2CNOB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
b'HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 P17 SUBUNIT
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cnoB00
1PAUB 2C2KB 2C2ZB 2HBRB 3D6FB 1GFWB 2XYGB 5IC4B 1QTNB 4ZVQB 4ZVOB 2CJXB 1I3OB 1SC4B 1RHQB 2QL7B 3R7BB 3P4UB 4DCJB 3KJFB 2XYPB 1SC1B 3KJQB 1RWMB 1RHRB 2CNKB 3SIPB 1RWKB 2P2CB 2FQQB 2Y1LB 1NMEB 1RHKB 1QDUB 1RWNB 3D6MB 5IC6B 4ZVUB 1ICEB 1RWWB 1RWXB 2CJYB 3D6HB 3KJNB 2CNNB 2H65B 1RHMB 3GJSB 4ZVTB 2H5JB 1IBCB 3EDQB 3R7SB 2QL9B 2H4WB 1BMQB 3R6GB 2HBZB 2H5IB 1RE1B 2H54B 2CNLB 2H4YB 3GJTB 2XZDB 2XYHB 2Y0BB 3NS7B 1PYOB 2HBYB 2CNOB 3IBCB 4ZVPB 1RWOB 1F9EB 4DCPB 4ZVRB 4JB8B 3R5JB 3R7NB 4DCOB 2C1EB 2C2OB 3R6LB 2XZTB 1SC3B 2H51B 3RJMB 1I51B 1RWPB 3P45B 1RWVB 2H48B 4ZVSB 2HBQB 2QLJB 4LSZB 2QLFB 2QL5B 2QLBB 3IBFB 2DKOB 2C2MB 3GJRB 3QNWB 3GJQB 1RHJB 1RHUB 3EDRB 5K20B 2CDRB
chains in the Genus database with same CATH superfamily
2XSFA 1BGXT 2GJIA 2C2DA 1VFJA 2UU9J 2QYGA 2VA2A 3OTCA 4DV3J 4G1QB 5K8OA 3FSXA 4LREA 4RBUA 3HMJG 2BQRA 3D4JA 5IC6B 4XK8C 2FGCA 4HEA9 5ETLA 1VC5A 2RS8A 4RNFA 3CJTA 3UN3A 3JS9A 3Q83A 4ZN3A 4RW6A 2MY7A 2W2PP 3DM2B 5D4PA 4AUKA 4AXJA 1UVIA 3BQ0A 4WF9Q 2YKNB 4EBCA 4RBVA 1ZAVA 3BB5A 1DY3A 4FXVA 5MAOA 5HROA 3DLBA 1TK5A 1YSJA 1WKLA 3HHLC 2KVQE 4DCOB 5L46A 2J76E 4ZPAA 1WHWA 5L9XA 2CUYA 4NE9C 2MZTA 5AXMA 1C1CA 2P9EA 3I0RA 4DV7J 1J5EF 2UXCF 1H0HB 1IKYA 4CRJA 1UZHA 5IM0A 3MPUB 1X0PA 4XAKA 1H7WA 2QL7B 3K5LA 3UN5A 3KK1A 4CM2A 2MLYA 5EN1A 3IAM9 1NAQA 4CNZA 4WXOA 3LANA 4NLWA 1YBTA 2VG6B 5SUHA 2B6AA 2I6WA 2VZ9A 2ZM6F 2E5LJ 4YDDB 2VJUA 4F0MA 5HO4A 1Y5NB 2G1DA 1P9YA 5JVHQ 4P72A 1C1CB 1UPPA 3CC7S 4OX7A 2KXHA 1RE1B 4J9LA 3I0RB 2HBYB 4AQYJ 1XBWA 1IKYB 3KLFA 3CD0A 2LQ5A 1JKHA 1QAXA 3BN7A 2P8IA 5K14A 3CCZA 1RK8A 2D3ZA 1ZETA 2VPYB 5GAHU 4DSEA 1VQKS 2ADCA 2UUCJ 4K5SA 3DHWC 4FS2A 1RTDA 4V1Ak 2CZ9A 2CJ9A 3PO5A 4JI1F 1G7CB 4A8KA 2VDIA 3GIMA 2MQPA 4I2QB 3BDEA 2ZH6A 2APOA 3T1YF 1RYRA 4CH0S 2BJEA 1IBLJ 5I3UA 2QN6B 3PYEA 3A3PB 5KFLA 2BRKA 5KFTA 2ZZNA 1PILA 4Z37A 3D6MB 2ILZA 3QT5A 1ZM9A 1I5OB 5D77A 3FQLA 4X65J 3TA0A 4PUOA 3FCHA 2CXEA 3IR6B 5IV3A 4KHPJ 2H54B 1RTDB 2IFXA 3EM1A 3FBBA 2MQOA 1IQZA 4DQRA 2A6OA 3TVZA 2VA3A 3FFIB 1DARA 3N9UC 1HL6A 5JMNA 2LXUA 2F5GA 1YQHA 3VVUA 2RUSA 3OUYA 3KLEA 2M52A 4O3NA 3OFFA 1WWHA 2IBOA 2ZD1B 4F7VA 1P8GA 3DNCA 2VKZG 3HLUA 2XS2A 2K1RB 1S57A 1RT5A 3GMGA 2A10A 3HJVA 1OY9A 4ZPCA 4NZ7A 3C8YA 4WKYA 3LWLA 4HACA 3CDEA 4X4SA 3BO4A 3FBCA 1X4GA 2J7UA 2HHHF 3RW6A 2B4VA 4DFJA 2AJQA 5CCLA 3KLIA 2KFYA 1N6QA 1WOPA 4OJGA 5F3TA 1NSPA 2J7WA 3PW0A 2X1FA 4ZVFA 3HM9A 4LR7A 2AX1A 2QA4S 1R7IA 4IQXA 4JV5J 1NJZA 2XLKA 2W9AA 5KFHA 1UZDA 1MU2B 2XEXA 1CJVA 4PWUA 5IS2A 3M9OB 4LR9A 3G82B 4N7TA 4P10A 2YNFB 3LPEA 2GO8A 4WZMA 1RISA 1K44A 3LW5C 4IFVA 1N6QB 1YBAA 3UR0A 1FRMA 3KUEA 4FKYA 3B4DA 1PYTA 4O3SA 2IAJA 3MAAA 1YJNS 5DRKA 4HI1A 2YKOA 2M0GB 3W5YA 3W66A 1KR4A 3VWSA 4QWDA 4RX6A 5B09A 1QSSA 3LUYA 4MT1A 1S9GB 4DL5A 3K59A 1RAHB 4C0HA 2O3DA 1B64A 3TYTA 4YB7A 2R4FA 4YHHF 4IFVB 2Z0GA 3TA2A 2PGCA 1PC5A 1UVKA 4B3SJ 2BBEA 4ECUA 2CZVC 2DNHA 2ZH7A 4QW8A 4EU0A 4H4OB 5CD4A 1VK3A 4C3KA 2AF6A 