4GO5X

The regulatory subunit of aspartate kinase from mycobacterium tuberculosis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
167
Chain Sequence
SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Aspartokinase
total genus 47
structure length 167
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go5X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go5X01
2CDQA 3IBWA 4GMKA 5IT4A 2JHEA 4GO5X 2J0WA 3N0VA 2F8MA 1KS2A 5IT0A 2RQMA 3U7JA 2P9CA 1LK7A 3MTJA 2DT9A 3DHWC 3NRBA 3O1LA 2QMWA 2KO1A 2DTJA 2RE1A 3CEDA 3IXQA 3LUYA 2P9EA 2I9SA 1YGYA 1UJ6A 2PA3A 3ENWA 4LUBA 2P9GA 2NYIA 3AB4B 3LOUA 4X84A 5IS2A 1LKZA 2LVWA 1Y7PA 2PC6A 1UJ5A 3OFFA 2QMXA 2MDAA 3HHEA 2FGCA 2QSWA 3ENQA 3UW1A 3DDNA 2H9ZA 3TUJC 3OBIA 1PSDA 2F1FA 3KWMA 3MWBA 3S1TA 3W7BA 2J0XA 3OFGA 5T41A 1ZPVA 4PWUA 4M8LA 3ENVA 3DHXA 3AB2B 3K5PA 1LK5A 1RWUA 2ZHOA 4GO7X 2RQKA 3DC2A 3L7OA 3TUIC 3AAWB 3TUZC 5JJBA 3OFEA 2QRRA 3OFHA 1YBAA 1M0SA 5FIIA 1U8SA 3MAHA 1UJ4A 2LQJA 3P96A 1SC6A 4IO1A 1XTZA 2JOQA 1O8BA 4NMLA
chains in the Genus database with same CATH superfamily
3K2YA 3PRVA 2DRBA 1Q4RA 3FJ2A 1F9EB 1Y3JA 3DRSA 4K59A 4KYZA 3SMZA 5EGYA 1S6PA 2FC8A 2PEHA 3PW4A 2E1CA 4JI3J 1W2IA 2MSTA 5HQLA 2ZH6A 2VONA 3CD7A 4IKAA 2UZAA 4X62J 4X4PA 1HBNA 2O01C 4LJMA 3TVKA 1MU2B 1QVGR 4DR4F 1F9FA 4R8UB 3K59A 2XEXA 2PFFB 3D28A 3D6HB 1F6TA 1CJTA 2YQ0A 3Q8UA 5B0GA 1N36F 3AD8C 2P6SA 4WP3A 3SV4A 3UPFA 3RRHA 3K0JA 1IVZA 3IWXA 1U8WA 2UUCJ 1RTDA 2WONA 1S59A 1N5VA 4HI2A 3OLBA 1H74A 5E0OA 3R9LA 1NLKL 5L39A 2UVWA 1RTJA 5D77A 3FC9A 1N36J 3TP2A 3JAMY 1FO1A 4NYZA 2QV6A 3ZZUA 1T05A 2RU3A 3M8YA 5DLFA 4CWBA 1HNXJ 4JOUA 4KHMA 1IKYB 1TKZB 3IR6B 4CH0S 4DI6A 3CJRA 3MM8B 4CTAB 1FVQA 3KMSA 2W4PA 2X7IA 3O8WA 3Q0AA 1U1QA 2VODA 1AW0A 1S1UB 5ETSA 1JJ2R 5ETVA 4X2BA 3MD1A 5CZXA 3GB0A 3MZIA 4USMA 2U2FA 4DX5A 2JC1A 1VQ8S 2JX2A 3ZFVA 3ET6A 3RRKA 4GRSA 3CO0P 2NUUG 1HKAA 4K0KF 2C42A 1TAUA 2DEIA 1LFWA 4P52A 5I3QA 1S72S 1O0PA 5KG6A 1WOOA 1IUJA 1DZ5A 1FI4A 2YQ3A 4H4KA 5ETPA 3W9HA 2I0XA 4FYVB 2HHQA 3MMAB 4J9SA 1RT6A 5LMNJ 2QMXA 3CVKA 2MZ1A 5H9EK 2FY1A 2YKQA 4DV3J 2FJXA 1GX6A 1XMQF 3HLUA 1DAXA 1WSVA 2O5DA 4F3QA 3R6LB 3PCOB 1P8GA 1H6KX 1BXNA 3DLEB 1RT7A 4G1QA 3SIPB 5KG0A 4I0WA 4DX8H 5A8KA 4TU8A 4X64J 4HHHA 1F2GA 1VRTB 4HEA9 1ZAVA 4DZ6A 3NMAA 3THPA 3GIIA 4P2MA 3VAFA 2UXBF 2C3UA 2HFUA 3UVJB 4NZ6A 1IBCB 3TZZA 3FCWA 2CIMA 3W5XA 4RBVA 4NA3A 2YX4A 1FDBA 3VAHA 1REVA 2HGLA 4GKJJ 3T9ZA 3OXFA 2UXCJ 1KKHA 5ETRA 5SUHA 3CDEA 2AF6A 3GCWP 4NA1A 2XMUA 1AA1B 4C0BA 1VCTA 4PYAA 5HQMA 1CG2A 1V5VA 2HAIA 3DLEA 1O5JA 2B7CB 3SSSA 3MMCB 3SXLA 1N4LA 1X0PA 4DV0F 4B3MF 1URRA 3R5GA 4MFBB 4PWDB 4FNHA 4ZPDA 1JXLA 1HD0A 2F9DA 3LF0A 1RTHB 3R3TA 4OHVA 4LR8A 5FIIA 3T19A 5B09A 3J7YU 3D6TB 4RUBA 2I38A 5DQGA 2BJEA 3ETOA 3KK2A 1VQMS 4JI2J 3ZTRA 4X4TA 3KNAA 2LQJA 4KHRA 4ZHRA 4J9LA 4QBUA 3MEKA 3V4MA 1JLFA 1KN6A 4F4KA 4ETZA 3KLVA 3JQMA 3JSYA 4F4WA 1NHUA 4ES1A 3EZ5A 3TAQA 2HHVA 5KFWA 3R7NB 3E01B 2BXJA 4I2PB 1VQPS 4KPYA 2GGPB 1NDKA 1RHRB 4QR2A 4OLOA 3WQPA 3OSNA 2I5JA 2C2DA 4AXJA 3TAMB 1GFWB 2VUGA 1HLWA 1FK9B 1U1RA 3EGWB 4DL0C 4MIAA 3TX0A 3BQ2A 3BB5A 5K8NA 3DGVA 2IJNA 2UUAJ 2GVDB 2VH7A 2CNNB 4QR1A 4WE1A 1EIYB 1WF1A 4C3KA 1AZSB 4LT6A 3VHQA 3LA0A 2AHOB 2RQMA 3J7Z5 2IMOA 3DOMB 2KRRA 3IAM9 2MKCA 1X5OA 2VU5A 3QAUA 2A18A 1TL5A 3PO4A 4PPZA 4WCEQ 2QX0A 4RWXA 1KR4A 4X4QA 3J7ZT 3JSRA 4KR0B 2W8LA 5F8MA 1BQXA 4OQJA 2VG6B 4PG4A 5C24A 2XC9A 2LKZA 3ITHA 3A3NB 3MDFA 3NBPB 3QSIA 1FNMA 4XPEA 3S7RA 5AJ3J 2HVDA 3JSMB 1VC0A 5ETQA 4OYPA 2CNKB 2VBZA 5K14B 4P71A 2DR5A 2CVIA 1ICEB 2BANB 2DISA 3AH6A 2QL9B 2ATLA 3HX9A 4CCHA 1Z2ZA 2Y1RI 4JI4F 2LA6A 3MEDB 3V6HA 1D8YA 3HJFA 2MY7A 2CJYB 1PIEA 4K7QA 2H5IB 1U1KA 1TL3B 5CD4H 2FJDB 4QWAA 1A9NB 4U8YA 2IM2A 5BR8J 2FVCA 3M2UB 1PC4A 2FUG9 5EHHA 2GA7A 2PA3A 2C1EB 3BO2A 4MKBA 1QAJA 2FLLA 4H54A 4RO0A 2KL8A 2PI4A 3WX8A 2NYIA 1SKSA 5LJ3Y 3BBBA 4NI2B 3BDEA 5ETNA 2Z0GA 3QIDA 4V1Ak 2QLWA 4JV0A 2B5JA 1M5PC 4HT7A 3MEDA 2AMCB 3H7HB 3OUYA 1HR0F 4Y3CA 3BGFA 6AT1B 1HI1A 1FKPB 3BH6B 4OZ1A 1KSPA 4I56A 2E5GA 1FRXA 3IBFB 4KSEB 4DV2J 4LF4J 3QSYB 4TVAB 4RW4B 2OELA 2DPIA 1FKOA 4KGZB 1QSSA 3HO1A 2CWKA 2F1FA 4LFCF 3UFCX 5A6PA 2DIVA 2YH1A 1VYAA 4PAAA 4G1PA 3RAMA 5KFIA 5T41A 1R8HA 2BKNA 3SCLE 3UCUP 4I67A 5THWA 1B99A 1RTJB 4FS1A 1HWLA 4Y00A 4ZMMA 4DV4F 1WI8A 3MM5B 4DQSA 3PX4A 1RHUB 4L74A 4OZ2A 1ZTTA 3UDLA 2JEFA 2M8DB 4WKRA 1M5HA 1AB8A 1WC0A 2AJ1A 5CYJA 1HYSA 5KT7A 1K1QA 2RF2B 3AB2B 3KMQA 3HFZB 4BC7A 4W4MA 2RS2A 1S7IA 1VHIA 3MPYA 2CNLB 1UETA 4F26A 5FLXY 1XNQF 1HWKA 1KVKA 1R8AA 1B7YB 1Y9OA 4F67A 4A8SA 4U67Q 2V63A 1SBRA 3CGIA 3NAHA 1JLGA 4CO5A 4DU7A 2VDIA 4DL4A 2VF3A 2DHGA 5HANA 2MZRA 1S6UA 3MPWA 3BSCA 2VQFJ 1SV5A 2QT7A 1KLMA 2OD4A 1GX5A 3AFGA 4U95A 4X65F 3Q8RB 3W5ZA 4USUA 2EK1A 1QTMA 3EXCX 2H65B 1RU2A 3MAHA 3R5AA 3T1AA 1RDRA 3HULA 1W25A 4C2MA 5D6GA 2RDIA 4KFBB 4IO1A 1N34J 4NLUA 2CJ9A 3GMGA 3ILOA 3EDQB 1CJUA 1RP5A 2J9DE 4OI3A 3TZYA 2NS1B 2B8QA 3W63A 3MEGA 3KLGA 2Y1JA 4RW9A 2FLPA 1WKJA 1RSCA 2IDLA 1WWHA 1EKSA 1DQ9A 2FJEB 5J2QA 2VG5B 5IQQA 5IT4A 3FUYA 1H2UX 1RT1A 2L3MA 4CLFA 