1FD8A

Solution structure of the cu(i) form of the yeast metallochaperone, atx1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords ATX1 COPPER CHAPERONE
publication title Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fd8A00
1SQEA 2GV1A 3LGNA 4HI1A 4OJGA 1KQKA 2ZDOA 2KT3A 1ULRA 2XMWA 3BDEA 5B0CA 1JK9B 2QIFA 2PD1A 1VQSA 1V3ZA 3WDOA 1SB6A 2ROPA 4Q2MA 1YJVA 2RMLA 3UDCA 1S6UA 4A4JA 3DXSX 3FRYA 3FMBA 2OD6A 3CJKA 2HFOA 3BM7A 4FNHA 1FE0A 5K9FA 1AW0A 1QUPA 2HQIA 2LXFA 3HFKA 2ASYA 1U7LA 1X7VA 1OQ3A 2IFXA 1TR0A 2HIQA 1Q53A 2K1RA 1Y9OA 2ROGA 4HH1A 4HL9A 1Y3KA 2ZDPA 3CJKB 1WD6A 2CRLA 2XMKA 2JDJA 2XMUA 2VV5A 5A6WA 1FEEA 1FVQA 2GFFA 3HF5A 5B0AA 2XMTA 4OIXA 4DN9A 4HH0A 2K2PA 1Q4RA 3HX9A 1Y0HA 3BN7A 2K1RB 2N7YA 3KG0A 3QGPA 1P8GA 2N4CA 2N4DA 3DCAA 1CC7A 2GA7A 5KAKA 2OP5A 1N5SA 1Q8LA 2BBEA 1FE4A 1XBWA 1YG0A 2EW9A 2KYZA 2OFHX 4U9RA 3LO3A 2K7JA 5B09A 2K7KA 4Y2MA 4YDXA 1RJJA 1YJRA 2FHMA 3HHLA 1Y3JA 1X8DA 2FTRA 2BJDA 3TNVA 2RILA 1MWZA 1TL4A 1GXTA 3IWXA 1YJTA 1CC8A 3QMQA 4A46A 2BUNA 3MZIA 5A6PA 3MCSA 2LQBA 1R6YA 3BGUA 3HHLB 5B0BA 2Q3PA 2KT2A 2PGCA 4OJ3A 2GGPA 4ZOSA 2AJ1A 3TOQA 4Y2KA 1OPZA 3HHLC 5F0WA 2FIUA 2W4PA 3IWLA 2W4CA 3LGMA 2LQ9A 5T7LA 1P6TA 3BF4A 1MWYA 2OKQA 1TZ0A 4OJHA 1CPZA 4A48A 2GCFA 2OMOA 4FNIA 1N5TA 3E8OA 2GO8A 4DL0C 1X0PA 4Y2IA 2GGPB 2W4DA 2IYIA 1YJUA 5B0EA 1VQYA 2FB0A 1FVSA 5T7LB 1N5QA 2HLTA 3FGVA 4ZA1A 1JWWA 3GZ7A 1AFJA 3K7RA 4NPOA 5IXUA 2QLWA 4NL5A 3HDSA 2HLUA 2RU9A 2QLXA 1N5VA 1KVJA 4YEAA 1K0VA 1TUVA 3KG1A 5B08A 1SI9A 4A47A 2XMJA 1GXUA 1Q8BA 2BJEA 1LQ9A 3BR8A 4HI2A 3VTIA 2AP6A 1S6OA 2IYGA 2BYCA 2XMMA 1IUJA 2AJ0A 3BB5A 3TRGA 1AFIA 1KVIA 2KKHA 1YRXA 2OFGX 2XMVA 4QOTA 3F44A 2ACYA 5F0UA 2OD4A 4F67A 4DPOA 5B0GA 3KNGA 2RSQA 2AW0A 5B0DA 1FD8A 2OAUA 1TL5A 4EFAC 3I9ZA 2QYCA 1OQ6A 3HHLD 3T9NA 2LDIA 1FESA 2L3MA 2ROEA 5B0FA 1OSDA 1URRA 4Q2LA 1APSA 4OJ1A 2VH7A 2HFNA 3KKFA 1W2IA 2G9OA
chains in the Genus database with same CATH superfamily
3IG1B 2UUAF 2CQHA 4P2SA 3TYTA 2YNGA 4C6AA 2YKNA 5L46A 4B08A 4ZP8A 5BJRA 2RQKA 1GTHA 1LWXA 1CJKB 3GB0A 1WEYA 3OTBA 5K8OA 1YBTA 3OBIA 4Q45A 3N0VA 1HNIB 1C0UA 4MAKA 3BS9A 5L9XA 2LU2A 3LWLA 3FRZA 1F3FA 4WK1A 2BJ1A 2ZD1A 3JSMA 2G0JA 4M5MA 2QEXS 2CQGA 2HGLA 4LR7A 2Z2ZA 1FRMA 3DLEB 3IR7B 1Y7PA 5FLXU 1XWLA 4A8WA 1LFPA 3PR4A 2R7SA 4EYHB 1S0MA 3KUEA 4J9OA 1RWUA 3H98A 3TQ1A 3GFZA 1D9DA 4TKTA 4ED7A 1UMJA 2XWYA 3MMBA 3DI6B 3OR1A 5A2QU 2OPRA 4ENOA 1S9FA 1RTDB 4P9SA 3D68A 2GW8A 1APSA 1SQEA 1I6JA 4UTGA 1YJVA 2JLGA 2LLZA 1YVFA 2ZH8A 3UD3P 1H7WA 1KSPA 2HG4A 3GFYA 4RNOA 4C11A 3PG9A 1DQ8A 2EK6A 2ZNYA 8ATCB 2ATLA 2IBOA 4PQAA 4DFKA 2H54B 1U6ZA 5FDLA 2RQCA 4X4VA 5E3CA 4RKUC 3J81Y 1YQHA 1UVKA 1ZM9A 1T0TV 4ZMMA 2YPZA 4KFBA 3DLKB 2QA4G 3V81B 2GO8A 3VAFA 3T1YJ 1S72S 3R6GB 2HHUA 4MJKA 1UWAA 3UD4P 3PYFA 3BEGB 1RT6A 2G2YA 4P2XA 7FDRA 1NRKA 3RTVA 2VJVA 4DU7A 2EC2A 3MEDB 5F3TA 2C3YA 4KYZA 4Q0BA 3F41A 4CTAA 5KFWA 3PY8A 4QIFA 3DU5A 5ETVA 2FDNA 4B9MA 3H5UA 2V68A 1VBZA 5KT7A 4I4BA 1EQMA 2BOPA 4DV2J 2ZM6J 4DUTA 1SJRA 3OTEA 2FHOB 5DZ6A 3TARA 2YH0A 1RT4B 3OTOF 1D8ZA 4DL3A 1T11A 2Y0BB 1Q82T 4DR1F 3RR7A 3LW5C 3Q2TC 3HZGA 2DBBA 4DSFA 3QIPB 1ZA1B 4PG4A 2DNOA 1T9UA 4P72A 5KFPA 4C3KA 4IYQA 1V3SA 1AZSB 3AT1B 1XMQJ 2LXUA 3AHPA 5C2GA 3A8KA 2QX0A 4FYWB 4J9KA 4JI7J 3DRSA 3UFCX 3JYTA 1TUGB 4ECYA 4ED6A 3MMAB 1U2RA 1MU2A 2FYXA 3IRXB 1CBKA 4X64J 2GX8A 3BB5A 2HNZB 2JH3A 3KNGA 1SL0A 2HZVA 4ZHRB 3CW2C 4UUXA 5F8MA 1RWVB 2V4RA 3MDFA 4JV5F 2MQQA 4Q2MA 1HW8A 1SXLA 4KGKA 3D1OA 3CPWR 1VLYA 3I0SA 1UEUA 2HIQA 3BGOP 2IJRA 2DNHA 5L38A 1CULB 3Q8SB 1VQ7S 2HWIA 3D7SB 2VG6A 4HH0A 4AQYF 2EG1A 3V6KA 1U1LA 5ADZA 4G1QA 5H9EJ 3QJLA 3AQPA 2V34A 4ED4A 4K8RA 4B3OA 3SMZA 1R43A 4K50A 1TL4A 1TL7B 4QIWD 4FYDA 2MKSA 4JV0A 2OI2A 1N48A 2B43A 4I1TA 2VG5B 2IYIA 2D69A 4EK2A 5M2PA 4OYPA 1U6BA 3G9CA 3BSOA 4DX6A 3T5HA 4ZS6A 4ZVFA 2CQPA 3JAMY 1FDNA 2XZTB 1NK0A 3DRRA 4CYUA 3C15B 1T03B 4DR6F 4MKAA 3ZC4A 5HI7A 4JI4F 5A76A 3CDAA 4DUZJ 4QPXA 3EICA 3I56S 4RX6A 3KK3B 1NK9A 2PD1A 1FX4A 2PSZA 1VRQC 2I2YA 2RQMA 1HNZF 1SC4B 1SC1B 2HNDA 1C4AA 2HHHJ 4RNFA 2CPIA 4FPRA 2YNIB 5HQLA 4LT6A 4X4RA 1HKAA 1JMTA 1FTCA 3UQSA 3WC2A 4DSJA 3HVTA 5LMUF 3R5AA 1BGXT 1JLAB 5LSOA 2O5DA 2D3OR 3MOZA 2RDDA 3I0RB 1DLOA 1NJYA 4YHHF 1OYEA 4J9NA 5KT4A 2N82B 3M1VA 4RW6B 2YKAA 1XMBA 4YS2A 3KJVA 2BKOA 4DQQA 3FGVA 8AT1B 2D3O1 2W9AA 3GIMA 1XERA 4JP8A 1VRTB 4DG1A 4QW9A 3NAIA 2RKIA 3R5JB 2CQ4A 1U24A 2P5VA 2RSQA 3MPVA 3DDIA 2ACMA 4KGXB 2EFVA 4RU2A 3B82A 1F5CA 3FSYA 3FBFA 2R7RA 5D0HA 3S01A 3DOKB 4H4MB 4KRWA 4C8ZA 1RT5B 3NNHA 1JB0C 3ZZPA 1JLCB 5A0YB 1RDRA 5CCLA 3MEEA 4RO0A 2FLOA 1GMVA 1H7XA 2L9NA 2KFYA 3D0IE 1GAOA 2DB1A 4YR0A 4RW7B 3MR2A 3KK2B 1RWOB 1I51B 3BPSP 1X8DA 2E1AA 5BYRA 1S0OA 2HK2A 3PYGA 2XZDB 2F9DA 1FRLA 4K7QA 2A1BA 3P3DA 3N6NA 5F0WA 5C42A 2HWTA 5K8MA 1TFWA 3A13A 2R2TA 3CD6S 3DOLB 3EM1A 4ELVA 1N54B 4O4RA 5EHHA 5J1PA 2VPYB 4UY8T 4NLUA 3BR8A 5CYQB 3HK2A 1ZZFA 4BLGA 3SSQA 2JEIA 2XWXA 3IS9B 3LOUA 2ZH3A 1MLAA 3KLEB 2DGVA 2HRTA 1S7IA 4WE1B 2LXFA 5G0RB 4NYPA 4B3RF 1GMWD 2QA1A 3LP0B 3I4PA 4B9TA 2RH3A 4PWWA 