4KY3A

Three-dimensional structure of the orthorhombic crystal of computationally designed insertion domain , northeast structural genomics consortium (nesg) target or327
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARSSKEAYKFLAILAKVFAELGYNDINRKMTVRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEITITGVPRQVLEELAKEAERLAKEFNITITITVTVEGQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Precise assembly of complex beta sheet topologies from de novo designed building blocks.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords designed protein OR327
total genus 40
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ky3A00
4LFAJ 4NXMJ 3IMQJ 4NEYA 2UXCJ 4B3TJ 2F4VJ 3T1YJ 4LF6J 4DR7J 1N36J 4OX9J 1N33J 1J5EJ 1XNRJ 1HR0J 4GKJJ 4NEZA 2HHHJ 1HNZJ 1N34J 1XNQJ 4AQYJ 4DR4J 2ZM6J 2UUCJ 5IT9U 5LMUJ 4DV3J 4LF8J 5BR8J 1XMOJ 1I94J 4JI1J 4JI5J 4DV7J 4DUYJ 2E5LJ 4JYAJ 3R2DJ 4JI0J 4JI3J 1IBLJ 4JI8J 3J81U 4LF7J 4HHUA 1HNWJ 4DR1J 4DV1J 5LM7E 2MEWA 5A2QU 3D3BJ 1IBKJ 4JI4J 2VQEJ 4DV5J 4JI7J 4LF4J 4GKKJ 5AJ3J 4DV2J 3R2CJ 4DR2J 4RJVA 4DV4J 2MQ8A 4V1Ak 1XMQJ 5FLXU 4JV5J 1IBMJ 4X62J 3JAMU 4B3RJ 4KYZA 4X65J 4PWWA 1FJGJ 2UXDJ 3D3CJ 4JI6J 4LF9J 4YY3J 1N32J 2UUBJ 4X66J 4B3MJ 1HNXJ 4X64J 4DV0J 2KVQE 4KY3A 4K0KJ 2KL8A 3J80U 4NXNJ 4DR5J 4LFBJ 3J7AN 2UU9J 3T1HJ 4JI2J 4DR3J 3W1YC 5IWAJ 4YHHJ 2VQFJ 2UXBJ 5LMNJ 4KHPJ 4DUZJ 2UUAJ 4DR6J 4LF5J 4B3SJ 4DV6J 3OTOJ 2MTLA 4LFCJ
chains in the Genus database with same CATH superfamily
3EE3A 1F0XA 1U47A 3L3CA 4OX9F 3IG1A 5HQ8A 3TI0A 5B0EA 5KG4A 3OSNA 4J9RA 4RNNA 4NRTA 4ID5A 2FJBB 1ELOA 4C8ZA 1V5IB 3NLCA 1I51B 4G1QA 4FVMA 4KGKA 4OJGA 4P2SA 4RUCA 2KXNB 1LWCB 1ZOTA 3UDCA 2XS7A 2E1MC 4N76A 1RT6B 4ZITA 5L1KA 3QFHA 2LLZA 2X3GA 1JMTA 3BGFA 1ZM3A 3EVMA 4YDDB 2C2MB 3C15A 3FMBA 4NX9A 3VAIA 3QJLA 2HHHJ 1CJVB 4AUKA 2CQIA 3NNHA 1SV5A 3MDFA 4PYAA 3GIIA 3IGNA 4HHHA 2FY1A 2ZM6J 4WFNQ 3SDEA 1C1BA 1GAOA 2F40A 3AJDA 4TLRA 1K1SA 1R8BA 1RHRB 2MY7A 2Q1LA 5IT9U 3JTPA 4ZOSA 5LOQA 3SQGB 1SC6A 3T9NA 4ES3A 2E9ZA 4XDDA 3QYYA 4CLYA 3TX8A 3E3XA 4C98A 2DEIA 2GVDB 4DUZF 1LWFA 3DHXA 4F4AA 4NA1A 3KK3A 2H65B 2OMLA 5DQGA 2RF2B 3FBFA 1HQEA 5KFBA 3FQLA 4FKXA 4K5RA 3J80Y 2BVZA 1X5OA 4BCAA 1FXRA 1WI8A 2RRBA 5ETSA 4DJBA 3TX0A 1TZ0A 4M94A 5F8JA 3DLEA 2MLYA 4QW8A 4H54A 4C11A 1RKJA 2RSQA 1R0AB 2W7OA 5C2GA 4FYXB 2ZH8A 1PGZA 1OYDA 4LRAA 4U7CA 3V6HA 5C42A 2CAJA 4OI1A 1RISA 4K4UA 3CJRA 1FE4A 2BANA 4R0JA 1CS4B 4CT8A 4DV1F 3CJ0A 1YBAA 1T9YA 2CDRB 3TO8A 5E3RA 3NNCA 1OY9A 1X4HA 1Y5NB 4ZPBA 3T41A 5JVGQ 3TZYA 4ITSA 2W7PA 2VHGA 2UUWA 3U7JA 4HDGA 1VQ6S 2J8SA 1V3RA 4G65A 1S9EA 2JX2A 2YWEA 1HNVA 1ICEB 2WAQD 2XMMA 2CQBA 4ICLA 4TU8A 4X4RA 3DI6B 1Q16B 3PKYA 1Q79A 3KLIB 3EDQB 2XCAA 4DG1B 4V19X 2UVVA 3ISZA 4KR0B 3VZHA 3BREA 1T05A 5IQQA 2CQHA 3HF5A 5GAHU 4KKOA 3CCJS 4IOBA 1O6XA 3DRSA 2D1CA 2ZZTA 4ED0A 1RB0A 4JI6J 2FB0A 4USVA 2HIYA 4OI2A 4F04B 2DCUB 1RU2A 2K1RB 4QBUA 1RT7B 5A8WA 3PFOA 5H9EJ 3KJQB 4B3MJ 2JJ4D 2KM8C 2ZH1A 2V2QA 3IFEA 3TUPA 2R7SA 2R7VA 3RYLA 4OYOA 1TAUA 2XULA 2BA9A 3G96A 1M0SA 2QA1A 1RWMB 1JLFB 4A8SA 5F8IA 3NS6A 1UFWA 2CFXA 2EFGA 4O4RA 3RGIA 2AV5A 2A2DA 5B0BA 5ITHA 4TU7A 3H2VE 3KJVA 1B7FA 3LP0B 3KLFA 2B9WA 2YNFA 2HQCA 2RVJA 1S1UB 2B3TB 2V5HG 2J0WA 3GIRA 3M30A 3POTA 3T19A 1VK3A 1JKHA 2EG1A 4DV4F 2HHQA 2Q3PA 2F9JA 2K06A 3W62A 1RTJA 4B9MA 1RHQB 2XSJA 5ETLA 5IQ6A 4ZIVA 4O3RA 1YJRA 1UPMB 2HRTA 2G1DA 3PEHA 4A8XA 2W8LA 3D0GE 2HW3A 3NGUA 3SQGA 3KG4A 1SJ1A 2MQNA 4N47A 3VV2B 3I5CA 3K5LA 4A8WA 2UXBF 3BDPA 1CEZA 4OFZA 3N9UC 4ZP6A 1BMQB 5K14B 4GC6A 2K7JA 1GMWD 2KZZA 4CH1A 4NZ7A 5M2RA 3D28A 3MFHA 4F4KA 4UY8T 2X3DA 3C3LA 3VAHA 4DPXA 4LR7A 3GJTB 2QA2A 1N34F 2MYFA 3FRYA 3OT9A 2ALZA 3A3OB 2VA2A 5B09A 4ZPWR 5C2CA 4JUZA 1FRIA 1UETA 2CQ1A 2CPXA 3CJKB 4P2FA 3V6DA 1M1HA 1TK5A 1DJ0A 2XEXA 1OQ6A 2DTJA 1XNQJ 1DY3A 1HKAA 1MROB 3VVUA 2HFVA 2DNHA 3CUNA 4Y6IA 2QG9B 3OSPA 2RU3A 3GYGA 1A6LA 5HVGA 1Z4UA 5LMUJ 2N7CA 1MU2B 4JI1F 4IG3A 1JLAA 4OIXA 2XWXA 2WVDA 2DNYA 1NJIT 1RI7A 2HHVA 3N4WA 2IA0A 4AD6A 2RIJA 1OYEA 3H59A 3ET6B 5F8LA 4B3SF 2XS2A 4DUYJ 1GMUA 3JQKA 1YZ6A 2W2NP 1N8RT 2ZFHA 1LFPA 1R8CA 4ATNA 1GTHA 1NHVA 1R0BG 5KFDA 5D3GA 2GV1A 2RDDA 4UOFA 5F0WA 4LF9F 2H5IB 3FQKA 4NCBA 4JI5F 4C8MA 1U1PA 2V67A 1IQZA 2E5LF 2J7UA 3MCOA 1N32F 1JNZB 3H7HB 1HNXF 1CPZA 4ZVGA 1XC9A 1UWBB 3K17A 1HL6A 4JI3F 4Y2IA 4WXWA 1FDBA 4ZVUB 3VGUA 2HPUA 1UFLA 5KT4A 5EWEA 3MMJA 5HLFA 2HWTA 4ZJLA 1M5PC 4PRFA 4PXEA 2XY6A 1QJHA 3S8SA 3DLJA 2QMUB 2GS8A 2C2NA 2C1EB 2N82B 2RS8A 4BBYA 2G2ZA 4R5PA 1C0TA 3CEDA 4MK8A 4JI7J 4P72A 1GNKA 1QAYA 4YMEA 3GG0A 4OZJA 2YX1A 4LRFA 1FTRA 2DNQA 2IM0A 1UCNA 1SJQA 1VI7A 3BGRB 3KHRA 1LWCA 2Z8QA 3TQEA 3M30B 4DR3F 1Y10A 3FMWA 2CNNB 3W2VA 2YNHA 3LP2A 3FGVA 2YH1A 1KD1T 3MAQA 2WCXA 1SBRA 2CIMA 4B3RJ 2CPDA 2J0XA 1YK9A 5CCMA 1BXNA 1Y00A 1X4FA 4J9NA 4DQQA 4ZLJA 1WC0A 2FJXA 4YY3J 1IXKA 1C1BB 2ASYA 3D9BA 1XJWB 5T7LA 3PR5B 2UUBJ 2HHWA 3BSNA 1YJUA 4LSNA 2X1BA 2DGQA 4HDHA 2DD8S 4J9VA 5D6GA 4K4TA 2WVEA 3NGSA 1LW2A 4KT0C 5KG3A 3RB3A 2KTQA 4DDFA 3CCRS 3FCHA 4O3NA 2DK2A 4YR0A 3MEDB 1WDDA 2R7UA 3HHLA 3PIPQ 2E5JA 1IBKF 2UU9F 3IWNC 1S1XB 2LEAA 4URQU 4BWMA 5ETPA 2XMVA 4IH5A 1KR4A 4AFFA 2NYIA 3A3NB 5KG2A 1UKUA 2CJKA 3AJ2A 2FC9A 1P8GA 3ONQA 1F3FA 2BE9B 3JS9A 2V4JA 1F5AA 2A3JA 2JVRA 3TVZA 1BWEA 2IFXA 1M5VC 1PCAA 3WHIA 4FS2A 3FJ2A 2C3YA 2KDOA 3TWZA 2QV6A 4NI2B 4O4GB 4ZCIA 1FX4A 5KFWA 3HT0A 1PILA 1SCJB 3FBEA 1UA0A 5D0HA 4DF8A 5J2QA 1HFEL 2WHOA 3C6TA 1FJGF 2PO4A 1QY7A 4DR6J 3I82A 1T9WA 1LEOA 2GMHA 3I0SB 4NA3A 3UD5A 1DAXA 3W65A 3CF5Q 2NQPA 3KWMA 3T1AA 1SJ4P 2YX7A 3O1LA 4NEYA 5LMNF 2BKPA 1XN9A 2OHDA 4LBPA 3PYEA 1H6KX 2YXLA 3KUHA 3MD3A 4RBTA 5HQLA 3G71S 3CULA 2JDJA 1LW0A 1Q78A 4O23A 2BUNA 1KDNA 5D15A 4B3TJ 2HAFA 4WWSA 2F4VJ 2J76E 2W9BB 5KFEA 1S1VA 1YWXA 3M8PB 2DR8A 4OYMA 3A8EA 3OTDA 5EHHA 1LXJA 2GMJA 3KLFB 2BOPA 2P9GA 1FRJA 3KUGA 4TLQA 3VAKA 3PW0A 1R3NA 4OHYA 2YNIB 2VA3A 2VKZG 2JHEA 2W7AA 4WFXA 1GQEA 3CSKA 3I96A 3POTB 4DQRA 3HT3A 1VQMS 1DZ5A 5DLFA 3U27A 4P7VA 1RA6A 2I5JB 3PVXA 2EBEA 2UUTA 2ZDOA 1FXLA 1DQ9A 3F0NA 1H38A 2BRLA 1RAHB 1TL7A 4UF4A 2HSEB 1ZAWA 2VB6A 2Y0SD 2MQLA 3LW5C 4X4OA 1VQKS 2H54B 3H98A 3DGVA 3I0RA 2L9WA 3QIDA 1C0TB 1FK9A 2GCFA 1SUQA 4WIQA 4U8VA 3H4BA 2UUCF 2J5AA 2M8HA 1Q53A 3KOAA 4X62F 2BEFA 1V6HA 3IAM9 2A1BA 3MGJA 4CNZA 3NCPA 5H1SV 2Z2YB 5A76A 3P49B 3AB2B 1ZZNA 1IBLJ 4IUFA 1Q8IA 2OFHX 4BLGA 2Q6BA 2XMJA 4GVLA 1FO1A 2DHAA 4CI0B 3GV5B 4X4NA 3Q8VA 1CSJA 3I4HX 4H4OB 3CGIA 2RT3A 1IR1A 2R4FA 4A47A 3HDSA 2VG7B 4NLSA 5D4NA 3TQ1A 4IR1A 1BQNA 5K8PA 3LWLA 5ETMA 1N5QA 1TTHB 2OELA 1V5VA 4JP8A 3FVYA 4RUBA 3THVA 4EZ9A 2VOPA 1PBAA 3IR5B 3ZNJ1 1TKZB 2IDEA 2DGOA 4O3PA 2RD5C 4USWA 1BLUA 2OSRA 5D4PA 4X4UA 4UOHA 1RAOA 1MU2A 1N0UA 1EAYC 4ZVTB 1JJHA 1HBMA 2ROEA 1F5BA 5DZ7A 2G0IA 1FFGB 2LU1A 2GC8A 2DXFA 2HFOA 3HSJA 3NRBA 1REVA 5EDWA 3T5KA 2L48A 3VCDA 3DRPA 3KLEB 2P9EA 1ZH5A 2XNQA 4RW6A 6FD1A 5AJ3F 2CPFA 2F8HA 2VG5B 2L08A 3M4XA 4ZHRB 4ED2A 1U1LA 1IBMJ 2DO4A 3M32A 1RWUA 4F8RA 1NK7A 3P6YC 4MK7A 5F3ZA 4X65J 1NZ8A 3KLHA 3T5HA 4C6AA 4O0NA 3QT7A 4LF9J 5J2NA 4Q0BB 3BR9A 2OI2A 2HVHA 1JJ2R 4DCPB 4KV8B 3EGVA 1UVMA 1AFJA 2Y1RI 4DQSA 1RTDA 2G0CA 5L39A 4QYZJ 4NXNF 4R5PB 3W2WA 1MWZA 3VZIA 1YX2A 5LL6d 4DQIA 2Y8YA 1WG5A 2OMOA 1RLDA 1T9VA 3W8GA 2IY5B 1FNXH 3CJ4A 4J91A 3VR1A 2V34A 4NLYA 2WVCA 3OJUA 3IRWP 4PXDA 4GKJF 4I6YA 5F0UA 3CDWA 4F67A 4YR3A 2NZ4A 3DU6A 1UJ6A 2E1RA 2CPIA 1EKRA 4MFBB 1FESA 1OS5A 1S9GB 2OPSA 4IG3B 5SUHA 2B8PA 2XYPB 4FF3A 3MM6B 1SH0A 2LQBA 2X1GA 3LPYA 2GO9A 3P96A 1FF2A 4ANCA 3VALA 5F41A 2R8JA 4B9SA 1G2EA 4DX6A 2IJNA 3KXDA 1WI6A 1TUGB 1T9XA 2DNLA 3HKWA 4YN3B 3S1TA 3C16B 1RABB 4DUZJ 4Z7CA 1S9FA 1ZYQA 2RNEA 2P8IA 2G9OA 3P5BP 3M1VA 4ZKAA 5HVHA 2CJXB 1HARA 5J1PA 2E1AA 2ZVSA 4LFAJ 1DLOA 2JFKA 2RE1A 2QLJB 4IH7A 2N3OA 3EUNA 4ES1A 2NXUA 4O0IA 5HMWA 2GIRA 5E3CA 1QTNB 1Y0HA 4PKDB 5DM6Q 1LXNA 1NSPA 2RKIA 3NMAA 4KO0A 1NK8A 3NCQA 4RWWA 1FJEB 1NU4A 2V2ZA 3NXZA 4I6WA 3C46A 3R2CJ 3PY8A 2N7YA 4QPTA 3DC2A 3DLKA 4G6VB 2XZTB 1C0UB 4PG7A 2HFSA 5J2PB 3Q2SC 1SJFA 1BY9A 1V3SA 1TL3A 4GVBB 2MZTA 3TJAA 3FRZA 4ZCLA 3PYDA 3OXLA 1O0PA 1WSVA 3KYLA 4DSEA 2HS3A 3C66A 4FDFA 1BWVA 4M5IA 3MAHA 3JYTA 1ZA1B 3O8WA 2A2CA 3NS5A 3TP2A 2XMAA 4C8KA 3T5LA 3BSAA 2RQMA 4HVZA 1DTQA 2I6WA 4TN2A 3LP1B 3M6XA 1QSYA 2HK2A 3K2YA 1FJGJ 2XG8A 1GK8A 4M5NA 4FN5A 3GV7B 3B54A 2QL9B 2VG6A 2RF2A 4ZMMA 4ECVA 1TFWA 4KJIA 3UO0A 1F9FA 2OTLS 4B3OB 4ZJQA 1T9TA 4AE5A 5LXRA 5EWGA 1RWPB 2RJZA 1NPPA 3UVJA 4C0OC 3LGNA 4LUBA 2PDAA 2ZVIA 3GZ7A 1U0HB 3I87A 1CC8A 4ZN3A 2MHNA 1T94A 3M9NB 4ED6A 1N33F 3X3UA 4MIWA 3PIOQ 3BJYA 1JLGB 1RLCL 1S6QA 3UW1A 2PA8D 5DG8A 2DGTA 2J0QD 1YRXA 1TL4A 1QVGR 3MF5A 1DTTB 3WIVA 4FXDA 2HVIA 1J2VA 4RL1A 2RQKA 1RT7A 4K8RA 1NK5A 4C7QA 2B51A 2D69A 2KH9A 2BQUA 2B0GA 3KHHA 1LV5A 1HMVB 2XI3A 3DDIA 5CYQA 1HQUA 2F63A 5CHCB 2HBRB 3IS9A 5EGYA 4X62J 1VBZA 1HWIA 3CCSS 4D3HA 3FFIB 5HATA 4UT4A 1PBUA 4KYZA 4KH1B 3VGSA 2QL7B 4DX8H 1X5SA 5M2UA 4TKTA 3HULA 5A0YB 1Z1ZA 5L1IA 5CAAA 2UXDJ 4JI8F 2ILZA 3I32A 3W5ZA 3KLVA 4Y2MA 1VRUA 2BJ8A 2HFUA 4I56A 3OV7A 1HNXJ 1AZSB 3PV8A 1W2BR 5DGAA 4ANEA 1SUQB 1CJTA 2RILA 4EBDA 2AYMA 1O8BA 2ZDPA 2U1AA 4W4MA 3QSYB 3RRKA 1S9EB 2NSBA 4M5DB 2Z4PA 3NBPA 1CS4A 1EETA 2QJ3A 5KG5A 1YIJS 3PO4A 3EWGA 4Z2XA 4F3QA 4DL3A 3DM2B 1S1WA 3C19A 1QAIA 1TFYA 1FD2A 1NDKA 4MMOA 1VISA 2XM3A 5HROA 2R7TA 2DGVA 3DOMA 4R0EA 2XY5A 2CQ2A 3JAMY 2WOMB 2R7RA 1NAQA 1B64A 1OSDA 3CJ3A 2DHGA 1FERA 3MCNA 3MMAB 2XGQA 1M1KT 1JKHB 4KFBB 2GZOA 2FJVA 2XMTA 2KYZA 4DR6F 3CJ5A 1EQMA 1N88A 3CO0P 4WP3A 2KU7A 2GO8A 2VC0A 4WU3A 4LFAF 5A2QY 3Q2TC 4KV8A 4PZVA 2VQFF 2KG0A 5EUHA 3LA0A 4L76A 3UE2A 4HI2A 2E1PA 1FWPA 5J1NA 4DMZA 4DX7A 4I2QA 2L9NA 2W4DA 4ZDNA 1NPRA 3D6HB 4OZ2A 1R6VA 4TU9A 3OUYA 4IR9A 3CC4S 4X2BA 4NLUA 3Q86A 4CH7A 1XBWA 4ZHRA 1HBUB 5C7PA 5DG9A 4DFMA 5HK4A 4M95A 1ROFA 1S7IA 1XWLA 2C3UA 4EMDA 3MR6A 1KQFB 3OFGA 3QT8A 3Q8YA 1S1TA 5T41A 4MKAA 2VV5A 1P6TA 4ES2A 4Q5VA 5B0CA 5KT2A 4ENOA 3K59A 2DVIA 4GKJJ 2D9OA 4NEZA 2DHSA 1HNZJ 5M2PA 2AU0A 1N34J 2G2OA 4NLRA 2O66A 3ZFVA 5GAHI 1T8EA 2FY8A 3FC9A 2PT0A 2OTJS 1IKWA 4DR2F 2J6SA 4RLEA 1D8YA 1BQNB 1SH3A 1VOMA 3CNQP 3H25A 4RW4B 3RAQA 1X5PA 3R5AA 1RT4A 4Y2KA 5E3AA 1I94J 2YVSA 3AA8A 4DBQA 4PPZA 1PKUA 2GJ2A 2GA7A 2NXEA 4WPAA 9RUBA 1FKOA 3PZPA 1VBYA 3IS9B 4UOGA 4JYAJ 1XK8A 3ILOA 1TK8A 1MG7A 3W61A 1M90T 4YY3F 1GT8A 2OPQB 3MWBA 1KSPA 3QGHA 4WJBA 5HMYA 4I7FA 2YNGA 3D0IE 1KTQA 1OQ3A 4IFYA 1AW0A 4F02A 1FD8A 1H98A 2HGMA 2MKIA 4B9UA 5DETA 