3MAAA 5GAGU 4DUZJ 1HBMA 3K8VA 1QD1A 1FRMA 4AFFA 3KDOA 2YNHB 4DL7A 1TL7B 1UTAA 1YDLA 3GJTB 4ENOA 3DOKB 2Y8YA 2BRKA 4JI6J 3AJDA 2CJBA 2MKYA 3GP9A 1OSDA 3RZAA 2FHMA 2MTLA 1MWQA 1N0UA 2IM3A 3PEJA 3S6EA 2E5LF 2VA2A 4Q0BB 1T02A 1WHXA 2E1PA 4CO4A 5CA5A 5KOWA 1T3NA 2R2TA 4L73A 3F0NA 4WU3A 4RNOA 2KRBA 1B70B 3DDKA 1SUQA 4OV6A 5EWGA 2FZCB 2F8EX 1C0TB 3GSIA 2ZH9A 4DUYJ 1RT5B 1S49A 2FLNA 4LFBF 5M2PA 3RUBL 3UDEA 4F2SA 3MAAB 1REGX 2MYFA 3BJYA 1X8DA 2IHR1 2KG0A 3PNIA 4GVBB 2MHNA 4DR6F 1TL1B 1UEKA 2HURA 2RJZA 4OFZA 2CYYA 1TKTB 2PGCA 2V8PA 2V69A 2V8GA 2VPYB 3BF4A 1IJFB 4KO0A 4NZ7A 2E7XA 4TXSA 4WBFA 3VQTA 5B7WA 4X4SA 2F4VF 2XBPA 2MJUA 4PXDA 4F0MA 4LF8F 3TANA 2RE1A 2YNIA 5IZHA 4ZVHA 3B4DA 2FHJA 2FDNA 2P6TA 3OL6A 2B9XA 1NK4A 1NK6A 3CW2C 2L41A 4XIUA 2NR0A 4C11A 2Q66A 2MMYA 4C4WA 1BQMA 3FRYA 2KXHA 4O3RA 3E01A 3NKYA 3BBFA 3H4BA 2JL9A 4IRKA 4ZOSA 4IFYB 4GVBA 1N33F 3AD9C 3A8KA 2J9CA 3GYGA 1KQGB 5A2QU 2DYAA 2YQ1A 3KLIA 1HMVB 3A8IA 1B3TA 1HQUA 1KBRA 3D54A 4XPCA 1P1LA 1QJHA 2HMIA 2V9WA 2Q6CA 2H48B 3CMES 4P7TA 1UZHA 4ED0A 1CC7A 4NL5A 4PRFA 1GXTA 2OPRA 1FDDA 4H4KC 1WKKA 1BQMB 1S4EA 4WPAA 3CCQS 2FGCA 4F50A 3H90A 2ACMA 1DY3A 1SIWB 1HPZA 2H9ZA 3FQLA 2CKWA 4UZBA 3AXKA 1T03A 4CNYA 2BW7A 3N01A 4JI1F 4FKYA 3I56S 3VALA 4B9TA 4Y2IA 4DPWA 4LF7F 2UV8G 2XS2A 1FJCA 1Q86T 3DRXA 4OI1A 4C0OC 4DDFA 3HMJG 3KLEA 2IAJB 3T41A 2XLKA 5D0RA 3F73A 3LGNA 1IBMJ 1TZ0A 2HMIB 2CPEA 5HAOA 1NSQA 2DHAA 2OIHA 5KG3A 3PHEA 1C4CA 1ZM4A 2FD2A 1VHFA 3A4TA 3T1HJ 3T5LA 4M5JA 1VQ7S 3POTB 4LIWA 3AJ1A 3OVSA 4C7QA 2CJKA 3OL8A 2ZHOA 2K2PA 1PJ5A 4LRFA 4DLGA 3HF5A 1MNEA 2YWKA 4KV8A 4U6PA 3Q24A 1KRPA 1PBUA 2YNFB 3DGPB 4Q45A 1K47A 1D9DA 1C1CB 3K5LA 4F7VA 1AUDA 3P49B 2HPUA 2L9WA 1K44A 2PMHA 5AE3A 3M8SA 1K8AT 2OFHX 4RW7A 4O0NA 4YB5A 3RG6A 3KLEB 2W7OA 3PVXA 4UY85 2AEJA 3GIRA 3KG1A 4I64A 1T0TV 3LAKA 1O6XA 1V3SA 2WVDA 1QUVA 3KK3B 3CJ4A 4H4MB 4MK7A 5F0UA 3TA0A 3G9CA 1OPIA 1Q16B 1S99A 1WHVA 2ATCB 3GU0A 3JTOA 3OUYB 1TK5A 4LMZA 1FESA 5I3UB 2IJRA 4I7FA 4EO8A 5HSPA 2QN6B 3SDEB 4RW4A 3HK2A 2HFOA 1PAEX 2FYXA 4PR6A 1TV6B 2V94A 1KEKA 1IM4A 1U25A 2CDQA 2RKIA 3MFIA 3MR5A 4NLGA 5F9NA 1S1TA 5E3QA 9ATCB 1N5YB 4K2XA 1OJ4A 5FLXU 1UVJA 1VQ9S 1C4AA 3R5DA 1DARA 4LF6F 1X31C 2NXEA 1DURA 2NREA 1F5AA 1TMMA 1HWIA 4NYOA 1UZDA 4EBCA 4MJKA 2CZ9A 4DBQA 1RUSA 1N32J 4NCGA 1T8EA 2RD5C 4L75A 4C8NA 3MI7X 6FD1A 1I6JA 3IO1A 2AYBA 1YJTA 2G0IA 2PD1A 3R5BA 2YKMA 2ZH2A 4DQQA 1U0HA 1R31A 2WB1D 2KT3A 5F9LA 1ULRA 3FCHA 4DL2A 1SI9A 4I2QA 4E98A 1F5CA 2HKEA 3PKMA 2F40A 1JLGB 4M5IA 5SZTA 3EPIA 1AFIA 1FXRA 2X51A 4OJ3A 1CULB 3FMBA 1SKRA 1N48A 1GMVA 2SXLA 1X4CA 2MSSA 1V6HA 5KG2A 1KNZA 2VG7B 1W7WA 8AT1B 2F63A 4ZVRB 1OS5A 4LBPA 3UE2A 2DNZA 1NMEB 3Q8PB 2CADA 5DG9A 2GQCA 5DZ7A 3OJSA 2C3OA 5AXMA 1PILA 4PPDA 2OEMA 3V4IA 1X4FA 1HR0J 4XDDA 1LFPA 3H5UA 1KP6A 3GTYX 5KFGA 4AD6A 4ZCMA 3UD4P 4DG1B 1SL2A 3ENWA 1VQ5S 4JI8J 4LUBA 1UW4A 3V81A 2WRMA 4BCAA 4QWCA 3LOUA 4TU7A 3RJMB 1PYOB 3D7SB 4NXMF 1MMNA 1RWMB 5MLCV 3CULA 2HWIA 2B5JB 3U27A 4TY8A 2WB4A 3I5CA 4YY3J 4RZRA 2QYCA 4USHA 2BOPA 4I4BA 2NPFA 2VKRA 1F9HA 2LA4A 1IKWA 4ILMA 4OHYA 2M5YA 3V6DB 2KI2A 2EW9A 1X5TA 1PJ7A 3QLHB 4RL1A 1LNQA 2QSWA 1RT2B 4QYZK 2ILZA 2Z2MA 3TO8A 2KJVA 4N5SA 3QRRA 1K1SA 3ZZZA 1RWXB 2KG1A 2HRYA 1NU4A 3QAEA 2CG4A 2QA2A 3AOBA 1U6ZA 1FJGJ 1WHYA 4QR0A 4XAKA 1ZM3A 2ZFHA 3G8QA 3H2VE 4HLBA 4LRDA 3ZZOA 4PWUA 2EFVA 3BQ1A 4RUCA 2HFVA 3H4DA 3LPEA 1DHMA 4K4ZA 3VGUA 1ZH5A 5DDRC 1S57A 2MXYA 2NCKL 4A46A 1JLCA 9RUBA 5BYRA 5ETOA 1I94J 3CUNA 2R7UA 4FXWA 2KHCA 2LXUA 2RIJA 2PO4A 3R5JB 1XK8A 1WDTA 4ITSA 1RT2A 3RU0A 2HYIB 3US5A 1DBDA 1RHMB 4LSLA 4M5GA 4P7VA 4UF4A 3SSRA 3O2IA 4J9OA 1U1NA 3MR2A 2WBRA 5FD1A 1YZ7A 2LMIA 1GAOA 4ECQA 3L7OA 5J2PB 1IBKF 1UWBA 2HK2A 3H2LA 3Q8VA 1D9FA 3IRXA 2XSFA 3C14A 3HPOA 1RTIB 1S79A 1Y5NB 2QIFA 4UT4A 1IR0A 1N56A 4B9MA 3QJLA 2MQNA 3G86A 3SQGB 1S7HA 2AJ2A 3J81Y 1KQFB 1UL3A 1S97A 3TARA 1K0TA 1YBAA 4OJGA 3HVTB 3UNGC 3SV3A 3BN7A 4P6QA 3N5FA 2VV5A 1EETA 3UVJA 2F9JA 1VRQC 3KJVA 1L5UA 1J5OA 2IJFA 3MUVP 3KJFB 1Y4ZB 5IOLA 1NKCA 1R8BA 1RK8A 1KHWA 1LV5A 2WVCA 2P5VA 2W25A 1Q7YT 1RT1B 3O44A 2CJXB 3LH2S 4NRTA 4ZVQB 5BYQA 4AYBD 2XCPA 4B3MJ 4IH6A 2OI2A 2KXFA 2BV3A 4ECVA 2GCFA 4UTGA 1TL7A 2RSQA 3K5OA 4TLRA 3GYNA 1V3RA 5DG8A 3OW2R 2VB6A 3RW7A 1KQSR 4QU7A 2QMUB 2YVSA 3TJ9A 3TW0A 4NZ0A 5JUMA 3KJVB 4IG0B 2LDYA 4F4AA 2QG9B 2ZH3A 4QQBA 2VIHA 2E5HA 2XY5A 2WSEC 1SCJB 5GMDA 1QSYA 2YNGB 2N7YA 1JJHA 2LXIA 4LF8J 3I87A 2DCLA 1YRUA 4L3NA 3JQJA 4ED4A 1WNEA 3B78A 4PG7A 4KGKA 1OY6A 1WKLA 3PJWA 2ZH8A 1F3FA 3MF5A 3QPIA 4YUDA 2CQ1A 2E66A 2UXDF 1B7FA 1S48A 2Q6BA 4DR6J 1Q79A 3TAMA 1KTVA 3JQKA 2ZBCA 2ZOMA 2ACYA 3IWLA 5F0WA 4EO6A 1VQOS 4USKA 1QUPA 4M5DA 3I4PA 4MYUA 2X3DA 1MW7A 5HP1B 5KFQA 3NL0A 2CZ4A 2D41A 4RBTA 1Q7LB 1YTYA 4Z7YA 2FJVA 2YWGA 4U96A 3WBZA 4JV2A 1MLAA 3N9UC 2MLZA 2AD9A 5C2CA 2MZJA 2HHSA 2E5LJ 2IFXA 1KOHA 2B51A 2V9KA 3K17A 5DDPC 4M94A 4QZVB 4DZDA 1HNVA 2AX1A 3PY8A 1TV6A 2DHXA 1FD8A 2WAQD 2YXLA 3QWPA 5EDWA 4DUZF 5T7LA 3L3CA 3RYLA 3E8OA 4ZITA 2OPPA 2XHWA 1DTQB 1RHKB 1TVRA 3KXDA 1QE1B 2OD6A 3BH7B 2W24A 3RBEA 4OHWA 