2EFGA 2C2NA 2UUCJ 1KQFB 1VIOA 2D1CA 5B09A 2YKMA 5ETTA 1HMVB 1PAUB 2GZOA 2FHKA 2HFUA 4NASA 4X62F 4RNMA 1VQ9S 2QMWA 3C14B 4M1KA 2YKQA 2DR9A 3HHNB 3K0JA 4QIGA 1SBRA 3D6FB 1KS2A 5GAHU 5KFVA 4LF4F 3X3UA 2IDEA 1FJGF 3D6MB 2OIHA 3FCVA 5DZ7A 3D4JA 5DM6Q 4L6V3 1S7HA 4FYVB 4ANDA 2JEFA 3BQ1A 2KRRA 5KFIA 1GH8A 2PN6A 2CWKA 1B0TA 2DH9A 2KHDA 2DITA 1CS4B 1HI8A 1FFSB 2O3DA 2W25A 2E5LF 4F4KA 2E5HA 4A8MP 1PJ5A 2WZ1A 5L8RC 2DRDA 5HATA 3QRRA 1LNQA 1BWEA 5EWEA 3BKFA 2GQQA 2AYBA 2QLFB 5IWAF 5H9FJ 4NMLA 2R8JA 2UU9F 5IQ6A 2I38A 1FD2A 3MAQA 2MJUA 2HMIA 2EWHA 2XNQA 4OYZA 3UNYA 3ENWA 1Y00A 3SSSA 5HBMA 4RBVA 2XMAA 2LEBA 2R2RA 1MWYA 1ZPWX 2OKQA 2GQCA 3QJPA 1RABB 5KT5A 1YJUA 4NWBA 2VOOA 2HLTA 4ZVHA 5AT1B 1FKOB 3ZZTA 1XR6A 1XC9A 3KK1A 2ALZA 1DBDA 1Y5LB 5GMKa 1XNRF 1MMDA 3MHYA 4TY9A 1TKTB 1NK6A 2XSJA 1RAEB 1N34J 1NO8A 2Z30B 3VALA 3J7ZT 5C25A 2PI4A 1RGVA 4KHPJ 3X1LB 2YNGB 3OFGA 2YKNB 1GTEA 3HKZD 3CD0A 3ZTQA 3RRHA 4ANEA 3MAHA 2I6WA 1UA0A 5KFKA 2YH1A 1Y3JA 2W7PA 2HURA 3G8QA 4URSA 1HNWF 3T5KA 5LXYA 4XDDA 4KT0C 4GO5X 1C0UB 4O3PA 2DT9A 2EFQA 3FBCA 2W24A 2DR7A 4X4SA 4TU9A 3E2EA 4P6QA 2C42A 1G2EA 4WTYA 3ELHA 1N4LA 2ZD1B 3JSMB 4Y2IA 1VQ8S 5F8HA 3PO5A 3ZNUA 1LOUA 4ED0A 3GIJA 2HQCA 3C3LA 2AHOB 1U8WA 2DGUA 1BLUA 3ENVA 1YRXA 3ILIA 2BQRA 2KB2A 2Q6CA 2R7VA 1GMWA 3QBCA 4O3NA 4F4YA 2J7UA 3MMBB 4LSZB 1VOMA 5LJ3Y 3OR1B 4OJ1A 2JVRA 2OPRB 3SI8A 2UUTA 2KT3A 3SDEA 4ZVSB 1FKPA 4J91A 3B6BA 2WTFA 3MPUB 2GVZA 4F2SA 2Y3YA 3J80U 2Z2LA 3L09A 2VV5A 2RE1A 3HM9A 4DR2J 1JNZB 1L3SA 5HLFA 2XG8A 1C1BA 3W5YA 4C11B 1T3NA 5KT3A 4DQIA 1LV5A 3PIPQ 4OX9J 3CE8A 4ED2A 1UJ5A 5FDLB 1UFWA 5IT9Y 4Y2KA 2CKWA 1KR4A 4USVA 2JX2A 2J6TA 4KFBB 4OFZA 4ZA1A 2WVFA 3TEGA 3DU6A 2DGWA 4OYBA 2NUHA 3QO9A 4TY8A 4X66J 4CLZA 2VASA 4TU8A 1UETA 3TJAA 4ZCIA 1RT6B 5BR8F 3GG0A 4M5JA 3W3SA 1LW2A 1RT7A 2BRKA 1DTQA 3U7JA 1OSDA 2V8VA 4Q0BB 4CTAB 2DCUB 2KH9A 1P9YA 4NOHA 3UD5A 4DS4A 3T5LA 2HQIA 1FA0A 3CB4A 2WSEC 3UN3A 2JEGA 1FDDA 2IVYA 1WEXA 1AUSL 2NXJA 4EBDA 1XMOJ 1DZ5A 2HVIA 1CJVA 5D0RA 3W8GA 2AMCB 2RNEA 1S77D 2EK1A 4ERDA 2BE2A 3GONA 2NZCA 4M5IA 2BEFA 2KXHA 2IA6A 1CC8A 4F02A 4LF8J 4N47A 2EI5A 3RB3A 3BKUA 2KRBA 1RADB 2V6AA 3ULHA 1YZ7A 2LVWA 3DLBA 4CDIA 3RBZA 4B9LA 4ZP6A 4DR3J 4XIUA 1BXNA 3W9IA 1N5QA 3MR3A 3KYLA 1WTFA 1NHUA 5KG7A 4P75A 2JL9A 4CLTA 3KOAA 1VQ5S 1HR0F 4UY85 1KBRA 4DPWA 3DRSB 3CO9A 3JYTB 1MU2B 2M0GB 2HQ3A 2CPHA 4RU9A 1FNXH 5U47A 3TZWA 1FWPA 2OGUA 1SIZA 3K2YA 4NA1A 3UVJA 2E44A 3HO1A 2QG9B 3N28A 2LCWA 3PTWA 1KQSR 1WC4A 2ZOMA 4FDFA 4M8LA 2NYIA 2OMLA 3SSRA 2V63A 4JI6F 2MHEA 2D9OA 3HVRA 4K4SA 4QIVA 3I0SB 4E0DA 3KUHA 2Y1RI 3QIDA 5IQQA 3D54A 1ZM3A 2VG6B 5EWGA 1VK8A 1IBCB 4PWUA 3MM9A 4G1QB 4A8XA 4Q8EA 3ZZ0A 4NXMF 3QT8A 4B3OB 2F7VA 2C2DA 4Y65A 2AJ1A 4C0BA 1WSVA 4E98A 3M30A 4ZVTB 4UF4A 3DYAA 2OMOA 4YY3J 1YRUA 4I0WA 4X2BA 2VPXB 3I82A 2HWHA 2MKCA 3KG1A 5ETQA 3TR5A 2BJEA 4WU2A 2RRNA 4IH6A 4IRKA 1H0HB 3DRRB 4CYUB 1HNXF 2OH2A 4URQU 4CP5A 1VC6A 4H4KA 2RUSA 4PG6A 1U0SA 4DR4F 2AEFA 1GX5A 1VYAA 2ZFHA 1HL6A 1FDBA 4TYBA 1RWKB 3VVTA 3J81U 2MKHA 2DY9A 5HJXA 1RAAB 3RZAA 2XO7A 4M5DA 1Q5VA 2WOMA 4YB7A 2F1FA 2HNDB 2X1AA 3Q83A 2VKZG 3POTA 1KDNA 4OZ5A 3KLGA 3R5DA 2B7CB 2KG0A 4KC5A 4PZVA 3HVTB 2QA4S 2FIUA 4KH1B 4PKDB 2R7WA 3W1YC 4LBHA 4OJHA 3MM7A 5SZTA 4JI2J 3E8OA 2W4DA 4WU3A 1DLOB 5B0EA 4AXIA 3EGWB 1FT8A 3N01A 3NNAA 2KO1A 4DV0F 3M1VB 2RU9A 4OI6A 3GMGA 3KJVB 2O67A 5HMYA 2M7SA 2IIHA 5F8GA 3ENQA 2XS5A 3CT9A 3NLCA 4ZVGA 4DG1B 4ILLA 2RKIB 5DDPC 3NBPA 4NRUA 3W60A 3MCOA 3E3XA 1TL3A 3R97A 2OSRA 5DO2A 3TA2A 1WF2A 4QWAA 2DISA 2W01A 3J7Z5 4YB6A 4DR5F 1XQIA 5F41A 2APOA 4DQPA 1NKEA 1WHWA 2XCAA 4LQ9A 4DSIA 2VD3A 3O8WA 2OSQA 3MEEB 4IH5A 1TL1A 4CWBA 2VG7A 5CZVA 5J2NA 2FC8A 4DX5A 5CH7B 3Q8YA 1RXOB 2PDAA 1RU2A 1XR7A 3SXLA 3G86A 5KG3A 2NSCA 1BQXA 3I55S 3HPOA 3D2WA 4DS5A 2GC8A 2HHPA 3CCZA 4JI5J 3B78A 5C42B 1UVNA 3LAKA 4DUYJ 1SH3A 3IBFB 4O3OA 5AE2A 4UZCA 3JSBA 1K0VA 1NK7A 2RIJA 4LVNP 5CAAA 5AJ3F 2MLYA 3HFVA 3CDWA 2ZH2A 1U47A 2XQCA 2J9DA 2VDHA 1OQ6A 4AE5A 4N5SA 5DDQC 1F9FA 3HXMA 1X4DA 2ROPA 3CDBA 3M8SA 3R7SB 4NLGA 4MFBA 2HGNA 3PM9A 4XDCA 4K4WA 1IBMF 3UE2A 2X1FA 4I64A 3PW2A 4U9RA 3PJWA 2CWXA 3HHLA 2BM1A 2JC1A 1IN0A 2ZZNA 1H73A 3R5CA 3OXGA 1MMNA 4U95A 4J9UE 5E3PA 1WKJA 2YKMB 2JEJA 2KDOA 4AT1B 1KEKA 4USWA 1URNA 1MG7A 2WRMA 2GAHC 3O2IA 2VICA 5EDWA 3C8YA 4ZP9A 1F2GA 2FVQA 3LTOA 2OEMA 1ZM4A 4ZLNA 2W8LA 4AUKA 5EN1A 1WOPA 1NSAA 1A9NB 3J7YU 3PCOB 1OPIA 2L9WA 4QBUA 3TZYA 2ZBPA 4NLXA 2V9KA 1O8BA 1QLNA 3QFWA 2P2CB 2LA4A 2BQUA 1ZH5A 4CO3A 2XYHB 5FIIA 2KJWA 3I5AA 4EI2A 1N52B 3BREA 4DV3J 2HMIB 4KR0B 3MM6A 2UXDJ 3AQOA 3CEDA 2F3JA 1O6XA 3I6PA 3BO2A 2CQDA 3Q86A 4C8OA 5ETMA 1M5HA 3OTDA 1RHRB 5HBMB 1JXEA 3AODA 3HD2A 3CC2S 3NGUA 4NL5A 1Q8BA 1N33J 2XMVA 2ZITA 2FZGB 2IBKA 4X65J 4NLYA 3KK1B 1UKUA 4RLEA 4ZJOA 3VZIA 2J9EA 2XSJB 4ED3A 3ISND 1TR0A 2F40A 5C25B 2AYEA 1KFDA 4RUBA 2GAGC 2HVZA 1I94F 3FZBA 3W8PA 2VPWB 4PABA 3NS6A 1JLFA 5KOXA 3LF0A 4JB8B 2LQBA 4O3RA 1JQGA 2CA9A 1RBOB 4P10A 3SCJE 1FTRA 2B9XA 2W2MP 3H40A 3QZ8A 4RW9A 2HPUA 4HACA 1P1TA 1HPZA 3NL0A 4K5SA 3H8YA 2ALYB 