1FD8A

Solution structure of the cu(i) form of the yeast metallochaperone, atx1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords ATX1 COPPER CHAPERONE
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fd8A00
1S6UA 4A46A 5T7LB 1AFIA 4HH1A 4A4JA 2L3MA 2ROGA 2RMLA 4ZOSA 2XMWA 1FE4A 3HX9A 2XMVA 1S6OA 4HI2A 3HHLA 2PGCA 2QIFA 2QYCA 3IWLA 1TZ0A 3KKFA 1CC8A 2OD6A 4DL0C 2LDIA 2RU9A 1MWZA 5A6PA 1P6TA 1SI9A 1YG0A 1TL5A 1GXTA 3DXSX 3F44A 3K7RA 1YJUA 2GCFA 1SQEA 2K2PA 3BR8A 2BUNA 2GGPB 2LQ9A 2QLXA 3BF4A 1FE0A 4A47A 4HL9A 2K1RA 2OD4A 1N5QA 2ASYA 2OP5A 5KAKA 1YJRA 1RJJA 3FGVA 4ZA1A 1ULRA 1CPZA 3GZ7A 4FNHA 1Q8BA 2ROEA 4Y2KA 2IYIA 2ACYA 2K7KA 2HFNA 2N7YA 5B0FA 3TRGA 2OKQA 4OIXA 3BM7A 2VH7A 3T9NA 3FRYA 1N5TA 1KVIA 2HFOA 2Q3PA 2KYZA 2QLWA 2OFGX 2BBEA 2RSQA 2KT3A 1VQYA 3QMQA 1N5VA 2HLUA 1JWWA 4YDXA 1WD6A 4U9RA 1TR0A 2PD1A 3TOQA 4HI1A 2BYCA 2OFHX 4F67A 1IUJA 3LGNA 2AJ0A 3MZIA 4NL5A 3CJKB 2EW9A 2XMMA 3QGPA 4Q2MA 1FD8A 4Y2IA 2HQIA 3MCSA 4NPOA 2XMTA 1X0PA 2G9OA 2W4CA 3BGUA 4Y2MA 3BB5A 2OMOA 2ZDOA 4Q2LA 3E8OA 1VQSA 5F0WA 4DN9A 3HFKA 2AP6A 1OQ6A 1YJVA 2AJ1A 3KNGA 1QUPA 1U7LA 4OJ3A 2IFXA 5A6WA 1XBWA 1KQKA 2XMUA 1FEEA 2K7JA 3CJKA 3VTIA 1LQ9A 5B0CA 1W2IA 1Y9OA 5IXUA 3I9ZA 1YJTA 5K9FA 2HLTA 2KKHA 4OJ1A 1GXUA 2OAUA 1X8DA 3DCAA 3LGMA 1CC7A 1TL4A 1OSDA 1Y3KA 4YEAA 2KT2A 5B0BA 2XMJA 1V3ZA 2N4CA 2N4DA 4FNIA 1Q8LA 1FVQA 1N5SA 1Y3JA 2GO8A 4OJGA 1Q4RA 2ROPA 5B0EA 5T7LA 1K0VA 2XMKA 1Y0HA 5B0GA 5B0DA 2W4DA 4DPOA 1APSA 1JK9B 1FVSA 3HHLD 5B09A 2FHMA 4QOTA 2BJEA 2FTRA 2VV5A 3HF5A 2AW0A 1KVJA 3KG0A 5B0AA 1FESA 2CRLA 3WDOA 1AW0A 2GGPA 3HDSA 1YRXA 2IYGA 3LO3A 2W4PA 2ZDPA 3IWXA 2BJDA 5B08A 2FB0A 3FMBA 2HIQA 3HHLB 2GFFA 3HHLC 2LQBA 2LXFA 3KG1A 4HH0A 3UDCA 4A48A 4EFAC 2K1RB 1URRA 2RILA 1MWYA 1R6YA 1AFJA 1Q53A 3TNVA 3BDEA 1P8GA 2GA7A 1SB6A 3BN7A 5F0UA 2FIUA 2GV1A 4OJHA 1OPZA 1X7VA 1TUVA 1OQ3A 2JDJA
chains in the Genus database with same CATH superfamily
4KSEB 3TA0A 1I94J 1QTNB 1JXLA 2MLXA 2N82B 2E9RX 4XK8C 4DFMA 1UP1A 3S01A 2KTQA 2CVEA 5KFUA 2GC8A 4L76A 3KLFB 3EVMA 3V2UC 4OHXA 1WG5A 2C1EB 4WFBQ 3FEYB 4MIWA 1VQOS 1R0BG 2I38A 4F4YA 3U1NA 5KFAA 3UR3C 1Z2ZA 3KJVB 2W9CA 3MR3A 4A8KA 1F1BB 4GC7A 2R7WA 2W2PP 3MEDB 4KT0C 2V69A 2XO7A 5HP1A 1I6JA 1YG0A 3ISND 1HNIB 1B7YB 3KUEA 4TXSA 4KHRA 2DGXA 3V4IA 2MKHA 4QYZK 1FJ7A 3LP1B 2GGPB 3W60A 1ZA2B 2COLA 1C4CA 1HBMA 2DGOA 2HQDA 3C66A 4RUBA 4RW9A 2QX0A 2K1RA 2F8EX 2WSFC 4LT6A 1W26A 4NLYA 2QFJA 1G4CA 5CHCB 1B0TA 1CPZA 3QRPA 1HHTP 1NKEA 1RT7B 1H2VZ 4AUKA 3RB3A 2M3DA 1DARA 2KH9A 2ACYA 4H4MB 3A1YG 1HNVB 3QBCA 1WTFA 1H98A 4B9UA 2IBOA 3DGPA 4ED4A 2E7XA 4JI4J 3OHAA 5AE2A 4C11B 2C3UA 3BSCA 2F4FA 2R3VA 2UXCF 3P5BP 4FF4A 5LJ5Y 4EUVA 2CA9A 1WD6A 4DFJA 2Y1JA 4ILLA 4IFYB 4WTOB 1ACMB 2WSCC 1T9UA 2C3OA 2MZQA 2RUGA 2XI3A 2YNFB 3PRBA 5GAHU 2XM3A 4PXEA 4DR1J 3RB6A 3KLEA 1S97A 4IH6A 2AGOA 3TJAA 2PDAA 2CZ4A 3QT5A 4CT8A 2DITA 3QT7A 4I2QB 1SL0A 1CEZA 4J9PA 4J9MA 2E9TA 1PBAA 3DRXA 1EX8A 2VUGA 2B4PA 4LMZA 3BGRA 5LSOA 1WOPA 2OMOA 5D4PA 1H2UX 1EJ7L 2MGZB 5H9EJ 1RT7A 4M5MA 1NK9A 1KQKA 1RT6B 1JIHA 1VMBA 3D4JA 3CJSA 3R5JB 2LXIA 4K50A 2RKIA 3VTIA 2HQGA 2H48B 4LBIA 2CNKB 4OHVA 2I8EA 2QV6A 3KG4A 2NZCA 5C25A 3MFIA 4DG1B 4URSA 1X4EA 2KFYA 2UUAF 3NKYA 1MROB 1JXVA 3TVYA 3TZXA 1J27A 3H25A 4DUYJ 1SH0A 2N4CA 5KFHA 3OTBA 2FJVA 1U6BA 1FEHA 4B9MA 2JRSA 1U8SA 2XYHB 3MAAB 4OJGA 5H9FK 3MXHP 1IBLF 1F6TA 1B64A 4CTAB 2VFSA 2LVWA 3OTDA 2XQCA 4DMZA 1DTQA 1JK9B 1DQAA 1WOSA 4IKAA 1FJGF 2EBGA 3S8SA 2W2NP 4MKBA 3ZZOA 3M2RB 3N4WA 4LFBJ 1SV5A 4YP3A 5B0AA 1N36J 1CJUB 4CYUA 2BA9A 2XLJA 3RR7A 4Q8EA 2E44A 3HDSA 4FBTA 3N5FA 1HBOB 2IYGA 4A8YA 4YQWA 2YWFA 1PJ5A 1VBYA 3BSNA 1YJ7A 4KQZA 3EGWB 2HHWA 4EFAC 4A48A 2B6AB 1QM9A 4F7VA 5I3UB 1YBTA 2AV5A 2RILA 5A76A 1RT6A 2L9NA 2VG6A 3RRKA 1F2HA 4ZKAA 4A8FA 3DLEA 2WBRA 5J1NA 1TL3A 5KT3A 2MY8A 4DR3F 1L3VA 1ZH5A 1U24A 4FPRA 2PA8D 3D9BA 4Z2XA 4MYTA 1HL6A 4Q0BA 3P49B 3BH7B 1SJ3P 1U09A 1XIQA 5CD4A 2FC9A 2GIFA 3D67A 3QZ8A 2X3GA 4R0JA 1B3TA 2QIFA 5DDRC 4UOCA 2YQ3A 4FF1A 3VALA 2L08A 3IS9B 4C0BA 1K73T 3VGVA 2LDIA 1VHFA 3L09A 3NBPA 1Z1ZA 1MWZA 1SH2A 2BV3A 2MDAA 1VRTA 2YKMA 2ZKTA 2BQUA 4NZ7A 1UVNA 1SV5B 1YZ7A 3PACA 3HJFA 3B82A 4K4ZA 1YJUA 3EPGA 3DLEB 5KG2A 2C2RA 5A0YB 3CJ2A 3VAFA 4MKYA 2CPZA 1QVGR 1JLGA 1KLMA 2J9DA 2Q43A 3TO8A 4WFXA 2MSSA 2ZUGA 1FRMA 4ITSA 2F63A 1WNEA 3RW7A 3CW2C 4LFCJ 1HNWF 3SZ2A 1WJ9A 2J5AA 3CEDA 2JZ5A 4M8LA 3BKFA 3KJVA 4FYVB 4NMLA 3HXMA 5J2QB 4OYIA 4KPYA 2F8MA 3OUYA 4DV5J 1FXLA 3CO9A 4AQYJ 4NEYA 4DL2A 2O67A 2ZNZA 1FRHA 4HACA 1SL1A 2DNRA 2G2YA 2HGNA 2YKOA 1TKZB 3VV2B 3EVWA 4O4GB 4CO4A 2ABYA 2FVPA 1G7CB 4YDXA 2ZE2B 4KHPF 4N76A 2YKQA 3MMJA 2OSRA 3MECB 1CJVB 1YX2A 5G4DA 3L3CA 2NZ4A 5J1EB 3HI9A 1XWLA 4ZLLA 2FVSA 1P27B 3GTYX 5KFIA 1NK6A 2HZAA 3OR2A 2MXYA 2QSFA 3OUYB 2W4CA 3BREA 3JXOA 4OZLA 3HP6A 3ZFVA 3H42A 5L1LA 4O3OA 3GLJA 3TVZA 4BHQA 3FVYA 2R2SA 4WZQA 1N34F 3DRSA 2OHDA 3DGPB 2LU2A 2D3UA 3OSNA 3HD2A 5BXIA 2UUCF 5DQIA 3OXFA 3RB4A 3M8RA 2JEIA 1ZAXA 1ZAVA 3ISNC 4HTIA 4P2FA 5HBMA 2C2ZB 1HMVA 2XZTB 5ETLA 3W61A 2E1CA 3JAMU 3Q24A 