5HJYA 5E7OB 1TMMA 1FKOB 2CRLA 1TL3A 2H48B 4LT6A 5IT4A 3EZ5A 3N6MA 1XK8A 2IM2A 4YMEA 5F0WA 3PJ9A 1HMVA 4IR9A 3DOKA 4WPAA 3H4BA 3OJUA 4LRCA 2ZHBA 3IA0A 5I3QA 5E3QA 2HEKA 2MZSA 1RDRA 4R0EA 1MMDA 4JI6J 3W63A 1S7HA 1F3FA 1H2TZ 2RRNA 1ZM4A 4FF1A 4WFXA 2CG8A 2UVVA 4GVBA 2EG2A 5LT5A 5BJRA 3MDFA 3O44A 4DXLA 1IWGA 2BJ3A 3QZ7A 1HI8A 2NXCA 4RUAA 1Q16B 4OYZA 2PSZA 5A0YA 2DPJA 3VAFA 4HR2A 2QSFA 4NCAA 1RT2A 4IDKB 3PYFA 4HTJA 2IJNA 2HNDB 4TY8A 3Q8RB 3MAQA 5KFRA 4EEYA 1FE4A 1E6YA 2R7OA 3AJ2A 3NEKA 3GSDA 5HMYA 5D0EA 2CQ4A 1NDKA 1RADB 2V0NA 5CYQB 4G3IA 3A3OB 2ZJQQ 1PG5B 1B3TA 1SBRA 2QLJB 3MD3A 2U1AA 1PO6A 2DB1A 3CWJA 3I5AA 2FC9A 3D6FB 3BF4A 4W92B 1EHWA 5D0RA 2K2PA 4IOAQ 5A0YB 3TP2A 2EFGA 3DI6B 2MQQA 4OX6A 5F8GA 1FRIA 2GAHC 3DU5A 3TEGA 4NLYA 3KDOA 1KDNA 3W62A 2JFDA 1R8PA 5E3RA 2Y8WA 1GMUA 2DGXA 3KJVB 2RDJA 1J5EJ 2UXCJ 1LK5A 3KNGA 1XR5A 1N5YB 1U47A 2DNZA 4FBUA 3QJJA 1VQNS 2H5JB 1IVZA 5K9FA 4CLLA 2ZH9A 2G0CA 2M7SA 1KHWA 5KG1A 4DL0C 3SCJE 2U2FA 3R5AA 2M3DA 2KZZA 3D7SB 2ZM6J 1M5PC 1SJQA 3C6TA 2HFUA 3OLAA 5HQ8A 1N5TA 2RKIB 2FD2A 1KWMA 3ISZA 4DG1B 2L9DA 4UQGA 3GJRB 2XMMA 4OV1A 2C2KB 2RS2A 3MM6B 4X4UA 5IC4B 3M6WA 2FJWA 2HHUA 1OWXA 1I3OB 2Y1RI 1S97A 1SKUB 4FPRA 1IM4A 4PEOA 3I32A 3FJ2A 1EQMA 3NNCA 3OJSA 1XERA 1U1NA 2DHSA 2LKZA 4DR4F 4ZK7M 1HPZA 4O0NA 5E3CA 3DLHA 3MCSA 2HZCA 4JI1J 1G4CA 2DXDA 2UXBF 1FCAA 4IH7A 2GV1A 3KK3B 2D9OA 3T1YJ 3KFWX 2HQDA 4ETXA 4CLUA 1OO0B 2NXNA 4ID5B 4TNOA 2G2ZA 3SYZA 1K8AT 1VQ5S 2W8LA 2NCKL 4IG3A 2HNYA 2RJZA 4A8OA 1NNDA 2DXEA 3MPWA 1RTIB 3OQ2A 4K4TA 2DNYA 2F7VA 2YXLA 4RL1A 3BSOA 1RAAB 4F3OA 1RUSA 5KAKA 3NY0A 1HNVA 2QLFB 3NBPA 1CG2A 3LGNA 3FRZA 2OPPB 3DLKA 4M5IA 3SDEB 5ADZA 4DPTA 1SJ3P 4F2SA 5B7WA 1RHQB 4ECQA 3I9ZA 4DX7A 2HFVA 1UVJA 4LFAF 1XC9A 2CVEA 1WHXA 1S6QA 4KHMA 1T03B 1S48A 3AY0A 4AXIA 4M5JA 1WDDA 4A8XA 2XMWA 4CO1A 2XSJB 4ZCIA 2KRBA 5KT4A 3PX0A 1IKVA 3TW0A 5H1SV 3H40A 3NGKA 4I0WA 1KLMA 4X62F 5CA5A 2M2BA 2HHHJ 3NMRA 4YFUA 2BKPA 4B3OA 5C24B 4K2JA 1TFWA 3BO3A 1MMNA 4X4VA 1WC3A 3CIZA 2OPSB 2JHEA 3R1LA 4LF2A 1B0VA 1S6QB 4KKOA 5D6GA 1XMOF 2AYBA 4A47A 4PQAA 1OSCA 4M94A 4H4MA 2W8KA 1ZYQA 4IO9Q 4HKQA 1PIEA 2RD5C 4DMZA 4URSA 3GIIA 1S1WB 1EB0A 3MMCA 1VC0A 1CC8A 1DTTB 3GIKA 1GFWB 2LA4A 2PDAA 5GAEU 4DPXA 4JI7F 1IKVB 2AD9A 2YNHB 4OYXA 2JLEA 2AW0A 4FS1A 3UDLA 4L74A 3OR2A 1UFWA 2P9GA 2G2YA 4B3OB 4ILLA 3T1AA 4HDHA 3BR9A 3HT0A 1NHUA 4MAKA 1RT6A 5H9FJ 3B4MA 1L3TA 3OTDA 2QO3A 3K2YA 4Y6IA 3VGTA 4NCGB 1R0BG 4ZHRA 2ABYA 1LWCB 4WCEQ 1ZPVA 3FRYA 4JI0F 2ZBPA 2OPQA 5GAGI 5A8KA 3OR1A 2QEXS 2XNRA 3MMCB 2RUGA 1SUQB 3QIDA 3BGRA 3ILLA 5DM7Q 1WTFA 1D8ZA 4MIAA 4ZDNA 1EIYB 4YHHJ 1RTZA 2KT3A 1HBOA 2GS8A 1XNQF 3H4DA 3GG1A 2XGPA 4UTGA 4WK1A 1RT6B 3TJ8A 2ASJA 1T9XA 3G6XA 4JV1A 1S0MA 1CJUA 3SMZA 1FJGF 2WB4A 1KTVA 2M4MA 2V94A 5KFMA 1F60B 3MTKA 2OPQB 1JLGB 2RF2A 1OQ6A 5AXKA 4RZRA 3OR1B 1WC0A 4OJ1A 4RPFA 1OSDA 4CO4A 3EGVA 4DV1F 4JYAF 2CQ2A 2ZBQA 3RGIA 3M8WA 3VZIA 1HQEA 2HQIA 4I7FA 4HHJA 3NXZA 2DH9A 1JXEA 1NZAA 1JXVA 1S99A 3LAKA 1CPZA 2G4BA 1FDAA 2H4YB 3TZWA 1CC7A 1UKUA 1RI7A 3R3TA 3N5FA 4TXSA 2VOOA 4YDXA 4DSKA 5HQLA 5JXSA 3CGIA 1PJ6A 4KGMA 2OTLS 2H51B 1FRHA 1S0VA 5ETRA 