2H4YB 4CI0B 3MFIA 1RBAA 1RP5A 3DC2A 5JMNA 2YKPA 3FC9A 1FCAA 1KC8T 5AXKA 4B3TJ 3GYGA 1FD8A 1ZS6A 1NKBA 3W63A 2UXCF 4UOCA 4FP9A 4DV6J 4NEZA 2RUGA 2HVHA 4LRBA 4K5RA 3D5MA 3Q24A 1N6QA 4JI0J 7AT1B 4LF6J 2BANA 5F9LA 5LSLA 1PILA 2DHSA 3SDEB 1FKPB 3TZZA 5IM0A 1QVFR 4TQRA 3DLHA 3QNWB 2GVZB 1DARA 3CD5A 1YI2S 4C97A 4DPTA 5KG5A 5HLFB 1C1BB 3QLHA 1GFWB 1K73T 3D1HA 3D66A 4DF8A 3RAXA 1T95A 3QWUA 1T94A 3PJXA 1NDLA 1HD0A 3CSKA 1RT2A 3BGRA 3K5PA 1N5VA 1ZA2B 2ZNZA 2XULA 1H2UX 9RUBA 3HSZA 4JI1J 1M5PC 4F67A 3QO9B 4TY8B 2M52A 2QYCA 2WAQD 2XGQA 2W9CA 1YDLA 2DK2A 3MCSA 1LW2B 1RT7B 3V5RA 1HNVA 1C1CA 5G4DA 4DV4J 2MQMA 1AYEA 1DTQB 3FMBA 1VGYA 3ZTOA 1HFEL 4OZ3A 2VBWA 3TEHB 1CG2A 2RDJA 5I3UA 1EJ7L 1YLXA 3JQMA 4MYTA 3IR6B 4DN9A 1HBNA 1LW0A 3IO1A 5DRKA 3TANA 5CQGA 1RAGB 3GJQB 1CJVB 1RTJA 3T3FA 4J9QA 4RJVA 2CPFA 1S9GA 4GKJF 5KFMA 3BO3A 2XS7A 2BE2B 4ZCMA 3PRBA 3CCVS 4C7QA 2W7AA 1QAIA 4DFMA 3ZTSA 2PI5A 4IH7A 2YVSA 2MY8A 4JI8J 1TV6A 2BDPA 1NH8A 1ICEB 4U67Q 4WIQA 2XHWA 2HHXA 1SL1A 2Y0SD 2QFJA 4L76A 1Q16B 4KH0B 1WACA 3N6MA 3QAUA 3GWCA 2P6TA 2R3VA 4IG0A 2AEJA 2FZCB 3UVJB 2G13A 1IBKJ 2QN6B 3HULA 1WHYA 2DNGA 1X7VA 1E6YA 3MM8A 3NOCA 4ED1A 1H38A 5D0EA 3ADAC 4MKBA 3HSJA 2B9EA 1RWXB 3GCXP 2WSCC 2BBEA 4TNOA 2K7KA 1ZZNA 3C6UA 4WFAQ 2B9YA 3KJFB 1U4BA 1RCOB 2D3UA 4RBTA 4A8FA 3KLIA 3FEZA 1UFLA 3MM9B 3G96A 2WVEA 3TVKA 2L41A 1M1GA 3MECA 1LWFA 4LFAJ 2HFVA 1OY6A 2LEAA 5DLFA 3M30B 1SH0A 4HT7A 3DYAB 4WP3A 4DV5J 1EZZB 1WG1A 4F25A 4DU8A 3V6HA 4LQ3A 3DGPA 1KVIA 5F8IA 3CJ5A 5KFNA 1S4EA 3BR9A 2UUBF 1XNQJ 1HWKA 3SCLE 3OFHA 4X4PA 2HKEA 1NZ8A 2V8GA 4WBFA 3NKYA 2YX1A 4I2PA 2HEKA 4FVMA 4A4JA 3FRYA 3VR1A 2M9KA 4HL9A 2UP1A 4YDDB 1ROFA 4BDPA 4QW8A 3RRKA 3RRGA 1QSSA 3GYNA 4QR1A 1P8GA 4LBPA 4OX7A 4M5DB 2LQJA 2QC3A 2WOMB 3CCJS 4OLPA 2K3KA 1H72C 4MYUA 3MR7A 3KLVA 2PE8A 3POTB 1D3WA 3TW0A 3KLGB 1KFSA 1YK9A 3FK4A 2CZVC 3C6TA 4MMOA 4MH8A 3ZNJ1 3I9V9 3IBWA 3O5TB 1FWLA 3W66A 2XCPA 1NPKA 4DFPA 4NXNJ 3CVKA 1CVJA 2DHGA 3FFIA 3MM7B 5AXNA 4G6VB 5I42A 5CCMA 1X4FA 1SI9A 4Q44A 2MTLA 3TUPA 2B5JA 1KN6A 2NYHA 1IR2A 3PJ9A 1NUEA 1N36J 2MQNA 4TLQA 2YX4A 2JHEA 1NPRA 1Z1ZA 4GVLA 3TA1A 2VQFF 2HS0A 4O0IA 3NBPB 3IN5A 4P7TA 2XLKA 2AT1B 3BQ0A 3CIMA 3I31A 1UVMA 5LXRA 4DSEA 3KDOA 3G6ES 1NU4A 1WTBA 4CQ1A 2MHNA 4ZPBA 1NHKL 2DNLA 2GHPA 1IXKA 1A7GE 3SIPB 4UT4A 2LMIA 4K4ZA 3GJRB 5KOWA 1TL1B 1WNEA 3L7PA 1U09A 2VQEJ 4ECXA 4RNNA 2VG7B 5J2NB 4DL5A 1RLDA 3N4WA 1VBKA 2ZUGA 1RHMB 3JSYA 2PA3A 3SV3A 4U8YA 2J0XA 4Q43A 2FJEB 2DHXA 3S7RA 4C4WA 1XN9A 4LSLA 3UDLA 1HQUA 2GHVC 3M6UA 4C3LA 4LRAA 2CQIA 4N8OA 1XK8A 3AOCA 1F9HA 4LF2A 4H4KC 2UXBF 4CRJA 4GVBA 3CF5Q 4YB1P 2PO4A 2FY8A 2JVOA 1JLEA 1KHVA 1R27B 3KTQA 1SJQA 4ED5A 4Q2LA 4Y28C 3RU0A 4URGA 4C8NA 1ZAXA 2W9BA 3HFZB 4O4GA 3K58A 3DXSX 2V8PA 1LXJA 2YWWA 2Q79A 3Q89A 1NCLA 2IM1A 3QT6A 2M3DA 3OFEA 2CG4A 1WC3A 4YB5A 1WORA 3KG0A 4MFBB 3CDUA 2ZHOA 2BM0A 2VFRA 2FHMA 1NK8A 1BMQB 4BHQA 1DTTA 1X5PA 1JJ4A 2PMWA 3HHLB 2CYYA 3W64A 1U1NA 2KM8B 4WJBA 4LRFA 5A8WA 5J2QA 4WP9A 3RB6A 2AX1A 1VBXA 4OX8A 2VONA 5ETRA 2F4VF 3R27A 2J9DE 3JTNA 4DQRA 4NPOA 3U02A 1YBAA 4LFCF 4XO0A 2IJNA 4CH7A 4OZLA 3S6EA 4M5HA 4GO7X 1RI7A 1S49A 2MLZA 2C2MB 5HMWA 1FKAF 3UR0A 5DQGA 3K5LA 2V2ZA 1FJ7A 1RHKB 2B4PA 3SFUA 3R6LB 3UDCA 1B7YB 1D9FA 2FLPA 3O6QA 2ASLA 1JLAA 1VK3A 3CIZA 4M95A 2ZHAA 1L3UA 4K0KJ 4NYZA 4IFVA 5A8KA 4RL1A 2OPQA 1OY8A 2IC3A 1RTIA 3WX4A 2EW9A 1O5JA 3BV8A 2PEHA 4IOCQ 1PBUA 4BC9A 2XLJA 1UZDA 5A6PA 2IM3A 2W4PA 3M2RA 1PO6A 4DL0C 2ASJA 3EVWA 4H4MA 1O0PA 3MM6B 2P9GA 2QL9B 4B3SJ 2AEMA 2Y8YA 3AB2B 2XMJA 1S99A 2HNYA 4F3OA 1PG5B 2XZWA 4R0EA 2ZC4A 4UQGA 2CADA 4GKKJ 1SQGA 1U2CA 1RU1A 2CJAA 2H51B 3K17A 2MZRA 1FESA 4IR1A 4ZVEA 3BYRA 4C2MA 3PFEA 2Y9HA 3MUMP 5H1SV 2DNMA 3MR5A 3KFWX 4USMA 1N88A 1VI7A 1PSDA 1NDKA 1FNMA 5D15A 3M8PA 2F5GA 1OQ3A 3NAHA 2BX6A 1Q53A 2R4FA 3H25A 3CCTA 3H2VE 2L9DA 1HLWA 3IAS9 4QWBA 1X4EA 2C3OA 1GXLA 2KM8C 1S10A 2VODA 3DLGA 3T6JA 3IC1A 4LRCA 3BSAA 2DIVA 2RILA 2HHTA 4MK7A 9ATCB 1JLFB 3U1LA 4IKAA 2OO4A 2N7CA 2V4QA 2M8HA 5J1EA 4I6YA 2DGXA 3NOGA 1D8YA 1T05A 2LA6A 4KE5A 1U0HA 1ZYQA 4RW9B 4DV7J 4J9RA 4B17A 1L3VA 4HACB 1BQNA 2U1AA 4B3MJ 1HPZB 3SCIE 2U2FA 2KZZA 1L3TA 5L1JA 3OR2A 3R5GA 5K8PA 4F7VA 2E5IA 5B0FA 3G6XA 3QRQA 5DLGA 3ZTPA 5E0OA 2HS4A 4F0MA 1HMVA 5MLCV 2DNYA 3NS5A 1AUDA 3LALA 5T14A 2BV3A 2B6AA 2H4WB 5DDRC 2LQ5A 4KAIA 3OL8A 1N6QB 2C3UA 2BANB 4U7CA 2CPEA 2VJUA 2CNNB 4IFYA 3Q0AA 4K4YA 2E7VA 5IM0B 4NLWA 4CT9A 1DQ9A 3MAAA 6FDRA 2O1PA 5D78A 4I6AA 4HEA9 3M8WA 2MSTA 1CJUA 1DAXA 4KO0A 2CPDA 3D0HE 4CZCA 1Q86T 3H4BA 2W2PP 4QR0A 3QLHB 1OPZA 2AU0A 3EMTA 2IPOB 3HKWA 4M63A 3CDEA 3BF4A 1BD6A 3QGIA 5ETSA 2B4VA 2BJ7A 4WZMA 1WDDA 1ZPVA 1CS4A 5T41A 4MK9A 1IKVA 3VHQA 1M5VC 1JWWA 2QLXA 3VAJA 1RT2B 1W26A 3FDSA 3BGRB 1HWLA 2UUAJ 4DLGA 1SUQA 1NPPA 3T1AA 4DPOA 3PW4A 4OI2A 2Y8WA 3N79A 4W4MA 2HS3A 3UN2A 2HFSA 3GR1A 2VBYA 4ID5A 3CJRA 2NS1B 3ITHA 5E3QA 5HQMA 4U7UD 4WFZA 4JYAF 1TTHB 3W61A 5D8HB 1J2VA 2XMWA 1EARA 5CD4H 2AGOA 2W9CB 1X9WA 4M5GA 5K9FA 1HNVB 1C1CB 1H98A 3BH7B 2M5YA 1ITPA 5DG7A 3UR3C 2JFDA 4CLUA 3OXFA 3MMCA 1MN7A 