2PC6A 2AQ4A 3J81j 2AIRB 1WORA 1KHVA 4ETZA 5ADZA 3H40A 2YQ1A 2NXJA 3OTCA 2ILYA 2XS5A 1NRKA 3H20A 3NS7B 4TVAB 2F3JA 2IRXA 5I3PA 3KK1A 4DV5J 4F4YA 4ED7A 1HYSB 4L73A 2WSEC 2R3VA 2W2QP 4ALZA 3B4MA 3GILA 3OLBA 1HBOB 1UFKA 3BYRA 1AB8A 5A8KA 3GFYA 2KYXA 2HWIA 5D4OA 2OO4A 4ILLA 1AROP 4WKYA 2WOMA 3CIZA 5B0GA 1EX8A 3MPYA 4YFUA 1PYTA 2BYCA 3W9JA 3JAMU 1PIEA 4ZVPB 4J9UE 3W2VB 2ERRA 1XMQF 3MM5B 3BH7B 2VBZA 2IVFB 3ZZRA 5LSRA 2MXYA 2HS0A 4PWWA 3BBFA 3DM2A 4QQBA 1H72C 4I64A 3TZZA 1H73A 1HQEB 1SL0A 3NAIA 1NK9A 1U1RA 4QU6A 2Y1JA 2PN6A 2G2YA 2VJVA 4DR1F 4J9QA 2CJAA 2V2KA 4ZPAA 3OHBA 4FBTA 3R1HA 3P4UB 3JYTB 5J2QB 3I5BA 4RU2A 4K0KJ 3GLJA 2AX0A 5GMKa 3RR7A 3Q89A 2KN4A 2BZ2A 4FYVB 4MJKA 2HURA 3KG1A 4FF4A 3CCVS 2W9AA 2NPIA 4KH0B 4AXJA 3JSMA 3MM9A 3UCZP 1PO6A 2IMOA 1W2IA 3TNVA 1K0VA 1HWUA 1N5TA 4QIFA 4CM2A 3KMQA 2R8GA 2NYHA 3NWRA 5SZTA 1ITPA 8RUCA 2ZOMA 3LH2S 3I56S 3UWTA 3OLAA 2HRYA 4KB7A 1HI8A 4I4BA 4A48A 5HMXA 4DQPA 1N54B 5IC6B 3VTIA 4NYPA 1JNRB 3D1HA 5E7OB 2LEBA 2FIUA 2O67A 3I6PA 3G4SS 1T02A 1VK8A 2P2CB 4R8UA 4YS2A 1T7PA 3M8QB 4FVCA 1VLOA 3H2UB 4OZLA 3QIPB 5GAEI 2UXDF 5KFTA 4CQ1A 1T3OA 1S0NA 4QYZK 2MZ1A 1X5TA 2BXJA 4YQWA 1U7LA 3PRBA 1FWKA 3A8IA 4MFBA 4KPCA 4URSA 1IBLF 1UEUA 3BBCA 1I5OB 3N6MA 5DQIA 3ISND 4HTIA 1U2FA 2VF3A 2P5VA 2DGWA 2J7KA 3I55S 2KM8B 1IKVA 2AKWB 2FJDB 1RHMB 5HP1A 5I4MA 1FXDA 2ZJQQ 3G8QA 3M6WA 4QYRA 1LWEB 3M2RA 1J5EJ 1VLYA 4Q8EA 2BE2B 2HIQA 3Q8PB 1D8ZA 2HVEA 4PG6A 1X9WA 2CNLB 2RU9A 2JLFA 2YNFB 4ID8A 4KGVB 1WSRA 1R8AA 4PABA 4ED4A 5KFOA 5DDPC 3VAFA 2MMYA 2DRDA 3M9OB 3QQCD 5DDOC 1YITS 3NG8A 3RR8A 1VR6A 2F9DA 4LVNP 4Q2MA 5KAKA 1ZAVA 1FRHA 3A8KA 4DS5A 2HBZB 3V4IA 1U8SA 3QAEA 3V2UC 3PRVA 5J2MB 4J9PA 2MPUA 2AYGA 4WTYA 2R8KA 3HM9A 3NL0A 1XQIA 3NGKA 1D09B 3OTOF 2O3DA 3MI7X 1RT2B 1VC5A 1QM9A 4DI6A 4WFAQ 4FYDA 2C2OB 2KT5A 3DRPB 1VQPS 1GMVA 4ZCKA 4IRKA 2FVRA 5FD1A 4KKOB 4G1QB 1HBOA 1WOPA 3BN4A 1E6VB 4DPWA 2VG5A 5LJ5Y 5FLXY 1MN7A 1B4SA 7FDRA 3H5YA 1RT6A 4LBHA 2CZ4A 2OKQA 1CJKA 2QLWA 3DMJB 4MTPA 4NPOA 2HQGA 4NWBA 4YB6A 5F8MA 2V9WA 3NBPB 3DCAA 4ZIWA 1QVFR 2JLGA 4OMFG 4WYWA 2FLLA 4KO0B 2ZWOA 2CQGA 1OIAA 1NJZA 5IZHA 3OBIA 4C3KA 2AEJA 3QFWA 3HHLC 1PC5A 2YKMB 3G82A 3CJKA 2AT1B 4LJMA 2MKSA 1X0PA 4NZ6A 1VQLS 5BYSA 2VQEF 3RBDA 4RJVA 1QE1B 5B0DA 3PHEA 4V1Ak 5KFKA 1IUJA 3GIKA 1NB7A 2BDPA 5C5JA 2R7XA 4CTAB 5LXYA 2CWKA 2GHVC 5IWAF 2M3DA 5CYMA 3CCZA 5HI7A 2HG4A 4DPUA 3SZ2A 3RRHA 1JJCB 1UW4A 4UTGA 2EI5A 4KTQA 1WWHA 4M5LA 1VQOS 3OFHA 4L6V3 5CZXA 3DLEB 2MHEA 1S99A 3THPA 1S9GA 2M7SA 1WEZA 4J9KA 3OTBA 2LECA 4RZRA 2DITA 2LQ5A 4OJ3A 1FVSA 1GFWB 2GGPA 5IV3A 3HVRA 4PQUB 3NOGA 3QGGA 2CKWA 3FKBA 2E5GA 3GFZA 3KK2A 4DR7J 3SCKE 1Y11A 2LQ9A 5KT3A 2MQOA 4B02A 1ZETA 1K1QA 1MMDA 3CB4A 1RA7A 4H4MA 5KFFA 2MGZB 2BANB 3JTOA 1UTAA 4OLPA 4WFYA 4C8LA 2B5JA 1U09A 2B9YA 2ZWPA 4LFBJ 4X4PA 2IHR1 4ZP7A 4W92B 4F36A 3IM8A 1T95A 3AOAA 2ZJPQ 4P74A 1RAJA 4LF5J 4ZVFA 1MLAA 5E41A 1X4AA 2NUHA 1U49A 3R7SB 1FEHA 1YBTA 4FNIA 2LQJA 2V69A 5J1EA 4QR2A 4YHHJ 3DOLB 2VQFJ 5BR8F 3C14A 1NNDA 2PSZA 3QLHB 2NXCA 4NMLA 1U45A 2VL1A 1VYAA 2NPFA 2FLOA 3Q0AA 5J2PA 3OL6A 4OHXA 5F3TA 3N5BA 3WX4A 4GVBA 4JI0F 2YKOA 3CCTA 1KHWA 5C25A 2XY7A 2YNGB 1F9EB 3G2XA 1P1TA 1W25A 4C9DA 3AFGA 1SIZA 1UJ4A 1NDCA 1NKEA 2WONB 3MM9B 4B17A 3AXMA 4OV1A 4QWBA 5GADI 4M5DA 3UNGC 1VS3A 1N33J 2XYGB 3HHLB 4Y3CA 4X4TA 2GMLA 1U48A 2JFDA 5A6WA 3UN2A 1IJEB 1C4AA 2IBOA 3DU5A 1TU0B 4ED8A 3RBEA 3QRRA 1HWKA 2OEKA 3X1LB 1YKWA 1LNQA 5KG6A 2P9CA 5CA5A 1XMOF 1NKBA 3LO3A 2OP5A 4RW8B 4RUAA 5IM0A 3BR8A 4L75A 4F25A 4DSFA 3V6KA 2DRBA 3MFIA 2W1BA 3NKYA 2BJDA 2VG7A 3FZBA 3DMJA 4KHRA 4RNOA 4ZN1A 3ILIA 3H8YA 2ZM6F 3FCVA 3NGTA 3CJTA 2D3UA 2BR0A 1S0MA 3PEJA 2OD6A 2VBWA 3L4BC 2HVZA 3V5RA 1DQ8A 2ZC3A 1C4CA 1WEYA 3CD5A 1SL1A 4JI3J 1NH7A 4JI8J 3TZXA 1DTTA 4HHUA 2XB2D 3DLHA 4F4XA 3DFEA 5AE3A 3TOQA 4KSEB 3OUYB 2GFFA 2MKHA 1G6BA 1D0EA 2RRAA 3MZIA 4C97A 2DH7A 2GGPB 4BC9A 4QWEA 2RQ4A 2O5DA 1J5EF 1Y3JA 2HNYA 4C11B 5KFVA 3C6TB 2QO3A 4HTJA 4PG5A 2MKKA 2RDJA 1RBAA 4DSKA 3AOCA 4QOTA 2DR7A 4LF4J 4NLPA 3IBFB 4BC7A 3M8SA 4DV2J 4QCLA 4UOCA 3EJMA 2C28A 4FYYB 4K2XA 1SC1B 3GONA 1IKVB 3FSYA 2ZJRQ 2CYYA 4B9LA 4LMZA 2J9CA 3L09A 3QWPA 3MMBA 1RK8A 5ETNA 5JMNA 4YR2A 3KK2B 3BQ0A 3VAJA 2V8HA 5T14A 1SPBP 1X4GA 1NMEB 2XGPA 2OUGA 3UI3A 1RYRA 1TMJA 2AGPA 3IR6B 1F9HA 1RT1A 2W2MP 4NRUA 4O3OA 3AQPA 1FRXA 3F44A 4IQXA 2B7BB 1CJTB 1DURA 1RKIA 3V4MA 5K8MA 2W9CA 1ACMB 2XI2A 2AHOB 4ILRA 1U1OA 2HMIB 3BO4A 3FUYA 7AT1B 2E9RX 4BHQA 4DPTA 3HI9A 2D9PA 4DN9A 2H51B 4ZVEA 4EUVA 3ZC4A 2UP1A 3MOZA 2VFVA 4QZVB 5ETKA 3MD1A 4LR8A 4DL6A 3M8QA 1AXQA 4EBCA 2KO1A 2DCLA 3BBBA 4H4KA 3ULHA 3QLHA 1JLBA 4N7TA 5GADU 1MN9A 4QWDA 5IFMA 1RP5A 1SKSA 4W90B 2HQ3A 5BXIA 4WTOB 2DNPA 2VODA 3H5UA 3D7SB 4M8LA 1D3WA 2VPXB 4IO1A 1DLOB 1JWWA 2YNHB 3LP2B 3M8YA 5F9LA 1KRPA 2QTWA 5A0YA 1BQMA 2DISA 3DOKB 3NOCA 4FF1A 4BDPA 2YWGA 1FRLA 1RWOB 1C2PA 1QD1A 4QPXA 4NLOA 4IFVA 2BW2A 3R5DA 1JLEA 1KS2A 2GNKA 1LWFB 1WKKA 1NDLA 4J7CA 3WX8A 3GPAA 3VGVA 5LMNJ 1RT5A 2VFRA 3SV3A 4U7UD 3DGPA 1U1KA 4KQZA 3OTOJ 1IN0A 4N41A 4F3MA 5D8HB 4JV2A 3SXLA 2F1FA 3PYGA 1IKXB 2FC8A 2RB7A 1R0CB 3E8OA 2VKRA 3GTYX 1RWVB 2XLIA 4OZNA 2KG1A 2PMHA 2HHPA 4ED3A 1KC8T 1FTCA 1N5VA 5DG7A 4ZVHA 4C4WA 1RXOB 2KHDA 1U2RA 3MMAA 3NAHA 1EETB 4EBEA 3HXMA 1DTQB 4FF2A 3KK3B 3ZZOA 3PX6A 3M32B 3DLGB 4I7FB 2RHQB 3KJFB 3GJSB 5HROB 2VG6B 2ZBCA 4DV2F 1YI2S 1V3ZA 1TKZA 4O4GA 3QZ8A 2KT3A 3TJ8A 2OPRB 1WKLA 3KJNB 1X9SA 2IVYA 2ZHBA 1PSDA 1KLMB 2RHSB 1HBMB 1OPZA 2A0FB 2DJWA 4I2PB 4DV3J 2JL9A 3CJ2A 3PX4A 5KFCA 2ZD1B 4LRCA 2QFIA 1MMLA 1TV6B 4EK2A 2E9TA 3WC0A 3E01B 2C3OA 2IM2A 1FA0A 1N0VC 3CTRA 3HVTB 4Y0FA 2ZNZA 4U9RA 1RT3B 2FYXA 2YTCA 4HHJA 4K4ZA 1DFDA 1FKOB 3GV8B 2GAHC 3J81U 4IFYB 4CLLA 5DZ6A 2ZEJA 1KBRA 2JC1A 2WONA 4YB1P 4OHWA 3MAAB 4QR1A 5L9NA 2GJIA 2H9ZA 4A46A 4DS4A 3O2IA 3TYTA 5G0RB 1HQUB 1PYSB 2OH2A 4DSJA 1VCTA 4OYBA 2FZKB 2VDIA 1HBNB 2VUGA 3A4TA 1DARA 1EIYB 2VASA 1WTBA 4WFBQ 2LKZA 1UP1A 1BE4A 3FCWA 3ISNC 5B0FA 2AYBA 3SSRA 2E1CA 3OFFA 5A8RB 2DGSA 2E44A 2IIHA 4M5HA 2FHKA 3M1VB 1RSCA 5AJ3J 1IWGA 1IBMF 4HH0A 5GAGI 3EYZA 1RWNB 1S5ZA 2HGLA 2AYEA 4TY8A 5C24A 4EZ6A 1CJKB 1KP6A 1O51A 1U02A 3US5A 1UVNA 3CT9A 3TEHB 4FZVA 3MTKA 1TKTA 3ETOA 4TYBA 1U25A 3GIMA 5L46A 5GVQA 3ZZYA 1S77D 3BKTA 3L7UA 2NCKL 2H4YB 4NLTA 1RT2A 5KT7A 2WB4A 3MM5A 5I3UA 1SIWB 2DPJA 2KXHA 2JEGA 2P6SA 1VRTB 3HK2A 2MLZA 5EX3A 2RDIA 2FDNA 5IS2A 3B82A 1XMBA 1H7XA 5KFQA 2KHCA 4Y65A 4Q7AA 2POKA 4OYWA 2XZWA 4KY3A 1FKPA 2COLA 1KOOA 3BGUA 3J7Z5 2QLBB 1HA1A 3BH6B 2FTRA 2KL8A 4B3MF 3NCRA 3PKMA 3MPWA 1S4EA 2WZ1A 1WF0A 2B6AA 3S6EA 2F8MA 1SJ3P 3OR2B 2B4VA 4DSLA 4DR5J 4DU7A 3CJQA 1YJVA 4Z7YA 2AMCB 4LF4F 2PEHA 5H9EK 1SKUB 3BSCA 4RW6B 4N77A 1RE1B 4WE1A 3RB0A 4QWAA 4JYAF 1ZAXA 3D66A 1G3OA 3DXBA 3N79A 4A8YA 1VBXA 2JEFA 1F6TA 2VFTA 3IR7B 4ZLPA 4RO0A 3QT6A 3EXCX 1QSLA 2AJ1A 3D2WA 4CRJA 3OTEA 2Y1IA 3MECB 1TVRB 3IA0A 2EC2A 1Q8KA 4BWJA 2JSXA 4I2PA 2BM1A 4LQ9A 3LOUA 3THTA 2ADBA 4A8KA 1KVJA 1VQ5S 1HNVB 1FT8A 2HVDA 2B43A 1FJ7A 2RRNA 1Q8BA 3IMQJ 4NASA 2J8AA 2VONA 1S0OA 3IO1A 2CJBA 4F7VA 2CVEA 1WF2A 2FGCA 4LSLB 2H3EB 4A8OA 1S97A 3V81A 2RH3A 4XPCA 5AXMA 5E0OA 1X7VA 1XERA 3HMJG 3V6DB 1XNRJ 1HR0J 4E98A 3MM7B 3F41A 1M1GA 4LRBA 3D54A 3KLGA 2CVIA 1RTIB 2I38A 3KKFA 4NLDA 3BPSP 4DOZA 4OYPA 1HLWA 3SYZA 4JI2F 3HLUA 1OWXA 2F4FA 1S79A 3HFZB 4ELTA 4AL6A 3LALA 3PO5A 4YHHF 3H42A 4J9MA 1XNQF 8ATCB 1B0VA 1XMOJ 2C2EA 4NCGA 3SEOA 3EZ5A 2R8HA 2UVRA 4AL5A 3V4IB 1S0VA 1KQKA 4XK8C 1OMSA 3UN5A 3ZZUA 1SL2A 4DV7J 5E5NA 4B3RF 5F8NA 5KFLA 3PRDA 4DFKA 1LQ9A 4PXCA 1WUUA 3AQOA 3TA2A 1BQMB 3DRRB 2V8GA 4LF7J 1NM2A 2FZGB 1NJXA 2MQMA 3N01A 4ETXA 2IBKA 4U96A 5FDLA 2AJ2A 5ETQA 2GQCA 1S10A 2ACMA 2WRMA 3PJWA 3U02A 3ZTPA 2E5IA 2HAIA 5CYJA 2FHJD 2R7QA 4CTAA 5K20B 2DHXA 5A2QU 5KT5A 2IC3B 1OY6A 2ZUAA 1GXUA 1PYOB 2VH7A 4TXSA 2LYVA 3SMZA 4I67A 2G13A 4FPIA 4WU2A 2W4PA 4OL8A 2C3MA 2K1RA 2LU2A 3KDNA 3M6VA 1FE0A 1SC4B 2WSCC 1UAWA 2D7SA 2EK1A 3CD6S 3PW5A 2FLNA 1NZAA 2OD4A 1S6OA 3MUTP 1WC3A 2KKHA 5D0RA 1FFSB 3RW6A 2HZAA 3PM9A 4Z37A 3QBCA 4RW9A 5ETOA 3TEGA 1Y4ZB 4ELVA 3QSIA 3JSMB 3MR5A 2V6AA 3K5NA 1H2UX 3W8PA 4LF5F 3RTVA 4ECXA 3LAMA 3K5MA 1U0HA 2MLXA 2VPZB 4OI3A 4WP9A 5DS7A 4ED5A 2AW0A 1PJ7A 1OSCA 3GE9A 3MPDA 3PR4A 3KLIA 3BKFA 4NLXA 2R2RA 4M63A 2XTJP 3DYAA 3ZZZA 4M1KA 2EKNA 1RCOB 2DNZA 2JRSA 1HBUA 4UZCA 2FQQB 2HWHA 3IC1A 4ZVSB 1UEVA 1JLGA 3RBXA 2OIHA 4IRDA 4IOAQ 1F60B 3ENVA 3IRXA 1K9MT 2W9BA 1SQEA 4Q2LA 6AT1B 4JB8B 1IKXA 3OL9A 3SIPB 3TRGA 2HQIA 2HYIB 3CCUS 2DEJA 3JQMA 2ZH2A 3T5JA 3ITHA 4LT6A 4NZ0A 5AXNA 2U2FA 4JOUA 4DCJB 4CIOA 4A8MP 2B5JB 3EMTA 1TAQA 3BPDA 2KI2A 5THWA 1N56A 2UUAJ 3KJVB 3OL7A 2CPEA 1GH8A 3AAWB 3BB5A 2BM0A 3M2UB 2XLJA 2B4UA 4H4MB 3GCWP 1DQAA 1JXVA 2ABYA 2C2KB 2QRRA 1IR2A 4OZ5A 4USKA 5BR8J 3VAGA 2AEMA 3I0SA 4OHZA 4DR7F 1WKJA 3N6LA 3I9ZA 3Q8RB 2V4QA 3W5YA 4PQUA 1BGXT 2HLTA 1AZSA 1Q5VA 5K9FA 5HO4A 2KZMA 3BM7A 3IWLA 2FVSA 3HO1A 4AXIA 1S1WB 2M2BA 3JSYA 3DLLQ 5HLFB 5KFUA 1JLQA 1XTZA 1IKYA 1FWLA 1L3KA 3PNIA 5IT9Y 3MTJA 2EPIA 1CJVA 4HR2A 3ET6A 1YG0A 2IRUA 4AL7A 1W7WA 4U7UK 2A18A 3PCOB 4GO5X 4OX6A 1DBDA 4H4OA 1JLBB 2CG4A 4DXLA 3CVKA 1T05B 2E7VA 1RAFB 1VIXA 3BO2A 2RUSA 3B8HA 4OZ3A 2BMBA 1PJ5A 4K2JA 3HHEA 4ZCMA 1NBEB 2BV3A 1U26A 3MEGB 2QFJA 3GSDA 3MEDA 5D0EA 1EQ0A 3SI8A 3MEEA 1H3DA 2DH8A 2EFVA 3PTWA 2ATCB 2YWWA 4DL0C 3QZ7A 2XMUA 4NYZA 2DPIA 4DL7A 2IC3A 3OD2A 4S0MA 3G6YA 4LF8F 1BQXA 4G1IA 3OR1A 4WFZA 5D0GA 5DRKA 1NSQA 4OHVA 2AJ0A 2HEKA 1KLNA 1TR0A 1FVQA 2L3MA 3LTOA 2V2VA 2Z58B 2YKQA 3CDEA 3M05A 4PQAA 4NYOA 5F8HA 1Q7YT 4DV1J 5LM7E 1FKPB 1U1QA 4OZ1A 5U47A 2CNKB 2FJEB 3W64A 3ZXWA 3V6JA 4C8NA 2C2RA 3PACA 2RUGA 3D3BJ 1CVJA 1FRMA 4UQTA 3A3PB 1B7YB 4Y34A 3ZTQA 3LGMA 5DM7Q 1LW0B 3IGVA 2MZSA 2W2OP 3R3TA 2NLWA 1JIHA 1NO8A 2V9KA 3CXCR 3WDOA 3LF0A 4X84A 4CO2A 1VQ4S 3V81B 1BUXA 2FPHX 2RAQA 2ZHOA 1RAIB 2KJWA 3BQ1A 1Q5YA 1WG4A 1KNZA 2R2TA 2GVDA 4A8FA 2VICA 1U6ZA 4J9OA 5J2NB 4Q0BA 4HKQA 4F2RA 4FXWA 5IOLA 2L9DA 3L7OA 2CADA 2WBRA 2H1YA 5A8RA 4X66J 4CO3A 4QWCA 4P75A 5AXKA 4K0KF 2CPJA 2LXUA 3WBZA 3PW4A 1YTYA 3R9LA 2AJFE 3M7VA 3R97A 4EO6A 4ZK7M 4OZ0A 4RW4A 3O3LA 2XBPA 3RW7A 2YQ3A 1SQGA 2HQDA 2PA3A 2CZVC 3AB4B 2OEJA 3EVOA 2YKNB 1HHTP 2D41A 4FP9A 2MSSA 3C16A 3HKZD 3HSGA 3MUMP 2NREA 2QLXA 2NUUG 3HJVA 1K8AT 3QWUA 4ZP9A 2W9CB 1TK0A 5L1JA 2HHHF 4CT9A 2CQ3A 1HNZF 2APOA 4JV1A 2BW7A 3DRSB 4U6PA 3PHTA 1HI0P 5CXTA 1RT1B 4PG8A 4JI2J 1K0TA 3HSDA 2IM1A 4RR5A 4ECUA 4YUDA 3CO9A 4P71A 2MZJA 3T1HF 2K7KA 