4I67A 2OPRA 3BBFA 4NA3A 2AGPA 2KU7A 2BJ7A 1DAXA 4U7CA 4P73A 4CH1A 1JLFA 1VBZA 2MZQA 5AE1A 4TU9A 3SFUA 4B9UA 1S9FA 4J9QA 2GMJA 1Q7LB 2GIQA 4Q7AA 1SC6A 4RBTA 3WZ0A 1YGYA 3BGLA 2YPZA 2W9BB 2O66A 5DQGA 3H20A 3N79A 3IO1A 3VAHA 2AYGA 3EICA 3ZZZA 4ZA1A 2H65B 8AT1B 4C97A 4LSNB 3JSMA 1X4EA 3OW2R 2IMWP 3R1HA 3HSDA 3PFOA 2KM8B 2GVDA 2XBPA 4DFKA 2XMTA 3LOUA 3DRXA 1CQMA 4NASA 1NM2A 4URGA 1RWOB 1VQSA 4DUTA 1B0PA 1V3RA 4YN3B 4NLQA 4X2BA 4QR2A 2DEJA 4LJMA 1WKJA 2DHHA 3OPKA 2W4DA 4KSEB 4PG5A 3OTOF 4LSZB 4ZS6A 2GQQA 2E5IA 6AT1B 3U27A 5AE2A 1VLYA 2WBMA 3EGWB 5K8PA 1IKXB 5KFIA 2R42A 3UI3A 5B0BA 1XMBA 3ZZRA 3P6YC 4DQPA 2W4PA 4LMZA 3ZZ0A 4OMFG 3SCIE 2HVZA 3GCXP 2E1CA 2GVDB 3HT3A 1EX8A 2YVSA 2H3EB 2G9OA 4U9RA 1HHQA 2L41A 1SIZA 1S1UA 1VHFA 2EFPA 2OSRA 2FZKB 5HANA 4OX9F 1IBKF 2ERRA 1HD0A 5ETNA 1P1TA 2YY3A 3TQEA 2YWGA 3TJ9A 3N28A 3CULA 3MMBA 2MY8A 1BWVA 4DR4J 3QT6A 3W2VB 1HR0F 1UL3A 1S1XB 4QYRA 4NLSA 2UXBJ 2KJWA 1Q1KA 4LIWA 1TL7A 4Y28C 2XZTB 4HLBA 3H5YA 4R0JA 4OYAA 4GO7X 2YWKA 4EUVA 3GV8B 3R27A 4PPDA 1UVMA 3ZTOA 3J7Z5 5JJBA 1GNKA 1JLAB 3CXCR 4ZVOB 2KRRA 3KLHB 3KLGB 2XS7A 1GXLA 1SL2A 5J2PA 2FZCB 3QJPA 1QVGR 3IP0A 3VF0B 4I68A 2ZNYA 5E41A 1V6HA 4QIGA 5A8RA 3RG6A 5I4MA 3EVMA 4FBTA 3CJ5A 4NCBA 5HBMA 4YB6A 3AB4B 4G1PA 1X60A 5MLCV 2YQ3A 4MKAA 4LFAJ 1UP1A 1KVJA 3ET6A 1IBCB 2MYFA 3D6TB 1S7IA 2CPFA 1JLEB 1JX4A 2ALYB 2B5JA 2X3GA 4ZIWA 6FDRA 2ZE2B 4OZLA 1UJ4A 2Z56B 3NGSA 4ECWA 5J2PB 4USKA 4CLKA 1L3VA 4B3RF 5J1NA 3R6LB 3GFXA 4RW7A 5IT9U 2HBQB 4X62J 2PE8A 1S1TA 3IXQA 4R8UB 2QL5B 3CD6S 1B0TA 2JEFA 4GRSA 5FDLA 4MK8A 3SV4A 1NZ8A 1RBAA 2BJ1A 5KFGA 4CM0A 5IT9Y 2JEJA 1GH8A 1FE0A 3CO9A 1GK8A 3UDCA 3G2XA 3OSNA 1C0UA 4M5MA 1XMOJ 2DNOA 1L5UA 4M5LA 1WF1A 4ED1A 1REGX 1RWKB 4MKVA 3KHLA 3LP0A 2I8EA 1I6JA 4CT9A 3PW7A 4QR0A 1YLXA 1S49A 4LIRA 2EFQA 2L48A 1M5KC 2OMOA 4LF8F 4YY3F 4JI7J 4EO8A 1FWLA 1JJHA 1WORA 4I69A 4RW7B 1TELA 4NZ6A 3BGUA 4ATNA 4QPTA 2AEFA 2F8MA 3MECA 4FZVA 1ZA2B 4I1TA 1V9OA 2OEJA 3QWPA 2JNJA 3NCQA 4PYDA 1R89A 3C2PA 2YBVA 4IH5A 5FIIA 4PAAA 4J37A 1T9TA 3CCUS 1HHTP 1C0UB 1FX4A 2HVIA 1VRTA 3M1VB 4F4AA 1BC6A 4JI0J 2BANB 2OD6A 3VTIA 4X66F 3POTA 2EVZA 1M5VC 3C15B 4A4JA 2JH3A 3HDSA 2Q66A 2V4JA 1EKSA 2Q43A 5KFOA 3S8SA 3JQMA 1FXRA 1SIWB 3PW4A 1Q8LA 1XNQJ 5B0CA 1PJ5A 2RAQA 2X51A 1YJUA 2DVIA 4QPXA 3DYAA 3N4WA 1X0FA 1MNEA 2GNKA 3PIOQ 4WZQA 4UF4A 1NB2A 2W7AA 2ZHOA 4LF1A 2XZDB 4LF9F 3CJ4A 2ASYA 3AAWB 4DV1J 4JYAJ 5T14A 2UVUA 3W5XA 1EETA 2V8HA 5KG3A 4DV4F 2P6SA 3IFEA 2DY9A 2E7WA 3BDPA 3TWZA 4QZVB 2VOPA 1U6FA 5L38A 3DXSX 1RWVB 1KQGB 2RU3A 3UCGA 1LXJA 1RAGB 1DTQA 2XI3A 2K3IA 1VHIA 3DDNA 2CDRB 1V5VA 4PCQA 4EGLA 5C42A 1XJWB 1UW9A 1N54B 2J7KA 3CCVS 1SQEA 2G13A 3MM7A 3TAMA 2A2CA 1OJ4A 3KJFB 3U1NA 5ETVA 1G2EA 4PQUA 3LP2A 2B0GA 4QW9A 2GJ2A 2DO0A 3P3DA 4I64A 4ANDA 4ELTA 2KB2A 3CJ0A 3OXFA 2VKRA 4L3KA 1WJ9A 3I5CA 3HULA 3KTQA 4EI2A 4C8LA 1TKXA 2L9WA 4YB1P 2MKIA 2VG7B 4Y34A 3CC2S 2OP5A 1VQ9S 1M0SA 3W5ZA 1UEKA 1Q5YA 3VGUA 3ZNUA 4BLGA 5FD1A 3OBIA 4ILRA 2V68A 3DLJA 1K0TA 2HHWA 4TLRA 3CMAS 2HFSA 4TQRA 4OZJA 1EZZB 5HVFA 4IQMA 3QBCA 1PSDA 1ZTWA 4WP3A 2WSCC 4WJBA 3M8YA 5KT7A 3LP2B 2ZDPA 2HK2A 2KFNA 4U8YA 