1JIHA 2D3UA 3I32A 3ZZYA 4K50A 4ZVUB 1AUSL 3K8WA 1DQ8A 3A1YG 3BR9A 3MR7A 3DLGA 1S77D 4PXEA 3ZZTA 3HSJA 1TP7A 2MDAA 3JB9k 4F2RA 2W7PA 2A6OA 3KJNB 3D67A 1BMQB 2DHHA 2VQFF 2DR8A 4I69A 4TQRA 2C3PA 5B0DA 5GAEI 1Y5LB 2C2RA 3WX4A 4L72B 1WF2A 4FS2A 3T1YJ 3KFWX 4C6AA 3HKWA 2PN6A 3DKDA 2JEGA 2EI5A 4ZP9A 2FHOB 1Q81T 3CD5A 5EN1A 4B9LA 3IG1A 3ZO7A 2CQDA 2RHQB 2W9AA 3AY0A 1VRUB 3DRPB 5KFSA 1HFEL 3MHYA 2OTLS 2RRNA 2GX8A 5D0EA 3HI9A 4R0JA 5EUHA 1YRXA 2RQ4A 2DNHA 2YNFA 4ERDA 2Y9HA 1CQMA 4CDIA 3U1NA 3RW6A 3J81U 5L1LA 3BGLA 1H72C 3TUIC 1NJYA 4UOGA 5D78A 3R6GB 4RW7B 1SH3A 2KYXA 2ZOFA 4E8UA 3GQCA 4IG3B 2MZQA 4DFMA 2UUCF 1IJEB 5IV4A 3BREA 5EWFA 2N3LA 2CNOB 4F8RA 3RRGA 2D3ZA 4CLYA 3S01A 3C66A 4WYLA 3FSYA 2DNGA 2EG2A 2HZVA 2JEJA 2MHEA 4L3KA 5DG7A 3PACA 4NWBA 4URSA 2JFDA 2QGFB 5GMKa 2XI3A 4DPYA 3C15B 4ANDA 3K7RA 2IYIA 4R25A 5KG5A 4YOEA 3FQKA 5JMNA 4FF3A 2X1GA 3IBWA 1X4HA 3ZNJ1 4CT8A 4DHVA 1YJWS 4JI3F 2PFDA 2ZJRQ 1GT8A 4RW8B 1GNKA 2BEFA 4IRDA 2YKNA 2E44A 3MCOA 5HVFA 4CYUB 2HIQA 5E41A 1GXUA 2V8VA 4HACB 5J1NA 3GV7B 1R0AA 4B9VA 3NNHA 3KG0A 5DJBA 5HMZA 1S9GA 4EFAC 4EEYA 1BD6A 3VAJA 1JXVA 3FK4A 4ZPAA 5KFXA 3W62A 3QATA 1J5EF 5KG4A 3C15A 1S1UA 5L9NA 2VFSA 4LSLB 2CQGA 4QWBA 3BKUA 2D9OA 2DNLA 2R2UA 3PXGa 2B4PA 2EVZA 3Q2SC 3D0GE 4LREA 2VFRA 1ZETA 3MFHA 4B17A 4I6WA 4ELTA 2OJ3A 1V3ZA 3DFEA 3UR0A 4NCBA 1RTIA 1VQLS 5J2QB 1HQEB 2XYHB 1CPZA 5DDOC 3ETMA 4U7UK 3LWMA 1FX2A 2DO0A 2GMJA 1GTEA 2P2CB 4IQMA 1BGXT 4UZCA 4XTTA 3TA2A 3DOKA 1WOPA 3MMAA 1RBAA 2N4DA 3FBEA 1NPPA 1WSRA 5M2UA 1UA0A 4OYOA 5J2NB 1IQTA 1EJ7L 2QLJB 2HNZB 4KH1B 4WFYA 3KJQB 4YHHF 4K4WA 2FJBB 2DY1A 1Q0NA 4JB8B 2PA8D 3VGTA 1N5QA 2MQPA 1WJ9A 1JLQB 2XO7A 1HNWJ 4IOAQ 1HARA 5K20B 3VAGA 2R4FA 3AA9A 5H9EJ 3N4WA 2J7WA 2BQUA 2DXDA 2ZKTA 2ZITA 3NCPA 3CSKA 2C28A 3QT5A 4ID8A 5IS2A 2G13A 3MM9B 3FZ2A 1VBXA 3HVAA 2LVWA 4EYHB 4KKOA 4A8XA 1Y7PA 4C98A 2DR7A 4X4VA 2HHXA 2AW0A 2KFNA 5H9FJ 1NJWA 3EJMA 3T6JA 1IKVA 5GAHU 3FCVA 3L7PA 4QW8A 3UCZP 5I42A 1OY9A 1TMJA 4K4TA 2WW4A 1XMBA 3PG9A 2W8KA 2YH0A 3FKBA 1FNOA 1VQNS 4LIRA 1G4CA 1LEOA 2DGVA 1HIYA 4FDFA 4ZLJA 2Y3YA 1R0BG 2XM3A 4DPXA 4B3TJ 2J6UA 1UVIA 1RTHA 4USIA 2BJ8A 4TYAA 2ZM6F 4ZVTB 3OR1A 4E2FB 1QAIA 1GMWD 7AT1B 4U7UD 4YHHJ 1BUXA 1F3VA 4ICLB 3M8WA 3SCIE 1IKVB 1NHKL 3K5PA 4FVMA 4EMDA 3A8JA 4U8VA 4A8FA 4YR3A 4CO2A 3BSNA 4BC9A 1IM6A 3CCWA 3FBBA 2RQKA 3BYRA 2CPIA 3J80Y 2H1YA 2JH3A 2WW8A 2GGPA 2JVOA 1NRKA 1S1WB 3D0HE 1YI2S 2BRLA 3CCLS 4DCPB 3TRGA 1RACB 3EX7B 1JJ4A 2CQBA 2VASA 2W1BA 3QIPA 5KFEA 3QT6A 3CMQA 2OPPB 1JLEB 2YTCA 2N82B 4IQXA 2BVZA 3AQPA 2ZHBA 4ECWA 4P72A 3G8TA 4ICLA 5KT6A 2IAJA 4OX9J 1SC4B 2HQDA 2NXJA 1AZSA 1BLUA 1FE4A 1ITPA 3CO9A 1NNDA 1QAXA 1UJ4A 4MYTA 3W3SA 4HHUA 2DNNA 1PC5A 5FDLA 3DOMA 1G6BA 3POTA 2KT2A 3IN5A 1FKAF 4ELUA 5KOXA 4ECXA 2M0GB 4Q2LA 2MGZA 1U1OA 2AQ4A 1J5EJ 4HKQA 2J7UA 1FWLA 2BE2B 2FTRA 3CDUA 5C5JA 1URNA 2DRAA 2AEFA 2ZZNA 3HVRA 1H2VZ 4RW6B 4YR0A 2ZWPA 1RAGB 3QIPB 2XULA 1C1CA 1YSJA 3T3FA 5IT9U 2RS8A 1UEUA 1WF0A 3ITHB 1JLEA 1VBKA 4ZIWA 2R7QA 4I6YA 1X5SA 2C2MB 3IRWP 2R7XA 5F8NA 1UAWA 1Y0HA 4N47A 2JHEA 2YWWA 3GIKA 2UXDJ 1PO6A 5F8GA 1QM9A 4FYYB 1U02A 3BEGB 1Y3KA 4NLRA 4OHZA 3VCDA 4C9DA 4OYWA 4ZVPB 1TUGB 1HNZF 1DTTB 3M8QA 5D15A 4YDXA 3W2WA 2DPJA 2MQOA 1LW0B 2ALYB 2QL5B 4YEAA 1HNXF 4CLKA 1OYEA 1WHWA 5JVHQ 4FBUA 5L1JA 2CQHA 3VQSA 1XERA 4ILLA 4EU0A 2RH3A 3SDEA 2J7KA 3CCZA 3NMRA 1LK7A 1C0UA 2JC0A 4N8OA 1S9EB 5LSLA 4Q5VA 5HJYA 5B0CA 3RB4A 1NHVA 2EEYA 1E6YB 1LXJA 2IA0A 3A12A 2ZJPQ 2DNRA 2ZE2B 4ZPWR 3DOLA 4TQSA 5LMUF 4F04B 2AYEA 3EM1A 3SBMA 2A1BA 4EI2A 2B43A 1QDUB 4N56A 3KLFB 3C8YA 2XQCA 4DR3J 3F44A 1RKIA 4YMEA 2XMAA 4IOCQ 1U48A 3N5BA 3OVBA 3D3BJ 4ZPCA 4QYRA 1KQKA 5D4NA 5IWAF 1VMBA 3GFXA 1VLOA 1D8ZA 1ZS6A 2GIFA 3OXLA 4FPRA 1F60B 2FZGB 1B4SA 4KB7A 4NLPA 4PQUB 2HHWA 2D3OR 1VJWA 1FEEA 1L3SA 1U1MA 5H9FK 2JWNA 2JRSA 1QE1A 1ZZFA 2YBVA 3DNCA 2QYGA 5CYQB 5CCMA 3DLBA 1X9SA 2VKZG 1S0OA 4R5PB 3DM2A 4Q43A 2PC6A 1JB0C 3UI3A 4OL8A 3KHLA 2HZCA 2W9BA 4J9MA 5HVGA 1RCXB 2R7RA 2ZOGA 2PT0A 4MMOA 1KHVA 1FF2A 3MEEB 3A3PB 3SCKE 4YR2A 2RUSA 1HD1A 1P9QC 3TEGA 1A0OB 2NXNA 3ISND 1M5OC 2ROEA 4UUXA 3NOCA 4B02A 2DCUB 4WFZA 4JUZA 2DNQA 4DG1A 1H3DA 1JLBA 1NAQA 3PW5A 1YIJS 1RT7B 2CPYA 1YJRA 3NGTA 4G1QB 1L3KA 1RISA 1S1VA 3D6FB 5L8RC 3TA1A 1VRTA 2HIYA 1ZPWX 5C25B 1KFDA 2AV5A 4DV1F 4KBIA 2UVUA 2LDIA 5IT9Y 1IKXB 4NLDA 1NSPA 2R2RA 3QZ7A 3DI6A 1WEZA 2ADBA 5RUBA 4WXWA 2GQQA 4O4GA 4OI4A 3IP0A 1XMOJ 3WIUA 4CLSA 2IVMA 1VISA 2FPHX 2R8IA 3BQ0A 3M8ZA 4DL6A 1RT4B 2KN4A 2YKOA 2HNZA 3W9IA 3P6YC 4HL9A 3OTCA 1FRIA 3LANA 2L9DA 5DM7Q 1JLBB 2OLWA 1NH7A 4AQYF 2ZUGA 4CIOA 1JLQA 4NXMJ 2VG5A 4UQGA 3TUZC 4DR7F 3TVZA 2C2ZB 4XDCA 1HBMB 4AL5A 1CVJA 4KAIA 5KFVA 2CG8A 3I31A 3OTEA 4MFBA 1CJVA 1UPMB 4KQZA 4OI6A 1FTCA 1D0EA 1BQNA 3SFUA 2GO9A 2WOMB 4RWWA 1L3TA 2ROGA 5HBMB 3V2UC 4DR7J 3GZ7A 1XNRF 2OTJS 3NCQA 3PW0A 3GLJA 2QEXS 3OV7A 4EWTA 1M1GA 1Q82T 4IO9Q 3EWGA 2HHTA 4OYXA 1N52B 1T9VA 2DB1A 3CDWA 3PX0A 2D74B 5L46A 2D9PA 3I9V9 4IFVB 4O3NA 5GADU 5F8JA 3ZTOA 2XZDB 3KHGA 3JYTA 1RAHB 5K9FA 4GO5X 4WIIA 2VC1A 4J90A 3HCXA 2O67A 2W7AA 3NS5A 3OR1B 3O6QA 1IBLJ 1T9WA 4OZ0A 4QIFA 1XN9A 3M05A 4JV5J 1JJCB 4ED5A 3FBCA 1EETB 4WE1B 4A8OA 2DRDA 3EUNA 3ULHA 5KG7A 4NOHA 4Q7AA 2K3KA 1RT6B 4ATNA 3OL7A 3O3LA 1HWUA 3M6UA 1VFJA 1Q78A 3PJXA 5CQGA 3VV2B 4A8YA 2XNRA 2VPXB 5IC6B 3M6VA 4JYAJ 4NYPA 5F8LA 2V4JA 1OIAA 1ZM9A 3R8YA 3EVOA 1GQEA 2DT9A 3FZBA 5ETKA 3DLLQ 2ZZMA 2A2CA 1VS3A 5HMWA 2GIRA 3THVA 1SKUB 2JNJA 4NLOA 1VC6A 1HQUB 2W2MP 1KC8T 4BDPA 3DN9A 1WUUA 2GIQA 5A8WA 2DTJA 2WVFA 4QYZJ 2DXEA 2PSZA 1HHSA 3D3CJ 2VQEF 2RILA 2Z2ZA 3IS9B 5L9XA 4ED6A 4DPTA 1BC6A 2VJVA 4DV7F 3LP1B 2Z2LA 4LF9J 3R1LA 1QVFR 1TAQA 5B0EA 2CPJA 3MTKA 2N4CA 2BE9B 2GO8A 2GV1A 3ENAA 4RKUC 4RUHA 2R7WA 4DR1F 4NXNF 1S9FA 3X1LB 3KHHA 1XBWA 3BGRA 4J5OA 4RU9A 4GC7A 4DU8A 4WTOB 3G4SS 2BW2A 3ADAC 4OX6A 2ZD1A 4B3SJ 3K89A 3KK1A 4C8MA 3MM6B 3BPSP 3OR2B 2PEBA 1UMJA 4LVNP 1PJ6A 2R42A 5K8PA 2XY7A 4OJ1A 2ZEJA 5EWEA 2VQEJ 3Q89A 1JNRB 1WG5A 3T1HF 1B64A 2O66A 2RU9A 1FTRA 4O0IA 4DCOB 4ZP8A 4YY3F 1R0CB 4I2PA 1FKOB 2HBQB 3IWNC 3CJ3A 3QO9B 3EGZA 3RGIA 3IMQJ 1TK0A 2J0XA 3BYPA 3OFGA 2Z4PA 1IR2A 3RBZA 2IA6A 1T94A 3KTQA 5KFTA 1TTHB 1H0HB 1TVRB 2FHJD 2ZD1B 4WU2A 4JI8F 1WTBA 1TFYA 4PCQA 4PXCA 2LP4A 3UO0A 2G4BA 2RB7A 4DN9A 2G2OA 1HYSB 1WEXA 5I3PA 3LO3A 2RF2A 2HWHA 1T9TA 4W92B 4MT1A 4I7FB 5ETTA 3HKZD 3NLCA 2HBYB 1RWWB 3GONA 3P8BB 1FEHA 5J1EA 1PKUA 3MECA 2RKIB 4YB7A 5LSOA 2H4YB 4L76A 5F8IA 2GZOA 2WSFC 3A3OB 4DFJA 3AOAA 4PEOA 3TNVA 2KFYA 5C24B 1TUVA 2XWYA 1ACMB 3Q2TC 1RZMA 1K0VA 1HHTP 1X0FA 2OGUA 4LF7J 1SV5B 1YG0A 2V6AA 4KH0B 4WXOA 2QE5A 5K14A 3DLJA 2DR6A 1M0SA 1YBUA 3UDCA 3BGUA 1WOSA 2BANA 2F8HA 4CRJA 4A48A 1U8SA 1VQ6S 3L4BC 1FJ7A 3Q8SB 4RLEA 2ADCA 2B0GA 2OPQA 2BE2A 2JOQA 3CJKB 3CJSA 4J9RA 2K1RB 5E7OB 2ZH1A 4DV5J 3M2UA 2MY8A 2MKKA 1M90T 3P3DA 4M5NA 1R7IA 4A4JA 3DLHA 3CWJA 5D3GA 2HSEB 3M6XA 1JWWA 4Y34A 3QYYA 1RTDB 4J9VA 4P74A 1EHWA 4LVOP 8RUCA 3TQ1A 3E2EA 2EFNA 2QA4G 4YFUA 2CQ2A 1RB0A 4ZN1A 3IGNA 4K8RA 5CCLA 1JNZB 1RCOB 4NASA 3R97A 2BBEA 2RMLA 1NPKA 1U24A 1SVDA 3ZC4A 2IRYA 4RJVA 4KHPF 2OPQB 1U2CA 3DMJA 4AL7A 2CPZA 2XG8A 4ZP6A 4FKXA 5KT5A 3UD3P 4FF4A 1Y00A 2ZC3A 4DV6J 1X4GA 4PG6A 2QJ3A 2O1PA 2VBXA 3DRSB 5HATA 3TUPA 1C0TA 3OTDA 3MTJA 1YRTA 5CXTA 1QTNB 5HO4A 4RBUA 3PR4A 1HNIB 3H0PA 3VVUA 3V81B 4B3RF 1SJ3P 3MPVA 4DPUA 3B8HA 2MKIA 2ZVSA 4HTJA 3GG1A 4KO0B 4WTYA 4DV6F 2LQ5A 1Q53A 2BKOA 2WOMA 1VLYA 3EZOA 1HI8A 1T11A 2XSJB 4C8OA 2ERRA 2K06A 1S0NA 4Y2MA 5IV3A 4Z7CA 1P1TA 1UEVA 1WELA 1YQHA 2GAHC 2RNEA 2V34A 2VPWB 4KPCA 2I9SA 4NLTA 4ZCLA 5K5MA 1N0VC 2ASDA 2PI5A 3I5BA 4ZPTR 5KFHA 2BA9A 1FE0A 3TR5A 4V19X 1HNIA 2MKJA 1WEYA 2E5IA 2OKQA 1U7LA 3ZZ0A 1SJQA 1N6QB 1AYEA 1VGYA 1OQ6A 1U09A 3KLHB 3ZTPA 1U0SA 2HNYA 3RAQA 1VBYA 2GJ2A 3AHPA 3T6BA 3M4XA 4MK9A 4ECUA 3CD6S 5B0BA 1FRJA 4JI5F 5ETMA 3SCJE 3H5XA 2VBYA 3OTOJ 5IWAJ 3OVAA 3MMJA 3N79A 2YKAA 2VL1A 4EZ9A 2MKSA 2KT5A 1J27A 1CQNA 3FMWA 2OPSB 2V67A 3VZIA 2XO6A 3MEGB 1TU0B 3OBIA 3KLGB 3I0RB 1RAJA 3O5TB 2V2VA 1H7WA 2R3VA 3C14B 4J9KA 4V19J 2NXUA 2F65A 3AODA 3UN5A 2HK3A 3VGVA 1ZM2A 2BACA 3GYXB 3NY0A 4OI0A 4M8LA 3OHBA 2BQ3A 3MXHP 1JMTA 1N33J 1ZOTA 1OWXA 2I1RA 1HBUB 3E3XA 2E5JA 4K5SA 5U47A 1VIXA 2ALZA 3DHXA 2HHHJ 4LR9A 4DV2F 2NSCA 3X3UA 1LOUA 2DK2A 1RI7A 4CLTA 3CJQA 3NXZA 5DO2A 4GVLA 1RT4A 2CJAA 2Q3PA 2J0SD 4ZJOA 4DPOA 2ZJQQ 5KFBA 1PYTA 5HROA 2NPIA 1HNZJ 3W61A 4XO0A 3QJPA 4HR2A 4DN0A 1AXQA 1F2HA 2BMBA 3D68A 3HSDA 4I6AA 4N7TA 2M4MA 4ZK7M 2RT3A 4J9NA 2POKA 3OT9A 4P75A 5D8HB 1X4EA 3HSGA 1RHQB 3M1VB 4LRCA 5AE2A 1NXIA 2XCAA 4ED8A 1CC8A 3MCSA 4ZS6A 4AXIA 1BQNB 3G96A 1KD1T 4DUYF 3KK1B 3OQ2A 1PG5B 4K2JA 4EZ6A 1NZ8A 3MM6A 4Y2AA 5G0RA 2XZTB 3P5TL 2OFGX 3KUGA 3QQCD 1OYDA 4B3SF 1X4BA 3BZQA 3C19A 3DCAA 1I5OB 3I5AA 3SSQA 3UDVA 4QIVA 2XY6A 1SL0A 2R9LA 2H5EA 1ELOA 2X1BA 2LYVA 4UW2A 3SEOA 4DR1J 2G9OA 3CE8A 5KFDA 2KM8C 2EFGA 4ZLLA 2APOA 4ZJQA 4A8KA 2R7TA 2R8HA 4MKVA 3JSMA 4ES2A 1FCAA 4WK1A 1T9UA 4LF9F 2XHCA 1LWCA 3BN4A 5GMEA 1JX4A 2V4QA 1DQAA 2FGOA 1RWPB 1RT3B 1RWNB 3VGSA 4DS5A 4ZVGA 2EBGA 3RB3A 3A8EA 3LPYA 3M2RA 7FD1A 4K4VA 2UV8A 5J1EB 2MGZB 3MECB 2UUAF 3WZ0A 4X65J 1FWKA 1IBLF 2E1RA 2HZAA 2XMMA 3IR5B 4CO3A 1UVNA 3EVWA 3TEHB 1GK8A 2GJIA 4I2QB 4OJHA 5IM0A 3RR7A 1R27B 1RAOA 1OSCA 1TKXB 3C6UB 3DDIA 2PE8A 4W90B 2HQ3A 4X66F 3MOJB 4KE5A 2J6TA 3BBCA 1KONA 3CXCR 3M2VA 2VFVA 5DGAA 1RWOB 1I51B 2BX6A 4YB1P 1V9OA 3CJ0A 5DGBA 3IS9A 3IXQA 2BKPA 3M7VA 1VJQA 2WSCC 4J7CA 1Y5IB 2G2YA 4D3HA 5C7PA 2FQQB 1HA1A 3TYTA 1L3VA 2HHUA 2J5AA 1KVJA 3CJ5A 2KB2A 1UFKA 4ID5B 4LBIA 5DS7A 4DSKA 2HFZA 2HS0A 1EARA 1E6YA 1CJKA 2FLOA 3HHLC 6FDRA 1Q8IA 4DR5J 1M1KT 1SC1B 1MN9A 2HS4A 2V2QA 3JXOA 3I4HX 5DETA 3CCTA 3AT1B 4EYIB 2RDDA 3KLFA 4LF4F 2UXCF 3VAKA 2W2NP 4OYZA 5J2MB 1GEHA 3H2UB 3PEHA 2FVPA 5KFFA 5B08A 5HLFA 1ZZNA 5I3UA 2UUTA 1CLFA 2VBWA 2NUHA 2B9YA 4OLPA 3C16A 3DDNA 3EICA 4EUVA 3M8PB 1PSDA 2JVRA 1XWLA 4YB6A 5B0FA 4J9PA 2W2PP 2WONB 1DRZA 2XB2D 4RR5A 5CYMA 4URGA 4LFAF 2K7JA 1YLXA 4DSEA 3CIZA 3CIMA 1LWFA 4NLVA 1UVLA 1XQIA 4AQYJ 3QFHA 1ROFA 2AEMA 3KKFA 3CD0A 4PQAA 5CYQA 5HK4A 2XMJA 5J2MA 3DRYA 5F41A 3R2DJ 3ONQA 5DQIA 4LQ9A 2BM1A 1YJNS 2KZMA 2XSJA 2M2BA 1S4FA 3ZTSA 