1FD8A

Solution structure of the cu(i) form of the yeast metallochaperone, atx1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATX1 COPPER CHAPERONE
publication title Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fd8A00
2BUNA 2QYCA 1R6YA 5B0DA 4EFAC 5B0CA 1X7VA 2G9OA 2LDIA 4YDXA 2HFNA 2BJEA 1CPZA 2KKHA 3TNVA 4YEAA 2GO8A 2XMJA 3QGPA 1KQKA 2VV5A 4HH0A 1N5SA 2PD1A 1FD8A 2OP5A 1Y0HA 2RSQA 2XMWA 3F44A 4HH1A 1Y3JA 1YJRA 3BB5A 4FNIA 4Y2IA 3WDOA 1Q8BA 2VH7A 2K2PA 2L3MA 1TL5A 1VQSA 2BBEA 5T7LA 3MCSA 3HHLB 2HQIA 2AJ1A 3TRGA 1S6UA 4Y2MA 2XMUA 1OSDA 1YG0A 3KKFA 2K1RA 4OJ1A 2N4DA 2K7JA 3MZIA 1MWZA 1TUVA 3IWLA 2KT3A 2ROGA 3DCAA 4A4JA 2HIQA 3FMBA 3GZ7A 2LQBA 4Y2KA 2CRLA 3FGVA 1XBWA 1SI9A 2RILA 1Y3KA 1N5VA 2GV1A 2IYIA 2N7YA 4Q2LA 2HFOA 2KT2A 2JDJA 4A47A 4HI2A 2W4CA 1V3ZA 5B0FA 2KYZA 2ZDOA 2AW0A 2AJ0A 2LQ9A 3BM7A 4A46A 4F67A 3HF5A 3HHLD 1AFIA 3BGUA 1Q8LA 3DXSX 2XMVA 5A6WA 1FEEA 5K9FA 3KG1A 2W4PA 2BYCA 2FIUA 1FVSA 1CC7A 2GGPB 1TL4A 3HDSA 5A6PA 2OFGX 2AP6A 1Y9OA 4OJHA 3BDEA 1P6TA 2QLXA 2PGCA 3T9NA 1P8GA 4DL0C 4OJGA 2GCFA 3HFKA 3LGNA 5F0WA 2HLTA 3VTIA 2HLUA 2K7KA 2ASYA 2OFHX 1FE4A 5B0BA 1AFJA 1W2IA 4FNHA 1X8DA 3HHLA 3KNGA 2Q3PA 3CJKB 1WD6A 3BN7A 3BF4A 3FRYA 5KAKA 3HHLC 5B0EA 1YJUA 3UDCA 2W4DA 1KVIA 4DPOA 3HX9A 3I9ZA 2ROPA 3BR8A 3LO3A 5B0GA 1X0PA 1AW0A 3E8OA 3IWXA 1Q4RA 1YJVA 4ZOSA 4A48A 1LQ9A 1N5TA 4OJ3A 1JWWA 1OPZA 1N5QA 2ROEA 1OQ6A 3LGMA 4HI1A 5F0UA 1K0VA 1QUPA 2GFFA 1YJTA 5B0AA 5B08A 2OKQA 2EW9A 2OD4A 2FB0A 4U9RA 2RU9A 1FESA 2RMLA 5IXUA 1SQEA 3QMQA 1FVQA 2ACYA 2GGPA 2XMKA 1TZ0A 1Q53A 2IFXA 1URRA 1TR0A 3K7RA 4NL5A 1CC8A 5B09A 1IUJA 1FE0A 2OMOA 2GA7A 2QLWA 1ULRA 1JK9B 2XMTA 5T7LB 2FHMA 4DN9A 2IYGA 2OAUA 1S6OA 1VQYA 2LXFA 2N4CA 2OD6A 2QIFA 4OIXA 4Q2MA 1APSA 1MWYA 2K1RB 3KG0A 4HL9A 2ZDPA 1GXUA 3CJKA 4QOTA 1SB6A 2FTRA 1GXTA 1YRXA 1OQ3A 2XMMA 1KVJA 4ZA1A 1RJJA 4NPOA 3TOQA 1U7LA 2BJDA
chains in the Genus database with same CATH superfamily
3E2EA 2QYCA 2MY7A 4YDXA 3MM7B 1CPZA 4YEAA 2DR9A 2B7BB 3M4XA 4KB7A 2V2ZA 3TUIC 2COLA 3H2UB 1YG0A 3HZGA 2KFZA 2F3JA 3HCXA 3MR3A 2DNPA 2CAJA 1S5ZA 4WTYA 1N5VA 4LSNA 1P9YA 1S1VB 2KT2A 2MLYA 4DV0J 4KPCA 2YWFA 4TY8A 1NKEA 4XDCA 2IPOB 4YR3A 4DL3A 2ACMA 4WZMA 2QN6B 3QAEA 3HHLC 2C3OA 2B8PA 4KGVB 3LALA 2WVDA 5I3QA 2DD8S 4ZCKA 4WZQA 1OQ6A 4LFBJ 3PEHA 4HTJA 1VK3A 2ZKTA 3MPYA 3QO9B 4HDHA 4K5RA 2HK2A 2KG0A 3R27A 4Q0BA 4QIEA 4UOGA 2JWNA 2B7CB 4J37A 1FTRA 2N3LA 2HVIA 4NLYA 4NRUA 1VQOS 5KFRA 3TOQA 2MLZA 2HQ3A 2QL9B 4QBUA 3MMBA 2ZUAA 3M8PA 3FFIB 2A2CA 2D69A 3JYTB 3KWMA 3OXGA 4CLLA 5CD4A 1TVRB 5T7LA 4X4NA 3V81A 4RWXA 1RT6A 4PG6A 4FS2A 1T9YA 1U8SA 4ZVRB 4ZLJA 2P8IA 3FGVA 3OTOF 4QZVB 1Y3KA 4Q2LA 2V9WA 4U6PA 1IR2A 4ETXA 2EFNA 4LFCF 3D3CJ 1VQ8S 2BR0A 2RRAA 1U6ZA 1RTJB 2F4FA 5F0WA 1T03B 1YIJS 4EBEA 3BV8A 2W4DA 2DHHA 3JSBA 1T9WA 2UUWA 4LF9J 3V5RA 1JLEB 3T3FA 2H48B 1R7IA 2RS2A 3RW6A 2Y1RI 1JK9B 1JJ4A 1ROFA 2QSFA 3OLBA 4KKOA 2W2NP 1WOSA 4NLTA 2VOPA 2NYIA 3P4UB 3ZNUA 4J90A 4DR7J 1Y11A 1FRXA 2LXUA 4DQPA 3CCWA 2KJVA 2YNIA 1RTIB 3MCOA 1N5SA 4TKTA 2R7QA 2PO4A 3WIUA 4ELVA 2AZ3A 2CIMA 3R7BB 3T1AA 4PXCA 3HFVA 1HD0A 5EWEA 4DV7J 2OPQA 2N7YA 1WELA 4X2BA 1I94F 3HHLD 2GW8A 1U1RA 3KNAA 2BDPA 4ZCLA 3R7NB 3VTIA 4CLYA 4WFYA 5J2MA 1LOUA 1B3TA 3SXLA 1KOOA 3W9HA 5J2NA 3JSRA 2GIQA 4NYZA 2ZE2B 1UMJA 3ENWA 5B0AA 4MYTA 2LA4A 2MXYA 4Z37A 4WU3A 3ZZPA 4EU0A 3GJTB 3RW7A 4K50A 5GMDA 3CD7A 5HMYA 3QLHB 5HL7Q 1Z4UA 3ETMA 2ZVSA 6AT1B 5DS7A 4RO0A 1W2BR 4ED7A 1CS4B 1IQZA 2RUGA 4LF5J 2J9CA 4WE1B 1RAAB 1IBMJ 4GO7X 3WHIA 2J7KA 4DLEA 3QIPB 3OXLA 2FHJD 1KONA 3R1HA 3KLEB 4ZPBA 4CYUA 3DLHA 2DHAA 3IRXB 1U4BA 5G4DA 2LA6A 1IR0A 1MMLA 4KRWA 3TVYA 1W7WA 4OFZA 2QLFB 5D3GB 3LGHA 2H1YA 2JVRA 1TKXB 1D9FA 3FUYA 1FX4A 4ZVSB 4URGA 1NSQA 1U1PA 2X3GA 2G1DA 1LWCB 1NDKA 2FC9A 2VOOA 2NSCA 5J1EB 4DPWA 1MWQA 2V4JA 4ECWA 2CWKA 3B8HA 5K5MA 4ID5B 3BS9A 4CO4A 1U02A 3MI7X 3IFEA 2KKHA 1BWEA 3M2RA 1VQKS 4I56A 4U8VA 2PC6A 1HQUB 4P71A 2JEGA 4P2FA 3RUBL 4F02A 3HHLB 3G6ES 1U49A 2BE2A 1KOHA 2HW3A 3N79A 4RWWA 2X1FA 2D9PA 2ZHBA 2IIHA 3Q22A 1V3ZA 4NLQA 2GQCA 2DRAA 3G2XA 4H4MB 4ECYA 3AQOA 1NCLA 3NLCA 4NXNJ 3UQSA 3KJNB 4LSLB 4QIVA 4G6VB 1IQTA 3K58A 3R3TA 5CH7B 5KFFA 2HKEA 4L73A 2JLFA 3ZTRA 4B3RF 2B6AA 1BD6A 5D78A 3W2WA 2V8DA 8RUCA 3NGDA 5CYQB 3W5YA 1YJTA 2EK6A 2M70A 4DFJA 5C42B 1HI8A 2E29A 1CULA 1ULRA 4MKYA 3IBWA 3KG0A 1S72S 2LEAA 1S10A 4PPDA 2R8JA 1VC5A 2VICA 2O66A 2V8PA 2F9JA 4M5HA 4DPXA 3EM1A 4IOBA 2VQFF 3HO1A 2XSFA 2V8HA 3EPGA 4AUKA 2ZOMA 5HVHA 4DV1F 4FDFA 1UW4A 3GIKA 3IWLA 2KT3A 4A4JA 2ZJQQ 2H9ZA 2QA4G 1WOPA 1IKVA 3DGPB 1X5SA 3H2LA 4R8UA 5IT9Y 4GRSA 5IT0A 1KN6A 2OLWA 2CZ4A 2RHQB 2QLJB 2FC8A 3HPOA 2POKA 2JJ4D 4OZ3A 5KOXA 3BSNA 2UV8A 1AW0A 4B9TA 1B7FA 4RU2A 3KLHB 3PKYA 1S57A 2BRLA 4ZVGA 1LEOA 1HNXF 1TVRA 2PE8A 3CPWR 3CCSS 1IKWB 3UDLA 4N5SA 3A4TA 1XTZA 4YQWA 3FRZA 2MEWA 5DG9A 3C6UB 4ZVQB 3FNNA 4WFXA 2UUCJ 3MM5A 3GILA 2VBXA 4MH8A 1WOOA 2VV5A 4HACA 3OHBA 2YXLA 3OQ2A 5GAHI 4YN3B 1EARA 1G2EA 4NMXA 2WSEC 2EEYA 4A47A 1DQ8A 3RYLA 4EMDA 3K5PA 2YKPA 4M5NA 4Y0FA 1Q95G 1N32F 1R89A 1DZ5A 