2CNOB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 P17 SUBUNIT
total genus 18
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cnoB00
2CNLB 2P2CB 2XYGB 2XZTB 2H4YB 4ZVUB 1RHRB 1I3OB 2QL7B 3QNWB 1RWMB 1F9EB 2XYPB 1RHJB 1IBCB 4ZVQB 2QL5B 2QLJB 1RWPB 5K20B 3KJQB 2H48B 2QLFB 3NS7B 4ZVRB 4JB8B 3D6MB 2H5JB 2CNOB 4LSZB 4ZVSB 2CNNB 1GFWB 3GJRB 2QLBB 3GJQB 1PYOB 1RWNB 3KJNB 2HBYB 1SC1B 2HBQB 3IBFB 2H65B 1RWWB 3R6GB 1ICEB 2FQQB 2HBZB 3D6FB 2C1EB 2CDRB 2C2OB 3D6HB 1RWXB 3GJSB 2HBRB 5IC4B 1RWKB 1QTNB 3R7NB 3R7SB 2CNKB 1RHUB 1RHKB 3R7BB 2H4WB 4ZVOB 2XYHB 1I51B 1BMQB 1QDUB 2DKOB 2H5IB 3GJTB 2CJYB 4DCOB 4DCJB 3P45B 4ZVTB 2CJXB 2H54B 1RHMB 3R5JB 2QL9B 3IBCB 2C2MB 1PAUB 1RWOB 2C2ZB 4ZVPB 3SIPB 2C2KB 3EDQB 3P4UB 5IC6B 2H51B 3EDRB 3R6LB 2Y0BB 3KJFB 1RWVB 2Y1LB 1RHQB 1SC3B 2XZDB 1RE1B 1NMEB 1SC4B 3RJMB 4DCPB
chains in the Genus database with same CATH superfamily
1IQTA 2ABYA 2RNEA 2W2OP 5HSPA 1RT6A 1TMJA 3QJPA 1QVGR 3QLHB 1EQ0A 1TKTB 3UDCA 4P2SA 2AJ0A 1S0NA 2LQ8A 2HQFA 1X5PA 4USWA 1V6HA 3KHGA 2WHOA 2R8JA 2ZJPQ 4C9DA 1RHRB 1TKXA 1E6VA 4OHVA 3NOGA 4C7QA 1WKLA 3M2RB 1Y5NB 2OEKA 1KEKA 4HT5A 2MKJA 1TFWA 3MECA 5B0BA 4RNMA 5E3QA 3GIJA 3HHLC 1NZ8A 3IRXA 3LGMA 3NP5A 2FJDB 4USVA 5KTQA 3J81j 1X0FA 2DNRA 5F9LA 3CCES 5D15A 2JEIA 1TMMA 2OHDA 2ERRA 1HR0J 1N5QA 2CQ0A 2IJNA 4KKOB 4QWAA 3MAHA 1HKAA 1KFSA 1VC5A 2JFDA 5KFLA 3W8GA 4CTAA 4F4XA 1PG5B 4DR5J 2H48B 1VQYA 2LQBA 3BGUA 3FJ2A 3W1YC 2FLPA 2CUYA 3ZXWA 2HG4A 4ANEA 1FRKA 2R7QA 4IH5A 3W61A 4X64F 2ROGA 1GMVA 3PX4A 2IBOA 1YZ6A 2BEFA 1LW2A 5GAGI 3DXSX 3L7UA 1U1PA 4O0NA 1H72C 3PRVA 1T95A 3M9OB 1UFKA 4FN5A 4B3SJ 2NUUG 1JLAA 3JSRA 5KG3A 4JI5F 1B64A 1RSCA 2CPFA 3PM9A 4NZ0A 3ISNC 3TVZA 1Q81T 4NYOA 4C11B 3RGIA 4X64J 1T05B 2W9BA 1CSJA 2G2OA 4M8LA 3LANA 1JLCB 4WE1B 3R1LA 4NOHA 2C2OB 4O4GA 3DU6A 2R7XA 4HDHA 1R8AA 3W9HA 3TZXA 3BBFA 4LRFA 2L3MA 1N36J 4LFCJ 3TEGA 1IR2A 2YQ1A 5GMEA 4NZ7A 3SYZA 5HP1B 2Y3YA 3NBPA 3DLKB 4ZJLA 4DX7A 2FZCB 2DY9A 4Y2IA 1RHKB 1IKYA 5D78A 2IJRA 4UUXA 1U0HB 5G0RB 1M5KC 2ZNZA 1LKZA 2GJ2A 5GAHI 4ECZA 2D3OR 1H2UX 3RW6A 1DZ5A 4U96A 1PJ5A 4ALZA 1H74A 3NGDA 4DXLA 1RAFB 3TUPA 3UVJA 1VBYA 2VOPA 1NSAA 4GC6A 4DV2J 2JLGA 5DG9A 1L3UA 3HFVA 3PIOQ 2CPXA 3PW7A 2HZCA 1YHQS 1SKWA 2IBKA 4C98A 2H54B 3DYAA 1S72S 2DK2A 4K4ZA 1RHMB 4N8OA 4YB7A 3QGIA 2UZAA 2BE9B 3ENVA 5K8OA 2J6UA 2R4FA 4UY85 1AROP 4CLSA 2WSEC 3BYPA 4KGVB 2BJ7A 1HBMB 4OYOA 3GPAA 3TWZA 1DY3A 1YSJA 4C3LA 5ITHA 3LQVA 2C2ZB 3NBPB 4OYMA 4J9KA 4NA1A 3I96A 1IR0A 4BWMA 2G1DA 1IKYB 1JIHA 2YWEA 1WKJA 1Z4UA 3GIIA 5I42B 4DUYJ 1WD6A 4G1IA 3DLGA 2Y0BB 2YKMB 5KFRA 4OQJA 5DQIA 2G0IA 2XI3A 3E01B 3TVYA 5KFFA 4J9RA 4LF4F 3CCSS 4C8ZA 1SJ3P 2GIQA 3DRSB 1SJQA 3UQSA 4P2FA 3I0SB 3VQSA 2MKCA 3MCMA 4TLRA 2XTJP 4LR9A 5LXYA 4KIAA 1XERA 2V8HA 5BYQA 2GGPA 3GMGA 2FUG9 3BQ1A 4TXSA 1V9OA 2HVDA 3U7JA 5CYQB 4QU6A 2BKPA 5KG1A 2V8GA 3ISND 4PXCA 2Q1LA 5L38A 3G8SA 1RB0A 2X51A 1RTDB 4K4SA 2V6AA 2FYXA 2AMCB 1JLAB 4YEAA 2MQNA 2XGQA 4ECUA 1XTZA 1ZPWX 2PDAA 3M8ZA 1FNXH 3M6WA 1M5VC 1KQSR 3MM7A 1D3WA 4KAIA 3T9ZA 4LF5F 4IR1A 1RT6B 2HIYA 1RAHB 2K06A 4UZBA 1RLCL 2M8DB 3T6JA 3JQMA 4QBUA 5L8RC 4WZMA 2WRMA 2DNGA 4DQIA 2M3DA 2CPEA 2DR5A 4E0DA 3CJ3A 3TQ1A 5HL7Q 4NL5A 5FDLB 1Y7PA 1TL3A 2CFXA 1LNQA 5HMWA 1UZHA 3U27A 3PCOB 2RE1A 3BGRB 3L09A 1HW8A 3CVKA 4AL5A 1KTVA 1Q7YT 2J8SA 2DXDA 5LMNJ 1WNEA 3RZAA 1JLGA 1PJ6A 1WACA 3NNCA 1FWKA 1DRZA 3CJ8A 1U0HA 4IQXA 4NLUA 2MLXA 4DFMA 1QAIA 4JI7J 4EBDA 1IBKF 4WKRA 2E66A 5F8JA 1URRA 2CNOB 4IQMA 3SV4A 4OI2A 1G1XA 1UFWA 4ZP7A 1RKIA 1WF0A 2FJEB 1LWXA 3ITHB 5C25A 1LEOA 5I3QA 4USMA 1FA0A 1CC7A 1WTBA 4WU2A 2F65A 4DFJA 2D7SA 4HDGA 2L41A 2H65B 4FS1A 1HARA 1MLAA 4W98A 4I6YA 4YR0A 1HNVB 4YB5A 4PEOA 5L1JA 2CQHA 3TZZA 2A1BA 5KFQA 3CCRS 1NO8A 3GLJA 3NCRA 2MXYA 3J7AN 3VR1A 1RWXB 4OYZA 5T41A 3HKZD 2KM8C 2JC0A 4IKAA 3T5KA 1DHMA 3JXOA 3RYLA 4UT4A 2AWZA 2KM8B 3DLHA 1UETA 2QYGA 5HI7A 1HYSB 1DQ9A 5C42B 2WB1D 3I0RB 4HACA 4XIUA 3T5HA 4N7TA 2F9DA 4AQYJ 1ZZFA 4A47A 2HNDA 4LR7A 4LSNB 4WPAA 1SL1A 1EZZB 2VFSA 3AOBA 3KHHA 2H4WB 4NLDA 3UD4P 4ZVOB 1OYEA 5K8PA 2W8LA 2JH3A 1TK8A 4OZJA 2ZH7A 2YQ3A 3M9NB 4CLYA 1K8AT 2F3JA 2ILYA 1U6ZA 3TRGA 3ILLA 4QWBA 4CLTA 1HQUB 2YNHB 4J9PA 2XS5A 1TAUA 1FDNA 2B4PA 2GQQA 3KNGA 4OYAA 5A8WB 1RA7A 9ATCB 4X65F 2ZC4A 3TAMB 1J5EJ 1QLNA 2V2ZA 3MEKA 2PA3A 3J7A1 2B8PA 1Q1KA 4QW9A 4OI0A 1S6PB 1KS2A 2BE2B 1Y10A 3DM2B 1N34J 4RUAA 3TA0A 3TUIC 2B6AA 2HK2A 5IFMA 4NYPA 2J6TA 2RS8A 2WB4A 3I9V9 2EFVA 4K4VA 2VG7B 1RWUA 4QIVA 1X5OA 1IJFB 8RUCA 2C3MA 4KHMA 1S4EA 2RB7A 3BYRA 3EVOA 3HD2A 2KHCA 2BOAA 4CYUA 5CZXA 2JC1A 2VPYB 3NGSA 4DBQA 1NLKL 1X4EA 2GVDB 2HRTA 1O8BA 3GG1A 3MAAB 5KFBA 3J80U 2W7PA 5L1KA 4DFKA 4ED6A 1D8YA 4CLPA 4PG6A 5DS7A 1WEYA 3M8QA 1DJ0A 3H2UB 3KWMA 3KXDA 3MOZA 5GAEI 2YWKA 2VOOA 4KJIA 1WOPA 2UUCJ 1L3KA 3GV5B 5J1PA 1C4AA 3P4UB 3FK4A 4ETZA 3H4BA 4NXNJ 1RTJB 2VASA 2VHGA 4ED4A 3KG4A 2QC3A 3U1LA 5C2GA 4C8OA 1N32J 3ADAC 1ZAWA 2DNYA 2MLZA 3AXKA 1R8HA 1HQUA 1YRTA 1WF1A 2YNHA 3FSIA 1SJFA 2AIRB 3OXFA 3M8RA 1SC3B 4AL6A 4B3MF 3HMJG 4PUOB 1S7IA 2PIIA 1AUDA 4DL2A 3L7OA 2HFOA 2XULA 4NXMF 1D8ZA 1DBDA 1SL2A 4ZS6A 5H9FK 2B4UA 3ZFVA 1VQNS 1JB0C 2ATCB 2RF2A 4QWEA 1IN0A 4OX9J 1MN7A 1YX2A 1VJQA 5A76A 4NCGA 1VQ4S 1Q8LA 2R2SA 2AEMA 4JOUA 4KPCA 3FRZA 3JSMA 2NXCA 4CH1A 2BYCA 3PW5A 4EU0A 2KVIA 4CYUB 2E5LF 3C16B 2DR8A 2LXUA 3FEXB 2Z57B 5AXMA 2UUAF 4B3RJ 2AJ1A 1TFYA 1FD2A 4OZNA 3HVAA 3DDKA 1PBAA 1VIXA 1OS5A 2RDJA 1U09A 1TU0B 2VQEF 1Y11A 3G6YA 2V4RA 4DR7F 2LDIA 1SXLA 2KDOA 2VG6A 1UZDA 3TVKA 4ZLPA 5D4PA 4ZPCA 1KBRA 2BX6A 1KLMA 2DXFA 2YVSA 5KFMA 2HURA 2VZ9A 1YLXA 3ZZPA 4OI1A 2XQCA 1U2FA 4HYKA 4I4BA 5ETVA 1JLBB 2NREA 3DRRA 3NEKA 4ZP8A 1TK5A 2B3TB 4FF2A 4ZLNA 3DKDA 3U1NA 2OPRA 3VAJA 1Q86T 1S6UA 4F02A 1CJTA 2CQDA 4UOGA 1VC0A 1GH8A 3FUYA 4ZK7M 4YY3F 4A8WA 4NZ6A 3M8PA 1RTZA 2L9NA 4IH6A 1T0TV 3QRQA 2OMOA 4WE1A 5DG8A 2EFQA 2JX2A 5AE2A 2X1GA 3ENQA 2HBYB 1FVSA 3KJNB 2XNQA 4ZA1A 2JFKA 3IBFB 5EX0A 1GXUA 3R1HA 3R6GB 2DB1A 5KFNA 3UE2A 1YJTA 1HWJA 4IG3B 2V68A 2HZVA 1U48A 2YY3A 4J9NA 1I94F 1UW9A 2NSCA 2OPQA 3CEDA 4OI4A 1SQFA 2W4CA 2HVEA 1RUSA 3AAWB 4S0MA 2BV3A 3FCWA 4A8OA 4DR6J 2L9WA 4URQU 2GQCA 1B0VA 1H98A 1MN9A 8AT1B 4UQGA 3CC2S 3N79A 1N6QA 1Y4ZB 1IKWA 5DJBA 2NPIA 4ILRA 3R7SB 3CCUS 2J7UA 3DI6A 3Q0AA 2AX0A 3BSCA 3THVA 5CXTA 1ACMB 1DLOA 3IR7B 5K8NA 2AQ4A 3C6UB 3FZBA 1VQLS 5EWFA 3C14B 3ENWA 3BM7A 4JYAJ 1VBKA 2FC9A 2HGLA 1TKTA 3FRYA 3SMZA 3OL8A 4U9RA 4KH0B 5HQMA 4OYIA 2YNGB 1MROA 5ETMA 1TL1A 1VOMA 4X62J 1VC6A 1RBLA 1BY9A 3QQCD 3CCZA 2XGPA 3V5RA 2IC3B 3CDEA 1I6JA 5E3CA 4CO1A 1F3VA 3A12A 4CH0S 4ED3A 1ZTTA 4PXBA 5J2MA 2ZZMA 2R7RA 4IRCA 2B8QA 3PRDA 3T5LA 1XR6A 2FHKA 4A8QA 2PFFB 2XY6A 3UN5A 3CJQA 1D9FA 3NL0A 1BWEA 3IS9A 2M9KA 1Q82T 2MHNA 2UUWA 1GXTA 3OSPA 2IM3A 2MY7A 2AYMA 2IDLA 2O1PA 5A6PA 5SZTA 2V34A 4EEYA 3Q86A 1U8SA 3C15B 2ZH2A 3D4JA 5L46A 1D9DA 1HI1A 1QAYA 4M95A 2ACYA 1Q16B 4EFAC 1IWGA 3EGNA 2HWIA 3M2VB 5KFUA 5DM6Q 3F73A 3T3FA 1FK9A 4DFPA 1FJCA 1JLQA 1AT1B 2PEHA 4Y2CA 4DJBA 5CYMB 3RTVA 3TUZC 2GMHA 2YNIB 4BC7A 2BQRA 1OMSA 3DRRB 3R8YA 3AD7C 4DPOA 1U1NA 2ZBQA 4V19J 5BYSA 3H98A 5IXUA 3LP2A 2YX7A 3VAGA 3AB4B 2RRNA 1R89A 2V0NA 2ZFHA 2H1YA 4YN3B 1X4CA 1CJKB 4J9VA 1XBWA 1REGX 4JV2A 4XO0A 2NS1B 1SUQA 3A8EA 3TJ9A 5KT6A 2ZZNA 2OPSB 2R42A 1IR1A 2WVEA 2HHUA 3PRBA 4CCHA 1IUJA 1N5SA 4RX6A 1QUVA 1VQ9S 3RAXA 2LMIA 1IM6A 4CM0A 2VH7A 5IT4A 2OELA 2UVVA 2VODA 3VAHA 2IVMA 1BLUA 1D09B 3HSJA 2G2ZA 4HVZA 1NDKA 1R8PA 3M32B 4U7UD 1JKHB 4NLRA 3MM9B 2CQCA 1JJ2R 2W8KA 3H8YA 3SQOP 4K4WA 3KJVA 4QYZJ 2HHPA 4B9UA 3RR7A 4QR0A 2LEAA 2PMHA 2G13A 4J9OA 1JJ4A 1NKEA 4FPIA 3JTNA 1GTEA 2Y1JA 4U7UK 3IM9A 5KFYA 5LXRA 4PR6A 1ZM9A 3MPWA 1U1RA 1FD8A 4X66F 1U7LA 2FLNA 2GW8A 1SV5A 3VGUA 4EWTA 4DV1J 2CWKA 3A8KA 2OI2A 1FTRA 1RAGB 1IXKA 3AD9C 2QV6A 4QOTA 1B70B 4CLFA 3CCMS 4ECVA 1VQPS 3T19A 1IKVA 2AX1A 3GJQB 2R7TA 4I56A 2YKMA 2Y9HA 4RW4A 4JI8J 4M5IA 4DPXA 2HBQB 4LVNP 1X9SA 1MWZA 1IKXB 3FC9A 3MAQA 5ETPA 2FVRA 3HT3A 5C42A 1UVNA 4QU7A 1HWKA 1GT8A 2XC9A 4LIWA 4K7QA 4DR5F 1HI8A 5CAAA 2P5VA 1UPPA 1JLFA 3IM8A 2E1PA 3FEZA 1NKCA 1UTAA 3UR3C 1QTNB 3MCOA 3R5DA 5C2CA 1A9NB 3R7NB 2CNKB 3I5CA 3QMQA 3MM8B 2RJZA 3Q8PB 5MLCV 3OUYA 3Q89A 1R8CA 2DGOA 2IA0A 5A8WA 4RW6B 4L73A 1EARA 1S59A 1WOOA 1QTMA 2FJVA 4MT1A 3BJYA 2CQIA 4H4KC 3Q8QB 1S1TB 4PXEA 2Y1IA 2PI5A 1M0SA 2YWFA 3Q22A 3OFGA 2W25A 2DBBA 1OPIA 2MKIA 1QD1A 1HNXF 1ZM2A 1LXNA 3CC7S 5JVGQ 2FJXA 2VPXB 3PHTA 1JLGB 1MWYA 2AW0A 2EBEA 3D3BJ 1CJKA 2EPIA 4OLOA 1RT7A 5H9EJ 2AHOB 2MTLA 2Y0SD 3LAKA 4ECTA 5E33A 2MGZB 2DNPA 3NKYA 3TJ8A 2E9RX 3T6BA 2B51A 5KFGA 4TYBA 3GFHA 1TZ0A 4C0OC 1YI2S 4M5HA 2E5HA 3V6HA 1FNOA 4LSLB 4LRDA 1JQGA 4F0KA 4B9LA 4N77A 3KNAA 3CJ0A 3T5JA 3N6LA 5HVFA 3EJMA 3KK2A 2ZUAA 1WF2A 2XBPA 3T9NA 5IT9Y 3HM9A 2MQ8A 5IC6B 4LR8A 3U02A 2B7CB 4RLEA 3NG8A 2HHTA 2QMUB 3SQGB 2YKPA 1KC8T 5EWEA 4DMZA 3SSSA 2F1FA 4RUCA 3J7ZT 3JYTB 3OTBA 2ADBA 4A4JA 2MKHA 4RL1A 2ZH4A 1N4LA 5D0GA 3IGNA 3OJUA 2KT3A 2OPQB 4WYWA 3R3TA 5J2NB 4X4OA 1JMTA 1WHWA 2Z0GA 3HI9A 2ZOMA 4YMEA 3TZWA 3MR2A 4ZJQA 2O01C 4DG1B 2YH0A 2HIQA 2BW2A 3HLUA 3Q8VA 4CM2A 1KQFB 3M05A 1TL1B 4BLGA 2EK1A 3N5BA 4OI6A 1RWMB 2XSJA 2ZE2A 4EBEA 3D2WA 1AB8A 2DYAA 2FIUA 1PILA 2UXDJ 1GMWD 1VR6A 3L95X 4P2MA 4ID5B 4QQBA 1XN9A 2BKNA 4LIRA 1BGXT 1I5OB 1YRXA 2ZDOA 2KZMA 5HJYA 2N4CA 2ZD1B 2ALYB 2V67A 5K20B 3TQEA 3IWXA 6AT1B 2VL1A 5DDPC 1T9VA 2VG5A 3OW2R 2YKQA 2HHSA 3R2CJ 2QLWA 1IM4A 1V3SA 3NGKA 2DO0A 2KB2A 4K0KF 1TL7B 1BQNA 4CLLA 3G9CA 3QT8A 1KHVA 2W7OA 2NYIA 1KLMB 1FXRA 2IYIA 2KI2A 2DR6A 3BKTA 3I5AA 2IVFB 4JV5J 4PG8A 1IBMJ 4Y2MA 1KNZA 2N7CA 3M9MB 5J2QA 1RTHB 1SH3A 1WJ9A 4ZCLA 3K5LA 3VAMA 1KQKA 2E7XA 4KV8B 1N0UA 2DGVA 2FD2A 2HFNA 3HFZB 2BJ9A 4KHRA 3GV7B 2GHPA 3FDSA 3C16A 1NJWA 1PIEA 3PX0A 2E9TA 4F8RA 2WCXA 2J8AA 4OZ1A 2ZITA 5KT2A 2ALZA 1SIZA 4DR2F 1RCXB 4I2QA 1QM9A 4J9QA 5IM0A 4DR4F 2HFUA 2XMVA 2RVJA 4AT1B 2IM0A 3GFYA 2K3KA 3TEHB 3HPOA 1VHIA 1RT2B 1TV6A 3K7RA 1XWLA 4MFBA 4NWBA 3TAPA 1RDRA 3E3XA 3FSYA 1HMVA 3ET6A 3OR2B 3UR0A 4GC7A 2GA7A 3RB6A 3POTA 3QPIA 1VQ7S 2V2KA 2ZH6A 2DNNA 4UW2A 3B82A 4N41A 4WF9Q 1VK8A 1KR4A 5KFPA 4DV6F 1WHYA 5KG2A 3Q8SB 4HTIA 1I51B 4IG0A 1GX5A 1HHSA 2HNYB 3K8WA 5FIIA 3PJXA 4UY8T 3H5XA 1XJWB 3G87A 2FTRA 1C1BA 4I0WA 5CCLA 4IOAQ 5F3TA 1S1XB 2QMWA 3SFGA 2OO4A 3MPYA 4A48A 3W5XA 2RF2B 4HI1A 2YKNA 4NASA 2IJFA 4USIA 3I6PA 1FFGB 3IGVA 3P3DA 3VWSA 