2CNOB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 P17 SUBUNIT
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cnoB00
1SC3B 4LSZB 3P4UB 2CNKB 4ZVQB 4JB8B 2H5IB 3GJSB 1SC4B 3NS7B 3KJQB 3IBCB 2FQQB 1RHMB 1RHQB 2Y0BB 2CNLB 1ICEB 4ZVOB 2QL7B 2P2CB 1RWNB 1QDUB 1SC1B 2CJXB 4DCPB 1PAUB 5K20B 2Y1LB 2HBZB 3R7NB 2CJYB 1I51B 1PYOB 1RHRB 1RWKB 2DKOB 1RWXB 4ZVSB 3RJMB 5IC6B 1RHJB 2H51B 3R6LB 2XYPB 2C1EB 2XYHB 4DCJB 3GJTB 5IC4B 1QTNB 3KJNB 1F9EB 1IBCB 2H65B 2CNNB 1RWWB 3R7BB 3KJFB 3GJQB 1RHUB 4DCOB 1GFWB 2H4WB 2QLFB 3GJRB 2CDRB 2QLBB 1BMQB 3R7SB 2XZDB 3SIPB 2H48B 2C2MB 1RWOB 2QL9B 3EDRB 1RWMB 2H5JB 2HBRB 4ZVTB 2XYGB 3EDQB 1I3OB 2H4YB 2H54B 2QL5B 2C2ZB 1RE1B 3D6HB 3P45B 2CNOB 2XZTB 4ZVRB 4ZVUB 1RHKB 3D6FB 4ZVPB 1RWVB 2C2OB 2C2KB 2HBYB 3R6GB 1RWPB 1NMEB 3D6MB 3IBFB 2HBQB 3QNWB 2QLJB 3R5JB
chains in the Genus database with same CATH superfamily
3Q8RB 4FVCA 5HVGA 4L6V3 2JVOA 1N33F 2VFUA 4HYKA 1U8SA 2G0CA 1U4BA 5KFJA 2XM3A 1QVFR 3BO3A 1S1XA 3F73A 1X5OA 4ECYA 4BLGA 2XULA 3TI0A 5DGAA 1X9WA 3PXGa 1NPPA 1VQ4S 1UWBA 4W92B 1FKPB 2CUYA 4GO5X 3R6LB 2R7UA 1NCLA 2AIRB 4CRJA 1JLCB 4ILLA 4LFCJ 1T9XA 4OL8A 4CM2A 3PIOQ 4Z7YA 4DU7A 5E7OB 4LFCF 4I67A 4B3OB 2B7CB 2R7RA 3PX6A 3W8PA 3AT1B 2AJFE 4I6AA 1Y5IB 4KV8B 2OPPA 2B8QA 1U6BA 3MF5A 4YN3B 3D0GE 4LUBA 4LBHA 3QWPA 1B70B 2MY7A 4PWUA 2RB7A 1RWPB 4P74A 1KRPA 2D3O1 4MKBA 2G0IA 2CQIA 3KLEB 2LCWA 2BE2B 4NLDA 3F44A 2X3DA 2A6MA 4U7CA 2C2DA 2QA4S 4DPOA 1RT4B 3GSIA 5E33A 1RCOB 2GGPA 5FIIA 4I56A 3OUYA 1NK9A 3MM5A 3QWUA 4GC6A 3MD1A 5IV4A 4CO3A 3Q24A 4ZP7A 2YKPA 3R97A 1HFEL 1RB0A 1JLAB 4JI5J 2O3DA 2AYGA 2X1GA 4AE5A 2J7KA 4JI5F 4QU7A 3KHRA 3KG0A 1H7XA 8AT1B 4ZVFA 4KFBB 2L3MA 4ZP9A 2AHOB 3Q2TC 3E51A 3OXGA 4CLYA 1PC4A 5M2RA 2QYCA 2ZH3A 5KT5A 3QFHA 4RW4A 2WOMB 3IBWA 3GIMA 1T03A 2ZH4A 3AQPA 1YBAA 2IC3A 5JXSA 1U47A 4DX8H 1RTIA 3KK2A 3A3PB 2Z2LA 4P73A 2ROEA 3K59A 2DB1A 2W9CB 4PPDA 3ITHA 4FF3A 3A4TA 3Q89A 3NS6A 2CQ4A 2AX1A 1M5HA 4AUKA 4YDDB 3O8WA 1PILA 4C3MA 4YS2A 2D74B 3HJFA 2V2VA 1HHSA 1YRUA 1WELA 4WCEQ 2WW4A 5IT9U 4F0KA 1TAQA 2DY1A 2FDNA 2C28A 1FKPA 2DTJA 4DL5A 3JQMA 3JXOA 1VC5A 1JLCA 1R8PA 1RT7B 4IKAA 2G4BA 4DV3F 1YWXA 4B3OA 3UQSA 5KOWA 1FRXA 1CBKA 2J6UA 2NXCA 2F1FA 2FLNA 2IFXA 2FUG9 4CT9A 3DNCA 3M2UB 1AZSB 1I94J 1FRLA 4KV8A 3ENWA 2ZD1A 1I94F 2O5DA 2K3IA 4M5HA 2BM0A 3IWXA 1AA1B 2WSCC 5IT9Y 4NPOA 3CVKA 3MOJB 3ZTQA 4JOUA 1F0XA 5HANA 3MXHP 3R7NB 2V4RA 1QUVA 3VAGA 1UKUA 3KLEA 1GQEA 2BE2A 3IR6B 4MT1A 2LXUA 3P6YC 2B51A 1RT4A 2W7PA 1U1MA 3D1OA 5E3QA 1KFDA 1RT6B 2FJAB 5I3PA 3DDNA 1DRZA 2JC0A 4RUCA 3FBBA 1JLAA 4ZLNA 4N76A 4DBQA 4ED8A 3UO0A 2W4PA 3TOQA 3DMJB 3CCJS 4O3NA 4PG5A 5ADZA 4KFBA 2QIFA 3PRBA 2FVCA 2JLFA 3R2DJ 1VJWA 3UDCA 3M8YA 3IS9B 2WOMA 3W65A 3MFIA 4ANCA 3O6QA 3K7RA 2RILA 5HQ8A 2YWGA 3SCIE 1OS5A 3MEGA 2Y9HA 1SJFA 3FMWA 3ZTOA 3OFFA 1ZM2A 2W9CA 2MLZA 3THTA 3IO1A 4Y28C 4R0JA 1IM6A 3PX0A 4U7UK 4QW9A 1I3OB 3CPWR 4H4KA 2H4YB 2XS5A 4FF2A 2VKRA 3N5FA 1MMDA 3N0VA 4TYAA 2C2OB 2FHOB 2E5IA 2D3UA 1B0PA 4L3KA 4JV5J 2N3LA 5ETOA 1HI8A 1UPPA 2CNKB 2F4VJ 3CO0P 3NBPA 4QBUA 4JV5F 3Q0AA 1O6XA 2F4VF 4F04B 1JLFB 2IVYA 1FI4A 1RT7A 4USJC 3B82A 3WHIA 3VGSA 4P2MA 2F8EX 5H9FJ 4WBFA 4GKJJ 4QCLA 1TZ0A 2B4OA 2XGPA 1UVIA 2AGPA 2VG5B 1OQ3A 2QE5A 3M2UA 4GKJF 1AZSA 2M5YA 2XYPB 2CVIA 2V9KA 4QWEA 4FYYB 1FX2A 3HT3A 1F5BA 3K57A 5AJ3J 4FYVB 3FEZA 2H65B 4J9LA 3P5BP 4EWTA 2BJDA 5AJ3F 2XSJB 3K2YA 1LK5A 1RUSA 1C2PA 5KTQA 4F4KA 1Q5YA 4QOTA 3KWMA 1KONA 3M6WA 4W90B 3W2WB 1HWUA 4DL7A 4X4TA 1S1VB 1W25A 2EG1A 2CQHA 3V5RA 2NUHA 1WG1A 2X1FA 2UUAJ 3DM2B 4CO0A 1UFKA 2JEGA 3LF0A 3QNWB 2J0WA 1SC3B 1RT6A 1A6LA 2CQCA 1B3TA 5CA5A 1HQ2A 4LREA 2LQ9A 1U49A 5C5JA 3UR0A 2ZBIA 2IMWP 1T0TV 1KS2A 1W2BR 3AY0A 4MK8A 4K59A 4RNHA 9ATCB 4AQYJ 3K5NA 3DMJA 5L1JA 1JX4A 3I4PA 1GK8A 2C1EB 3D0IE 2ZH1A 3GFHA 1X4EA 4URGA 2D1CA 4ZCIA 2CDQA 2FHJD 3IS9A 1FDNA 1U6FA 2EFNA 1NK5A 3CDWA 1OSDA 2WSFC 1MW7A 3FFIB 2UZAA 3AB2B 2BEFA 4OZ0A 3NG8A 3TANA 3ILIA 2CPZA 2V8HA 4B3SJ 2QSFA 2BVZA 2DO4A 4B3SF 5DM7Q 1OWXA 2PE8A 3TQEA 3V4MA 3UDVA 4O44B 2W01A 2E1MC 2DNYA 2EFVA 2RH3A 1MWZA 4NLRA 2CNLB 2DH7A 3DRPB 4IH7A 3CDEA 2V6AA 1HNWF 2Z2ZA 4ECTA 2VQFF 1FJGJ 4DPWA 2C22A 4AT1B 3MPUB 2ZBRA 1T05B 2CQ1A 3T6BA 1D9DA 2BABA 1JLFA 4DR3F 4LR8A 3GZ7A 3EZ5A 2KVIA 1RISA 4RU2A 4GC7A 1VQLS 2QA4G 4JBCA 3H5UA 1UEKA 1IKWB 1YQHA 3TA0A 2DNRA 4KHMA 2JHEA 3OR2A 5HMXA 3LP1B 2AWZA 3R6GB 1HARA 4X2BA 1RZMA 1K1QA 3D68A 3GE9A 2XSJA 1M1KT 2CJQA 2KT3A 4IRDA 2RDJA 1H72C 3H4DA 2GFFA 3W2WA 1S1VA 1WUUA 1N5TA 3G6VA 5LMUJ 4RUAA 4ICLB 4WFYA 1N5SA 3K17A 3WC2A 3JTNA 1GNKA 2QFIA 3DM2A 2KHDA 2LEBA 1ZA1B 4KGMA 1XMQJ 2VONA 4WU3A 4P52A 4CLSA 1XMQF 3BGOP 1NU4A 4HH0A 1S6UA 3ZTPA 1CULB 4ZDNA 1A7GE 2V0NA 4DR1F 2A2DA 1C1BA 4F4XA 3V81B 4DS5A 3IGVA 2PMHA 4IQXA 4OIXA 2PI5A 1RTJB 1SB6A 2IPOB 5KFCA 1JQGA 3IWNC 4PWDB 4CM0A 1UVJA 4DUTA 4ELUA 3HSZA 2LA4A 2Z4PA 2OD4A 3BBCA 2E7VA 4C8OA 4MKAA 2Y1RI 3D2WA 5C2GA 4I2QB 1UP1A 4WK1A 4MKYA 3AFGA 2IBKA 4NLGA 3NNCA 2RRNA 3CCTA 2GIQA 3OLAA 3R5CA 4K7QA 3W9HA 2GVDB 3DLHA 4WIIA 1EP4B 4HVZA 5KFTA 2X1AA 4O44A 2AJ4A 3QO9B 3G71S 3VZHA 2MJUA 4C8LA 1KQGB 1V5VA 3FZBA 1SL2A 2HVHA 1FE4A 3U7JA 2OMLA 3DRPA 1NAQA 3HX9A 4NRUA 2HQDA 4ZN1A 2LU1A 4K4YA 2EEYA 4CO4A 2CQ2A 5CZXA 3RR7A 2UV8A 2W1BA 3T19A 1EHWA 4F3QA 2VDHA 2XZTB 4ZVUB 4ED7A 1IJFB 3NOGA 1T05A 3RTVA 3BF4A 3P96A 3QRPA 4DU8A 2E1AA 3RRGA 2B4VA 3HMJG 5AXLA 2BRKA 3HSDA 4NCBA 1NEEA 2KM8B 4X65J 3PYGA 2QGFB 1C4CA 2KHCA 2JDJA 3G82B 1IKWA 1H73A 5HMZA 3E3XA 1FRIA 3LP1A 2ABYA 5CABA 3CDBA 3NL0A 2B43A 1OPIA 1ZTWA 4USVA 3TA1A 3TZZA 3DN9A 1Y11A 2MQMA 5HBMB 4OZ5A 4EBEA 4OYAA 2ZJQQ 3NCPA 1FWPA 1HR0F 3HD1A 4KH1B 1JJHA 4ID5B 1IKYB 3LGHA 1CG2A 4H54A 2F9DA 3EDQB 2EBGA 3UCUP 4QIFA 3ISNC 1IR2A 1DTQB 3RU0A 5I3QA 3FZ2A 2IA6A 2HZVA 1CULA 4JI4J 2DNKA 1RTZA 2M88A 5J1PA 3U1MA 3Q8QB 4U9RA 2O1PA 5L9NA 3TX0A 2I5JB 1B7FA 4D3GA 4ZA1A 2FLOA 1RTJA 4YR3A 4ZVEA 4PG4A 2NSBA 1WF0A 3IC1A 1TP7A 4R8UB 3IMQJ 2CG8A 2HS0A 4PWDA 3C14B 4Z2XA 3G87A 2FC8A 2OMOA 3TAQA 2DVIA 4EO6A 2MQOA 3OTBA 4NZ7A 4I2QA 3J7ZT 3DI6B 4K5RA 4JV2A 3KJNB 5HQMA 3KNGA 1IBCB 3I6PA 2UXCJ 1B0VA 5IOLA 2ATLA 4PKDB 3NAHA 1KQSR 2UXCF 2JOQA 4KGKA 5LSLA 3M05A 2HG4A 1UW9A 2GVDA 4TQRA 2VPZB 3M9OB 2RNEA 2DNLA 3MI7X 3ENAA 3EVWA 3QO9A 2HFUA 1FE0A 1SKWA 3JQJA 3CJ3A 1WC6A 1DTTB 5F8IA 3HKZD 4CI0B 1KVIA 3ISND 2E29A 4FPIA 3I5BA 2ZDOA 1L3VA 1T9YA 5BJRA 4DV4J 5KFAA 1DQAA 3O44A 2BJ9A 2QTWA 3TA2A 4YFUA 3SZ2A 2BQUA 4DV4F 5HP1B 2RKIA 1RLCL 2IBOA 3SYZA 3G4SS 3JSMB 2HNZA 3EMTA 3A8KA 1WOOA 2IYIA 4IFYB 4DHVA 2QZ8A 5J2QB 1NM2A 3N9UC 2APOA 3Q83A 5K9FA 4X66F 4G1PA 3H90A 4ZCLA 2IRXA 4G1IA 1AXQA 5F0WA 2P9EA 1NPKA 1VYAA 5EWFA 3G82A 4EMDA 1FXRA 2W7AA 1PGZA 1JJ2R 2MKCA 4P2FA 4LSNB 2W2NP 1H2VZ 4I2PB 3OL6A 2J0XA 3J7Z5 1NRKA 2ZHOA 1NK0A 1B4SA 2JSXA 5HBMA 2ASJA 5E2QA 3OV7A 2XLKA 4CQ1A 1JJCB 1U26A 1YBUA 2V69A 1FRMA 3TRGA 4QIGA 3MAAB 2BW7A 5HQLA 4GVBB 3Q2SC 4WPAA 4ID5A 1IKYA 1R6YA 2MKYA 2ZZNA 5H1SV 2ZBPA 4RBVA 3QGHA 3MM6B 2Q43A 1S6OA 4LF8J 1DTQA 4ZVHA 2AJ0A 2JZ5A 4C8YA 4B3MJ 2CKWA 2RUGA 2OELA 3BJYA 4LSLB 1SJRA 3Q22A 1S49A 5ETPA 2I5JA 1NO8A 5IC6B 1R27B 1H6KX 1R0CB 5MAOA 3KK3B 1C0UB 1T9VA 1V3RA 4ZIVA 2XO6A 2XQCA 4MAKA 4R8UA 4LF5J 3C14A 3W3SA 2RS2A 1TUGB 3FSXA 4LF5F 1LXNA 4IYQA 4IH5A 5IT4A 5KFDA 3BYPA 2GIRA 3N4WA 3DI6A 2R2RA 4A8KA 1F1BB 1VI7A 1G6BA 1Y4ZB 2RF2B 2UP1A 1KQFB 2DT9A 4O3SA 2R8IA 1G2EA 3MM8B 2RHQB 2BJ8A 1UVKA 3G8TA 1IKVB 1CS4B 3FSYA 3CIZA 5CZVA 4IFVB 1CJTB 2FLLA 2ALZA 3EGZA 3VVUA 1QJHA 4U8YA 1DTTA 2R3VA 4OI0A 4UOCA 5DQGA 3VVTA 1MWYA 3PKYA 2A18A 3TAMB 2MYFA 3W5ZA 5KFSA 3PW2A 2Y8WA 1Q4RA 3FCHA 1P1LA 1YRXA 3GJTB 3HSJA 4M5GA 4OI1A 3GR1A 2CIMA 1HNXJ 2VL1A 5HP1A 2VH7A 3KLIB 3FRZA 2CQPA 4M5LA 1HNXF 2CDRB 3JSMA 3BSAA 3HM9A 4ZPTR 1H3DA 1RA7A 4IFYA 3G9CA 1B0TA 1VRQC 4DX7A 2K7KA 3TYTA 3NKYA 2LP4A 2UVUA 2ZC3A 3LH2S 3D3CJ 3ISZA 1FFSB 1FA0A 2CJ9A 3GMGA 1FKAF 4DF8A 3IBFB 3BKUA 4LSNA 3OL9A 2D69A 4ENOA 1BQNB 4I2PA 3H2LA 3QBCA 4CO2A 2OGUA 2ZNZA 3PIPQ 3LP0B 3QT6A 1I6JA 2EC0A 1NSKL 1OY6A 1DAXA 1XQIA 4J9NA 1CEZA 3MAAA 4KRWA 4UF4A 4NXMJ 1BD6A 4GVBA 2ZH2A 6FD1A 1RWKB 5KFVA 3MPDA 2CPFA 2AJQA 4IG0B 5KFXA 4NXMF 1ZS6A 3OFGA 1Q16B 1JJ4A 2R7OA 4EUVA 1E6VB 3MM6A 3ILOA 4WTYA 1SV5B 4DSFA 3GSDA 3QMQA 2OH2A 1FRHA 4KSEB 5KFBA 1EETB 4PG6A 4Y3CA 3FBCA 3V6KA 2BX6A 3BR8A 5EDWA 3EPGA 3H5YA 2HBRB 4U96A 2ZHAA 3LP2B 1YJTA 1JMTA 2HEKA 2YKOA 1C0UA 2ZH5A 4EBDA 3IR7B 2KO1A 2UV8G 1U1LA 4ID8A 1NJZA 4YB1P 2MQLA 1CJUB 6FDRA 1VHIA 5HL7Q 2M3DA 3AODA 2C2RA 3NWRA 1NUEA 2D9PA 1LKZA 3LANA 1YLXA 3KXDA 3TVYA 3LPYA 1FWLA 2MZJA 1J5OB 3PZPA 2AJ2A 2V2ZA 1NJIT 3RB3A 4PG7A 2BKOA 1FK9B 3EWGA 4DL6A 1N32J 3MM8A 2DXEA 3H59A 1U2RA 1N32F 2YNHA 1IKVA 4BC9A 4Y2CA 1CS4A 3RYLA 2ASDA 1Q81T 2CQ3A 4O0IA 3MM7B 1HHTP 4LVNP 2VOPA 4NA1A 4IFVA 1WJ9A 1CJTA 2FJBB 1DARA 2W4CA 2XG8A 5HLFB 2ATCB 3EDRB 5LXYA 1U0SA 1CC8A 1D9FA 2Z2MA 2Z8QA 2RQMA 4J9QA 3I56S 1WG5A 3TAMA 1ZETA 4N56A 4M5MA 2MQPA 3D4JA 4NZ6A 5LT5A 4ELTA 3KLIA 1EIYB 4PXBA 3SSSA 2DBBA 3HHKA 4I68A 3I32A 1T3NA 5ETLA 4AL6A 2Q66A 1PKUA 3VR1A 4QJVA 4Y2MA 1ICEB 4UUXA 4V19J 3S1TA 4FS1A 3H5SA 1M0SA 3AA8A 2GCFA 3UFCX 3UCZP 2LFVA 5F8GA 4HI1A 2DKOB 2QMXA 2FGCA 1LW0B 1HQEB 3D3BJ 1BQNA 1MU2B 3N79A 2RHSB 4Y65A 3LP0A 4JI2F 3T1YF 1YITS 2ZH7A 2DHXA 1VGYA 2EFGA 4HACB 2FJEB 2HZCA 2XYGB 1WNEA 3N5BA 2DRBA 4I6YA 2V5HG 4RW9B 4IG0A 3US5A 1KFSA 4NLOA 1E6VA 1SV5A 2KL8A 3I0SB 3TQ1A 3HFZB 1RK8A 3RAXA 1N52B 1UMJA 4L73A 2GAHC 1EETA 3UI3A 2R9LA 5C24B 4DUZJ 1R8BA 3GLJA 2CWXA 1WI8A 1ZAVA 5LM7E 1VLYA 2J8SA 4DUZF 4IQMA 5DDOC 4O3RA 3M8SA 3LP2A 4UY85 1KVKA 2LEPA 4ED3A 2E66A 2HHSA 2NSCA 2WVCA 2ZBQA 2N3OA 4DFJA 1UJ6A 4P72A 2AT1B 5L39A 2BXJA 1WC4A 3FC9A 2P9GA 3ZZRA 1N5YB 1U1RA 3T1AA 5D0GA 1ZA2B 4RO0A 4CO1A 5IM0B 4USIA 4H4MB 3SEOA 5L9XA 1UA1A 4DR6J 3P5TL 2ROGA 3PY8A 3W9JA 4RL1A 1J5OA 1WC1A 4DR6F 1IQTA 1FK9A 1K8AT 4OJ3A 2YNGB 2BUNA 3PM9A 2UXDJ 2OFGX 3NGUA 1GTHA 4OI3A 5IWAJ 1P8GA 3VAJA 1WWHA 1Y3KA 2BYCA 3C15B 2UXDF 2FJWA 5IWAF 3J7AN 2ZJPQ 1SPBP 3MM7A 3FCVA 3GG0A 2R2TA 1D8ZA 1DY3A 4J9UE 4CLPA 2XY6A 1S4EA 5HLFA 1Q79A 1N4LA 1VDHA 5C7PA 3TZWA 2IJRA 1JXVA 1YJ7A 5M2UA 2OHDA 2L48A 1N8RT 2FC9A 1YZ7A 2VC0A 3HVTB 4OI6A 1VQYA 2CQDA 3DOKB 2BW2A 3ZTSA 1S12A 2EK6A 3SQGB 1IKXB 1X4AA 3EZUA 1SI9A 5D4NA 1FNOA 5GMDA 1ZOTA 3SV4A 1WKLA 2OPSB 2VPXB 4O3OA 3O3LA 2JEJA 2LDIA 5KFQA 3PR5B 4ITSA 2H48B 2IIHA 3MPWA 2BJEA 2E7XA 3CEDA 3HK2A 5KG0A 