4KY3A

Three-dimensional structure of the orthorhombic crystal of computationally designed insertion domain , northeast structural genomics consortium (nesg) target or327
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARSSKEAYKFLAILAKVFAELGYNDINRKMTVRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEITITGVPRQVLEELAKEAERLAKEFNITITITVTVEGQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords designed protein OR327
publication title Precise assembly of complex beta sheet topologies from de novo designed building blocks.
pubmed doi rcsb
source organism Synthetic construct
total genus 40
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ky3A00
4X64J 4JI0J 5AJ3J 4DV0J 3T1YJ 1HNWJ 1IBKJ 3R2CJ 4LF8J 1HR0J 2UU9J 4X62J 4JI2J 2KL8A 1J5EJ 4JI8J 4DUZJ 1XMQJ 1N34J 5LM7E 2UXCJ 4LFAJ 3JAMU 4NEZA 3D3BJ 2UXDJ 3J81U 4DV3J 4JI3J 4K0KJ 4OX9J 4KHPJ 4LF5J 2KVQE 4B3TJ 4JI1J 1IBMJ 1HNZJ 4HHUA 2VQFJ 2MTLA 4DV6J 4B3SJ 4YY3J 5A2QU 5FLXU 2UUAJ 4LF6J 4JI6J 1FJGJ 1N36J 1N33J 4X65J 2MEWA 4DR3J 4KYZA 3J80U 1IBLJ 4NEYA 4DV2J 4DV4J 4NXNJ 4JV5J 4DUYJ 4AQYJ 4GKJJ 2MQ8A 2UUBJ 1N32J 1HNXJ 4X66J 4LF9J 5IWAJ 4DR4J 4DR7J 2UUCJ 1XNQJ 4B3MJ 4LFCJ 1XMOJ 4DV5J 4JI7J 4JYAJ 5IT9U 3T1HJ 3J7AN 4LF7J 4B3RJ 1I94J 3IMQJ 4DR1J 4V1Ak 5BR8J 5LMUJ 4KY3A 4LFBJ 4DR5J 4GKKJ 4PWWA 2E5LJ 4DR2J 4JI5J 4DV7J 4DV1J 4JI4J 4YHHJ 4RJVA 3R2DJ 5LMNJ 2HHHJ 3OTOJ 1XNRJ 2VQEJ 2F4VJ 2ZM6J 2UXBJ 4LF4J 4NXMJ 4DR6J 3D3CJ 3W1YC
chains in the Genus database with same CATH superfamily
1HBOB 2CJQA 5LSLA 2M9KA 5CD4H 2XMTA 1NB2A 1FKPA 2WBMA 1YX2A 2O1PA 2FHKA 2QO3A 2UXCJ 2RB7A 3Q2SC 2HKEA 3QMQA 5KOWA 3CO0P 4QJVA 4R0EA 1FKAF 1XR6A 1P9QC 3OFFA 4HDGA 3M9NB 2FJEB 2RQCA 1M5KC 2X7IA 1UWBB 1U09A 4CI0B 1FXRA 3C16A 1VRUA 3BR9A 3MMCB 3DGVA 5E3CA 2O01C 1WC3A 1VBKA 2UXBF 2HZCA 2YNIB 2UUBJ 3IA0A 3PV8A 1RAAB 1LWCB 5GMDA 2IIHA 2FHOB 4Q0BB 3BKFA 3IGNA 2OPPA 5AXKA 1RGVA 3MPWA 3WZ0A 3R97A 3CJ4A 1G4CA 6FDRA 1M5SA 2MHNA 4YHHJ 3DRPB 2LQBA 1D1UA 1T03B 1Q1KA 3T9ZA 2ZHBA 1O5JA 2FJDB 1PIEA 1C1BA 1DY3A 2VODA 1RADB 2D9PA 2Y3YA 2Z58B 2BOAA 2ZE2B 3OSNA 2OP5A 4F67A 2VJUA 2HBRB 1BWEA 1U0SA 3U7JA 3B8HA 4WE1B 4LBIA 4B3TJ 1VQ5S 1KKHA 1HA1A 3MEEA 3OTOF 4FXWA 1P1LA 1EETB 3Q22A 2CNLB 3IRXA 1RWPB 2L9NA 2D3UA 1KP6A 4PYAA 1PKUA 4TU7A 1U6FA 1X4CA 3FK4A 3R5DA 4HHHA 3MM6A 1BHNA 2OEJA 2G2OA 2QV6A 2V50A 2IM1A 1FFSB 5KTQA 5G0RA 3GJQB 2F8EX 3MAAA 4RW8A 2J9DA 3FMBA 4HL9A 4DR6J 1L3SA 4V19J 1HBUB 4X4TA 3P8BB 1BC6A 5C42A 1TFYA 5EDWA 3GIJA 3I9ZA 4TU8A 2QA1A 1S6QB 3KJQB 3OHBA 1T05A 1S76D 4YEAA 3O3LA 3M4XA 3BQ2A 4W90B 2E5LF 2LDYA 4QOTA 4ZP6A 2YKNA 1S4FA 1NDLA 2QN6B 1IKVB 4LJMA 3DHWC 2AHOB 5DQHA 3E01B 4M5HA 2X1BA 4KR0B 4ZPAA 3P96A 5D8HB 3ZZRA 3P45B 1MLAA 3EUNA 4B3MJ 3K5MA 2HGNA 2BR0A 3FBCA 1MWZA 4BC7A 3GIKA 1X4DA 4F8RA 2QLFB 3MMJA 4B9LA 3BGOP 3R2DJ 1XNRJ 4I6AA 4MK7A 8RUCA 1TKDA 1WNEA 1H7XA 2Z2YB 4YB7A 4P2MA 2B3TB 3SYZA 1DBDA 2ZD1B 1VLYA 3NS5A 3DLHA 3MEGA 1FESA 4Z7YA 2WHOA 2BA9A 5GADI 2VFSA 3GSIA 3HVTB 4OZ3A 5HP1A 3KLFA 3PEJA 4FPIA 1SJFA 1U0HB 3CDUA 1FK9A 2BBEA 3CJ3A 2BOPA 3P3DA 4ECTA 4A47A 2DGVA 4MH8A 3WX8A 2LVWA 4NLPA 4QPTA 4CYUA 1U1NA 2ALYB 4QWDA 2IC3B 1M5VC 3JQJA 1NK4A 4W92B 4WTYA 4DCPB 2J9CA 1KVKA 4I68A 3DYAB 1FA0A 1RHRB 3ZXWA 3CCTA 4J9SA 1OQ3A 3ET6B 1Q8LA 1FNOA 4R5PB 2OSRA 5F3TA 3GPAA 2OGUA 3SQOP 4X4SA 5J1EA 3C15B 4EFAC 4PPDA 3GYXB 2Q1LA 1VQ6S 1UVNA 1KS2A 4K5SA 3UDLA 5DRKA 3FCWA 5DZ7A 2XCPA 3BSNA 4HACA 4FVCA 2EG2A 4A8YA 1NZAA 2MGZB 1RDRA 3CF5Q 2AW0A 4ZHRA 4KHPJ 2XMVA 2VUGA 3K5OA 1IBKF 3UVJB 3BV8A 3OBIA 3EGWB 4V19X 3A3OB 1RT1B 4OHZA 1OY9A 1QUPA 2AJ0A 4WFBQ 1UEKA 4IFVB 2QSWA 3PTWA 1Y11A 3N9UC 4XPCA 1N32J 3KG1A 2E7XA 2GS8A 3C19A 5HVGA 4PG6A 5ETRA 1X4AA 4V1Ak 1GMUA 2H65B 5I3QA 4MFBA 3EYZA 2QLWA 3HJVA 2DIUA 3NNHA 2ZDOA 1FJCA 4RW7A 2PEBA 2HMIB 3K89A 1RXOB 3MECB 4DFKA 4I1TA 4PUOB 1KONA 4X65F 3KFWX 2QLJB 1VC0A 4RNNA 4LF8J 3CD5A 1DRZA 1J5EJ 2Y0SD 4HT5A 3KLVA 3FBEA 4C97A 3H59A 3J81U 1X31C 1RHMB 3SCIE 4H4OA 2MYFA 4H4KC 3NNAA 3W9IA 3U02A 2UP1A 1TL7B 3MEDB 5HAOA 4DZDA 3CIZA 3FVYA 1VQMS 4DR3J 3MDFA 4C8MA 1W2IA 1T3OA 3CNQP 3JSRA 1EP4B 1GNKA 1DARA 4ED8A 4USJC 1VMBA 4L73A 3NWGA 3W8PA 4A8KA 3D7SB 3QJJA 4WKRA 1REVA 5ITHA 1BQMB 1KWMA 3P4UB 4LSLB 3KG4A 4F4KA 3HF5A 1RT2B 3QLHB 1RYSA 3D1HA 1AROP 1H74A 2W7PA 4Y6IA 4RJVA 1JX4A 2UVVA 3E3XA 3SSRA 3SCKE 3I5AA 3DM2B 1TTHB 1SKSA 2E5HA 1RWMB 3MGJA 2W4DA 1H6KX 3EDQB 5D4OA 2WVBA 1W2BR 2QA4S 3SEOA 1HBOA 1JNRB 3SCJE 4K5RA 2Q6CA 2MQNA 2XY6A 4L3NA 3NNCA 2RRBA 4J37A 3CUNA 3N0VA 4LRCA 1HR0F 2MSTA 1X4GA 1RHKB 3FJ2A 5MAOA 4M5MA 5JVGQ 2ACYA 3EJMA 3K7RA 3NOCA 1UTAA 3MMCA 2LQJA 2N3LA 2CQPA 3JQMA 2YNIA 2G0IA 2ZNZA 5F8MA 1LWCA 5H9EJ 1Q8BA 1N34F 5EUHA 4Q0BA 5A6WA 3CEDA 3M8SA 3KMSA 4C3KA 2XO7A 4QIVA 1S1XB 2QG9B 1D0EA 1NJYA 3GU0A 4DV6F 3H2VE 4P73A 5CA5A 3OVSA 3DRPA 3I96A 4CZCA 3GP9A 4FKXA 1LWEB 2WW4A 2EK6A 1T03A 3DI6B 4RZRA 2G2YA 3UD4P 1SC6A 4I2PB 1RLDA 2APOA 3CC2S 4F4AA 3RB0A 4DDFA 3D67A 2YWFA 3JQKA 2ZE2A 3O8WA 1H2VZ 1WOOA 3IR5B 1N36J 4WE1A 2DGWA 1LOUA 4RW4B 3GFZA 4ECXA 1FX4A 1GXLA 3MWBA 3OL8A 2CPEA 4F4XA 1S49A 1EETA 1RABB 3RU0A 4JI1F 3AODA 2HS4A 2MKYA 5KFNA 3PVXA 2BMBA 2GQCA 4P2XA 4NOHA 1I5OB 4K7QA 3HZGA 3FDSA 2C3YA 2RU9A 1NM2A 5K8MA 2UVWA 2I5JB 1SJQA 4HHJA 4ED1A 2HHSA 4QU6A 3TEHB 1RCOB 1PAUB 3R7SB 4OI1A 2YX7A 3R2CJ 2Q66A 2CQBA 2KVIA 5LXYA 1N8RT 1HBUA 4HTJA 2E5JA 4B9UA 4QZVB 5LM7E 3LP2B 2FJBB 1Q7YT 6AT1B 5FJ4A 2Y1LB 1T95A 5FDLB 4BS2A 1NEEA 3M8PB 1S6QA 4PKDB 1RCXB 2HBYB 2CQ4A 1KLMA 2DR6A 4DPWA 3TVKA 1R8BA 4LF6J 4C98A 1Q8KA 1RTHB 4LF4F 3RB6A 9ATCB 1IKVA 4YS2A 3E01A 1CULB 1KC8T 5I4MA 2CZVC 2GW8A 1Y4ZB 4JI7J 2HZAA 4OYBA 3SV4A 3IWLA 4DQIA 3ILJA 2B56A 4DSJA 3OR2B 3N5FA 1S0NA 2GVZB 1K1QA 4X4OA 1DURA 4NXMJ 1FRLA 1MSWD 3BDEA 4IOBA 3UN5A 4ZJOA 3W64A 2GQ2A 4DUYF 1NJIT 2UUCF 2MLXA 2ZD1A 2JH3A 2E7WA 4ECVA 2Z0GA 3HVTA 2YWEA 2FVPA 2ZH7A 2VU5A 4B9SA 4J7CA 1NSQA 1U0HA 2QX0A 1LWFB 4ECYA 1L3UA 1JXEA 1REGX 4KGXB 4L75A 2V68A 3H0PA 1FJGJ 4ZVEA 5AT1B 4N41A 2AEFA 4IDKB 1FXLA 3M8YA 2R2SA 1JLCB 2QZ8A 2CQ3A 2IC3A 4B3RJ 3MR5A 1UEVA 2U1AA 2Q43A 4ZVQB 5IT0A 5CD4A 2DK2A 4NI2B 4CH1A 4FNIA 3HKZD 3DYAA 4WIQA 1KHVA 1VC5A 4J9RA 4EUVA 2CQ2A 4X4UA 5HK4A 4DPYA 2MXYA 4C2MA 2H5JB 3A8JA 3UFCX 3GB0A 2WB4A 3ZO7A 1MW7A 3C15A 3TX0A 3UPFA 3H4BA 3R3TA 2NQPA 1P9YA 2X1AA 1SJ1A 1CEZA 4CLLA 2IDEA 1U1PA 4AXJA 4LSNB 2DXDA 3VZIA 2NXUA 2MGZA 4JP8A 4EZ6A 3AA9A 2MTLA 3BN4A 4UT4A 4IQXA 4FVMA 3FMWA 2VPZB 3M8QB 2DNOA 2L3MA 5D0RA 3UVJA 4CCHA 1Y7PA 1RT1A 4JI0F 2Z4PA 4U9RA 4IFVA 1DQAA 3V6JA 3TR5A 1CJTB 4LRAA 5EX0A 5BR8J 2JEGA 5AE1A 5K8PA 4ITSA 4H4MB 4A8OA 1JIHA 2E9RX 4H54A 3MPVA 4DL0C 1OMSA 3MPUB 4W4MA 2GGPB 2QMWA 4ED2A 3G82B 2W7OA 3NXZA 4N47A 5KFEA 2YBVA 1I94F 4LR7A 4FN5A 3Q8PB 3S1TA 2HMIA 3H98A 1BQNB 4ETZA 3MECA 3ILOA 4PUOA 4K4UA 1NPRA 3BYRA 3F41A 5C24B 5KFQA 4CH7A 2FGOA 2V5HG 2JHEA 1I1GA 5CYJA 1SB6A 5HVHA 5KG1A 4ZCMA 2Y1IA 4OZJA 3S6EA 4EO6A 2VD3A 4MIWA 3LPEA 2QMUB 1TL7A 2VQEF 2ASYA 4U95A 2XG8A 3MEDA 4GKJJ 2ZC3A 4LF9J 2DGXA 2Z8QA 5DDOC 1UFLA 2AGOA 4USKA 2E44A 1EP4A 2DR8A 2BEFA 3LWMA 1AXQA 1AYEA 2ZVSA 4G6VB 5IV4A 2KH9A 2DNHA 3JXOA 3D6MB 2EFQA 5GAEU 1KD1T 4AQYF 1BQMA 4LSLA 4K59A 2ZVIA 3N28A 1RT2A 3X3UA 3QLHA 3C2PA 2A6MA 4OI0A 4X64J 4DQQA 1KR4A 2MKCA 5EN1A 2FTRA 4DEZA 3DM2A 1WF1A 4USIA 5K14B 1UL3A 2ZNYA 5KFWA 2XMWA 3UCGA 2XWXA 3BPSP 4DV5F 3C3LA 5L8RC 1VFJA 2G9OA 1M90T 2GMHA 1S10A 5CCMA 1KQFB 1FVQA 5LL6d 4DSIA 1RZMA 4OV1A 4FPRA 4LRFA 2XWYA 2HS0A 2AGPA 3EZOA 3OLAA 1VIOA 3OTDA 2RD5C 4DFJA 3QJLA 5DLFA 4TLQA 2OHDA 3N6NA 2GJIA 1GMVA 4RW9B 2ZH5A 2JLFA 5IT9Y 4U6PA 3KYLA 4KHMA 5D78A 1X5PA 3J81j 1B70B 4EO8A 3MFHA 4J9UE 4Q44A 4FS2A 3OXLA 1S1XA 1HARA 3EZ5A 1LWEA 2H5EA 2YQ3A 1S9EB 2BKPA 4Y2KA 2G13A 1H7WA 3DI6A 4WK1A 4I2PA 1YJ9S 3T6JA 2Z30B 5CYQB 5U47A 1DQ9A 2JX2A 2IA0A 1V5VA 4DOZA 2DHAA 5BYQA 3KLIB 4DR7J 3MPDA 4MJKA 4RW4A 2DGQA 2XO6A 2R9LA 3Q0AA 3M2VB 3RW7A 5JXSA 5KT7A 2JC0A 4ZVUB 2OIHA 4PRFA 4NLOA 4NASA 5LMNJ 3NMAA 2FVSA 3NG8A 2FIUA 4GC6A 2F8HA 1R8CA 4DL4A 2JLGA 2F1FA 3P5BP 3GIMA 5CXTA 3BZQA 1Y5NB 4YB6A 1NK9A 4WP3A 4JI2J 1URNA 1NSKL 1GMWD 1S0OA 3C8YA 2ASJA 4LFAJ 2Y8YA 4ZA1A 1QDUB 3PO5A 3LP2A 2DNYA 3EWGA 2YXLA 5FDLA 3I5BA 3QT6A 3FEZA 4P7TA 3M8PA 3L7PA 2CQIA 5KFOA 1IR1A 3OTCA 1HI8A 3AA8A 2W9BB 1BLUA 1JLGB 1WUUA 4ES2A 2EBEA 3PM9A 5J2QB 5A76A 1RTHA 3T1YF 2QL9B 1TL3B 2RU3A 3OJUA 1CULA 1UZHA 3W2VB 1UW9A 4OHXA 1JMTA 1TR0A 4FYWB 4X2BA 2V8HA 1KEKA 1XC9A 3OD2A 4NLWA 3Q8UA 4DV1J 1WKLA 2CZ4A 2MJNA 5T14A 1O51A 1AUSL 5HN0A 3OR2A 2GVZA 1DAXA 4M63A 3R7NB 5T7LB 5J2PB 2AJ2A 1WC0A 3LUYA 3KHGA 1NKCA 1VHFA 1SIWB 3NOGA 3FGVA 9RUBA 3CGIA 5J1NA 2XMAA 4JYAF 1C0TB 3PYFA 4A46A 4PCQA 2OPQB 4DR1F 3OW2R 3KOAA 3VQSA 3CJRA 2YKMB 2ZOGA 4YY3J 2Y8WA 5A2QU 3N6MA 4HVZA 1F5CA 2XNQA 2MEWA 2FQQB 2LMIA 3KLHB 3FEXB 5K8OA 1LWFA 1Q16B 1NHUA 3T5JA 3ZC4A 5KFDA 2MZSA 2YNHB 3R1HA 4IDKA 1N6QB 2KDOA 1JLCA 1VRTB 1FDDA 1YBTA 1G3OA 3PFEA 2QYGA 5IQ6A 3NGTA 5KOXA 3ZZZA 4PQUB 2C2OB 1KFSA 4ZCLA 3K8WA 4NI2A 2CVIA 3SDEB 1A7GE 3HO1A 3CCSS 1SJ4P 2GC8A 5HLFB 2CA9A 3PX6A 3A8EA 4I6YA 5K8NA 1XIQA 1RTIB 2IBOA 4DV2F 2KT2A 2BANB 4WP8A 4QR0A 2ZOFA 2HK2A 1HWUA 1ZOTA 2RS2A 3I9V9 1TVRB 3QSIA 2KN4A 1R6VA 4LSNA 4B3SJ 4OZ2A 3B82A 2HVDA 2R7VA 2D74B 3H20A 3R5JB 1N48A 4DG1B 5J2NB 2HHWA 3C66A 3GFYA 4Z7CA 2GIQA 3M8QA 2OKQA 2ZH1A 1X9WA 3HT3A 1U1LA 2FY8A 2R7QA 5E3RA 2C3UA 2PD1A 5A8KB 4P71A 2ATCB 5KAKA 1IJEB 3MEKA 3VR1A 2V8VA 2M2BA 1TAUA 2UXCF 5KG6A 2R8GA 2YWGA 3NGUA 1B3TA 1RA6A 2D7SA 2W2PP 2NXEA 1CJTA 4DV7J 1WDDA 2DB1A 3TNVA 3GJSB 1U02A 4H4MA 4K8RA 2C42A 2B9EA 2W4PA 2NUUG 2IRYA 2KB2A 1OPIA 5DDRC 5F8LA 1FTCA 2GJFA 2VBWA 1LV5A 2GGPA 3G82A 3U1MA 3OL7A 2J9EA 3HULA 4ED0A 4U7UD 4Y3CA 3MM7B 3DC2A 2KKHA 2UUBF 1YJVA 2ZFHA 1GFWB 4IRDA 4OYAA 4F4ZA 3KJNB 2MKJA 1BQNA 3MD1A 2AJ1A 3HHKA 3GG1A 2XHCA 3H90A 2HWHA 2XS2A 5C24A 2KT5A 4OX7A 4YHHF 2YKAA 4P7VA 4WU2A 4JI6J 1FE0A 2X1FA 1LWXA 3AOCA 2F9DA 4OMFG 3HSJA 2BQRA 5F3ZA 4CNZA 1FFGB 2GO8A 4HH0A 1KVIA 2V34A 3LGHA 1M5PC 1WC6A 2OAUA 3O1LA 1H2UX 4LF1A 4KY3A 1N5YB 2EG1A 2JVOA 4CWBA 1FRMA 3MCMA 1YLXA 2H54B 2YY3A 2ASLA 1XK8A 2FUG9 2QE5A 1UP1A 2AYGA 4UOCA 4Q2MA 1UA1A 4DX5A 3WDOA 2BRKA 3KJFB 3ENAA 4B3TF 3R5AA 5IFMA 5J2MB 1RT3B 3IM9A 1OYEA 2YNFB 5C7PA 1U1QA 1TKXB 1XMBA 2ERRA 3L95X 1S9GB 4CT8A 4CIOA 4NLDA 3IRWP 1MNEA 2FC8A 2BM0A 2LQ5A 3MOZA 2W8LA 4Y00A 1U6BA 3PIOQ 2JNJA 5K14A 3T5LA 3D2WA 2UVUA 4DF4A 2IY5B 1WDTA 2NXCA 1U26A 2HNZB 4UY8T 3CO9A 2WBRA 1R27B 4ZVRB 2UZAA 2DJWA 2Q3PA 1RAJA 2CPJA 4WFNQ 3KUGA 1NDKA 1MWYA 4W98A 