4KY3A

Three-dimensional structure of the orthorhombic crystal of computationally designed insertion domain , northeast structural genomics consortium (nesg) target or327
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARSSKEAYKFLAILAKVFAELGYNDINRKMTVRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEITITGVPRQVLEELAKEAERLAKEFNITITITVTVEGQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Precise assembly of complex beta sheet topologies from de novo designed building blocks.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords designed protein OR327
total genus 40
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ky3A00
4LFAJ 4YY3J 1XMOJ 4LF9J 5BR8J 4YHHJ 4X62J 1J5EJ 4DV5J 4DV0J 4DR3J 2UUBJ 3J80U 3OTOJ 2KVQE 4DV6J 1IBMJ 4OX9J 4DV1J 3D3BJ 3W1YC 4PWWA 4HHUA 4DR5J 4DV7J 1XNQJ 4GKKJ 4JI7J 4LF4J 4KHPJ 3R2DJ 4JYAJ 3T1HJ 4JI1J 4DR2J 1XNRJ 3D3CJ 4KYZA 4B3SJ 4K0KJ 2VQFJ 4DUYJ 4LF7J 3IMQJ 4DV3J 3T1YJ 4DV4J 4NXNJ 5FLXU 4JI3J 2UXBJ 5LM7E 5LMNJ 1I94J 4JI0J 5IWAJ 4DV2J 4X64J 1XMQJ 4B3RJ 2UUAJ 5A2QU 4DR4J 4LF5J 2HHHJ 1N36J 1N34J 4B3TJ 4NEYA 1N33J 2UXDJ 4GKJJ 4B3MJ 1FJGJ 4LF6J 4LFCJ 4JV5J 3J81U 5LMUJ 3R2CJ 2F4VJ 2ZM6J 1HNWJ 2MEWA 4LF8J 4JI6J 4JI8J 4DR6J 2VQEJ 1N32J 4NXMJ 4AQYJ 2MTLA 4V1Ak 4RJVA 5AJ3J 1HR0J 4JI4J 5IT9U 1IBKJ 3JAMU 2UUCJ 4X66J 4JI5J 2MQ8A 4DR7J 2UXCJ 2E5LJ 4NEZA 2KL8A 4KY3A 1IBLJ 2UU9J 1HNXJ 4LFBJ 4DR1J 4DUZJ 4JI2J 1HNZJ 3J7AN 4X65J
chains in the Genus database with same CATH superfamily
3HKZD 1BQNB 3RBEA 3MUVP 2M0GB 2ASDA 1TFYA 4ILMA 1U2RA 6AT1B 1CJKB 5M2UA 3DOMA 4FXWA 2L9WA 4HR2A 1TMMA 1I5OB 2CVIA 2XHWA 5KFBA 2ZH1A 2J9EA 2XBPA 3AOAA 3HDSA 1T7PA 1VFJA 3ONQA 2UUBJ 4OHYA 2GNKA 2R8HA 2YNHB 3QT6A 4O3QA 1K47A 3RTVA 2HRTA 1F9EB 3K5PA 5DJBA 2HVEA 2XYHB 4XPEA 1CQMA 2RS2A 4Y65A 1S1VA 4CYUA 2HW3A 1DBDA 3ILIA 1S79A 5CYMA 4C9DA 1RHMB 2GVZA 3CEDA 4QWEA 4LRCA 4DV7J 1N5YA 1FKOA 1JLBA 2G0JA 1TL7B 1YX2A 3R7NB 3UVJA 2ZUAA 4DX5A 1NZ8A 1VRUA 3FEYB 4RPFA 4USTA 3R2DJ 3SSQA 3OFEA 4U9RA 5GAHI 2HHPA 1MNEA 1WEZA 1QUPA 3NCPA 3THVA 1NK7A 2CPFA 4IUFA 2ATLA 1Y5LB 2V94A 3ETMA 3LA0A 7AT1B 5KFNA 3PFEA 4LF6F 1Q5VA 3FSYA 1UTAA 1WTFA 2OKQA 2VG6A 3OPKA 5J1EA 5HANA 5J2PB 4N5SA 4LFCF 1LXNA 3PRVA 3U1LA 3ITHB 4K2JA 4RW8B 4AUKA 2IJRA 5B0CA 4ERDA 1UVIA 1RE1B 2M4MA 2YNHA 3C6TA 2GAHC 3M8SA 1S72S 2DCUB 1NXIA 1D0EA 3J7A1 4ZPVR 2A6MA 4DQQA 3LANA 3H2UB 3VAKA 1UPMB 2CJXB 2JC1A 2VC0A 2W2MP 5KFYA 2BKOA 3OTOF 4FYVB 3DRSB 3I6PA 4PZVA 1FEHA 2DO0A 2V34A 4DMZA 2EKYA 2ZHBA 2I0XA 3NS6A 4ZN3A 3KLIA 3VAIA 4M1KA 1HL6A 2QN6B 3CJTA 1I94F 3OUYB 3T19A 1JKHA 2VG5A 3ENQA 1RAFB 3MCNA 3GFYA 4PWDA 3M2UB 1R27B 3D1HA 2UXDJ 2YWEA 3SSRA 4C11B 2AW0A 1EP4A 4FKYA 2DKOB 5E7OB 5F8IA 3D1QA 2OTJS 2P9EA 2HS4A 4QPTA 3OTCA 2MKJA 3AODA 4WIIA 1HQEA 4HDHA 4EO6A 2DXEA 2VQEF 2AGOA 2VV5A 2BANB 3PM9A 3Q22A 3ZZRA 2O5DA 1HNWJ 5DQIA 5D15A 4J91A 2I5JA 4KV8B 4OYXA 2QG9B 1UWAA 4DWIA 4ECTA 4G1PA 4I7FB 2H9ZA 4Y2KA 1LWCB 1Y11A 2FD2A 4GMKA 2B0GA 2Z2ZA 3RBZA 1FWLA 2V6AA 3IG1A 1N5SA 4YDDB 3VAFA 3FCHA 3FK4A 2OAUA 4UOHA 3ZZOA 3ISZA 1T9VA 2NYIA 1KHWA 3DDIA 3ZNJ1 2M9KA 1FX2A 2JL9A 4ZN1A 1T9TA 1YWXA 5AJ3J 2V9KA 5CABA 5BYSA 2KYZA 2W2PP 3IS9A 4FXVA 1EARA 3C14B 2HHVA 1XR5A 1Y7PA 3O2IA 1S48A 3H42A 3ZZPA 4AE5A 4R0EA 2A18A 4ID5B 2OIHA 1OQ3A 2E5LJ 3HD1A 4R8UB 4NLPA 3NP5A 2R7RA 4OYWA 2DEJA 4YY3F 2HYIB 3GPAA 2KN4A 1LFWA 4ZVPB 3DRXA 4YHHF 4IQXA 1S12A 3W2WB 1XR6A 4LBPA 5L1IA 1PAEX 4O3NA 2DNHA 5JVHQ 3NLCA 3V4IA 2IIHA 3QATA 4FVMA 3AH6A 1SL0A 5K14B 4LFAJ 3J7AN 3M2VB 5DDPC 2AJ0A 2DGSA 2G13A 3I32A 1H6KX 4PYAA 1NEEA 3N28A 4A48A 3D0HE 4IG0A 1YKWA 2M52A 3Q8RB 2I2YA 3OLAA 3BN7A 4Z2XA 3CJ0A 2ZEJA 2NXCA 3OFFA 3TI0A 3BQ2A 5D0RA 5B0EA 2PMWA 3W64A 2ZZMA 4WFAQ 4B17A 2BDPA 3MOJB 2KVQE 2MZRA 2XG8A 4H4OB 5F3TA 1IBMJ 3J7YI 4IO1A 3LTOA 2LEAA 2VG7B 4YOEA 3MZIA 3BO4A 4WE1A 1V6HA 2MKHA 4O4RA 1D8YA 2I1RA 2K2PA 1VQ5S 3DHWC 3JYTA 2DGTA 4UOCA 1LWEA 3U1NA 4DEZA 4XDCA 3TOQA 1YJTA 4DZDA 4KHPJ 1UW9A 2JX2A 1WACA 1TUWA 2DNQA 5HATA 5HMXA 2CQ1A 2RD5C 2EFGA 4Q2MA 1YJWS 4N47A 3JSYA 4O0NA 1K8AT 1URNA 3PR4A 3SV3A 1SIZA 1TVRB 1WUUA 3VZHA 1SJ1A 4C3LA 4ZVRB 3N4WA 2BXJA 5KT5A 4K0KJ 1TKTA 1VLYA 4DXLA 1JKHB 1JXEA 2YQ3A 3BGRA 4C3MA 4CWBA 2M7SA 2IVMA 2ZVSA 2UVUA 2KXNB 1GX6A 3T1YJ 4HACB 2DNNA 3C6TB 3VGTA 2QLXA 1KKHA 1Z2LA 4JB8B 3HFZB 1TQLA 4P72A 2Y0BB 4QBUA 2XO6A 1JJHA 2F4FA 2N7YA 4A4JA 1Q7LB 2BZ2A 2V5HG 3ENAA 2E9ZA 2CPZA 1IR2A 2V69A 3BSOA 3CJ8A 1IBCB 2AV5A 4C8LA 2DB1A 3LPYA 5A2QU 2YWKA 1GMWA 3BKTA 3X1LB 2HHHJ 1F9FA 3OVBA 4LRBA 3BDPA 4Q44A 2E5LF 2M8HA 3U7JA 5EGYA 2FHOB 2PE8A 4TU7A 3BB5A 1GXUA 2EI5A 1CJTB 1MROB 3NS7B 3R27A 1S1WA 2OPSA 3P96A 4I69A 1I51B 4CDIA 1QSYA 3SXLA 5L1LA 2VBWA 4J9OA 2PI5A 4PXDA 4ZPTR 3E01B 1OPIA 1Z2ZA 4ZIVA 3JAMY 1CEZA 1SQGA 4RBUA 3ZTRA 3MAQA 5HSPA 3MDFA 2Q3PA 4WFNQ 5F8LA 5CD4A 1DURA 1MWZA 1VS3A 2Z57B 3R6GB 2AD9A 2DTJA 2VPZB 4FDFA 3NNHA 4U95A 1RK8A 4CYUB 2ZJPQ 3MM5A 3LH2S 1O8BA 4C0OC 2D3OR 2DITA 5CYMB 3HO1A 2ZBCA 2VUGA 2CPEA 3OTBA 1F5CA 2Y0SD 3LALA 1K73T 4DF4A 1RT1B 3ILLA 5LSLA 4OI0A 1VBXA 4JI8F 5ETSA 3UVJB 4DPXA 2ZD1A 2AJQA 3UCZP 5KFIA 3VALA 1NUEA 3KG1A 3KJVA 5IT9U 3JAMU 2QMUB 2JEGA 2OP5A 3KMSA 2YWFA 3D68A 3HX9A 2F5GA 2QMXA 5E41A 2MGZA 3I55S 3MR3A 1UAWA 4RNFA 2VJUA 1YTYA 2QJ3A 2UXCJ 2AYGA 4LBIA 3DNCA 1MMNA 1O51A 2I8EA 1BQXA 5T7LB 4IG3A 1S1XB 3PXGa 5HI7A 8AT1B 1T11A 4M5KA 2WSEC 5ETMA 4Q2LA 3UCGA 3X3UA 1HWJA 5BJRA 4QR0A 1HWUA 4PR6A 5CD4H 2ASJA 5DDQC 2NXUA 2HQDA 3CDWA 4FPRA 5HQ8A 2HRUA 2E5IA 3H2VE 3I82A 4XO0A 1U1MA 3N6NA 3AQPA 4TLRA 3O5TB 3OR1A 1F9HA 3CCWA 3IRXA 2OPPB 3BPDA 1WHYA 3C3LA 1IKXB 2O01C 1WKLA 3NGTA 1LOUA 2OHDA 3NMRA 1HWKA 1X9SA 5D0GA 4K50A 2ZE2A 1WD6A 1JLEB 4DV5J 4I6WA 4IDKA 3R97A 1VJQA 2SXLA 4CLZA 4DL3A 2N82B 5KFGA 1HBMB 3QGHA 5C42B 1NB2A 1S9EB 2N3OA 1E6VB 2ZHAA 2KKHA 1P9YA 4EBCA 1TP7A 4WZMA 2CZ9A 2V68A 4ANDA 4YUDA 2ADCA 3UFCX 1M5PC 4DV6J 2HQIA 1TKTB 2KT5A 1SH3A 2LXFA 3MD1A 3H8YA 2HQCA 5CQGA 2MMYA 3UDVA 1Q82T 3BGRB 3DLLQ 3C15B 2G2OA 2YKNA 3BR9A 2CQ3A 4YMEA 4WE1B 2CJBA 4DFJA 2V2KA 2PSZA 4ZLNA 3DYAB 2EK6A 1WWHA 2OPRB 3DGPA 1P9QC 1K1QA 2XZTB 4KO0B 3MAAB 5E3PA 1NK6A 1K0VA 4EZ9A 3ZZTA 2YKMA 3MOZA 1JXLA 3OR1B 3HLUA 3HULA 1PBUA 3OXFA 4RUCA 3I0SB 1B7YB 4YFUA 1R8HA 4DR2J 3D0GE 4MJKA 2F1FA 1XNRJ 3D3CJ 4QYRA 2V8DA 1SUQB 3H5YA 3MEKA 2C1EB 2LECA 1HNWF 4QIWD 1PJ5A 1AZSA 5C25A 1FD2A 2G2YA 1L3KA 1X5TA 3HSZA 5HBMB 4CRJA 4ECXA 2XY5A 4GKKF 1C2PA 2PMHA 3QFHA 4NLUA 3EYZA 2H51B 5IV4A 2L48A 2EWHA 5EWFA 2FDNA 2VG6B 3PYFA 4ID5A 4KB7A 1MU2A 1VDHA 2HBQB 3HVWA 2CPDA 5D4NA 1L3UA 3CDEA 5E5NA 2J0WA 3RYLA 2HBZB 1JJCB 2P8IA 2IDEA 1S59A 2R4FA 2WVFA 4O4GB 5CYQA 3TEGA 1D1UA 2VBXA 1FERA 3BREA 4GC7A 3VAJA 1NCLA 3KOAA 5FDLA 4WZQA 4DPTA 2XTJP 3LAKA 4QYZK 4DV2F 5A8WB 5EWEA 2QRRA 3UW1A 2BABA 2YQ0A 1Y5NB 2ROGA 3QFWA 4GO7X 5IT9Y 2R7VA 1X31C 4OI2A 1Z4UA 1BLUA 1VRQC 5HQLA 1SIWB 3M1VB 2W8LA 3SV4A 4QU6A 4RNMA 4K4YA 4RO0A 4NZ6A 1RADB 2B9XA 2COLA 4G1IA 1KTVA 1WORA 3AXMA 5HBMA 4ZHRB 3SZ2A 1S0NA 3BGLA 1RWXB 4G1QB 2AMCB 3UD3P 1HARA 1SCJB 1VRTB 2DHAA 5ETLA 3M32B 2XHCA 4R5PB 4DR5F 4FN5A 4ECWA 2ZOMA 2D3UA 3P45B 5FIIA 3W60A 1K9MT 3P49B 2ZBRA 4NL5A 1ITPA 5LL6d 3GJTB 2HVIA 1RWUA 2J0XA 5ETRA 2AX0A 3F0NA 1FXRA 5E3RA 3T6JA 3JB9k 4PAAA 2XB2D 1HR0F 1S9GB 5L8RC 3HJFA 2D3ZA 3DLGB 2M3DA 2R7OA 2V8GA 3GJSB 3AA8A 4QW8A 2V4JA 3J7YU 1G6BA 2BQUA 4KFBB 1GT8A 2CPXA 3QGPA 3GU0A 3R9LA 2UUCJ 4ZPWR 2MQ8A 3D6FB 3DC2A 2KDOA 2ACMA 2DHGA 3A3NB 2ACYA 3ULHA 2HFNA 1RA7A 3VCDA 4ED2A 3QLHA 3CCZA 3CJ4A 4PG6A 4CTAA 3SDEB 5IFMA 3CC2S 4UOGA 2CQ0A 1FXLA 5KOXA 5A6WA 2UU9J 1WHWA 5J1PA 4DN9A 1LWXA 3DM2B 2RT3A 4USVA 1NJZA 4M5LA 1NPKA 1TR0A 4P52A 4JI7F 2E66A 3PYDA 2XMVA 1MW7A 3FFIB 2XSJA 4KGXB 1VMBA 1Q53A 1XN9A 2EFOA 2V63A 3KG0A 3SCJE 4CLUA 3OLBA 1FE0A 3CD6S 4WKRA 3W9IA 4EYHB 4LF9J 1IQTA 2OPPA 3DRPA 2VHGA 1S0MA 1TL3A 2HMIB 2B4UA 2CJQA 4ZMMA 5H9EJ 1VQ8S 1RBLA 1YRUA 4KHRA 4CNZA 1CBKA 2V4JB 2LQBA 3QIPA 5AXMA 1WI8A 2WVEA 4AQYF 3KKFA 4P2MA 5AJ3F 2IM1A 3KLGB 3HK2A 1T05B 4ELUA 4I2PB 4BS2A 5CHCB 4ZPBA 2EKNA 3ZC4A 1IJEB 2EC0A 4L3NA 3WIUA 4LBHA 3TZYA 5G0RA 3RBXA 2XS7A 1G2EA 1T94A 1X7VA 3CTRA 5AXLA 4K8RA 2Q6BA 2XEXA 4ZP7A 2RHSB 2R7WA 2QO3A 2JEFA 1IKWA 1DHMA 1W26A 4OFZA 1VBKA 2F3JA 3K8VA 3HHLA 4J9SA 3PW5A 4Y3CA 2DIUA 2C2EA 2Z2YB 4N8NA 1SVDA 2E1PA 3PRBA 4NPOA 4WXOA 1WEYA 2P6TA 5KFPA 3BSNA 2RSQA 6FD1A 2N3LA 1HPZA 1NNDA 3NOGA 4H4MA 4O44A 5IM0A 2OGUA 2VBZA 1U1NA 3HVRA 3CUNA 1F3VA 4ZS6A 3UD5A 4EBDA 2VQFJ 3MMAA 4NI2B 4OYIA 2H65B 1OJ4A 1JMTA 2PDAA 1GTHA 2WVDA 3FQLA 5G0RB 4WTYA 3KUHA 4JP8A 4R25A 3P3DA 4E98A 3L95X 1RT2A 3VVTA 4MKBA 1S1UA 1FEEA 5LSRA 1EIYB 1S1TB 4HT7A 2BANA 5I42B 4EYIB 2W7PA 1HYSB 4DR4J 4F04B 1CJUA 4FYDA 2CKWA 4C8OA 3KXDA 4W90B 1RTIB 2DJWA 3LP1B 4E8UA 5KG5A 2F40A 5FD1A 5IT4A 4RUAA 4PUOA 4KH1B 5D78A 2W7AA 2GIRA 2NQPA 3H5SA 3I31A 3GONA 1LQ9A 1TL1A 2FHMA 3NBPA 4UY85 1C4CA 2K06A 2AJ2A 3GYXB 4NEYA 2HNDA 1VBZA 1JLEA 2HNZB 1T0TV 3DXBA 1C1BA 1DQ8A 1LK7A 1XERA 3Q89A 4OZ0A 3MECA 5H1SV 3JSMB 1HIYA 2MHNA 3MF5A 4CT8A 3IAM9 3V6HA 2NYHA 2DR5A 5A8KB 2HHXA 1OO0B 4P2SA 3SCKE 3BSCA 2QLFB 3GR1A 4P7VA 3KMQA 2OEKA 2EPIA 2OH2A 2F8MA 3EPIA 5AE1A 1S7HA 4OMFG 2FUG9 4RW6B 1ZPVA 1W2BR 2LQ5A 3Q83A 3R1HA 3MPUB 2NLWA 3OVAA 2BQRA 3DYAA 1RJJA 1NK9A 2FJWA 3EGNA 5D3GA 2R7TA 2PA3A 5KFOA 2XMJA 3LP1A 2FVPA 1HBOB 3H2LA 4EMDA 4WWSA 5ITHA 3H40A 3SIPB 1MWQA 3QT7A 1WC5A 1Q95G 3V4IB 1HR0J 1VQ4S 1EB0A 1KQKA 2FVCA 2DNOA 5H9EK 3QSYB 2J0SD 2VFSA 3D66A 3J81Y 1C1BB 1U0HA 1ZTWA 4IFYA 4PWUA 3W63A 1MMDA 2QLWA 3AJ2A 1RHKB 2KL8A 2XO7A 2CPHA 1RBAA 3I87A 3FUYA 4D3GA 2G2ZA 3MD3A 2D3O1 4GRSA 5DDRC 3AD8C 3AOCA 3HI9A 5LJ3Y 1XMQF 4DR7F 4JI2J 3AY0A 2JRSA 3BGOP 3BZQA 3LOUA 3M8YA 4OZ3A 4Y00A 4A8XA 3IRWP 1NSAA 3ICLA 4DG1B 1LW0A 3C6UB 3IC1A 3JSRA 3MMBB 3NGRA 4N77A 2MZ1A 3CCLS 4O3PA 3P5BP 3G8QA 4F50A 1V9OA 4KGKA 1S9FA 4R0JA 2CQ2A 4RW9A 4RW7A 3PYGA 5T41A 4ZVTB 3KYLA 2KTQA 5A8WA 4PRFA 4FF4A 1JWWA 4I7FA 3DXSX 5HMWA 3PIOQ 2BJ9A 2RRNA 3BBBA 4ZVSB 4QQBA 1X0FA 2IA6A 5K8NA 1LW2A 3MM9A 4M95A 1TL7A 1JX4A 4LSNB 1IR0A 1OY8A 1UETA 4QWCA 3VAMA 1UZHA 2H3EB 2ZDOA 3GIRA 3TQEA 4O0IA 3PJWA 4NCAA 1N5VA 4WXWA 4KKOB 4ZLLA 3M8WA 1VQSA 4WF9Q 1R0CB 2WRMA 4CH1A 1V5VA 5AT1B 5L46A 1DRZA 4GKKJ 2AHOB 4YB6A 4DQIA 4ZJOA 2WSFC 1S0VA 1OY6A 2VF3A 4NLRA 1RU1A 1S6PB 1QTNB 1RDRA 2EFPA 3PW4A 2AF6A 2LXUA 3G82B 2NR0A 1C1CA 2BE2B 2L9DA 4J9VA 2G1DA 4F4XA 1YJNS 4LSZB 3H5XA 3DGPB 1BD6A 2CYYA 3R7SB 3F44A 1X4BA 4AD6A 4KH0B 1ELOA 1NPRA 4DV5F 4FS1A 2LEPA 1FTRA 4RU2A 4OV1A 2RH3A 4IFVA 1TL1B 1ZAXA 4YP3A 