4GO5X

The regulatory subunit of aspartate kinase from mycobacterium tuberculosis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
167
Chain Sequence
SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 47
structure length 167
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go5X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go5X01
5IS2A 5T41A 5IT0A 3TUIC 3ENWA 3L7OA 2QRRA 2LVWA 2QMWA 2DTJA 4LUBA 1O8BA 2ZHOA 1U8SA 1LKZA 1YGYA 4NMLA 3DC2A 4PWUA 3MTJA 3UW1A 3N0VA 2I9SA 3KWMA 2NYIA 3ENQA 4IO1A 2F1FA 2DT9A 1XTZA 1LK7A 1Y7PA 1PSDA 4GO7X 3NRBA 4M8LA 2KO1A 2RQKA 1UJ5A 1LK5A 3AAWB 3P96A 3IBWA 3AB4B 2J0XA 3IXQA 5IT4A 3O1LA 3DHXA 3W7BA 1SC6A 2FGCA 2MDAA 1YBAA 3CEDA 3DHWC 3OBIA 4GMKA 2P9EA 2P9GA 3K5PA 4GO5X 5FIIA 3MAHA 2JOQA 2CDQA 2F8MA 1M0SA 2PC6A 1UJ6A 3TUZC 3HHEA 3LOUA 3MWBA 3OFHA 1KS2A 2J0WA 3OFGA 1RWUA 2JHEA 3U7JA 2RQMA 5JJBA 3DDNA 2QMXA 2PA3A 3LUYA 2LQJA 4X84A 3AB2B 3OFFA 3S1TA 3TUJC 3ENVA 2QSWA 2H9ZA 2RE1A 1UJ4A 3OFEA 1ZPVA 2P9CA
chains in the Genus database with same CATH superfamily
2K06A 1KDNA 2GJIA 1A0OB 3FK4A 4TQSA 3VGUA 3WC2A 2MY7A 3MD1A 1NXIA 5HQ8A 4F04B 3CIZA 2DNQA 1QVGR 4MAKA 5C25B 3KLFB 3DU6A 2MZ1A 4RW9A 4JI7J 3LWLA 4L72B 2W8KA 2YTCA 3RRGA 1FKAF 1T03B 4OI1A 2WB1D 2YKAA 3DLEB 4IYQA 4QR2A 3P3DA 1SL2A 1WHVA 4G1QB 3MZIA 4G6VB 3BO4A 3CD5A 2ALZA 1NH8A 2LECA 1HWKA 5L9NA 1NHVA 1IM4A 1HNXF 4U96A 4GO5X 4ATNA 4ZITA 2FY8A 1ZOTA 2VF3A 2P2CB 2N7CA 3EDRB 1TKTA 2BJ8A 1UPPA 3V4IB 2FGOA 3KFWX 2L9DA 3GFXA 2F63A 2FJDB 4GVBA 4KV8B 2CWXA 4O3SA 3SI8A 2Y8WA 4NLWA 4AT1B 5J1NA 3MM5A 3CMAS 4C0OC 3C15A 1Q95G 3CCSS 5FLXU 3E3XA 3L09A 2QLJB 2OFHX 5HI7A 5KG7A 4OI4A 3Q23A 3RBXA 1B64A 4N8NA 1IQTA 5F41A 3NCQA 5E3PA 2GVDB 4DV1J 1CS4A 4A8WA 2RILA 3H8YA 3TOQA 3KLEA 1HWLA 1IR0A 3FSYA 3MEDA 2WHOA 2Q6CA 3N79A 2RSQA 3W2WB 3L95X 3AJDA 4DV6J 4CT9A 4O3NA 1C1CB 1HNVA 3ILIA 1WG5A 1EAYC 4DV2F 3GR0A 1XMOJ 3TANA 1KLNA 4ECZA 1H2UX 5JXSA 3UWTA 5HP1A 2V8GA 2NZ4A 5EDWA 3AOCA 5J2PB 4OYAA 5HN0A 2XLKA 1ZAXA 3SV3A 2KHDA 2ABYA 3HT0A 4LRBA 1RHRB 2YNIA 4NA1A 2BM0A 1RI7A 4ERDA 1RLCL 1KVIA 1H98A 2XY5A 4LUBA 2KL8A 3M30A 1VOMA 4QYRA 4PYAA 5IV3A 2VICA 1E6VB 2QLWA 4F50A 4QJVA 1N0UA 3SBMA 2KO1A 1TKXA 1FRXA 3UDLA 1FRMA 1LWEB 3L7PA 2JFDA 3R5BA 1VC0A 1JLEA 1GX5A 4G3IA 3DLLQ 1ZH5A 2CQ4A 3MM7A 1D8YA 3H2UB 3J7ZT 1F1BB 2IYIA 5JUMA 3OLBA 3BSCA 1N5QA 3M2VA 2DXDA 4PQUA 1PKUA 1VQPS 1JLQB 2G1DA 5IC6B 4U7UD 4M1KA 1S6PA 1MU2B 4Q7AA 1H73A 1NCLA 3OR1B 2QLBB 5FD1A 1HD1A 1RCXB 5J1EB 2W1BA 1Q8LA 2Z2ZA 4J9OA 4NLUA 3DDKA 4CO2A 1DQ9A 3UPFA 4KJIA 5B0BA 4A8SA 4QIFA 5D3GA 4IRDA 1RBOB 1GQEA 1R8CA 3RRHA 2BJ7A 4PPDA 2BOAA 1XERA 3VF0B 4E8UA 1Q4RA 4ELVA 1PSDA 3M9MB 4DQIA 4OYXA 3ILJA 2LFVA 2GMJA 4PXCA 4MK7A 1Q78A 1R7IA 5H9FK 1TKZA 1YKWA 5KFTA 3RAXA 4K4SA 4ZCKA 3HSZA 4LF4J 3MPUB 2HLTA 3AD9C 5CZXA 1CQNA 3BV8A 4YR3A 4AFFA 5KFWA 1BQNB 2IA0A 1D0EA 3IBCB 1U8WA 2ZWOA 1U0HB 5IWAJ 1SJRA 1UVIA 4J9MA 3ZZYA 3BJYA 3DDIA 3MF5A 3PIOQ 3NGRA 3TX8A 5J2QB 2DEIA 2VDHA 3QSIA 4NLQA 3W63A 4A46A 2WW8A 2HYIB 3ENWA 2B56A 3KLHB 2RD5C 3K58A 3RZAA 4WJBA 2IM3A 5A76A 4CM2A 4YDDB 3HP6A 2FPHX 5M2UA 3UW1A 1RT3A 5C2GA 1D3WA 2UUWA 3CJ5A 4V19J 4YDXA 1QUVA 3SDEB 1EKRA 1FEHA 4QR1A 2MKKA 1TL3A 2HLUA 4WE1A 1Y11A 1OIAA 3CO9A 2AX0A 1U1RA 2DHXA 2WSEC 3IS9B 3AB4B 2CQGA 1FA0A 2HQCA 3MEEB 1AA1B 2CJ9A 5HAOA 4LF7F 1FNOA 4USIA 1S1VB 1REVA 4J5OA 2DNMA 2ACMA 4ZLJA 2GX8A 2HPUA 4LT6A 1M5KC 4QWEA 2NS1B 3HHNB 4CT8A 4KHPJ 4X4UA 3R3TA 4R0EA 1PBUA 1RZMA 3SQOP 1MNEA 5I42A 2MQQA 4IG0A 3Q8RB 1RAEB 1RA6A 2LA4A 2YQ0A 2J9DA 4HT7A 1FKPA 4C8NA 1T3OA 3B8HA 3KK3A 1U45A 1DLOA 3BGFA 1LW0B 1U1NA 2V34A 2LU2A 3MDFA 1U47A 2XYHB 5DLFA 1LWFA 1RHMB 1JLCA 3DOKB 4KH0B 2BXJA 5T7LA 3FZBA 3GILA 3CO0P 4YR0A 2AGPA 2V2KA 3B78A 2KN4A 4KFBA 2G2OA 2HFNA 4USUA 1NK4A 5A8KA 4LRCA 4TYAA 3TEGA 5LT5A 3SYZA 2FHJD 1QSLA 4U8YA 2EFQA 5RUBA 2B8QA 2HKEA 2EC2A 3CEDA 3OBIA 4H4OB 4ALZA 2DNYA 4JYAF 1Z2LA 4A48A 4K4YA 2XY7A 2J6UA 2YWFA 3O6QA 1JLAB 1LWCB 1RT5A 2AW0A 4DPWA 3OV7A 1WORA 2WONA 3IWNC 2DXFA 2FZKB 3JXOA 1DBDA 3B6BA 4NPOA 2PMWA 1S79A 5GMKa 2FLLA 3R7SB 4CYUA 5H9EK 2PN6A 3CJSA 1N5YA 1WKJA 2BJ9A 4WFXA 3HPOA 4YY3F 2ATLA 1YGYA 2YKMA 2R2TA 3MI7X 2QL7B 4B02A 2YWWA 3WC0A 1DRZA 1YJUA 1RYSA 2V63A 2OD4A 4YHHJ 4PG5A 2O66A 4RNFA 3CJRA 1RWKB 4Y0FA 4IFVA 4A8XA 3ZZTA 5FDLA 4ED3A 3FCHA 4N5SA 3CCLS 4KHMA 3W2VB 1T8EA 1VQ9S 1WEYA 1N48A 1EARA 4ZHRB 5JMNA 3EGVA 3UQSA 3UE2A 1GMUA 1CG2A 5A8RB 2PO4A 5HQLA 2R8JA 4UW2A 2H4WB 4ZLLA 1V5IB 1JJ4A 5LSRA 2YQ3A 3TO8A 4LF4F 1RAGB 1ACMB 3SQGA 1WSVA 2R8IA 1HI1A 3DGPB 4ZJQA 2QMXA 2PA3A 2C3YA 2RRAA 1PC5A 1Z2ZA 3CD6S 3X1LB 1XMBA 2DHGA 3AH6A 1KLMB 1ZA1B 3HT3A 2J8SA 3W3SA 1X31C 3C14B 2KM8B 3MOJB 2Z2MA 2Z58B 4FS1A 5U47A 1G1XA 4L3KA 3CCMS 3ADAC 2BMBA 3C46A 1X4EA 2YX1A 2HIYA 2C3PA 3PRBA 1U2FA 3QZ8A 3I87A 5K8MA 2P5VA 2J7UA 5B0AA 5K5MA 2YWEA 4LF1A 2B0GA 1VIOA 3QT7A 4J9VA 3E51A 3R5GA 2R7SA 2CAJA 4NA3A 4IFYB 4CLZA 2I5JA 5ETSA 3TZWA 5DJBA 2DD8S 1P1LA 3OHAA 3R97A 2B9EA 2BQRA 1RTDA 1KONA 2I2YA 2LXIA 1RWVB 4K2XA 3NNCA 4FBUA 3KMQA 4UZBA 4CLSA 2DGXA 2V8DA 2EK6A 2R2SA 3T5HA 4OJ3A 4DFJA 