5EWFA 2XY6A 1P27B 5J1NA 2OTLS 4PWDA 1PAEX 1Q8LA 5I3UB 4CLWA 1PC5A 4I69A 3ETMA 2KHCA 1HBNB 2V9WA 1LW0B 3AJDA 2AJ4A 3QZ7A 1RTJB 5JVGQ 3B4MA 2PGCA 2GGPA 1S9GB 5JUMA 5KT6A 2AJ2A 1QAJA 2YWFA 2HQDA 2JOQA 4LF5F 3IAM9 1EB0A 4ID8A 2AGQA 2AYGA 3IM9A 4DFJA 3GSIA 1JLBA 2DY1A 5E3AA 1TV6B 1BHNA 4HVZA 1REGX 1PIEA 4EU0A 1AT1B 1YBUA 2HHWA 1URRA 2KTQA 3LGHA 4WTOB 4FS2A 2BE7D 2B7BB 2LP4A 4B9UA 3BM7A 2BMBA 3MXHP 2E1MC 4IG0B 1LFWA 4ECTA 4IOBA 1UW4A 4LMZA 1E6YB 3BN7A 2RS8A 2RVJA 3MM8B 4KGVB 5KFTA 5AXMA 3FMWA 1OY9A 1QTMA 2I0XA 3GTYX 3A3PB 3VQSA 1YZ6A 1RJJA 1MNEA 1RZMA 1DY3A 4FKYA 3C6UB 4H4OA 3WIUA 2XBPA 3KLIB 3O1LA 5KG4A 2JNJA 2F63A 3BH6B 3MECB 1LWFB 3IRWP 3PX4A 2DHHA 3P49B 4UQTA 2FVSA 2QGFB 4JV1A 2GIFA 5AXLA 3I5BA 4QQBA 4YQWA 3DGPB 5KFJA 2ROEA 3PX0A 5HJYA 2ZHBA 1NLKL 1ZTWA 1NHVA 3OTOJ 4DR1J 1S79A 1PYSB 4IOAQ 8RUCA 5L39A 3LP2A 2OUGA 2QMXA 4I2PB 3K89A 2ILZA 2QTWA 4IO9Q 1X9SA 3PHTA 1OJ4A 2MQPA 1U1PA 1YJ9S 1XR5A 1N8RT 4CLPA 4ECUA 4N8NA 4Y2MA 3EDQB 3L4BC 2YBVA 1SKRA 4A46A 5AE3A 3SV4A 1OIAA 4FKXA 5D0GA 1BQMA 1LEOA 4XPEA 1TZ0A 4P2FA 5F3ZA 3C6TB 3DMJA 2FB0A 3LUYA 2ZOFA 5CABA 2VC0A 3ISNC 1FDAA 2VBXA 1QY7A 4JV5J 1TUVA 2WBMA 1GXUA 1HW9A 4FBTA 5LOQA 2UV8G 1IWAA 1TQLA 1NSKL 2CQ0A 3FFIB 5I42B 2WHOA 4TVAB 1R0CB 2Y1JA 2E9TA 1VR6A 2WVDA 4NLRA 3A8IA 4ECZA 2B5JB 4LR9A 5L1IA 4D3GA 1ZOTA 1W2IA 4AQYJ 2MQOA 4W98A 2XC9A 1JK9B 3DDKA 1WDTA 2DGSA 2H5JB 2JRSA 3KLFA 3RW7A 4LSNA 4LF9F 4ZDNA 5DDOC 1CEZA 3DHWC 1Q4RA 1O51A 2QSFA 4I68A 3LPYA 2E1CA 2EFPA 1N32F 2R8HA 4C8MA 1HBOA 4K2JA 4DR6J 4J9PA 3LGMA 1S1UA 2GCFA 2VFVA 2OPPA 3CCQS 5K20B 1X5TA 1T3OA 1NDPA 4MK8A 4GMKA 4BS2A 4LSLB 2ZZTA 1HQUB 5HVFA 3A4TA 4KGMA 4PXCA 3TRGA 4WZQA 3MI7X 5DGAA 2FUG9 2XTJP 2B0GA 1HNZJ 1LK5A 3AH6A 1KLMA 4GVBB 4PAAA 2DTJA 4AL5A 1V3ZA 1JLEB 2HZAA 4XAKA 2YY3A 2J9CA 3TX8A 3TP2A 2ADBA 5GAHI 3S8SA 5LMUJ 2W9BB 2IFXA 4O4GB 2ATCB 4IR9A 3DGVA 2VZ9A 1NK5A 2DCLA 1R8PA 2GJ2A 2BE9B 1S1TA 1AROP 2AX0A 2N4CA 4YHHJ 1RLCL 1IKWA 4MIBA 4MKVA 2Z56B 1RACB 2W2QP 4C3MA 2CUYA 4C0OC 2C22A 4PG7A 1DTTB 1ZTTA 4LF7F 2B56A 4WXOA 3V2UC 2J7KA 3M6VA 1FRIA 4DBQA 2P8IA 5IC4B 3VAMA 1VQYA 4CNZA 4P2MA 1U1KA 5A8WB 5J2QB 3JTOA 2NXEA 1M1KT 3PNIA 1IKXA 1NJWA 3ZZYA 3FNNA 1YIJS 1S1XA 3OTCA 4DL4A 1VQ4S 2LECA 2M2BA 3DM2A 4ZN1A 4QJVA 3K57A 1WG4A 2DD8S 2LFVA 1U7LA 1TKXA 1UWBA 1PKUA 2C1EB 4AD6A 4LREA 1FVQA 5D6GA 2XMTA 1FF2A 1QM9A 1RT1A 4IFVB 5A8KB 2WVBA 2OPQB 1FFGB 1RWMB 2D41A 2IC3B 3MFHA 4L75A 5L1LA 4B9SA 1RTIB 3AXMA 3MZIA 3GIKA 3NMAA 1HWJA 2FJWA 5T7LA 3NCQA 1WC0A 3PDNA 3M9NB 1VLOA 3JTPA 2IRUA 2W2OP 1B4SA 3M2RB 2QLWA 2ERRA 5JVHQ 2XB2D 5D4NA 2E66A 3FKBA 1TAQA 3ZXWA 4ATNA 2QMUB 1IUJA 2BJ8A 5FD1A 1KWMA 3LWMA 2HNYB 3GLJA 3N6LA 3H2LA 1B0PA 3PACA 4B3RJ 1HD1A 4Z7YA 3MOJB 3DLJA 5B0CA 3WX8A 2OJ3A 1YGYA 2HAIA 2FVCA 1IVZA 1WHVA 2WBRA 4X62J 4A8QA 3VGVA 5EGYA 2YX7A 4ITSA 1VQNS 2GFFA 4NI2A 3M8PB 5IS2A 4QWCA 4QR2A 5KFUA 1OYDA 3OSPA 3MMJA 1HBMA 4LF4J 3AA8A 5BYQA 1H74A 3DLGB 1FJGJ 5E5NA 1BWVA 4K4TA 2WONA 2G1DA 1UPMB 3O44A 1VMBA 2MQLA 5KG2A 4WFNQ 3OW2R 1SKUB 3MTKA 2AV5A 5J1EB 3CCUS 1LQ9A 1M90T 4KPYA 4Y34A 1T05B 3RB0A 2E5LJ 1U0HB 2OLWA 4I7FA 3V4IA 1OSCA 5KFRA 1FK9A 1BQNB 2NSBA 2ZWOA 3GJSB 4F0HA 1NM2A 3CWJA 3OR2B 4DPXA 4QU6A 4DV1J 3CO0P 5IWAJ 2H48B 3T1HF 2J6UA 1BC6A 4X4QA 4ETZA 2AWZA 1S1VA 2B6AB 2NXNA 3EGVA 3DHXA 4Y6IA 3QGPA 2GA7A 1RSCA 4E8UA 1EIYB 4IFYB 2NR0A 1C0TA 3MAAB 4FZVA 3A3NB 2CJKA 4FXWA 1CJUB 5EX0A 2KT2A 3CJ2A 2GMJA 4KO0B 2RQ4A 2UVUA 1CLFA 1LKZA 3THVA 4F2RA 3HVAA 1X0PA 3ZFVA 4JI3F 3MTJA 1G6BA 4HKQA 3QSIA 1HWUA 4KHRA 1NSQA 3LPEA 1XNRJ 3GV8B 4BCAA 1RWNB 5D77A 4LVOP 4DL2A 4IO1A 3Q23A 2F8HA 4F4WA 3RBXA 4R8UA 1IKVB 3CJ0A 2BABA 2K3IA 4WKYA 2QO3A 3OLAA 3NGSA 4OX6A 3C19A 2DNKA 1TFYA 2NCKL 2QL7B 4NE9C 1SUQB 4ICLA 2Y1IA 2A10A 4FF1A 5J2MA 5KG0A 3PX6A 4NMXA 4ID5B 3ITHB 3MD3A 2ZJRQ 1RISA 3VGSA 1UVIA 4Y0FA 2IRXA 1HNWJ 4W90B 3WBZA 5KFCA 1U45A 3KJNB 3RJMB 2LEPA 3KDNA 1VISA 2DRAA 3OVSA 4Q7AA 4NEYA 1KHWA 2HHVA 4DDFA 1HQEA 3ZZUA 4ZJLA 3M6WA 3MMCB 2B8PA 4PWDB 2QT7A 1Q5YA 3W2VA 3MR6A 4OYMA 1YITS 4Z7CA 5C2CA 1Y4ZB 1PC4A 3EPIA 3TVZA 4A48A 3T19A 2GGPB 1RT3A 1NNDA 3MGJA 2FPHX 2GQ2A 4G65A 3CCMS 4ZPVR 2R9LA 3EGNA 4YR3A 1F1BB 2ZH1A 5B0GA 3DRYA 1JLBB 3IP0A 2HIYA 3CMQA 1S76D 3ET6A 3LANA 1REVA 5H9FK 4OZNA 5BYSA 2ZDOA 1ZETA 1KNZA 3CC7S 1S6UA 2FVRA 4P52A 2MKJA 5LMNF 2ZKUA 4DN0A 1SJ4P 3VCDA 1SJ1A 2CPJA 1R7IA 4YN3B 3CNQP 3R9LA 1TMJA 3G8SA 1S4FA 1SKWA 1Q1KA 3KWMA 3L7OA 1H6KX 4BWJA 2ABYA 2V2QA 1QTNB 4HHHA 1LWEA 2AJQA 1LXNA 4OJ3A 2DVIA 2CNOB 2H65B 5HP1A 5BR8J 3MEKA 4Q5VA 1T9XA 1HYSA 3JQKA 4DZ6A 1B0VA 1R8CA 4H4OB 1BUXA 3PW0A 2CIMA 1Y10A 4I2QB 4CLKA 4QZVB 2VB6A 3A1YG 1FRKA 3OVBA 4DR7F 4WXWA 5JXSA 3NRBA 1F2HA 4KSEB 4JBCA 4IG3A 1F0XA 2DNRA 2IM2A 1YKWA 2I5JA 4PEOA 4DCOB 3GJTB 2MPUA 4HI1A 3CULA 3EVMA 2AKWB 1TK5A 4IQXA 4NZ7A 2RF2A 3DRPA 2NZ4A 2HRYA 3JQJA 3PKYA 3LP2B 3FBEA 4X4OA 3P8BB 4NCGA 2UVRA 4QYZJ 4NLOA 3OPKA 1VHFA 1L3KA 3OV7A 4RW8A 5KFEA 4PR6A 3J7AN 4K59A 4M94A 1HR0J 2FLNA 3A8EA 4ZCKA 5L1KA 1F6TA 2HHSA 1BQMB 3U1MA 2CQCA 1WC5A 2FLLA 2KXNB 3H42A 3DMJB 4J9SA 4YMEA 4C0HA 3TQEA 1VJWA 