4DR6F 4PABA 2V2ZA 3BM7A 5H9EK 2J76E 3PG9A 2NSCA 1S5ZA 1KQKA 4DPUA 3J7AN 3JTPA 1K0TA 3V2UC 4C8NA 2GMLA 3CMQA 3ZZPA 4GRSA 3W62A 5D6GA 2KXNB 2MB0B 4X4QA 4QCLA 2AF6A 2DEJA 2N7CA 1FO1A 2EKNA 1RUSA 4KPYA 4JBCA 4RW9A 3HD2A 4Q8FA 2MY7A 3TA2A 1PAEX 1RE1B 5EX3A 3K57A 3PRDA 5EWGA 1S97A 2XYGB 3VAKA 2DHXA 3ENQA 1PGZA 3A3NB 4B3MF 2C28A 1HWJA 2ILYA 4ANEA 1SQFA 3PZPA 1VK3A 2CDQA 1Q82T 2JWNA 4EZ9A 1S9EA 4USTA 3TA0A 3GV8B 4PG5A 1HL6A 1JJCB 2CQ1A 2XBPA 1HHQA 1SKUB 1XNRF 1TAQA 5CYQA 4TYAA 3CPWR 2W2NP 4CP5A 3BKUA 4LFCJ 1XMOJ 4WWSA 3KLIA 4USMA 4FXDA 3EZUA 2O5DA 1WELA 4DU8A 3O5TB 1YKWA 3M1VB 3CJKB 4ID5B 2R7UA 4JV1A 3M2VA 2LLZA 2ZH8A 4YQWA 3QT5A 3LP1B 4ZPCA 1QLNA 1IKWB 3PJXA 3T3FA 4LRBA 2CPXA 4EBCA 2NREA 2A18A 4EI2A 3POTB 3MMBB 3RRKA 3GJTB 3P49B 2JFDA 4PAAA 3PHTA 4DV0J 1T94A 2HHTA 3A12A 1FD8A 1PBAA 4X62J 4PXBA 5KFSA 4OLOA 4XTTA 5CHCB 2VF3A 3FSIA 2XC9A 5DG8A 4RW6B 2PMHA 1KOHA 2VFUA 3UW1A 3D9BA 2LA4A 1B0PA 3AOAA 1IWAA 1SH0A 4NYPA 3PCOB 2G1HA 5DZ6A 1EQMA 3W8GA 4JB8B 1D9FA 4KO0B 2BZ2A 2HHQA 1FNXH 2ZZTA 1R6YA 1VYAA 4PG4A 2FLNA 1GX5A 3DHXA 3S01A 3OFGA 4C0OC 4C3MA 3J7YU 3IXQA 1VQ4S 4OJ3A 2W9BA 1CQMA 1JLGA 2K7JA 3Q2TC 4OI3A 5C25B 2J7KA 5J2QA 3MPYA 2XMJA 3GILA 3CSKA 3FCHA 3KMQA 2BJ1A 4ZPTR 2NSBA 1TL3A 2DYAA 3FNNA 3HHEA 2BYCA 3W2VA 4ZJQA 2VV5A 3HMJG 4KHPF 1S57A 1T8EA 3LO3A 2XLIA 4ZVPB 2E5IA 4E2FB 4OI2A 3BR8A 1N32F 4YB1P 5T7LA 2H9ZA 5J2PA 2R2UA 3WC2A 2OPPB 3AD9C 4EMDA 4XK8C 3FKBA 1GMWA 1C0TA 2OPQA 3ILLA 3M6XA 4U96A 5EWEA 5DQIA 2L9DA 4NEYA 2R2TA 2YKMA 3RAQA 1HNXJ 1IBCB 2FJVA 1T9YA 2H4WB 2AJFE 2FZCB 3MTKA 3KLHA 3P5TL 2CG4A 4LF8F 4CO1A 3IMQJ 1J5EF 4LIWA 2HG4A 4DPTA 2YNHA 2CJ9A 1N6QA 4L76A 1VR6A 1VRTA 2G1DA 3D54A 4USUA 2RUSA 3KNGA 4XAKA 4CQ1A 2VPWB 5ETMA 2RKIA 4RNMA 4K2JA 4PQUA 3LA0A 2VA2A 4F0KA 3G4SS 3M6UA 2KG0A 1U2FA 5K5MA 3TJ9A 2F5GA 1DTQB 2CVEA 4DPOA 4DR3F 2I2YA 3SDEA 5HMXA 2OD6A 2UU9J 2DTJA 5HLFA 1RTJB 2UV8A 3GTYX 2OD4A 1RTIA 4LT6A 1QUVA 2FJAB 1PO6A 4I7FB 2AX1A 1WC4A 2WW8A 4HH1A 5JUMA 1PSDA 4MKVA 2J0XA 2GAGC 1WG4A 2JRSA 3PYDA 5GMEA 4TY8B 1WHVA 2NPIA 1TVRA 4M5GA 2B4PA 2YX1A 4ZN1A 1XNQJ 2M88A 3TVYA 5THWA 2ZH4A 3V4MA 1APSA 2CIMA 4DG1A 4QIEA 3H5XA 3WQPA 2BX6A 3J80Y 3I55S 4LFBJ 4DR5J 5A8KA 2GO9A 2LEBA 2NXNA 5ETPA 3LF0A 3PYEA 1C4CA 4HDHA 1T7PA 3ZTPA 1NMEB 2XY7A 4WCEQ 4NRTA 2HBQB 1JK9B 4IFYB 2ZITA 4C8YA 1RAEB 1BMQB 3SV3A 1F60B 4WJBA 1Y0HA 1YJRA 5KG3A 2BV3A 1HW8A 1FWPA 1SJRA 3OHAA 3GYNA 1TUWA 2FDNA 4FYVB 1R89A 2HQFA 3MM7A 4UOGA 5M2PA 3DLEB 3G8SA 3IAM9 1RAOA 4DL3A 3ISZA 4OQJA 3CJSA 2WTFA 5D4LA 5F9NA 2ALZA 1HQ2A 2K3IA 1WHWA 1L5UA 3PRVA 5C5JA 1HWIA 5DM6Q 2HLUA 5HJXA 1B4SA 3QGIA 1NH7A 1QAJA 1IQZA 2R7TA 4OIXA 2WOMB 4ES1A 2HIQA 1N5YA 1R43A 4RWXA 4LBHA 5F8NA 1SQGA 2A2DA 1N36F 1W26A 4QIGA 5J2MA 1BGXT 1RT3A 1TV6B 1YJNS 3WIUA 2R42A 4DFMA 3I6PA 2YNFA 1TKXA 4U7CA 4R0JA 1TL1B 2H3EB 1S9GA 3VGTA 1Y3KA 2BJ8A 4LF5J 3MR2A 2HK3A 3CTRA 3CJ5A 4C8ZA 1FXDA 4Z37A 2CQCA 3QFHA 2ZOMA 2FPHX 3LTOA 1UZDA 2OELA 4ILRA 5M2RA 3TZWA 3PX4A 1YZ6A 1YJWS 2HQDA 1NDPA 4JUZA 3AD7C 1KVJA 3VTIA 2GVDB 3AXKA 4ED5A 4PWWA 1NHVA 2DD8S 3RTVA 3QGHA 1MMNA 5KFZA 3T1AA 2D3O1 2D3OR 1IXKA 2DH9A 1M5HA 4TU9A 2EFPA 2V63A 1D9DA 1WTFA 1CBKA 2VC0A 1Y5LB 4L3KA 4LF6F 1U24A 2HNYB 1S4EA 1QAYA 4ECSA 4YDDB 3PDNA 1IBKJ 4WU3A 5D0EA 2WVEA 4AL6A 5HSPA 2K1RB 3GONA 2FY1A 2E1RA 1YWXA 3C6TB 1R0BG 3HM9A 3ILIA 1VQYA 2NZ4A 1UETA 2HYIB 3H4DA 3KUHA 1BQXA 3BS9A 1X9SA 5B0DA 4RLEA 4KGVB 3ISND 4QW8A 2DPJA 2DGUA 5HROB 1UJ4A 2DXFA 2ACMA 2PO4A 2JL9A 4NXMF 3EVMA 2K2PA 3HLUA 5IOLA 1LXNA 5I42B 4G1PA 5F8GA 3AD8C 1Y10A 2VBZA 4BWJA 5KFGA 4ZDNA 4CLFA 2X1GA 2RF2B 4GO5X 2HRUA 5AE3A 4GVBB 2QRRA 1HNVB 2DNPA 4P52A 2V4QA 2DT9A 4N76A 4KE5A 3VCDA 4D3HA 4F3MA 4ZMMA 5FIIA 4NLQA 3CE8A 4QBUA 3M1VA 3CJKA 4ID5A 4RNFA 2WCXA 3M7VA 4TLRA 3LP1A 1IKWA 1FJGF 3E51A 1AA1B 3POTA 3MMBA 1ZM9A 4P74A 1UPPA 1XMQJ 3K17A 3J7Z5 2HVZA 3SZ2A 4B3RF 1GXTA 4OZ5A 2PA8D 2RJZA 3NCQA 3JTOA 3K5LA 4DL2A 4RW6A 2M3DA 2CPYA 2HQCA 3RZAA 2JEIA 2W8KA 1HPZB 4F50A 2HFSA 3NEKA 1AB8A 2WSCC 4KO0A 5DG7A 2EKYA 3CVKA 2QA4G 5BJRA 4R8UB 1KBRA 3OXGA 2ZWPA 3DNCA 2KXFA 5I3UB 1VC6A 2VA3A 1IR2A 3GV7B 1K73T 1N52B 4URSA 3WBZA 1LNQA 2VG5B 4WIIA 4J9PA 4K4ZA 1T0TV 2IYIA 5C25A 4G1IA 4KH0B 8AT1B 2VPXB 1YRXA 3CULA 3L4BC 1KFDA 2ILZA 2PFDA 3DLGB 2AIRB 4F36A 1GTEA 3QQCD 4TKTA 2ZKTA 1RAFB 4LMZA 5DDQC 5A8RB 1VQKS 2VJVA 2WSFC 1HR0J 4IR1A 5GAHI 4M95A 2HS3A 2OUGA 4KQZA 4NMLA 4KC5A 5BR8F 1KOOA 4X4RA 3HFVA 1LK7A 1SL0A 2CRLA 1N54B 4ILMA 1LFPA 4DHVA 4PXEA 2Z2MA 5L9NA 1QAIA 1T9TA 3IAS9 2BABA 3UCZP 4ZVFA 2C2NA 2DNKA 3FQLA 5KT6A 5F0UA 2DCUB 2VASA 1IQTA 2IA6A 2M70A 2IMOA 4ZVHA 2M52A 3GE9A 3ULHA 2EFNA 3KXDA 3L09A 3RR8A 1TUVA 1U6ZA 2OTJS 1VLOA 5B0GA 1U49A 1RTDB 2F9JA 1CS4B 2JZ5A 1HNWJ 4OYMA 3SCLE 1RU1A 4MYUA 3TJAA 2DNGA 1FDAA 4P75A 2V69A 1DTQA 3D0HE 3UNGC 1CJUB 5CQGA 1G6BA 1DJ0A 4DSKA 2SXLA 2V67A 3BPDA 1RTJA 3OQ2A 2QLXA 4FDFA 2BJ9A 5GAGI 2FD2A 2Z57B 1ZZNA 2HGMA 4CLSA 2DR5A 4JI1J 5KFPA 4HHUA 2RRAA 4I7FA 3AT1B 1SKWA 2DY1A 2H1YA 5BYRA 1NJXA 5KT3A 2HIYA 1TL5A 2F8MA 3KK1B 4X64F 3G8TA 4TY8A 1VISA 2Z56B 4ZPDA 4F2SA 7AT1B 2XZWA 3T1HJ 4FKYA 5FLXY 3Q24A 4QQBA 4DI6A 2VDIA 3DRRA 2CPHA 1D09B 5E3QA 5L1KA 4FXVA 2CADA 4CLPA 4DN0A 3VAIA 3K5PA 1TL4A 3UWTA 1D8ZA 1HIYA 4QR1A 4TQSA 5KT4A 4O3PA 1KLMB 3BBFA 4G1QB 2DGSA 1FJEB 3G6XA 1NU4A 1E6VB 4J90A 2W01A 2A3JA 2BJ3A 4IFYA 2POKA 5B0AA 2BKNA 2HPUA 3OLBA 4NE9C 3D3BJ 4O0IA 3QWPA 4RUHA 3PW2A 5KFUA 4UUXA 1WEXA 5DLGA 4M5LA 1PJ5A 2HQ3A 4K50A 5D4PA 2AEMA 3TEGA 1Q5VA 4ZVSB 3CCLS 3DLEA 3AJ2A 4OZ0A 3JYTB 4OJHA 1U8WA 4U8VA 2I0XA 2ZBPA 4DPXA 1J27A 1IR0A 1NO8A 4F7VA 4RU9A 4IYQA 3CDBA 3H5UA 4DMZA 1S0MA 2DHGA 2PGCA 1XBWA 3RB3A 3R6LB 1RJJA 1F9HA 4WKYA 2R8IA 1I6JA 1JLQB 4A8XA 3G8QA 5KG2A 2FLPA 2B9XA 1ZA1B 3GFHA 4J9MA 4QYRA 2ZM6J 2WOMA 2YKQA 3AHPA 2YVSA 1ELOA 4FYDA 1SVDA 1P6TA 5HVFA 4TXSA 2YNGB 4OJGA 2KL8A 4DR7F 3UDVA 1R7IA 3MM9B 3FFIB 4P9SA 3GR0A 3T5KA 1WWHA 1V6HA 3FSXA 4Y65A 1TV6A 5KFJA 3CMAS 3MZIA 3V5RA 1CJKB 4MIAA 1TL1A 3QRRA 4OZNA 4WYWA 3KK2B 4KTQA 3FQKA 3H40A 2IRUA 2NS1B 5LMNF 3FZBA 4ZCKA 1GXUA 4WBFA 3DLBA 4JV5J 4WFXA 1Z1ZA 1ZM2A 3R27A 3Q83A 4Q8EA 4F4YA 2KT3A 1JLBB 3LWLA 1YI2S 4JI2F 2KRBA 2N4CA 4CLZA 1LQ9A 4KBIA 2OTLS 3B4MA 4WFZA 2GVDA 3W2WB 4K4YA 2XI3A 2CKWA 4KPCA 4NZ7A 5E7OB 5IC6B 1AFIA 3CMES 1DZ5A 1H72C 5AJ3J 2PSZA 1RU2A 2A1BA 3QNWB 1FRKA 3DRYA 3G6VA 2B4OA 5B0EA 4DS5A 1P27B 2LEAA 4MYTA 1NSAA 2HNYA 2ROGA 4RBVA 4ANDA 2BUNA 1AUDA 1RB0A 2WVDA 2P9CA 1JLAB 4OYWA 1F6TA 2K1RA 3TAPA 3NWRA 3BF4A 3S8SA 2V2KA 3C6TA 1U1KA 4RR5A 4J9LA 3FSYA 4DV1F 1N33J 4O3QA 3DMJB 2RQKA 2VKZG 1S1TB 3LQVA 2VOOA 4BCAA 3WX4A 5HROA 1VQ9S 1FERA 2IJNA 3PW7A 1EAYC 1I94J 2B43A 2JFKA 2JVRA 1QM9A 5I42A 1NKEA 1NK6A 2QL7B 2CQGA 3OJSA 3BH6B 4JI5J 1T11A 2RF2A 4PZVA 1V3SA 4GVBA 2HHHJ 3ISNC 4KT0C 1HNVA 2OEKA 4MK9A 2DNMA 2ZBRA 2AZ1A 3SFUA 3RRHA 4ILLA 3BDPA 2L41A 1HWLA 2LXFA 4CO3A 4ED4A 2C2ZB 4NWBA 3EVOA 4DJBA 3CJ0A 3W9HA 5J1PA 3QAUA 3T19A 2V0NA 3BYPA 3JAMY 3GLJA 2PDAA 4NA2A 4KYZA 3HKWA 3LGMA 4AQYJ 4P2SA 2CFXA 1XERA 1HPZA 4I64A 4RBTA 3L9ZA 1VQPS 5F41A 4RNOA 3NY0A 3JSMB 2PA3A 1IJFB 3KJVB 3DN9A 4U8YA 1T9XA 3NAHA 1QJHA 4R8UA 4P10A 2MKIA 1YRUA 2NYHA 2JDJA 5I3UA 2VHGA 3GIRA 2VG5A 3THPA 4F2RA 3TI0A 1FF2A 3BGRA 3QJPA 4ZVTB 2QFJA 4OI6A 4B3SF 3I0RB 5LJ3Y 3DLGA 3DLJA 2MHEA 5CCLA 2C3OA 3HHNB 2PFFB 1OYDA 2PEHA 1RAIB 1YVFA 5A8RA 2GNKA 4NCBA 3PX0A 5ETOA 1VQ8S 2BQ3A 2J7WA 4ZLPA 2DRDA 4A48A 3A8KA 1SIZA 1D3WA 3NBPB 4E8UA 1VRQC 2E66A 4F02A 3QT7A 3BH7B 3KLGA 2RILA 4X4VA 1YJTA 2BRLA 1X4EA 2LQ9A 4ICLB 1HHTP 5DO2A 2BJEA 1WI8A 1Q4RA 3WIVA 1UJ5A 5HMYA 1FDNA 2V94A 3HVAA 2XYPB 4WZMA 4Y2AA 4HLBA 5L9XA 4NYZA 4ZKAA 1X8DA 3NGRA 2FJXA 2HVEA 1H0HB 3JS9A 1X4BA 3MD3A 3V6DB 1MROB 2G2ZA 1OS5A 2N7YA 3WHIA 1XEZA 2W1BA 1OSDA 2MQOA 2E1MC 4JI6F 5AXMA 1JXLA 2W2OP 4TN2A 1RBLA 3DXBA 1RTDA 1CS4A 3PR5B 2E9ZA 2B8PA 3MM8A 4U67Q 5AE2A 3GG0A 2ZBCA 3MCNA 4IQMA 4OX9J 4USHA 3HFZB 2RDDA 1CJUA 3ZZYA 3JSYA 1HNZJ 2RQMA 3GZ7A 1V5IB 2EC0A 5GADU 4IG3B 4UOFA 4X66J 5IWAJ 3KTQA 1RAHB 1LKZA 1UPMB 2HHVA 5IV3A 1Z4UA 2FLOA 3KK1A 2D41A 1SH3A 3OT9A 2QA2A 1RYRA 2NZCA 3DRXA 3TANA 1M1GA 3M9MB 4FBTA 3NCRA 3OR1B 3CD7A 3MMAB 1S6OA 2J0SD 2MKHA 4ETXA 4NLUA 1WTBA 1R0CB 5KFIA 4QPXA 4KH1B 3EXCX 4NRUA 4FF4A 3MXHP 5L39A 4G1QA 2LQ8A 2QGFB 4MKYA 4NLVA 4DUZJ 3GQCA 6FD1A 8ATCB 2C2DA 3B78A 4KIAA 1E6VA 2AZ3A 4EYHB 3VF0B 4O4GB 5DETA 2HRYA 2IYGA 2E1AA 3HD1A 2VQFJ 1TUGB 1G7CB 1MU2B 5BXIA 2IHR1 4FF1A 4IKAA 4IG0B 1NK8A 3RRGA 2MDAA 1ZPVA 3D0IE 4BLGA 3O6QA 4KFBB 2A10A 2PE8A 1Y9OA 3JYTA 4NZ6A 3DOKB 2AX0A 1OJ4A 2R8JA 1S79A 2N4DA 3QRPA 2B51A 2O66A 2BDPA 1UCNA 1ZTWA 2DY9A 2M5YA 4ENOA 1U48A 5D77A 1RT6B 2X3GA 1SC4B 4A8FA 1JLQA 1UVKA 2B4UA 5D0GA 4WYLA 2HHUA 4KV8B 2XLKA 2KYZA 1OY8A 4WF9Q 2FHJA 2A2CA 2HQIA 1UVIA 2GX8A 4BC9A 4R25A 1VCTA 4N8OA 3MTJA 4NZ0A 4RNHA 1RKJA 2QTWA 4LFCF 1XMOF 1X5TA 3ETOA 2X3DA 4N5SA 1SKRA 2YNGA 2XHWA 4UTGA 2JSXA 3K0JA 4K0KJ 3MM9A 4NYOA 3FFIA 3ZFVA 4IH5A 5B0BA 1HHSA 1LW2B 2I6WA 2DXEA 3I4HX 3W66A 1JJ2R 5B0FA 1XJWB 5IS2A 1CJKA 1FNMA 1OSCA 3KK2A 1FKOB 4QR2A 4RPFA 2ADBA 4DV0F 1TMJA 3H8YA 3T9NA 4X62F 3U1NA 1Q86T 3RAXA 3FRZA 4M94A 1JLBA 3TQ1A 4DQRA 4NXNF 1GAOA 3D1OA 4OJ1A 1PCAA 3DDNA 5SZTA 1U45A 1C0UB 5DGAA 3W2WA 3RB4A 2HLTA 4I0WA 3HJFA 1UW4A 4DU7A 5KFLA 3TWZA 2AJQA 3GCXP 1X0FA 2R7XA 4AE5A 2GCFA 2DKOB 2P2CB 4AXIA 4UQTA 2VC1A 2FGCA 4LSZB 5EGYA 3ZTRA 1JLAA 3OPKA 2Y9HA 4DL7A 1NPKA 3LALA 1DTTB 1WC5A 4KGMA 2MQMA 2ZJQQ 1Y00A 1IBLJ 4JV0A 1RT4B 4RUAA 4NCAA 3BB5A 4URQU 1K9MT 2UXDF 2MKSA 1NK7A 3UI3A 1LK5A 3DMJA 1ZA2B 1JJ4A 3ZTOA 5JMNA 5IT9U 3GCWP 1S1TA 3EPIA 3TUPA 5LMUJ 2CJXB 3TP2A 2DNRA 3C46A 3HP6A 1T02A 4AD6A 3SSQA 3VAJA 2XGPA 1OWXA 3TVZA 2PI4A 3R6GB 4K4VA 3DOLB 4DL6A 1Q81T 1UVMA 1AZSB 3HK2A 1YQHA 3GSDA 3L7OA 1VBYA 3B6BA 3VAMA 4OV6A 1HNXF 4BBYA 1C4AA 4J5OA 2BE7D 4F26A 2VPYB 3CD0A 1RK8A 4EGLA 2F63A 2YH0A 3PW5A 2CPZA 1EHWA 1L3KA 1JKHB 4DL5A 3GIIA 4IO1A 4FBUA 2LU2A 1YSJA 1ULRA 4GO7X 3MOJB 4FNHA 3Q86A 3DDIA 1QVFR 2IVMA 3CC7S 1OQ6A 4XDCA 3M8WA 1VQNS 1WEZA 4CLTA 4OL8A 3BO2A 3VVTA 2UU9F 2ROEA 1RI7A 3A1YG 1U7LA 3JSMA 3KJVA 4I4BA 4B9VA 1WG1A 4G65A 2IRXA 1U1RA 2DNQA 4UF4A 3W1YC 2MKKA 4OX6A 3OTEA 2Y1JA 1PJ7A 1FRXA 3F0NA 3I0RA 1XNQF 3QRQA 3UD3P 2R3VA 1BUXA 2BQUA 2Z2ZA 2CNKB 3KDNA 4LFBF 3UO0A 4DR5F 5ETQA 4LQ3A 2R7WA 4A8MP 4O23A 5D0HA 3KK3A 1HMVB 5KFBA 4NX9A 3RAMA 1JLFB 3NBPA 1HBNB 3CD6S 3FC9A 2MQ8A 2B9WA 1HWKA 4ICLA 4NL5A 4QWCA 2GHVC 1SJ3P 4ER8A 2KO1A 1J2VA 2HSEB 4PPZA 4C3LA 2V8DA 3EGNA 3MAHA 2XM3A 1B0TA 1HD1A 4DLGA 4TQRA 3H7HB 