3S1TA 3KMSA 4C8ZA 5GMDA 1RT6A 2CNKB 4IQMA 1VQ8S 4RX6A 2M3DA 2C3MA 3TZXA 2ASYA 3KG4A 2W7PA 3EXCX 2OEKA 3D6HB 4Y6IA 4TU8A 2UU9J 4U95A 1R8HA 1FESA 2HQ3A 3M2RB 1HBMB 1WC3A 4ZMMA 2M88A 3R8YA 4GKKJ 4OJ1A 4LVNP 3SXLA 3QJJA 1JLGA 4KBIA 4QWDA 4XK8C 1M5OC 4A8KA 2GA7A 2OPPA 3UCGA 2HK3A 1H7WA 5C42B 3NS6A 2CPEA 9RUBA 3QIPA 3P49B 3T1YF 2M8HA 2QN6B 4QIWD 1RACB 1RT2B 3MM6B 2F4VJ 1F2HA 2JHEA 4R5PB 1R8AA 2C42A 2D7SA 1FWLA 3A8KA 3IGNA 3LQVA 2W25A 5HK4A 2BM1A 2B4VA 3DRXA 1RWXB 4WP9A 2O3DA 1XR7A 1RWOB 3RUBL 4DR1J 1FHTA 3AQOA 1X0PA 2M70A 2AD9A 2G2YA 4WIQA 1R0BG 4N76A 2I8EA 3NNAA 4ID5A 4NXNF 3UDEA 1VJQA 1NNDA 3GIKA 5IT9Y 1HWJA 1NJZA 5T14A 2J9DE 2LQ8A 5M2PA 4RW9B 1TMMA 4GMKA 2GNKA 4FDFA 3TJ8A 4I6AA 1CC8A 2DBBA 1HA1A 3HZGA 3N5FA 4U6PA 2EFVA 2MMYA 1VRTA 3BKFA 3MCMA 1FJ7A 1WC4A 2LQJA 1LNQA 4P7VA 2BABA 4CO0A 2CJKA 1R3NA 2AX1A 2CQ0A 3HDSA 3OHBA 2CYYA 2K3KA 3SFUA 2MY8A 2VDIA 5F0WA 5K20B 2EFPA 5D0EA 1VRUA 3RW6A 1TKTB 4DPTA 4LFAJ 3MPVA 4C9DA 1RB0A 4ZVTB 4ED4A 5AE1A 4GVBB 3H5SA 3IC1A 4ZA1A 4PXDA 2UVRA 4UOFA 4JI6J 1HHSA 1EJ7L 1SI9A 3MM5B 3LANA 3QSYB 3C15B 4CLLA 4TU9A 4M5GA 8RUCA 4ELTA 4XPCA 1KTVA 1N36J 1FFGB 3R1LA 2R2RA 4M5LA 2CQ3A 4U7UK 5IT4A 1F9FA 2UP1A 3U1LA 1YJNS 4ED8A 5THWA 2UV8G 3QJPA 1CS4B 2C2DA 1T7PA 1TMJA 3Q8SB 2JC0A 3LA0A 3MMBA 2N4CA 3MEDB 4Z2XA 1NPRA 4I69A 4OV1A 3PFEA 3NCPA 4IOCQ 2KTQA 1HNVB 4F0KA 1T9UA 1RU2A 3GJRB 2VFRA 3CJ0A 1GNKA 1I6JA 5HP1B 1GAOA 3WBZA 2OP5A 1WTFA 1MG7A 1XNRJ 3CC2S 1BLUA 4PWUA 2JNJA 3Q86A 2V9KA 3DRYA 1NSQA 4IUFA 2XS5A 4F4YA 3M4XA 4RW6A 1FI4A 2DNRA 1X4GA 3FSIA 1H38A 8ATCB 2YNIB 2CJQA 1W25A 1FJEB 1Y0HA 3M30B 2OSQA 1HBOA 5GAGI 3O1LA 1URNA 3MXHP 1TKDA 4YMEA 3K59A 1DTQA 1RLDA 1NAQA 2ZOFA 1KWMA 1TKXB 2V50A 2MKIA 5KFZA 4MIWA 2RQ4A 4NI2B 3VAGA 2V6AA 1B7YB 3GU0A 1JLEB 1RKIA 4PQAA 2KG0A 4B3OA 1HHQA 3MM7B 1QSSA 1ZM2A 2IVFB 4OHYA 3CCES 3T3FA 1RKJA 4X2BA 1RAJA 1PAEX 2CVIA 5GAHU 4ECQA 3MGJA 4PZVA 4ES3A 3M2VB 2XNQA 2LDYA 1SKWA 4C2MA 3FQKA 3OTOF 3M9OB 1S6PB 4DS5A 4KPCA 1SJ3P 2YNHA 4JOUA 2DITA 5ETTA 2ASLA 4OL8A 3HSJA 4M5IA 2XEXA 3NMRA 1S0VA 2IHR1 4PG7A 4O3PA 1B7FA 1HKAA 2CZ9A 4NA2A 2R7WA 3NWGA 2ZZTA 2GQCA 5D3GB 1JJHA 5KFUA 2ADCA 3AFGA 4GKJF 4C4WA 3IXQA 3V6DB 4DR1F 2PEHA 4DX8H 4ECWA 3BR8A 2E5IA 3O2IA 2YPZA 3DRRA 5HVGA 3B4MA 1ZM9A 1Q7YT 1TKZB 2MXYA 4LF8J 2ROGA 2FLOA 4QBUA 2X51A 4QZVB 4B3RJ 3PKYA 2P9CA 2VKRA 2R8HA 2XO6A 4OX8A 4FF3A 1JLFA 5L1IA 1UEVA 4ANCA 4NCGA 1H74A 5D6GA 1K47A 1S6UA 2LU1A 3BM7A 3EUNA 4PPZA 2DO4A 3RB6A 2BKNA 1LOUA 3FJ2A 4LBPA 3BSOA 1S1UA 4TLQA 2HNZA 2F40A 1UW4A 1WC1A 4Q8FA 3BQ0A 4WFZA 2GJ2A 2IJRA 4AL6A 3QPIA 1Y3JA 4PR6A 1YJ9S 3UI3A 2BW7A 4OHVA 1TL3B 2HVDA 2CPFA 4WE1B 2Q66A 3KJFB 2WRMA 4ZP6A 2KXNB 3NLCA 4LF5J 1N36F 4ED2A 4B9VA 2DNGA 1S57A 1T94A 3IGVA 5HVFA 4J7CA 4P74A 4IH5A 1GXUA 4WKYA 2UUCJ 4ELUA 1L3VA 3B54A 3AB2B 4MKAA 3DNCA 1EP4A 2LQBA 1REVB 1T9YA 3I0SA 4R8UA 2IRXA 4PCQA 3G71S 3FBFA 4RW7B 3VAJA 2Y3YA 2XZWA 1UVKA 2C28A 5IT9U 5E3AA 2CPJA 2WK4A 2WB4A 2ROEA 3CCZA 2QV6A 2MZTA 4PXEA 6AT1B 4OI0A 2W9BA 1U1KA 2OMLA 5I42B 3EVMA 2UXBJ 4AQYF 3GSDA 4IG0B 5D77A 1QE1A 1RWNB 1AB8A 3I4PA 3F56A 4USMA 4JI5F 3CJ3A 3NP5A 3P5TL 1FKPB 4C48A 3CVKA 3GJSB 3NGSA 5EUHA 4AL5A 3OSNA 4OHXA 3KK3B 1DLOB 5KT2A 4EK2A 2LEAA 1LQ9A 2KYXA 2EFGA 5A2QY 3MR2A 3SCIE 1LWFB 1JLCB 2HHTA 2FGCA 2J8AA 2QL5B 3AA9A 3BREA 5T7LB 2DR9A 1B4SA 2B4UA 2W7AA 3QT6A 1J27A 2HFUA 1Y4ZB 2GAGC 2UUTA 4KFBB 2RS8A 5A8KB 2BE2A 4MYTA 4Q8EA 2GMHA 1T9WA 2R7QA 3CB4A 3QYYA 2IDEA 2KT2A 2DNLA 3M8RA 2IVYA 2NXEA 4J9UE 1BUXA 2QLXA 1BMQB 3BGRA 1JJCB 3THPA 3ZO7A 1YJ7A 4F25A 2KXFA 4CH7A 1RT5B 2FUG9 2G13A 3C16B 3TQ1A 4O4GA 4OX9J 2WONB 4U8VA 4HLBA 2KXHA 1AXQA 1YJTA 2HRYA 2DCUB 2NREA 5J1PA 3KHGA 4F0HA 4CYUB 1N5YB 2ZZNA 4WBFA 3FCVA 4CLWA 5HMYA 4P2MA 3MECA 1M5PC 4KQZA 3DOLA 3HJFA 5D4LA 1IN0A 4M5JA 2E5LJ 3PW5A 4DHVA 1K44A 3K8VA 2MKHA 3H2VE 4HEA9 1G6BA 1NPPA 4W90B 3WX8A 4IFVB 5FDLB 2C2EA 3LOUA 3OT9A 5B0CA 3ZZUA 1FDAA 1QDUB 3F0NA 1VK3A 3CDEA 5K9FA 2I6WA 4DL2A 1QAJA 1X4FA 3UD4P 2ERRA 1HWIA 4V19X 3VVTA 3SQGB 4LF8F 1NDCA 5BYRA 2EK1A 2GIFA 4WXWA 3BQ2A 2VFUA 1REGX 4FKXA 1UWAA 5D0GA 1IBKJ 4JB8B 2J6SA 2ZC3A 3VAMA 1IWGA 1AYEA 1FWPA 4JV0A 4O4RA 5A0YB 1F5BA 1RT7A 1EETA 1S99A 1U49A 2HHVA 1S7HA 4C8YA 5DM7Q 5GAGU 2POKA 2XG8A 4LBIA 4OJHA 2ZUGA 4JI3F 3K5PA 2IY5B 2DNOA 3EZOA 2GHPA 1NKBA 1FFWB 3CMES 2VIHA 2I5JB 2CVEA 1N56A 4DG1A 4L76A 3CGIA 4DR7J 4HR2A 2VUGA 1F5CA 1AROP 3TW0A 2OJ3A 2WBRA 3BBFA 2HIQA 4K7QA 2O5DA 4ED5A 4JV1A 4DUYJ 4BDPA 3EICA 2RVJA 2CDRB 1VQ7S 1DQ8A 3BBBA 3JAMU 2R8KA 1M5SA 4CWBA 3GIRA 3W64A 3GP9A 3PV8A 1U6BA 2DR5A 2ZHAA 1CJTA 3DLKB 4OLPA 2B9YA 1VQMS 4HI2A 1A7GE 3IWXA 2ZH3A 4NMXA 1VQSA 5BXIA 2VZ9A 3ZZRA 4Y00A 1VJWA 2F9JA 3TI0A 3M6XA 2ZNZA 1YRUA 3BGOP 4ILMA 4EFAC 2C2MB 2DHSA 4YEAA 1VQ6S 4K4UA 2OAUA 1P27B 5FIIA 3T5KA 2WVBA 1IKXA 2VH7A 3ZTQA 2MQ8A 1DARA 2HQDA 1HNZF 3LP1A 2F5GA 2LCWA 2KVQE 5I3PA 1B0TA 3Q22A 3BEGB 2DPJA 2OPPB 1JKHA 3FVYA 3O5TB 4RBUA 3CW2C 3QIPB 4C7QA 3K5LA 5T41A 2M0GB 1UP1A 5AE2A 1Q5YA 1W2IA 4YFUA 1NMEB 3N9UC 3BDEA 4DF8A 2F8EX 5H9FJ 1WDDA 1HNIA 2BQ3A 2JEJA 2UXCJ 2JVRA 4ETXA 4OQJA 2Y1IA 