3P8BB 3MURP 3IMQJ 5F0UA 2FJEB 1P1LA 1NU4A 1RGVA 1VQ6S 3Q24A 5HL7Q 5J2PA 5K20B 5KT6A 3PW2A 3K5NA 1HQ2A 3GJQB 3IBFB 5D6GA 4MIWA 4UQGA 4C11A 1KTQA 2LDIA 3KJNB 2C22A 1QAIA 4NLGA 4PQUB 5ETKA 1VQKS 3A4TA 3RRGA 1N36J 4OYBA 3RAQA 3LW5C 3ENVA 2W25A 4HHJA 4DOZA 1Q16B 2E1RA 2EBEA 2AYBA 3CB4A 3R5GA 3DRPB 4K0KF 1G4CA 3MUMP 1IQZA 5EX0A 2DRAA 1Q5YA 4K5RA 1DAXA 1NAQA 1F5BA 2BM0A 3WC0A 1TMJA 2NREA 2CG8A 4ZPDA 1TKZB 3KJFB 3MM7A 3HVTB 1RWVB 3D1OA 3IP0A 4JV0A 1RTDB 2FC8A 1HA1A 4ED1A 1RB0A 2IRYA 3UDLA 1Y4ZB 2VODA 4DZ6A 2GX8A 1FDNA 1H2VZ 4IH6A 1PYOB 1Q8IA 4G1QA 1RU2A 1IKWB 2D74B 4YB7A 5IC6B 4USMA 3QGIA 2W9BA 2Z2LA 1UJ6A 5DS7A 2LMIA 1VQOS 1NK4A 3DDNA 3U27A 1DTQA 2ZWOA 2DH7A 1FNXH 2YNIB 5HMYA 3C6UA 1RKIA 3MM8A 1U24A 2JZ5A 4LR8A 3KNAA 4JI5J 1JLAB 5LOQA 1NPPA 1T95A 2W24A 1NSKL 4OHXA 1BGXT 5D4OA 1HBNA 3CXCR 5L9XA 5JXSA 4DHVA 1FJCA 1IBLJ 1WG4A 1MMLA 1E6VA 2HAFA 2B56A 1GMVA 1HW9A 1C0TB 3FZ2A 2F7VA 2LQ9A 5DLGA 2Z58B 1FK9B 2IC3B 2BMBA 3Q8SB 2YKPA 1ZTTA 1DTTA 3ILOA 1S10A 2IDLA 1BC6A 3E01A 2MHEA 4O3OA 2AGQA 2E1MC 5HVHA 1LK5A 5DGAA 4OZNA 3RW7A 1WJ9A 2B9EA 3FFIA 2BV3A 4MIAA 1M1HA 2X3DA 2QSFA 3MAAA 1SH0A 1S57A 5L39A 1RAHB 2J7UA 3J7ZT 4DLEA 3W61A 1N6QA 4LUBA 3EVOA 3JYTB 2J6TA 4FF3A 2DY1A 3FDSA 5J2QA 1LWFB 1DY3A 2FYXA 3B8HA 5IWAF 4PABA 1FRXA 3CGIA 1EX8A 4PEOA 1SL2A 1R6YA 4CT9A 2OO4A 2RB7A 3HSGA 3MWBA 5B08A 4NCBA 4PWWA 1SJFA 5HLFA 3EE3A 5K9FA 3CJ5A 4DSIA 8ATCB 3TAMA 2CJYB 3PV8A 4F3MA 3GE9A 2HFVA 4B9LA 3D9BA 3J7Z5 1EP4B 4M5HA 4PPZA 3GCWP 5KFLA 2XGPA 5CH7B 1BWEA 2QFJA 3BBCA 2IM3A 3CIMA 4M5MA 2J9DE 3R7BB 2B7CB 3QZ8A 3JSBA 2A10A 2IM2A 4GC6A 4ZLPA 2MKCA 1S6OA 1UEKA 4RLEA 1SBRA 2BA9A 2FJDB 1F3FA 1RT5A 2GMLA 3DOLB 1KQFB 1NJIT 3BS9A 2CWKA 4U6PA 5HVGA 3IRXB 2VOPA 4P73A 3M6UA 4MAKA 2X1AA 3ET6B 2CNNB 4UF4A 1VJWA 1IM4A 4LQ9A 5KFFA 3M1VA 3IR7B 2Y1LB 4UUWA 2W9CB 5F8HA 4FPIA 5D0HA 3HZEA 4ZJLA 2IRXA 3MMAB 4NI2A 2NSCA 3TAPA 2BJ7A 4C2MA 2DGQA 2EFQA 1IJFB 4J9NA 2QEXS 4IQMA 1H38A 4AL6A 1VRTA 2BOPA 2E1CA 2DNZA 1D09B 2BVZA 2VASA 2YPYA 3CJRA 3LO3A 1GFWB 4WKYA 4DV4F 1UVJA 1B0VA 2K3KA 2AT1B 3MPVA 4LREA 4LJMA 2HWHA 5GAGI 3M6WA 4F8RA 3H59A 4OX7A 2RHQB 2ZBIA 4RW7B 1HFEL 4RBTA 1X4CA 1P27B 2LXIA 3W7BA 4X4OA 2IA0A 2R8JA 4B3MJ 2E7VA 4WFZA 5D0EA 1U25A 1RYSA 1NDLA 1Z1ZA 2IJFA 3CJKA 2Z56B 3HVTA 3MUTP 2BYCA 3M8PA 3GIKA 2GMJA 2ROEA 2ZD1B 1VK8A 4G6VB 4JI6J 4JV2A 2DH8A 2YQ1A 2PA8D 3K59A 1WTBA 2JVOA 2ZNZA 3MPDA 1R89A 3OTEA 1AA1B 2XY7A 3JQJA 2VFRA 2DGUA 2YTCA 3FC9A 4NLWA 5D4LA 4NXMJ 3HFVA 1UVMA 3CIZA 4NA3A 4QU7A 5I3PA 3V6DA 2XC9A 2MTLA 1SC6A 1N36F 3DLHA 9RUBA 1ZM4A 3MHYA 3KLHB 2BRLA 1IBMF 1T9XA 5C5JA 1FVQA 2XMKA 5L1KA 1VLOA 4C4WA 3NOCA 4ELTA 3OHBA 2FLPA 2I5JB 2Z4PA 3ZZYA 2G9OA 2CJAA 4FYXB 3OVSA 3OL7A 4J9PA 2QV6A 3SEOA 2EFVA 4TXSA 3QIPB 1S5ZA 2XULA 1RT6A 2C3YA 5KFDA 4KSEB 2VU5A 4KHMA 2ZITA 3KLVA 2J9DA 3NGSA 2Y8WA 2NZ4A 1EZZB 5E3AA 4DR1J 1C0TA 3FKBA 1AW0A 1U1KA 3LAMA 2EVZA 3AJDA 1G1XA 2R9LA 3AB2B 3VR1A 3K5MA 3CD7A 1PG5B 3MTJA 4CIOA 2CXEA 1CS4B 2VFTA 3OD2A 1VHIA 1WDTA 5A2QY 1B4SA 1J5EJ 4USKA 3IGVA 4QWBA 1MG7A 2LQ8A 2O3DA 3EXCX 1FJEB 5E2QA 4ECYA 1ZS6A 1QTMA 2FZCB 4USWA 3P4UB 4DCJB 3D6MB 3MEDA 2MJUA 2J7WA 3OTOJ 4Q8EA 2DNLA 4CO4A 4M63A 2O1PA 2P9GA 4Y34A 4WYLA 3FNNA 3T1AA 1GAOA 2DBBA 2HRYA 2CAJA 5F9LA 1O6XA 4Q8FA 2XS5A 2D9PA 4F4KA 4KFBA 1ZYQA 3T1HF 1N4LA 3HSDA 1LV5A 4AXJA 3ENWA 5IQQA 2DO4A 2H54B 3W2VA 1IKYB 1OQ6A 4QIGA 2PEHA 2B4OA 1QVFR 3DN9A 3SMZA 5IS2A 3SFUA 1U1OA 4LQ3A 4DU7A 3EZOA 1HBUB 1CQNA 1PKUA 1N52B 4B9SA 1HHQA 3FRYA 3PNIA 3T1HJ 2CA9A 2CPYA 3RBDA 1CS4A 4LRDA 5AE3A 2W9BB 3QPIA 1REVA 3KLEB 2RDJA 4MTPA 4ENOA 4DS5A 2ZOFA 4EZ6A 5ETNA 2DR8A 4PCQA 3KNGA 3I0RB 1S6PA 1FXDA 1OPZA 2FPHX 2WSCC 2XLJA 2BJ3A 2KFYA 2ASLA 1T03A 1A7GE 4WCEQ 1LFPA 1UJ5A 3Q2TC 4B3RF 4RKUC 1SJ3P 1LWEB 1H2UX 5GVQA 2C28A 4ELVA 5KFCA 4DBQA 2BE9B 4TU9A 1HI1A 1R0AA 2YNFB 2KXFA 4NXNJ 1AT1B 3LGHA 1RTJA 2GS8A 4EO8A 4OZ2A 1SUQA 5KFQA 3KLFB 4WP3A 4XAKA 3K89A 5KOWA 4UT4A 1BQNA 2HFZA 3JXOA 4OQJA 4DR1F 4CO0A 1KEKA 2UUAJ 1YZ7A 3PW0A 5CCLA 1U6BA 3QQCD 2GW8A 1N0VC 1XQIA 2HKEA 4KAIA 1LXJA 3T9NA 2YNGA 3PRDA 4OI4A 4DFPA 4A8FA 3C2PA 3LGNA 1X4GA 1IBLF 2HFOA 3V81B 2ZH5A 4OZJA 1KLMB 2XS2A 1OYDA 1KC8T 4P10A 5KG4A 4X4RA 4E0DA 4J7CA 1ZM3A 2F65A 1QAYA 2CIMA 4DLGA 2HHQA 5LMUJ 2XLIA 2ZM6J 4MK7A 1WG5A 2ZNYA 4NXMF 3VQSA 1T3NA 2E1AA 1PCAA 4PXBA 2HLTA 3WZ0A 2W2OP 3FRZA 3FMBA 3W9HA 3UNGC 2BEFA 2J8SA 4N7TA 1AFJA 1SXLA 2ILYA 1NH8A 2VDIA 1RHRB 3VGVA 4ETZA 2MKYA 2CJ9A 3L7PA 2MKSA 5MAOA 4B3MF 2MY7A 1JK9B 1OSDA 3WDOA 2KHCA 4DR3F 4A8SA 2MLZA 3W3SA 5GADU 5J1EB 3POTA 2K1RA 2AJ1A 2ZJQQ 1GNKA 2XYPB 5EX3A 1N32F 4ZVHA 1B70B 1H0HB 2BJDA 2C2ZB 2CPJA 1YBAA 4DPUA 1S76D 2Y9HA 1DTQB 5F41A 1CJUB 5BYRA 3LWMA 1IM6A 4DSFA 3DLBA 3EJMA 4L6V3 4QJVA 4Z7CA 1H73A 2GGPB 5HK4A 3WC2A 1K44A 1XR7A 3E51A 3N0VA 4B08A 4DL7A 1SJRA 1HLWA 5DG7A 3NBPB 3M30A 1L5UA 4YR2A 1SH2A 2LDYA 3PX4A 2DNRA 3KUEA 4OZ5A 4LSNA 1RHQB 5KFJA 1TK0A 2M8DB 4C8KA 2LU2A 2MQNA 4I2QB 7FDRA 3VGUA 4ECQA 5HN0A 2XMTA 4K59A 3L7OA 2MQOA 4X62J 1VIXA 1XK8A 1UPPA 3LUYA 3D2WA 2HURA 3N6MA 2MXYA 5ADZA 3H20A 4K7QA 4I0WA 2ZC4A 4DR3J 2FC9A 2L08A 1PILA 2V2QA 2VB6A 4ECSA 4URGA 3Q86A 1VISA 2BJEA 3TUZC 4ZCKA 2IY5B 2A1BA 2DR6A 4F0HA 3ZNUA 2A3JA 2HHTA 1VC5A 2ZKUA 1IBKF 1QDUB 4DV1J 3ZTSA 2KT2A 3VF0B 1WOOA 4KRWA 5HMZA 1URRA 4OYPA 2KM8C 2ZM6F 1S77D 1IXKA 3FEXB 3IBCB 3W2VB 4BBYA 2B43A 3DKDA 4QZVB 4WP8A 1YI2S 5ETOA 3M2RA 2JLFA 3FBEA 2RNEA 2V4RA 4JI1J 1KFDA 5DQGA 2MZJA 2ZVIA 5B0DA 4P6QA 3Q23A 2QYGA 2YVSA 3IM9A 3CPWR 1TAQA 3ETOA 3CMES 2HHSA 4C8ZA 1VQ9S 2FJXA 4IRKA 1SC1B 4FKXA 3NGUA 2KFZA 1KBRA 2H4YB 1CSJA 1RT2B 4DSLA 4F2SA 2RQ4A 2DH9A 3P5TL 4TQRA 3K58A 4J9QA 1HWLA 2MB0B 5J2MB 4IOAQ 2MKKA 2HBRB 3LPEA 2AEFA 2GVZB 2JEIA 4KO0A 3DOLA 1KONA 1G3OA 1JLCA 1RWWB 2R42A 1D8ZA 3JTNA 5IWAJ 2M70A 4EEYA 2XSFA 1Q1KA 2B8QA 2Q43A 5EHHA 1OY9A 4HLBA 2BQ3A 2GFFA 4LVNP 4WJBA 3DLEA 5DG9A 4B3RJ 2C2NA 3AXKA 3KLIB 2KYXA 1ZBTA 2QSWA 3DCAA 1SB6A 1V5IB 1TAUA 1UEVA 2RKIB 4PKDB 4A46A 4RNNA 3Q0AA 2EG2A 3FZBA 5IC4B 4Z37A 1OYEA 3VQTA 2QGFB 2Q79A 1MWYA 1OMSA 2PN6A 4FVCA 3JQKA 3OFHA 4DCPB 4YR0A 3Q8PB 2BRKA 3M9NB 5A76A 4DR4F 5IZHA 1HYSA 4L74A 2YNIA 3FBBA 1RTIA 3GMGA 2GQCA 3I9V9 5C2GA 1JB0C 1JLFA 1IR1A 1QM9A 1QUVA 2HEKA 3LQVA 4OHWA 4B3SF 4P7TA 5KT2A 3GV7B 4FYYB 4EU0A 4TU8A 1HNVA 5C2CA 4DSKA 2V8VA 2ABYA 4EWTA 4KHPF 1RAEB 4WIQA 5ETVA 2FVQA 1UVNA 2AEJA 2MLXA 1BQMA 2HBYB 1YJVA 2DY9A 1VCTA 1X4FA 1X5SA 2L9NA 2P9CA 3AOBA 3M8PB 4M5DB 1U0HB 1L3SA 1Y10A 1TVRA 1MSWD 1U49A 4F02A 3VGSA 1TKXB 2JSXA 1HHTP 3LP2A 2BX6A 2W2QP 2B9WA 3UR3C 5F9NA 3T3FA 3BH7B 3UI3A 3MFIA 1RAJA 3FSXA 3ISND 3BQ0A 2ADBA 3B4MA 3KTQA 4NE9C 5I4MA 4DV1F 2YWGA 3QJJA 3M8QB 4HTIA 1PC4A 1KLNA 2FHJA 3ZZUA 3I9ZA 4PG7A 4Y2IA 5HP1A 2B51A 2GGPA 1Y3KA 1UEUA 2RQMA 3G2XA 4X4VA 1FRIA 1T9WA 1FA0A 3CD0A 5IT0A 5IQ6A 4H4MB 1U1RA 2UXBF 4CLPA 4U7CA 1FFWB 1GXTA 2HIYA 4JOUA 4V19X 3AFGA 3M8RA 4ZDNA 3PFOA 1RA6A 2DEIA 3MM7B 2RDDA 1JNZB 3S6EA 3TAQA 4I68A 1NO8A 4CO5A 3MR2A 5HAOA 2DPJA 2UXCF 2DISA 1EKRA 3IS9B 3IGNA 4IG0B 3I5BA 5E0OA 1DQAA 4CLLA 4U8YA 2HK2A 3M6XA 3LP2B 5DDOC 4B3OA 2LCWA 1C4AA 2R7XA 1R3NA 1FRHA 3C15A 5J1NA 2JFKA 2XMUA 1SC3B 3I56S 2MQPA 1VGYA 2OUGA 2GIQA 1J5OA 4EI2A 1W7WA 1JLGB 2UUTA 4NMLA 3MMJA 2R2UA 3G6VA 2OPRA 3N6LA 2MZSA 3FBCA 4KT0C 4JI6F 3T6BA 4TYBA 2BR0A 1VQMS 3QMQA 2L3MA 1CC8A 3I5CA 2VIHA 5GAEU 1SC4B 2HVZA 4LF4J 4IFVB 3WX4A 4RNOA 1B3TA 4M5IA 3JSMA 1UJ4A 3OFGA 2AJFE 1R0BG 4HI1A 4ECVA 1V3RA 2MJNA 3TEHB 2YY3A 3QWPA 4RW4B 3E3XA 3OV7A 1VC6A 3NRBA 3K57A 3C46A 4GKJF 1RWKB 2VBYA 2IMWP 4B3SJ 1K1SA 2IHR1 1WI6A 2HS3A 4LRAA 4K4XA 2AGPA 1X8DA 3C66A 2PEBA 1W2IA 2ASYA 5T7LA 5B7WA 2E5HA 2W4CA 2VG7A 5CAAA 1UA1A 1RABB 2YBVA 1J5OB 1KOOA 3K8WA 5LSOA 1S7IA 3L3CA 1JLGA 3K5OA 4OZ1A 3US5A 4DQRA 2IAJB 4KV8A 3A8JA 4WFXA 5FDLB 1RQ0A 4QIVA 2QA2A 4Y6IA 2GJ2A 5THWA 3TQ1A 2FJBB 4KQZA 4ZVQB 5KT7A 4RU9A 3LP0A 2VFUA 1HPZB 2PO4A 1IKXA 4J9RA 2H5JB 2KVIA 1QSLA 1LWFA 4DL0C 2HHHF 1XMQJ 1O5JA 2V4QA 2HK3A 2MZQA 4LF5J 1U09A 4IKAA 1H7XA 2I6WA 1RWNB 5DLFA 3M05A 3PKYA 2RDIA 4I2QA 2ERRA 1X0PA 4CCHA 1K0TA 4TY8B 2PGCA 3TX8A 2J8AA 4CLWA 2HQ3A 1UVKA 5I3UB 1Q7YT 3PY8A 2Q6CA 2DIVA 1GH8A 4R5PA 2R8KA 3CW2C 3NWGA 1FI4A 1OWXA 2YKNB 4PXCA 2JEJA 4LF6J 2V2ZA 1LW0B 2G0IA 4USHA 2A6OA 3WIVA 2YXLA 4HEA9 2EG1A 1Y00A 4OLOA 3BQ1A 3O6QA 2PFDA 2F4VJ 4JV5J 2M5YA 2QE5A 2CZVC 5E3CA 4DX8H 4A8YA 5AXKA 3V5RA 4I67A 1HNVB 2FLOA 2WONA 3H5UA 3W8GA 1UP1A 1U1PA 4DV7F 1KWMA 5K14A 2DRBA 2R7QA 3PYEA 1KR4A 2JWNA 4DPWA 2XMAA 1RTDA 5JJBA 4J9UE 1SKUB 1YQHA 4ED6A 3RB4A 3TA1A 3NCRA 2EK1A 4CO1A 2B5JB 2F63A 5K8MA 3AT1B 3DOKB 4RJVA 4DPYA 1IBKJ 3DRRB 3KHRA 5B0FA 2JLGA 1X4DA 3TJ8A 4TNOA 3NY0A 2NSBA 1XIQA 3PHEA 4M5NA 4NCGA 3GIJA 3I4HX 4KJIA 3EICA 4J9KA 4ZVOB 1E6YB 5K8OA 4NYZA 4OJHA 3QJLA 4CQ1A 3O8WA 4UUXA 1FFSB 4C97A 3RU0A 2LQJA 1FJGF 3MCMA 1RHJB 2CUYA 4KGZB 3TWZA 2QLBB 3W65A 1U2CA 2VICA 4JUZA 1FVSA 2WOMA 2W1BA 3D0IE 5B0AA 3T5HA 2EW9A 2YX1A 4NLXA 1ACMB 3IG1B 4NZ0A 1SJ4P 3QNWB 2GVDA 4WFYA 5BR8J 3RB0A 2BBEA 4H54A 2IM0A 3DLEB 4YHHJ 3G96A 3PW7A 2R7SA 2XY6A 3KUGA 4ID8A 1R6VA 2MGZB 3GV8B 2B5JA 2E7XA 3TNVA 4DUZF 1XMOF 1N8RT 2VQFF 3BN4A 1HW8A 2RMLA 2FY8A 2MQQA 3ILJA 2DGWA 1S6QA 1GQEA 1S1XA 2E7WA 2G4BA 4NCGB 5KFZA 4IRCA 4Y2CA 2NPFA 4F36A 3OJUA 3KDNA 2FTRA 3TYTA 2BJ8A 2G1HA 2ROPA 4RUHA 1JNRB 1WSVA 1XNRF 3TUIC 1T03B 4BWMA 4DR2F 1NK8A 4O23A 3GR0A 1J27A 4HKQA 5KT4A 3GWCA 4RW9B 5GAEI 2DVIA 4PQAA 1RLDA 3EDQB 4O44B 3UR0A 4JI7J 4KPCA 1YDLA 2YNFA 4FYWB 4J9LA 2LEBA 2KFNA 2KG0A 2C3MA 1RT3A 2D69A 1FDDA 2ZKTA 2B6AB 3PJXA 1VRUB 4TLQA 1TKZA 3N5FA 4USIA 3M2VA 4ZVGA 4FF1A 4A8KA 1GMUA 2HQFA 1ZZNA 1X9WA 2C2RA 5D4PA 4K4WA 2U1AA 2VPYB 3IAS9 4H4KA 5CCMA 4IR1A 2DHHA 2VKZG 4QIFA 1NHVA 4ICLB 1UZDA 5B09A 2APOA 1IWAA 5ETTA 2R8IA 3OL9A 1WKJA 4NLTA 1M1KT 3CDUA 3G8TA 4IH5A 3EVMA 1O0PA 3SI8A 2PI4A 1PIEA 3B54A 3NCQA 3B6BA 4A8OA 3FCVA 3TR5A 5CYQB 3L9ZA 3MAHA 1I94J 4X4UA 1WSRA 2QA4S 4U7UD 1BWVA 2AYMA 3M4XA 5DRKA 2RQCA 3H25A 3G71S 2FVRA 4DQPA 4QYZJ 2DNPA 3TA2A 2PMZD 1FHTA 2ALZA 4OJ1A 4ZKAA 4Q45A 1H98A 2VFVA 3NEKA 3CMQA 3JQMA 1RWPB 3S01A 2VG5B 5I3QA 2WTFA 1N34J 4CLYA 1CJKA 4B9TA 1FESA 3OTDA 2RKIA 1U6FA 4BCAA 1Q79A 3QT5A 4LFCJ 1ZAVA 2GJIA 1L3TA 4M8LA 4RW6A 4FBUA 1EKSA 4DV3F 1JJ2R 1HNIA 2JVRA 5E33A 2ZJRQ 4DUTA 2XCPA 1S49A 2H48B 5JVGQ 2MEWA 3T1YF 1DARA 4ILRA 2J0QD 3MGJA 4JI8J 2NXNA 2QL7B 3PEHA 3Q2SC 4OYZA 5IV3A 3DI6B 2UXDF 4I4BA 2CDRB 2HZAA 2WZ1A 1PBAA 4MKAA 4OI6A 2Y1IA 4LRFA 2FLLA 1MN7A 2OJ3A 5J2QB 1TK8A 2KJVA 2YH0A 4TKTA 4OX8A 2WAQD 