5L46A 3CDWA 2A6OA 3D3CJ 2MQQA 3V6DA 2L08A 3VGSA 1MROA 3VGUA 3MR7A 4QYZK 3I32A 3QO9A 2EFGA 4DSFA 3MCOA 1SI9A 3MFIA 4ZITA 2R4FA 3QATA 3BBCA 4DSLA 1ZBTA 3G6YA 1QTMA 4C11B 2DO0A 2KVQE 3LOUA 1U47A 2DHSA 3RYLA 2FC9A 3EM1A 2YWWA 1RKIA 4ECZA 1KQGB 3PJ9A 1RP5A 2CDRB 2W2QP 1L3TA 2JOQA 2LYVA 4OYOA 3TJ8A 2QJ3A 1U4BA 3B4DA 4IG3A 4KSEB 4GVLA 2EVZA 4DLEA 2LCWA 5HQLA 5CZXA 1ZAVA 3QYYA 5AXNA 2AYMA 3CCES 2DRBA 1GX6A 1S6PB 2DISA 2DPIA 2FZKB 3UE2A 4LF5F 4DFPA 4QIWD 5HI7A 1NZ8A 4LF2A 4M5IA 2CWKA 1CG2A 2K7KA 3H5SA 4OHWA 2AEJA 1F3VA 3IR7B 3OR1A 4CT9A 4K4SA 3MMAA 2P6SA 2CPIA 2LDIA 4CDIA 3D6TB 3H2UB 5F0WA 3ZNUA 3N79A 4LRDA 1Q95G 3KNAA 1Y5IB 1UFKA 3GV5B 1X60A 3K8VA 3SBMA 4O4GA 4DN9A 1V9OA 4YMEA 5IZHA 3QIDA 2UUAJ 5K9FA 4QIFA 3GJRB 3AJDA 1MU2A 1ZZFA 3L7UA 3PIPQ 3V6HA 2RVJA 4IG0A 3ZTSA 1EKSA 2VBXA 1IM6A 1N56A 3LH2S 1U2CA 4KFBA 1QSSA 2OPRB 1U1OA 3K5NA 1MN7A 3DOKA 2IAJB 3I31A 2EXUA 5F8IA 4ZIVA 3ZZOA 5E33A 5HBMB 3RGIA 4O3NA 2HURA 3VAHA 1VI7A 3G2XA 4NLRA 2IM0A 1RT6A 4Q43A 4J9KA 1BWVA 2XSFA 3BREA 4KV8A 5AXLA 3TUIC 1N5VA 3FEYB 4KHRA 5CZVA 1O8BA 3KG0A 4ED6A 2IM3A 5F8HA 4ERDA 4JI3J 1IKYB 4B9MA 4ECUA 2IM2A 4OZLA 2COLA 2L48A 1AFJA 4WZQA 4PG8A 2AT1B 2E9TA 3L3CA 1LW2A 3DU6A 3I56S 3W7BA 3PR4A 2HFZA 2RKIB 4DR4J 4G3IA 1FEEA 3ZNJ1 2F3JA 4M5JA 4O44B 4Z2XA 4EYIB 3BJYA 1FKOA 5IQQA 3NS6A 3CJ8A 4MAKA 3D4JA 2Q6BA 3BKTA 2GHWA 1UA0A 1ZETA 4URGA 1XMQF 3GFXA 2F65A 3TX8A 2J9DE 1NPPA 2V4JB 2WK4A 5KFHA 2Z2LA 1KN6A 3PEHA 3N6LA 4DV4F 5IC4B 3D6HB 2VFTA 4ZP8A 1RWVB 1KHWA 3CC4S 1PG5B 3SI8A 1NJZA 1A6LA 3IO1A 2CXEA 2OH2A 4AL5A 3GWCA 5HQMA 5T41A 3G9CA 1C0UA 3HZEA 4PXCA 5LJ5Y 4JI8J 3THVA 4NA1A 4JI4F 4ZPBA 2XB2D 5H9FK 2BJDA 2XMKA 3EVWA 5A0YB 2X51A 4RUBA 3M2UB 4H4KA 2C22A 1YBAA 2EFVA 2MSSA 2PMWA 3QWUA 2Q79A 4D3GA 5IM0B 4WFYA 1OIAA 1N88A 3UD5A 2W9AA 4CO2A 3FCVA 1X5SA 1DTTA 3UDCA 2QYCA 3RUBL 2VZ9A 5M2UA 4EK2A 3QAEA 3HSGA 3U1LA 1JQGA 3A4TA 4O3RA 1RT4A 4LF7J 4XDDA 2DR7A 4P72A 4LR9A 2KFYA 4KRWA 1MMDA 1RWNB 4GKKJ 3HDSA 1UWBA 2QMXA 4WTOB 3CT9A 2C2RA 2VG6B 1GEHA 3ZZ0A 3V6KA 5KFKA 3RBZA 3VZHA 3CJ2A 2AQ4A 2C1EB 3TUZC 1ZPWX 2VL1A 5B7WA 2LXIA 1RSCA 2AGQA 4Y34A 3UN2A 4EBDA 3DOLA 4HTIA 2ATLA 1AZSA 2QEXS 2HNDB 2R7OA 1WHYA 3I87A 2DH8A 5KT5A 1K44A 1NXIA 5B0CA 2C3MA 4UQGA 1UMJA 3QZ7A 3TAMB 3MHYA 2RDJA 2PT0A 5GAEI 3UCUP 5ETKA 4ECQA 1S9FA 2B8QA 3J81Y 1N5QA 3W61A 1JKHA 1VJQA 3LP0B 5EWFA 2F40A 3O44A 1QVGR 4CLYA 4CTAB 1HNWF 1VDHA 3EDRB 4OX8A 4EU0A 1X4FA 5DM7Q 3PKMA 4AT1B 2RUGA 2GQQA 1UAWA 2OMOA 1UVLA 1FEHA 2FB0A 1TK8A 3EICA 1U1MA 4XIUA 4FF2A 3Q23A 2JEFA 2XEXA 1RBAA 3MI7X 2XYHB 4BWMA 2KRRA 3PNIA 2XLJA 2IBKA 5JVHQ 1RA7A 1TKTB 1RT5B 2CQ0A 4B9TA 1P1TA 2EW9A 1N0UA 4PXDA 1PJ6A 3T1HF 3CCUS 2OMLA 3W60A 3DLKB 3MUMP 2NLWA 1ZAXA 4QWBA 2RH3A 4Y0FA 2OO4A 1NLKL 3IBCB 1M1KT 4FS1A 4C9DA 2WVFA 3TUJC 1CC8A 1JWWA 4S0MA 2P6TA 1K8AT 1HMVA 3ELHA 2DIVA 2QIFA 1JLFA 2V9KA 3W65A 1HBNA 1K1SA 3G86A 1N5SA 2RAQA 3AB4B 3IR6B 4PG7A 3M8ZA 2M0GB 3X1LB 1FRIA 2LEPA 5RUBA 3SXLA 1FTRA 3BO3A 1S7IA 1NB7A 4CLKA 3MR6A 3MF5A 2ZJPQ 5HATA 4OYIA 1HBMB 1M1HA 1UEUA 5BYSA 3UQSA 3CDAA 1N4LA 2M4MA 3K2YA 1HQUB 2KHCA 2W7AA 1YTYA 2L9WA 2BM1A 3FZ2A 2VICA 3CJTA 3HHLD 1RQ0A 1SH2A 3T5HA 1F1BB 5KFRA 5HMZA 4O0NA 2XULA 3M32B 5L1JA 2V6AA 3BGFA 2D1CA 1NBEB 4ED3A 1Q53A 3PW4A 2AWZA 4K4XA 5D3GB 3CB4A 3CCVS 1FVSA 1F5BA 4C11A 2GA7A 1NSPA 1UVJA 4HI2A 2XZTB 1SCJB 2ASDA 2C3PA 2ZM6F 2F4FA 4YR2A 1C1CB 1RISA 1TELA 2DNNA 3PY8A 3IBWA 3BEGB 4OHVA 3GR1A 3UR3C 4ZVOB 3DKDA 4CNYA 2QSFA 3KDOA 3W3SA 2D69A 1R31A 1NAQA 1RAGB 5HL7Q 1TK0A 1TQLA 2XZDB 1A9NB 1YZ7A 4DR2J 2ROPA 3QGGA 3KHRA 4E0DA 4CO5A 3LANA 4B9NA 3FRYA 2F4VJ 2IFXA 2U2FA 1S6PA 2AYBA 4F0MA 4OYZA 2PIIA 4LR8A 1NUEA 1HW9A 4JV5F 3HHLB 3AY0A 4EBEA 1VGYA 3I0SB 3ET6A 5C2GA 4LIRA 4R5PA 3KUEA 4OYPA 3DOMB 1CQNA 3QIPB 4DV3J 2FJWA 1FJ7A 4Y2CA 2KYXA 2MY8A 4DF8A 4OZ1A 1IBMJ 4K4WA 2DGTA 3E2EA 4KGZB 3UN3A 2MLZA 4ZP9A 1T3NA 3J80U 4ZPWR 2AD9A 3JTNA 1TZ0A 4TVAB 5AJ3F 1XN9A 1E6YB 1AT1B 4AFFA 3NCPA 1JXVA 1BD6A 3IFEA 5KFYA 3PYGA 1EQ0A 4KKOB 2J6SA 2OPRA 1HD0A 3EXYA 2IAJA 3DRSB 1VBXA 3VV2B 2NYIA 1O0PA 2GIFA 3U27A 4PWDB 1WI6A 2UXBJ 5HBMA 3RJMB 3SSSA 4ZIWA 1N33F 2KFZA 4IH6A 4MTPA 2BKOA 1SV5B 1PYOB 5HO4A 1VBZA 2NR0A 3MR3A 2V4RA 2BE2B 2OFHX 2FVRA 2RMLA 4B17A 2V2QA 2YQ1A 1T9UA 2EC2A 5DQGA 2IPOB 4JI5F 4DWIA 1FD2A 1IKYA 2G0JA 4A8QA 3G96A 1R8PA 2HHHF 4LQ9A 1K0VA 5GMKa 1RT7B 1VOMA 3LGNA 1WJ9A 2EPIA 4MT1A 3HT0A 2YKPA 4ANCA 5E5NA 2ZH9A 1QSYA 4LBPA 4ZN3A 3ITHB 4I69A 3V4IB 4O44A 2KG1A 1WSRA 1HI0P 1VJWA 1LEOA 4IRKA 4NPOA 2ZBQA 1MG7A 3ICLA 1YJUA 2DEIA 2ZEJA 3VVUA 3OTOJ 1FDBA 4FZVA 1X0PA 2V4JA 2AMCB 4OI4A 1IWGA 3V81B 3LAMA 3CCJS 4B02A 3IG1B 3CWJA 2FYXA 1D9AA 2ZZMA 3TOQA 5DJBA 1CVJA 3NAIA 2B7CB 1B99A 1NDCA 1U2RA 3DRRB 2DH7A 1N5TA 2C2MB 3LAKA 1RHQB 3CCRS 3TZZA 5A8WB 5KT2A 1NNDA 5A0YA 2N3OA 3M2UA 2R7RA 3OXFA 1QSLA 2MZ1A 3CCQS 1QD1A 3AOBA 5IM0A 2UV8G 1ZS6A 4ECRA 1RWKB 2K8GA 1RACB 1YIJS 2RHSB 3EGVA 3HXMA 3CCMS 3IC1A 3QGPA 2BVZA 4Q2LA 2CWXA 2ZDPA 2WRMA 2E5LJ 2ZC4A 2EBGA 4ALZA 1S99A 2E1PA 2YPYA 1ZAWA 1NK0A 3VAFA 4NMXA 4TYBA 3PRBA 4NLXA 3PXGa 4CRJA 2VG6A 4M5DB 5DGBA 2VFVA 3ZZTA 4DX7A 5HMWA 1F9FA 2DNZA 1ROFA 5MLCV 2GFFA 4YR3A 1SQEA 3O2IA 1TU0B 3R5BA 2P9GA 3US5A 1QE1B 5KG4A 2G0CA 1O6XA 2C2EA 4AL7A 4NA3A 4CLWA 1VIXA 2HEKA 3PACA 4UZBA 4ZVGA 2KTQA 1SC3B 2HNDA 1R8HA 4PEOA 2RSQA 3PJWA 4IR9A 2ZJRQ 3CW2C 3Q8SB 3TAMA 3UNYA 4DUTA 4F3OA 1S6UA 5KFFA 3PO4A 2CNNB 4B3OB 4N7TA 1LFWA 1FX2A 5E3AA 2QC3A 2AU0A 3LP0A 1SPBP 4ZPVR 2WB1D 1XR7A 3S7RA 1IN0A 5CYMB 4CTAA 2HFVA 1UFWA 2ZH3A 2CPDA 3NKYA 3H25A 4ZJLA 2IVFB 4OX9F 1F3FA 1V3RA 2YH1A 1QAXA 1P8GA 2DBBA 1HNZF 2IMWP 3HCXA 3K59A 3H5YA 3M2RB 1W25A 4MMOA 4Y2MA 1TK5A 4X66F 5IWAF 2MPUA 1EKRA 5K20B 1N0VC 3N5BA 2DGOA 2VBYA 2CPFA 4F25A 1TKTA 1RT5A 2OSQA 1KDNA 2XI2A 4RUCA 4PWUA 2ZH6A 2I5JA 1WC1A 3DLKA 1OO0B 3H2LA 3DGPB 2GJ2A 1RHUB 3KLEB 4OFZA 2BACA 5F9LA 2V8GA 4IRCA 4I2QB 1YRTA 3VAGA 2KJWA 2G4BA 2B0GA 1ZM3A 1GQEA 4Y28C 4DUZF 3HFKA 3R9LA 4CLUA 4GC7A 2HVHA 3IP0A 3C14B 3SMZA 5E3PA 3M8RA 4JI7F 1TKZB 2VQFF 1TP7A 2DRAA 5KFXA 3G6ES 1HBMA 3QBCA 1NRKA 4IH7A 3IN5A 3BN7A 1RWWB 2OPSB 1HKAA 1SC1B 4CM2A 1H73A 1HQUA 1F2HA 2FVQA 3NRBA 1PYSB 1FT8A 3AJ1A 4I56A 3VGVA 5HANA 3Q8VA 3KWMA 1HYSB 2CYYA 3W5ZA 5KG0A 3M32A 4I6WA 5KFAA 4AUKA 2EI5A 4NCGB 2O3DA 3HHLC 4M8LA 4X65J 5EHHA 5D3GA 5B08A 3ADAC 2BJ7A 4XPEA 2XMMA 2KHDA 1Q78A 3LW5C 1HQEB 2HQGA 3QSYB 1EJ7L 1C1CA 3CIMA 3HSZA 3TO8A 2GHPA 2N82B 3BQ1A 5H1SV 3BSAA 4K0KF 5A6PA 2XNRA 5L38A 3CDEA 3FUYA 2AJ4A 1CPZA 2B5JB 5LXRA 3AB2B 5ETTA 2RE1A 2HVIA 3OTBA 1KNZA 3UDEA 3J7YI 2IJFA 1WF0A 1XR5A 2H4YB 3NGDA 4DQSA 1VQOS 3HHLA 1BY9A 5LSOA 4DS4A 2XSJB 1DLOB 3I0SA 2QL5B 1Q7LB 1Q8IA 3OUYB 3HSDA 3DOMA 1EB0A 3QIPA 4L74A 2YKOA 2W9CB 5FLXU 2W2MP 1DHMA 2J6TA 3ZZUA 2LECA 4C8LA 3OVBA 3BGRB 3AXMA 1QY7A 1S1VB 5HJYA 3CCZA 4ED7A 1SL1A 3D28A 2DHHA 4K4TA 3R5GA 2E29A 1X5OA 2H51B 2PI5A 2R7SA 4PYDA 2AYEA 4O3OA 1E6YA 3ENVA 1QTNB 3R5CA 2A0FB 2ZHOA 3EE3A 5E2QA 2H5IB 2J0QD 1KTVA 3MM5B 4NLYA 3J7ZT 4X4NA 2CJKA 1FRJA 4KJIA 4KKOA 2VFRA 4BHQA 4UOHA 4ZP7A 2PN6A 3DRSA 4CO0A 3KLGB 1S1UB 4PWDA 5ADZA 4DCOB 3I82A 1IBLF 1JJHA 2DITA 2RDIA 2XGQA 1S1WB 2B6AB 1N34J 2IDLA 1JNZB 3TAQA 1SV5A 3H42A 3QT8A 4ZS6A 3F73A 2YWHA 5LMUF 3MCSA 1VQLS 1HNIB 3M6WA 4ELTA 1AW0A 5ETSA 1VHIA 2BE2A 4AYBD 2J6UA 3I4PA 2ABYA 4DV6J 1FWKA 4WXWA 1Y3JA 1RWUA 1PC4A 2OJ3A 4ELUA 3CJQA 3VQTA 3OFHA 3R1LA 3TQEA 3D6FB 3RW6A 1RT7A 3MAQA 4P2FA 2VG7B 4UY85 5L1IA 2CQDA 5A2QY 4J9VA 2RS8A 2YPZA 4TY9A 3MM8B 1CJVB 3ITHA 2HWIA 2DR9A 2VOPA 1JLEB 4J91A 3V4IA 1CC7A 4GKJF 1IM4A 4ZOSA 4LF9F 1KSPA 4QYZJ 4IO9Q 1CSJA 2LFVA 3Q89A 2HAIA 2NPFA 4C0BA 1VK8A 2QFIA 2DCLA 2NUHA 3OVAA 4L6V3 4ATNA 5JJBA 2WVCA 4B08A 4RL1A 3V81A 4A8SA 5E0OA 4KAIA 3D1QA 1VQSA 3IG1A 4NEZA 4JOUA 4MK8A 1EARA 4FYXB 2EWHA 4DCJB 4UUWA 2VIHA 2CJAA 4HT7A 1EX8A 1J5OB 2CZ9A 1URRA 2PC6A 3C6UB 2LKZA 2DVIA 1U8SA 4BDPA 1IKXB 2E7VA 2FHJD 5A8WA 4YB5A 4RBUA 4OLPA 3SQGB 2W24A 1MMLA 2BW7A 2WONB 4OYXA 5LT5A 2HFOA 2D3ZA 4FF3A 4KGKA 4YP3A 4USVA 2YX4A 3QFWA 2KFNA 4YN3B 2KZZA 1RHJB 4XO0A 3RG6A 3BO4A 4RU2A 1X7VA 2AKWB 1PC5A 4LF4J 1F5AA 1LW0B 5CAAA 1FE4A 1NHKL 4M5DA 1PBUA 4FYYB 2R8HA 3LPYA 4JV2A 1W7WA 4UW2A 1K47A 2VH7A 2JEJA 2FVCA 3OL6A 4ECWA 1ZTTA 3DFEA 1QE1A 2K3KA 1T9VA 2B4VA 3AAWB 3M9OB 5DS7A 3TW0A 3AQOA 3DLLQ 5D15A 2ZH2A 2JLEA 5L1LA 3AQPA 3P6YC 2JJ4D 4DUYJ 2BXJA 3N01A 2UUCJ 3IWNC 1Q0NA 2HAFA 3M30B 4UZCA 1ZYQA 1YDLA 2VKRA 4B3OA 1IUJA 1PYTA 3SIPB 4TNOA 3ONQA 1CLFA 3IS9B 2MZJA 3NP5A 4QW9A 1B64A 1NKBA 3I5CA 1OPZA 2FZGB 3M05A 4K2XA 5CYMA 3TYTA 3TARA 1SUQB 2KU7A 4IOCQ 5SUHA 3NGSA 1MN9A 2RQ4A 1VS3A 5IXUA 5ETVA 1BE4A 2VONA 2V2VA 2FLLA 1LXJA 2J8AA 4WXOA 5KFCA 4Y2IA 2V9WA 3M2RA 3JAMU 1WF2A 7FD1A 1R8AA 2ZZNA 3R8YA 3QPIA 1BXNA 1XQIA 2XS5A 3MUTP 2MZRA 2W4CA 2J5AA 2B7BB 3AFGA 2R2RA 1S72S 3NMRA 1WSVA 2DNLA 4LFAF 4NXNJ 4A8WA 2KM8B 2P9EA 4ZLLA 1ITPA 1NH8A 1VQ7S 3DGPA 1R0AB 3D5MA 5LOQA 3KLEA 4DSEA 1JB0C 3TZYA 4FP9A 4CM0A 4I2QA 1KQSR 3W9JA 4LREA 3PKYA 2B9YA 4DXLA 2XTJP 3E8OA 1S12A 5ETLA 2LP4A 4LUBA 1GT8A 4HEA9 1S48A 3NLCA 2M8DB 1FKPB 1RTZA 1F9EB 3AH6A 4C8OA 1I51B 4C6AA 2JC1A 2UUAF 4JI0J 3EPGA 3C14A 2KXHA 1WOSA 2IVYA 5H9FJ 1TKZA 2J7UA 3OFEA 4DX6A 4F3QA 1GH8A 3Q8QB 2OPSA 4ZLNA 2UXDJ 4QWAA 4QWEA 5G4DA 2CJBA 3BSCA 3C16B 1VRUB 1NK5A 4WK3A 2E5GA 2BE9B 1HYSA 3FBBA 3TRGA 2NCKL 4U7UK 1WACA 2CAJA 1R3NA 3A3PB 1Z2LA 1WD6A 4M5NA 5GAHU 4NCGA 3SFGA 3HX9A 1I3OB 2D9OA 2ADCA 2HW3A 3BGLA 3TA1A 3DDKA 1WOPA 4RWWA 2F7VA 4YY3F 1HQEA 2H48B 4DBQA 4JI3F 2I1RA 1KTQA 1S59A 2YTCA 3IBFB 2VQEJ 5KFVA 3B54A 4HR2A 3W5XA 4E98A 1YGYA 1C1BB 2UUTA 1RWOB 2IJRA 1B7FA 2KZMA 2EK1A 3T6BA 4MIBA 2KJVA 2B5JA 1SXLA 2CJYB 2MJUA 2MLYA 3IGVA 1WG5A 4DR4F 2HZVA 4ELVA 2GAHC 4A4JA 5ETNA 3DXSX 4QU7A 2P8IA 1WHXA 3A13A 1FWLA 3JSBA 1FHTA 5B09A 3MEEB 3D0GE 4C48A 1NCLA 2HRTA 3RR7A 1TMMA 4CH0S 3WC0A 1M0SA 1RLCL 2XSJA 3PHEA 3GMGA 1DLOA 4YOEA 3D68A 1H98A 3KHLA 3OUYA 3IRXB 1FI4A 3CXCR 4RX6A 2BANA 2ZBIA 2W9CA 4Q5VA 4Q45A 2YQ0A 1Q79A 2C2KB 3MM6B 4DV5J 2PMZD 3VALA 2EEYA 3N4WA 5KG5A 5CH7B 1S1VA 5GAGU 4JI8F 2HFNA 5G0RB 2WAQD 2MMYA 3MAAB 4RW8B 3RBEA 4O3SA 4MKAA 2CUYA 2R8KA 3KHHA 2Y0BB 4Q7AA 5C42B 1YK9A 5J2NA 3BBBA 3Q8RB 3MM5A 3KK3B 1D8YA 3EGZA 2LU1A 1FCAA 2OEMA 1T05B 1WKJA 5DDPC 4DV7F 2E1CA 1S1UA 3Q8YA 1Q5YA 4LVOP 4MKBA 4X84A 3ENWA 4LF7F 2YKNB 1S1WA 2B6AA 2CG8A 3EX7B 1YHQS 4RO0A 5F8JA 3HVRA 3R7BB 4GKKF 2MZTA 3F56A 2OI2A 2HHPA 3UR0A 1X4HA 2UVRA 3DU5A 1HNIA 2HWTA 1WKKA 1Z2ZA 2OFGX 4RKUC 3J7A1 2GV1A 1KLNA 4EEYA 5KFMA 1X9MA 3QO9B 3BQ0A 