5HL7Q 3NGSA 1XMOF 4LF5F 2R7VA 4RU2A 2QA1A 3H42A 3Q23A 3ILLA 4AL6A 2KYZA 3EXYA 4WP8A 2O3DA 1WC4A 3GCXP 5KAKA 1F1BB 2B9WA 2B8PA 2YKPA 3D0IE 3VAMA 4GKKF 3SYZA 4P9SA 1BWVA 4USWA 4DQIA 4J91A 1S76D 1YVFA 1BE4A 2HNYB 4HACA 2M70A 3OFEA 1PBAA 4DX6A 5LSRA 1S9GB 4DF4A 3CDBA 3QGGA 4YQWA 2YNHA 1R89A 3ELHA 1M5VC 3UN3A 4FNIA 4G3IA 2OO4A 3OL9A 2GVZB 3DI6B 3P96A 1IXKA 2YPZA 3QT7A 1H38A 3PYEA 1L3UA 4Q0BA 1FD2A 2MLYA 3CJKA 4DL3A 2K1RA 2IIHA 1KDNA 2OPSA 3D66A 3V4IB 2OP5A 1AROP 1ZA2B 2LXFA 3I0RA 3DXBA 2KKHA 4DSFA 4ZA1A 1AT1B 1RT5A 3EZUA 5HJXA 1H7XA 3N6LA 1FDNA 3UR3C 4DSJA 1APSA 4CM0A 1KLMB 1CS4B 1MROA 2G0CA 2MQQA 3G6XA 2QA4S 4ZCKA 3OD2A 1E6VA 1X9WA 4PKDB 2P8IA 2E1MC 3H5YA 1WD6A 4ZP7A 2M52A 4P2XA 2JLEA 2F8MA 5LT5A 5HBMA 4BS2A 1IKWB 2HRUA 3D5MA 3DMJB 4NEZA 4QJVA 2VOOA 1NSAA 4B3OB 4DFPA 3GV5B 1DJ0A 2IRUA 3AD7C 5BXIA 3NGDA 2E9RX 4U9RA 4DR4J 1G1XA 2FIUA 5A76A 4UUWA 1SJ1A 5KFJA 2NYHA 4YP3A 4PWWA 1F5BA 4DQRA 4A8QA 2EPIA 2W2OP 3ISZA 1P27B 4K4YA 4CLLA 3BKFA 4WK3A 3VF0B 1JLAA 2N7CA 2CQIA 3KG4A 2BDPA 2ZH5A 3M1VA 2G2ZA 4ES3A 4K5RA 3JYTB 3KUHA 2QMWA 3O1LA 2YX7A 3LTOA 3KLIB 4QCLA 2W01A 3PM9A 1JLCB 3GV8B 1IKYA 1TKZA 3BDPA 4F25A 5KFOA 1P6TA 4IRCA 1NB7A 2A0FB 3TQEA 4C48A 5I42B 2CQ3A 4K4XA 1FXDA 2UVVA 4DWIA 4JV1A 4PXBA 2OPRB 2ZKUA 1YGYA 5K8OA 3R27A 3W8GA 2UU9F 1HW8A 2AJFE 3EVMA 1JLAB 4UOCA 4LR7A 1SJRA 2V4JB 4JI0F 1TL1A 2G1HA 1Z4UA 4DUTA 3RB0A 2HQCA 4QIWD 1SQGA 4B9UA 5T7LB 2EKNA 1D3WA 5CAAA 2AZ3A 2CDRB 1FDAA 3GE9A 4KC5A 4DF8A 3U1LA 3RAXA 2C2EA 2E29A 2AYGA 2UU9J 2XMVA 2KHDA 1Q5VA 4ANEA 3OFFA 3FVYA 4RNFA 4EBEA 1VC5A 1NBEB 1UVMA 1NK7A 3HT3A 2VFUA 5LJ5Y 2ILYA 4FN5A 4OX9F 3TUJC 1X9MA 3CC7S 3P5BP 1UKUA 2DBBA 4IFYA 3OSPA 1G2EA 1RWKB 2DKOB 4KIAA 5D0HA 2AGQA 1RYSA 2RHSB 1IWAA 4TLQA 1Y10A 3SFGA 2M88A 2KU7A 2XZWA 2AT1B 3KDNA 2KVIA 4CO1A 2DGUA 3LWLA 4A8WA 1ZPVA 4JI0J 4ZN3A 2DJWA 2B6AB 1HHQA 2BJDA 3PRDA 3G8SA 3GPAA 3P4UB 1SQFA 2GHWA 1HI0P 5KFUA 4IG0A 4YDDB 1RA7A 1J2VA 3FFIB 3VAIA 1ZAXA 2HLUA 1U2FA 3M32B 4CP5A 1TK8A 2DY9A 5AT1B 4IYQA 5BYSA 3PR5B 2E1AA 5HROB 3M30B 2NQPA 1RLCL 2QTWA 2C3YA 1FXLA 3PHTA 3GFYA 2V8HA 1MWYA 1Z1ZA 2CPFA 1T3OA 5CHCB 4CM2A 1RHJB 3GJQB 5DQHA 4RNMA 2W4CA 1S6OA 3GFHA 3MMCA 4QIEA 4AE5A 4QWEA 4ECYA 4JI7F 4PUOB 2B7BB 3QGHA 4QU6A 2DR9A 3IM8A 2B6AA 2WZ1A 2IDEA 3L95X 4USJC 4KGVB 4C8YA 2ZBRA 2YWFA 3GG0A 3OFHA 3FFIA 3FSXA 2CXEA 1U26A 3JSBA 1DTTA 3M8QB 4OI2A 2GHVC 1UFWA 4OZ5A 3W2WB 3PYGA 4F4ZA 3UWTA 3HXMA 5AE1A 2V4RA 2HVIA 1CEZA 2WCXA 1NDPA 1HW9A 2Q79A 3UCGA 1NCLA 3IGVA 2VHGA 2OEJA 3JTNA 1YK9A 4X62F 4M5MA 4PABA 2A3JA 2H5JB 4MKAA 3ILJA 2YKMB 3H40A 2I8EA 1U6BA 1FK9A 2H4WB 4FP9A 4FYXB 4ECZA 3UNYA 2BM0A 2ZE2A 5IXUA 3KK3A 1HNWF 4G65A 1CULA 5HI7A 2GVDA 4GKKJ 3R7SB 4OYAA 5CH7B 3V6KA 3HFVA 3PZPA 1VQKS 2JLGA 4QWDA 1K9MT 2VG7A 3FEXB 4O23A 3IFEA 3B6BA 4CLWA 1Y11A 3DLGB 4TY9A 4IH7A 2QLFB 2EC0A 1BWEA 2X1AA 5D4PA 4DSIA 1MSWD 2CVEA 4USTA 4NLQA 3B4MA 4LBHA 3MR6A 2DNMA 3HM9A 3IR7B 3PRBA 2IM1A 5H1SV 1U47A 1VR6A 2OHDA 3GSDA 1RU1A 2YX1A 4OIXA 4PG8A 3J7AN 1FJGF 1HWJA 4CH1A 3E51A 5KFPA 2ABYA 2E9TA 4NEYA 4CO0A 4HYKA 5IFMA 4Y28C 1X4DA 1RAEB 3FGVA 3CCES 2Y1LB 4F3MA 4ECSA 2W4DA 3LUYA 2Y8WA 2KTQA 3AJ2A 2GNKA 4P73A 3V6DA 4FPIA 2FJWA 1ZTWA 2ZZTA 4D3GA 2MQ8A 4OZ3A 4EGLA 3S8SA 2CQ0A 2EFQA 2M3DA 2OMOA 2PMZD 2NXCA 3L9ZA 1C1BB 2LEBA 1S1XB 1R8CA 4DS4A 3HJVA 2NZCA 3D2WA 1CJKB 3G87A 4NX9A 4LFAJ 1FX4A 2LLZA 3FEYB 4X84A 2Z30B 1T9YA 2JSXA 3DU5A 3GJSB 3Q8YA 3M6WA 2HRTA 4NLYA 4O3OA 5HQ8A 3J7YI 1SQEA 1HL6A 4MIWA 4B9SA 3DYAA 1D09B 3TAPA 4C8KA 1S0VA 3I55S 2R7SA 5MAOA 2HVEA 2PMWA 1WC1A 2GQ2A 1VBZA 3MM8A 2XGPA 5HMXA 1M5SA 2DD8S 3CTRA 5A0YA 3C6TB 5E3CA 3LALA 8ATCB 1FHTA 3TI0A 4ECTA 1KLNA 3T9NA 4ZVFA 3CJ8A 3PYDA 1YWXA 4NCAA 1G7CB 2CUYA 7FDRA 4X66J 2OAUA 3DXSX 5CYMB 3PIPQ 2M9KA 3M9MB 4DR5F 2ZDOA 1ZYQA 1LWFB 2BJ1A 2YKNB 3IRXB 4WFAQ 3TWZA 1M1HA 4TY8B 4WIQA 1MMDA 3NGKA 1TKTA 3DYAB 2G1DA 3HZGA 3ICLA 4FZVA 5E33A 1S5ZA 2MQLA 5F3TA 3IA0A 1LWEB 4WJBA 5G4DA 2UUBF 2EG1A 4IDKB 2DH8A 2E9ZA 3HVTA 3HHNB 3NGUA 3VZHA 3JTPA 1N8RT 2RUGA 2V68A 3PW7A 2C2OB 3HHLA 2HVZA 2NSBA 2V50A 3RBXA 5AXLA 1J5OB 2LQ8A 2AJ4A 2Z2YB 3VVTA 2IC3A 2R7OA 3I96A 4G1IA 4KT0C 1RA6A 1YJUA 3CCJS 3T1YF 3F56A 4IFVA 4WFBQ 3LW5C 2ZM6J 2ASLA 3W9JA 4TU9A 3IAS9 5A8KB 5IQ6A 4N8NA 1HQEA 2F3JA 3NOGA 5JJBA 1LWEA 3D1OA 1HMVA 2OSRA 2QRRA 3VR1A 2RDJA 1HBOA 4DMZA 2LCWA 3OXGA 3PFOA 3HHKA 4CQ1A 1HBUA 4I1TA 3BM7A 3HHLB 3CF5Q 4LF2A 4FBTA 1XR6A 2FB0A 2MLXA 5F3ZA 1WG4A 2MQMA 4EBDA 1XTZA 2YPYA 1FRLA 5KFKA 4FF1A 4NMLA 3Q86A 4RW9B 3QGPA 1HPZB 3A13A 1UWBB 4IOBA 4P2SA 3T5KA 4DJBA 2HS3A 3JAMU 1UFLA 2ZH7A 3FDSA 3W65A 5IC4B 4M1KA 1S0MA 2IM0A 3UN2A 2B4OA 4DCJB 5KT3A 2GS8A 1HBOB 4FVCA 3U1MA 1E6VB 4PWDA 2A10A 4OMFG 2J0WA 2UUWA 5HVHA 3SI8A 3HT0A 1UCNA 1RGVA 2OMLA 1TQLA 1FVSA 3AA8A 1RE1B 4ZLPA 1TR0A 4L6V3 5LM7E 1I3OB 1R6VA 4C3LA 5HP1A 1YHQS 2XS5A 1KS2A 3H98A 1WACA 3EDRB 4C97A 5IT0A 4BLGA 2FC9A 4DOZA 2GW8A 3EPGA 4Z2XA 1YJ7A 2XMTA 3L7UA 1SUQB 3LP1A 3M30A 3UD5A 4OV1A 5I4MA 3V6JA 2QSFA 3DU6A 5D4OA 4QIGA 4MK8A 2W2QP 1S9EA 2I2YA 4DSLA 4HHJA 3W8PA 3NG8A 2J6SA 2DGSA 1A7GE 3DHWC 3NGRA 2BABA 