4NCAA 2CJQA 3TAQA 4RPFA 4J5OA 2UXBJ 3Q24A 2LQ8A 1ZA2B 4KC5A 1BC6A 1FEEA 4DL4A 2LA4A 1YJ7A 4JI6F 2MSTA 8AT1B 4MKVA 2QIFA 3D67A 4DV7F 2AGOA 2EWHA 4UUWA 3Q22A 1UW9A 2GIFA 1U6BA 3PJ9A 5I3UB 1FNOA 4WE1B 4NXMJ 1WOSA 4P7TA 3UDLA 5FDLB 2I1RA 5HSPA 1SI9A 1RWKB 1Q7LB 1NH8A 3GFHA 3KNGA 1KOHA 4DPYA 3GR0A 3UNYA 5KTQA 1N36J 1OJ4A 4P52A 1XR7A 4USUA 2X51A 1HHQA 3LWMA 5HN0A 2JH3A 4CO5A 5KG0A 4JV0A 3NNAA 4C3MA 2LXIA 1UVJA 2YH0A 3Q8UA 1CULB 2ZNYA 1U8WA 3UCUP 2W8KA 1EZZB 2PMZD 5HAOA 2YY3A 3W2WB 1JJ4A 2BJEA 3EDRB 4P2XA 3DYAB 1UVKA 3HVWA 2EW9A 3MCSA 4EI2A 2FUG9 4EO8A 3UPFA 5KFHA 1HD0A 4N5SA 2C42A 5G0RA 2GIQA 4RW9B 2QA4G 2CQCA 2UUAF 3DNCA 1N5YB 1LFWA 4HI1A 4XAKA 5JXSA 1T03B 2E5LJ 4GC7A 1HIYA 1TP7A 3CDBA 3K89A 5C24B 2MJNA 2I2YA 1FJCA 1D9FA 2LFVA 2X7IA 1RT3A 2GQ2A 1RBOB 1FHTA 2VPYB 1KWMA 4CCHA 1LWXA 4ECTA 2XLKA 5MAOA 1REGX 1B0TA 3HVAA 3KHLA 5BJRA 2MEWA 4E2FB 2V4JB 1LK5A 1HBNA 1RADB 2M52A 4MIBA 1VQ7S 4LSLA 1KFSA 2QN6B 4TYAA 1QUVA 1VDHA 4OYAA 1WC1A 1J5OA 1U2CA 3HVTA 2D3O1 5KFXA 2BE7D 3BKUA 1VFJA 3R6GB 3D6MB 2BBEA 2ZKTA 2NS1B 3S7RA 4AQYF 4I1TA 1NXIA 1PC4A 1KQSR 5H9FK 4GKKJ 2QZ8A 1S6QB 2Y3YA 3D4JA 3KG0A 4MYUA 3ILLA 4FPRA 1RAEB 3G6XA 1MNEA 2AZ3A 2BJ3A 3FEZA 3CCES 1UMJA 3MM6A 2MQ8A 2OPRA 4E8UA 1JLQB 1TL7B 4D3GA 4OYXA 3FBCA 4IH6A 3SCIE 4DFPA 2HS4A 4B9TA 1FRKA 1SXLA 3GQCA 2OEMA 5ETTA 3T6JA 3QGIA 4LF1A 2QX0A 2YKPA 1WELA 2ZHAA 3O5TB 3EPIA 4IDKB 3H5SA 3OW2R 3P3DA 3D3CJ 3NGRA 1C1CA 1YSJA 1HNWF 1NUEA 2XYHB 3UCGA 1CQNA 3E51A 3MOJB 3UFCX 1R27B 4CO1A 2YQ0A 1GX6A 1URRA 2KVQE 4ZLLA 4J90A 3MCMA 1L3TA 3ENQA 1NK0A 4USTA 2EKYA 1NSAA 4K4VA 1R89A 4QIEA 1R31A 5E3QA 3LAKA 3LPEA 1YRUA 3OR1B 1N48A 3KLHB 1U6FA 3R5JB 3ZTRA 3PW2A 2HNYB 1TL3B 1TKTB 2EXUA 3UDVA 1QAXA 1H2VZ 1JQGA 1OY8A 1VRTA 3H4DA 2DB1A 2XC9A 2B9EA 3QRPA 3LUYA 4PPDA 3HHDA 2XO6A 2ZE2B 2CPHA 3ELHA 4DR3J 1P1LA 4KGZB 1VC0A 1KFDA 2ZZMA 5IWAJ 1FDDA 4OJ1A 1LK7A 4NL5A 2XCPA 5ETRA 4TY9A 5HBMB 3TVKA 4IO9Q 2HNZB 2N4DA 4MT1A 4ILMA 3GSIA 1RT4B 3O6QA 3KHGA 2GAGC 2M5YA 2Y1LB 4F0KA 4HL9A 2R9LA 1I94F 3BF4A 2BRKA 1WHVA 2DGXA 2JEIA 4DZDA 1UZDA 1JLCA 3UDEA 4PWDB 1MW7A 1Q0NA 1KN6A 1TKXB 2DKOB 3MHYA 4LFCJ 3D0HE 4KHPF 4UZBA 3U1MA 2ZH5A 2HGNA 4DLGA 4FKYA 4USIA 2UU9J 4HEA9 2QYGA 4KAIA 2HK3A 3ADAC 5CYMB 4CO0A 2IYGA 4WZQA 3MR3A 3K57A 3BN7A 3G8SA 3N5FA 4H4KC 2EG2A 2XQCA 3Q23A 3HHKA 2VD3A 1YQHA 4YDXA 4CDIA 2D3OR 2YWFA 1WG1A 5CZVA 4F26A 2B6AB 4IG0A 5DGBA 4F4WA 1F1BB 5C42B 4LIWA 4B9VA 1M5OC 1L5UA 1PG5B 1HPZB 1L3UA 2DO0A 5KFZA 3UQSA 1CBKA 4HT5A 2MQPA 3A12A 4DR4J 3AJ1A 3J7YU 1HQ2A 4GMKA 3DOLA 4ICLB 3SQOP 2E29A 1ZS6A 2DXEA 4IYQA 3MXHP 2CQDA 1Q8LA 3ILJA 4DU8A 3NY0A 3EXYA 2LEPA 3W7BA 1IBCB 5KFNA 1WHYA 4JI5J 3GIJA 3RRGA 1R7IA 3MMBB 4DUTA 1FNMA 2YX4A 3DRRA 4P10A 2Z0GA 3FNNA 5AE1A 5KG7A 5MLCV 2MQQA 1ZTTA 6FDRA 3R2DJ 2I5JA 2YNIA 1PAUB 4GRSA 2VIHA 5CABA 4LBIA 2IJFA 5LSOA 4P9SA 2LP4A 2M8DB 2DGUA 4F2SA 4LF6F 2PE8A 1N36F 1RJJA 4Q43A 1HD1A 1VJQA 2VBYA 2CPYA 4CYUB 1L3VA 1TMMA 5LJ3Y 1H2TZ 1SV5B 2CQ4A 1IBKJ 4JI4J 3CDAA 1NDPA 2GVZB 5KG1A 3DHWC 3PX0A 2JC0A 2C3PA 3KK1B 1HYSA 3OJSA 4PR6A 3HCXA 4HH1A 1YGYA 2K3KA 2CZ9A 3GMGA 4W98A 3FEXB 1F3VA 4LREA 4OLOA 5RUBA 3RJMB 5IM0B 1B70B 1HWJA 3JXOA 4A8QA 1RYSA 3PJXA 1RHJB 1S76D 3I9V9 4LIRA 5DO2A 2ADCA 1KEKA 2WBMA 5AE2A 3A1YG 4WF9Q 1NJYA 2KFNA 2FHOB 5L38A 5L1LA 1WNEA 2VFUA 2JLEA 3PW7A 2PMWA 1HNIB 4XDCA 1ZPWX 4HT7A 2J6UA 5H9FJ 4AYBD 3QO9A 2R42A 3OPKA 4DCOB 4XIUA 1IM4A 1A7GE 1VMBA 1WD6A 3IG1B 3GYNA 3QPIA 4ECZA 4YEAA 1WEXA 4R8UB 3TUZC 2VBXA 3L9ZA 1TKXA 2LA6A 2DBBA 4P2MA 1FCAA 1D1UA 3BQ2A 1S1TB 2J9EA 2HHTA 2K2PA 4DX5A 5HJXA 1Q86T 3CMQA 3ENAA 2BX6A 4NE9C 4LR9A 2CJ9A 4IQMA 1ZM2A 3SFGA 5I3QA 3N28A 3EPGA 3J7AN 2QGFB 3H90A 1O5JA 1N5SA 1X4CA 4RUHA 1M5KC 2PI4A 4RW7B 1ULRA 4I2QB 1FDAA 1IKYB 4L72B 2UVUA 1A9NB 1WTFA 2DIUA 1H0HB 1FDNA 2CUYA 4JV5F 1VHIA 2DXDA 4I68A 2BQRA 2KRBA 2ROPA 2WW8A 3CJ8A 3K5OA 3W9IA 2O01C 2X1AA 4EYIB 1X4EA 1SKRA 4CWBA 1RTDB 4LQ3A 5DDQC 1YDLA 2WB1D 4M5JA 3KTQA 4Q44A 3CWJA 2UXCF 3K7RA 3MM7A 2OAUA 2ZH4A 4DV6J 2WVFA 2UUBF 2QLFB 4WCEQ 4YP3A 3TJ9A 3OQ2A 4ZLNA 2MTLA 2DR5A 4I0WA 5BYQA 2H5EA 2LDIA 3D5MA 4TQSA 2JVOA 4ZVRB 1GXLA 5J2MA 1APSA 3PG9A 2GQQA 3BYPA 4U8YA 2WTFA 2CNOB 3ITHB 4KFBA 1FX2A 3W63A 1QLNA 2CRLA 1I1GA 2VZ9A 4G3IA 3MPVA 3VAMA 2D3ZA 3QJPA 4PEOA 4TY8B 2E66A 2M88A 3J81Y 4F50A 2IRYA 2OSQA 4UUXA 1TL5A 1S1UA 1HW9A 1CC7A 2RKIB 2W25A 3GFXA 3MR7A 4QIWD 3ZNUA 3CCQS 1X9MA 2YKMA 3G82B 3PYFA 4MAKA 3ICLA 5KFGA 3AHPA 4DV3F 3D6FB 4AQYJ 2Z57B 2HMIA 4JI7F 3MEEB 2CG8A 2EFNA 5DLGA 4MKBA 1AYEA 5HJYA 5I42A 4RBVA 3HFKA 3B4DA 1AUSL 4Q8FA 1UVIA 3NMRA 1UEKA 2B4PA 3N0VA 4USHA 1N6QB 3H2LA 1D9DA 4O44B 1S48A 1C0UA 4DPOA 3W9HA 1BHNA 2AWZA 1J5OB 2ASLA 2F7VA 1NSKL 5E33A 4EYHB 4X65F 4V19J 2ZBQA 1KONA 1A0OB 4JI0J 1ZM4A 3TAMB 1I3OB 2JOQA 3TUJC 3GJRB 1P9YA 3FSIA 4DL2A 3I5AA 2ZH6A 4EEYA 3HPOA 4QU7A 5IT0A 2VU5A 1EP4B 1WOOA 2FHJA 3G86A 3PDNA 1TKDA 2B7CB 3DN9A 3PFEA 2I9SA 3MEKA 3HSZA 1N5YA 1TUVA 2O1PA 2LDYA 3CC7S 3NWGA 2E5HA 2J6TA 1KVIA 3C6UB 1MWQA 2QYCA 2PFDA 1SVDA 3DLGA 4CZCA 3UD4P 2ATLA 1Z2LA 2KVIA 2MJUA 3N6NA 1KQGB 3R5CA 2AGQA 1CJUB 1FKAF 4RWXA 2HRUA 3UVJB 3CCLS 5HP1B 4GKKF 2IPOB 1U1MA 3EGZA 2XSFA 4RW7A 1VBKA 5FLXU 3TA1A 5IT4A 4LRDA 1VQ9S 3R7NB 1Y5IB 2HFZA 2DNMA 2BE2A 2Y0BB 3I31A 1RCXB 3M8WA 3ZTSA 2FVQA 3MM8A 1KVKA 1JXLA 4DL5A 2NXNA 2IJRA 1S12A 2M4MA 4ZP8A 1TUWA 3DRXA 4C0HA 4X64F 3OVAA 3AXKA 2MB0B 2OPPA 5CD4H 1RTZA 2F65A 3WIUA 4K5SA 2ZBRA 1B99A 1X4BA 3P45B 1RTIA 3A8JA 3BS9A 1G1XA 2WVBA 2DNGA 1RHKB 4ELUA 2AJ4A 1SH2A 3C8YA 3RG6A 1Q4RA 3W66A 5CD4A 2DYAA 3K5PA 4CLTA 3J7YI 2Z2ZA 4F3OA 2YPZA 4IG0B 3IP0A 4DV0F 4C2MA 4UQGA 2MZQA 2QT7A 2HZVA 2GJFA 4NXNJ 3CCWA 3QIPA 4FXVA 4B08A 5HVFA 3TANA 2QL5B 2BQ3A 1F5CA 2KXFA 3BSOA 5IXUA 5LT5A 3B6BA 1DRZA 3FFIA 4FBUA 3MAAA 2B9XA 1VRUB 4KRWA 2CXEA 1S6PA 2E7WA 1SQFA 2B8QA 3OXFA 4TNOA 4X4VA 2FVPA 1DHMA 1TL1B 2V8VA 3HHLD 4DEZA 1UPPA 5LSLA 2PD1A 1SB6A 2ZBPA 4ZPCA 3TR5A 3BO3A 3AD9C 5CCLA 2ZOGA 1HHSA 4WKRA 2EK6A 1XEZA 3KDOA 3VGTA 1VQ8S 4KHPJ 1F2HA 3CDUA 2N4CA 2BABA 5I42B 2UUCJ 1GTEA 3DRYA 5B0AA 5BYRA 3PXGa 2PI5A 4OX7A 3RB4A 4KPYA 4KE5A 4FNHA 1S7HA 2Z30B 3T6BA 4M5GA 4F4ZA 2KT2A 2UV8G 1CULA 2DR9A 2ZKUA 3FEYB 2R7OA 3T1YJ 5KOXA 5G4DA 5D78A 4ED1A 5L8RC 2DHHA 2Y9HA 2QC3A 1HR0F 4LF6J 1X0FA 2MDAA 4RX6A 2DT9A 3MPUB 2D74B 5GAGU 3AH6A 2KJVA 3MMCA 4UW2A 3IAS9 3JSBA 1HWLA 3BDEA 4L3KA 3MURP 3TZWA 3R5BA 1YVFA 4QR0A 4ZA1A 5AT1B 5KFAA 2VPWB 3UD3P 4F0HA 3IBWA 1QSSA 1RUSA 2CPZA 1XR5A 4O3QA 4LVOP 3VVTA 1HW8A 2CA9A 2H5JB 1YJNS 1QTMA 4YOEA 3R27A 1NHUA 4U67Q 4K4WA 4OYIA 2DY1A 2KB2A 5AXLA 4HYKA 2MGZA 3I4PA 3R1LA 5K8OA 3SDEB 1YLXA 3GCXP 5A6PA 4J9SA 2QMXA 2W01A 1Y7PA 2BJ1A 5FJ4A 2JZ5A 1LWEA 2DNNA 2K3IA 3F56A 3M2RB 3LQVA 2NR0A 4HACA 2XHCA 2OPQA 1CLFA 4LFCF 1P27B 1CJUA 1WJ9A 3R5GA 3A13A 1RACB 3UR0A 4K4SA 4MH8A 3M8PA 3QGPA 4DSIA 2V8DA 4EFAC 4KIAA 4FYWB 1HNWJ 3IRXB 2J0SD 3C15B 2V8PA 3UR3C 2QMWA 3GJQB 4C48A 3R8YA 2K8GA 2XHWA 3BGLA 2G0JA 4RKUC 4Y00A 4CLSA 1X8DA 3OVBA 1H74A 1YJWS 4ERDA 5GMDA 1Y3KA 2HKEA 4NLWA 5KFSA 5JJBA 4DV0J 1L3SA 1UZHA 1IKWB 1J27A 1XNRF 1E6YB 4USMA 4PAAA 2SXLA 3D68A 3IXQA 2AP6A 4DR5F 4JBCA 1HPZA 4ECSA 2ASDA 1T3NA 2M9KA 3ZZ0A 3J7A1 5A8WB 4WBFA 2PFFB 1E6VA 3M6UA 2AZ1A 2DIVA 2DNRA 3AODA 4Y28C 2ZH7A 1XMQJ 3JQJA 4I69A 3U1LA 1M5SA 1YBUA 4K7QA 1GMWA 2XMKA 4L74A 4WK1A 2MKJA 3WQPA 2M70A 3EGWB 4X4SA 2V4RA 1UWAA 3CCMS 4FS1A 3TW0A 3GG1A 3VHQA 5ETVA 4ZPTR 1OPIA 2C2DA 2GVZA 1RWWB 1KTVA 1TL1A 2HNDA 4U95A 1T03A 1S49A 2FHMA 2YWKA 2CQ0A 2ZE2A 4ZS6A 4LF7F 2XNRA 2ROGA 4DHVA 1T0TV 2XO7A 1HI1A 1NCLA 2WSFC 4CLKA 3W60A 3J7ZT 2GX8A 3M2UA 3Q83A 4USJC 1EB0A 3NP5A 5K14A 2NSCA 3FK4A 2J9DA 3I0RB 3OFEA 4RNHA 4ZVOB 1RWXB 4NCGB 1RAGB 4NMXA 4PCQA 1IR0A 5KOWA 1RHUB 3H5XA 4K50A 1R8PA 4KBIA 3ZTOA 1NJWA 1YRTA 2ALYB 2EFQA 3RAMA 4JI4F 2Q66A 2DR6A 3HJFA 2C2ZB 1M5HA 5E2QA 3M8ZA 3M9MB 4IDKA 3G9CA 2H4WB 4TQRA 4NLGA 3JB9k 1IWAA 2ZC4A 1Q82T 3VQSA 3QATA 2R8IA 1LOUA 3T3FA 4J9LA 4ECQA 2GHWA 1YZ7A 4ECYA 5CQGA 3MMCB 5KT6A 3CD7A 3W1YC 3TARA 1SJRA 5B08A 1NB2A 4I6AA 2J9DE 4B3OA 4ID5B 1RT5B 1VGYA 3T9ZA 4MK9A 4DV6F 3M8RA 2OLWA 2FGOA 3C6UA 5HQMA 4C0BA 1RDRA 3M2VB 3GP9A 4IFVB 1FFWB 3EM1A 3O44A 4CLZA 1JLFA 2R2SA 5IV4A 4P73A 3AA9A 3D1OA 3DGPB 4M5KA 1UJ5A 3VWSA 3QO9B 4CM0A 4DWIA 3HZGA 3ZZPA 2C22A 1QUPA 1W26A 2UXCJ 4DZ6A 1ZZFA 4EWTA 4PUOA 3VF0B 3RAXA 1RTHB 4ECRA 2EFOA 5L9XA 2XWYA 3GB0A 3QJJA 4LF2A 2G1HA 1X31C 1HMVA 5D4LA 1PJ6A 4RBUA 4OX9J 2ZITA 4PXBA 4URGA 2ZUGA 1B3TA 2YKNA 3QRQA 4Y2CA 2HHUA 2KFYA 4QW9A 4ECWA 3QT5A 5HANA 3EICA 2A6OA 2OJ3A 5JUMA 1S57A 1K44A 3SSSA 3DLBA 2GHPA 2VFSA 4E0DA 1ZBTA 3DKDA 1WF1A 1E6YA 3NEKA 3QNWB 5C25B 1B0PA 2I0XA 2A10A 3HD2A 1JLCB 5DQHA 1U0SA 3OVSA 2AEFA 3BZQA 1NEEA 4CYUA 3G87A 2E7XA 1MROA 3ETMA 1NKCA 1URNA 4DUYF 1TV6A 2XZDB 4DR4F 4LF8J 1IJFB 2V50A 2HNZA 5EX0A 3EZUA 1KLMA 2MY8A 4MKYA 3SCJE 1RQ0A 2CWXA 4OQJA 2ACYA 5GAEU 1IVZA 1JX4A 4QIVA 2DY9A 2KFZA 1F2GA 1K47A 2OPPB 2ZBIA 3CE8A 3KNAA 2AD9A 1R8HA 2B4OA 3BGRA 3AT1B 2IA6A 4ZVQB 2MKYA 2Q6CA 2F5GA 3BGOP 4DR1J 2OGUA 3IN5A 4F0MA 4C3LA 2UVWA 3HZEA 5DJBA 2DRAA 2W2PP 2AF6A 2UZAA 3P8BB 2ZH3A 4RU9A 4L3NA 3G6VA 1YJTA 1OO0B 1R43A 2RMLA 3CIMA 3MR2A 2VQEJ 1NHKL 2HLUA 2IMWP 4CLWA 3EGNA 3H0PA 3W5XA 3RBZA 4JI1J 2H48B 3OXGA 4C8OA 1WC5A 2Z2LA 3LANA 2QEXS 4RNFA 5FIIA 2JNJA 4DR2J 4DV4J 1LKZA 1D9AA 1EARA 1S6UA 5IC4B 4RW8A 4LSZB 1WC6A 1XIQA 1Y9OA 1EP4A 3DOMB 1QE1A 1JLEB 3LP1A 3TAPA 2YWHA 2DNOA 4B9NA 2EFPA 3B78A 4K4YA 4JV5J 2IAJB 3UN3A 5KFPA 4BS2A 4O44A 2GW8A 2FZCB 2ZH9A 1R6YA 2J7WA 1WACA 1WHWA 2Z2MA 1RU1A 1T11A 3GU0A 4OYZA 5GMEA 1G4CA 1S59A 3CJSA 4CLPA 3MEGA 1AUDA 3RUBL 1S6PB 4OI4A 1QAJA 4ANDA 3OHAA 2HHSA 1TVRA 2CJYB 2ZD1A 3JTNA 1AT1B 1UL3A 1VJWA 2WW4A 3KLEA 3SSQA 4P6QA 3S01A 1S1XA 2V0NA 5HBMA 1SC3B 3FSXA 1G7CB 4IKAA 2VOOA 4KGXB 3J80U 4CNYA 3DXSX 3ZO7A 5DDRC 3MECA 1Z2ZA 1SKWA 3M2VA 2FD2A 1VQSA 3KFWX 3WC2A 4ZJOA 4PUOB 4M5MA 4DN0A 1NLKL 3RZAA 4LSNB 5CYQB 3T1HJ 4PG4A 1MWYA 3Q8SB 2Z56B 2MKCA 1HNIA 2P6TA 4R25A 4YB5A 4N8OA 1VC6A 4C8YA 4PWUA 1RTHA 1TQLA 4PYDA 1NPKA 1Y5LB 3C14B 1WHXA 4ZPDA 4CH0S 1NK4A 1I6JA 1AFIA 1QDUB 1RBLA 2BJ7A 2QE5A 5HMZA 2UV8A 4WP8A 2AX1A 4N56A 5J1EB 3SV4A 3CMES 1IM6A 1ZTWA 3AD8C 7FD1A 3NGDA 3SFUA 1CQMA 2FJWA 4NLQA 3HP6A 1GEHA 1EHWA 2X1FA 5CH7B 4X4QA 2EEYA 2F8EX 1VHFA 1JB0C 4XTTA 2HQFA 2A6MA 2Y8WA 1RTJB 3EVWA 1H7WA 3FBBA 4DLEA 2ASJA 2HHXA 4OI0A 3OL8A 2DNKA 5D77A 4EU0A 2HNDB 2OFGX 4CO4A 1EJ7L 4MYTA 2EBGA 1UVLA 1X60A 2AJQA 2W24A 4K4XA 3CD0A 2WK4A 3HFVA 4OI6A 3LP0A 4XPEA 3ZZTA 4Q45A 3EX7B 