2HPUA 3GONA 5D0GA 2D69A 4OI3A 4EO6A 5J2NB 1RHUB 5FLXU 4Q8EA 1TKXB 3LGHA 1UWBA 2GQCA 1F3VA 2J0XA 1UVNA 3ITHB 3HHLD 3J7ZT 2YNIB 1HYSB 4A8FA 5FLXY 3F73A 3BH6B 1JLQB 2V50A 2WOMB 1IBMF 1ZPWX 2FLNA 2JVOA 1N33F 3DGPA 2VBWA 1YJTA 4OYOA 2V34A 3NNAA 5ETMA 4ED4A 1RHMB 3E51A 9ATCB 2V2KA 1S1VA 4AYBD 3MEEA 3LA0A 3CJKB 3GIJA 3EE3A 1FEHA 2FGOA 1UWBB 3H7HB 1EAYC 4UUWA 4DX5A 3R5JB 4OX9J 3Q8YA 1IBKJ 2B8PA 3D0HE 3ZTRA 4X4PA 4EWTA 3IBWA 2OHDA 5BR8F 2B4PA 2CJAA 2E29A 2I5JB 3SEOA 3GJQB 1HR0J 3EDRB 4AE5A 2OSQA 3WHIA 2HHSA 3IWNC 5KOWA 1NK6A 2N82B 2MLXA 3EMTA 1QSYA 1CJTA 2HHXA 3DLEB 2ROGA 1Y9OA 2J0WA 1DHMA 5HAOA 5B0EA 3ISND 3ELHA 2R8IA 1R8CA 4ZVHA 4PXDA 3C16B 1RWNB 1WD6A 3TAQA 2AKWB 2CPZA 2ZKUA 3OD2A 4DSIA 4E0DA 3V4IA 3CCMS 5HN0A 3UCUP 4N76A 4H4KC 2ZWPA 4K0KF 4DV0F 1N36F 3L7UA 4CLTA 4PG8A 3IM8A 1W7WA 1U1MA 1YIJS 2VU5A 3OV7A 4TKTA 2GMHA 3ZZPA 4FYYB 2VV5A 4ZVRB 2YKPA 2BV3A 4B9LA 1J5OA 3KLVA 3RBDA 3RAXA 2DR7A 4CP5A 4NX9A 2VQFF 2GO9A 3IBFB 5IXUA 5I42A 2HQ3A 2FHOB 2B4OA 1RB0A 2YX1A 1P1LA 4I2PA 2F63A 2DGUA 2QMWA 3V81A 1VBXA 3K5NA 5EUHA 4B3RJ 5C2CA 4ZMMA 3I56S 5E33A 1AUSL 5HLFA 1CS4B 5DDOC 4C7QA 2R7RA 4DV2F 3Q89A 1OMSA 2XNQA 2V4RA 1X9WA 1V3ZA 4QQBA 2RRAA 1Z2ZA 5HJXA 2BJ8A 3NL0A 4PABA 1HQUA 4CLSA 1VOMA 8ATCB 1B70B 5EGYA 3AJ1A 1A0OB 3EZOA 2NREA 4CLFA 4WKRA 2KG0A 5FJ4A 4N41A 1FK9A 1FFWB 3W65A 4LF8J 4HYKA 2WVDA 4YY3J 2KT2A 4KGXB 3NMAA 2E44A 1VQ6S 2NPFA 3OT9A 2VBZA 3M8PB 2OKQA 1H38A 5K8MA 1N5SA 4RW9A 1Y5IB 1KVKA 4O4GB 3B54A 3I82A 1QSLA 4ZJLA 1VISA 3Q0AA 2L9NA 2RDDA 2EBGA 2UUWA 2GW8A 1N5QA 2X1AA 3BO2A 4RWXA 4JV2A 4X66J 2V8GA 1TUVA 1VIOA 4IFYB 1D9FA 2ZKTA 1GMWA 4IH6A 5KFZA 4FPIA 3V2UC 2BA9A 1VMBA 3GFYA 3G9CA 3MOJB 4WU3A 1U8WA 2DRDA 4UOHA 2HKEA 1HLWA 3MEGA 5ETOA 3MR5A 4IRCA 1W2IA 3MEDA 5IOLA 1F9EB 3H2UB 3CB4A 2KDOA 1D9DA 4TU8A 3PJWA 3IRWP 3D67A 2EK1A 3AD7C 3I31A 3MGJA 1UW4A 2N7CA 3M8QA 1U4BA 2JVRA 3HSZA 5EWEA 4LF9J 2RRBA 4EZ6A 2KZMA 1S72S 1HKAA 4DV4J 1F2GA 5F9LA 1MWQA 3UVJB 4ED3A 4R5PA 3DRYA 4K4XA 1NPKA 1E6VA 1XN9A 1NMEB 4ECYA 3M6VA 1L3UA 4H54A 3UW1A 4OX8A 1KC8T 3R5CA 1U0HA 2QRRA 2DNKA 4GKJF 4JI5F 2HGLA 2EG1A 4WTOB 3FQKA 4ZVEA 3WQPA 2VFUA 2D74B 4PXEA 5DQIA 3QMQA 3OVSA 1HW9A 4USVA 3EDQB 4DL2A 2LQ8A 3MM5B 3D66A 2LXFA 1KQFB 5KG0A 4WFAQ 3R6GB 4AL6A 1YZ7A 4ZPDA 2YKAA 2C28A 1TKTA 2FIUA 3DKDA 1N48A 2K8GA 2EFNA 1SC3B 2Z2ZA 5E5NA 5EX0A 1WC4A 4R5PB 4DZ6A 3KMSA 3PX6A 1CBKA 2LEAA 3H2VE 4U96A 3ENQA 1VRUB 2G0JA 2YTCA 4J9VA 1LWXA 3HZEA 1AXQA 2ZHAA 2BRLA 3RW7A 1YX2A 1JB0C 3JB9k 1NJIT 4DN0A 1Q4RA 2OH2A 2M5YA 2VHGA 1HFEL 3BR8A 3P49B 1UEUA 2ZEJA 1HD1A 3RAQA 3EXYA 4ZVUB 2G1HA 5KT3A 4AT1B 1EP4B 2H1YA 1DBDA 1JLBB 2DPIA 1L3KA 4TVAB 1IBMJ 3M8RA 2Z2LA 1N33J 1ZOTA 2XY6A 2C3UA 2W01A 4S0MA 3KG0A 2CNOB 2QLXA 1W25A 3US5A 4Z7YA 4Q0BB 3T6JA 4ECSA 4CWBA 1RAEB 2C2OB 2GGPA 4ZP6A 1QM9A 2J6UA 3IN5A 1YRUA 1VJQA 3JTNA 4M5KA 3NCRA 5A2QU 3MEKA 2BOAA 2SXLA 5F8LA 2ZZMA 2D41A 1ZM3A 5IV4A 1FF2A 2RQKA 5A2QY 3PJXA 5CXTA 1U48A 4B17A 4DL6A 1UWAA 4P75A 1CJKA 2VB6A 5F3ZA 5BR8J 4RUBA 2P2CB 3N0VA 3MPVA 2EFVA 2IRXA 2Y1LB 2F4VF 5KFQA 2G0IA 1U1KA 1KLNA 3OSPA 2R7QA 5ETPA 1HQ2A 3UQSA 3BYRA 5IZHA 4N56A 4DR5F 2KVIA 2HG4A 3QSIA 4LBPA 