2XO7A 5HVHA 1XMQJ 2XGQA 4DJBA 3BPSP 2XWXA 2H5JB 3HK2A 4QPTA 4QR0A 3RG6A 3O44A 4OZ1A 3EPGA 1YBAA 1T9VA 1MN9A 4UOGA 5ETVA 3MCNA 2Y1JA 4WPAA 1U6ZA 2E5JA 2DJWA 3D2WA 4NRUA 2VPZB 4ID5B 3LPYA 1A9NB 5IQ6A 2ZJPQ 2AJ0A 3ZNUA 5ADZA 4UUWA 4I4BA 3GV7B 5DRKA 3KJNB 2MKSA 1HQ2A 2CNOB 3QT5A 2N82B 4DV0F 4U9RA 3VAIA 2EPIA 1VRTB 2MJNA 2AJFE 3L9ZA 3UD3P 7FDRA 4S0MA 1SH0A 2HNYB 3NRBA 3ZZ0A 3J7YI 1FNMA 3HXMA 4RZRA 4DSEA 3G9CA 1VRUB 4H4KC 3FRZA 2AZ1A 2MQLA 2L41A 5DS7A 3SCLE 3GIJA 3VCDA 5I3QA 1NHKL 2VBYA 1I51B 1S6OA 1CJVA 2JL9A 2JX2A 3A3PB 4DFMA 1GX6A 1Y3KA 2V5HG 1JJ2R 4ZIWA 1S9EA 3NBPA 5JVGQ 4WP8A 1XC9A 5KG1A 3BKTA 4CO1A 4UUXA 2AEFA 4B3SF 1IKWA 4DUTA 3CCQS 2BVZA 2PI5A 4QPXA 1OWXA 2GHWA 5DDQC 2MGZA 1G7CB 5A6PA 3FCWA 3W65A 3MMBB 4DR7F 3GV5B 2M5YA 4DV7F 2BANA 2NCKL 4LIRA 3U27A 2PSZA 4DUYF 3NGUA 4X62J 1WNEA 3DN9A 2W4CA 4DI6A 3VWSA 1WEZA 4XPEA 3BO3A 4WZQA 3M7VA 4L6V3 3P4UB 1FE0A 2ZD1A 1TTHB 2EVZA 2YNGA 2FVPA 3CD0A 4LF9J 2LKZA 1FRJA 2CUYA 1DTTA 3VZHA 4RW6B 5MAOA 3TP2A 4K0KJ 2L9NA 4IKAA 3MPYA 2QLFB 5F9LA 4DLEA 5AJ3J 2RKIA 1JMTA 5F8LA 2IBKA 1N5SA 1MWZA 1HBOB 4DR4F 5H9EJ 2HVZA 4KGZB 1RAHB 2C2KB 1DTQB 2FB0A 4OV6A 5BR8F 4K50A 4FYDA 3OTEA 2VFSA 2W8LA 2DK2A 1NZ8A 3CNQP 3FSXA 1R31A 4DL0C 4B3OB 4ILLA 3B82A 2GVZA 4QWBA 1PGZA 5E0OA 4USVA 4X4NA 1XJWB 4B3MJ 3OVBA 3KLVA 5LSLA 1RBAA 3UVJA 3MR7A 4V1Ak 4EO6A 1YHQS 4QU7A 4OYPA 5CYMA 2YNHB 2WVFA 2VASA 1KEKA 2VOOA 4F2SA 4CP5A 4NLGA 2UUAJ 1BWVA 3FNNA 2UXCF 4DX5A 3DKDA 1WOSA 2E7VA 2HMIA 1XMQF 1WACA 2R42A 1BY9A 4BHQA 1PYTA 1QY7A 4P72A 2R2UA 4N47A 5DQGA 5KFKA 3KLGA 4KGKA 3ETMA 2YWGA 1HPZB 4K5RA 4M5KA 2VJUA 4ZVRB 2G0JA 1N34F 5D78A 1JIHA 4EWTA 1N32F 3DRRB 1V5VA 4MFBB 3UR3C 3IO1A 1CLFA 2N7YA 4L75A 1FXLA 1S0MA 3TUIC 2LVWA 4CIOA 2HHSA 1ITPA 4H4MA 3MMCA 2UVWA 1MROA 3EGZA 1FX4A 2JC1A 1S0NA 2MB0B 2BE7D 4EZ9A 4IR9A 1IKYA 5ETRA 4TQRA 3IRWP 2OMOA 3TARA 2M7SA 2XHCA 4USHA 3NKYA 3QGGA 2A2DA 1JLFB 2F8HA 4ZJOA 2JEFA 3EZUA 4NCGB 4URGA 2G4BA 4MJKA 3LGMA 1SKSA 4TXSA 4DPYA 1KSPA 3PEJA 2RUGA 4ZVHA 1S1UB 4BBYA 2HNZB 3JSBA 1EKSA 3C66A 5L38A 3U7JA 2OPSA 1HLWA 3VHQA 2MLXA 4EUVA 3TUJC 4DLGA 3W5YA 1OMSA 2GS8A 4RJVA 3TJ9A 2ZBIA 2W9CA 1CULB 2D3UA 3G6ES 4O3QA 2J5AA 2E29A 3Q8PB 1LFPA 2RRNA 4DV4F 2EWHA 2I9SA 3N4WA 3QWPA 3V2UC 3I0SB 4R8UB 1GMWA 4LR8A 4F36A 1BWEA 2VV5A 5EN1A 1DQAA 1FF2A 3JQKA 4KGXB 2IJNA 2VA3A 2IBOA 5HSPA 3CDWA 2W9BB 2ROPA 5KFDA 3WX4A 1YZ7A 2VB6A 1X9MA 1L3TA 1QE1B 3NGDA 2ZKTA 1UCNA 4I7FA 1K8AT 3I82A 4RKUC 3PX0A 3MEGA 4OZJA 2YH0A 4WFNQ 2F65A 1U02A 1B0VA 3OSPA 4NWBA 1AUDA 3D28A 3FFIA 1J5EF 4NEZA 1NU4A 2H5EA 2NSCA 5AJ3F 5L1KA 3LAMA 1IKVA 3AOAA 3R5DA 2BE2B 4HH1A 3FKBA 2BR0A 5J2MA 3OQ2A 2K1RA 2RU9A 6FDRA 1CJUA 3OTCA 3OJSA 3KWMA 2W4DA 3TAPA 3AODA 4DEZA 4DV3F 3BGRB 2B3TB 5ETMA 4ZOSA 3CUNA 4C3KA 1H2TZ 4WZMA 4CLPA 1JLBA 3D6TB 4IR1A 4ECTA 3I5BA 4LSZB 3C3LA 2GGPA 4O4GB 2FJVA 3A8EA 3HI9A 4I64A 2FHMA 2KRBA 3VZIA 4B3MF 4E0DA 4KO0A 1C4CA 3EWGA 2ADBA 3HZEA 2V8VA 1L5UA 1SQGA 2L9WA 2CPXA 2R3VA 3BYPA 3C6UA 2HGNA 1VBKA 3MECB 3QAUA 3EX7B 5IOLA 2FHOB 2IVMA 3DOLB 4NZ6A 2UUAF 4Q5VA 4PG8A 2CZVC 2BOPA 3D66A 3RB4A 2W2QP 2DRBA 3PJWA 4I1TA 3S7RA 3M1VA 5LL6d 4USKA 1KOHA 2BW2A 1WTBA 4N41A 1KNZA 3T6BA 4B3TJ 1S9GA 3CCRS 4DV2J 3LP2A 3ZZOA 4OYWA 6FD1A 1FKOA 2W4PA 2WW4A 4OZ2A 3OXLA 4YS2A 1X0FA 2H51B 4CNZA 2FHKA 1VLYA 5KT6A 3R5CA 4OHWA 2DYAA 3EE3A 1TELA 2V4RA 3H7HB 2HEKA 2JH3A 3M6WA 3H0PA 2ZBPA 2B7CB 3HHLA 2DEJA 1P9QC 1TU0B 3K5NA 4Y2KA 3KHRA 3BGLA 4KY3A 2YPYA 1EX8A 5HJXA 4NYZA 3PTWA 2MPUA 1OO0B 2BJDA 3Q8YA 2DH8A 2OD6A 2A6OA 3J7AN 2M52A 2KU7A 1M0SA 1HW8A 3TUZC 3PXGa 4NLDA 1FJGJ 1RT7B 1EETB 1Q79A 3TJAA 4DCOB 4B9UA 4H4KA 1U1OA 1RWUA 3DDNA 1WC0A 1EQ0A 4ANDA 4F4AA 5AXNA 3DRSB 4DUZF 4FNHA 2B7BB 1HIYA 2B6AA 4NLPA 1APSA 1SL0A 2I1RA 3NEKA 3UN2A 4DG1B 4DBQA 4XDDA 1T05A 1XIQA 2A10A 4A47A 2D1CA 3AXMA 4FKYA 4WFYA 5ETLA 4CLUA 1HR0F 5IQQA 2ZH4A 2ZH2A 1SVDA 3HMJG 3MUVP 3V6KA 4F3OA 3SEOA 2GIQA 1J5OA 2CQ1A 4M5HA 5L39A 2A18A 2C22A 3BPDA 1RHKB 1U6FA 1CJTB 3ZZPA 3K57A 2MZRA 4ZPCA 1Q1KA 3QGIA 1SIZA 4USWA 2FVCA 2HFSA 1B99A 2NXJA 1I1GA 2XB2D 5F8JA 3OUYA 1YLXA 1T0TV 1HQEA 2H9ZA 3I32A 4PG6A 3K5OA 1FDBA 1QVFR 1IKXB 2ASJA 3ZTOA 1HQUB 5ETKA 1L3SA 3AY0A 2J0SD 3LP1B 3PW7A 4X4VA 4MKBA 1R8BA 2C1EB 2CQIA 5F8MA 2CFXA 1JKHB 5HBMB 1RSCA 3KDNA 2WOMA 3NGKA 3KUEA 2QO3A 3RAQA 4ZPBA 2ASDA 2CRLA 1NLKL 4ECRA 1NPKA 2ZZMA 1SKRA 1RQ0A 2EBGA 1X9WA 1NSAA 3C19A 3LPEA 4DV5J 3SCJE 3UO0A 1C0TA 4QOTA 1M5VC 4KH1B 3M05A 2FIUA 2UVUA 5DQHA 4ED6A 1RADB 2QEXS 4BS2A 1O5JA 4RW8A 4DWIA 5KFCA 3A3NB 3BF4A 3PACA 3RW7A 1KFDA 2ZBCA 4Q0BA 4X4OA 4ED0A 3J80Y 1AFIA 2VJVA 4LF7J 1V3RA 2U2FA 4EBDA 1LW2A 2XWYA 1KC8T 4DX7A 1RK8A 2GCFA 3KLFA 1GTEA 2HFOA 3S6EA 2XSFA 2NXUA 2MLYA 4QW9A 1VC5A 1VC6A 4XTTA 3FBEA 4B9NA 3M8WA 2AKWB 2MZQA 4B3TF 1FRHA 1JXEA 4G1QA 1NK9A 3W61A 4DL6A 4NLTA 2ZH5A 4CLTA 1MMLA 4K4TA 2ZUAA 1KN6A 2XM3A 4O3RA 1KRPA 5AT1B 3JS9A 1U1PA 1RHJB 1XWLA 1FERA 4WU3A 4UZCA 2APOA 4DR6J 1KHVA 3CCJS 1EHWA 2Y8YA 1I94F 2J7WA 5HROA 2HVEA 5GVQA 1TL7A 5KG6A 1WI8A 1SC3B 1NKCA 2G0CA 1TUWA 4KAIA 1S1XA 4C8MA 5LMNJ 2UVVA 2A2CA 2CA9A 3OL7A 4CLFA 3JSMA 