1ZPVA 1U1NA 4WYLA 1K73T 2HFNA 3IBCB 3TAMA 1U24A 5A8KB 1C1CB 2B56A 2JWNA 4EGLA 2HBYB 3WZ0A 1S1VB 2XMWA 1N4LA 5EN1A 2V94A 4OV6A 4RNMA 2L41A 3K0JA 4CP5A 1UWBA 1RZMA 2HBQB 4CLUA 1VQYA 1CG2A 3Q8QB 3CW2C 3C2PA 3RB6A 3K8VA 2NZCA 3DLKB 4WIIA 1VQNS 3E2EA 4DFJA 1ZM9A 2V63A 4DG1A 2V68A 3HD1A 3LGHA 3KMSA 2ZZNA 1REVB 1JK9B 3U1NA 2BACA 4NXMF 1T9UA 3TA0A 3R6LB 2ZOFA 5HL7Q 2LXFA 1BD6A 4B3TF 2F4VF 1KKHA 1WDTA 3AOBA 1Q95G 4MIAA 4QIGA 2FVCA 2IAJA 2KRRA 1LW2B 4Y2AA 2PEBA 4A4JA 1GX5A 2IYIA 2W4CA 3AD7C 3DDNA 1JLAB 1Q1KA 2BJ9A 1FK9B 3RU0A 3QAUA 4ER8A 4K59A 3FDSA 2QSWA 3D6TB 3E01A 3QMQA 5K5MA 2I8EA 1N52B 1UA1A 4J37A 2YPYA 1N6QA 2PGCA 3TVYA 4KHMA 1S4FA 4LFBF 3TUIC 5LMUF 5EWFA 4OJHA 3CMAS 5T7LB 4UY85 1R0AA 2N3LA 3G8TA 4PWDA 4DV5F 4WXOA 2OPSB 4GO7X 2YKAA 2MZRA 4NA2A 2VDHA 5F8GA 2R7WA 1MSWD 3EZOA 3SBMA 3R7BB 3MM8B 3MUVP 3CPWR 2EVZA 3K58A 3GR1A 1P9QC 4IRCA 4XO0A 2BOAA 3BV8A 3DDKA 2XSJB 3OR2A 4ZPVR 1RAAB 2BKOA 2RQCA 2VJUA 1VRQC 2LVWA 4KGMA 2QSFA 4HACB 4OX8A 1N32J 5JVHQ 1JXEA 2BKNA 3ENWA 3VQTA 3KUEA 3FZ2A 1FI4A 4WK3A 2RS2A 1WC4A 4N8NA 3CC2S 1S72S 2JEJA 4X64J 2M0GB 2LMIA 3AY0A 1AA1B 3T1YF 5E3PA 4X66F 2FLPA 1GXTA 1EKSA 4NI2A 5K8NA 3P5TL 2VC1A 1NK6A 3G6ES 4HLBA 1X4DA 2CQPA 1TELA 2HZCA 2Q43A 2CDQA 4AT1B 4QJVA 2PIIA 3KLGB 2QA4S 2EC0A 2R2UA 2IDLA 3GYXB 3IWXA 5KFIA 1PAEX 3DOKA 1IQTA 4YB7A 5D3GB 2FJAB 3D1QA 3F73A 1XR6A 3L7PA 4WZMA 3IM9A 3DI6A 4O3SA 4NLVA 3W3SA 5B7WA 4G1PA 2Q79A 1Q81T 2DH9A 9ATCB 3GWCA 3HX9A 5F9NA 3HHNB 1RGVA 2IM3A 1MMNA 3K8WA 3BEGB 4IOCQ 3L95X 5KFRA 2LCWA 1YHQS 5KFMA 4CLFA 4B3SJ 5KFJA 1YJ9S 3JSRA 2IVMA 3SCLE 4DF4A 1VIOA 1U4BA 2G4BA 5KFYA 2YBVA 1V9OA 4NOHA
chains in the Genus database with same CATH topology
4LFAJ 4NXMJ 3IMQJ 4NEYA 2UXCJ 4B3TJ 2F4VJ 3T1YJ 4LF6J 4DR7J 1N36J 4OX9J 1N33J 1J5EJ 1XNRJ 1HR0J 4GKJJ 4NEZA 2HHHJ 1HNZJ 1N34J 1XNQJ 4AQYJ 4DR4J 2ZM6J 2UUCJ 5IT9U 5LMUJ 4DV3J 4LF8J 5BR8J 1XMOJ 1I94J 4JI1J 4JI5J 4DV7J 4DUYJ 2E5LJ 4JYAJ 3R2DJ 4JI0J 4JI3J 1IBLJ 4JI8J 3J81U 4LF7J 4HHUA 1HNWJ 4DR1J 4DV1J 5LM7E 2MEWA 5A2QU 3D3BJ 1IBKJ 4JI4J 2VQEJ 4DV5J 4JI7J 4LF4J 4GKKJ 5AJ3J 4DV2J 3R2CJ 4DR2J 4RJVA 4DV4J 2MQ8A 4V1Ak 1XMQJ 5FLXU 4JV5J 1IBMJ 4X62J 3JAMU 4B3RJ 4KYZA 4X65J 4PWWA 1FJGJ 2UXDJ 3D3CJ 4JI6J 4LF9J 4YY3J 1N32J 2UUBJ 4X66J 4B3MJ 1HNXJ 4X64J 4DV0J 2KVQE 4KY3A 4K0KJ 2KL8A 3J80U 4NXNJ 4DR5J 4LFBJ 3J7AN 2UU9J 3T1HJ 4JI2J 4DR3J 3W1YC 5IWAJ 4YHHJ 2VQFJ 2UXBJ 5LMNJ 4KHPJ 4DUZJ 2UUAJ 4DR6J 4LF5J 4B3SJ 4DV6J 3OTOJ 2MTLA 4LFCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA J;  4NXM J;  3IMQ J;  4NEY A;  2UXC J;  4B3T J;  2F4V J;  3T1Y J;  4LF6 J;  4DR7 J;  1N36 J;  4OX9 J;  1N33 J;  1J5E J;  1XNR J;  1HR0 J;  4GKJ J;  4NEZ A;  2HHH J;  1HNZ J;  1N34 J;  1XNQ J;  4AQY J;  4DR4 J;  2ZM6 J;  2UUC J;  5IT9 U;  5LMU J;  4DV3 J;  4LF8 J;  5BR8 J;  1XMO J;  1I94 J;  4JI1 J;  4JI5 J;  4DV7 J;  4DUY J;  2E5L J;  4JYA J;  3R2D J;  4JI0 J;  4JI3 J;  1IBL J;  4JI8 J;  3J81 U;  4LF7 J;  4HHU A;  1HNW J;  4DR1 J;  4DV1 J;  5LM7 E;  2MEW A;  5A2Q U;  3D3B J;  1IBK J;  4JI4 J;  2VQE J;  4DV5 J;  4JI7 J;  4LF4 J;  4GKK J;  5AJ3 J;  4DV2 J;  3R2C J;  4DR2 J;  4RJV A;  4DV4 J;  2MQ8 A;  4V1A k;  1XMQ J;  5FLX U;  4JV5 J;  1IBM J;  4X62 J;  3JAM U;  4B3R J;  4KYZ A;  4X65 J;  4PWW A;  1FJG J;  2UXD J;  3D3C J;  4JI6 J;  4LF9 J;  4YY3 J;  1N32 J;  2UUB J;  4X66 J;  4B3M J;  1HNX J;  4X64 J;  4DV0 J;  2KVQ E;  4KY3 A;  4K0K J;  2KL8 A;  3J80 U;  4NXN J;  4DR5 J;  4LFB J;  3J7A N;  2UU9 J;  3T1H J;  4JI2 J;  4DR3 J;  3W1Y C;  5IWA J;  4YHH J;  2VQF J;  2UXB J;  5LMN J;  4KHP J;  4DUZ J;  2UUA J;  4DR6 J;  4LF5 J;  4B3S J;  4DV6 J;  3OTO J;  2MTL A;  4LFC J; 
#chains in the Genus database with same CATH topology
 3EE3 A;  1F0X A;  1U47 A;  3L3C A;  4OX9 F;  3IG1 A;  5HQ8 A;  3TI0 A;  5B0E A;  5KG4 A;  3OSN A;  4J9R A;  4RNN A;  4NRT A;  4ID5 A;  2FJB B;  1ELO A;  4C8Z A;  1V5I B;  3NLC A;  1I51 B;  4G1Q A;  4FVM A;  4KGK A;  4OJG A;  4P2S A;  4RUC A;  2KXN B;  1LWC B;  1ZOT A;  3UDC A;  2XS7 A;  2E1M C;  4N76 A;  1RT6 B;  4ZIT A;  5L1K A;  3QFH A;  2LLZ A;  2X3G A;  1JMT A;  3BGF A;  1ZM3 A;  3EVM A;  4YDD B;  2C2M B;  3C15 A;  3FMB A;  4NX9 A;  3VAI A;  3QJL A;  2HHH J;  1CJV B;  4AUK A;  2CQI A;  3NNH A;  1SV5 A;  3MDF A;  4PYA A;  3GII A;  3IGN A;  4HHH A;  2FY1 A;  2ZM6 J;  4WFN Q;  3SDE A;  1C1B A;  1GAO A;  2F40 A;  3AJD A;  4TLR A;  1K1S A;  1R8B A;  1RHR B;  2MY7 A;  2Q1L A;  5IT9 U;  3JTP A;  4ZOS A;  5LOQ A;  3SQG B;  1SC6 A;  3T9N A;  4ES3 A;  2E9Z A;  4XDD A;  3QYY A;  4CLY A;  3TX8 A;  3E3X A;  4C98 A;  2DEI A;  2GVD B;  4DUZ F;  1LWF A;  3DHX A;  4F4A A;  4NA1 A;  3KK3 A;  2H65 B;  2OML A;  5DQG A;  2RF2 B;  3FBF A;  1HQE A;  5KFB A;  3FQL A;  4FKX A;  4K5R A;  3J80 Y;  2BVZ A;  1X5O A;  4BCA A;  1FXR A;  1WI8 A;  2RRB A;  5ETS A;  4DJB A;  3TX0 A;  1TZ0 A;  4M94 A;  5F8J A;  3DLE A;  2MLY A;  4QW8 A;  4H54 A;  4C11 A;  1RKJ A;  2RSQ A;  1R0A B;  2W7O A;  5C2G A;  4FYX B;  2ZH8 A;  1PGZ A;  1OYD A;  4LRA A;  4U7C A;  3V6H A;  5C42 A;  2CAJ A;  4OI1 A;  1RIS A;  4K4U A;  3CJR A;  1FE4 A;  2BAN A;  4R0J A;  1CS4 B;  4CT8 A;  4DV1 F;  3CJ0 A;  1YBA A;  1T9Y A;  2CDR B;  3TO8 A;  5E3R A;  3NNC A;  1OY9 A;  1X4H A;  1Y5N B;  4ZPB A;  3T41 A;  5JVG Q;  3TZY A;  4ITS A;  2W7P A;  2VHG A;  2UUW A;  3U7J A;  4HDG A;  1VQ6 S;  2J8S A;  1V3R A;  4G65 A;  1S9E A;  2JX2 A;  2YWE A;  1HNV A;  1ICE B;  2WAQ D;  2XMM A;  2CQB A;  4ICL A;  4TU8 A;  4X4R A;  3DI6 B;  1Q16 B;  3PKY A;  1Q79 A;  3KLI B;  3EDQ B;  2XCA A;  4DG1 B;  4V19 X;  2UVV A;  3ISZ A;  4KR0 B;  3VZH A;  3BRE A;  1T05 A;  5IQQ A;  2CQH A;  3HF5 A;  5GAH U;  4KKO A;  3CCJ S;  4IOB A;  1O6X A;  3DRS A;  2D1C A;  2ZZT A;  4ED0 A;  1RB0 A;  4JI6 J;  2FB0 A;  4USV A;  2HIY A;  4OI2 A;  4F04 B;  2DCU B;  1RU2 A;  2K1R B;  4QBU A;  1RT7 B;  5A8W A;  3PFO A;  5H9E J;  3KJQ B;  4B3M J;  2JJ4 D;  2KM8 C;  2ZH1 A;  2V2Q A;  3IFE A;  3TUP A;  2R7S A;  2R7V A;  3RYL A;  4OYO A;  1TAU A;  2XUL A;  2BA9 A;  3G96 A;  1M0S A;  2QA1 A;  1RWM B;  1JLF B;  4A8S A;  5F8I A;  3NS6 A;  1UFW A;  2CFX A;  2EFG A;  4O4R A;  3RGI A;  2AV5 A;  2A2D A;  5B0B A;  5ITH A;  4TU7 A;  3H2V E;  3KJV A;  1B7F A;  3LP0 B;  3KLF A;  2B9W A;  2YNF A;  2HQC A;  2RVJ A;  1S1U B;  2B3T B;  2V5H G;  2J0W A;  3GIR A;  3M30 A;  3POT A;  3T19 A;  1VK3 A;  1JKH A;  2EG1 A;  4DV4 F;  2HHQ A;  2Q3P A;  2F9J A;  2K06 A;  3W62 A;  1RTJ A;  4B9M A;  1RHQ B;  2XSJ A;  5ETL A;  5IQ6 A;  4ZIV A;  4O3R A;  1YJR A;  1UPM B;  2HRT A;  2G1D A;  3PEH A;  4A8X A;  2W8L A;  3D0G E;  2HW3 A;  3NGU A;  3SQG A;  3KG4 A;  1SJ1 A;  2MQN A;  4N47 A;  3VV2 B;  3I5C A;  3K5L A;  4A8W A;  2UXB F;  3BDP A;  1CEZ A;  4OFZ A;  3N9U C;  4ZP6 A;  1BMQ B;  5K14 B;  4GC6 A;  2K7J A;  1GMW D;  2KZZ A;  4CH1 A;  4NZ7 A;  5M2R A;  3D28 A;  3MFH A;  4F4K A;  4UY8 T;  2X3D A;  3C3L A;  3VAH A;  4DPX A;  4LR7 A;  3GJT B;  2QA2 A;  1N34 F;  2MYF A;  3FRY A;  3OT9 A;  2ALZ A;  3A3O B;  2VA2 A;  5B09 A;  4ZPW R;  5C2C A;  4JUZ A;  1FRI A;  1UET A;  2CQ1 A;  2CPX A;  3CJK B;  4P2F A;  3V6D A;  1M1H A;  1TK5 A;  1DJ0 A;  2XEX A;  1OQ6 A;  2DTJ A;  1XNQ J;  1DY3 A;  1HKA A;  1MRO B;  3VVU A;  2HFV A;  2DNH A;  3CUN A;  4Y6I A;  2QG9 B;  3OSP A;  2RU3 A;  3GYG A;  1A6L A;  5HVG A;  1Z4U A;  5LMU J;  2N7C A;  1MU2 B;  4JI1 F;  4IG3 A;  1JLA A;  4OIX A;  2XWX A;  2WVD A;  2DNY A;  1NJI T;  1RI7 A;  2HHV A;  3N4W A;  2IA0 A;  4AD6 A;  2RIJ A;  1OYE A;  3H59 A;  3ET6 B;  5F8L A;  4B3S F;  2XS2 A;  4DUY J;  1GMU A;  3JQK A;  1YZ6 A;  2W2N P;  1N8R T;  2ZFH A;  1LFP A;  1R8C A;  4ATN A;  1GTH A;  1NHV A;  1R0B G;  5KFD A;  5D3G A;  2GV1 A;  2RDD A;  4UOF A;  5F0W A;  4LF9 F;  2H5I B;  3FQK A;  4NCB A;  4JI5 F;  4C8M A;  1U1P A;  2V67 A;  1IQZ A;  2E5L F;  2J7U A;  3MCO A;  1N32 F;  1JNZ B;  3H7H B;  1HNX F;  1CPZ A;  4ZVG A;  1XC9 A;  1UWB B;  3K17 A;  1HL6 A;  4JI3 F;  4Y2I A;  4WXW A;  1FDB A;  4ZVU B;  3VGU A;  2HPU A;  1UFL A;  5KT4 A;  5EWE A;  3MMJ A;  5HLF A;  2HWT A;  4ZJL A;  1M5P C;  4PRF A;  4PXE A;  2XY6 A;  1QJH A;  3S8S A;  3DLJ A;  2QMU B;  2GS8 A;  2C2N A;  2C1E B;  2N82 B;  2RS8 A;  4BBY A;  2G2Z A;  4R5P A;  1C0T A;  3CED A;  4MK8 A;  4JI7 J;  4P72 A;  1GNK A;  1QAY A;  4YME A;  3GG0 A;  4OZJ A;  2YX1 A;  4LRF A;  1FTR A;  2DNQ A;  2IM0 A;  1UCN A;  1SJQ A;  1VI7 A;  3BGR B;  3KHR A;  1LWC A;  2Z8Q A;  3TQE A;  3M30 B;  4DR3 F;  1Y10 A;  3FMW A;  2CNN B;  3W2V A;  2YNH A;  3LP2 A;  3FGV A;  2YH1 A;  1KD1 T;  3MAQ A;  2WCX A;  1SBR A;  2CIM A;  4B3R J;  2CPD A;  2J0X A;  1YK9 A;  5CCM A;  1BXN A;  1Y00 A;  1X4F A;  4J9N A;  4DQQ A;  4ZLJ A;  1WC0 A;  2FJX A;  4YY3 J;  1IXK A;  1C1B B;  2ASY A;  3D9B A;  1XJW B;  5T7L A;  3PR5 B;  2UUB J;  2HHW A;  3BSN A;  1YJU A;  4LSN A;  2X1B A;  2DGQ A;  4HDH A;  2DD8 S;  4J9V A;  5D6G A;  4K4T A;  2WVE A;  3NGS A;  1LW2 A;  4KT0 C;  5KG3 A;  3RB3 A;  2KTQ A;  4DDF A;  3CCR S;  3FCH A;  4O3N A;  2DK2 A;  4YR0 A;  3MED B;  1WDD A;  2R7U A;  3HHL A;  3PIP Q;  2E5J A;  1IBK F;  2UU9 F;  3IWN C;  1S1X B;  2LEA A;  4URQ U;  4BWM A;  5ETP A;  2XMV A;  4IH5 A;  1KR4 A;  4AFF A;  2NYI A;  3A3N B;  5KG2 A;  1UKU A;  2CJK A;  3AJ2 A;  2FC9 A;  1P8G A;  3ONQ A;  1F3F A;  2BE9 B;  3JS9 A;  2V4J A;  1F5A A;  2A3J A;  2JVR A;  3TVZ A;  1BWE A;  2IFX A;  1M5V C;  1PCA A;  3WHI A;  4FS2 A;  3FJ2 A;  2C3Y A;  2KDO A;  3TWZ A;  2QV6 A;  4NI2 B;  4O4G B;  4ZCI A;  1FX4 A;  5KFW A;  3HT0 A;  1PIL A;  1SCJ B;  3FBE A;  1UA0 A;  5D0H A;  4DF8 A;  5J2Q A;  1HFE L;  2WHO A;  3C6T A;  1FJG F;  2PO4 A;  1QY7 A;  4DR6 J;  3I82 A;  1T9W A;  1LEO A;  2GMH A;  3I0S B;  4NA3 A;  3UD5 A;  1DAX A;  3W65 A;  3CF5 Q;  2NQP A;  3KWM A;  3T1A A;  1SJ4 P;  2YX7 A;  3O1L A;  4NEY A;  5LMN F;  2BKP A;  1XN9 A;  2OHD A;  4LBP A;  3PYE A;  1H6K X;  2YXL A;  3KUH A;  3MD3 A;  4RBT A;  5HQL A;  3G71 S;  3CUL A;  2JDJ A;  1LW0 A;  1Q78 A;  4O23 A;  2BUN A;  1KDN A;  5D15 A;  4B3T J;  2HAF A;  4WWS A;  2F4V J;  2J76 E;  2W9B B;  5KFE A;  1S1V A;  1YWX A;  3M8P B;  2DR8 A;  4OYM A;  3A8E A;  3OTD A;  5EHH A;  1LXJ A;  2GMJ A;  3KLF B;  2BOP A;  2P9G A;  1FRJ A;  3KUG A;  4TLQ A;  3VAK A;  3PW0 A;  1R3N A;  4OHY A;  2YNI B;  2VA3 A;  2VKZ G;  2JHE A;  2W7A A;  4WFX A;  1GQE A;  3CSK A;  3I96 A;  3POT B;  4DQR A;  3HT3 A;  1VQM S;  1DZ5 