3T6BA 4LRBA 2XZWA 3EWGA 4ELVA 1DQAA 1B4SA 2DR6A 3VV2B 4MK7A 4U95A 1VR6A 2CIMA 3RB6A 1GT8A 2MKYA 1Y00A 3WIVA 2ZH2A 4O44A 1DURA 4KHRA 4HHUA 4K0KJ 4DV0J 1N36J 2XY5A 2V5HG 1X5SA 3NWGA 1S4EA 2AZ3A 4YEAA 3RAMA 3EPGA 1SKSA 4OI0A 4FXDA 3HHLB 1HBUA 1Y4ZB 4A8SA 4WU2A 1ZAXA 5HP1A 2WCXA 2BE7D 3OVAA 5HI7A 3Q8PB 1BD6A 1HNXF 2V2QA 4RU2A 3WDOA 4TYBA 1R43A 2VQFJ 2DJWA 2HWTA 4FYWB 1OQ3A 2J8SA 4E98A 4C9DA 5KFDA 2PMWA 3HHDA 4HI2A 1RWWB 2MQLA 3CJQA 2A18A 5EDWA 4M5DA 1KHVA 2MEWA 3GILA 4RNNA 3M2RB 1URNA 4ZCLA 4WFZA 1M90T 3RB3A 3VQSA 4DX6A 4DV2J 4MH8A 4UT4A 2EI5A 4LF6F 3M7VA 2AT1B 3AODA 3CDAA 1XNRF 1LW2B 2C2EA 1NU4A 3OXLA 4Y0FA 5G4DA 1NK8A 3QGIA 2ZH5A 3DOLA 2BW2A 1KVIA 1P27B 3HPOA 3FEZA 3OL8A 3T9ZA 2CPJA 3QLHA 3KDNA 2UZAA 4DV5F 3LP1A 4CYUB 3MUTP 3EZUA 4WE1A 3TRGA 4YS2A 2HFNA 1REVA 2QG9B 1TTHB 1RT4B 4GC7A 4MIWA 3IRXA 4DWIA 5F8IA 4NRUA 3L95X 2FTRA 3CVKA 4NYZA 1YBUA 2X1BA 5DDRC 3BH7B 3F44A 2HLTA 1U25A 2MZJA 4BC7A 3AXMA 1K0VA 1RWXB 1IJFB 4PXBA 4W98A 2VJVA 2LCWA 4U8VA 1NK0A 2CG4A 4L76A 4ZVTB 2AP6A 3RB0A 3DOLB 1RT1B 3R5GA 3OFGA 3HXMA 4KE5A 2J9DE 2NXJA 1IM6A 3GCWP 2C3YA 2HFOA 4K5RA 5F8MA 2KM8C 2BKOA 3TVYA 4AL5A 1YK9A 2YH1A 5D15A 4C8KA 2QMXA 2JZ5A 2NZCA 5C25A 2FVCA 1TKZB 3NGRA 2ZH4A 1VBKA 1HBMB 4ZVSB 3RBEA 3FMBA 1UETA 4KFBB 3QPIA 4OZ0A 4WFNQ 2BW7A 2DT9A 4Q44A 2AJ2A 2OJ3A 1APSA 2YX4A 5BYQA 2Y9HA 3LF0A 1RHRB 3GB0A 1RACB 4ED6A 4G1QA 3U1LA 4ICLB 3BPDA 3W9HA 1XTZA 4KRWA 4DU7A 3NGTA 2JEIA 4N77A 4OZ2A 2DXFA 3GJSB 3I0SB 1YZ6A 4IO1A 3H25A 1NSKL 4FVCA 3RRKA 2F65A 4LBIA 2CYYA 1Q78A 4XIUA 1VQMS 2VASA 4HHHA 3DM2A 1NBEB 3FBFA 4GVLA 4CLZA 1KOHA 3CC4S 2YKNA 2QA2A 4GKJJ 4JI5J 4RW8A 4P6QA 3GR0A 3UD4P 4J9KA 4ANEA 1TZ0A 2ZJRQ 3CCQS 1CQNA 2V8PA 1GX6A 1KSPA 3CJ8A 5F8NA 1R31A 2AWZA 1AW0A 4DR1F 2LEPA 3HHNB 4OYIA 2J9CA 1NKEA 3M9NB 4FYXB 1TK8A 3HHEA 2A1BA 5DGAA 4LF7F 4PRFA 4KY3A 4M5GA 1YTYA 3CJ2A 3V6KA 1FI4A 2YNGB 1HWKA 5A6WA 3W60A 3DC2A 2Z58B 3EUNA 4RNHA 2KYXA 1FXLA 3UDVA 5DZ7A 4QIVA 1TMJA 4RW8B 2VG6A 3K89A 4NI2B 2HVHA 1WEYA 5DLGA 1XWLA 4RJVA 1ULRA 3MR7A 2BX6A 5AE3A 1HHSA 4CO3A 3H2LA 1UTAA 1RSCA 1NHVA 3T5HA 3R2CJ 5CD4H 3RBZA 3TEHB 1FT8A 3CDWA 3DXBA 4HH1A 2MSSA 5F41A 4ZJQA 2ZVIA 3IWXA 5GVQA 2NSCA 2LECA 5G0RB 2FJAB 1F5CA 2XLJA 1FHTA 1WI6A 2Q3PA 4FVMA 2ZOGA 5B0GA 2J9DA 2HWIA 1RTJB 2FHKA 1TAUA 2CQBA 1JJCB 1CVJA 1TL1B 4NXNF 5CZXA 2M70A 4LF4F 1FDNA 4I2QA 1KBRA 5KFBA 2COLA 4ZP7A 4DF8A 2MQNA 3G8SA 1HNZF 1Y0HA 1ZZNA 1VQYA 2PEBA 2XMUA 4DEZA 1MLAA 3N5BA 2HZVA 3BREA 2JC0A 1MROA 4M63A 5CYMA 3UNYA 2F4VJ 2R2SA 4W90B 2XYHB 1JQGA 4F0HA 1H6KX 1QE1A 2RQ4A 1FNOA 1V3SA 4DR5J 1X5PA 3MUMP 3RRGA 3FFIA 5F9NA 2GJFA 3DRPB 5KFVA 1C0TB 2BE2B 4OI6A 2B4UA 4LRFA 3D3BJ 4PZVA 3LGMA 5IFMA 3PEHA 2ZD1A 1ZTTA 1Q95G 5KFKA 5K8NA 5GMKa 3A3NB 2RH3A 4L3NA 4ED0A 2K06A 2F9JA 4KB7A 2K1RA 4IUFA 1FRXA 1MROB 2WONA 5CYMB 1R8HA 4MFBB 2NPIA 2DGTA 2I0XA 5BYRA 1QE1B 3D9BA 1QDUB 2E1PA 2ZUAA 1PBUA 1S9EB 2AZ1A 5HMWA 1WACA 2ZBCA 4PWDB 3OXGA 2C2NA 4OI1A 3MCOA 1AZSA 4DZDA 5DO2A 1HNXJ 2E7XA 3CJSA 1N5VA 4D3GA 1U8SA 1EARA 3IG1A 2XO6A 5KFPA 2BZ2A 3GJTB 5CQGA 3M4XA 1VQOS 3NOCA 2HIQA 3IR7B 3CUNA 1R0CB 4DPUA 2FY1A 3CD5A 2W9CB 3M2UB 3FZBA 3W3SA 1EKRA 