1R7IA 4KBIA 4OJ3A 2GA7A 5KFAA 1BHNA 4MFBB 1T9UA 4L76A 3MR7A 2DCLA 1OS5A 5A8RA 5KG2A 1Q81T 2Z0GA 1OIAA 2UV8G 1D9FA 1PC5A 1XMBA 5C42A 2UUAF 1VHFA 3DOKA 3EM1A 3R5AA 1CLFA 2N7CA 3EDRB 3HFKA 2RQKA 2J5AA 2AJ4A 4PXEA 3TAMB 2FGOA 1RISA 2V67A 1KFSA 3AB4B 3BEGB 3C16A 3CT9A 2XQCA 1DFDA 1YBTA 3DFEA 2OTLS 3TA0A 3MCSA 2B4PA 3GIIA 2D9OA 1HNXJ 3IWXA 1F6TA 2LFVA 3HSJA 6FDRA 1H74A 3BDEA 1J5EF 4Q0BB 3FEZA 3G8SA 3GQCA 4TN2A 1KLMA 2IRUA 4X4SA 4JI5F 2JHEA 3N79A 3MEEA 3OR2B 2WB1D 2RS8A 5A6PA 4IO9Q 4C8NA 1HNXF 2LKZA 1JLAA 3IR5B 4QW9A 2YKQA 3DLJA 3OXLA 1RT1A 4F7VA 3W5XA 3GIMA 1YVFA 3HD2A 3BYPA 3ZTQA 1RT3B 4DL6A 3ZTPA 1HHSA 4ETXA 5BXIA 3RW6A 2CQCA 2OI2A 4F3OA 4ANCA 3D7SB 3S7RA 3FSIA 5AXNA 5GMKa 4FP9A 4BC9A 1IKYA 5AE2A 1FDBA 4ED7A 2YH1A 4KPYA 4KGMA 4DX7A 5F8MA 3CCSS 1FKPA 5EUHA 3PVXA 2RIJA 2A2CA 2H4WB 3CDBA 5CXTA 4RWWA 3C16B 4A47A 1YLXA 4OV6A 4KC5A 2RVJA 4DSEA 1REVB 3KLEA 2HAIA 4IOBA 1WNEA 3B78A 4WK3A 3HVAA 2B9YA 1VQYA 1EQMA 4JI1F 1XNQJ 3EGZA 2IPOB 1YBUA 3VWSA 1HBOA 3HKWA 3JTPA 3V6DB 4ED5A 2DR9A 3MEEB 2BW7A 1XEZA 3CULA 1SQFA 2Y1RI 3WQPA 3GFXA 3THTA 1VYAA 4ZIWA 4OX9F 3HF5A 2A2DA 2WCXA 2RAQA 4LSLA 3N01A 2BKNA 4OYOA 5KFXA 2P5VA 3BGFA 1YGYA 3HHLD 1GTEA 4DUYJ 3GTYX 2HQGA 1P1TA 2CFXA 1QE1A 5GAGU 1F1BB 1U1QA 1TKDA 1MROA 1KN6A 1ICEB 4DL4A 3EUNA 4BLGA 2HHWA 3GFHA 5LM7E 4AFFA 3SCLE 2AU0A 3CDAA 1UFWA 4HTJA 5KFSA 5CYJA 2MDAA 1HI8A 3BBFA 4AXIA 1R8PA 2Y8YA 1HQUB 2DPIA 4LF7F 3DRYA 4RR5A 5KG6A 3HT3A 3EX7B 1Y5IB 1FCAA 1NSQA 5DQHA 1HNZF 3S8SA 2WOMB 3D28A 2QLJB 2CNOB 1RT6B 2HNYA 3R5DA 2OMOA 1JIHA 4MFBA 3LGMA 3ZZ0A 2DHXA 5U47A 4V19J 2CZ4A 3UNYA 3DHXA 3M2RB 3R5CA 2UU9F 5RUBA 3RR7A 2LYVA 1TUGB 4B02A 4ZJQA 3P6YC 3UPFA 5KG1A 2DR7A 2A0FB 5GADI 3RRHA 4LF1A 2IYIA 1U48A 1TELA 4H4OA 4ES3A 5F3ZA 2DNGA 1U7LA 4LF8J 2V9WA 4WFBQ 4IR9A 1KHVA 4YR3A 2R8GA 2X1BA 1SKRA 3ZTOA 1YSJA 1AB8A 3BSAA 1S4FA 4W98A 2WHOA 5GMEA 4C0HA 2ZH2A 1TL3B 4ZVUB 2HMIA 3UD4P 1M1GA 1RCXB 2J76E 3HXMA 4AQYJ 4OZLA 4FNHA 4V1Ak 5KG3A 5DO2A 2HZCA 3MTKA 4ED8A 1EETA 4OIXA 4WU3A 1NDCA 1NHKL 1U2FA 3IO1A 5GMDA 3KLGA 1NJXA 5KT3A 2RUSA 3SBMA 4CZCA 4C6AA 4DR7J 2HGLA 3H7HB 2FZKB 4URSA 3T9ZA 2DHSA 4IFYB 3W5ZA 4CO2A 4U96A 3VHQA 3EPGA 5BR8F 5KG0A 4BWJA 1HBUA 4K4ZA 4ICLA 5M2PA 4EK2A 4CLFA 3E8OA 4LVOP 1FKPB 1WG1A 2CQPA 3C14A 5A0YA 3SQGA 1M5VC 2HZVA 3UN3A 3M32A 4LF9F 3BKFA 1M0SA 3HHLB 3TARA 3TJAA 2BOAA 2JH3A 3CSKA 4ALZA 3H0PA 3T5JA 2B7BB 4R8UA 1JJ4A 1X4EA 4EBEA 2HLUA 4NA2A 1NKBA 4X65J 4I6AA 3CC4S 3PDNA 2MLYA 3PIPQ 1JLQA 3EXYA 1S9GA 5DZ6A 3LWLA 4YS2A 2YKMB 4A8MP 1RP5A 4ZPAA 2O67A 3TVZA 4L72B 9ATCB 1C0UA 2NZCA 4DSJA 2GCFA 1KQGB 4XDDA 2UUWA 2F8HA 1ZH5A 3CCJS 2UV8A 1FF2A 1J2VA 3QT8A 2ZZTA 1B0PA 2AIRB 1KDNA 3W1YC 1NKCA 1DLOB 1FRKA 4PPDA 4DFMA 4DR5J 1HNIB 2EC2A 2F9DA 4P71A 5D77A 2XI2A 2MSSA 5K5MA 2G0CA 3JTOA 3MR5A 1FWPA 1UL3A 2JFDA 3OXGA 4QWAA 3LF0A 3GZ7A 4K4VA 4CM2A 5F8GA 2C2DA 1Y9OA 2AZ1A 4QR2A 1SV5B 1WF0A 3I0SA 2EFNA 3Q8YA 3SSSA 3UDCA 3RB6A 1R8AA 4LSLB 4OYMA 5HROB 1KRPA 3WX8A 3CC7S 1SPBP 2J7KA 2FHKA 2ZOGA 3F56A 5KFHA 1RI7A 2XM3A 4LFAF 1TK5A 2LA4A 5B0BA 4UY8T 1KVJA 4NASA 5DETA 2CQ4A 2CQGA 1UA0A 2UUBF 4N76A 4LF5F 4DV6F 4P9SA 2FLNA 3S1TA 4PWDB 2IVYA 4JI3J 1WEXA 4LF2A 2IC3A 4WYWA 3TVYA 1CC7A 3MMCB 2RU3A 1BMQB 4IG3B 4Y2AA 1ZZFA 1EQ0A 4L3KA 4WPAA 3THPA 3G82A 4A8WA 3TUPA 5IXUA 2YX7A 1SJQA 1ZA2B 4WBFA 1GX5A 4RNHA 2R2TA 4NLVA 4ZP8A 3KK2B 3W62A 3MR6A 5J2NA 1N6QB 1BXNA 4ZOSA 2MQLA 3RRKA 4HYKA 4CO3A 4C0BA 5HJXA 4K2XA 8RUCA 1U4BA 1AUDA 1N56A 3G9CA 3FJ2A 3IN5A 5F8JA 1R0AB 4W4MA 4ZA1A 1N5YB 4B3TJ 5SZTA 3GCXP 3HMJG 4GKJJ 2YX4A 1CPZA 4KGVB 2RF2A 2DT9A 2FIUA 3AAWB 3GFZA 2M2BA 1ZA1B 2VJVA 2NXJA 4U8VA 1WF1A 3J81U 1WF2A 1RTHA 1CJTA 2WVCA 2YWWA 1PSDA 1KD1T 1NBEB 2Y3YA 1TKXA 2PFFB 3WHIA 3R6LB 4DR6J 4JBCA 4LF4F 3PJ9A 2CRLA 4X4QA 1ULRA 2VQEJ 4RW8A 1B99A 2HPUA 4M5JA 1U26A 1S99A 2X1GA 2E29A 4DDFA 3NMAA 1NJWA 1X5PA 4NYPA 2RILA 3OSPA 1RT7B 2XSJB 3H98A 3HT0A 1RSCA 5J2NB 3KK2A 1TTHB 1JQGA 4QOTA 3W9JA 3K2YA 3TJ9A 3BJYA 3DI6A 3PZPA 1UW4A 2VOOA 3OQ2A 4QPXA 4A8QA 1YJ7A 3G6ES 3DRSA 2GVDB 2YWHA 1BQMB 2AZ3A 3F41A 4ZP6A 3G6YA 3SYZA 2CDQA 3NS5A 1ZM9A 1RCOB 2VZ9A 2ZBQA 1FDAA 5KG7A 2ZH3A 3CCMS 4KTQA 4NYOA 3NXZA 2HS0A 2AWZA 3G6XA 1I6JA 2BJ1A 4MYTA 1Y0HA 4ZLJA 1QE1B 1RTHB 2GJFA 3GB0A 1IN0A 4BC7A 1SKWA 3UN5A 1VI7A 1PYSB 4DCOB 3PO5A 1TL5A 4XIUA 3MFHA 3M7VA 3QGGA 3QRQA 4Y0FA 2K3IA 4OHZA 2VH7A 1GXLA 1HQEB 2CJKA 1KP6A 2OD4A 4P2XA 1XMOJ 4JI2F 4N41A 4HVZA 4Q0BA 2V8PA 3NNCA 3IA0A 1UMJA 1S0OA 5EN1A 1EHWA 1KSPA 3K7RA 4CM0A 5FLXY 4LFBF 2JC0A 3L09A 5KFEA 1MLAA 4XPCA 1HD0A 1QSSA 2BW2A 2V8HA 2MZTA 4MH8A 3GLJA 5KFWA 3UCUP 4PG5A 1AROP 1OSCA 1TZ0A 3J80Y 2HFUA 1NKEA 4K5SA 2W8KA 1RWOB 2E44A 4ECRA 1VC0A 3U02A 3PACA 3D67A 3KJQB 1PO6A 4RW4A 4YEAA 4X84A 1RHUB 2HFSA 4XK8C 1FKAF 4AL5A 4UQTA 2MYFA 3CCVS 4DUYF 3RAXA 1APSA 1R43A 3MCOA 3M9MB 1M90T 4HDGA 4PG8A 4JYAJ 4DG1A 1FRJA 2KI2A 4H4KC 3A8KA 3KLHA 4DFKA 3FCWA 5LJ5Y 2LLZA 2ZDPA 3TP2A 2BE7D 4F4ZA 2NUHA 4ITSA 1RYRA 3ISNC 3CCTA 3QAEA 4Y2MA 1N0UA 5M2RA 1V3ZA 2JJ4D 3PO4A 2E9TA 1X4AA 4P75A 5LT5A 1T8EA 3LP0B 4ES2A 4ZCMA 4M94A 2W01A 3DLKB 3GILA 4ES1A 2W9CA 2OSRA 4NMXA 2NCKL 4I56A 1UWBB 2RF2B 3BGUA 5H9FK 2KH9A 1SI9A 2EEYA 2OPSB 3A13A 1FRMA 5HO4A 5A0YB 4UZBA 3EZ5A 1NDPA 3IFEA 3DU6A 4WTOB 1A9NB 1XJWB 4X64J 1P8GA 1Q4RA 3C8YA 4PG4A 3EMTA 3VVUA 3MEGA 4U67Q 4Z7YA 3MM5B 1AXQA 5DG8A 2Q66A 3M8ZA 2XGQA 3N5BA 2VONA 1PJ7A 3ZZZA 1ZAWA 2GAGC 3ADAC 1JLQB 4JYAF 4DS4A 3KK1B 3MI7X 2FY1A 4FNIA 2OSQA 3AQOA 3ET6A 3PR5B 1FNOA 4F25A 4DL5A 3R8YA 4BHQA 3DMJB 2XMMA 4OYAA 1FE4A 4F4YA 1VQNS 2E9RX 1BY9A 1LEOA 1CULA 3FGVA 3MECB 1FRLA 2F4VF 1LKZA 3NWRA 2UVWA 4I2PA 1QAXA 4WP9A 3EZUA 2VA3A 3R2CJ 1M5HA 2FQQB 1RT4A 2DXFA 4I6YA 3QWUA 3DOMB 3NG8A 1LNQA 1I1GA 4X4NA 4X4PA 1RXOB 2JDJA 2OD6A 1YJRA 4X2BA 3DGVA 4YDXA 4OLPA 1HI0P 3TX0A 5CZXA 3NKYA 3HHKA 1U1LA 4B9VA 2UVVA 3MEGB 4P74A 1W25A 4NWBA 4GO5X 2GQ2A 2KB2A 3BF4A 4IOCQ 1QAJA 2PT0A 3PEJA 3CCRS 3CJQA 3RUBL 4DX6A 4TY9A 1SV5A 4ZK7M 3HHNB 3I96A 3ZXWA 3AD9C 5DZ7A 5K8PA 1WOPA 2ZE2B 3DMJA 1RTJB 3KLFA 3OBIA 2E5GA 1U8WA 2AQ4A 1U45A 4X62F 4CP5A 3UO0A 1LW2B 3CJ2A 3MM9B 3F73A 2OEJA 4OL8A 2C3UA 2XNQA 3CF5Q 2ATCB 1F5AA 2ALYB 1U47A 3BPSP 1TV6A 1R31A 2JOQA 4LIWA 1H7WA 1U0SA 2Q1LA 1NHUA 2MSTA 2YKAA 3ITHA 1HNZJ 4NEZA 5F8NA 2LVWA 1S1UB 7FD1A 4YY3J 2QL5B 4NLOA 2UZAA 1PGZA 5I42A 3KWMA 4MYUA 4Q5VA 1AFIA 4GVBA 4LR7A 3SQOP 1KQSR 1SQEA 2N4DA 5HP1B 2QC3A 3CCQS 2QTWA 3MM8B 3I4PA 2VC1A 2OPQA 2X3GA 3BO2A 1QJHA 1DQ9A 2XZWA 2GMHA 1PJ6A 2R7UA 4DQSA 4OX9J 4XTTA 2UUCF 5JUMA 1V3SA 4QIEA 2PC6A 2QFIA 3PTWA 5C25B 2QA4G 1KS2A 5H9FJ 3PG9A 1N5QA 2GO9A 2KRBA 4HHUA 3UDEA 4AT1B 4C98A 2O66A 3EVWA 4N56A 5LXRA 1RZMA 3M2UA 1NSPA 3HPOA 1Q78A 2OEMA 4B3TF 3R5BA 1AUSL 1Q86T 4ANEA 1PYTA 1KOHA 4HHHA 3QO9B 3O1LA 2H5EA 2ZHOA 3IBWA 3TVKA 3DDKA 4AL7A 4DF8A 2JLEA 4FS2A 3MEDB 2R2RA 1S4EA 1RT7A 4OI1A 3VAGA 4B9UA 4LR9A 1NM2A 4Q43A 4NLDA 4QR1A 3QJPA 3Q8VA 2EXUA 1REGX 1WC1A 4EFAC 4MT1A 2W9AA 4LF7J 3ELHA 1LWCA 2C3PA 1RLCL 1RAIB 2AKWB 4J9MA 2N4CA 3VAHA 4ED3A 1N88A 2RJZA 1B64A 1CVJA 2ZC3A 1IUJA 2C2MB 3J81j 3NL0A 1X60A 2LA6A 4KE5A 5CA5A 1RKJA 1T3OA 1BUXA 5LMNJ 1HBMA 1PAUB 2B3TB 2XYGB 4MMOA 2MPUA 2XWYA 4JI0J 1X9MA 2WBRA 1RT4B 2DGOA 4DV2J 2CQBA 2AX1A 2DXDA 1N33F 4KR0B 1R8CA 1A6LA 1FT8A 1QY7A 4NLSA 3V4MA 1QD1A 2ZH7A 1WC0A 2ILZA 4F26A 3HJVA 3IM8A 4JI3F 4JI4F 1S1TA 4CI0B 1BE4A 1E6YA 1GMWD 2FGCA 1IVZA 4DJBA 5SUHA 2I38A 2ZWPA 1N33J 2P6SA 3UQSA 3T5KA 4J90A 3OT9A 2UP1A 4C8YA 1FJGJ 3GSIA 3KFWX 1YG0A 4RBVA 3IXQA 1IKVB 3T5LA 3DU5A 3CJSA 1UCNA 4Q7AA 5F0WA 1F0XA 5DGBA 2D41A 2HNDB 2IMOA 2VPXB 3A12A 1HWIA 2QYCA 2C2OB 3NAHA 4HL9A 5L9NA 2GHVC 2DNYA 4LIRA 4OHVA 2DNKA 4F3QA 3KJVB 3PKMA 1NDKA 3OUYA 1NH7A 2WW4A 4DI6A 2J6SA 3QRPA 4KKOA 4UOFA 4URQU 1UFLA 1SL1A 4MK8A 4MK9A 2VA2A 3BYRA 1U6ZA 1VQPS 1R8BA 3D6TB 3MPWA 4NRTA 3NAIA 1FK9A 1N54B 3VTIA 3GG1A 3M9OB 3V81A 1YK9A 5KFRA 1JXVA 1RAGB 2W4PA 4HH1A 3E2EA 2HHUA 3CE8A 4RZRA 4X66J 5HQMA 2XWXA 2I9SA 2RRAA 5KFVA 3MXHP 3QAUA 2HVDA 4F4AA 1EJ7L 2C3OA 4FXDA 1HBNB 2B8PA 1WC3A 2GHWA 2JNJA 4RX6A 3CJKB 4NA1A 4LMZA 1M5KC 1S97A 1T9YA 2ZFHA 3RB3A 3TO8A 3HCXA 4F0KA 1SKSA 4NZ7A 1T05A 4JV5F 3OL8A 4LFBJ 1L3VA 2D1CA 3EGVA 2C42A 2L41A 1UWBA 2XCAA 5G4DA 3OL6A 2ZH6A 5LMNF 2R3VA 2HVHA 2W2NP 4ZHRA 3Q8QB 3CD5A 4OI3A 4Y28C 4USJC 2BM1A 2CQIA 3IR6B 1XBWA 3POTB 3TUJC 5MLCV 3CCES 1WOSA 1ZPWX 4HI2A 4ECUA 3GYGA 4MKVA 1KNZA 1F60B 2C2KB 4F2RA 1RTZA 3BV8A 4TYAA 1UVLA 5BYQA 5KFTA 1GK8A 2CNKB 4ZCIA 1YZ6A 2Y1JA 4C3KA 2QMWA 4FBTA 3TZZA 2VKRA 2WVBA 3FMWA 1S6UA 1Y3JA 3MMBA 3QZ7A 2K7KA 3OR2A 1JLFB 3FBFA 3J80U 3OHAA 2IJNA 3B4DA 2OPQB 1H72C 1RT5B 3DLGA 1FKOB 4FF2A 5HROA 3HP6A 1ZM2A 4F4WA 4DU8A 3D3BJ 1EETB 1N48A 3AHPA 2HWIA 4L75A 3M6VA 1D3WA 3KK3A 3RZAA 2YPZA 1IWGA 3JS9A 4PYDA 5LXYA 1S9EA 2D7SA 2OFHX 2WBMA 4L73A 4M5DA 3KHHA 1CJVB 3NGDA 4YQWA 2IFXA 2HG4A 3SDEA 4CLSA 2YNGB 3AD7C 2ZZNA 2W4DA 2W7OA 1WHVA 4EUVA 2FJAB 3UN2A 3FQKA 2VDHA 3RGIA 4CLTA 3PX0A 1ZETA 1RACB 3BM7A 4HH0A 4EGLA 2U2FA 2BE2A 1C1CB 1WHXA 2NS1B 4FZVA 2YKOA 2KHDA 5EDWA 3W8PA 3TZXA 2GQQA 3GG0A 1F2HA 4C8MA 2IBKA 2KZZA 4DV4J 3PCOB 2UXBJ 2ZH4A 1JLCB 2HNZA 3MPYA 3TRGA 3V2UC 3T41A 1XC9A 2HSEB 4C48A 2QX0A 4CH0S 1X4HA 4G65A 4TY8A 4KIAA 3CJ3A 3CO9A 3KG4A 3NNAA 2IVFB 4CLKA 1FO1A 1CG2A 1FTCA 3KDOA 2FZGB 4YB5A 2XZDB 2OFGX 3D54A 4B3OB 3H90A 4X66F 1DTTB 1P6TA 2NUUG 4HT5A 3QYYA 2B4VA 2FJVA 4ZCLA 1D9AA 2GZOA 2MQMA 2RE1A 3MM6B 3K17A 4IYQA 4O4GA 5KFUA 2KJWA 3VV2B 3W5YA 3I0RA 1WELA 4GVBB 3BO3A 3EWGA 1HQUA 3V6KA 4B9NA 2RU9A 1NRKA 1NLKL 1U02A 3RJMB 4AYBD 2ZH8A 2H1YA 1RAAB 2GO8A 1WC6A 2HGMA 1XWLA 1YJUA 1NMEB 2QA1A 2WONB 3GYNA 4WK1A 4ED4A 1IKVA 4I1TA 2KXHA 5IM0B 2H5IB 1JLBB 3CWJA 3GV5B 1X5OA 2LP4A 3CO0P 4B9MA 4ZITA 3K5LA 1DZ5A 2KRRA 3EGWB 2V0NA 4ILLA 2PD1A 1M5OC 3CCUS 2E5JA 3R5JB 5C7PA 1T02A 1XNQF 4CH7A 5LMUF 1YITS 1FD8A 4RWXA 3BR8A 4LT6A 1Q0NA 1S1WB 1YJ9S 1VQLS 2DYAA 3UWTA 1HKAA 3NGKA 3H4BA 2F8EX 3MMCA 4JI4J 3QO9A 2ZUGA 1RBOB 1ZOTA 1QVGR 3MM6A 1XTZA 3ZO7A 1TUVA 2J9CA 1VIOA 1N5TA 4K4SA 4J37A 4DL2A 2CVEA 2PIIA 4PUOB 5ETPA 1D9DA 2KO1A 2VD3A 3HZGA 3CNQP 3L7UA 2QIFA 2CADA 4KY3A 1RWMB 4M5GA 5L1JA 2Z30B 3ZFVA 4ED0A 2X51A 2WB4A 3U1MA 4DPOA 5A8RB 2NPIA 4OJGA 4ER8A 2XNRA 1F2GA 4JI0F 2GC8A 3QLHB 3D6HB 5A8KA 5C24B 3HHLC 4W92B 1VR6A 5I3UA 1CJVA 1TFWA 1S6QB 1UKUA 5IOLA 3TW0A 5KTQA 2GV1A 1VOMA 3DM2A 3HHEA 4ZVFA 1YHQS 4O3RA 4DV0J 4X4TA 1VK3A 2K1RB 1DLOA 2IBOA 2GIFA 1FWKA 2MY8A 2VPWB 4ZPCA 2WW8A 3RG6A 2KZMA 3Q8UA 4TQSA 4I64A 1B7FA 5L38A 2CNLB 4IRDA 1NZAA 2HIQA 2WK4A 