A;  5DLF A;  3U27 A;  4P7V A;  1RA6 A;  2I5J B;  3PVX A;  2EBE A;  2UUT A;  2ZDO A;  1FXL A;  1DQ9 A;  3F0N A;  1H38 A;  2BRL A;  1RAH B;  1TL7 A;  4UF4 A;  2HSE B;  1ZAW A;  2VB6 A;  2Y0S D;  2MQL A;  3LW5 C;  4X4O A;  1VQK S;  2H54 B;  3H98 A;  3DGV A;  3I0R A;  2L9W A;  3QID A;  1C0T B;  1FK9 A;  2GCF A;  1SUQ A;  4WIQ A;  4U8V A;  3H4B A;  2UUC F;  2J5A A;  2M8H A;  1Q53 A;  3KOA A;  4X62 F;  2BEF A;  1V6H A;  3IAM 9;  2A1B A;  3MGJ A;  4CNZ A;  3NCP A;  5H1S V;  2Z2Y B;  5A76 A;  3P49 B;  3AB2 B;  1ZZN A;  1IBL J;  4IUF A;  1Q8I A;  2OFH X;  4BLG A;  2Q6B A;  2XMJ A;  4GVL A;  1FO1 A;  2DHA A;  4CI0 B;  3GV5 B;  4X4N A;  3Q8V A;  1CSJ A;  3I4H X;  4H4O B;  3CGI A;  2RT3 A;  1IR1 A;  2R4F A;  4A47 A;  3HDS A;  2VG7 B;  4NLS A;  5D4N A;  3TQ1 A;  4IR1 A;  1BQN A;  5K8P A;  3LWL A;  5ETM A;  1N5Q A;  1TTH B;  2OEL A;  1V5V A;  4JP8 A;  3FVY A;  4RUB A;  3THV A;  4EZ9 A;  2VOP A;  1PBA A;  3IR5 B;  3ZNJ 1;  1TKZ B;  2IDE A;  2DGO A;  4O3P A;  2RD5 C;  4USW A;  1BLU A;  2OSR A;  5D4P A;  4X4U A;  4UOH A;  1RAO A;  1MU2 A;  1N0U A;  1EAY C;  4ZVT B;  1JJH A;  1HBM A;  2ROE A;  1F5B A;  5DZ7 A;  2G0I A;  1FFG B;  2LU1 A;  2GC8 A;  2DXF A;  2HFO A;  3HSJ A;  3NRB A;  1REV A;  5EDW A;  3T5K A;  2L48 A;  3VCD A;  3DRP A;  3KLE B;  2P9E A;  1ZH5 A;  2XNQ A;  4RW6 A;  6FD1 A;  5AJ3 F;  2CPF A;  2F8H A;  2VG5 B;  2L08 A;  3M4X A;  4ZHR B;  4ED2 A;  1U1L A;  1IBM J;  2DO4 A;  3M32 A;  1RWU A;  4F8R A;  1NK7 A;  3P6Y C;  4MK7 A;  5F3Z A;  4X65 J;  1NZ8 A;  3KLH A;  3T5H A;  4C6A A;  4O0N A;  3QT7 A;  4LF9 J;  5J2N A;  4Q0B B;  3BR9 A;  2OI2 A;  2HVH A;  1JJ2 R;  4DCP B;  4KV8 B;  3EGV A;  1UVM A;  1AFJ A;  2Y1R I;  4DQS A;  1RTD A;  2G0C A;  5L39 A;  4QYZ J;  4NXN F;  4R5P B;  3W2W A;  1MWZ A;  3VZI A;  1YX2 A;  5LL6 d;  4DQI A;  2Y8Y A;  1WG5 A;  2OMO A;  1RLD A;  1T9V A;  3W8G A;  2IY5 B;  1FNX H;  3CJ4 A;  4J91 A;  3VR1 A;  2V34 A;  4NLY A;  2WVC A;  3OJU A;  3IRW P;  4PXD A;  4GKJ F;  4I6Y A;  5F0U A;  3CDW A;  4F67 A;  4YR3 A;  2NZ4 A;  3DU6 A;  1UJ6 A;  2E1R A;  2CPI A;  1EKR A;  4MFB B;  1FES A;  1OS5 A;  1S9G B;  2OPS A;  4IG3 B;  5SUH A;  2B8P A;  2XYP B;  4FF3 A;  3MM6 B;  1SH0 A;  2LQB A;  2X1G A;  3LPY A;  2GO9 A;  3P96 A;  1FF2 A;  4ANC A;  3VAL A;  5F41 A;  2R8J A;  4B9S A;  1G2E A;  4DX6 A;  2IJN A;  3KXD A;  1WI6 A;  1TUG B;  1T9X A;  2DNL A;  3HKW A;  4YN3 B;  3S1T A;  3C16 B;  1RAB B;  4DUZ J;  4Z7C A;  1S9F A;  1ZYQ A;  2RNE A;  2P8I A;  2G9O A;  3P5B P;  3M1V A;  4ZKA A;  5HVH A;  2CJX B;  1HAR A;  5J1P A;  2E1A A;  2ZVS A;  4LFA J;  1DLO A;  2JFK A;  2RE1 A;  2QLJ B;  4IH7 A;  2N3O A;  3EUN A;  4ES1 A;  2NXU A;  4O0I A;  5HMW A;  2GIR A;  5E3C A;  1QTN B;  1Y0H A;  4PKD B;  5DM6 Q;  1LXN A;  1NSP A;  2RKI A;  3NMA A;  4KO0 A;  1NK8 A;  3NCQ A;  4RWW A;  1FJE B;  1NU4 A;  2V2Z A;  3NXZ A;  4I6W A;  3C46 A;  3R2C J;  3PY8 A;  2N7Y A;  4QPT A;  3DC2 A;  3DLK A;  4G6V B;  2XZT B;  1C0U B;  4PG7 A;  2HFS A;  5J2P B;  3Q2S C;  1SJF A;  1BY9 A;  1V3S A;  1TL3 A;  4GVB B;  2MZT A;  3TJA A;  3FRZ A;  4ZCL A;  3PYD A;  3OXL A;  1O0P A;  1WSV A;  3KYL A;  4DSE A;  2HS3 A;  3C66 A;  4FDF A;  1BWV A;  4M5I A;  3MAH A;  3JYT A;  1ZA1 B;  3O8W A;  2A2C A;  3NS5 A;  3TP2 A;  2XMA A;  4C8K A;  3T5L A;  3BSA A;  2RQM A;  4HVZ A;  1DTQ A;  2I6W A;  4TN2 A;  3LP1 B;  3M6X A;  1QSY A;  2HK2 A;  3K2Y A;  1FJG J;  2XG8 A;  1GK8 A;  4M5N A;  4FN5 A;  3GV7 B;  3B54 A;  2QL9 B;  2VG6 A;  2RF2 A;  4ZMM A;  4ECV A;  1TFW A;  4KJI A;  3UO0 A;  1F9F A;  2OTL S;  4B3O B;  4ZJQ A;  1T9T A;  4AE5 A;  5LXR A;  5EWG A;  1RWP B;  2RJZ A;  1NPP A;  3UVJ A;  4C0O C;  3LGN A;  4LUB A;  2PDA A;  2ZVI A;  3GZ7 A;  1U0H B;  3I87 A;  1CC8 A;  4ZN3 A;  2MHN A;  1T94 A;  3M9N B;  4ED6 A;  1N33 F;  3X3U A;  4MIW A;  3PIO Q;  3BJY A;  1JLG B;  1RLC L;  1S6Q A;  3UW1 A;  2PA8 D;  5DG8 A;  2DGT A;  2J0Q D;  1YRX A;  1TL4 A;  1QVG R;  3MF5 A;  1DTT B;  3WIV A;  4FXD A;  2HVI A;  1J2V A;  4RL1 A;  2RQK A;  1RT7 A;  4K8R A;  1NK5 A;  4C7Q A;  2B51 A;  2D69 A;  2KH9 A;  2BQU A;  2B0G A;  3KHH A;  1LV5 A;  1HMV B;  2XI3 A;  3DDI A;  5CYQ A;  1HQU A;  2F63 A;  5CHC B;  2HBR B;  3IS9 A;  5EGY A;  4X62 J;  1VBZ A;  1HWI A;  3CCS S;  4D3H A;  3FFI B;  5HAT A;  4UT4 A;  1PBU A;  4KYZ A;  4KH1 B;  3VGS A;  2QL7 B;  4DX8 H;  1X5S A;  5M2U A;  4TKT A;  3HUL A;  5A0Y B;  1Z1Z A;  5L1I A;  5CAA A;  2UXD J;  4JI8 F;  2ILZ A;  3I32 A;  3W5Z A;  3KLV A;  4Y2M A;  1VRU A;  2BJ8 A;  2HFU A;  4I56 A;  3OV7 A;  1HNX J;  1AZS B;  3PV8 A;  1W2B R;  5DGA A;  4ANE A;  1SUQ B;  1CJT A;  2RIL A;  4EBD A;  2AYM A;  1O8B A;  2ZDP A;  2U1A A;  4W4M A;  3QSY B;  3RRK A;  1S9E B;  2NSB A;  4M5D B;  2Z4P A;  3NBP A;  1CS4 A;  1EET A;  2QJ3 A;  5KG5 A;  1YIJ S;  3PO4 A;  3EWG A;  4Z2X A;  4F3Q A;  4DL3 A;  3DM2 B;  1S1W A;  3C19 A;  1QAI A;  1TFY A;  1FD2 A;  1NDK A;  4MMO A;  1VIS A;  2XM3 A;  5HRO A;  2R7T A;  2DGV A;  3DOM A;  4R0E A;  2XY5 A;  2CQ2 A;  3JAM Y;  2WOM B;  2R7R A;  1NAQ A;  1B64 A;  1OSD A;  3CJ3 A;  2DHG A;  1FER A;  3MCN A;  3MMA B;  2XGQ A;  1M1K T;  1JKH B;  4KFB B;  2GZO A;  2FJV A;  2XMT A;  2KYZ A;  4DR6 F;  3CJ5 A;  1EQM A;  1N88 A;  3CO0 P;  4WP3 A;  2KU7 A;  2GO8 A;  2VC0 A;  4WU3 A;  4LFA F;  5A2Q Y;  3Q2T C;  4KV8 A;  4PZV A;  2VQF F;  2KG0 A;  5EUH A;  3LA0 A;  4L76 A;  3UE2 A;  4HI2 A;  2E1P A;  1FWP A;  5J1N A;  4DMZ A;  4DX7 A;  4I2Q A;  2L9N A;  2W4D A;  4ZDN A;  1NPR A;  3D6H B;  4OZ2 A;  1R6V A;  4TU9 A;  3OUY A;  4IR9 A;  3CC4 S;  4X2B A;  4NLU A;  3Q86 A;  4CH7 A;  1XBW A;  4ZHR A;  1HBU B;  5C7P A;  5DG9 A;  4DFM A;  5HK4 A;  4M95 A;  1ROF A;  1S7I A;  1XWL A;  2C3U A;  4EMD A;  3MR6 A;  1KQF B;  3OFG A;  3QT8 A;  3Q8Y A;  1S1T A;  5T41 A;  4MKA A;  2VV5 A;  1P6T A;  4ES2 A;  4Q5V A;  5B0C A;  5KT2 A;  4ENO A;  3K59 A;  2DVI A;  4GKJ J;  2D9O A;  4NEZ A;  2DHS A;  1HNZ J;  5M2P A;  2AU0 A;  1N34 J;  2G2O A;  4NLR A;  2O66 A;  3ZFV A;  5GAH I;  1T8E A;  2FY8 A;  3FC9 A;  2PT0 A;  2OTJ S;  1IKW A;  4DR2 F;  2J6S A;  4RLE A;  1D8Y A;  1BQN B;  1SH3 A;  1VOM A;  3CNQ P;  3H25 A;  4RW4 B;  3RAQ A;  1X5P A;  3R5A A;  1RT4 A;  4Y2K A;  5E3A A;  1I94 J;  2YVS A;  3AA8 A;  4DBQ A;  4PPZ A;  1PKU A;  2GJ2 A;  2GA7 A;  2NXE A;  4WPA A;  9RUB A;  1FKO A;  3PZP A;  1VBY A;  3IS9 B;  4UOG A;  4JYA J;  1XK8 A;  3ILO A;  1TK8 A;  1MG7 A;  3W61 A;  1M90 T;  4YY3 F;  1GT8 A;  2OPQ B;  3MWB A;  1KSP A;  3QGH A;  4WJB A;  5HMY A;  4I7F A;  2YNG A;  3D0I E;  1KTQ A;  1OQ3 A;  4IFY A;  1AW0 A;  4F02 A;  1FD8 A;  1H98 A;  2HGM A;  2MKI A;  4B9U A;  5DET A;  2PC6 A;  2AQ4 A;  3J81 j;  2AIR B;  1WOR A;  1KHV A;  4ETZ A;  5ADZ A;  3H40 A;  2YQ1 A;  2NXJ A;  3OTC A;  2ILY A;  2XS5 A;  1NRK A;  3H20 A;  3NS7 B;  4TVA B;  2F3J A;  2IRX A;  5I3P A;  3KK1 A;  4DV5 J;  4F4Y A;  4ED7 A;  1HYS B;  4L73 A;  2WSE C;  2R3V A;  2W2Q P;  4ALZ A;  3B4M A;  3GIL A;  3OLB A;  1HBO B;  1UFK A;  3BYR A;  1AB8 A;  5A8K A;  3GFY A;  2KYX A;  2HWI A;  5D4O A;  2OO4 A;  4ILL A;  1ARO P;  4WKY A;  2WOM A;  3CIZ A;  5B0G A;  1EX8 A;  3MPY A;  4YFU A;  1PYT A;  2BYC A;  3W9J A;  3JAM U;  1PIE A;  4ZVP B;  4J9U E;  3W2V B;  2ERR A;  1XMQ F;  3MM5 B;  3BH7 B;  2VBZ A;  2IVF B;  3ZZR A;  5LSR A;  2MXY A;  2HS0 A;  4PWW A;  3BBF A;  3DM2 A;  4QQB A;  1H72 C;  4I64 A;  3TZZ A;  1H73 A;  1HQE B;  1SL0 A;  3NAI A;  1NK9 A;  1U1R A;  4QU6 A;  2Y1J A;  2PN6 A;  2G2Y A;  2VJV A;  4DR1 F;  4J9Q A;  2CJA A;  2V2K A;  4ZPA A;  3OHB A;  4FBT A;  3R1H A;  3P4U B;  3JYT B;  5J2Q B;  3I5B A;  4RU2 A;  4K0K J;  3GLJ A;  2AX0 A;  5GMK a;  3RR7 A;  3Q89 A;  2KN4 A;  2BZ2 A;  4FYV B;  4MJK A;  2HUR A;  3KG1 A;  4FF4 A;  3CCV S;  2W9A A;  2NPI A;  4KH0 B;  4AXJ A;  3JSM A;  3MM9 A;  3UCZ P;  1PO6 A;  2IMO A;  1W2I A;  3TNV A;  1K0V A;  1HWU A;  1N5T A;  4QIF A;  4CM2 A;  3KMQ A;  2R8G A;  2NYH A;  3NWR A;  5SZT A;  1ITP A;  8RUC A;  2ZOM A;  3LH2 S;  3I56 S;  3UWT A;  3OLA A;  2HRY A;  4KB7 A;  1HI8 A;  4I4B A;  4A48 A;  5HMX A;  4DQP A;  1N54 B;  5IC6 B;  3VTI A;  4NYP A;  1JNR B;  3D1H A;  5E7O B;  2LEB A;  2FIU A;  2O67 A;  3I6P A;  3G4S S;  1T02 A;  1VK8 A;  2P2C B;  4R8U A;  4YS2 A;  1T7P A;  3M8Q B;  4FVC A;  1VLO A;  3H2U B;  4OZL A;  3QIP B;  5GAE I;  2UXD F;  5KFT A;  4CQ1 A;  1T3O A;  1S0N A;  4QYZ K;  2MZ1 A;  1X5T A;  2BXJ A;  4YQW A;  1U7L A;  3PRB A;  1FWK A;  3A8I A;  4MFB A;  4KPC A;  4URS A;  1IBL F;  1UEU A;  3BBC A;  1I5O B;  3N6M A;  5DQI A;  3ISN D;  4HTI A;  1U2F A;  2VF3 A;  2P5V A;  2DGW A;  2J7K A;  3I55 S;  2KM8 B;  1IKV A;  2AKW B;  2FJD B;  1RHM B;  5HP1 A;  5I4M A;  1FXD A;  2ZJQ Q;  3G8Q A;  3M6W A;  4QYR A;  1LWE B;  3M2R A;  1J5E J;  1VLY A;  4Q8E A;  2BE2 B;  2HIQ A;  3Q8P B;  1D8Z A;  2HVE A;  4PG6 A;  1X9W A;  2CNL B;  2RU9 A;  2JLF A;  2YNF B;  4ID8 A;  4KGV B;  1WSR A;  1R8A A;  4PAB A;  4ED4 A;  5KFO A;  5DDP C;  3VAF A;  2MMY A;  2DRD A;  3M9O B;  3QQC D;  5DDO C;  1YIT S;  3NG8 A;  3RR8 A;  1VR6 A;  2F9D A;  4LVN P;  4Q2M A;  5KAK A;  1ZAV A;  1FRH A;  3A8K A;  4DS5 A;  2HBZ B;  3V4I A;  1U8S A;  3QAE A;  3V2U C;  3PRV A;  5J2M B;  4J9P A;  2MPU A;  2AYG A;  4WTY A;  2R8K A;  3HM9 A;  3NL0 A;  1XQI A;  3NGK A;  1D09 B;  3OTO F;  2O3D A;  3MI7 X;  1RT2 B;  1VC5 A;  1QM9 A;  4DI6 A;  4WFA Q;  4FYD A;  2C2O B;  2KT5 A;  3DRP B;  1VQP S;  1GMV A;  4ZCK A;  4IRK A;  2FVR A;  5FD1 A;  4KKO B;  4G1Q B;  1HBO A;  1WOP A;  3BN4 A;  1E6V B;  4DPW A;  2VG5 A;  5LJ5 Y;  5FLX Y;  1MN7 A;  1B4S A;  7FDR A;  3H5Y A;  1RT6 A;  4LBH A;  2CZ4 A;  2OKQ A;  1CJK A;  2QLW A;  3DMJ B;  4MTP A;  4NPO A;  2HQG A;  4NWB A;  4YB6 A;  5F8M A;  2V9W A;  3NBP B;  3DCA A;  4ZIW A;  1QVF R;  2JLG A;  4OMF G;  4WYW A;  2FLL A;  4KO0 B;  2ZWO A;  2CQG A;  1OIA A;  1NJZ A;  5IZH A;  3OBI A;  4C3K A;  2AEJ A;  3QFW A;  3HHL C;  1PC5 A;  2YKM B;  3G82 A;  3CJK A;  2AT1 B;  4LJM A;  2MKS A;  1X0P A;  4NZ6 A;  1VQL S;  5BYS A;  2VQE F;  3RBD A;  4RJV A;  1QE1 B;  5B0D A;  3PHE A;  4V1A k;  5KFK A;  1IUJ A;  3GIK A;  1NB7 A;  2BDP A;  5C5J A;  2R7X A;  4CTA B;  5LXY A;  2CWK A;  2GHV C;  5IWA F;  2M3D A;  5CYM A;  3CCZ A;  5HI7 A;  2HG4 A;  4DPU A;  3SZ2 A;  3RRH A;  1JJC B;  1UW4 A;  4UTG A;  2EI5 A;  4KTQ A;  1WWH A;  4M5L A;  1VQO S;  3OFH A;  4L6V 3;  5CZX A;  3DLE