9RUBA 4X4PA 3G96A 2C2EA 4FXDA 4DSEA 1N5TA 1C1CA 3LO3A 1PC5A 3T1HJ 2C3PA 1YRUA 3KTQA 1NK5A 2G4BA 4K4UA 3IFEA 2IHR1 4X84A 1KVKA 5ETTA 1PO6A 3KOAA 2CQGA 4WZQA 4JV1A 5JXSA 3I0RA 4HACB 4DUZJ 2BKOA 2DHHA 3LA0A 4KFBA 4NYZA 2WW4A 5K14A 4CQ1A 2HQCA 4KGKA 2IAJB 4IO1A 4CZCA 2YNIA 4AXIA 2GFFA 2HEKA 4KKOA 4B3TJ 1SJRA 4R5PA 1XK8A 3HSGA 1FDBA 1VQSA 5GAHU 1YITS 1X60A 1HW9A 4JI4F 3FBCA 3QAUA 1OIAA 1S9GB 3M6VA 4U67Q 1Q8BA 3CCVS 4ILLA 2CJBA 4ED8A 1PKUA 4TNOA 4MKVA 1YJUA 2W4DA 1SC4B 2R8GA 2HVZA 3FFIA 2DGUA 2DNKA 4H4OB 4DCPB 5DGBA 4ZP9A 2FDNA 1RTIB 4Q5VA 5CD4A 4L3KA 1UCNA 4USHA 3BPSP 2OUGA 3AOAA 6FD1A 1X4AA 1E6YA 3AODA 1SKRA 1HQEA 5HMXA 1NKBA 4AQYF 2XLIA 1YBTA 1B7FA 4EZ9A 4V1Ak 2DNMA 3OUYB 1F9EB 4Z7CA 3QIPA 2W4PA 1JLCA 1FX4A 1NJXA 2DT9A 2DXEA 1Q8KA 2DO4A 2RRAA 3AT1B 2OSRA 4K2XA 5I3PA 1S1TA 4J7CA 3IG1A 1UA1A 3HO1A 1RHJB 2JDJA 3BSAA 3B54A 3DLEB 3I9ZA 4O3OA 3S1TA 3EXCX 3JAMU 1UVJA 5BXIA 5GMKa 5AXLA 3C46A 2HRUA 3IRXB 1Q5YA 3AQPA 3CCTA 1LK5A 2YX1A 2E5JA 4ZPDA 4ZVRB 3US5A 5HVGA 1ZTWA 4Y00A 2CAJA 1HBOA 3G8QA 3QWUA 3CC4S 5LL6d 1HQ2A 1XNRF 3HF5A 4KYZA 3CUNA 1KHWA 2XZWA 3HSZA 3L7PA 3UD3P 2A2DA 2KXNB 4ZVSB 2D3UA 3NAIA 5F9NA 5GADI 2NZ4A 2HQGA 2QLBB 3TZYA 1C1BB 5E3AA 5J2PB 2N82B 4ZLJA 4CO3A 4ZIWA 2ZH3A 1RLDA 5L1LA 4G1PA 3MMCA 4DQQA 3SBMA 4M1KA 3IR5B 1UWAA 3RB0A 1RJJA 4MKBA 3J81U 3CJ2A 5KFCA 4C8YA 4GO5X 4CNYA 1IKVB 2CDRB 4X66J 1OYDA 2ZHOA 5AE3A 4F4WA 3PDNA 2J0SD 2X3GA 2LEPA 3H90A 4IYQA 2QYCA 1VIOA 3EUNA 5DM7Q 2IVYA 3GJSB 2VONA 1GXLA 1YIJS 3LPEA 3HCXA 2WVFA 1FWLA 2N4DA 4ID8A 2E5IA 4L6V3 3S8SA 4Z7YA 4ZIVA 3RR8A 3VZHA 5E0OA 1RZMA 3ENAA 4JUZA 5CQGA 1NK6A 4BBYA 1JLBA 2PEBA 2GCFA 5KFXA 4IUFA 3KLGA 3V6DB 5EUHA 2XS2A 2VD3A 1HD0A 3GFZA 3FQKA 2D9OA 3OHAA 1WG1A 3KLIB 1S9FA 3J7Z5 2XCAA 1HA1A 1UJ5A 3DRYA 4PKDB 3POTB 1NPRA 4N56A 1WG4A 3NNHA 2DKOB 2H5IB 3BN4A 2LLZA 3MDFA 1Q4RA 2IM2A 3LP1A 2EFOA 4KV8A 4WWSA 4RNFA 1NJYA 3QZ8A 1WC4A 1GEHA 3BSOA 3MEEB 5M2UA 3C6TA 2A6OA 2OPSA 2DGWA 2W2QP 4AYBD 1S97A 3P49B 2V9KA 4WCEQ 1CBKA 4YUDA 3R5AA 1AFIA 1NNDA 4Q8EA 2QL9B 5EN1A 4XDDA 1LWFA 4M5MA 4QWDA 2GJIA 2Z30B 1AXQA 1VGYA 3QJJA 3V6KA 3H59A 3NS5A 2CQ2A 1S6QB 4K4XA 3PTWA 3SEOA 1X9WA 3DCAA 3GE9A 3A1YG 4PQUA 3GB0A 5HQ8A 5K8MA 1S99A 2CYYA 4BHQA 2C3UA 4ZCKA 2CJ9A 3NS6A 2J0XA 3OT9A 5A8RB 4F7VA 5F0UA 2I0XA 1C2PA 2FHJD 2HFZA 2LXFA 1LQ9A 3PFOA 4ED1A 2IRYA 2LEBA 1HBOB 3GIRA 3HD1A 4FP9A 2XHWA 3K5MA 2XZDB 3IXQA 3PW4A 2J9EA 3A4TA 3K5PA 3CCJS 5A8KB 4A46A 1HLWA 4G1QA 4F4ZA 4YY3J 1HNIA 2VKRA 2AJFE 4UOFA 4RWXA 4OJHA 3CCQS 2CNLB 3MR7A 4JV0A 1T03B 4KGXB 4ZMMA 5L39A 1RT4A 2XZTB 4R8UA 3CW2C 3KLHB 2RAQA 3N6NA 4QIWD 2ZM6F 4J9SA 1J27A 4O3SA 2C2NA 3GIMA 1T05A 3CD0A 1CJUA 3BSNA 1HNVA 1NH7A 4F3OA 2YKAA 1UWBB 2KTQA 3LH2S 3ISZA 1Y5IB 5F8NA 4FKXA 3OVAA 3KK3A 3SZ2A 4L74A 2EBGA 3DXBA 4ZPWR 4WP3A 5CZVA 4ZVQB 1YJ9S 4KRWA 2QL5B 1ZOTA 4X4SA 4C8KA 3OVSA 5AJ3J 3CJTA 1A7GE 4BDPA 4J91A 5L9NA 4LF4J 1Q8IA 2JHEA 2E5LJ 1AW0A 2CKWA 4JB8B 4PG7A 1U49A 1REVB 5D4LA 2DHSA 2XB2D 4L76A 4B3OB 2U1AA 4V19X 1N88A 2IRXA 4B3TF 4NLYA 2A6MA 3OTOJ 4LF9J 4MK9A 2W1BA 2Q6CA 2YNFA 3MTJA 3WDOA 5D6GA 3O3LA 3BO4A 4JI0J 4LT6A 2M4MA 4QYRA 3JSBA 1S12A 4C11A 2CQ3A 3CCWA 4DUTA 2NCKL 2AZ1A 5LSOA 5GAGU 3NWRA 2A10A 4ANDA 3CB4A 3BH6B 4C0BA 1YQHA 2PN6A 4KFBB 1H2VZ 3I82A 2XY5A 3P6YC 2NLWA 3IRWP 3BB5A 1YJNS 1CPZA 2HPUA 1ZM4A 3DOKA 4Y6IA 3SFUA 1XR5A 2MGZA 4K4YA 2KG0A 5FLXY 1D0EA 3D6HB 2UXCJ 3QIPB 4R5PB 2OH2A 2CIMA 1H0HB 2BQUA 3T41A 1R8BA 5J2NA 3E2EA 3CJKB 4QCLA 3MMBB 3BKFA 4UQTA 3X3UA 3RAQA 1DAXA 2BW7A 1RWKB 1T3OA 2OLWA 4C3KA 4FS2A 3OL7A 5H9FJ 1WC5A 4YB1P 3FFIB 4H4OA 1G7CB 4OMFG 4CNZA 2XLJA 1T9YA 4J5OA 5CABA 1C4CA 2EC2A 4JI1J 5HROA 3AA8A 4ZVGA 5LM7E 4DPYA 4ICLA 3C8YA 4M94A 2Y8WA 2WVDA 2OPRB 4RNHA 3UCGA 2YNFB 1KQGB 1B99A 3HHLA 4IFVA 2YKNB 1TL3B 7AT1B 5F8GA 4H4KA 1TUVA 2FGOA 4IOCQ 2J0QD 1X8DA 3NRBA 2CPZA 4DSJA 1KVIA 4X4UA 3VQTA 2BANA 2R3VA 4E2FB 5KFAA 1W2BR 3W3SA 4P7TA 1NSKL 3QT6A 2EFNA 4M5LA 2HYIB 4F26A 3OVBA 1NHKL 4FDFA 4UOHA 5KFTA 2RUGA 3J7YI 4OHYA 4KBIA 4B17A 4P52A 3OQ2A 3UFCX 1LK7A 4ECYA 1LW0B 4LF7F 1NK4A 4DX5A 4ANCA 2ZH1A 4Q8FA 1J2VA 1NDLA 3HT0A 1RT1A 3ILJA 3KLFA 2FVQA 5KFVA 3MMJA 1VQMS 4DV0F 1FXDA 3D28A 4OZ0A 1MMLA 4O44A 3NOCA 1AFJA 3LUYA 1W25A 5EDWA 1FESA 5IQ6A 1WELA 3CMES 3DMJB 4NRTA 4Y3CA 2C2KB 3IR6B 1M1GA 2GIFA 3MAAA 2B9YA 2HRYA 2J7KA 1R6VA 1FDAA 4PQAA 4RW6A 5IT0A 1U47A 4Q2LA 2VQEJ 2DR9A 1S6QA 2LXIA 4MK7A 2W7AA 4PWDB 4QW8A 3BH7B 3M1VB 1S1WB 3J81Y 2XMAA 3DOLA 1JNRB 4J90A 1D9AA 4JP8A 4IFVB 1BQNB 4C48A 2FB0A 3MMAA 4I6WA 4DR1F 1F9HA 1S49A 1RHQB 4HHHA 4U95A 1Q5VA 1VJWA 2G1HA 1WG5A 3MI7X 3Q2SC 3VHQA 5KFWA 2ZH8A 2VA2A 2GZOA 4WYLA 2XS7A 3RJMB 4ERDA 2GJFA 2MJNA 1TTHB 3KFWX 1L3SA 3N4WA 4NLQA 4DZDA 4C3MA 3OFHA 4TLQA 2KG1A 3CPWR 3I0SA 1WSRA 3O1LA 4JI1F 4K50A 2H4YB 4FYVB 1ZH5A 5ETQA 4CO5A 1B4SA 4Y34A 2ZC3A 4C2MA 3GCXP 4C8LA 3DOMA 2HHHJ 1H7WA 2J9DA 2K3IA 3FNNA 3M7VA 3HX9A 4BS2A 1F0XA 1UJ4A 3OFEA 5EGYA 4NRUA 5JUMA 4LRCA 3KUGA 1YKWA 4MYTA 3DGPB 3LWMA 1HYSA 3IO1A 2DNLA 3GWCA 2C2RA 1FJGJ 4X2BA 1FFWB 2YPZA 1FT8A 1RWPB 4OI3A 4DV6J 3KUEA 4CWBA 5K5MA 3RRHA 1LWEB 2ZEJA 4EO6A 5L1IA 1U8WA 4B9SA 1WI6A 2V8PA 1DTTB 4I64A 4KGZB 3D6MB 3VGTA 4DQRA 2AEJA 1KD1T 2BR0A 2VFTA 4ZOSA 4LF2A 4KC5A 1GFWB 1REVA 2EXUA 3GJRB 2XI2A 2D3ZA 4ZHRB 3ZTOA 4AUKA 1APSA 1ZAVA 2IM1A 4RUHA 3D6TB 2U2FA 3PACA 1E6YB 4PRFA 1V5IB 5DQHA 5DO2A 1RXOB 3QT7A 2O3DA 3K5NA 1RT7B 1NK8A 1IBKJ 2HBZB 4NLPA 3NMRA 1XR7A 2MKSA 2M0GB 2AGPA 2FJWA 2DNOA 1U2RA 2RUSA 3BKUA 4WFNQ 2HMIA 4M5KA 1X4HA 3EXYA 5CYQA 2X1BA 2W2PP 5BJRA 4DV2F 3MR5A 4DL0C 3IS9B 2MZTA 3VAIA 3MOJB 4CO2A 3ZTRA 5HMZA 1QSYA 1VBZA 1PSDA 1NSPA 1SI9A 5KFZA 3W64A 3IC1A 3I4HX 5F8HA 3R5BA 3CJKA 1X5TA 5U47A 4CH7A 4EYHB 3PYFA 2EK6A 3CNQP 2HFVA 2JVOA 3BR8A 3IAS9 4ZVEA 1GMWA 5KFKA 1XMQF 1NDPA 1R0AB 2PA8D 4XDCA 2AD9A 4B08A 4YOEA 1CJVB 5HATA 3T1YJ 2HKEA 3JYTA 1DLOB 3ZTQA 3HHEA 4B9MA 1NZAA 1SJ1A 4JI6J 2KU7A 3ILOA 4O0IA 3J80Y 2DIVA 2DNHA 4NLWA 2VBYA 1NSQA 3DRPA 4R25A 4A8SA 1RTIA 2HFSA 2Z58B 3SCIE 4B3SF 5IWAF 1XIQA 3BZQA 3C19A 1T02A 2CPDA 4RPFA 3KYLA 3K58A 4ZLLA 1WEXA 2KJVA 4C0HA 1U1LA 2C3YA 3BGRA 2D69A 3BGLA 5T7LB 3H5YA 5D0RA 3RUBL 4Y28C 2C2MB 4ECWA 2RQCA 3HVRA 1N32F 1M5SA 4OV6A 3TO8A 3SSRA 4IR9A 4HHJA 1VDHA 4DL6A 2QA2A 5HO4A 1UVKA 4LQ9A 3WBZA 3ZZRA 5IV3A 2WSCC 2AT1B 2PT0A 4U8VA 4JV5F 5EHHA 3KLFB 4DS5A 2DHGA 5L9XA 3UCZP 2UXBF 4XPCA 1OY6A 2BJ3A 1EAYC 2H9ZA 2A0FB 2RMLA 3EGWB 3R6LB 1SKSA 2GS8A 2OPPB 2QEXS 3CXCR 4DSIA 2HVIA 1XQIA 1JNZB 4X65J 2QG9B 1LFWA 4Y2KA 1S48A 4F4YA 1T03A 3F44A 3KLEA 5DDOC 5KG0A 3MFHA 1TVRB 5KFOA 3OSNA 3HK2A 2E44A 2FPHX 2ROPA 3UD5A 1IBMF 4UOCA 1F3FA 2ASLA 2B4VA 4IDKB 4P2XA 2IY5B 2KYXA 2I1RA 3Q8RB 1VRUB 2PC6A 2CA9A 2RQMA 2YPYA 1R6YA 3AQOA 3T1YF 1LWFB 3K8VA 3MUMP 3V4IA 3RRKA 2HQ3A 4DV5J 5F8LA 1HBNB 1YDLA 2MQQA 4QYZK 1S6PA 3BREA 1X4GA 3MEEA 2VPWB 1VLYA 3PFEA 1PYTA 2AEFA 1IBCB 3GYXB 3OXGA 2HSEB 1P9QC 4IRKA 3RB4A 3KDNA 3L3CA 1LW0A 1FDDA 3EMTA 4KE5A 1GTHA 2BANB 1N5VA 1X31C 2O5DA 4ECSA 1Y5LB 4ECQA 2CQBA 4K59A 2D9PA 3UO0A 2W9AA 1Z2LA 1R0AA 3HJFA 3B78A 3MEGB 4LF6J 1ZA2B 4ICLB 2VICA 2WVCA 2ZZTA 3QSIA 2Y1RI 4QIEA 3G6VA 4ECRA 3W9JA 4DR6F 1UW4A 2KYZA 3Q2TC 5ADZA 1JK9B 1PYOB 4YP3A 2FVSA 1RWNB 3ZZUA 2E5GA 2J9DE 3W2VA 1VRTA 2OMLA 4WKYA 1FFSB 4WFAQ 3B4DA 1RWWB 4LF6F 2ADCA 1P27B 1FRMA 3D68A 4F3MA 3BQ2A 2UXCF 2C1EB 2VG7A 4X4QA 1XMOF 2E7WA 3EVWA 1LV5A 3A8JA 3D1QA 1ZPVA 1RU2A 2UP1A 1ZETA 3VGVA 4NA3A 1K1QA 3FQLA 4QZVB 3H5UA 3QO9B 4JI0F 2GVDA 1W26A 5IC4B 4DPUA 3MTKA 4XTTA 2LP4A 2ZH9A 5SUHA 3DC2A 3IWLA 4N5SA 1BUXA 1BWVA 2XY7A 2GV1A 2RHQB 4TU9A 3UDLA 3K57A 2K8GA 2ZBIA 1F5BA 4NLOA 1U25A 2J5AA 1VRQC 2K7JA 1CJUB 3C15A 5IOLA 5K9FA 4TYAA 4CLUA 4PAAA 1WHXA 3D0HE 3W66A 3KK2B 1DTTA 2XYHB 3B8HA 4NMXA 4DV5F 4ZVHA 4W92B 3LPYA 4WP9A 4Q44A 1X4DA 4MTPA 3MXHP 1N33J 4M5NA 1PYSB 5A2QU 2CJYB 1FNMA 3B4MA 3I5BA 3P45B 1GQEA 2OEMA 1NPPA 1N52B 4ZN1A 4TU8A 1RBOB 2VUGA 2WONB 2ZWPA 2HHWA 2OD6A 3LGHA 4ITSA 5E3RA 3RBZA 1HI0P 2F4FA 2JEJA 4NCBA 4GKKJ 4NLVA 3FBEA 1U0SA 2VG6B 4LUBA 1LWCA 2X1AA 1U4BA 3MM7B 1RU1A 2VBZA 3O2IA 2KH9A 1KONA 1Q78A 3M8PB 4O4RA 4OZ3A 1EKRA 2JVRA 3EE3A 4USTA 3AD8C 1ROFA 1WDDA 2I8EA 3HULA 4DV7J 3IG1B 1RAEB 4HL9A 3C6UA 4ZVPB 2DH7A 3SIPB 2M2BA 1RT3B 3CIMA 5B0GA 3WZ0A 3KK1B 5DQGA 3MMAB 4DPTA 1S1VA 1S77D 2FLOA 3I56S 3PNIA 5HVHA 1RKJA 2KL8A 2NYHA 3GFXA 3BDPA 2VBWA 3ETOA 1N6QB 1LWEA 4JBCA 4U8YA 1FXLA 1NB2A 2AJ4A 1FE4A 3F0NA 3BBBA 2K1RA 1RACB 1S9EB 1LXJA 2YKOA 3H2VE 4DV0J 4FXWA 1NMEB 4B9TA 1TKZB 4B9VA 1FE0A 1KDNA 1U02A 3SQGA 1H38A 2HW3A 3DRXA 2HMIB 1O51A 1ZA1B 4GKJJ 1FI4A 2B43A 2LA6A 2RQ4A 5IS2A 2YWWA 4JI6F 1RTHA 2P2CB 4OX8A 3RAMA 7FDRA 3UNYA 4RKUC 3D7SB 4RW4B 3W60A 1LWCB 1RISA 5KOWA 4ZVUB 5A0YA 5HAOA 3ZNJ1 3VTIA 1T3NA 5KT7A 1S5ZA 2Z2ZA 2HS4A 4DR1J 2HS3A 2OFHX 1EETB 2Q66A 4PQUB 5KFEA 1Z2ZA 2QFJA 5C24B 5F3ZA 2AV5A 2CRLA 2F8MA 3EZUA 5GVQA 3V81B 2KFZA 3G6XA 4F4AA 5K14B 2HAFA 2MEWA 5HLFB 3MM5B 1QJHA 4TN2A 1RK8A 2KT5A 4P9SA 2LVWA 2GMLA 4AXJA 4HLBA 4GVBB 1U1QA 2D3O1 5ETSA 1WC1A 3HVTB 4I2PA 3KJQB 4P6QA 3NS7B 5B08A 1R3NA 3E01A 3JQJA 2B9WA 1UL3A 1CVJA 1BQXA 2UU9J 3G2XA 1QE1A 4RW8A 5DZ6A 3D1OA 4EK2A 1SVDA 2CVEA 1WEZA 4DSKA 2F4VJ 4JI2J 3R5CA 2HWTA 4OYXA 3TA1A 2XNRA 4OYBA 1XNQF 1JLEA 3MM6A 4FVMA 4IFYB 1WDTA 2G0JA 3QWPA 2BACA 2CQ1A 1SC1B 1ZZNA 1UMJA 5A0YB 2FQQB 4DV1F 2XLKA 1F2GA 3TOQA 4DUZF 3BS9A 5M2RA 1TL4A 1YJWS 3MHYA 1VMBA 3IMQJ 1OQ3A 3K89A 1VRTB 2OEJA 4QIFA 3PKYA 3VV2B 3C3LA 2VDHA 1WKKA 1YJRA 3PVXA 1VBXA 3T1HF 3K5OA 3MPDA 2RIJA 4EMDA 4PCQA 4PG4A 1UEVA 1HR0F 5BR8F 5J1NA 2GMJA 4LRBA 3N01A 3ZZ0A 1G2EA 1PCAA 2DY1A 2Q79A 2X3DA 4QJVA 5D77A 1V3RA 3PEHA 3HJVA 3CULA 4JI3F 3M32A 1TQLA 2UUBF 3H2LA 2DIUA 2EEYA 2RKIA 5D0EA 4PWWA 4BCAA 1HPZA 3CDAA 1UP1A 3O8WA 4Q7AA 5DETA 4XPEA 4A8KA 4GKKF 4H54A 1S57A 3OL6A 2NXNA 3FSXA 4ZPAA 2BMBA 4H4MA 3VZIA 3M8SA 1XC9A 1YBUA 2BRLA 2MZRA 3MCNA 4NI2B 2ZBCA 3MMCB 3GIKA 1FTCA 3QRRA 1C0TA 1MU2B 2EG1A 3P5TL 3R5JB 4K2JA 3VAFA 4CT8A 2B9EA 1YGYA 2DD8S 3M8YA 1FO1A 3DU5A 4YDXA 1VLOA 2OP5A 3AY0A 4X4RA 4DX6A 4FNHA 2YTCA 2NUHA 2JJ4D 2M88A 1O5JA 4NEZA 2IMWP 1RWOB 2R8KA 2V4QA 1HFEL 2E1MC 2MQPA 5HBMB 2Q43A 3EZ5A 1Y0HA 3PXGa 2W9BB 3C14A 4DL4A 3QAEA 4I6AA 1XNRJ 5IWAJ 2A18A 3EDRB 3Q23A 4ELUA 3DLBA 3TNVA 1K44A 3PV8A 1Q53A 4A8MP 4KY3A 5EX3A 4F3QA 2P9GA 2Z8QA 1YWXA 1UVMA 1NRKA 2IRUA 4Z37A 1HNXJ 3NCQA 5D4OA 4DG1A 1RE1B 2E9ZA 3F41A 2MKKA 4XAKA 1VHFA 4MAKA 2GC8A 3AXMA 