4U7UK 4QCLA 3L4BC 2OELA 2Z8QA 3V6JA 3B82A 1A0OB 2RUGA 4NLYA 2QT7A 3C19A 3A8IA 3SCIE 2FHJD 1I3OB 4CNYA 4TVAB 1Q8KA 2V2VA 3BH6B 4O3SA 2VL1A 2FB0A 3PHTA 3A3PB 3QBCA 3FVYA 1FNMA 4IH7A 2FVSA 4LF8F 4WU2A 1N34F 1AYEA 5DM7Q 1HMVB 4K4UA 2DNMA 2NXEA 1NK5A 4JV1A 4ATNA 2OMLA 3PX6A 1NK0A 5D8HB 5HLFB 3G4SS 1YRTA 2UVRA 2R2SA 1VQ7S 4X65F 5KFKA 3G87A 3G86A 2POKA 2Z2MA 3AJ1A 4KYZA 1RAOA 4UZCA 1FFGB 4YB1P 1YIJS 4GVLA 4E2FB 3R3TA 3W66A 1WDDA 3UE2A 1FX4A 1S1VB 2CQHA 4F67A 2CQDA 4RL1A 2ZBPA 4YN3B 5HJYA 5T14A 4DV3J 4UTGA 3RAMA 3O3LA 3BKUA 2KT3A 3KK1A 4F0MA 2DGXA 4ZVEA 5FLXU 1FJ7A 2QL9B 2BUNA 5CZVA 2CPIA 2GHPA 2J6UA 1TU0B 5FJ4A 1CULB 2F9JA 2QZ8A 2KU7A 1Q8BA 3HHDA 4NOHA 3R1LA 1GEHA 2P2CB 3GSDA 4DN0A 2LU1A 1B0TA 2BACA 3D4JA 2CWXA 4N8OA 3IWNC 2HWTA 1HMVA 1ROFA 1RUSA 5JMNA 1AZSB 1HD1A 2K8GA 4CTAB 3IWLA 2DGVA 3GJRB 4K4TA 3A3OB 3CVKA 3SQGB 5EWGA 4G3IA 1KVKA 3O44A 2KG1A 1QLNA 5ETQA 3AA9A 3N9UC 1MU2B 3M8QA 1NJYA 2IAJA 2V50A 4ZP9A 2XLKA 4ECZA 4QWDA 1TL4A 1U8SA 3K0JA 4NX9A 1H2TZ 4BDPA 5J2MA 5D3GB 3I5AA 3WBZA 1WC4A 5GAHU 2CG4A 2EBGA 3QIDA 4OX6A 4NLQA 2AEMA 3OJSA 2DK2A 2HGNA 2B6AA 1C0UB 2DD8S 3DLKA 1MN9A 3M30B 3KK3B 3CMAS 2HNYB 1H3DA 3H4DA 1N32J 4MIBA 4NRUA 1KVIA 5KFMA 2KM8B 4DV0F 3QRRA 2RRBA 2OLWA 2AP6A 3D5MA 3TZWA 5E3QA 3SFGA 4DR6F 1TV6B 4S0MA 5C24A 1G7CB 3QSIA 5HVFA 3VZIA 3DRRA 2IYGA 5B0GA 4D3HA 2XMWA 5DM6Q 3GP9A 5KAKA 2X7IA 4J5OA 4HACA 2M88A 2K7JA 3A1YG 2DRDA 3KHGA 4PQUA 1UFKA 4C7QA 1WKKA 3TANA 1DJ0A 4RUBA 3RR8A 2XI3A 1YRXA 3KHLA 2AYEA 4USUA 2ZH9A 4NXNF 2X1FA 3W2WA 1VBYA 1M5SA 2BKPA 3A8EA 4X64F 1Q8LA 4DUZJ 1NB7A 4IDKB 3OW2R 4UW2A 4P2FA 3HM9A 1EAYC 3OSNA 2MKIA 4MKYA
chains in the Genus database with same CATH topology
4LFAJ 4YY3J 1XMOJ 4LF9J 5BR8J 4YHHJ 4X62J 1J5EJ 4DV5J 4DV0J 4DR3J 2UUBJ 3J80U 3OTOJ 2KVQE 4DV6J 1IBMJ 4OX9J 4DV1J 3D3BJ 3W1YC 4PWWA 4HHUA 4DR5J 4DV7J 1XNQJ 4GKKJ 4JI7J 4LF4J 4KHPJ 3R2DJ 4JYAJ 3T1HJ 4JI1J 4DR2J 1XNRJ 3D3CJ 4KYZA 4B3SJ 4K0KJ 2VQFJ 4DUYJ 4LF7J 3IMQJ 4DV3J 3T1YJ 4DV4J 4NXNJ 5FLXU 4JI3J 2UXBJ 5LM7E 5LMNJ 1I94J 4JI0J 5IWAJ 4DV2J 4X64J 1XMQJ 4B3RJ 2UUAJ 5A2QU 4DR4J 4LF5J 2HHHJ 1N36J 1N34J 4B3TJ 4NEYA 1N33J 2UXDJ 4GKJJ 4B3MJ 1FJGJ 4LF6J 4LFCJ 4JV5J 3J81U 5LMUJ 3R2CJ 2F4VJ 2ZM6J 1HNWJ 2MEWA 4LF8J 4JI6J 4JI8J 4DR6J 2VQEJ 1N32J 4NXMJ 4AQYJ 2MTLA 4V1Ak 4RJVA 5AJ3J 1HR0J 4JI4J 5IT9U 1IBKJ 3JAMU 2UUCJ 4X66J 4JI5J 2MQ8A 4DR7J 2UXCJ 2E5LJ 4NEZA 2KL8A 4KY3A 1IBLJ 2UU9J 1HNXJ 4LFBJ 4DR1J 4DUZJ 4JI2J 1HNZJ 3J7AN 4X65J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA J;  4YY3 J;  1XMO J;  4LF9 J;  5BR8 J;  4YHH J;  4X62 J;  1J5E J;  4DV5 J;  4DV0 J;  4DR3 J;  2UUB J;  3J80 U;  3OTO J;  2KVQ E;  4DV6 J;  1IBM J;  4OX9 J;  4DV1 J;  3D3B J;  3W1Y C;  4PWW A;  4HHU A;  4DR5 J;  4DV7 J;  1XNQ J;  4GKK J;  4JI7 J;  4LF4 J;  4KHP J;  3R2D J;  4JYA J;  3T1H J;  4JI1 J;  4DR2 J;  1XNR J;  3D3C J;  4KYZ A;  4B3S J;  4K0K J;  2VQF J;  4DUY J;  4LF7 J;  3IMQ J;  4DV3 J;  3T1Y J;  4DV4 J;  4NXN J;  5FLX U;  4JI3 J;  2UXB J;  5LM7 E;  5LMN J;  1I94 J;  4JI0 J;  5IWA J;  4DV2 J;  4X64 J;  1XMQ J;  4B3R J;  2UUA J;  5A2Q U;  4DR4 J;  4LF5 J;  2HHH J;  1N36 J;  1N34 J;  4B3T J;  4NEY A;  1N33 J;  2UXD J;  4GKJ J;  4B3M J;  1FJG J;  4LF6 J;  4LFC J;  4JV5 J;  3J81 U;  5LMU J;  3R2C J;  2F4V J;  2ZM6 J;  1HNW J;  2MEW A;  4LF8 J;  4JI6 J;  4JI8 J;  4DR6 J;  2VQE J;  1N32 J;  4NXM J;  4AQY J;  2MTL A;  4V1A k;  4RJV A;  5AJ3 J;  1HR0 J;  4JI4 J;  5IT9 U;  1IBK J;  3JAM U;  2UUC J;  4X66 J;  4JI5 J;  2MQ8 A;  4DR7 J;  2UXC J;  2E5L J;  4NEZ A;  2KL8 A;  4KY3 A;  1IBL J;  2UU9 J;  1HNX J;  4LFB J;  4DR1 J;  4DUZ J;  4JI2 J;  1HNZ J;  3J7A N;  4X65 J; 
#chains in the Genus database with same CATH topology
 3HKZ D;  1BQN B;  3RBE A;  3MUV P;  2M0G B;  2ASD A;  1TFY A;  4ILM A;  1U2R A;  6AT1 B;  1CJK B;  5M2U A;  3DOM A;  4FXW A;  2L9W A;  4HR2 A;  1TMM A;  1I5O B;  2CVI A;  2XHW A;  5KFB A;  2ZH1 A;  2J9E A;  2XBP A;  3AOA A;  3HDS A;  1T7P A;  1VFJ A;  3ONQ A;  2UUB J;  4OHY A;  2GNK A;  2R8H A;  2YNH B;  3QT6 A;  4O3Q A;  1K47 A;  3RTV A;  2HRT A;  1F9E B;  3K5P A;  5DJB A;  2HVE A;  2XYH B;  4XPE A;  1CQM A;  2RS2 A;  4Y65 A;  1S1V A;  4CYU A;  2HW3 A;  1DBD A;  3ILI A;  1S79 A;  5CYM A;  4C9D A;  1RHM B;  2GVZ A;  3CED A;  4QWE A;  4LRC A;  4DV7 J;  1N5Y A;  1FKO A;  1JLB A;  2G0J A;  1TL7 B;  1YX2 A;  3R7N B;  3UVJ A;  2ZUA A;  4DX5 A;  1NZ8 A;  1VRU A;  3FEY B;  4RPF A;  4UST A;  3R2D J;  3SSQ A;  3OFE A;  4U9R A;  5GAH I;  2HHP A;  1MNE A;  1WEZ A;  1QUP A;  3NCP A;  3THV A;  1NK7 A;  2CPF A;  4IUF A;  2ATL A;  1Y5L B;  2V94 A;  3ETM A;  3LA0 A;  7AT1 B;  5KFN A;  3PFE A;  4LF6 F;  1Q5V A;  3FSY A;  1UTA A;  1WTF A;  2OKQ A;  2VG6 A;  3OPK A;  5J1E A;  5HAN A;  5J2P B;  4N5S A;  4LFC F;  1LXN A;  3PRV A;  3U1L A;  3ITH B;  4K2J A;  4RW8 B;  4AUK A;  2IJR A;  5B0C A;  4ERD A;  1UVI A;  1RE1 B;  2M4M A;  2YNH A;  3C6T A;  2GAH C;  3M8S A;  1S72 S;  2DCU B;  1NXI A;  1D0E A;  3J7A 1;  4ZPV R;  2A6M A;  4DQQ A;  3LAN A;  3H2U B;  3VAK A;  1UPM B;  2CJX B;  2JC1 A;  2VC0 A;  2W2M P;  5KFY A;  2BKO A;  3OTO F;  4FYV B;  3DRS B;  3I6P A;  4PZV A;  1FEH A;  2DO0 A;  2V34 A;  4DMZ A;  2EKY A;  2ZHB A;  2I0X A;  3NS6 A;  4ZN3 A;  3KLI A;  3VAI A;  4M1K A;  1HL6 A;  2QN6 B;  3CJT A;  1I94 F;  3OUY B;  3T19 A;  1JKH A;  2VG5 A;  3ENQ A;  1RAF B;  3MCN A;  3GFY A;  4PWD A;  3M2U B;  1R27 B;  3D1H A;  2UXD J;  2YWE A;  3SSR A;  4C11 B;  2AW0 A;  1EP4 A;  4FKY A;  2DKO B;  5E7O B;  5F8I A;  3D1Q A;  2OTJ S;  2P9E A;  2HS4 A;  4QPT A;  3OTC A;  2MKJ A;  3AOD A;  4WII A;  1HQE A;  4HDH A;  4EO6 A;  2DXE A;  2VQE F;  2AGO A;  2VV5 A;  2BAN B;  3PM9 A;  3Q22 A;  3ZZR A;  2O5D A;  1HNW J;  5DQI A;  5D15 A;  4J91 A;  2I5J A;  4KV8 B;  4OYX A;  2QG9 B;  1UWA A;  4DWI A;  4ECT A;  4G1P A;  4I7F B;  2H9Z A;  4Y2K A;  1LWC B;  1Y11 A;  2FD2 A;  4GMK A;  2B0G A;  2Z2Z A;  3RBZ A;  1FWL A;  2V6A A;  3IG1 A;  1N5S A;  4YDD B;  3VAF A;  3FCH A;  3FK4 A;  2OAU A;  4UOH A;  3ZZO A;  3ISZ A;  1T9V A;  2NYI A;  1KHW A;  3DDI A;  3ZNJ 1;  2M9K A;  1FX2 A;  2JL9 A;  4ZN1 A;  1T9T A;  1YWX A;  5AJ3 J;  2V9K A;  5CAB A;  5BYS A;  2KYZ A;  2W2P P;  3IS9 A;  4FXV A;  1EAR A;  3C14 B;  2HHV A;  1XR5 A;  1Y7P A;  3O2I A;  1S48 A;  3H42 A;  3ZZP A;  4AE5 A;  4R0E A;  2A18 A;  4ID5 B;  2OIH A;  1OQ3 A;  2E5L J;  3HD1 A;  4R8U B;  4NLP A;  3NP5 A;  2R7R A;  4OYW A;  2DEJ A;  4YY3 F;  2HYI B;  3GPA A;  2KN4 A;  1LFW A;  4ZVP B;  3DRX A;  4YHH F;  4IQX A;  1S12 A;  3W2W B;  1XR6 A;  4LBP A;  5L1I A;  1PAE X;  4O3N A;  2DNH A;  5JVH Q;  3NLC A;  3V4I A;  2IIH A;  3QAT A;  4FVM A;  3AH6 A;  1SL0 A;  5K14 B;  4LFA J;  3J7A N;  3M2V B;  5DDP C;  2AJ0 A;  2DGS A;  2G13 A;  3I32 A;  1H6K X;  4PYA A;  1NEE A;  3N28 A;  4A48 A;  3D0H E;  4IG0 A;  1YKW A;  2M52 A;  3Q8R B;  2I2Y A;  3OLA A;  3BN7 A;  4Z2X A;  3CJ0 A;  2ZEJ A;  2NXC A;  3OFF A;  3TI0 A;  3BQ2 A;  5D0R A;  5B0E A;  2PMW A;  3W64 A;  2ZZM A;  4WFA Q;  4B17 A;  2BDP A;  3MOJ B;  2KVQ E;  2MZR A;  2XG8 A;  4H4O B;  5F3T A;  1IBM J;  3J7Y I;  4IO1 A;  3LTO A;  2LEA A;  2VG7 B;  4YOE A;  3MZI A;  3BO4 A;  4WE1 A;  1V6H A;  2MKH A;  4O4R A;  1D8Y A;  2I1R A;  2K2P A;  1VQ5 S;  3DHW C;  3JYT A;  2DGT A;  4UOC A;  1LWE A;  3U1N A;  4DEZ A;  4XDC A;  3TOQ A;  1YJT A;  4DZD A;  4KHP J;  1UW9 A;  2JX2 A;  1WAC A;  1TUW A;  2DNQ A;  5HAT A;  5HMX A;  2CQ1 A;  2RD5 C;  2EFG A;  4Q2M A;  1YJW S;  4N47 A;  3JSY A;  4O0N A;  1K8A T;  1URN A;  3PR4 A;  3SV3 A;  1SIZ A;  1TVR B;  1WUU A;  3VZH A;  1SJ1 A;  4C3L A;  4ZVR B;  3N4W A;  2BXJ A;  5KT5 A;  4K0K J;  1TKT A;  1VLY A;  4DXL A;  1JKH B;  1JXE A;  2YQ3 A;  3BGR A;  4C3M A;  4CWB A;  2M7S A;  2IVM A;  2ZVS A;  2UVU A;  2KXN B;  1GX6 A;  3T1Y J;  4HAC B;  2DNN A;  3C6T B;  3VGT A;  2QLX A;  1KKH A;  1Z2L A;  4JB8 B;  3HFZ B;  1TQL A;  4P72 A;  2Y0B B;  4QBU A;  2XO6 A;  1JJH A;  2F4F A;  2N7Y A;  4A4J A;  1Q7L B;  2BZ2 A;  2V5H G;  3ENA A;  2E9Z A;  2CPZ A;  1IR2 A;  2V69 A;  3BSO A;  3CJ8 A;  1IBC B;  2AV5 A;  4C8L A;  2DB1 A;  3LPY A;  5A2Q U;  2YWK A;  1GMW A;  3BKT A;  3X1L B;  2HHH J;  1F9F A;  3OVB A;  4LRB A;  3BDP A;  4Q44 A;  2E5L F;  2M8H A;  3U7J A;  5EGY A;  2FHO B;  2PE8 A;  4TU7 A;  3BB5 A;  1GXU A;  2EI5 A;  1CJT B;  1MRO B;  3NS7 B;  3R27 A;  1S1W A;  2OPS A;  3P96 A;  4I69 A;  1I51 B;  4CDI A;  1QSY A;  3SXL A;  5L1L A;  2VBW A;  4J9O A;  2PI5 A;  4PXD A;  4ZPT R;  3E01 B;  1OPI A;  1Z2Z A;  4ZIV A;  3JAM Y;  1CEZ A;  1SQG A;  4RBU A;  3ZTR A;  3MAQ A;  5HSP A;  3MDF A;  2Q3P A;  4WFN Q;  5F8L A;  5CD4 A;  1DUR A;  1MWZ A;  1VS3 A;  2Z57 B;  3R6G B;  2AD9 A;  2DTJ A;  2VPZ B;  4FDF A;  3NNH A;  4U95 A;  1RK8 A;  4CYU B;  2ZJP Q;  3MM5 A;  3LH2 S;  1O8B A;  4C0O C;  2D3O R;  2DIT A;  5CYM B;  3HO1 A;  2ZBC A;  2VUG A;  2CPE A;  3OTB A;  1F5C A;  2Y0S D;  3LAL A;  1K73 T;  4DF4 A;  1RT1 B;  3ILL A;  5LSL A;  4OI0 A;  1VBX A;  4JI8 F;  5ETS A;  3UVJ B;  4DPX A;  2ZD1 A;  2AJQ A;  3UCZ P;  5KFI A;  3VAL A;  1NUE A;  3KG1 A;  3KJV A;  5IT9 U;  3JAM U;  2QMU B;  2JEG A;  2OP5 A;  3KMS A;  2YWF A;  3D68 A;  3HX9 A;  2F5G A;  2QMX A;  5E41 A;  2MGZ A;  3I55 S;  3MR3 A;  1UAW A;  4RNF A;  2VJU A;  1YTY A;  2QJ3 A;  2UXC J;  2AYG A;  4LBI A;  3DNC A;  1MMN A;  1O51 A;  2I8E A;  1BQX A;  5T7L B;  4IG3 A;  1S1X B;  3PXG a;  5HI7 A;  8AT1 B;  1T11 A;  4M5K A;  2WSE C;  5ETM A;  4Q2L A;  3UCG A;  3X3U A;  1HWJ A;  5BJR A;  4QR0 A;  1HWU A;  4PR6 A;  5CD4 H;  2ASJ A;  5DDQ C;  2NXU A;  2HQD A;  3CDW A;  4FPR A;  5HQ8 A;  2HRU A;  2E5I A;  3H2V E;  3I82 A;  4XO0 A;  1U1M A;  3N6N A;  3AQP A;  4TLR A;  3O5T B;  3OR1 A;  1F9H A;  3CCW A;  3IRX A;  2OPP B;  3BPD A;  1WHY A;  3C3L A;  1IKX B;  2O01 C;  1WKL A;  3NGT A;  1LOU A;  2OHD A;  3NMR A;  1HWK A;  1X9S A;  5D0G A;  4K50 A;  2ZE2 A;  1WD6 A;  1JLE B;  4DV5 J;  4I6W A;  4IDK A;  3R97 A;  1VJQ A;  2SXL A;  4CLZ A;  4DL3 A;  2N82 B;  5KFG A;  1HBM B;  3QGH A;  5C42 B;  1NB2 A;  1S9E B;  2N3O A;  1E6V B;  2ZHA A;  2KKH A;  1P9Y A;  4EBC A;  1TP7 A;  4WZM A;  2CZ9 A;  2V68 A;  4AND A;  4YUD A;  2ADC A;  3UFC X;  1M5P C;  4DV6 J;  2HQI A;  1TKT B;  2KT5 A;  1SH3 A;  2LXF A;  3MD1 A;  3H8Y A;  2HQC A;  5CQG A;  2MMY A;  3UDV A;  1Q82 T;  3BGR B;  3DLL Q;  3C15 B;  2G2O A;  2YKN A;  3BR9 A;  2CQ3 A;  4YME