B;  2MHE A;  1S99 A;  3THP A;  1S9G A;  2M7S A;  1WEZ A;  4J9K A;  3OTB A;  2LEC A;  4RZR A;  2DIT A;  2LQ5 A;  4OJ3 A;  1FVS A;  1GFW B;  2GGP A;  5IV3 A;  3HVR A;  4PQU B;  3NOG A;  3QGG A;  2CKW A;  3FKB A;  2E5G A;  3GFZ A;  3KK2 A;  4DR7 J;  3SCK E;  1Y11 A;  2LQ9 A;  5KT3 A;  2MQO A;  4B02 A;  1ZET A;  1K1Q A;  1MMD A;  3CB4 A;  1RA7 A;  4H4M A;  5KFF A;  2MGZ B;  2BAN B;  3JTO A;  1UTA A;  4OLP A;  4WFY A;  4C8L A;  2B5J A;  1U09 A;  2B9Y A;  2ZWP A;  4LFB J;  4X4P A;  2IHR 1;  4ZP7 A;  4W92 B;  4F36 A;  3IM8 A;  1T95 A;  3AOA A;  2ZJP Q;  4P74 A;  1RAJ A;  4LF5 J;  4ZVF A;  1MLA A;  5E41 A;  1X4A A;  2NUH A;  1U49 A;  3R7S B;  1FEH A;  1YBT A;  4FNI A;  2LQJ A;  2V69 A;  5J1E A;  4QR2 A;  4YHH J;  3DOL B;  2VQF J;  5BR8 F;  3C14 A;  1NND A;  2PSZ A;  3QLH B;  2NXC A;  4NML A;  1U45 A;  2VL1 A;  1VYA A;  2NPF A;  2FLO A;  3Q0A A;  5J2P A;  3OL6 A;  4OHX A;  5F3T A;  3N5B A;  3WX4 A;  4GVB A;  4JI0 F;  2YKO A;  3CCT A;  1KHW A;  5C25 A;  2XY7 A;  2YNG B;  1F9E B;  3G2X A;  1P1T A;  1W25 A;  4C9D A;  3AFG A;  1SIZ A;  1UJ4 A;  1NDC A;  1NKE A;  2WON B;  3MM9 B;  4B17 A;  3AXM A;  4OV1 A;  4QWB A;  5GAD I;  4M5D A;  3UNG C;  1VS3 A;  1N33 J;  2XYG B;  3HHL B;  4Y3C A;  4X4T A;  2GML A;  1U48 A;  2JFD A;  5A6W A;  3UN2 A;  1IJE B;  1C4A A;  2IBO A;  3DU5 A;  1TU0 B;  4ED8 A;  3RBE A;  3QRR A;  1HWK A;  2OEK A;  3X1L B;  1YKW A;  1LNQ A;  5KG6 A;  2P9C A;  5CA5 A;  1XMO F;  1NKB A;  3LO3 A;  2OP5 A;  4RW8 B;  4RUA A;  5IM0 A;  3BR8 A;  4L75 A;  4F25 A;  4DSF A;  3V6K A;  2DRB A;  3MFI A;  2W1B A;  3NKY A;  2BJD A;  2VG7 A;  3FZB A;  3DMJ A;  4KHR A;  4RNO A;  4ZN1 A;  3ILI A;  3H8Y A;  2ZM6 F;  3FCV A;  3NGT A;  3CJT A;  2D3U A;  2BR0 A;  1S0M A;  3PEJ A;  2OD6 A;  2VBW A;  3L4B C;  2HVZ A;  3V5R A;  1DQ8 A;  2ZC3 A;  1C4C A;  1WEY A;  3CD5 A;  1SL1 A;  4JI3 J;  1NH7 A;  4JI8 J;  3TZX A;  1DTT A;  4HHU A;  2XB2 D;  3DLH A;  4F4X A;  3DFE A;  5AE3 A;  3TOQ A;  4KSE B;  3OUY B;  2GFF A;  2MKH A;  1G6B A;  1D0E A;  2RRA A;  3MZI A;  4C97 A;  2DH7 A;  2GGP B;  4BC9 A;  4QWE A;  2RQ4 A;  2O5D A;  1J5E F;  1Y3J A;  2HNY A;  4C11 B;  5KFV A;  3C6T B;  2QO3 A;  4HTJ A;  4PG5 A;  2MKK A;  2RDJ A;  1RBA A;  4DSK A;  3AOC A;  4QOT A;  2DR7 A;  4LF4 J;  4NLP A;  3IBF B;  4BC7 A;  3M8S A;  4DV2 J;  4QCL A;  4UOC A;  3EJM A;  2C28 A;  4FYY B;  4K2X A;  1SC1 B;  3GON A;  1IKV B;  3FSY A;  2ZJR Q;  2CYY A;  4B9L A;  4LMZ A;  2J9C A;  3L09 A;  3QWP A;  3MMB A;  1RK8 A;  5ETN A;  5JMN A;  4YR2 A;  3KK2 B;  3BQ0 A;  3VAJ A;  2V8H A;  5T14 A;  1SPB P;  1X4G A;  1NME B;  2XGP A;  2OUG A;  3UI3 A;  1RYR A;  1TMJ A;  2AGP A;  3IR6 B;  1F9H A;  1RT1 A;  2W2M P;  4NRU A;  4O3O A;  3AQP A;  1FRX A;  3F44 A;  4IQX A;  2B7B B;  1CJT B;  1DUR A;  1RKI A;  3V4M A;  5K8M A;  2W9C A;  1ACM B;  2XI2 A;  2AHO B;  4ILR A;  1U1O A;  2HMI B;  3BO4 A;  3FUY A;  7AT1 B;  2E9R X;  4BHQ A;  4DPT A;  3HI9 A;  2D9P A;  4DN9 A;  2H51 B;  4ZVE A;  4EUV A;  3ZC4 A;  2UP1 A;  3MOZ A;  2VFV A;  4QZV B;  5ETK A;  3MD1 A;  4LR8 A;  4DL6 A;  3M8Q A;  1AXQ A;  4EBC A;  2KO1 A;  2DCL A;  3BBB A;  4H4K A;  3ULH A;  3QLH A;  1JLB A;  4N7T A;  5GAD U;  1MN9 A;  4QWD A;  5IFM A;  1RP5 A;  1SKS A;  4W90 B;  2HQ3 A;  5BXI A;  4WTO B;  2DNP A;  2VOD A;  3H5U A;  3D7S B;  4M8L A;  1D3W A;  2VPX B;  4IO1 A;  1DLO B;  1JWW A;  2YNH B;  3LP2 B;  3M8Y A;  5F9L A;  1KRP A;  2QTW A;  5A0Y A;  1BQM A;  2DIS A;  3DOK B;  3NOC A;  4FF1 A;  4BDP A;  2YWG A;  1FRL A;  1RWO B;  1C2P A;  1QD1 A;  4QPX A;  4NLO A;  4IFV A;  2BW2 A;  3R5D A;  1JLE A;  1KS2 A;  2GNK A;  1LWF B;  1WKK A;  1NDL A;  4J7C A;  3WX8 A;  3GPA A;  3VGV A;  5LMN J;  1RT5 A;  2VFR A;  3SV3 A;  4U7U D;  3DGP A;  1U1K A;  4KQZ A;  3OTO J;  1IN0 A;  4N41 A;  4F3M A;  5D8H B;  4JV2 A;  3SXL A;  2F1F A;  3PYG A;  1IKX B;  2FC8 A;  2RB7 A;  1R0C B;  3E8O A;  2VKR A;  3GTY X;  1RWV B;  2XLI A;  4OZN A;  2KG1 A;  2PMH A;  2HHP A;  4ED3 A;  1KC8 T;  1FTC A;  1N5V A;  5DG7 A;  4ZVH A;  4C4W A;  1RXO B;  2KHD A;  1U2R A;  3MMA A;  3NAH A;  1EET B;  4EBE A;  3HXM A;  1DTQ B;  4FF2 A;  3KK3 B;  3ZZO A;  3PX6 A;  3M32 B;  3DLG B;  4I7F B;  2RHQ B;  3KJF B;  3GJS B;  5HRO B;  2VG6 B;  2ZBC A;  4DV2 F;  1YI2 S;  1V3Z A;  1TKZ A;  4O4G A;  3QZ8 A;  2KT3 A;  3TJ8 A;  2OPR B;  1WKL A;  3KJN B;  1X9S A;  2IVY A;  2ZHB A;  1PSD A;  1KLM B;  2RHS B;  1HBM B;  1OPZ A;  2A0F B;  2DJW A;  4I2P B;  4DV3 J;  2JL9 A;  3CJ2 A;  3PX4 A;  5KFC A;  2ZD1 B;  4LRC A;  2QFI A;  1MML A;  1TV6 B;  4EK2 A;  2E9T A;  3WC0 A;  3E01 B;  2C3O A;  2IM2 A;  1FA0 A;  1N0V C;  3CTR A;  3HVT B;  4Y0F A;  2ZNZ A;  4U9R A;  1RT3 B;  2FYX A;  2YTC A;  4HHJ A;  4K4Z A;  1DFD A;  1FKO B;  3GV8 B;  2GAH C;  3J81 U;  4IFY B;  4CLL A;  5DZ6 A;  2ZEJ A;  1KBR A;  2JC1 A;  2WON A;  4YB1 P;  4OHW A;  3MAA B;  4QR1 A;  5L9N A;  2GJI A;  2H9Z A;  4A46 A;  4DS4 A;  3O2I A;  3TYT A;  5G0R B;  1HQU B;  1PYS B;  2OH2 A;  4DSJ A;  1VCT A;  4OYB A;  2FZK B;  2VDI A;  1HBN B;  2VUG A;  3A4T A;  1DAR A;  1EIY B;  2VAS A;  1WTB A;  4WFB Q;  2LKZ A;  1UP1 A;  1BE4 A;  3FCW A;  3ISN C;  5B0F A;  2AYB A;  3SSR A;  2E1C A;  3OFF A;  5A8R B;  2DGS A;  2E44 A;  2IIH A;  4M5H A;  2FHK A;  3M1V B;  1RSC A;  5AJ3 J;  1IWG A;  1IBM F;  4HH0 A;  5GAG I;  3EYZ A;  1RWN B;  1S5Z A;  2HGL A;  2AYE A;  4TY8 A;  5C24 A;  4EZ6 A;  1CJK B;  1KP6 A;  1O51 A;  1U02 A;  3US5 A;  1UVN A;  3CT9 A;  3TEH B;  4FZV A;  3MTK A;  1TKT A;  3ETO A;  4TYB A;  1U25 A;  3GIM A;  5L46 A;  5GVQ A;  3ZZY A;  1S77 D;  3BKT A;  3L7U A;  2NCK L;  2H4Y B;  4NLT A;  1RT2 A;  5KT7 A;  2WB4 A;  3MM5 A;  5I3U A;  1SIW B;  2DPJ A;  2KXH A;  2JEG A;  2P6S A;  1VRT B;  3HK2 A;  2MLZ A;  5EX3 A;  2RDI A;  2FDN A;  5IS2 A;  3B82 A;  1XMB A;  1H7X A;  5KFQ A;  2KHC A;  4Y65 A;  4Q7A A;  2POK A;  4OYW A;  2XZW A;  4KY3 A;  1FKP A;  2COL A;  1KOO A;  3BGU A;  3J7Z 5;  2QLB B;  1HA1 A;  3BH6 B;  2FTR A;  2KL8 A;  4B3M F;  3NCR A;  3PKM A;  3MPW A;  1S4E A;  2WZ1 A;  1WF0 A;  2B6A A;  3S6E A;  2F8M A;  1SJ3 P;  3OR2 B;  2B4V A;  4DSL A;  4DR5 J;  4DU7 A;  3CJQ A;  1YJV A;  4Z7Y A;  2AMC B;  4LF4 F;  2PEH A;  5H9E K;  1SKU B;  3BSC A;  4RW6 B;  4N77 A;  1RE1 B;  4WE1 A;  3RB0 A;  4QWA A;  4JYA F;  1ZAX A;  3D66 A;  1G3O A;  3DXB A;  3N79 A;  4A8Y A;  1VBX A;  2JEF A;  1F6T A;  2VFT A;  3IR7 B;  4ZLP A;  4RO0 A;  3QT6 A;  3EXC X;  1QSL A;  2AJ1 A;  3D2W A;  4CRJ A;  3OTE A;  2Y1I A;  3MEC B;  1TVR B;  3IA0 A;  2EC2 A;  1Q8K A;  4BWJ A;  2JSX A;  4I2P A;  2BM1 A;  4LQ9 A;  3LOU A;  3THT A;  2ADB A;  4A8K A;  1KVJ A;  1VQ5 S;  1HNV B;  1FT8 A;  2HVD A;  2B43 A;  1FJ7 A;  2RRN A;  1Q8B A;  3IMQ J;  4NAS A;  2J8A A;  2VON A;  1S0O A;  3IO1 A;  2CJB A;  4F7V A;  2CVE A;  1WF2 A;  2FGC A;  4LSL B;  2H3E B;  4A8O A;  1S97 A;  3V81 A;  2RH3 A;  4XPC A;  5AXM A;  5E0O A;  1X7V A;  1XER A;  3HMJ G;  3V6D B;  1XNR J;  1HR0 J;  4E98 A;  3MM7 B;  3F41 A;  1M1G A;  4LRB A;  3D54 A;  3KLG A;  2CVI A;  1RTI B;  2I38 A;  3KKF A;  4NLD A;  3BPS P;  4DOZ A;  4OYP A;  1HLW A;  3SYZ A;  4JI2 F;  3HLU A;  1OWX A;  2F4F A;  1S79 A;  3HFZ B;  4ELT A;  4AL6 A;  3LAL A;  3PO5 A;  4YHH F;  3H42 A;  4J9M A;  1XNQ F;  8ATC B;  1B0V A;  1XMO J;  2C2E A;  4NCG A;  3SEO A;  3EZ5 A;  2R8H A;  2UVR A;  4AL5 A;  3V4I B;  1S0V A;  1KQK A;  4XK8 C;  1OMS A;  3UN5 A;  3ZZU A;  1SL2 A;  4DV7 J;  5E5N A;  4B3R F;  5F8N A;  5KFL A;  3PRD A;  4DFK A;  1LQ9 A;  4PXC A;  1WUU A;  3AQO A;  3TA2 A;  1BQM B;  3DRR B;  2V8G A;  4LF7 J;  1NM2 A;  2FZG B;  1NJX A;  2MQM A;  3N01 A;  4ETX A;  2IBK A;  4U96 A;  5FDL A;  2AJ2 A;  5ETQ A;  2GQC A;  1S10 A;  2ACM A;  2WRM A;  3PJW A;  3U02 A;  3ZTP A;  2E5I A;  2HAI A;  5CYJ A;  2FHJ D;  2R7Q A;  4CTA A;  5K20 B;  2DHX A;  5A2Q U;  5KT5 A;  2IC3 B;  1OY6 A;  2ZUA A;  1GXU A;  1PYO B;  2VH7 A;  4TXS A;  2LYV A;  3SMZ A;  4I67 A;  2G13 A;  4FPI A;  4WU2 A;  2W4P A;  4OL8 A;  2C3M A;  2K1R A;  2LU2 A;  3KDN A;  3M6V A;  1FE0 A;  1SC4 B;  2WSC C;  1UAW A;  2D7S A;  2EK1 A;  3CD6 S;  3PW5 A;  2FLN A;  1NZA A;  2OD4 A;  1S6O A;  3MUT P;  1WC3 A;  2KKH A;  5D0R A;  1FFS B;  3RW6 A;  2HZA A;  3PM9 A;  4Z37 A;  3QBC A;  4RW9 A;  5ETO A;  3TEG A;  1Y4Z B;  4ELV A;  3QSI A;  3JSM B;  3MR5 A;  2V6A A;  3K5N A;  1H2U X;  3W8P A;  4LF5 F;  3RTV A;  4ECX A;  3LAM A;  3K5M A;  1U0H A;  2MLX A;  2VPZ B;  4OI3 A;  4WP9 A;  5DS7 A;  4ED5 A;  2AW0 A;  1PJ7 A;  1OSC A;  3GE9 A;  3MPD A;  3PR4 A;  3KLI A;  3BKF A;  4NLX A;  2R2R A;  4M63 A;  2XTJ P;  3DYA A;  3ZZZ A;  4M1K A;  2EKN A;  1RCO B;  2DNZ A;  2JRS A;  1HBU A;  4UZC A;  2FQQ B;  2HWH A;  3IC1 A;  4ZVS B;  1UEV A;  1JLG A;  3RBX A;  2OIH A;  4IRD A;  4IOA Q;  1F60 B;  3ENV A;  3IRX A;  1K9M T;  2W9B A;  1SQE A;  4Q2L A;  6AT1 B;  4JB8 B;  1IKX A;  3OL9 A;  3SIP B;  3TRG A;  2HQI A;  2HYI B;  3CCU S;  2DEJ A;  3JQM A;  2ZH2 A;  3T5J A;  3ITH A;  4LT6 A;  4NZ0 A;  5AXN A;  2U2F A;  4JOU A;  4DCJ B;  4CIO A;  4A8M P;  2B5J B;  3EMT A;  1TAQ A;  3BPD A;  2KI2 A;  5THW A;  1N56 A;  2UUA J;  3KJV B;  3OL7 A;  2CPE A;  1GH8 A;  3AAW B;  3BB5 A;  2BM0 A;  3M2U B;  2XLJ A;  2B4U A;  4H4M B;  3GCW P;  1DQA A;  1JXV A;  2ABY A;  2C2K B;  2QRR A;  1IR2 A;  4OZ5 A;  4USK A;  5BR8 J;  3VAG A;  2AEM A;  3I0S A;  4OHZ A;  4DR7 F;  1WKJ A;  3N6L A;  3I9Z A;  3Q8R B;  2V4Q A;  3W5Y A;  4PQU A;  1BGX T;  2HLT A;  1AZS A;  1Q5V A;  5K9F A;  5HO4 A;  2KZM A;  3BM7 A;  3IWL A;  2FVS A;  3HO1 A;  4AXI A;  1S1W B;  2M2B A;  3JSY A;  3DLL Q;  5HLF B;  5KFU A;  1JLQ A;  1XTZ A;  1IKY A;  1FWL A;  1L3K A;  3PNI A;  5IT9 Y;  3MTJ A;  2EPI A;  1CJV A;  4HR2 A;  3ET6 A;  1YG0 A;  2IRU A;  4AL7 A;  1W7W A;  4U7U K;  2A18 A;  3PCO B;  4GO5 X;  4OX6 A;  1DBD A;  4H4O A;  1JLB B;  2CG4 A;  4DXL A;  3CVK A;  1T05 B;  2E7V A;  1RAF B;  1VIX A;  3BO2 A;  2RUS A;  3B8H A;  4OZ3 A;  2BMB A;  1PJ5 A;  4K2J A;  3HHE A;  4ZCM A;  1NBE B;  2BV3 A;  1U26 A;  3MEG B;  2QFJ A;  3GSD A;  3MED A;  5D0E A;  1EQ0 A;  3SI8 A;  3MEE A;  1H3D A;  2DH8 A;  2EFV A;  3PTW A;  2ATC B;  2YWW A;  4DL0 C;  3QZ7 A;  2XMU A;  4NYZ A;  2DPI A;  4DL7 A;  2IC3 A;  3OD2 A;  4S0M A;  3G6Y A;  4LF8 F;  1BQX A;  4G1I A;  3OR1 A;  4WFZ A;  5D0G A;  5DRK A;  1NSQ A;  4OHV A;  2AJ0 A;  2HEK A;  1KLN A;  1TR0 A;  1FVQ A;  2L3M