1SKUB 4C6AA 5CHCB 4WP8A 4N76A 3PR4A 2ZJQQ 3W5YA 5J2PA 4F0HA 2AP6A 4ATNA 1KOOA 1YK9A 5T7LA 2SXLA 2ZHBA 2HGMA 4WTYA 3LOUA 3VVTA 3TJAA 2XCPA 1FF2A 1X4BA 2DHXA 4IG3A 3OD2A 2ZM6J 1OQ6A 3DDIA 2J6SA 4MK8A 3PW2A 4E8UA 2CPJA 2HAIA 2JLFA 3K0JA 3OXLA 2VQFF 2MQMA 4Y65A 5HANA 2YWHA 4G3IA 1FRXA 3FEYB 5A2QY 5KG7A 2V8DA 2MPUA 2VC0A 4XK8C 2OJ3A 2UUBJ 4O3RA 1CLFA 2D41A 2NXJA 2EWHA 1T9WA 2MDAA 2R7UA 3BPDA 4RW9B 2D74B 1RI7A 2K7KA 3KLGB 3BGOP 4WBFA 3V6DA 3GILA 2YNGA 1MMNA 4KO0A 2F9JA 2RDIA 4LFAJ 4ETXA 2CNNB 5A8KA 5F0WA 1YG0A 1VISA 3CCLS 3R27A 1S7HA 3ETMA 3VCDA 2H3EB 2I2YA 1EIYB 5ETNA 2D1CA 3L9ZA 4U7CA 4NCGB 1PBUA 1TKXB 4Y2AA 2QLXA 4YB6A 4Q43A 4RNOA 2CXEA 1JLFB 4WIIA 2VKZG 5IV4A 3OTOF 2QT7A 1Q0NA 3OR1B 3SSQA 2MQOA 1K1SA 4LJMA 4CIOA 1JXLA 2KJWA 3HZGA 5LMNF 2N3OA 3VF0B 2FY8A 1U1OA 2EW9A 1FWPA 2R8HA 5E3PA 4LREA 4P72A 1EKSA 4O44B 3MCSA 2I38A 1Q79A 1WI8A 4ED7A 1RAIB 2F63A 3QGPA 5KOXA 2YH1A 5CH7B 3CD6S 3SDEB 3WC0A 2EI5A 3HHLD 4HH0A 1S1WA 4DLEA 2HNZA 4DF8A 3G71S 4RU2A 3E51A 3M2UB 3TAQA 1QDUB 1W2IA 2VBXA 3M8WA 2CDQA 2JZ5A 3W2WB 2G0CA 2NSBA 5ETKA 4ZCIA 5CD4H 4DDFA 1SJ4P 1QVFR 1RT5B 1VQ6S 3QGGA 2CJXB 4D3GA 1ZAXA 1S1UA 2LYVA 3K2YA 4NPOA 2UVUA 5C7PA 1YVFA 1VCTA 2XMJA 3OTEA 5BYRA 3VVUA 2XO6A 1XNQJ 1FRLA 4K4TA 1RADB 4D3HA 2BRKA 1NBEB 1Y3JA 3ZO7A 3ULHA 2AYBA 1WSVA 3DNCA 2XMUA 2MKYA 3A13A 2UV8A 3KUHA 1UJ6A 3EX7B 3HZEA 2QFIA 3R9LA 5DDRC 4GRSA 4OZ5A 1HMVB 3ET6B 4F04B 2JEGA 2QA1A 3KJVB 4P74A 4PWUA 2AJQA 3DI6B 1U2CA 5DZ7A 1DQ8A 3NGRA 3EGZA 2ZOGA 3ILIA 1KN6A 1JX4A 4DLGA 1H7XA 2QSFA 1ELOA 1HWUA 1KWMA 1S9EA 2CADA 2CJQA 3OPKA 4I2QB 2WSFC 4IFYA 3JQKA 1K9MT 3IAM9 1O6XA 2OFGX 2V63A 4KQZA 1RWVB 5JMNA 5KT4A 2EC0A 1OSCA 1SH0A 1CS4B 1GK8A 1S1VB 2KKHA 3TP2A 4LF5J 2J0WA 3FBFA 4LMZA 3BDEA 4FPRA 3EWGA 3KMQA 1P9YA 1P6TA 3P8BB 2R2TA 1P1LA 1YBAA 2DHAA 3M2RA 2C28A 2XM3A 1M1KT 1VK3A 1ZYQA 4FF4A 2GIRA 4F50A 3G4SS 3CSKA 2VQFJ 3D1HA 1QSSA 2IMOA 1KKHA 1I3OB 2B5JA 2F8EX 1FERA 2XSFA 3TANA 5HLFA 4TU7A 2GVZA 1T9XA 2RD5C 2QJ3A 3DOKB 2KFYA 4NLTA 3D0GE 4WK1A 1U6FA 2O67A 1B0TA 1T94A 2Q3PA 1K73T 2IAJA 2Z2MA 3EZOA 2OGUA 3WQPA 3ELHA 3KK1A 4O3NA 2FHOB 2RILA 3M4XA 5ETRA 3H4DA 2OIHA 1OWXA 2DGXA 2CQPA 2I5JA 3GYGA 4RBUA 1FJEB 4LFCF 3I4PA 3QFWA 5A8RA 2W9CB 2MMYA 1LW2B 4RR5A 3CD5A 3NNAA 2H5JB 2C42A 3CE8A 2LECA 2HLTA 2QZ8A 1NXIA 3D67A 4HT7A 4MIBA 1HPZB 1SCJB 3JAMY 2DGSA 2WTFA 1U6BA 1X9MA 4RUBA 2I9SA 2ZKUA 1OY8A 2XMKA 4QPTA 4P73A 4K8RA 3UNGC 2XMMA 2LA4A 2WONA 3QT5A 4WFXA 3KLHA 1R0CB 2AJ2A 5HBMA 1S0VA 1T11A 3QO9A 3OHBA 1V3ZA 3BO2A 1RAJA 3AJ1A 1RQ0A 3P96A 3QFHA 4PUOA 3OBIA 2BDPA 2GAGC 3FBBA 3MECB 2ZKTA 4JI7F 4LQ3A 2HHXA 3EM1A 4F67A 2W2NP 2JNJA 2DGTA 3WX8A 1FKAF 3THTA 3EYZA 2Z2LA 5FD1A 1C0UA 4DSFA 1TUGB 4AE5A 4GVLA 4OZLA 1U1MA 2VJUA 2GX8A 4LSLA 2LU2A 1T9UA 1Y9OA 2GHWA 3KLIA 4IH7A 4A8FA 2I6WA 2M8HA 4Q0BA 4RBTA 4DOZA 3TX8A 3LWLA 4E98A 2B7BB 3PZPA 5H9EK 4B3OA 4FVCA 1CULA 2RQKA 2OKQA 3KHLA 2F8HA 1F60B 4PWDA 4RZRA 4WXOA 4DX8H 1SV5B 2JRSA 1GMUA 2QE5A 3HVWA 1CEZA 1IWAA 2WOMB 5AXKA 2IDEA 4YDDB 1NCLA 2WBRA 1G4CA 3CWJA 3GJTB 1NUEA 2GQ2A 3H7HB 5ETOA 1SPBP 4ZVTB 4F2SA 4TKTA 3LP2B 1L3TA 4NE9C 2F5GA 3M2UA 4DQSA 4NXMJ 3QRPA 2WVBA 2G2YA 3OLBA 5LOQA 2DNZA 1WTFA 5FDLA 4LBIA 3W5ZA 3JSYA 3C2PA 1RA6A 4ELTA 2VPZB 2UUCF 1RT5A 2F4VF 2MZ1A 2P9CA 3CO0P 5KFDA 1AZSB 1X4FA 3MPVA 1DTQA 4LRAA 3QZ7A 4LF7J 4FXVA 4FNIA 2VF3A 2KO1A 2V50A 1EETA 5GMDA 2RS2A 2EG2A 1PAUB 1UFLA 1FX2A 2W01A 3JSMB 1RYSA 5M2PA 4USUA 5I3UB 2HNDB 4LSNA 4J9LA 1KFDA 4F0MA 1OO0B 3H5SA 3ZTSA 2AYEA 5G0RA 2MZQA 3K59A 2CPHA 1WHVA 1I1GA 3GZ7A 3LGNA 4ZDNA 3UCUP 5HROB 2UXBJ 4L3NA 3A8IA 1XMBA 4MIWA 4P71A 2GGPB 4DN0A 2NQPA 2QA4S 4LF1A 4DI6A 3GR1A 4RU9A 4RW8B 4DF4A 4MKAA 4I67A 2DEJA 2ZUGA 2UVWA 1R43A 1VYAA 4AFFA 2YBVA 1R31A 3M1VA 2IC3A 3W9IA 4FBTA 4PG5A 3I87A 2Z4PA 2NZCA 4I68A 4KT0C 3B6BA 4FYYB 1S1UB 1HBUB 2J9CA 2PSZA 2EKNA 2J7WA 3M6XA 3NWGA 3UW1A 3W62A 4YQWA 3NAHA 4WIQA 4DEZA 4KHPJ 2PI4A 1U24A 5E2QA 1UPMB 2KVQE 2N7YA 4IOBA 3CO9A 3TW0A 3ZZZA 1TUWA 1BQMB 2BUNA 2O66A 1RABB 3D3CJ 3EGVA 3LAMA 4P10A 3GV8B 4ED0A 4WU3A 5AT1B 2E1AA 1K47A 1RT1B 4M5GA 2QGFB 4PPZA 1FRIA 3MZIA 3RRGA 2CPYA 4J37A 4CLZA 5LT5A 5CA5A 1MSWD 4ZPVR 2XYPB 4N8NA 4DUYF 1KRPA 1URNA 1NHVA 3UN3A 2R2UA 2QLJB 5LMUJ 1CG2A 4KPYA 1W7WA 3RBXA 2V69A 1CQNA 1RAOA 1TR0A 5B7WA 1DFDA 1H3DA 1M1HA 1UA0A 1YJVA 2ZDPA 5J2MB 2QX0A 2KXFA 3V2UC 3HP6A 2F40A 4TQSA 1JJCB 1G3OA 2BM0A 3KLEB 2W9CA 3LP0A 3ICLA 3MEDB 1SC6A 3PG9A 4LSZB 4ZVFA 3I55S 4DSLA 3G6ES 1MROB 3ONQA 3SV3A 3OTCA 5DDQC 1UKUA 2NXEA 1N5YB 2A2CA 2F7VA 4L72B 4H4MB 4QIGA 1RTDA 4JI5J 1TP7A 4O3PA 4ER8A 1K0TA 4EBCA 2LFVA 1CJTB 1B0PA 2VB6A 3DRPB 2CZVC 3FZ2A 3O44A 4I7FB 2DPJA 3GSIA 2FJAB 4M63A 4WTOB 5JJBA 2WZ1A 1SB6A 3UPFA 3KKFA 2BABA 4C4WA 3BN7A 3I31A 2FY1A 5FJ4A 2DH8A 2PMZD 2R2RA 1S0OA 2COLA 3UDVA 4K0KJ 3DHWC 3IWNC 1FK9B 3KK3B 3GYNA 2RT3A 3KG1A 4CO4A 2BBEA 2N3LA 3SCKE 4LFAF 4PABA 2QIFA 2RSQA 3PJWA 4TY8A 1RYRA 1FEEA 1ZBTA 2EFGA 2MSTA 3D66A 5KFSA 2FZGB 4YS2A 2CG8A 2FHJA 2OSQA 5LJ5Y 5AE1A 1VQKS 4MIAA 2GNKA 3S01A 4NLGA 1FKPA 1UAWA 3QATA 3FKBA 3Q8UA 2LU1A 2XO7A 1BC6A 2AF6A 4ZPTR 1K0VA 3UDEA 1BMQB 5D8HB 2V2QA 4KSEB 2DJWA 3MM8A 4NI2A 3WC2A 4RW7A 3GR0A 1EHWA 2NXUA 3S7RA 1FHTA 4CDIA 1GAOA 1FKOA 4KHPF 4DS4A 4DCJB 3CMQA 4G6VB 3I32A 3GONA 4OHXA 1JKHA 4OIXA 3MGJA 3CIZA 4RO0A 1TK0A 1RT4B 1QAJA 1GNKA 4OJ1A 1MNEA 4J9MA 2MZSA 3MD3A 4OX9F 4FYWB 2CVIA 2HK3A 4DL3A 3IBCB 1XMQJ 3ZNUA 3GU0A 4OYPA 4DV7F 1FEHA 1BQMA 2AKWB 2BZ2A 3AJDA 4ELVA 1WUUA 2ZNYA 1HNWJ 2RU3A 4NLXA 3RBEA 1KP6A 2FHMA 2JOQA 4HEA9 3W7BA 1TKDA 2Z2YB 4L75A 1BXNA 1PC4A 2RHSB 2AZ3A 3EVMA 1WC6A 3MM5A 4M5DB 5LMUF 1IBLF 2CPIA 4LF9F 3DGPA 3EDQB 2J76E 2M52A 2JEFA 4Q2MA 2PE8A 1VI7A 1WORA 1F1BB 2KHDA 1CULB 2P8IA 4ZJOA 4OHZA 5DG7A 1N56A 2AYGA 1IVZA 4QR2A 1SQGA 3KJFB 4ZPBA 2Y1LB 3O6QA 1M5OC 3G82A 3PKMA 2FLLA 1Q7LB 2V2VA 2HHHF 1FRHA 2UU9F 1VQOS 3QYYA 2VFVA 3MURP 1KLNA 1X0PA 2BQ3A 3CJSA 4Q45A 1JJHA 2OPPA 5B09A 5KFHA 4W90B 2FGCA 2BE7D 4EGLA 1CS4A 2QSWA 3RBDA 1Q95G 4NX9A 1C1CB 2R7SA 5CYJA 2YX4A 5BR8J 2VFRA 4QPXA 1D1UA 5HK4A 2ZBPA 1R27B 5KAKA 2IFXA 3M8QB 2DRDA 2ZWOA 2M70A 2XWXA 3A3OB 4LVOP 1EB0A 4O4GB 4EI2A 1H2TZ 2IYGA 3IN5A 3CDBA 2BOPA 4WK3A 1P1TA 3DOMB 3JS9A 3AA9A 1EP4A 2ASDA 1OSDA 5ETLA 4M5DA 2VIHA 1T8EA 3FVYA 4DZ6A 4Z2XA 5EWGA 4KO0B 2BJ8A 2ZJRQ 4FYXB 2E29A 4ID5A 2WK4A 3Q8YA 3SDEA 2L9DA 4Y0FA 4HTJA 2XG8A 3BO3A 4MH8A 1PAEX 1VFJA 3GCWP 2BA9A 4ES2A 2BJDA 4PZVA 3FCHA 1N48A 4FF3A 2MLYA 2POKA 2A3JA 2UUTA 2PO4A 1F9FA 2WAQD 3M30A 2EVZA 3BBCA 3V6JA 2Q6BA 2DRAA 3ZC4A 4DN9A 5MAOA 3QIDA 3QLHA 2OTLS 3MWBA 2C2DA 2B4OA 2BE2A 3DM2A 4F36A 2DCUB 2G9OA 5CYMA 4LBHA 2B5JB 5E7OB 1NJIT 4LF8J 3HFKA 3TUJC 4MKYA 1QAXA 3E8OA 1X5SA 4O3QA 3DMJA 3D6FB 4NEYA 4TQRA 2FJBB 1UWBA 3H0PA 4WXWA 3PY8A 1NU4A 3UWTA 1AA1B 3M6UA 4WJBA 1NK9A 3GTYX 4JYAF 1FJGF 1HWLA 3AOCA 1S4FA 4YR3A 1J5EF 4ES1A 1FCAA 1MW7A 3N0VA 4OX6A 1T9TA 2CQ4A 5B0CA 1RP5A 4NA2A 3SCLE 4TY8B 1JXEA 1RT3A 3M2VA 3U1MA 3ZTPA 3THPA 3OLAA 2DITA 4DR3F 1FRJA 2AGOA 4MJKA 3AB2B 1HNZF 3FCVA 1BHNA 3TX0A 1U45A 3K17A 3T1AA 3KLVA 5LJ3Y 1N5YA 1RCOB 4DU7A 2GVZB 4FKYA 2QMXA 2FVCA 2LQ5A 3O5TB 2PGCA 4HHUA 1S6OA 5C5JA 2PMWA 3MD1A 3H25A 3BQ0A 4GMKA 3PO5A 1IKXA 5GADU 2GO8A 1QY7A 2V4JA 1EQMA 3MEGA 4I69A 4KGMA 4CLKA 4OV1A 4RNNA 3PR5B 2QRRA 1HWIA 1NHUA 2B9XA 3LP0B 3MEDA 5DRKA 4BWJA 1QSLA 3AFGA 1Y3KA 1E6VB 4QWCA 3SI8A 1HHTP 1UVLA 4ZCMA 4URGA 2LQJA 1U1KA 1IKWB 2PD1A 5HN0A 1B3TA 3MR3A 4B3MJ 4HH1A 4O23A 2ZOFA 4UZCA 2R7VA 1QUPA 7FD1A 1HBMA 2JLEA 4A8XA 4EZ6A 4DV4J 2DPIA 4FBUA 2LDYA 2X1FA 5B0AA 1J5OA 2KZZA 3WIUA 1H73A 5D0HA 3EICA 2YQ0A 5JVHQ 1HBUA 3ZZOA 5KFJA 2DRBA 3CDUA 1R0BG 3UN2A 1HHQA 3CD7A 3RU0A 5CCMA 4DL7A 3ZZTA 3DLGB 2BJEA 3A3NB 4HI2A 4ED5A 1S79A 1N34F 1EX8A 4OJ3A 5G4DA 1HD1A 5IT9U 3ITHA 1A6LA 4UTGA 3BEGB 2HVHA 2XYGB 2BM1A 4ZKAA 2GHVC 5GAEU 1DARA 4UUWA 2GO9A 1AZSA 3W2VB 2IPOB 2QO3A 2R7WA 4I7FA 3TARA 1L3VA 1SH2A 2QL7B 4OL8A 3QBCA 3QNWB 5KG6A 4DV3J 4P7VA 2DTJA 2ATLA 4B02A 5FLXU 3L4BC 1XEZA 2CG4A 2LCWA 2QTWA 3JTOA 3MF5A 5I3UA 2L48A 2P9EA 2AU0A 5D3GA 4DR7J 1N33F 2RRBA 4IRDA 3DYAB 1T7PA 4LBPA 1F2HA 4FYDA 3FMWA 3FGVA 5KT5A 1V5VA 1ULRA 3NCPA 1TAQA 2BXJA 3UVJB 4DV3F 1SIWB 2E1RA 3GP9A 2MB0B 1S76D 2QLFB 2KRBA 3OR2A 4C8MA 3AHPA 1WC0A 2CZ9A 4NMLA 2CJKA 3N9UC 2B56A 4ILMA 2MHEA 4OLPA 3OJSA 5J1EA 4NCAA 2APOA 2VC1A 2HNZB 2ZD1A 3TR5A 4YHHJ 6FDRA 1A0OB 3OFFA 4PXDA 3HVTA 4EUVA 3HHLB 2HNYA 3OV7A 1N36F 1ITPA 4DPWA 5KG5A 3W2WA 1LFPA 2MY8A 3BF4A 1MG7A 4UF4A 4DR2J 5B0EA 2ZVIA 2E1CA 2M5YA 1TL7A 2K2PA 2ZH5A 3IA0A 3MUVP 3TAMA 1VRUA 5IZHA 4MYUA 3LP1B 3CJ4A 3H40A 1OY9A 3VALA 4OX7A 1SBRA 3G82B 3PIPQ 2OD4A 2W24A 3D9BA 3V4IB 2MQLA 5DLGA 5T14A 3UI3A 1NB7A 1KVJA 1G6BA 2HQDA 1TVRA 1ZS6A 3GG0A 4RJVA 2R9LA 3TI0A 1M90T 4KR0B 1NM2A 5D3GB 4KTQA 1EJ7L 3PJ9A 2ACMA 2CWXA 4I1TA 5AXNA 4IO9Q 4R0JA 2ZHAA 2FVPA 3HHNB 3DFEA 5KFIA 1RHUB 1M5PC 2OTJS 5HJXA 2VFUA 1TKZA 1NH8A 3A3PB 3MFIA 2WOMA 3CGIA 3KHRA 3D54A 3RW7A 3R7BB 4TY9A 3W65A 1S10A 2UUAJ 5HP1A 1FKOB 4B3RF 2LQ9A 3HKWA 3Q83A 3DOLB 5H1SV 4LFBJ 1CQMA 2OAUA 2CZ4A 2NPFA 1HIYA 1S9GA 3CMAS 2ASJA 2P6SA 4X4NA 3GSDA 1IQZA 2JL9A 1VQ5S 3GQCA 4ZP6A 2XSJB 2MSSA 1JLEB 1FVQA 1BE4A 4CRJA 3KMSA 3W63A 2Y8YA 2VG5B 2WW8A 4OHWA 4OZ2A 4X62F 1DURA 3P5BP 1N0VC 2DNQA 3CT9A 1H6KX 1VS3A 4RW7B 3EPGA 4DL5A 2YWGA 3N5FA 3R97A 5LSLA 1XMOJ 1UEKA 2KXHA 4NLSA 4KH1B 4CI0B 2R7OA 2UVRA 4F4KA 4ZN3A 1IJEB 1DQAA 3AJ2A 3KDOA 3NGTA 4LF8F 2HHVA 1N54B 1OPZA 2IIHA 3AH6A 1C0UB 3LTOA 4I2PB 2ZE2B 3HHKA 5KG4A 4DV4F 2HHQA 3S6EA 2HQIA 1P8GA 3R5GA 4FF1A 5RUBA 1F6TA 1Z1ZA 5AJ3F 3V81A 3MR6A 2HS0A 3BR9A 3DGVA 3NLCA 1X7VA 4X4TA 3CJ5A 3DLEA 1NEEA 4EO8A 4F25A 2KFNA 4ENOA 1IBLJ 4QR1A 4N47A 3ZZYA 2VV5A 4J9UE 2VU5A 1LOUA 4YHHF 3MPUB 1WC3A 2Z56B 2C3OA 1CC8A 2FC8A 2XMWA 3PYEA 3BV8A 3MUTP 1RBAA 3VGSA 3G8TA 3DLLQ 5IQQA 4OFZA 1HL6A 1MWQA 4ZHRA 1FKPB 2DGQA 3DHXA 2P6TA 1ZM3A 3RG6A 2K1RB 4YR2A 3KG0A 1S0MA 1RGVA 2JWNA 1B7YB 1RT2A 1TV6B 2RKIB 3OTDA 4HR2A 4MFBB 2ASYA 4MMOA 4P75A 4ED2A 3CJRA 4CO0A 2H5EA 4DU8A 4LFBF 2NR0A 1PJ7A 1SQEA 4JI3J 2L08A 3NY0A 1N8RT 4W4MA 4GO7X 1KOHA 4GKJF 4C8NA 5DGAA 3HXMA 4CTAB 2YXLA 4TVAB 1C0TB 1MU2A 5DLFA 5B0FA 2V4JB 4USJC 4HKQA 1QE1B 2ZVSA 2V94A 1S1XA 4ES3A 3SXLA 3LW5C 1AYEA 3JB9k 2MYFA 4OJGA 5A6WA 4R0EA 2RH3A 1HNWF 2MJUA 2FZKB 2R8IA 4IG0B 1NDCA 3TYTA 1NK0A 5LSRA 1FJ7A 2DVIA 5HMYA 3R2DJ 2DR7A 1WOSA 4M5JA 4DHVA 2ROEA 1PGZA 3OL9A 3H42A 2M7SA 4IDKA 1HNIB 2RU9A 2MZJA 4CT9A 5I4MA 1Y00A 2ILZA 4OYWA 3BGFA 4WFBQ 3NMAA 3X1LB 4BC9A 8ATCB 3NXZA 4CP5A 5IM0B 4JI4J 1ICEB 2XEXA 3HHDA 3PYDA 1HBNA 4JI8F 4U6PA 3CF5Q 3DDNA 3MM6B 2HLUA 1F5AA 2KN4A 1JXVA 2CJAA 3N28A 3QSYB 4DQPA 1RTJA 4NXNF 1DTQB 2ZBRA 2XWYA 1UVIA 2UV8G 1J5OB 1JWWA 3MM9A 1OJ4A 3IP0A 2HBRB 1L5UA 2V8VA 2RDDA 3CDWA 3DN9A 4R8UB 1U26A 3DRSA 1MMDA 2QA4G 2V9WA 3JTPA 3PEJA 4ZITA 2WBMA 2XMTA 3WHIA 2UXDF 3HDSA 2VDIA 3MMBA 4G1QB 4PPDA 3RB3A 1VQ8S 2EFPA 3G86A 3LF0A 3PHEA 4RBVA 5THWA 1GX6A 3VAKA 5I42A 4RW9A 2VJVA 4RWWA 2VA3A 5J1EB 3QJLA 4AL7A 2LKZA 3M30B 1F5CA 3PW0A 1BD6A 3PYGA 4FZVA 4G65A 2IA6A 4EYIB 3C66A 3F56A 4CLWA 3PO4A 4PYDA 2HZAA 2DEIA 3C6TB 3LALA 4DR3J 5J2QB 1HNZJ 4DCOB 1R7IA 4A8YA 3D0IE 4C97A 5E5NA 2V5HG 2GAHC 5F8IA 4ECXA 2QN6B 1TL5A 3CTRA 5F8MA 1AUSL 3DLJA 2DISA 4USKA 1EP4B 1SUQB 2KRRA 4URSA 2JSXA 3N6MA 1O0PA 2X7IA 3OR1A 4GVBA 3FMBA 1YZ7A 2AGQA 3TA2A 3NGUA 1WWHA 3W8PA 2DCLA 5B0DA 3PX6A 4K5SA 1M5HA 4WFZA 2B6AB 1I94J 2KT2A 4B9NA 2E7VA 2W2MP 3DLKA 1NJZA 3WIVA 5C24A 4DWIA 2XHCA 5D4NA 1YTYA 3SCJE 1KSPA 1YJ7A 2EKYA 3H20A 4DR4J 2C22A 4Q0BB 4WFYA 4PYAA 2HGNA 1NPKA 3D5MA 3HSDA 3WX4A 2H51B 3IBWA 1NAQA 4KB7A 1NK7A 1TELA 2I5JB 2PFDA 4JI2F 1UEUA 1CJVA 2DH9A 2HWHA 1KTQA 2BJ1A 5HQLA 4AD6A 3J7YU 4YFUA 3QGHA 5E41A 3Q24A 4F2RA 1SL0A 1RAAB 5KT3A 4K5RA 5F41A 3EPIA 2B0GA 4X4VA 3V4MA 1JLQB 2BVZA 1HQEB 5C25B