1HLWA 1HI1A 2AP6A 1EZZB 2VG7A 7FDRA 1G1XA 2HHXA 2W25A 2QT7A 1YITS 5KG7A 3MEGB 3VWSA 5DG9A 1CJVA 4C7QA 2O67A 2NXJA 1JLEA 1XTZA 2LA6A 5HP1B 3KLFB 2VB6A 3BGUA 3NGKA 3GYGA 1FK9B 1NJWA 2BW2A 5KFTA 2FHMA 3CCWA 2XY5A 2UUWA 1GK8A 1PILA 3G71S 1DQ8A 3M6VA 3W5YA 2VDHA 4ZCIA 1UJ6A 4LVNP 1B7YB 4CYUB 2AV5A 1ZM4A 4M1KA 4C0HA 4C8KA 2Y1RI 1YG0A 1L3VA 4NLTA 1T9WA 2RNEA 2ZUGA 4YR0A 1J5OA 3OV7A 1TFWA 3C6UA 3F44A 1H3DA 1IKXA 5IT4A 2MQPA 2CQHA 3SQGA 2HNZA 5J1EB 4NLGA 2OLWA 3PW0A 2WONA 2V8PA 1G2EA 4DX8H 1GTHA 1S7HA 4N56A 3A8IA 2XCAA 1SBRA 1EIYB 4L72B 3JB9k 2WSEC 4WPAA 2HFUA 2K06A 4HACB 4YDXA 4CO4A 3T1YJ 2MZQA 1LW0A 1B0VA 3NL0A 3OSPA 4J9NA 1FRHA 4ZHRB 4I67A 2GMJA 2I8EA 1ZH5A 2RIJA 5E41A 1XWLA 1ICEB 4ES3A 1F2GA 4OHYA 4N8NA 2CNOB 3VHQA 5FD1A 1H38A 3HI9A 2GIRA 4ZK7M 4O4RA 4ZLJA 4F4WA 2XS7A 5LSRA 1RWXB 3FBFA 3KKFA 3W63A 3OL9A 4IUFA 4YFUA 2XQCA 2LXUA 4PR6A 3DCAA 1S0VA 4JYAJ 4M5KA 4MFBB 1M5OC 4WFAQ 4WP9A 4DR1J 4KB7A 3NS7B 4P6QA 3IWXA 4YUDA 3PFOA 2M7SA 3M30A 1UWAA 2I9SA 2P5VA 2ZKUA 2DO4A 3K58A 1UKUA 2HBZB 4RW7B 2KI2A 3IS9A 4HKQA 1WORA 2M8HA 1DFDA 2KM8C 2RRNA 4J9QA 1HFEL 1V3ZA 1ACMB 3MUVP 4J9OA 4HI1A 1S77D 3TZXA 2RHQB 2J8SA 1FFWB 1SUQA 4USWA 4F0HA 4PQAA 5HQ8A 5D4NA 3ETMA 3IM8A 2HGLA 2YWKA 4H4OB 3EMTA 2ZUAA 1KRPA 1IVZA 2XMUA 4GMKA 1WEYA 3D66A 3T41A 1SL2A 3RBDA 1C2PA 2EFOA 2J0WA 3HHDA 4DR2F 2ZWOA 4NLSA 2MQLA 3HVWA 4HYKA 3ZTQA 5CABA 3HPOA 5I3PA 2F4VF 4DV2J 3MURP 4DV4J 3THTA 1YJ7A 2ZHAA 2I38A 2WZ1A 1REVB 3QZ8A 4DQPA 1MWQA 4ID8A 1YBUA 4F04B 2RT3A 1RBOB 2QLBB 4N77A 1F0XA 1R0AA 3G87A 2GZOA 5GVQA 1H2TZ 5C2CA 3RBXA 4IOAQ 4JI4J 4DV3F 4EWTA 1OY6A 1IBMF 1A0OB 1U25A 4X4PA 4DZ6A 3BSOA 4C4WA
chains in the Genus database with same CATH topology
4X64J 4JI0J 5AJ3J 4DV0J 3T1YJ 1HNWJ 1IBKJ 3R2CJ 4LF8J 1HR0J 2UU9J 4X62J 4JI2J 2KL8A 1J5EJ 4JI8J 4DUZJ 1XMQJ 1N34J 5LM7E 2UXCJ 4LFAJ 3JAMU 4NEZA 3D3BJ 2UXDJ 3J81U 4DV3J 4JI3J 4K0KJ 4OX9J 4KHPJ 4LF5J 2KVQE 4B3TJ 4JI1J 1IBMJ 1HNZJ 4HHUA 2VQFJ 2MTLA 4DV6J 4B3SJ 4YY3J 5A2QU 5FLXU 2UUAJ 4LF6J 4JI6J 1FJGJ 1N36J 1N33J 4X65J 2MEWA 4DR3J 4KYZA 3J80U 1IBLJ 4NEYA 4DV2J 4DV4J 4NXNJ 4JV5J 4DUYJ 4AQYJ 4GKJJ 2MQ8A 2UUBJ 1N32J 1HNXJ 4X66J 4LF9J 5IWAJ 4DR4J 4DR7J 2UUCJ 1XNQJ 4B3MJ 4LFCJ 1XMOJ 4DV5J 4JI7J 4JYAJ 5IT9U 3T1HJ 3J7AN 4LF7J 4B3RJ 1I94J 3IMQJ 4DR1J 4V1Ak 5BR8J 5LMUJ 4KY3A 4LFBJ 4DR5J 4GKKJ 4PWWA 2E5LJ 4DR2J 4JI5J 4DV7J 4DV1J 4JI4J 4YHHJ 4RJVA 3R2DJ 5LMNJ 2HHHJ 3OTOJ 1XNRJ 2VQEJ 2F4VJ 2ZM6J 2UXBJ 4LF4J 4NXMJ 4DR6J 3D3CJ 3W1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 J;  4JI0 J;  5AJ3 J;  4DV0 J;  3T1Y J;  1HNW J;  1IBK J;  3R2C J;  4LF8 J;  1HR0 J;  2UU9 J;  4X62 J;  4JI2 J;  2KL8 A;  1J5E J;  4JI8 J;  4DUZ J;  1XMQ J;  1N34 J;  5LM7 E;  2UXC J;  4LFA J;  3JAM U;  4NEZ A;  3D3B J;  2UXD J;  3J81 U;  4DV3 J;  4JI3 J;  4K0K J;  4OX9 J;  4KHP J;  4LF5 J;  2KVQ E;  4B3T J;  4JI1 J;  1IBM J;  1HNZ J;  4HHU A;  2VQF J;  2MTL A;  4DV6 J;  4B3S J;  4YY3 J;  5A2Q U;  5FLX U;  2UUA J;  4LF6 J;  4JI6 J;  1FJG J;  1N36 J;  1N33 J;  4X65 J;  2MEW A;  4DR3 J;  4KYZ A;  3J80 U;  1IBL J;  4NEY A;  4DV2 J;  4DV4 J;  4NXN J;  4JV5 J;  4DUY J;  4AQY J;  4GKJ J;  2MQ8 A;  2UUB J;  1N32 J;  1HNX J;  4X66 J;  4LF9 J;  5IWA J;  4DR4 J;  4DR7 J;  2UUC J;  1XNQ J;  4B3M J;  4LFC J;  1XMO J;  4DV5 J;  4JI7 J;  4JYA J;  5IT9 U;  3T1H J;  3J7A N;  4LF7 J;  4B3R J;  1I94 J;  3IMQ J;  4DR1 J;  4V1A k;  5BR8 J;  5LMU J;  4KY3 A;  4LFB J;  4DR5 J;  4GKK J;  4PWW A;  2E5L J;  4DR2 J;  4JI5 J;  4DV7 J;  4DV1 J;  4JI4 J;  4YHH J;  4RJV A;  3R2D J;  5LMN J;  2HHH J;  3OTO J;  1XNR J;  2VQE J;  2F4V J;  2ZM6 J;  2UXB J;  4LF4 J;  4NXM J;  4DR6 J;  3D3C J;  3W1Y C; 
#chains in the Genus database with same CATH topology
 1HBO B;  2CJQ A;  5LSL A;  2M9K A;  5CD4 H;  2XMT A;  1NB2 A;  1FKP A;  2WBM A;  1YX2 A;  2O1P A;  2FHK A;  2QO3 A;  2UXC J;  2RB7 A;  3Q2S C;  2HKE A;  3QMQ A;  5KOW A;  3CO0 P;  4QJV A;  4R0E A;  1FKA F;  1XR6 A;  1P9Q C;  3OFF A;  4HDG A;  3M9N B;  2FJE B;  2RQC A;  1M5K C;  2X7I A;  1UWB B;  1U09 A;  4CI0 B;  1FXR A;  3C16 A;  1VRU A;  3BR9 A;  3MMC B;  3DGV A;  5E3C A;  2O01 C;  1WC3 A;  1VBK A;  2UXB F;  2HZC A;  2YNI B;  2UUB J;  3IA0 A;  3PV8 A;  1RAA B;  1LWC B;  5GMD A;  2IIH A;  2FHO B;  4Q0B B;  3BKF A;  3IGN A;  2OPP A;  5AXK A;  1RGV A;  3MPW A;  3WZ0 A;  3R97 A;  3CJ4 A;  1G4C A;  6FDR A;  1M5S A;  2MHN A;  4YHH J;  3DRP B;  2LQB A;  1D1U A;  1T03 B;  1Q1K A;  3T9Z A;  2ZHB A;  1O5J A;  2FJD B;  1PIE A;  1C1B A;  1DY3 A;  2VOD A;  1RAD B;  2D9P A;  2Y3Y A;  2Z58 B;  2BOA A;  2ZE2 B;  3OSN A;  2OP5 A;  4F67 A;  2VJU A;  2HBR B;  1BWE A;  1U0S A;  3U7J A;  3B8H A;  4WE1 B;  4LBI A;  4B3T J;  1VQ5 S;  1KKH A;  1HA1 A;  3MEE A;  3OTO F;  4FXW A;  1P1L A;  1EET B;  3Q22 A;  2CNL B;  3IRX A;  1RWP B;  2L9N A;  2D3U A;  1KP6 A;  4PYA A;  1PKU A;  4TU7 A;  1U6F A;  1X4C A;  3FK4 A;  3R5D A;  4HHH A;  3MM6 A;  1BHN A;  2OEJ A;  2G2O A;  2QV6 A;  2V50 A;  2IM1 A;  1FFS B;  5KTQ A;  5G0R A;  3GJQ B;  2F8E X;  3MAA A;  4RW8 A;  2J9D A;  3FMB A;  4HL9 A;  4DR6 J;  1L3S A;  4V19 J;  1HBU B;  4X4T A;  3P8B B;  1BC6 A;  5C42 A;  1TFY A;  5EDW A;  3GIJ A;  3I9Z A;  4TU8 A;  2QA1 A;  1S6Q B;  3KJQ B;  3OHB A;  1T05 A;  1S76 D;  4YEA A;  3O3L A;  3M4X A;  3BQ2 A;  4W90 B;  2E5L F;  2LDY A;  4QOT A;  4ZP6 A;  2YKN A;  1S4F A;  1NDL A;  2QN6 B;  1IKV B;  4LJM A;  3DHW C;  2AHO B;  5DQH A;  3E01 B;  4M5H A;  2X1B A;  4KR0 B;  4ZPA A;  3P96 A;  5D8H B;  3ZZR A;  3P45 B;  1MLA A;  3EUN A;  4B3M J;  3K5M A;  2HGN A;  2BR0 A;  3FBC A;  1MWZ A;  4BC7 A;  3GIK A;  1X4D A;  4F8R A;  2QLF B;  3MMJ A;  4B9L A;  3BGO P;  3R2D J;  1XNR J;  4I6A A;  4MK7 A;  8RUC A;  1TKD A;  1WNE A;  1H7X A;  2Z2Y B;  4YB7 A;  4P2M A;  2B3T B;  3SYZ A;  1DBD A;  2ZD1 B;  1VLY A;  3NS5 A;  3DLH A;  3MEG A;  1FES A;  4Z7Y A;  2WHO A;  2BA9 A;  5GAD I;  2VFS A;  3GSI A;  3HVT B;  4OZ3 A;  5HP1 A;  3KLF A;  3PEJ A;  4FPI A;  1SJF A;  1U0H B;  3CDU A;  1FK9 A;  2BBE A;  3CJ3 A;  2BOP A;  3P3D A;  4ECT A;  4A47 A;  2DGV A;  4MH8 A;  3WX8 A;  2LVW A;  4NLP A;  4QPT A;  4CYU A;  1U1N A;  2ALY B;  4QWD A;  2IC3 B;  1M5V C;  3JQJ A;  1NK4 A;  4W92 B;  4WTY A;  4DCP B;  2J9C A;  1KVK A;  4I68 A;  3DYA B;  1FA0 A;  1RHR B;  3ZXW A;  3CCT A;  4J9S A;  1OQ3 A;  3ET6 B;  1Q8L A;  1FNO A;  4R5P B;  2OSR A;  5F3T A;  3GPA A;  2OGU A;  3SQO P;  4X4S A;  5J1E A;  3C15 B;  4EFA C;  4PPD A;  3GYX B;  2Q1L A;  1VQ6 S;  1UVN A;  1KS2 A;  4K5S A;  3UDL A;  5DRK A;  3FCW A;  5DZ7 A;  2XCP A;  3BSN A;  4HAC A;  4FVC A;  2EG2 A;  4A8Y A;  1NZA A;  2MGZ B;  1RDR A;  3CF5 Q;  2AW0 A;  4ZHR A;  4KHP J;  2XMV A;  2VUG A;  3K5O A;  1IBK F;  3UVJ B;  3BV8 A;  3OBI A;  3EGW B;  4V19 X;  3A3O B;  1RT1 B;  4OHZ A;  1OY9 A;  1QUP A;  2AJ0 A;  4WFB Q;  1UEK A;  4IFV B;  2QSW A;  3PTW A;  1Y11 A;  3N9U C;  4XPC A;  1N32 J;  3KG1 A;  2E7X A;  2GS8 A;  3C19 A;  5HVG A;  4PG6 A;  5ETR A;  1X4A A;  4V1A k;  1GMU A;  2H65 B;  5I3Q A;  4MFB A;  3EYZ A;  2QLW A;  3HJV A;  2DIU A;  3NNH A;  2ZDO A;  1FJC A;  4RW7 A;  2PEB A;  2HMI B;  3K89 A;  1RXO B;  3MEC B;  4DFK A;  4I1T A;  4PUO B;  1KON A;  4X65 F;  3KFW X;  2QLJ B;  1VC0 A;  4RNN A;  4LF8 J;  3CD5 A;  1DRZ A;  1J5E J;  2Y0S D;  4HT5 A;  3KLV A;  3FBE A;  4C97 A;  3H59 A;  3J81 U;  1X31 C;  1RHM B;  3SCI E;  4H4O A;  2MYF A;  4H4K C;  3NNA A;  3W9I A;  3U02 A;  2UP1 A;  1TL7 B;  3MED B;  5HAO A;  4DZD A;  3CIZ A;  3FVY A;  1VQM S;  4DR3 J;  3MDF A;  4C8M A;  1W2I A;  1T3O A;  3CNQ P;  3JSR A;  1EP4 B;  1GNK A;  1DAR A;  4ED8 A;  4USJ C;  1VMB A;  4L73 A;  3NWG A;  3W8P A;  4A8K A;  3D7S B;  3QJJ A;  4WKR A;  1REV A;  5ITH A;  1BQM B;  1KWM A;  3P4U B;  4LSL B;  3KG4 A;  4F4K A;  3HF5 A;  1RT2 B;  3QLH B;  1RYS A;  3D1H A;  1ARO P;  1H74 A;  2W7P A;  4Y6I A;  4RJV A;  1JX4 A;  2UVV A;  3E3X A;  3SSR A;  3SCK E;  3I5A A;  3DM2 B;  1TTH B;  1SKS A;  2E5H A;  1RWM B;  3MGJ A;  2W4D A;  1H6K X;  3EDQ B;  5D4O A;  2WVB A;  1W2B R;  2QA4 S;  3SEO A;  1HBO A;  1JNR B;  3SCJ E;  4K5R A;  2Q6C A;  2MQN A;  2XY6 A;  4L3N A;  3NNC A;  2RRB A;  4J37 A;  3CUN A;  3N0V A;  4LRC A;  1HR0 F;  2MST A;  1X4G A;  1RHK B;  3FJ2 A;  5MAO A;  4M5M A;  5JVG Q;  2ACY A;  3EJM A;  3K7R A;  3NOC A;  1UTA A;  3MMC A;  2LQJ A;  2N3L A;  2CQP A;  3JQM A;  2YNI A;  2G0I A;  2ZNZ A;  5F8M A;  1LWC A;  5H9E J;  1Q8B A;  1N34 F;  5EUH A;  4Q0B A;  5A6W A;  3CED A;  3M8S A;  3KMS A;  4C3K A;  2XO7 A;  4QIV A;  1S1X B;  2QG9 B;  1D0E A;  1NJY A;  3GU0 A;  4DV6 F;  3H2V E;  4P73 A;  5CA5 A;  3OVS A;  3DRP A;  3I96 A;  4CZC A;  3GP9 A;  4FKX A;  1LWE B;  2WW4 A;  2EK6 A;  1T03 A;  3DI6 B;  4RZR A;  2G2Y A;  3UD4 P;  1SC6 A;  4I2P B;  1RLD A;  2APO A;  3CC2 S;  4F4A A;  3RB0 A;  4DDF A;  3D67 A;  2YWF A;  3JQK A;  2ZE2 A;  3O8W A;  1H2V Z;  1WOO A;  3IR5 B;  1N36 J;  4WE1 A;  2DGW A;  1LOU A;  4RW4 B;  3GFZ A;  4ECX A;  1FX4 A;  1GXL A;  3MWB A;  3OL8 A;  2CPE A;  4F4X A;  1S49 A;  1EET A;  1RAB B;  3RU0 A;  4JI1 F;  3AOD A;  2HS4 A;  2MKY A;  5KFN A;  3PVX A;  2BMB A;  2GQC A;  4P2X A;  4NOH A;  1I5O B;  4K7Q A;  3HZG A;  3FDS A;  2C3Y A;  2RU9 A;  1NM2 A;  5K8M A;  2UVW A;  2I5J B;  1SJQ A;  4HHJ A;  4ED1 A;  2HHS A;  4QU6 A;  3TEH B;  1RCO B;  1PAU B;  3R7S B;  4OI1 A;  2YX7 A;  3R2C J;  2Q66 A;  2CQB A;  2KVI A;  5LXY A;  1N8R T;  1HBU A;  4HTJ A;  2E5J A;  4B9U A;  4QZV B;  5LM7 E;  3LP2 B;  2FJB B;  1Q7Y T;  6AT1 B;  5FJ4 A;  2Y1L B;  1T95 A;  5FDL B;  4BS2 A;  1NEE A;  3M8P B;  1S6Q A;  4PKD B;  1RCX B;  2HBY B;  2CQ4 A;  1KLM A;  2DR6 A;  4DPW A;  3TVK A;  1R8B A;  4LF6 J;  4C98 A;  1Q8K A;  1RTH B;  4LF4 F;  3RB6 A;  9ATC B;  1IKV A;  4YS2 A;  3E01 A;  1CUL B;  1KC8 T;  5I4M A;  2CZV C;  2GW8 A;  1Y4Z B;  4JI7 J;  2HZA A;  4OYB A;  3SV4 A;  3IWL A;  4DQI A;  3ILJ A;  2B56 A;  4DSJ A;  3OR2 B;  3N5F A;  1S0N A;  2GVZ B;  1K1Q A;  4X4O A;  1DUR A;  4NXM J;  1FRL A;  1MSW D;  3BDE A;  4IOB A;  3UN5 A;  4ZJO A;  3W64 A;  2GQ2 A;  4DUY F;  1NJI T;  2UUC F;  2MLX A;  2ZD1 A;  2JH3 A;  2E7W A;  4ECV A;  2Z0G A;  3HVT A;  2YWE A;  2FVP A;  2ZH7 A;  2VU5 A;  4B9S A;  4J7C A;  1NSQ A;  1U0H A;  2QX0 A;  1LWF B;  4ECY A;  1L3U A;  1JXE A;  1REG X;  4KGX B;  4L75 A;  2V68 A;  3H0P A;  1FJG J;  4ZVE A;  5AT1 B;  4N41 A;  2AEF A;  4IDK B;  1FXL A;  3M8Y A;  2R2S