1WKKA 1CJVB 5HATA 1TL4A 4GVLA 3HD1A 1FJGF 3MMJA 4M63A 4HTJA 2HZCA 4Y28C 1S9EB 3NBPB 4JYAJ 2D9OA 5KG2A 4XIUA 3GB0A 1HL6A 1CQMA 5IZHA 1FD2A 2IYGA 1FCAA 4CI0B 3FBCA 2HSEB 3D67A 3GONA 4JI4F 4FZVA 3CMQA 4GO7X 3I56S 4CM0A 1IKWB 4BC7A 1Q8KA 1VCTA 1PIEA 1WOPA 4YR2A 2ILYA 2DY9A 5K8OA 3RYLA 2BANB 3BBCA 4YY3J 2ZJQQ 3R27A 4X4TA 3UNGC 1R6VA 4HDHA 2XMAA 1Z4UA 5DM6Q 3ILOA 2Y1RI 4CH1A 2Z56B 5DZ7A 5KT3A 1T9XA 2DO0A 2OUGA 3KG0A 2CJBA 1VQ5S 2ZD1B 2JLEA 2YNGB 1WD6A 2CJYB 3N6MA 4X84A 1DTTB 1V6HA 1VRQC 2RHQB 2FC9A 3HVWA 3JTNA 1O51A 5KT7A 2HHWA 1VBYA 2PD1A 2RKIB 1CSJA 4IOAQ 3MUTP 4FVMA 3ONQA 4EBEA 3I9ZA 5SZTA 1VQNS 3SMZA 3HFZB 3HHKA 4YUDA 2OIHA 4DPOA 1NKEA 4ZN3A 2W2NP 3DLJA 1UFLA 1FT8A 1RISA 3KJQB 1X5TA 5GADU 2WVEA 2KFZA 2R7XA 1GTHA 1N33F 1YWXA 1X5PA 1X4CA 2B9WA 2GVZB 2MDAA 1FO1A 1FVQA 4X64F 3CIMA 1R0AA 1DAXA 1K1QA 3UVJB 3I4HX 1TQLA 2VG6A 2GZOA 3IR5B 1NK6A 1TZ0A 5DGAA 2DNPA 1S77D 4X4SA 2WSFC 3THVA 2U1AA 4QQBA 3C2PA 4XAKA 4M5NA 2NSBA 4NL5A 3GJTB 4RLEA 2ZH9A 3I0RA 5E3QA 2CZ4A 4DV5F 2HMIB 2NXCA 3NNHA 3H4DA 1ZPVA 1OPZA 1OPIA 5SUHA 2DPIA 3KLGB 4ZP7A 3GZ7A 2DXEA 3UR0A 2HWTA 1R6YA 4OZ3A 1SXLA 4Z7YA 2XHWA 3I5AA 3E01A 1XTZA 2OTLS 1F2GA 3TAMA 3GSIA 4R0JA 2HWHA 1M5HA 4BCAA 3ICLA 3KHLA 1TVRA 1YK9A 1YBTA 2E1PA 4H4MB 3MMCB 1MROB 4G1PA 3E8OA 2V4JA 3BDPA 5HLFA 3RR8A 1YJWS 2EXUA 4A8OA 3HVTA 3HD2A 1EZZB 4JI8F 3EXYA 1RTIA 2GC8A 3FC9A 4WK3A 1B0PA 1S72S 5B0FA 1RA7A 4ECSA 2LQ5A 3H25A 2HS4A 4DR6F 4AD6A 2VFTA 2MKYA 4LRFA 3SZ2A 3G8SA 4LFBJ 3CCWA 4DR2J 4X4RA 4DSKA 3MFIA 2W01A 5LMNF 2PEBA 2V2ZA 4KT0C 1PJ5A 1ZYQA 2LXUA 2DTJA 1UA1A 2MQNA 2XC9A 2ZJRQ 3T1YJ 4RUHA 1LKZA 5E5NA 4DL7A 2OPSB 4Q2MA 1VHIA 4PYDA 3UFCX 3SDEA 4HL9A 2XGPA 5C7PA 3GE9A 2AGQA 4J90A 3BB5A 4QCLA 1FDDA 4LF6F 4M95A 4MMOA 2W9CB 1DFDA 5B0DA 2BQUA 4IO9Q 4USJC 4JI1J 3RBEA 4FF4A 3BH6B 2AYMA 1YIJS 1BGXT 3MUMP 1VBZA 1JWWA 5ITHA 2B9XA 3MAAA 3LGHA 2CADA 1PAUB 4EGLA 4YB7A 1RT4A 4ED7A 5KFGA 3JQJA 2F8MA 2AJ4A 4WK1A 2DB1A 3JTOA 2K7JA 4CNYA 5IM0A 2AJQA 3M8YA 1QSYA 2QA4S 2ZOGA 4O3OA 4I2PA 4NXNJ 3G6YA 1OJ4A 1RWMB 2UZAA 4I7FB 3HJVA 1P6TA 1AT1B 3MEGB 2HRUA 4DFPA 1SBRA 5CYJA 1R8PA 2HBZB 3NS7B 1Y5IB 4F3QA 2YKNA 3A8JA 3FFIB 1RWWB 2JZ5A 2DH7A 1IR2A 3ENQA 2E1CA 1KQSR 5KFVA 4TU7A 1SUQA 4JV5J 4WKRA 5ETOA 1IKVB 2LLZA 4MT1A 4CDIA 3PO5A 5J2MB 2K1RB 5DZ6A 3PX4A 1CJUB 2EI5A 1DY3A 2NZCA 2QG9B 4X66J 4YP3A 2LA6A 2CNNB 3KK1A 2DY1A 3G8QA 5L1JA 2XYGB 3A12A 5GAHI 4QYZK 3PX6A 5FLXY 2Y1LB 1RAOA 2ZBRA 5DDRC 1HD0A 1JLBB 5AXLA 1N88A 2GGPB 3PYDA 4C3MA 3POTA 4QIGA 5HMXA 4P75A 5LMUF 4E2FB 3G6VA 2RF2A 5KFPA 3ELHA 2WSCC 4KO0B 1KBRA 2RH3A 4DOZA 1RXOB 3L7UA 2PMZD 2IM2A 2RE1A 4P6QA 2ZM6F 3H90A 3C6UB 1YDLA 4M5MA 5E3RA 4W98A 2BRKA 3PNIA 2ILZA 5CQGA 1OY9A 4OX6A 2F1FA 3M1VB 4FNIA 1G2EA 4EYHB 5L46A 1S9GB 1KR4A 3D0GE 4PG4A 3PYGA 2XCPA 3LP2B 2XTJP 4CO5A 2IAJA 1FKOB 3U02A 1NJXA 1U26A 3W1YC 2HK2A 1K0TA 3MR5A 2P9GA 2F4FA 2YH1A 3H59A 4DF4A 3HCXA 2O01C 3HHLB 1ZM4A 3V6JA 1E6YA 3GPAA 2MJUA 1T11A 4KKOA 2MZSA 3HHDA 3PW4A 2X1BA 3RR7A 3PZPA 5KFQA 5AE3A 2ZKUA 2ALYB 9ATCB 4HH0A 4NLSA 3SSRA 4U67Q 3D3CJ 3VAHA 1T02A 2A6MA 2KG1A 5KTQA 3BZQA 1B70B 1ELOA 3PJXA 3HFKA 4XDCA 2CQ2A 4RPFA 5F3ZA 4NLRA 4LFBF 4DR2F 1VR6A 4I2QA 2GMLA 2MQOA 3IAS9 2HHXA 1AZSA 2VC1A 3D0HE 3N5BA 4WFBQ 2K8GA 1T05B 4RUBA 2FVSA 2LXFA 3OTOJ 4BWJA 3GIMA 2ZE2A 4ZPVR 4FVCA 1N5VA 5KAKA 2JEIA 1YX2A 3T9ZA 5K14A 5LXRA 3BO2A 1WOOA 5EWGA 4JI1F 1R43A 3JSYA 2ZVIA 3HKZD 2IC3A 1Y9OA 1J5OB 3OFGA 4NOHA 2PFDA 1YZ6A 5KFEA 3H5YA 4GKJJ 1U7LA 4O0NA 1RYRA 3H5XA 4KE5A 3D1OA 3TVYA 1MLAA 5HO4A 4LSNA 4F0MA 1AW0A 2VQFF 1VLOA 3RB3A 4L3NA 2Y0BB 3R9LA 3VGVA 4C8KA 2KT3A 4CQ1A 3CDAA 3OUYB 5J2NA 2MHEA 2ZDOA 1HQEB 4NZ0A 3Q24A 4JP8A 2VA2A 5FJ4A 3A3OB 1S4FA 3GCWP 4LVOP 2YKOA 2IDLA 1NHUA 3ZTRA 4FP9A 2VG7A 1IR1A 2AZ3A 3CCTA 3EYZA 1Y5NB 3R6LB 3BQ1A 2FVRA 2KKHA 5CCLA 4UOCA 3MPWA 4HDGA 3OL8A 3MM8A 3LP0A 4JV5F 1WWHA 3TZYA 2BYCA 2WOMB 2CQPA 2EW9A 5B0EA 1Y00A 4D3HA 1YRTA 2OKQA 2XS2A 3Q8QB 3AHPA 3DLBA 5CD4H 3CCVS 3W60A 3GJQB 3RBZA 2BA9A 4X66F 3LUYA 2YQ1A 4LQ3A 4YOEA 4K5SA 3ITHA 2B51A 1UVNA 3NGTA 4I6WA 5GAEI 1KP6A 1UJ4A 5G0RA 4F4ZA 1NDPA 1C0TB 1HFEL 2YKPA 1CC7A 1IUJA 3MM9A 3TX0A 2WVDA 2I0XA 4K4VA 1NEEA 4RW8B 4EO8A 4G65A 4NMLA 2YNFA 1RAAB 1SQEA 2NYIA 5DO2A 1T95A 2LP4A 4NCAA 1RABB 3Q8UA 2VG5A 4IDKA 1QTMA 1LW2B 3PEHA 1IBMF 1YJVA 3QMQA 1QJHA 2DGUA 3KLEB 1UEUA 3CPWR 4HHHA 2L48A 3Q0AA 3FMBA 5C2CA 4AE5A 3K7RA 4ZVUB 4AQYJ 3LF0A 1IBCB 2HQIA 4DMZA 4Y34A 2RHSB 4JI5J 3QATA 1TV6A 3FUYA 2RB7A 1S6QA 4DQSA 4J91A 1N6QA 2UUBJ 3PM9A 1F9HA 5HROB 4TVAB 2KJWA 2Z2YB 1TL7B 3P45B 4Q43A 1PJ7A 2GQQA 1S1XB 3GIIA 1NJIT 1NK0A 1LEOA 2DGTA 4I0WA 2DR8A 3HSDA 4F02A 5KFHA 1KFSA 3JSMB 4KGVB 1PO6A 4FYXB 3KJVA 2BDPA 4M8LA 2G1HA 2DNKA 3N01A 3EMTA 2M9KA 3LWMA 4ZVQB 4JI2J 4J9SA 1HBNA 2D69A 4FXVA 2E9TA 4NRTA 4JBCA 1KOOA 4F4WA 2IIHA 3MMAA 2CQHA 2MSSA 3G82A 3QRQA 3K0JA 1GK8A 4DQPA 4DPXA 4PQUB 2DRAA 2GIRA 1X7VA 3R6GB 3KKFA 2X3DA 3ENVA 2G2ZA 2DR7A 3VQSA 1ZTTA 3UD5A 4IG3A 1YG0A 4WIIA 4C97A 4ZVPB 3D5MA 3KLIA 4C8OA 3H5UA 4BC9A 2D74B 4HHJA 3T19A 4ILRA 2AT1B 1VHFA 1C0UA 3AA8A 1Y7PA 3NOCA 2JVOA 