chains in the Genus database with same CATH topology
2CNLB 2P2CB 2XYGB 2XZTB 2H4YB 4ZVUB 1RHRB 1I3OB 2QL7B 3QNWB 1RWMB 1F9EB 2XYPB 1RHJB 1IBCB 4ZVQB 2QL5B 2QLJB 1RWPB 5K20B 3KJQB 2H48B 2QLFB 3NS7B 4ZVRB 4JB8B 3D6MB 2H5JB 2CNOB 4LSZB 4ZVSB 2CNNB 1GFWB 3GJRB 2QLBB 3GJQB 1PYOB 1RWNB 3KJNB 2HBYB 1SC1B 2HBQB 3IBFB 2H65B 1RWWB 3R6GB 1ICEB 2FQQB 2HBZB 3D6FB 2C1EB 2CDRB 2C2OB 3D6HB 1RWXB 3GJSB 2HBRB 5IC4B 1RWKB 1QTNB 3R7NB 3R7SB 2CNKB 1RHUB 1RHKB 3R7BB 2H4WB 4ZVOB 2XYHB 1I51B 1BMQB 1QDUB 2DKOB 2H5IB 3GJTB 2CJYB 4DCOB 4DCJB 3P45B 4ZVTB 2CJXB 2H54B 1RHMB 3R5JB 2QL9B 3IBCB 2C2MB 1PAUB 1RWOB 2C2ZB 4ZVPB 3SIPB 2C2KB 3EDQB 3P4UB 5IC6B 2H51B 3EDRB 3R6LB 2Y0BB 3KJFB 1RWVB 2Y1LB 1RHQB 1SC3B 2XZDB 1RE1B 1NMEB 1SC4B 3RJMB 4DCPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNL B;  2P2C B;  2XYG B;  2XZT B;  2H4Y B;  4ZVU B;  1RHR B;  1I3O B;  2QL7 B;  3QNW B;  1RWM B;  1F9E B;  2XYP B;  1RHJ B;  1IBC B;  4ZVQ B;  2QL5 B;  2QLJ B;  1RWP B;  5K20 B;  3KJQ B;  2H48 B;  2QLF B;  3NS7 B;  4ZVR B;  4JB8 B;  3D6M B;  2H5J B;  2CNO B;  4LSZ B;  4ZVS B;  2CNN B;  1GFW B;  3GJR B;  2QLB B;  3GJQ B;  1PYO B;  1RWN B;  3KJN B;  2HBY B;  1SC1 B;  2HBQ B;  3IBF B;  2H65 B;  1RWW B;  3R6G B;  1ICE B;  2FQQ B;  2HBZ B;  3D6F B;  2C1E B;  2CDR B;  2C2O B;  3D6H B;  1RWX B;  3GJS B;  2HBR B;  5IC4 B;  1RWK B;  1QTN B;  3R7N B;  3R7S B;  2CNK B;  1RHU B;  1RHK B;  3R7B B;  2H4W B;  4ZVO B;  2XYH B;  1I51 B;  1BMQ B;  1QDU B;  2DKO B;  2H5I B;  3GJT B;  2CJY B;  4DCO B;  4DCJ B;  3P45 B;  4ZVT B;  2CJX B;  2H54 B;  1RHM B;  3R5J B;  2QL9 B;  3IBC B;  2C2M B;  1PAU B;  1RWO B;  2C2Z B;  4ZVP B;  3SIP B;  2C2K B;  3EDQ B;  3P4U B;  5IC6 B;  2H51 B;  3EDR B;  3R6L B;  2Y0B B;  3KJF B;  1RWV B;  2Y1L B;  1RHQ B;  1SC3 B;  2XZD B;  1RE1 B;  1NME B;  1SC4 B;  3RJM B;  4DCP B; 
#chains in the Genus database with same CATH topology
 1IQT A;  2ABY A;  2RNE A;  2W2O P;  5HSP A;  1RT6 A;  1TMJ A;  3QJP A;  1QVG R;  3QLH B;  1EQ0 A;  1TKT B;  3UDC A;  4P2S A;  2AJ0 A;  1S0N A;  2LQ8 A;  2HQF A;  1X5P A;  4USW A;  1V6H A;  3KHG A;  2WHO A;  2R8J A;  2ZJP Q;  4C9D A;  1RHR B;  1TKX A;  1E6V A;  4OHV A;  3NOG A;  4C7Q A;  1WKL A;  3M2R B;  1Y5N B;  2OEK A;  1KEK A;  4HT5 A;  2MKJ A;  1TFW A;  3MEC A;  5B0B A;  4RNM A;  5E3Q A;  3GIJ A;  3HHL C;  1NZ8 A;  3IRX A;  3LGM A;  3NP5 A;  2FJD B;  4USV A;  5KTQ A;  3J81 j;  1X0F A;  2DNR A;  5F9L A;  3CCE S;  5D15 A;  2JEI A;  1TMM A;  2OHD A;  2ERR A;  1HR0 J;  1N5Q A;  2CQ0 A;  2IJN A;  4KKO B;  4QWA A;  3MAH A;  1HKA A;  1KFS A;  1VC5 A;  2JFD A;  5KFL A;  3W8G A;  4CTA A;  4F4X A;  1PG5 B;  4DR5 J;  2H48 B;  1VQY A;  2LQB A;  3BGU A;  3FJ2 A;  3W1Y C;  2FLP A;  2CUY A;  3ZXW A;  2HG4 A;  4ANE A;  1FRK A;  2R7Q A;  4IH5 A;  3W61 A;  4X64 F;  2ROG A;  1GMV A;  3PX4 A;  2IBO A;  1YZ6 A;  2BEF A;  1LW2 A;  5GAG I;  3DXS X;  3L7U A;  1U1P A;  4O0N A;  1H72 C;  3PRV A;  1T95 A;  3M9O B;  1UFK A;  4FN5 A;  4B3S J;  2NUU G;  1JLA A;  3JSR A;  5KG3 A;  4JI5 F;  1B64 A;  1RSC A;  2CPF A;  3PM9 A;  4NZ0 A;  3ISN C;  3TVZ A;  1Q81 T;  4NYO A;  4C11 B;  3RGI A;  4X64 J;  1T05 B;  2W9B A;  1CSJ A;  2G2O A;  4M8L A;  3LAN A;  1JLC B;  4WE1 B;  3R1L A;  4NOH A;  2C2O B;  4O4G A;  3DU6 A;  2R7X A;  4HDH A;  1R8A A;  3W9H A;  3TZX A;  3BBF A;  4LRF A;  2L3M A;  1N36 J;  4LFC J;  3TEG A;  1IR2 A;  2YQ1 A;  5GME A;  4NZ7 A;  3SYZ A;  5HP1 B;  2Y3Y A;  3NBP A;  3DLK B;  4ZJL A;  4DX7 A;  2FZC B;  2DY9 A;  4Y2I A;  1RHK B;  1IKY A;  5D78 A;  2IJR A;  4UUX A;  1U0H B;  5G0R B;  1M5K C;  2ZNZ A;  1LKZ A;  2GJ2 A;  5GAH I;  4ECZ A;  2D3O R;  1H2U X;  3RW6 A;  1DZ5 A;  4U96 A;  1PJ5 A;  4ALZ A;  1H74 A;  3NGD A;  4DXL A;  1RAF B;  3TUP A;  3UVJ A;  1VBY A;  2VOP A;  1NSA A;  4GC6 A;  4DV2 J;  2JLG A;  5DG9 A;  1L3U A;  3HFV A;  3PIO Q;  2CPX A;  3PW7 A;  2HZC A;  1YHQ S;  1SKW A;  2IBK A;  4C98 A;  2H54 B;  3DYA A;  1S72 S;  2DK2 A;  4K4Z A;  1RHM B;  4N8O A;  4YB7 A;  3QGI A;  2UZA A;  2BE9 B;  3ENV A;  5K8O A;  2J6U A;  2R4F A;  4UY8 5;  1ARO P;  4CLS A;  2WSE C;  3BYP A;  4KGV B;  2BJ7 A;  1HBM B;  4OYO A;  3GPA A;  3TWZ A;  1DY3 A;  1YSJ A;  4C3L A;  5ITH A;  3LQV A;  2C2Z B;  3NBP B;  4OYM A;  4J9K A;  4NA1 A;  3I96 A;  1IR0 A;  4BWM A;  2G1D A;  1IKY B;  1JIH A;  2YWE A;  1WKJ A;  1Z4U A;  3GII A;  5I42 B;  4DUY J;  1WD6 A;  4G1I A;  3DLG A;  2Y0B B;  2YKM B;  5KFR A;  4OQJ A;  5DQI A;  2G0I A;  2XI3 A;  3E01 B;  3TVY A;  5KFF A;  4J9R A;  4LF4 F;  3CCS S;  4C8Z A;  1SJ3 P;  2GIQ A;  3DRS B;  1SJQ A;  3UQS A;  4P2F A;  3I0S B;  3VQS A;  2MKC A;  3MCM A;  4TLR A;  2XTJ P;  4LR9 A;  5LXY A;  4KIA A;  1XER A;  2V8H A;  5BYQ A;  2GGP A;  3GMG A;  2FUG 9;  3BQ1 A;  4TXS A;  1V9O A;  2HVD A;  3U7J A;  5CYQ B;  4QU6 A;  2BKP A;  5KG1 A;  2V8G A;  3ISN D;  4PXC A;  2Q1L A;  5L38 A;  3G8S A;  1RB0 A;  2X51 A;  1RTD B;  4K4S A;  2V6A A;  2FYX A;  2AMC B;  1JLA B;  4YEA A;  2MQN A;  2XGQ A;  4ECU A;  1XTZ A;  1ZPW X;  2PDA A;  3M8Z A;  1FNX H;  3M6W A;  1M5V C;  1KQS R;  3MM7 A;  1D3W A;  4KAI A;  3T9Z A;  4LF5 F;  4IR1 A;  1RT6 B;  2HIY A;  1RAH B;  2K06 A;  4UZB A;  1RLC L;  2M8D B;  3T6J A;  3JQM A;  4QBU A;  5L8R C;  4WZM A;  2WRM A;  2DNG A;  4DQI A;  2M3D A;  2CPE A;  2DR5 A;  4E0D A;  3CJ3 A;  3TQ1 A;  5HL7 Q;  4NL5 A;  5FDL B;  1Y7P A;  1TL3 A;  2CFX A;  1LNQ A;  5HMW A;  1UZH A;  3U27 A;  3PCO B;  2RE1 A;  3BGR B;  3L09 A;  1HW8 A;  3CVK A;  4AL5 A;  1KTV A;  1Q7Y T;  2J8S A;  2DXD A;  5LMN J;  1WNE A;  3RZA A;  1JLG A;  1PJ6 A;  1WAC A;  3NNC A;  1FWK A;  1DRZ A;  3CJ8 A;  1U0H A;  4IQX A;  4NLU A;  2MLX A;  4DFM A;  1QAI A;  4JI7 J;  4EBD A;  1IBK F;  4WKR A;  2E66 A;  5F8J A;  1URR A;  2CNO B;  4IQM A;  3SV4 A;  4OI2 A;  1G1X A;  1UFW A;  4ZP7 A;  1RKI A;  1WF0 A;  2FJE B;  1LWX A;  3ITH B;  5C25 A;  1LEO A;  5I3Q A;  4USM A;  1FA0 A;  1CC7 A;  1WTB A;  4WU2 A;  2F65 A;  4DFJ A;  2D7S A;  4HDG A;  2L41 A;  2H65 B;  4FS1 A;  1HAR A;  1MLA A;  4W98 A;  4I6Y A;  4YR0 A;  1HNV B;  4YB5 A;  4PEO A;  5L1J A;  2CQH A;  3TZZ A;  2A1B A;  5KFQ A;  3CCR S;  1NO8 A;  3GLJ A;  3NCR A;  2MXY A;  3J7A N;  3VR1 A;  1RWX B;  4OYZ A;  5T41 A;  3HKZ D;  2KM8 C;  2JC0 A;  4IKA A;  3T5K A;  1DHM A;  3JXO A;  3RYL A;  4UT4 A;  2AWZ A;  2KM8 B;  3DLH A;  1UET A;  2QYG A;  5HI7 A;  1HYS B;  1DQ9 A;  5C42 B;  2WB1 D;  3I0R B;  4HAC A;  4XIU A;  3T5H A;  4N7T A;  2F9D A;  4AQY J;  1ZZF A;  4A47 A;  2HND A;  4LR7 A;  4LSN B;  4WPA A;  1SL1 A;  1EZZ B;  2VFS A;  3AOB A;  3KHH A;  2H4W B;  4NLD A;  3UD4 P;  4ZVO B;  1OYE A;  5K8P A;  2W8L A;  2JH3 A;  1TK8 A;  4OZJ A;  2ZH7 A;  2YQ3 A;  3M9N B;  4CLY A;  1K8A T;  2F3J A;  2ILY A;  1U6Z A;  3TRG A;  3ILL A;  4QWB A;  4CLT A;  1HQU B;  2YNH B;  4J9P A;  2XS5 A;  1TAU A;  1FDN A;  2B4P A;  2GQQ A;  3KNG A;  4OYA A;  5A8W B;  1RA7 A;  9ATC B;  4X65 F;  2ZC4 A;  3TAM B;  1J5E J;  1QLN A;  2V2Z A;  3MEK A;  2PA3 A;  3J7A 1;  2B8P A;  1Q1K A;  4QW9 A;  4OI0 A;  1S6P B;  1KS2 A;  2BE2 B;  1Y10 A;  3DM2 B;  1N34 J;  4RUA A;  3TA0 A;  3TUI C;  2B6A A;  2HK2 A;  5IFM A;  4NYP A;  2J6T A;  2RS8 A;  2WB4 A;  3I9V 9;  2EFV A;  4K4V A;  2VG7 B;  1RWU A;  4QIV A;  1X5O A;  1IJF B;  8RUC A;  2C3M A;  4KHM A;  1S4E A;  2RB7 A;  3BYR A;  3EVO A;  3HD2 A;  2KHC A;  2BOA A;  4CYU A;  5CZX A;  2JC1 A;  2VPY B;  3NGS A;  4DBQ A;  1NLK L;  1X4E A;  2GVD B;  2HRT A;  1O8B A;  3GG1 A;  3MAA B;  5KFB A;  3J80 U;  2W7P A;  5L1K A;  4DFK A;  4ED6 A;  1D8Y A;  4CLP A;  4PG6 A;  5DS7 A;  1WEY A;  3M8Q A;  1DJ0 A;  3H2U B;  3KWM A;  3KXD A;  3MOZ A;  5GAE I;  2YWK A;  2VOO A;  4KJI A;  1WOP A;  2UUC J;  1L3K A;  3GV5 B;  5J1P A;  1C4A A;  3P4U B;  3FK4 A;  4ETZ A;  3H4B A;  4NXN J;  1RTJ B;  2VAS A;  2VHG A;  4ED4 A;  3KG4 A;  2QC3 A;  3U1L A;  5C2G A;  4C8O A;  1N32 J;  3ADA C;  1ZAW A;  2DNY A;  2MLZ A;  3AXK A;  1R8H A;  1HQU A;  1YRT A;  1WF1 A;  2YNH A;  3FSI A;  1SJF A;  2AIR B;  3OXF A;  3M8R A;  1SC3 B;  4AL6 A;  4B3M F;  3HMJ G;  4PUO B;  1S7I A;  2PII A;  1AUD A;  4DL2 A;  3L7O A;  2HFO A;  2XUL A;  4NXM F;  1D8Z A;  1DBD A;  1SL2 A;  4ZS6 A;  5H9F K;  2B4U A;  3ZFV A;  1VQN S;  1JB0 C;  2ATC B;  2RF2 A;  4QWE A;  1IN0 A;  4OX9 J;  1MN7 A;  1YX2 A;  1VJQ A;  5A76 A;  4NCG A;  1VQ4 S;  1Q8L A;  2R2S A;  2AEM A;  4JOU A;  4KPC A;  3FRZ A;  3JSM A;  2NXC A;  4CH1 A;  2BYC A;  3PW5 A;  4EU0 A;  2KVI A;  4CYU B;  2E5L F;  3C16 B;  2DR8 A;  2LXU A;  3FEX B;  2Z57 B;  5AXM A;  2UUA F;  4B3R J;  2AJ1 A;  1TFY A;  1FD2 A;  4OZN A;  3HVA A;  3DDK A;  1PBA A;  1VIX A;  1OS5 A;  2RDJ A;  1U09 A;  1TU0 B;  2VQE F;  1Y11 A;  3G6Y A;  2V4R A;  4DR7 F;  2LDI A;  1SXL A;  2KDO A;  2VG6 A;  1UZD A;  3TVK A;  4ZLP A;  5D4P A;  4ZPC A;  1KBR A;  2BX6 A;  1KLM A;  2DXF A;  2YVS A;  5KFM A;  2HUR A;  2VZ9 A;  1YLX A;  3ZZP A;  4OI1 A;  