1TK5A 1LW0A 3DDKA 5DZ7A 1HQEA 3JQKA 3VGUA 1MU2A 3S7RA 2HFZA 3BSNA 1BWVA 1SL1A 2BJ1A 1YVFA 3B54A 4HACA 3VALA 4J9MA 2NREA 4ZVQB 2XMMA 3QT8A 3K5PA 3NS7B 4FP9A 4RW9A 2NUUG 1KVJA 4XO0A 3UD3P 5HJXA 2QMWA 3I0SA 3Q8SB 2HVEA 2VF3A 2DHHA 1HKAA 1LFPA 1WOPA 4KKOB 5K20B 2NQPA 2YXLA 5C24A 2EW9A 1KBRA 2PEHA 4C8MA 3T5HA 3NAIA 5IFMA 5JUMA 1NK8A 3GYGA 2ZITA 3TEHB 3C2PA 2MKIA 2YQ1A 1FKOB 1M5SA 2YX1A 2V68A 1I5OB 4OYZA 5LMNJ 5DZ6A 2BACA 3JYTB 1YZ6A 5LMNF 4USKA 3HCXA 3PHTA 2ZZTA 5T41A 2Y1JA 4MYUA 5IM0A 4H4MA 1H0HB 5B0GA 4J9RA 2GAGC 1RSCA 3B6BA 2YNGA 3ZC4A 1HPZB 5HSPA 2U2FA 3I55S 3C15A 4B9NA 1TMJA 3BSOA 2MPUA 1HI1A 3UCGA 3R5BA 3W7BA 2MZRA 1KSPA 4K4ZA 3QYYA 3M6XA 4J9KA 3PJXA 1D3WA 3H5XA 4C0OC 1I51B 1VHFA 4X4OA 2FIUA 2MZSA 3ZTRA 3EE3A 1UFWA 4PUOB 5E3RA 5IC4B 1VLOA 1P6TA 4ZN3A 4KT0C 3PG9A 5E0OA 3OTDA 3DOKA 3PW4A 4JI8F 4DV2F 3SQGA 2KFNA 1S9GB 3T5KA 2VDIA 2OTLS 2PO4A 3EX7B 3H4BA 2PDAA 4KGXB 4KHPJ 4OYXA 1PAEX 1H2UX 2J5AA 2OPSA 3PYFA 2IA0A 4KHPF 1Q7LB 4KBIA 2F7VA 3R5DA 4M95A 3DYAB 1LXJA 4EEYA 4LT6A 2X51A 3DGVA 2XY7A 2D3ZA 2HFNA 3LGMA 1RQ0A 1ACMB 2B0GA 4I0WA 1R8CA 3KLHB 2ZM6J 4NXNJ 2Y0BB 2FY8A 1PJ6A 1P27B 3GQCA 3BS9A 4NXNF 5KT4A 4CLKA 3OD2A 2MLXA 3HHEA 1TKDA 2YWHA 2J9DE 3QIPB 5KG2A 1OMSA 1KC8T 2V8GA 4Y6IA 1UJ5A 1R43A 2HNDB 4AFFA 2V4JB 3UNGC 5GADU 1T8EA 1FF2A 5KFIA 3LWLA 1KTVA 2VBZA 4WK3A 1ZZFA 3DKDA 3R3TA 4IDKA 1J5EJ 2AW0A 4KKOA 3OTCA 2AYMA 4QIEA 3AOAA 4HEA9 1J5EF 2VA2A 4ECRA 4DQSA 5EWGA 1BHNA 4NYZA 3HHNB 4UT4A 4XPEA 1FKOA 2HZAA 5D15A 4LQ9A 2KKHA 3BPDA 3D0HE 3BR9A 3E8OA 3SMZA 3UWTA 4M5KA 5DRKA 1IR0A 4DSJA 3Q23A 3AQOA 4OHYA 2PMWA 2HVZA 3NNAA 3EGNA 4L74A 2BRLA 3VAIA 1SUQA 4ZPWR 2CYYA 2PA3A 3G8SA 1QAXA 5HMYA 1SC1B 1UFLA 4LFBJ 3MR3A 1EAYC 2W8LA 2O66A 4LFAJ 1GEHA 1KP6A 1UEVA 1RTDA 2GO9A 3CIMA 1TAUA 3AOCA 2HWIA 2WHOA 1Y5NB 2K7JA 2A1BA 1RBOB 3N01A 3BH6B 2DCUB 1G3OA 3TW0A 1VQ7S 3OLBA 2CPXA 2RUSA 4HLBA 5AXMA 2Y0SD 1KHWA 2X3GA 1D1UA 4K4WA 1RKJA 4KIAA 3RBDA 1S1UB 2CZ9A 4PUOA 3S01A 1BQMB 1UL3A 2HAIA 1R0AB 3MTJA 1HHQA 3QT5A 4D3HA 1S9GA 3N6MA 3M6VA 4L72B 1RYSA 3TUIC 5E3PA 2HGMA 4CT8A 4J91A 4PXCA 4QIWD 3ILLA 3WDOA 3J81U 5DM6Q 3LW5C 3V6HA 3CWJA 1KDNA 3PTWA 1SQGA 4DCPB 2PD1A 1PBUA 3CTRA 3RGIA 2YWFA 4DX5A 2KXNB 1X4HA 2MKSA 2QG9B 5B09A 1XWLA 2BM1A 5K8OA 3KLHA 2DGOA 3I87A 3C8YA 3ICLA 4B9MA 1CVJA 2IVMA 3F41A 1GX6A 1DLOB 3C66A 2VBYA 1Y3JA 2WB4A 3FEYB 1X5PA 3QIPA 2UU9J 2HGLA 3O5TB 4F0HA 3J81Y 4M5DB 3UD4P 1R89A 2HNDA 2JWNA 4PR6A 2CPJA 2V4JA 1XR7A 4BDPA 2HGNA 4ZVPB 5E41A 3M4XA 2H3EB 3MGJA 3BQ1A 5GVQA 4JI0J 3QQCD 4O3PA 4KHRA 1OYDA 1F2GA 2M2BA 2ILYA 4JI0F 3PEHA 4F02A 4MMOA 3KHHA 5KFOA 3A8IA 4URSA 4PQUB 3ZZTA 2AP6A 2V8VA 1R0BG 4YEAA 5LSRA 4N47A 4S0MA 4LF6J 4AXIA 4O4GB 3SV3A 1SXLA 2Y1LB 3T1HJ 5HK4A 1YBTA 2CADA 4OYMA 5GADI 3T1HF 4EZ6A 2HQFA 4J9OA 1ZM3A 2COLA 2R2UA 1GMWA 3BO4A 4P7VA 4X4NA 2Q1LA 2CPHA 5IQ6A 2M9KA 3VWSA 1VQ8S 2VFVA 4LRBA 5D4PA 2KTQA 1HNIB 2JLEA 2QA2A 1FXLA 2C3MA 2XS2A 4HT5A 5K14B 4NLPA 4DV0J 3K8WA 1N6QB 4NMXA 1E6YB 5DG9A 1UETA 4DV0F 2ZVSA 3HDSA 1APSA 4IOBA 3AOBA 2PFDA 4ES2A 1G1XA 3M2VB 4FNHA 1MWQA 1WDDA 1KWMA 1WHVA 5EGYA 4LR7A 3NNHA 3MOZA 4R25A 2FQQB 1C1CB 1S1UA 4CWBA 4ERDA 1UAWA 4CLZA 1BQMA 1R0AA 2A2CA 3M8ZA 1PAUB 3C6UB 5F9LA 1RWUA 3P49B 1J27A 3CJ5A 5L1IA 3LUYA 3BEGB 4K4XA 4B9TA 2IJNA 1GX5A 1GAOA 3KJFB 4ZPVR 1RJJA 4HI2A 2E5HA 1N88A 3HHLC 2G2YA 1X4DA 4F4WA 2C2ZB 2ACYA 3D6HB 4UQGA 3ETOA 3BBFA 4N7TA 1FDBA 4RW6B 3DRXA 2UUCJ 4DN0A 2WB1D 5E3AA 4XDDA 4C8NA 5KOXA 3KKFA 1DLOA 2UUCF 4OZ3A 3NWGA 2KYXA 3VF0B 2MHNA 3PNIA 2OI2A 1NNDA 4DR2J 2HHPA 3NGSA 4NI2A 4TY9A 1SC4B 4M5DA 3KJQB 2E5LJ 2RS8A 2C3UA 1K0TA 4ZKAA 2XNRA 2EFQA 3MUMP 2E5LF 3OL8A 3ENQA 3QRQA 2D3OR 3JAMU 1RU1A 1VBKA 5KFPA 1FEHA 4AD6A 1VIOA 4OYWA 1NBEB 2AQ4A 2R7TA 2DNOA 1UVLA 1FFGB 4DQIA 3MEKA 3BQ2A 3K0JA 4K4VA 4PQUA 1CQMA 4FXWA 4ETXA 3UN5A 2VG7B 1GFWB 2YWKA 2QLBB 1IVZA 4O4GA 2HW3A 1L3UA 2DNNA 1RAFB 4CTAB 2YWEA 1ZPWX 3AAWB 2IM2A 4P7TA 2EWHA 1HNVB 1MNEA 5JVGQ 1IBMJ 3V6JA 1SKRA 3IAS9 2DGSA 3JB9k 1RADB 3JAMY 4DZDA 1SJ3P 5KFGA 4A8OA 1IBMF 3TJAA 1JB0C 1SH0A 3N6LA 4ECXA 3FCWA 1HNIA 4C8KA 1Z1ZA 5EN1A 1T95A 4DUYJ 4LSZB 5K14A 2G9OA 2C3PA 5ETNA 1N6QA 2VJUA 1E6YA 4BWMA 1S6QB 4WP8A 2MTLA 1KEKA 1H7WA 3VGTA 2OJ3A 1CPZA 3RAQA 4WXOA 3RBEA 4A47A 4I7FB 3VAMA 4QIVA 5A0YB 2JC1A 3DXBA 3M2VA 1Y00A 1FD2A 1TK8A 2Y3YA 2HYIB 3Q8VA 4DCJB 4C4WA 3VTIA 2M4MA 3L09A 3TZXA 1C1CA 3QSYB 1RTHB 4L3NA 2F40A 2OEJA 1YDLA 3ZZOA 3GV5B 2ZWOA 3PJ9A 3C6UA 2AX0A 5H9EJ 5CXTA 4GMKA 1S1TB 2KI2A 2RD5C 4ZITA 2GV1A 1FTCA 2E5GA 1ZM9A 3H8YA 4NL5A 1NKEA 3SXLA 3H42A 1NMEB 1U6ZA 3W60A 3ONQA 1N34J 2YKAA 2KFZA 1T9UA 4Q2LA 4IRKA 1QVGR 2W9BB 3BGFA 2GQ2A 2B3TB 2AZ1A 5B0EA 2GQCA 5J1EB 2QC3A 2OFHX 4RR5A 3PYEA 4RW6A 4LRFA 4AXJA 4DS4A 2BQRA 3A3NB 2MSSA 2JVRA 1HWKA 1EARA 3CCLS 2KN4A 5CYJA 4ZLJA 1CJVB 5HVHA 2Z58B 3GCWP 3K8VA 2B6AB 3TUJC 3JS9A 1WC3A 4CP5A 1U8WA 4F7VA 2R8JA 1FDAA 4DR7J 2J7UA 3V6DB 3HT0A 3GJRB 4EI2A 1RAEB 5AE1A 4DR7F 1C0TB 1RBAA 2B56A 2DEJA 1JXLA 4FKXA 4Q8FA 4C11B 4XPCA 2M0GB 2E7WA 4ETZA 1VC6A 1NHVA 1RHKB 1Q7YT 2IDEA 5KG7A 5DLGA 3UPFA 2VG7A 3AJDA 1QD1A 2CAJA 2FVPA 1W2IA 5A8RB 4WWSA 4CTAA 5KG4A 3D6TB 3ZZPA 4WYWA 4ZPBA 5BYQA 1NKBA 1RLDA 1HNVA 3DGPB 3N28A 2HPUA 1TK0A 3CCSS 3NGRA 2E9ZA 1GT8A 2FD2A 3BQ0A 4A8QA 1ZBTA 1RA6A 4DQPA 4USWA 1RAJA 4ZHRB 2AGQA 3D9BA 1S6QA 1RWWB 4J9PA 5GMKa 2XSFA 4ECZA 2QL9B 4I7FA 5A0YA 3IM9A 4AL5A 4JI6J 1IUJA 2CA9A 3OVAA 2NYIA 1RAIB 4CO5A 3ZZ0A 4JI6F 1UEUA 4N8NA 1OQ6A 4RNMA 2ASLA 4FF1A 4WE1B 1RTHA 1TKZB 3GIIA 3NMAA 2XMAA 3VHQA 3QIDA 5D77A 1Q8BA 4HH1A 1ITPA 3R5JB 1HIYA 5B08A 4EFAC 1XNQJ 4RJVA 1S1TA 3CUNA 1HW8A 1DJ0A 1XNQF 1X31C 7FDRA 2Z56B 4P6QA 3ZO7A 4X64J 4F36A 2FZCB 2XC9A 2ZE2B 1HNZJ 4X64F 1HNZF 3A13A 4USTA 4ZK7M 3LAKA 3A3OB 3E01B 1N5QA 5JVHQ 1ELOA 5HVFA 4F2SA 2P5VA 2WVBA 5J1EA 1EB0A 5SZTA 5KFEA 1LFWA 4DFMA 2DEIA 2FGOA 2QLWA 4TN2A 1WOSA 1NZ8A 4OX6A 3HPOA 2RIJA 2YY3A 3M30B 3CD6S 5CHCB 1WHYA 3U1LA 2P6SA 1BWEA 3PJWA 2QL5B 1Q8KA 2B6AA 2ADBA 2XCAA 3HSGA 5RUBA 1HW9A 4X4PA 2WAQD 1R31A 3V6DA 2R7SA 2BOAA 4DPYA 5DETA 3NOCA 2RU3A 1WEYA 1XR6A 3DLLQ 4HTJA 1SH3A 2W4DA 4C11A 5L8RC 2LDYA 2JJ4D 4Y2KA 4MIWA 3CB4A 4F4ZA 2HQIA 2ZWPA 5ETRA 2ZC4A 3MR5A 5DQIA 4NLTA 2HBZB 3FDSA 4RW8B 5A8RA 4RNOA 3BKFA 5EUHA 1U2CA 4DOZA 3GWCA 5GAEU 4B3TJ 4YB7A 3DGPA 4OX7A 4O3QA 5C2CA 2XMUA 4B3TF 4FYDA 1NSPA 4OYBA 3W1YC 4YB6A 2ZH9A 4QYZK 4TQSA 1XERA 4N8OA 2HKEA 4A4JA 1TVRB 4B9VA 3FUYA 2UUAF 3BGLA 4Y34A 5KFUA 4ZHRA 5HROB 4Z37A 2GC8A 4CH0S 1C4AA 1AYEA 3UN2A 2Q79A 3CW2C 4PCQA 1RCXB 4DF4A 1VQPS 4AQYF 5ETMA 2HRTA 2XMVA 4G1QB 1HI0P 1FVQA 1EQMA 1TKZA 2KDOA 4MK7A 5U47A 2D7SA 5HATA 1BXNA 1S72S 4OZ2A 4ZVSB 4NZ0A 3QSIA 4RNFA 2X7IA 3IGNA 3D28A 4FDFA 3W61A 3OFEA 4ZLLA 2VB6A 2QLFB 5KT6A 1JLBB 3I5AA 2ZE2A 2VPWB 2VC1A 3UNYA 3DLEB 1Z2LA 4USMA 1PSDA 4OI2A 5SUHA 1F9FA 2DCLA 2YNFB 3E01A 5CAAA 2VFRA 3M8QB 2RJZA 5J1NA 2W2PP 2WBRA 3AXKA 1CSJA 3ENVA 2B9WA 2ACMA 3IA0A 4RLEA 2OEKA 5CQGA 3ZNUA 3RG6A 3HD2A 3EUNA 1UVMA 1KNZA 3KG1A 4RPFA 3G6YA 2DGUA 3MMAB 3D67A 1S0OA 2Y8YA 2OD6A 2FJDB 1FJGF 2GIFA 2WBMA 4ZCMA 2CJXB 2P9CA 1NB2A 4ANEA 4MKVA 1HBMB 2CJAA 1RXOB 2UXBJ 1LW2B 4NA3A 5HAOA 1QTMA 3TP2A 2VG5A 5GAGU 3HXMA 3OSNA 3BB5A 5DLFA 1DZ5A 1XC9A 2CQ0A 3M8PB 2XZDB 5KFFA 3BV8A 4X62J 3MUTP 4OLPA 2I6WA 2KRRA 2H5JB 3VV2B 3KUGA 1N48A 4DPUA 4RW8A 3FSIA 1PYTA 3FMBA 4FXVA 1W26A 2K8GA 1FVSA 4XDCA 3MAQA 1K9MT 2WK4A 4ECSA 1YGYA 1K44A 3KLVA 1Z2ZA 4FF4A 3C16B 2E5JA 2HS4A 4NE9C 5KFNA 2C2NA 1VQ5S 1UVNA 4CLTA 5LMUF 3GV8B 4RKUC 1TVRA 3MFHA 2RT3A 5JMNA 3EPIA 3SFUA 1IWAA 3WIVA 3F56A 1QAIA 3EXYA 2W8KA 3HVAA 3MD3A 2VJVA 5HROA 2IY5B 2GHWA 3NEKA 4U8VA 3HF5A 2DGWA 2KRBA 3CD5A 5GAEI 2CJYB 1T9WA 1S99A 2BE9B 4JV1A 1RHJB 2HLTA 1QAJA 2A0FB 2V2KA 3OW2R 2YVSA 5IS2A 1OJ4A 1TU0B 3LALA 3EYZA 3CF5Q 2KFYA 1Q8IA 3IG1B 5D0RA 2ZKUA 4DG1B 1KOHA 1K73T 4P71A 5KFHA 3K5LA 1S0MA 1DQ9A 3OXLA 4HHUA 4ZMMA 2QRRA 1FEEA 3I9V9 4H4KC 3SSQA 2ZHBA 4YY3J 3H0PA 3KG4A 3DLGB 1PIEA 2UUWA 4Q8EA 3P45B 4YY3F 4NEZA 2YQ0A 2IAJB 2JFKA 3FFIA 3L95X 3QATA 3EVMA 4PYAA 2J0QD 3LQVA 1S10A 1RAOA 3OXFA 1SQFA 1TTHB 4ED2A 3FVYA 4DI6A 1HWIA 2DGTA 1JLBA 2J0SD 1HWJA 3W2VB 3DLEA 4NA2A 1HL6A 2DIUA 4C6AA 1RHQB 1RAGB 2YNFA 2HSEB 2LLZA 4MIBA 3H2VE 3M8QA 1VBYA 2GGPB 2F4FA 4N41A 3QAEA 4G65A 4OYIA 3R5AA 2MQNA 1U1OA 4CCHA 2BDPA 1JLEB 1F9HA 1RI7A 1B99A 2BBEA 1R3NA 3FEXB 2MZQA 3L7UA 2Q6CA 3OVSA 2XMKA 2ZNYA 3MMAA 3TUZC 1CC7A 1I1GA 5C42B 3B4DA 2XMTA 1X7VA 1LWFB 1RWOB 3OL7A 2L9WA 3M8WA 2DNMA 1M5PC 1HBMA 3MDFA 2A6OA 1RACB 2ZFHA 4ECWA 1LW2A 4KJIA 2IRUA 2VG6B 1ROFA 4Q7AA 4HHJA 2BKNA 3I4HX 1Y7PA 3MUVP 1N56A 2IC3B 1S57A 3PRDA 2NPIA 4M8LA 2YH0A 4X65F 2DH8A 2EFOA 3M8PA 3UR3C 1KTQA 4OHXA 2CPYA 3POTB 4P9SA 1J2VA 2W25A 1NK7A 4MJKA 5EX0A 1BUXA 3H98A 2ZOFA 1FT8A 1QSSA 2YH1A 4X4QA 2VD3A 1R7IA 3C16A 1N33J 4ICLA 2FJVA 1N0UA 4OX8A 5GAGI 4F26A 4WF9Q 2HRYA 4RBUA 1PBAA 4J7CA 4ALZA 5GMEA 1BLUA 1H98A 5HN0A 4WFNQ 2EPIA 2ZH8A 3CXCR 5DG8A 2YQ3A 2BOPA 3W8GA 3AA9A 1EKRA 4JI4F 3V81A 2KU7A 3EGWB 1OSCA 5J2PB 3D7SB 1X9MA 2B5JB 2GJIA 2I0XA 2CPEA 2OEMA 2V8PA 2M8HA 4NLVA 3IG1A 4PYDA 2CZ4A 3R27A 3MPYA 4DG1A 3AD8C 1FTRA 3ILJA 4F67A 2ZD1B 2HHHJ 3B4MA 3MECB 5M2PA 2HHHF 3DLGA 4XK8C 2HQCA 2IAJA 2NS1B 4OZ1A 4ZPCA 1OYEA 4HHHA 2VPYB 4C3KA 2OLWA 2XWYA 4RUBA 4HT7A 2FHJA 3U1NA 3IRWP 2MQQA 1NK4A 3W2VA 1FNMA 1EP4A 2LECA 3JSBA 2AEMA 1WF1A 4QPTA 2POKA 3SCLE 2VUGA 2RRBA 1TV6B 1VIXA 2OTJS 1JLEA 2R4FA 2V4QA 2MY8A 3C6TB 1KQKA 4DMZA 1NDCA 4YQWA 3ZZUA 2WONB 4NASA 1AFIA 5LJ3Y 1U1QA 4JI3J 4OZNA 5C42A 4PZVA 1LWFA 5EWEA 3BN4A 2NXNA 1SL0A 1N36J 4JI3F 3W5YA 3L7OA 2LQ5A 4NLWA 1M5KC 4ILMA 4B02A 2J9EA 3THVA 4QWCA 3CJTA 2OP5A 1RHMB 4Z7CA 1N36F 1ZAXA 2VG6A 1QSLA 5KG1A 2QL7B 2XMJA 3CE8A 1QDUB 2RAQA 4ECVA 1NHUA 3TVKA 3DHXA 4O0NA 1IQZA 3WIUA 1Q78A 3JTOA 4LF7J 1PYOB 3FGVA 1U1NA 3CJRA 3MEGB 1LV5A 2W9AA 4LF7F 3POTA 1XEZA 1IBKJ 2L41A 1GXUA 4OYOA 1QTNB 4RWWA 1FJ7A 4ED5A 5ETSA 1VBXA 4GRSA 1IBKF 2EXUA 3JSYA 2RU9A 4ZPDA 2I38A 4DPTA 2RMLA 1L3KA 2CWKA 1M1GA 4LJMA 3I0RB 1SJ1A 4CH1A 3UDEA 5F9NA 4KY3A 2LA6A 3V2UC 4LF8F 4NCAA 1L3TA 1FXDA 3NBPB 5L46A 2DISA 1RU2A 2BZ2A 1RDRA 5DG7A 2PIIA 4RWXA 4B3MF 4DV3J 4M1KA 5J2PA 4LF4J 4UW2A 2KXFA 4KC5A 2B5JA 3GV7B 4A8XA 2XS7A 4CNZA 5DS7A 4LF4F 2B8PA 2WCXA 3CSKA 3MM9B 3ZFVA 1VQKS 4NLYA 4FBUA 1JLQB 2I2YA 2IDLA 4TLRA 1ZTTA 2MB0B 1UA0A 1YK9A 1JNZB 3RJMB 3MECA 5B0FA 3QJLA 2MZ1A 2V9WA 1F9EB 4TVAB 1PJ5A 3R2CJ 3PFEA 3R7BB 3PW7A 