1MSWD 1SJ1A 2YX4A 2UXDF 4RBTA 5LM7E 2B4OA 5F8HA 4QWCA 3PG9A 3F41A 4MTPA 1VQKS 3WIVA 2XCAA 3RAMA 3F73A 4CZCA 3M8SA 3KYLA 3BSNA 4ENOA 4Y3CA 3W7BA 2CPHA 3R2DJ 2Z0GA 1NDLA 4LR9A 3PDNA 3H42A 4N8OA 4NI2A 1H72C 4F2RA 3ZC4A 3DXSX 1FRKA 3K2YA 3EGWB 3W5XA 1MW7A 2BZ2A 3MHYA 2ZNYA 1YVFA 3MWBA 1BXNA 4URQU 1D8ZA 2C3UA 1N0VC 1RE1B 1R0AB 1O0PA 3ETOA 1LXJA 3FEZA 2VG6B 2EBEA 4JI3J 5EX0A 1OSDA 5KOWA 1XBWA 3Q83A 2JEGA 4F26A 1Q82T 2XI2A 2EG2A 3GG0A 2R7RA 3I0RB 1GT8A 2RT3A 3T41A 2V67A 4WU2A 1RT3B 1MMDA 2QE5A 2XY6A 2CG8A 4P73A 2ZC4A 3M6UA 1GXTA 3DI6A 2W2PP 2OPQA 4QWAA 2ZBQA 2R7UA 3V6DA 4ID8A 1R27B 2R4FA 3GR1A 4ECYA 1IBLJ 3E01B 5CCMA 4USTA 5CZVA 4A8FA 3JSRA 1VDHA 1UA0A 1U24A 1V9OA 3CWJA 3TAMB 3W5ZA 3V5RA 1K0VA 1TVRB 2AEJA 3BN7A 4ES1A 3TA2A 5DDPC 1JXVA 4MK9A 3MFHA 3GQCA 4PXBA 4JI7F 2V4JB 3DLGA 5HLFB 1YSJA 2OH2A 3HVTB 1RWPB 4A8YA 3OL9A 3KG1A 3SFGA 5AXMA 4RBVA 2KH9A 5KFSA 4JV2A 1RTIB 3LALA 2PI4A 4DSIA 4OI6A 1JB0C 2W24A 2XSJA 5HQMA 4O23A 2C2NA 4LQ9A 2G0IA 5D4OA 1SC4B 4KYZA 3H40A 4RU9A 2DNHA 2Q79A 2DHHA 2UUBF 3CJQA 4RL1A 4F7VA 2ZH6A 1HNZJ 3MTJA 4LBHA 2C2RA 3H4BA 2QA4G 3PW2A 4DL4A 4TN2A 5GMEA 1Q0NA 2RDIA 3QRPA 3WDOA 3CCUS 5F8GA 2EFNA 3BH7B 1UVLA 1KQFB 1RTZA 2B8PA 4P52A 3D6FB 2BX6A 4J9QA 4ZVEA 3NCRA 3Q2SC 4DU7A 5L9XA 3TYTA 3RTVA 2D9PA 2PMHA 1OQ6A 3T5LA 1R0CB 5DQIA 2KI2A 5KFNA 4JI2F 1NSPA 3CC7S 2LEBA 4DL3A 3ET6A 3NG8A 4DV1F 4X4QA 3VQTA 4HKQA 3MAAB 1S97A 3K17A 4RW7A 1QLNA 4L73A 5GAEU 1VISA 1UEKA 5F0UA 1RT4B 3CD7A 2OLWA 4K59A 3L7OA 3PVXA 4DV6F 2QYCA 4UQTA 4WF9Q 5IM0B 4DXLA 1FRIA 4C3LA 4X4PA 1J2VA 1F3VA 4I2PB 4NX9A 1YITS 1XMOF 2YKMB 1N5TA 2WCXA 1ULRA 4Y2CA 2FYXA 2BV3A 1LK5A 2XMTA 1ZPWX 3R5AA 5F3TA 4LR7A 2M2BA 3H20A 4DV0J 2MHNA 2YKNB 4C11A 3N6LA 4ANEA 2VFVA 4LSLA 3IM9A 4FXWA 4G1IA 2E7XA 1X4AA 4OZ5A 1WUUA 1SJ4P 1SUQB 2JDJA 2LQ9A 2ZOMA 1OYEA 1ZAWA 5D0HA 3CC4S 1M1GA 2IA6A 4DZ6A 3P8BB 4K2JA 3TA0A 2FJXA 1PC4A 1F0XA 3WIUA 3NAHA 2V8PA 4ZIVA 1WHXA 3THTA 1D09B 3KK1B 2R7VA 2HW3A 5F8IA 2J0QD 3CJ8A 3QIDA 3C16A 1HNWJ 2XYPB 3RRKA 3POTB 2RF2B 3UNYA 3PO4A 3US5A 4B08A 5C24A 3AXKA 1Q81T 2NQPA 3DOMA 2B43A 3FZ2A 4B3SJ 2IJFA 3P96A 1N8RT 4P71A 4RO0A 1VBXA 4DV7J 3G86A 5IFMA 4Y2MA 2WVCA 1BHNA 4ZLNA 2F9DA 4HT5A 4AXJA 4C8LA 4WCEQ 4CLKA 1RTDB 1SH2A 3LW5C 2EKYA 1ZA2B 2CNLB 4X65J 2CKWA 4H54A 2PFFB 1JNRB 3X3UA 2YX7A 2KB2A 2IAJB 3G87A 3NS5A 1IBLF 3ZTPA 4Z37A 2HVIA 4FPIA 1N52B 2QX0A 2CIMA 1PYSB 4EEYA 1TUGB 1RT6B 2YXLA 2QZ8A 1X60A 4EI2A 2XMMA 2XI3A 2AYBA 1HI0P 1E6YB 4RNNA 1QM9A 4KKOB 1H6KX 1K73T 2DIVA 5EWEA 1S5ZA 2Q43A 4OYIA 4FYVB 1UFWA 4DR4J 3JQMA 1SKUB 2FC8A 5IWAF 3QFWA 2N3OA 3LTOA 5A0YA 2KHCA 3M6VA 2RNEA 3AOBA 2ZHBA 3GFZA 4HTIA 5BR8J 5DG8A 4F4KA 2H48B 5CYQA 2Z57B 3PJ9A 1UW9A 2IRUA 2XMWA 2HHPA 2FHJA 5LSOA 3GYNA 2XQCA 4FXDA 1JLGB 3OJUA 4ZVOB 2J7KA 4I2QB 4FN5A 5CXTA 3MOZA 2J6TA 2BKPA 2V0NA 3JB9k 1AZSB 1V3SA 4P2FA 1TL1A 2X3GA 5CD4A 2VQEJ 4DSFA 4ZN1A 2OHDA 2VBXA 3H2LA 1RDRA 2ZE2B 2C2ZB 2JJ4D 3PYEA 3V6HA 2BJ1A 1VGYA 2QGFB 1WG4A 4WTOB 2WTFA 5K14B 5HJYA 3IFEA 4N56A 2CWKA 5D4NA 3EVOA 5DG7A 1AUSL 5F8NA 4TYBA 3M32A 1X5OA 1Q53A 2F7VA 4O0IA 4TLRA 2IC3B 2E9RX 1U0SA 4RNMA 2XNRA 3BSAA 4HYKA 2HHHJ 3DLKA 4XO0A 1N34J 2HNDA 1UAWA 2AWZA 3D6MB 1O6XA 5K8PA 4KHPF 2MSTA 1N32J 3TEHB 1A6LA 4LSNB 3ZFVA 3I96A 1EQMA 2P6SA 3QBCA 7FD1A 4AYBD 2C2OB 2VONA 2J0XA 2KFNA 2GJFA 5J2NB 3HFVA 1QD1A 2NPFA 1FFSB 4FPRA 2IM1A 4CO4A 2ZEJA 3DM2A 3MR3A 2OEMA 3C6TA 3FDSA 2VG7B 4NE9C 5A2QU 3OFHA 1W26A 2J0WA 3HHLC 3CJKA 2GW8A 4NLVA 3MM8B 3LP0B 2JSXA 1DURA 2RJZA 4ZCIA 4DS4A 5IS2A 5IT0A 4J9PA 2QA1A 4DQQA 2GO8A 1U1LA 3K89A 2R7TA 3AJ1A 3T9NA 2KRRA 5BJRA 2DIUA 1NJWA 3WZ0A 3ITHB 4IH6A 5EX3A 1X5SA 5ETNA 3V81A 1L3KA 5G0RB 1HNWF 2BJEA 2E5HA 1U1QA 4HVZA 5IXUA 3KK2A 2XMVA 4R25A 3MM9B 5DETA 5KFYA 2EKNA 4K4XA 4OMFG 2YNFB 3PKMA 3K8WA 1HYSA 2BKOA 2VG5B 2CXEA 3OD2A 2ZH8A 3QGHA 4IDKB 4GRSA 4OYMA 3EDQB 4DV4J 2Z30B 4DPUA 3FBBA 2EFOA 3GV8B 1I3OB 3FEXB 1Q16B 2KDOA 3GCXP 5E2QA 4I56A 3HX9A 2CJXB 1NO8A 2HURA 1WKLA 1SQFA 2XZTB 4N7TA 4RW4A 4YHHF 5M2RA 2HRTA 1BD6A 3MR6A 1SC1B 2GFFA 1BC6A 4X65F 4PWDA 4ZVGA 1TV6B 1S6QB 5KFJA 1N6QB 3P6YC 2HNYA 3KHHA 4P2SA 1UKUA 2QYGA 3NAIA 1WC6A 3OLAA 4F67A 1BQXA 3U1NA 4JI0J 1S9FA 4OZNA 1KQGB 1J5EJ 3CTRA 2M4MA 1TR0A 2KT5A 2FLNA 4CCHA 1FEEA 1OY6A 5BYQA 3N28A 3BS9A 3M8QA 1CVJA 2WAQD 5EHHA 3DHXA 3IWLA 2HBYB 2RDDA 3DHWC 3IRXA 3TR5A 3OXGA 3KJVB 5CABA 4UOHA 4IOBA 3DYAA 3G96A 4DV3J 1S4EA 2FTRA 1UVJA 5CH7B 4P7TA 3J7A1 3I5CA 1HBNB 2HAIA 3DRPA 3TVZA 3MMAB 2HS0A 4MK8A 3G82B 4DDFA 4NEYA 1VQ4S 3G6XA 3MD3A 2VQEF 4NLXA 1FK9A 5LJ3Y 1GMWD 1QAXA 1HBUA 3AD8C 4IO1A 4DCJB 1NH7A 3HVAA 1HARA 2IFXA 5DDOC 4IG3B 5I3UA 4J9KA 2XLJA 1RAFB 4LJMA 2DGWA 1S49A 1NB2A 3PHTA 3KLIB 4I6YA 2HHHF 1H3DA 2AMCB 4QYZJ 3QLHA 3BYRA 1C0UB 2FVQA 3EPIA 4ICLA 4KSEB 1MWYA 5D8HB 1NM2A 4RNOA 5CHCB 1M90T 1GMVA 4DN0A 2UU9F 3O3LA 2HVHA 2KVIA 4HHUA 4UY85 3EVWA 1Q7LB 5ETPA 4P10A 4GKKF 8AT1B 2OGUA 2QSWA 3D0IE 1FX2A 2JFKA 2VBWA 4J9NA 3PR4A 2VC0A 4I67A 3QFHA 2DHAA 2V94A 4UT4A 5D0RA 1RTHA 3NWRA 4WP3A 4ES2A 3D4JA 2BE9B 4NLYA 1DJ0A 2W2MP 5KG3A 2GO9A 3TAQA 3LO3A 2F4VF 2BRLA 2RQKA 