A;  3LTO A;  2V2V A;  2Z58 B;  2YKQ A;  3CDE A;  3M05 A;  4PQA A;  4NYO A;  5F8H A;  1Q7Y T;  4DV1 J;  5LM7 E;  1FKP B;  1U1Q A;  4OZ1 A;  5U47 A;  2CNK B;  2FJE B;  3W64 A;  3ZXW A;  3V6J A;  4C8N A;  2C2R A;  3PAC A;  2RUG A;  3D3B J;  1CVJ A;  1FRM A;  4UQT A;  3A3P B;  1B7Y B;  4Y34 A;  3ZTQ A;  3LGM A;  5DM7 Q;  1LW0 B;  3IGV A;  2MZS A;  2W2O P;  3R3T A;  2NLW A;  1JIH A;  1NO8 A;  2V9K A;  3CXC R;  3WDO A;  3LF0 A;  4X84 A;  4CO2 A;  1VQ4 S;  3V81 B;  1BUX A;  2FPH X;  2RAQ A;  2ZHO A;  1RAI B;  2KJW A;  3BQ1 A;  1Q5Y A;  1WG4 A;  1KNZ A;  2R2T A;  2GVD A;  4A8F A;  2VIC A;  1U6Z A;  4J9O A;  5J2N B;  4Q0B A;  4HKQ A;  4F2R A;  4FXW A;  5IOL A;  2L9D A;  3L7O A;  2CAD A;  2WBR A;  2H1Y A;  5A8R A;  4X66 J;  4CO3 A;  4QWC A;  4P75 A;  5AXK A;  4K0K F;  2CPJ A;  2LXU A;  3WBZ A;  3PW4 A;  1YTY A;  3R9L A;  2AJF E;  3M7V A;  3R97 A;  4EO6 A;  4ZK7 M;  4OZ0 A;  4RW4 A;  3O3L A;  2XBP A;  3RW7 A;  2YQ3 A;  1SQG A;  2HQD A;  2PA3 A;  2CZV C;  3AB4 B;  2OEJ A;  3EVO A;  2YKN B;  1HHT P;  2D41 A;  4FP9 A;  2MSS A;  3C16 A;  3HKZ D;  3HSG A;  3MUM P;  2NRE A;  2QLX A;  2NUU G;  3HJV A;  1K8A T;  3QWU A;  4ZP9 A;  2W9C B;  1TK0 A;  5L1J A;  2HHH F;  4CT9 A;  2CQ3 A;  1HNZ F;  2APO A;  4JV1 A;  2BW7 A;  3DRS B;  4U6P A;  3PHT A;  1HI0 P;  5CXT A;  1RT1 B;  4PG8 A;  4JI2 J;  1K0T A;  3HSD A;  2IM1 A;  4RR5 A;  4ECU A;  4YUD A;  3CO9 A;  4P71 A;  2MZJ A;  3T1H F;  2K7K A;  4NCA A;  2CJQ A;  3TAQ A;  4RPF A;  4J5O A;  2UXB J;  3Q24 A;  2LQ8 A;  1ZA2 B;  4KC5 A;  1BC6 A;  1FEE A;  4DL4 A;  2LA4 A;  1YJ7 A;  4JI6 F;  2MST A;  8AT1 B;  4MKV A;  2QIF A;  3D67 A;  4DV7 F;  2AGO A;  2EWH A;  4UUW A;  3Q22 A;  1UW9 A;  2GIF A;  1U6B A;  3PJ9 A;  5I3U B;  1FNO A;  4WE1 B;  4NXM J;  1WOS A;  4P7T A;  3UDL A;  5FDL B;  2I1R A;  5HSP A;  1SI9 A;  1RWK B;  1Q7L B;  1NH8 A;  3GFH A;  3KNG A;  1KOH A;  4DPY A;  3GR0 A;  3UNY A;  5KTQ A;  1N36 J;  1OJ4 A;  4P52 A;  1XR7 A;  4USU A;  2X51 A;  1HHQ A;  3LWM A;  5HN0 A;  2JH3 A;  4CO5 A;  5KG0 A;  4JV0 A;  3NNA A;  4C3M A;  2LXI A;  1UVJ A;  2YH0 A;  3Q8U A;  1CUL B;  2ZNY A;  1U8W A;  3UCU P;  2W8K A;  1EZZ B;  2PMZ D;  5HAO A;  2YY3 A;  3W2W B;  1JJ4 A;  2BJE A;  3EDR B;  4P2X A;  3DYA B;  1UVK A;  3HVW A;  2EW9 A;  3MCS A;  4EI2 A;  2FUG 9;  4EO8 A;  3UPF A;  5KFH A;  1HD0 A;  4N5S A;  2C42 A;  5G0R A;  2GIQ A;  4RW9 B;  2QA4 G;  2CQC A;  2UUA F;  3DNC A;  1N5Y B;  1LFW A;  4HI1 A;  4XAK A;  5JXS A;  1T03 B;  2E5L J;  4GC7 A;  1HIY A;  1TP7 A;  3CDB A;  3K89 A;  5C24 B;  2MJN A;  2I2Y A;  1FJC A;  1D9F A;  2LFV A;  2X7I A;  1RT3 A;  2GQ2 A;  1RBO B;  1FHT A;  2VPY B;  1KWM A;  4CCH A;  1LWX A;  4ECT A;  2XLK A;  5MAO A;  1REG X;  1B0T A;  3HVA A;  3KHL A;  5BJR A;  2MEW A;  4E2F B;  2V4J B;  1LK5 A;  1HBN A;  1RAD B;  2M52 A;  4MIB A;  1VQ7 S;  4LSL A;  1KFS A;  2QN6 B;  4TYA A;  1QUV A;  1VDH A;  4OYA A;  1WC1 A;  1J5O A;  1U2C A;  3HVT A;  2D3O 1;  5KFX A;  2BE7 D;  3BKU A;  1VFJ A;  3R6G B;  3D6M B;  2BBE A;  2ZKT A;  2NS1 B;  3S7R A;  4AQY F;  4I1T A;  1NXI A;  1PC4 A;  1KQS R;  5H9F K;  4GKK J;  2QZ8 A;  1S6Q B;  2Y3Y A;  3D4J A;  3KG0 A;  4MYU A;  3ILL A;  4FPR A;  1RAE B;  3G6X A;  1MNE A;  2AZ3 A;  2BJ3 A;  3FEZ A;  3CCE S;  1UMJ A;  3MM6 A;  2MQ8 A;  2OPR A;  4E8U A;  1JLQ B;  1TL7 B;  4D3G A;  4OYX A;  3FBC A;  4IH6 A;  3SCI E;  4DFP A;  2HS4 A;  4B9T A;  1FRK A;  1SXL A;  3GQC A;  2OEM A;  5ETT A;  3T6J A;  3QGI A;  4LF1 A;  2QX0 A;  2YKP A;  1WEL A;  2ZHA A;  3O5T B;  3EPI A;  4IDK B;  3H5S A;  3OW2 R;  3P3D A;  3D3C J;  3NGR A;  1C1C A;  1YSJ A;  1HNW F;  1NUE A;  2XYH B;  3UCG A;  1CQN A;  3E51 A;  3MOJ B;  3UFC X;  1R27 B;  4CO1 A;  2YQ0 A;  1GX6 A;  1URR A;  2KVQ E;  4ZLL A;  4J90 A;  3MCM A;  1L3T A;  3ENQ A;  1NK0 A;  4UST A;  2EKY A;  1NSA A;  4K4V A;  1R89 A;  4QIE A;  1R31 A;  5E3Q A;  3LAK A;  3LPE A;  1YRU A;  3OR1 B;  1N48 A;  3KLH B;  1U6F A;  3R5J B;  3ZTR A;  3PW2 A;  2HNY B;  1TL3 B;  1TKT B;  2EXU A;  3UDV A;  1QAX A;  1H2V Z;  1JQG A;  1OY8 A;  1VRT A;  3H4D A;  2DB1 A;  2XC9 A;  2B9E A;  3QRP A;  3LUY A;  4PPD A;  3HHD A;  2XO6 A;  2ZE2 B;  2CPH A;  3ELH A;  4DR3 J;  1P1L A;  4KGZ B;  1VC0 A;  1KFD A;  2ZZM A;  5IWA J;  1FDD A;  4OJ1 A;  1LK7 A;  4NL5 A;  2XCP A;  5ETR A;  4TY9 A;  5HBM B;  3TVK A;  4IO9 Q;  2HNZ B;  2N4D A;  4MT1 A;  4ILM A;  3GSI A;  1RT4 B;  3O6Q A;  3KHG A;  2GAG C;  2M5Y A;  2Y1L B;  4F0K A;  4HL9 A;  2R9L A;  1I94 F;  3BF4 A;  2BRK A;  1WHV A;  2DGX A;  2JEI A;  4DZD A;  1UZD A;  1JLC A;  3UDE A;  4PWD B;  1MW7 A;  1Q0N A;  1KN6 A;  1TKX B;  2DKO B;  3MHY A;  4LFC J;  3D0H E;  4KHP F;  4UZB A;  3U1M A;  2ZH5 A;  2HGN A;  4DLG A;  4FKY A;  4USI A;  2UU9 J;  4HEA 9;  2QYG A;  4KAI A;  2HK3 A;  3ADA C;  5CYM B;  4CO0 A;  2IYG A;  4WZQ A;  3MR3 A;  3K57 A;  3BN7 A;  3G8S A;  3N5F A;  4H4K C;  2EG2 A;  2XQC A;  3Q23 A;  3HHK A;  2VD3 A;  1YQH A;  4YDX A;  4CDI A;  2D3O R;  2YWF A;  1WG1 A;  5CZV A;  4F26 A;  2B6A B;  4IG0 A;  5DGB A;  4F4W A;  1F1B B;  5C42 B;  4LIW A;  4B9V A;  1M5O C;  1L5U A;  1PG5 B;  1HPZ B;  1L3U A;  2DO0 A;  5KFZ A;  3UQS A;  1CBK A;  4HT5 A;  2MQP A;  3A12 A;  4DR4 J;  3AJ1 A;  3J7Y U;  1HQ2 A;  4GMK A;  3DOL A;  4ICL B;  3SQO P;  2E29 A;  1ZS6 A;  2DXE A;  4IYQ A;  3MXH P;  2CQD A;  1Q8L A;  3ILJ A;  4DU8 A;  3NY0 A;  3EXY A;  2LEP A;  3W7B A;  1IBC B;  5KFN A;  1WHY A;  4JI5 J;  3GIJ A;  3RRG A;  1R7I A;  3MMB B;  4DUT A;  1FNM A;  2YX4 A;  3DRR A;  4P10 A;  2Z0G A;  3FNN A;  5AE1 A;  5KG7 A;  5MLC V;  2MQQ A;  1ZTT A;  6FDR A;  3R2D J;  2I5J A;  2YNI A;  1PAU B;  4GRS A;  2VIH A;  5CAB A;  4LBI A;  2IJF A;  5LSO A;  4P9S A;  2LP4 A;  2M8D B;  2DGU A;  4F2S A;  4LF6 F;  2PE8 A;  1N36 F;  1RJJ A;  4Q43 A;  1HD1 A;  1VJQ A;  2VBY A;  2CPY A;  4CYU B;  1L3V A;  1TMM A;  5LJ3 Y;  1H2T Z;  1SV5 B;  2CQ4 A;  1IBK J;  4JI4 J;  3CDA A;  1NDP A;  2GVZ B;  5KG1 A;  3DHW C;  3PX0 A;  2JC0 A;  2C3P A;  3KK1 B;  1HYS A;  3OJS A;  4PR6 A;  3HCX A;  4HH1 A;  1YGY A;  2K3K A;  2CZ9 A;  3GMG A;  4W98 A;  3FEX B;  1F3V A;  4LRE A;  4OLO A;  5RUB A;  3RJM B;  5IM0 B;  1B70 B;  1HWJ A;  3JXO A;  4A8Q A;  1RYS A;  3PJX A;  1RHJ B;  1S76 D;  3I9V 9;  4LIR A;  5DO2 A;  2ADC A;  1KEK A;  2WBM A;  5AE2 A;  3A1Y G;  4WF9 Q;  1NJY A;  2KFN A;  2FHO B;  5L38 A;  5L1L A;  1WNE A;  2VFU A;  2JLE A;  3PW7 A;  2PMW A;  1HNI B;  4XDC A;  1ZPW X;  4HT7 A;  2J6U A;  5H9F J;  4AYB D;  3QO9 A;  2R42 A;  3OPK A;  4DCO B;  4XIU A;  1IM4 A;  1A7G E;  1VMB A;  1WD6 A;  3IG1 B;  3GYN A;  3QPI A;  4ECZ A;  4YEA A;  1WEX A;  4R8U B;  3TUZ C;  2VBX A;  3L9Z A;  1TKX A;  2LA6 A;  2DBB A;  4P2M A;  1FCA A;  1D1U A;  3BQ2 A;  1S1T B;  2J9E A;  2HHT A;  2K2P A;  4DX5 A;  5HJX A;  1Q86 T;  3CMQ A;  3ENA A;  2BX6 A;  4NE9 C;  4LR9 A;  2CJ9 A;  4IQM A;  1ZM2 A;  3SFG A;  5I3Q A;  3N28 A;  3EPG A;  3J7A N;  2QGF B;  3H90 A;  1O5J A;  1N5S A;  1X4C A;  4RUH A;  1M5K C;  2PI4 A;  4RW7 B;  1ULR A;  4I2Q B;  1FDA A;  1IKY B;  4L72 B;  2UVU A;  1A9N B;  1WTF A;  2DIU A;  1H0H B;  1FDN A;  2CUY A;  4JV5 F;  1VHI A;  2DXD A;  4I68 A;  2BQR A;  2KRB A;  2ROP A;  2WW8 A;  3CJ8 A;  3K5O A;  3W9I A;  2O01 C;  2X1A A;  4EYI B;  1X4E A;  1SKR A;  4CWB A;  1RTD B;  4LQ3 A;  5DDQ C;  1YDL A;  2WB1 D;  4M5J A;  3KTQ A;  4Q44 A;  3CWJ A;  2UXC F;  3K7R A;  3MM7 A;  2OAU A;  2ZH4 A;  4DV6 J;  2WVF A;  2UUB F;  2QLF B;  4WCE Q;  4YP3 A;  3TJ9 A;  3OQ2 A;  4ZLN A;  2MTL A;  2DR5 A;  4I0W A;  5BYQ A;  2H5E A;  2LDI A;  3D5M A;  4TQS A;  2JVO A;  4ZVR B;  1GXL A;  5J2M A;  1APS A;  3PG9 A;  2GQQ A;  3BYP A;  4U8Y A;  2WTF A;  2CNO B;  3ITH B;  4KFB A;  1FX2 A;  3W63 A;  1QLN A;  2CRL A;  1I1G A;  2VZ9 A;  4G3I A;  3MPV A;  3VAM A;  2D3Z A;  3QJP A;  4PEO A;  4TY8 B;  2E66 A;  2M88 A;  3J81 Y;  4F50 A;  2IRY A;  2OSQ A;  4UUX A;  1TL5 A;  1S1U A;  1HW9 A;  1CC7 A;  2RKI B;  2W25 A;  3GFX A;  3MR7 A;  4QIW D;  3ZNU A;  3CCQ S;  1X9M A;  2YKM A;  3G82 B;  3PYF A;  4MAK A;  3ICL A;  5KFG A;  3AHP A;  4DV3 F;  3D6F B;  4AQY J;  2Z57 B;  2HMI A;  4JI7 F;  3MEE B;  2CG8 A;  2EFN A;  5DLG A;  4MKB A;  1AYE A;  5HJY A;  5I42 A;  4RBV A;  3HFK A;  3B4D A;  1AUS L;  4Q8F A;  1UVI A;  3NMR A;  1UEK A;  2B4P A;  3N0V A;  4USH A;  1N6Q B;  3H2L A;  1D9D A;  4O44 B;  1S48 A;  1C0U A;  4DPO A;  3W9H A;  1BHN A;  2AWZ A;  1J5O B;  2ASL A;  2F7V A;  1NSK L;  5E33 A;  4EYH B;  4X65 F;  4V19 J;  2ZBQ A;  1KON A;  1A0O B;  4JI0 J;  1ZM4 A;  3TAM B;  1I3O B;  2JOQ A;  3TUJ C;  3GJR B;  1P9Y A;  3FSI A;  4DL2 A;  3I5A A;  2ZH6 A;  4EEY A;  3HPO A;  4QU7 A;  5IT0 A;  2VU5 A;  1EP4 B;  1WOO A;  2FHJ A;  3G86 A;  3PDN A;  1TKD A;  2B7C B;  3DN9 A;  3PFE A;  2I9S A;  3MEK A;  3HSZ A;  1N5Y A;  1TUV A;  2O1P A;  2LDY A;  3CC7 S;  3NWG A;  2E5H A;  2J6T A;  1KVI A;  3C6U B;  1MWQ A;  2QYC A;  2PFD A;  1SVD A;  3DLG A;  4CZC A;  3UD4 P;  2ATL A;  1Z2L A;  2KVI A;  2MJU A;  3N6N A;  1KQG B;  3R5C A;  2AGQ A;  1CJU B;  1FKA F;  4RWX A;  2HRU A;  3UVJ B;  3CCL S;  5HP1 B;  4GKK F;  2IPO B;  1U1M A;  3EGZ A;  2XSF A;  4RW7 A;  1VBK A;  5FLX U;  3TA1 A;  5IT4 A;  4LRD A;  1VQ9 S;  3R7N B;  1Y5I B;  2HFZ A;  2DNM A;  2BE2 A;  2Y0B B;  3I31 A;  1RCX B;  3M8W A;  3ZTS A;  2FVQ A;  3MM8 A;  1KVK A;  1JXL A;  4DL5 A;  2NXN A;  2IJR A;  1S12 A;  2M4M A;  4ZP8 A;  1TUW A;  3DRX A;  4C0H A;  4X64 F;  3OVA A;  3AXK A;  2MB0 B;  2OPP A;  5CD4 H;  1RTZ A;  2F65 A;  3WIU A;  4K5S A;  2ZBR A;  1B99 A;  1X4B A;  3P45 B;  1RTI A;  3A8J A;  3BS9 A;  1G1X A;  2WVB A;  2DNG A;  1RHK B;  4ELU A;  2AJ4 A;  1SH2 A;  3C8Y A;  3RG6 A;  1Q4R A;  3W66 A;  5CD4 A;  2DYA A;  3K5P A;  4CLT A;  3J7Y I;  2Z2Z A;  4F3O A;  2YPZ A;  4IG0 B;  3IP0 A;  4DV0 F;  4C2M A;  4UQG A;  2MZQ A;  2QT7 A;  2HZV A;  2GJF A;  4NXN J;  3CCW A;  3QIP A;  4FXV A;  4B08 A;  5HVF A;  3TAN A;  2QL5 B;  2BQ3 A;  1F5C A;  2KXF A;  3BSO A;  5IXU A;  5LT5 A;  3B6B A;  1DRZ A;  3FFI A;  4FBU A;  3MAA A;  2B9X A;  1VRU B;  4KRW A;  2CXE A;  1S6P A;  2E7W A;  1SQF A;  2B8Q A;  3OXF A;  4TNO A;  4X4V A;  2FVP A;  1DHM A;  1TL1 B;  2V8V A;  3HHL D;  4DEZ A;  1UPP A;  5LSL A;  2PD1 A;  1SB6 A;  2ZBP A;  4ZPC A;  3TR5 A;  3BO3 A;  3AD9 C;  5CCL A;  2ZOG A;  1HHS A;  4WKR A;  2EK6 A;  1XEZ A;  3KDO A;  3VGT A;  1VQ8 S;  4KHP J;  1F2H