2C42A 1RWNB 4B9NA 1D3WA 2WBMA 2ASLA 1R8AA 1KRPA 1EQ0A 1V3ZA 4IOBA 1S1XB 3EXYA 1KWMA 2PMWA 3TEGA 4USIA 5CD4H 3D3CJ 1HQUA 4M5LA 4ECXA 1WELA 3OR2B 3JYTA 1LK5A 3IRXA 1CJTA 2CQCA 2QL7B 5AXKA 2XO6A 2OTJS 3HKZD 2W9BB 2QL5B 4I2QA 2ILZA 3MECA 2XYPB 2GQ2A 3NLCA 4FZVA 3VAGA 5D3GB 2B4OA 4N8OA 3KK3B 5DG7A 1U02A 2CWKA 3Q8UA 1UWBA 4O0IA 4DQIA 4DXLA 4FXVA 1F0XA 3CNQP 2MYFA 2JVRA 4LF1A 5HP1B 4OLOA 1JJ2R 4JI3J 4OX9J 3KLFA 3W65A 2EKNA 3LO3A 4B3OB 4C8KA 3CD5A 3GV8B 3LP1A 4ES2A 3J7YU 1UA1A 2NYHA 3HHLC 4ZVFA 3N6NA 5DQHA 2K1RB 1Z2LA 2ZBIA 3M8YA 4OZ5A 2BKNA 5GVQA 4DZ6A 2RDJA 3DDKA 5L8RC 1I51B 1XMBA 3MDFA 2V50A 3BN7A 4LIRA 2FIUA 2GV1A 5E7OB 4WFAQ 3CCQS 1OPZA 5L1IA 1NM2A 3ISZA 5L1JA 3M32A 1X4HA 2UVWA 1HR0F 4CP5A 1VISA 4Q43A 3AODA 3W5XA 4QIEA 2RAQA 1U47A 1BQXA 3ZXWA 2NCKL 5KFEA 4EGLA 1D8YA 1IR1A 3BBFA 1JJ4A 2E9ZA 2P9GA 3L7OA 2UVUA 4DF4A 1IKXA 1RT5A 2DNKA 4HDGA 4ID5B 1HI1A 2QYCA 5AXMA 1KTVA 3W64A 2DRAA 1H0HB 4DZDA 1JX4A 1DLOA 3FCHA 3CVKA 2R9LA 2EFGA 1S0VA 2LDYA 2DGTA 5FD1A 2AYMA 4DX7A 4X62F 1X4AA 3GMGA 3S1TA 1TQLA 4X4VA 1SQEA 1NK4A 2BUNA 4LQ9A 1IM6A 3M8WA 4NLVA 4OYAA 4HL9A 5T41A 3GILA 4RZRA 4ED7A 4USTA 3SV3A 2HNYA 3EJMA 1FJGJ 4WU2A 2HGLA 1VFJA 2EG1A 2EEYA 1GEHA 3A8KA 3ZTPA 1TKXA 2YX4A 5D4LA 5GAEU 3TANA 4LBPA 1YQHA 3H5UA 3MTKA 1KDNA 2DK2A 2NXNA 2NXJA 3SYZA 4L3NA 5SUHA 2FY1A 2ZOFA 2XBPA 3WBZA 3D1HA 3NGDA 5LMNF 3A3OB 2YH1A 5B7WA 2ERRA 2HHUA 3O1LA 3T19A 4KGZB 2UVRA 3JB9k 1S76D 1N0VC 4RR5A 4DG1A 2QLWA 1WEYA 3OFHA 4DQPA 3QJPA 2LLZA 4CO5A 2HS3A 2CQ3A 2V2KA 1VBZA 1EETA 4ZMMA 2BYCA 1NZ8A 2Z58B 4M94A 2CQIA 1DURA 3QYYA 4KRWA 3RB0A 4NYOA 2VASA 4TU8A 2BZ2A 4K4WA 2IMOA 4X64J 3NAHA 2XMMA 9RUBA 2AF6A 2GIQA 2EFPA 1XMQJ 2ZBPA 2HVZA 1KN6A 4P75A 5U47A 4NPOA 3SCIE 3W9HA 1YJWS 3C3LA 3AXKA 5I42B 2HK3A 3BGUA 5C42B 3RAMA 2WVDA 3MCOA 2CPFA 2BQ3A 1T9XA 3KK2B 4MT1A 1VQSA 1UFLA 1X9MA 1LWCB 2E1PA 1XNQJ 2ZBRA 2XSJA 3ILIA 2DEIA 1PYTA 2G1DA 3GYGA 1VQ8S 3DRRA 5F9NA 2RT3A 4RW6A 1VQNS 5J2NB 1HNXF 3I9ZA 2CJQA 3Q86A 5K9FA 3MWBA 3G82A 2KKHA 3HT0A 4ILMA 4M63A 2CPDA 4OV6A 3CJRA 1HBNA 1B70B 3W7BA 3PX6A 4ZDNA 1S1TA 1HNZJ 4FYXB 3ZC4A 1RBAA 4Z37A 3ZTRA 4NCGB 1Y3JA 3I87A 1S9FA 4PQUB 3GR0A 1VGYA 1FHTA 2XMKA 3BEGB 2VOOA 2GMHA 2ZWOA 5FDLB 3BSAA 2ZWPA 4JI0F 3PEHA 2HAFA 3D3BJ 3EUNA 2MLZA 3CF5Q 1HQ2A 4N8NA 3C46A 1FD2A 3I32A 4F4KA 4QOTA 1SQGA 4JB8B 2BJEA 3IAM9 4IRKA 3LTOA 4DPYA 2K8GA 1ZBTA 1BHNA 2XB2D 2VPYB 4RBUA 2GGPA 3DRPB 5MLCV 2BDPA 3KOAA 5EWGA 1VR6A 1Q5YA 2AT1B 2Z56B 4LSLB 2BJDA 3MR5A 4I7FA 2W2OP 4PR6A 4FYWB 1YTYA 4PWDB 5AE3A 3SI8A 2LU1A 2ZH4A 4USJC 3TNVA 2HNDB 5DG9A 4I6YA 4WP3A 2FYXA 2YKMB 4OJHA 4OYMA 4QQBA 4DPXA 3N9UC 4XPCA 1KNZA 4LF7F 4ED5A 5C2CA 3TA1A 4HYKA 1RT4B 2B9YA 1CQNA 1S6UA 3MURP 3ENWA 3GJTB 1MWQA 1MW7A 3Q8RB 1RCXB 2J0WA 1JLGB 1KLMB 2XMWA 1FE4A 2EXUA 4QPTA 2CPXA 4HI2A 1RP5A 3K17A 2W9BA 3UCUP 1WKJA 3ITHA 2FZKB 5HLFB 1G6BA 3IWLA 2C2EA 3DLKB 1WHXA 1JLAA 1O8BA 1SXLA 4ANEA 2NPFA 1RTHB 3TJ8A 1IJFB 2Y1LB 3BGOP 4JV1A 2RNEA 5CCMA 1P6TA 4OZ2A 1B4SA 4NLPA 1VJQA 2MB0B 4X4QA 2DO0A 3I4PA 3HMJG 2IVFB 4J9QA 3SIPB 3J7Z5 2MKIA 1FE0A 1FO1A 2BXJA 2FD2A 3CCTA 4LRAA 4XPEA 2R7XA 1F2GA 1LW0A 5KAKA 5C5JA 2VA3A 4IUFA 1YJRA 3G4SS 2VQEJ 2YKNB 4C8NA 3A8JA 4H54A 3FCWA 1JKHA 2DY9A 2W7AA 2E5IA 3DXBA 1NHUA 4S0MA 1IBKF 3G8QA 1NSAA 4L6V3 3RGIA 1G2EA 3PJ9A 2VDIA 3GJQB 1X4DA 4K7QA 3TX0A 3CDAA 2IRYA 3KTQA 2UXBJ 2PFFB 4I64A 4OZJA 1N5TA 5SZTA 4YOEA 2OFGX 5BR8F 2O5DA 4ZLNA 3I5CA 2Y8YA 2PFDA 2AQ4A 4JI7F 4ANCA 2ZVIA 3HK2A 3LGNA 2XLIA 1CJTB 4DSIA 1MU2B 4OX6A 2MQNA 4AFFA 5JXSA 3FKBA 4ZPWR 2ZD1A 5KG0A 1O6XA 1OYEA 4WKRA 2J9CA 1NPPA 1HWJA 2BJ3A 4K2XA 4IRDA 3UN3A 3FSIA 4Y2MA 5D0RA 1DTQB 4DPUA 4PWUA 3OLBA 3Q8VA 1HD1A 1F3VA 2AP6A 4PABA 4JI5J 1WSVA 4I68A 1B7FA 3ETMA 2MKJA 2FHJA 1X31C 4NE9C 2HHHJ 4NA1A 2DVIA 1SC4B 2CYYA 3LGHA 4KGVB 2UUWA 2KVQE 1H7WA 2CJXB 3AD8C 1RHQB 3TW0A 4RU2A 1SVDA 3KLGB 2RJZA 2H4WB 1T0TV 2EC2A 3DLBA 3R7BB 2XYGB 4LF4F 1R6VA 3M1VB 3HULA 2QRRA 3N0VA 3QNWB 3W8GA 3ZZUA 1V6HA 3CDEA 5EHHA 4U7CA 2VPZB 4Y6IA 1NZAA 4PXBA 4DUZF 1MN7A 3T3FA 3T1HJ 1VQPS 3B54A 2MZSA 1RTZA 2PO4A 2X3DA 4OHWA 4PWWA 5B0GA 2OPSB 1WC4A 5CYQB 3SQGA 3IXQA 3OTEA 1FFGB 1RI7A 3PW2A 4KJIA 3VZIA 3C6UB 2DY1A 5A8WB 2HHSA 2CPEA 2IAJA 5E33A 4MTPA 5KFMA 1NH7A 4X66F 2FTRA 2LQ8A 1FCAA 3IMQJ 4K5RA 5C24B 2WB4A 1ZA1B 4N56A 2C2DA 4DCPB 4DR4J 3HKWA 4P6QA 2YQ0A 2OUGA 3W9JA 2VQFJ 2P6TA 2NSBA 4XDDA 4MYUA 2I6WA 4DBQA 5EWEA 4K2JA 5HK4A 4ZIVA 3J81Y 3SV4A 1QLNA 2WVBA 3QIPB 5MAOA 1PYSB 4OMFG 2KI2A 3HM9A 2W8LA 3CXCR 2OJ3A 3CMES 4NLTA 1LFWA 2MSTA 2V8PA 2C3MA 4TN2A 3VHQA 1Q53A 4AL7A 3BDEA 1DJ0A 2IRUA 2XI2A 5KFLA 2AJQA 3M30B 1AXQA 4OV1A 3RTVA 2OPSA 4J90A 2M0GB 3GSDA 4WWSA 3BO4A 1WC0A 3PX4A 3H90A 4DV3J 1PJ7A 5EDWA 3UVJB 3CJ8A 3DRPA 2WOMA 1TKZA 4NYPA 4W4MA 5HQMA 4IG0B 3OL8A 1F9HA 3E01B 3OPKA 1F60B 4MFBA 3C14A 3FNNA 3HX9A 1HNXJ 1MMDA 4CO3A 5DLFA 4WK1A 3VZHA 3ZTOA 5KFSA 3MUTP 2AGQA 2OD6A 2JFDA 4OX8A 2XMAA 3EE3A 1A0OB 4QWEA 3U7JA 3UD4P 2DRBA 4MMOA 4ZP6A 1CJVA 2A1BA 5A6PA 2ZH2A 5KG3A 4KC5A 3P45B 2Q6CA 4DCOB 3I5BA 3I5AA 4ECYA 3GP9A 1CJUA 3BR8A 1UZDA 3MMCB 2FC8A 2FLOA 