3RGIA 4DUZJ 1HMVA 3QWUA 3M8PA 3QRRA 2QT7A 2XS7A 3OVSA 3CULA 4IRCA 5H1SV 3R2CJ 1ZZFA 1CJKA 1RTJA 1Q8BA 2X1GA 4MIBA 2PE8A 4WYWA 2AHOB 2A3JA 4NZ7A 3PYFA 3DI6B 2HBRB 1HPZA 2OPQB 3T1HJ 4QIVA 3JAMY 3PIPQ 1HR0J 4RU2A 4OZLA 1UWBA 3IAM9 5A6WA 2VD3A 1SB6A 4UF4A 2GV1A 5LXYA 4MFBA 4QIEA 1WHWA 2MKJA 1EP4B 2VL1A 3GWCA 5DGBA 1JXLA 1RJJA 3J81j 5KT5A 4YB5A 2XULA 2YKQA 4I68A 3VTIA 2DRDA 4KIAA 1P1TA 4Y2AA 3DLGB 4JUZA 3W8PA 2DCLA 3QZ7A 2V2VA 1GFWB 2MTLA 2DT9A 5HANA 4P9SA 1WEXA 1G3OA 5HMZA 3R1HA 3I31A 4PUOA 3HHLD 2OPRA 2XSJB 1D9AA 3KUGA 4QU6A 2H3EB 4O44A 1WF1A 1WG1A 4HACA 4DQRA 5C5JA 4ZP8A 4DU8A 1S1TA 4JI0F 3DMJA 4OHZA 2JLFA 4LFAF 1NSKL 4DN9A 4B9SA 4ZVFA 4TY8A 3QT8A 3HHEA 2DNZA 3T1AA 3G8TA 1ROFA 1X4DA 3UCZP 4JI6F 3ISNC 3ISZA 2I38A 2R7OA 2Q1LA 2VPXB 1NRKA 2Q3PA 1CULA 1P8GA 3BKUA 2BACA 4ZPAA 1S59A 2HHQA 2VBZA 1JQGA 4ZP9A 5B7WA 3ET6B 3AJ2A 5A8WA 1T3NA 2YVSA 1WSRA 3GYGA 1RT1A 3VR1A 4EU0A 1C1BA 2QFIA 2IMOA 2MLZA 3AD7C 4Y65A 3RJMB 4OJGA 4EZ6A 3BGUA 3GFYA 3R7BB 2FLPA 4CTAA 1VS3A 1XNRF 3PRVA 3ULHA 5KFFA 2OSRA 5KFIA 4OFZA 3IR6B 4C11B 2WBMA 3IG1A 4LSLB 4U7CA 4ETZA 4WTYA 2V68A 3R7NB 3GMGA 3O8WA 4YB1P 2B5JA 5E33A 1CEZA 2AJ1A 5IC4B 2XMKA 4B17A 1I94J 1UL3A 4ZJLA 5AXKA 1UZDA 1SH3A 2IPOB 1GEHA 1YTYA 3SV4A 3M8ZA 1OY8A 5GADI 1S48A 4ED1A 2E1RA 3Q2TC 4OYOA 3MTKA 1HWUA 1U4BA 1F5AA 4CH0S 3K5MA 3VVUA 2OFGX 3LGNA 2KZMA 1ZS6A 1NJYA 3HSGA 1TAUA 3MAQA 1RGVA 1U2CA 1U48A 1H0HB 1FTRA 1FRLA 4J9RA 1BQMA 1WJ9A 3QQCD 2B4PA 4ITSA 5C24B 3IMQJ 3UN3A 3DOMB 2MEWA 3HVRA 4JI4J 2H54B 3JYTA 4ER8A 5D15A 3W62A 1S1WA 4F3MA 1U1MA 1H7XA 4OYZA 1PYOB 1LFWA 2Z4PA 4URSA 3UDCA 4RWWA 2X7IA 4RUAA 1SV5A 1JX4A 4GC7A 1G4CA 4MIAA 4WYLA 2QSFA 2QTWA 4ZLPA 3T1HF 4M5DA 1X8DA 1PJ6A 1O8BA 2NLWA 4LIWA 4NLOA 4QW8A 5KFMA 5KFBA 2V4QA 4PEOA 5CAAA 1UFKA 3B4DA 2FJAB 4ZPDA 3I9V9 3GTYX 2V69A 2GQ2A 2AF6A 3JTPA 3UCUP 4EBCA 4LF2A 3T6JA 3R5JB 4RR5A 3UDVA 2Z8QA 2F3JA 3HKWA 2HQFA 2QIFA 1XQIA 4DR3J 3IBWA 2EG1A 4B3RF 1Y5LB 3A1YG 4ZCLA 1IJFB 1WHYA 2VU5A 2CPIA 3IR7B 1RCOB 2VHGA 2E9ZA 3OTDA 1RU1A 3D9BA 1VQYA 1B3TA 2KZZA 1NBEB 2ZFHA 5CYQB 2AIRB 3J81Y 2PGCA 1OYDA 3M2UA 2DR6A 3OL6A 1XN9A 3OR2A 2RQMA 2Y0SD 3D3BJ 2XBPA 2ZH1A 2W2OP 1KQKA 3DRSA 5KFXA 2UV8A 1FNXH 3ILLA 1N33J 2XLIA 1SCJB 1BE4A 2H5IB 4F4XA 2FJBB 3VAFA 1ZBTA 5IV4A 3D1HA 4X64J 4KHRA 3PHEA 5B08A 1TL1B 3EM1A 4YN3B 2HGMA 4NYOA 2H65B 4A8MP 4FS2A 4LREA 3N0VA 2ZVSA 4K4WA 1LK7A 3DFEA 4LF5F 1QUPA 1ZZNA 1HNIB 3M32B 1GXLA 4OZ0A 2UUCF 3IA0A 1NK8A 2DNNA 2MZJA 4CO3A 2BBEA 1F6TA 4GC6A 5B0GA 2RRBA 2VPYB 3TRGA 3D68A 3QO9A 1OQ3A 3G4SS 2HNDB 4BWMA 1FXDA 1VQLS 2FD2A 1ZTWA 2K7KA 1LWXA 2AJ2A 2UXBF 1MMNA 2MYFA 4C0HA 2W7OA 2ATCB 4FF1A 3DGVA 1C4AA 1N4LA 5C25A 3HULA 3KDOA 2Q6BA 4TKTA 3RB0A 1KTQA 3PY8A 1HQUA 3F44A 2HBQB 1T03A 4D3GA 4B9TA 3DLEA 1M1KT 4JI8J 2WZ1A 4ZDNA 1QAIA 5E7OB 3DM2B 4E98A 3C6TB 4ZKAA 2HS3A 1Q8IA 1ZETA 2RQCA 1XEZA 2QMUB 5HBMA 3CJKB 1FTCA 1CPZA 2CPZA 2JRSA 2X1FA 4DR5J 2KYZA 3HLUA 2KM8C 3KXDA 1WDTA 3OW2R 1P9YA 5K8NA 3ISND 3OVAA 4ZS6A 3ZNJ1 1VQOS 3EGNA 4AUKA 4L74A 3V4IA 4KV8A 1XK8A 4IQXA 4CLYA 3N6NA 4KTQA 1SC6A 5E3CA 3QAEA 3FEYB 3KTQA 3IM8A 4UY8T 4UTGA 3A4TA 2P9EA 4K8RA 2JLGA 3V81B 3W9JA 1IXKA 1MN7A 2LDIA 1WC5A 3MAHA 4W92B 4LF6J 4OIXA 4OX9F 3KK2B 2E5GA 3L4BC 2ZH7A 2PDAA 4C0BA 2CJAA 1IWAA 2VOPA 1CBKA 1TUVA 2QFJA 1HYSB 4RUCA 4ZVSB 3FRYA 4NXMJ 2GVDA 4TY9A 2D3O1 5DG9A 3OFEA 1L3UA 1K1SA 5DLGA 3CT9A 4UQGA 4RWXA 2QMWA 3AQPA 2MGZB 1URRA 4MYUA 3DCAA 4PWWA 2E5LF 4DX6A 1H2VZ 1SIWB 3CE8A 3W2WA 1PBAA 1V3ZA 4RW4B 1C1CA 2NR0A 3QJLA 2MQMA 3CJ4A 2NPIA 2H1YA 2MQPA 2AEMA 2OI2A 1X4BA 4PWDB 3RU0A 3W9IA 1XR6A 4J9LA 5J2PA 4LRDA 2NUUG 4DFKA 4B9LA 4NCBA 5KFAA 3TA1A 2HFVA 2O67A 1HW9A 3NL0A 1SL1A 1Q5VA 4KC5A 2CDQA 4LMZA 2AP6A 4DR3F 4RNHA 3KUHA 3D7SB 3D54A 3M8QB 1IBKF 3NXZA 1S0OA 3G2XA 2CQBA 5KG0A 1E6VA 3GG1A 3NMAA 3IRXB 1NK7A 4ECXA 1XR5A 2XMUA 1D1UA 1LWEA 2V8HA 1KHWA 2DH9A 3DYAB 3E2EA 4HI1A 2QRRA 4FYYB 2ZHOA 4AL7A 5KFRA 1SJFA 3EZ5A 4EMDA 3DC2A 3DRPB 1VMBA 4ZCMA 1UTAA 1KVKA 2QJ3A 2E44A 4IRKA 2N3LA 2N4DA 3I6PA 5LMUJ 2OELA 2YWHA 2VKZG 5JVHQ 1JLQA 1UJ5A 1TK8A 3PRDA 5KFOA 4Q45A 1MU2A 2ZM6J 3VV2B 2VODA 4MH8A 1FK9B 1TFYA 5CYMB 3GYXB 4C98A 1WF2A 3OR1A 1PCAA 1R89A 5J1EA 1HBUB 3M9NB 5F9NA 3SSQA 3W8GA 3Q8VA 1AFJA 2LYVA 2Y9HA 2L3MA 3HO1A 5I3UB 1IJEB 3BR9A 3W66A 1YBUA 2KJVA 2ZWPA 3QLHB 1S10A 3I55S 3P5BP 3GFHA 4ICLB 4Q2LA 2QA2A 2OO4A 3PR5B 2DVIA 4KPYA 4IH7A 2E1AA 1KD1T 4KRWA 2ZDPA 5KG5A 3DLHA 4LFCJ 1U25A 3WQPA 2E1MC 2V9WA 4N77A 1JNZB 4EYIB 4Z7CA 1BQNA 2OTJS 4LRAA 1UETA 1IKYB 1I5OB 4PAAA 3HM9A 1VFJA 2EC0A 3J81U 2HWIA 1U0HA 3ENAA 2BJ3A 3BN4A 1GH8A 2CQDA 3LAKA 1RTHB 1M1HA 1ICEB 5KFLA 1FWKA 5D4PA 2V2QA 5J2QA 2NUHA 4PKDB 1TAQA 2D41A 4DR5F 3TZZA 2A0FB 1JK9B 5E41A 2P8IA 4OYBA 3KOAA 1UZHA 1X9SA 1S12A 1HMVB 1DZ5A 3IP0A 1XNQJ 3CF5Q 3KLHA 4K4ZA 1NB7A 3M8PB 1WI6A 3HF5A 2YWKA 1CJKB 3VGSA 1RTJB 2AYEA 4CRJA 5HMWA 4KB7A 1IVZA 2CQCA 3KNAA 1UWBB 3IS9A 3GLJA 3MEEA 4B9MA 1K9MT 4NXMF 3UN5A 2FZCB 1S1VA 1YI2S 3J80U 3SCKE 4BLGA 3TVKA 1YRXA 1RHUB 4DSLA 2RUSA 1TK5A 2E7WA 5HL7Q 1NUEA 4DL5A 5G4DA 2VQFJ 3QNWB 1F3FA 1S76D 2L08A 1Y10A 2DKOB 