5F0UA 4HTJA 1UPPA 2D9PA 4JI6J 3DXBA 1UJ6A 1SKSA 3PO4A 1Q0NA 3WQPA 2CQBA 3HMJG 2BR0A 1CQMA 2P9EA 1K1SA 2MY7A 4NA2A 4ES1A 5C7PA 4WPAA 4FPIA 3L95X 5DQHA 4NXMJ 3NEKA 4K4XA 2YWKA 5B0AA 3HF5A 3KLFB 2RT3A 2V5HG 4LSNB 1R89A 3P45B 2FC9A 1JJ2R 2B8QA 2KYZA 5LSRA 2QFIA 3VZHA 5KFXA 3ZZZA 4CM2A 4USJC 2RRAA 4L3NA 3VAIA 2DR8A 1UVLA 4X4UA 4KJIA 3VAKA 4WK3A 2CJYB 3ZO7A 1HBOB 3F73A 3R7BB 1HNXJ 1S1UB 4YP3A 2J0WA 1XTZA 3K7RA 3M32A 1VC0A 1Q8IA 3QWPA 5FJ4A 2OPPB 4FXVA 4PXEA 1PBAA 3MCNA 4ZJQA 1TU0B 2ACYA 4DR4J 2HSEB 2RHQB 1WJ9A 3IA0A 4ZITA 5MAOA 2VH7A 1WF0A 4OJGA 3DDNA 3ENAA 4PG8A 1KLMB 5CD4A 2ZUAA 1NXIA 4PPZA 5F9NA 1Z4UA 2UVWA 1WD6A 1WUUA 5A8RA 5IV3A 1D1UA 1T8EA 2AF6A 3NGRA 3R7NB 1S1TB 2KXFA 2QZ8A 2XY5A 2RAQA 3NWGA 1H2VZ 1IKWB 2OHDA 4DV0J 4EMDA 1X60A 5KFLA 4Z37A 4ZN3A 4CLYA 5DG9A 3FQKA 1RQ0A 4WFXA 2CQ2A 3TAQA 3TO8A 3W65A 4D3HA 3J7YI 3RBEA 1J5EJ 3D6TB 2ASDA 5HVGA 4L72B 2Q66A 1RAJA 1NH7A 1UCNA 4UOHA 5HROA 3BJYA 4ER8A 2R42A 1IKXB 4DR5J 2CAJA 3EZ5A 4G3IA 1RCXB 3DLLQ 1S1XB 4EZ6A 2G9OA 1WC1A 3MUTP 2XGPA 1U49A 3DM2B 4Y2CA 5IT4A 3MWBA 4OYXA 3HHKA 3TAMA 3MF5A 3RAQA 1G1XA 1QAXA 3NCPA 1JJCB 2Z58B 1TKXB 1UWBB 2CQ1A 5CXTA 2DGOA 1YTYA 3NGKA 1KVKA 4OHYA 4TXSA 4V19X 1S59A 1RT1B 3SQGA 7FD1A 2ZBCA 1S97A 3M4XA 1NB2A 3J7A1 3H7HB 3VVUA 3M9MB 4FF2A 5F8LA 1EETA 2VU5A 4U7UK 5AJ3J 4E2FB 2HQGA 2RRBA 4CLSA 5T7LB 2V67A 2BJ9A 1GMUA 4BC7A 4F36A 2XS2A 4ALZA 3G4SS 2KZMA 4J5OA 4LJMA 4DMZA 3PR5B 4R5PA 2G0IA 5HQ8A 1JLGA 3EJMA 2L08A 3OFFA 4IQMA 3NS7B 3T1YF 2PFFB 5KFOA 2ZJPQ 1UJ4A 1J5OA 1IKYA 2KN4A 1IBMJ 3CXCR 1DQAA 1H3DA 2LU1A 1RAHB 3RR8A 1SCJB 5KFDA 3HFKA 3IGVA 1NZAA 1CJTA 1GT8A 5HMXA 3AAWB 5RUBA 4K4VA 1DURA 4OZJA 2D7SA 4NI2B 2AIRB 1WELA 5C24A 4DV2F 1K1QA 2ZM6F 1TUWA 1RTZA 1HBMB 3CGIA 2VBZA 1S12A 3OL9A 2EFOA 5BXIA 4KQZA 3RGIA 2Z4PA 1Q95G 4KGZB 4ZPAA 2FHJD 2WONB 1TELA 3NMRA 3LQVA 5D3GA 4OI3A 1IJFB 2XMMA 1XMQF 3PHEA 4FF4A 1RB0A 3T5JA 1SQFA 2NPFA 3V6DA 1YJ7A 2QV6A 2GS8A 2DH8A 4OYIA 4AXJA 4JI7F 3T9NA 2V0NA 3CCLS 2DPIA 1K44A 3V4IB 2DR6A 4I7FB 2VHGA 1FK9B 2IAJA 3DRXA 3EDRB 3MPDA 4X64F 2DR5A 2G1HA 2PMHA 2HFOA 4ECSA 2V94A 1QJHA 1YSJA 5ETLA 2DGTA 1TKZA 1Y3KA 2HBRB 2ZH6A 3PEJA 4CLFA 3HSDA 1MN9A 3H5SA 1S1VB 2OP5A 2B3TB 3TJ8A 5F8NA 3L7UA 4RR5A 3RW6A 1RKJA 5I3PA 1RAOA 3QMQA 5AE1A 3AJ1A 1F5AA 1QE1A 3K59A 1X4CA 2ZH7A 1C0TB 1P6TA 3KJQB 1U8SA 3QYYA 1NKCA 3KHLA 2A6MA 2SXLA 2C3PA 4ZIWA 3G6YA 3EUNA 4JUZA 4J7CA 2R8KA 2DXFA 2BYCA 1KTVA 2B4UA 2MB0B 4R8UB 3NCRA 2HK3A 2OPSA 1KKHA 1KD1T 2WCXA 3PV8A 2I1RA 5ETKA 1SPBP 3RBDA 1RBLA 2KVQE 1I94J 4ICLB 3I32A 4DUZF 5J2MB 2ZEJA 3PFOA 3H0PA 1TMMA 4PQUA 1TP7A 4ZPDA 5IV4A 3THPA 3HX9A 3DKDA 3KXDA 1WKLA 2RU3A 1BY9A 3GE9A 2CJXB 1N5SA 2BA9A 4O3SA 2V4JA 3MUVP 3VGTA 2UZAA 3THTA 1HQEB 2HHHF 4NLTA 1EKRA 3D1QA 4OMFG 4OI4A 2BW2A 3W2VB 1IR0A 3AY0A 4HTIA 4A8YA 4NLQA 4TU7A 2R7XA 3HDSA 2UXCJ 1RT3B 2H5IB 2DEJA 5DS7A 3UN5A 1Q79A 2DYAA 1W7WA 2DNPA 1J27A 2E9RX 5EUHA 1V9OA 5HK4A 2ZZMA 3H5XA 1ZAWA 3PIOQ 3PEHA 2YTCA 3K5NA 3P5BP 1M5SA 3ET6B 1REVB 3CJ3A 2XYGB 2M70A 1HI0P 2COLA 3CMES 1AW0A 4N76A 1IBLJ 4CO5A 2CQ3A 1Z2LA 1FRJA 2YQ3A 2MKIA 1HA1A 1X4BA 1RA7A 1UEKA 3VAGA 1R0BG 3QPIA 3CCRS 2HGMA 2FHJA 1YWXA 2IVFB 3ETOA 1R3NA 5I3QA 3IMQJ 2DRBA 3KUGA 2FQQB 1LWEB 1UEVA 2X3GA 1SV5A 2C2OB 5HP1B 1R8BA 3PRVA 1HYSB 2BQ3A 2HBQB 3L9ZA 4QOTA 4WCEQ 3H4DA 4OL8A 5HSPA 5B7WA 3HT3A 3E01A 2QA2A 4ZVPB 4DPUA 4KKOA 4IG3B 2CNLB 2RD5C 2F4FA 2V2VA 2I5JB 3EX7B 1V5IB 2BJ3A 2Q43A 4IUFA 4DSLA 2PC6A 2LXIA 4GKJJ 4I6WA 2RF2B 3KLHA 2WW4A 3DRPB 1VQOS 4O3QA 3AXKA 2FY1A 2Z0GA 5KFBA 4NCGB 2QLJB 2GO9A 3QQCD 1NB7A 3C16A 3B54A 2ZKTA 4RW8B 2WK4A 4P71A 4OHZA 4DV1F 3GILA 2MZQA 2UUCF 3ZZOA 2DKOB 3K5OA 4MTPA 3G87A 2Q1LA 4C48A 2QL5B 4X84A 2RB7A 4H54A 3M7VA 4HI2A 4UUWA 4A8OA 4XK8C 2NREA 2EKYA 4DJBA 2WVCA 2UUWA 3HJVA 1L5UA 3I87A 2HRUA 1U2FA 5IZHA 3Q8VA 1NAQA 3HVWA 3GQCA 4OHVA 4WIIA 3PYEA 3GYXB 2XEXA 4WWSA 4HH1A 3BGLA 2QE5A 2C2EA 3FZ2A 3G2XA 1AXQA 4AL6A 3CJSA 2IVMA 1X4HA 3DCAA 1CC7A 2E1RA 5IOLA 2R2UA 4CH0S 2IM0A 2CFXA 5DQIA 4F3MA 2GIRA 3AD9C 4USTA 2MZTA 4KTQA 3CJ4A 2LDYA 1QD1A 2XHCA 2DNNA 2GNKA 1S1WA 2UUBJ 4LFBJ 3W2WA 4UOGA 3AD7C 1U48A 1WG5A 1VBYA 1S0VA 2MZSA 3M32B 5ITHA 2AJ0A 3A12A 2JLEA 2KVIA 1B99A 4AFFA 2EG2A 4Y00A 4LIWA 2LDIA 2UVVA 4ZKAA 5GAGI 1KRPA 4OI0A 2OFHX 2EXUA 2QIFA 2GHWA 4WFYA 4ILRA 1MROA 1NJIT 4V1Ak 2YWEA 2ZVSA 2E29A 3FCHA 3OUYA 1Y9OA 4CO4A 3SFGA 2ZDPA 2QRRA 1N34F 1QUVA 1XIQA 3VV2B 3QRPA 1B7FA 1YG0A 5A8RB 3IGNA 4KHPF 4DCPB 1ZAVA 3M8ZA 1RYRA 1DRZA 2HBYB 5B0BA 2IMWP 2F9JA 1QDUB 3UWTA 5IXUA 2VL1A 2J8SA 2VQFJ 3DOMA 2A18A 1RA6A 1S6OA 4Z2XA 1FRXA 3OL6A 3UDEA 3LP1A 1UW9A 4K2XA 1RHUB 2NXUA 1R8AA 1SJ3P 1EAYC 1VQLS 1FNOA 1HI1A 2MLXA 2HFNA 5HROB 3ZZRA 3GG1A 2ZBIA 2ZBRA 1RAFB 4F04B 2X1BA 4B9VA 3EE3A 1S6PA 2IMOA 4QCLA 3TAMB 3IXQA 1EHWA 4Y3CA 3JS9A 1XJWB 4QIEA 2BJDA 3IWXA 1KP6A 3RB4A 1AB8A 4TQSA 1SC3B 4DR2F 3UNGC 3SQGB 1F5BA 2YXLA 3PKMA 5DG8A 4FF3A 2AD9A 2UXBJ 1IWGA 3CJTA 3BDPA 3QFHA 2W8KA 1EETB 1IM6A 1AFJA 4OX9F 2GJFA 2IHR1 3PW7A 2CNKB 1UAWA 2KG1A 1B70B 4M5KA 4USIA 1FO1A 2B9WA 5KFYA 3US5A 2AW0A 2GMHA 3VF0B 4R5PB 3I9ZA 4HHJA 