2YNFA 1Y9OA 5ETLA 1GXLA 5RUBA 2FYXA 2XS7A 3PRVA 3PW5A 4B08A 3ZC4A 3GV7B 2JX2A 1SH3A 3MXHP 2YKNA 3WC0A 4Y28C 1KLMB 4UUXA 4IG3A 1QJHA 4CTAB 2F8HA 4FXDA 1WSRA 3PEJA 5DZ7A 3I0SA 1HWKA 3L9ZA 3UN2A 2AWZA 1T94A 1YBTA 4NA1A 1QY7A 4WKRA 2DPJA 2E5HA 2H4YB 1VCTA 3R5CA 2KM8C 1SVDA 3QT5A 3JTNA 1PAEX 2IAJB 1TP7A 1TK8A 1VI7A 1SV5A 3MM6B 5CHCB 1VC6A 1SL2A 4O4RA 3G4SS 2ZZTA 2C22A 3SIPB 1JJCB 1SPBP 1YSJA 5L1IA 1REVA 5BXIA 1BMQB 1F9EB 5KFCA 2W9CB 1IBKJ 2HHTA 4J9SA 2GJFA 4UZBA 4HDGA 2JRSA 3NAHA 3K0JA 4F4XA 4HHHA 2EWHA 3W64A 3P5BP 1RI7A 1T3OA 4NASA 3W66A 5H9FJ 2VFTA 1C2PA 1ZM4A 4URQU 1WKJA 5AXMA 3AB4B 2E1RA 3BPSP 2WK4A 1ZPWX 1D9AA 1S6QA 3MEGB 2AU0A 2H3EB 3CC7S 1ZZNA 1HMVB 2IM0A 2I0XA 1QE1A 2GMLA 1S79A 4ZPDA 3WX4A 3BB5A 4O0IA 3W2VA 5IV3A 4NI2A 3IGVA 2LQ5A 3TRGA 1NK9A 1MWZA 1SKRA 3LANA 1R6VA 5IZHA 3V6JA 4K4ZA 1RAIB 1NPPA 4ED4A 3HVAA 4PXDA 4UY85 5HJYA 1VS3A 3VZHA 2HFVA 2DVIA 5A8KA 4ZP9A 4Z7CA 2CQBA 3HHKA 1RT2A 3CDBA 2ZJPQ 1YZ7A 2ROEA 1RT1A 1HQUA 4LF6F 4S0MA 4YB6A 2HMIB 2W8LA 2VU5A 4LVOP 4HL9A 2R8HA 1FKAF 4ANDA 3QAUA 3UCGA 2VFSA 2V9KA 4PQUA 5B0DA 4DBQA 5LM7E 3IN5A 1K8AT 2QYGA 3GG1A 3R97A 2XS2A 2HK3A 4QWBA 1UVIA 2P6SA 4YMEA 2V6AA 3VAMA 4ZLNA 4DQIA 4ILMA 2MHEA 1TK0A 3A8EA 5DZ6A 2YBVA 3EXCX 4K0KF 1OYEA 4YFUA 1JLCB 4WCEQ 4A8FA 2F40A 2VC0A 2OPRA 1S59A 1PSDA 3Q86A 3OTOJ 3DMJA 2DGVA 3J7YI 1FVSA 4LFCJ 5IWAF 1JLAB 3MFIA 4EK2A 3H4DA 2DGSA 4JOUA 1U26A 5KOWA 1XK8A 1RT5B 4N77A 1Q7LB 3SV3A 1IKXA 3LO3A 3EZ5A 1N5YA 2HHVA 4JI3F 2O5DA 1UFKA 2W8KA 2HQGA 5J2QA 1FESA 2UZAA 3QMQA 5GADI 2UU9J 5BYSA 3FCHA 1NJWA 3UCUP 1M5SA 4TU9A 4J9NA 4FP9A 3C16A 2DTJA 3RRKA 1IBLF 5KFXA 1NDPA 2OTJS 4F0MA 4DI6A 2W7PA 4OYIA 3W1YC 1GMWA 2CDRB 2VONA 2DYAA 5K20B 2VIHA 4KPYA 1P1LA 2QL7B 2HSEB 3DOKA 1N34J 1Y5LB 2GO9A 4DV5F 2HGNA 1OPIA 4ERDA 4GC6A 2BX6A 5HAOA 4CO1A 1HNZJ 4QJVA 1I94J 4JI0J 5KG5A 2W2PP 4DX8H 2DISA 1SH0A 4C9DA 2W9AA 2XI3A 2MZQA 3TUJC 4HLBA 2CNOB 5D0EA 1I3OB 4I2PA 3D1QA 1NHVA 5ETQA 3IWXA 5JXSA 2HS0A 1RP5A 3I55S 2R7XA 4LRFA 1CC8A 3AT1B 4ES2A 3MUMP 4UQGA 1X4CA 3JSMB 1YWXA 2DHSA 3KK3A 3PJWA 2IJRA 1PO6A 4WYLA 1GX5A 1U2CA 1DFDA 3DRRA 4OX6A 3I31A 3GV5B 1NO8A 2MDAA 3GTYX 4DR6F 2I1RA 5ETSA 4DS4A 2Q6CA 2PFDA 4H4KA 3U27A 3GYXB 2HVEA 3BREA 4WIQA 1PJ5A 4DG1A 4RKUC 2HNDB 4CTAA 3PR4A 2LLZA 2ASLA 1MN7A 3VR1A 4YHHJ 2N82B 1MSWD 2OFGX 3AODA 2D3UA 5HMWA 1SJ3P 3C6TB 3MAAB 1ZBTA 4TVAB 2HNYA 5L46A 1F0XA 4LF2A 2FJEB 5M2UA 3NGUA 3IRWP 1HARA 1NNDA 1PGZA 1PC4A 2CQ1A 3NNHA 5L1KA 1NJYA 2EVZA 5IXUA 4DS5A 1I6JA 2M7SA 3MEEB 1L3TA 1KRPA 1FE0A 4H54A 1LXNA 1XMOJ 2FTRA 2XCAA 1ZAWA 4B3SF 3CT9A 2D7SA 3DLGA 4X84A 3A3NB 2B56A 3TA2A 1D0EA 3GFXA 2JNJA 1GK8A 5DO2A 4ES1A 4ICLB 1FWKA 4GMKA 2AZ1A 2DEIA 2FJVA 2IVYA 1HD1A 1Y5IB 2LXIA 2HZAA 3JS9A 1H38A 3UVJA 3W61A 3KLVA 2AEMA 2XNQA 3N9UC 3HVTB 2RQKA 2GS8A 3NMAA 2NYHA 1HBOA 5KFVA 2QMWA 5KFMA 2Z0GA 4UUWA 4KSEB 4G3IA 3LP0B 2ZZNA 3KUGA 4QIWD 4BWJA 3M1VB 1L3VA 3VGSA 4V19X 2MSTA 5E3RA 4M94A 1QSSA 3VQTA 3PV8A 2WTFA 1UPMB 1XC9A 2XMAA 4CZCA 4YB5A 4XPEA 1H2UX 1LWFB 1UETA 3NS7B 4XK8C 2CJKA 4CDIA 4ES3A 1ZTWA 1D8ZA 1NH8A 4WXWA 3A13A 1FD2A 5EHHA 3R2DJ 4HYKA 3QJPA 3CDUA 1RT4A 3CDWA 3TANA 3H98A 1RAOA 4OHVA 2R7WA 3VAKA 5C2CA 1C0UB 2C2MB 2HRUA 1NMEB 2VQFJ 3MM8A 4JI2F 2GC8A 2E9ZA 2KJWA 3VAHA 3HSZA 1EKSA 4NA2A 4L74A 1IXKA 1SJRA 1FT8A 2ZNYA 1J2VA 3E51A 3AAWB 2CPJA 2Q43A 2IHR1 2RF2A 3X3UA 4KIAA 4USHA 1TKZA 3ISNC 2L48A 3POTA 4I2QB 4EUVA 3PTWA 4ZPAA 5J1PA 3G82A 1HPZB 2UP1A 3C15A 4DSLA 1FVQA 7FDRA 4B9NA 1TV6B 3MMCB 4KV8A 4IOCQ 1HNXJ 5GMKa 1XN9A 2M8HA 1JJ2R 3UWTA 1BC6A 1WKKA 1MG7A 3EE3A 2YPZA 5FIIA 4DPYA 1FRJA 2G2OA 2YVSA 2UXCF 4QR0A 3PJ9A 1B99A 1SJQA 2ZZMA 3ENQA 1TL3A 4CCHA 3KLFB 2VJUA 1QTNB 2RUSA 2XI2A 2HEKA 2X7IA 4EYHB 2M2BA 3B4MA 4Y2KA 4Z2XA 1IR1A 2HQFA 5K14A 1XIQA 3D1OA 5F3TA 4HI2A 1W25A 4DEZA 1DQAA 1N48A 3NCQA 5C25B 3N4WA 3CNQP 3V6KA 4KBIA 3DRXA 1S9EB 3K8VA 4OV6A 1RHQB 1T3NA 1T95A 2OD4A 2QMXA 2I38A 1SH2A 1FDBA 3L3CA 2YNHB 5I42A 3K7RA 1HBNB 2ADBA 3BBFA 3HFZB 1WHVA 4IFYA 1FRLA 2B3TB 4ITSA 2EI5A 3H4BA 1IKYA 1JX4A 4WWSA 2YTCA 2UUTA 2OI2A 3KUEA 2CZVC 3PFEA 2MPUA 3AY0A 2DR5A 2VKRA 4YR0A 2W01A 4ZVFA 1BWVA 4NLVA 2BA9A 4RW4A 2CQ4A 4JYAF 1G3OA 1NB2A 1QAJA 2K1RA 4M8LA 2ZC3A 3M6VA 5HSPA 1M5KC 2AEFA 3ISND 2N3OA 3SSQA 3FBBA 2VQEF 2LU1A 4RUCA 5ETOA 3UO0A 4RW8B 1AUDA 3KUHA 1N54B 4LR7A 2YWGA 3U1MA 2HLUA 3BGRA 2CJBA 3S01A 4DFKA 2E1AA 2G2ZA 2R2UA 4JI1F 3DLKA 1AZSB 3THTA 3S8SA 3K5MA 2J7WA 3PO4A 2M8DB 3HVRA 2D1CA 1SC4B 3RJMB 2HNZB 4ZVEA 1BQNA 1PILA 2G0JA 2D74B 4F4YA 1JLQA 2P5VA 5CABA 4ED5A 4LRBA 3PY8A 2QV6A 3DGVA 1B64A 5KFZA 4NCGB 4C48A 3L7UA 1TL1A 1NLKL 4JUZA 3FCWA 4PABA 3C6TA 3MAAA 3J7YU 4MFBB 2V94A 3DI6A 3MCSA 3FBFA 1Q7YT 4JV1A 1IJFB 2FJBB 2HFOA 4LJMA 4HHUA 2JC0A 1FK9A 3B54A 2Y8YA 1YZ6A 2EBGA 2LECA 1ZETA 4IOAQ 5GADU 3M2VB 2RDJA 1XR5A 3T9ZA 2ZFHA 1I1GA 4EBDA 4DPOA 3HKZD 2CQPA 4LF8J 5HJXA 2CJAA 3TEGA 5CYMA 4ZOSA 3T6JA 2JVOA 1XNQJ 4OJ3A 1WTBA 3C2PA 4FBTA 2IJFA 3KK2B 2NR0A 4WFAQ 3MMAA 1UVKA 3O8WA 3AJ2A 2VG6B 3HD2A 3PX6A 2R4FA 2XHCA 5FDLB 1U6FA 4FYWB 4OX8A 3CGIA 3J7Z5 2C2EA 1QTMA 3JQKA 3LOUA 1YBAA 