A;  4WE1 B;  2CJB A;  4DFJ A;  2V2K A;  2PSZ A;  4ZLN A;  3DYA B;  2EK6 A;  1WWH A;  2OPR B;  3DGP A;  1P9Q C;  1K1Q A;  2XZT B;  4KO0 B;  3MAA B;  5E3P A;  1NK6 A;  1K0V A;  4EZ9 A;  3ZZT A;  2YKM A;  3MOZ A;  1JXL A;  3OR1 B;  3HLU A;  3HUL A;  1PBU A;  3OXF A;  4RUC A;  3I0S B;  1B7Y B;  4YFU A;  1R8H A;  4DR2 J;  3D0G E;  4MJK A;  2F1F A;  1XNR J;  3D3C J;  4QYR A;  2V8D A;  1SUQ B;  3H5Y A;  3MEK A;  2C1E B;  2LEC A;  1HNW F;  4QIW D;  1PJ5 A;  1AZS A;  5C25 A;  1FD2 A;  2G2Y A;  1L3K A;  1X5T A;  3HSZ A;  5HBM B;  4CRJ A;  4ECX A;  2XY5 A;  4GKK F;  1C2P A;  2PMH A;  3QFH A;  4NLU A;  3EYZ A;  2H51 B;  5IV4 A;  2L48 A;  2EWH A;  5EWF A;  2FDN A;  2VG6 B;  3PYF A;  4ID5 A;  4KB7 A;  1MU2 A;  1VDH A;  2HBQ B;  3HVW A;  2CPD A;  5D4N A;  1L3U A;  3CDE A;  5E5N A;  2J0W A;  3RYL A;  2HBZ B;  1JJC B;  2P8I A;  2IDE A;  1S59 A;  2R4F A;  2WVF A;  4O4G B;  5CYQ A;  3TEG A;  1D1U A;  2VBX A;  1FER A;  3BRE A;  4GC7 A;  3VAJ A;  1NCL A;  3KOA A;  5FDL A;  4WZQ A;  4DPT A;  2XTJ P;  3LAK A;  4QYZ K;  4DV2 F;  5A8W B;  5EWE A;  2QRR A;  3UW1 A;  2BAB A;  2YQ0 A;  1Y5N B;  2ROG A;  3QFW A;  4GO7 X;  5IT9 Y;  2R7V A;  1X31 C;  4OI2 A;  1Z4U A;  1BLU A;  1VRQ C;  5HQL A;  1SIW B;  3M1V B;  2W8L A;  3SV4 A;  4QU6 A;  4RNM A;  4K4Y A;  4RO0 A;  4NZ6 A;  1RAD B;  2B9X A;  2COL A;  4G1I A;  1KTV A;  1WOR A;  3AXM A;  5HBM A;  4ZHR B;  3SZ2 A;  1S0N A;  3BGL A;  1RWX B;  4G1Q B;  2AMC B;  3UD3 P;  1HAR A;  1SCJ B;  1VRT B;  2DHA A;  5ETL A;  3M32 B;  2XHC A;  4R5P B;  4DR5 F;  4FN5 A;  4ECW A;  2ZOM A;  2D3U A;  3P45 B;  5FII A;  3W60 A;  1K9M T;  3P49 B;  2ZBR A;  4NL5 A;  1ITP A;  5LL6 d;  3GJT B;  2HVI A;  1RWU A;  2J0X A;  5ETR A;  2AX0 A;  3F0N A;  1FXR A;  5E3R A;  3T6J A;  3JB9 k;  4PAA A;  2XB2 D;  1HR0 F;  1S9G B;  5L8R C;  3HJF A;  2D3Z A;  3DLG B;  2M3D A;  2R7O A;  2V8G A;  3GJS B;  3AA8 A;  4QW8 A;  2V4J A;  3J7Y U;  1G6B A;  2BQU A;  4KFB B;  1GT8 A;  2CPX A;  3QGP A;  3GU0 A;  3R9L A;  2UUC J;  4ZPW R;  2MQ8 A;  3D6F B;  3DC2 A;  2KDO A;  2ACM A;  2DHG A;  3A3N B;  2ACY A;  3ULH A;  2HFN A;  1RA7 A;  3VCD A;  4ED2 A;  3QLH A;  3CCZ A;  3CJ4 A;  4PG6 A;  4CTA A;  3SDE B;  5IFM A;  3CC2 S;  4UOG A;  2CQ0 A;  1FXL A;  5KOX A;  5A6W A;  2UU9 J;  1WHW A;  5J1P A;  4DN9 A;  1LWX A;  3DM2 B;  2RT3 A;  4USV A;  1NJZ A;  4M5L A;  1NPK A;  1TR0 A;  4P52 A;  4JI7 F;  2E66 A;  3PYD A;  2XMV A;  1MW7 A;  3FFI B;  2XSJ A;  4KGX B;  1VMB A;  1Q53 A;  1XN9 A;  2EFO A;  2V63 A;  3KG0 A;  3SCJ E;  4CLU A;  3OLB A;  1FE0 A;  3CD6 S;  4WKR A;  3W9I A;  4EYH B;  4LF9 J;  1IQT A;  2OPP A;  3DRP A;  2VHG A;  1S0M A;  1TL3 A;  2HMI B;  2B4U A;  2CJQ A;  4ZMM A;  5H9E J;  1VQ8 S;  1RBL A;  1YRU A;  4KHR A;  4CNZ A;  1CBK A;  2V4J B;  2LQB A;  3QIP A;  5AXM A;  1WI8 A;  2WVE A;  4AQY F;  3KKF A;  4P2M A;  5AJ3 F;  2IM1 A;  3KLG B;  3HK2 A;  1T05 B;  4ELU A;  4I2P B;  4BS2 A;  5CHC B;  4ZPB A;  2EKN A;  3ZC4 A;  1IJE B;  2EC0 A;  4L3N A;  3WIU A;  4LBH A;  3TZY A;  5G0R A;  3RBX A;  2XS7 A;  1G2E A;  1T94 A;  1X7V A;  3CTR A;  5AXL A;  4K8R A;  2Q6B A;  2XEX A;  4ZP7 A;  2RHS B;  2R7W A;  2QO3 A;  2JEF A;  1IKW A;  1DHM A;  1W26 A;  4OFZ A;  1VBK A;  2F3J A;  3K8V A;  3HHL A;  4J9S A;  3PW5 A;  4Y3C A;  2DIU A;  2C2E A;  2Z2Y B;  4N8N A;  1SVD A;  2E1P A;  3PRB A;  4NPO A;  4WXO A;  1WEY A;  2P6T A;  5KFP A;  3BSN A;  2RSQ A;  6FD1 A;  2N3L A;  1HPZ A;  1NND A;  3NOG A;  4H4M A;  4O44 A;  5IM0 A;  2OGU A;  2VBZ A;  1U1N A;  3HVR A;  3CUN A;  1F3V A;  4ZS6 A;  3UD5 A;  4EBD A;  2VQF J;  3MMA A;  4NI2 B;  4OYI A;  2H65 B;  1OJ4 A;  1JMT A;  2PDA A;  1GTH A;  2WVD A;  3FQL A;  5G0R B;  4WTY A;  3KUH A;  4JP8 A;  4R25 A;  3P3D A;  4E98 A;  3L95 X;  1RT2 A;  3VVT A;  4MKB A;  1S1U A;  1FEE A;  5LSR A;  1EIY B;  1S1T B;  4HT7 A;  2BAN A;  5I42 B;  4EYI B;  2W7P A;  1HYS B;  4DR4 J;  4F04 B;  1CJU A;  4FYD A;  2CKW A;  4C8O A;  3KXD A;  4W90 B;  1RTI B;  2DJW A;  3LP1 B;  4E8U A;  5KG5 A;  2F40 A;  5FD1 A;  5IT4 A;  4RUA A;  4PUO A;  4KH1 B;  5D78 A;  2W7A A;  2GIR A;  2NQP A;  3H5S A;  3I31 A;  3GON A;  1LQ9 A;  1TL1 A;  2FHM A;  3NBP A;  4UY8 5;  1C4C A;  2K06 A;  2AJ2 A;  3GYX B;  4NEY A;  2HND A;  1VBZ A;  1JLE A;  2HNZ B;  1T0T V;  3DXB A;  1C1B A;  1DQ8 A;  1LK7 A;  1XER A;  3Q89 A;  4OZ0 A;  3MEC A;  5H1S V;  3JSM B;  1HIY A;  2MHN A;  3MF5 A;  4CT8 A;  3IAM 9;  3V6H A;  2NYH A;  2DR5 A;  5A8K B;  2HHX A;  1OO0 B;  4P2S A;  3SCK E;  3BSC A;  2QLF B;  3GR1 A;  4P7V A;  3KMQ A;  2OEK A;  2EPI A;  2OH2 A;  2F8M A;  3EPI A;  5AE1 A;  1S7H A;  4OMF G;  2FUG 9;  4RW6 B;  1ZPV A;  1W2B R;  2LQ5 A;  3Q83 A;  3R1H A;  3MPU B;  2NLW A;  3OVA A;  2BQR A;  3DYA A;  1RJJ A;  1NK9 A;  2FJW A;  3EGN A;  5D3G A;  2R7T A;  2PA3 A;  5KFO A;  2XMJ A;  3LP1 A;  2FVP A;  1HBO B;  3H2L A;  4EMD A;  4WWS A;  5ITH A;  3H40 A;  3SIP B;  1MWQ A;  3QT7 A;  1WC5 A;  1Q95 G;  3V4I B;  1HR0 J;  1VQ4 S;  1EB0 A;  1KQK A;  2FVC A;  2DNO A;  5H9E K;  3QSY B;  2J0S D;  2VFS A;  3D66 A;  3J81 Y;  1C1B B;  1U0H A;  1ZTW A;  4IFY A;  4PWU A;  3W63 A;  1MMD A;  2QLW A;  3AJ2 A;  1RHK B;  2KL8 A;  2XO7 A;  2CPH A;  1RBA A;  3I87 A;  3FUY A;  4D3G A;  2G2Z A;  3MD3 A;  2D3O 1;  4GRS A;  5DDR C;  3AD8 C;  3AOC A;  3HI9 A;  5LJ3 Y;  1XMQ F;  4DR7 F;  4JI2 J;  3AY0 A;  2JRS A;  3BGO P;  3BZQ A;  3LOU A;  3M8Y A;  4OZ3 A;  4Y00 A;  4A8X A;  3IRW P;  1NSA A;  3ICL A;  4DG1 B;  1LW0 A;  3C6U B;  3IC1 A;  3JSR A;  3MMB B;  3NGR A;  4N77 A;  2MZ1 A;  3CCL S;  4O3P A;  3P5B P;  3G8Q A;  4F50 A;  1V9O A;  4KGK A;  1S9F A;  4R0J A;  2CQ2 A;  4RW9 A;  4RW7 A;  3PYG A;  5T41 A;  4ZVT B;  3KYL A;  2KTQ A;  5A8W A;  4PRF A;  4FF4 A;  1JWW A;  4I7F A;  3DXS X;  5HMW A;  3PIO Q;  2BJ9 A;  2RRN A;  3BBB A;  4ZVS B;  4QQB A;  1X0F A;  2IA6 A;  5K8N A;  1LW2 A;  3MM9 A;  4M95 A;  1TL7 A;  1JX4 A;  4LSN B;  1IR0 A;  1OY8 A;  1UET A;  4QWC A;  3VAM A;  1UZH A;  2H3E B;  2ZDO A;  3GIR A;  3TQE A;  4O0I A;  3PJW A;  4NCA A;  1N5V A;  4WXW A;  4KKO B;  4ZLL A;  3M8W A;  1VQS A;  4WF9 Q;  1R0C B;  2WRM A;  4CH1 A;  1V5V A;  5AT1 B;  5L46 A;  1DRZ A;  4GKK J;  2AHO B;  4YB6 A;  4DQI A;  4ZJO A;  2WSF C;  1S0V A;  1OY6 A;  2VF3 A;  4NLR A;  1RU1 A;  1S6P B;  1QTN B;  1RDR A;  2EFP A;  3PW4 A;  2AF6 A;  2LXU A;  3G82 B;  2NR0 A;  1C1C A;  2BE2 B;  2L9D A;  4J9V A;  2G1D A;  4F4X A;  1YJN S;  4LSZ B;  3H5X A;  3DGP B;  1BD6 A;  2CYY A;  3R7S B;  3F44 A;  1X4B A;  4AD6 A;  4KH0 B;  1ELO A;  1NPR A;  4DV5 F;  4FS1 A;  2LEP A;  1FTR A;  4RU2 A;  4OV1 A;  2RH3 A;  4IFV A;  1TL1 B;  1ZAX A;  4YP3 A;  3P8B B;  3MUR P;  3IMQ J;  5F0U A;  2FJE B;  1P1L A;  1NU4 A;  1RGV A;  1VQ6 S;  3Q24 A;  5HL7 Q;  5J2P A;  5K20 B;  5KT6 A;  3PW2 A;  3K5N A;  1HQ2 A;  3GJQ B;  3IBF B;  5D6G A;  4MIW A;  4UQG A;  4C11 A;  1KTQ A;  2LDI A;  3KJN B;  2C22 A;  1QAI A;  4NLG A;  4PQU B;  5ETK A;  1VQK S;  3A4T A;  3RRG A;  1N36 J;  4OYB A;  3RAQ A;  3LW5 C;  3ENV A;  2W25 A;  4HHJ A;  4DOZ A;  1Q16 B;  2E1R A;  2EBE A;  2AYB A;  3CB4 A;  3R5G A;  3DRP B;  4K0K F;  1G4C A;  3MUM P;  1IQZ A;  5EX0 A;  2DRA A;  1Q5Y A;  4K5R A;  1DAX A;  1NAQ A;  1F5B A;  2BM0 A;  3WC0 A;  1TMJ A;  2NRE A;  2CG8 A;  4ZPD A;  1TKZ B;  3KJF B;  3MM7 A;  3HVT B;  1RWV B;  3D1O A;  3IP0 A;  4JV0 A;  1RTD B;  2FC8 A;  1HA1 A;  4ED1 A;  1RB0 A;  2IRY A;  3UDL A;  1Y4Z B;  2VOD A;  4DZ6 A;  2GX8 A;  1FDN A;  1H2V Z;  4IH6 A;  1PYO B;  1Q8I A;  4G1Q A;  1RU2 A;  1IKW B;  2D74 B;  4YB7 A;  5IC6 B;  4USM A;  3QGI A;  2W9B A;  2Z2L A;  1UJ6 A;  5DS7 A;  2LMI A;  1VQO S;  1NK4 A;  3DDN A;  3U27 A;  1DTQ A;  2ZWO A;  2DH7 A;  1FNX H;  2YNI B;  5HMY A;  3C6U A;  1RKI A;  3MM8 A;  1U24 A;  2JZ5 A;  4LR8 A;  3KNA A;  4JI5 J;  1JLA B;  5LOQ A;  1NPP A;  1T95 A;  2W24 A;  1NSK L;  4OHX A;  1BGX T;  5D4O A;  1HBN A;  3CXC R;  5L9X A;  5JXS A;  4DHV A;  1FJC A;  1IBL J;  1WG4 A;  1MML A;  1E6V A;  2HAF A;  2B56 A;  1GMV A;  1HW9 A;  1C0T B;  3FZ2 A;  2F7V A;  2LQ9 A;  5DLG A;  2Z58 B;  1FK9 B;  2IC3 B;  2BMB A;  3Q8S B;  2YKP A;  1ZTT A;  1DTT A;  3ILO A;  1S10 A;  2IDL A;  1BC6 A;  3E01 A;  2MHE A;  4O3O A;  2AGQ A;  2E1M C;  5HVH A;  1LK5 A;  5DGA A;  4OZN A;  3RW7 A;  1WJ9 A;  2B9E A;  3FFI A;  2BV3 A;  4MIA A;  1M1H A;  2X3D A;  2QSF A;  3MAA A;  1SH0 A;  1S57 A;  5L39 A;  1RAH B;  2J7U A;  3J7Z T;  4DLE A;  3W61 A;  1N6Q A;  4LUB A;  3EVO A;  3JYT B;  2J6T A;  4FF3 A;  2DY1 A;  3FDS A;  5J2Q A;  1LWF B;  1DY3 A;  2FYX A;  3B8H A;  5IWA F;  4PAB A;  1FRX A;  3CGI A;  1EX8 A;  4PEO A;  1SL2 A;  1R6Y A;  4CT9 A;  2OO4 A;  2RB7 A;  3HSG A;  3MWB A;  5B08 A;  4NCB A;  4PWW A;  1SJF A;  5HLF A;  3EE3 A;  5K9F A;  3CJ5 A;  4DSI A;  8ATC B;  3TAM A;  2CJY B;  3PV8 A;  4F3M A;  3GE9 A;  2HFV A;  4B9L A;  3D9B A;  3J7Z 5;  1EP4 B;  4M5H A;  4PPZ A;  3GCW P;  5KFL A;  2XGP A;  5CH7 B;  1BWE A;  2QFJ A;  3BBC A;  2IM3 A;  3CIM A;  4M5M A;  2J9D E;  3R7B B;  2B7C B;  3QZ8 A;  3JSB A;  2A10 A;  2IM2 A;  4GC6 A;  4ZLP A;  2MKC A;  1S6O A;  1UEK A;  4RLE A;  1SBR A;  2BA9 A;  2FJD B;  1F3F A;  1RT5 A;  2GML A;  3DOL B;  1KQF B;  1NJI T;  3BS9 A;  2CWK A;  4U6P A;  5HVG A;  3IRX B;  2VOP A;  4P73 A;  3M6U A;  4MAK A;  2X1A A;  3ET6 B;  2CNN B;  4UF4 A;  1VJW A;  1IM4 A;  4LQ9 A;  5KFF A;  3M1V A;  3IR7 B;  2Y1L B;  4UUW A;  2W9C B;  5F8H A;  4FPI A;  5D0H A;  3HZE A;  4ZJL A;  2IRX A;  3MMA B;  4NI2 A;  2NSC A;  3TAP A;  2BJ7 A;  4C2M A;  2DGQ A;  2EFQ A;  1IJF B;  4J9N A;  2QEX S;  4IQM A;  1H38 A;  4AL6 A;  1VRT A;  2BOP A;  2E1C A;  2DNZ A;  1D09 B;  2BVZ A;  2VAS A;  2YPY A;  3CJR A;  3LO3 A;  1GFW B;  4WKY A;  4DV4 F;  1UVJ A;  1B0V A;  2K3K A;  2AT1 B;  3MPV A;  4LRE A;  4LJM A;  2HWH A;  5GAG I;  3M6W A;  4F8R A;  3H59 A;  4OX7 A;  2RHQ B;  2ZBI A;  4RW7 B;  1HFE L;  4RBT A;  1X4C A;  1P27 B;  2LXI A;  3W7B A;  4X4O A;  2IA0 A;  2R8J A;  4B3M J;  2E7V A;  4WFZ A;  5D0E A;  1U25 A;  1RYS A;  1NDL A;  1Z1Z A;  2IJF A;  3CJK A;  2Z56 B;  3HVT A;  3MUT P;  2BYC A;  3M8P A;  3GIK A;  2GMJ A;  2ROE A;  2ZD1 B;  1VK8 A;  4G6V B;  4JI6 J;  4JV2 A;  2DH8 A;  2YQ1 A;  2PA8 D;  3K59 A;  1WTB A;  2JVO A;  2ZNZ A;  3MPD A;  1R89 A;  3OTE A;  1AA1 B;  2XY7 A;  3JQJ A;  2VFR A;  2DGU A;  2YTC A;  3FC9 A;  4NLW A;  5D4L A;  4NXM J;  3HFV A;  1UVM