2R7VA 2HHQA 2HQ3A 4BC7A 2P8IA 1MROB 4R5PB 2W2MP 4USUA 2H54B 3EJMA 3DRSB 1FESA 3RW7A 1HYSB 2MHEA 1RGVA 1NZAA 2VOOA 4PWWA 3N6NA 1TV6A 2EFPA 4QYZJ 4WFAQ 1X60A 2ZOGA 4DSIA 2HFSA 3MCSA 3C6TA 1WTFA 4DV6J 3M32B 1BQXA 1LWXA 4KQZA 3R5GA 4DV6F 1URRA 2WONA 3FKBA 3D5MA 3VGVA 4EU0A 1WTBA 1QM9A 2J9CA 4KH0B 4KB7A 3KHLA 1S48A 5K5MA 3DXSX 2VQEJ 5J2QA 1X0PA 2HAFA 5J2MB 4RUHA 2VQEF 4URQU 1PYSB 1OIAA 3WZ0A 5KG6A 1X9SA 1IBLJ 1VMBA 1X4FA 1WEZA 2Q3PA 2GVZB 2MMYA 2RQKA 1REGX 3W63A 1IBLF 2R8GA 4W4MA 3DU5A 3RB0A 2VODA 3WX4A 2YKMB 3G8QA 1WDTA 1AW0A 2HHXA 3SSRA 3UN3A 2ZDPA 2XHWA 1SJ4P 1Y10A 2C2KB 1VRTB 1VQSA 4ES3A 2W7OA 3PO4A 3T41A 2H5EA 3OBIA 3MEEB 1GTEA 4WU2A 2AV5A 5JJBA 1Z4UA 2LXIA 3RAMA 3PRVA 3O2IA 3I0RA 5DGBA 3SQOP 4FZVA 1KOOA 4P2SA 2XHCA 2R2SA 3ELHA 4QWAA 3SI8A 4OLOA 1P1TA 2LQBA 2VA3A 2JLGA 2NYHA 4LRCA 2JH3A 1IN0A 3AD7C 3CJQA 4LSLA 2NPFA 1TUWA 2QA1A 2CQBA 1U48A 1S0VA 2U1AA 4CYUB 2CPIA 1FJCA 4TKTA 4CLLA 2H1YA 3KK3A 1RHUB 4DCOB 3AHPA 1VQNS 3MR2A 4KE5A 3SIPB 3MM9A 4LQ3A 1JLQA 3CMQA 1HA1A 4QR2A 3QGIA 3OR2B 1Q86T 2EI5A 5B0AA 2Q6BA 2RF2A 1DQ8A 5I4MA 4M94A 1OO0B 3QZ7A 1RYRA 2BE7D 1MROA 1QY7A 2KZMA 2KYZA 5LJ5Y 2LXFA 4DEZA 4R5PA 1Q5VA 4NLSA 1F3VA 4C48A 3DRSA 1XIQA 1TELA 4A8SA 1HYSA 2GS8A 1D9AA 4NWBA 4I6WA 2MGZB 5K8MA 2B7BB 2PC6A 3CDUA 1V3ZA 1M5VC 1U1KA 4DSLA 2H51B 2KM8C 2PT0A 3HLUA 2R7WA 3M32A 4ZS6A 1C1BB 4ED4A 3BYRA 3KYLA 4C9DA 3ETMA 2H4WB 5AXNA 3JTPA 4MYTA 1S7IA 1WC5A 4OJHA 3M2RB 3AXMA 5KT2A 3ZXWA 3B78A 2UVRA 2W2QP 3OHBA 4WYLA 2JRSA 1T9TA 1U45A 3MPVA 1P9QC 5ITHA 3ULHA 4A8MP 4PQAA 5J2MA 1ULRA 1G7CB 2KT5A 1HD0A 1N0VC 2VFTA 2GVZA 4W98A 2FLPA 3Q8YA 4LF9J 1NDKA 2HFOA 1B64A 5B0BA 4EO8A 1VK3A 4LF9F 2N4CA 2YKMA 2K3KA 5FJ4A 5DDQC 1VRUB 3GIJA 1WD6A 1VRTA 5C25B 4LVOP 1FJEB 2KJVA 3HHDA 3MEEA 5HJYA 2AMCB 1HNWJ 4NLUA 4NYOA 2VASA 2DGVA 2R8KA 4IRCA 2CVEA 2VQFJ 4I4BA 4F50A 1M90T 2EKNA 3E2EA 3CCES 3T3FA 1Q0NA 2J76E 5D0HA 2RSQA 1U09A 3PACA 4FKYA 4KGVB 1WI6A 1T7PA 3SCJE 2LEAA 1VS3A 1SKUB 3PYDA 4B3RJ 2PA8D 4DR3J 5FD1A 2WVFA 4ZP6A 1OY8A 4CYUA 3TVZA 1CJKB 4B3RF 1SIWB 1NDPA 1XR5A 2GZOA 4JV0A 3OJUA 4DSKA 4PXDA 4DPXA 2M7SA 1X4BA 4WIQA 5BYRA 1CJUA 2HRUA 1NXIA 1F3FA 3FBEA 1X8DA 2AZ3A 4C98A 4RZRA 8ATCB 4FNIA 1LNQA 2DR8A 2I9SA 4K8RA 1HBUB 3TO8A 1UPMB 1M5OC 4EBCA 4LIRA 2DD8S 1WEXA 3M7VA 4KR0B 3H7HB 4M63A 2HIQA 2GHPA 3VZIA 1SBRA 1H74A 1DFDA 1IXKA 1MSWD 3HZGA 2GX8A 2QMUB 3L7PA 3KFWX 1F5CA 4QYRA 2MGZA 2C2MB 3RBZA 1FCAA 2J8AA 3DRRB 3SBMA 4YUDA 4Q2MA 3TNVA 4DR1J 4WFZA 1H2TZ 1TR0A 3HKWA 4DFKA 2HVIA 3BDPA 4ZOSA 3DHWC 1NLKL 1YJ9S 3PHEA 2ZOMA 1RWVB 2J6SA 3CCVS 1VQMS 5T7LB 2ADCA 3M2RA 4OV6A 4HR2A 4A46A 4U7UD 5DDRC 5D4OA 1WC0A 3T9ZA 2E9RX 2G1DA 2E1PA 4Q43A 3R1LA 1TL1B 1X4CA 4A48A 3HO1A 3EZOA 1JWWA 5J2NB 2C3OA 3GYXB 2G1HA 3R8YA 3DRYA 5CYMB 4N5SA 1VBZA 4Y2AA 1YX2A 2IMOA 4QWDA 5HMWA 3CT9A 3CCUS 2YKNB 1ZH5A 2HHWA 5LL6d 1U1PA 4NX9A 3Q8UA 5KG3A 3BGRB 1BE4A 1BC6A 4WP9A 5THWA 1VRUA 3H40A 5C25A 4OQJA 4K4SA 3GFYA 4K4TA 1U2FA 2KXHA 3KMQA 4G6VB 5KFWA 5KFKA 5DJBA 2B9YA 2K2PA 4ECUA 1XN9A 3PW5A 3MR6A 2HURA 4MH8A 2HVDA 1SVDA 3WBZA 2YBVA 2RKIB 4JB8B 5H9EK 2ASYA 2XZWA 3W62A 4XTTA 4GVLA 5FLXU 1SC6A 2HNZB 2Z0GA 2ILZA 3T5JA 1CJKA 2MXYA 1O51A 3FQLA 5IV3A 3OFHA 4WFBQ 1YTYA 2VICA 3EM1A 5F8JA 5T14A 3KMSA 1YJVA 3M1VB 3NP5A 2ERRA 3NGTA 2CPDA 4O4RA 1N5YA 4F3MA 2VBXA 2QX0A 4C0BA 4DQRA 1WF2A 1YI2S 3PVXA 2JNJA 2OIHA 2OPRB 4A8WA 2I1RA 5KFYA 1RT3B 3CCZA 3J7A1 1K1SA 4Y00A 5ETQA 3VQTA 1KLMB 4ED6A 2N7CA 1HBUA 4OMFG 2WVEA 1NSAA 5FLXY 3NCQA 1VC0A 1HR0J 4JUZA 4RW7B 4X4UA 1RABB 2HBYB 3V4IB 1Q82T 3OTOJ 1YSJA 3NLCA 4ECQA 3A8JA 2LMIA 3T5LA 2QLJB 2R7QA 5BXIA 3OTOF 3DRRA 4FN5A 2CRLA 3EICA 4ED0A 4TU7A 3QAUA 4DR5J 3GPAA 2XLJA 1VJQA 3TX8A 1FRJA 1RKIA 3D1HA 3HVTA 4DR5F 2DXFA 4J9SA 5T7LA 2CQGA 1GMVA 3BO2A 4C3LA 1IKXA 1HWLA 1U02A 5HI7A 1O5JA 2RQCA 1EJ7L 3QRRA 4DL4A 3M6UA 4IR9A 5FDLB 1TL1A 2FTRA 3CJ4A 3GJQB 5J2NA 3PEJA 4PABA 2GO8A 3GONA 3FK4A 3RRHA 5CYMA 4FXDA 1VQ6S 1IM4A 2YKNA 2HHVA 2CNOB 1Y9OA 4F2RA 1WACA 3BGRA 2MKKA 4ZJQA 1V6HA 3TEGA 5IXUA 3ZNJ1 2ZM6F 2KJWA 5EX3A 3OR1B 1T11A 2HBQB 2F5GA 1WORA 3FNNA 1ZPVA 2ZBCA 4CDIA 5D8HB 2YKQA 1S76D 1JXEA 4I69A 3U27A 4GO7X 2UVWA 2CJBA 3MAHA 3RW6A 2HFVA 4YR2A 1VFJA 4G3IA 2OAUA 3MMBB 4ZCKA 1RWXB 5CCLA 4C7QA 2AYBA 1Q8LA 5A8KB 3KDOA 2XMWA 5BYSA 5KFZA 4WXWA 4Q5VA 2GNKA 3QJPA 2YPYA 2FZGB 1XTZA 3OT9A 2DR7A 4WJBA 4X66J 4UUWA 3KOAA 1TL7B 3M1VA 1BY9A 3TWZA 3O1LA 3JYTA 1XK8A 5F8NA 9RUBA 2JL9A 2Z2YB 3IR5B 4LF2A 5GAHU 2OPRA 2G2ZA 1RT3A 2IM3A 5D78A 1NKCA 4X4VA 4IUFA 1KLMA 4X84A 2WW8A 2PN6A 3K5MA 4J9VA 4C8ZA 5L1LA 3GU0A 3R1HA 4LFBF 2OSQA 4LFAF 1HPZA 4RW7A 4Q0BB 3VAFA 5AE2A 2NXJA 1K0VA 4P2XA 3DC2A 2DH9A 4FS2A 3SDEB 1REVB 3V4IA 3S8SA 1NHKL 2V50A 5L1KA 3CMAS 3FQKA 3BREA 3MTKA 4ZVGA 5E3CA 3EXCX 2HHUA 2C3YA 2DPJA 4QW8A 4BS2A 5IT0A 3QJJA 1VISA 2HIYA 1MMNA 1IJEB 4USHA 3CJ0A 2YNIB 3MMCB 1MN7A 1H38A 3R7SB 5CYQB 3QPIA 4TLQA 1D0EA 1UTAA 3FJ2A 4MFBB 4FPRA 1YJNS 1KLNA 1W7WA 1T02A 5DDPC 3M8RA 3BM7A 3RB6A 4J37A 2MKHA 3LTOA 5FDLA 4JYAJ 1QUPA 2FVSA 1PJ7A 2LVWA 2N7YA 3MEDB 4JYAF 3R9LA 3Q86A 1WG4A 2AKWB 4I64A 2G2OA 3DYAA 3LOUA 3A12A 3I9ZA 4X4RA 2WZ1A 1DHMA 1LWCB 2CZVC 4IO1A 1Y5LB 5A2QU 1R6VA 2YNHB 1VR6A 3OR1A 3K89A 4IO9Q 3IP0A 3WQPA 4XAKA 3RR8A 3CNQP 2IYGA 5AE3A 2UU9F 4UQTA 1Q95G 5A6WA 3CD7A 1BMQB 4F0MA 3TJ9A 2RRAA 4DXLA 2EKYA 1FWKA 2LQ8A 2Y1IA 3IRXB 3AH6A 4ZVTB 3MMBA 3UDLA 3SFGA 3OVBA 1NH7A 3VAHA 5A8KA 2QJ3A 5A2QY 3RB4A 3GFZA 1S79A 4DL0C 4YHHJ 1QSYA 1RAAB 2FZKB 2AEJA 3IAM9 2FB0A 1S6PB 1RT2B 2XBPA 3KLGB 4YHHF 3BGUA 3D54A 1JLGB 1HLWA 4P10A 4LF6F 2WRMA 3UVJB 1YIJS 4IR1A 2BJ7A 3C19A 3W66A 4YMEA 1TL7A 3EGVA 3CCWA 3MWBA 5CH7B 3PO5A 2GHVC 4TU9A 1GXTA 1YRTA 2V63A 3BPSP 5F41A 3OQ2A 4QQBA 4N77A 4B08A 4WZMA 4V19X 3GTYX 4AYBD 2AEFA 2V34A 1P9YA 4OI4A 2NCKL 4EYIB 2YTCA 4Q0BA 4CLWA 3K5OA 2DPIA 3LPEA 3SDEA 1REVA 1T3OA 4NOHA 3FBFA 3MMJA 4E2FB 3BH7B 3L3CA 5GAHI 5KT7A 3HFKA 4TXSA 1GMUA 5D6GA 3H25A 3THPA 3ZZZA 5LOQA 3C46A 2YNIA 2UVVA 3MMCA 5CYQA 2YX4A 5KAKA 4MFBA 1YKWA 1O0PA 2GA7A 2KVQE 4MIAA 3DCAA 2KZZA 4LR9A 1FHTA 2HQGA 4HDGA 1YJWS 1OPZA 4X4SA 2EC2A 2EBEA 2HLUA 2XI3A 2MKJA 5CD4A 1QE1B 1ZAWA 4EK2A 2VIHA 1Y0HA 4V1Ak 3MEDA 4MTPA 2E9TA 1FX4A 1TQLA 1RHRB 4K2JA 2QN6B 5F3TA 4QU6A 2ZUGA 2QYGA 2BA9A 2N82B 3VCDA 1XNRJ 3SCKE 3U02A 1NJYA 1LWCA 4YB5A 2DITA 1VQ9S 4GKKJ 4OJGA 1FRKA 1XNRF 5ETTA 2UUBJ 4M5IA 4AL7A 1URNA 1EZZB 2DO0A 4GKKF 3DLBA 8RUCA 3CJSA 2UUBF 5AXKA 2HNYB 2DK2A 3AJ2A 4CIOA 4B9SA 2JEIA 1V5IB 7AT1B 2GJFA 5D3GB 1V9OA 2N4DA 3G96A 4FBTA 1DBDA 1TMMA 2BV3A 1JKHB 4DR2F 4I1TA 2J7WA 2F8MA 3BN7A 2F3JA 4E8UA 4KTQA 2QEXS 4ZIWA 4UY8T 2BR0A 4RU9A 4IH6A 3IRXA 3TAPA 3VAKA 2ZKTA 1YJUA 4ZVOB 2C2EA 2L08A 2DNZA 2W24A 4F25A 5CD4H 3DOMB 4DV7J 3X3UA 3L4BC 2JX2A 4UZCA 4B17A 1Q53A 2AF6A 5G4DA 2F8HA 1S6PA 4DV7F 1RT2A 4U95A 3KLGA 3PDNA 1KR4A 1JLGA 3UVJA 2BQ3A 4KYZA 4DLEA 3LO3A 4BHQA 5K8NA 4MK9A 2DIVA 2HMIB 5KFMA 4R0EA 1X0FA 2HWTA 2DNPA 3OSPA 2IM1A 1F6TA 5A8WB 1WHWA 3GFXA 2PMZD 1WKJA 4H4OB 2FY1A 1RT1B 3HHLD 3GILA 4LBIA 3NCRA 2IM0A 3BSCA 3ET6B 1NH8A 1AFJA 3QGPA 1X4GA 4JI2J 4DN9A 3IM8A 3T1YJ 2BKPA 4DL2A 1NK6A 2CG4A 1KKHA 3MZIA 4ZVRB 3G6XA 3I31A 4DUYF 4K2XA 3CCQS 4EGLA 4Y2IA 1WSVA 1NB7A 5F8MA 3J7YU 2R42A 3BZQA 3MURP 3K58A 3D6MB 3QFWA 1SH2A 2B9EA 5HO4A 2W2OP 3PX4A 1JNRB 1S4FA 4YOEA 1F2HA 1VK8A 3H2UB 4JI7J 4ES1A 2DRAA 4ZPAA 3OHAA 5LSOA 4JI7F 2GMLA 1EQ0A 4WKYA 4QZVB 3RZAA 4B9UA 3AD9C 2XCPA 2Z57B 1DURA 2EVZA 4K50A 1B7YB 2D9OA 3Q8PB 3WX8A 2M52A 2CXEA 4CZCA 1V3SA 4WTOB 4ER8A 2NZ4A 4EYHB 1FNXH 5G0RB 2XB2D 4ATNA 3T9NA 1QE1A 2F65A 3IWLA 2KG0A 3BBBA 2J6TA 1L5UA 4NLQA 4RNNA 5B0CA 3CJ8A 3BKTA 1N34F 1YHQS 5MLCV 2V2QA 2MLYA 4UZBA 3D66A 2BMBA 4RBTA 5D0EA 4Y0FA 2JEFA 4KAIA 2DXDA 5LXRA 2PI4A 2KT2A 1R8AA 2HNYA 2H5IB 2XI2A 2G13A 3MCMA 3CDAA 2BANB 5D3GA 3DOLB 1UJ4A 3DDIA 2P2CB 1RWNB 4A8YA 1JKHA 5ETVA 3MCOA 3KDNA 2DY9A 2XGQA 5AT1B 1TFYA 3KNAA 4HKQA 3LAMA 5I42B 2ALYB 2AYEA 3PKMA 2XEXA 3NGKA 3J80U 2RE1A 2M8DB 2K1RB 3PFOA 3EVOA 5CCMA 1CQNA 3GB0A 1X5SA 2D41A 3I5CA 3DOMA 1HBOB 2DGXA 1S5ZA 2GW8A 2FVQA 4E0DA 2B4UA 2PSZA 3CO9A 4CH7A 4LRDA 4OZJA 2YWWA 4BBYA 5F8HA 1RE1B 4DFPA 2QO3A 2HMIA 2A10A 2KH9A 4ZJOA 1YG0A 4F4YA 2AU0A 4OHWA 3PR4A 1OY9A 5A8WA 4J90A 2AGOA 1L3SA 4K0KJ 3NRBA 4H4OA 4OHZA 4DR4J 1RT1A 1FD8A 1QLNA 1IR1A 3MHYA 3J80Y 4K0KF 2OPQB 3ET6A 4DR4F 2YX7A 2OSRA 4LMZA 2CJKA 2LKZA 1PC5A 2NR0A 1QAYA 1MMLA 2KG1A 5A6PA 3HVWA 3CJ2A 5IZHA 3A8EA 1PG5B 3QGGA 4U6PA 3HVRA 4PRFA 4DLGA 3HHLB 1JK9B 2X1BA 2ZUAA 1HQUB 4NEYA 2OKQA 2XYHB 2R7XA 1A0OB 4YDXA 1HBNB 4OV1A 2RDDA 3W5XA 3KTQA 1LK7A 4IDKB 4Q44A 3RBXA 3CC4S 2OUGA 3KLFB 2XY5A 4KGZB 3GCXP 2XWXA 1GMWD 3MR7A 2VKZG 1NSQA 2HWHA 4CNYA 1S59A 3GIKA 2GQQA 1LEOA 2R8HA 4YR0A 2YPZA 2VU5A 4E98A 3CJKB 4P75A 3J7YI 4HTIA 7FD1A 2ZZMA 4A8FA 3RRKA 3C3LA 5G0RA 3OPKA 5KT3A 1S0NA 1S9EB 4DSEA 5IQQA 2PEBA 4QR0A 3TZYA 2XNQA 1TL3B 2K06A 4LBPA 1SUQB 1MN9A 1TFWA 3GP9A 3J81j 1S97A 2RQ4A 2W9BA 4F3OA 3KK1B 1AT1B 1VCTA 3QZ8A 1UZDA 3M9NB 4QWBA 1XMBA 4PXEA 6AT1B 3NGDA 3W9IA 3G2XA 3QLHB 4OFZA 2AD9A 2FHKA 4O23A 1LWEB 3NY0A 1RTDB 2VFSA 3VQSA 4C97A 4WKRA 1FERA 4K4UA 2V94A 4QR1A 1BGXT 2BANA 1CJVA 3DOLA 2MJNA 1K47A 4IOAQ 1X5TA 1EKSA 2IRYA 3IFEA 2FJXA 3NMRA 1F5AA 1WKKA 2GJ2A 3OTEA 2DGQA 2I8EA 4UOHA 4LF1A 5I42A 1KHVA 2GMJA 1C0TA 4JI8J 4DV2J 2DNHA 3HP6A 1LQ9A 2E1RA 2K1RA 5B7WA 1TL5A 2L9DA 3ZZYA 2UUTA 3JSRA 4YP3A 1ZYQA 1HBOA 1U0HB 3GIRA 3AB4B 5DQHA 4ELVA 3UW1A 1S9FA 2WSEC 4U67Q 1YJRA 4B9LA 3P4UB 3S6EA 4UOGA 4WP3A 3IBCB 4C2MA 1UCNA 1XBWA 3P3DA 1R8HA 3MCNA 5EHHA 2IHR1 1O8BA 2MZTA 1UZHA 1SIZA 3BDEA 2E1CA 2HK2A 2OPQA 1JIHA 1VOMA 4DQQA 2A3JA 5F3ZA 3M9MB 5F0UA 2J9DA 2V67A 4NYPA 1TKTB 1D09B 4PEOA 3I82A 1CLFA 3HHLA 4WFXA 3W64A 5BR8J 4DX6A 1U25A 1HQUA 1RT5B 4BWJA 3OJSA 2DJWA 2DHAA 1XMOJ 2LU2A 5BR8F 1KD1T 3CCRS 1HBNA 4OZLA 3CC7S 1XMOF 4ANDA 2RDIA 3CC2S 3KLFA 4KPCA 4WE1A 2OO4A 2KB2A 2H9ZA 1AUDA 1G4CA 5ETKA 4DZ6A 4KO0B 1UW4A 4FYWB 4L75A 4CLFA 3CJKA 1NJWA 2QSWA 2PFFB 3D1QA 1F60B 3H20A 4JI1J 3DLJA 2GMHA 1S9EA 4ILRA 2IVFB 4TYBA 2HS3A 2VBWA 4JI1F 2JFDA 2FPHX 3HI9A 4DL3A 1TL3A 1IWGA 4DV5J 4BCAA 5E5NA 3LA0A 2ZH6A 3IN5A 1NPRA 1U24A 3UE2A 4DV5F 3KK1A 2DR5A 4OJ1A 5I3UB 1HMVB 4HDHA 1SCJB 4FYXB 1PO6A 2LYVA 4C0HA 3QLHA 1TL4A 3KHGA 1WHXA 4PAAA 2C42A 1LWEA 4NCGB 3KJVB 4RX6A 4OX9J 2MEWA 3M30A 3LWMA 3F0NA 1PCAA 4IG3B 2XTJP 2ROPA 4OX9F 2WVDA 1S1WB 2B4PA 4CLUA 3T6JA 4M5JA 5H9FK 4M5NA 2M70A 2SXLA 1A9NB 2EK1A 1NDLA 3GYNA 3P8BB 2O01C 4UTGA 1SQEA 2MQ8A 3TJ8A 2VV5A 2NLWA 3WC0A 5KFRA 1EX8A 4ZP8A 2UXBF 3PV8A 4KPYA 1TKXB 5D4LA 3G6ES 1U0HA 2L9NA 1FO1A 4K5SA 3CULA 1RP5A 3HZEA 3NS5A 2PGCA 2O67A 2DYAA 4X62F 1ZM4A 2G0JA 3CGIA 2CNNB 3B8HA 5F8LA 2FHMA 2CFXA 3UD5A 4TY8B 3DLKB 2Z30B 5A76A 2ZVIA 2ZJRQ 4LRAA 1N54B 3IXQA 2WTFA 4ZLPA 3RUBL 3ADAC 1S1XB 1TKTA 4NI2B 2B9XA 1D8YA 2QT7A 1UWBB 1S7HA 3QT7A 3L9ZA 5B0DA 2XO7A 3KUHA 3DFEA 3GJSB 2BJ3A 4JP8A 1SJQA 4IOCQ 1RT5A 1FFWB 2DR6A 2HK3A 2MDAA 4G1QA 2AJ1A 3G86A 2OPPB 4Q45A 4WZQA 3AJ1A 4KO0A 4NRTA 2QFJA 1MG7A 2HHTA 4F8RA 1T94A 1GH8A 2DHGA 3FRYA 4PPZA 3I96A 3NXZA 4XIUA 4OYPA 5DO2A 2ZEJA 4F4AA 2DHSA 5KFLA 4TU8A 2F9JA 2NZCA 4LIWA 1AB8A 1RWMB 3KUEA 4OHVA 2FYXA 1MLAA 3X1LB 1AROP 4DDFA 2VZ9A 3D6FB 5I3UA 1HMVA 3CCMS 4QPXA 1N5VA 1LOUA 2NXEA 1SKSA 3OUYB 2XLIA 1S77D 2DRDA 5L38A 3MM5B 4NCGA 3KJVA 2VHGA 1WSRA 3DU6A 4HL9A 1XJWB 4PG8A 2LQJA 2NXUA 4L76A 1RAHB 4IG3A 4ED1A 3HJVA 2P6TA 3TARA 3PW0A 2EG2A 1S1WA 4ZJLA 4NMLA 1ZZNA 1NJXA 4DV1J 1Q1KA 2E44A 2QV6A 2DR9A 5KG5A 3GR0A 4DV1F 2IJFA 1FDDA 4EZ9A 1RBLA 5K8PA 3TR5A 1HD1A 4RW4B 4DWIA 2FVRA 1T03B 1GXLA 3HFVA 2QLXA 3A1YG 2RVJA 3LGNA 1KN6A 3HULA 1TKXA 3CD0A 1M1HA 2DNQA 4DJBA 1U7LA 3GG1A 3TUPA 4J5OA 1RTIB 3KK2B 2V8DA 3PCOB 1TUVA 2F63A 1UWAA 1VQOS 4TNOA 3ITHB 2MSTA 4NLXA 3CMES 1AUSL 4FVMA 4TY8A 2DNGA 3DLKA 4UOFA