4U6PA 2QLXA 4QWDA 1HWLA 1YZ6A 1JJHA 3MMAB 1JB0C 4A47A 1WC5A 1S0OA 4LFCF 1HNWJ 1H3DA 3OTOF 4DWIA 1L3UA 2DBBA 3B78A 1OY6A 1WF2A 2CQHA 3FGVA 3D6HB 3VCDA 4YS2A 2HFVA 4DV7J 1M90T 2IPOB 3DLKA 2V9KA 4UQTA 3DU6A 4X4RA 3IAS9 4P7VA 4PG7A 3DOLA 3ZZPA 3M30A 2XSJB 1HI0P 2XWXA 1T03B 3MD1A 5J1PA 4H4OB 3U27A 2HVEA 2DT9A 4PYAA 1ICEB 5KOWA 4LF5F 2NXUA 4HEA9 5DDPC 2DNGA 2MLYA 1WWHA 3DOMB 5IV3A 5GAHI 4DDFA 4ZHRA 4TQRA 3R7SB 1HQUB 1MSWD 4GMKA 1HI8A 3DMJB 3JTOA 5E41A 3LF0A 2V34A 2HS4A 1RACB 3DYAA 1NAQA 4LRCA 2OPQA 1J2VA 4G6VB 4HT7A 1VI7A 3UNGC 5LSLA 4QW9A 2R8GA 2IY5B 5DM6Q 1TTHB 5JUMA 5KFOA 4DFPA 3HFVA 3D1QA 4RW8A 5HROB 2WONA 1SC1B 4RJVA 5CA5A 2PMZD 4DLGA 4DL5A 1X4BA 3GFHA 4M5HA 4R8UA 4ZIWA 4NLWA 4NXNF 1K44A 4DSJA 2M7SA 1YJVA 3MEGA 4P9SA 3GIJA 3GR1A 4JUZA 2KRRA 3UCGA 3LP2B 1HYSB 4TLQA 3MEKA 2W7PA 1SJ4P 1T3NA 1SJ1A 2LXUA 3EVOA 1R0AB 2PI4A 1W2IA 2AIRB 2O1PA 3SCLE 4R5PA 4F36A 2V67A 4X4TA 1VQKS 3CCSS 2RS2A 2DNLA 4OJ1A 3VVTA 3IM8A 3H98A 3Q89A 3UQSA 2UXDJ 2PA3A 4LFAJ 1QTMA 4EYIB 4DQRA 2CQ2A 2HSEB 4I56A 4O4GA 2VG5A 3J7ZT 4B9SA 4JV5J 2F65A 1RADB 4O3PA 3O3LA 2IJNA 1Q4RA 2E66A 3OL6A 3CO0P 2DCUB 2MQQA 3N5BA 5L46A 3I0SA 4PYDA 2DNOA 2DEJA 3Q0AA 4DV2J 1GMVA 3BPSP 2PSZA 3Q23A 4ILRA 3TZYA 4ED1A 2HBQB 3HHLD 5IFMA 5J2PA 2V2ZA 1SPBP 3OSPA 1Q82T 1FJCA 1VC6A 4BLGA 4C8YA 1T95A 3PHTA 2DH9A 1KR4A 2A18A 1RAIB 3PNIA 2H3EB 4ZITA 4U7UD 2HBZB 4OZ3A 4CNZA 3T5JA 1WSRA 1XMOF 4X65J 1O51A 3BKTA 4C0HA 3NS6A 3TAMA 4F4WA 3NY0A 5ETRA 4RO0A 3PO5A 5L1KA 4WFYA 5L38A 3DRSB 4YDDB 1U4BA 1M5OC 2NR0A 2XNRA 5I3PA 4L75A 1RB0A 2B9EA 2OTLS 4B3MJ 2XLKA 2XY7A 4L73A 1TUVA 3I96A 4RUHA 1VQ7S 5BJRA 2HHVA 3KYLA 1WKLA 4HHUA 5KFGA 3V4IB 3M9NB 1V3SA 5T7LB 3TZZA 3LPYA 2AHOB 4G65A 4RW9B 4G1QA 2V0NA 2ZNYA 4I6AA 1K8AT 4B3RF 2XCAA 2KZZA 5GMEA 2QA1A 2IIHA 3N01A 4FVMA 4X62J 5EUHA 3DGVA 4J9SA 3KKFA 3W1YC 1BMQB 2UUAJ 2Y0BB 1GQEA 3LQVA 1M1KT 4F2RA 3OLAA 4GKKF 5J2PB 3CT9A 1RHRB 4WXOA 2JEFA 1HW9A 1AYEA 1UTAA 1VBKA 1VLOA 3Q83A 3QFWA 2FDNA 4LF9J 2HRTA 2LQ9A 4QR1A 4DR6J 2R7TA 2NXEA 3BF4A 1FX4A 1U6FA 2WOMB 4ALZA 5I42A 3UN5A 3DI6A 4OYXA 3KK2A 1ZZNA 4MIBA 2YWEA 1KHVA 2G0CA 2VU5A 1SUQB 1UFKA 1QJHA 5DS7A 3R1HA 3R1LA 1RTIA 2AJ4A 2OEKA 1DHMA 1JLFA 1NDCA 1PCAA 1RWUA 1VRTB 2A0FB 3THPA 3W63A 4C3LA 5IC6B 4A8MP 2EC0A 3NL0A 3R97A 2VOPA 4MFBB 3AJDA 2FPHX 3JQJA 3BM7A 4U8VA 3T9NA 3KHHA 4USHA 4CLZA 3K8WA 2BM1A 4DHVA 1KVIA 1IWAA 3NGTA 1GMWA 3M8PA 3MPDA 5K8PA 4NCGA 2KT3A 3AOBA 2JX2A 4UZCA 3PM9A 3FBEA 2YXLA 3H59A 3QO9A 3DC2A 1S4FA 4U9RA 3BN4A 3EXCX 3IGNA 3QSYB 2ZZTA 4KV8A 1UJ6A 3HFZB 3ZO7A 3PYGA 2ZUAA 1JNZB 1CS4B 5AJ3F 3CC7S 4NZ6A 3CCES 3QGPA 3NWGA 3FFIB 4CRJA 3GB0A 4MH8A 3KLGA 1XK8A 2J7UA 4C3KA 3KLHA 1RTJB 3Q8YA 2UVVA 3M1VA 3EGVA 2XS2A 1XEZA 1N6QA 3N6LA 3G96A 3NNCA 5GMKa 3E8OA 2M5YA 2JEJA 3PRDA 3CCJS 4I7FB 1F5CA 4KFBB 2XHWA 1ZOTA 1T3OA 4M5GA 2RUSA 4HKQA 4DUTA 4FP9A 1FDBA 2D9OA 2YH0A 5B0CA 2HLTA 2LA4A 4EZ6A 1UVJA 3NGRA 1WUUA 2KVIA 1S6PA 3D68A 1GXUA 4UUXA 3LGMA 4WIQA 4AXJA 5LXYA 2XEXA 3JSMB 2XZDB 1IBCB 2EFNA 2H9ZA 3NS7B 4OFZA 2QO3A 3QJLA 4FNIA 1Q8LA 3I4HX 2HVHA 5IOLA 2ROPA 1U1KA 4IYQA 1TKTA 1YRUA 4LUBA 2L9WA 4OLPA 3QZ7A 1TP7A 3LAKA 3I0RA 2AEFA 1U49A 4LF5J 4NXMJ 2QA2A 3CB4A 3LALA 4DPOA 4C9DA 3IR5B 4F0MA 3FMWA 1JXEA 3KJQB 5KFWA 4DV4J 4LSZB 2LQJA 4CIOA 3H0PA 3ILLA 4YB5A 4CLKA 1KFDA 2XZWA 3M2VB 5ADZA 5KG7A 3QJJA 1U2CA 1T9TA 3SDEB 1FESA 1AW0A 1TL1A 5G0RA 3PIPQ 2FLLA 2QJ3A 2VA2A 3AD7C 2CG8A 2RQKA 5A2QU 4ZVHA 2ZH1A 1U1OA 1N6QB 4AYBD 5IT9U 4WE1A 2QTWA 4IQXA 2ZDPA 3IWXA 3RUBL 4QPXA 1RTHA 1V9OA 2KHDA 3KG1A 4LQ3A 1Q0NA 3MI7X 2APOA 3JS9A 3IRWP 3CJTA 4CH7A 4U96A 3TR5A 1R6YA 3KFWX 1S10A 3GIRA 4WCEQ 4QWCA 1REVA 3OJUA 3QRRA 3W3SA 4AL6A 3J80U 5GADU 2ZVSA 2J7WA 2ADBA 1Q7YT 4GRSA 4HR2A 4JI8J 2LEAA 5KFQA 2FHOB 3KK3A 4DSLA 1N32F 3SSRA 1NJXA 2KB2A 3CIMA 3GV5B 4F3MA 5M2PA 3RBZA 1ZAWA 3DOLB 2AJFE 3OFEA 5CYJA 1T8EA 1N34J 2GVDA 2VG7A 4UF4A 4DV6F 4OZ0A 1RWXB 4ETXA 4LBHA 2SXLA 3K5LA 1FWLA 4Y28C 4NI2A 2ZKUA 1KS2A 3V5RA 2JVOA 5KT4A 2J6UA 4JI3F 1YSJA 2XNQA 2L48A 4I2PA 4LSNB 4R0EA 1UPMB 4EBDA 2AX0A 3LH2S 1N54B 1M5HA 4LR7A 2FHJD 4CLFA 3FBBA 1KLNA 5D15A 4EO6A 3E2EA 1N4LA 3CCRS 3TAMB 1REVB 2C2MB 3M32B 3RRHA 3GYXB 4J9KA 4E0DA 4R25A 2JOQA 1PC5A 2WAQD 1FKPA 1HWUA 1O0PA 1RAOA 2F7VA 2DIVA 2OP5A 2QMXA 4I1TA 3QAUA 5F8HA 4DLEA 4WFNQ 3DDIA 1IKXB 1RT5B 2HFZA 1S48A 1MG7A 1SBRA 2AEJA 4ID5A 4RWXA 4P2SA 4FNHA 4O3QA 3UCZP 1QSSA 4JI4F 2UXBF 2CVIA 1VRUA 3RJMB 3NG8A 1Q8KA 3FZBA 5ITHA 2W25A 3CD7A 2N7YA 1JLEB 1N0UA 3ZTQA 2BJ1A 3PJXA 3VQTA 3TVKA 5BR8J 4RNMA 1X0FA 1CBKA 1U1MA 1KHWA 4OIXA 4JYAF 3H7HB 3KWMA 5F8GA 1Q8IA 2OPPB 1YBAA 2BRKA 3NEKA 2ZH9A 2DTJA 1GK8A 1WC6A 3A13A 3UD5A 3PFOA 2LKZA 4B3MF 1Y5IB 2RSQA 2KFNA 3P3DA 3C19A 4BCAA 2FLPA 2JLEA 4QU7A 3T1YF 3OL9A 5F9LA 3K57A 3N6MA 4ETZA 1RXOB 4NLUA 4F67A 1PBUA 2POKA 3DU5A 3MM8A 1UETA 3GQCA 1NHKL 2X7IA 2E7VA 1U0HB 3VGUA 1S59A 2OLWA 1X5OA 3G6XA 4ZCMA 4YB7A 2PEHA 1S6QA 3CDWA 2RRAA 3IC1A 1T7PA 1HWIA 2KDOA 5LMUF 5HVGA 3CSKA 3KJFB 5IC4B 5LXRA 3W2WA 2KU7A 3WIUA 3QRQA 1S9EA 2WVCA 3QIPA 4EBCA 4NLSA 1RT1B 2O01C 4OJ3A 1NKCA 4DQSA 