A;  3CIZ A;  4NA3 A;  4QU7 A;  5I3P A;  3V6D A;  2XC9 A;  2MTL A;  1SC6 A;  1N36 F;  3DLH A;  9RUB A;  1ZM4 A;  3MHY A;  3KLH B;  2BRL A;  1IBM F;  1T9X A;  5C5J A;  1FVQ A;  2XMK A;  5L1K A;  1VLO A;  4C4W A;  3NOC A;  4ELT A;  3OHB A;  2FLP A;  2I5J B;  2Z4P A;  3ZZY A;  2G9O A;  2CJA A;  4FYX B;  3OVS A;  3OL7 A;  4J9P A;  2QV6 A;  3SEO A;  2EFV A;  4TXS A;  3QIP B;  1S5Z A;  2XUL A;  1RT6 A;  2C3Y A;  5KFD A;  4KSE B;  2VU5 A;  4KHM A;  2ZIT A;  3KLV A;  2J9D A;  3NGS A;  2Y8W A;  2NZ4 A;  1EZZ B;  5E3A A;  4DR1 J;  1C0T A;  3FKB A;  1AW0 A;  1U1K A;  3LAM A;  2EVZ A;  3AJD A;  1G1X A;  2R9L A;  3AB2 B;  3VR1 A;  3K5M A;  3CD7 A;  1PG5 B;  3MTJ A;  4CIO A;  2CXE A;  1CS4 B;  2VFT A;  3OD2 A;  1VHI A;  1WDT A;  5A2Q Y;  1B4S A;  1J5E J;  4USK A;  3IGV A;  4QWB A;  1MG7 A;  2LQ8 A;  2O3D A;  3EXC X;  1FJE B;  5E2Q A;  4ECY A;  1ZS6 A;  1QTM A;  2FZC B;  4USW A;  3P4U B;  4DCJ B;  3D6M B;  3MED A;  2MJU A;  2J7W A;  3OTO J;  4Q8E A;  2DNL A;  4CO4 A;  4M63 A;  2O1P A;  2P9G A;  4Y34 A;  4WYL A;  3FNN A;  3T1A A;  1GAO A;  2DBB A;  2HRY A;  2CAJ A;  5F9L A;  1O6X A;  4Q8F A;  2XS5 A;  2D9P A;  4F4K A;  4KFB A;  1ZYQ A;  3T1H F;  1N4L A;  3HSD A;  1LV5 A;  4AXJ A;  3ENW A;  5IQQ A;  2DO4 A;  2H54 B;  3W2V A;  1IKY B;  1OQ6 A;  4QIG A;  2PEH A;  2B4O A;  1QVF R;  3DN9 A;  3SMZ A;  5IS2 A;  3SFU A;  1U1O A;  4LQ3 A;  4DU7 A;  3EZO A;  1HBU B;  1CQN A;  1PKU A;  1N52 B;  4B9S A;  1HHQ A;  3FRY A;  3PNI A;  3T1H J;  2CA9 A;  2CPY A;  3RBD A;  1CS4 A;  4LRD A;  5AE3 A;  2W9B B;  3QPI A;  1REV A;  3KLE B;  2RDJ A;  4MTP A;  4ENO A;  4DS5 A;  2ZOF A;  4EZ6 A;  5ETN A;  2DR8 A;  4PCQ A;  3KNG A;  3I0R B;  1S6P A;  1FXD A;  1OPZ A;  2FPH X;  2WSC C;  2XLJ A;  2BJ3 A;  2KFY A;  2ASL A;  1T03 A;  1A7G E;  4WCE Q;  1LFP A;  1UJ5 A;  3Q2T C;  4B3R F;  4RKU C;  1SJ3 P;  1LWE B;  1H2U X;  5GVQ A;  2C28 A;  4ELV A;  5KFC A;  4DBQ A;  2BE9 B;  4TU9 A;  1HI1 A;  1R0A A;  2YNF B;  2KXF A;  4NXN J;  1AT1 B;  3LGH A;  1RTJ A;  2GS8 A;  4EO8 A;  4OZ2 A;  1SUQ A;  5KFQ A;  3KLF B;  4WP3 A;  4XAK A;  3K89 A;  5KOW A;  4UT4 A;  1BQN A;  2HFZ A;  3JXO A;  4OQJ A;  4DR1 F;  4CO0 A;  1KEK A;  2UUA J;  1YZ7 A;  3PW0 A;  5CCL A;  1U6B A;  3QQC D;  2GW8 A;  1N0V C;  1XQI A;  2HKE A;  4KAI A;  1LXJ A;  3T9N A;  2YNG A;  3PRD A;  4OI4 A;  4DFP A;  4A8F A;  3C2P A;  3LGN A;  1X4G A;  1IBL F;  2HFO A;  3V81 B;  2ZH5 A;  4OZJ A;  1KLM B;  2XS2 A;  1OYD A;  1KC8 T;  4P10 A;  5KG4 A;  4X4R A;  4E0D A;  4J7C A;  1ZM3 A;  2F65 A;  1QAY A;  2CIM A;  4DLG A;  2HHQ A;  5LMU J;  2XLI A;  2ZM6 J;  4MK7 A;  1WG5 A;  2ZNY A;  4NXM F;  3VQS A;  1T3N A;  2E1A A;  1PCA A;  4PXB A;  2HLT A;  3WZ0 A;  2W2O P;  3FRZ A;  3FMB A;  3W9H A;  3UNG C;  2BEF A;  2J8S A;  4N7T A;  1AFJ A;  1SXL A;  2ILY A;  1NH8 A;  2VDI A;  1RHR B;  3VGV A;  4ETZ A;  2MKY A;  2CJ9 A;  3L7P A;  2MKS A;  5MAO A;  4B3M F;  2MY7 A;  1JK9 B;  1OSD A;  3WDO A;  2KHC A;  4DR3 F;  4A8S A;  2MLZ A;  3W3S A;  5GAD U;  5J1E B;  3POT A;  2K1R A;  2AJ1 A;  2ZJQ Q;  1GNK A;  2XYP B;  5EX3 A;  1N32 F;  4ZVH A;  1B70 B;  1H0H B;  2BJD A;  2C2Z B;  2CPJ A;  1YBA A;  4DPU A;  1S76 D;  2Y9H A;  1DTQ B;  5F41 A;  1CJU B;  5BYR A;  3LWM A;  1IM6 A;  4DSF A;  3DLB A;  3EJM A;  4L6V 3;  4QJV A;  4Z7C A;  1H73 A;  2GGP B;  5HK4 A;  3WC2 A;  1K44 A;  1XR7 A;  3E51 A;  3N0V A;  4B08 A;  4DL7 A;  1SJR A;  1HLW A;  5DG7 A;  3NBP B;  3M30 A;  1L5U A;  4YR2 A;  1SH2 A;  2LDY A;  3PX4 A;  2DNR A;  3KUE A;  4OZ5 A;  4LSN A;  1RHQ B;  5KFJ A;  1TK0 A;  2M8D B;  4C8K A;  2LU2 A;  2MQN A;  4I2Q B;  7FDR A;  3VGU A;  4ECQ A;  5HN0 A;  2XMT A;  4K59 A;  3L7O A;  2MQO A;  4X62 J;  1VIX A;  1XK8 A;  1UPP A;  3LUY A;  3D2W A;  2HUR A;  3N6M A;  2MXY A;  5ADZ A;  3H20 A;  4K7Q A;  4I0W A;  2ZC4 A;  4DR3 J;  2FC9 A;  2L08 A;  1PIL A;  2V2Q A;  2VB6 A;  4ECS A;  4URG A;  3Q86 A;  1VIS A;  2BJE A;  3TUZ C;  4ZCK A;  2IY5 B;  2A1B A;  2DR6 A;  4F0H A;  3ZNU A;  2A3J A;  2HHT A;  1VC5 A;  2ZKU A;  1IBK F;  1QDU B;  4DV1 J;  3ZTS A;  2KT2 A;  3VF0 B;  1WOO A;  4KRW A;  5HMZ A;  1URR A;  4OYP A;  2KM8 C;  2ZM6 F;  1S77 D;  1IXK A;  3FEX B;  3IBC B;  3W2V B;  4BBY A;  2B43 A;  3DKD A;  4QZV B;  4WP8 A;  1YI2 S;  5ETO A;  3M2R A;  2JLF A;  3FBE A;  2RNE A;  2V4R A;  4JI1 J;  1KFD A;  5DQG A;  2MZJ A;  2ZVI A;  5B0D A;  4P6Q A;  3Q23 A;  2QYG A;  2YVS A;  3IM9 A;  3CPW R;  1TAQ A;  3ETO A;  3CME S;  2HHS A;  4C8Z A;  1VQ9 S;  2FJX A;  4IRK A;  1SC1 B;  4FKX A;  3NGU A;  2KFZ A;  1KBR A;  2H4Y B;  1CSJ A;  1RT2 B;  4DSL A;  4F2S A;  2RQ4 A;  2DH9 A;  3P5T L;  4TQR A;  3K58 A;  4J9Q A;  1HWL A;  2MB0 B;  5J2M B;  4IOA Q;  2MKK A;  2HBR B;  3LPE A;  2AEF A;  2GVZ B;  2JEI A;  4KO0 A;  3DOL A;  1KON A;  1G3O A;  1JLC A;  1RWW B;  2R42 A;  1D8Z A;  3JTN A;  5IWA J;  2M70 A;  4EEY A;  2XSF A;  1Q1K A;  2B8Q A;  2Q43 A;  5EHH A;  1OY9 A;  4HLB A;  2BQ3 A;  2GFF A;  4LVN P;  4WJB A;  3DLE A;  5DG9 A;  4B3R J;  2C2N A;  3AXK A;  3KLI B;  2KYX A;  1ZBT A;  2QSW A;  3DCA A;  1SB6 A;  1V5I B;  1TAU A;  1UEV A;  2RKI B;  4PKD B;  4A46 A;  4RNN A;  3Q0A A;  2EG2 A;  3FZB A;  5IC4 B;  4Z37 A;  1OYE A;  3VQT A;  2QGF B;  2Q79 A;  1MWY A;  1OMS A;  2PN6 A;  4FVC A;  3JQK A;  3OFH A;  4DCP B;  4YR0 A;  3Q8P B;  2BRK A;  3M9N B;  5A76 A;  4DR4 F;  5IZH A;  1HYS A;  4L74 A;  2YNI A;  3FBB A;  1RTI A;  3GMG A;  2GQC A;  3I9V 9;  5C2G A;  1JB0 C;  1JLF A;  1IR1 A;  1QM9 A;  1QUV A;  2HEK A;  3LQV A;  4OHW A;  4B3S F;  4P7T A;  5KT2 A;  3GV7 B;  4FYY B;  4EU0 A;  4TU8 A;  1HNV A;  5C2C A;  4DSK A;  2V8V A;  2ABY A;  4EWT A;  4KHP F;  1RAE B;  4WIQ A;  5ETV A;  2FVQ A;  1UVN A;  2AEJ A;  2MLX A;  1BQM A;  2HBY B;  1YJV A;  2DY9 A;  1VCT A;  1X4F A;  1X5S A;  2L9N A;  2P9C A;  3AOB A;  3M8P B;  4M5D B;  1U0H B;  1L3S A;  1Y10 A;  1TVR A;  1MSW D;  1U49 A;  4F02 A;  3VGS A;  1TKX B;  2JSX A;  1HHT P;  3LP2 A;  2BX6 A;  2W2Q P;  2B9W A;  3UR3 C;  5F9N A;  3T3F A;  3BH7 B;  3UI3 A;  3MFI A;  1RAJ A;  3FSX A;  3ISN D;  3BQ0 A;  2ADB A;  3B4M A;  3KTQ A;  4NE9 C;  5I4M A;  4DV1 F;  2YWG A;  3QJJ A;  3M8Q B;  4HTI A;  1PC4 A;  1KLN A;  2FHJ A;  3ZZU A;  3I9Z A;  4PG7 A;  4Y2I A;  5HP1 A;  2B51 A;  2GGP A;  1Y3K A;  1UEU A;  2RQM A;  3G2X A;  4X4V A;  1FRI A;  1T9W A;  1FA0 A;  3CD0 A;  5IT0 A;  5IQ6 A;  4H4M B;  1U1R A;  2UXB F;  4CLP A;  4U7C A;  1FFW B;  1GXT A;  2HIY A;  4JOU A;  4V19 X;  3AFG A;  3M8R A;  4ZDN A;  3PFO A;  1RA6 A;  2DEI A;  3MM7 B;  2RDD A;  1JNZ B;  3S6E A;  3TAQ A;  4I68 A;  1NO8 A;  4CO5 A;  3MR2 A;  5HAO A;  2DPJ A;  2UXC F;  2DIS A;  1EKR A;  3IS9 B;  3IGN A;  4IG0 B;  3I5B A;  5E0O A;  1DQA A;  4CLL A;  4U8Y A;  2HK2 A;  3M6X A;  3LP2 B;  5DDO C;  4B3O A;  2LCW A;  1C4A A;  2R7X A;  1R3N A;  1FRH A;  3C15 A;  5J1N A;  2JFK A;  2XMU A;  1SC3 B;  3I56 S;  2MQP A;  1VGY A;  2OUG A;  2GIQ A;  1J5O A;  4EI2 A;  1W7W A;  1JLG B;  2UUT A;  4NML A;  3MMJ A;  2R2U A;  3G6V A;  2OPR A;  3N6L A;  2MZS A;  3FBC A;  4KT0 C;  4JI6 F;  3T6B A;  4TYB A;  2BR0 A;  1VQM S;  3QMQ A;  2L3M A;  1CC8 A;  3I5C A;  2VIH A;  5GAE U;  1SC4 B;  2HVZ A;  4LF4 J;  4IFV B;  3WX4 A;  4RNO A;  1B3T A;  4M5I A;  3JSM A;  1UJ4 A;  3OFG A;  2AJF E;  1R0B G;  4HI1 A;  4ECV A;  1V3R A;  2MJN A;  3TEH B;  2YY3 A;  3QWP A;  4RW4 B;  3E3X A;  3OV7 A;  1VC6 A;  3NRB A;  3K57 A;  3C46 A;  4GKJ F;  1RWK B;  2VBY A;  2IMW P;  4B3S J;  1K1S A;  2IHR 1;  1WI6 A;  2HS3 A;  4LRA A;  4K4X A;  2AGP A;  1X8D A;  3C66 A;  2PEB A;  1W2I A;  2ASY A;  5T7L A;  5B7W A;  2E5H A;  2W4C A;  2VG7 A;  5CAA A;  1UA1 A;  1RAB B;  2YBV A;  1J5O B;  1KOO A;  3K8W A;  5LSO A;  1S7I A;  3L3C A;  1JLG A;  3K5O A;  4OZ1 A;  3US5 A;  4DQR A;  2IAJ B;  4KV8 A;  3A8J A;  4WFX A;  5FDL B;  1RQ0 A;  4QIV A;  2QA2 A;  4Y6I A;  2GJ2 A;  5THW A;  3TQ1 A;  2FJB B;  4KQZ A;  4ZVQ B;  5KT7 A;  4RU9 A;  3LP0 A;  2VFU A;  1HPZ B;  2PO4 A;  1IKX A;  4J9R A;  2H5J B;  2KVI A;  1QSL A;  1LWF A;  4DL0 C;  2HHH F;  1XMQ J;  1O5J A;  2V4Q A;  2HK3 A;  2MZQ A;  4LF5 J;  1U09 A;  4IKA A;  1H7X A;  2I6W A;  1RWN B;  5DLF A;  3M05 A;  3PKY A;  2RDI A;  4I2Q A;  2ERR A;  1X0P A;  4CCH A;  1K0T A;  4TY8 B;  2PGC A;  3TX8 A;  2J8A A;  4CLW A;  2HQ3 A;  1UVK A;  5I3U B;  1Q7Y T;  3PY8 A;  2Q6C A;  2DIV A;  1GH8 A;  4R5P A;  2R8K A;  3CW2 C;  3NWG A;  1FI4 A;  1OWX A;  2YKN B;  4PXC A;  2JEJ A;  4LF6 J;  2V2Z A;  1LW0 B;  2G0I A;  4USH A;  2A6O A;  3WIV A;  2YXL A;  4HEA 9;  2EG1 A;  1Y00 A;  4OLO A;  3BQ1 A;  3O6Q A;  2PFD A;  2F4V J;  4JV5 J;  2M5Y A;  2QE5 A;  2CZV C;  5E3C A;  4DX8 H;  4A8Y A;  5AXK A;  3V5R A;  4I67 A;  1HNV B;  2FLO A;  2WON A;  3H5U A;  3W8G A;  1UP1 A;  1U1P A;  4DV7 F;  1KWM A;  5K14 A;  2DRB A;  2R7Q A;  3PYE A;  1KR4 A;  2JWN A;  4DPW A;  2XMA A;  1RTD A;  5JJB A;  4J9U E;  1SKU B;  1YQH A;  4ED6 A;  3RB4 A;  3TA1 A;  3NCR A;  2EK1 A;  4CO1 A;  2B5J B;  2F63 A;  5K8M A;  3AT1 B;  3DOK B;  4RJV A;  4DPY A;  1IBK J;  3DRR B;  3KHR A;  5B0F A;  2JLG A;  1X4D A;  3TJ8 A;  4TNO A;  3NY0 A;  2NSB A;  1XIQ A;  3PHE A;  4M5N A;  4NCG A;  3GIJ A;  3I4H X;  4KJI A;  3EIC A;  4J9K A;  4ZVO B;  1E6Y B;  5K8O A;  4NYZ A;  4OJH A;  3QJL A;  4CQ1 A;  3O8W A;  4UUX A;  1FFS B;  4C97 A;  3RU0 A;  2LQJ A;  1FJG F;  3MCM A;  1RHJ B;  2CUY A;  4KGZ B;  3TWZ A;  2QLB B;  3W65 A;  1U2C A;  2VIC A;  4JUZ A;  1FVS A;  2WOM A;  2W1B A;  3D0I E;  5B0A A;  3T5H A;  2EW9 A;  2YX1 A;  4NLX A;  1ACM B;  3IG1 B;  4NZ0 A;  1SJ4 P;  3QNW B;  2GVD A;  4WFY A;  5BR8 J;  3RB0 A;  2BBE A;  4H54 A;  2IM0 A;  3DLE B;  4YHH J;  3G96 A;  3PW7 A;  2R7S A;  2XY6 A;  3KUG A;  4ID8 A;  1R6V A;  2MGZ B;  3GV8 B;  2B5J A;  2E7X A;  3TNV A;  4DUZ F;  1XMO F;  1N8R T;  2VQF F;  3BN4 A;  1HW8 A;  2RML A;  2FY8 A;  2MQQ A;  3ILJ A;  2DGW A;  1S6Q A;  1GQE A;  1S1X A;  2E7W A;  2G4B A;  4NCG B;  5KFZ A;  4IRC A;  4Y2C A;  2NPF A;  4F36 A;  3OJU A;  3KDN A;  2FTR A;  3TYT A;  2BJ8 A;  2G1H A;  2ROP A;  4RUH A;  1JNR B;  1WSV A;  1XNR F;  3TUI C;  1T03 B;  4BWM A;  4DR2 F;  1NK8 A;  4O23 A;  3GR0 A;  1J27 A;  4HKQ A;  5KT4 A;  3GWC A;  4RW9 B;  5GAE I;  2DVI A;  4PQA A;  1RLD A;  3EDQ B;  4O44 B;  3UR0 A;  4JI7 J;  4KPC A;  1YDL A;  2YNF A;  4FYW B;  4J9L A;  2LEB A;  2KFN A;  2KG0 A;  2C3M A;  1RT3 A;  2D69 A;  1FDD