1Q86T 1NKBA 1FFGB 2OUGA 1MU2A 2E7VA 1FD8A 2WONB 4FYDA 1YJ9S 2N4DA 3SSSA 1S6PB 4C0OC 2DISA 2HRYA 2HHQA 4Q5VA 2XWXA 1NK7A 3MPDA 3V5RA 4LF6J 3AQPA 3G82A 1SL1A 4J9SA 4ED5A 2WK4A 2YNFA 4F26A 4USMA 2Y1JA 7AT1B 2XYGB 1SB6A 1AZSB 3MPYA 1XNRJ 1MW7A 2ASDA 4WK3A 4YP3A 4LF5F 5DQHA 2FB0A 1GXUA 4M8LA 4A46A 3KG4A 1VS3A 4NLOA 2LFVA 3IG1B 1VDHA 1FRLA 4EFAC 4RUCA 1NJXA 4DV5J 4TQSA 2CVIA 3QQCD 1U45A 2GZOA 4EBEA 2E5GA 1HWIA 5J2QB 3ZC4A 2N3LA 1S9GA 1FNMA 3A4TA 3W9JA 4O3QA 5DM6Q 1ELOA 1S59A 4P9SA 4Q45A 3NNHA 2D9PA 2A2DA 4H4KA 2H5IB 2DCUB 3JYTB 2PC6A 2FJDB 1MWZA 2RMLA 5DZ6A 2ZBIA 4GKKJ 2CQDA 3Q2SC 3QRQA 2VFSA 5AXLA 2E9TA 3ULHA 1NRKA 4RNMA 3O1LA 2H9ZA 3DGVA 2NLWA 2EK6A 2KXNB 4H4OA 1IKWB 4M1KA 3ZZOA 1MN7A 3I55S 4FN5A 3IC1A 4J9UE 3JSBA 1FKOA 2QLBB 5KG7A 5F0UA 2XCPA 3KUGA 4C0BA 2R9LA 3QYYA 4LRAA 1FWKA 2Q6CA 3C6UB 5T7LB 1S79A 2R7XA 2IM0A 1YKWA 1SC4B 5DDQC 3HFKA 2NSBA 3DRRB 3P5BP 1RKJA 3LPYA 3N6NA 2CNKB 2KKHA 1RLDA 2AYEA 5KOXA 4DLEA 1Y3JA 3AH6A 4XDCA 1WHVA 1OYEA 3BV8A 1IR2A 4KT0C 5THWA 4USWA 1HWLA 1KONA 2C2RA 5GAHI 2R7WA 1XIQA 4E2FB 2G2OA 1FEEA 2C3PA 1TVRB 3ZNJ1 2DGSA 1FJ7A 2IHR1 4K4UA 1RT7A 4IDKA 1JIHA 2K3KA 2HNDA 4IG0B 2DH8A 4U7UK 4DSFA 5HK4A 3NGUA 5E3PA 3UNGC 3JQJA 2C2MB 5CYQA 3GYXB 4AD6A 3C3LA 1Q53A 2HRUA 4AFFA 1YJVA 2IM3A 3PHEA 4CCHA 3K5PA 2HWHA 4DCJB 1JMTA 4KIAA 3KUHA 5CZVA 2DGWA 1U49A 3KOAA 3DI6A 3R5DA 4J90A 4DR1J 3MM8B 2D7SA 3TZXA 3QAUA 1RT7B 2PA3A 2OTJS 3CE8A 3T5LA 4A8YA 3R9LA 4LF7J 1MWYA 2O01C 3KJVA 1FXDA 3M6XA 1N5YA 3D68A 1IQTA 3D28A 1H2VZ 3MF5A 4GO5X 2CQIA 3H0PA 5HATA 1LFPA 4PYAA 4PR6A 3R7NB 5KFCA 2RHQB 3CD7A 3ZO7A 3G6VA 4ZPBA 2NUHA 1WG5A 3CO0P 2UV8A 3DLGB 1M1HA 1MMLA 4PG7A 3V4MA 3LALA 2RKIA 3QNWB 4BDPA 3RBXA 1FERA 3VQTA 4ED8A 4DG1A 2CJXB 1WEXA 2FLLA 1X4AA 3MM6A 3FDSA 4UOFA 3JAMU 3ZXWA 3LAMA 1TV6B 3LTOA 3DU6A 3S01A 5EWGA 3K5OA 2VC1A 4DS5A 3S7RA 3JAMY 1LW0B 2LEBA 5DDPC 1BHNA 4QCLA 1DQ8A 2WBRA 2FDNA 4JV0A 3DMJA 4NXNJ 2D3UA 3T41A 4LF4J 4CLPA 1RTHB 4ID8A 3AOCA 1SJFA 3KK3A 1O6XA 1FWPA 3I96A 5DS7A 2R7SA 2BEFA 4C11B 3FVYA 1HNZJ 1U02A 4ZVPB 4ID5A 2HLUA 4JI8F 2RHSB 4ECVA 4DN9A 3RB4A 3I87A 1RTIA 3S6EA 1RKIA 1X8DA 1RJJA 1RA7A 1S12A 1X4BA 2KYZA 3SQGB 2B7CB 4F67A 2JX2A 1QLNA 3UDEA 3KHRA 1J27A 2KHCA 2MSTA 1YJ7A 3DMJB 2OPPA 3SDEA 4ELUA 5L1JA 3L7OA 2QZ8A 2ZOFA 5IT0A 4KV8B 3CCRS 2LQ9A 4Q2MA 1SV5B 2QFIA 3TVKA 4QWEA 1FESA 2VC0A 3CCES 4FF2A 5KFFA 2DNQA 3G6YA 1N8RT 2R2RA 2V63A 4USJC 1T03A 3DLLQ 4K4WA 3DOMB 4UZCA 3ZTPA 2HZAA 1QUPA 4ALZA 2XSJA 4OZNA 4LVOP 1T95A 3GFHA 1KRPA 3MMAA 3P8BB 3A8JA 2PI4A 3GLJA 2AGQA 1R3NA 4GC6A 4BBYA 3RJMB 5C24A 4CO0A 2E1MC 4F4KA 4F02A 4OYWA 3J81U 4BS2A 2OPSA 4Y65A 4B02A 2KL8A 1T9VA 3Q22A 3J81Y 3V6JA 2D3OR 4NEYA 1H7XA 5KG5A 2KTQA 1S1WA 2XHCA 1DTTA 4DUZF 3JSRA 4FP9A 1IJEB 4ZITA 4J9NA 2J6TA 2OMLA 4CI0B 5T41A 2YNHA 2NS1B 2LDIA 3MMAB 3DHXA 1U7LA 3WBZA 1IN0A 2DHAA 3VZHA 2KH9A 2ALZA 4TU7A 1NO8A 4LF5J 4ZIVA 4JV5F 3TOQA 1C1BB 2QYCA 3NGDA 4DL7A 3C14B 4NCGA 4YR3A 3PHTA 4V19J 1LWCA 4LQ9A 3FCWA 1BQMA 3QT7A 3CPWR 1D9AA 2Y3YA 2ZDOA 1SUQA 3GU0A 2QFJA 4DSJA 1DLOB 5D4NA 3NCPA 4BWJA 4ILMA 2CPDA 2F9DA 1U24A 4OHZA 5D3GB 4K4ZA 4X4TA 4DJBA 2KN4A 1PC4A 1Y11A 3J7AN 3M2VB 