2IFXA 1EETB 4Q7AA 3CCLS 2V4QA 2BKPA 2XCPA 3EZ5A 5JVHQ 2NSCA 4BWJA 4GVBA 1SJFA 4IDKB 3G71S 5CZVA 5E3QA 3T1AA 4WJBA 1NJZA 1VRQC 2BEFA 3DCAA 2OAUA 5L9XA 1HARA 5ETMA 1U45A 2XTJP 3AB4B 4YY3J 2QT7A 2P9CA 3R6LB 1RWWB 4K4XA 1IN0A 1HD0A 4B9LA 2QA4S 4UY8T 1FVQA 3ADAC 4FKXA 5T7LA 5KFRA 1YLXA 3MR6A 2MQMA 2YWWA 1UW4A 1YGYA 1BWVA 4Y0FA 4YR2A 4DR2J 2C3PA 3AFGA 4UOFA 3HHNB 1V5VA 2AD9A 1KQSR 1BGXT 3C15A 3P5TL 4IH5A 4NRTA 4YMEA 2FHMA 1HQEB 3CJ0A 3SQOP 3UVJA 5GAGU 4PPZA 5CCLA 1R8HA 2VV5A 1BD6A 4TNOA 5F8JA 2G13A 1GMWD 4LF6F 3MAHA 5FLXY 4RKUC 2YNGA 4TYBA 3MM5A 2FVQA 1X4CA 3A8EA 2G0JA 1RAJA 1PC4A 2C3YA 5D78A 2NYIA 4HDHA 1HPZB 2CPJA 3EZUA 1RU1A 4X64F 1XMQF 4KGXB 5J2NA 4M5JA 1WI8A 2CJ9A 4DI6A 2CQDA 4E98A 3PR5B 2HHXA 3A3PB 1FA0A 2BJ9A 2FUG9 4WYWA 2ZJPQ 1UMJA 3F0NA 3H5YA 2BRLA 4DV3F 1AFJA 4RX6A 3CJ4A 2CKWA 2ZFHA 5A0YA 1S99A 1X7VA 2JNJA 3LP0B 5HO4A 5DM7Q 2FJAB 3ILJA 6FDRA 3DOKB 1OJ4A 5DG8A 1TL1B 5G0RB 2RVJA 3NOCA 1JLFB 2CJKA 1R7IA 3MD3A 5KG1A 2C2KB 1VIXA 2F40A 2W2QP 4ZHRB 5AXNA 2EBEA 2X51A 4F25A 1U25A 5F3ZA 4CWBA 2XS7A 4B9TA 1S9GA 1CQMA 1RYRA 4H4OA 3H4BA 4K4TA 3UW1A 2HNDA 1DY3A 1GNKA 1J5EF 3K5MA 5DDQC 7FDRA 1QDUB 2UUBF 5IWAF 3IFEA 2RQMA 5KFTA 2K2PA 3AA8A 1WI6A 1NDKA 4NXMF 2FHKA 4CO2A 3CCZA 4H4KA 4DV4F 2F5GA 3NRBA 4ZPDA 4YHHJ 2CZVC 4ZA1A 1YJNS 1XC9A 4OX9F 5KG6A 2YBVA 3ULHA 4WFZA 4OHYA 2WHOA 2GS8A 3VQSA 3GFZA 3SSSA 3BYRA 1C1BB 1RLDA 1ZM2A 3M2UB 2BQRA 4DR5J 3DLHA 1U1QA 1J5OA 1BLUA 4C3MA 1FXDA 3CC4S 4KAIA 3TYTA 1FFWB 1FRXA 2W01A 3NCQA 3DNCA 4J9UE 4NYZA 4WPAA 2ALZA 2R7QA 4QJVA 1AROP 3CCVS 1EAYC 3W2VA 4TKTA 1P1LA 4NA2A 2VFUA 2BR0A 1SKRA 2DR8A 1G1XA 1FKOA 4F02A 2Z4PA 5IZHA 5E3PA 3M7VA 4O3SA 2QGFB 1FT8A 1NPRA 5HBMB 4LRBA 4V19J 3HZEA 1T02A 3OXGA 4KKOB 3VGSA 2HHQA 3MZIA 1ZM9A 1SC6A 2AJ2A 2HFUA 2M70A 3P96A 4B02A 2EW9A 1Q16B 4LREA 3TEHB 4DL4A 2PC6A 2O3DA 3G82B 3DLGA 2B9XA 1FD8A 3QPIA 4Y2IA 4H4MA 2ZOGA 2HHTA 2FJBB 2IC3A 3FQLA 3X3UA 3J80Y 1RHUB 2GJIA 3AD9C 4W98A 3K58A 4DF8A 3RR8A 3R2DJ 4TU9A 3SXLA 2MZJA 1JKHB 2ZDOA 4ANDA 5KFPA 1GXLA 1OYDA 1BQMA 4C98A 2H5JB 1D09B 4U7UK 2J8AA 4A8SA 3CUNA 2RS8A 1XBWA 3NP5A 1FEEA 1TV6A 5EX3A 1Y11A 5IXUA 4YN3B 2W9AA 4CLLA 4ZVQB 3E3XA 3LUYA 3H5XA 1FI4A 2NLWA 1W7WA 4IH7A 3M6VA 4LVNP 4HACB 1X8DA 3MM7B 1UW9A 1U2FA 1VCTA 1YKWA 5E0OA 8AT1B 3KLEB 1T9VA 3T5KA 1TK8A 2I0XA 4DV2F 4JI1F 4JP8A 1Q5VA 4FF3A 1N5SA 2QYGA 3MEEB 1NO8A 1RISA 2MKSA 4DR4F 1S79A 2O66A 5D8HB 4EZ9A 3IWNC 1EB0A 3AAWB 3FRZA 1OSCA 3BGRB 4M5DB 1APSA 1TL7B 4ZP8A 1S12A 5IQQA 1I3OB 2E1RA 2IVMA 2OPQB 2R2RA 3VAJA 1UZHA 4BDPA 4G1QB 4LSNA 2GO9A 1RT4A 1P1TA 3HCXA 2G2OA 2IC3B 4FN5A 5ETTA 2PMHA 3FUYA 2CNOB 4G1IA 5D0HA 1HLWA 1YRXA 5AE1A 3PKYA 3MOZA 4ELTA 4BC7A 1FRLA 1VS3A 2HIQA 2HURA 2ILYA 1C4AA 2YVSA 1FKPB 2E5HA 1PSDA 1EZZB 2YPZA 4I6WA 2GA7A 5THWA 1SB6A 2ZBQA 3I31A 1UKUA 3FBFA 3RW6A 4PXDA 2HIYA 3QLHA 3EICA 1S72S 4DV0F 4JI5F 4QYZJ 2RF2B 4ZCKA 4A4JA 2HRYA 3M2RA 2DRDA 1LNQA 2WVEA 1NK7A 4ZN3A 2XC9A 4O23A 3MEEA 4PPDA 3BQ1A 5CAAA 1GFWB 1LW2B 2PGCA 1YI2S 1DAXA 2JC1A 2QEXS 1DZ5A 2QLBB 3ZNJ1 4JI2J 1FTCA 4DSEA 2CWXA 1VQMS 1JLEA 1WC3A 2HGMA 4WK3A 4Q5VA 3T1HF 5I3UA 3BR9A 3M8QA 2I2YA 2C22A 3M8PB 2FQQB 2Z2YB 4B3SF 4OQJA 4B3TJ 4WU3A 3QO9B 1NK5A 4EEYA 2M4MA 2ASYA 3U1LA 1UAWA 2EFVA 5L9NA 1R8CA 2XGPA 2VIHA 1D1UA 2AMCB 5KFNA 3NXZA 2B56A 2OMLA 4KB7A 3AY0A 2KN4A 2JL9A 2ROEA 3D0GE 4YUDA 1TMJA 5ETPA 1S5ZA 4IG3A 4MK7A 4WBFA 3ZZ0A 1FJEB 2VONA 1VIOA 2KO1A 3JAMY 4ED2A 4KHPJ 3TZWA 4DUYF 4QIVA 4N5SA 3Q2TC 3KDNA 2ZJQQ 2HFSA 2I5JA 1M5PC 3M6WA 2XULA 1IBLJ 1F9EB 1M1GA 4L72B 2DNYA 2HFOA 2DD8S 2YX7A 1FF2A 2EK1A 4RW7A 4M5NA 4F4ZA 1N5VA 2ZC3A 1C0UB 1S7HA 2OSQA 1IR2A 3FJ2A 1SJRA 3FK4A 1KFSA 5CH7B 3SBMA 4IO1A 4LRFA 4DEZA 1NB2A 1Q1KA 4F04B 2MPUA 4LVOP 1SC3B 3OQ2A 3FC9A 4L74A 3M2VA 3M8QB 3QIDA 1K1QA 4XAKA 2X1FA 2HQIA 2MKKA 2GHPA 4DPTA 5F8LA 2MMYA 2AYEA 2XY5A 3C16B 2I1RA 3OD2A 4CNYA 3NCRA 1X0PA 4JI1J 2V2QA 3I0RB 3IG1A 3DKDA 4AXIA 4ZJQA 1Q81T 3AQOA 2VJUA 1WACA 1A7GE 2CJAA 3RAQA 4LFAF 2LA6A 2AJ1A 2ZM6F 4I4BA 2UUBJ 3UFCX 4OI1A 2BABA 2UXDF 1CULB 3R5BA 3PW4A 4N77A 4QZVB 3C15B 5DETA 1RTIB 1X4FA 2G1HA 4D3GA 2ZITA 3H20A 3PO4A 1YJTA 1GH8A 4MKAA 4IR1A 2OELA 3LANA 3T5LA 1RAFB 5EX0A 5C2GA 1IBKJ 1CLFA 2I5JB 2IJRA 1GTEA 1TL4A 3GE9A 3K2YA 4Q45A 2LFVA 2U1AA 3PW5A 2XMJA 4EBEA 3WC0A 3C6TA 3CD0A 4DR5F 3K5OA 3DYAB 3AQPA 2YNHB 4O44B 1I1GA 1RQ0A 1BE4A 3W66A 4F3QA 3I9V9 4QBUA 3TWZA 1WORA 3T5HA 2E1AA 3E51A 4URQU 4CLPA 3POTB 4C2MA 8ATCB 3R5GA 2VG7B 5JVGQ 1NH8A 2VD3A 4NLRA 4ZJOA 1EHWA 4PUOA 2AW0A 1TFWA 2CQ1A 2L9DA 2U2FA 2V4JA 3MPVA 5AT1B 2GHWA 3PYEA 5KFJA 2V9WA 3U1MA 2HAIA 2GHVC 2IDEA 3KMSA 2KM8B 2R2TA 4M1KA 3KLIB 4BBYA 2EI5A 2LQBA 4R5PB 3UDCA 4KFBA 3PVXA 5LSRA 3EDQB 4O0NA 3MM9A 1YVFA 4RLEA 5KFKA 4HT5A 1FKAF 3MPWA 2V8GA 4XTTA 4MK8A 4CLWA 5F0UA 4ZPVR 4CDIA 2HVIA 2XY6A 3FSYA 3PDNA 1Q7LB 3I55S 4XO0A 2JDJA 4RUCA 3MMCA 3KK1B 1CG2A 3EWGA 4C48A 4PRFA 2YKNA 3A8IA 1U1NA 1X5TA 1XJWB 3WQPA 2BOPA 3A3NB 1YHQS 4UOHA 4OI3A 5BYRA 1UWBB 3Q8SB 2QA4G 4F2SA 3P6YC 2GVZA 4DL6A 3HZGA 2AU0A 3PV8A 2DHGA 2YKAA 4NX9A 4CH0S 1QE1A 3ELHA 5GAGI 3MPUB 4HHHA 4DQQA 