA 1FF2A 1W25A 1XTZA 4C9DA 4RW7A 3N01A 2VG6A 2EG2A 3QGIA 4I0WA 4IRDA 2ZNZA 2P6TA 2KRBA 2YNIA 2KDOA 1MNEA 3PEJA 4KR0B 3C8YA 5CXTA 1QAXA 1U1KA 1URNA 2VPZB 2OPQA 1JLEA 2WONA 1V3ZA 2G9OA 3LP1B 3MMAB 4DLEA 1NKBA 4F2SA 4I4BA 2JOQA 1QUVA 2KTQA 4IO1A 4EWTA 1FNOA 1X4DA 4J9LA 4F4ZA 3GR0A 4CO3A 5KFEA 2MQQA 3BO4A 2HGLA 1FEEA 2P9CA 5DDOC 4MTPA 3UI3A 2MKCA 2B5JA 4BDPA 3Q0AA 2LQJA 2JH3A 2AV5A 4TLRA 1BLUA 4ZP7A 4I6YA 3U27A 3R5BA 1WI8A 4DEZA 1DTQA 1JWWA 2LQBA 1HD0A 1AW0A 5I3UB 4ELUA 5M2RA 5KFVA 1RKJA 3AJ1A 3SXLA 2BM0A 2WB1D 3CVKA 4C11B 4WFYA 5DG9A 3P49B 3M8RA 4IFVB 4KFBA 3PW0A 3HI9A 3LP0B 3BSCA 3VAGA 4AL5A 3DYAB 4C98A 3PW7A 4FN5A 1ZM3A 3M1VB 3OHBA 4KO0B 4K50A 1SBRA 1NKCA 1ELOA 4H4OA 3OFFA 3VAIA 1S1TB 2I0XA 2RJZA 1N4LA 5GAEU 2DNPA 3GFYA 1KOHA 1LWEB 4HH1A 4QQBA 2XY5A 3TRGA 2RF2A 2W9BA 4UY8T 2PD1A 2IA6A 4NXMF 1UVMA 1RYRA 2UP1A 1LFPA 1T95A 4NX9A 2CZ4A 4DN0A 4KB7A 4MK9A 4YDDB 2QT7A 1ZAWA 5KFPA 3DXSX 4TNOA 3NMRA 5J2MA 1TKTB 3OJUA 4PPZA 2GFFA 3K59A 4YOEA 3PFOA 4K4YA 1FJGF 1W2IA 3M32B 3RYLA 4R0EA 4CQ1A 1HWUA 5AE2A 4X66F 4DV3F 2LQ9A 1YJVA 2FGCA 2RF2B 4DR2F 3I9ZA 3CCES 4PWDA 2XZWA 4G6VB 2B6AA 4ZVHA 4MIBA 1UJ6A 3W2WA 4USHA 1J5EF 3OL7A 3RAQA 3V5RA 5I4MA 2WAQD 3RW6A 1VQSA 2D7SA 3H5SA 2YY3A 5KG6A 4B17A 3LWLA 1FVSA 1KLMA 1HNVA 1TAQA 5D77A 3POTA 3EGNA 3AAWB 4IH7A 4TY8A 1VQ9S 2YNGA 4M5DA 2V9WA 3FRZA 3SQGB 3JTNA 4WU2A 5I3QA 2FVCA 4OZJA 3DRSB 4LT6A 4ED7A 4EEYA 4DL4A 4Y2CA 3N9UC 3EX7B 1IKWB 1S1XA 4OI6A 3KNAA 2HNZA 4JI3F 2HW3A 4WTYA 2RIJA 3NS5A 5J2QB 2DPJA 3K5MA 5KFGA 1PILA 3M05A 1DBDA 1CG2A 3UNGC 4CO5A 5GAGU 5GAHI 1IBMF 3IN5A 1CPZA 5D4OA 4TY8B 3I5AA 3CO9A 2HHPA 3GR1A 1VRUA 3TNVA 3P5TL 4QWCA 3KHRA 2FLNA 4A4JA 1VOMA 4L3NA 2QO3A 4O3PA 4DR7F 2POKA 3GFHA 4NLPA 5HMXA 3LPYA 4WYWA 1KFSA 1NK7A 4R5PA 1BY9A 2HPUA 4O3OA 1UJ4A 1LFWA 3R27A 4LF7F 1XBWA 2B4OA 2NLWA 