chains in the Genus database with same CATH topology
1SC3B 4LSZB 3P4UB 2CNKB 4ZVQB 4JB8B 2H5IB 3GJSB 1SC4B 3NS7B 3KJQB 3IBCB 2FQQB 1RHMB 1RHQB 2Y0BB 2CNLB 1ICEB 4ZVOB 2QL7B 2P2CB 1RWNB 1QDUB 1SC1B 2CJXB 4DCPB 1PAUB 5K20B 2Y1LB 2HBZB 3R7NB 2CJYB 1I51B 1PYOB 1RHRB 1RWKB 2DKOB 1RWXB 4ZVSB 3RJMB 5IC6B 1RHJB 2H51B 3R6LB 2XYPB 2C1EB 2XYHB 4DCJB 3GJTB 5IC4B 1QTNB 3KJNB 1F9EB 1IBCB 2H65B 2CNNB 1RWWB 3R7BB 3KJFB 3GJQB 1RHUB 4DCOB 1GFWB 2H4WB 2QLFB 3GJRB 2CDRB 2QLBB 1BMQB 3R7SB 2XZDB 3SIPB 2H48B 2C2MB 1RWOB 2QL9B 3EDRB 1RWMB 2H5JB 2HBRB 4ZVTB 2XYGB 3EDQB 1I3OB 2H4YB 2H54B 2QL5B 2C2ZB 1RE1B 3D6HB 3P45B 2CNOB 2XZTB 4ZVRB 4ZVUB 1RHKB 3D6FB 4ZVPB 1RWVB 2C2OB 2C2KB 2HBYB 3R6GB 1RWPB 1NMEB 3D6MB 3IBFB 2HBQB 3QNWB 2QLJB 3R5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC3 B;  4LSZ B;  3P4U B;  2CNK B;  4ZVQ B;  4JB8 B;  2H5I B;  3GJS B;  1SC4 B;  3NS7 B;  3KJQ B;  3IBC B;  2FQQ B;  1RHM B;  1RHQ B;  2Y0B B;  2CNL B;  1ICE B;  4ZVO B;  2QL7 B;  2P2C B;  1RWN B;  1QDU B;  1SC1 B;  2CJX B;  4DCP B;  1PAU B;  5K20 B;  2Y1L B;  2HBZ B;  3R7N B;  2CJY B;  1I51 B;  1PYO B;  1RHR B;  1RWK B;  2DKO B;  1RWX B;  4ZVS B;  3RJM B;  5IC6 B;  1RHJ B;  2H51 B;  3R6L B;  2XYP B;  2C1E B;  2XYH B;  4DCJ B;  3GJT B;  5IC4 B;  1QTN B;  3KJN B;  1F9E B;  1IBC B;  2H65 B;  2CNN B;  1RWW B;  3R7B B;  3KJF B;  3GJQ B;  1RHU B;  4DCO B;  1GFW B;  2H4W B;  2QLF B;  3GJR B;  2CDR B;  2QLB B;  1BMQ B;  3R7S B;  2XZD B;  3SIP B;  2H48 B;  2C2M B;  1RWO B;  2QL9 B;  3EDR B;  1RWM B;  2H5J B;  2HBR B;  4ZVT B;  2XYG B;  3EDQ B;  1I3O B;  2H4Y B;  2H54 B;  2QL5 B;  2C2Z B;  1RE1 B;  3D6H B;  3P45 B;  2CNO B;  2XZT B;  4ZVR B;  4ZVU B;  1RHK B;  3D6F B;  4ZVP B;  1RWV B;  2C2O B;  2C2K B;  2HBY B;  3R6G B;  1RWP B;  1NME B;  3D6M B;  3IBF B;  2HBQ B;  3QNW B;  2QLJ B;  3R5J B; 
#chains in the Genus database with same CATH topology
 3Q8R B;  4FVC A;  5HVG A;  4L6V 3;  2JVO A;  1N33 F;  2VFU A;  4HYK A;  1U8S A;  2G0C A;  1U4B A;  5KFJ A;  2XM3 A;  1QVF R;  3BO3 A;  1S1X A;  3F73 A;  1X5O A;  4ECY A;  4BLG A;  2XUL A;  3TI0 A;  5DGA A;  1X9W A;  3PXG a;  1NPP A;  1VQ4 S;  1UWB A;  4W92 B;  1FKP B;  2CUY A;  4GO5 X;  3R6L B;  2R7U A;  1NCL A;  2AIR B;  4CRJ A;  1JLC B;  4ILL A;  4LFC J;  1T9X A;  4OL8 A;  4CM2 A;  3PIO Q;  4Z7Y A;  4DU7 A;  5E7O B;  4LFC F;  4I67 A;  4B3O B;  2B7C B;  2R7R A;  3PX6 A;  3W8P A;  3AT1 B;  2AJF E;  4I6A A;  1Y5I B;  4KV8 B;  2OPP A;  2B8Q A;  1U6B A;  3MF5 A;  4YN3 B;  3D0G E;  4LUB A;  4LBH A;  3QWP A;  1B70 B;  2MY7 A;  4PWU A;  2RB7 A;  1RWP B;  4P74 A;  1KRP A;  2D3O 1;  4MKB A;  2G0I A;  2CQI A;  3KLE B;  2LCW A;  2BE2 B;  4NLD A;  3F44 A;  2X3D A;  2A6M A;  4U7C A;  2C2D A;  2QA4 S;  4DPO A;  1RT4 B;  3GSI A;  5E33 A;  1RCO B;  2GGP A;  5FII A;  4I56 A;  3OUY A;  1NK9 A;  3MM5 A;  3QWU A;  4GC6 A;  3MD1 A;  5IV4 A;  4CO3 A;  3Q24 A;  4ZP7 A;  2YKP A;  3R97 A;  1HFE L;  1RB0 A;  1JLA B;  4JI5 J;  2O3D A;  2AYG A;  2X1G A;  4AE5 A;  2J7K A;  4JI5 F;  4QU7 A;  3KHR A;  3KG0 A;  1H7X A;  8AT1 B;  4ZVF A;  4KFB B;  2L3M A;  4ZP9 A;  2AHO B;  3Q2T C;  3E51 A;  3OXG A;  4CLY A;  1PC4 A;  5M2R A;  2QYC A;  2ZH3 A;  5KT5 A;  3QFH A;  4RW4 A;  2WOM B;  3IBW A;  3GIM A;  1T03 A;  2ZH4 A;  3AQP A;  1YBA A;  2IC3 A;  5JXS A;  1U47 A;  4DX8 H;  1RTI A;  3KK2 A;  3A3P B;  2Z2L A;  4P73 A;  2ROE A;  3K59 A;  2DB1 A;  2W9C B;  4PPD A;  3ITH A;  4FF3 A;  3A4T A;  3Q89 A;  3NS6 A;  2CQ4 A;  2AX1 A;  1M5H A;  4AUK A;  4YDD B;  3O8W A;  1PIL A;  4C3M A;  4YS2 A;  2D74 B;  3HJF A;  2V2V A;  1HHS A;  1YRU A;  1WEL A;  4WCE Q;  2WW4 A;  5IT9 U;  4F0K A;  1TAQ A;  2DY1 A;  2FDN A;  2C28 A;  1FKP A;  2DTJ A;  4DL5 A;  3JQM A;  3JXO A;  1VC5 A;  1JLC A;  1R8P A;  1RT7 B;  4IKA A;  2G4B A;  4DV3 F;  1YWX A;  4B3O A;  3UQS A;  5KOW A;  1FRX A;  1CBK A;  2J6U A;  2NXC A;  2F1F A;  2FLN A;  2IFX A;  2FUG 9;  4CT9 A;  3DNC A;  3M2U B;  1AZS B;  1I94 J;  1FRL A;  4KV8 A;  3ENW A;  2ZD1 A;  1I94 F;  2O5D A;  2K3I A;  4M5H A;  2BM0 A;  3IWX A;  1AA1 B;  2WSC C;  5IT9 Y;  4NPO A;  3CVK A;  3MOJ B;  3ZTQ A;  4JOU A;  1F0X A;  5HAN A;  3MXH P;  3R7N B;  2V4R A;  1QUV A;  3VAG A;  1UKU A;  3KLE A;  1GQE A;  2BE2 A;  3IR6 B;  4MT1 A;  2LXU A;  3P6Y C;  2B51 A;  1RT4 A;  2W7P A;  1U1M A;  3D1O A;  5E3Q A;  1KFD A;  1RT6 B;  2FJA B;  5I3P A;  3DDN A;  1DRZ A;  2JC0 A;  4RUC A;  3FBB A;  1JLA A;  4ZLN A;  4N76 A;  4DBQ A;  4ED8 A;  3UO0 A;  2W4P A;  3TOQ A;  3DMJ B;  3CCJ S;  4O3N A;  4PG5 A;  5ADZ A;  4KFB A;  2QIF A;  3PRB A;  2FVC A;  2JLF A;  3R2D J;  1VJW A;  3UDC A;  3M8Y A;  3IS9 B;  2WOM A;  3W65 A;  3MFI A;  4ANC A;  3O6Q A;  3K7R A;  2RIL A;  5HQ8 A;  2YWG A;  3SCI E;  1OS5 A;  3MEG A;  2Y9H A;  1SJF A;  3FMW A;  3ZTO A;  3OFF A;  1ZM2 A;  2W9C A;  2MLZ A;  3THT A;  3IO1 A;  4Y28 C;  4R0J A;  1IM6 A;  3PX0 A;  4U7U K;  4QW9 A;  1I3O B;  3CPW R;  4H4K A;  2H4Y B;  2XS5 A;  4FF2 A;  2VKR A;  3N5F A;  1MMD A;  3N0V A;  4TYA A;  2C2O B;  2FHO B;  2E5I A;  2D3U A;  1B0P A;  4L3K A;  4JV5 J;  2N3L A;  5ETO A;  1HI8 A;  1UPP A;  2CNK B;  2F4V J;  3CO0 P;  3NBP A;  4QBU A;  4JV5 F;  3Q0A A;  1O6X A;  2F4V F;  4F04 B;  1JLF B;  2IVY A;  1FI4 A;  1RT7 A;  4USJ C;  3B82 A;  3WHI A;  3VGS A;  4P2M A;  2F8E X;  5H9F J;  4WBF A;  4GKJ J;  4QCL A;  1TZ0 A;  2B4O A;  2XGP A;  1UVI A;  2AGP A;  2VG5 B;  1OQ3 A;  2QE5 A;  3M2U A;  4GKJ F;  1AZS A;  2M5Y A;  2XYP B;  2CVI A;  2V9K A;  4QWE A;  4FYY B;  1FX2 A;  3HT3 A;  1F5B A;  3K57 A;  5AJ3 J;  4FYV B;  3FEZ A;  2H65 B;  4J9L A;  3P5B P;  4EWT A;  2BJD A;  5AJ3 F;  2XSJ B;  3K2Y A;  1LK5 A;  1RUS A;  1C2P A;  5KTQ A;  4F4K A;  1Q5Y A;  4QOT A;  3KWM A;  1KON A;  3M6W A;  4W90 B;  3W2W B;  1HWU A;  4DL7 A;  4X4T A;  1S1V B;  1W25 A;  2EG1 A;  2CQH A;  3V5R A;  2NUH A;  1WG1 A;  2X1F A;  2UUA J;  3DM2 B;  4CO0 A;  1UFK A;  2JEG A;  3LF0 A;  3QNW B;  2J0W A;  1SC3 B;  1RT6 A;  1A6L A;  2CQC A;  1B3T A;  5CA5 A;  1HQ2 A;  4LRE A;  2LQ9 A;  1U49 A;  5C5J A;  3UR0 A;  2ZBI A;  2IMW P;  1T0T V;  1KS2 A;  1W2B R;  3AY0 A;  4MK8 A;  4K59 A;  4RNH A;  9ATC B;  4AQY J;  3K5N A;  3DMJ A;  5L1J A;  1JX4 A;  3I4P A;  1GK8 A;  2C1E B;  3D0I E;  2ZH1 A;  3GFH A;  1X4E A;  4URG A;  2D1C A;  4ZCI A;  2CDQ A;  2FHJ D;  3IS9 A;  1FDN A;  1U6F A;  2EFN A;  1NK5 A;  3CDW A;  1OSD A;  2WSF C;  1MW7 A;  3FFI B;  2UZA A;  3AB2 B;  2BEF A;  4OZ0 A;  3NG8 A;  3TAN A;  3ILI A;  2CPZ A;  2V8H A;  4B3S J;  2QSF A;  2BVZ A;  2DO4 A;  4B3S F;  5DM7 Q;  1OWX A;  2PE8 A;  3TQE A;  3V4M A;  3UDV A;  4O44 B;  2W01 A;  2E1M C;  2DNY A;  2EFV A;  2RH3 A;  1MWZ A;  4NLR A;  2CNL B;  2DH7 A;  3DRP B;  4IH7 A;  3CDE A;  2V6A A;  1HNW F;  2Z2Z A;  4ECT A;  2VQF F;  1FJG J;  4DPW A;  2C22 A;  4AT1 B;  3MPU B;  2ZBR A;  1T05 B;  2CQ1 A;  3T6B A;  1D9D A;  2BAB A;  1JLF A;  4DR3 F;  4LR8 A;  3GZ7 A;  3EZ5 A;  2KVI A;  1RIS A;  4RU2 A;  4GC7 A;  1VQL S;  2QA4 G;  4JBC A;  3H5U A;  1UEK A;  1IKW B;  1YQH A;  3TA0 A;  2DNR A;  4KHM A;  2JHE A;  3OR2 A;  5HMX A;  3LP1 B;  2AWZ A;  3R6G B;  1HAR A;  4X2B A;  1RZM A;  1K1Q A;  3D68 A;  3GE9 A;  2XSJ A;  1M1K T;  2CJQ A;  2KT3 A;  4IRD A;  2RDJ A;  1H72 C;  3H4D A;  2GFF A;  3W2W A;  1S1V A;  1WUU A;  1N5T A;  3G6V A;  5LMU J;  4RUA A;  4ICL B;  4WFY A;  1N5S A;  3K17 A;  3WC2 A;  3JTN A;  1GNK A;  2QFI A;  3DM2 A;  2KHD A;  2LEB A;  1ZA1 B;  4KGM A;  1XMQ J;  2VON A;  4WU3 A;  4P52 A;  4CLS A;  1XMQ F;  3BGO P;  1NU4 A;  4HH0 A;  1S6U A;  3ZTP A;  1CUL B;  4ZDN A;  1A7G E;  2V0N A;  4DR1 F;  2A2D A;  1C1B A;  4F4X A;  3V81 B;  4DS5 A;  3IGV A;  2PMH A;  4IQX A;  4OIX A;  2PI5 A;  1RTJ B;  1SB6 A;  2IPO B;  5KFC A;  1JQG A;  3IWN C;  4PWD B;  4CM0 A;  1UVJ A;  4DUT A;  4ELU A;  3HSZ A;  2LA4 A;  2Z4P A;  2OD4 A;  3BBC A;  2E7V A;  4C8O A;  4MKA A;  2Y1R I;  3D2W A;  5C2G A;  4I2Q B;  1UP1 A;  4WK1 A;  4MKY A;  3AFG A;  2IBK A;  4NLG A;  3NNC A;  2RRN A;  3CCT A;  2GIQ A;  3OLA A;  3R5C A;  4K7Q A;  3W9H A;  2GVD B;  3DLH A;  4WII A;  1EP4 B;  4HVZ A;  5KFT A;  2X1A A;  4O44 A;  2AJ4 A;  3QO9 B;  3G71 S;  3VZH A;  2MJU A;  4C8L A;  1KQG B;  1V5V A;  3FZB A;  1SL2 A;  2HVH A;  1FE4 A;  3U7J A;  2OML A;  3DRP A;  1NAQ A;  3HX9 A;  4NRU A;  2HQD A;  4ZN1 A;  2LU1 A;  4K4Y A;  2EEY A;  4CO4 A;  2CQ2 A;  5CZX A;  3RR7 A;  2UV8 A;  2W1B A;  3T19 A;  1EHW A;  4F3Q A;  2VDH A;  2XZT B;  4ZVU B;  4ED7 A;  1IJF B;  3NOG A;  1T05 A;  3RTV A;  3BF4 A;  3P96 A;  3QRP A;  4DU8 A;  2E1A A;  3RRG A;  2B4V A;  3HMJ G;  5AXL A;  2BRK A;  3HSD A;  4NCB A;  1NEE A;  2KM8 B;  4X65 J;  3PYG A;  2QGF B;  1C4C A;  2KHC A;  2JDJ A;  3G82 B;  1IKW A;  1H73 A;  5HMZ A;  3E3X A;  1FRI A;  3LP1 A;  2ABY A;  5CAB A;  3CDB A;  3NL0 A;  2B43 A;  1OPI A;  1ZTW A;  4USV A;  3TA1 A;  3TZZ A;  3DN9 A;  1Y11 A;  2MQM A;  5HBM B;  4OZ5 A;  4EBE