3POTA 4ED8A 1H6KX 2HQFA 1WDTA 5HQLA 3MM9B 4O4RA 3AJ2A 5BYQA 1E6VA 4F0HA 1RYSA 3D6FB 2RQCA 2H1YA 4UY85 5KG4A 1LFPA 4CM2A 2MQ8A 1SCJB 1XR7A 2K3IA 3IP0A 3NGSA 2OD4A 1N5QA 1EKRA 3CWJA 4LSLA 4OYWA 1S9EB 4TVAB 1ULRA 1Y4ZB 1RDRA 4NMXA 4X84A 4PG6A 5C7PA 3WZ0A 3KHLA 3D54A 1S1WB 3OT9A 2JSXA 1R31A 3VWSA 3ZZRA 1S6QB 1UEUA 4KBIA 4Y2AA 2PIIA 5K5MA 2VF3A 2WTFA 3KMQA 3IR6B 1PKUA 5B0FA 1UVMA 2CPIA 2MQLA 3EX7B 2FJXA 1H72C 2JFKA 1S1UA 4FYYB 4WKYA 3IN5A 1D9DA 2WB1D 5EN1A 3NAIA 2XG8A 3LA0A 4YFUA 1VQ6S 5J2MB 2W1BA 3W5ZA 4AT1B 1D8ZA 4DV1J 1XNRF 1MROA 4QCLA 5KFVA 2CDQA 4NCBA 1B0PA 4UQGA 5HAOA 2P6SA 4CLUA 1P9QC 4USUA 2GMJA 5D4NA 1SH3A 2G2ZA 3MR7A 2DGWA 1IUJA 4GVLA 1IKVA 2DGSA 1FRIA 4QYRA 4Y34A 3KHRA 1D9FA 2RE1A 3FDSA 2A2CA 3HVAA 5CYMB 5HSPA 3MCSA 3W62A 3H8YA 4KGMA 5CZXA 4OYBA 1P9YA 3PIOQ 2UV8A 1RAAB 2Z57B 4U8YA 2HVDA 1EP4B 1YIJS 1YK9A 2HW3A 1NU4A 4RW4B 4DN9A 1N56A 1BWEA 1RT3A 2KT5A 2IM2A 2VKZG 2IAJB 1RE1B 3Q22A 1TELA 3KJNB 4PCQA 3G9CA 1XR5A 1VBXA 1HR0J 2BKOA 4ECVA 3RZAA 1FWKA 4HVZA 3WX4A 4CQ1A 4ES3A 4QR2A 3GG1A 5IM0B 4GO5X 3OVAA 2XWYA 1H2TZ 2Z2MA 5T14A 2D74B 2R8JA 4J91A 4W90B 1RTJA 4ZPTR 1Y3KA 3ENQA 1Q78A 3PEJA 1V5IB 2KT2A 2RIJA 3OFFA 4CO0A 1FDAA 2BW2A 2RRBA 3G8SA 2N3LA 2VICA 1N8RT 1YBUA 3AH6A 5B0EA 1FNXH 1X4GA 1CS4A 1WKKA 2ZH8A 2BE2B 1R89A 2GIRA 3HLUA 2CNNB 5HL7Q 4Z7CA 4GKJJ 3FFIA 3RBXA 3C8YA 4DU7A 1IQZA 1U0HA 1RWMB 7FD1A 3PYDA 1DTTB 1CJKA 2YKPA 4ZJLA 1HNIA 1YDLA 2P2CB 3DFEA 2HG4A 4DR7F 2JLGA 3LAMA 2HZCA 2IVYA 2A2DA 3GJRB 2J0SD 2ACMA 4LF7J 3OBIA 5KFXA 1RHMB 1C2PA 1TVRB 5F3TA 5B08A 2MZ1A 5DRKA 1RT1A 4AD6A 3NBPB 1FFSB 1R8BA 4JBCA 5DO2A 5CABA 2OEMA 3V6DB 2QSWA 4K4VA 3UE2A 4D3HA 2J9EA 5LT5A 4P2XA 1U26A 3NS5A 4OI2A 5KT7A 5HATA 4ED0A 3RYLA 2DIUA 1OQ3A 3QT8A 1KONA 3FSXA 3M05A 2CJYB 4KPCA 3BS9A 3US5A 4G1PA 3MHYA 2BVZA 2JC0A 2NUHA 3F56A 3PTWA 3W2VB 2YPYA 1VC5A 4WP8A 1RU2A 3R5DA 2VODA 4YB6A 4C7QA 2W7OA 4YB1P 1W2BR 4C8LA 5M2RA 1GT8A 1UEVA 2DHAA 2GQCA 2GW8A 2VB6A 3D7SB 4USVA 4EYHB 5IS2A 2VHGA 2DPIA 1TZ0A 4P10A 3CD6S 1HBUB 2GQQA 4KKOA 3B6BA 4RW7B 1S4EA 4ZLJA 2J6TA 4DL0C 3C6UA 5DLGA 3HO1A 3UO0A 2PEBA 1DTTA 3DDNA 1KOOA 2QL9B 3DLJA 3DOMA 4ZN1A 4M95A 3NWRA 1FKOB 4ERDA 3QWPA 1LOUA 2VKRA 4ZVTB 1JLCB 3VVUA 2HQCA 2HMIB 2IRXA 5LM7E 3M9MB 4FYDA 2HWTA 1Q86T 3QATA 4M5KA 2X1BA 3GZ7A 3SCKE 3A12A 2MGZA 3DLLQ 2GZOA 2P9EA 3BH6B 3RBEA 2H51B 2R7OA 4WP9A 2HWHA 4E8UA 3I56S 2V68A 1N33J 3ZTSA 1HNZF 2GX8A 2RDIA 2MZTA 1LK7A 2OKQA 1BXNA 2OEJA 2VC1A 2KRBA 5HMWA 1M5SA 3T6BA 3PKMA 2PE8A 2CFXA 1BQMB 1BUXA 3G8TA 2DR9A 2HRUA 2Q3PA 2WW8A 3GPAA 2BW7A 4KO0B 3R6GB 1UPPA 4JI8F 2ZHOA 1R0AA 4IOAQ 3OHBA 2H4YB 4DV5F 4HI1A 2OFHX 4NLQA 4AQYF 1SIZA 2R2UA 5F8IA 1QAIA 1NHVA 3CJKB 3UR0A 4DV6J 3MM7A 4FS2A 2GJ2A 4PWDA 3K59A 1SQFA 1T05A 2VPXB 2AYGA 3WC2A 1IQTA 2QLJB 3PXGa 1S6PB 1X5SA 2W8KA 4CI0B 5EWFA 2N7CA 4K0KJ 1XTZA 4CYUB 4U95A 3EGZA 3NOGA 1BQNA 1WHYA 4Q44A 4PUOB 1HBOA 2MHEA 3CJQA 1U1RA 3IBWA 2MY7A 4V1Ak 3UDEA 5GADI 2FVRA 2H5IB 1VRUB 2AZ1A 2DNQA 3HFKA 2CQBA 2WW4A 3PFEA 5A6WA 3BQ0A 5JJBA 2FLNA 5KG5A 4EWTA 3L7UA 3MMBA 4DUZJ 5LL6d 1I94F 1DQ9A 4BWMA 4B08A 3EYZA 2E5LJ 2CQ4A 4DSKA 1MMLA 4KE5A 3DM2B 4P74A 2ZH7A 1U1PA 3PZPA 3PW0A 3AOCA 1YRTA 4NLXA 1OSDA 3DHXA 4YEAA 5EGYA 3ZNUA 1VC0A 3VAHA 1QAJA 1AUDA 2F9DA 4Q0BB 4WF9Q 1Z4UA 2R7UA 2GO8A 1VQ5S 1NSKL 1R0CB 2GAHC 3K0JA 4CZCA 1OMSA 1LW2A 2MZRA 5K8MA 2ATLA 3SEOA 2G4BA 3P8BB 2C28A 2WVFA 2YY3A 5M2UA 1MMNA 1TK5A 3FBCA 4JOUA 1FNOA 3SCJE 4UOGA 2H5EA 2VFVA 5A8RB 3PR4A 1TK0A 3DLGB 1XQIA 4P52A 3HF5A 4ED3A 1LWFA 2KXHA 4HHJA 3KG0A 2OH2A 3MR2A 2NS1B 3D6MB 4GC6A 4O3RA 1VOMA 1WG1A 4CT9A 2DR5A 3K8VA 4R8UB 5HMZA 2I9SA 2KM8C 2KG1A 4LFBF 3GIIA 4WTYA 2FB0A 4HH0A 1CVJA 2BMBA 1VQ9S 1RT2B 4LJMA 1S0MA 1RKJA 2RD5C 2RU3A 2JEGA 1VQLS 4ZS6A 3H2LA 4QIGA 4UW2A 3HD1A 6FD1A 3NMRA 4IG3B 1WC1A 1TKXB 2B4VA 3BBCA 4DJBA 2Q66A 2EFQA 1S1WA 3N79A 4P7TA 3UDLA 2F4VJ 1N5YB 3HSZA 2HNYB 1U1LA 4ZVPB 3OVBA 1AFIA 4ZP9A 5IV4A 4JI6J 4P71A 3ONQA 3D28A 3MGJA 3MM5B 1KD1T 4K5SA 3AXMA 4ICLA 2XMVA 4KGKA 1RTDA 4B9VA 1PAUB 2OO4A 5A8WA 1NDLA 1KOHA 3SMZA 5K8NA 3RRGA 5J2MA 4IRCA 1TL7A 2BACA 4I0WA 2V8DA 2VFTA 2VL1A 2R7SA 2RU9A 5A8RA 2R8HA 4OI4A 1H74A 4HLBA 1IR0A 4IFVA 2B5JB 3ZZZA 1KQGB 3LP0A 1LWFB 3DXSX 2AX1A 3TA2A 3MOJB 1KBRA 2HYIB 1FRKA 1HPZA 2V8VA 4UUWA 2OPPA 4AL5A 2NPIA 3GSIA 4GKJF 1HHQA 5CYMA 3UWTA 4YR0A 4W92B 2BOAA 1R43A 3B4MA 3MCMA 4X4SA 2IJFA 2CNLB 4GO7X 2HNZB 2FGCA 2HEKA 2D3O1 3J7AN 1GX6A 2K7KA 3M8ZA 2UV8G 4AE5A 3BO2A 2HFNA 4IG0A 2QN6B 4RNNA 1M5VC 3O6QA 1ZM3A 2HWIA 3L9ZA 2VH7A 2ZJRQ 4U67Q 4P73A 3M9OB 3FRYA 3J7A1 1ZS6A 2QFIA 2DNZA 3W2WB 1IM4A 3IA0A 4ICLB 2IMWP 1X60A 1LWXA 4X2BA 4J7CA 4FVCA 4LRDA 5KT5A 1NPKA 3QGGA 3TOQA 4MKVA 4X66J 3V6HA 4IQMA 4NXNJ 1S77D 3W8PA 2EK6A 1AUSL 1HBNB 4KYZA 3NNHA 3ET6B 1KC8T 2DR7A 3UNYA 1MNEA 5E5NA 2VQFF 2LEPA 4ELUA 4OZNA 3RAXA 1M0SA 3KUGA 1ZZFA 3D1OA 3R3TA 2ZM6J 3KXDA 4ZK7M 1T03A 1LXJA 1EIYB 1L3KA 3BDPA 1BC6A 2J9DE 1D0EA 1C1BA 1SIWB 2DKOB 3GJSB 2E29A 1U8WA 1OQ6A 3KNGA 3OXLA 4ZVOB 1WHVA 3MTJA 1HWKA 5H9EK 3CDUA 2HNZA 9ATCB 2VZ9A 2VQEF 3V6KA 1LQ9A 3JQKA 2VC0A 3SSQA 1DRZA 