4LF4F 1CJUB 1F3FA 3HVTA 3CJ4A 1M0SA 1CQNA 2KFYA 4ZPVR 2WW4A 3LP2A 4J9OA 2XC9A 2IJNA 3M30A 4O44A 1O5JA 1UCNA 4HT7A 4ZVTB 3DCAA 2BV3A 2XM3A 3QWPA 3KXDA 4RZRA 4WF9Q 2FY8A 4OI1A 4CT8A 2V68A 2OELA 3TEHB 3QSIA 1JLGB 4M5DB 4U67Q 2DR8A 4K0KJ 4C11B 1NZ8A 1LK7A 2JFDA 1C1CB 2EG1A 2VBZA 2FZCB 3OHAA 2K7KA 3QFWA 1GTEA 1D8YA 2CG8A 3B78A 2O01C 1QUVA 4WJBA 4RW9A 2YKAA 3T1YJ 3DYAB 1YGYA 5E33A 2QEXS 4OI0A 1UTAA 1VQ9S 4LREA 4JI7F 3H42A 1UEUA 3OW2R 4MIWA 5KT3A 4J9KA 2DIVA 1XQIA 4JI3J 1VRTB 2OJ3A 2MKSA 4ZVPB 4X4OA 2P9GA 2DH9A 1UAWA 1TKDA 3AD7C 4DR2F 1B70B 2HS4A 2A2DA 3IA0A 1KEKA 2HURA 2DXEA 1IBLJ 1CLFA 3CSKA 4KHPJ 1YJ9S 4QIFA 9ATCB 2UXDF 4N47A 5KT5A 4B9UA 5DLGA 2DXFA 2K3IA 4X66J 2F9DA 1FJEB 1B4SA 1C4CA 3OTCA 2CJQA 4JI8J 4FZVA 5IT9U 3EDQB 3TJAA 1YKWA 3ZZRA 4DV5J 2KRRA 3PHEA 3EWGA 2AW0A 2P9EA 2ILYA 3HF5A 3NP5A 2NZCA 1CJKB 1FHTA 2GGPB 4J5OA 3TX8A 2RRNA 2WBRA 3OL6A 1WHWA 1PBAA 1UA0A 2VUGA 1T9UA 5KFDA 3IAS9 3VVTA 5EN1A 3K5NA 2L41A 3GFZA 4N41A 2VD3A 3MWBA 2VJVA 3ITHA 1C0TA 4GKJJ 4W92B 3V6DB 4CH0S 1YRUA 1ZAVA 2C2NA 3C66A 4BDPA 4P7TA 4LRAA 5B0CA 4PKDB 2FVRA 2V2KA 2OSRA 4HH0A 4A8QA 3PO5A 1JKHA 1GFWB 2AGPA 4H4OA 2XY7A 3N6NA 1BE4A 5HP1A 3KHLA 2XSJA 4DR6J 4OHYA 2GAHC 1J5EF 2HFSA 5D4OA 1U0SA 2LQBA 3TAMB 3EDRB 4M5LA 2BE9B 3GPAA 4ZP6A 4D3GA 1MU2B 3BGFA 3AXKA 2W9BB 2BQRA 5A8WB 1RAHB 5DETA 3G87A 4ECVA 1X9SA 2K06A 2BJ3A 4X4QA 2B9XA 2KVIA 1N33J 5DQIA 1ZAXA 2NLWA 8ATCB 1N52B 3GIJA 2MB0B 1NK7A 2DNQA 3QJJA 4PUOB 2AYEA 2I2YA 4DL6A 4O23A 1RWOB 2QO3A 2MKHA 4F3OA 1N8RT 1TR0A 1P9QC 3HJVA 2XO7A 2WONA 2MQLA 3AJ1A 4DN9A 1U2RA 1VQYA 1RTDA 1P27B 3BO3A 2XLIA 4AYBD 4F2RA 5E2QA 1NHUA 2J6SA 2FJDB 4WFZA 4B3SJ 1CJVA 1VRUA 4GKKF 5JMNA 3WX8A 4ZPWR 2EC0A 2BJ1A 1XNRF 1E6VA 2BBEA 3PR5B 3C14A 1S6UA 5KFWA 5F9LA 2R2TA 3JAMY 4R5PB 2V8GA 3PHTA 1JB0C 1RQ0A 2J0QD 3T1HF 2LQ9A 1SL1A 1F3VA 4MTPA 2ZWPA 2IRXA 3ZZOA 1ZM9A 2BABA 2J6TA 3A12A 1CJTB 3H90A 1U1LA 3TX0A 1HLWA 1EB0A 4RU9A 1UFWA 2Z2LA 3SDEA 4IQMA 2F7VA 4C8ZA 2ZH1A 2XYHB 1F60B 4JI5F 1WDDA 1BQMB 4U9RA 3KMQA 3IS9B 4L75A 1Q53A 3J80U 1S9GB 1U45A 1VQLS 1OY8A 2QX0A 2UVUA 2OEMA 2CPIA 1C4AA 3FEXB 5DRKA 1HWLA 5F8NA 3UD3P 3R1LA 1TELA 3GMGA 2ATLA 1QVFR 5AJ3J 1YBUA 3OTDA 1VQSA 2JEJA 4I6WA 2BANB 2UUAF 4DN0A 1LWXA 5LMUJ 1VHIA 2RIJA 1XWLA 4NCBA 4M5KA 3PYDA 4LQ9A 1WKLA 3UDEA 4B3OB 1U0HB 3BGUA 3Q8YA 5K8PA 2KVQE 2BW2A 1YLXA 2MQMA 1RT7B 4X62F 1PKUA 5DQGA 1X0FA 3FQLA 1FRHA 4LVNP 1WUUA 3HSJA 1R0AB 3UDCA 4DR5F 3DLEA 1MNEA 4E0DA 4RW6A 4KHMA 4C8MA 1X60A 1RSCA 4NLRA 4KJIA 1S1TA 3P3DA 3TP2A 1A7GE 3ILOA 4FBUA 5L1JA 3QT6A 3NGKA 3CCJS 1RHRB 1A0OB 4E2FB 3OPKA 4RUBA 1I51B 3ISZA 3DRPA 2J8AA 1HNIA 1CEZA 2HVDA 1F9FA 2BJDA 4OHWA 2G0IA 4ELTA 4I6AA 2PD1A 4KGZB 4F4ZA 1YJRA 2HWHA 2AIRB 3M9MB 2AYBA 1FO1A 4R0EA 1Y7PA 4RL1A 3KMSA 3I96A 4FN5A 2MKJA 1WTFA 3E01A 2GV1A 2Y1LB 2AT1B 1KBRA 1S1XB 4I7FB 2G4BA 3PZPA 2AJ0A 1VRTA 3T5HA 4F4KA 1JLBB 3HDSA 1FDAA 5A8RB 1J5OB 1OJ4A 1VMBA 1S1UB 3AFGA 1RWVB 3N0VA 1RYSA 1HQEA 2FQQB 3FKBA 3KTQA 2X1AA 1T05A 2NZ4A 2MGZA 1KKHA 2PMWA 1UFLA 2OEJA 3BEGB 4TQSA 1REGX 4P72A 4DL2A 5DGBA 1WF2A 4EGLA 3PKMA 4DSJA 3OFFA 2KHCA 1IUJA 2OMOA 5EDWA 1G4CA 4KT0C 1EJ7L 2HVHA 3VAJA 2Z8QA 3HVWA 3LP1B 4LBHA 2DO4A 4C3LA 2XO6A 2MJUA 2XMJA 3AA9A 3BQ0A 2XHWA 3MD3A 2IM1A 3AH6A 4QU6A 3MECB 1GNKA 5BJRA 2RB7A 3G86A 2DITA 4ED3A 1VQ7S 1GTHA 2DNNA 2OPSA 3HHDA 3DKDA 2ZH7A 1CVJA 4JV2A 1A9NB 2QLBB 3L7OA 2EFVA 1IWAA 2F8MA 5KFIA 4X4VA 1YX2A 3CDEA 3EICA 5HROB 1KQSR 4ED8A 1TMJA 3ADAC 1KHWA 3EZUA 5A0YA 3NWGA 2ASYA 1VISA 4CO5A 4ZLPA 4I68A 2VDHA 4DR1J 3HKWA 4LRCA 3NOGA 2KZMA 4ENOA 3PCOB 4FXVA 5U47A 1FRIA 1EP4B 2C2KB 1SQEA 3TJ8A 1LW0B 4J7CA 4TN2A 2ZDPA 1WSVA 2QE5A 2B6AB 3HM9A 4ZA1A 4J91A 4DSFA 3CW2C 4MMOA 5K8OA 5M2RA 1FA0A 4GC7A 4DR4F 3CJTA 2DCLA 4CLTA 3CXCR 2VG5B 1R31A 5ETVA 1CBKA 3QWUA 5I3UB 1KFSA 4MK8A 1KFDA 4C3MA 4DV3F 1FKPA 3DM2B 2Y8WA 4MKAA 2H65B 2JEIA 4OYZA 4LF7F 3QFHA 3RR8A 3MTKA 1BY9A 2DHGA 1DBDA 2MLXA 3CULA 2YKMB 3N6LA 4DZDA 3RR7A 4N76A 1T0TV 1XR6A 1VQNS 3Q83A 3KLIA 3KK1A 2YKOA 5KFQA 1N5TA 4DUZJ 4RPFA 1SXLA 4PWDA 1U2FA 3AD9C 3BPDA 2E9TA 2FZKB 4NLOA 3TAQA 3ZFVA 3CEDA 3VQSA 1TL7A 1X5OA 4DX7A 4PWUA 2B5JA 4PG5A 3ZNJ1 4JB8B 2W2MP 4CNYA 3X1LB 2RKIA 2ZM6F 4USTA 1FDNA 3QQCD 4Y2IA 5HLFB 1O6XA 4CI0B 3G8TA 4IO9Q 1S1WB 1VYAA 1H0HB 4J9RA 1FNOA 4C6AA 1SUQB 4FVCA 3GONA 1BQMA 4C8YA 4K4XA 2NPFA 1R0BG 3Q8PB 1S97A 1F1BB 2A1BA 2C28A 3CCVS 2WB4A 2CKWA 4ZDNA 3DOMA 2RU3A 1LW2A 3I4HX 4I69A 3H40A 2RH3A 3MM9B 3R7SB 4LFAF 3GE9A 4DUYJ 5CCLA 1SKWA 5FJ4A 2OEKA 3Q8SB 3CE8A 4C0OC 2H5IB 3HD1A 3MEDA 3CCQS 4I1TA 4UOHA 3HHEA 3KLGA 2HZCA 3BQ1A 2W7AA 5K8MA 2IFXA 2X3DA 5D15A 2XMTA 1ACMB 3IMQJ 3QGGA 4GVBA 3KJVA 1Y4ZB 1GT8A 2MKCA 2P2CB 2LFVA 1HBMB 5J2PB 3CUNA 2AHOB 3VVUA 3MCNA 1C1BB 2HWTA 4OYPA 4HR2A 2JLGA 4QYZJ 2GQ2A 5HMZA 1SKUB 3VALA 5E3CA 1UPPA 2HQDA 1DTTB 3V4IA 5F41A 3IG1B 3JQMA 4X65F 3MZIA 2YH1A 4NYOA 2GVZA 5KFLA 5C24A 2RILA 3THPA 4NYPA 1EZZB 2F1FA 4KR0B 5DG8A 2PMZD 1S6PB 3OSNA 4OHZA 2CPYA 2ZD1A 1X4AA 5KFTA 2U1AA 5EX3A 5CYJA 3IM8A 3D0GE 1PYSB 2Z30B 3S6EA 1DTQB 2HBYB 4CLPA 2Y3YA 3OTBA 2OFHX 4IFVB 2MZRA 