1JLGB 4NLVA 3KKFA 1VQKS 4DOZA 3K5MA 4X66F 3BDEA 3QSYB 1K47A 4M5NA 5KG1A 2MKYA 1J5OB 1IKYB 3BYPA 3S1TA 1T7PA 3PXGa 2IY5B 2ASYA 1VDHA 5GADI 3M2VA 3W5ZA 2XMUA 2YNFA 5A6WA 2XM3A 2K2PA 5KFHA 1CJTB 3UCZP 3G6VA 2R8GA 4ECQA 1T9TA 1XBWA 2G0CA 1FJCA 4C8LA 2F4VJ 4ECWA 3W62A 3FEYB 1GEHA 3BBCA 2GVDA 5C24B 1XMOF 4LFCJ 2PT0A 3FSIA 2RHSB 2DJWA 1UTAA 3NNCA 3IR5B 2HVDA 3ISZA 2E7XA 3M8QA 1JLQA 2VF3A 2MYFA 2QYGA 1F3VA 2EC0A 4LF8F 3NGTA 3OVAA 3OSNA 4A47A 1I1GA 1YHQS 3O3LA 3GV5B 5D3GB 2DXEA 2DXDA 3Q22A 4ZP7A 4DR3F 1YJNS 3HHLD 1WOOA 3B8HA 4L74A 2V2KA 3OLBA 3V6DB 1KQKA 3P6YC 1E6VA 1U1QA 3CJKA 2IAJB 2FGOA 1QUPA 2A3JA 1PGZA 1QAYA 3DNCA 4TN2A 1RHQB 5GAGU 2HAFA 4EEYA 2L48A 1TKZB 4ZVOB 2FZKB 1M1HA 1G7CB 1CSJA 4XPCA 4V19J 3W5XA 2H3EB 2A0FB 3BKTA 1TK8A 4I56A 3MPWA 4PCQA 4CM0A 3GP9A 4FBUA 1B3TA 5CYJA 3JB9k 5D4OA 4B9NA 2IJFA 1Y11A 4N77A 1VC5A 4F26A 1QE1B 3W9JA 3GIIA 2FJDB 4LRDA 3QGGA 3BZQA 3KMQA 1VS3A 5ETPA 4DCJB 1SVDA 1U1OA 4WKRA 4GRSA 4YY3F 2KFZA 5L9NA 4DQSA 2ZH9A 4ILMA 3U27A 1UP1A 2KU7A 4DL6A 3HLUA 1DFDA 1W25A 2OPSB 2IA0A 4RWXA 2BXJA 1A6LA 1SB6A 3Q8RB 3M8RA 1S9EA 1QSYA 4LBIA 4C98A 4HHUA 1JIHA 4ES3A 3SBMA 5D4PA 3FJ2A 1J5EF 4RNHA 2DEIA 2DO4A 2PA8D 1U6FA 2ZE2A 3ILJA 4WYLA 2HFZA 4WF9Q 4NZ6A 4OYOA 4PQUB 5LM7E 4ZVUB 4TYAA 2CG8A 4M5LA 1GXTA 4Q8FA 2V4JB 4GC6A 2EPIA 3IM8A 1R6YA 3WC0A 2AJFE 3ILOA 4FS1A 2RDIA 2LQ9A 2JWNA 1TVRA 4EWTA 4IDKA 1JJHA 1X4AA 4ED8A 3ILLA 3VQTA 2HLUA 4USKA 3UCGA 5B08A 3VTIA 2XSFA 1OWXA 2LYVA 3H5YA 1SH2A 4F0KA 4JI2F 3TA0A 2KL8A 2UV8A 4RZRA 2OEKA 3QT5A 1IM4A 3BO4A 5E2QA 4P73A 3I96A 3FUYA 3LGNA 3NWRA 1MW7A 1SL2A 3KHHA 4FNHA 2ZWPA 3Q8QB 4BBYA 2BACA 3H59A 2Y1LB 3QATA 2LKZA 4HYKA 5KFQA 4YOEA 1RTHA 4KV8A 5DETA 5JJBA 3KNAA 1YJRA 1OMSA 3CCWA 5DGBA 5GADU 4R0JA 2KT5A 2Q6BA 3H20A 5HANA 1X31C 2BUNA 1HHQA 3N9UC 5GAEI 3TOQA 5IT0A 1S6QA 3CC4S 2HQFA 3P4UB 2N3OA 1HIYA 2JLFA 2GMLA 3TX0A 3JAMU 4JYAJ 4G1PA 1IR1A 3ZTRA 3J81j 1SV5B 1R6VA 4F50A 4JI5F 2BW7A 3P96A 3BN4A 4DUYF 4OHWA 3BSNA 2C28A 2L3MA 1N0UA 1EP4A 4QYRA 4FVCA 4JOUA 3E01B 3PZPA 3AD8C 2XNRA 2OD6A 2VDIA 2J76E 4KPCA 3CUNA 4RW4A 4KKOB 3NG8A 1N5YA 3CMAS 2EEYA 3EWGA 5J2PA 2YNHA 1WWHA 2D3ZA 2A6OA 3OQ2A 1MMLA 3G82A 4NYOA 3DN9A 5THWA 2HW3A 2H5EA 3KLHB 1PYOB 3GU0A 5E41A 3D3BJ 2EKNA 4W92B 2N3LA 1S57A 1LWCA 3HT0A 3FSXA 4LF5J 4WFBQ 3RAMA 3BGUA 2YPYA 3C16B 2HBZB 3PW5A 4S0MA 2XI2A 4EYIB 1VRUA 3OJSA 1FJEB 3PVXA 4DF4A 2OELA 3MM5A 4X4NA 3GSDA 4PXBA 4L73A 2ADCA 1FXLA 4JV2A 5ETNA 2AYMA 1WKKA 4CO1A 4Y2AA 4PYDA 3EGZA 1JX4A 3V6JA 2PEBA 4FYXB 4ZVQB 1S48A 3D28A 1WSRA 1VQSA 1KLNA 1EQ0A 1NEEA 3C2PA 1WI8A 2V8HA 4DL7A 4U8VA 3EZUA 2MZ1A 5F8JA 2K1RA 4DSKA 2R7UA 2JDJA 4O44A 2C3MA 1JKHA 1HQ2A 2DNQA 5LL6d 2HHQA 3SEOA 3ICLA 2V50A 4C9DA 2QJ3A 1Q7LB 2MGZA 4DLEA 3TNVA 5E7OB 4EO6A 4EGLA 2P6SA 3G8TA 2W4CA 4FXDA 3KMSA 2DIUA 1DHMA 3M8YA 2MDAA 2A2CA 2CJ9A 2NLWA 3JSRA 1ELOA 4MIWA 1M5OC 1S1WB 1T9WA 1R0AA 2MXYA 1DJ0A 1NK4A 2V69A 4DV3F 5GVQA 3W2WB 2X3DA 2UXDF 1G4CA 3AOBA 3HI9A 1AFIA 1VQPS 2KKHA 1S0NA 5FLXY 2OAUA 3NXZA 2KYXA 3A3OB 2BZ2A 4CIOA 2W2NP 5M2RA 4QWDA 4ECVA 5DM7Q 2J0QD 3HP6A 1N56A 1VCTA 2XO6A 4EBEA 4NCBA 4USHA 1ULRA 4MKYA 1N33F 1Y5IB 4N7TA 3GCWP 3SQOP 2O66A 2I9SA 4ES2A 5A2QY 1W2BR 3AJ2A 2VFTA 4X65F 1MROB 2BKPA 3CD7A 3OUYB 1Q7YT 2JJ4D 4RUHA 3QGHA 4OYAA 4I2QA 2FTRA 1TK0A 2K8GA 3TAPA 1HWIA 2F65A 3EZOA 3DFEA 2FJAB 4ANCA 2JZ5A 2OEJA 1RKIA 5LJ5Y 3M2UA 1CPZA 3F56A 3IFEA 4LF1A 5CYMA 2MZJA 1IBLF 1YX2A 6FD1A 3L3CA 4MIAA 5GAEU 1U1MA 3W9HA 3DOMB 2B51A 2CZ4A 2C2RA 4LR8A 4LF9J 1PJ7A 1V6HA 5KFGA 3LP1B 2VKRA 2XY7A 1PCAA 3GV7B 4DHVA 4X4TA 2DHAA 3WDOA 3KHGA 1FWKA 4B3TF 3OHBA 1X4GA 2EBGA 1N32J 4PUOA 1FHTA 4MT1A 4DV6F 4LUBA 3MEGA 1S6PB 5GMDA 2N7YA 3QJJA 4FN5A 4UW2A 2N4DA 1Z2ZA 4J9LA 4JI0F 2BOAA 2XI3A 3LO3A 2Z8QA 4ELTA 4LF6F 4YDXA 3M05A 4F4ZA 2M8DB 1YJTA 3VAHA 1HBUA 5K14A 1VQMS 1RHJB 5GMEA 1T02A 1OO0B 3AA9A 2J6SA 1I3OB 4QU7A 1K9MT 1FRHA 5E3RA 2ILYA 4PRFA 1X9MA 1VFJA 3BBFA 3EXYA 2KJVA 3TUIC 2OD4A 2JFKA 4UOFA 3W7BA 3FVYA 1JXVA 4RBUA 3IG1A 3D67A 4RWWA 2ZC3A 1IQTA 4F4AA 3R8YA 1KOOA 2AZ3A 2GV1A 3QAEA 4P7VA 5KFFA 3GIRA 3C46A 1JNRB 1YJWS 1GK8A 4JI1F 4CO2A 1CJKA 2CDRB 4NCAA 3KG4A 4ZPWR 4HDHA 4ZLLA 3PRDA 1IQZA 1HNIA 3BBBA 4DV4F 2DH7A 3M2VB 4JI4J 2YNFB 4LF7J 3E51A 2HZCA 4F4XA 1MWZA 1ZBTA 4HR2A 4N56A 1UFKA 1FX2A 4OHXA 1VJQA 4PXDA 3DLEA 1Q8KA 3IBCB 3F0NA 4YFUA 1GQEA 1RWWB 2DNZA 3Q8PB 2NPIA 3G71S 2GVDB 1G3OA 5CHCB 4FNIA 1EKSA 4CCHA 3M8QB 1JLQB 2R7QA 2AGPA 3DI6A 4YEAA 4R25A 4U96A 1GNKA 2YQ1A 3NGDA 3BQ2A 1RTDA 3TZXA 3F44A 4L3KA 3Q2SC 4JI8F 4U6PA 4DXLA 3OD2A 2XYPB 3K8VA 2F8MA 4B02A 2A2DA 4ZCLA 3SYZA 1P9QC 1YRTA 4NRTA 1PYTA 1SIWB 4I67A 1E6VB 4NLDA 4LFBF 3CJKB 1RE1B 2POKA 1NDCA 2VIHA 1R31A 1VQ6S 3RYLA 2FJXA 1Y0HA 4ELUA 3RG6A 1WHXA 1U1RA 3QT7A 1IBKF 3MD1A 1FE4A 5LT5A 3TJ9A 2CDQA 4PG5A 5DJBA 4NA3A 2LQ8A 3DLKA 1UA1A 3JXOA 1UZHA 3WHIA 3V81A 3T9ZA 1RUSA 5IT9U 3SZ2A 3PYDA 2ZH5A 2BVZA 4DEZA 2BRLA 4J90A 4TLRA 4HLBA 3BSCA 4LIRA 2C2ZB 1WF1A 2CXEA 4C8KA 2PIIA 3ONQA 2V8DA 3MEDA 5H9EK 2FJVA 4QPTA 2E7WA 3LH2S 2CPZA 4CO0A 2CZ9A 4NX9A 4OQJA 4LFAF 3C66A 2RS2A 1TL5A 3P5TL 