A;  1JLC B;  2QZ8 A;  2CQ3 A;  2IC3 A;  4B3R J;  3MR5 A;  1UEV A;  2U1A A;  2Q43 A;  4ZVQ B;  5IT0 A;  5CD4 A;  2DK2 A;  4NI2 B;  4CH1 A;  4FNI A;  3HKZ D;  3DYA A;  4WIQ A;  1KHV A;  1VC5 A;  4J9R A;  4EUV A;  2CQ2 A;  4X4U A;  5HK4 A;  4DPY A;  2MXY A;  4C2M A;  2H5J B;  3A8J A;  3UFC X;  3GB0 A;  2WB4 A;  3ZO7 A;  1MW7 A;  3C15 A;  3TX0 A;  3UPF A;  3H4B A;  3R3T A;  2NQP A;  1P9Y A;  2X1A A;  1SJ1 A;  1CEZ A;  4CLL A;  2IDE A;  1U1P A;  4AXJ A;  4LSN B;  2DXD A;  3VZI A;  2NXU A;  2MGZ A;  4JP8 A;  4EZ6 A;  3AA9 A;  2MTL A;  3BN4 A;  4UT4 A;  4IQX A;  4FVM A;  3FMW A;  2VPZ B;  3M8Q B;  2DNO A;  2L3M A;  5D0R A;  3UVJ A;  4CCH A;  1Y7P A;  1RT1 A;  4JI0 F;  2Z4P A;  4U9R A;  4IFV A;  1DQA A;  3V6J A;  3TR5 A;  1CJT B;  4LRA A;  5EX0 A;  5BR8 J;  2JEG A;  5AE1 A;  5K8P A;  4ITS A;  4H4M B;  4A8O A;  1JIH A;  2E9R X;  4H54 A;  3MPV A;  4DL0 C;  1OMS A;  3MPU B;  4W4M A;  2GGP B;  2QMW A;  4ED2 A;  3G82 B;  2W7O A;  3NXZ A;  4N47 A;  5KFE A;  2YBV A;  1I94 F;  4LR7 A;  4FN5 A;  3Q8P B;  3S1T A;  2HMI A;  3H98 A;  1BQN B;  4ETZ A;  3MEC A;  3ILO A;  4PUO A;  4K4U A;  1NPR A;  3BYR A;  3F41 A;  5C24 B;  5KFQ A;  4CH7 A;  2FGO A;  2V5H G;  2JHE A;  1I1G A;  5CYJ A;  1SB6 A;  5HVH A;  5KG1 A;  4ZCM A;  2Y1I A;  4OZJ A;  3S6E A;  4EO6 A;  2VD3 A;  4MIW A;  3LPE A;  2QMU B;  1TL7 A;  2VQE F;  2ASY A;  4U95 A;  2XG8 A;  3MED A;  4GKJ J;  2ZC3 A;  4LF9 J;  2DGX A;  2Z8Q A;  5DDO C;  1UFL A;  2AGO A;  4USK A;  2E44 A;  1EP4 A;  2DR8 A;  2BEF A;  3LWM A;  1AXQ A;  1AYE A;  2ZVS A;  4G6V B;  5IV4 A;  2KH9 A;  2DNH A;  3JXO A;  3D6M B;  2EFQ A;  5GAE U;  1KD1 T;  4AQY F;  1BQM A;  4LSL A;  4K59 A;  2ZVI A;  3N28 A;  1RT2 A;  3X3U A;  3QLH A;  3C2P A;  2A6M A;  4OI0 A;  4X64 J;  4DQQ A;  1KR4 A;  2MKC A;  5EN1 A;  2FTR A;  4DEZ A;  3DM2 A;  1WF1 A;  4USI A;  5K14 B;  1UL3 A;  2ZNY A;  5KFW A;  2XMW A;  3UCG A;  2XWX A;  3BPS P;  4DV5 F;  3C3L A;  5L8R C;  1VFJ A;  2G9O A;  1M90 T;  2GMH A;  1S10 A;  5CCM A;  1KQF B;  1FVQ A;  5LL6 d;  4DSI A;  1RZM A;  4OV1 A;  4FPR A;  4LRF A;  2XWY A;  2HS0 A;  2AGP A;  3EZO A;  3OLA A;  1VIO A;  3OTD A;  2RD5 C;  4DFJ A;  3QJL A;  5DLF A;  4TLQ A;  2OHD A;  3N6N A;  2GJI A;  1GMV A;  4RW9 B;  2ZH5 A;  2JLF A;  5IT9 Y;  4U6P A;  3KYL A;  4KHM A;  5D78 A;  1X5P A;  3J81 j;  1B70 B;  4EO8 A;  3MFH A;  4J9U E;  4Q44 A;  4FS2 A;  3OXL A;  1S1X A;  1HAR A;  3EZ5 A;  1LWE A;  2H5E A;  2YQ3 A;  1S9E B;  2BKP A;  4Y2K A;  2G13 A;  1H7W A;  3DI6 A;  4WK1 A;  4I2P A;  1YJ9 S;  3T6J A;  2Z30 B;  5CYQ B;  5U47 A;  1DQ9 A;  2JX2 A;  2IA0 A;  1V5V A;  4DOZ A;  2DHA A;  5BYQ A;  3KLI B;  4DR7 J;  3MPD A;  4MJK A;  4RW4 A;  2DGQ A;  2XO6 A;  2R9L A;  3Q0A A;  3M2V B;  3RW7 A;  5JXS A;  5KT7 A;  2JC0 A;  4ZVU B;  2OIH A;  4PRF A;  4NLO A;  4NAS A;  5LMN J;  3NMA A;  2FVS A;  3NG8 A;  2FIU A;  4GC6 A;  2F8H A;  1R8C A;  4DL4 A;  2JLG A;  2F1F A;  3P5B P;  3GIM A;  5CXT A;  3BZQ A;  1Y5N B;  4YB6 A;  1NK9 A;  4WP3 A;  4JI2 J;  1URN A;  1NSK L;  1GMW D;  1S0O A;  3C8Y A;  2ASJ A;  4LFA J;  2Y8Y A;  4ZA1 A;  1QDU B;  3PO5 A;  3LP2 A;  2DNY A;  3EWG A;  2YXL A;  5FDL A;  3I5B A;  3QT6 A;  3FEZ A;  4P7T A;  3M8P A;  3L7P A;  2CQI A;  5KFO A;  1IR1 A;  3OTC A;  1HI8 A;  3AA8 A;  2W9B B;  1BLU A;  1JLG B;  1WUU A;  4ES2 A;  2EBE A;  3PM9 A;  5J2Q B;  5A76 A;  1RTH A;  3T1Y F;  2QL9 B;  1TL3 B;  2RU3 A;  3OJU A;  1CUL A;  1UZH A;  3W2V B;  1UW9 A;  4OHX A;  1JMT A;  1TR0 A;  4FYW B;  4X2B A;  2V8H A;  1KEK A;  1XC9 A;  3OD2 A;  4NLW A;  3Q8U A;  4DV1 J;  1WKL A;  2CZ4 A;  2MJN A;  5T14 A;  1O51 A;  1AUS L;  5HN0 A;  3OR2 A;  2GVZ A;  1DAX A;  4M63 A;  3R7N B;  5T7L B;  5J2P B;  2AJ2 A;  1WC0 A;  3LUY A;  3KHG A;  1NKC A;  1VHF A;  1SIW B;  3NOG A;  3FGV A;  9RUB A;  3CGI A;  5J1N A;  2XMA A;  4JYA F;  1C0T B;  3PYF A;  4A46 A;  4PCQ A;  2OPQ B;  4DR1 F;  3OW2 R;  3KOA A;  3VQS A;  3CJR A;  2YKM B;  2ZOG A;  4YY3 J;  2Y8W A;  5A2Q U;  3N6M A;  4HVZ A;  1F5C A;  2XNQ A;  2MEW A;  2FQQ B;  2LMI A;  3KLH B;  3FEX B;  5K8O A;  1LWF A;  1Q16 B;  1NHU A;  3T5J A;  3ZC4 A;  5KFD A;  2MZS A;  2YNH B;  3R1H A;  4IDK A;  1N6Q B;  2KDO A;  1JLC A;  1VRT B;  1FDD A;  1YBT A;  1G3O A;  3PFE A;  2QYG A;  5IQ6 A;  3NGT A;  5KOX A;  3ZZZ A;  4PQU B;  2C2O B;  1KFS A;  4ZCL A;  3K8W A;  4NI2 A;  2CVI A;  3SDE B;  1A7G E;  3HO1 A;  3CCS S;  1SJ4 P;  2GC8 A;  5HLF B;  2CA9 A;  3PX6 A;  3A8E A;  4I6Y A;  5K8N A;  1XIQ A;  1RTI B;  2IBO A;  4DV2 F;  2KT2 A;  2BAN B;  4WP8 A;  4QR0 A;  2ZOF A;  2HK2 A;  1HWU A;  1ZOT A;  2RS2 A;  3I9V 9;  1TVR B;  3QSI A;  2KN4 A;  1R6V A;  4LSN A;  4B3S J;  4OZ2 A;  3B82 A;  2HVD A;  2R7V A;  2D74 B;  3H20 A;  3R5J B;  1N48 A;  4DG1 B;  5J2N B;  2HHW A;  3C66 A;  3GFY A;  4Z7C A;  2GIQ A;  3M8Q A;  2OKQ A;  2ZH1 A;  1X9W A;  3HT3 A;  1U1L A;  2FY8 A;  2R7Q A;  5E3R A;  2C3U A;  2PD1 A;  5A8K B;  4P71 A;  2ATC B;  5KAK A;  1IJE B;  3MEK A;  3VR1 A;  2V8V A;  2M2B A;  1TAU A;  2UXC F;  5KG6 A;  2R8G A;  2YWG A;  3NGU A;  1B3T A;  1RA6 A;  2D7S A;  2W2P P;  2NXE A;  1CJT A;  4DV7 J;  1WDD A;  2DB1 A;  3TNV A;  3GJS B;  1U02 A;  4H4M A;  4K8R A;  2C42 A;  2B9E A;  2W4P A;  2NUU G;  2IRY A;  2KB2 A;  1OPI A;  5DDR C;  5F8L A;  1FTC A;  2GJF A;  2VBW A;  1LV5 A;  2GGP A;  3G82 A;  3U1M A;  3OL7 A;  2J9E A;  3HUL A;  4ED0 A;  4U7U D;  4Y3C A;  3MM7 B;  3DC2 A;  2KKH A;  2UUB F;  1YJV A;  2ZFH A;  1GFW B;  4IRD A;  4OYA A;  4F4Z A;  3KJN B;  2MKJ A;  1BQN A;  3MD1 A;  2AJ1 A;  3HHK A;  3GG1 A;  2XHC A;  3H90 A;  2HWH A;  2XS2 A;  5C24 A;  2KT5 A;  4OX7 A;  4YHH F;  2YKA A;  4P7V A;  4WU2 A;  4JI6 J;  1FE0 A;  2X1F A;  1LWX A;  3AOC A;  2F9D A;  4OMF G;  3HSJ A;  2BQR A;  5F3Z A;  4CNZ A;  1FFG B;  2GO8 A;  4HH0 A;  1KVI A;  2V34 A;  3LGH A;  1M5P C;  1WC6 A;  2OAU A;  3O1L A;  1H2U X;  4LF1 A;  4KY3 A;  1N5Y B;  2EG1 A;  2JVO A;  4CWB A;  1FRM A;  3MCM A;  1YLX A;  2H54 B;  2YY3 A;  2ASL A;  1XK8 A;  2FUG 9;  2QE5 A;  1UP1 A;  2AYG A;  4UOC A;  4Q2M A;  1UA1 A;  4DX5 A;  3WDO A;  2BRK A;  3KJF B;  3ENA A;  4B3T F;  3R5A A;  5IFM A;  5J2M B;  1RT3 B;  3IM9 A;  1OYE A;  2YNF B;  5C7P A;  1U1Q A;  1TKX B;  1XMB A;  2ERR A;  3L95 X;  1S9G B;  4CT8 A;  4CIO A;  4NLD A;  3IRW P;  1MNE A;  2FC8 A;  2BM0 A;  2LQ5 A;  3MOZ A;  2W8L A;  4Y00 A;  1U6B A;  3PIO Q;  2JNJ A;  5K14 A;  3T5L A;  3D2W A;  2UVU A;  4DF4 A;  2IY5 B;  1WDT A;  2NXC A;  1U26 A;  2HNZ B;  4UY8 T;  3CO9 A;  2WBR A;  1R27 B;  4ZVR B;  2UZA A;  2DJW A;  2Q3P A;  1RAJ A;  2CPJ A;  4WFN Q;  3KUG A;  1NDK A;  1MWY A;  4W98 A;  4DR6 F;  4PAB A;  2V2Z A;  3BM7 A;  5H9E K;  2J76 E;  3PG9 A;  2NSC A;  1S5Z A;  1KQK A;  4DPU A;  3J7A N;  3JTP A;  1K0T A;  3V2U C;  4C8N A;  2GML A;  3CMQ A;  3ZZP A;  4GRS A;  3W62 A;  5D6G A;  2KXN B;  2MB0 B;  4X4Q A;  4QCL A;  2AF6 A;  2DEJ A;  2N7C A;  1FO1 A;  2EKN A;  1RUS A;  4KPY A;  4JBC A;  4RW9 A;  3HD2 A;  4Q8F A;  2MY7 A;  3TA2 A;  1PAE X;  1RE1 B;  5EX3 A;  3K57 A;  3PRD A;  5EWG A;  1S97 A;  2XYG B;  3VAK A;  2DHX A;  3ENQ A;  1PGZ A;  3A3N B;  4B3M F;  2C28 A;  1HWJ A;  2ILY A;  4ANE A;  1SQF A;  3PZP A;  1VK3 A;  2CDQ A;  1Q82 T;  2JWN A;  4EZ9 A;  1S9E A;  4UST A;  3TA0 A;  3GV8 B;  4PG5 A;  1HL6 A;  1JJC B;  2CQ1 A;  2XBP A;  1HHQ A;  1SKU B;  1XNR F;  1TAQ A;  5CYQ A;  4TYA A;  3CPW R;  2W2N P;  4CP5 A;  3BKU A;  4LFC J;  1XMO J;  4WWS A;  3KLI A;  4USM A;  4FXD A;  3EZU A;  2O5D A;  1WEL A;  4DU8 A;  3O5T B;  1YKW A;  3M1V B;  3CJK B;  4ID5 B;  2R7U A;  4JV1 A;  3M2V A;  2LLZ A;  2ZH8 A;  4YQW A;  3QT5 A;  3LP1 B;  4ZPC A;  1QLN A;  1IKW B;  3PJX A;  3T3F A;  4LRB A;  2CPX A;  4EBC A;  2NRE A;  2A18 A;  4EI2 A;  3POT B;  3MMB B;  3RRK A;  3GJT B;  3P49 B;  2JFD A;  4PAA A;  3PHT A;  4DV0 J;  1T94 A;  2HHT A;  3A12 A;  1FD8 A;  1PBA A;  4X62 J;  4PXB A;  5KFS A;  4OLO A;  4XTT A;  5CHC B;  2VF3 A;  3FSI A;  2XC9 A;  5DG8 A;  4RW6 B;  2PMH A;  1KOH A;  2VFU A;  3UW1 A;  3D9B A;  2LA4 A;  1B0P A;  3AOA A;  1IWA A;  1SH0 A;  4NYP A;  3PCO B;  2G1H A;  5DZ6 A;  1EQM A;  3W8G A;  4JB8 B;  1D9F A;  4KO0 B;  2BZ2 A;  2HHQ A;  1FNX H;  2ZZT A;  1R6Y A;  1VYA A;  4PG4 A;  2FLN A;  1GX5 A;  3DHX A;  3S01 A;  3OFG A;  4C0O C;  4C3M A;  3J7Y U;  3IXQ A;  1VQ4 S;  4OJ3 A;  2W9B A;  1CQM A;  1JLG A;  2K7J A;  3Q2T C;  4OI3 A;  5C25 B;  2J7K A;  5J2Q A;  3MPY A;  2XMJ A;  3GIL A;  3CSK A;  3FCH A;  3KMQ A;  2BJ1 A;  4ZPT R;  2NSB A;  1TL3 A;  2DYA A;  3FNN A;  3HHE A;  2BYC A;  3W2V A;  4ZJQ A;  2VV5 A;  3HMJ G;  4KHP F;  1S57 A;  1T8E A;  3LO3 A;  2XLI A;  4ZVP B;  2E5I A;  4E2F B;  4OI2 A;  3BR8 A;  1N32 F;  4YB1 P;  5T7L A;  2H9Z A;  5J2P A;  2R2U A;  3WC2 A;  2OPP B;  3AD9 C;  4EMD A;  4XK8 C;  3FKB A;  1GMW A;  1C0T A;  2OPQ A;  3ILL A;  3M6X A;  4U96 A;  5EWE A;  5DQI A;  2L9D A;  4NEY A;  2R2T A;  2YKM A;  3RAQ A;  1HNX J;  1IBC B;  2FJV A;  1T9Y A;  2H4W B;  2AJF E;  2FZC B;  3MTK A;  3KLH A;  3P5T L;  2CG4 A;  4LF8 F;  4CO1 A;  3IMQ J;  1J5E F;  4LIW A;  2HG4 A;  4DPT A;  2YNH A;  2CJ9 A;  1N6Q A;  4L76 A;  1VR6 A;  1VRT A;  2G1D A;  3D54 A;  4USU A;  2RUS A;  3KNG A;  4XAK A;  4CQ1 A;  2VPW B;  5ETM A;  2RKI A;  4RNM A;  4K2J A;  4PQU A;  3LA0 A;  2VA2 A;  4F0K A;  3G4S S;  3M6U A;  2KG0 A;  1U2F A;  5K5M A;  3TJ9 A;  2F5G A;  1DTQ B;  2CVE A;  4DPO A;  4DR3 F;  2I2Y A;  3SDE A;  5HMX A;  2OD6 A;  2UU9 J;  2DTJ A;  5HLF A;  1RTJ B;  2UV8 A;  3GTY X;  2OD4 A;  1RTI A;  4LT6 A;  1QUV A;  2FJA B;  1PO6 A;  4I7F B;  2AX1 A;  1WC4 A;  2WW8 A;  4HH1 A;  5JUM A;  1PSD A;  4MKV A;  2J0X A;  2GAG C;  1WG4 A;  2JRS A;  3PYD A;  5GME A;  4TY8 B;  1WHV A;  2NPI A;  1TVR A;  4M5G A;  2B4P A;  2YX1 A;  4ZN1 A;  1XNQ J;  2M88 A;  3TVY A;  5THW A;  2ZH4 A;  3V4M A;  1APS A;  2CIM A;  4DG1 A;  4QIE A;  3H5X A;  3WQP A;  2BX6 A;  3J80 Y;  3I55 S;  4LFB J;  4DR5 J;  5A8K A;  2GO9 A;  2LEB A;  2NXN A;  5ETP A;  3LF0 A;  3PYE A;  1C4C A;  4HDH A;  1T7P A;  3ZTP A;  1NME B;  2XY7 A;  4WCE Q;  4NRT A;  2HBQ B;  1JK9 B;  4IFY B;  2ZIT A;  4C8Y A;  1RAE B;  1BMQ B;  3SV3 A;  1F60 B;  4WJB A;  1Y0H A;  1YJR A;  5KG3 A;  2BV3 A;  1HW8 A;  1FWP A;  1SJR A;  3OHA A;  3GYN A;  1TUW A;  2FDN A;  4FYV B;  1R89 A;  2HQF A;  3MM7 A;  4UOG A;  5M2P A;  3DLE B;  3G8S A;  3IAM 9;  1RAO A;  4DL3 A;  3ISZ A;  