4NLVA 2XMVA 2FPHX 1KD1T 5KFEA 2QA1A 2W24A 3MM9B 4B3MF 4ZVQB 1HARA 5KFSA 2R7TA 2PO4A 2XG8A 3AQOA 2R8KA 1SH0A 4U7UD 2GVZA 3E8OA 2XMAA 2ZITA 2V69A 3EJMA 1FJEB 1JLGA 1BQMB 3QRPA 2AU0A 2Y1IA 4KTQA 2LQBA 2VFTA 1VQLS 1LWEB 4CZCA 4FNIA 2VICA 2CPYA 3D0GE 4DFMA 5DJBA 2FVQA 1QAYA 5CYJA 1AA1B 4QIFA 3R2DJ 2JLFA 2WRMA 5DG7A 1T9YA 1T02A 1UA0A 2IJRA 2GVZB 3DN9A 2RT3A 2A6MA 3QT8A 1T3OA 2HIYA 2GA7A 1X7VA 4XDDA 2NQPA 4URQU 2CPXA 4CLYA 2B9WA 3X3UA 2VDHA 1A9NB 1WC6A 2V9KA 2GCFA 2PA8D 3BSCA 2NUUG 3A8KA 3LH2S 5D4LA 3HD2A 2DITA 2M8HA 1LWFB 3ZZUA 2W9BA 1WG1A 3NS5A 4EYIB 2ZZTA 3K58A 4OI4A 4ES2A 4HL9A 3H5SA 5DLFA 4DPWA 4N8OA 4YQWA 1IR1A 3QWUA 2CNLB 2IBKA 3RU0A 4LSNA 1URRA 4JI3F 2JRSA 4CNYA 1AT1B 5ETQA 1J2VA 4J9OA 2XHWA 4DR6F 3HP6A 3RTVA 3TUPA 1NKCA 2UP1A 4N8NA 4F3MA 2IC3A 4F4ZA 5L39A 4O4RA 4RLEA 3J80U 1H3DA 1RHJB 2CQCA 4ZN1A 4I56A 5L1KA 5DG9A 1KS2A 2KFZA 3J80Y 1NHKL 2C3OA 1IKXA 3P4UB 1WUUA 4UOCA 4FF3A 3VCDA 4Y2MA 4KO0A 4CIOA 3PYDA 4YOEA 1FDBA 1JLCA 4ZLPA 3PTWA 4B9MA 2K7JA 4PG4A 4RW6B 3ETMA 5KFJA 5LJ3Y 4ETZA 4C2MA 3BKFA 4QU6A 3D54A 2IC3B 1WDTA 1NUEA 4OHYA 4X4QA 3TNVA 3R7SB 2IMOA 5HROB 3OL6A 3HFVA 2WW4A 1RYSA 3VAGA 1AUDA 1SJ1A 2P9CA 1PAEX 1ZA1B 1SI9A 1VRQC 5GAEI 3TX8A 3PRVA 3W2VA 3IM9A 4KO0B 2AHOB 4X4OA 1S1XA 3HHKA 2VH7A 1JLCB 3ENWA 4X4RA 3IGVA 4JI2F 1BXNA 3ETOA 3RUBL 2O1PA 3MR6A 5IM0B 2E9ZA 3JTPA 3QSYB 2FYXA 4JI8J 2J9EA 3KK1B 4KAIA 3QAEA 3I5BA 1H2UX 3ISNC 2GFFA 3CT9A 1F2HA 3LWMA 1VQ7S 3KMQA 1LFWA 1SC1B 2R2TA 1JLAA 1NK5A 2NR0A 5F8HA 1FVSA 3KLHA 3KLGA 2B6AB 5ETTA 4DPOA 1MN9A 2FJEB 2HVEA 2VBXA 3ZTQA 1QD1A 1TQLA 3UN2A 2IYIA 5GMEA 1X4CA 4EZ9A 1QVFR 4P71A 4E8UA 1UCNA 3KLFB 5LJ5Y 1JKHB 4HTIA 4ZCKA 1O5JA 3GV7B 2FVRA 5K14B 2WTFA 2QTWA 3VR1A 5E2QA 1JLEA 1C4CA 4B9NA 2ZE2A 2EC2A 4IOBA 4NXMF 5B08A 1DZ5A 2NYIA 1W26A 2ZJPQ 4DR2F 4DFPA 1JJ2R 4A48A 4OV6A 3AD9C 2DKOB 1R8AA 4J9PA 3FCVA 1VI7A 2M9KA 3SZ2A 5L9NA 1PAUB 4OYPA 4R8UA 5D0HA 3L7PA 2MQMA 5I3UB 4P2SA 2ACYA 1XEZA 1RP5A 4QOTA 1RAIB 4U67Q 3LQVA 3AA8A 1C2PA 5RUBA 4KGKA 3NWRA 1YWXA 2CZ4A 2NZ4A 4UQTA 2ZH8A 4NLGA 3FC9A 3H5UA 3FBEA 2X3DA 4PUOB 2NXEA 4TYAA 2HSEB 2HHVA 2ILYA 4CH7A 1O8BA 4DUZJ 1BUXA 3H5XA 4P2XA 3H90A 4C8OA 2PEHA 2V8DA 2OD4A 3OUYB 3KLEB 3O3LA 2MJNA 2HMIA 4X84A 4C3LA 3PDNA 3HSGA 2ATLA 2AEMA 3P45B 3M1VA 1F1BB 2BE9B 3HO1A 4ED2A 1RT5B 5IQQA 4F50A 2HRTA 1QY7A 1SH3A 1VGYA 1ZZFA 5DETA 1U2CA 1YI2S 3KK2A 2BANA 3T9NA 4NA2A 4J7CA 1KFSA 2O5DA 3VVTA 3O6QA 4HACB 3C15A 2ASLA 2I2YA 5LSLA 2W7OA 3BYPA 3OVBA 1UPMB 4PWWA 1FKAF 3VAKA 3UFCX 2GC8A 3KLIB 4WIQA 3OLBA 2XCAA 3QATA 5B0DA 2HMIB 4MTPA 4ECXA 3V6HA 4B3MJ 1YHQS 2CQHA 4UZBA 3SQOP 1YRTA 1TFYA 4DQQA 4JBCA 4BHQA 1VCTA 1T94A 1CJVB 4BWMA 5HMZA 3BGOP 3UD5A 4WP8A 3KK2B 3HKZD 1YJRA 4HT7A 4Q43A 3SCKE 3BPSP 4NLTA 2IRUA 4IR1A 1BQNA 4FF4A 5KT6A 4K4YA 4F0KA 1F5BA 2DNLA 2WZ1A 1N32F 1UA1A 1X5TA 2MKCA 1T9UA 5B0AA 4OLPA 5KT2A 2IAJB 3MAAB 5H9EJ 4KGVB 3W9IA 2FLPA 4BC9A 2HGNA 3NOGA 1F5AA 3W2WA 3BSNA 1FJGJ 2LVWA 2VBYA 4AL7A 4F4YA 2E1RA 2MPUA 2XMJA 4OLOA 2YQ0A 1X4FA 2AJ1A 3NS6A 4NOHA 1BQNB 2W4CA 2CQGA 3DCAA 2GHPA 2N4CA 1X4HA 1GEHA 4KQZA 1EJ7L 2GIFA 2DR5A 2VG7A 3QFHA 2H5EA 3MWBA 1XR6A 3Q86A 1CLFA 2EEYA 