1TK0A 2G9OA 4PUOB 1VIXA 4TNOA 3TWZA 2OPRB 4YQWA 3QGPA 2LMIA 4KR0B 2FY1A 4O44B 1LW0A 4HACB 3VGTA 2VPWB 1T9TA 4AXIA 1ZAVA 3J7Z5 4P2XA 3OFFA 2RU3A 3DOKA 1S1TB 3DMJB 3VAKA 1NDKA 2K2PA 1FVSA 2RIJA 5ETQA 2ZITA 1PG5B 4TY8B 2CPYA 2COLA 1D9DA 4Y2IA 2AGOA 3MEKA 2J9EA 1LXNA 2CPDA 2HFZA 1PILA 1YJRA 2XMJA 1DHMA 2OEJA 3S8SA 3T5JA 1TP7A 2KFYA 4H4OA 2ACYA 2HHUA 1U09A 3MPDA 2HAFA 2R9LA 4FYWB 3VALA 1MWQA 2FJEB 3AAWB 2RMLA 1JLAA 2MKCA 1LWCA 1C2PA 5A8WB 3DU5A 2FDNA 2HZVA 4OI2A 4J37A 4OX7A 5EGYA 1RT1B 3DXBA 4DCPB 2D3ZA 1C1BB 2C3OA 2JOQA 1NZAA 3CJTA 1SJQA 2AQ4A 4FF2A 5KG4A 1FE4A 4A8QA 2RDJA 2DGOA 1NK5A 5I4MA 3S01A 4X62F 1IBMJ 5JJBA 1Q86T 1D9FA 4W4MA 2GAHC 2LEPA 2HG4A 3NY0A 3W9HA 4CTAB 4ZK7M 2FJWA 2E66A 3OTBA 2EEYA 3LH2S 4LF9F 3ZXWA 1VI7A 2X1AA 3W2VA 2GHVC 4ZHRA 3IG1B 5KOXA 4K0KF 5BYSA 1UVMA 2B5JB 5A8RA 1HNXJ 4FBTA 2IMWP 4ECUA 1RP5A 3RBDA 1LV5A 5L1LA 2NXNA 5EWFA 2DGVA 4LFCF 2D3OR 1X4HA 2CG4A 3DGPA 1UMJA 1FJCA 3J7YU 2H4YB 1KLMA 1W2BR 1KVJA 1Z1ZA 2AYGA 3C14A 2DGSA 3ZZZA 3CXCR 2J9CA 3TNVA 1UJ6A 2Z2LA 3V4MA 1FXRA 1KS2A 3IBFB 1BQMB 4ZPTR 3OXFA 4PABA 3AT1B 4YB6A 5LOQA 7AT1B 2NYHA 1VK8A 2IM0A 2IRYA 2QL9B 1RBLA 4WFAQ 1HHTP 1XNQF 2R8GA 3JYTB 3TUPA 1S1WB 2B6AB 4IFYA 3WHIA 3FQLA 2HGLA 2BEFA 4DZDA 2FZGB 1SV5B 3CDBA 1SPBP 2A1BA 2P6TA 4NASA 1W7WA 3MURP 2XZDB 4M5DB 2O1PA 4WWSA 1EB0A 1OS5A 2SXLA 1UPMB 2W9AA 3CJ2A 4MKVA 2M8DB 3EJMA 4KGMA 5B09A 3NOGA 1RHQB 2YY3A 1OSCA 2PC6A 3CSKA 1IQZA 2K3IA 3IN5A 5L8RC 2UXDJ 2PA8D 2YBVA 3C8YA 2DGQA 1RUSA 4WXOA 2QC3A 1IM6A 1RAIB 3FMWA 2AV5A 4ZPWR 1VYAA 3PFOA 4C6AA 5CA5A 2DISA 3L3CA 3M2RA 1HBMA 1EIYB 2PIIA 2HQGA 4A4JA 3D1QA 3ZTSA 3M2UB 1U8SA 3U1MA 3OR2B 3OPKA 3FGVA 1WELA 2BUNA 2J76E 4ECVA 5MLCV 4M94A 4NYPA 1QAYA 5KT4A 3A8IA 5C42A 3MCSA 3SIPB 1ZM3A 1S7IA 4MKYA 3TQEA 1RT2A 3MM6A 4DSJA 1HI8A 3H98A 3KNGA 3PCOB 4R5PA 2RS2A 2PT0A 2AU0A 2FQQB 3A13A 1N54B 3MCOA 1F60B 5LJ5Y 2RAQA 1WF0A 3Q89A 1F9EB 1FD8A 3PW0A 4Q44A 2HZAA 3SSSA 1YQHA 4PRFA 1TFWA 4OI3A 1TL5A 1U2RA 4F8RA 4OLOA 3CDUA 3QO9B 1QTNB 1FDNA 1KKHA 4Q0BB 2JWNA
chains in the Genus database with same CATH topology
1X4FA 1VQ4S 3G6XA 5LMNF 3MD3A 3UD4P 2ERRA 2VQEF 4KT0C 1HWIA 1ZYQA 4V19X 2GJIA 2LXUA 2DTJA 1UA1A 3SQGB 2MQNA 4LF8F 2XC9A 2ZJRQ 4TQSA 4RUHA 1LKZA 4NLXA 5BYRA 3WC2A 2MY7A 5E5NA 4DL7A 3MD1A 1FK9A 2EK1A 2OPSB 4Q2MA 5HQ8A 3CIZA 4WXWA 5LJ3Y 3BQ2A 3UFCX 2DNQA 2VFUA 1QVGR 4MAKA 5C25B 3SDEA 1QAXA 3KLFB 3DU6A 4HL9A 2XGPA 3GE9A 2MZ1A 2AGQA 4RW9A 1HBUA 3BB5A 3LWLA 4QCLA 1FDDA 4IO1A 4L72B 4LF6F 4M95A 2W8KA 2YTCA 2J6SA 1NH7A 2ZC3A 3RRGA 1FKAF 3VAMA 1T03B 4MMOA 4OI1A 2WB1D 3HVAA 1HARA 2YKAA 3DLEB 2IFXA 4IYQA 4JV0A 4QR2A 5DDOC 2W9CB 1DFDA 4O4RA 5A0YB 4IG3B 3P3DA 5I3UA 1SL2A 4J9KA 2XLJA 1WHVA 4G1QB 1F5BA 5B0DA 2BQUA 3MZIA 4IO9Q 4G6VB 4LJMA 3BO4A 3CD5A 4USJC 1RT7A 1EETA 1S99A 2DGWA 3RBEA 2ALZA 1NH8A 1U49A 1S49A 2HHVA 1S7HA 4C8YA 4FF4A 5DM7Q 2LECA 2AYMA 1YIJS 5GAGU 3KLIB 1BGXT 1HWKA 2POKA 5L9NA 4I6YA 1NHVA 1IM4A 2HHHF 1H3DA 3MUMP 1VBZA 2XG8A 4QYZJ 3QLHA 1JWWA 1HNXF 1C0UB 4OJHA 5ITHA 2FVQA 2B9XA 2ZUGA 4JI3F 3EPIA 4ICLA 3K5PA 2DNOA 4GO5X 4KSEB 4ATNA 4EGLA 1MWYA 5D8HB 4YB7A 1RT4A 4ED7A 2GHPA 1NKBA 5KFGA 1ZOTA 2F8MA 4RNOA 3CMES 5CHCB 2N7CA 2I5JB 1M90T 2AJ4A 2CVEA 1TKTA 4WK1A 2DB1A 4DN0A 1N56A 4DG1A 2UU9F 3V4IB 3O3LA 3CGIA 2FGOA 3JTOA 2K7JA 4CNYA 2VUGA 3KFWX 1F5CA 5IM0A 2L9DA 3GFXA 4KV8B 1AROP 2FJDB 3TW0A 2KVIA 2QA4S 2WBRA 2ZOGA 1QSYA 2OJ3A 4O3OA 4I2PA 4UY85 3G6YA 2HIQA 4O3SA 1Q7LB 3SI8A 2O5DA 4NLWA 4ED5A 2UZAA 4JV1A 4GKKF 4I7FB 5J1NA 4BDPA 2QSWA 3MM5A 3CMAS 1P6TA 4C0OC 2RVJA 3D0IE 2JFKA 2VBWA 3MEGB 3CCSS 2HRUA 4J9NA 3E3XA 3L09A 4DFPA 2OFHX 3PR4A 5HI7A 1DQ8A 1SBRA 1VQ7S 2VC0A 5KG7A 4I67A 2R8KA 4OI4A 5CYJA 2DHAA 1R8PA 2V94A 3Q23A 1RTHA 1M5SA 3PV8A 1Y5IB 1B64A 4F3QA 4N8NA 2YKNA 1U6BA 3FFIB 2JZ5A 2DR5A 4ES2A 4NLYA 1IQTA 1DJ0A 5F41A 2DH7A 5KG3A 3NCQA 3ENQA 2GO9A 2ZHAA 2E1CA 3TAQA 5E3PA 1KQSR 5KFVA 3DLKB 4TU7A 1SUQA 4OLPA 2B9YA 1VQMS 3LO3A 4HI2A 4A8WA 1A7GE 2RILA 2F4VF 2BRLA 2RQKA 3IWXA 4WKRA 3H8YA 1IKVB 3TOQA 2ZH3A 2LLZA 1HMVA 1VQSA 3QWUA 3KLEA 3PO5A 1HWLA 1IR0A 3FSYA 2VZ9A 3MEDA 3ZZRA 4Y00A 2WHOA 5J2MB 1VJWA 3M8PA 2F9JA 3TI0A 2Q6CA 3M6XA 3N79A 2QT7A 2RSQA 3W2WB 2K1RB 2ZNZA 2XS7A 3OVSA 3L95X 3CULA 3PX4A 4IRCA 5H1SV 2EI5A 1YRUA 4CT9A 1ZZFA 4ILMA 4EFAC 4O3NA 1RTJA 1Q8BA 4YP3A 1C1CB 1HNVA 2LA6A 2X1GA 2DHSA 4YEAA 1VQ6S 4MIBA 1WG5A 3KK1A 4K4UA 2OAUA 3G8QA 2PE8A 5L1JA 1P27B 5FIIA 3T5KA 4WYWA 4DV2F 3GR0A 2A3JA 4NZ7A 3TANA 5GAHI 1KLNA 1IKXA 2VH7A 3PX6A 3DI6B 5FLXY 4ECZA 1H2UX 5JXSA 3UWTA 1HPZA 2OPQB 5HP1A 2V8GA 1DARA 5DDRC 2NZ4A 5EDWA 1HD0A 4QIVA 3JAMY 5J2PB 1HNZF 1JLBB 3PIPQ 5HN0A 2XLKA 4RU2A 5AXLA 4OZLA 1ZAXA 1N88A 1UWBA 2GGPB 3IAM9 3LP1A 5A6WA 2VD3A 4C3MA 2LCWA 3SV3A 3POTA 4QIGA 5HMXA 1SB6A 5I3PA 5LMUF 1B0TA 3G6VA 2KHDA 2RF2A 3Q22A 5KFPA 3BEGB 2GV1A 2DPJA 5LXYA 2ABYA 2WSCC 4MFBA 4KO0B 4QIEA 2OPPB 1JKHA 1WHWA 3FVYA 2MKJA 2RH3A 4DOZA 3O5TB 1EP4B 2IM2A 2VL1A 2PMZD 3GWCA 2RE1A 4RBUA 5DGBA 1JXLA 3QIPB 1RJJA 4P6QA 4C7QA 2ZM6F 5KT5A 3K5LA 2YNIA 4YB5A 2XULA 4NA1A 2BM0A 5T41A 2M0GB 1RI7A 1UP1A 5AE2A 