A;  2ZKT A;  2B6A B;  3PJX A;  1VRU B;  4TLQ A;  1TKZ A;  3N5F A;  4USI A;  3M2V A;  4ZVG A;  4FF1 A;  4A8K A;  1GMU A;  2HQF A;  1ZZN A;  1X9W A;  2C2R A;  5D4P A;  4K4W A;  2U1A A;  2VPY B;  3IAS 9;  4H4K A;  5CCM A;  4IR1 A;  2DHH A;  2VKZ G;  4QIF A;  1NHV A;  4ICL B;  1UZD A;  5B09 A;  2APO A;  1IWA A;  5ETT A;  2R8I A;  3OL9 A;  1WKJ A;  4NLT A;  1M1K T;  3CDU A;  3G8T A;  4IH5 A;  3EVM A;  1O0P A;  3SI8 A;  2PI4 A;  1PIE A;  3B54 A;  3NCQ A;  3B6B A;  4A8O A;  3FCV A;  3TR5 A;  5CYQ B;  3L9Z A;  3MAH A;  1I94 J;  4X4U A;  1WSR A;  2QA4 S;  4U7U D;  1BWV A;  2AYM A;  3M4X A;  5DRK A;  2RQC A;  3H25 A;  3G71 S;  2FVR A;  4DQP A;  4QYZ J;  2DNP A;  3TA2 A;  2PMZ D;  1FHT A;  2ALZ A;  4OJ1 A;  4ZKA A;  4Q45 A;  1H98 A;  2VFV A;  3NEK A;  3CMQ A;  3JQM A;  1RWP B;  3S01 A;  2VG5 B;  5I3Q A;  2WTF A;  1N34 J;  4CLY A;  1CJK A;  4B9T A;  1FES A;  3OTD A;  2RKI A;  1U6F A;  4BCA A;  1Q79 A;  3QT5 A;  4LFC J;  1ZAV A;  2GJI A;  1L3T A;  4M8L A;  4RW6 A;  4FBU A;  1EKS A;  4DV3 F;  1JJ2 R;  1HNI A;  2JVR A;  5E33 A;  2ZJR Q;  4DUT A;  2XCP A;  1S49 A;  2H48 B;  5JVG Q;  2MEW A;  3T1Y F;  1DAR A;  4ILR A;  2J0Q D;  3MGJ A;  4JI8 J;  2NXN A;  2QL7 B;  3PEH A;  3Q2S C;  4OYZ A;  5IV3 A;  3DI6 B;  2UXD F;  4I4B A;  2CDR B;  2HZA A;  2WZ1 A;  1PBA A;  4MKA A;  4OI6 A;  2Y1I A;  4LRF A;  2FLL A;  1MN7 A;  2OJ3 A;  5J2Q B;  1TK8 A;  2KJV A;  2YH0 A;  4TKT A;  4OX8 A;  2WAQ D;  1R7I A;  4KBI A;  4OJ3 A;  2GA7 A;  5KFA A;  1BHN A;  4MFB B;  1T9U A;  4L76 A;  3MR7 A;  2DCL A;  1OS5 A;  5A8R A;  5KG2 A;  1Q81 T;  2Z0G A;  1OIA A;  2UV8 G;  1D9F A;  1PC5 A;  1XMB A;  5C42 A;  2UUA F;  1VHF A;  3DOK A;  3EM1 A;  3R5A A;  1CLF A;  2N7C A;  3EDR B;  3HFK A;  2RQK A;  2J5A A;  2AJ4 A;  4PXE A;  3TAM B;  2FGO A;  1RIS A;  2V67 A;  1KFS A;  3AB4 B;  3BEG B;  3C16 A;  3CT9 A;  2XQC A;  1DFD A;  1YBT A;  3DFE A;  2OTL S;  3TA0 A;  3MCS A;  2B4P A;  3GII A;  2D9O A;  1HNX J;  3IWX A;  1F6T A;  2LFV A;  3HSJ A;  6FDR A;  1H74 A;  3BDE A;  1J5E F;  4Q0B B;  3FEZ A;  3G8S A;  3GQC A;  4TN2 A;  1KLM A;  2IRU A;  4X4S A;  4JI5 F;  2JHE A;  3N79 A;  3MEE A;  3OR2 B;  2WB1 D;  2RS8 A;  5A6P A;  4IO9 Q;  4C8N A;  1HNX F;  2LKZ A;  1JLA A;  3IR5 B;  4QW9 A;  2YKQ A;  3DLJ A;  3OXL A;  1RT1 A;  4F7V A;  3W5X A;  3GIM A;  1YVF A;  3HD2 A;  3BYP A;  3ZTQ A;  1RT3 B;  4DL6 A;  3ZTP A;  1HHS A;  4ETX A;  5BXI A;  3RW6 A;  2CQC A;  2OI2 A;  4F3O A;  4ANC A;  3D7S B;  3S7R A;  3FSI A;  5AXN A;  5GMK a;  4FP9 A;  4BC9 A;  1IKY A;  5AE2 A;  1FDB A;  4ED7 A;  2YH1 A;  4KPY A;  4KGM A;  4DX7 A;  5F8M A;  3CCS S;  1FKP A;  5EUH A;  3PVX A;  2RIJ A;  2A2C A;  2H4W B;  3CDB A;  5CXT A;  4RWW A;  3C16 B;  4A47 A;  1YLX A;  4OV6 A;  4KC5 A;  2RVJ A;  4DSE A;  1REV B;  3KLE A;  2HAI A;  4IOB A;  1WNE A;  3B78 A;  4WK3 A;  3HVA A;  2B9Y A;  1VQY A;  1EQM A;  4JI1 F;  1XNQ J;  3EGZ A;  2IPO B;  1YBU A;  3VWS A;  1HBO A;  3HKW A;  3JTP A;  3V6D B;  4ED5 A;  2DR9 A;  3MEE B;  2BW7 A;  1XEZ A;  3CUL A;  1SQF A;  2Y1R I;  3WQP A;  3GFX A;  3THT A;  1VYA A;  4ZIW A;  4OX9 F;  3HF5 A;  2A2D A;  2WCX A;  2RAQ A;  4LSL A;  3N01 A;  2BKN A;  4OYO A;  5KFX A;  2P5V A;  3BGF A;  1YGY A;  3HHL D;  1GTE A;  4DUY J;  3GTY X;  2HQG A;  1P1T A;  2CFX A;  1QE1 A;  5GAG U;  1F1B B;  1U1Q A;  1TKD A;  1MRO A;  1KN6 A;  1ICE B;  4DL4 A;  3EUN A;  4BLG A;  2HHW A;  3GFH A;  5LM7 E;  4AFF A;  3SCL E;  2AU0 A;  3CDA A;  1UFW A;  4HTJ A;  5KFS A;  5CYJ A;  2MDA A;  1HI8 A;  3BBF A;  4AXI A;  1R8P A;  2Y8Y A;  1HQU B;  2DPI A;  4LF7 F;  3DRY A;  4RR5 A;  5KG6 A;  3HT3 A;  3EX7 B;  1Y5I B;  1FCA A;  1NSQ A;  5DQH A;  1HNZ F;  3S8S A;  2WOM B;  3D28 A;  2QLJ B;  2CNO B;  1RT6 B;  2HNY A;  3R5D A;  2OMO A;  1JIH A;  4MFB A;  3LGM A;  3ZZ0 A;  2DHX A;  5U47 A;  4V19 J;  2CZ4 A;  3UNY A;  3DHX A;  3M2R B;  3R5C A;  2UU9 F;  5RUB A;  3RR7 A;  2LYV A;  1TUG B;  4B02 A;  4ZJQ A;  3P6Y C;  3UPF A;  5KG1 A;  2DR7 A;  2A0F B;  5GAD I;  3RRH A;  4LF1 A;  2IYI A;  1U48 A;  1TEL A;  4H4O A;  4ES3 A;  5F3Z A;  2DNG A;  1U7L A;  4LF8 J;  2V9W A;  4WFB Q;  4IR9 A;  1KHV A;  4YR3 A;  2R8G A;  2X1B A;  1SKR A;  3ZTO A;  1YSJ A;  1AB8 A;  3BSA A;  1S4F A;  4W98 A;  2WHO A;  5GME A;  4C0H A;  2ZH2 A;  1TL3 B;  4ZVU B;  2HMI A;  3UD4 P;  1M1G A;  1RCX B;  2J76 E;  3HXM A;  4AQY J;  4OZL A;  4FNH A;  4V1A k;  5KG3 A;  5DO2 A;  2HZC A;  3MTK A;  4ED8 A;  1EET A;  4OIX A;  4WU3 A;  1NDC A;  1NHK L;  1U2F A;  3IO1 A;  5GMD A;  3KLG A;  1NJX A;  5KT3 A;  2RUS A;  3SBM A;  4CZC A;  4C6A A;  4DR7 J;  2HGL A;  3H7H B;  2FZK B;  4URS A;  3T9Z A;  2DHS A;  4IFY B;  3W5Z A;  4CO2 A;  4U96 A;  3VHQ A;  3EPG A;  5BR8 F;  5KG0 A;  4BWJ A;  1HBU A;  4K4Z A;  4ICL A;  5M2P A;  4EK2 A;  4CLF A;  3E8O A;  4LVO P;  1FKP B;  1WG1 A;  2CQP A;  3C14 A;  5A0Y A;  3SQG A;  1M5V C;  2HZV A;  3UN3 A;  3M32 A;  4LF9 F;  3BKF A;  1M0S A;  3HHL B;  3TAR A;  3TJA A;  2BOA A;  2JH3 A;  3CSK A;  4ALZ A;  3H0P A;  3T5J A;  2B7B B;  4R8U A;  1JJ4 A;  1X4E A;  4EBE A;  2HLU A;  4NA2 A;  1NKB A;  4X65 J;  4I6A A;  3CC4 S;  3PDN A;  2MLY A;  3PIP Q;  1JLQ A;  3EXY A;  1S9G A;  5DZ6 A;  3LWL A;  4YS2 A;  2YKM B;  4A8M P;  1RP5 A;  4ZPA A;  2O67 A;  3TVZ A;  4L72 B;  9ATC B;  1C0U A;  2NZC A;  4DSJ A;  2GCF A;  1KQG B;  4XDD A;  2UUW A;  2F8H A;  1ZH5 A;  3CCJ S;  2UV8 A;  1FF2 A;  1J2V A;  3QT8 A;  2ZZT A;  1B0P A;  2AIR B;  1KDN A;  3W1Y C;  1NKC A;  1DLO B;  1FRK A;  4PPD A;  4DFM A;  4DR5 J;  1HNI B;  2EC2 A;  2F9D A;  4P71 A;  5D77 A;  2XI2 A;  2MSS A;  5K5M A;  2G0C A;  3JTO A;  3MR5 A;  1FWP A;  1UL3 A;  2JFD A;  3OXG A;  4QWA A;  3LF0 A;  3GZ7 A;  4K4V A;  4CM2 A;  5F8G A;  2C2D A;  1Y9O A;  2AZ1 A;  4QR2 A;  1SV5 B;  1WF0 A;  3I0S A;  2EFN A;  3Q8Y A;  3SSS A;  3UDC A;  3RB6 A;  1R8A A;  4LSL B;  4OYM A;  5HRO B;  1KRP A;  3WX8 A;  3CC7 S;  1SPB P;  2J7K A;  2FHK A;  2ZOG A;  3F56 A;  5KFH A;  1RI7 A;  2XM3 A;  4LFA F;  1TK5 A;  2LA4 A;  5B0B A;  4UY8 T;  1KVJ A;  4NAS A;  5DET A;  2CQ4 A;  2CQG A;  1UA0 A;  2UUB F;  4N76 A;  4LF5 F;  4DV6 F;  4P9S A;  2FLN A;  3S1T A;  4PWD B;  2IVY A;  4JI3 J;  1WEX A;  4LF2 A;  2IC3 A;  4WYW A;  3TVY A;  1CC7 A;  3MMC B;  2RU3 A;  1BMQ B;  4IG3 B;  4Y2A A;  1ZZF A;  1EQ0 A;  4L3K A;  4WPA A;  3THP A;  3G82 A;  4A8W A;  3TUP A;  5IXU A;  2YX7 A;  1SJQ A;  1ZA2 B;  4WBF A;  1GX5 A;  4RNH A;  2R2T A;  4NLV A;  4ZP8 A;  3KK2 B;  3W62 A;  3MR6 A;  5J2N A;  1N6Q B;  1BXN A;  4ZOS A;  2MQL A;  3RRK A;  4HYK A;  4CO3 A;  4C0B A;  5HJX A;  4K2X A;  8RUC A;  1U4B A;  1AUD A;  1N56 A;  3G9C A;  3FJ2 A;  3IN5 A;  5F8J A;  1R0A B;  4W4M A;  4ZA1 A;  1N5Y B;  4B3T J;  5SZT A;  3GCX P;  3HMJ G;  4GKJ J;  2YX4 A;  1CPZ A;  4KGV B;  2RF2 A;  2DT9 A;  2FIU A;  3AAW B;  3GFZ A;  2M2B A;  1ZA1 B;  2VJV A;  2NXJ A;  4U8V A;  1WF1 A;  3J81 U;  1WF2 A;  1RTH A;  1CJT A;  2WVC A;  2YWW A;  1PSD A;  1KD1 T;  1NBE B;  2Y3Y A;  1TKX A;  2PFF B;  3WHI A;  3R6L B;  4DR6 J;  4JBC A;  4LF4 F;  3PJ9 A;  2CRL A;  4X4Q A;  1ULR A;  2VQE J;  4RW8 A;  1B99 A;  2HPU A;  4M5J A;  1U26 A;  1S99 A;  2X1G A;  2E29 A;  4DDF A;  3NMA A;  1NJW A;  1X5P A;  4NYP A;  2RIL A;  3OSP A;  1RT7 B;  2XSJ B;  3H98 A;  3HT0 A;  1RSC A;  5J2N B;  3KK2 A;  1TTH B;  1JQG A;  4QOT A;  3W9J A;  3K2Y A;  3TJ9 A;  3BJY A;  3DI6 A;  3PZP A;  1UW4 A;  2VOO A;  3OQ2 A;  4QPX A;  4A8Q A;  1YJ7 A;  3G6E S;  3DRS A;  2GVD B;  2YWH A;  1BQM B;  2AZ3 A;  3F41 A;  4ZP6 A;  3G6Y A;  3SYZ A;  2CDQ A;  3NS5 A;  1ZM9 A;  1RCO B;  2VZ9 A;  2ZBQ A;  1FDA A;  5KG7 A;  2ZH3 A;  3CCM S;  4KTQ A;  4NYO A;  3NXZ A;  2HS0 A;  2AWZ A;  3G6X A;  1I6J A;  2BJ1 A;  4MYT A;  1Y0H A;  4ZLJ A;  1QE1 B;  1RTH B;  2GJF A;  3GB0 A;  1IN0 A;  4BC7 A;  1SKW A;  3UN5 A;  1VI7 A;  1PYS B;  4DCO B;  3PO5 A;  1TL5 A;  4XIU A;  3MFH A;  3M7V A;  3QGG A;  3QRQ A;  4Y0F A;  2K3I A;  4OHZ A;  2VH7 A;  1GXL A;  1HQE B;  2CJK A;  1KP6 A;  2OD4 A;  4P2X A;  1XMO J;  4JI2 F;  4N41 A;  4HVZ A;  4Q0B A;  2V8P A;  3NNC A;  3IA0 A;  1UMJ A;  1S0O A;  5EN1 A;  1EHW A;  1KSP A;  3K7R A;  4CM0 A;  5FLX Y;  4LFB F;  2JC0 A;  3L09 A;  5KFE A;  1MLA A;  4XPC A;  1HD0 A;  1QSS A;  2BW2 A;  2V8H A;  2MZT A;  4MH8 A;  3GLJ A;  5KFW A;  3UCU P;  4PG5 A;  1ARO P;  1OSC A;  1TZ0 A;  3J80 Y;  2HFU A;  1NKE A;  4K5S A;  2W8K A;  1RWO B;  2E44 A;  4ECR A;  1VC0 A;  3U02 A;  3PAC A;  3D67 A;  3KJQ B;  1PO6 A;  4RW4 A;  4YEA A;  4X84 A;  1RHU B;  2HFS A;  4XK8 C;  1FKA F;  4AL5 A;  4UQT A;  2MYF A;  3CCV S;  4DUY F;  3RAX A;  1APS A;  1R43 A;  3MCO A;  3M9M B;  1M90 T;  4HDG A;  4PG8 A;  4JYA J;  4DG1 A;  1FRJ A;  2KI2 A;  4H4K C;  3A8K A;  3KLH A;  4DFK A;  3FCW A;  5LJ5 Y;  2LLZ A;  2ZDP A;  3TP2 A;  2BE7 D;  4F4Z A;  2NUH A;  4ITS A;  1RYR A;  3ISN C;  3CCT A;  3QAE A;  4Y2M A;  1N0U A;  5M2R A;  1V3Z A;  2JJ4 D;  3PO4 A;  2E9T A;  1X4A A;  4P75 A;  5LT5 A;  1T8E A;  3LP0 B;  4ES2 A;  4ZCM A;  4M94 A;  2W01 A;  3DLK B;  3GIL A;  4ES1 A;  2W9C A;  2OSR A;  4NMX A;  2NCK L;  4I56 A;  1UWB B;  2RF2 B;  3BGU A;  5H9F K;  2KH9 A;  1SI9 A;  2EEY A;  2OPS B;  3A13 A;  1FRM A;  5HO4 A;  5A0Y B;  4UZB A;  3EZ5 A;  1NDP A;  3IFE A;  3DU6 A;  4WTO B;  1A9N B;  1XJW B;  4X64 J;  1P8G A;  1Q4R A;  3C8Y A;  4PG4 A;  3EMT A;  3VVU A;  3MEG A;  4U67 Q;  4Z7Y A;  3MM5 B;  1AXQ A;  5DG8 A;  2Q66 A;  3M8Z A;  2XGQ A;  3N5B A;  2VON A;  1PJ7 A;  3ZZZ A;  1ZAW A;  2GAG C;  3ADA C;  1JLQ B;  4JYA F;  4DS4 A;  3KK1 B;  3MI7 X;  2FY1 A;  4FNI A;  2OSQ A;  3AQO A;  3ET6 A;  3PR5 B;  1FNO A;  4F25 A;  4DL5 A;  3R8Y A;  4BHQ A;  3DMJ B;  2XMM A;  4OYA A;  1FE4 A;  4F4Y A;  1VQN S;  2E9R X;  1BY9 A;  1LEO A;  1CUL A;  3FGV A;  3MEC B;  1FRL A;  2F4V F;  1LKZ A;  3NWR A;  2UVW A;  4I2P A;  1QAX A;  4WP9 A;  3EZU A;  2VA3 A;  3R2C J;  1M5H A;  2FQQ B;  1RT4 A;  2DXF A;  4I6Y A;  3QWU A;  3DOM B;  3NG8 A;  1LNQ A;  1I1G A;  4X4N A;  4X4P A;  1RXO B;  2JDJ A;  2OD6 A;  1YJR A;  4X2B A;  3DGV A;  4YDX A;  4OLP A;  1HI0 P;  3TX0 A;  5CZX A;  3NKY A;  3HHK A;  1U1L A;  4B9V A;  2UVV A;  3MEG B;  4P74 A;  1W25 A;  4NWB A;  4GO5 X;  2GQ2 A;  2KB2 A;  3BF4 A;  4IOC Q;  1QAJ A;  2PT0 A;  3PEJ A;  3CCR S;  3CJQ A;  3RUB L;  4DX6 A;  4TY9 A;  1SV5 A;  4ZK7 M;  3HHN B;  3I96 A;  3ZXW A;  3AD9 C;  5DZ7 A;  5K8P A;  1WOP A;  