3CTRA 4RUAA 2YWHA 4C0OC 4DS4A 2XSFA 1T05B 1Y10A 3O8WA 2VBYA 2E5GA 2B3TB 2QZ8A 2DISA 1N33F 2H65B 3KUHA 2WONB 3KNAA 1K0VA 1FWPA 2BANA 1C0TB 2MJUA 3CMQA 5B0DA 2W4DA 4TY9A 1NSPA 2CQ0A 3PHEA 4Y3CA 1XERA 3ET6A 4RW8B 1NXIA 5HROA 4DX8H 2Y8WA 1GX5A 1REGX 3CCUS 1HBUA 5E3CA 1QSYA 4A8QA 5C25B 2F1FA 5F8NA 4ID8A 3L7PA 3GIMA 4NI2B 3N28A 4XDCA 4K4UA 3S6EA 2R8IA 3JSBA 4H4KC 5I3QA 4ZLPA 2P5VA 3PY8A 2HMIA 3OW2R 1YJ9S 3PX0A 4NCAA 1IBMJ 3NNAA 4IO9Q 2AGPA 1T9WA 2UXCJ 3EPIA 1BY9A 4G3IA 2DYAA 1OY9A 3QQCD 4ZVGA 2VG5B 4DCJB 3FCVA 4FS1A 3UI3A 1VLYA 3QFHA 1RLCL 2FY8A 1VHIA 4HH1A 4DR1F 3UPFA 2RMLA 1F9FA 4C8ZA 2ZC4A 5F41A 3MM6B 4EK2A 1S1VA 2PN6A 4B3TF 3HHLA 2E5LF 5HN0A 3Q8QB 2YTCA 1NRKA 1NK0A 1DQ8A 4B3OA 1VK8A 5KFYA 3HVTB 2HQ3A 2UU9J 1RK8A 1JMTA 1J5OB 2R8KA 1UA0A 2D41A 2Z8QA 4ED6A 3FZ2A 1R8PA 1KKHA 2KZMA 2V4JB 3OR1B 1UJ4A 2ZHAA 2M2BA 1JLBB 1TUGB 4DL7A 1KTQA 4P72A 1LEOA 1PAEX 3MF5A 2UUCJ 2B51A 3DRYA 4A8XA 1AZSA 1S1VB 1L3SA 2JJ4D 1RWKB 1SJQA 2ZD1B 2OPRA 4LIWA 5RUBA 4X4OA 2EFOA 1ROFA 4F50A 2DPJA 4F8RA 1QSLA 4DV1F 2Y0SD 3AA9A 2MTLA 4JV0A 1RT3B 1S1TB 2HKEA 4NASA 1ZETA 1VJWA 3H2VE 2FZCB 2GAGC 1PJ6A 3BPDA 4ATNA 4K4YA 4ELVA 4I69A 2CIMA 5LMNJ 4C8MA 4ZPAA 2RRNA 4NOHA 2LP4A 4GVBB 4URGA 1TR0A 3OTCA 5DZ6A 5K14A 1KSPA 3FEZA 3MMBB 5FIIA 1N48A 2EWHA 1K1SA 3IM9A 4UZBA 5DGBA 3G6YA 5LMUJ 4F26A 4CTAA 1B0VA 1GMUA 4CLTA 4X65F 3TJ9A 4DL3A 4OYZA 2DHHA 2HS0A 3SQGB 5K20B 1IKYA 2QE5A 3BGFA 1JLQA 4OYPA 4KH1B 3VF0B 3THTA 2Y1IA 2M88A 1I5OB 2G9OA 5IWAJ 3O5TB 5F0WA 4Q2LA 2V2VA 5D0EA 2YNIA 4QIWD 2HZVA 1AZSB 3HHKA 1NJYA 1YITS 4LF8J 4USWA 2K7JA 1WG4A 3K89A 1EQMA 2NUUG 2BJ8A 2RQ4A 3QSIA 5K14B 5J1EA 2VG6B 2J8SA 1RAGB 2HPUA 1L5UA 1CC7A 2DH8A 2QLFB 1NSQA 4ZVRB 4DFKA 2N4DA 1UL3A 2OGUA 5ETKA 4K8RA 2LMIA 3TI0A 1IVZA 1XR6A 2YX1A 2W2MP 3DHWC 1AA1B 4ZVSB 2CPYA 4WXWA 5LJ3Y 4DR7J 2DJWA 1CULA 1N52B 2V8HA 3DOKA 1LWCA 1FVSA 1R27B 5DZ7A 4UTGA 3W5YA 5IT4A 5KT2A 4N41A 1RWPB 5HMXA 1NK8A 3SFGA 5KFDA 3KDOA 4B17A 4JI0J 2RF2A 2B7CB 4ENOA 2VPWB 2NREA 1M1HA 1RABB 4RBTA 1LW0B 1WEXA 2GMLA 3R2CJ 4J5OA 4ZCLA 2DNPA 1HHSA 1NNDA 5GMDA 1QAYA 4BC9A 2KL8A 3MPYA 1ZPVA 4C97A 3KHGA 5BYSA 2EPIA 4KY3A 2AZ3A 1VYAA 4RL1A 5K8OA 1OPIA 3CE8A 3MMAA 3L95X 3P4UB 2B9WA 1C1CA 3H40A 4LR8A 2MHNA 1EKSA 4A46A 5J2QA 2WCXA 4M5IA 2ROGA 4ZP7A 2A6OA 5DJBA 3SDEA 3BBBA 2ZZMA 2CAJA 3M6UA 1NMEB 1S6OA 1RZMA 2BE2A 4F3OA 4K4SA 3H5SA 3QGIA 3MUMP 4ECRA 1CC8A 5ETQA 4PG8A 2XGQA 4DR3J 4FF2A 2H54B 4HTJA 3ZZTA 3F73A 4V19X 3ILOA 1RHKB 3DMJA 3PG9A 1Q79A 1HQEA 5H1SV 2OIHA 3R5AA 4YHHF 3G2XA 1RWVB 2MKCA 1FXRA 1FK9A 4Z7YA 3LOUA 5HVHA 3KLIA 3NGUA 1X9SA 2YWGA 3I6PA 1OS5A 1WOOA 3V4MA 5HQ8A 3MUVP 4IOCQ 4JYAJ 2GVZB 3VAMA 2GVDB 1XMOJ 1WF1A 1UWAA 3VR1A 2F8HA 1G3OA 4FXWA 5KFFA 2G0IA 1YWXA 2BM0A 4Y2KA 3HVTA 2IYIA 1DLOB 2RKIB 4ES1A 4OI0A 3JQMA 4I2PB 3OVSA 1X5PA 3LP2A 3PJWA 3TRGA 2RHQB 2A3JA 2E7WA 1LKZA 2DGVA 2FGOA 1E6VB 2CG4A 3ENAA 3D66A 3LPEA 4YR3A 2L41A 3GCWP 1PG5B 1U48A 1TKDA 4RNHA 1QE1B 2M9KA 2A10A 1KEKA 1S49A 2KYXA 2KYZA 1F5AA 3IG1B 4DX6A 4XIUA 1WEZA 4CLYA 2M8HA 4DS5A 2DB1A 3OJSA 1HBMB 4NZ0A 5E3AA 3HT3A 2CXEA 5ETNA 1ZPWX 2ALYB 4RNFA 2QMUB 1ZYQA 4B3RJ 3D2WA 2MQOA 2AJ0A 4K0KF 2D1CA 3W9IA 2VBWA 3MEDA 1NEEA 1C0TA 4K59A 2EVZA 3BO3A 4DSFA 2RB7A 3GG0A 4KIAA 3T41A 3CJ3A 1JNRB 4NRUA 4X4NA 1PIEA 3R5CA 1RBOB 1ITPA 2IHR1 2CPHA 5HVFA 3HHEA 5CQGA 3O2IA 1JLCA 2E1MC 2IM3A 4LF2A 2FJWA 2D7SA 3GYNA 2CADA 5KOXA 2JLFA 3BKUA 3HHDA 3R8YA 3HSDA 2B6AA 3LWMA 5F8MA 2F3JA 1RGVA 3Q2SC 4F4XA 4DR2F 2DR6A 3HVWA 1NLKL 3CGIA 3D0IE 1HKAA 4ZVUB 4TYAA 3MM8B 4WZMA 2RH3A 3OL7A 1K0TA 3ENVA 1TU0B 4PKDB 4KR0B 3TARA 1IKWB 2YWKA 4MAKA 2MJNA 4KO0A 4MK9A 3WX8A 1RWOB 1D9AA 1VK3A 1LXNA 4ZPBA 1Y5LB 2ZH3A 1AT1B 4Q8FA 3IS9A 5KFCA 1H38A 1HFEL 2J76E 1JLQB 4TU7A 5B09A 1NDPA 1RBLA 1HA1A 3AOAA 1WHWA 4PG4A 2KG0A 3FQKA 1EP4A 1H7XA 4X4PA 4J9LA 3KK1A 3TUPA 3WDOA 3G6VA 1SKWA 3TQEA 1UFWA 2RHSB 4IDKA 2DNHA 2MEWA 3T6JA 2CQPA 2DXDA 1U2RA 2J0XA 2GNKA 2D9PA 3MM6A 2W4PA 3UN2A 5KT6A 3IR7B 2K06A 3OR1A 3HHLB 1AB8A 2GFFA 5H9FJ 5I4MA 2J0QD 3NGKA 2B5JA 1CSJA 3MAQA 3EGNA 2JWNA 1MLAA 4JI6F 1UEKA 1UVLA 1EARA 1CJKB 4I67A 3Q8PB 1SUQA 2PT0A 4FPIA 1UVKA 1PILA 2D69A 1H73A 2IDLA 3DI6B 2EKYA 2OPRB 3J7YI 2B0GA 5A2QY 2A6MA 2Z2LA 5A8KB 3BSOA 2WRMA 4LF8F 4ZOSA 2IM0A 4OI6A 5FJ4A 1WDDA 1N88A 3TUZC 3LWLA 3S7RA 3VAIA 1TVRA 2KXNB 4FKYA 3R9LA 2LECA 1RKIA 2E5JA 3ETOA 1F3FA 1ZM4A 3O44A 2D3OR 1M5KC 2WK4A 4NLDA 2DCLA 2F9JA 1UVIA 1TMMA 3PYFA 1SI9A 2R42A 4X4UA 1GTHA 2CZ9A 2KJVA 3K7RA 1FTRA 3KLVA 3PW7A 4DN0A 1NJWA 2DNMA 2ZEJA 3D6TB 3V6DA 3FEXB 3RU0A 3EZOA 2B4UA 3J81U 1HW8A 3KLHB 4Y2CA 2Q79A 2BE7D 4J9OA 4OX7A 2M52A 3VGTA 1C1CB 4P2MA 5ETSA 4ECUA 4UT4A 4LF9F 3CPWR 4FDFA 2Z2ZA 3GFYA 3C16A 4LF4J 4YY3F 1SKSA 4ER8A 2UUTA 1X9WA 1IKYB 1VDHA 1QAXA 2HHPA 2BJ7A 2CDRB 2Z30B 2R7RA 3C2PA 1MN9A 3B4DA 3I82A 3M4XA 3SFUA 2DH7A 2QMWA 1N36F 3K5NA 4Y00A 4FBUA 2B8PA 4RW4A 2W9CB 5IT0A 3GONA 1IJEB 2EG2A 2HLUA 1RCOB 3EM1A 4J9RA 3IRXB 3MCNA 1ZTWA 1JWWA 2J7KA 3X1LB 4RU9A 3CC2S 1TAUA 2C2OB 1K9MT 2DGUA 4WIIA 3ICLA 3BV8A 4IFVB 5D3GA 5FDLA 4L3KA 2B43A 3ZZYA 3C6TB 4EI2A 