A;  4OYA A;  2ZJQ Q;  3NCP A;  1FWP A;  1HR0 F;  3HD1 A;  4KH1 B;  1JJH A;  4ID5 B;  1IKY B;  3LGH A;  1CG2 A;  4H54 A;  2F9D A;  3EDQ B;  2EBG A;  3UCU P;  4QIF A;  3ISN C;  1IR2 A;  1DTQ B;  3RU0 A;  5I3Q A;  3FZ2 A;  2IA6 A;  2HZV A;  1CUL A;  4JI4 J;  2DNK A;  1RTZ A;  2M88 A;  5J1P A;  3U1M A;  3Q8Q B;  4U9R A;  2O1P A;  5L9N A;  3TX0 A;  2I5J B;  1B7F A;  4D3G A;  4ZA1 A;  2FLO A;  1RTJ A;  4YR3 A;  4ZVE A;  4PG4 A;  2NSB A;  1WF0 A;  3IC1 A;  1TP7 A;  4R8U B;  3IMQ J;  2CG8 A;  2HS0 A;  4PWD A;  3C14 B;  4Z2X A;  3G87 A;  2FC8 A;  2OMO A;  3TAQ A;  2DVI A;  4EO6 A;  2MQO A;  3OTB A;  4NZ7 A;  4I2Q A;  3J7Z T;  3DI6 B;  4K5R A;  4JV2 A;  3KJN B;  5HQM A;  3KNG A;  1IBC B;  3I6P A;  2UXC J;  1B0V A;  5IOL A;  2ATL A;  4PKD B;  3NAH A;  1KQS R;  2UXC F;  2JOQ A;  4KGK A;  5LSL A;  3M05 A;  2HG4 A;  1UW9 A;  2GVD A;  4TQR A;  2VPZ B;  3M9O B;  2RNE A;  2DNL A;  3MI7 X;  3ENA A;  3EVW A;  3QO9 A;  2HFU A;  1FE0 A;  1SKW A;  3JQJ A;  3CJ3 A;  1WC6 A;  1DTT B;  5F8I A;  3HKZ D;  4CI0 B;  1KVI A;  3ISN D;  2E29 A;  4FPI A;  3I5B A;  2ZDO A;  1L3V A;  1T9Y A;  5BJR A;  4DV4 J;  5KFA A;  1DQA A;  3O44 A;  2BJ9 A;  2QTW A;  3TA2 A;  4YFU A;  3SZ2 A;  2BQU A;  4DV4 F;  5HP1 B;  2RKI A;  1RLC L;  2IBO A;  3SYZ A;  3G4S S;  3JSM B;  2HNZ A;  3EMT A;  3A8K A;  1WOO A;  2IYI A;  4IFY B;  4DHV A;  2QZ8 A;  5J2Q B;  1NM2 A;  3N9U C;  2APO A;  3Q83 A;  5K9F A;  4X66 F;  4G1P A;  3H90 A;  4ZCL A;  2IRX A;  4G1I A;  1AXQ A;  5F0W A;  2P9E A;  1NPK A;  1VYA A;  5EWF A;  3G82 A;  4EMD A;  1FXR A;  2W7A A;  1PGZ A;  1JJ2 R;  2MKC A;  4P2F A;  4LSN B;  2W2N P;  1H2V Z;  4I2P B;  3OL6 A;  2J0X A;  3J7Z 5;  1NRK A;  2ZHO A;  1NK0 A;  1B4S A;  2JSX A;  5HBM A;  2ASJ A;  5E2Q A;  3OV7 A;  2XLK A;  4CQ1 A;  1JJC B;  1U26 A;  1YBU A;  2V69 A;  1FRM A;  3TRG A;  4QIG A;  3MAA B;  2BW7 A;  5HQL A;  4GVB B;  3Q2S C;  4WPA A;  4ID5 A;  1IKY A;  1R6Y A;  2MKY A;  2ZZN A;  5H1S V;  2ZBP A;  4RBV A;  3QGH A;  3MM6 B;  2Q43 A;  1S6O A;  4LF8 J;  1DTQ A;  4ZVH A;  2AJ0 A;  2JZ5 A;  4C8Y A;  4B3M J;  2CKW A;  2RUG A;  2OEL A;  3BJY A;  4LSL B;  1SJR A;  3Q22 A;  1S49 A;  5ETP A;  2I5J A;  1NO8 A;  5IC6 B;  1R27 B;  1H6K X;  1R0C B;  5MAO A;  3KK3 B;  1C0U B;  1T9V A;  1V3R A;  4ZIV A;  2XO6 A;  2XQC A;  4MAK A;  4R8U A;  4LF5 J;  3C14 A;  3W3S A;  2RS2 A;  1TUG B;  3FSX A;  4LF5 F;  1LXN A;  4IYQ A;  4IH5 A;  5IT4 A;  5KFD A;  3BYP A;  2GIR A;  3N4W A;  3DI6 A;  2R2R A;  4A8K A;  1F1B B;  1VI7 A;  1G6B A;  1Y4Z B;  2RF2 B;  2UP1 A;  1KQF B;  2DT9 A;  4O3S A;  2R8I A;  1G2E A;  3MM8 B;  2RHQ B;  2BJ8 A;  1UVK A;  3G8T A;  1IKV B;  1CS4 B;  3FSY A;  3CIZ A;  5CZV A;  4IFV B;  1CJT B;  2FLL A;  2ALZ A;  3EGZ A;  3VVU A;  1QJH A;  4U8Y A;  1DTT A;  2R3V A;  4OI0 A;  4UOC A;  5DQG A;  3VVT A;  1MWY A;  3PKY A;  2A18 A;  3TAM B;  2MYF A;  3W5Z A;  5KFS A;  3PW2 A;  2Y8W A;  1Q4R A;  3FCH A;  1P1L A;  1YRX A;  3GJT B;  3HSJ A;  4M5G A;  4OI1 A;  3GR1 A;  2CIM A;  1HNX J;  2VL1 A;  5HP1 A;  2VH7 A;  3KLI B;  3FRZ A;  2CQP A;  4M5L A;  1HNX F;  2CDR B;  3JSM A;  3BSA A;  3HM9 A;  4ZPT R;  1H3D A;  1RA7 A;  4IFY A;  3G9C A;  1B0T A;  1VRQ C;  4DX7 A;  2K7K A;  3TYT A;  3NKY A;  2LP4 A;  2UVU A;  2ZC3 A;  3LH2 S;  3D3C J;  3ISZ A;  1FFS B;  1FA0 A;  2CJ9 A;  3GMG A;  1FKA F;  4DF8 A;  3IBF B;  3BKU A;  4LSN A;  3OL9 A;  2D69 A;  4ENO A;  1BQN B;  4I2P A;  3H2L A;  3QBC A;  4CO2 A;  2OGU A;  2ZNZ A;  3PIP Q;  3LP0 B;  3QT6 A;  1I6J A;  2EC0 A;  1NSK L;  1OY6 A;  1DAX A;  1XQI A;  4J9N A;  1CEZ A;  3MAA A;  4KRW A;  4UF4 A;  4NXM J;  1BD6 A;  4GVB A;  2ZH2 A;  6FD1 A;  1RWK B;  5KFV A;  3MPD A;  2CPF A;  2AJQ A;  4IG0 B;  5KFX A;  4NXM F;  1ZS6 A;  3OFG A;  1Q16 B;  1JJ4 A;  2R7O A;  4EUV A;  1E6V B;  3MM6 A;  3ILO A;  4WTY A;  1SV5 B;  4DSF A;  3GSD A;  3QMQ A;  2OH2 A;  1FRH A;  4KSE B;  5KFB A;  1EET B;  4PG6 A;  4Y3C A;  3FBC A;  3V6K A;  2BX6 A;  3BR8 A;  5EDW A;  3EPG A;  3H5Y A;  2HBR B;  4U96 A;  2ZHA A;  3LP2 B;  1YJT A;  1JMT A;  2HEK A;  2YKO A;  1C0U A;  2ZH5 A;  4EBD A;  3IR7 B;  2KO1 A;  2UV8 G;  1U1L A;  4ID8 A;  1NJZ A;  4YB1 P;  2MQL A;  1CJU B;  6FDR A;  1VHI A;  5HL7 Q;  2M3D A;  3AOD A;  2C2R A;  3NWR A;  1NUE A;  2D9P A;  1LKZ A;  3LAN A;  1YLX A;  3KXD A;  3TVY A;  3LPY A;  1FWL A;  2MZJ A;  1J5O B;  3PZP A;  2AJ2 A;  2V2Z A;  1NJI T;  3RB3 A;  4PG7 A;  2BKO A;  1FK9 B;  3EWG A;  4DL6 A;  1N32 J;  3MM8 A;  2DXE A;  3H59 A;  1U2R A;  1N32 F;  2YNH A;  1IKV A;  4BC9 A;  4Y2C A;  1CS4 A;  3RYL A;  2ASD A;  1Q81 T;  2CQ3 A;  4O0I A;  3MM7 B;  1HHT P;  4LVN P;  2VOP A;  4NA1 A;  4IFV A;  1WJ9 A;  1CJT A;  2FJB B;  1DAR A;  2W4C A;  2XG8 A;  5HLF B;  2ATC B;  3EDR B;  5LXY A;  1U0S A;  1CC8 A;  1D9F A;  2Z2M A;  2Z8Q A;  2RQM A;  4J9Q A;  3I56 S;  1WG5 A;  3TAM A;  1ZET A;  4N56 A;  4M5M A;  2MQP A;  3D4J A;  4NZ6 A;  5LT5 A;  4ELT A;  3KLI A;  1EIY B;  4PXB A;  3SSS A;  2DBB A;  3HHK A;  4I68 A;  3I32 A;  1T3N A;  5ETL A;  4AL6 A;  2Q66 A;  1PKU A;  3VR1 A;  4QJV A;  4Y2M A;  1ICE B;  4UUX A;  4V19 J;  3S1T A;  4FS1 A;  3H5S A;  1M0S A;  3AA8 A;  2GCF A;  3UFC X;  3UCZ P;  2LFV A;  5F8G A;  4HI1 A;  2DKO B;  2QMX A;  2FGC A;  1LW0 B;  1HQE B;  3D3B J;  1BQN A;  1MU2 B;  3N79 A;  2RHS B;  4Y65 A;  3LP0 A;  4JI2 F;  3T1Y F;  1YIT S;  2ZH7 A;  2DHX A;  1VGY A;  2EFG A;  4HAC B;  2FJE B;  2HZC A;  2XYG B;  1WNE A;  3N5B A;  2DRB A;  4I6Y A;  2V5H G;  4RW9 B;  4IG0 A;  3US5 A;  1KFS A;  4NLO A;  1E6V A;  1SV5 A;  2KL8 A;  3I0S B;  3TQ1 A;  3HFZ B;  1RK8 A;  3RAX A;  1N52 B;  1UMJ A;  4L73 A;  2GAH C;  1EET A;  3UI3 A;  2R9L A;  5C24 B;  4DUZ J;  1R8B A;  3GLJ A;  2CWX A;  1WI8 A;  1ZAV A;  5LM7 E;  1VLY A;  2J8S A;  4DUZ F;  4IQM A;  5DDO C;  4O3R A;  3M8S A;  3LP2 A;  4UY8 5;  1KVK A;  2LEP A;  4ED3 A;  2E66 A;  2HHS A;  2NSC A;  2WVC A;  2ZBQ A;  2N3O A;  4DFJ A;  1UJ6 A;  4P72 A;  2AT1 B;  5L39 A;  2BXJ A;  1WC4 A;  3FC9 A;  2P9G A;  3ZZR A;  1N5Y B;  1U1R A;  3T1A A;  5D0G A;  1ZA2 B;  4RO0 A;  4CO1 A;  5IM0 B;  4USI A;  4H4M B;  3SEO A;  5L9X A;  1UA1 A;  4DR6 J;  3P5T L;  2ROG A;  3PY8 A;  3W9J A;  4RL1 A;  1J5O A;  1WC1 A;  4DR6 F;  1IQT A;  1FK9 A;  1K8A T;  4OJ3 A;  2YNG B;  2BUN A;  3PM9 A;  2UXD J;  2OFG X;  3NGU A;  1GTH A;  4OI3 A;  5IWA J;  1P8G A;  3VAJ A;  1WWH A;  1Y3K A;  2BYC A;  3C15 B;  2UXD F;  2FJW A;  5IWA F;  3J7A N;  2ZJP Q;  1SPB P;  3MM7 A;  3FCV A;  3GG0 A;  2R2T A;  1D8Z A;  1DY3 A;  4J9U E;  4CLP A;  2XY6 A;  1S4E A;  5HLF A;  1Q79 A;  1N4L A;  1VDH A;  5C7P A;  3TZW A;  2IJR A;  1JXV A;  1YJ7 A;  5M2U A;  2OHD A;  2L48 A;  1N8R T;  2FC9 A;  1YZ7 A;  2VC0 A;  3HVT B;  4OI6 A;  1VQY A;  2CQD A;  3DOK B;  2BW2 A;  3ZTS A;  1S12 A;  2EK6 A;  3SQG B;  1IKX B;  1X4A A;  3EZU A;  1SI9 A;  5D4N A;  1FNO A;  5GMD A;  1ZOT A;  3SV4 A;  1WKL A;  2OPS B;  2VPX B;  4O3O A;  3O3L A;  2JEJ A;  2LDI A;  5KFQ A;  3PR5 B;  4ITS A;  2H48 B;  2IIH A;  3MPW A;  2BJE A;  2E7X A;  3CED A;  3HK2 A;  5KG0 A;  1TK5 A;  1LW0 A;  3DDK A;  5DZ7 A;  1HQE A;  3JQK A;  3VGU A;  1MU2 A;  3S7R A;  2HFZ A;  3BSN A;  1BWV A;  1SL1 A;  2BJ1 A;  1YVF A;  3B54 A;  4HAC A;  3VAL A;  4J9M A;  2NRE A;  4ZVQ B;  2XMM A;  3QT8 A;  3K5P A;  3NS7 B;  4FP9 A;  4RW9 A;  2NUU G;  1KVJ A;  4XO0 A;  3UD3 P;  5HJX A;  2QMW A;  3I0S A;  3Q8S B;  2HVE A;  2VF3 A;  2DHH A;  1HKA A;  1LFP A;  1WOP A;  4KKO B;  5K20 B;  2NQP A;  2YXL A;  5C24 A;  2EW9 A;  1KBR A;  2PEH A;  4C8M A;  3T5H A;  3NAI A;  5IFM A;  5JUM A;  1NK8 A;  3GYG A;  2ZIT A;  3TEH B;  3C2P A;  2MKI A;  2YQ1 A;  1FKO B;  1M5S A;  2YX1 A;  2V68 A;  1I5O B;  4OYZ A;  5LMN J;  5DZ6 A;  2BAC A;  3JYT B;  1YZ6 A;  5LMN F;  4USK A;  3HCX A;  3PHT A;  2ZZT A;  5T41 A;  2Y1J A;  4MYU A;  5IM0 A;  4H4M A;  1H0H B;  5B0G A;  4J9R A;  2GAG C;  1RSC A;  3B6B A;  2YNG A;  3ZC4 A;  1HPZ B;  5HSP A;  2U2F A;  3I55 S;  3C15 A;  4B9N A;  1TMJ A;  3BSO A;  2MPU A;  1HI1 A;  3UCG A;  3R5B A;  3W7B A;  2MZR A;  1KSP A;  4K4Z A;  3QYY A;  3M6X A;  4J9K A;  3PJX A;  1D3W A;  3H5X A;  4C0O C;  1I51 B;  1VHF A;  4X4O A;  2FIU A;  2MZS A;  3ZTR A;  3EE3 A;  1UFW A;  4PUO B;  5E3R A;  5IC4 B;  1VLO A;  1P6T A;  4ZN3 A;  4KT0 C;  3PG9 A;  5E0O A;  3OTD A;  3DOK A;  3PW4 A;  4JI8 F;  4DV2 F;  3SQG A;  2KFN A;  1S9G B;  3T5K A;  2VDI A;  2OTL S;  2PO4 A;  3EX7 B;  3H4B A;  2PDA A;  4KGX B;  4KHP J;  4OYX A;  1PAE X;  1H2U X;  2J5A A;  2OPS A;  3PYF A;  2IA0 A;  4KHP F;  1Q7L B;  4KBI A;  2F7V A;  3R5D A;  4M95 A;  3DYA B;  1LXJ A;  4EEY A;  4LT6 A;  2X51 A;  3DGV A;  2XY7 A;  2D3Z A;  2HFN A;  3LGM A;  1RQ0 A;  1ACM B;  2B0G A;  4I0W A;  1R8C A;  3KLH B;  2ZM6 J;  4NXN J;  2Y0B B;  2FY8 A;  1PJ6 A;  1P27 B;  3GQC A;  3BS9 A;  4NXN F;  5KT4 A;  4CLK A;  3OD2 A;  2MLX A;  3HHE A;  1TKD A;  2YWH A;  2J9D E;  3QIP B;  5KG2 A;  1OMS A;  1KC8 T;  2V8G A;  4Y6I A;  1UJ5 A;  1R43 A;  2HND B;  4AFF A;  2V4J B;  3UNG C;  5GAD U;  1T8E A;  1FF2 A;  5KFI A;  3LWL A;  1KTV A;  2VBZ A;  4WK3 A;  1ZZF A;  3DKD A;  3R3T A;  4IDK A;  1J5E J;  2AW0 A;  4KKO A;  3OTC A;  2AYM A;  4QIE A;  3AOA A;  4HEA 9;  1J5E F;  2VA2 A;  4ECR A;  4DQS A;  5EWG A;  1BHN A;  4NYZ A;  3HHN B;  4UT4 A;  4XPE A;  1FKO A;  2HZA A;  5D15 A;  4LQ9 A;  2KKH A;  3BPD A;  3D0H E;  3BR9 A;  3E8O A;  3SMZ A;  3UWT A;  4M5K A;  5DRK A;  1IR0 A;  4DSJ A;  3Q23 A;  3AQO A;  4OHY A;  2PMW A;  2HVZ A;  3NNA A;  3EGN A;  4L74 A;  2BRL A;  3VAI A;  1SUQ A;  4ZPW R;  2CYY A;  2PA3 A;  3G8S A;  1QAX A;  5HMY A;  1SC1 B;  1UFL A;  4LFB J;  3MR3 A;  1EAY C;  2W8L A;  2O66 A;  4LFA J;  1GEH A;  1KP6 A;  1UEV A;  1RTD A;  2GO9 A;  3CIM A;  1TAU A;  3AOC A;  2HWI A;  2WHO A;  1Y5N B;  2K7J A;  2A1B A;  1RBO B;  3N01 A;  3BH6 B;  2DCU B;  1G3O A;  3TW0 A;  1VQ7 S;  3OLB A;  2CPX A;  2RUS A;  4HLB A;  5AXM A;  2Y0S D;  1KHW A;  2X3G A;  1D1U A;  4K4W A;  1RKJ A;  4KIA A;  3RBD A;  1S1U B;  2CZ9 A;  4PUO A;  3S01 A;  1BQM B;  1UL3 A;  2HAI A;  1R0A B;  3MTJ A;  1HHQ A;  3QT5 A;  4D3H A;  1S9G A;  3N6M A;  3M6V A;  4L72 B;  1RYS A;  3TUI C;  5E3P A;  2HGM A;  4CT8 A;  4J91 A;  4PXC A;  4QIW D;  3ILL A;  3WDO A;  3J81 U;  5DM6 Q;  3LW5 C;  3V6H A;  3CWJ A;  1KDN A;  3PTW A;  1SQG A;  4DCP B;  2PD1 A;  1PBU A;  3CTR A;  3RGI A;  2YWF A;  4DX5 A;  2KXN B;  1X4H A;  2MKS A;  2QG9 B;  5B09 A;  1XWL A;  2BM1 A;  5K8O A;  3KLH A;  2DGO A;  3I87 A;  3C8Y A;  3ICL A;  4B9M A;  1CVJ A;  2IVM A;  3F41 A;  1GX6 A;  1DLO B;  3C66 A;  2VBY A;  1Y3J A;  2WB4 A;  3FEY B;  1X5P A;  3QIP A;  2UU9 J;  2HGL A;  3O5T B;  4F0H A;  3J81 Y;  4M5D B;  3UD4 P;  1R89 A;  2HND A;  2JWN A;  4PR6 A;  2CPJ A;  2V4J A;  1XR7 A;  4BDP A;  2HGN A;  4ZVP B;  5E41 A;  3M4X A;  2H3E B;  3MGJ A;  3BQ1 A;  5GVQ A;  4JI0 J;  3QQC D;  4O3P A;  4KHR A;  1OYD A;  1F2G A;  2M2B A;  2ILY A;  4JI0 F;  3PEH A;  4F02 A;  4MMO A;  3KHH A;  5KFO A;  3A8I A;  4URS A;  4PQU B;  3ZZT A;  2AP6 A;  2V8V A;  1R0B G;  4YEA A;  5LSR A;  4N47 A;  4S0M A;  4LF6 J;  4AXI A;  4O4G B;  3SV3 A;  1SXL A;  2Y1L B;  3T1H J;  5HK4 A;  1YBT A;  2CAD A;  4OYM A;  5GAD I;  3T1H F;  4EZ6 A;  2HQF A;  4J9O A;  1ZM3 A;  2COL A;  2R2U A;  1GMW A;  3BO4 A;  4P7V A;  4X4N A;  2Q1L A;  2CPH A;  5IQ6 A;  2M9K A;  3VWS A;  1VQ8 S;  2VFV A;  4LRB A;  5D4P A;  2KTQ A;  1HNI B;  2JLE A;  2QA2 A;  1FXL A;  2C3M A;  2XS2 A;  4HT5 A;  5K14 B;  4NLP A;  4DV0 J;  3K8W A;  1N6Q B;  4NMX A;  1E6Y B;  5DG9 A;  1UET A;  4DV0 F;  2ZVS A;  3HDS A;  1APS A;  4IOB A;  3AOB A;  2PFD A;  4ES2 A;  1G1X A;  3M2V B;  4FNH A;  1MWQ A;  1WDD A;  1KWM A;  1WHV A;  5EGY A;  4LR7 A;  3NNH A;  3MOZ A;  4R25 A;  2FQQ B;  1C1C B;  1S1U A;  4CWB A;  4ERD A;  1UAW A;  4CLZ A;  1BQM A;  1R0A A;  2A2C A;  3M8Z A;  1PAU B;  3C6U B;  5F9L A;  1RWU A;  3P49 B;  1J27 A;  3CJ5 A;  5L1I A;  3LUY A;  3BEG B;  4K4X A;  4B9T A;  2IJN A;  1GX5 A;  1GAO A;  3KJF B;  4ZPV R;  1RJJ A;  4HI2 A;  2E5H A;  1N88 A;  3HHL C;  2G2Y A;  1X4D A;  4F4W A;  2C2Z B;  2ACY A;  3D6H B;  4UQG A;  3ETO A;  3BBF A;  4N7T A;  1FDB A;  4RW6 B;  3DRX A;  2UUC J;  4DN0 A;  2WB1 D;  5E3A A;  4XDD A;  4C8N A;  5KOX A;  3KKF A;  1DLO A;  2UUC F;  4OZ3 A;  3NWG A;  2KYX A;  3VF0 B;  2MHN A;  3PNI A;  2OI2 A;  1NND A;  4DR2 J;  2HHP A;  3NGS A;  4NI2 A;  4TY9 A;  1SC4 B;  4M5D A;  3KJQ B;  2E5L J;  2RS8 A;  2C3U A;  1K0T A;  4ZKA A;  2XNR A;  2EFQ A;  3MUM P;  2E5L F;  3OL8 A;  3ENQ A;  3QRQ A;  2D3O R;  3JAM U;  1RU1 A;  1VBK A;  5KFP A;  1FEH A;  4AD6 A;  1VIO A;  4OYW A;  1NBE B;  2AQ4 A;  2R7T A;  2DNO A;  1UVL A;  1FFG B;  4DQI A;  3MEK A;  3BQ2 A;  3K0J A;  4K4V A;  4PQU A;  1CQM A;  4FXW A;  4ETX A;  3UN5 A;  2VG7 B;  1GFW B;  2YWK A;  2QLB B;  1IVZ A;  4O4G A;  2HW3 A;  1L3U A;  2DNN A;  1RAF B;  4CTA B;  2YWE A;  1ZPW X;  3AAW B;  2IM2 A;  4P7T A;  2EWH A;  1HNV B;  1MNE A;  5JVG Q;  1IBM J;  3V6J A;  1SKR A;  3IAS 9;  2DGS A;  3JB9 k;  1RAD B;  3JAM Y;  4DZD A;  1SJ3 P;  5KFG A;  4A8O A;  1IBM F;  3TJA A;  1JB0 C;  1SH0 A;  3N6L A;  4ECX A;  3FCW A;  1HNI A;  4C8K A;  1Z1Z A;  5EN1 A;  1T95 A;  4DUY J;  4LSZ B;  5K14 A;  2G9O A;  2C3P A;  5ETN A;  1N6Q A;  2VJU A;  1E6Y A;  4BWM A;  1S6Q B;  4WP8 A;  2MTL A;  1KEK A;  1H7W A;  3VGT A;  2OJ3 A;  1CPZ A;  3RAQ A;  4WXO A;  3RBE A;  4A47 A;  4I7F B;  3VAM A;  4QIV A;  5A0Y B;  2JC1 A;  3DXB A;  3M2V A;  1Y00 A;  1FD2 A;  1TK8 A;  2Y3Y A;  2HYI B;  3Q8V A;  4DCJ B;  4C4W A;  3VTI A;  2M4M A;  3L09 A;  3TZX A;  1C1C A;  3QSY B;  1RTH B;  4L3N A;  2F40 A;  2OEJ A;  1YDL A;  3ZZO A;  3GV5 B;  2ZWO A;  3PJ9 A;  3C6U A;  2AX0 A;  5H9E J;  5CXT A;  4GMK A;  1S1T B;  2KI2 A;  2RD5 C;  4ZIT A;  2GV1 A;  1FTC A;  2E5G A;  1ZM9 A;  3H8Y A;  4NL5 A;  1NKE A;  3SXL A;  3H42 A;  1NME B;  1U6Z A;  3W60 A;  3ONQ A;  1N34 J;  2YKA A;  2KFZ A;  1T9U A;  4Q2L A;  4IRK A;  1QVG R;  2W9B B;  3BGF A;  2GQ2 A;  2B3T B;  2AZ1 A;  5B0E A;  2GQC A;  5J1E B;  2QC3 A;  2OFH X;  4RR5 A;  3PYE A;  4RW6 A;  4LRF A;  4AXJ A;  4DS4 A;  2BQR A;  3A3N B;  2MSS A;  2JVR A;  1HWK A;  1EAR A;  3CCL S;  2KN4 A;  5CYJ A;  4ZLJ A;  1CJV B;  5HVH A;  2Z58 B;  3GCW P;  3K8V A;  2B6A B;  3TUJ C;  3JS9 A;  1WC3 A;  4CP5 A;  1U8W A;  4F7V A;  2R8J A;  1FDA A;  4DR7 J;  2J7U A;  3V6D B;  3HT0 A;  3GJR B;  4EI2 A;  1RAE B;  5AE1 A;  4DR7 F;  1C0T B;  1RBA A;  2B56 A;  2DEJ A;  1JXL A;  4FKX A;  4Q8F A;  4C11 B;  4XPC A;  2M0G B;  2E7W A;  4ETZ A;  1VC6 A;  1NHV A;  1RHK B;  1Q7Y T;  2IDE A;  5KG7 A;  5DLG A;  3UPF A;  2VG7 A;  3AJD A;  1QD1 A;  2CAJ A;  2FVP A;  1W2I A;  5A8R B;  4WWS A;  4CTA A;  5KG4 A;  3D6T B;  3ZZP A;  4WYW A;  4ZPB A;  5BYQ A;  1NKB A;  1RLD A;  1HNV A;  3DGP B;  3N28 A;  2HPU A;  1TK0 A;  3CCS S;  3NGR A;  2E9Z A;  1GT8 A;  2FD2 A;  3BQ0 A;  4A8Q A;  1ZBT A;  1RA6 A;  4DQP A;  4USW A;  1RAJ A;  4ZHR B;  2AGQ A;  3D9B A;  1S6Q A;  1RWW B;  4J9P A;  5GMK a;  2XSF A;  4ECZ A;  2QL9 B;  4I7F A;  5A0Y A;  3IM9 A;  4AL5 A;  4JI6 J;  1IUJ A;  2CA9 A;  3OVA A;  2NYI A;  1RAI B;  4CO5 A;  3ZZ0 A;  4JI6 F;  1UEU A;  4N8N A;  1OQ6 A;  4RNM A;  2ASL A;  4FF1 A;  4WE1 B;  1RTH A;  1TKZ B;  3GII A;  3NMA A;  2XMA A;  3VHQ A;  3QID A;  5D77 A;  1Q8B A;  4HH1 A;  1ITP A;  3R5J B;  1HIY A;  5B08 A;  4EFA C;  1XNQ J;  4RJV A;  1S1T A;  3CUN A;  1HW8 A;  1DJ0 A;  1XNQ F;  1X31 C;  7FDR A;  2Z56 B;  4P6Q A;  3ZO7 A;  4X64 J;  4F36 A;  2FZC B;  2XC9 A;  2ZE2 B;  1HNZ J;  4X64 F;  1HNZ F;  3A13 A;  4UST A;  4ZK7 M;  3LAK A;  3A3O B;  3E01 B;  1N5Q A;  5JVH Q;  1ELO A;  5HVF A;  4F2S A;  2P5V A;  2WVB A;  5J1E A;  1EB0 A;  5SZT A;  5KFE A;  1LFW A;  4DFM A;  2DEI A;  2FGO A;  2QLW A;  4TN2 A;  1WOS A;  1NZ8 A;  4OX6 A;  3HPO A;  2RIJ A;  2YY3 A;  3M30 B;  3CD6 S;  5CHC B;  1WHY A;  3U1L A;  2P6S A;  1BWE A;  3PJW A;  2QL5 B;  1Q8K A;  2B6A A;  2ADB A;  2XCA A;  3HSG A;  5RUB A;  1HW9 A;  4X4P A;  2WAQ D;  1R31 A;  3V6D A;  2R7S A;  2BOA A;  4DPY A;  5DET A;  3NOC A;  2RU3 A;  1WEY A;  1XR6 A;  3DLL Q;  4HTJ A;  1SH3 A;  2W4D A;  4C11 A;  5L8R C;  2LDY A;  2JJ4 D;  4Y2K A;  4MIW A;  3CB4 A;  4F4Z A;  2HQI A;  2ZWP A;  5ETR A;  2ZC4 A;  3MR5 A;  5DQI A;  4NLT A;  2HBZ B;  3FDS A;  4RW8 B;  5A8R A;  4RNO A;  3BKF A;  5EUH A;  1U2C A;  4DOZ A;  3GWC A;  5GAE U;  4B3T J;  4YB7 A;  3DGP A;  4OX7 A;  4O3Q A;  5C2C A;  2XMU A;  4B3T F;  4FYD A;  1NSP A;  4OYB A;  3W1Y C;  4YB6 A;  2ZH9 A;  4QYZ K;  4TQS A;  1XER A;  4N8O A;  2HKE A;  4A4J A;  1TVR B;  4B9V A;  3FUY A;  2UUA F;  3BGL A;  4Y34 A;  5KFU A;  4ZHR A;  5HRO B;  4Z37 A;  2GC8 A;  4CH0 S;  1C4A A;  1AYE A;  3UN2 A;  2Q79 A;  3CW2 C;  4PCQ A;  1RCX B;  4DF4 A;  1VQP S;  4AQY F;  5ETM A;  2HRT A;  2XMV A;  4G1Q B;  1HI0 P;  1FVQ A;  1EQM A;  1TKZ A;  2KDO A;  4MK7 A;  5U47 A;  2D7S A;  5HAT A;  1BXN A;  1S72 S;  4OZ2 A;  4ZVS B;  4NZ0 A;  3QSI A;  4RNF A;  2X7I A;  3IGN A;  3D28 A;  4FDF A;  3W61 A;  3OFE A;  4ZLL A;  2VB6 A;  2QLF B;  5KT6 A;  1JLB B;  3I5A A;  2ZE2 A;  2VPW B;  2VC1 A;  3UNY A;  3DLE B;  1Z2L A;  4USM A;  1PSD A;  4OI2 A;  5SUH A;  1F9F A;  2DCL A;  2YNF B;  3E01 A;  5CAA A;  2VFR A;  3M8Q B;  2RJZ A;  5J1N A;  2W2P P;  2WBR A;  3AXK A;  1CSJ A;  3ENV A;  2B9W A;  2ACM A;  3IA0 A;  4RLE A;  2OEK A;  5CQG A;  3ZNU A;  3RG6 A;  3HD2 A;  3EUN A;  1UVM A;  1KNZ A;  3KG1 A;  4RPF A;  3G6Y A;  2DGU A;  3MMA B;  3D67 A;  1S0O A;  2Y8Y A;  2OD6 A;  2FJD B;  1FJG F;  2GIF A;  2WBM A;  4ZCM A;  2CJX B;  2P9C A;  1NB2 A;  4ANE A;  4MKV A;  1HBM B;  2CJA A;  1RXO B;  2UXB J;  1LW2 B;  4NA3 A;  5HAO A;  1QTM A;  3TP2 A;  2VG5 A;  5GAG U;  3HXM A;  3OSN A;  3BB5 A;  5DLF A;  1DZ5 A;  1XC9 A;  2CQ0 A;  3M8P B;  2XZD B;  5KFF A;  3BV8 A;  4X62 J;  3MUT P;  4OLP A;  2I6W A;  2KRR A;  2H5J B;  3VV2 B;  3KUG A;  1N48 A;  4DPU A;  4RW8 A;  3FSI A;  1PYT A;  3FMB A;  4FXV A;  1W26 A;  2K8G A;  1FVS A;  4XDC A;  3MAQ A;  1K9M T;  2WK4 A;  4ECS A;  1YGY A;  1K44 A;  3KLV A;  1Z2Z A;  4FF4 A;  3C16 B;  2E5J A;  2HS4 A;  4NE9 C;  5KFN A;  2C2N A;  1VQ5 S;  1UVN A;  4CLT A;  5LMU F;  3GV8 B;  4RKU C;  1TVR A;  3MFH A;  2RT3 A;  5JMN A;  3EPI A;  3SFU A;  1IWA A;  3WIV A;  3F56 A;  1QAI A;  3EXY A;  2W8K A;  3HVA A;  3MD3 A;  2VJV A;  5HRO A;  2IY5 B;  2GHW A;  3NEK A;  4U8V A;  3HF5 A;  2DGW A;  2KRB A;  3CD5 A;  5GAE I;  2CJY B;  1T9W A;  1S99 A;  2BE9 B;  4JV1 A;  1RHJ B;  2HLT A;  1QAJ A;  2A0F B;  2V2K A;  3OW2 R;  2YVS A;  5IS2 A;  1OJ4 A;  1TU0 B;  3LAL A;  3EYZ A;  3CF5 Q;  2KFY A;  1Q8I A;  3IG1 B;  5D0R A;  2ZKU A;  4DG1 B;  1KOH A;  1K73 T;  4P71 A;  5KFH A;  3K5L A;  1S0M A;  1DQ9 A;  3OXL A;  4HHU A;  4ZMM A;  2QRR A;  1FEE A;  3I9V 9;  4H4K C;  3SSQ A;  2ZHB A;  4YY3 J;  3H0P A;  3KG4 A;  3DLG B;  1PIE A;  2UUW A;  4Q8E A;  3P45 B;  4YY3 F;  4NEZ A;  2YQ0 A;  2IAJ B;  2JFK A;  3FFI A;  3L95 X;  3QAT A;  3EVM A;  4PYA A;  2J0Q D;  3LQV A;  1S10 A;  1RAO A;  3OXF A;  1SQF A;  1TTH B;  4ED2 A;  3FVY A;  4DI6 A;  1HWI A;  2DGT A;  1JLB A;  2J0S D;  1HWJ A;  3W2V B;  3DLE A;  4NA2 A;  1HL6 A;  2DIU A;  4C6A A;  1RHQ B;  1RAG B;  2YNF A;  2HSE B;  2LLZ A;  4MIB A;  3H2V E;  3M8Q A;  1VBY A;  2GGP B;  2F4F A;  4N41 A;  3QAE A;  4G65 A;  4OYI A;  3R5A A;  2MQN A;  1U1O A;  4CCH A;  2BDP A;  1JLE B;  1F9H A;  1RI7 A;  1B99 A;  2BBE A;  1R3N A;  3FEX B;  2MZQ A;  3L7U A;  2Q6C A;  3OVS A;  2XMK A;  2ZNY A;  3MMA A;  3TUZ C;  1CC7 A;  1I1G A;  5C42 B;  3B4D A;  2XMT A;  1X7V A;  1LWF B;  1RWO B;  3OL7 A;  2L9W A;  3M8W A;  2DNM A;  1M5P C;  1HBM A;  3MDF A;  2A6O A;  1RAC B;  2ZFH A;  4ECW A;  1LW2 A;  4KJI A;  2IRU A;  2VG6 B;  1ROF A;  4Q7A A;  4HHJ A;  2BKN A;  3I4H X;  1Y7P A;  3MUV P;  1N56 A;  2IC3 B;  1S57 A;  3PRD A;  2NPI A;  4M8L A;  2YH0 A;  4X65 F;  2DH8 A;  2EFO A;  3M8P A;  3UR3 C;  1KTQ A;  4OHX A;  2CPY A;  3POT B;  4P9S A;  1J2V A;  2W25 A;  1NK7 A;  4MJK A;  5EX0 A;  1BUX A;  3H98 A;  2ZOF A;  1FT8 A;  1QSS A;  2YH1 A;  4X4Q A;  2VD3 A;  1R7I A;  3C16 A;  1N33 J;  4ICL A;  2FJV A;  1N0U A;  4OX8 A;  5GAG I;  4F26 A;  4WF9 Q;  2HRY A;  4RBU A;  1PBA A;  4J7C A;  4ALZ A;  5GME A;  1BLU A;  1H98 A;  5HN0 A;  4WFN Q;  2EPI A;  2ZH8 A;  3CXC R;  5DG8 A;  2YQ3 A;  2BOP A;  3W8G A;  3AA9 A;  1EKR A;  4JI4 F;  3V81 A;  2KU7 A;  3EGW B;  1OSC A;  5J2P B;  3D7S B;  1X9M A;  2B5J B;  2GJI A;  2I0X A;  2CPE A;  2OEM A;  2V8P A;  2M8H A;  4NLV A;  3IG1 A;  4PYD A;  2CZ4 A;  3R27 A;  3MPY A;  4DG1 A;  