2Z58B 1TQLA 2YNGA 3H5SA 4WIIA 2C2ZB 3FSIA 2XYPB 2DNLA 4JBCA 2E7VA 1N0VC 1RLCL 3PYFA 4CM0A 4B17A 4ETZA 2DH7A 3I0RA 2JZ5A 4DV4F 3PYEA 4OYWA 2FLOA 4KGKA 5LMNF 1RAGB 2CADA 2R3VA 1WG1A 3DRSA 1FXRA 4Q7AA 4F36A 1VBKA 1IM6A 1X4HA 4TNOA 2ABYA 4Y6IA 2L3MA 2EXUA 5AE3A 3NS6A 4IG0B 4NZ7A 4URSA 1TUVA 2VBYA 3MHYA 1J5EJ 2JDJA 2AX0A 3VAFA 1OO0B 3C3LA 2HRTA 5G0RA 3G6VA 3MFHA 4ZPTR 2CDQA 3A1YG 2FVCA 1Z2ZA 3BGLA 2ASJA 3LP1A 2EFQA 1Y10A 3UCZP 2DEJA 4NX9A 3B6BA 3LGMA 2J7UA 2IMWP 5BYQA 1VIOA 1YITS 3I4PA 2XY6A 3ENAA 1EETA 5I4MA 4W4MA 1WHYA 4B3MF 2CNLB 3R6LB 5KG6A 3M32A 1TKTB 4DV6J 4R25A 3VZIA 5KTQA 4DFMA 2B9YA 1H98A 3WIVA 3Q8QB 4ZKAA 1VQPS 1MN9A 3NBPA 2PFFB 4WU2A 1YK9A 3EJMA 2AJ2A 1S12A 3QZ7A 3LQVA 3G8SA 1XNRJ 3I82A 3NGTA 2CPFA 4P73A 1RK8A 3IP0A 5AXLA 3M8QA 3MPVA 2HFZA 2DK2A 4F67A 5T41A 3RAMA 4AXJA 3K89A 4O3OA 4MKVA 4PCQA 2GVDB 1L3KA 1Q86T 4PEOA 3NS5A 5CA5A 2H5JB 5HBMA 3GJSB 2DNKA 3TAPA 4ZJLA 4RW7B 4ER8A 1RWMB 4JI5J 3SCIE 2VPXB 2H5EA 1BHNA 4AL5A 1S48A 5IOLA 2KYXA 1FWLA 3CJKA 4OZ1A 2SXLA 3GCWP 3D9BA 1FNXH 3M8ZA 4P6QA 2FGOA 4K4VA 1YJWS 1EAYC 3RBXA 4DU7A 3QJLA 2ZH5A 1FX2A 2CQ3A 3J81Y 1KQGB 2CZ9A 1TAUA 4N8NA 3M7VA 1OSDA 3GIIA 4DL7A 3Q0AA 2UUAJ 5IFMA 2IDEA 1RB0A 3IR6B 5KFKA 1LV5A 3KG1A 1SIZA 2DGOA 1FJGJ 2YWKA 1GAOA 4TLQA 2ZH6A 1T8EA 4USKA 3HFKA 2HLTA 3R8YA 3KFWX 2NXCA 4DV0F 1FE4A 3DLJA 1VQ6S 3NOCA 1YJUA 4IH7A 4BCAA 3B82A 4FPIA 1X0PA 3CTRA 2ATCB 3L09A 3N28A 4IH6A 1HBUB 3O44A 5HLFA 1PC5A 3PW4A 1VJWA 4O4GB 3UD5A 4YR2A 2P9CA 2UXBJ 4PPZA 3GFYA 4KE5A 3M6WA 3SSSA 3THVA 1FRMA 3BYPA 1D1UA 4BBYA 3TWZA 5IM0B 2OIHA 1Z1ZA 2OPPB 1YRTA 3BH7B 2IC3A 3QT7A 2D9OA 1MMDA 4MKBA 2RQCA 4WFBQ 1M5OC 2ZUGA 1UJ5A 2Z57B 3OUYA 2GJ2A 1UP1A 3H59A 3JTOA 4ZHRB 2ZH3A 2BE7D 5HQ8A 4LR9A 1UKUA 4G1QB 1TUGB 3US5A 3DU5A 2I9SA 4P2MA 2CA9A 1WEZA 5JJBA 5J2PA 2BQUA 1ZM2A 4KFBA 1MROA 3KDNA 1MW7A 3MR6A 2WOMB 3BYRA 5CAAA 1RT3B 2DO0A 3ILIA 3CO0P 3QGIA 4EO6A 4DR3F 4LF9F 1V3SA 1UWBA 5H9EK 1N6QB 3NL0A 3M2UB 1RWPB 3LTOA 1DLOA 1WJ9A 4CRJA 1LFPA 2I5JA 4P75A 1NSKL 4NLXA 4O0NA 1R27B 4CWBA 3AA8A 2Y0SD 2F8EX 3D6TB 1RTHB 2DKOB 2OP5A 1MMNA 3F56A 2NXNA 4IFVA 1FXLA 1M1KT 4V1Ak 1NKCA 4UQTA 5EWFA 4YUDA 3LW5C 2IYIA 3AOCA 2AYMA 2VG7B 3MM7A 2W4PA 3KDOA 2LEBA 2ZKUA 3MURP 1TFWA 2MKYA 5IQ6A 3H8YA 4PZVA 4WP8A 1RWWB 5KG2A 2VPWB 2J6UA 1S1VA 1F5BA 5JUMA 4ED1A 1HL6A 4CLFA 4ZK7M 3HP6A 5HVFA 3I87A 2EFPA 2DR6A 4ZIVA 4PRFA 4CM2A 2MY8A 3FEYB 3LPYA 3ZTPA 1GEHA 4ECXA 1OSCA 1TUWA 1RKIA 3DDNA 1YRXA 3TVZA 3TARA 5HMXA 1P1TA 3NEKA 1URNA 1FKOB 2VL1A 1UEVA 1D09B 3DDIA 1HNVB 1IVZA 3QO9A 2OGUA 1JLFB 1VC0A 1KWMA 2JOQA 3NNCA 1HHSA 4OZJA 3M05A 3BKFA 3DC2A 3JSYA 1VJQA 3H5UA 2QGFB 2CRLA 4LF5F 4OLOA 2GAGC 4UW2A 3F73A 1WDTA 2QA4S 4F7VA 4X64J 2W4CA 3FFIA 3ICLA 4IDKB 4DV3J 4K4SA 3JYTA 3WQPA 3F0NA 1RADB 3Q2TC 5THWA 3LGNA 4LF7J 4OI4A 3QRRA 3BQ2A 2R2RA 1S77D 2J8SA 2HHXA 1NHKL 2GJIA 1FRKA 1NXIA 3GR1A 2VFUA 4M63A 2YY3A 3MUTP 1NRKA 1RTJA 2XWXA 4QPTA 3GIMA 1T03A 4Q8FA 4PG7A 2KXFA 5LT5A 4ZMMA 4WTOB 1KC8T 4UT4A 4LSNB 1NK4A 3RGIA 3QBCA 2JHEA 1WC4A 1U1MA 4TY8B 1JLEA 2FLNA 4OX7A 3F44A 1HWUA 2NUUG 4ZN3A 1S0MA 2ZM6J 2HFUA 3PW2A 2CQ2A 4TYAA 4LSZB 4NZ0A 2HAIA 1YVFA 2VB6A 4DXLA 1RTIA 4Q0BB 3SMZA 5KT4A 2B0GA 3D68A 3SCKE 3UR0A 1NK0A 3OV7A 1V3RA 2PEHA 4YS2A 3FZBA 2HYIB 3MMBB 4NXNF 3M8PB 2QL5B 4QR2A 2XZWA 2WB1D 4LFAJ 5LSOA 4AL7A 2MQOA 3W8PA 4LT6A 5DDQC 2Z4PA 4IR9A 1PYOB 1RHUB 3CDAA 3PW0A 3RB3A 5T7LB 3FQKA 2I6WA 3V81B 4YB1P 1NSPA 3MTJA 5BR8J 4M95A 3MOZA 3ULHA 5HN0A 2FZGB 2ZE2A 4CIOA 2WSFC 3M8RA 3JTPA 3VGTA 2E5GA 4P2XA 3O2IA 3QLHA 2CNKB 4LBIA 2Y1IA 1RWNB 3OXFA 4ECTA 1LFWA 4IRDA 1SI9A 1HBUA 2NQPA 2M4MA 1CS4A 4J9UE 2F4VF 3AXMA 5KFEA 4RNFA 2UUBF 4HEA9 3CD5A 2RDDA 4WE1A 1VFJA 3D54A 2QT7A 4NZ6A 4KKOB 3BF4A 3FRYA 3DNCA 2C3YA 3CMAS 2DPIA 1PG5B 5KFOA 1JQGA 3QIPA 2YNIB 1NJIT 1PYTA 4JV5F 5L8RC 3ILLA 2I8EA 3KLEA 1WORA 2D3O1 3IRXA 3ONQA 4Z7YA 2DJWA 4Y2CA 1RZMA 2WRMA 4ECRA 3ZZTA 2XWYA 2KT5A 2DB1A 2OPQB 1XERA 4DV4J 2KL8A 5D3GA 1WEYA 1L3UA 4YP3A 1TKXA 4C98A 2AKWB 4KH1B 3OFGA 2XMWA 1L5UA 3ZO7A 1LWCA 1TL5A 1VBXA 5J2MB 3R5DA 1TFYA 5J1EA 4A8OA 4IR1A 4U7CA 2O3DA 2LU2A 4C3KA 1DY3A 4FKYA 5F8MA 3ENVA 2V4QA 2RHSB 2L08A 4ID5A 1RT3A 2ZDOA 4RNHA 4KAIA 3HULA 2CUYA 1TMMA 1B0PA 3QPIA 4UZCA 3D28A 2DY1A 2CQCA 1T9TA 4WFNQ 4IQXA 2YWEA 3OSPA 3M2UA 1XMQF 1V5VA 3WZ0A 3HHLA 4ZITA 1VK8A 3DLBA 1KVIA 3J7A1 4UF4A 2QZ8A 2XTJP 1QD1A 4TY9A 4LR8A 5GAGI 3DU6A 1H73A 4HI1A 1FI4A 2QFIA 2X51A 3GLJA 4H4MA 3EVOA 3TA1A 4Y34A 1N56A 3VCDA 3BDPA 1GH8A 2CJXB 3HHNB 1S76D 2YX7A 3QT8A 4LSLA 2FPHX 1RDRA 4N8OA 2XYGB 3C8YA 2J0SD 1RJJA 1JXLA 1NPKA 1RU2A 2ZBQA 2BUNA 5CYQA 3DRYA 3L4BC 4NE9C 2DGUA 4CYUB 1KQKA 4HKQA 1RA6A 5DG7A 5C42A 3RBDA 1H74A 1HW8A 3EGZA 3M8SA 4NEZA 3DFEA 4CO3A 3GWCA 4JP8A 3EYZA 4O3NA 4RR5A 1FEEA 2ZH9A 2C3UA 5L39A 2C2OB 1O51A 3MD1A 1WG5A 1HIYA 2FHJA 4AFFA 4DDFA 1ZA2B 2ZHAA 3U7JA 1NBEB 3I9ZA 4WP9A 4V19J 5KFPA 1IBKF 1W26A 2B4UA 2GIFA 4AE5A 3M2RB 1SL0A 2A18A 1QDUB 2J9DE 3DGPA 3CJRA 2E7XA 2C2RA 2BE2B 5LXRA 5HI7A 5E3AA 2C2DA 3SFUA 3TZXA 3OVBA 3KLHA 1LNQA 1TK5A 2DXDA 3QSYB 3M8YA 2RSQA 4JV0A 3K8WA 2MKIA 