3V6JA 5HMYA 1E6YA 1U0SA 1R3NA 4F4AA 3RG6A 2IA0A 2HBYB 3QGHA 2YNHA 4PQAA 1TKTB 4ZPCA 4C11A 4E2FB 5D6GA 5FLXU 1SL2A 3U02A 1Y5NB 4USMA 2Q1LA 3CIZA 3BB5A 4J37A 2ZBCA 5LOQA 3A4TA 2GJFA 3BYPA 1HNVA 1U7LA 2QG9B 3GFXA 4CLSA 5HJYA 2ADCA 5D0GA 3GV7B 4WE1B 4IFYA 2XMUA 5HI7A 4NEZA 4PXCA 1O5JA 2IM1A 5AXLA 2AKWB 3CJKA 1XN9A 3QT6A 1PGZA 4C8OA 4RBVA 1RAEB 3VAKA 1MU2A 2DGQA 2JH3A 7AT1B 4TLRA 3DN9A 2DHSA 3R7NB 6AT1B 1XNQF 1FNMA 1GAOA 1W25A 1TUWA 1BQNB 3WIVA 1FERA 1L3TA 3RBDA 1E6YB 1FDDA 1NCLA 3PCOB 3H4DA 1LV5A 2YNFA 1J5EJ 2ZE2A 1FRJA 1Y0HA 2V6AA 2VDHA 2N3OA 5D4OA 4JV5F 1ELOA 2CQGA 3NCPA 2AEMA 2JHEA 5KTQA 1PYOB 1RUSA 3JTPA 5E2QA 3T1YJ 4IR9A 3TAPA 3HVRA 2XS5A 1JLAB 1S0NA 2XHCA 5DQGA 2F4VF 1NBEB 2VJVA 2MQPA 4DV7F 1SKUB 1TFYA 5ETVA 3WHIA 5D77A 5CXTA 2YQ1A 1UCNA 1TV6B 3IBCB 3CJ5A 2LXFA 4ECWA 3QAEA 1VQ4S 3DM2A 3JTNA 2FJDB 4DPWA 4ECZA 1P8GA 3JYTB 1Y7PA 3K5PA 1WF0A 3HSGA 2LEBA 2M8DB 2DHXA 2DNNA 1VQYA 5IT9Y 1IKWA 2FJEB 1JLBA 3AJ1A 1FX2A 2DO4A 3GWCA 5C24A 4JI2F 3THVA 3NMAA 3F41A 5DGAA 3MFHA 1HYSA 4OYOA 2L3MA 3TUJC 3V81A 2ZHBA 4BS2A 1FDNA 4M5DA 4B3SJ 5KFZA 1QVFR 3IO1A 2AWZA 4NWBA 4A8OA 2BANB 4JV2A 1HIYA 3GCXP 4USKA 2V5HG 1T11A 4OHZA 4CO1A 3AHPA 2LCWA 2P8IA 3BZQA 2CUYA 2FZGB 2B7BB 4RPFA 1S1UB 3UDVA 2C2NA 1TL3B 4DX5A 4O3NA 1PO6A 4PZVA 1K47A 1GXTA 1TL5A 3F44A 2UZAA 1T9YA 5E3RA 1ZTTA 1OO0B 4DU8A 2GCFA 4QWBA 3QWUA 4CH1A 2MKYA 5GAEI 5A8KA 2BX6A 1RT2A 2QC3A 3E01A 3EDRB 3JSRA 1Q95G 1RJJA 1OIAA 2ZH5A 1RTDB 1IKVB 4LF6J 5KFBA 4TQSA 3V81B 4NA3A 2OI2A 1RA6A 4C6AA 4F0KA 1Q8BA 3QLHB 3CMAS 4J9NA 3LW5C 3GIKA 2KFZA 2FVCA 2CJBA 3G6ES 3G86A 4J9VA 4RW6B 1URNA 1LWEA 2RDDA 5HANA 2LQ5A 4ZVEA 3OFGA 1KQFB 4OZ1A 1KVKA 1XNRJ 4LR9A 3JSYA 2V4RA 3JSMA 4OL8A 4MJKA 3TAQA 2WSEC 3B8HA 2J6SA 4N47A 5ETOA 4EU0A 4QW8A 2VBZA 4ECTA 2UP1A 4KTQA 2BBEA 2VBXA 3G87A 2D3ZA 3IGVA 3QMQA 4RWWA 2IA6A 4PQUA 3BQ2A 2NQPA 2KHCA 2KJWA 2PD1A 5L39A 5IM0A 4TY8B 3T9ZA 3MAAA 1DFDA 1S57A 3M2UA 4NL5A 4KH0B 3CCWA 2ASJA 4NLGA 3D0HE 4ECQA 4Q2MA 5CYQA 2Q6BA 2W24A 4EO8A 4FXDA 4QU6A 1UJ5A 1TAQA 4PAAA 5HJXA 2X1AA 1NB7A 5DDOC 1LWEB 2XMTA 4EMDA 1B99A 5AJ3J 3L4BC 2Y1RI 4N7TA 2ZH6A 4PEOA 4JI7J 4DOZA 5JMNA 2WZ1A 3M8SA 1U6ZA 1RHJB 3AT1B 3HSJA 1QUPA 1S7IA 2YNGB 4CM0A 4A8WA 1NKBA 2PI5A 1DBDA 4PG5A 2ATCB 4KHMA 4QR0A 4DV0J 4C4WA 2Y3YA 2IBKA 3CULA 1A9NB 1Y9OA 2AYBA 2ZZNA 4KV8B 4QWAA 1OY8A 4MIAA 1RSCA 2Y9HA 3BJYA 4WYLA 2R7VA 4ZCIA 1NUEA 1Y00A 3TUIC 3GU0A 5IQ6A 1A6LA 1C0UA 3TX8A 5B0BA 2R4FA 4RNOA 2ZOMA 3OV7A 2HBRB 1N32J 2HHHF 4ECSA 4GKKJ 3MEGB 3ITHB 1F5BA 2HK2A 2V94A 5C42A 1OWXA 5HLFA 4TY8A 3OTOJ 1NJIT 2NXCA 1N5YA 1QD1A 3AB2B 2BE9B 1S9GB 3IBFB 3H2UB 2Z0GA 3M6XA 3TP2A 3UD3P 4DR6F 1KVJA 1T94A 1IBMF 2DXFA 1WTBA 2X1GA 2CRLA 1RAHB 3DRRB 1FK9B 3CCMS 1QY7A 1RA7A 2V63A 3EMTA 1JJCB 3R27A 1S1XA 3C14B 1V3RA 4QIFA 2KXFA 3J81j 3PRVA 3FMBA 1IXKA 1JQGA 2YNIB 1KP6A 1IWGA 3D5MA 3TQ1A 1URRA 3I0SB 1MWYA 2K3KA 1HMVB 3BGLA 2DXEA 2VFRA 4NLOA 4O44A 2ASDA 1QUVA 3CDBA 3HPOA 3HJVA 4Y65A 4CCHA 8RUCA 2LYVA 2B8QA 2UU9F
chains in the Genus database with same CATH topology
4KSEB 3TA0A 1JXLA 2N82B 2E9RX 4XK8C 4DFMA 1UP1A 3S01A 2KTQA 2CVEA 5KFUA 2GC8A 3KLFB 3V2UC 4OHXA 1WG5A 4WFBQ 3FEYB 4MIWA 1VQOS 2I38A 4F4YA 3U1NA 5KFAA 3UR3C 1Z2ZA 3KJVB 2W9CA 3MR3A 4A8KA 4GC7A 2R7WA 4KT0C 3MEDB 2XO7A 5HP1A 1I6JA 1YG0A 3ISND 1HNIB 4TXSA 4KHRA 2DGXA 3V4IA 2MKHA 1FJ7A 3LP1B 2GGPB 4WCEQ 2COLA 2DGOA 1C4CA 1HBMA 4XO0A 3C66A 4RW9A 2Q66A 2QFJA 2HHTA 2K1RA 2F8EX 2WSFC 4LT6A 4NLYA 5CHCB 1B0TA 1CPZA 1HHTP 1NKEA 1RT7B 1H2VZ 4AUKA 3RB3A 2M3DA 1DARA 2KH9A 2ACYA 4H4MB 3A1YG 1HNVB 1WTFA 1H98A 4B9UA 2IBOA 3DGPA 2E7XA 3OHAA 5AE2A 4C11B 2C3UA 3BSCA 2UXCF 4FF4A 5LJ5Y 4EUVA 1WD6A 4DFJA 2Y1JA 4ILLA 4IFYB 2WSCC 2C3OA 2MZQA 2RUGA 2XI3A 2YNFB 3PRBA 5GAHU 3RB6A 4PXEA 3KLEA 1S97A 4IH6A 2AGOA 2PDAA 2CZ4A 4CT8A 2DITA 4I2QB 1SL0A 1CEZA 4J9PA 4J9MA 2E9TA 3DRXA 2VUGA 2B4PA 4LMZA 3BGRA 5LSOA 2OMOA 5D4PA 1H2UX 2MGZB 5H9EJ 1RT7A 1NK9A 1KQKA 1RT6B 1JIHA 1VMBA 2LXIA 4K50A 2RKIA 3VTIA 4OHVA 2I8EA 2QV6A 3KG4A 3MFIA 5C25A 2UUAF 4DG1B 4URSA 1X4EA 2KFYA 3NKYA 1MROB 3TVYA 3H25A 1SH0A 2N4CA 5KFHA 3OTBA 2FJVA 1U6BA 1FEHA 4B9MA 2JRSA 1U8SA 4OJGA 3MXHP 1IBLF 1B64A 4CTAB 2VFSA 2LVWA 3OTDA 4DMZA 1DTQA 1JK9B 1DQAA 4IKAA 1FJGF 2EBGA 3S8SA 4MKBA 3ZZOA 3M2RB 3N4WA 1SV5A 4YP3A 5B0AA 2XLJA 3RR7A 2BA9A 4Q8EA 2E44A 3HDSA 3N5FA 1HBOB 2IYGA 4A8YA 4YQWA 2YWFA 1VBYA 3BSNA 4KQZA 3EGWB 2HHWA 4EFAC 4A48A 2B6AB 1QM9A 5I3UB 2AV5A 2RILA 4A8FA 1RT6A 2L9NA 2VG6A 3RRKA 4ZKAA 3DLEA 2WBRA 5J1NA 1TL3A 5KT3A 2MY8A 4DR3F 1L3VA 1ZH5A 1U24A 4FPRA 2PA8D 4Z2XA 4MYTA 1HL6A 4Q0BA 3P49B 1SJ3P 1U09A 2FC9A 3QZ8A 2X3GA 4R0JA 2QIFA 5DDRC 4UOCA 2YQ3A 4FF1A 3VALA 2L08A 3IS9B 4C0BA 1K73T 2LDIA 1VHFA 3L09A 3NBPA 1Z1ZA 1MWZA 1SH2A 2BV3A 2MDAA 1VRTA 2YKMA 2ZKTA 2BQUA 4NZ7A 1UVNA 1SV5B 3PACA 3HJFA 3B82A 4K4ZA 1YJUA 3EPGA 3DLEB 5KG2A 2C2RA 5A0YB 3CJ2A 3VAFA 4MKYA 2CPZA 1QVGR 1JLGA 1KLMA 2J9DA 2Q43A 3TO8A 4WFXA 2MSSA 2ZUGA 1FRMA 4ITSA 1WNEA 3RW7A 1HNWF 3SZ2A 3CEDA 2J5AA 4M8LA 2JZ5A 3KJVA 4KPYA 5J2QB 4NMLA 3HXMA 1FXLA 2F8MA 3OUYA 3CO9A 4DL2A 2O67A 