4OQJ A;  3CJS A;  2WTF A;  5D4L A;  5F9N A;  2ALZ A;  1HQ2 A;  2K3I A;  1WHW A;  1L5U A;  3PRV A;  5C5J A;  1HWI A;  5DM6 Q;  2HLU A;  5HJX A;  1B4S A;  3QGI A;  1NH7 A;  1QAJ A;  1IQZ A;  2R7T A;  4OIX A;  2WOM B;  4ES1 A;  2HIQ A;  1N5Y A;  1R43 A;  4RWX A;  4LBH A;  5F8N A;  1SQG A;  2A2D A;  1N36 F;  1W26 A;  4QIG A;  5J2M A;  1BGX T;  1RT3 A;  1TV6 B;  1YJN S;  3WIU A;  2R42 A;  4DFM A;  3I6P A;  2YNF A;  1TKX A;  4U7C A;  4R0J A;  1TL1 B;  2H3E B;  1S9G A;  3VGT A;  1Y3K A;  2BJ8 A;  4LF5 J;  3MR2 A;  2HK3 A;  3CTR A;  3CJ5 A;  4C8Z A;  1FXD A;  4Z37 A;  2CQC A;  3QFH A;  2ZOM A;  2FPH X;  3LTO A;  1UZD A;  2OEL A;  4ILR A;  5M2R A;  3TZW A;  3PX4 A;  1YZ6 A;  1YJW S;  2HQD A;  1NDP A;  4JUZ A;  3AD7 C;  1KVJ A;  3VTI A;  2GVD B;  3AXK A;  4ED5 A;  4PWW A;  1NHV A;  2DD8 S;  3RTV A;  3QGH A;  1MMN A;  5KFZ A;  3T1A A;  2D3O 1;  2D3O R;  1IXK A;  2DH9 A;  1M5H A;  4TU9 A;  2EFP A;  2V63 A;  1D9D A;  1WTF A;  1CBK A;  2VC0 A;  1Y5L B;  4L3K A;  4LF6 F;  1U24 A;  2HNY B;  1S4E A;  1QAY A;  4ECS A;  4YDD B;  3PDN A;  1IBK J;  4WU3 A;  5D0E A;  2WVE A;  4AL6 A;  5HSP A;  2K1R B;  3GON A;  2FY1 A;  2E1R A;  1YWX A;  3C6T B;  1R0B G;  3HM9 A;  3ILI A;  1VQY A;  2NZ4 A;  1UET A;  2HYI B;  3H4D A;  3KUH A;  1BQX A;  3BS9 A;  1X9S A;  5B0D A;  4RLE A;  4KGV B;  3ISN D;  4QW8 A;  2DPJ A;  2DGU A;  5HRO B;  1UJ4 A;  2DXF A;  2ACM A;  2PO4 A;  2JL9 A;  4NXM F;  3EVM A;  2K2P A;  3HLU A;  5IOL A;  1LXN A;  5I42 B;  4G1P A;  5F8G A;  3AD8 C;  1Y10 A;  2VBZ A;  4BWJ A;  5KFG A;  4ZDN A;  4CLF A;  2X1G A;  2RF2 B;  4GO5 X;  2HRU A;  5AE3 A;  4GVB B;  2QRR A;  1HNV B;  2DNP A;  4P52 A;  2V4Q A;  2DT9 A;  4N76 A;  4KE5 A;  3VCD A;  4D3H A;  4F3M A;  4ZMM A;  5FII A;  4NLQ A;  3CE8 A;  4QBU A;  3M1V A;  3CJK A;  4ID5 A;  4RNF A;  2WCX A;  3M7V A;  4TLR A;  3LP1 A;  1IKW A;  1FJG F;  3E51 A;  1AA1 B;  3POT A;  3MMB A;  1ZM9 A;  4P74 A;  1UPP A;  1XMQ J;  3K17 A;  3J7Z 5;  2HVZ A;  3SZ2 A;  4B3R F;  1GXT A;  4OZ5 A;  2PA8 D;  2RJZ A;  3NCQ A;  3JTO A;  3K5L A;  4DL2 A;  4RW6 A;  2M3D A;  2CPY A;  2HQC A;  3RZA A;  2JEI A;  2W8K A;  1HPZ B;  4F50 A;  2HFS A;  3NEK A;  1AB8 A;  2WSC C;  4KO0 A;  5DG7 A;  2EKY A;  3CVK A;  2QA4 G;  5BJR A;  4R8U B;  1KBR A;  3OXG A;  2ZWP A;  3DNC A;  2KXF A;  5I3U B;  1VC6 A;  2VA3 A;  1IR2 A;  3GV7 B;  1K73 T;  1N52 B;  4URS A;  3WBZ A;  1LNQ A;  2VG5 B;  4WII A;  4J9P A;  4K4Z A;  1T0T V;  2IYI A;  5C25 A;  4G1I A;  4KH0 B;  8AT1 B;  2VPX B;  1YRX A;  3CUL A;  3L4B C;  1KFD A;  2ILZ A;  2PFD A;  3DLG B;  2AIR B;  4F36 A;  1GTE A;  3QQC D;  4TKT A;  2ZKT A;  1RAF B;  4LMZ A;  5DDQ C;  5A8R B;  1VQK S;  2VJV A;  2WSF C;  1HR0 J;  4IR1 A;  5GAH I;  4M95 A;  2HS3 A;  2OUG A;  4KQZ A;  4NML A;  4KC5 A;  5BR8 F;  1KOO A;  4X4R A;  3HFV A;  1LK7 A;  1SL0 A;  2CRL A;  1N54 B;  4ILM A;  1LFP A;  4DHV A;  4PXE A;  2Z2M A;  5L9N A;  1QAI A;  1T9T A;  3IAS 9;  2BAB A;  3UCZ P;  4ZVF A;  2C2N A;  2DNK A;  3FQL A;  5KT6 A;  5F0U A;  2DCU B;  2VAS A;  1IQT A;  2IA6 A;  2M70 A;  2IMO A;  4ZVH A;  2M52 A;  3GE9 A;  3ULH A;  2EFN A;  3KXD A;  3L09 A;  3RR8 A;  1TUV A;  1U6Z A;  2OTJ S;  1VLO A;  5B0G A;  1U49 A;  1RTD B;  2F9J A;  1CS4 B;  2JZ5 A;  1HNW J;  4OYM A;  3SCL E;  1RU1 A;  4MYU A;  3TJA A;  2DNG A;  1FDA A;  4P75 A;  2V69 A;  1DTQ A;  3D0H E;  3UNG C;  1CJU B;  5CQG A;  1G6B A;  1DJ0 A;  4DSK A;  2SXL A;  2V67 A;  3BPD A;  1RTJ A;  3OQ2 A;  2QLX A;  4FDF A;  2BJ9 A;  5GAG I;  2FD2 A;  2Z57 B;  1ZZN A;  2HGM A;  4CLS A;  2DR5 A;  4JI1 J;  5KFP A;  4HHU A;  2RRA A;  4I7F A;  3AT1 B;  1SKW A;  2DY1 A;  2H1Y A;  5BYR A;  1NJX A;  5KT3 A;  2HIY A;  1TL5 A;  2F8M A;  3KK1 B;  4X64 F;  3G8T A;  4TY8 A;  1VIS A;  2Z56 B;  4ZPD A;  4F2S A;  7AT1 B;  2XZW A;  3T1H J;  4FKY A;  5FLX Y;  3Q24 A;  4QQB A;  4DI6 A;  2VDI A;  3DRR A;  2CPH A;  1D09 B;  5E3Q A;  5L1K A;  4FXV A;  2CAD A;  4CLP A;  4DN0 A;  3VAI A;  3K5P A;  1TL4 A;  3UWT A;  1D8Z A;  1HIY A;  4QR1 A;  4TQS A;  5KT4 A;  4O3P A;  1KLM B;  3BBF A;  4G1Q B;  2DGS A;  1FJE B;  3G6X A;  1NU4 A;  1E6V B;  4J90 A;  2W01 A;  2A3J A;  2BJ3 A;  4IFY A;  2POK A;  5B0A A;  2BKN A;  2HPU A;  3OLB A;  4NE9 C;  3D3B J;  4O0I A;  3QWP A;  4RUH A;  3PW2 A;  5KFU A;  4UUX A;  1WEX A;  5DLG A;  4M5L A;  1PJ5 A;  2HQ3 A;  4K50 A;  5D4P A;  2AEM A;  3TEG A;  1Q5V A;  4ZVS B;  3CCL S;  3DLE A;  3AJ2 A;  4OZ0 A;  3JYT B;  4OJH A;  1U8W A;  4U8V A;  2I0X A;  2ZBP A;  4DPX A;  1J27 A;  1IR0 A;  1NO8 A;  4F7V A;  4RU9 A;  4IYQ A;  3CDB A;  3H5U A;  4DMZ A;  1S0M A;  2DHG A;  2PGC A;  1XBW A;  3RB3 A;  3R6L B;  1RJJ A;  1F9H A;  4WKY A;  2R8I A;  1I6J A;  1JLQ B;  4A8X A;  3G8Q A;  5KG2 A;  2FLP A;  2B9X A;  1ZA1 B;  3GFH A;  4J9M A;  4QYR A;  2ZM6 J;  2WOM A;  2YKQ A;  3AHP A;  2YVS A;  1ELO A;  4FYD A;  1SVD A;  1P6T A;  5HVF A;  4TXS A;  2YNG B;  4OJG A;  2KL8 A;  4DR7 F;  3UDV A;  1R7I A;  3MM9 B;  3FFI B;  4P9S A;  3GR0 A;  3T5K A;  1WWH A;  1V6H A;  3FSX A;  4Y65 A;  1TV6 A;  5KFJ A;  3CMA S;  3MZI A;  3V5R A;  1CJK B;  4MIA A;  1TL1 A;  3QRR A;  4OZN A;  4WYW A;  3KK2 B;  4KTQ A;  3FQK A;  3H40 A;  2IRU A;  2NS1 B;  5LMN F;  3FZB A;  4ZCK A;  1GXU A;  4WBF A;  3DLB A;  4JV5 J;  4WFX A;  1Z1Z A;  1ZM2 A;  3R27 A;  3Q83 A;  4Q8E A;  4F4Y A;  2KT3 A;  1JLB B;  3LWL A;  1YI2 S;  4JI2 F;  2KRB A;  2N4C A;  4CLZ A;  1LQ9 A;  4KBI A;  2OTL S;  3B4M A;  4WFZ A;  2GVD A;  3W2W B;  4K4Y A;  2XI3 A;  2CKW A;  4KPC A;  4NZ7 A;  5E7O B;  5IC6 B;  1AFI A;  3CME S;  1DZ5 A;  1H72 C;  5AJ3 J;  2PSZ A;  1RU2 A;  2A1B A;  3QNW B;  1FRK A;  3DRY A;  3G6V A;  2B4O A;  5B0E A;  4DS5 A;  1P27 B;  2LEA A;  4MYT A;  1NSA A;  2HNY A;  2ROG A;  4RBV A;  4AND A;  2BUN A;  1AUD A;  1RB0 A;  2WVD A;  2P9C A;  1JLA B;  4OYW A;  1F6T A;  2K1R A;  3TAP A;  3NWR A;  3BF4 A;  3S8S A;  2V2K A;  3C6T A;  1U1K A;  4RR5 A;  4J9L A;  3FSY A;  4DV1 F;  1N33 J;  4O3Q A;  3DMJ B;  2RQK A;  2VKZ G;  1S1T B;  3LQV A;  2VOO A;  4BCA A;  3WX4 A;  5HRO A;  1VQ9 S;  1FER A;  2IJN A;  3PW7 A;  1EAY C;  1I94 J;  2B43 A;  2JFK A;  2JVR A;  1QM9 A;  5I42 A;  1NKE A;  1NK6 A;  2QL7 B;  2CQG A;  3OJS A;  3BH6 B;  4JI5 J;  1T11 A;  2RF2 A;  4PZV A;  1V3S A;  4GVB A;  2HHH J;  3ISN C;  4KT0 C;  1HNV A;  2OEK A;  4MK9 A;  2DNM A;  2ZBR A;  2AZ1 A;  3SFU A;  3RRH A;  4ILL A;  3BDP A;  2L41 A;  1HWL A;  2LXF A;  4CO3 A;  4ED4 A;  2C2Z B;  4NWB A;  3EVO A;  4DJB A;  3CJ0 A;  3W9H A;  5J1P A;  3QAU A;  3T19 A;  2V0N A;  3BYP A;  3JAM Y;  3GLJ A;  2PDA A;  4NA2 A;  4KYZ A;  3HKW A;  3LGM A;  4AQY J;  4P2S A;  2CFX A;  1XER A;  1HPZ A;  4I64 A;  4RBT A;  3L9Z A;  1VQP S;  5F41 A;  4RNO A;  3NY0 A;  3JSM B;  2PA3 A;  1IJF B;  3KJV B;  3DN9 A;  4U8Y A;  1T9X A;  3NAH A;  1QJH A;  4R8U A;  4P10 A;  2MKI A;  1YRU A;  2NYH A;  2JDJ A;  5I3U A;  2VHG A;  3GIR A;  2VG5 A;  3THP A;  4F2R A;  3TI0 A;  1FF2 A;  3BGR A;  3QJP A;  4ZVT B;  2QFJ A;  4OI6 A;  4B3S F;  3I0R B;  5LJ3 Y;  3DLG A;  3DLJ A;  2MHE A;  5CCL A;  2C3O A;  3HHN B;  2PFF B;  1OYD A;  2PEH A;  1RAI B;  1YVF A;  5A8R A;  2GNK A;  4NCB A;  3PX0 A;  5ETO A;  1VQ8 S;  2BQ3 A;  2J7W A;  4ZLP A;  2DRD A;  4A48 A;  3A8K A;  1SIZ A;  1D3W A;  3NBP B;  4E8U A;  1VRQ C;  2E66 A;  4F02 A;  3QT7 A;  3BH7 B;  3KLG A;  2RIL A;  4X4V A;  1YJT A;  2BRL A;  1X4E A;  2LQ9 A;  4ICL B;  1HHT P;  5DO2 A;  2BJE A;  1WI8 A;  1Q4R A;  3WIV A;  1UJ5 A;  5HMY A;  1FDN A;  2V94 A;  3HVA A;  2XYP B;  4WZM A;  4Y2A A;  4HLB A;  5L9X A;  4NYZ A;  4ZKA A;  1X8D A;  3NGR A;  2FJX A;  2HVE A;  1H0H B;  3JS9 A;  1X4B A;  3MD3 A;  3V6D B;  1MRO B;  2G2Z A;  1OS5 A;  2N7Y A;  3WHI A;  1XEZ A;  2W1B A;  1OSD A;  2MQO A;  2E1M C;  4JI6 F;  5AXM A;  1JXL A;  2W2O P;  4TN2 A;  1RBL A;  3DXB A;  1RTD A;  1CS4 A;  3PR5 B;  2E9Z A;  2B8P A;  3MM8 A;  4U67 Q;  5AE2 A;  3GG0 A;  2ZBC A;  3MCN A;  4IQM A;  4OX9 J;  4USH A;  3HFZ B;  2RDD A;  1CJU A;  3ZZY A;  3JSY A;  1HNZ J;  2RQM A;  3GZ7 A;  1V5I B;  2EC0 A;  5GAD U;  4IG3 B;  4UOF A;  4X66 J;  5IWA J;  3KTQ A;  1RAH B;  1LKZ A;  1UPM B;  2HHV A;  5IV3 A;  1Z4U A;  2FLO A;  3KK1 A;  2D41 A;  1SH3 A;  3OT9 A;  2QA2 A;  1RYR A;  2NZC A;  3DRX A;  3TAN A;  1M1G A;  3M9M B;  4FBT A;  3NCR A;  3OR1 B;  3CD7 A;  3MMA B;  1S6O A;  2J0S D;  2MKH A;  4ETX A;  4NLU A;  1WTB A;  1R0C B;  5KFI A;  4QPX A;  4KH1 B;  3EXC X;  4NRU A;  4FF4 A;  3MXH P;  5L39 A;  4G1Q A;  2LQ8 A;  2QGF B;  4MKY A;  4NLV A;  4DUZ J;  3GQC A;  6FD1 A;  8ATC B;  2C2D A;  3B78 A;  4KIA A;  1E6V A;  2AZ3 A;  4EYH B;  3VF0 B;  4O4G B;  5DET A;  2HRY A;  2IYG A;  2E1A A;  3HD1 A;  2VQF J;  1TUG B;  1G7C B;  1MU2 B;  5BXI A;  2IHR 1;  4FF1 A;  4IKA A;  4IG0 B;  1NK8 A;  3RRG A;  2MDA A;  1ZPV A;  3D0I E;  4BLG A;  3O6Q A;  4KFB B;  2A10 A;  2PE8 A;  1Y9O A;  3JYT A;  4NZ6 A;  3DOK B;  2AX0 A;  1OJ4 A;  2R8J A;  1S79 A;  2N4D A;  3QRP A;  2B51 A;  2O66 A;  2BDP A;  1UCN A;  1ZTW A;  2DY9 A;  2M5Y A;  4ENO A;  1U48 A;  5D77 A;  1RT6 B;  2X3G A;  1SC4 B;  4A8F A;  1JLQ A;  1UVK A;  2B4U A;  5D0G A;  4WYL A;  2HHU A;  4KV8 B;  2XLK A;  2KYZ A;  1OY8 A;  4WF9 Q;  2FHJ A;  2A2C A;  2HQI A;  1UVI A;  2GX8 A;  4BC9 A;  4R25 A;  1VCT A;  4N8O A;  3MTJ A;  4NZ0 A;  4RNH A;  1RKJ A;  2QTW A;  4LFC F;  1XMO F;  1X5T A;  3ETO A;  2X3D A;  4N5S A;  1SKR A;  2YNG A;  2XHW A;  4UTG A;  2JSX A;  3K0J A;  4K0K J;  3MM9 A;  4NYO A;  3FFI A;  3ZFV A;  4IH5 A;  5B0B A;  1HHS A;  1LW2 B;  2I6W A;  2DXE A;  3I4H X;  3W66 A;  1JJ2 R;  5B0F A;  1XJW B;  5IS2 A;  1CJK A;  1FNM A;  1OSC A;  3KK2 A;  1FKO B;  4QR2 A;  4RPF A;  2ADB A;  4DV0 F;  1TMJ A;  3H8Y A;  3T9N A;  4X62 F;  3U1N A;  1Q86 T;  3RAX A;  3FRZ A;  4M94 A;  1JLB A;  3TQ1 A;  4DQR A;  4NXN F;  1GAO A;  3D1O A;  4OJ1 A;  1PCA A;  3DDN A;  5SZT A;  1U45 A;  1C0U B;  5DGA A;  3W2W A;  3RB4 A;  2HLT A;  4I0W A;  3HJF A;  1UW4 A;  4DU7 A;  5KFL A;  3TWZ A;  2AJQ A;  3GCX P;  1X0F A;  2R7X A;  4AE5 A;  2GCF A;  2DKO B;  2P2C B;  4AXI A;  4UQT A;  2VC1 A;  2FGC A;  4LSZ B;  5EGY A;  3ZTR A;  1JLA A;  3OPK A;  2Y9H A;  4DL7 A;  1NPK A;  3LAL A;  1DTT B;  1WC5 A;  4KGM A;  2MQM A;  2ZJQ Q;  1Y00 A;  1IBL J;  4JV0 A;  1RT4 B;  4RUA A;  4NCA A;  3BB5 A;  4URQ U;  1K9M T;  2UXD F;  2MKS A;  1NK7 A;  3UI3 A;  1LK5 A;  3DMJ A;  1ZA2 B;  