2XQC A;  1U2F A;  4HYK A;  4I4B A;  5ETV A;  1JLB B;  2NRE A;  3DRR A;  3NEK A;  4ZP8 A;  1TK5 A;  2B3T B;  4FF2 A;  4ZLN A;  3DKD A;  3U1N A;  2OPR A;  3VAJ A;  1Q86 T;  1S6U A;  4F02 A;  1CJT A;  2CQD A;  4UOG A;  1VC0 A;  1GH8 A;  3FUY A;  4ZK7 M;  4YY3 F;  4A8W A;  4NZ6 A;  3M8P A;  1RTZ A;  2L9N A;  4IH6 A;  1T0T V;  3QRQ A;  2OMO A;  4WE1 A;  5DG8 A;  2EFQ A;  2JX2 A;  5AE2 A;  2X1G A;  3ENQ A;  2HBY B;  1FVS A;  3KJN B;  2XNQ A;  4ZA1 A;  2JFK A;  3IBF B;  5EX0 A;  1GXU A;  3R1H A;  3R6G B;  2DB1 A;  5KFN A;  3UE2 A;  1YJT A;  1HWJ A;  4IG3 B;  2V68 A;  2HZV A;  1U48 A;  2YY3 A;  4J9N A;  1I94 F;  1UW9 A;  2NSC A;  2OPQ A;  3CED A;  4OI4 A;  1SQF A;  2W4C A;  2HVE A;  1RUS A;  3AAW B;  4S0M A;  2BV3 A;  3FCW A;  4A8O A;  4DR6 J;  2L9W A;  4URQ U;  2GQC A;  1B0V A;  1H98 A;  1MN9 A;  8AT1 B;  4UQG A;  3CC2 S;  3N79 A;  1N6Q A;  1Y4Z B;  1IKW A;  5DJB A;  2NPI A;  4ILR A;  3R7S B;  3CCU S;  2J7U A;  3DI6 A;  3Q0A A;  2AX0 A;  3BSC A;  3THV A;  5CXT A;  1ACM B;  1DLO A;  3IR7 B;  5K8N A;  2AQ4 A;  3C6U B;  3FZB A;  1VQL S;  5EWF A;  3C14 B;  3ENW A;  3BM7 A;  4JYA J;  1VBK A;  2FC9 A;  2HGL A;  1TKT A;  3FRY A;  3SMZ A;  3OL8 A;  4U9R A;  4KH0 B;  5HQM A;  4OYI A;  2YNG B;  1MRO A;  5ETM A;  1TL1 A;  1VOM A;  4X62 J;  1VC6 A;  1RBL A;  1BY9 A;  3QQC D;  3CCZ A;  2XGP A;  3V5R A;  2IC3 B;  3CDE A;  1I6J A;  5E3C A;  4CO1 A;  1F3V A;  3A12 A;  4CH0 S;  4ED3 A;  1ZTT A;  4PXB A;  5J2M A;  2ZZM A;  2R7R A;  4IRC A;  2B8Q A;  3PRD A;  3T5L A;  1XR6 A;  2FHK A;  4A8Q A;  2PFF B;  2XY6 A;  3UN5 A;  3CJQ A;  1D9F A;  3NL0 A;  1BWE A;  3IS9 A;  2M9K A;  1Q82 T;  2MHN A;  2UUW A;  1GXT A;  3OSP A;  2IM3 A;  2MY7 A;  2AYM A;  2IDL A;  2O1P A;  5A6P A;  5SZT A;  2V34 A;  4EEY A;  3Q86 A;  1U8S A;  3C15 B;  2ZH2 A;  3D4J A;  5L46 A;  1D9D A;  1HI1 A;  1QAY A;  4M95 A;  2ACY A;  1Q16 B;  4EFA C;  1IWG A;  3EGN A;  2HWI A;  3M2V B;  5KFU A;  5DM6 Q;  3F73 A;  3T3F A;  1FK9 A;  4DFP A;  1FJC A;  1JLQ A;  1AT1 B;  2PEH A;  4Y2C A;  4DJB A;  5CYM B;  3RTV A;  3TUZ C;  2GMH A;  2YNI B;  4BC7 A;  2BQR A;  1OMS A;  3DRR B;  3R8Y A;  3AD7 C;  4DPO A;  1U1N A;  2ZBQ A;  4V19 J;  5BYS A;  3H98 A;  5IXU A;  3LP2 A;  2YX7 A;  3VAG A;  3AB4 B;  2RRN A;  1R89 A;  2V0N A;  2ZFH A;  2H1Y A;  4YN3 B;  1X4C A;  1CJK B;  4J9V A;  1XBW A;  1REG X;  4JV2 A;  4XO0 A;  2NS1 B;  1SUQ A;  3A8E A;  3TJ9 A;  5KT6 A;  2ZZN A;  2OPS B;  2R42 A;  1IR1 A;  2WVE A;  2HHU A;  3PRB A;  4CCH A;  1IUJ A;  1N5S A;  4RX6 A;  1QUV A;  1VQ9 S;  3RAX A;  2LMI A;  1IM6 A;  4CM0 A;  2VH7 A;  5IT4 A;  2OEL A;  2UVV A;  2VOD A;  3VAH A;  2IVM A;  1BLU A;  1D09 B;  3HSJ A;  2G2Z A;  4HVZ A;  1NDK A;  1R8P A;  3M32 B;  4U7U D;  1JKH B;  4NLR A;  3MM9 B;  2CQC A;  1JJ2 R;  2W8K A;  3H8Y A;  3SQO P;  4K4W A;  3KJV A;  4QYZ J;  2HHP A;  4B9U A;  3RR7 A;  4QR0 A;  2LEA A;  2PMH A;  2G13 A;  4J9O A;  1JJ4 A;  1NKE A;  4FPI A;  3JTN A;  1GTE A;  2Y1J A;  4U7U K;  3IM9 A;  5KFY A;  5LXR A;  4PR6 A;  1ZM9 A;  3MPW A;  1U1R A;  1FD8 A;  4X66 F;  1U7L A;  2FLN A;  2GW8 A;  1SV5 A;  3VGU A;  4EWT A;  4DV1 J;  2CWK A;  3A8K A;  2OI2 A;  1FTR A;  1RAG B;  1IXK A;  3AD9 C;  2QV6 A;  4QOT A;  1B70 B;  4CLF A;  3CCM S;  4ECV A;  1VQP S;  3T19 A;  1IKV A;  2AX1 A;  3GJQ B;  2R7T A;  4I56 A;  2YKM A;  2Y9H A;  4RW4 A;  4JI8 J;  4M5I A;  4DPX A;  2HBQ B;  4LVN P;  1X9S A;  1MWZ A;  1IKX B;  3FC9 A;  3MAQ A;  5ETP A;  2FVR A;  3HT3 A;  5C42 A;  1UVN A;  4QU7 A;  1HWK A;  1GT8 A;  2XC9 A;  4LIW A;  4K7Q A;  4DR5 F;  1HI8 A;  5CAA A;  2P5V A;  1UPP A;  1JLF A;  3IM8 A;  2E1P A;  3FEZ A;  1NKC A;  1UTA A;  3UR3 C;  1QTN B;  3MCO A;  3R5D A;  5C2C A;  1A9N B;  3R7N B;  2CNK B;  3I5C A;  3QMQ A;  3MM8 B;  2RJZ A;  3Q8P B;  5MLC V;  3OUY A;  3Q89 A;  1R8C A;  2DGO A;  2IA0 A;  5A8W A;  4RW6 B;  4L73 A;  1EAR A;  1S59 A;  1WOO A;  1QTM A;  2FJV A;  4MT1 A;  3BJY A;  2CQI A;  4H4K C;  3Q8Q B;  1S1T B;  4PXE A;  2Y1I A;  2PI5 A;  1M0S A;  2YWF A;  3Q22 A;  3OFG A;  2W25 A;  2DBB A;  1OPI A;  2MKI A;  1QD1 A;  1HNX F;  1ZM2 A;  1LXN A;  3CC7 S;  5JVG Q;  2FJX A;  2VPX B;  3PHT A;  1JLG B;  1MWY A;  2AW0 A;  2EBE A;  3D3B J;  1CJK A;  2EPI A;  4OLO A;  1RT7 A;  5H9E J;  2AHO B;  2MTL A;  2Y0S D;  3LAK A;  4ECT A;  5E33 A;  2MGZ B;  2DNP A;  3NKY A;  3TJ8 A;  2E9R X;  3T6B A;  2B51 A;  5KFG A;  4TYB A;  3GFH A;  1TZ0 A;  4C0O C;  1YI2 S;  4M5H A;  2E5H A;  3V6H A;  1FNO A;  4LSL B;  4LRD A;  1JQG A;  4F0K A;  4B9L A;  4N77 A;  3KNA A;  3CJ0 A;  3T5J A;  3N6L A;  5HVF A;  3EJM A;  3KK2 A;  2ZUA A;  1WF2 A;  2XBP A;  3T9N A;  5IT9 Y;  3HM9 A;  2MQ8 A;  5IC6 B;  4LR8 A;  3U02 A;  2B7C B;  4RLE A;  3NG8 A;  2HHT A;  2QMU B;  3SQG B;  2YKP A;  1KC8 T;  5EWE A;  4DMZ A;  3SSS A;  2F1F A;  4RUC A;  3J7Z T;  3JYT B;  3OTB A;  2ADB A;  4A4J A;  2MKH A;  4RL1 A;  2ZH4 A;  1N4L A;  5D0G A;  3IGN A;  3OJU A;  2KT3 A;  2OPQ B;  4WYW A;  3R3T A;  5J2N B;  4X4O A;  1JMT A;  1WHW A;  2Z0G A;  3HI9 A;  2ZOM A;  4YME A;  3TZW A;  3MR2 A;  4ZJQ A;  2O01 C;  4DG1 B;  2YH0 A;  2HIQ A;  2BW2 A;  3HLU A;  3Q8V A;  4CM2 A;  1KQF B;  3M05 A;  1TL1 B;  4BLG A;  2EK1 A;  3N5B A;  4OI6 A;  1RWM B;  2XSJ A;  2ZE2 A;  4EBE A;  3D2W A;  1AB8 A;  2DYA A;  2FIU A;  1PIL A;  2UXD J;  1GMW D;  1VR6 A;  3L95 X;  4P2M A;  4ID5 B;  4QQB A;  1XN9 A;  2BKN A;  4LIR A;  1BGX T;  1I5O B;  1YRX A;  2ZDO A;  2KZM A;  5HJY A;  2N4C A;  2ZD1 B;  2ALY B;  2V67 A;  5K20 B;  3TQE A;  3IWX A;  6AT1 B;  2VL1 A;  5DDP C;  1T9V A;  2VG5 A;  3OW2 R;  2YKQ A;  2HHS A;  3R2C J;  2QLW A;  1IM4 A;  1V3S A;  3NGK A;  2DO0 A;  2KB2 A;  4K0K F;  1TL7 B;  1BQN A;  4CLL A;  3G9C A;  3QT8 A;  1KHV A;  2W7O A;  2NYI A;  1KLM B;  1FXR A;  2IYI A;  2KI2 A;  2DR6 A;  3BKT A;  3I5A A;  2IVF B;  4JV5 J;  4PG8 A;  1IBM J;  4Y2M A;  1KNZ A;  2N7C A;  3M9M B;  5J2Q A;  1RTH B;  1SH3 A;  1WJ9 A;  4ZCL A;  3K5L A;  3VAM A;  1KQK A;  2E7X A;  4KV8 B;  1N0U A;  2DGV A;  2FD2 A;  2HFN A;  3HFZ B;  2BJ9 A;  4KHR A;  3GV7 B;  2GHP A;  3FDS A;  3C16 A;  1NJW A;  1PIE A;  3PX0 A;  2E9T A;  4F8R A;  2WCX A;  2J8A A;  4OZ1 A;  2ZIT A;  5KT2 A;  2ALZ A;  1SIZ A;  4DR2 F;  1RCX B;  4I2Q A;  1QM9 A;  4J9Q A;  5IM0 A;  4DR4 F;  2HFU A;  2XMV A;  2RVJ A;  4AT1 B;  2IM0 A;  3GFY A;  2K3K A;  3TEH B;  3HPO A;  1VHI A;  1RT2 B;  1TV6 A;  3K7R A;  1XWL A;  4MFB A;  4NWB A;  3TAP A;  1RDR A;  3E3X A;  3FSY A;  1HMV A;  3ET6 A;  3OR2 B;  3UR0 A;  4GC7 A;  2GA7 A;  3RB6 A;  3POT A;  3QPI A;  1VQ7 S;  2V2K A;  2ZH6 A;  2DNN A;  4UW2 A;  3B82 A;  4N41 A;  4WF9 Q;  1VK8 A;  1KR4 A;  5KFP A;  4DV6 F;  1WHY A;  5KG2 A;  3Q8S B;  4HTI A;  1I51 B;  4IG0 A;  1GX5 A;  1HHS A;  2HNY B;  3K8W A;  5FII A;  3PJX A;  4UY8 T;  3H5X A;  1XJW B;  3G87 A;  2FTR A;  1C1B A;  4I0W A;  5CCL A;  4IOA Q;  5F3T A;  1S1X B;  2QMW A;  3SFG A;  2OO4 A;  3MPY A;  4A48 A;  3W5X A;  2RF2 B;  4HI1 A;  2YKN A;  4NAS A;  2IJF A;  4USI A;  3I6P A;  1FFG B;  3IGV A;  3P3D A;  3VWS A;  9RUB A;  4X4P A;  3G96 A;  2C2E A;  4FXD A;  4DSE A;  1N5T A;  1C1C A;  3LO3 A;  1PC5 A;  3T1H J;  2C3P A;  1YRU A;  3KTQ A;  1NK5 A;  2G4B A;  4K4U A;  3IFE A;  2IHR 1;  4X84 A;  1KVK A;  5ETT A;  1PO6 A;  3KOA A;  2CQG A;  4WZQ A;  4JV1 A;  5JXS A;  3I0R A;  4HAC B;  4DUZ J;  2BKO A;  2DHH A;  3LA0 A;  4KFB A;  4NYZ A;  2WW4 A;  5K14 A;  4CQ1 A;  2HQC A;  4KGK A;  2IAJ B;  4IO1 A;  4CZC A;  2YNI A;  4AXI A;  2GFF A;  2HEK A;  4KKO A;  4B3T J;  1SJR A;  4R5P A;  1XK8 A;  3HSG A;  1FDB A;  1VQS A;  5GAH U;  1YIT S;  1X60 A;  1HW9 A;  4JI4 F;  3FBC A;  3QAU A;  1OIA A;  1S9G B;  3M6V A;  4U67 Q;  1Q8B A;  3CCV S;  4ILL A;  2CJB A;  4ED8 A;  1PKU A;  4TNO A;  4MKV A;  1YJU A;  2W4D A;  1SC4 B;  2R8G A;  2HVZ A;  3FFI A;  2DGU A;  2DNK A;  4H4O B;  4DCP B;  5DGB A;  4ZP9 A;  2FDN A;  1RTI B;  4Q5V A;  5CD4 A;  4L3K A;  1UCN A;  4USH A;  3BPS P;  2OUG A;  3AOA A;  6FD1 A;  1X4A A;  1E6Y A;  3AOD A;  1SKR A;  1HQE A;  5HMX A;  1NKB A;  4AQY F;  2XLI A;  1YBT A;  1B7F A;  4EZ9 A;  4V1A k;  2DNM A;  3OUY B;  1F9E B;  4Z7C A;  3QIP A;  2W4P A;  1JLC A;  1FX4 A;  1NJX A;  2DT9 A;  2DXE A;  1Q8K A;  2DO4 A;  2RRA A;  3AT1 B;  2OSR A;  4K2X A;  5I3P A;  1S1T A;  4J7C A;  3IG1 A;  1UA1 A;  3HO1 A;  1RHJ B;  2JDJ A;  3BSA A;  3B54 A;  3DLE B;  3I9Z A;  4O3O A;  3S1T A;  3EXC X;  3JAM U;  1UVJ A;  5BXI A;  5GMK a;  5AXL A;  3C46 A;  2HRU A;  3IRX B;  1Q5Y A;  3AQP A;  3CCT A;  1LK5 A;  2YX1 A;  2E5J A;  4ZPD A;  4ZVR B;  3US5 A;  5HVG A;  1ZTW A;  4Y00 A;  2CAJ A;  1HBO A;  3G8Q A;  3QWU A;  3CC4 S;  5LL6 d;  1HQ2 A;  1XNR F;  3HF5 A;  4KYZ A;  3CUN A;  1KHW A;  2XZW A;  3HSZ A;  3L7P A;  3UD3 P;  2A2D A;  2KXN B;  4ZVS B;  2D3U A;  3NAI A;  5F9N A;  5GAD I;  2NZ4 A;  2HQG A;  2QLB B;  3TZY A;  1C1B B;  5E3A A;  5J2P B;  2N82 B;  4ZLJ A;  4CO3 A;  4ZIW A;  2ZH3 A;  1RLD A;  5L1L A;  4G1P A;  3MMC A;  4DQQ A;  3SBM A;  4M1K A;  3IR5 B;  1UWA A;  3RB0 A;  1RJJ A;  4MKB A;  3J81 U;  3CJ2 A;  5KFC A;  4C8Y A;  4GO5 X;  4CNY A;  1IKV B;  2CDR B;  4X66 J;  1OYD A;  2ZHO A;  5AE3 A;  4F4W A;  3PDN A;  2J0S D;  2X3G A;  2LEP A;  3H90 A;  4IYQ A;  2QYC A;  1VIO A;  3EUN A;  5DM7 Q;  2IVY A;  3GJS B;  2VON A;  1GXL A;  1YIJ S;  3LPE A;  3HCX A;  2WVF A;  1FWL A;  2N4D A;  4ID8 A;  2E5I A;  4L6V 3;  3S8S A;  4Z7Y A;  4ZIV A;  3RR8 A;  3VZH A;  5E0O A;  1RZM A;  3ENA A;  4JUZ A;  5CQG A;  1NK6 A;  4BBY A;  1JLB A;  2PEB A;  2GCF A;  5KFX A;  4IUF A;  3KLG A;  3V6D B;  5EUH A;  2XS2 A;  2VD3 A;  1HD0 A;  3GFZ A;  3FQK A;  2D9O A;  3OHA A;  1WG1 A;  3KLI B;  1S9F A;  3J7Z 5;  2XCA A;  1HA1 A;  1UJ5 A;  3DRY A;  4PKD B;  3POT B;  1NPR A;  4N56 A;  1WG4 A;  3NNH A;  2DKO B;  2H5I B;  3BN4 A;  2LLZ A;  3MDF A;  1Q4R A;  2IM2 A;  3LP1 A;  2EFO A;  4KV8 A;  4WWS A;  4RNF A;  1NJY A;  3QZ8 A;  1WC4 A;  1GEH A;  3BSO A;  3MEE B;  5M2U A;  3C6T A;  2A6O A;  2OPS A;  2DGW A;  2W2Q P;  4AYB D;  1S97 A;  3P49 B;  2V9K A;  4WCE Q;  1CBK A;  4YUD A;  3R5A A;  1AFI A;  1NND A;  4Q8E A;  2QL9 B;  5EN1 A;  4XDD A;  1LWF A;  4M5M A;  4QWD A;  2GJI A;  2Z30 B;  1AXQ A;  1VGY A;  3QJJ A;  3V6K A;  3H59 A;  3NS5 A;  2CQ2 A;  1S6Q B;  4K4X A;  3PTW A;  3SEO A;  1X9W A;  3DCA A;  3GE9 A;  3A1Y G;  4PQU A;  3GB0 A;  5HQ8 A;  5K8M A;  1S99 A;  2CYY A;  4BHQ A;  2C3U A;  4ZCK A;  2CJ9 A;  3NS6 A;  2J0X A;  3OT9 A;  5A8R B;  4F7V A;  5F0U A;  2I0X A;  1C2P A;  2FHJ D;  2HFZ A;  2LXF A;  1LQ9 A;  3PFO A;  4ED1 A;  2IRY A;  2LEB A;  1HBO B;  3GIR A;  3HD1 A;  4FP9 A;  2XHW A;  3K5M A;  2XZD B;  3IXQ A;  3PW4 A;  2J9E A;  3A4T A;  3K5P A;  3CCJ S;  5A8K B;  4A46 A;  1HLW A;  4G1Q A;  4F4Z A;  4YY3 J;  1HNI A;  2VKR A;  2AJF E;  4UOF A;  4RWX A;  4OJH A;  3CCQ S;  2CNL B;  3MR7 A;  4JV0 A;  1T03 B;  4KGX B;  4ZMM A;  5L39 A;  1RT4 A;  2XZT B;  4R8U A;  3CW2 C;  3KLH B;  2RAQ A;  3N6N A;  4QIW D;  2ZM6 F;  4J9S A;  1J27 A;  4O3S A;  2C2N A;  3GIM A;  1T05 A;  3CD0 A;  1CJU A;  3BSN A;  1HNV A;  1NH7 A;  4F3O A;  2YKA A;  1UWB B;  2KTQ A;  3LH2 S;  3ISZ A;  1Y5I B;  5F8N A;  4FKX A;  3OVA A;  3KK3 A;  3SZ2 A;  4L74 A;  2EBG A;  3DXB A;  4ZPW R;  4WP3 A;  5CZV A;  4ZVQ B;  1YJ9 S;  4KRW A;  2QL5 B;  1ZOT A;  4X4S A;  4C8K A;  3OVS A;  5AJ3 J;  3CJT A;  1A7G E;  4BDP A;  4J91 A;  5L9N A;  4LF4 J;  1Q8I A;  2JHE A;  2E5L J;  1AW0 A;  2CKW A;  4JB8 B;  4PG7 A;  1U49 A;  1REV B;  5D4L A;  2DHS A;  2XB2 D;  4L76 A;  4B3O B;  2U1A A;  4V19 X;  1N88 A;  2IRX A;  4B3T F;  4NLY A;  2A6M A;  3OTO J;  4LF9 J;  4MK9 A;  2W1B A;  2Q6C A;  2YNF A;  3MTJ A;  3WDO A;  5D6G A;  3O3L A;  3BO4 A;  4JI0 J;  4LT6 A;  2M4M A;  4QYR A;  3JSB A;  1S12 A;  4C11 A;  2CQ3 A;  3CCW A;  4DUT A;  2NCK L;  2AZ1 A;  5LSO A;  5GAG U;  3NWR A;  2A10 A;  4AND A;  3CB4 A;  3BH6 B;  4C0B A;  1YQH A;  2PN6 A;  4KFB B;  1H2V Z;  3I82 A;  2XY5 A;  3P6Y C;  2NLW A;  3IRW P;  3BB5 A;  1YJN S;  1CPZ A;  2HPU A;  1ZM4 A;  3DOK A;  4Y6I A;  3SFU A;  1XR5 A;  2MGZ A;  4K4Y A;  2KG0 A;  5FLX Y;  1D0E A;  3D6H B;  2UXC J;  3QIP B;  4R5P B;  2OH2 A;  2CIM A;  1H0H B;  2BQU A;  3T41 A;  1R8B A;  5J2N A;  3E2E A;  3CJK B;  4QCL A;  3MMB B;  3BKF A;  4UQT A;  3X3U A;  3RAQ A;  1DAX A;  2BW7 A;  1RWK B;  1T3O A;  2OLW A;  4C3K A;  4FS2 A;  3OL7 A;  5H9F J;  1WC5 A;  4YB1 P;  3FFI B;  4H4O A;  1G7C B;  4OMF G;  4CNZ A;  2XLJ A;  1T9Y A;  4J5O A;  5CAB A;  1C4C A;  2EC2 A;  4JI1 J;  5HRO A;  3AA8 A;  4ZVG A;  5LM7 E;  4DPY A;  4ICL A;  3C8Y A;  4M94 A;  2Y8W A;  2WVD A;  2OPR B;  4RNH A;  3UCG A;  2YNF B;  1KQG B;  1B99 A;  3HHL A;  4IFV A;  2YKN B;  1TL3 B;  7AT1 B;  5F8G A;  4H4K A;  1TUV A;  2FGO A;  4IOC Q;  2J0Q D;  1X8D A;  3NRB A;  2CPZ A;  4DSJ A;  1KVI A;  4X4U A;  3VQT A;  2BAN A;  2R3V A;  4E2F B;  5KFA A;  1W2B R;  3W3S A;  4P7T A;  1NSK L;  3QT6 A;  2EFN A;  4M5L A;  2HYI B;  4F26 A;  3OVB A;  1NHK L;  4FDF A;  4UOH A;  5KFT A;  2RUG A;  3J7Y I;  4OHY A;  4KBI A;  4B17 A;  4P52 A;  3OQ2 A;  3UFC X;  1LK7 A;  4ECY A;  1LW0 B;  4LF7 F;  1NK4 A;  4DX5 A;  4ANC A;  2ZH1 A;  4Q8F A;  1J2V A;  1NDL A;  3HT0 A;  1RT1 A;  3ILJ A;  3KLF A;  2FVQ A;  5KFV A;  3MMJ A;  1VQM S;  4DV0 F;  1FXD A;  3D28 A;  4OZ0 A;  1MML A;  4O44 A;  3NOC A;  1AFJ A;  3LUY A;  1W25 A;  5EDW A;  1FES A;  5IQ6 A;  1WEL A;  3CME S;  3DMJ B;  4NRT A;  4Y3C A;  2C2K B;  3IR6 B;  1M1G A;  2GIF A;  3MAA A;  2B9Y A;  2HRY A;  2J7K A;  1R6V A;  1FDA A;  4PQA A;  4RW6 A;  5IT0 A;  1U47 A;  4Q2L A;  2VQE J;  2DR9 A;  1S6Q A;  2LXI A;  4MK7 A;  2W7A A;  4PWD B;  4QW8 A;  3BH7 B;  3M1V B;  1S1W B;  3J81 Y;  2XMA A;  3DOL A;  1JNR B;  4J90 A;  1D9A A;  4JP8 A;  4IFV B;  1BQN B;  4C48 A;  2FB0 A;  3MMA A;  4I6W A;  4DR1 F;  1F9H A;  1S49 A;  1RHQ B;  4HHH A;  4U95 A;  1Q5V A;  1VJW A;  2G1H A;  1WG5 A;  3MI7 X;  3Q2S C;  3VHQ A;  5KFW A;  2ZH8 A;  2VA2 A;  2GZO A;  4WYL A;  2XS7 A;  3RJM B;  4ERD A;  2GJF A;  2MJN A;  1TTH B;  3KFW X;  1L3S A;  3N4W A;  4NLQ A;  4DZD A;  4C3M A;  3OFH A;  4TLQ A;  2KG1 A;  3CPW R;  3I0S A;  1WSR A;  3O1L A;  4JI1 F;  4K50 A;  2H4Y B;  4FYV B;  1ZH5 A;  5ETQ A;  4CO5 A;  1B4S A;  4Y34 A;  2ZC3 A;  4C2M A;  3GCX P;  4C8L A;  3DOM A;  2HHH J;  1H7W A;  2J9D A;  2K3I A;  3FNN A;  3M7V A;  3HX9 A;  4BS2 A;  1F0X A;  1UJ4 A;  3OFE A;  5EGY A;  4NRU A;  5JUM A;  4LRC A;  3KUG A;  1YKW A;  4MYT A;  3DGP B;  3LWM A;  1HYS A;  3IO1 A;  2DNL A;  3GWC A;  2C2R A;  1FJG J;  4X2B A;  1FFW B;  2YPZ A;  1FT8 A;  1RWP B;  4OI3 A;  4DV6 J;  3KUE A;  4CWB A;  5K5M A;  3RRH A;  1LWE B;  2ZEJ A;  4EO6 A;  5L1I A;  1U8W A;  4B9S A;  1WI6 A;  2V8P A;  1DTT B;  4I64 A;  4KGZ B;  3D6M B;  3VGT A;  4DQR A;  2AEJ A;  1KD1 T;  2BR0 A;  2VFT A;  4ZOS A;  4LF2 A;  4KC5 A;  1GFW B;  1REV A;  2EXU A;  3GJR B;  2XI2 A;  2D3Z A;  4ZHR B;  3ZTO A;  4AUK A;  1APS A;  1ZAV A;  2IM1 A;  4RUH A;  3D6T B;  2U2F A;  3PAC A;  1E6Y B;  4PRF A;  1V5I B;  5DQH A;  5DO2 A;  1RXO B;  3QT7 A;  2O3D A;  3K5N A;  1RT7 B;  1NK8 A;  1IBK J;  2HBZ B;  4NLP A;  3NMR A;  1XR7 A;  2MKS A;  2M0G B;  2AGP A;  2FJW A;  2DNO A;  1U2R A;  2RUS A;  3BKU A;  4WFN Q;  2HMI A;  4M5K A;  1X4H A;  3EXY A;  5CYQ A;  2X1B A;  2W2P P;  5BJR A;  4DV2 F;  3MR5 A;  4DL0 C;  3IS9 B;  2MZT A;  3VAI A;  3MOJ B;  4CO2 A;  3ZTR A;  5HMZ A;  1QSY A;  1VBZ A;  1PSD A;  1NSP A;  1SI9 A;  5KFZ A;  3W64 A;  3IC1 A;  3I4H X;  5F8H A;  3R5B A;  3CJK A;  1X5T A;  5U47 A;  4CH7 A;  4EYH B;  3PYF A;  2EK6 A;  3CNQ P;  2HFV A;  2JVO A;  3BR8 A;  3IAS 9;  4ZVE A;  1GMW A;  5KFK A;  1XMQ F;  1NDP A;  1R0A B;  2PA8 D;  4XDC A;  2AD9 A;  4B08 A;  4YOE A;  1CJV B;  5HAT A;  3T1Y J;  2HKE A;  3JYT A;  1DLO B;  3ZTQ A;  3HHE A;  4B9M A;  1NZA A;  1SJ1 A;  4JI6 J;  2KU7 A;  3ILO A;  4O0I A;  3J80 Y;  2DIV A;  2DNH A;  4NLW A;  2VBY A;  1NSQ A;  3DRP A;  4R25 A;  4A8S A;  1RTI A;  2HFS A;  2Z58 B;  3SCI E;  4B3S F;  5IWA F;  1XIQ A;  3BZQ A;  3C19 A;  1T02 A;  2CPD A;  4RPF A;  3KYL A;  3K58 A;  4ZLL A;  1WEX A;  2KJV A;  4C0H A;  1U1L A;  2C3Y A;  3BGR A;  2D69 A;  3BGL A;  5T7L B;  3H5Y A;  5D0R A;  3RUB L;  4Y28 C;  2C2M B;  4ECW A;  2RQC A;  3HVR A;  1N32 F;  1M5S A;  4OV6 A;  3TO8 A;  3SSR A;  4IR9 A;  4HHJ A;  1VDH A;  4DL6 A;  2QA2 A;  5HO4 A;  1UVK A;  4LQ9 A;  3WBZ A;  3ZZR A;  5IV3 A;  2WSC C;  2AT1 B;  2PT0 A;  4U8V A;  4JV5 F;  5EHH A;  3KLF B;  4DS5 A;  2DHG A;  5L9X A;  3UCZ P;  2UXB F;  4XPC A;  1OY6 A;  2BJ3 A;  1EAY C;  2H9Z A;  2A0F B;  2RML A;  3EGW B;  3R6L B;  1SKS A;  2GS8 A;  2OPP B;  2QEX S;  3CXC R;  4DSI A;  2HVI A;  1XQI A;  1JNZ B;  4X65 J;  2QG9 B;  1LFW A;  4Y2K A;  1S48 A;  4F4Y A;  1T03 A;  3F44 A;  3KLE A;  5DDO C;  5KG0 A;  3MFH A;  1TVR B;  5KFO A;  3OSN A;  3HK2 A;  2E44 A;  2FPH X;  2ROP A;  3UD5 A;  1IBM F;  4UOC A;  1F3F A;  2ASL A;  2B4V A;  4IDK B;  4P2X A;  2IY5 B;  2KYX A;  2I1R A;  3Q8R B;  1VRU B;  2PC6 A;  2CA9 A;  2RQM A;  2YPY A;  1R6Y A;  3AQO A;  3T1Y F;  1LWF B;  3K8V A;  3MUM P;  3V4I A;  3RRK A;  2HQ3 A;  4DV5 J;  5F8L A;  1HBN B;  1YDL A;  2MQQ A;  4QYZ K;  1S6P A;  3BRE A;  1X4G A;  3MEE A;  2VPW B;  1VLY A;  3PFE A;  1PYT A;  2AEF A;  1IBC B;  3GYX B;  3OXG A;  2HSE B;  1P9Q C;  4IRK A;  3RB4 A;  3KDN A;  3L3C A;  1LW0 A;  1FDD A;  3EMT A;  4KE5 A;  1GTH A;  2BAN B;  1N5V A;  1X31 C;  2O5D A;  4ECS A;  1Y5L B;  4ECQ A;  2CQB A;  4K59 A;  2D9P A;  3UO0 A;  2W9A A;  1Z2L A;  1R0A A;  3HJF A;  3B78 A;  3MEG B;  4LF6 J;  1ZA2 B;  4ICL B;  2VIC A;  2WVC A;  2ZZT A;  3QSI A;  2Y1R I;  4QIE A;  3G6V A;  4ECR A;  3W9J A;  4DR6 F;  1UW4 A;  2KYZ A;  3Q2T C;  5ADZ A;  1JK9 B;  1PYO B;  4YP3 A;  2FVS A;  1RWN B;  3ZZU A;  2E5G A;  2J9D E;  3W2V A;  1VRT A;  2OML A;  4WKY A;  1FFS B;  4WFA Q;  3B4D A;  1RWW B;  4LF6 F;  2ADC A;  1P27 B;  1FRM A;  3D68 A;  4F3M A;  3BQ2 A;  2UXC F;  2C1E B;  2VG7 A;  4X4Q A;  1XMO F;  2E7W A;  3EVW A;  1LV5 A;  3A8J A;  3D1Q A;  1ZPV A;  1RU2 A;  2UP1 A;  1ZET A;  3VGV A;  4NA3 A;  1K1Q A;  3FQL A;  4QZV B;  3H5U A;  3QO9 B;  4JI0 F;  2GVD A;  1W26 A;  5IC4 B;  4DPU A;  3MTK A;  4XTT A;  2LP4 A;  2ZH9 A;  5SUH A;  3DC2 A;  3IWL A;  4N5S A;  1BUX A;  1BWV A;  2XY7 A;  2GV1 A;  2RHQ B;  4TU9 A;  3UDL A;  3K57 A;  2K8G A;  2ZBI A;  1F5B A;  4NLO A;  1U25 A;  2J5A A;  1VRQ C;  2K7J A;  1CJU B;  3C15 A;  5IOL A;  5K9F A;  4TYA A;  4CLU A;  4PAA A;  1WHX A;  3D0H E;  3W66 A;  3KK2 B;  1DTT A;  2XYH B;  3B8H A;  4NMX A;  4DV5 F;  4ZVH A;  4W92 B;  3LPY A;  4WP9 A;  4Q44 A;  1X4D A;  4MTP A;  3MXH P;  1N33 J;  4M5N A;  1PYS B;  5A2Q U;  2CJY B;  1FNM A;  3B4M A;  3I5B A;  3P45 B;  1GQE A;  2OEM A;  1NPP A;  1N52 B;  4ZN1 A;  4TU8 A;  1RBO B;  2VUG A;  2WON B;  2ZWP A;  2HHW A;  2OD6 A;  3LGH A;  4ITS A;  5E3R A;  3RBZ A;  1HI0 P;  2F4F A;  2JEJ A;  4NCB A;  4GKK J;  4NLV A;  3FBE A;  1U0S A;  2VG6 B;  4LUB A;  1LWC A;  2X1A A;  1U4B A;  3MM7 B;  1RU1 A;  2VBZ A;  3O2I A;  2KH9 A;  1KON A;  1Q78 A;  3M8P B;  4O4R A;  4OZ3 A;  1EKR A;  2JVR A;  3EE3 A;  4UST A;  3AD8 C;  1ROF A;  1WDD A;  2I8E A;  3HUL A;  4DV7 J;  3IG1 B;  1RAE B;  4HL9 A;  3C6U A;  4ZVP B;  2DH7 A;  3SIP B;  2M2B A;  1RT3 B;  3CIM A;  5B0G A;  3WZ0 A;  3KK1 B;  5DQG A;  3MMA B;  4DPT A;  1S1V A;  1S77 D;  2FLO A;  3I56 S;  3PNI A;  5HVH A;  1RKJ A;  2KL8 A;  2NYH A;  3GFX A;  3BDP A;  2VBW A;  3ETO A;  1N6Q B;  1LWE A;  4JBC A;  4U8Y A;  1FXL A;  1NB2 A;  2AJ4 A;  1FE4 A;  3F0N A;  3BBB A;  2K1R A;  1RAC B;  1S9E B;  1LXJ A;  2YKO A;  3H2V E;  4DV0 J;  4FXW A;  1NME B;  4B9T A;  1TKZ B;  4B9V A;  1FE0 A;  1KDN A;  1U02 A;  3SQG A;  1H38 A;  2HW3 A;  3DRX A;  2HMI B;  1O51 A;  1ZA1 B;  4GKJ J;  1FI4 A;  2B43 A;  2LA6 A;  2RQ4 A;  5IS2 A;  2YWW A;  4JI6 F;  1RTH A;  2P2C B;  4OX8 A;  3RAM A;  7FDR A;  3UNY A;  4RKU C;  3D7S B;  4RW4 B;  3W60 A;  1LWC B;  1RIS A;  5KOW A;  4ZVU B;  5A0Y A;  5HAO A;  3ZNJ 1;  3VTI A;  1T3N A;  5KT7 A;  1S5Z A;  2Z2Z A;  2HS4 A;  4DR1 J;  2HS3 A;  2OFH X;  1EET B;  2Q66 A;  4PQU B;  5KFE A;  1Z2Z A;  2QFJ A;  5C24 B;  5F3Z A;  2AV5 A;  2CRL A;  2F8M A;  3EZU A;  5GVQ A;  3V81 B;  2KFZ A;  3G6X A;  4F4A A;  5K14 B;  2HAF A;  2MEW A;  5HLF B;  3MM5 B;  1QJH A;  4TN2 A;  1RK8 A;  2KT5 A;  4P9S A;  2LVW A;  2GML A;  4AXJ A;  4HLB A;  4GVB B;  1U1Q A;  2D3O 1;  5ETS A;  1WC1 A;  3HVT B;  4I2P A;  3KJQ B;  4P6Q A;  3NS7 B;  5B08 A;  1R3N A;  3E01 A;  3JQJ A;  2B9W A;  1UL3 A;  1CVJ A;  1BQX A;  2UU9 J;  3G2X A;  1QE1 A;  