3HD1A 2WB1D 3CTRA 2BKNA 2K06A 1FFWB 2FD2A 4EZ9A 2GIQA 1VIXA 2RJZA 4KBIA 4DV5F 3CJQA 3GFXA 1GX6A 3I5CA 3MURP 3MCMA 2Z2YB 3EYZA 4IRDA 4AYBD 4NLPA 1ZM2A 2QLBB 4DPYA 1S5ZA 6AT1B 1RT4A 1XNQF 3H2UB 2F8EX 2R7TA 2CRLA 2XMKA 4EO8A 1S9EB 2W1BA 1QSLA 4QWEA 1U25A 3UI3A 4YR2A 5M2UA 1MSWD 3QIPA 1SC6A 1BE4A 5KAKA 2ZE2B 3FQLA 1TL3B 3FCWA 2XLIA 4OV6A 2CJBA 2MKKA 2JSXA 4HDGA 1EX8A 1AZSA 5E33A 2NUUG 2YWGA 3OT9A 1TKDA 1Y5NB 3HZEA 1LK7A 2MEWA 3CCES 2M4MA 3MMAA 4DZDA 3IRXA 2X7IA 1TVRB 4IDKB 3T41A 1P1LA 2AQ4A 2HNZA 1NJZA 3VWSA 1KVJA 5ETOA 2EBEA 4ZHRA 3A8JA 3T1HJ 1M5KC 3OHAA 4IRCA 2YKOA 2KI2A 4NXNF 4CNYA 2MJNA 4ZLPA 3FEXB 1X0FA 2Z2MA 3EPGA 1NJXA 2R2SA 1PJ6A 1WEZA 1CULA 1N36F 2VPZB 3R2DJ 1FERA 4OZ0A 5CA5A 1R8HA 2E9ZA 4EUVA 5D4LA 1TL7A 3TUZC 3U1NA 3R1LA 4JI3J 3CCSS 1RTHB 1WOSA 2HVEA 4KV8B 4ECRA 4WYWA 3BPDA 4ZPCA 3IWNC 2FJBB 2VG5A 2Q3PA 5HMZA 1I5OB 4N41A 1HHSA 2YQ0A 1A0OB 1C2PA 1H2TZ 1S6QB 3C15A 1T03A 2VQEF 1ACMB 4HT5A 2I8EA 1C4CA 1QVGR 2J8AA 1X5OA 3OXLA 3BGFA 4KB7A 1V5VA 4CH1A 1RWPB 3HHDA 3KK3A 2E1PA 5HVHA 2UU9J 1D09B 3K8WA 3UDVA 1KQGB 2ZJQQ 5KG6A 4KY3A 4CT8A 4AL7A 4EFAC 4RUCA 2E5JA 1RAIB 3I4HX 2ZH4A 2HYIB 1RK8A 1MWQA 1AA1B 5KFSA 5KFZA 1Q81T 3UO0A 4GC7A 4OLOA 1EP4B 4RUAA 2YNIA 4O23A 2ROGA 2JC0A 3H90A 1FEEA 4RW4B 2CPYA 1N5YB 5J2PB 2YNHB 4A8SA 3N5BA 2K7JA 3GFHA 2WSFC 2D74B 3G82B 2IRYA 3I0RA 2E5GA 4WP8A 4RW6A 4ZOSA 2CJQA 1LWCB 3AB4B 4OZ1A 1NMEB 3D9BA 3N5FA 4G1IA 4NZ0A 3TWZA 1VRTA 1JXLA 1WC6A 1VRUB 3R5BA 2J7WA 3B4DA 5KT2A 3MPYA 3CJ8A 2H9ZA 5C5JA 4DX8H 1TAUA 3MM5B 3D0GE 3R3TA 2KFNA 4CLLA 5LMNJ 1U26A 3DOKA 1RT5A 3Q8UA 3R1HA 2FGCA 1JLCA 3D6HB 1CQNA 5A0YA 5KTQA 2G4BA 2CVIA 2DO0A 3TI0A 2NQPA 2MMYA 2RMLA 4BWMA 1X5SA 3OJUA 2YWHA 2PFDA 2VOPA 4DWIA 1D0EA 1U02A 2WB4A 4RW7A 3NY0A 3OL7A 3KK2A 5HN0A 4OIXA 2K1RB 1XEZA 4O44B 1IJEB 4F8RA 4USUA 1JKHB 2VUGA 2C2KB 4K0KF 4XTTA 4ETXA 2P9CA 2J5AA 2MGZB 2CVEA 3HHLC 3DOLA 4DR7J 2WW8A 1V3RA 1FVSA 4ZLJA 3T6BA 2O01C 5CYQA 1F60B 4C8YA 4EBCA 3HJFA 4A8KA 3HHEA 5HL7Q 4DX7A 3IS9A 3LAMA 2X51A 4ZK7M 1R0AB 2DGQA 2OFGX 5B0DA 2CPXA 3KLEA 4B3SF 4WE1A 4J37A 2MQ8A 2W7OA 2VC1A 1WI6A 2R8IA 3AOAA 5IFMA 2R7OA 5G0RA 2VFSA 3LP0A 2VA3A 4ZVRB 3HCXA 4GKKF 3D3CJ 1K0TA 2G2OA 3EVOA 2OTJS 1VHIA 2Z57B 3TVYA 5HO4A 3EXCX 4FYYB 5K5MA 2X1GA 2G2ZA 2VFUA 5I4MA 3C14A 4UZBA 2J0SD 5EX3A 1B64A 1T9YA 3J80Y 3R2CJ 2ZBQA 1UL3A 2DPJA 3IWLA 4OZ2A 1NSPA 1UVJA 3V4MA 1N5TA 4OV1A 3GR0A 4OYWA 3M2UB 3GZ7A 4OI1A 4O0NA 3M6XA 5CYMB 1HHTP 3FBBA 2AP6A 2IYGA 1D9AA 1F9EB 2EFNA 3RUBL 3UW1A 1RYSA 2FVPA 4KHMA 2ZOGA 4ZPTR 2H1YA 2ZVIA 4DV7F 2B4OA 1FXRA 3AFGA 4B3MF 1SJFA 2EVZA 2NXCA 5K8NA 1FE0A 4J9VA 4F3QA 1HARA 2QSWA 3WIVA 4K4UA 1KTQA 1FEHA 3KHRA 4P74A 3UPFA 4DI6A 3LA0A 3SCKE 5SUHA 4PUOB 4ZIVA 1KONA 2AZ1A 4J9MA 3MEGB 5HAOA 3GPAA 1NBEB 3HSGA 3UCUP 1FI4A 1KOHA 2VA2A 1OS5A 5CZXA 1HBUB 5K14B 3TUJC 1FKOA 1FXDA 4YUDA 3WZ0A 2IDLA 3VGUA 3M9OB 4KIAA 4PYAA 2PMZD 1K8AT 2MSSA 5IC6B 1T9VA 1N0VC 1M0SA 2GJIA 1Q78A 1TKTA 2M88A 4NLSA 5KFAA 4PPDA 3NP5A 4RPFA 4QYZK
chains in the Genus database with same CATH topology
3K5MA 3IG1B 3VZIA 2J9EA 4X66F 3BDEA 5B0CA 2OJ3A 1YGYA 2UUAF 5KG1A 2CQHA 2HAIA 4P2SA 3TYTA 2YNGA 2FVCA 2XSJB 4ED3A 1J5OB 1IKYB 2YKNA 4B08A 3S1TA 1WHVA 3ISND 1T7PA 4ZP8A 3PXGa 2WBRA 5BJRA 2ASYA 2RQKA 1TR0A 5GADI 4A8QA 3M2VA 1GTHA 2F40A 5C25B 5EGYA 2AYEA 1KFDA 2XMUA 3GB0A 2YNFA 2YX7A 4ITSA 5A6WA 1VQNS 2GFFA 2K2PA 1WEYA 3M8PB 5IS2A 5KFHA 3OTBA 2HVZA 3OBIA 5K8OA 1I94F 4Q45A 4QWCA 3UCZP 3FZBA 3G6VA 4QR2A 4ECQA 3N0VA 5KFUA 2R8GA 1XBWA 3OSPA 1HNIB 1C0UA 4MAKA 2VPWB 3BS9A 2G0CA 3MMJA 1FJCA 4C8LA 1HBMA 5L9XA 2LU2A 3NS6A 3LWLA 3AA8A 3FRZA 5BYQA 4ECWA 1JLFA 3FEYB 3DLGB 5KOXA 3LF0A 5E5NA 5C24B 1XMOF 2LQBA 4WK1A 4O3RA 2PT0A 3FSIA 2ZD1A 3JSMA 2DJWA 3NNCA 3IR5B 3SCJE 2QEXS 2CQGA 1FTRA 2B9XA 2HGLA 4K4TA 2WONA 1FRMA 3ISZA 2E7XA 3M8QA 3DLEB 1JLQA 2G1DA 3IR7B 3O44A 3H40A 1Y7PA 2MYFA 3QZ8A 1VMBA 4RW9A 2MQLA 5KG2A 2HPUA 1XWLA 4WFNQ 4A8WA 1LFPA 3PR4A 2R7SA 1P1TA 1HPZA 4EYHB 1S0MA 2EC0A 3NL0A 4LF8F 3OW2R 4J9OA 1RWUA 3H98A 3MTKA 4K5SA 2AV5A 5J1EB 3OVAA 3OSNA 3H8YA 4A47A 3CCUS 3TQ1A 1LQ9A 3MFIA 3GFZA 4CI0B 1M90T 1D9DA 1RP5A 1I1GA 1YHQS 3DC2A 4TKTA 4Y34A 3RB0A 1T05B 4ED7A 4KPYA 1UMJA 2XWYA 3MMBA 2YKPA 3O3LA 2OLWA 1FCAA 3DI6B 1KC8T 3GV5B 4I7FA 3OR1A 1OSCA 5AXKA 5KFRA 3V4IA 5D3GB 2OPRA 1FK9A 1BQNB 2NSBA 3Q22A 4ZP7A 1FD8A 4DR3F 1YJNS 1S9FA 3HHLD 1RTDB 1NKBA 3B8HA 3CWJA 3OR2B 2UXCF 4UOCA 4FP9A 2GW8A 1APSA 2V2KA 4QU6A 3OLBA 2RUGA 3V6DB 2HVHA 1SQEA 1KQKA 4K5RA 3P6YC 1I6JA 1E6VA 1U1QA 3D5MA 1YJVA 3Q24A 3T1HF 2JLGA 2LLZA 1YVFA 3CJKA 2ZH8A 2J6UA 3UD3P 2IAJB 1N6QA 2FGOA 1H7WA 1BC6A 1QUPA 2A3JA 1KSPA 2BANA 4X4QA 1QAYA 1PGZA 5F9LA 3DNCA 4TN2A 4ETZA 5LSLA 1PILA 2DHSA 2HG4A 2AWZA 3GFYA 3SDEB 4RNOA 4C11A 1S1VA 1FKPB 1DQ8A 5GAGU 2B6AB 2EK6A 5IM0A 1QVFR 4TQRA 2ZNYA 4EEYA 3DLHA 3DHXA 4Y6IA 3QGPA 2L48A 1DARA 2IBOA 4PQAA 1TKZB 4DFKA 2ATLA 3CD5A 2GA7A 1U6ZA 1YI2S 4C97A 4E8UA 5FDLA 1G7CB 5KG5A 1CSJA 2RQCA 4X4VA 5E3CA 4XPCA 5HLFB 1C1BB 4RKUC 4IFYB 3QLHA 2NR0A 3J81Y 1K73T 1YQHA 4V19J 3D1HA 1C0TA 4FZVA 1UVKA 1ZM9A 2CJKA 