3BDEA 3IAM9 1WHVA 3PHEA 4LSNB 4WFZA 4TKTA 2XCPA 2ASLA 3BREA 2RS2A 2IAJA 4DV4F 1C0TA 3RBDA 3TANA 1TL5A 1WHYA 2F40A 3DCAA 3H4DA 2L9DA 2ZOFA 1JXEA 2GJ2A 4EFAC 3RB6A 1YJTA 4KC5A 3RW7A 3MEEA 2ZNYA 1REVB 1U6BA 2WCXA 4RUCA 1JX4A 2MPUA 1KQGB 1D9DA 1XEZA 4IG3B 4DQQA 1NRKA 1UVNA 2DBBA 3ITHB 1U6ZA 3MM8A 2DHXA 4KHMA 2B7BB 4WYLA 1S77D 3T1HF 3KTQA 4DG1A 3TVZA 1L3KA 2ZDPA 4OX6A 1SKRA 1HPZB 3TYTA 3TA2A 5F8HA 3IGVA 3KLFA 2DR5A 4PG5A 5B0DA 4IFVA 2RQCA 2NSBA 2WSCC 3K5LA 2ZZMA 4QU7A 5C24A 5E41A 4QIFA 2OKQA 5EX0A 1TVRA 1C4AA 3MTJA 3NGKA 3OXFA 4ZCMA 1MROA 4LIRA 2ZHAA 1ZTTA 1SL2A 1SXLA 2RSQA 2NXUA 2AJFE 2HWTA 2V4JB 1R27B 3Q8RB 2R7UA 4YEAA 2EK1A 5GADU 3H8YA 3DMJA 5T7LA 1N6QB 3H5YA 2COLA 1FKPB 4LSLA 4RBVA 3UR0A 1TKXA 1LWEA 3H2LA 5A6WA 1N56A 1T03A 1HNIB 1R89A 2QA4G 2B5JB 5LXRA 2MKIA 3DRRA 3ENQA 2Z8QA 1IXKA 4KO0A 1YIJS 3TOQA 3OSNA 3CSKA 1S10A 2B3TB 2DR7A 1HQEB 3QWUA 1X5OA 3AB2B 2AJ1A 3RR7A 1FDNA 4O3RA 3LP0A 3O6QA 5H9EJ 2I9SA 3S6EA 2W9BB 1M5PC 2UVRA 3BM7A 2CYYA 1YTYA 3HHNB 2MKHA 2CQ3A 4PUOB 3L95X 3FRYA 3K58A 2CPIA 3PW5A 4OHXA 2LEBA 3ZZUA 4JV1A 1K1QA 2H9ZA 2CDQA 1RI7A 4I64A 2PMZD 3MM9A 1TL4A 4XDDA 3J7YI 4PR6A 3AA9A 4ZS6A 4C0BA 4DSEA 2V4QA 3PNIA 1FKOB 5CD4H 2CQ1A 1P8GA 3M8PB 4DLGA 2FY1A 2QA2A 2C28A 2AD9A 1WF1A 3HPOA 3TA0A 2KXNB 4J9OA 4QCLA 1KVIA 4ZA1A 4ECWA 2IM0A 1JLEB 5LJ3Y 3NL0A 4XDCA 1OS5A 3CGIA 1JK9B 3SDEB 1NH8A 4N56A 2J0WA 3EXCX 5HN0A 2Q79A 1H7WA 2LECA 1HBMB 3PR5B 3G8SA 2G0CA 4ZPWR 1VBZA 5DETA 1VIXA 2PDAA 5GAGI 2VPWB 2UUCF 1JB0C 3QJLA 2HNZB 3OTEA 1EETA 2KJWA 2AW0A 3JYTA 1VGYA 2PC6A 4C8MA 3CC2S 2ZE2A 4PUOA 2D41A 2IA0A 2YWGA 2VL1A 3M9NB 3K0JA 2VOOA 5JVHQ 2RUGA 1NB7A 2R9LA 2OJ3A 2MZJA 5IM0A 2J6TA 4BC7A 2XI2A 4IOBA 3OUYB 2M0GB 2VG6B 4WK3A 3MEGB 4OLOA 2VB6A 2VQEF 3IWNC 2X1FA 2YWFA 4OX7A 2AJ4A 2KH9A 4QW8A 1JLAB 1S0OA 3KG4A 4WJBA 2A10A 5J1EA 3VALA