4RW8 A;  5DZ6 A;  3D1O A;  4EK2 A;  1SVD A;  2CVE A;  1WEZ A;  4DSK A;  2F4V J;  4JI2 J;  3R5C A;  2HWT A;  4OYX A;  3TA1 A;  2XNR A;  4OYB A;  1XNQ F;  1JLE A;  3MM6 A;  4FVM A;  4IFY B;  1WDT A;  2G0J A;  3QWP A;  2BAC A;  2CQ1 A;  1SC1 B;  1ZZN A;  1UMJ A;  5A0Y B;  2FQQ B;  4DV1 F;  2XLK A;  1F2G A;  3TOQ A;  4DUZ F;  3BS9 A;  5M2R A;  1TL4 A;  1YJW S;  3MHY A;  1VMB A;  3IMQ J;  1OQ3 A;  3K89 A;  1VRT B;  2OEJ A;  4QIF A;  3PKY A;  3VV2 B;  3C3L A;  2VDH A;  1WKK A;  1YJR A;  3PVX A;  1VBX A;  3T1H F;  3K5O A;  3MPD A;  2RIJ A;  4EMD A;  4PCQ A;  4PG4 A;  1UEV A;  1HR0 F;  5BR8 F;  5J1N A;  2GMJ A;  4LRB A;  3N01 A;  3ZZ0 A;  1G2E A;  1PCA A;  2DY1 A;  2Q79 A;  2X3D A;  4QJV A;  5D77 A;  1V3R A;  3PEH A;  3HJV A;  3CUL A;  4JI3 F;  3M32 A;  1TQL A;  2UUB F;  3H2L A;  2DIU A;  2EEY A;  2RKI A;  5D0E A;  4PWW A;  4BCA A;  1HPZ A;  3CDA A;  1UP1 A;  3O8W A;  4Q7A A;  5DET A;  4XPE A;  4A8K A;  4GKK F;  4H54 A;  1S57 A;  3OL6 A;  2NXN A;  3FSX A;  4ZPA A;  2BMB A;  4H4M A;  3VZI A;  3M8S A;  1XC9 A;  1YBU A;  2BRL A;  2MZR A;  3MCN A;  4NI2 B;  2ZBC A;  3MMC B;  3GIK A;  1FTC A;  3QRR A;  1C0T A;  1MU2 B;  2EG1 A;  3P5T L;  3R5J B;  4K2J A;  3VAF A;  4CT8 A;  2B9E A;  1YGY A;  2DD8 S;  3M8Y A;  1FO1 A;  3DU5 A;  4YDX A;  1VLO A;  2OP5 A;  3AY0 A;  4X4R A;  4DX6 A;  4FNH A;  2YTC A;  2NUH A;  2JJ4 D;  2M88 A;  1O5J A;  4NEZ A;  2IMW P;  1RWO B;  2R8K A;  2V4Q A;  1HFE L;  2E1M C;  2MQP A;  5HBM B;  2Q43 A;  3EZ5 A;  1Y0H A;  3PXG a;  2W9B B;  3C14 A;  4DL4 A;  3QAE A;  4I6A A;  1XNR J;  5IWA J;  2A18 A;  3EDR B;  3Q23 A;  4ELU A;  3DLB A;  3TNV A;  1K44 A;  3PV8 A;  1Q53 A;  4A8M P;  4KY3 A;  5EX3 A;  4F3Q A;  2P9G A;  2Z8Q A;  1YWX A;  1UVM A;  1NRK A;  2IRU A;  4Z37 A;  1HNX J;  3NCQ A;  5D4O A;  4DG1 A;  1RE1 B;  2E9Z A;  3F41 A;  2MKK A;  4XAK A;  1VHF A;  4MAK A;  2GC8 A;  3AXM A;  1SKU B;  4C6A A;  5CHC B;  4WP8 A;  4N76 A;  3PR4 A;  2ZJQ Q;  3W5Y A;  5J2P A;  4F0H A;  2AP6 A;  4ATN A;  1KOO A;  1YK9 A;  5T7L A;  2SXL A;  2ZHB A;  2HGM A;  4WTY A;  3LOU A;  3VVT A;  3TJA A;  2XCP A;  1FF2 A;  1X4B A;  2DHX A;  4IG3 A;  3OD2 A;  2ZM6 J;  1OQ6 A;  3DDI A;  2J6S A;  4MK8 A;  3PW2 A;  4E8U A;  2CPJ A;  2HAI A;  2JLF A;  3K0J A;  3OXL A;  2VQF F;  2MQM A;  4Y65 A;  5HAN A;  2YWH A;  4G3I A;  1FRX A;  3FEY B;  5A2Q Y;  5KG7 A;  2V8D A;  2MPU A;  2VC0 A;  4XK8 C;  2OJ3 A;  2UUB J;  4O3R A;  1CLF A;  2D41 A;  2NXJ A;  2EWH A;  1T9W A;  2MDA A;  2R7U A;  3BPD A;  4RW9 B;  2D74 B;  1RI7 A;  2K7K A;  3KLG B;  3BGO P;  4WBF A;  3V6D A;  3GIL A;  2YNG A;  1MMN A;  4KO0 A;  2F9J A;  2RDI A;  4LFA J;  4ETX A;  2CNN B;  5A8K A;  5F0W A;  1YG0 A;  1VIS A;  3CCL S;  3R27 A;  1S7H A;  3ETM A;  3VCD A;  2H3E B;  2I2Y A;  1EIY B;  5ETN A;  2D1C A;  3L9Z A;  4U7C A;  4NCG B;  1PBU A;  1TKX B;  4Y2A A;  2QLX A;  4YB6 A;  4Q43 A;  4RNO A;  2CXE A;  1JLF B;  4WII A;  2VKZ G;  5IV4 A;  3OTO F;  2QT7 A;  1Q0N A;  3OR1 B;  3SSQ A;  2MQO A;  1K1S A;  4LJM A;  4CIO A;  1JXL A;  2KJW A;  3HZG A;  5LMN F;  2N3O A;  3VF0 B;  2FY8 A;  1U1O A;  2EW9 A;  1FWP A;  2R8H A;  5E3P A;  4LRE A;  4P72 A;  1EKS A;  4O44 B;  3MCS A;  2I38 A;  1Q79 A;  1WI8 A;  4ED7 A;  1RAI B;  2F63 A;  3QGP A;  5KOX A;  2YH1 A;  5CH7 B;  3CD6 S;  3SDE B;  3WC0 A;  2EI5 A;  3HHL D;  4HH0 A;  1S1W A;  4DLE A;  2HNZ A;  4DF8 A;  3G71 S;  4RU2 A;  3E51 A;  3M2U B;  3TAQ A;  1QDU B;  1W2I A;  2VBX A;  3M8W A;  2CDQ A;  2JZ5 A;  3W2W B;  2G0C A;  2NSB A;  5ETK A;  4ZCI A;  5CD4 H;  4DDF A;  1SJ4 P;  1QVF R;  1RT5 B;  1VQ6 S;  3QGG A;  2CJX B;  4D3G A;  1ZAX A;  1S1U A;  2LYV A;  3K2Y A;  4NPO A;  2UVU A;  5C7P A;  1YVF A;  1VCT A;  2XMJ A;  3OTE A;  5BYR A;  3VVU A;  2XO6 A;  1XNQ J;  1FRL A;  4K4T A;  1RAD B;  4D3H A;  2BRK A;  1NBE B;  1Y3J A;  3ZO7 A;  3ULH A;  2AYB A;  1WSV A;  3DNC A;  2XMU A;  2MKY A;  3A13 A;  2UV8 A;  3KUH A;  1UJ6 A;  3EX7 B;  3HZE A;  2QFI A;  3R9L A;  5DDR C;  4GRS A;  4OZ5 A;  1HMV B;  3ET6 B;  4F04 B;  2JEG A;  2QA1 A;  3KJV B;  4P74 A;  4PWU A;  2AJQ A;  3DI6 B;  1U2C A;  5DZ7 A;  1DQ8 A;  3NGR A;  3EGZ A;  2ZOG A;  3ILI A;  1KN6 A;  1JX4 A;  4DLG A;  1H7X A;  2QSF A;  1ELO A;  1HWU A;  1KWM A;  1S9E A;  2CAD A;  2CJQ A;  3OPK A;  4I2Q B;  2WSF C;  4IFY A;  3JQK A;  1K9M T;  3IAM 9;  1O6X A;  2OFG X;  2V63 A;  4KQZ A;  1RWV B;  5JMN A;  5KT4 A;  2EC0 A;  1OSC A;  1SH0 A;  1CS4 B;  1GK8 A;  1S1V B;  2KKH A;  3TP2 A;  4LF5 J;  2J0W A;  3FBF A;  4LMZ A;  3BDE A;  4FPR A;  3EWG A;  3KMQ A;  1P9Y A;  1P6T A;  3P8B B;  2R2T A;  1P1L A;  1YBA A;  2DHA A;  3M2R A;  2C28 A;  2XM3 A;  1M1K T;  1VK3 A;  1ZYQ A;  4FF4 A;  2GIR A;  4F50 A;  3G4S S;  3CSK A;  2VQF J;  3D1H A;  1QSS A;  2IMO A;  1KKH A;  1I3O B;  2B5J A;  2F8E X;  1FER A;  2XSF A;  3TAN A;  5HLF A;  4TU7 A;  2GVZ A;  1T9X A;  2RD5 C;  2QJ3 A;  3DOK B;  2KFY A;  4NLT A;  3D0G E;  4WK1 A;  1U6F A;  2O67 A;  1B0T A;  1T94 A;  2Q3P A;  1K73 T;  2IAJ A;  2Z2M A;  3EZO A;  2OGU A;  3WQP A;  3ELH A;  3KK1 A;  4O3N A;  2FHO B;  2RIL A;  3M4X A;  5ETR A;  3H4D A;  2OIH A;  1OWX A;  2DGX A;  2CQP A;  2I5J A;  3GYG A;  4RBU A;  1FJE B;  4LFC F;  3I4P A;  3QFW A;  5A8R A;  2W9C B;  2MMY A;  1LW2 B;  4RR5 A;  3CD5 A;  3NNA A;  2H5J B;  2C42 A;  3CE8 A;  2LEC A;  2HLT A;  2QZ8 A;  1NXI A;  3D67 A;  4HT7 A;  4MIB A;  1HPZ B;  1SCJ B;  3JAM Y;  2DGS A;  2WTF A;  1U6B A;  1X9M A;  4RUB A;  2I9S A;  2ZKU A;  1OY8 A;  2XMK A;  4QPT A;  4P73 A;  4K8R A;  3UNG C;  2XMM A;  2LA4 A;  2WON A;  3QT5 A;  4WFX A;  3KLH A;  1R0C B;  2AJ2 A;  5HBM A;  1S0V A;  1T11 A;  3QO9 A;  3OHB A;  1V3Z A;  3BO2 A;  1RAJ A;  3AJ1 A;  1RQ0 A;  3P96 A;  3QFH A;  4PUO A;  3OBI A;  2BDP A;  2GAG C;  3FBB A;  3MEC B;  2ZKT A;  4JI7 F;  4LQ3 A;  2HHX A;  3EM1 A;  4F67 A;  2W2N P;  2JNJ A;  2DGT A;  3WX8 A;  1FKA F;  3THT A;  3EYZ A;  2Z2L A;  5FD1 A;  1C0U A;  4DSF A;  1TUG B;  4AE5 A;  4GVL A;  4OZL A;  1U1M A;  2VJU A;  2GX8 A;  4LSL A;  2LU2 A;  1T9U A;  1Y9O A;  2GHW A;  3KLI A;  4IH7 A;  4A8F A;  2I6W A;  2M8H A;  4Q0B A;  4RBT A;  4DOZ A;  3TX8 A;  3LWL A;  4E98 A;  2B7B B;  3PZP A;  5H9E K;  4B3O A;  4FVC A;  1CUL A;  2RQK A;  2OKQ A;  3KHL A;  2F8H A;  1F60 B;  4PWD A;  4RZR A;  4WXO A;  4DX8 H;  1SV5 B;  2JRS A;  1GMU A;  2QE5 A;  3HVW A;  1CEZ A;  1IWA A;  2WOM B;  5AXK A;  2IDE A;  4YDD B;  1NCL A;  2WBR A;  1G4C A;  3CWJ A;  3GJT B;  1NUE A;  2GQ2 A;  3H7H B;  5ETO A;  1SPB P;  4ZVT B;  4F2S A;  4TKT A;  3LP2 B;  1L3T A;  4NE9 C;  2F5G A;  3M2U A;  4DQS A;  4NXM J;  3QRP A;  2WVB A;  2G2Y A;  3OLB A;  5LOQ A;  2DNZ A;  1WTF A;  5FDL A;  4LBI A;  3W5Z A;  3JSY A;  3C2P A;  1RA6 A;  4ELT A;  2VPZ B;  2UUC F;  1RT5 A;  2F4V F;  2MZ1 A;  2P9C A;  3CO0 P;  5KFD A;  1AZS B;  1X4F A;  3MPV A;  1DTQ A;  4LRA A;  3QZ7 A;  4LF7 J;  4FXV A;  4FNI A;  2VF3 A;  2KO1 A;  2V50 A;  1EET A;  5GMD A;  2RS2 A;  2EG2 A;  1PAU B;  1UFL A;  1FX2 A;  2W01 A;  3JSM B;  1RYS A;  5M2P A;  4USU A;  5I3U B;  2HND B;  4LSN A;  4J9L A;  1KFD A;  4F0M A;  1OO0 B;  3H5S A;  3ZTS A;  2AYE A;  5G0R A;  2MZQ A;  3K59 A;  2CPH A;  1WHV A;  1I1G A;  3GZ7 A;  3LGN A;  4ZDN A;  3UCU P;  5HRO B;  2UXB J;  4L3N A;  3A8I A;  1XMB A;  4MIW A;  4P71 A;  2GGP B;  4DN0 A;  2NQP A;  2QA4 S;  4LF1 A;  4DI6 A;  3GR1 A;  4RU9 A;  4RW8 B;  4DF4 A;  4MKA A;  4I67 A;  2DEJ A;  2ZUG A;  2UVW A;  1R43 A;  1VYA A;  4AFF A;  2YBV A;  1R31 A;  3M1V A;  2IC3 A;  3W9I A;  4FBT A;  4PG5 A;  3I87 A;  2Z4P A;  2NZC A;  4I68 A;  4KT0 C;  3B6B A;  4FYY B;  1S1U B;  1HBU B;  2J9C A;  2PSZ A;  2EKN A;  2J7W A;  3M6X A;  3NWG A;  3UW1 A;  3W62 A;  4YQW A;  3NAH A;  4WIQ A;  4DEZ A;  4KHP J;  2PI4 A;  1U24 A;  5E2Q A;  1UPM B;  2KVQ E;  2N7Y A;  4IOB A;  3CO9 A;  3TW0 A;  3ZZZ A;  1TUW A;  1BQM B;  2BUN A;  2O66 A;  1RAB B;  3D3C J;  3EGV A;  3LAM A;  4P10 A;  3GV8 B;  4ED0 A;  4WU3 A;  5AT1 B;  2E1A A;  1K47 A;  1RT1 B;  4M5G A;  2QGF B;  4PPZ A;  1FRI A;  3MZI A;  3RRG A;  2CPY A;  4J37 A;  4CLZ A;  5LT5 A;  5CA5 A;  1MSW D;  4ZPV R;  2XYP B;  4N8N A;  4DUY F;  1KRP A;  1URN A;  1NHV A;  3UN3 A;  2R2U A;  2QLJ B;  5LMU J;  1CG2 A;  4KPY A;  1W7W A;  3RBX A;  2V69 A;  1CQN A;  1RAO A;  1TR0 A;  5B7W A;  1DFD A;  1H3D A;  1M1H A;  1UA0 A;  1YJV A;  2ZDP A;  5J2M B;  2QX0 A;  2KXF A;  3V2U C;  3HP6 A;  2F40 A;  4TQS A;  1JJC B;  1G3O A;  2BM0 A;  3KLE B;  2W9C A;  3LP0 A;  3ICL A;  3MED B;  1SC6 A;  3PG9 A;  4LSZ B;  4ZVF A;  3I55 S;  4DSL A;  3G6E S;  1MRO B;  3ONQ A;  3SV3 A;  3OTC A;  5DDQ C;  1UKU A;  2NXE A;  1N5Y B;  2A2C A;  2F7V A;  4L72 B;  4H4M B;  4QIG A;  1RTD A;  4JI5 J;  1TP7 A;  4O3P A;  4ER8 A;  1K0T A;  4EBC A;  2LFV A;  1CJT B;  1B0P A;  2VB6 A;  3DRP B;  2CZV C;  3FZ2 A;  3O44 A;  4I7F B;  2DPJ A;  3GSI A;  2FJA B;  4M63 A;  4WTO B;  5JJB A;  2WZ1 A;  1SB6 A;  3UPF A;  3KKF A;  2BAB A;  4C4W A;  3BN7 A;  3I31 A;  2FY1 A;  5FJ4 A;  2DH8 A;  2PMZ D;  2R2R A;  1S0O A;  2COL A;  3UDV A;  4K0K J;  3DHW C;  3IWN C;  1FK9 B;  3KK3 B;  3GYN A;  2RT3 A;  3KG1 A;  4CO4 A;  2BBE A;  2N3L A;  3SCK E;  4LFA F;  4PAB A;  2QIF A;  2RSQ A;  3PJW A;  4TY8 A;  1RYR A;  1FEE A;  1ZBT A;  2EFG A;  2MST A;  3D66 A;  5KFS A;  2FZG B;  4YS2 A;  2CG8 A;  2FHJ A;  2OSQ A;  5LJ5 Y;  5AE1 A;  1VQK S;  4MIA A;  2GNK A;  3S01 A;  4NLG A;  1FKP A;  1UAW A;  3QAT A;  3FKB A;  3Q8U A;  2LU1 A;  2XO7 A;  1BC6 A;  2AF6 A;  4ZPT R;  1K0V A;  3UDE A;  1BMQ B;  5D8H B;  2V2Q A;  4KSE B;  2DJW A;  3MM8 A;  4NI2 A;  3WC2 A;  4RW7 A;  3GR0 A;  1EHW A;  2NXU A;  3S7R A;  1FHT A;  4CDI A;  1GAO A;  1FKO A;  4KHP F;  4DS4 A;  4DCJ B;  3CMQ A;  4G6V B;  3I32 A;  3GON A;  4OHX A;  1JKH A;  4OIX A;  3MGJ A;  3CIZ A;  4RO0 A;  1TK0 A;  1RT4 B;  1QAJ A;  1GNK A;  4OJ1 A;  1MNE A;  4J9M A;  2MZS A;  3MD3 A;  4OX9 F;  4FYW B;  2CVI A;  2HK3 A;  4DL3 A;  3IBC B;  1XMQ J;  3ZNU A;  3GU0 A;  4OYP A;  4DV7 F;  1FEH A;  1BQM A;  2AKW B;  2BZ2 A;  3AJD A;  4ELV A;  1WUU A;  2ZNY A;  1HNW J;  2RU3 A;  4NLX A;  3RBE A;  1KP6 A;  2FHM A;  2JOQ A;  4HEA 9;  3W7B A;  1TKD A;  2Z2Y B;  4L75 A;  1BXN A;  1PC4 A;  2RHS B;  2AZ3 A;  3EVM A;  1WC6 A;  3MM5 A;  4M5D B;  5LMU F;  1IBL F;  2CPI A;  