1JJ4 A;  3ZTO A;  5JMN A;  5IT9 U;  3GCW P;  1S1T A;  3EPI A;  3TUP A;  5LMU J;  2CJX B;  3TP2 A;  2DNR A;  3C46 A;  3HP6 A;  1T02 A;  4AD6 A;  3SSQ A;  3VAJ A;  2XGP A;  1OWX A;  3TVZ A;  2PI4 A;  3R6G B;  4K4V A;  3DOL B;  4DL6 A;  1Q81 T;  1UVM A;  1AZS B;  3HK2 A;  1YQH A;  3GSD A;  3L7O A;  1VBY A;  3B6B A;  3VAM A;  4OV6 A;  1HNX F;  4BBY A;  1C4A A;  4J5O A;  2BE7 D;  4F26 A;  2VPY B;  3CD0 A;  1RK8 A;  4EGL A;  2F63 A;  2YH0 A;  3PW5 A;  2CPZ A;  1EHW A;  1L3K A;  1JKH B;  4DL5 A;  3GII A;  4IO1 A;  4FBU A;  2LU2 A;  1YSJ A;  1ULR A;  4GO7 X;  3MOJ B;  4FNH A;  3Q86 A;  3DDI A;  1QVF R;  2IVM A;  3CC7 S;  1OQ6 A;  4XDC A;  3M8W A;  1VQN S;  1WEZ A;  4CLT A;  4OL8 A;  3BO2 A;  3VVT A;  2UU9 F;  2ROE A;  1RI7 A;  3A1Y G;  1U7L A;  3JSM A;  3KJV A;  4I4B A;  4B9V A;  1WG1 A;  4G65 A;  2IRX A;  1U1R A;  2DNQ A;  4UF4 A;  3W1Y C;  2MKK A;  4OX6 A;  3OTE A;  2Y1J A;  1PJ7 A;  1FRX A;  3F0N A;  3I0R A;  1XNQ F;  3QRQ A;  3UD3 P;  2R3V A;  1BUX A;  2BQU A;  2Z2Z A;  2CNK B;  3KDN A;  4LFB F;  3UO0 A;  4DR5 F;  5ETQ A;  4LQ3 A;  2R7W A;  4A8M P;  4O23 A;  5D0H A;  3KK3 A;  1HMV B;  5KFB A;  4NX9 A;  3RAM A;  1JLF B;  3NBP A;  1HBN B;  3CD6 S;  3FC9 A;  2MQ8 A;  2B9W A;  1HWK A;  4ICL A;  4NL5 A;  4QWC A;  2GHV C;  1SJ3 P;  4ER8 A;  2KO1 A;  1J2V A;  2HSE B;  4PPZ A;  4C3L A;  2V8D A;  3EGN A;  3MAH A;  2XM3 A;  1B0T A;  1HD1 A;  4DLG A;  4TQR A;  3H7H B;  5L46 A;  3CDW A;  2A6O A;  3D3C J;  2MQQ A;  3V6D A;  2L08 A;  3VGS A;  1MRO A;  3VGU A;  3MR7 A;  4QYZ K;  3I32 A;  3QO9 A;  2EFG A;  4DSF A;  3MCO A;  1SI9 A;  3MFI A;  4ZIT A;  2R4F A;  3QAT A;  3BBC A;  4DSL A;  1ZBT A;  3G6Y A;  1QTM A;  4C11 B;  2DO0 A;  2KVQ E;  3LOU A;  1U47 A;  2DHS A;  3RYL A;  2FC9 A;  3EM1 A;  2YWW A;  1RKI A;  4ECZ A;  1KQG B;  3PJ9 A;  1RP5 A;  2CDR B;  2W2Q P;  1L3T A;  2JOQ A;  2LYV A;  4OYO A;  3TJ8 A;  2QJ3 A;  1U4B A;  3B4D A;  4IG3 A;  4KSE B;  4GVL A;  2EVZ A;  4DLE A;  2LCW A;  5HQL A;  5CZX A;  1ZAV A;  3QYY A;  5AXN A;  2AYM A;  3CCE S;  2DRB A;  1GX6 A;  1S6P B;  2DIS A;  2DPI A;  2FZK B;  3UE2 A;  4LF5 F;  4DFP A;  4QIW D;  5HI7 A;  1NZ8 A;  4LF2 A;  4M5I A;  2CWK A;  1CG2 A;  2K7K A;  3H5S A;  4OHW A;  2AEJ A;  1F3V A;  3IR7 B;  3OR1 A;  4CT9 A;  4K4S A;  3MMA A;  2P6S A;  2CPI A;  2LDI A;  4CDI A;  3D6T B;  3H2U B;  5F0W A;  3ZNU A;  3N79 A;  4LRD A;  1Q95 G;  3KNA A;  1Y5I B;  1UFK A;  3GV5 B;  1X60 A;  3K8V A;  3SBM A;  4O4G A;  4DN9 A;  1V9O A;  4YME A;  5IZH A;  3QID A;  2UUA J;  5K9F A;  4QIF A;  3GJR B;  3AJD A;  1MU2 A;  1ZZF A;  3L7U A;  3PIP Q;  3V6H A;  2RVJ A;  4IG0 A;  3ZTS A;  1EKS A;  2VBX A;  1IM6 A;  1N56 A;  3LH2 S;  1U2C A;  4KFB A;  1QSS A;  2OPR B;  1U1O A;  3K5N A;  1MN7 A;  3DOK A;  2IAJ B;  3I31 A;  2EXU A;  5F8I A;  4ZIV A;  3ZZO A;  5E33 A;  5HBM B;  3RGI A;  4O3N A;  2HUR A;  3VAH A;  1VI7 A;  3G2X A;  4NLR A;  2IM0 A;  1RT6 A;  4Q43 A;  4J9K A;  1BWV A;  2XSF A;  3BRE A;  4KV8 A;  5AXL A;  3TUI C;  1N5V A;  3FEY B;  4KHR A;  5CZV A;  1O8B A;  3KG0 A;  4ED6 A;  2IM3 A;  5F8H A;  4ERD A;  4JI3 J;  1IKY B;  4B9M A;  4ECU A;  2IM2 A;  4OZL A;  2COL A;  2L48 A;  1AFJ A;  4WZQ A;  4PG8 A;  2AT1 B;  2E9T A;  3L3C A;  1LW2 A;  3DU6 A;  3I56 S;  3W7B A;  3PR4 A;  2HFZ A;  2RKI B;  4DR4 J;  4G3I A;  1FEE A;  3ZNJ 1;  2F3J A;  4M5J A;  4O44 B;  4Z2X A;  4EYI B;  3BJY A;  1FKO A;  5IQQ A;  3NS6 A;  3CJ8 A;  4MAK A;  3D4J A;  2Q6B A;  3BKT A;  2GHW A;  1UA0 A;  1ZET A;  4URG A;  1XMQ F;  3GFX A;  2F65 A;  3TX8 A;  2J9D E;  1NPP A;  2V4J B;  2WK4 A;  5KFH A;  2Z2L A;  1KN6 A;  3PEH A;  3N6L A;  4DV4 F;  5IC4 B;  3D6H B;  2VFT A;  4ZP8 A;  1RWV B;  1KHW A;  3CC4 S;  1PG5 B;  3SI8 A;  1NJZ A;  1A6L A;  3IO1 A;  2CXE A;  2OH2 A;  4AL5 A;  3GWC A;  5HQM A;  5T41 A;  3G9C A;  1C0U A;  3HZE A;  4PXC A;  5LJ5 Y;  4JI8 J;  3THV A;  4NA1 A;  4JI4 F;  4ZPB A;  2XB2 D;  5H9F K;  2BJD A;  2XMK A;  3EVW A;  5A0Y B;  2X51 A;  4RUB A;  3M2U B;  4H4K A;  2C22 A;  1YBA A;  2EFV A;  2MSS A;  2PMW A;  3QWU A;  2Q79 A;  4D3G A;  5IM0 B;  4WFY A;  1OIA A;  1N88 A;  3UD5 A;  2W9A A;  4CO2 A;  3FCV A;  1X5S A;  1DTT A;  3UDC A;  2QYC A;  3RUB L;  2VZ9 A;  5M2U A;  4EK2 A;  3QAE A;  3HSG A;  3U1L A;  1JQG A;  3A4T A;  4O3R A;  1RT4 A;  4LF7 J;  4XDD A;  2DR7 A;  4P72 A;  4LR9 A;  2KFY A;  4KRW A;  1MMD A;  1RWN B;  4GKK J;  3HDS A;  1UWB A;  2QMX A;  4WTO B;  3CT9 A;  2C2R A;  2VG6 B;  1GEH A;  3ZZ0 A;  3V6K A;  5KFK A;  3RBZ A;  3VZH A;  3CJ2 A;  2AQ4 A;  2C1E B;  3TUZ C;  1ZPW X;  2VL1 A;  5B7W A;  2LXI A;  1RSC A;  2AGQ A;  4Y34 A;  3UN2 A;  4EBD A;  3DOL A;  4HTI A;  2ATL A;  1AZS A;  2QEX S;  2HND B;  2R7O A;  1WHY A;  3I87 A;  2DH8 A;  5KT5 A;  1K44 A;  1NXI A;  5B0C A;  2C3M A;  4UQG A;  1UMJ A;  3QZ7 A;  3TAM B;  3MHY A;  2RDJ A;  2PT0 A;  5GAE I;  3UCU P;  5ETK A;  4ECQ A;  1S9F A;  2B8Q A;  3J81 Y;  1N5Q A;  3W61 A;  1JKH A;  1VJQ A;  3LP0 B;  5EWF A;  2F40 A;  3O44 A;  1QVG R;  4CLY A;  4CTA B;  1HNW F;  1VDH A;  3EDR B;  4OX8 A;  4EU0 A;  1X4F A;  5DM7 Q;  3PKM A;  4AT1 B;  2RUG A;  2GQQ A;  1UAW A;  2OMO A;  1UVL A;  1FEH A;  2FB0 A;  1TK8 A;  3EIC A;  1U1M A;  4XIU A;  4FF2 A;  3Q23 A;  2JEF A;  2XEX A;  1RBA A;  3MI7 X;  2XYH B;  4BWM A;  2KRR A;  3PNI A;  2XLJ A;  2IBK A;  5JVH Q;  1RA7 A;  1TKT B;  1RT5 B;  2CQ0 A;  4B9T A;  1P1T A;  2EW9 A;  1N0U A;  4PXD A;  1PJ6 A;  3T1H F;  3CCU S;  2OML A;  3W60 A;  3DLK B;  3MUM P;  2NLW A;  1ZAX A;  4QWB A;  2RH3 A;  4Y0F A;  2OO4 A;  1NLK L;  3IBC B;  1M1K T;  4FS1 A;  4C9D A;  2WVF A;  3TUJ C;  1CC8 A;  1JWW A;  4S0M A;  2P6T A;  1K8A T;  1HMV A;  3ELH A;  2DIV A;  2QIF A;  1JLF A;  2V9K A;  3W65 A;  1HBN A;  1K1S A;  3G86 A;  1N5S A;  2RAQ A;  3AB4 B;  3IR6 B;  4PG7 A;  3M8Z A;  2M0G B;  3X1L B;  1FRI A;  2LEP A;  5RUB A;  3SXL A;  1FTR A;  3BO3 A;  1S7I A;  1NB7 A;  4CLK A;  3MR6 A;  3MF5 A;  2ZJP Q;  5HAT A;  4OYI A;  1HBM B;  1M1H A;  1UEU A;  5BYS A;  3UQS A;  3CDA A;  1N4L A;  2M4M A;  3K2Y A;  1HQU B;  2KHC A;  2W7A A;  1YTY A;  2L9W A;  2BM1 A;  3FZ2 A;  2VIC A;  3CJT A;  3HHL D;  1RQ0 A;  1SH2 A;  3T5H A;  1F1B B;  5KFR A;  5HMZ A;  4O0N A;  2XUL A;  3M32 B;  5L1J A;  2V6A A;  3BGF A;  2D1C A;  1NBE B;  4ED3 A;  1Q53 A;  3PW4 A;  2AWZ A;  4K4X A;  5D3G B;  3CB4 A;  3CCV S;  1FVS A;  1F5B A;  4C11 A;  2GA7 A;  1NSP A;  1UVJ A;  4HI2 A;  2XZT B;  1SCJ B;  2ASD A;  2C3P A;  2ZM6 F;  2F4F A;  4YR2 A;  1C1C B;  1RIS A;  1TEL A;  2DNN A;  3PY8 A;  3IBW A;  3BEG B;  4OHV A;  3GR1 A;  3UR3 C;  4ZVO B;  3DKD A;  4CNY A;  2QSF A;  3KDO A;  3W3S A;  2D69 A;  1R31 A;  1NAQ A;  1RAG B;  5HL7 Q;  1TK0 A;  1TQL A;  2XZD B;  1A9N B;  1YZ7 A;  4DR2 J;  2ROP A;  3QGG A;  3KHR A;  4E0D A;  4CO5 A;  3LAN A;  4B9N A;  3FRY A;  2F4V J;  2IFX A;  2U2F A;  1S6P A;  2AYB A;  4F0M A;  4OYZ A;  2PII A;  4LR8 A;  1NUE A;  1HW9 A;  4JV5 F;  3HHL B;  3AY0 A;  4EBE A;  1VGY A;  3I0S B;  3ET6 A;  5C2G A;  4LIR A;  4R5P A;  3KUE A;  4OYP A;  3DOM B;  1CQN A;  3QIP B;  4DV3 J;  2FJW A;  1FJ7 A;  4Y2C A;  2KYX A;  2MY8 A;  4DF8 A;  4OZ1 A;  1IBM J;  4K4W A;  2DGT A;  3E2E A;  4KGZ B;  3UN3 A;  2MLZ A;  4ZP9 A;  1T3N A;  3J80 U;  4ZPW R;  2AD9 A;  3JTN A;  1TZ0 A;  4TVA B;  5AJ3 F;  1XN9 A;  1E6Y B;  1AT1 B;  4AFF A;  3NCP A;  1JXV A;  1BD6 A;  3IFE A;  5KFY A;  3PYG A;  1EQ0 A;  4KKO B;  2J6S A;  2OPR A;  1HD0 A;  3EXY A;  2IAJ A;  3DRS B;  1VBX A;  3VV2 B;  2NYI A;  1O0P A;  2GIF A;  3U27 A;  4PWD B;  1WI6 A;  2UXB J;  5HBM A;  3RJM B;  3SSS A;  4ZIW A;  1N33 F;  2KFZ A;  4IH6 A;  4MTP A;  2BKO A;  1SV5 B;  1PYO B;  5HO4 A;  1VBZ A;  2NR0 A;  3MR3 A;  2V4R A;  2BE2 B;  2OFH X;  2FVR A;  2RML A;  4B17 A;  2V2Q A;  2YQ1 A;  1T9U A;  2EC2 A;  5DQG A;  2IPO B;  4JI5 F;  4DWI A;  1FD2 A;  1IKY A;  2G0J A;  4A8Q A;  3G96 A;  1R8P A;  2HHH F;  4LQ9 A;  1K0V A;  5GMK a;  1RT7 B;  1VOM A;  3LGN A;  1WJ9 A;  2EPI A;  4MT1 A;  3HT0 A;  2YKP A;  4ANC A;  5E5N A;  2ZH9 A;  1QSY A;  4LBP A;  4ZN3 A;  3ITH B;  4I69 A;  3V4I B;  4O44 A;  2KG1 A;  1WSR A;  1HI0 P;  1VJW A;  1LEO A;  4IRK A;  4NPO A;  2ZBQ A;  1MG7 A;  3ICL A;  1YJU A;  2DEI A;  2ZEJ A;  3VVU A;  3OTO J;  1FDB A;  4FZV A;  1X0P A;  2V4J A;  2AMC B;  4OI4 A;  1IWG A;  3V81 B;  3LAM A;  3CCJ S;  4B02 A;  3IG1 B;  3CWJ A;  2FYX A;  1D9A A;  2ZZM A;  3TOQ A;  5DJB A;  1CVJ A;  3NAI A;  2B7C B;  1B99 A;  1NDC A;  1U2R A;  3DRR B;  2DH7 A;  1N5T A;  2C2M B;  3LAK A;  1RHQ B;  3CCR S;  3TZZ A;  5A8W B;  5KT2 A;  1NND A;  5A0Y A;  2N3O A;  3M2U A;  2R7R A;  3OXF A;  1QSL A;  2MZ1 A;  3CCQ S;  1QD1 A;  3AOB A;  5IM0 A;  2UV8 G;  1ZS6 A;  4ECR A;  1RWK B;  2K8G A;  1RAC B;  1YIJ S;  2RHS B;  3EGV A;  3HXM A;  3CCM S;  3IC1 A;  3QGP A;  2BVZ A;  4Q2L A;  2CWX A;  2ZDP A;  2WRM A;  2E5L J;  2ZC4 A;  2EBG A;  4ALZ A;  1S99 A;  2E1P A;  2YPY A;  1ZAW A;  1NK0 A;  3VAF A;  4NMX A;  4TYB A;  3PRB A;  4NLX A;  3PXG a;  4CRJ A;  2VG6 A;  4M5D B;  5DGB A;  2VFV A;  3ZZT A;  4DX7 A;  5HMW A;  1F9F A;  2DNZ A;  1ROF A;  5MLC V;  2GFF A;  4YR3 A;  1SQE A;  3O2I A;  1TU0 B;  3R5B A;  2P9G A;  3US5 A;  1QE1 B;  5KG4 A;  2G0C A;  1O6X A;  2C2E A;  4AL7 A;  4NA3 A;  4CLW A;  1VIX A;  2HEK A;  3PAC A;  4UZB A;  4ZVG A;  2KTQ A;  1SC3 B;  2HND A;  1R8H A;  4PEO A;  2RSQ A;  3PJW A;  4IR9 A;  2ZJR Q;  3CW2 C;  3Q8S B;  3TAM A;  3UNY A;  4DUT A;  4F3O A;  1S6U A;  5KFF A;  3PO4 A;  2CNN B;  4B3O B;  4N7T A;  1LFW A;  1FX2 A;  5E3A A;  2QC3 A;  2AU0 A;  3LP0 A;  1SPB P;  4ZPV R;  2WB1 D;  1XR7 A;  3S7R A;  1IN0 A;  5CYM B;  4CTA A;  2HFV A;  1UFW A;  2ZH3 A;  2CPD A;  3NKY A;  3H25 A;  4ZJL A;  2IVF B;  4OX9 F;  1F3F A;  1V3R A;  2YH1 A;  1QAX A;  1P8G A;  2DBB A;  1HNZ F;  2IMW P;  3HCX A;  3K59 A;  3H5Y A;  3M2R B;  1W25 A;  4MMO A;  4Y2M A;  1TK5 A;  4X66 F;  5IWA F;  2MPU A;  1EKR A;  5K20 B;  1N0V C;  3N5B A;  2DGO A;  2VBY A;  2CPF A;  4F25 A;  1TKT A;  1RT5 A;  2OSQ A;  1KDN A;  2XI2 A;  4RUC A;  4PWU A;  2ZH6 A;  2I5J A;  1WC1 A;  3DLK A;  1OO0 B;  3H2L A;  3DGP B;  2GJ2 A;  1RHU B;  3KLE B;  4OFZ A;  2BAC A;  5F9L A;  2V8G A;  4IRC A;  4I2Q B;  1YRT A;  3VAG A;  2KJW A;  2G4B A;  2B0G A;  1ZM3 A;  1GQE A;  4Y28 C;  4DUZ F;  3HFK A;  3R9L A;  4CLU A;  4GC7 A;  2HVH A;  3IP0 A;  3C14 B;  3SMZ A;  5E3P A;  3M8R A;  4JI7 F;  1TKZ B;  2VQF F;  1TP7 A;  2DRA A;  5KFX A;  3G6E S;  1HBM A;  3QBC A;  1NRK A;  4IH7 A;  3IN5 A;  3BN7 A;  1RWW B;  2OPS B;  1HKA A;  1SC1 B;  4CM2 A;  1H73 A;  1HQU A;  1F2H A;  2FVQ A;  3NRB A;  1PYS B;  1FT8 A;  3AJ1 A;  4I56 A;  3VGV A;  5HAN A;  3Q8V A;  3KWM A;  1HYS B;  2CYY A;  3W5Z A;  5KG0 A;  3M32 A;  4I6W A;  5KFA A;  4AUK A;  2EI5 A;  4NCG B;  2O3D A;  3HHL C;  4M8L A;  4X65 J;  5EHH A;  5D3G A;  5B08 A;  3ADA C;  2BJ7 A;  4XPE A;  2XMM A;  2KHD A;  1Q78 A;  3LW5 C;  1HQE B;  2HQG A;  3QSY B;  1EJ7 L;  1C1C A;  3CIM A;  3HSZ A;  3TO8 A;  2GHP A;  2N82 B;  3BQ1 A;  5H1S V;  3BSA A;  4K0K F;  5A6P A;  2XNR A;  5L38 A;  3CDE A;  3FUY A;  2AJ4 A;  1CPZ A;  2B5J B;  5LXR A;  3AB2 B;  5ETT A;  2RE1 A;  2HVI A;  3OTB A;  1KNZ A;  3UDE A;  3J7Y I;  2IJF A;  1WF0 A;  1XR5 A;  2H4Y B;  3NGD A;  4DQS A;  1VQO S;  3HHL A;  1BY9 A;  5LSO A;  4DS4 A;  2XSJ B;  1DLO B;  3I0S A;  2QL5 B;  1Q7L B;  1Q8I A;  3OUY B;  3HSD A;  3DOM A;  1EB0 A;  3QIP A;  4L74 A;  2YKO A;  2W9C B;  5FLX U;  2W2M P;  1DHM A;  2J6T A;  3ZZU A;  2LEC A;  4C8L A;  3OVB A;  3BGR B;  3AXM A;  1QY7 A;  1S1V B;  5HJY A;  3CCZ A;  4ED7 A;  1SL1 A;  3D28 A;  2DHH A;  4K4T A;  3R5G A;  2E29 A;  1X5O A;  2H51 B;  2PI5 A;  2R7S A;  4PYD A;  2AYE A;  4O3O A;  1E6Y A;  3ENV A;  1QTN B;  3R5C A;  2A0F B;  2ZHO A;  3EE3 A;  5E2Q A;  2H5I B;  2J0Q D;  1KTV A;  3MM5 B;  4NLY A;  3J7Z T;  4X4N A;  2CJK A;  1FRJ A;  4KJI A;  4KKO A;  2VFR A;  4BHQ A;  4UOH A;  4ZP7 A;  2PN6 A;  3DRS A;  4CO0 A;  3KLG B;  1S1U B;  4PWD A;  5ADZ A;  4DCO B;  3I82 A;  1IBL F;  1JJH A;  2DIT A;  2RDI A;  2XGQ A;  1S1W B;  2B6A B;  1N34 J;  2IDL A;  1JNZ B;  3TAQ A;  1SV5 A;  3H42 A;  3QT8 A;  4ZS6 A;  3F73 A;  2YWH A;  5LMU F;  3MCS A;  1VQL S;  1HNI B;  3M6W A;  4ELT A;  1AW0 A;  5ETS A;  1VHI A;  2BE2 A;  4AYB D;  2J6U A;  3I4P A;  2ABY A;  4DV6 J;  1FWK A;  4WXW A;  1Y3J A;  1RWU A;  1PC4 A;  2OJ3 A;  4ELU A;  3CJQ A;  3VQT A;  3OFH A;  3R1L A;  3TQE A;  3D6F B;  3RW6 A;  1RT7 A;  3MAQ A;  4P2F A;  2VG7 B;  4UY8 5;  5L1I A;  2CQD A;  5A2Q Y;  4J9V A;  2RS8 A;  2YPZ A;  4TY9 A;  3MM8 B;  1CJV B;  3ITH A;  2HWI A;  2DR9 A;  2VOP A;  1JLE B;  4J91 A;  3V4I A;  1CC7 A;  4GKJ F;  1IM4 A;  4ZOS A;  4LF9 F;  1KSP A;  4QYZ J;  4IO9 Q;  1CSJ A;  2LFV A;  3Q89 A;  2HAI A;  2NPF A;  4C0B A;  1VK8 A;  2QFI A;  2DCL A;  2NUH A;  3OVA A;  4L6V 3;  4ATN A;  5JJB A;  2WVC A;  4B08 A;  4RL1 A;  3V81 A;  4A8S A;  5E0O A;  4KAI A;  3D1Q A;  1VQS A;  3IG1 A;  4NEZ A;  4JOU A;  4MK8 A;  1EAR A;  4FYX B;  2EWH A;  4DCJ B;  4UUW A;  2VIH A;  2CJA A;  4HT7 A;  1EX8 A;  1J5O B;  2CZ9 A;  1URR A;  2PC6 A;  3C6U B;  2LKZ A;  2DVI A;  1U8S A;  4BDP A;  1IKX B;  2E7V A;  2FHJ D;  5A8W A;  4YB5 A;  4RBU A;  4OLP A;  3SQG B;  2W24 A;  1MML A;  2BW7 A;  2WON B;  4OYX A;  5LT5 A;  2HFO A;  2D3Z A;  4FF3 A;  4KGK A;  4YP3 A;  4USV A;  2YX4 A;  3QFW A;  2KFN A;  4YN3 B;  2KZZ A;  1RHJ B;  4XO0 A;  3RG6 A;  3BO4 A;  4RU2 A;  1X7V A;  2AKW B;  1PC5 A;  4LF4 J;  1F5A A;  1LW0 B;  5CAA A;  1FE4 A;  1NHK L;  4M5D A;  1PBU A;  4FYY B;  2R8H A;  3LPY A;  4JV2 A;  1W7W A;  4UW2 A;  1K47 A;  2VH7 A;  2JEJ A;  2FVC A;  3OL6 A;  4ECW A;  1ZTT A;  3DFE A;  1QE1 A;  2K3K A;  1T9V A;  2B4V A;  3AAW B;  3M9O B;  5DS7 A;  3TW0 A;  3AQO A;  3DLL Q;  5D15 A;  2ZH2 A;  2JLE A;  5L1L A;  3AQP A;  3P6Y C;  2JJ4 D;  4DUY J;  2BXJ A;  3N01 A;  2UUC J;  3IWN C;  1Q0N A;  2HAF A;  3M30 B;  4UZC A;  1ZYQ A;  1YDL A;  2VKR A;  4B3O A;  1IUJ A;  1PYT A;  3SIP B;  4TNO A;  3ONQ A;  1CLF A;  3IS9 B;  2MZJ A;  3NP5 A;  4QW9 A;  1B64 A;  1NKB A;  3I5C A;  1OPZ A;  2FZG B;  3M05 A;  4K2X A;  5CYM A;  3TYT A;  3TAR A;  1SUQ B;  2KU7 A;  4IOC Q;  5SUH A;  3NGS A;  1MN9 A;  2RQ4 A;  1VS3 A;  5IXU A;  5ETV A;  1BE4 A;  2VON A;  2V2V A;  2FLL A;  1LXJ A;  2J8A A;  4WXO A;  5KFC A;  4Y2I A;  2V9W A;  3M2R A;  3JAM U;  1WF2 A;  7FD1 A;  1R8A A;  2ZZN A;  3R8Y A;  3QPI A;  1BXN A;  1XQI A;  2XS5 A;  3MUT P;  2MZR A;  2W4C A;  2J5A A;  2B7B B;  3AFG A;  2R2R A;  1S72 S;  3NMR A;  1WSV A;  2DNL A;  4LFA F;  4NXN J;  4A8W A;  2KM8 B;  2P9E A;  4ZLL A;  1ITP A;  1NH8 A;  1VQ7 S;  3DGP A;  1R0A B;  3D5M A;  5LOQ A;  3KLE A;  4DSE A;  1JB0 C;  3TZY A;  4FP9 A;  4CM0 A;  4I2Q A;  1KQS R;  3W9J A;  4LRE A;  3PKY A;  2B9Y A;  4DXL A;  2XTJ P;  3E8O A;  1S12 A;  5ETL A;  2LP4 A;  4LUB A;  1GT8 A;  4HEA 9;  1S48 A;  3NLC A;  2M8D B;  1FKP B;  1RTZ A;  1F9E B;  3AH6 A;  4C8O A;  1I51 B;  4C6A A;  2JC1 A;  2UUA F;  4JI0 J;  3EPG A;  3C14 A;  2KXH A;  1WOS A;  2IVY A;  5H9F J;  1TKZ A;  2J7U A;  3OFE A;  4DX6 A;  4F3Q A;  1GH8 A;  3Q8Q B;  2OPS A;  4ZLN A;  2UXD J;  4QWA A;  4QWE A;  5G4D A;  2CJB A;  3BSC A;  3C16 B;  1VRU B;  1NK5 A;  4WK3 A;  2E5G A;  2BE9 B;  1HYS A;  3FBB A;  3TRG A;  2NCK L;  4U7U K;  1WAC A;  2CAJ A;  1R3N A;  3A3P B;  1Z2L A;  1WD6 A;  4M5N A;  5GAH U;  4NCG A;  3SFG A;  3HX9 A;  1I3O B;  2D9O A;  2ADC A;  2HW3 A;  3BGL A;  3TA1 A;  3DDK A;  1WOP A;  4RWW A;  2F7V A;  4YY3 F;  1HQE A;  2H48 B;  4DBQ A;  4JI3 F;  2I1R A;  1KTQ A;  1S59 A;  2YTC A;  3IBF B;  2VQE J;  5KFV A;  3B54 A;  4HR2 A;  3W5X A;  4E98 A;  1YGY A;  1C1B B;  2UUT A;  1RWO B;  2IJR A;  1B7F A;  2KZM A;  2EK1 A;  3T6B A;  4MIB A;  2KJV A;  2B5J A;  1SXL A;  2CJY B;  2MJU A;  2MLY A;  3IGV A;  1WG5 A;  4DR4 F;  2HZV A;  4ELV A;  2GAH C;  4A4J A;  5ETN A;  3DXS X;  4QU7 A;  2P8I A;  1WHX A;  3A13 A;  1FWL A;  3JSB A;  1FHT A;  5B09 A;  3MEE B;  3D0G E;  4C48 A;  1NCL A;  2HRT A;  3RR7 A;  1TMM A;  4CH0 S;  3WC0 A;  1M0S A;  1RLC L;  2XSJ A;  3PHE A;  3GMG A;  1DLO A;  4YOE A;  3D68 A;  1H98 A;  3KHL A;  3OUY A;  3IRX B;  1FI4 A;  3CXC R;  4RX6 A;  2BAN A;  2ZBI A;  2W9C A;  4Q5V A;  4Q45 A;  2YQ0 A;  1Q79 A;  2C2K B;  3MM6 B;  4DV5 J;  2PMZ D;  3VAL A;  2EEY A;  3N4W A;  5KG5 A;  5CH7 B;  1S1V A;  5GAG U;  4JI8 F;  2HFN A;  5G0R B;  2WAQ D;  2MMY A;  3MAA B;  4RW8 B;  3RBE A;  4O3S A;  4MKA A;  2CUY A;  2R8K A;  3KHH A;  2Y0B B;  4Q7A A;  5C42 B;  1YK9 A;  5J2N A;  3BBB A;  3Q8R B;  3MM5 A;  3KK3 B;  1D8Y A;  3EGZ A;  2LU1 A;  1FCA A;  2OEM A;  1T05 B;  1WKJ A;  5DDP C;  4DV7 F;  2E1C A;  1S1U A;  3Q8Y A;  1Q5Y A;  4LVO P;  4MKB A;  4X84 A;  3ENW A;  4LF7 F;  2YKN B;  1S1W A;  2B6A A;  2CG8 A;  3EX7 B;  1YHQ S;  4RO0 A;  5F8J A;  3HVR A;  3R7B B;  4GKK F;  2MZT A;  3F56 A;  2OI2 A;  2HHP A;  3UR0 A;  1X4H A;  2UVR A;  3DU5 A;  1HNI A;  2HWT A;  1WKK A;  1Z2Z A;  2OFG X;  4RKU C;  3J7A 1;  2GV1 A;  1KLN A;  4EEY A;  5KFM A;  1X9M A;  3QO9 B;  3BQ0 A;  1HLW A;  1HI1 A;  2AP6 A;  1EZZ B;  2VG7 A;  7FDR A;  1G1X A;  2HHX A;  2W25 A;  2QT7 A;  1YIT S;  5KG7 A;  3MEG B;  3VWS A;  5DG9 A;  1CJV A;  4C7Q A;  2O67 A;  2NXJ A;  1JLE A;  1XTZ A;  2LA6 A;  5HP1 B;  3KLF B;  2VB6 A;  3BGU A;  3NGK A;  3GYG A;  1FK9 B;  1NJW A;  2BW2 A;  5KFT A;  2FHM A;  3CCW A;  2XY5 A;  2UUW A;  1GK8 A;  1PIL A;  3G71 S;  1DQ8 A;  3M6V A;  3W5Y A;  2VDH A;  4ZCI A;  1UJ6 A;  4LVN P;  1B7Y B;  4CYU B;  2AV5 A;  1ZM4 A;  4M1K A;  4C0H A;  4C8K A;  2Y1R I;  1YG0 A;  1L3V A;  4NLT A;  1T9W A;  2RNE A;  2ZUG A;  4YR0 A;  1J5O A;  3OV7 A;  1TFW A;  3C6U A;  3F44 A;  1H3D A;  1IKX A;  5IT4 A;  2MQP A;  2CQH A;  3SQG A;  2HNZ A;  5J1E B;  4NLG A;  2OLW A;  3PW0 A;  2WON A;  2V8P A;  1G2E A;  4DX8 H;  1GTH A;  1S7H A;  4N56 A;  3A8I A;  2XCA A;  1SBR A;  1EIY B;  4L72 B;  3JB9 k;  2WSE C;  4WPA A;  2HFU A;  2K06 A;  4HAC B;  4YDX A;  4CO4 A;  3T1Y J;  2MZQ A;  1LW0 A;  1B0V A;  3NL0 A;  3OSP A;  4J9N A;  1FRH A;  4ZHR B;  4I67 A;  2GMJ A;  2I8E A;  1ZH5 A;  2RIJ A;  5E41 A;  1XWL A;  1ICE B;  4ES3 A;  1F2G A;  4OHY A;  4N8N A;  2CNO B;  3VHQ A;  5FD1 A;  1H38 A;  3HI9 A;  2GIR A;  4ZK7 M;  4O4R A;  4ZLJ A;  4F4W A;  2XS7 A;  5LSR A;  1RWX B;  3FBF A;  3KKF A;  3W63 A;  3OL9 A;  4IUF A;  4YFU A;  2XQC A;  2LXU A;  4PR6 A;  3DCA A;  1S0V A;  4JYA J;  4M5K A;  4MFB B;  1M5O C;  4WFA Q;  4WP9 A;  4DR1 J;  4KB7 A;  3NS7 B;  4P6Q A;  3IWX A;  4YUD A;  3PFO A;  2M7S A;  3M30 A;  1UWA A;  2I9S A;  2P5V A;  2ZKU A;  2DO4 A;  3K58 A;  1UKU A;  2HBZ B;  4RW7 B;  2KI2 A;  3IS9 A;  4HKQ A;  1WOR A;  2M8H A;  1DFD A;  2KM8 C;  2RRN A;  4J9Q A;  1HFE L;  1V3Z A;  1ACM B;  3MUV P;  4J9O A;  4HI1 A;  1S77 D;  3TZX A;  2RHQ B;  2J8S A;  1FFW B;  1SUQ A;  4USW A;  4F0H A;  4PQA A;  5HQ8 A;  5D4N A;  3ETM A;  3IM8 A;  2HGL A;  2YWK A;  4H4O B;  3EMT A;  2ZUA A;  1KRP A;  1IVZ A;  2XMU A;  4GMK A;  1WEY A;  3D66 A;  3T41 A;  1SL2 A;  3RBD A;  1C2P A;  2EFO A;  2J0W A;  3HHD A;  4DR2 F;  2ZWO A;  4NLS A;  2MQL A;  3HVW A;  4HYK A;  3ZTQ A;  5CAB A;  3HPO A;  5I3P A;  2F4V F;  4DV2 J;  3MUR P;  4DV4 J;  3THT A;  1YJ7 A;  2ZHA A;  2I38 A;  2WZ1 A;  1REV B;  3QZ8 A;  4DQP A;  1MWQ A;  4ID8 A;  1YBU A;  4F04 B;  2RT3 A;  1RBO B;  2QLB B;  4N77 A;  1F0X A;  1R0A A;  3G87 A;  2GZO A;  5GVQ A;  1H2T Z;  5C2C A;  3RBX A;  4IOA Q;  4JI4 J;  4DV3 F;  4EWT A;  1OY6 A;  1IBM F;  1A0O B;  1U25 A;  4X4P A;  4DZ6 A;  3BSO A;  4C4W A; 
#chains in the Genus database with same CATH homology
 4X64 J;  4JI0 J;  5AJ3 J;  4DV0 J;  3T1Y J;  1HNW J;  1IBK J;  3R2C J;  4LF8 J;  1HR0 J;  2UU9 J;  4X62 J;  4JI2 J;  2KL8 A;  1J5E J;  4JI8 J;  4DUZ J;  1XMQ J;  1N34 J;  5LM7 E;  2UXC J;  4LFA J;  3JAM U;  4NEZ A;  3D3B J;  2UXD J;  3J81 U;  4DV3 J;  4JI3 J;  4K0K J;  4OX9 J;  4KHP J;  4LF5 J;  2KVQ E;  4B3T J;  4JI1 J;  1IBM J;  1HNZ J;  4HHU A;  2VQF J;  2MTL A;  4DV6 J;  4B3S J;  4YY3 J;  5A2Q U;  5FLX U;  2UUA J;  4LF6 J;  4JI6 J;  1FJG J;  1N36 J;  1N33 J;  4X65 J;  2MEW A;  4DR3 J;  4KYZ A;  3J80 U;  1IBL J;  4NEY A;  4DV2 J;  4DV4 J;  4NXN J;  4JV5 J;  4DUY J;  4AQY J;  4GKJ J;  2MQ8 A;  2UUB J;  1N32 J;  1HNX J;  4X66 J;  4LF9 J;  5IWA J;  4DR4 J;  4DR7 J;  2UUC J;  1XNQ J;  4B3M J;  4LFC J;  1XMO J;  4DV5 J;  4JI7 J;  4JYA J;  5IT9 U;  3T1H J;  3J7A N;  4LF7 J;  4B3R J;  1I94 J;  3IMQ J;  4DR1 J;  4V1A k;  5BR8 J;  5LMU J;  4KY3 A;  4LFB J;  4DR5 J;  4GKK J;  4PWW A;  2E5L J;  4DR2 J;  4JI5 J;  4DV7 J;  4DV1 J;  4JI4 J;  4YHH J;  4RJV A;  3R2D J;  5LMN J;  2HHH J;  3OTO J;  1XNR J;  2VQE J;  2F4V J;  2ZM6 J;  2UXB J;  4LF4 J;  4NXM J;  4DR6 J;  3D3C J;  3W1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...