2YKQA 1W2IA 4ERDA 4I68A 1KVIA 4YFUA 3C6UB 3VTIA 4KIAA 1H98A 2XY5A 4LUBA 1P1TA 3N9UC 4Y2AA 3M30A 1VOMA 3DLGB 5E3RA 4JUZA 3BDEA 4QYRA 2BRKA 3PNIA 4DF8A 1E6VB 2DCLA 2QLWA 2ILZA 2F8EX 3QZ7A 5CQGA 5H9FJ 4F50A 4OX6A 2F1FA 3M1VB 2DT9A 4QJVA 1N0UA 1WEXA 1G3OA 1HNIA 5HMZA 2BQ3A 2JEJA 2KO1A 4FNIA 3R1HA 1TKXA 1FRXA 2JVRA 3UDLA 4OQJA 1FRMA 1LWEB 3L7PA 3I31A 4ETXA 4EYHB 2JFDA 2Y1IA 1G2EA 2XO7A 4PUOA 3HHLD 4DJBA 2XGQA 1S9GB 2OPRA 1KR4A 3R5BA 2XSJB 3D0GE 2XWXA 1D9AA 3HK2A 4PG4A 1VC0A 2XCPA 3LP2B 4QU6A 4QPTA 1JLEA 4CO5A 4QR0A 1GX5A 4O44A 1WF1A 1WG1A 4G3IA 3DLLQ 2IAJA 1ZH5A 1FKOB 4DQRA 2CQ4A 5C5JA 3MM7A 3U02A 1D8YA 3O44A 4OZ1A 4ZP8A 3EPGA 1NJXA 1U26A 1YBAA 3H2UB 1S1TA 3J7ZT 4JI0F 2IYIA 3DMJA 5JUMA 1K0TA 3MR5A 4OHZA 2P9GA 3OLBA 3BSCA 1N5QA 2Y1JA 3M2VA 2JLFA 2YH1A 1U6ZA 4LFAF 2E5JA 4DN9A 4B9SA 4PQUA 2DJWA 4ZVFA 3D2WA 1JLQB 1VQPS 4TY8A 4NRUA 2G1DA 2VPZB 3H59A 4DF4A 3HHEA 2DNZA 3T1AA 3G8TA 1ROFA 4ID5B 4M1KA 1S6PA 2O01C 3HHLB 3LPYA 1X4DA 1ZM4A 1MU2B 3UCZP 4Q7AA 3V6JA 1A9NB 4JI6F 5IQ6A 1E6YA 2ZJPQ 2MJUA 3OR1B 2AJ0A 5FD1A 1HD1A 5ADZA 3ISNC 4UUWA 3ISZA 4KKOA 2I38A 4I4BA 2MZSA 5J1EB 2R7OA 3GV7B 3HHDA 5DRKA 3PW4A 2X1BA 2Q1LA 3RR7A 2VPXB 3PZPA 1NRKA 5KFQA 2MKSA 2Q3PA 1P8GA 5AE3A 2ZKUA 2N82B 1Q8LA 4HH0A 4NLSA 4J9OA 2BACA 4ZPAA 3SSRA 4U67Q 4DV0F 4U9RA 3VAHA 4NLUA 3DDKA 4CO2A 1DQ9A 3UPFA 2HHQA 3VAIA 2EPIA 1T02A 1VRTB 5B0BA 4A8SA 2VBZA 4QIFA 4KJIA 2MJNA 2AJFE 5D3GA 2KG1A 5KTQA 4IRDA 4ZP9A 5B7WA 3BZQA 1ELOA 3UD3P 3AJ2A 1GQEA 3PJXA 5A8WA 1R8CA 1T3NA 3HFKA 7FDRA 3RRHA 4XDCA 2YVSA 1SH0A 4PPDA 1XERA 1RT1A 2CQ2A 3VR1A 2HNYB 3VF0B 5F3ZA 4NLRA 4LFBF 4E8UA 1Q4RA 4DR2F 4ELVA 4EU0A 1PSDA 3NRBA 3ZZ0A 3M9MB 4I2QA 4DQIA 3J7YI 1FNMA 2GMLA 3HXMA 1C1BA 2GMJA 4PXCA 2IMOA 4MK7A 2MQOA 1Q78A 1R7IA 4RZRA 3IAS9 4DSEA 2HHXA 1TKZA 3G9CA 2VC1A 5KFTA 3RAXA 1VRUB 4K4SA 4ZCKA 3D0HE 3N5BA 4WFBQ 2K8GA 4H4KC 3FRZA 1T05B 2HLTA 2MQLA 2L41A 4Y65A 2FVSA 2LXFA 4OJGA 5DS7A 4BWJA 4EZ6A 5CZXA 1CQNA 3GIMA 3BGUA 2ZE2A 4YR3A 3SCLE 3GIJA 4AFFA 4ZPVR 3VCDA 5KFWA 1BQNB 2IA0A 4FVCA 1N5VA 5I3QA 5KAKA 3GFYA 2VBYA 2JEIA 1D0EA 3T9ZA 1S6OA 5K14A 2FLPA 2JL9A 2JX2A 5LXRA 4CTAA 3BO2A 4DFMA 1VS3A 5EWGA 1XNRF 3ULHA 1GX6A 1SJRA 1Y3KA 2V5HG 4JI1F 1UVIA 1JJ2R 4J9MA 3ZZYA 5KFFA 1S9EA 3NBPA 1R43A 3BJYA 3JSYA 5JVGQ 3HKZD 2OSRA 2IC3A 1Y9OA 5KFIA 4OFZA 1J5OB 3MF5A 3OFGA 3IR6B 3PIOQ 4C11B 1XC9A 4NOHA 2WBMA 3TX8A 3IG1A 4LSLB 5KG1A 5J2QB 4CO1A 4U7CA 4ETZA 5KFEA 3H5YA 4WTYA 4NLQA 1U7LA 3GMGA 3O8WA 4YB1P 2B5JA 5E33A 1RYRA 3H5XA 4UUXA 1CEZA 4B3SF 4KE5A 3D1OA 2AJ1A 1IKWA 3TVYA 2BVZA 2XMKA 4B17A 3CCQS 2PI5A 4QPXA 1OWXA 1UL3A 2GHWA 5DDQC 2MGZA 5HO4A 5AXKA 4A46A 2WW8A 1G7CB 5A6PA 2HYIB 3ENWA 4LSNA 2B56A 3MMBB 1SH3A 1AW0A 3KLHB 1YTYA 3SV4A 2VQFF 4DR7F 3GV5B 3RB3A 2RD5C 2M5YA 3RZAA 3K58A 4DV7F 4WJBA 2IM3A 2BANA 4L3NA 4YDDB 3HP6A 5GADI 4C8KA 2KT3A 4LIRA 1S48A 3U27A 4ED1A 2FPHX 2PSZA 4CQ1A 5M2UA 3CDAA 4DUYF 3UW1A 1RT3A 1D3WA 3OUYB 2UUWA 3CJ5A 5J2NA 4V19J 2MHEA 2E1RA 2ZDOA 3Q2TC 4YDXA 1QUVA 3SDEB 1WNEA 1HQEB 3DN9A 3MTKA 1HWUA 1U4BA 1FEHA 2W4CA 4NZ0A 4QR1A 2MKKA 1F5AA 3VWSA 4CH0S 3K5MA 1WEZA 3Q24A 1TL3A 2VA2A 2OFGX 2HLUA 4XPEA 3LGNA 4WE1A 2KZMA 5FJ4A 3BO3A 1NJYA 1OIAA 3CO9A 4WZQA 1S4FA 2AX0A 1U1RA 2DHXA 4L6V3 1TAUA 4LVOP 2YKOA 1NHUA 1RGVA 3MAQA 4FP9A 2WSEC 1U48A 1FE0A 2VG7A 1H0HB 1FTRA 2ZD1A 3IS9B 1FRLA 3AB4B 3CCTA 3EYZA 1Y5NB 2EVZA 2YNGA 2CQGA 3BQ1A 4J9RA 2KKHA 5CCLA 2FVPA 1FA0A 3CD0A 2FVRA 1BQMA 3MEEB 2LKZA 2CJ9A 4UOCA 1FRJA 2B4PA 3MPWA 4HDGA 1DTTA 4ITSA 5C24B 4LF7F 3OL8A 1FNOA 4USIA 1S1VB 1REVA 3MM8A 4J5OA 3VZHA 3LP0A 4JV5F 1WWHA 2DNMA 4RW6B 5MAOA 3TP2A 2BYCA 2L9NA 4IKAA 2WOMB 2GX8A 3MPYA 2HPUA 2CQPA 4LT6A 1M5KC 4QWEA 2EW9A 3HVRA 2NS1B 5B0EA 5F9LA 1Y00A 4DLEA 4D3HA 1YRTA 2OKQA 3JYTA 2XS2A 1S1WA 3Q8QB 2RKIA 3AHPA 4F3MA 1JMTA 1U1MA 1H7XA 5F8LA 3DLBA 3HHNB 1LFWA 2IBKA 4CT8A 1N5SA 5CD4H 3CCVS 1MWZA 4X4UA 2Z4PA 3R3TA 4R0EA 4URSA 1HBOB 4DR4F 3UDCA 4RWWA 2BA9A 4RUAA 1SV5A 4X66F 5H9EJ 1MNEA 2HVZA 4GC7A 3LUYA 5I42A 1JX4A 2MQQA 4IG0A 4LQ3A 4YOEA 4K5SA 4MIAA 3Q8RB 3ITHA 1RA6A 2LA4A 2B51A 4K50A 1DTQB 2FB0A 4WYLA 5BR8F 1UVNA 4I6WA 5GAEI 4FYDA 2QSFA 1UJ4A 2J9DA 3OTEA 4HT7A 5G0RA 4ZLPA 4F4ZA 3T1HF 1FKPA 2VFSA 4M5DA 4C8NA 1C0TB 2W8LA 1T3OA 3B8HA 1HFEL 3KK3A 2YKPA 1U45A 1DLOA 1X8DA 2DK2A 2NLWA 1O8BA 3BGFA 4LIWA 4NLOA 1CC7A 1IUJA 3FSXA 1LW0B 3MM9A 4QW8A 5KFMA 1R31A 1U1NA 4DL0C 4B3OB 2I0XA 4K4VA 1NEEA 2LU2A 4RW8B 4EO8A 5KFBA 4ILLA 3MDFA 2V4QA 1U47A 4NMLA 3B4DA 2FJAB 3B82A 5DLFA 2YNFA 1LWFA 1JLCA 4QWBA 3DOKB 1PGZA 2BXJA 1SQEA 4ZPDA 5T7LA 3I9V9 2NYIA 5E0OA 5DO2A 4X4NA 3FZBA 1T95A 4NCAA 2GQ2A 2AF6A 2VG5A 3KLVA 5LSLA 3GILA 3OVBA 4IDKA 3JTPA 1QTMA 3UCUP 4YR0A 4EBCA 2AGPA 2V2KA 3B78A 2KN4A 1LW2B 3PEHA 3T6JA 4KFBA 4EO6A 1IBMF 2HFNA 1YJVA 1YHQS 1NK4A 4QU7A 2Z8QA 2F3JA 5A8KA 3HKWA 2QIFA 5CYMA 4TYAA 5LT5A 2YNHB 3SYZA 3QMQA 2FHJD 1QJHA 2DGUA 3IBWA 2VASA 1KEKA 3KLEB 2VOOA 1UEUA 2EG1A 1QSLA 2EFQA 4F2SA 4B3RF 1Y5LB 3A1YG 3CPWR 2L48A 4NLGA 4ZCLA 3Q0AA 3FMBA 1IJFB 3CEDA 1WHYA 4AE5A 3OBIA 3K7RA 4H4OB 3FNNA 4ALZA 2UXCF 2DNYA 2CPIA 3IR7B 4JYAF 2HMIA 1XMQF