4LF9 F;  3DGP A;  3EDQ B;  2J76 E;  2M52 A;  2JEF A;  4Q2M A;  2PE8 A;  1VI7 A;  1WOR A;  1F1B B;  2KHD A;  1CUL B;  2P8I A;  4ZJO A;  4OHZ A;  5DG7 A;  1N56 A;  2AYG A;  1IVZ A;  4QR2 A;  1SQG A;  3KJF B;  4ZPB A;  2Y1L B;  3O6Q A;  1M5O C;  3G82 A;  3PKM A;  2FLL A;  1Q7L B;  2V2V A;  2HHH F;  1FRH A;  2UU9 F;  1VQO S;  3QYY A;  2VFV A;  3MUR P;  1KLN A;  1X0P A;  2BQ3 A;  3CJS A;  4Q45 A;  1JJH A;  2OPP A;  5B09 A;  5KFH A;  4W90 B;  2FGC A;  2BE7 D;  4EGL A;  1CS4 A;  2QSW A;  3RBD A;  1Q95 G;  4NX9 A;  1C1C B;  2R7S A;  5CYJ A;  2YX4 A;  5BR8 J;  2VFR A;  4QPX A;  1D1U A;  5HK4 A;  2ZBP A;  1R27 B;  5KAK A;  2IFX A;  3M8Q B;  2DRD A;  2ZWO A;  2M70 A;  2XWX A;  3A3O B;  4LVO P;  1EB0 A;  4O4G B;  4EI2 A;  1H2T Z;  2IYG A;  3IN5 A;  3CDB A;  2BOP A;  4WK3 A;  1P1T A;  3DOM B;  3JS9 A;  3AA9 A;  1EP4 A;  2ASD A;  1OSD A;  5ETL A;  4M5D A;  2VIH A;  1T8E A;  3FVY A;  4DZ6 A;  4Z2X A;  5EWG A;  4KO0 B;  2BJ8 A;  2ZJR Q;  4FYX B;  2E29 A;  4ID5 A;  2WK4 A;  3Q8Y A;  3SDE A;  2L9D A;  4Y0F A;  4HTJ A;  2XG8 A;  3BO3 A;  4MH8 A;  1PAE X;  1VFJ A;  3GCW P;  2BA9 A;  4ES2 A;  2BJD A;  4PZV A;  3FCH A;  1N48 A;  4FF3 A;  2MLY A;  2POK A;  2A3J A;  2UUT A;  2PO4 A;  1F9F A;  2WAQ D;  3M30 A;  2EVZ A;  3BBC A;  3V6J A;  2Q6B A;  2DRA A;  3ZC4 A;  4DN9 A;  5MAO A;  3QID A;  3QLH A;  2OTL S;  3MWB A;  2C2D A;  2B4O A;  2BE2 A;  3DM2 A;  4F36 A;  2DCU B;  2G9O A;  5CYM A;  4LBH A;  2B5J B;  5E7O B;  1NJI T;  4LF8 J;  3HFK A;  3TUJ C;  4MKY A;  1QAX A;  3E8O A;  1X5S A;  4O3Q A;  3DMJ A;  3D6F B;  4NEY A;  4TQR A;  2FJB B;  1UWB A;  3H0P A;  4WXW A;  3PY8 A;  1NU4 A;  3UWT A;  1AA1 B;  3M6U A;  4WJB A;  1NK9 A;  3GTY X;  4JYA F;  1FJG F;  1HWL A;  3AOC A;  1S4F A;  4YR3 A;  1J5E F;  4ES1 A;  1FCA A;  1MW7 A;  3N0V A;  4OX6 A;  1T9T A;  2CQ4 A;  5B0C A;  1RP5 A;  4NA2 A;  3SCL E;  4TY8 B;  1JXE A;  1RT3 A;  3M2V A;  3U1M A;  3ZTP A;  3THP A;  3OLA A;  2DIT A;  4DR3 F;  1FRJ A;  2AGO A;  4MJK A;  3AB2 B;  1HNZ F;  3FCV A;  1BHN A;  3TX0 A;  1U45 A;  3K17 A;  3T1A A;  3KLV A;  5LJ3 Y;  1N5Y A;  1RCO B;  4DU7 A;  2GVZ B;  4FKY A;  2QMX A;  2FVC A;  2LQ5 A;  3O5T B;  2PGC A;  4HHU A;  1S6O A;  5C5J A;  2PMW A;  3MD1 A;  3H25 A;  3BQ0 A;  4GMK A;  3PO5 A;  1IKX A;  5GAD U;  2GO8 A;  1QY7 A;  2V4J A;  1EQM A;  3MEG A;  4I69 A;  4KGM A;  4CLK A;  4OV1 A;  4RNN A;  3PR5 B;  2QRR A;  1HWI A;  1NHU A;  2B9X A;  3LP0 B;  3MED A;  5DRK A;  4BWJ A;  1QSL A;  3AFG A;  1Y3K A;  1E6V B;  4QWC A;  3SI8 A;  1HHT P;  1UVL A;  4ZCM A;  4URG A;  2LQJ A;  1U1K A;  1IKW B;  2PD1 A;  5HN0 A;  1B3T A;  3MR3 A;  4B3M J;  4HH1 A;  4O23 A;  2ZOF A;  4UZC A;  2R7V A;  1QUP A;  7FD1 A;  1HBM A;  2JLE A;  4A8X A;  4EZ6 A;  4DV4 J;  2DPI A;  4FBU A;  2LDY A;  2X1F A;  5B0A A;  1J5O A;  2KZZ A;  3WIU A;  1H73 A;  5D0H A;  3EIC A;  2YQ0 A;  5JVH Q;  1HBU A;  3ZZO A;  5KFJ A;  2DRB A;  3CDU A;  1R0B G;  3UN2 A;  1HHQ A;  3CD7 A;  3RU0 A;  5CCM A;  4DL7 A;  3ZZT A;  3DLG B;  2BJE A;  3A3N B;  4HI2 A;  4ED5 A;  1S79 A;  1N34 F;  1EX8 A;  4OJ3 A;  5G4D A;  1HD1 A;  5IT9 U;  3ITH A;  1A6L A;  4UTG A;  3BEG B;  2HVH A;  2XYG B;  2BM1 A;  4ZKA A;  2GHV C;  5GAE U;  1DAR A;  4UUW A;  2GO9 A;  1AZS A;  3W2V B;  2IPO B;  2QO3 A;  2R7W A;  4I7F A;  3TAR A;  1L3V A;  1SH2 A;  2QL7 B;  4OL8 A;  3QBC A;  3QNW B;  5KG6 A;  4DV3 J;  4P7V A;  2DTJ A;  2ATL A;  4B02 A;  5FLX U;  3L4B C;  1XEZ A;  2CG4 A;  2LCW A;  2QTW A;  3JTO A;  3MF5 A;  5I3U A;  2L48 A;  2P9E A;  2AU0 A;  5D3G A;  4DR7 J;  1N33 F;  2RRB A;  4IRD A;  3DYA B;  1T7P A;  4LBP A;  1F2H A;  4FYD A;  3FMW A;  3FGV A;  5KT5 A;  1V5V A;  1ULR A;  3NCP A;  1TAQ A;  2BXJ A;  3UVJ B;  4DV3 F;  1SIW B;  2E1R A;  3GP9 A;  2MB0 B;  1S76 D;  2QLF B;  2KRB A;  3OR2 A;  4C8M A;  3AHP A;  1WC0 A;  2CZ9 A;  4NML A;  2CJK A;  3N9U C;  2B56 A;  4ILM A;  2MHE A;  4OLP A;  3OJS A;  5J1E A;  4NCA A;  2APO A;  2VC1 A;  2HNZ B;  2ZD1 A;  3TR5 A;  4YHH J;  6FDR A;  1A0O B;  3OFF A;  4PXD A;  3HVT A;  4EUV A;  3HHL B;  2HNY A;  3OV7 A;  1N36 F;  1ITP A;  4DPW A;  5KG5 A;  3W2W A;  1LFP A;  2MY8 A;  3BF4 A;  1MG7 A;  4UF4 A;  4DR2 J;  5B0E A;  2ZVI A;  2E1C A;  2M5Y A;  1TL7 A;  2K2P A;  2ZH5 A;  3IA0 A;  3MUV P;  3TAM A;  1VRU A;  5IZH A;  4MYU A;  3LP1 B;  3CJ4 A;  3H40 A;  1OY9 A;  3VAL A;  4OX7 A;  1SBR A;  3G82 B;  3PIP Q;  2OD4 A;  2W24 A;  3D9B A;  3V4I B;  2MQL A;  5DLG A;  5T14 A;  3UI3 A;  1NB7 A;  1KVJ A;  1G6B A;  2HQD A;  1TVR A;  1ZS6 A;  3GG0 A;  4RJV A;  2R9L A;  3TI0 A;  1M90 T;  4KR0 B;  1NM2 A;  5D3G B;  4KTQ A;  1EJ7 L;  3PJ9 A;  2ACM A;  2CWX A;  4I1T A;  5AXN A;  4IO9 Q;  4R0J A;  2ZHA A;  2FVP A;  3HHN B;  3DFE A;  5KFI A;  1RHU B;  1M5P C;  2OTJ S;  5HJX A;  2VFU A;  1TKZ A;  1NH8 A;  3A3P B;  3MFI A;  2WOM A;  3CGI A;  3KHR A;  3D54 A;  3RW7 A;  3R7B B;  4TY9 A;  3W65 A;  1S10 A;  2UUA J;  5HP1 A;  1FKO B;  4B3R F;  2LQ9 A;  3HKW A;  3Q83 A;  3DOL B;  5H1S V;  4LFB J;  1CQM A;  2OAU A;  2CZ4 A;  2NPF A;  1HIY A;  1S9G A;  3CMA S;  2ASJ A;  2P6S A;  4X4N A;  3GSD A;  1IQZ A;  2JL9 A;  1VQ5 S;  3GQC A;  4ZP6 A;  2XSJ B;  2MSS A;  1JLE B;  1FVQ A;  1BE4 A;  4CRJ A;  3KMS A;  3W63 A;  2Y8Y A;  2VG5 B;  2WW8 A;  4OHW A;  4OZ2 A;  4X62 F;  1DUR A;  3P5B P;  1N0V C;  2DNQ A;  3CT9 A;  1H6K X;  1VS3 A;  4RW7 B;  3EPG A;  4DL5 A;  2YWG A;  3N5F A;  3R97 A;  5LSL A;  1XMO J;  1UEK A;  2KXH A;  4NLS A;  4KH1 B;  4CI0 B;  2R7O A;  2UVR A;  4F4K A;  4ZN3 A;  1IJE B;  1DQA A;  3AJ2 A;  3KDO A;  3NGT A;  4LF8 F;  2HHV A;  1N54 B;  1OPZ A;  2IIH A;  3AH6 A;  1C0U B;  3LTO A;  4I2P B;  2ZE2 B;  3HHK A;  5KG4 A;  4DV4 F;  2HHQ A;  3S6E A;  2HQI A;  1P8G A;  3R5G A;  4FF1 A;  5RUB A;  1F6T A;  1Z1Z A;  5AJ3 F;  3V81 A;  3MR6 A;  2HS0 A;  3BR9 A;  3DGV A;  3NLC A;  1X7V A;  4X4T A;  3CJ5 A;  3DLE A;  1NEE A;  4EO8 A;  4F25 A;  2KFN A;  4ENO A;  1IBL J;  4QR1 A;  4N47 A;  3ZZY A;  2VV5 A;  4J9U E;  2VU5 A;  1LOU A;  4YHH F;  3MPU B;  1WC3 A;  2Z56 B;  2C3O A;  1CC8 A;  2FC8 A;  2XMW A;  3PYE A;  3BV8 A;  3MUT P;  1RBA A;  3VGS A;  3G8T A;  3DLL Q;  5IQQ A;  4OFZ A;  1HL6 A;  1MWQ A;  4ZHR A;  1FKP B;  2DGQ A;  3DHX A;  2P6T A;  1ZM3 A;  3RG6 A;  2K1R B;  4YR2 A;  3KG0 A;  1S0M A;  1RGV A;  2JWN A;  1B7Y B;  1RT2 A;  1TV6 B;  2RKI B;  3OTD A;  4HR2 A;  4MFB B;  2ASY A;  4MMO A;  4P75 A;  4ED2 A;  3CJR A;  4CO0 A;  2H5E A;  4DU8 A;  4LFB F;  2NR0 A;  1PJ7 A;  1SQE A;  4JI3 J;  2L08 A;  3NY0 A;  1N8R T;  4W4M A;  4GO7 X;  1KOH A;  4GKJ F;  4C8N A;  5DGA A;  3HXM A;  4CTA B;  2YXL A;  4TVA B;  1C0T B;  1MU2 A;  5DLF A;  5B0F A;  2V4J B;  4USJ C;  4HKQ A;  1QE1 B;  2ZVS A;  2V94 A;  1S1X A;  4ES3 A;  3SXL A;  3LW5 C;  1AYE A;  3JB9 k;  2MYF A;  4OJG A;  5A6W A;  4R0E A;  2RH3 A;  1HNW F;  2MJU A;  2FZK B;  2R8I A;  4IG0 B;  1NDC A;  3TYT A;  1NK0 A;  5LSR A;  1FJ7 A;  2DVI A;  5HMY A;  3R2D J;  2DR7 A;  1WOS A;  4M5J A;  4DHV A;  2ROE A;  1PGZ A;  3OL9 A;  3H42 A;  2M7S A;  4IDK A;  1HNI B;  2RU9 A;  2MZJ A;  4CT9 A;  5I4M A;  1Y00 A;  2ILZ A;  4OYW A;  3BGF A;  4WFB Q;  3NMA A;  3X1L B;  4BC9 A;  8ATC B;  3NXZ A;  4CP5 A;  5IM0 B;  4JI4 J;  1ICE B;  2XEX A;  3HHD A;  3PYD A;  1HBN A;  4JI8 F;  4U6P A;  3CF5 Q;  3DDN A;  3MM6 B;  2HLU A;  1F5A A;  2KN4 A;  1JXV A;  2CJA A;  3N28 A;  3QSY B;  4DQP A;  1RTJ A;  4NXN F;  1DTQ B;  2ZBR A;  2XWY A;  1UVI A;  2UV8 G;  1J5O B;  1JWW A;  3MM9 A;  1OJ4 A;  3IP0 A;  2HBR B;  1L5U A;  2V8V A;  2RDD A;  3CDW A;  3DN9 A;  4R8U B;  1U26 A;  3DRS A;  1MMD A;  2QA4 G;  2V9W A;  3JTP A;  3PEJ A;  4ZIT A;  2WBM A;  2XMT A;  3WHI A;  2UXD F;  3HDS A;  2VDI A;  3MMB A;  4G1Q B;  4PPD A;  3RB3 A;  1VQ8 S;  2EFP A;  3G86 A;  3LF0 A;  3PHE A;  4RBV A;  5THW A;  1GX6 A;  3VAK A;  5I42 A;  4RW9 A;  2VJV A;  4RWW A;  2VA3 A;  5J1E B;  3QJL A;  4AL7 A;  2LKZ A;  3M30 B;  1F5C A;  3PW0 A;  1BD6 A;  3PYG A;  4FZV A;  4G65 A;  2IA6 A;  4EYI B;  3C66 A;  3F56 A;  4CLW A;  3PO4 A;  4PYD A;  2HZA A;  2DEI A;  3C6T B;  3LAL A;  4DR3 J;  5J2Q B;  1HNZ J;  4DCO B;  1R7I A;  4A8Y A;  3D0I E;  4C97 A;  5E5N A;  2V5H G;  2GAH C;  5F8I A;  4ECX A;  2QN6 B;  1TL5 A;  3CTR A;  5F8M A;  1AUS L;  3DLJ A;  2DIS A;  4USK A;  1EP4 B;  1SUQ B;  2KRR A;  4URS A;  2JSX A;  3N6M A;  1O0P A;  2X7I A;  3OR1 A;  4GVB A;  3FMB A;  1YZ7 A;  2AGQ A;  3TA2 A;  3NGU A;  1WWH A;  3W8P A;  2DCL A;  5B0D A;  3PX6 A;  4K5S A;  1M5H A;  4WFZ A;  2B6A B;  1I94 J;  2KT2 A;  4B9N A;  2E7V A;  2W2M P;  3DLK A;  1NJZ A;  3WIV A;  5C24 A;  4DWI A;  2XHC A;  5D4N A;  1YTY A;  3SCJ E;  1KSP A;  1YJ7 A;  2EKY A;  3H20 A;  4DR4 J;  2C22 A;  4Q0B B;  4WFY A;  4PYA A;  2HGN A;  1NPK A;  3D5M A;  3HSD A;  3WX4 A;  2H51 B;  3IBW A;  1NAQ A;  4KB7 A;  1NK7 A;  1TEL A;  2I5J B;  2PFD A;  4JI2 F;  1UEU A;  1CJV A;  2DH9 A;  2HWH A;  1KTQ A;  2BJ1 A;  5HQL A;  4AD6 A;  3J7Y U;  4YFU A;  3QGH A;  5E41 A;  3Q24 A;  4F2R A;  1SL0 A;  1RAA B;  5KT3 A;  4K5R A;  5F41 A;  3EPI A;  2B0G A;  4X4V A;  3V4M A;  1JLQ B;  2BVZ A;  1HQE B;  5C25 B; 
#chains in the Genus database with same CATH homology
 2CNL B;  2P2C B;  2XYG B;  2XZT B;  2H4Y B;  4ZVU B;  1RHR B;  1I3O B;  2QL7 B;  3QNW B;  1RWM B;  1F9E B;  2XYP B;  1RHJ B;  1IBC B;  4ZVQ B;  2QL5 B;  2QLJ B;  1RWP B;  5K20 B;  3KJQ B;  2H48 B;  2QLF B;  3NS7 B;  4ZVR B;  4JB8 B;  3D6M B;  2H5J B;  2CNO B;  4LSZ B;  4ZVS B;  2CNN B;  1GFW B;  3GJR B;  2QLB B;  3GJQ B;  1PYO B;  1RWN B;  3KJN B;  2HBY B;  1SC1 B;  2HBQ B;  3IBF B;  2H65 B;  1RWW B;  3R6G B;  1ICE B;  2FQQ B;  2HBZ B;  3D6F B;  2C1E B;  2CDR B;  2C2O B;  3D6H B;  1RWX B;  3GJS B;  2HBR B;  5IC4 B;  1RWK B;  1QTN B;  3R7N B;  3R7S B;  2CNK B;  1RHU B;  1RHK B;  3R7B B;  2H4W B;  4ZVO B;  2XYH B;  1I51 B;  1BMQ B;  1QDU B;  2DKO B;  2H5I B;  3GJT B;  2CJY B;  4DCO B;  4DCJ B;  3P45 B;  4ZVT B;  2CJX B;  2H54 B;  1RHM B;  3R5J B;  2QL9 B;  3IBC B;  2C2M B;  1PAU B;  1RWO B;  2C2Z B;  4ZVP B;  3SIP B;  2C2K B;  3EDQ B;  3P4U B;  5IC6 B;  2H51 B;  3EDR B;  3R6L B;  2Y0B B;  3KJF B;  1RWV B;  2Y1L B;  1RHQ B;  1SC3 B;  2XZD B;  1RE1 B;  1NME B;  1SC4 B;  3RJM B;  4DCP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...