2NXEA 1IKWA 1WC3A 2CQIA 4I0WA 1WEXA 3CD0A 3GV8B 1ZS6A 4TLRA 1X4DA 1Y00A 3W2WB 1RCOB 3C6UA 4J9QA 1AXQA 3K5OA 4A8YA 1SIWB 3NNAA 5EGYA 3MOJB 2QLXA 1CULB 2WVFA 4FYVB 4NCAA 2C42A 2CXEA 2IRYA 2HZVA 1UVNA 1RBAA 2BOPA 5ETTA 3W65A 4ZCMA 2CPXA 1ITPA 4A8KA 1RCXB 1XEZA 3TW0A 5FLXY 2ACYA 1URRA 3G96A 1B0VA 3BSCA 4Q2MA 3CJ0A 4CH1A 4ECUA 2YX4A 4ZP7A 1JMTA 4DSIA 3PJXA 3RBZA 2RQ4A 2VZ9A 1KLMA 3F41A 1IKVB 4K4UA 2FD2A 4JI6F 4NOHA 4NLDA 4QU7A 4K5SA 4R8UB 4FNIA 4KTQA 5ETMA 2F65A 4OI2A 4X4PA 4MT1A 5HANA 3CCMS 3CJSA 2HBQB 2KI2A 3PRDA 2WBMA 5HATA 2VA3A 3CCES 3D1HA 2J9EA 5D0GA 2FDNA 2DY9A 4KQZA 1HWJA 1X4BA 2IAJA 4U96A 5E7OB 3MM6A 2V4RA 3Q89A 1NPRA 3C19A 3HT0A 2KXHA 1X8DA 2Q3PA 1H7XA 2K3KA 2MZTA 3MM5B 4K2JA 1OPZA 3UR3C 3D3BJ 5KG3A 4HACB 3OTEA 2W9CA 4QWAA 2QLWA 1S6OA 2YX1A 3LPEA 2CNNB 1KD1T 4DR3J 4Q45A 2UU9F 4NLSA 3RU0A 4U7UD 1Q81T 3QYYA 3TZWA 2CYYA 4I67A 4NA3A 3ILJA 2O67A 5F8GA 3MPWA 2YNFB 2R7OA 3WDOA 1UJ4A 2MZJA 3Q24A 2EKNA 4OYMA 2BXJA 1RWKB 4OYBA 4OYXA 4KYZA 1Q8KA 4M5GA 3MEGA 1QLNA 5IC4B 2YKNB 2OO4A 1HMVA 4IG3B 3M8WA 2FHOB 2AYGA 1N34F 4C97A 1IM4A 2G2YA 4B3RJ 2B9EA 3ZTSA 3UD4P 3I5CA 3R5JB 2B4VA 3FC9A 4EBCA 3I0SB 3SQGB 4X4TA 1HNZF 3CJQA 5H9EJ 1BQXA 3B4DA 4JI0F 2BVZA 5B0GA 2MTLA 5GAHU 1VBYA 1WC5A 4F0KA 3TUZC 2CPDA 4DZ6A 4FYYB 3OD2A 2V67A 1SV5B 2RVJA 4E98A 1SJ1A 1HQ2A 2FHMA 2QIFA 2ZVIA 2FLPA 2UV8G 6FD1A 2GNKA 1SB6A 1X5PA 2JH3A 1GXTA 3W9IA 4RNNA 2DGWA 4M5IA 3CC4S 2Y1JA 4DV1J 2W25A 1REVB 3BJYA 5H1SV 2ZBPA 3O5TB 4C8LA 2HMIA 2JC1A 3P96A 3KKFA 3KYLA 3NGRA 4H4KC 2AD9A 2Y9HA 1DARA 4PXEA 3BR9A 4DL5A 3Q8UA 1Q78A 5JVGQ 5KG1A 2HWIA 2E66A 3RTVA 1V9OA 5HQLA 3I6PA 1K44A 2EFGA 2HS3A 3G6XA 1S6QB 1KVKA 1WC6A 4YHHF 1NH7A 4NWBA 1OMSA 1JLCA 3D0HE 2V50A 1QE1B 4Y65A 4ZN1A 2CQGA 4Q43A 1AROP 2Q6BA 2E7WA 4NL5A 3W2VB 3CC2S 5DDOC 1U1OA 4NI2B 1R8CA 4DLGA 1JLAA 3OJSA 2N4CA 4FF1A 4F50A 1RT5A 2MZ1A 1GMWD 1FNMA 5JVHQ 2PMHA 1LWEB 1WACA 3G9CA 3Q2SC 3EUNA 3IO1A 3M6XA 2HHQA 1XMOF 3VF0B 2WVBA 1FD8A 3GCXP 5A8KB 1HA1A 2XBPA 2LMIA 3NG8A 3LH2S 4AD6A 3NKYA 3CF5Q 2R8KA 1N32J 1RT2B 2QC3A 4YY3F 1A6LA 3SYZA 1SJ4P 1RT1B 2F63A 3EGNA 4R0JA 2IVFB 1JXEA 1KQFB 1FERA 1S4EA 5EWGA 2IDLA 2IMOA 2CPZA 2PDAA 2Z2ZA 1PAUB 2PA3A 4DU8A 3G71S 2DNGA 4PQUB 4NXMF 1V6HA 2DGTA 3K2YA 4G1PA 2DNMA 4ZCIA 4KH0B 5LXYA 2RMLA 3C46A 2FGCA 4U95A 3W62A 2PSZA 1RAJA 2HRYA 2DCUB 2V69A 2W2OP 4QWDA 3J81U 2R7UA 2W7OA 3VWSA 1IWGA 4M1KA 2OPRB 4ED0A 3DMJB 3Q8RB 1VOMA 3QGHA 2XZDB 4XAKA 3JSMA 3MF5A 4FYDA 1IKXB 1XMBA 1M5VC 1DURA 1N5YB 4F25A 1S0VA 5GAGU 1GMVA 1ZTTA 5J2QB 5HQMA 2NSBA 2AP6A 2E9RX 2A0FB 1WI8A 1ZA1B 2F4VJ 4MAKA 3PDNA 4MK7A 3C16B 4KY3A 2UUBJ 3IBFB 4QWEA 1S99A 2DGXA 4C7QA 1F5CA 3NCRA 1PIEA 3IM9A 2RE1A 2CJ9A 1X31C 1R8BA 2HNDA 5F0UA 4B02A 4UY8T 5MLCV 3BO2A 4C8NA 5B09A 1VDHA 4CQ1A 3D5MA 4JV5J 3DOKB 3DXBA 3IC1A 5KFJA 4ECZA 1VQMS 3FBEA 4EWTA 3SCLE 1T9XA 1S9FA 4EFAC 2LDIA 5FD1A 2HVZA 3T6BA 1HI1A 4X4RA 3MEEA 4DF8A 4I2PB 1TTHB 3CMES 3PRBA 3ETOA 1VGYA 3BGOP 2W2QP 3LF0A 1G6BA 2KYZA 4AXIA 4OLPA 3NGSA 4J9MA 1F2HA 1P6TA 4ICLA 4P2SA 1R3NA 4ZJOA 4OL8A 3I5AA 3TQEA 3KK3B 3HLUA 2R42A 4LF6J 1HYSB 3KOAA 2ZC4A 1XMQJ 4FKXA 3DRRB 2HAFA 4B9SA 5HK4A 2YH0A 4LIWA 4ZLLA 3D67A 4FVMA 3IXQA 2O1PA 2R8IA 2W24A 3RB0A 3LP0A 2M88A 1ZYQA 2XMMA 4LIRA 1PBUA 4DG1B 3M1VA 5HVGA 4CO2A 1X4GA 4IO1A 3LAKA 3EGVA 1LWFA 2VH7A 3SQGA 4B3TF 3SV4A 3VV2B 2L9WA 2HNYB 2HQIA 2J0WA 4CNZA 2XMUA 4ELUA 1NSAA 3BBCA 2LP4A 4M5MA 1R8HA 5IWAJ 4JI4F 3ZTQA 1Q8LA 3OL7A 4O3RA 4Q5VA 2JLEA 1QAIA 3VGUA 1C0UA 5DLFA 4B9VA 4OZNA 1AFJA 3EVMA 5EX0A 4RNOA 2AQ4A 4LBPA 1RHJB 5GAEI 3HX9A 3DLGB 3TJ9A 5LJ5Y 1S4FA 1SC3B 2AJQA 1YJ7A 4OZ0A 2CQ0A 5AXNA 3EXYA 2GMJA 3RZAA 4A8SA 4K8RA 2QRRA 5E3QA 2ZITA 2P6TA 1JJHA 4IYQA 3OL9A 1VHFA 2HBZB 1V5IB 4E8UA 5IC6B 3W5XA 5DM7Q 4I2QA 3CO9A 3UVJB 5D0RA 1HPZA 4OYAA 2CQDA 1JNRB 1HBOB 1Y3JA 2EC2A 3OR1B 3OLAA 1TV6A 3MMCA 2RRBA 4WBFA 3MMJA 2B43A 3J80Y 1YDLA 2E1CA 2VC1A 1N4LA 4L6V3 2WW8A 2BMBA 3GU0A 1H3DA 1ICEB 1GQEA 4FF3A 4LF1A 3KLFA 4FNHA 1QVGR 1LWEA 4J9VA 5CZXA 5KG4A 2IVMA 5C5JA 3PNIA 1RT4B 3W7BA 1RISA 4DHVA 2VKZG 3M9NB 4LF8F 1T02A 5C25A 2XLKA 2KXNB 4QYRA 1XNQF 3MM8B 3GYGA 2DGQA 2ALYB 3KHRA 2FJWA 2BJ7A 4DFPA 1S9EA 2VASA 4PG4A 4F4WA 1N36F 5KFSA 4HH1A 5KG0A 3AOBA 1Q8BA 2YNHA 1VQ4S 2RF2B 1HBNA 4XO0A 4JI6J 2RNEA 1TKZB 2PI4A 4C0BA 4P52A 3POTB 1M1HA 5GVQA 4IKAA 1CQMA 2DR7A 4RBTA 1IN0A 3G82B 2CVIA 3D7SB 4RLEA 1HR0F 1OYDA 3C15B 2MMYA 2XULA 4YDDB 1J27A 3PX0A 4KV8B 1OWXA 5B7WA 3V2UC 1AYEA 4N56A 1ZM3A 1YJNS 3L95X 2VHGA 2C3PA 3P5TL 2LQJA 3IAM9 4CH7A 2KN4A 2QTWA 1Q4RA 2A3JA 3UW1A 2V34A 2MSSA 1CG2A 3T1YF 4MJKA 2NCKL 2MQNA 3T5KA 4RW8A 4IH5A 1TL3B 2N7CA 4DPUA 1BXNA 2RJZA 4TU7A 2A6OA 4ZJQA 5GMEA 1RAFB 4ANCA 1FDDA 1GXUA 1WF1A 3PM9A 1R43A 5K14B 1R6YA 1AZSA 3WC2A 4WP3A 5KT7A 3MAHA 3W9JA 1FWPA 4F4AA 3P8BB 2HNZA 4K7QA 2FVQA 4TYBA 2FJXA 2LYVA 2EG2A 3TA0A 1U1KA 3FBCA 1EX8A 5AE1A 4KHPF 4BLGA 3R9LA 3PVXA 1X5TA 1WI6A 3HZEA 3TUPA 5B0FA 4X66F 3BKUA 1OS5A 2ZNZA 2HPUA 3FZ2A 4NCGA 3ZZYA 2MQQA 1KTVA 2V63A 4JI8F 2FIUA 3RBEA 5I42B 2PGCA 2OTLS 4MFBA 4I64A 4IFYB 2E5JA 5J1NA 4QQBA 1WD6A 1IKYB 1DHMA 