1SL1A 3DOLB 3LGMA 1FJEB 4IUFA 2ZBPA 1VI7A 3QMQA 4CNZA 1N54B 1SJ4P 1TELA 2YNIB 2YWHA 2UVRA 4ZVSB 1NO8A 3HSZA 4ETXA 3M2RB 3TOQA 2EFPA 1IWGA 3QBCA 2DEJA 1ZA1B 3LP0B 2QFJA 2HHHF 2DO4A 2HGNA 2J9DA 3GFZA 1FRHA 1S1TB 2WVEA 2XNQA 3R7BB 5KFYA 1K73T 5IM0B 2DNKA 1NPRA 1NEEA 2HQFA 3NBPA 2MJNA 4ILRA 2FZKB 5GADI 3CDAA 1H73A 2DGTA 4J37A 2G0JA 4WKYA 3MUTP 4DR2J 1RKJA 2RVJA 2GFFA 2ZBQA 4LF1A 1R8PA 1TL4A 3L09A 1LW2A 2MKHA 2JZ5A 3G82B 2V2ZA 1N5TA 4HDHA 2Z58B 4OYIA 3MMBB 4QPTA 3CT9A 2GHPA 1IQZA 3VTIA 2GJFA 2V8DA 3GWCA 1NK9A 1I94F 3OTOF 3BR8A 1TL3A 4DEZA 1WC5A 1VQSA 2XWXA 3D4JA 4Y2CA 2W9CA 3LGHA 3QJJA 4RW6A 3KWMA 2J76E 1OPZA 3HDSA 2C22A 1N5SA 2AIRB 3PYFA 2GAGC 5CABA 1DTQA 4ID5A 1RAFB 3MCNA 3MPUB 4NI2A 2OUGA 1IBKJ 4B3RJ 1NJZA 1S1VB 3ENVA 1LW2B 4CH7A 1T95A 1MMLA 1EP4B 4O44B 1B0PA 1YBTA 3QRPA 2KZZA 2AJQA 4LFBJ 3I9ZA 4Y6IA 4BWMA 3QZ8A 4YN3B 2XLIA 3MURP 2AGOA 1XC9A 4LF5J 1S6QA 4O4GB 3HZEA 2DIUA 2LECA 5E3AA 2F4FA 2DVIA 1H98A 4KV8B 2XGQA 4KHPJ 3ZTQA 5L38A 2Z56B 4GC6A 1S12A 4C0HA 2QFIA 3M8PA 5K8MA 5D3GB 1C1BA 2XMWA 1GTHA 3AAWB 3BSAA 5M2RA 1QSLA 1SIZA 1X60A 3KNGA 4M5KA 5KFLA 4MTPA 1EQ0A 2AJ0A 3H59A 4RW8A 2CWXA 3QGIA 4FXDA 4KJIA 2IMWP 1JXEA 1RXOB 3MM5A 3T5HA 3WC2A 1NJXA 1R0AB 3GIJA 5KG1A 2XI2A 3SQOP 2OH2A 1SJFA 4P10A 2IBKA 3FSIA 2FVSA 2B4VA 4Y65A 2V2KA 5KFRA 4PZVA 2J8SA 3W2VB 5A0YB 2HW3A 2CPXA 2FJAB 3HD2A 4DXLA 4OZLA 2BOAA 4GMKA 4R0EA 4ZDNA 2K3IA 4IG3A 3PKYA 1N5YA 1FFGB 3BGOP 1Q1KA 2IVFB 3H8YA 3W60A 5GAEU 4TN2A 2CJQA 3IC1A 3JS9A 1IR1A 3QWUA 1VQ4S 3DRRA 2MPUA 5C2GA 2ZHAA 1B0VA 1T05B 4DV5F 4BHQA 1Q8BA 1UVKA 1XNQJ 1EKRA 4PG5A 4CTAA 5ETLA 1Q95G 3U02A 3W2VA 2GVZA 2A2DA 5A8RB 2K7KA 4RPFA 4TNOA 1N32F 4NLXA 2DGOA 2LEPA 3MEEA 5L1IA 2BUNA 1LXNA 5J2NA 3B54A 4UOHA 5L1KA 1SXLA 2HWTA 5ITHA 2E7WA 5HN0A 4LF6J 3T5JA 5J2PA 1NUEA 3C46A 1FFSB 3W5YA 1V5IB 3KLHA 3CCRS 3W64A 2RRBA 4ZVOB 2HLTA 1JKHB 1CS4A 1MROB 2DGQA 3KUEA 5C25A 3NRBA 5KT4A 3HVWA 5KFNA 1Q8KA 2ZH4A 4ER8A 4FF2A 1FRKA 5A8RA 3H20A 2ZUAA 5DZ6A 2VZ9A 2BJ9A 2Y0BB 4KKOB 2R8KA 3CMAS 4C8LA 3TJAA 3R2CJ 4FXVA 4F36A 3MM7B 1KOOA 4J9UE 4HVZA 3WHIA 2CQPA 4OZNA 1NJIT 3RB6A 2HNDB 3C2PA 1UJ6A 2IVYA 3NWGA 1PGZA 1FERA 1B0TA 1S1XA 1YJVA 4NMXA 3NEKA 4Q8FA 2NZ4A 4Q44A 3PO5A 4TKTA 4F3OA 4C8ZA 3HHDA 1X7VA 2ZVIA 1NKEA 2WBMA 1U1PA 4W98A 2QZ8A 3D1QA 4OYMA 2HFNA 3I82A 4N76A 2DNOA 1WI6A 3BGRB 2K8GA 1LKZA 1NSKL 1NK8A 2R8GA 1PAUB 1U49A 2IRXA 4K4UA 2V5HG 4DV7J 3PDNA 2Q43A 1UP1A 2YNGA 3QLHA 2DH7A 2XYPB 2L08A 3D6MB 1SB6A 4DQPA 3EMTA 2IPOB 1RBOB 1I1GA 2D1CA 4CT9A 2BZ2A 2H51B 3FBFA 2CAJA 1U2RA 4NA2A 3K57A 2KDOA 4MH8A 3HFKA 2M8HA 4TYBA 2N3OA 1FWPA 5ADZA 2RQCA 3NNCA 1KVIA 2MEWA 3CPWR 1VK8A 2HHPA 3MPDA 4AT1B 1YJ9S 2HG4A 2ASJA 4NXNJ 2CRLA 2CPDA 1OMSA 1UW9A 3TX8A 1HQ2A 1EQMA 5KTQA 1S10A 4JI1J 2ZNYA 4IDKA 3MGJA 4JYAF 2EWHA 1PCAA 2VICA 3LQVA 2IYGA 1MN7A 1W26A 2Y0SD 4ZHRB 3G71S 2COLA 1JLFB 2U1AA 1LK5A 4USVA 3C3LA 3PFEA 1YX2A 4GO7X 4HI1A 2H54B 2IC3B 5B0AA 4FYDA 3CCUS 1IBMF 3DC2A 4UOFA 1SC3B 2PDAA 3CJTA 1T03B 1D9AA 4AUKA 3FNNA 3CCVS 2FHKA 2FVQA 4LQ3A 4YS2A 5GVQA 4PYDA 4EK2A 5JVGQ 2BQRA 5DLGA 1O51A 3NCRA 4F4XA 2EBEA 1VDHA 2DNYA 5CZVA 3BSOA 1Q8LA 3BV8A 2LU2A 1XEZA 5A8WB 4ZLNA 1RT3A 5C42A 1FA0A 3G82A 3TZWA 4DL5A 1DFDA 1U4BA 3RTVA 1SC6A 3MMBA 3M32A 2ROPA 4LRAA 3FRZA 3G2XA 4LSZB 1LW0A 3AQOA 1S1WA 4JI5J 4JV5F 3NP5A 2W9CB 3I0SA 4N77A 2BR0A 3HP6A 4H4OA 1XIQA 3G6VA 2E7VA 2AZ1A 3DGPA 2JFKA 3ISNC 1T7PA 5AXKA 3J81j 1TKXA 3C6UA 5DDQC 3K5MA 1EAYC 1RAAB 2ZDPA 3SZ2A 2HAFA 4Q8EA 3ZZPA 1H2TZ 2VA3A 4ZJLA 4M5HA 4CI0B 4CLZA 2WTFA 1EP4A 4O44A 2ZC4A 3IG1B 3OPKA 3IM9A 4UQTA 4H4MA 5FDLB 3V5RA 2MB0B 3K5NA 1GXLA 4K4SA 1FFWB 1RWVB 3GIMA 5E5NA 3OR2A 4GKJF 1MU2A 2D69A 2VOPA 2RRAA 4UY8T 2I6WA 3I0SB 3FEZA 3MR3A 3BO3A 4MKYA 1XNRJ 1XR5A 1N88A 4KTQA 2Z57B 3F41A 4DLEA 2F4VJ 2DNPA 4Y0FA 1TUWA 2QC3A 1SPBP 1VOMA 1IN0A 2LQ9A 2YWEA 3EGVA 2QL7B 4I68A 5JXSA 4PQUA 4M5DB 4F0KA 2HGMA 4HH1A 2F5GA 2ZWOA 3W1YC 4ZKAA 2KO1A 4OHXA 1WC3A 2HQIA 2IBOA 4R5PA 2AWZA 3CEDA 4G6VB 1OO0B 3AOCA 4RNNA 4X4OA 1SH0A 5J1PA 5HLFB 1U1LA 4WP9A 1LWXA 5LXRA 1C2PA 3NAIA 4JI6F 1EX8A 4NPOA 1HNVB 4N41A 3PJ9A 5KFCA 5E3PA 5A6WA 5KFAA 3ZXWA 1CSJA 4QPXA 3KOAA 1WC6A 5E2QA 1N6QA 2P9GA 2VJUA 3QFWA 4NE9C 2J9EA 4NLSA 4Y2KA 1NH8A 3ET6B 5AXNA 1OY8A 4A47A 3G6ES 2PIIA 4WFNQ 3DRRB 1LQ9A 4Q2MA 5KFZA 4O3PA 1TKDA 3GR0A 4XK8C 2DGWA 1N34F 4HH0A 5BJRA 1NZAA 1UJ5A 3CB4A 3WDOA 2XLJA 3P45B 3K58A 1YZ6A 2BYCA 4LSNA 2EK6A 3OLAA 3CNQP 3ENQA 4DR3F 3UW1A 2HBRB 2UUBJ 3LP2B 4O3SA 3BS9A 5F8HA 2CZVC 2DGXA 3D9BA 4WFXA 4DR2F 4ELVA 3BPDA 2BJ7A 2LQBA 3THTA 3N6MA 2Q1LA 1M5KC 3NWRA 1WG1A 1JKHA 1U6FA 3MUMP 4ED7A 4LFCJ 3KHRA 1KWMA 3RR8A 1SKWA 1Z2LA 2W9BB 4F4YA 1FNXH 1VRUA 1HBNB 2B4UA 3DRPA 4ZPBA 2AX0A 2XS7A 2J0QD 2JDJA 3NS7B 2CQCA 4KGMA 2JJ4D 3MAQA 1RJJA 5A2QY 4R8UA 1D1UA 2UP1A 3J7A1 2HVHA 1Q5YA 1EZZB 1TFWA 4WF9Q 3C6TA 2XYGB 2HNDA 1X5PA 4DX7A 1GMWA 2YY3A 4DV4J 1FT8A 5LMUJ 4F0HA 3CC4S 3DLKB 4KRWA 2F7VA 1CBKA 2LEAA 1RADB 1JK9B 5D0GA 2VD3A 2QO3A 3RBDA 1JQGA 2HBZB 2MZTA 1W2BR 1IKXA 4JBCA 3MM9A 2FVRA 2IY5B 1RABB 1WORA 4O4RA 5LOQA 4B9NA 1NDLA 5BR8F 3CC2S 4ED2A 1RBLA 