3AD8 C;  1FTR A;  3ILJ A;  4F67 A;  2ZD1 B;  2HHH J;  3B4M A;  3MEC B;  5M2P A;  2HHH F;  3DLG A;  4XK8 C;  2HQC A;  2IAJ A;  2NS1 B;  4OZ1 A;  4ZPC A;  1OYE A;  4HHH A;  2VPY B;  4C3K A;  2OLW A;  2XWY A;  4RUB A;  4HT7 A;  2FHJ A;  3U1N A;  3IRW P;  2MQQ A;  1NK4 A;  3W2V A;  1FNM A;  1EP4 A;  2LEC A;  3JSB A;  2AEM A;  1WF1 A;  4QPT A;  2POK A;  3SCL E;  2VUG A;  2RRB A;  1TV6 B;  1VIX A;  2OTJ S;  1JLE A;  2R4F A;  2V4Q A;  2MY8 A;  3C6T B;  1KQK A;  4DMZ A;  1NDC A;  4YQW A;  3ZZU A;  2WON B;  4NAS A;  1AFI A;  5LJ3 Y;  1U1Q A;  4JI3 J;  4OZN A;  5C42 A;  4PZV A;  1LWF A;  5EWE A;  3BN4 A;  2NXN A;  1SL0 A;  1N36 J;  4JI3 F;  3W5Y A;  3L7O A;  2LQ5 A;  4NLW A;  1M5K C;  4ILM A;  4B02 A;  2J9E A;  3THV A;  4QWC A;  3CJT A;  2OP5 A;  1RHM B;  4Z7C A;  1N36 F;  1ZAX A;  2VG6 A;  1QSL A;  5KG1 A;  2QL7 B;  2XMJ A;  3CE8 A;  1QDU B;  2RAQ A;  4ECV A;  1NHU A;  3TVK A;  3DHX A;  4O0N A;  1IQZ A;  3WIU A;  1Q78 A;  3JTO A;  4LF7 J;  1PYO B;  3FGV A;  1U1N A;  3CJR A;  3MEG B;  1LV5 A;  2W9A A;  4LF7 F;  3POT A;  1XEZ A;  1IBK J;  2L41 A;  1GXU A;  4OYO A;  1QTN B;  4RWW A;  1FJ7 A;  4ED5 A;  5ETS A;  1VBX A;  4GRS A;  1IBK F;  2EXU A;  3JSY A;  2RU9 A;  4ZPD A;  2I38 A;  4DPT A;  2RML A;  1L3K A;  2CWK A;  1M1G A;  4LJM A;  3I0R B;  1SJ1 A;  4CH1 A;  3UDE A;  5F9N A;  4KY3 A;  2LA6 A;  3V2U C;  4LF8 F;  4NCA A;  1L3T A;  1FXD A;  3NBP B;  5L46 A;  2DIS A;  1RU2 A;  2BZ2 A;  1RDR A;  5DG7 A;  2PII A;  4RWX A;  4B3M F;  4DV3 J;  4M1K A;  5J2P A;  4LF4 J;  4UW2 A;  2KXF A;  4KC5 A;  2B5J A;  3GV7 B;  4A8X A;  2XS7 A;  4CNZ A;  5DS7 A;  4LF4 F;  2B8P A;  2WCX A;  3CSK A;  3MM9 B;  3ZFV A;  1VQK S;  4NLY A;  4FBU A;  1JLQ B;  2I2Y A;  2IDL A;  4TLR A;  1ZTT A;  2MB0 B;  1UA0 A;  1YK9 A;  1JNZ B;  3RJM B;  3MEC A;  5B0F A;  3QJL A;  2MZ1 A;  2V9W A;  1F9E B;  4TVA B;  1PJ5 A;  3R2C J;  3PFE A;  3R7B B;  3PW7 A;  2R7V A;  2HHQ A;  2HQ3 A;  4BC7 A;  2P8I A;  1MRO B;  4R5P B;  2W2M P;  4USU A;  2H54 B;  3EJM A;  3DRS B;  1FES A;  3RW7 A;  1HYS B;  2MHE A;  1RGV A;  1NZA A;  2VOO A;  4PWW A;  3N6N A;  1TV6 A;  2EFP A;  4QYZ J;  4WFA Q;  1X60 A;  2ZOG A;  4DSI A;  2HFS A;  3MCS A;  3C6T A;  1WTF A;  4DV6 J;  3M32 B;  1BQX A;  1LWX A;  4KQZ A;  3R5G A;  4DV6 F;  1URR A;  2WON A;  3FKB A;  3D5M A;  3VGV A;  4EU0 A;  1WTB A;  1QM9 A;  2J9C A;  4KH0 B;  4KB7 A;  3KHL A;  1S48 A;  5K5M A;  3DXS X;  2VQE J;  5J2Q A;  1X0P A;  2HAF A;  5J2M B;  4RUH A;  2VQE F;  4URQ U;  1PYS B;  1OIA A;  3WZ0 A;  5KG6 A;  1X9S A;  1IBL J;  1VMB A;  1X4F A;  1WEZ A;  2Q3P A;  2GVZ B;  2MMY A;  2RQK A;  1REG X;  3W63 A;  1IBL F;  2R8G A;  4W4M A;  3DU5 A;  3RB0 A;  2VOD A;  3WX4 A;  2YKM B;  3G8Q A;  1WDT A;  1AW0 A;  2HHX A;  3SSR A;  3UN3 A;  2ZDP A;  2XHW A;  1SJ4 P;  1Y10 A;  2C2K B;  1VRT B;  1VQS A;  4ES3 A;  2W7O A;  3PO4 A;  3T41 A;  2H5E A;  3OBI A;  3MEE B;  1GTE A;  4WU2 A;  2AV5 A;  5JJB A;  1Z4U A;  2LXI A;  3RAM A;  3PRV A;  3O2I A;  3I0R A;  5DGB A;  3SQO P;  4FZV A;  1KOO A;  4P2S A;  2XHC A;  2R2S A;  3ELH A;  4QWA A;  3SI8 A;  4OLO A;  1P1T A;  2LQB A;  2VA3 A;  2JLG A;  2NYH A;  4LRC A;  2JH3 A;  1IN0 A;  3AD7 C;  3CJQ A;  4LSL A;  2NPF A;  1TUW A;  2QA1 A;  2CQB A;  1U48 A;  1S0V A;  2U1A A;  4CYU B;  2CPI A;  1FJC A;  4TKT A;  4CLL A;  2H1Y A;  3KK3 A;  1RHU B;  4DCO B;  3AHP A;  1VQN S;  3MR2 A;  4KE5 A;  3SIP B;  3MM9 A;  4LQ3 A;  1JLQ A;  3CMQ A;  1HA1 A;  4QR2 A;  3QGI A;  3OR2 B;  1Q86 T;  2EI5 A;  5B0A A;  2Q6B A;  2RF2 A;  1DQ8 A;  5I4M A;  4M94 A;  1OO0 B;  3QZ7 A;  1RYR A;  2BE7 D;  1MRO A;  1QY7 A;  2KZM A;  2KYZ A;  5LJ5 Y;  2LXF A;  4DEZ A;  4R5P A;  1Q5V A;  4NLS A;  1F3V A;  4C48 A;  3DRS A;  1XIQ A;  1TEL A;  4A8S A;  1HYS A;  2GS8 A;  1D9A A;  4NWB A;  4I6W A;  2MGZ B;  5K8M A;  2B7B B;  2PC6 A;  3CDU A;  1V3Z A;  1M5V C;  1U1K A;  4DSL A;  2H51 B;  2KM8 C;  2PT0 A;  3HLU A;  2R7W A;  3M32 A;  4ZS6 A;  1C1B B;  4ED4 A;  3BYR A;  3KYL A;  4C9D A;  3ETM A;  2H4W B;  5AXN A;  3JTP A;  4MYT A;  1S7I A;  1WC5 A;  4OJH A;  3M2R B;  3AXM A;  5KT2 A;  3ZXW A;  3B78 A;  2UVR A;  2W2Q P;  3OHB A;  4WYL A;  2JRS A;  1T9T A;  1U45 A;  3MPV A;  1P9Q C;  5ITH A;  3ULH A;  4A8M P;  4PQA A;  5J2M A;  1ULR A;  1G7C B;  2KT5 A;  1HD0 A;  1N0V C;  2VFT A;  2GVZ A;  4W98 A;  2FLP A;  3Q8Y A;  4LF9 J;  1NDK A;  2HFO A;  1B64 A;  5B0B A;  4EO8 A;  1VK3 A;  4LF9 F;  2N4C A;  2YKM A;  2K3K A;  5FJ4 A;  5DDQ C;  1VRU B;  3GIJ A;  1WD6 A;  1VRT A;  5C25 B;  4LVO P;  1FJE B;  2KJV A;  3HHD A;  3MEE A;  5HJY A;  2AMC B;  1HNW J;  4NLU A;  4NYO A;  2VAS A;  2DGV A;  2R8K A;  4IRC A;  2CVE A;  2VQF J;  4I4B A;  4F50 A;  1M90 T;  2EKN A;  3E2E A;  3CCE S;  3T3F A;  1Q0N A;  2J76 E;  5D0H A;  2RSQ A;  1U09 A;  3PAC A;  4FKY A;  4KGV B;  1WI6 A;  1T7P A;  3SCJ E;  2LEA A;  1VS3 A;  1SKU B;  3PYD A;  4B3R J;  2PA8 D;  4DR3 J;  5FD1 A;  2WVF A;  4ZP6 A;  1OY8 A;  4CYU A;  3TVZ A;  1CJK B;  4B3R F;  1SIW B;  1NDP A;  1XR5 A;  2GZO A;  4JV0 A;  3OJU A;  4DSK A;  4PXD A;  4DPX A;  2M7S A;  1X4B A;  4WIQ A;  5BYR A;  1CJU A;  2HRU A;  1NXI A;  1F3F A;  3FBE A;  1X8D A;  2AZ3 A;  4C98 A;  4RZR A;  8ATC B;  4FNI A;  1LNQ A;  2DR8 A;  2I9S A;  4K8R A;  1HBU B;  3TO8 A;  1UPM B;  1M5O C;  4EBC A;  4LIR A;  2DD8 S;  1WEX A;  3M7V A;  4KR0 B;  3H7H B;  4M63 A;  2HIQ A;  2GHP A;  3VZI A;  1SBR A;  1H74 A;  1DFD A;  1IXK A;  1MSW D;  3HZG A;  2GX8 A;  2QMU B;  3L7P A;  3KFW X;  1F5C A;  4QYR A;  2MGZ A;  2C2M B;  3RBZ A;  1FCA A;  2J8A A;  3DRR B;  3SBM A;  4YUD A;  4Q2M A;  3TNV A;  4DR1 J;  4WFZ A;  1H2T Z;  1TR0 A;  3HKW A;  4DFK A;  2HVI A;  3BDP A;  4ZOS A;  3DHW C;  1NLK L;  1YJ9 S;  3PHE A;  2ZOM A;  1RWV B;  2J6S A;  3CCV S;  1VQM S;  5T7L B;  2ADC A;  3M2R A;  4OV6 A;  4HR2 A;  4A46 A;  4U7U D;  5DDR C;  5D4O A;  1WC0 A;  3T9Z A;  2E9R X;  2G1D A;  2E1P A;  4Q43 A;  3R1L A;  1TL1 B;  1X4C A;  4A48 A;  3HO1 A;  3EZO A;  1JWW A;  5J2N B;  2C3O A;  3GYX B;  2G1H A;  3R8Y A;  3DRY A;  5CYM B;  4N5S A;  1VBZ A;  4Y2A A;  1YX2 A;  2IMO A;  4QWD A;  5HMW A;  3CT9 A;  3CCU S;  2YKN B;  1ZH5 A;  2HHW A;  5LL6 d;  1U1P A;  4NX9 A;  3Q8U A;  5KG3 A;  3BGR B;  1BE4 A;  1BC6 A;  4WP9 A;  5THW A;  1VRU A;  3H40 A;  5C25 A;  4OQJ A;  4K4S A;  3GFY A;  4K4T A;  1U2F A;  2KXH A;  3KMQ A;  4G6V B;  5KFW A;  5KFK A;  5DJB A;  2B9Y A;  2K2P A;  4ECU A;  1XN9 A;  3PW5 A;  3MR6 A;  2HUR A;  4MH8 A;  2HVD A;  1SVD A;  3WBZ A;  2YBV A;  2RKI B;  4JB8 B;  5H9E K;  2ASY A;  2XZW A;  3W62 A;  4XTT A;  4GVL A;  5FLX U;  1SC6 A;  2HNZ B;  2Z0G A;  2ILZ A;  3T5J A;  1CJK A;  2MXY A;  1O51 A;  3FQL A;  5IV3 A;  3OFH A;  4WFB Q;  1YTY A;  2VIC A;  3EM1 A;  5F8J A;  5T14 A;  3KMS A;  1YJV A;  3M1V B;  3NP5 A;  2ERR A;  3NGT A;  2CPD A;  4O4R A;  1N5Y A;  4F3M A;  2VBX A;  2QX0 A;  4C0B A;  4DQR A;  1WF2 A;  1YI2 S;  3PVX A;  2JNJ A;  2OIH A;  2OPR B;  4A8W A;  2I1R A;  5KFY A;  1RT3 B;  3CCZ A;  3J7A 1;  1K1S A;  4Y00 A;  5ETQ A;  3VQT A;  1KLM B;  4ED6 A;  2N7C A;  1HBU A;  4OMF G;  2WVE A;  1NSA A;  5FLX Y;  3NCQ A;  1VC0 A;  1HR0 J;  4JUZ A;  4RW7 B;  4X4U A;  1RAB B;  2HBY B;  3V4I B;  1Q82 T;  3OTO J;  1YSJ A;  3NLC A;  4ECQ A;  3A8J A;  2LMI A;  3T5L A;  2QLJ B;  2R7Q A;  5BXI A;  3OTO F;  3DRR A;  4FN5 A;  2CRL A;  3EIC A;  4ED0 A;  4TU7 A;  3QAU A;  4DR5 J;  3GPA A;  2XLJ A;  1VJQ A;  3TX8 A;  1FRJ A;  1RKI A;  3D1H A;  3HVT A;  4DR5 F;  2DXF A;  4J9S A;  5T7L A;  2CQG A;  1GMV A;  3BO2 A;  4C3L A;  1IKX A;  1HWL A;  1U02 A;  5HI7 A;  1O5J A;  2RQC A;  1EJ7 L;  3QRR A;  4DL4 A;  3M6U A;  4IR9 A;  5FDL B;  1TL1 A;  2FTR A;  3CJ4 A;  3GJQ B;  5J2N A;  3PEJ A;  4PAB A;  2GO8 A;  3GON A;  3FK4 A;  3RRH A;  5CYM A;  4FXD A;  1VQ6 S;  1IM4 A;  2YKN A;  2HHV A;  2CNO B;  1Y9O A;  4F2R A;  1WAC A;  3BGR A;  2MKK A;  4ZJQ A;  1V6H A;  3TEG A;  5IXU A;  3ZNJ 1;  2ZM6 F;  2KJW A;  5EX3 A;  3OR1 B;  1T11 A;  2HBQ B;  2F5G A;  1WOR A;  3FNN A;  1ZPV A;  2ZBC A;  4CDI A;  5D8H B;  2YKQ A;  1S76 D;  1JXE A;  4I69 A;  3U27 A;  4GO7 X;  2UVW A;  2CJB A;  3MAH A;  3RW6 A;  2HFV A;  4YR2 A;  1VFJ A;  4G3I A;  2OAU A;  3MMB B;  4ZCK A;  1RWX B;  5CCL A;  4C7Q A;  2AYB A;  1Q8L A;  5A8K B;  3KDO A;  2XMW A;  5BYS A;  5KFZ A;  4WXW A;  4Q5V A;  2GNK A;  3QJP A;  2YPY A;  2FZG B;  1XTZ A;  3OT9 A;  2DR7 A;  4WJB A;  4X66 J;  4UUW A;  3KOA A;  1TL7 B;  3M1V A;  1BY9 A;  3TWZ A;  3O1L A;  3JYT A;  1XK8 A;  5F8N A;  9RUB A;  2JL9 A;  2Z2Y B;  3IR5 B;  4LF2 A;  5GAH U;  2OPR A;  2G2Z A;  1RT3 A;  2IM3 A;  5D78 A;  1NKC A;  4X4V A;  4IUF A;  1KLM A;  4X84 A;  2WW8 A;  2PN6 A;  3K5M A;  4J9V A;  4C8Z A;  5L1L A;  3GU0 A;  3R1H A;  4LFB F;  2OSQ A;  4LFA F;  1HPZ A;  4RW7 A;  4Q0B B;  3VAF A;  5AE2 A;  2NXJ A;  1K0V A;  4P2X A;  3DC2 A;  2DH9 A;  4FS2 A;  3SDE B;  1REV B;  3V4I A;  3S8S A;  1NHK L;  2V50 A;  5L1K A;  3CMA S;  3FQK A;  3BRE A;  3MTK A;  4ZVG A;  5E3C A;  3EXC X;  2HHU A;  2C3Y A;  2DPJ A;  4QW8 A;  4BS2 A;  5IT0 A;  3QJJ A;  1VIS A;  2HIY A;  1MMN A;  1IJE B;  4USH A;  3CJ0 A;  2YNI B;  3MMC B;  1MN7 A;  1H38 A;  3R7S B;  5CYQ B;  3QPI A;  4TLQ A;  1D0E A;  1UTA A;  3FJ2 A;  4MFB B;  4FPR A;  1YJN S;  1KLN A;  1W7W A;  1T02 A;  5DDP C;  3M8R A;  3BM7 A;  3RB6 A;  4J37 A;  2MKH A;  3LTO A;  5FDL A;  4JYA J;  1QUP A;  2FVS A;  1PJ7 A;  2LVW A;  2N7Y A;  3MED B;  4JYA F;  3R9L A;  3Q86 A;  1WG4 A;  2AKW B;  4I64 A;  2G2O A;  3DYA A;  3LOU A;  3A12 A;  3I9Z A;  4X4R A;  2WZ1 A;  1DHM A;  1LWC B;  2CZV C;  4IO1 A;  1Y5L B;  5A2Q U;  1R6V A;  2YNH B;  1VR6 A;  3OR1 A;  3K89 A;  4IO9 Q;  3IP0 A;  3WQP A;  4XAK A;  3RR8 A;  3CNQ P;  2IYG A;  5AE3 A;  2UU9 F;  4UQT A;  1Q95 G;  5A6W A;  3CD7 A;  1BMQ B;  4F0M A;  3TJ9 A;  2RRA A;  4DXL A;  2EKY A;  1FWK A;  2LQ8 A;  2Y1I A;  3IRX B;  3AH6 A;  4ZVT B;  3MMB A;  3UDL A;  3SFG A;  3OVB A;  1NH7 A;  3VAH A;  5A8K A;  2QJ3 A;  5A2Q Y;  3RB4 A;  3GFZ A;  1S79 A;  4DL0 C;  4YHH J;  1QSY A;  1RAA B;  2FZK B;  2AEJ A;  3IAM 9;  2FB0 A;  1S6P B;  1RT2 B;  2XBP A;  3KLG B;  4YHH F;  3BGU A;  3D54 A;  1JLG B;  1HLW A;  4P10 A;  4LF6 F;  2WRM A;  3UVJ B;  1YIJ S;  4IR1 A;  2BJ7 A;  3C19 A;  3W66 A;  4YME A;  1TL7 A;  