2ZNZA 1FRHA 1SL1A 2DNRA 2HGNA 2YKOA 1TKZB 4O4GB 4CO4A 2ABYA 2FVPA 1G7CB 4YDXA 2ZE2B 4KHPF 4N76A 2YKQA 3MMJA 2OSRA 3MECB 5G4DA 3L3CA 2NZ4A 5J1EB 3HI9A 1XWLA 2FVSA 1P27B 5KFIA 1NK6A 3OR2A 2MXYA 3OUYB 2QSFA 2W4CA 3BREA 4OZLA 3HP6A 3ZFVA 5L1LA 4O3OA 3TVZA 4BHQA 3FVYA 2R2SA 4WZQA 1N34F 3DRSA 2LU2A 2D3UA 3OSNA 2UUCF 5DQIA 3OXFA 3RB4A 3M8RA 2JEIA 1ZAXA 1ZAVA 3ISNC 4HTIA 5HBMA 1HMVA 2E1CA 3Q24A 2C42A 4B9NA 2WBMA 1D3WA 2ASLA 1R8AA 1KRPA 1V3ZA 4IOBA 1S1XB 3EXYA 5CD4H 4USIA 4ECXA 1HQUA 1WELA 3OR2B 3JYTA 1LK5A 3IRXA 2CQCA 5AXKA 2OTJS 3HKZD 2W9BB 4I2QA 2ILZA 3MECA 2GQ2A 3NLCA 4FZVA 3VAGA 5D3GB 2B4OA 4N8OA 3KK3B 5DG7A 1UWBA 4O0IA 4DQIA 4FXVA 1F0XA 5HP1B 2MYFA 2JVRA 1JJ2R 4OLOA 3KLFA 4B3OB 3LO3A 4C8KA 3CD5A 3GV8B 3LP1A 4ES2A 3J7YU 1UA1A 4ZVFA 3HHLC 3N6NA 5DQHA 2K1RB 1Z2LA 2ZBIA 4OZ5A 5GVQA 2RDJA 3DDKA 5L8RC 1XMBA 3MDFA 3BN7A 4LIRA 2FIUA 2GV1A 5E7OB 3CCQS 1OPZA 5L1IA 3ISZA 5L1JA 3M32A 1X4HA 2UVWA 1HR0F 4Q43A 4QIEA 1U47A 1BQXA 5KFEA 4EGLA 1D8YA 1JJ4A 2E9ZA 2P9GA 3L7OA 2UVUA 4DF4A 1IKXA 1RT5A 2DNKA 4HDGA 4ID5B 2QYCA 1HI1A 5AXMA 1KTVA 2DRAA 1H0HB 1JX4A 1DLOA 3FCHA 3CVKA 2R9LA 2EFGA 1S0VA 2LDYA 2DGTA 5FD1A 2AYMA 4X62F 1X4AA 3GMGA 3S1TA 1TQLA 4X4VA 1SQEA 1NK4A 2BUNA 4LQ9A 4NLVA 5T41A 4HL9A 3GILA 4RZRA 4ED7A 3SV3A 2HNYA 4WU2A 2HGLA 1VFJA 2EG1A 5F8JA 5GAEU 1TKXA 2YX4A 5D4LA 3TANA 1YQHA 3H5UA 3MTKA 2DK2A 2FY1A 3SYZA 4L3NA 5SUHA 2ZOFA 2XBPA 3WBZA 3D1HA 3NGDA 5LMNF 2YH1A 5B7WA 2ERRA 2HHUA 3O1LA 3T19A 2UVRA 3JB9k 1S76D 1N0VC 4DG1A 2QLWA 1WEYA 3OFHA 4DQPA 3QJPA 2LLZA 4CO5A 2HS3A 2CQ3A 2V2KA 1VBZA 1EETA 4ZMMA 2BYCA 4M94A 2CQIA 1DURA 3QYYA 4KRWA 3RB0A 4NYOA 2VASA 4TU8A 2BZ2A 4K4WA 2IMOA 3NAHA 2XMMA 2AF6A 2GIQA 2EFPA 2HVZA 1KN6A 5U47A 1YJWS 4NPOA 3SCIE 3C3LA 5I42B 3BGUA 5C42B 3RAMA 2CPFA 2BQ3A 3KK2B 1VQSA 1UFLA 1X9MA 1LWCB 2XSJA 2G1DA 1VQ8S 3DRRA 5F9NA 2RT3A 4RW6A 1VQNS 5J2NB 1HNXF 3I9ZA 2CJQA 5K9FA 3MWBA 2KKHA 4ILMA 4M63A 2CPDA 1HBNA 3W7BA 3PX6A 4ZDNA 1S1TA 3ZC4A 4Z37A 4NCGB 1Y3JA 3I87A 1S9FA 4PQUB 3GR0A 1VGYA 1FHTA 3BEGB 2XMKA 2VOOA 2GMHA 5FDLB 3BSAA 4JI0F 3PEHA 3EUNA 3CF5Q 4N8NA 3C46A 1FD2A 3I32A 4F4KA 4QOTA 2BJEA 3IAM9 4IRKA 2K8GA 1ZBTA 2XB2D 2VPYB 4RBUA 2GGPA 3DRPB 5MLCV 2BDPA 3KOAA 5EWGA 4LSLB 2BJDA 3MR5A 4I7FA 4PR6A 1YTYA 4PWDB 5AE3A 3SI8A 2LU1A 2ZH4A 4USJC 3TNVA 2HNDB 5DG9A 4I6YA 4QQBA 2YKMB 4OJHA 1KNZA 3N9UC 4XPCA 4LF7F 4ED5A 3TA1A 4HYKA 1RT4B 2B9YA 1CQNA 1S6UA 3MURP 3ENWA 1MW7A 3Q8RB 2J0WA 1JLGB 1KLMB 2XMWA 1FE4A 4QPTA 2CPXA 4HI2A 1RP5A 2W9BA 3UCUP 3ITHA 5HLFB 1G6BA 3IWLA 2C2EA 3DLKB 1WHXA 1JLAA 1O8BA 1SXLA 2NPFA 1RTHB 1IJFB 4JV1A 2RNEA 5CCMA 1P6TA 4NLPA 2MB0B 4X4QA 2DO0A 3I4PA 3HMJG 2IVFB 4J9QA 3J7Z5 2MKIA 1FE0A 1FO1A 2BXJA 2FD2A 3CCTA 4XPEA 2R7XA 1F2GA 1LW0A 5KAKA 5C5JA 2VA3A 4IUFA 1YJRA 3G4SS 2YKNB 4C8NA 4H54A 1JKHA 2W7AA 2E5IA 3DXBA 1NHUA 1IBKF 3G8QA 4L6V3 1G2EA 1X4DA 3CDAA 2IRYA 3KTQA 2PFFB 4I64A 4OZJA 1N5TA 5SZTA 4YOEA 2OFGX 5BR8F 2O5DA 3I5CA 2AQ4A 4JI7F 3HK2A 3LGNA 2XLIA 4DSIA 1MU2B 4OX6A 2MQNA 4AFFA 5JXSA 4ZPWR 2ZD1A 5KG0A 4WKRA 2J9CA 1HWJA 4K2XA 4IRDA 3FSIA 4Y2MA 1DTQB 3OLBA 4PWUA 1HD1A 2AP6A 1B7FA 4I68A 2MKJA 2FHJA 4NA1A 2DVIA 2CYYA 2UUWA 1H7WA 3TW0A 3KLGB 2RJZA 3DLBA 4LF4F 3M1VB 3N0VA 2QRRA 3ZZUA 2IBKA 4U7CA 1V6HA 3CDEA 5EHHA 2VPZB 4Y6IA 1NZAA 4PXBA 4DUZF 3T3FA 1VQPS 2MZSA 4OHWA 2PO4A 5B0GA 2OPSB 5CYQB 3SQGA 3IXQA 3OTEA 3PW2A 1RI7A 4KJIA 3VZIA 3C6UB 2HHSA 5A8WB 2CPEA 2IAJA 5E33A 4MTPA 5KFMA 1NH7A 4X66F 2FTRA 4Q0BB 1FCAA 4N56A 4K5RA 5C24B 2WB4A 2C2DA 3HKWA 4P6QA 2P6TA 2NSBA 4XDDA 4MYUA 4DBQA 5EWEA 3J81Y 3SV4A 4I67A 1QLNA 3QIPB 5MAOA 2W8LA 4OMFG 2KI2A 3HM9A 2OJ3A 3CXCR 3CMES 4NLTA 1LFWA 2MSTA 2C3MA 4TN2A 1Q53A 4AL7A 3BDEA 1DJ0A 2IRUA 2XI2A 5KFLA 2AJQA 3M30B 1AXQA 4OV1A 2OPSA 2M0GB 3GSDA 3BO4A 3PX4A 5EDWA 4NYPA 3DRPA 2WOMA 1TKZA 3OL8A 2C28A 4IG0B 3E01B 3OPKA 1F60B 4MFBA 3FNNA 3HX9A 1MMDA 4CO3A 5DLFA 4WK1A 3VZHA 5KFSA 3MUTP 2AGQA 2OD6A 2JFDA 4OX8A 4QWEA 2DRBA 3U7JA 3UD4P 4MMOA 4ZP6A 2ZH2A 2A1BA 5A6PA 5KG3A 4KC5A 2Q6CA 3I5BA 3I5AA 4ECYA 3MMCB 3BR8A 4U6PA 2FC8A 2FLOA 2QLXA 4QWDA 1HWLA 3MMAB 1JJHA 4A47A 1JB0C 1S0OA 4LFCF 1H3DA 3OTOF 4DWIA 1L3UA 2DBBA 3B78A 2CQHA 1WF2A 3FGVA 3VCDA 1M90T 3DLKA 2V9KA 4UQTA 3DU6A 4X4RA 3IAS9 4P7VA 4PG7A 3DOLA 3ZZPA 3M30A 2XSJB 1HI0P 2XWXA 1L3TA 3MD1A 5J1PA 4H4OB 3U27A 2DT9A 5KOWA 4LF5F 2NXUA 4HEA9 5DDPC 2DNGA 1WWHA 5GAHI 4DDFA 4ZHRA 4TQRA 1HQUB 1MSWD 4GMKA 1HI8A 3DMJB 3JTOA 5E41A 3LF0A 2HS4A 3DYAA 1NAQA 2OPQA 1J2VA 4G6VB 4HT7A 1VI7A 3UNGC 5LSLA 4QW9A 2R8GA 5DM6Q 5JUMA 5KFOA 4DFPA 3D1QA 4RW8A 5HROB 2WONA 4DL5A 5CA5A 2PMZD 4DLGA 1X4BA 3GFHA 4R8UA 4NLWA 4NXNF 4DSJA 2M7SA 1YJVA 3MEGA 3GIJA 3GR1A 4JUZA 2KRRA 3UCGA 3LP2B 1HYSB 4TLQA 3MEKA 2W7PA 1SJ4P 1T3NA 1SJ1A 2LXUA 1R0AB 2PI4A 1W2IA 2O1PA 3SCLE 4R5PA 4X4TA 1VQKS 3CCSS 2RS2A 2DNLA 4OJ1A 3H98A 3UQSA 2PA3A 1QTMA 4EYIB 4DQRA 2CQ2A 4I56A 4B9SA 4O4GA 2VG5A 3J7ZT 4O3PA 3O3LA 2IJNA 1Q4RA 2E66A 3OL6A 2DCUB 2MQQA 3N5BA 3I0SA 2DNOA 1T8EA 3Q0AA 2PSZA 3Q23A 4ILRA 4ED1A 4JI3F 3HHLD 5IFMA 5J2PA 3OSPA 1FJCA 1Q82T 1VC6A 4C8YA 1T95A 2DH9A 1KR4A 2A18A 3PNIA