2BKNA 2L9DA 5IQQA 1M5PC 3LAMA 1O0PA 3GG0A 2FB0A 2K8GA 4RW4B 3ZTOA 1BLUA 3Q23A 1WG4A 4ECSA 4OYOA 3M2VA 2M9KA 4OIXA 4ATNA 2K1RB 5AT1B 4HVZA 2KM8B 4KGXB 4J9PA 5SZTA 1TAQA 3CCLS 1NJZA 4K59A 2BJEA 4JI2J 4K4YA 3KK2A 4GKJF 5BYRA 2ALZA 2VG6A 2KHDA 3TYTA 4USWA 1U1NA 3BGRB 4K4WA 5FDLA 5KFBA 3BSOA 1HYSA 5F8LA 3HJFA 3DLKB 3PG9A 1U8WA 1CJUA 4RJVA 4CLZA 1Q1KA 3OL8A 1Q79A 5K9FA 3UDVA 1BQNB 4QPXA 2BEFA 1GX6A 4DCJB 1JLQB 2BZ2A 1U24A 3TZZA 5CZVA 4DPTA 2QA2A 2LKZA 4DJBA 4USMA 3OBIA 1NU4A 1JLGA 1TL1B 3N6MA 4M5DA 2ADCA 1N33F 4C11A 4DOZA 3DI6B 4Y00A 1C1CA 1RUSA 2LXFA 1MWYA 2UXCJ 2A6MA 5ETKA 4MIBA 3CCUS 3DYAA 4RNMA 2BQ3A 2OHDA 3CIMA 3AB2B 1JNZB 3GFHA 1FK9B 4PAAA 3BH6B 3R2CJ 5CD4H 2V0NA 3I56S 3H2VE 2X1BA 3CWJA 1F2GA 4F8RA 1NEEA 1RXOB 2YKQA 3CJ2A 4HT5A 3BSAA 4Y2AA 2B8QA 5DDRC 2HBRB 2JEFA 4DCPB 5CYMB 9RUBA 5KFAA 1H7WA 4FS1A 4W98A 5E0OA 3TR5A 3BKTA 1LK5A 3RB4A 4YY3J 3MMAB 4FYXB 5L9XA 1RBLA 2HHHF 3M6UA 1K47A 2KG1A 2GMHA 2KZZA 5SUHA 1FFGB 4C0HA 2KFNA 2XEXA 3NRBA 2GFFA 3HI9A 1S7HA 3OR1A 2RU9A 3SEOA 3T41A 3LP2B 4NXMJ 2FHKA 1CJKA 1S7IA 2GGPA 3M30B 4O44B 5A2QY 4ZPCA 1WC0A 2IYGA 4YOEA 2KB2A 4QOTA 3P49B 2VPYB 4B9LA 4JYAJ 3IR5B 3PW7A 3QGPA 2C3MA 2VBWA 2C1EB 2OMLA 3MDFA 2V2VA 1NM2A 3BZQA 3QNWB 5D4NA 5LSRA 4RW9B 2VQEJ 3O6QA 5AJ3F 4RBUA 3V6DA 4AQYF 1K73T 1RBOB 3JXOA 3QRQA 4DQQA 3GSIA 3HXMA 3K57A 5LMUF 4JI1J 1HNWF 2AMCB 1UZDA 4OJHA 3T9NA 1UVMA 3OR2B 4P9SA 2J0XA 2FY1A 1UA1A 4ILLA 2IA0A 5B0EA 5FLXU 1EKRA 3P45B 3CMQA 3CD6S 1O8BA 3TAMA 1PJ6A 1UZHA 3DHXA 3HSDA 1MU2A 2EW9A 2B51A 1NJXA 2W9BA 3FCVA 4ANEA 5F8JA 5A8WA 1KTQA 4OQJA 2HQCA 5CXTA 2OAUA 1NK8A 5ADZA 1NK5A 1UW9A 3OFEA 5T14A 1BUXA 2FJAB 3NXZA 3DLLQ 2B9WA 2R7SA 2WZ1A 1RYRA 4PUOA 2CG4A 2NS1B 1U09A 4CO0A 2QSWA 3MAQA 1WWHA 1QAXA 4Y2MA 2NUHA 3QIDA 1EHWA 4Y3CA 2OSQA 3J7ZT 2IM2A 3D0IE 2BRKA 3E3XA 5GAEU 1ZPVA 3MGJA 2NXUA 1LKZA 1Q5VA 2ZOFA 4A46A 1QSYA 3UNGC 3DXSX 5A6WA 4CT9A 2WHOA 4EZ6A 2XCPA 3SCJE 4ZP8A 4ILRA 2AEJA 1M90T 3ITHB 1C0TB 4NRTA 1KS2A 2DT9A 5DQHA 4MYUA 3AOAA 4R5PA 1SQGA 2HG4A 2V5HG 4A48A 2DNOA 4ALZA 2ZHOA 4DQRA 3A8KA 1QUPA 2CFXA 2NXJA 1JKHB 2Y0BB 4H4OB 4MK9A 2R7RA 4LF4J 1RLDA 1CJTA 1X4EA 3CJ8A 2DNRA 3SI8A 5HP1B 2XSJB 4PQAA 1F5AA 2VF3A 2CPEA 4NLWA 5L38A 3LA0A 3ELHA 1UEKA 3SSRA 4A8XA 2Q1LA 3GQCA 3IS9A 2K2PA 1S9GA 4UTGA 2CWXA 3D4JA 3DN9A 2ZH8A 4XTTA 4OZ2A 3OT9A 2ZWOA 3R5AA 4B3TJ 1ZH5A 3GZ7A 2EBEA 1KHVA 3HK2A 3I9V9 3ZZUA 1K1QA 3BBBA 2XZTB 1SJFA 2BACA 2XMVA 1EQMA 4JI4J 2IY5B 5D4LA 3BDEA 2VA2A 2WONB 2ZJRQ 4JI7J 1RTDB 3FDSA 2BANA 2KRBA 3MR5A 2J76E 2U2FA 4YB7A 3VGVA 3G8QA 4CLKA 1RHKB 3CJ3A 1CJVB 4DR2J 3KJQB 4B3OA 1U0HA 4DR1F 1VRUB 1U25A 2XMKA 1E6VB 1RT7A 1RACB 3GIRA 3C14B 4QIGA 1HI0P 2H51B 1R0AA 2UXDJ 2R7TA 4OHXA 1U7LA 1SCJB 1D9DA 4P10A 2G13A 7FD1A 3N5FA 5CCMA 2MKKA 1PCAA 2HHWA 4RBVA 4LUBA 2RS8A 4DV2F 3K17A 3EPIA 2R9LA 1ZZFA 2DH8A 1Q0NA 4OJ1A 3SDEB 3MUVP 1LXJA 2Z56B 2JL9A 2J9DA 4PG8A 2QA1A 4O3PA 3HSGA 2IM3A 3EX7B 1FEHA 2BKOA 2IRUA 2IBOA 5E5NA 2E1PA 3N5BA 3NAIA 2AJFE 2BW7A 1S1XA 1K0VA 4I7FA 1VIXA 4AL6A 2LCWA 3H0PA 2RAQA 4C4WA 1JLBA 5A8RA 1J5OA 1VRQC 4DUZF 1S1UA 2VODA 1U47A 4NLUA 2E5LF 1D3WA 2HHSA 3W60A 1U48A 1K1SA 3FVYA 4TXSA 1CSJA 2BM1A 3CIZA 5LOQA 4J9LA 3GSDA 2EKYA 2UVRA 1N36J 2HIYA 2AJ1A 1XR7A 2AGQA 2CJYB 3DLEB 3MCMA 1SC1B 4RW6B 1DJ0A 3SZ2A 4QW8A 3MR7A 2RDIA 1S1TB 3ET6B 1SBRA 1TL4A 3UFCX 4ZIWA 1F6TA 3MECA 1HR0J 3EVWA 4IRKA 2E5IA 1ELOA 1RTZA 4OMFG 2UVWA 4W90B 2ERRA 3DRPB 3BN7A 1HNIB 3DDKA 4QYZK 4HHJA 1X9MA 4L3KA 1WHXA 4G65A 2VDIA 2PI5A 5HROA 3UI3A 4EI2A 4DUYF 1K9MT 3SBMA 3D6FB 1XJWB 3AQPA 3KHHA 5LL6d 4GKKJ 3E01B 2HHPA 1LQ9A 1KDNA 4PR6A 4QR1A 3I5BA 2ZBCA 5IS2A 2MYFA 1YI2S 1EP4A 4ED2A 1PJ7A 3OR2A 2ASDA 3PYGA 1LW0A 3J81j 2MQ8A 5KFUA 3R5BA 2FVSA 3T1HJ 1HQEB 1T05B 2N4DA 2ZOGA 2MGZB 3AHPA 1YQHA 1T11A 3EMTA 2LEPA 2KTQA 4MIAA 4TU8A 4X4UA 2YWWA 1RU1A 3U1NA 3NWRA 2B4OA 2GIRA 2Z2MA 4XPCA 3BN4A 5KG7A 3GJRB 2VG5A 5B0BA 2R8GA 2XB2D 2HGMA 3RG6A 1M5HA 4N7TA 5KAKA 1H6KX 3LWLA 5I3UA 1EIYB 4IUFA 2PA8D 3S1TA 1KP6A 1OIAA 3DM2A 2F5GA 4UOFA 1X4FA 2YQ1A 5B08A 2OKQA 4OX9F 5I3PA 1IBCB 3EZOA 5LJ3Y 3K5LA 2YKMA 1AT1B 5D0HA 2FLLA 4X4SA 4F0HA 2OPSB 3GP9A 1BGXT 2Z2YB 1NAQA 1KNZA 4KO0B 3TVKA 3A3OB 3CB4A 4A8MP 5A0YB 2DRDA 4GVLA 1VLYA 2G0CA 3SFGA 4PWWA 1N0UA 3U1LA 4X62J 5AXKA 1DQ9A 5DJBA 1UJ6A 3PX4A 3CVKA 4DX6A 3DOLB 1FFSB 4DR5J 2M5YA 4BHQA 2AV5A 8AT1B 4U8YA 4C8KA 4OJGA 4LMZA 1Y5NB 1S1WA 2GHVC 4LFBF 4EEYA 1SUQA 4WKYA 3GR0A 3EGWB 4EZ9A 2VFVA 1FXDA 2BM0A 3H25A 2ILZA 4CLWA 4KGMA 3QRPA 1NB7A 1U1QA 3OFHA 1OY9A 2WSCC 1Q82T 3MM9A 5LSLA 2GZOA 1FKPB 2KO1A 1SQFA 1T9VA 2G9OA 3CCTA 4DV6F 5KFHA 3PIPQ 3M9OB 1DAXA 4KC5A 1VQ5S 2H4WB 2ZH2A 4QCLA 3D2WA 3LUYA 1HBMA 3KLIB 2BJ8A 2R7VA 5DM6Q 1AB8A 2VFRA 1XBWA 3KK1B 1HHQA 1IJEB 3PXGa 4PWDB 3T19A 1C1BA 2MHNA 3A3PB 1NUEA 2FUG9 1NKBA 1TL7B 4PYAA 4EO8A 1DTTA 2B5JB 3T5JA 3IG1A 1RABB 1W2IA 3KNGA 3N01A 2LVWA 3Q8VA 2HHHJ 4WYWA 1WNEA 3BR8A 4NLGA 2RKIB 3CCZA 2Q66A 5L9NA 1S6PA 2NREA 2PIIA 4UOCA 2GQQA 3QATA 2ZEJA 3ZXWA 3WBZA 2GA7A 1DTQA 3UN5A 2DIUA 1TU0B 5D4PA 4DR7F 4USIA 3O1LA 4Q8EA 3W63A 1QSLA 2IA6A 2XGQA 4DUTA 