2ZE2 B;  3DMJ A;  1RTJ B;  3KLF A;  3OBI A;  2E5G A;  1U8W A;  2AQ4 A;  1U45 A;  4X62 F;  4CP5 A;  3UO0 A;  1LW2 B;  3CJ2 A;  3MM9 B;  3F73 A;  2OEJ A;  4OL8 A;  2C3U A;  2XNQ A;  3CF5 Q;  2ATC B;  1F5A A;  2ALY B;  1U47 A;  3BPS P;  1TV6 A;  1R31 A;  2JOQ A;  4LIW A;  1H7W A;  1U0S A;  2Q1L A;  1NHU A;  2MST A;  2YKA A;  3ITH A;  1HNZ J;  4NEZ A;  5F8N A;  2LVW A;  1S1U B;  7FD1 A;  4YY3 J;  2QL5 B;  4NLO A;  2UZA A;  1PGZ A;  5I42 A;  3KWM A;  4MYU A;  4Q5V A;  1AFI A;  4GVB A;  4LR7 A;  3SQO P;  1KQS R;  1SQE A;  2N4D A;  5HP1 B;  2QC3 A;  3CCQ S;  2QTW A;  3MM8 B;  3I4P A;  2VC1 A;  2OPQ A;  2X3G A;  3BO2 A;  1QJH A;  1DQ9 A;  2XZW A;  2GMH A;  1PJ6 A;  2R7U A;  4DQS A;  4OX9 J;  4XTT A;  2UUC F;  5JUM A;  1V3S A;  4QIE A;  2PC6 A;  2QFI A;  3PTW A;  5C25 B;  2QA4 G;  1KS2 A;  5H9F J;  3PG9 A;  1N5Q A;  2GO9 A;  2KRB A;  4HHU A;  3UDE A;  4AT1 B;  4C98 A;  2O66 A;  3EVW A;  4N56 A;  5LXR A;  1RZM A;  3M2U A;  1NSP A;  3HPO A;  1Q78 A;  2OEM A;  4B3T F;  3R5B A;  1AUS L;  1Q86 T;  4ANE A;  1PYT A;  1KOH A;  4HHH A;  3QO9 B;  3O1L A;  2H5E A;  2ZHO A;  3IBW A;  3TVK A;  3DDK A;  4AL7 A;  4DF8 A;  2JLE A;  4FS2 A;  3MED B;  2R2R A;  1S4E A;  1RT7 A;  4OI1 A;  3VAG A;  4B9U A;  4LR9 A;  1NM2 A;  4Q43 A;  4NLD A;  4QR1 A;  3QJP A;  3Q8V A;  2EXU A;  1REG X;  1WC1 A;  4EFA C;  4MT1 A;  2W9A A;  4LF7 J;  3ELH A;  1LWC A;  2C3P A;  1RLC L;  1RAI B;  2AKW B;  4J9M A;  2N4C A;  3VAH A;  4ED3 A;  1N88 A;  2RJZ A;  1B64 A;  1CVJ A;  2ZC3 A;  1IUJ A;  2C2M B;  3J81 j;  3NL0 A;  1X60 A;  2LA6 A;  4KE5 A;  5CA5 A;  1RKJ A;  1T3O A;  1BUX A;  5LMN J;  1HBM A;  1PAU B;  2B3T B;  2XYG B;  4MMO A;  2MPU A;  2XWY A;  4JI0 J;  1X9M A;  2WBR A;  1RT4 B;  2DGO A;  4DV2 J;  2CQB A;  2AX1 A;  2DXD A;  1N33 F;  4KR0 B;  1R8C A;  1A6L A;  1FT8 A;  1QY7 A;  4NLS A;  3V4M A;  1QD1 A;  2ZH7 A;  1WC0 A;  2ILZ A;  4F26 A;  3HJV A;  3IM8 A;  4JI3 F;  4JI4 F;  1S1T A;  4CI0 B;  1BE4 A;  1E6Y A;  1GMW D;  2FGC A;  1IVZ A;  4DJB A;  5SUH A;  2I38 A;  2ZWP A;  1N33 J;  2P6S A;  3UQS A;  3T5K A;  4J90 A;  3OT9 A;  2UP1 A;  4C8Y A;  1FJG J;  3GSI A;  3KFW X;  1YG0 A;  4RBV A;  3IXQ A;  1IKV B;  3T5L A;  3DU5 A;  3CJS A;  1UCN A;  4Q7A A;  5F0W A;  1F0X A;  5DGB A;  2D41 A;  2HND B;  2IMO A;  2VPX B;  3A12 A;  1HWI A;  2QYC A;  2C2O B;  3NAH A;  4HL9 A;  5L9N A;  2GHV C;  2DNY A;  4LIR A;  4OHV A;  2DNK A;  4F3Q A;  3KJV B;  3PKM A;  1NDK A;  3OUY A;  1NH7 A;  2WW4 A;  4DI6 A;  2J6S A;  3QRP A;  4KKO A;  4UOF A;  4URQ U;  1UFL A;  1SL1 A;  4MK8 A;  4MK9 A;  2VA2 A;  3BYR A;  1U6Z A;  1VQP S;  1R8B A;  3D6T B;  3MPW A;  4NRT A;  3NAI A;  1FK9 A;  1N54 B;  3VTI A;  3GG1 A;  3M9O B;  3V81 A;  1YK9 A;  5KFR A;  1JXV A;  1RAG B;  2W4P A;  4HH1 A;  3E2E A;  2HHU A;  3CE8 A;  4RZR A;  4X66 J;  5HQM A;  2XWX A;  2I9S A;  2RRA A;  5KFV A;  3MXH P;  3QAU A;  2HVD A;  4F4A A;  1EJ7 L;  2C3O A;  4FXD A;  1HBN B;  2B8P A;  1WC3 A;  2GHW A;  2JNJ A;  4RX6 A;  3CJK B;  4NA1 A;  4LMZ A;  1M5K C;  1S97 A;  1T9Y A;  2ZFH A;  3RB3 A;  3TO8 A;  3HCX A;  4F0K A;  1SKS A;  4NZ7 A;  1T05 A;  4JV5 F;  3OL8 A;  4LFB J;  1L3V A;  2D1C A;  3EGV A;  2C42 A;  2L41 A;  1UWB A;  2XCA A;  5G4D A;  3OL6 A;  2ZH6 A;  5LMN F;  2R3V A;  2HVH A;  2W2N P;  4ZHR A;  3Q8Q B;  3CD5 A;  4OI3 A;  4Y28 C;  4USJ C;  2BM1 A;  2CQI A;  3IR6 B;  1XBW A;  3POT B;  3TUJ C;  5MLC V;  3CCE S;  1WOS A;  1ZPW X;  4HI2 A;  4ECU A;  3GYG A;  4MKV A;  1KNZ A;  1F60 B;  2C2K B;  4F2R A;  1RTZ A;  3BV8 A;  4TYA A;  1UVL A;  5BYQ A;  5KFT A;  1GK8 A;  2CNK B;  4ZCI A;  1YZ6 A;  2Y1J A;  4C3K A;  2QMW A;  4FBT A;  3TZZ A;  2VKR A;  2WVB A;  3FMW A;  1S6U A;  1Y3J A;  3MMB A;  3QZ7 A;  2K7K A;  3OR2 A;  1JLF B;  3FBF A;  3J80 U;  3OHA A;  2IJN A;  3B4D A;  2OPQ B;  1H72 C;  1RT5 B;  3DLG A;  1FKO B;  4FF2 A;  5HRO A;  3HP6 A;  1ZM2 A;  4F4W A;  4DU8 A;  3D3B J;  1EET B;  1N48 A;  3AHP A;  2HWI A;  4L75 A;  3M6V A;  1D3W A;  3KK3 A;  3RZA A;  2YPZ A;  1IWG A;  3JS9 A;  4PYD A;  5LXY A;  1S9E A;  2D7S A;  2OFH X;  2WBM A;  4L73 A;  4M5D A;  3KHH A;  1CJV B;  3NGD A;  4YQW A;  2IFX A;  2HG4 A;  3SDE A;  4CLS A;  2YNG B;  3AD7 C;  2ZZN A;  2W4D A;  2W7O A;  1WHV A;  4EUV A;  2FJA B;  3UN2 A;  3FQK A;  2VDH A;  3RGI A;  4CLT A;  3PX0 A;  1ZET A;  1RAC B;  3BM7 A;  4HH0 A;  4EGL A;  2U2F A;  2BE2 A;  1C1C B;  1WHX A;  2NS1 B;  4FZV A;  2YKO A;  2KHD A;  5EDW A;  3W8P A;  3TZX A;  2GQQ A;  3GG0 A;  1F2H A;  4C8M A;  2IBK A;  2KZZ A;  4DV4 J;  3PCO B;  2UXB J;  2ZH4 A;  1JLC B;  2HNZ A;  3MPY A;  3TRG A;  3V2U C;  3T41 A;  1XC9 A;  2HSE B;  4C48 A;  2QX0 A;  4CH0 S;  1X4H A;  4G65 A;  4TY8 A;  4KIA A;  3CJ3 A;  3CO9 A;  3KG4 A;  3NNA A;  2IVF B;  4CLK A;  1FO1 A;  1CG2 A;  1FTC A;  3KDO A;  2FZG B;  4YB5 A;  2XZD B;  2OFG X;  3D54 A;  4B3O B;  3H90 A;  4X66 F;  1DTT B;  1P6T A;  2NUU G;  4HT5 A;  3QYY A;  2B4V A;  2FJV A;  4ZCL A;  1D9A A;  2GZO A;  2MQM A;  2RE1 A;  3MM6 B;  3K17 A;  4IYQ A;  4O4G A;  5KFU A;  2KJW A;  3VV2 B;  3W5Y A;  3I0R A;  1WEL A;  4GVB B;  3BO3 A;  3EWG A;  1HQU A;  3V6K A;  4B9N A;  2RU9 A;  1NRK A;  1NLK L;  1U02 A;  3RJM B;  4AYB D;  2ZH8 A;  2H1Y A;  1RAA B;  2GO8 A;  1WC6 A;  2HGM A;  1XWL A;  1YJU A;  1NME B;  2QA1 A;  2WON B;  3GYN A;  4WK1 A;  4ED4 A;  1IKV A;  4I1T A;  2KXH A;  5IM0 B;  2H5I B;  1JLB B;  3CWJ A;  3GV5 B;  1X5O A;  2LP4 A;  3CO0 P;  4B9M A;  4ZIT A;  3K5L A;  1DZ5 A;  2KRR A;  3EGW B;  2V0N A;  4ILL A;  2PD1 A;  1M5O C;  3CCU S;  2E5J A;  3R5J B;  5C7P A;  1T02 A;  1XNQ F;  4CH7 A;  5LMU F;  1YIT S;  1FD8 A;  4RWX A;  3BR8 A;  4LT6 A;  1Q0N A;  1S1W B;  1YJ9 S;  1VQL S;  2DYA A;  3UWT A;  1HKA A;  3NGK A;  3H4B A;  2F8E X;  3MMC A;  4JI4 J;  3QO9 A;  2ZUG A;  1RBO B;  1ZOT A;  1QVG R;  3MM6 A;  1XTZ A;  3ZO7 A;  1TUV A;  2J9C A;  1VIO A;  1N5T A;  4K4S A;  4J37 A;  4DL2 A;  2CVE A;  2PII A;  4PUO B;  5ETP A;  1D9D A;  2KO1 A;  2VD3 A;  3HZG A;  3CNQ P;  3L7U A;  2QIF A;  2CAD A;  4KY3 A;  1RWM B;  4M5G A;  5L1J A;  2Z30 B;  3ZFV A;  4ED0 A;  2X51 A;  2WB4 A;  3U1M A;  4DPO A;  5A8R B;  2NPI A;  4OJG A;  4ER8 A;  2XNR A;  1F2G A;  4JI0 F;  2GC8 A;  3QLH B;  3D6H B;  5A8K A;  5C24 B;  3HHL C;  4W92 B;  1VR6 A;  5I3U A;  1CJV A;  1TFW A;  1S6Q B;  1UKU A;  5IOL A;  3TW0 A;  5KTQ A;  2GV1 A;  1VOM A;  3DM2 A;  3HHE A;  4ZVF A;  1YHQ S;  4O3R A;  4DV0 J;  4X4T A;  1VK3 A;  2K1R B;  1DLO A;  2IBO A;  2GIF A;  1FWK A;  2MY8 A;  2VPW B;  4ZPC A;  2WW8 A;  3RG6 A;  2KZM A;  3Q8U A;  4TQS A;  4I64 A;  1B7F A;  5L38 A;  2CNL B;  4IRD A;  1NZA A;  2HIQ A;  2WK4 A;  4U7U K;  4QCL A;  3L4B C;  2OEL A;  2Z8Q A;  3V6J A;  3B82 A;  1A0O B;  2RUG A;  4NLY A;  2QT7 A;  3C19 A;  3A8I A;  3SCI E;  2FHJ D;  1I3O B;  4CNY A;  4TVA B;  1Q8K A;  2V2V A;  3BH6 B;  4O3S A;  2VL1 A;  2FB0 A;  3PHT A;  3A3P B;  3QBC A;  3FVY A;  1FNM A;  4IH7 A;  2FVS A;  4LF8 F;  4WU2 A;  1N34 F;  1AYE A;  5DM7 Q;  1HMV B;  4K4U A;  2DNM A;  2NXE A;  1NK5 A;  4JV1 A;  4ATN A;  2OML A;  3PX6 A;  1NK0 A;  5D8H B;  5HLF B;  3G4S S;  1YRT A;  2UVR A;  2R2S A;  1VQ7 S;  4X65 F;  5KFK A;  3G87 A;  3G86 A;  2POK A;  2Z2M A;  3AJ1 A;  4KYZ A;  1RAO A;  4UZC A;  1FFG B;  4YB1 P;  1YIJ S;  4GVL A;  4E2F B;  3R3T A;  3W66 A;  1WDD A;  3UE2 A;  1FX4 A;  1S1V B;  2CQH A;  4F67 A;  2CQD A;  4RL1 A;  2ZBP A;  4YN3 B;  5HJY A;  5T14 A;  4DV3 J;  4UTG A;  3RAM A;  3O3L A;  3BKU A;  2KT3 A;  3KK1 A;  4F0M A;  2DGX A;  4ZVE A;  5FLX U;  1FJ7 A;  2QL9 B;  2BUN A;  5CZV A;  2CPI A;  2GHP A;  2J6U A;  1TU0 B;  5FJ4 A;  1CUL B;  2F9J A;  2QZ8 A;  2KU7 A;  1Q8B A;  3HHD A;  4NOH A;  3R1L A;  1GEH A;  2P2C B;  3GSD A;  4DN0 A;  2LU1 A;  1B0T A;  2BAC A;  3D4J A;  2CWX A;  4N8O A;  3IWN C;  2HWT A;  1HMV A;  1ROF A;  1RUS A;  5JMN A;  1AZS B;  1HD1 A;  2K8G A;  4CTA B;  3IWL A;  2DGV A;  3GJR B;  4K4T A;  3A3O B;  3CVK A;  3SQG B;  5EWG A;  4G3I A;  1KVK A;  3O44 A;  2KG1 A;  1QLN A;  5ETQ A;  3AA9 A;  3N9U C;  1MU2 B;  3M8Q A;  1NJY A;  2IAJ A;  2V50 A;  4ZP9 A;  2XLK A;  4ECZ A;  4QWD A;  1TL4 A;  1U8S A;  3K0J A;  4NX9 A;  1H2T Z;  4BDP A;  5J2M A;  5D3G B;  3I5A A;  3WBZ A;  1WC4 A;  5GAH U;  2CG4 A;  2EBG A;  3QID A;  4OX6 A;  4NLQ A;  2AEM A;  3OJS A;  2DK2 A;  2HGN A;  2B6A A;  1C0U B;  2DD8 S;  3DLK A;  1MN9 A;  3M30 B;  3KK3 B;  3CMA S;  2HNY B;  1H3D A;  3H4D A;  1N32 J;  4MIB A;  4NRU A;  1KVI A;  5KFM A;  2KM8 B;  4DV0 F;  3QRR A;  2RRB A;  2OLW A;  2AP6 A;  3D5M A;  3TZW A;  5E3Q A;  3SFG A;  4DR6 F;  1TV6 B;  4S0M A;  5C24 A;  1G7C B;  3QSI A;  5HVF A;  3VZI A;  3DRR A;  2IYG A;  5B0G A;  4D3H A;  2XMW A;  5DM6 Q;  3GP9 A;  5KAK A;  2X7I A;  4J5O A;  4HAC A;  2M88 A;  2K7J A;  3A1Y G;  2DRD A;  3KHG A;  4PQU A;  1UFK A;  4C7Q A;  1WKK A;  3TAN A;  1DJ0 A;  4RUB A;  3RR8 A;  2XI3 A;  1YRX A;  3KHL A;  2AYE A;  4USU A;  2ZH9 A;  4NXN F;  2X1F A;  3W2W A;  1VBY A;  1M5S A;  2BKP A;  3A8E A;  4X64 F;  1Q8L A;  4DUZ J;  1NB7 A;  4IDK B;  3OW2 R;  4UW2 A;  4P2F A;  3HM9 A;  1EAY C;  3OSN A;  2MKI A;  4MKY A; 
#chains in the Genus database with same CATH homology
 4LFA J;  4YY3 J;  1XMO J;  4LF9 J;  5BR8 J;  4YHH J;  4X62 J;  1J5E J;  4DV5 J;  4DV0 J;  4DR3 J;  2UUB J;  3J80 U;  3OTO J;  2KVQ E;  4DV6 J;  1IBM J;  4OX9 J;  4DV1 J;  3D3B J;  3W1Y C;  4PWW A;  4HHU A;  4DR5 J;  4DV7 J;  1XNQ J;  4GKK J;  4JI7 J;  4LF4 J;  4KHP J;  3R2D J;  4JYA J;  3T1H J;  4JI1 J;  4DR2 J;  1XNR J;  3D3C J;  4KYZ A;  4B3S J;  4K0K J;  2VQF J;  4DUY J;  4LF7 J;  3IMQ J;  4DV3 J;  3T1Y J;  4DV4 J;  4NXN J;  5FLX U;  4JI3 J;  2UXB J;  5LM7 E;  5LMN J;  1I94 J;  4JI0 J;  5IWA J;  4DV2 J;  4X64 J;  1XMQ J;  4B3R J;  2UUA J;  5A2Q U;  4DR4 J;  4LF5 J;  2HHH J;  1N36 J;  1N34 J;  4B3T J;  4NEY A;  1N33 J;  2UXD J;  4GKJ J;  4B3M J;  1FJG J;  4LF6 J;  4LFC J;  4JV5 J;  3J81 U;  5LMU J;  3R2C J;  2F4V J;  2ZM6 J;  1HNW J;  2MEW A;  4LF8 J;  4JI6 J;  4JI8 J;  4DR6 J;  2VQE J;  1N32 J;  4NXM J;  4AQY J;  2MTL A;  4V1A k;  4RJV A;  5AJ3 J;  1HR0 J;  4JI4 J;  5IT9 U;  1IBK J;  3JAM U;  2UUC J;  4X66 J;  4JI5 J;  2MQ8 A;  4DR7 J;  2UXC J;  2E5L J;  4NEZ A;  2KL8 A;  4KY3 A;  1IBL J;  2UU9 J;  1HNX J;  4LFB J;  4DR1 J;  4DUZ J;  4JI2 J;  1HNZ J;  3J7A N;  4X65 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...