3EGV A;  3CCW A;  3MWB A;  5CH7 B;  3PO5 A;  2GHV C;  4TU9 A;  1GXT A;  1YRT A;  2V63 A;  3BPS P;  5F41 A;  3OQ2 A;  4QQB A;  4N77 A;  4B08 A;  4WZM A;  4V19 X;  3GTY X;  4AYB D;  2AEF A;  2V34 A;  1P9Y A;  4OI4 A;  2NCK L;  4EYI B;  2YTC A;  4Q0B A;  4CLW A;  3K5O A;  2DPI A;  3LPE A;  3SDE A;  1REV A;  1T3O A;  4NOH A;  3FBF A;  3MMJ A;  4E2F B;  3BH7 B;  3L3C A;  5GAH I;  5KT7 A;  3HFK A;  4TXS A;  1GMU A;  5D6G A;  3H25 A;  3THP A;  3ZZZ A;  5LOQ A;  3C46 A;  2YNI A;  2UVV A;  3MMC A;  5CYQ A;  2YX4 A;  5KAK A;  4MFB A;  1YKW A;  1O0P A;  2GA7 A;  2KVQ E;  4MIA A;  3DCA A;  2KZZ A;  4LR9 A;  1FHT A;  2HQG A;  4HDG A;  1YJW S;  1OPZ A;  4X4S A;  2EC2 A;  2EBE A;  2HLU A;  2XI3 A;  2MKJ A;  5CD4 A;  1QE1 B;  1ZAW A;  4EK2 A;  2VIH A;  1Y0H A;  4V1A k;  3MED A;  4MTP A;  2E9T A;  1FX4 A;  1TQL A;  1RHR B;  4K2J A;  2QN6 B;  5F3T A;  4QU6 A;  2ZUG A;  2QYG A;  2BA9 A;  2N82 B;  3VCD A;  1XNR J;  3SCK E;  3U02 A;  1NJY A;  1LWC A;  4YB5 A;  2DIT A;  1VQ9 S;  4GKK J;  4OJG A;  1FRK A;  1XNR F;  5ETT A;  2UUB J;  4M5I A;  4AL7 A;  1URN A;  1EZZ B;  2DO0 A;  4GKK F;  3DLB A;  8RUC A;  3CJS A;  2UUB F;  5AXK A;  2HNY B;  2DK2 A;  3AJ2 A;  4CIO A;  4B9S A;  2JEI A;  1V5I B;  7AT1 B;  2GJF A;  5D3G B;  1V9O A;  2N4D A;  3G96 A;  4FBT A;  1DBD A;  1TMM A;  2BV3 A;  1JKH B;  4DR2 F;  4I1T A;  2J7W A;  2F8M A;  3BN7 A;  2F3J A;  4E8U A;  4KTQ A;  2QEX S;  4ZIW A;  4UY8 T;  2BR0 A;  4RU9 A;  4IH6 A;  3IRX A;  3TAP A;  3VAK A;  2ZKT A;  1YJU A;  4ZVO B;  2C2E A;  2L08 A;  2DNZ A;  2W24 A;  4F25 A;  5CD4 H;  3DOM B;  4DV7 J;  3X3U A;  3L4B C;  2JX2 A;  4UZC A;  4B17 A;  1Q53 A;  2AF6 A;  5G4D A;  2F8H A;  1S6P A;  4DV7 F;  1RT2 A;  4U95 A;  3KLG A;  3PDN A;  1KR4 A;  1JLG A;  3UVJ A;  2BQ3 A;  4KYZ A;  4DLE A;  3LO3 A;  4BHQ A;  5K8N A;  4MK9 A;  2DIV A;  2HMI B;  5KFM A;  4R0E A;  1X0F A;  2HWT A;  2DNP A;  3OSP A;  2IM1 A;  1F6T A;  5A8W B;  1WHW A;  3GFX A;  2PMZ D;  1WKJ A;  4H4O B;  2FY1 A;  1RT1 B;  3HHL D;  3GIL A;  4LBI A;  3NCR A;  2IM0 A;  3BSC A;  3ET6 B;  1NH8 A;  1AFJ A;  3QGP A;  1X4G A;  4JI2 J;  4DN9 A;  3IM8 A;  3T1Y J;  2BKP A;  4DL2 A;  1NK6 A;  2CG4 A;  1KKH A;  3MZI A;  4ZVR B;  3G6X A;  3I31 A;  4DUY F;  4K2X A;  3CCQ S;  4EGL A;  4Y2I A;  1WSV A;  1NB7 A;  5F8M A;  3J7Y U;  2R42 A;  3BZQ A;  3MUR P;  3K58 A;  3D6M B;  3QFW A;  1SH2 A;  2B9E A;  5HO4 A;  2W2O P;  3PX4 A;  1JNR B;  1S4F A;  4YOE A;  1F2H A;  1VK8 A;  3H2U B;  4JI7 J;  4ES1 A;  2DRA A;  4ZPA A;  3OHA A;  5LSO A;  4JI7 F;  2GML A;  1EQ0 A;  4WKY A;  4QZV B;  3RZA A;  4B9U A;  3AD9 C;  2XCP A;  2Z57 B;  1DUR A;  2EVZ A;  4K50 A;  1B7Y B;  2D9O A;  3Q8P B;  3WX8 A;  2M52 A;  2CXE A;  4CZC A;  1V3S A;  4WTO B;  4ER8 A;  2NZ4 A;  4EYH B;  1FNX H;  5G0R B;  2XB2 D;  4ATN A;  3T9N A;  1QE1 A;  2F65 A;  3IWL A;  2KG0 A;  3BBB A;  2J6T A;  1L5U A;  4NLQ A;  4RNN A;  5B0C A;  3CJ8 A;  3BKT A;  1N34 F;  1YHQ S;  5MLC V;  2V2Q A;  2MLY A;  4UZB A;  3D66 A;  2BMB A;  4RBT A;  5D0E A;  4Y0F A;  2JEF A;  4KAI A;  2DXD A;  5LXR A;  2PI4 A;  2KT2 A;  1R8A A;  2HNY A;  2H5I B;  2XI2 A;  2G13 A;  3MCM A;  3CDA A;  2BAN B;  5D3G A;  3DOL B;  1UJ4 A;  3DDI A;  2P2C B;  1RWN B;  4A8Y A;  1JKH A;  5ETV A;  3MCO A;  3KDN A;  2DY9 A;  2XGQ A;  5AT1 B;  1TFY A;  3KNA A;  4HKQ A;  3LAM A;  5I42 B;  2ALY B;  2AYE A;  3PKM A;  2XEX A;  3NGK A;  3J80 U;  2RE1 A;  2M8D B;  2K1R B;  3PFO A;  3EVO A;  5CCM A;  1CQN A;  3GB0 A;  1X5S A;  2D41 A;  3I5C A;  3DOM A;  1HBO B;  2DGX A;  1S5Z A;  2GW8 A;  2FVQ A;  4E0D A;  2B4U A;  2PSZ A;  3CO9 A;  4CH7 A;  4LRD A;  4OZJ A;  2YWW A;  4BBY A;  5F8H A;  1RE1 B;  4DFP A;  2QO3 A;  2HMI A;  2A10 A;  2KH9 A;  4ZJO A;  1YG0 A;  4F4Y A;  2AU0 A;  4OHW A;  3PR4 A;  1OY9 A;  5A8W A;  4J90 A;  2AGO A;  1L3S A;  4K0K J;  3NRB A;  4H4O A;  4OHZ A;  4DR4 J;  1RT1 A;  1FD8 A;  1QLN A;  1IR1 A;  3MHY A;  3J80 Y;  4K0K F;  2OPQ B;  3ET6 A;  4DR4 F;  2YX7 A;  2OSR A;  4LMZ A;  2CJK A;  2LKZ A;  1PC5 A;  2NR0 A;  1QAY A;  1MML A;  2KG1 A;  5A6P A;  3HVW A;  3CJ2 A;  5IZH A;  3A8E A;  1PG5 B;  3QGG A;  4U6P A;  3HVR A;  4PRF A;  4DLG A;  3HHL B;  1JK9 B;  2X1B A;  2ZUA A;  1HQU B;  4NEY A;  2OKQ A;  2XYH B;  2R7X A;  1A0O B;  4YDX A;  1HBN B;  4OV1 A;  2RDD A;  3W5X A;  3KTQ A;  1LK7 A;  4IDK B;  4Q44 A;  3RBX A;  3CC4 S;  2OUG A;  3KLF B;  2XY5 A;  4KGZ B;  3GCX P;  2XWX A;  1GMW D;  3MR7 A;  2VKZ G;  1NSQ A;  2HWH A;  4CNY A;  1S59 A;  3GIK A;  2GQQ A;  1LEO A;  2R8H A;  4YR0 A;  2YPZ A;  2VU5 A;  4E98 A;  3CJK B;  4P75 A;  3J7Y I;  4HTI A;  7FD1 A;  2ZZM A;  4A8F A;  3RRK A;  3C3L A;  5G0R A;  3OPK A;  5KT3 A;  1S0N A;  1S9E B;  4DSE A;  5IQQ A;  2PEB A;  4QR0 A;  3TZY A;  2XNQ A;  1TL3 B;  2K06 A;  4LBP A;  1SUQ B;  1MN9 A;  1TFW A;  3GP9 A;  3J81 j;  1S97 A;  2RQ4 A;  2W9B A;  4F3O A;  3KK1 B;  1AT1 B;  1VCT A;  3QZ8 A;  1UZD A;  3M9N B;  4QWB A;  1XMB A;  4PXE A;  6AT1 B;  3NGD A;  3W9I A;  3G2X A;  3QLH B;  4OFZ A;  2AD9 A;  2FHK A;  4O23 A;  1LWE B;  3NY0 A;  1RTD B;  2VFS A;  3VQS A;  4C97 A;  4WKR A;  1FER A;  4K4U A;  2V94 A;  4QR1 A;  1BGX T;  2BAN A;  1CJV A;  3DOL A;  2MJN A;  1K47 A;  4IOA Q;  1X5T A;  1EKS A;  2IRY A;  3IFE A;  2FJX A;  3NMR A;  1F5A A;  1WKK A;  2GJ2 A;  3OTE A;  2DGQ A;  2I8E A;  4UOH A;  4LF1 A;  5I42 A;  1KHV A;  2GMJ A;  1C0T A;  4JI8 J;  4DV2 J;  2DNH A;  3HP6 A;  1LQ9 A;  2E1R A;  2K1R A;  5B7W A;  1TL5 A;  2L9D A;  3ZZY A;  2UUT A;  3JSR A;  4YP3 A;  1ZYQ A;  1HBO A;  1U0H B;  3GIR A;  3AB4 B;  5DQH A;  4ELV A;  3UW1 A;  1S9F A;  2WSE C;  4U67 Q;  1YJR A;  4B9L A;  3P4U B;  3S6E A;  4UOG A;  4WP3 A;  3IBC B;  4C2M A;  1UCN A;  1XBW A;  3P3D A;  1R8H A;  3MCN A;  5EHH A;  2IHR 1;  1O8B A;  2MZT A;  1UZH A;  1SIZ A;  3BDE A;  2E1C A;  2HK2 A;  2OPQ A;  1JIH A;  1VOM A;  4DQQ A;  2A3J A;  5F3Z A;  3M9M B;  5F0U A;  2J9D A;  2V67 A;  4NYP A;  1TKT B;  1D09 B;  4PEO A;  3I82 A;  1CLF A;  3HHL A;  4WFX A;  3W64 A;  5BR8 J;  4DX6 A;  1U25 A;  1HQU A;  1RT5 B;  4BWJ A;  3OJS A;  2DJW A;  2DHA A;  1XMO J;  2LU2 A;  5BR8 F;  1KD1 T;  3CCR S;  1HBN A;  4OZL A;  3CC7 S;  1XMO F;  4AND A;  2RDI A;  3CC2 S;  3KLF A;  4KPC A;  4WE1 A;  2OO4 A;  2KB2 A;  2H9Z A;  1AUD A;  1G4C A;  5ETK A;  4DZ6 A;  4KO0 B;  1UW4 A;  4FYW B;  4L75 A;  4CLF A;  3CJK A;  1NJW A;  2QSW A;  2PFF B;  3D1Q A;  1F60 B;  3H20 A;  4JI1 J;  3DLJ A;  2GMH A;  1S9E A;  4ILR A;  2IVF B;  4TYB A;  2HS3 A;  2VBW A;  4JI1 F;  2JFD A;  2FPH X;  3HI9 A;  4DL3 A;  1TL3 A;  1IWG A;  4DV5 J;  4BCA A;  5E5N A;  3LA0 A;  2ZH6 A;  3IN5 A;  1NPR A;  1U24 A;  3UE2 A;  4DV5 F;  3KK1 A;  2DR5 A;  4OJ1 A;  5I3U B;  1HMV B;  4HDH A;  1SCJ B;  4FYX B;  1PO6 A;  2LYV A;  4C0H A;  3QLH A;  1TL4 A;  3KHG A;  1WHX A;  4PAA A;  2C42 A;  1LWE A;  4NCG B;  3KJV B;  4RX6 A;  4OX9 J;  2MEW A;  3M30 A;  3LWM A;  3F0N A;  1PCA A;  4IG3 B;  2XTJ P;  2ROP A;  4OX9 F;  2WVD A;  1S1W B;  2B4P A;  4CLU A;  3T6J A;  4M5J A;  5H9F K;  4M5N A;  2M70 A;  2SXL A;  1A9N B;  2EK1 A;  1NDL A;  3GYN A;  3P8B B;  2O01 C;  4UTG A;  1SQE A;  2MQ8 A;  3TJ8 A;  2VV5 A;  2NLW A;  3WC0 A;  5KFR A;  1EX8 A;  4ZP8 A;  2UXB F;  3PV8 A;  4KPY A;  1TKX B;  5D4L A;  3G6E S;  1U0H A;  2L9N A;  1FO1 A;  4K5S A;  3CUL A;  1RP5 A;  3HZE A;  3NS5 A;  2PGC A;  2O67 A;  2DYA A;  4X62 F;  1ZM4 A;  2G0J A;  3CGI A;  2CNN B;  3B8H A;  5F8L A;  2FHM A;  2CFX A;  3UD5 A;  4TY8 B;  3DLK B;  2Z30 B;  5A76 A;  2ZVI A;  2ZJR Q;  4LRA A;  1N54 B;  3IXQ A;  2WTF A;  4ZLP A;  3RUB L;  3ADA C;  1S1X B;  1TKT A;  4NI2 B;  2B9X A;  1D8Y A;  2QT7 A;  1UWB B;  1S7H A;  3QT7 A;  3L9Z A;  5B0D A;  2XO7 A;  3KUH A;  3DFE A;  3GJS B;  2BJ3 A;  4JP8 A;  1SJQ A;  4IOC Q;  1RT5 A;  1FFW B;  2DR6 A;  2HK3 A;  2MDA A;  4G1Q A;  2AJ1 A;  3G86 A;  2OPP B;  4Q45 A;  4WZQ A;  3AJ1 A;  4KO0 A;  4NRT A;  2QFJ A;  1MG7 A;  2HHT A;  4F8R A;  1T94 A;  1GH8 A;  2DHG A;  3FRY A;  4PPZ A;  3I96 A;  3NXZ A;  4XIU A;  4OYP A;  5DO2 A;  2ZEJ A;  4F4A A;  2DHS A;  5KFL A;  4TU8 A;  2F9J A;  2NZC A;  4LIW A;  1AB8 A;  1RWM B;  3KUE A;  4OHV A;  2FYX A;  1MLA A;  3X1L B;  1ARO P;  4DDF A;  2VZ9 A;  3D6F B;  5I3U A;  1HMV A;  3CCM S;  4QPX A;  1N5V A;  1LOU A;  2NXE A;  1SKS A;  3OUY B;  2XLI A;  1S77 D;  2DRD A;  5L38 A;  3MM5 B;  4NCG A;  3KJV A;  2VHG A;  1WSR A;  3DU6 A;  4HL9 A;  1XJW B;  4PG8 A;  2LQJ A;  2NXU A;  4L76 A;  1RAH B;  4IG3 A;  4ED1 A;  3HJV A;  2P6T A;  3TAR A;  3PW0 A;  2EG2 A;  1S1W A;  4ZJL A;  4NML A;  1ZZN A;  1NJX A;  4DV1 J;  1Q1K A;  2E44 A;  2QV6 A;  2DR9 A;  5KG5 A;  3GR0 A;  4DV1 F;  2IJF A;  1FDD A;  4EZ9 A;  1RBL A;  5K8P A;  3TR5 A;  1HD1 A;  4RW4 B;  4DWI A;  2FVR A;  1T03 B;  1GXL A;  3HFV A;  2QLX A;  3A1Y G;  2RVJ A;  3LGN A;  1KN6 A;  3HUL A;  1TKX A;  3CD0 A;  1M1H A;  2DNQ A;  4DJB A;  1U7L A;  3GG1 A;  3TUP A;  4J5O A;  1RTI B;  3KK2 B;  2V8D A;  3PCO B;  1TUV A;  2F63 A;  1UWA A;  1VQO S;  4TNO A;  3ITH B;  2MST A;  4NLX A;  3CME S;  1AUS L;  4FVM A;  4TY8 A;  2DNG A;  3DLK A;  4UOF A; 
#chains in the Genus database with same CATH homology
 1SC3 B;  4LSZ B;  3P4U B;  2CNK B;  4ZVQ B;  4JB8 B;  2H5I B;  3GJS B;  1SC4 B;  3NS7 B;  3KJQ B;  3IBC B;  2FQQ B;  1RHM B;  1RHQ B;  2Y0B B;  2CNL B;  1ICE B;  4ZVO B;  2QL7 B;  2P2C B;  1RWN B;  1QDU B;  1SC1 B;  2CJX B;  4DCP B;  1PAU B;  5K20 B;  2Y1L B;  2HBZ B;  3R7N B;  2CJY B;  1I51 B;  1PYO B;  1RHR B;  1RWK B;  2DKO B;  1RWX B;  4ZVS B;  3RJM B;  5IC6 B;  1RHJ B;  2H51 B;  3R6L B;  2XYP B;  2C1E B;  2XYH B;  4DCJ B;  3GJT B;  5IC4 B;  1QTN B;  3KJN B;  1F9E B;  1IBC B;  2H65 B;  2CNN B;  1RWW B;  3R7B B;  3KJF B;  3GJQ B;  1RHU B;  4DCO B;  1GFW B;  2H4W B;  2QLF B;  3GJR B;  2CDR B;  2QLB B;  1BMQ B;  3R7S B;  2XZD B;  3SIP B;  2H48 B;  2C2M B;  1RWO B;  2QL9 B;  3EDR B;  1RWM B;  2H5J B;  2HBR B;  4ZVT B;  2XYG B;  3EDQ B;  1I3O B;  2H4Y B;  2H54 B;  2QL5 B;  2C2Z B;  1RE1 B;  3D6H B;  3P45 B;  2CNO B;  2XZT B;  4ZVR B;  4ZVU B;  1RHK B;  3D6F B;  4ZVP B;  1RWV B;  2C2O B;  2C2K B;  2HBY B;  3R6G B;  1RWP B;  1NME B;  3D6M B;  3IBF B;  2HBQ B;  3QNW B;  2QLJ B;  3R5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...