4USUA 1X7VA 5A76A 3GYNA 4BC7A 2GO8A 2R2SA 3KHGA 1WC1A 2QG9B 3DOMB 1LW2B 2RT3A 1I5OB 4RX6A 4DV7F 2EFOA 2FVPA 4DL4A 4LQ3A 5D8HB 6FDRA 4DWIA 5KFGA 1E6YB 5AE2A 2HIQA 3FMBA 2QJ3A 4HTIA 3IR7B 3TZYA 4ZS6A 3NY0A 1G1XA 2DNZA 2GHWA 3KG4A 3MEDB 5M2PA 4AQYJ 3KLGB 5DDPC 2AX1A 1B0TA 5A6PA 4DSKA 1HKAA 3HT3A 4GVBB 3KJVB 1HNWJ 2XLJA 5C7PA 4IG0A 2HGLA 1FJGF 4K4TA 3AJDA 2ROPA 4DF4A 3UE2A 2BKPA 4OI3A 1N5QA 3RAXA 2XS5A 4L72B 3V4IB 1AA1B 3D6HB 4DR4J 4ED6A 2W1BA 1APSA 2OH2A 3AD8C 2YQ0A 2RQMA 1RKJA 2ZH4A 2GVZB 5D6GA 5C24B 3FJ2A 5IV4A 2KU7A 3ET6A 4DMZA 1RWXB 2Q79A 2ZD1B 2UXBF 1VLOA 5KFYA 1IBMF 4FXWA 2PT0A 1Y0HA 3MEKA 4I6YA 2J5AA 1GMUA 1UVLA 4ECQA 1TKTA 2K7JA 4G1IA 2L9NA 3LWMA 2UVVA 2YNGB 3VAGA 2H54B 1QM9A 2XY5A 4ID8A 1HW9A 1WF0A 3R5GA 2JFKA 5HO4A 2GHPA 1UVJA 3I0RB 3I32A 4DQSA 2MJNA 4DL0C 3T5LA 2DNYA 5C2GA 5KFNA 2RD5C 4I4BA 3DRSB 1YJVA 4WK1A 4NLPA 2D3OR 2EK1A 5E41A 4F26A 2XQCA 1HFEL 3RRGA 1SKSA 2AF6A 1FJCA 4WXOA 3JAMU 1B7YB 2GVDA 2OD6A 3A8IA 2LDYA 2OUGA 3FSXA 1HHTP 3A8JA 3D6MB 3J7AN 1R8AA 3RRHA 3GJQB 1YTYA 2E1MC 2HFNA 4RW7A 3TNVA 5G0RB 3ZZ0A 2MQPA 5K8NA 3P6YC 5IT4A 1UL3A 4K2XA 4OZLA 3DHWC 3W5ZA 5ETRA 2M52A 2WVEA 4PXBA 3PACA 3G6YA 3W8GA 2QMUB 4OI6A 2V2QA 2AJ4A 5KT2A 1FJ7A 2VPZB 3OVAA 1EETB 1QAYA 3JB9k 4O3QA 2HHUA 3H5YA 3M32B 3OVSA 2M3DA 4OZ5A 3KJFB 3FMWA 4ZVUB 1K0TA 1RT6B 4F04B 4XDDA 3H20A 1JIHA 4KO0A 3NBPB 1NDLA 2XG8A 2PN6A 3S7RA 2WAQD 3BO4A 1RA7A 4FF2A 4M5JA 2QFJA 3CCRS 1EQ0A 4B9MA 3TI0A 5D77A 1FTCA 1KVJA 1NK6A 2GX8A 4CLUA 2NPIA 1DRZA 1Z2LA 2KDOA 3M8QB 3W3SA 4PYDA 2CPHA 4BWMA 3VAIA 3DOLA 1RE1B 4X65J 1NZAA 2BOAA 1VBZA 3D66A 4O4GA 1X9WA 4ZVHA 5HBMB 4NMLA 2V8VA 4DV2J 2ROGA 4OV1A 5F8HA 1RWUA 3FK4A 5IM0A 3H5XA 4KHRA 1UWAA 4C8OA 1CC7A 4WPAA 3R6GB 2OPPA 3ZZZA 4BS2A 1AUSL 2GCFA 4X64F 1VR6A 4C2MA 3CJKB 3SQOP 2DRBA 1HWIA 4DSEA 3IBCB 5KT6A 2KH9A 3E8OA 4ZHRA 3GB0A 3HMJG 3OJUA 2DBBA 4L76A 7AT1B 1M1GA 1KSPA 1G7CB 2YQ3A 4G1QA 5LMNJ 2AGOA 5EUHA 1TZ0A 4TQRA 4EYIB 1SC6A 2BJ9A 1R8PA 1Q16B 2WCXA 2ZBIA 2UUCF 3K59A 1OQ3A 2PEBA 4NPOA 4A8WA 2A10A 2X1GA 2E5LJ 5J2NB 2DHXA 4BC9A 3O3LA 2WOMA 3UN3A 2YPYA 4Q44A 1U6BA 2D3ZA 1RAEB 2APOA 1N6QA 2MZSA 4DCOB 3NMRA 5CQGA 5F8IA 3UPFA 3JQJA 5DGAA 2XNRA 1YHQS 4XIUA 1RTHA 4IRCA 2YWHA 3CJ5A 1FCAA 4USJC 4F3MA 3PIOQ 2CVEA 5MAOA 4QW9A 1Q5YA 1T7PA 5A2QU 2EPIA 4B3MJ 1H2VZ 3H7HB 2M0GB 2VG7A 3V6HA 2IBKA 4DX5A 1S49A 2IC3B 4O3SA 4RUHA 4CP5A 4WK3A 1E6YA 3MR2A 3MPUB 3OUYB 5L1LA 3FSYA 1R0CB 3RAQA 1FF2A 2DNHA 1KLNA 4CLSA 5H9FK 4L3NA 5BR8F 1MLAA 1S0NA 4AT1B 3QZ8A 1RGVA 4FPRA 1RHMB 4FF4A 5ITHA 2V4JB 1FFWB 4P7VA 1F9HA 4KFBB 2CQHA 1MROB 5F9NA 4ZVOB 1FKOA 3UNYA 1H2TZ 3FEZA 3BM7A 1AFIA 1HNVA 4F3QA 2BYCA 2WVCA 1L3SA 1S0OA 3L7PA 4D3HA 4NEYA 4LRDA 2E44A 4F2SA 4RUAA 1P8GA 2D41A 1JLFA 1UWBB 4GO5X 5ETNA 4P74A 1OY6A 3TQ1A 2ZBRA 1H72C 1DLOB 3TO8A 2LQ8A 2I5JB 1JXVA 2G1HA 3NCPA 4QWCA 1Q8IA 1JWWA 3U02A 5F3ZA 3IWNC 1N88A 3MPDA 5E3PA 4IDKA 3IGNA 4USVA 3VHQA 1KR4A 4U7UK 5ETPA 3PFOA 4OX9J 2JSXA 3V4MA 1ZOTA 2B4PA 2XGPA 1NDCA 3RB6A
chains in the Genus database with same CATH topology
3E2EA 2QYCA 3PY8A 4K59A 2VL1A 1UEVA 2QV6A 2MY7A 4YDXA 3MM7B 1B64A 5KFZA 4NCGB 2BJEA 1CPZA 1TL1A 1HNVB 4YEAA 3QO9A 4K4YA 2DR9A 2B7BB 3KK2A 4GKJF 5BYRA 3M4XA 4JUZA 4KB7A 2ALZA 3C6TA 2VG6A 2KHDA 3J7YU 4MFBB 1JLFB 2V94A 3DI6A 3TYTA 1VC0A 2JOQA 1U1NA 3NNCA 1HHSA 3TUIC 3BGRB 4OZJA 2COLA 3MCSA 4K4WA 5FDLA 5KFBA 3BSOA 3H2UB 3M05A 1HYSA 1YG0A 3DC2A 3HZGA 1Q7YT 3JSYA 4JV1A 5F8LA 3HJFA 2F3JA 2KFZA 3H5UA 3MR3A 2DNPA 3DLKB 2CRLA 4LF5F 1IJFB 4OLOA 2FJBB 4WTYA 1N5VA 4UW2A 4LSNA 3F73A 2HFOA 2QA4S 1S1VB 2KT2A 4LJMA 2W4CA 1Q1KA 2JC0A 3FFIA 3ICLA 1FK9A 2YWFA 4TY8A 4IDKB 3OL8A 3HHNB 1NKEA 1Q79A 4K4SA 3JYTA 4XDCA 5K9FA 2EBGA 2LECA 1ZETA 4IOAQ 1BQNB 4YR3A 4DL3A 4QPXA 3Q2TC 5THWA 1GX6A 3M2VB 5GADU 2RDJA 1JLQB 3LGNA 1XR5A 4OI4A 3T9ZA 4WZMA 3BQ2A 2BZ2A 3QAEA 2ZFHA 3HHLC 2C3OA 1I1GA 1U24A 3LALA 4EBDA 4DPOA 5CZVA 3HKZD 2CQPA 5I3QA 2CJAA 2QA2A 2R2RA 5CYMA 2DD8S 2LKZA 4ZOSA 2JVOA 4ZCKA 3T6JA 4DJBA 1S77D 4WZQA 4OJ3A 3OBIA 1WTBA 3C2PA 2HHXA 4FBTA 1OQ6A 1NU4A 3PEHA 4HTJA 1JLGA 1TL1B 3N6MA 4M5DA 1VK3A 2ZKTA 3MPYA 2GJIA 2ADCA 1FRKA 3QO9B 2IJFA 4HDHA 3KK2B 2NR0A 1N33F 4WFAQ 4K5RA 3MMAA 1UVKA 4C11A 3O8WA 2KG0A 3R27A 3AJ2A 4DOZA 2VG6B 4Q0BA 3PX6A 4QIEA 3DI6B 4Y00A 2R4FA 2JWNA 2B7CB 1C1CA 4J37A 3GR1A 2VFUA 4M63A 2YY3A 1U6FA 1FTRA 2LXFA 2N3LA 1NRKA 1RTJA 2XWXA 4QPTA 4OX8A 3MUTP 3GIMA 1MWYA 1T03A 4Q8FA 4PG7A 2KXFA 5LT5A 2HVIA 4NLYA 3CGIA 3J7Z5 4NRUA 2C2EA 1QTMA 4MIBA 1VQOS 5KFRA 3CCUS 4ZMMA 1KC8T 3DYAA 3TOQA 3LOUA 4RNMA 2BQ3A 2HQ3A 4QBUA 1YBAA 3CIMA 4LSNB 3MMBA 4LF4F 1NK4A 3M8PA 3AB2B 2JHEA 1JNZB 1U1MA 3FFIB 3GFHA 1FK9B 3HVTA 4TY8B 1JLEA 2A2CA 5CD4H 2V0NA 3CJ4A 3I56S 3JYTB 2FLNA 3H2VE 1M0SA 1CQNA 4OX7A 3F44A 2X1BA 3CWJA 2KFYA 1HWUA 2NUUG 4ZPVR 3LP2A 4J9OA 1S0MA 2XC9A 1F2GA 4F8RA 2IJNA 3KWMA 3M30A 3OXGA 1NEEA 1TVRB 4O44A 3PW2A 5T7LA 2YKQA 3CJ2A 3V81A 4X4NA 4HT5A 3BSAA 2CQ2A 4Y2AA 4RWXA 1O5JA 5DDRC 4TYAA 4HT7A 1RT6A 4NZ0A 2HAIA 1YVFA 2VB6A 4PG6A 4FS2A 1U8SA 2JEFA 3DCAA 2BV3A 5CYMB 3FGVA 3QWPA 3OTOF 4QZVB 4RZRA 