2X3GA 3BO4A 1KTQA 5KT2A 3TZXA 1YKWA 3KK2B 1DLOA 4ECRA 2D7SA 4B3OA 2GMLA 1GH8A 5FJ4A 2KH9A 2CA9A 3ILIA 5G0RB 2C2NA 2B9EA 2XTJP 3DLKA 3H25A 1AFJA 1NM2A 3TJ8A 3QRQA 1YITS 5EX3A 1F0XA 1QY7A 1WTFA 3BKTA 3PTWA 4KY3A 2QLXA 4M63A 4CYUA 2KVQE 5AJ3F 1CJVB 4C11B 2AGPA 3PW2A 2EFOA 1R6YA 2OEKA 3SQGA 5KFMA 5CD4A 1NDCA 5GAGI 3CCSS 3N0VA 2KJWA 1BY9A 1DLOB 2WVBA 3CJ2A 1LWCB 2VDHA 3D1HA 1R43A 3N28A 5DRKA 3EYZA 1P9YA 4RNHA 4J9QA 2L48A 2CQ4A 4X4UA 2XMKA 1R3NA 2FY8A 4ZIVA 2EKYA 2V0NA 4JI4J 4ZVEA 3U7JA 2MZSA 4OX7A 5E3RA 3OHAA 2B56A 1XR7A 3PV8A 2P9CA 4MAKA 3AXMA 1NB2A 4CLUA 3KYLA 3GJRB 2ASYA 4IR9A 3G6YA 1QAYA 1MG7A 3R5CA 1QLNA 5HMYA 1MWZA 2AYMA 2VG6A 3Q22A 3B82A 4BWJA 4B3TF 2AKWB 2JEIA 3J80U 4A8MP 2GMHA 2GC8A 1G3OA 1XJWB 4RUAA 1EB0A 1T9XA 2A6MA 1BHNA 3M2VB 1VK3A 4M5LA 4NLWA 4WYWA 2C3MA 3QNWB 2DH9A 1ZAWA 3MM7A 4M95A 1REVB 3Q83A 2P9EA 4Z37A 4URQU 4JI2F 4CZCA 3PIOQ 4E0DA 3NNAA 2HQGA 3HD1A 3QT8A 4OZJA 2JLFA 4RX6A 3WC0A 3M9OB 4ED1A 3R1HA 4H4OB 3GR1A 2Y1IA 3PX6A 3ZNUA 4JP8A 3M9NB 2BE7D 4OYBA 2H3EB 4BBYA 2RAQA 2KXNB 1RTZA 3AB4B 3EE3A 3M8RA 2ZBIA 4JI7J 2ZNZA 4QOTA 2Z8QA 2AP6A 2R8JA 2BJ3A 4QW9A 1RYRA 2DITA 1NKBA 4O3QA 2M7SA 4IH5A 1PYSB 2L9NA 5EX0A 3WIVA 4FYWB 5LXYA 1FKPA 3HHEA 2OSQA 2R2SA 2DHSA 2J8AA 3ZZRA 3IBCB 4S0MA 3UQSA 5GAHI 3Q8QB 3LP0A 3C16B 2DXFA 3HHLD 3I6PA 3MWBA 4HTIA 1SH2A 1C0UB 3N6NA 1OQ3A 1VQYA 3VWSA 3S1TA 4PUOA 2I5JB 3W7BA 4DV0J 3EGNA 1VIOA 3MCMA 4OX8A 1GMUA 4B08A 4ZCIA 2HFSA 2NLWA 4C3MA 1NK0A 2D3O1 2WHOA 1U45A 1NK5A 3LAMA 3OTBA 2HEKA 2EC2A 1UWAA 4ANCA 1XMQJ 4P2FA 4X4RA 4KGXB 1RWUA 1WDDA 2LU1A 5LMNF 4F02A 1UPPA 2VC0A 1ZBTA 5DM6Q 4WWSA 4U7CA 3OJUA 4WZQA 3QO9A 2X1FA 2UXBJ 2CPHA 4HDGA 1RLDA 4DV1J 1UA1A 4NRUA 4HT5A 2CFXA 4IR1A 4K0KJ 3MOZA 2QLBB 4WZMA 2KM8B 1A6LA 2AU0A 1S6PB 3MD3A 2VPZB 2KFZA 5C42B 2EXUA 3DM2B 1RQ0A 2WK4A 4ZPVR 3CCMS 3W66A 4MIBA 3GILA 4DV3F 1RAIB 5LL6d 1KFSA 5T14A 2C2KB 4NCGB 4ED3A 2LFVA 5D4LA 3TVYA 1S6QB 3H5SA 4KFBA 4X64F 4LSNB 4ALZA 4DFKA 4CLPA 1O8BA 2VFTA 1CJUB 1U0HB 3LP2A 4LRBA 2B3TB 1X4AA 3NS6A 4X4NA 1CJTB
chains in the Genus database with same CATH topology
3K2YA 2DRBA 1Q4RA 3FJ2A 1Y3JA 3DRSA 4K59A 3SMZA 5EGYA 1S6PA 2FC8A 2PEHA 3PW4A 2E1CA 1W2IA 2MSTA 2ZH6A 2VONA 3CD7A 4IKAA 2UZAA 4X4PA 1HBNA 2O01C 4LJMA 3TVKA 1MU2B 1QVGR 4DR4F 1F9FA 4R8UB 3K59A 2XEXA 3D28A 5B0GA 1N36F 2P6SA 3SV4A 3RRHA 3UPFA 3K0JA 3IWXA 1RTDA 2WONA 1N5VA 4HI2A 3OLBA 5E0OA 5L39A 2UVWA 1RTJA 5D77A 3TP2A 3JAMY 1FO1A 4NYZA 2QV6A 3ZZUA 1T05A 2RU3A 5DLFA 4JOUA 4KHMA 1IKYB 1TKZB 3IR6B 4CH0S 3MM8B 4CTAB 1FVQA 3KMSA 2W4PA 3O8WA 3Q0AA 1U1QA 2VODA 1AW0A 1S1UB 1JJ2R 4X2BA 3MD1A 5CZXA 3GB0A 3MZIA 2U2FA 2JC1A 1VQ8S 2JX2A 3ZFVA 3RRKA 2NUUG 4K0KF 2C42A 1TAUA 1LFWA 5I3QA 1S72S 1O0PA 5KG6A 1DZ5A 1IUJA 4H4KA 2YQ3A 2I0XA 2HHQA 3MMAB 4J9SA 1RT6A 2QMXA 3CVKA 2MZ1A 2FY1A 2YKQA 2FJXA 1GX6A 1XMQF 3HLUA 1DAXA 2O5DA 4F3QA 1P8GA 1H6KX 3DLEB 1RT7A 4G1QA 5KG0A 4DX8H 4I0WA 5A8KA 4TU8A 1F2GA 1VRTB 4HEA9 1ZAVA 3NMAA 3THPA 3GIIA 3VAFA 2UXBF 2C3UA 4NZ6A 2CIMA 4RBVA 4NA3A 2YX4A 1FDBA 3VAHA 1REVA 2HGLA 3T9ZA 3OXFA 5SUHA 2RDJA 3CDEA 2AF6A 4C0BA 4NA1A 2XMUA 1CG2A 2HAIA 3DLEA 1O5JA 2B7CB 3SSSA 3MMCB 3SXLA 1N4LA 1X0PA 4DV0F 4B3MF 1URRA 4MFBB 4PWDB 4FNHA 4ZPDA 1JXLA 1HD0A 2F9DA 3LF0A 1RTHB 3R3TA 4OHVA 5FIIA 3T19A 5B09A 3J7YU 3KK2A 5DQGA 2I38A 4B9SA 2BJEA 3ETOA 1VQMS 3KNAA 4X4TA 2LQJA 4KHRA 4ZHRA 4J9LA 4QBUA 3MEKA 3V4MA 1JLFA 1KN6A 4F4KA 4ETZA 3KLVA 3JSYA 3TAQA 4F4WA 1NHUA 4ES1A 3EZ5A 2HHVA 5KFWA 3E01B 2BXJA 4I2PB 1VQPS 4KPYA 2GGPB 4QR2A 4OLOA 3OSNA 2C2DA 2I5JA 4AXJA 3TAMB 2VUGA 1FK9B 1U1RA 3EGWB 4MIAA 3BQ2A 3BB5A 5K8NA 2IJNA 2VH7A 4QR1A 4WE1A 1WF1A 4C3KA 4LT6A 2RQMA 3J7Z5 2IMOA 2KRRA 3IAM9 2MKCA 1X5OA 3QAUA 2A18A 1TL5A 3PO4A 4PPZA 4WCEQ 4RWXA 1KR4A 4X4QA 3J7ZT 3JSRA 4KR0B 2W8LA 5F8MA 1BQXA 4OQJA 2VG6B 4PG4A 5C24A 2XC9A 2LKZA 3ITHA 3MDFA 3NBPB 4XPEA 3JSMB 1FNMA 1VC0A 3S7RA 2VBZA 5K14B 2DR5A 2CVIA 2BANB 2DISA 3AH6A 2ATLA 3HX9A 4CCHA 1Z2ZA 2Y1RI 4JI4F 2LA6A 3MEDB 3V6HA 1D8YA 3HJFA 2MY7A 1U1KA 1TL3B 5CD4H 2FJDB 4QWAA 1A9NB 2IM2A 2FVCA 3M2UB 1PC4A 2FUG9 5EHHA 2GA7A 2PA3A 3BO2A 1QAJA 4MKBA 2FLLA 4H54A 2PI4A 2NYIA 1SKSA 5LJ3Y 3BDEA 2Z0GA 3QIDA 2QLWA 4JV0A 2B5JA 1M5PC 4HT7A 3MEDA 3OUYA 1HR0F 4Y3CA 3BGFA 1HI1A 1FKPB 4OZ1A 1KSPA 4I56A 2E5GA 1FRXA 4KSEB 4RW4B 2DPIA 1QSSA 1FKOA 3HO1A 2F1FA 4LFCF 3UFCX 5A6PA 2DIVA 2YH1A 3RAMA 1ZYQA 4G1PA 5KFIA 5T41A 1R8HA 3SCLE 3UCUP 4I67A 5THWA 1RTJB 4FS1A 1HWLA 4Y00A 4ZMMA 4DV4F 1WI8A 3MM5B 4DQSA 3PX4A 1ZTTA 3UDLA 2JEFA 2M8DB 4WKRA 1M5HA 1HYSA 2AJ1A 5CYJA 5KT7A 1K1QA 2RF2B 3AB2B 3KMQA 4BC7A 2RS2A 3MPYA 1UETA 4F26A 5FLXY 1XNQF 1HWKA 1R8AA 1Y9OA 4F67A 4A8SA 4U67Q 1SBRA 3CGIA 3NAHA 1JLGA 4CO5A 4DL4A 2DHGA 2MZRA 1S6UA 3MPWA 3BSCA 1SV5A 2QT7A 1KLMA 2OD4A 1GX5A 3Q8RB 4X65F 1QTMA 2EK1A 3EXCX 3MAHA 3R5AA 3T1AA 1RDRA 1W25A 4C2MA 5D6GA 2RDIA 4KFBB 4IO1A 4NLUA 2CJ9A 3GMGA 1RP5A 2J9DE 4OI3A 2NS1B 3MEGA 3KLGA 2Y1JA 4RW9A 2FLPA 1WWHA 1DQ9A 2FJEB 5J2QA 2VG5B 5IQQA 5IT4A 1H2UX 1RT1A 2L3MA 5GAGU 1HBMA 3K8VA 4AFFA 1FRMA 2YNHB 4DL7A 3DOKB 2BRKA 2CJBA 1OSDA 3RZAA 2FHMA 3S6EA 1N0UA 