A;  3CDU A;  2N4C A;  2BAB A;  5I42 B;  2UUC J;  1GTE A;  3DRY A;  5B0A A;  5BYR A;  3PXG a;  2PI5 A;  4OX7 A;  3RB4 A;  4KPY A;  4KE5 A;  4FNH A;  1S7H A;  2Z30 B;  3T6B A;  4M5G A;  4F4Z A;  2KT2 A;  2UV8 G;  1CUL A;  2DR9 A;  2ZKU A;  3FEY B;  2R7O A;  3T1Y J;  5KOX A;  5G4D A;  5D78 A;  4ED1 A;  5L8R C;  2DHH A;  2Y9H A;  2QC3 A;  1HR0 F;  4LF6 J;  1X0F A;  2MDA A;  4RX6 A;  2DT9 A;  3MPU B;  2D74 B;  5GAG U;  3AH6 A;  2KJV A;  3MMC A;  4UW2 A;  3IAS 9;  3JSB A;  1HWL A;  3BDE A;  4L3K A;  3MUR P;  3TZW A;  3R5B A;  1YVF A;  4QR0 A;  4ZA1 A;  5AT1 B;  5KFA A;  2VPW B;  3UD3 P;  4F0H A;  3IBW A;  1QSS A;  1RUS A;  2CPZ A;  1XR5 A;  4O3Q A;  4LVO P;  3VVT A;  1HW8 A;  2CA9 A;  2H5J B;  1YJN S;  1QTM A;  4YOE A;  3R27 A;  1NHU A;  4U67 Q;  4K4W A;  4OYI A;  2DY1 A;  2KB2 A;  5AXL A;  4HYK A;  2MGZ A;  3I4P A;  3R1L A;  5K8O A;  3SDE B;  1YLX A;  3GCX P;  5A6P A;  4J9S A;  2QMX A;  2W01 A;  1Y7P A;  2BJ1 A;  5FJ4 A;  2JZ5 A;  1LWE A;  2DNN A;  2K3I A;  3F56 A;  3M2R B;  3LQV A;  2NR0 A;  4HAC A;  2XHC A;  2OPQ A;  1CLF A;  4LFC F;  1P27 B;  1CJU A;  1WJ9 A;  3R5G A;  3A13 A;  1RAC B;  3UR0 A;  4K4S A;  4MH8 A;  3M8P A;  3QGP A;  4DSI A;  2V8D A;  4EFA C;  4KIA A;  4FYW B;  1HNW J;  3IRX B;  2J0S D;  3C15 B;  2V8P A;  3UR3 C;  2QMW A;  3GJQ B;  4C48 A;  3R8Y A;  2K8G A;  2XHW A;  3BGL A;  2G0J A;  4RKU C;  4Y00 A;  4CLS A;  1X8D A;  3OVB A;  1H74 A;  1YJW S;  4ERD A;  5GMD A;  1Y3K A;  2HKE A;  4NLW A;  5KFS A;  5JJB A;  4DV0 J;  1L3S A;  1UZH A;  1IKW B;  1J27 A;  1XNR F;  1E6Y B;  4USM A;  4PAA A;  2SXL A;  3D68 A;  3IXQ A;  2AP6 A;  4DR5 F;  4JBC A;  1HPZ A;  4ECS A;  2ASD A;  1T3N A;  2M9K A;  3ZZ0 A;  3J7A 1;  5A8W B;  4WBF A;  2PFF B;  1E6V A;  3M6U A;  2AZ1 A;  2DIV A;  2DNR A;  3AOD A;  4Y28 C;  2ZH7 A;  1XMQ J;  3JQJ A;  4I69 A;  3U1L A;  1M5S A;  1YBU A;  4K7Q A;  1GMW A;  2XMK A;  4L74 A;  4WK1 A;  2MKJ A;  3WQP A;  2M70 A;  3EGW B;  4X4S A;  2V4R A;  1UWA A;  3CCM S;  4FS1 A;  3TW0 A;  3GG1 A;  3VHQ A;  5ETV A;  4ZPT R;  1OPI A;  2C2D A;  2GVZ A;  1RWW B;  1KTV A;  1TL1 A;  2HND A;  4U95 A;  1T03 A;  1S49 A;  2FHM A;  2YWK A;  2CQ0 A;  2ZE2 A;  4ZS6 A;  4LF7 F;  2XNR A;  2ROG A;  4DHV A;  1T0T V;  2XO7 A;  1HI1 A;  1NCL A;  2WSF C;  4CLK A;  3W60 A;  3J7Z T;  2GX8 A;  3M2U A;  3Q83 A;  4USJ C;  1EB0 A;  3NP5 A;  5K14 A;  2NSC A;  3FK4 A;  2J9D A;  3I0R B;  3OFE A;  4RNH A;  4ZVO B;  1RWX B;  4NCG B;  1RAG B;  4NMX A;  4PCQ A;  1IR0 A;  5KOW A;  1RHU B;  3H5X A;  4K50 A;  1R8P A;  4KBI A;  3ZTO A;  1NJW A;  1YRT A;  2ALY B;  2EFQ A;  3RAM A;  4JI4 F;  2Q66 A;  2DR6 A;  3HJF A;  2C2Z B;  1M5H A;  5E2Q A;  3M8Z A;  3M9M B;  4IDK A;  3G9C A;  2H4W B;  4TQR A;  4NLG A;  3JB9 k;  1IWA A;  2ZC4 A;  1Q82 T;  3VQS A;  3QAT A;  2R8I A;  1LOU A;  3T3F A;  4J9L A;  4ECQ A;  2GHW A;  1YZ7 A;  4ECY A;  5CQG A;  3MMC B;  5KT6 A;  3CD7 A;  3W1Y C;  3TAR A;  1SJR A;  5B08 A;  1NB2 A;  4I6A A;  2J9D E;  4B3O A;  4ID5 B;  1RT5 B;  1VGY A;  3T9Z A;  4MK9 A;  4DV6 F;  3M8R A;  2OLW A;  2FGO A;  3C6U A;  5HQM A;  4C0B A;  1RDR A;  3M2V B;  3GP9 A;  4IFV B;  1FFW B;  3EM1 A;  3O44 A;  4CLZ A;  1JLF A;  2R2S A;  5IV4 A;  4P73 A;  3AA9 A;  3D1O A;  3DGP B;  4M5K A;  1UJ5 A;  3VWS A;  3QO9 B;  4CM0 A;  4DWI A;  3HZG A;  3ZZP A;  2C22 A;  1QUP A;  1W26 A;  2UXC J;  4DZ6 A;  1ZZF A;  4EWT A;  4PUO A;  3VF0 B;  3RAX A;  1RTH B;  4ECR A;  2EFO A;  5L9X A;  2XWY A;  3GB0 A;  3QJJ A;  4LF2 A;  2G1H A;  1X31 C;  1HMV A;  5D4L A;  1PJ6 A;  4RBU A;  4OX9 J;  2ZIT A;  4PXB A;  4URG A;  2ZUG A;  1B3T A;  2YKN A;  3QRQ A;  4Y2C A;  2HHU A;  2KFY A;  4QW9 A;  4ECW A;  3QT5 A;  5HAN A;  3EIC A;  2A6O A;  2OJ3 A;  5JUM A;  1S57 A;  1K44 A;  3SSS A;  3DLB A;  2GHP A;  2VFS A;  4E0D A;  1ZBT A;  3DKD A;  1WF1 A;  1E6Y A;  3NEK A;  3QNW B;  5C25 B;  1B0P A;  2I0X A;  2A10 A;  3HD2 A;  1JLC B;  5DQH A;  1U0S A;  3OVS A;  2AEF A;  3BZQ A;  1NEE A;  4CYU A;  3G87 A;  2E7X A;  1MRO A;  3ETM A;  1NKC A;  1URN A;  4DUY F;  1TV6 A;  2XZD B;  4DR4 F;  4LF8 J;  1IJF B;  2V50 A;  2HNZ A;  5EX0 A;  3EZU A;  1KLM A;  2MY8 A;  4MKY A;  3SCJ E;  1RQ0 A;  2CWX A;  4OQJ A;  2ACY A;  5GAE U;  1IVZ A;  1JX4 A;  4QIV A;  2DY9 A;  2KFZ A;  1F2G A;  1K47 A;  2OPP B;  2ZBI A;  3CE8 A;  3KNA A;  2AD9 A;  1R8H A;  2B4O A;  3BGR A;  3AT1 B;  2IA6 A;  4ZVQ B;  2MKY A;  2Q6C A;  2F5G A;  3BGO P;  4DR1 J;  2OGU A;  3IN5 A;  4F0M A;  4C3L A;  2UVW A;  3HZE A;  5DJB A;  2DRA A;  2W2P P;  2AF6 A;  2UZA A;  3P8B B;  2ZH3 A;  4RU9 A;  4L3N A;  3G6V A;  1YJT A;  1OO0 B;  1R43 A;  2RML A;  3CIM A;  3MR2 A;  2VQE J;  1NHK L;  2HLU A;  2IMW P;  4CLW A;  3EGN A;  3H0P A;  3W5X A;  3RBZ A;  4JI1 J;  2H48 B;  3OXG A;  4C8O A;  1WC5 A;  2Z2L A;  3LAN A;  2QEX S;  4RNF A;  5FII A;  2JNJ A;  4DR2 J;  4DV4 J;  1LKZ A;  1D9A A;  1EAR A;  1S6U A;  5IC4 B;  4RW8 A;  4LSZ B;  1WC6 A;  1XIQ A;  1Y9O A;  1EP4 A;  3DOM B;  1QE1 A;  1JLE B;  3LP1 A;  3TAP A;  2YWH A;  2DNO A;  4B9N A;  2EFP A;  3B78 A;  4K4Y A;  4JV5 J;  2IAJ B;  3UN3 A;  5KFP A;  4BS2 A;  4O44 A;  2GW8 A;  2FZC B;  2ZH9 A;  1R6Y A;  2J7W A;  1WAC A;  1WHW A;  2Z2M A;  1RU1 A;  1T11 A;  3GU0 A;  4OYZ A;  5GME A;  1G4C A;  1S59 A;  3CJS A;  4CLP A;  3MEG A;  1AUD A;  3RUB L;  1S6P B;  4OI4 A;  1QAJ A;  4AND A;  3OHA A;  2HHS A;  1TVR A;  2CJY B;  2ZD1 A;  3JTN A;  1AT1 B;  1UL3 A;  1VJW A;  2WW4 A;  3KLE A;  3SSQ A;  4P6Q A;  3S01 A;  1S1X A;  2V0N A;  5HBM A;  1SC3 B;  3FSX A;  1G7C B;  4IKA A;  2VOO A;  4KGX B;  3J80 U;  4CNY A;  3DXS X;  3ZO7 A;  5DDR C;  3MEC A;  1Z2Z A;  1SKW A;  3M2V A;  2FD2 A;  1VQS A;  3KFW X;  3WC2 A;  4ZJO A;  4PUO B;  4M5M A;  4DN0 A;  1NLK L;  3RZA A;  4LSN B;  5CYQ B;  3T1H J;  4PG4 A;  1MWY A;  3Q8S B;  2Z56 B;  2MKC A;  1HNI A;  2P6T A;  4R25 A;  4YB5 A;  4N8O A;  1VC6 A;  4C8Y A;  4PWU A;  1RTH A;  1TQL A;  4PYD A;  1NPK A;  1Y5L B;  3C14 B;  1WHX A;  4ZPD A;  4CH0 S;  1NK4 A;  1I6J A;  1AFI A;  1QDU B;  1RBL A;  2BJ7 A;  2QE5 A;  5HMZ A;  2UV8 A;  4WP8 A;  2AX1 A;  4N56 A;  5J1E B;  3SV4 A;  3CME S;  1IM6 A;  1ZTW A;  3AD8 C;  7FD1 A;  3NGD A;  3SFU A;  1CQM A;  2FJW A;  4NLQ A;  3HP6 A;  1GEH A;  1EHW A;  2X1F A;  5CH7 B;  4X4Q A;  2EEY A;  2F8E X;  1VHF A;  1JB0 C;  4XTT A;  2HQF A;  2A6M A;  2Y8W A;  1RTJ B;  3EVW A;  1H7W A;  3FBB A;  4DLE A;  2ASJ A;  2HHX A;  4OI0 A;  3OL8 A;  2DNK A;  5D77 A;  4EU0 A;  2HND B;  2OFG X;  4CO4 A;  1EJ7 L;  4MYT A;  2EBG A;  1UVL A;  1X60 A;  2AJQ A;  2W24 A;  4K4X A;  3CD0 A;  2WK4 A;  3HFV A;  4OI6 A;  3LP0 A;  4XPE A;  3ZZT A;  4Q45 A;  3EX7 B;  1ZPV A;  1U1N A;  4WYL A;  1K73 T;  2HFN A;  3IBC B;  3TAM A;  1U24 A;  5A8K B;  1C1C B;  2B56 A;  2JWN A;  4EGL A;  2HBY B;  3WZ0 A;  1S1V B;  2XMW A;  1N4L A;  5EN1 A;  2V94 A;  4OV6 A;  4RNM A;  2L41 A;  3K0J A;  4CP5 A;  1UWB A;  1RZM A;  2HBQ B;  4CLU A;  1VQY A;  1CG2 A;  3Q8Q B;  3CW2 C;  3C2P A;  3RB6 A;  3K8V A;  2NZC A;  3DLK B;  4WII A;  1VQN S;  3E2E A;  4DFJ A;  1ZM9 A;  2V63 A;  4DG1 A;  2V68 A;  3HD1 A;  3LGH A;  3KMS A;  2ZZN A;  1REV B;  1JK9 B;  3U1N A;  2BAC A;  4NXM F;  1T9U A;  3TA0 A;  3R6L B;  2ZOF A;  5HL7 Q;  2LXF A;  1BD6 A;  4B3T F;  2F4V F;  1KKH A;  1WDT A;  3AOB A;  1Q95 G;  4MIA A;  4QIG A;  2FVC A;  2IAJ A;  2KRR A;  1LW2 B;  4Y2A A;  2PEB A;  4A4J A;  1GX5 A;  2IYI A;  2W4C A;  3AD7 C;  3DDN A;  1JLA B;  1Q1K A;  2BJ9 A;  1FK9 B;  3RU0 A;  3QAU A;  4ER8 A;  4K59 A;  3FDS A;  2QSW A;  3D6T B;  3E01 A;  3QMQ A;  5K5M A;  2I8E A;  1N52 B;  1UA1 A;  4J37 A;  2YPY A;  1N6Q A;  2PGC A;  3TVY A;  4KHM A;  1S4F A;  4LFB F;  3TUI C;  5LMU F;  5EWF A;  4OJH A;  3CMA S;  5T7L B;  4UY8 5;  1R0A A;  2N3L A;  3G8T A;  4PWD A;  4DV5 F;  4WXO A;  2OPS B;  4GO7 X;  2YKA A;  2MZR A;  4NA2 A;  2VDH A;  5F8G A;  2R7W A;  1MSW D;  3EZO A;  3SBM A;  3R7B B;  3MM8 B;  3MUV P;  3CPW R;  2EVZ A;  3K58 A;  3GR1 A;  1P9Q C;  4IRC A;  4XO0 A;  2BOA A;  3BV8 A;  3DDK A;  2XSJ B;  3OR2 A;  4ZPV R;  1RAA B;  2BKO A;  2RQC A;  2VJU A;  1VRQ C;  2LVW A;  4KGM A;  2QSF A;  4HAC B;  4OX8 A;  1N32 J;  5JVH Q;  1JXE A;  2BKN A;  3ENW A;  3VQT A;  3KUE A;  3FZ2 A;  1FI4 A;  4WK3 A;  2RS2 A;  1WC4 A;  4N8N A;  3CC2 S;  1S72 S;  2JEJ A;  4X64 J;  2M0G B;  2LMI A;  3AY0 A;  1AA1 B;  3T1Y F;  5E3P A;  4X66 F;  2FLP A;  1GXT A;  1EKS A;  4NI2 A;  5K8N A;  3P5T L;  2VC1 A;  1NK6 A;  3G6E S;  4HLB A;  1X4D A;  2CQP A;  1TEL A;  2HZC A;  2Q43 A;  2CDQ A;  4AT1 B;  4QJV A;  2PII A;  3KLG B;  2QA4 S;  2EC0 A;  2R2U A;  2IDL A;  3GYX B;  3IWX A;  5KFI A;  1PAE X;  3DOK A;  1IQT A;  4YB7 A;  5D3G B;  2FJA B;  3D1Q A;  3F73 A;  1XR6 A;  3L7P A;  4WZM A;  3IM9 A;  3DI6 A;  4O3S A;  4NLV A;  3W3S A;  5B7W A;  4G1P A;  2Q79 A;  1Q81 T;  2DH9 A;  9ATC B;  3GWC A;  3HX9 A;  5F9N A;  3HHN B;  1RGV A;  2IM3 A;  1MMN A;  3K8W A;  3BEG B;  4IOC Q;  3L95 X;  5KFR A;  2LCW A;  1YHQ S;  5KFM A;  4CLF A;  4B3S J;  5KFJ A;  1YJ9 S;  3JSR A;  2IVM A;  3SCL E;  4DF4 A;  1VIO A;  1U4B A;  2G4B A;  5KFY A;  2YBV A;  1V9O A;  4NOH A; 
#chains in the Genus database with same CATH homology
 4LFA J;  4NXM J;  3IMQ J;  4NEY A;  2UXC J;  4B3T J;  2F4V J;  3T1Y J;  4LF6 J;  4DR7 J;  1N36 J;  4OX9 J;  1N33 J;  1J5E J;  1XNR J;  1HR0 J;  4GKJ J;  4NEZ A;  2HHH J;  1HNZ J;  1N34 J;  1XNQ J;  4AQY J;  4DR4 J;  2ZM6 J;  2UUC J;  5IT9 U;  5LMU J;  4DV3 J;  4LF8 J;  5BR8 J;  1XMO J;  1I94 J;  4JI1 J;  4JI5 J;  4DV7 J;  4DUY J;  2E5L J;  4JYA J;  3R2D J;  4JI0 J;  4JI3 J;  1IBL J;  4JI8 J;  3J81 U;  4LF7 J;  4HHU A;  1HNW J;  4DR1 J;  4DV1 J;  5LM7 E;  2MEW A;  5A2Q U;  3D3B J;  1IBK J;  4JI4 J;  2VQE J;  4DV5 J;  4JI7 J;  4LF4 J;  4GKK J;  5AJ3 J;  4DV2 J;  3R2C J;  4DR2 J;  4RJV A;  4DV4 J;  2MQ8 A;  4V1A k;  1XMQ J;  5FLX U;  4JV5 J;  1IBM J;  4X62 J;  3JAM U;  4B3R J;  4KYZ A;  4X65 J;  4PWW A;  1FJG J;  2UXD J;  3D3C J;  4JI6 J;  4LF9 J;  4YY3 J;  1N32 J;  2UUB J;  4X66 J;  4B3M J;  1HNX J;  4X64 J;  4DV0 J;  2KVQ E;  4KY3 A;  4K0K J;  2KL8 A;  3J80 U;  4NXN J;  4DR5 J;  4LFB J;  3J7A N;  2UU9 J;  3T1H J;  4JI2 J;  4DR3 J;  3W1Y C;  5IWA J;  4YHH J;  2VQF J;  2UXB J;  5LMN J;  4KHP J;  4DUZ J;  2UUA J;  4DR6 J;  4LF5 J;  4B3S J;  4DV6 J;  3OTO J;  2MTL A;  4LFC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...