5KFAA 1Y3KA 4WF9Q 1H7WA 4Q2LA 4FS1A 4OI1A 4CT8A 2V9WA 5E0OA 4U6PA 3TR5A 4ETXA 1JLGB 2EFNA 4M5DB 1LK5A 4U67Q 3RB4A 2DR8A 4LFCF 1VQ8S 3MMAB 4C11B 2BR0A 1NJZA 1RTIA 4Q0BB 1LK7A 3SMZA 5KT4A 2RRAA 5L9XA 2B0GA 2HHHF 2JFDA 1C1CB 3M6UA 1U6ZA 2EG1A 2VBZA 3SCKE 3UR0A 1RTJB 3OHAA 5F0WA 1T03B 2K7KA 1YIJS 2KG1A 1GTEA 1D8YA 3B78A 4EBEA 2O01C 1NK0A 2GMHA 3OV7A 1QUVA 4WJBA 1V3RA 4RW9A 2KZZA 2YKAA 2W4DA 2PEHA 3DYAB 5SUHA 3JSBA 4C0HA 1YGYA 3FZBA 5E33A 2HYIB 3MMBB 2QEXS 4NXNF 4OI0A 2UUWA 2KFNA 3M8PB 1VQ9S 2XEXA 4JI7F 4QR2A 2XZWA 2WB1D 1UEUA 3V5RA 3OW2R 1JLEB 4MIWA 5LSOA 5KT3A 4J9KA 3T3FA 3NRBA 4AL7A 2GFFA 2MQOA 3HI9A 2DIVA 1S7HA 3OR1A 2RU9A 3SEOA 4LT6A 3LP2B 1VRTB 2FHKA 5DDQC 1R7IA 2Z4PA 2OJ3A 2RS2A 2GGPA 4IR9A 3RW6A 2MKSA 4X4OA 2Y1RI 3M30B 3CDAA 4O44B 5A2QY 2P9GA 2DH9A 4ZPCA 3PW0A 1UAWA 1TKDA 1JK9B 5T7LB 3FQKA 1ROFA 3RB3A 2IYGA 3V81B 1JJ4A 4DR2F 4YOEA 2QSFA 3OLBA 2KB2A 4KKOA 4QOTA 4YB1P 2HS4A 4NLTA 2A2DA 2NYIA 3IA0A 2VOPA 3MTJA 1FRXA 4M95A 3P49B 1KEKA 3MOZA 2VPYB 2LXUA 3ULHA 3CCWA 4DQPA 4B9LA 5HN0A 3IR5B 2ZE2A 1CLFA 3PW7A 3CSKA 2KJVA 2YNIA 3QGPA 4CIOA 1YJ9S 1RTIB 2C3MA 4QIFA 1N5SA 2WSFC 2VBWA 4TKTA 2UXDF 2R7QA 2PO4A 4N47A 5KT5A 2OMLA 4ELVA 4B9UA 3M8RA 3JTPA 3MDFA 2CIMA 5DLGA 3BZQA 2E5GA 2K3IA 3T1AA 2F9DA 5D4NA 1FJEB 3O2IA 3QLHA 4PXCA 5LSRA 1C4CA 3OTCA 4RW9B 2CJQA 2Y1IA 3O6QA 5AJ3F 3OXFA 4RBUA 4FZVA 1HD0A 4ECTA 5EWEA 1LFWA 4IRDA 3V6DA 1SI9A 1HBUA 4AQYF 2OPQA 2NQPA 1K73T 2N7YA 1WELA 4X2BA 1I94F 3ZZRA 2KRRA 3PHEA 4DQQA 3HXMA 2AW0A 3K57A 2P9EA 2ILYA 3HF5A 3HHLD 1S76D 2M4MA 3NP5A 5LMUF 2GW8A 2F4VF 1FHTA 1U1RA 1HNWF 2GGPB 3KNAA 4J5OA 5KFEA 4OJHA 4RNFA 3T9NA 3TX8A 4HEA9 2UUBF 2RRNA 3CD5A 2BDPA 2WBRA 4ZCLA 4WE1A 1UVMA 3OR2B 3VTIA 2J0XA 4WFYA 2FY1A 5J2MA 1VFJA 1UA1A 3D54A 1LOUA 2QT7A 4NZ6A 4KKOB 3OL6A 3BF4A 3FRYA 4ILLA 2IA0A 5B0EA 3SXLA 1WHWA 3DNCA 1KOOA 2C3YA 3CMAS 2DPIA 1UA0A 3CD6S 1O8BA 2VUGA 5KFOA 3TAMA 5J2NA 3JSRA 2GIQA 4NYZA 2ZE2B 3QIPA 5KFDA 1UMJA 2YNIB 3ENWA 3DHXA 1NJIT 5B0AA 3IAS9 4JV5F 4MYTA 5L8RC 1MU2A 2EW9A 2B51A 2LA4A 2MXYA 1NJXA 5EN1A 2I8EA 4Z37A 3KLEA 2W9BA 3K5NA 4WU3A 3ZZPA 5A8WA 5F8JA 4EU0A 2L41A 1KTQA 3GFZA 4OQJA 3RW7A 3IRXA 3ONQA 4N41A 2VD3A 3MWBA 4K50A 5CXTA 2DJWA 4Y2CA 2OAUA 3CD7A 3ITHA 5HMYA 3QLHB 5HL7Q 1Z4UA 1NK8A 2WRMA 1C0TA 5ADZA 4ECRA 2ZVSA 3ZZTA 2XWYA 1NK5A 2KT5A 2DB1A 3OFEA 1URNA 4W92B 5T14A 3V6DB 2FJAB 5DS7A 4CH0S 3DLLQ 1YRUA 1XERA 2OPQB 1ZAVA 2B9WA 3C66A 1WEYA 5D3GA 4BDPA 4P7TA 2R7SA 5B0CA 1W2BR 1RYRA 1L3UA 4PKDB 4YP3A 1TKXA 4PUOA 4C98A 4ED7A 2FVRA 2V2KA 2OSRA 3OFGA 4HH0A 2XMWA 2CG4A 1IQZA 2NS1B 4A8QA 1L5UA 3PO5A 2RUGA 1JKHA 1LWCA 2AGPA 4H4OA 1U09A 4CO0A 1TL5A 2J9CA 2QSWA 4WE1B 3MAQA 2XY7A 1VBXA 5J2MB 1WWHA 3R5DA 4GO7X 3N6NA 1TFYA 5J1EA 4A8OA 5HP1A 1QAXA 4Y2MA 2NUHA 4IR1A 3KHLA 2XSJA 3QIDA 4OHYA 4U7CA 2O3DA 1J5EF 2LU2A 4Y3CA 2J7KA 4C3KA 2OSQA 3J7ZT 4DLEA 5D4OA 2IM2A 2LQBA 3D0IE 3TAMB 2BRKA 5F8MA 3ENVA 3E3XA 5GAEU 1ZPVA 3MGJA 2V4QA 2L08A 2NXUA 1LKZA 3QIPB 4ID5A 4ZP6A 1RT3A 2ZOFA 3OXLA 2FHJD 2ZDOA 4RNHA 4D3GA 4A46A 1QSYA 1KONA 1MU2B 4KAIA 3R1HA 3BGFA 3UNGC 3KLEB 3DXSX 2W9BB 1B0PA 4ZPBA 5A6WA 5A8WB 4CT9A 3QPIA 2BQRA 3DLHA 2DHAA 2WHOA 5DETA 4EZ6A 3D28A 3IRXB 4ZP8A 3SCJE 2XCPA 2CQCA 4ILRA 1U4BA 5G4DA 4WFNQ 4ECVA 1X9SA 1M90T 4IQXA 2YWEA 3ITHB 2LA6A 3OSPA 1IR0A 3M2UA 1XMQF 1C0TB 4NRTA 3WZ0A 1KS2A 2B9XA 4X4QA 2KVIA 2DT9A 3HHLA 1MMLA 5DQHA 1VK8A 5DQIA 3DLBA 1KVIA 1ZAXA 4MYUA 3J7A1 4KRWA 2NLWA 4R5PA 2QZ8A 2HG4A 3TVYA 1N52B 2V5HG 4TY9A 3GIJA 2MB0B 4OFZA 1NK7A 5GAGI 5D3GB 2DNQA 4A48A 3QJJA 3DU6A 2DNOA 2JVRA 4ALZA 2ZHOA 1TKXB 4DQRA 4HI1A 4PUOB 1D9FA 1QUPA 2AYEA 2CFXA 2I2YA 4DL6A 4O23A 4URGA 2X51A 4H4MA 3TA1A 1U1PA 2QO3A 2MKHA 2X3GA 2G1DA 1JKHB 1LWCB 4H4OB 4MK9A 2R7RA 2FC9A 4F3OA 4Y34A 1N56A 1N8RT 1TR0A 2VOOA 2NSCA 1P9QC 3VCDA 2XO7A 3BDPA 2WONA 1GH8A 2MQLA 3AJ1A 4DN9A 5J1EB 1U2RA 1X4EA 2YX7A 1VQYA 4LSLA 2DNRA 3SI8A 5HP1B 2FPHX 2V4JA 1P27B 4ECWA 1RTDA 1RDRA 2XSJB 3BO3A 4PQAA 3B8HA 2XLIA 4AYBD 4F2RA 5K5MA 5E2QA 4N8OA 1F5AA 3C8YA 2J0SD 2CPEA 1RJJA 1JXLA 1NHUA 4NLWA 5L38A 2J6SA 2FJDB 2BUNA 4WFZA 4ID5B 3BS9A 4CO4A 5CYQA 3DRYA 3MI7X 3SSRA 3IFEA 4A8XA 2KKHA 1BWEA 2DGUA 2Q1LA 3GQCA 1KQKA 3M2RA 4HKQA 1RA6A 1VQKS 4I56A 5DG7A 1VRUA 4GKKF 5C42A 3IS9A 3RBDA 2EC0A 4ZPWR 2PC6A 1HQUB 2K2PA 1XNRF 2JEGA 1E6VA 1S9GA 2BBEA 1HW8A 3EGZA 3PR5B 3M8SA 3DN9A 2ZH8A 3HHLB 4F02A 3G6ES 1S6UA 1U49A 3DFEA 2BE2A 5F9LA 5KFWA 2R2TA 4CO3A 1KOHA 3JAMY 4R5PB 2V8GA 3R5AA 1ZH5A 2HW3A 1JB0C 3N79A 3GZ7A 3GWCA 4RWWA 2EBEA 2X1FA 2D9PA 1RQ0A 1KHVA 2ZHBA 3Q22A 3HK2A 3I9V9 2J0QD 3EYZA 3T1HF 1V3ZA 4NLQA 3ZZUA 2GQCA 2LQ9A 1K1QA 1SL1A 4O3NA 2DRAA 1SJFA 2BACA 4MTPA 4H4MB 2XMVA 1FEEA 2IRXA 2ZH9A 4ECYA 3AQOA 2C3UA 1ZM9A 2BABA 3ZZOA 3NLCA 2J6TA 5D4LA 3BDEA 2VA2A 2WONB 5L39A 3UQSA 4LSLB 2ZJRQ 1O51A 3MD1A 4QIVA 1WG5A 4G6VB 1U1LA 1RTDB 1IQTA 2FHJA 3K58A 3R3TA 5CH7B 3FDSA 5KFFA 2BANA 1UFWA 2Z2LA 4AFFA 4RU9A 4DDFA 2KRBA 2JLFA 3MR5A 2J76E 2U2FA 4YB7A 3SDEA 2ZHAA 4B3RF 3U7JA 2B6AA 1BD6A 4IQMA 3I9ZA 2F7VA 5D78A 4V19J 4C8ZA 3G8QA 3W2WA 5KFPA 2ZH1A 1IBKF 2V8DA 3NGDA 3CJ3A