2IM3A 3PEJA 2E5LF 2VA2A 4Q0BB 1T02A 1WHXA 4CO4A 5KOWA 5CA5A 2R2TA 4WU3A 4RNOA 2KRBA 5EWGA 3DDKA 1SUQA 2F8EX 1C0TB 2ZH9A 4LFBF 1RT5B 1S49A 2FLNA 5M2PA 4F2SA 2MYFA 3BJYA 1X8DA 2IHR1 2KG0A 3PNIA 4DR6F 2MHNA 1TL1B 2RJZA 2UVVA 4OFZA 4C11A 2CYYA 1TKTB 2PGCA 2V8GA 3BF4A 4KO0A 2VPYB 4NZ7A 1IJFB 4TXSA 4WYLA 2E7XA 5B7WA 3VQTA 4X4SA 2C28A 2F4VF 2XBPA 2MJUA 4PXDA 4LF8F 3TANA 2RE1A 2YNIA 5IZHA 4ZVHA 3B4DA 2FHJA 2FDNA 2P6TA 3OL6A 2B9XA 1NK4A 1NK6A 2NR0A 2L41A 4XIUA 2Q66A 4C4WA 2MMYA 1BQMA 3FRYA 2KXHA 4O3RA 3E01A 3NKYA 3H4BA 2JL9A 4IRKA 4ZOSA 4IFYB 1N33F 2J9CA 1KQGB 3KLIA 1HMVB 1HQUA 3D54A 4XPCA 1P1LA 1QJHA 2HMIA 2V9WA 2Q6CA 3CMES 4P7TA 4ED0A 1CC7A 4NL5A 4PRFA 1GXTA 2OPRA 1FDDA 4H4KC 3CCQS 1BQMB 4F50A 2FGCA 1SIWB 1HPZA 2H9ZA 3FQLA 2CKWA 1T03A 4CNYA 3N01A 4JI1F 3I56S 4B9TA 3VALA 4Y2IA 2XS2A 4LF7F 2UV8G 1FJCA 1Q86T 3DRXA 4OI1A 4C0OC 4DDFA 3HMJG 3KLEA 2IAJB 2XLKA 3F73A 2HMIB 3LGNA 1TZ0A 2CPEA 2OIHA 2DHAA 5KG3A 3PHEA 1C4CA 1ZM4A 2FD2A 1VHFA 1VQ7S 3T5LA 3POTB 4LIWA 3AJ1A 3OVSA 4C7QA 2CJKA 3OL8A 2ZHOA 2K2PA 4DLGA 3HF5A 1MNEA 2YWKA 4KV8A 4U6PA 3Q24A 1KRPA 2YNFB 1D9DA 2R7SA 4Q45A 1C1CB 3K5LA 1AUDA 3P49B 2HPUA 2L9WA 2PMHA 5AE3A 3M8SA 1K8AT 2OFHX 4RW7A 4YB5A 3KLEB 2W7OA 3PVXA 4UY85 3KG1A 4I64A 3KK3B 3LAKA 1V3SA 1QUVA 3CJ4A 4H4MB 4MK7A 5F0UA 3TA0A 3G9CA 1OPIA 1Q16B 1S99A 1WHVA 3JTOA 3OUYB 1TK5A 4LMZA 1FESA 5I3UB 4I7FA 4EO8A 3SDEB 4RW4A 3HK2A 2HFOA 4PR6A 1TV6B 2V94A 1KEKA 1IM4A 1U25A 2CDQA 2RKIA 3MFIA 3MR5A 4NLGA 5F9NA 1S1TA 5E3QA 1N5YB 4K2XA 1UVJA 1VQ9S 1C4AA 3R5DA 1DARA 4LF6F 1DURA 2NREA 1F5AA 1HWIA 4NYOA 4EBCA 4MJKA 4DBQA 4NCGA 1T8EA 2RD5C 6FD1A 4C8NA 3MI7X 1I6JA 3IO1A 2AYBA 1YJTA 2PD1A 3R5BA 2YKMA 2ZH2A 4DQQA 1R31A 2WB1D 2KT3A 5F9LA 1ULRA 3FCHA 4DL2A 1SI9A 4I2QA 4E98A 1F5CA 3PKMA 2F40A 1JLGB 5SZTA 3EPIA 1AFIA 1FXRA 2X51A 4OJ3A 3FMBA 1SKRA 1N48A 2SXLA 1X4CA 2MSSA 1V6HA 5KG2A 1KNZA 2VG7B 1OS5A 3UE2A 2DNZA 3Q8PB 5DG9A 3OJSA 2GQCA 2C3OA 5AXMA 1PILA 4PPDA 3V4IA 1X4FA 4XDDA 1LFPA 3H5UA 4ZCMA 5KFGA 3UD4P 1SL2A 4DG1B 1VQ5S 3ENWA 4LUBA 1UW4A 3V81A 2WRMA 4BCAA 4QWCA 3LOUA 4TU7A 3CULA 4NXMF 1MMNA 5MLCV 2HWIA 2B5JB 3U27A 4TY8A 2WB4A 3I5CA 4RZRA 2BOPA 2QYCA 4USHA 4I4BA 2NPFA 2VKRA 2LA4A 1IKWA 4ILMA 4OHYA 2M5YA 3V6DB 2KI2A 2EW9A 1X5TA 3QLHB 2QSWA 1RT2B 2ILZA 2Z2MA 3TO8A 2KJVA 4N5SA 1K1SA 3ZZZA 2KG1A 2HRYA 1NU4A 3QAEA 2CG4A 2QA2A 1U6ZA 1WHYA 4QR0A 4XAKA 1ZM3A 2ZFHA 3G8QA 3H2VE 4HLBA 3ZZOA 4PWUA 2EFVA 3BQ1A 4RUCA 3H4DA 1DHMA 4K4ZA 1ZH5A 5DDRC 2MXYA 4A46A 1JLCA 5BYRA 2R7UA 3CUNA 4FXWA 2KHCA 2LXUA 2RIJA 2PO4A 3RU0A 1XK8A 4ITSA 1RT2A 2HYIB 3US5A 1DBDA 4LSLA 4P7VA 3SSRA 3O2IA 4J9OA 1U1NA 3MR2A 2WBRA 5FD1A 2LMIA 1GAOA 4ECQA 3L7OA 5J2PB 1IBKF 1UWBA 3H2LA 1D9FA 3IRXA 2XSFA 3HPOA 1N56A 1RTIB 1S79A 1Y5NB 2QIFA 4B9MA 1IR0A 3QJLA 2MQNA 3G86A 3SQGB 1S7HA 3J81Y 1K0TA 1KQFB 1UL3A 1S97A 3TARA 1YBAA 4OJGA 3HVTB 3UNGC 3SV3A 3BN7A 4P6QA 3N5FA 2VV5A 1EETA 2F9JA 3KJVA 1L5UA 1J5OA 2IJFA 3MUVP 1Y4ZB 1NKCA 1R8BA 1RK8A 1KHWA 1LV5A 2P5VA 2W25A 1Q7YT 1RT1B 3O44A 3LH2S 4NRTA 5BYQA 4AYBD 2XCPA 4IH6A 2KXFA 2BV3A 4ECVA 2GCFA 2RSQA 3K5OA 4TLRA 3GYNA 1V3RA 5DG8A 3OW2R 2VB6A 3RW7A 1KQSR 4QU7A 2YVSA 5JUMA 3TW0A 4NZ0A 3KJVB 4IG0B 2LDYA 2ZH3A 4QQBA 2E5HA 2XY5A 2WSEC 1QSYA 2YNGB 2N7YA 1JJHA 2LXIA 3I87A 2DCLA 1YRUA 4L3NA 1WNEA 3B78A 4PG7A 4KGKA 3PJWA 2ZH8A 3MF5A 3QPIA 4YUDA 2CQ1A 2E66A 2UXDF 1B7FA 1S48A 2Q6BA 1Q79A 3TAMA 1KTVA 2ZBCA 2ZOMA 2ACYA 3IWLA 5F0WA 4EO6A 1VQOS 1QUPA 4M5DA 3I4PA 4MYUA 1MW7A 5HP1B 5KFQA 3NL0A 2CZ4A 2D41A 4RBTA 1Q7LB 1YTYA 2FJVA 2PFFB 2YWGA 4JV2A 3WBZA 3N9UC 2AD9A 2MZJA 2HHSA 2IFXA 1KOHA 2B51A 2V9KA 5DDPC 4M94A 4QZVB 1HNVA 2AX1A 3PY8A 1TV6A 2DHXA 1FD8A 2WAQD 3QWPA 5EDWA 4DUZF 5T7LA 3L3CA 3RYLA 3E8OA 2OPPA 2XHWA 1DTQB 1TVRA 1QE1B 2OD6A 2W24A 3RBEA 4OHWA 1JIHA 2D3UA 3I32A 3ZZYA 4K50A 3K8WA 1DQ8A 3A1YG 3BR9A 1S77D 3DLGA 4PXEA 3ZZTA 1TP7A 2MDAA 3JB9k 4F2RA 2W7PA 2VQFF 2DR8A 4I69A 4TQRA 2C3PA 5B0DA 5GAEI 1Y5LB 2C2RA 3WX4A 4L72B 1WF2A 4FS2A 3KFWX 3HKWA 2PN6A 2JEGA 2EI5A 4ZP9A 2FHOB 1Q81T 3CD5A 5EN1A 4B9LA 3IG1A 2W9AA 2CQDA 3AY0A 1VRUB 3DRPB 5KFSA 1HFEL 3MHYA 2OTLS 2RRNA 2GX8A 3HI9A 4R0JA 5EUHA 1YRXA 2RQ4A 2DNHA 2YNFA 4ERDA 1CQMA 3U1NA 3RW6A 5L1LA 1NJYA 3BGLA 3TUIC 5D78A 4RW7B 1SH3A 2KYXA 2ZOFA 4E8UA 3GQCA 4IG3B 2MZQA 4DFMA 2UUCF 1IJEB 5EWFA 3BREA 2N3LA 4F8RA 3RRGA 2D3ZA 3S01A 3C66A 3FSYA 2DNGA 2EG2A 2JEJA 2MHEA 5DG7A 3PACA 4NWBA 4URSA 2JFDA 5GMKa 2XI3A 3K7RA 2IYIA 4R25A 5KG5A 4YOEA 3FQKA 4FF3A 2X1GA 3IBWA 1X4HA 4DHVA 4CT8A 1YJWS 4JI3F 2ZJRQ 1GT8A 4RW8B 1GNKA 4IRDA 2YKNA 2E44A 2HIQA 5E41A 1GXUA 2V8VA 5J1NA 3GV7B 1R0AA 4B9VA 3NNHA 3KG0A 5DJBA 5HMZA 1S9GA 4EFAC 4EEYA 1BD6A 3VAJA 5KFXA 4ZPAA 1J5EF 5KG4A 1S1UA 5L9NA 2VFSA 4LSLB 2CQGA 4QWBA 2D9OA 2DNLA 2R2UA 3PXGa 2B4PA 2EVZA 3Q2SC 3D0GE 1ZETA 2VFRA 4ELTA 3MFHA 4B17A 4I6WA 2OJ3A 1V3ZA 3DFEA 3UR0A 4NCBA 1RTIA 1VQLS 5J2QB 1HQEB 1CPZA 5DDOC 4U7UK 3LWMA 2DO0A 2GMJA 1GTEA 4IQMA 1BGXT 3TA2A 3DOKA 3MMAA 2N4DA 5M2UA 1UA0A 5J2NB 1IQTA 2HNZB 4WFYA 4K4WA 3H5XA 4YHHF 2FJBB 2PA8D 1N5QA 2MQPA 2XO7A 1JLQB 4IOAQ 1HARA 3VAGA 2R4FA 3AA9A 5H9EJ