1TK8A 4ZMMA 4I56A 3MPWA 4DF8A 4FXWA 5EX0A 3RAXA 2KT2A 3CJ2A 4PCQA 4FBUA 2GMJA 1T95A 4KFBA 4KO0B 3DLKB 3QWUA 1T94A 3PJXA 5CYJA 2RQ4A 3JB9k 5D4OA 2QA4G 2IJFA 2UVUA 4B9NA 1CLFA 1LKZA 1HD0A 3V81B 3CSKA 3THVA 4F2RA 4N77A 1VC5A 2GO8A 3VAFA 3HVAA 1X0PA 3ZFVA 4F26A 3MTJA 1G6BA 1QE1B 1RT2A 4JI3F 4HKQA 1HWUA 4KHRA 2FJDB 3BGRA 3GIIA 1S72S 2HHUA 4MJKA 3GV8B 3UD4P 4BCAA 5D77A 4LVOP 3K5PA 3BEGB 1RT6A 3BZQA 3QGGA 4IO1A 4DL2A 3KMQA 1VS3A 3Q23A 2F8HA 7FDRA 1N5VA 4F4WA 4R8UA 1IKVB 1NRKA 3CJ0A 3RTVA 2BABA 2ZNZA 2XULA 2K3IA 1H2UX 4WKRA 1U1OA 4WKYA 1M5PC 2QO3A 4F67A 3MEDB 3QO9B 5F3TA 2C3YA 4YY3F 2KFZA 4TY8B 5L9NA 4DQSA 3OLAA 2ZH9A 4OX6A 4ILMA 4Q0BA 3F41A 2M52A 4CTAA 2DNKA 2QYCA 3U27A 5KFWA 1UP1A 3PY8A 1TFYA 2WAQD 2KU7A 1SUQB 4DL6A 2XGQA 4ICLA 2Y1IA 2A10A 4QIFA 2W9CA 4FF1A 3DU5A 3HLUA 1DFDA 5J2MA 2FDNA 2DK2A 1W25A 2OPSB 3MCSA 1LW2B 1RT7B 2IA0A 5KG0A 3PX6A 4B9MA 4RWXA 3V5RA 1HNVA 1C1CA 3H5UA 5G4DA 1VBZA 2BXJA 2MQMA 1A6LA 1SB6A 1DTQB 4ID5B 5KT7A 3ITHB 4I4BA 3Q8RB 3FMBA 1VGYA 3M8RA 1S9EA 1QSYA 4C98A 1HFEL 3MD3A 2ZJRQ 1JIHA 2BOPA 4ES3A 1RISA 2VBWA 5D4PA 1UVIA 3FJ2A 1J5EF 1CG2A 4Y0FA 1SJRA 2IRXA 3OTEA 4RNHA 4W90B 2DO4A 2PA8D 2FHOB 2RDJA 3WBZA 5KFCA 3TARA 1U45A 1U6FA 2ZE2A 5I3UA 4WYLA 2YH0A 1RT4B 4MYTA 2LEPA 3IR6B 4DN9A 3OTOF 1D8ZA 2HFZA 4DL3A 2DRAA 4WF9Q 3OVSA 4Q7AA 1Q82T 4DR1F 3RR7A 1HBNA 4NZ6A 3LW5C 1LW0A 3IO1A 1KHWA 5DRKA 4DDFA 1HQEA 4PQUB 3Q2TC 2HHVA 3TANA 3HZGA 2DBBA 4DSFA 3ZZUA 5CQGA 4TYAA 3M6WA 1RTJA 3MMCB 3QIPB 3T3FA 4J9QA 2CPFA 1S9GA 4PG4A 4GKJF 1GXTA 4PWDB 2QT7A 4Q8FA 5KFMA 2V4JB 2DNOA 3BO3A 5KFPA 3W2VA 2BE2B 4C3KA 4ZCMA 4IYQA 4GC6A 3MR6A 2EPIA 3PRBA 2XS7A 1R6YA 3CCVS 3WC0A 2AJFE 1YITS 1V3SA 4FS1A 4C7QA 1Y4ZB 2RDIA 2LQ9A 2JWNA 2W7AA 1TVRA 1PC4A 4EWTA 3EPIA 2LXUA 4IDKA 4DFMA 3TVZA 1QAIA 3AHPA 3T19A 4A48A 2PI5A 1JJHA 2GGPB 1X4AA 4ED8A 4IH7A 2YVSA 2MY8A 1RT3A 1NNDA 4J9KA 3MGJA 3DRSA 1TV6A 2BDPA 3UFCX 3JYTA 2FPHX 3VQTA 2HLUA 4ECYA 2GQ2A 1NH8A 4ED6A 3MMAB 3CCMS 4ZPVR 1U2RA 1MU2A 4U67Q 2R9LA 3IRXB 3UCGA 2XHWA 5B08A 2HHXA 3VTIA 1SL1A 2XSFA 3EGNA 1OWXA 2Y0SD 2LYVA 2QFJA 2GX8A 3BB5A 2HNZB 4YR3A 3H5YA 1SH2A 2ZH1A 4JI2F 1Q16B 2JH3A 3DRYA 3KNGA 5B0GA 1JLBB 1SL0A 3TA0A 4ZHRB 1S76D 3LANA 1REVA 2UV8A 1WACA 4RZRA 4UUXA 5F8MA 1IM4A 3BO4A 5E2QA 3N6MA 3QAUA 3I96A 3GWCA 2V4RA 2P6TA 3MDFA 4IG0A 4OZNA 4JV5F 3LGNA 5BYSA 2ZDOA 1ZETA 1MW7A 1SL2A 2MQQA 4Q2MA 3CC7S 1KNZA 1HW8A 1SXLA 2G13A 1S6UA 4KGKA 3KHHA 3D1OA 4FNHA 2FVRA 3Q8QB 1WHYA 2MKJA 2DNGA 3CPWR 1VLYA 3I0SA 1X7VA 2ZKUA 1UEUA 5LMNF 1E6YA 4BBYA 2BACA 2HIQA 3MM8A 3H59A 4DN0A 4ED1A 3VCDA 1SJ4P 2DNHA 5L38A 1H38A 1SJ1A 2CPJA 1R7IA 2LKZA 4HYKA 3Q8SB 1VQ7S 2HWIA 5KFQA 4YOEA 2VG6A 4HH0A 4AQYF 1RTHA 4MKBA 2EG1A 3V6KA 1U1LA 5ADZA 4G1QA 4KV8A 5H9EJ 5DETA 3AQPA 2WSCC 2BBEA 3QJLA 3G8SA 4TNOA 4B3OA 5JJBA 2K7KA 3KNAA 3SMZA 1S4FA 1YJRA 1ZZNA 1SKWA 3C6UA 1R43A 3CCWA 4WFAQ 2B9YA 5DGBA 5GADU 4K50A 1TL4A 1Q1KA 2KT5A 3KWMA 3L7OA 1H6KX 2Q6BA 3H20A 4QIWD 4R0JA 4FYDA 1U4BA 1VQKS 2MKSA 4BWJA 4JV0A 2D3UA 2ABYA 2BUNA 4RBTA 4A8FA 3KLIA 3FEZA 3N9UC 5GAEI 1LWEA 1UFLA 1LXNA 4OJ3A 3TOQA 1N48A 5IT0A 2AJQA 2DVIA 2B43A 1S6QA 3MM9B 3CC4S 4I1TA 3G96A 3TVKA 2L41A 4BDPA 5HP1A 3MECA 2VG5B 1LWFA 3MEKA 4Q5VA 2N3OA 1HYSA 2IYIA 2LEAA 1B0VA 1R8CA 5DLFA 4H4OB 5M2PA 1U6BA 3M30B 3G9CA 3BSOA 1SH0A 3T5HA 3PW0A 4HT7A 4ZS6A 4ZVFA 2CIMA 3DYAB 2JLFA 4I2QB 2GMLA 2CQPA 3JAMY 1FDNA 1WG1A 1NK0A 4QZVB 4G1PA 3DRRA 2VB6A 1T03B 3A1YG 1SV5B 4DR6F 4MKAA 3ZC4A 1FRKA 5HI7A 4JI4F 3OVBA 4DR7F 4F25A 3V6HA 4LQ3A 3DGPA 3CDAA 1KVIA 4F50A 4QPXA 5F8IA 4JI5F 4WXWA 3CJ5A 5JXSA 5KFNA 3I56S 3BR9A 3NRBA 2UUBF 3P96A 3BN4A 4RX6A 3KK3B 1HWKA 4KSEB 4DUYF 4JBCA 4OHWA 3BSNA 4IG3A 3SCLE 2C28A 3OFHA 1NK9A 2L3MA 1N0UA 4X4PA 1F0XA 2DNRA 2IM2A 1EP4A 2V8GA 2I5JA 4QYRA 3NKYA 4FVCA 4JOUA 2MPUA 4HI1A 3CULA 2YX1A 3E01B 4I2PA 3PZPA 2PD1A 2PSZA 4FVMA 4A4JA 3FRYA 2I2YA 2XNRA 2OD6A 1TK5A 4IQXA 4NZ7A 2RQMA 2J76E 3CUNA 2RF2A 4RW4A 3VR1A 4KKOB 1HNZF 3NG8A 3DRPA 2NZ4A 2HNDA 2M9KA 1N5YA 3CMAS 4HL9A 1C4AA 5J2PA 2UP1A 4YDDB 2HRYA 1ROFA 2YNHA 4QW8A 3RRKA 3PKYA 4RNFA 1WWHA 3LP2B 2D3ZA 2CPIA 3RRGA 3OQ2A 4X4OA 4FPRA 2YNIB 1QSSA 3GYNA 1MMLA 4LT6A 4QR1A 4NCGA 4X4RA 2UVRA 1JMTA 1P8GA 4NYOA 4OX7A 4M5DB 3DN9A 2LQJA 4QYZJ 2WOMB 4NLOA 5THWA 3CCJS 4OLPA 2HW3A 2H5EA 3OPKA 2K3KA 3KLHB 5E41A 1VHFA 1FTCA 3UQSA 4MYUA 1L3KA 3WC2A 3OV7A 3KLVA 4DSJA 3HVTA 4RW8A 5KFEA 5LMUF 4PR6A 2PE8A 4W92B 2N3LA 1LWCA 3FSXA 3POTB 1D3WA 3R5AA 4K59A 3TW0A 3RAMA 4WFBQ 1BGXT 3BGUA 3KLGB 1JLAB 5LSOA 1KFSA 2O5DA 2D3OR 3MOZA 4M94A 2FLNA 2CZVC 3I0RB 1DLOA 3A8EA 3C6TA 1NJYA 4MMOA 4YHHF 4ZCKA 5L1KA 4MH8A 3PW5A 2XI2A 4J9NA 4EYIB 5KT4A 1VRUA 2N82B 3I9V9 3M1VA 3IBWA 4RW6B 3O5TB 3OJSA 2XCPA 2HHSA 2YKAA 1XMBA 1BQMB 1FJEB 3KJVA 3PVXA 3U1MA 2CQCA 4DFPA 4DQQA 3FGVA 3CVKA 2FLLA 1CVJA 2DHGA 3FFIA 3MM7B 5AXNA 4G6VB 2KXNB 4DF4A 5I42A 3MM5A 2W9AA 4X4NA 3GIMA 1XERA 3GSDA 5CCMA 1X4FA 3DMJB 1SI9A 4J9SA 4PXBA 4Q44A 1VRTB 2ADCA 4YMEA 4DG1A 4QW9A 4C0HA 3NAIA 2RKIA 2B5JA 1VJWA 1FXLA 1KN6A 4JV2A 5F0UA 2CQ4A 4HTJA 1U24A 2MQNA 2P5VA 2RSQA 3MPVA 2D9PA 4TLQA