4CDIA 3IBCB 3W2WB 2FUG9 1K9MT 1PKUA 1TL3B 5AXNA 4G6VB 5EX3A 1HMVB 5HVHA 4DQIA 4KPCA 1S77D 2LU2A 1FJCA 1M5SA 2MZRA 3DOKB 3PW5A 1UVLA 3EGNA 3OFHA 1UMJA 2RQCA 4JI3J 5LSRA 2JOQA 3U1MA 2Q1LA 2VUGA 1A7GE 5J2NA 3KHGA 4DV6F 5HQMA 4DR6J 2VPZB 4ZKAA 4GVBB 4O3RA 2HS4A 2CADA 3ITHA 3G6ES 2YNIA 2VPWB 3BJYA 1HYSA 2FQQB 4Y2AA 2FHMA 2QE5A 1RAJA 1JLQA 3M30A 3H59A 2HVDA 2WOMA 1RCOB 2B8QA 2ZVSA 4WYWA 2OEMA 2DNMA 5GADI 2HHPA 1U6ZA 1RT2B 4TY8B 3R8YA 1E6YB 1PYOB 3IWLA 3DDIA 2DH7A 3C46A 2LU1A 3CJKA 3CEDA 2HQFA 4IYQA 3PXGa 4K7QA 3CJ3A 2DNRA 3JQKA 2V4QA 2HAIA 3FSYA 1RQ0A 4ZJOA 4ERDA 5GAGU 1NSAA 3OTOJ 3M30B 1VK8A 2XM3A 1R6YA 2HFZA 2GAGC 4NRTA 5LXYA 4ITSA 2I5JA 4QJVA 1VQ8S 3BKTA 1QTNB 3Q24A 3PFEA 2BVZA 2MQ8A 3PY8A 1L3SA 2GX8A 3DRSA 3QZ8A 1OS5A 3W8GA 1TUWA 3HFZB 4JI2J 3DLEA 1Q8KA 3UD3P 1N56A 5C5JA 3D3CJ 2ZOMA 2CWKA 3PNIA 4OHWA 4P7TA 2GIRA 1RBLA 3C16A 1JNRB 5E3AA 2O67A 2FJXA 1SQFA 2QSWA 4HH0A 2QX0A 2YH0A 2DYAA 3EX7B 3VAIA 1P6TA 2KHDA 4WYLA 3C6TB 4MYTA 2MHEA 2DTJA 1NJYA 4DCPB 3RR7A 1P9QC 3GPAA 3DRSB 5BYSA 2DRBA 1Y10A 4ES3A 1PBAA 2QJ3A 2OFGX 4TLQA 1M5OC 2BM1A 5EWFA 2A3JA 1X9SA 3HF5A 3NAHA 2DY1A 3CSKA 4NXMJ 3L4BC 1WG4A 1HPZB 4DR2J 2DNPA 2PN6A 1GTHA 4WXWA 2UUAF 4XTTA 3T19A 2HQCA 5J1PA 5IQ6A 4UUXA 2CJYB 1CS4A 2L3MA 2V9WA 2EKNA 4RW4A 1QJHA 4A8QA 2IVMA 2Z4PA 3M32A 4ED7A 3QGPA 3ZTSA 2HAFA 1T3NA 2CQ0A 2CJKA 2X7IA 4IG3B 2HNYB 1BQXA 3BS9A 3PRBA 5H9EK 2R8HA 4M5NA 2MB0B 4PPZA 1B7FA 4NLRA 3KG1A 1HNVB 3NBPB 2MXYA 3CCTA 3TO8A 1LV5A 2ZH1A 3DLKB 2VIHA 2M88A 2LA6A 1WF0A 3M8PA 4RW4B 3E3XA 1ZBTA 2JSXA 2FHJD 3QGHA 3M32B 3KXDA 4MMOA 2CQ3A 4O4GA 4C8NA 2RE1A 2WVCA 2Z2YB 4L73A 3FKBA 2JFKA 3PVXA 3ENAA 1VYAA 3PW2A 4F25A 2CQ1A 2MLZA 1HWJA 4PXCA 2QT7A 1X5OA 3CNQP 4O3OA 1Q5VA 2HYIB 4IFYA 2XULA 3NP5A 1KLMB 1WI8A 1UFLA 1Z4UA 3RYLA 4I6YA 1V5IB 1U1RA 2H4WB 3CDBA 2WVEA 2WW8A 4WFYA 3HVRA 4K2XA 3MMJA 4MKBA 4J5OA 2DR9A 2JDJA 1Y7PA 1BE4A 3MURP 4KKOB 5BXIA 2B51A 3MHYA 2ZC4A 1R0AA 4DL4A 1PCAA 5LMNF 4H4MB 3MXHP 4DU8A 4L72B 3M8SA 4XPEA 4I6WA 3T5KA 3R5BA 4F8RA 4OL8A 3NRBA 1SKWA 3A1YG 2WHOA 3FEXB 3OR2B 1Q0NA 1U09A 1N32J 3TI0A 3AXKA 5HL7Q 4N47A 2PD1A 3GG0A 3O2IA 1WEZA 1S76D 3MFHA 3UVJA 2RSQA 1RHKB 1VC6A 1KTQA 5KG4A 4ZHRB 2XC9A 4L75A 3KJNB 2OIHA 1R0AB 3W8PA 2C22A 2RQMA 3TUZC 4KPYA 1X9MA 3HZGA 1FO1A 1X31C 3BZQA 5A8KB 1JXLA 1CEZA 3J7A1 4F04B 1AB8A 3BGRB 3V6DA 1RT3A 4KJIA 5C2GA 4DLGA 2DIVA 2J0QD 1JNZB 3MM5A 2DGOA 3P5TL 4ZCMA 4DOZA 4LFCF 4Q8FA 2WSFC 3C19A 1HBOB 3OTBA 3TQ1A 2UUTA 4C8YA 2BMBA 2ADBA 4P2MA 1CJUB 4JP8A 4OQJA 3HKWA 4KC5A 4DSLA 1XQIA 2R2UA 2RF2B 1VRUA 2RDIA 5HMXA 2EWHA 3X1LB 3THTA 1NH7A 2PI5A 3QJLA 1Q7YT 1ACMB 1DFDA 1WC5A 3V6DB 1RT3B 3J7YI 2RU9A 4Y2KA 4K4SA 3H8YA 2MMYA 2AYMA 1U1OA 3WX8A 1HQEB 1U2FA 1GTEA 1ICEB 3PR4A 4I7FB 4M95A 1F9HA 4DV6J 3PM9A 2RIJA 4OJ3A 1TL5A 2VF3A 3RR8A 3EPIA 2IA0A 1EP4A 2E9RX 4NLUA 2MKKA 3BN4A 3F41A 1JLBA 4EK2A 3SXLA 3GQCA 2XLIA 2DIUA 1I94F 2BM0A 1TL4A 2KI2A 4ZVGA 1H98A 2OPRB 1GQEA 1I51B 2DNGA 2W2QP 1Q81T 4Q0BA 4NLPA 3ADAC 1NK4A 3UPFA 3QRRA 4A8MP 2YPYA 3BBCA 4USUA 4FXWA 3CF5Q 3TUJC 3TUIC 1JLFB 4CTAA 3MOZA 1TP7A 1JK9B 2VG5A 4NLXA 1N52B 4DUYF 5F8JA 1TR0A 1KEKA 4B9SA 3U02A 1FX2A 2KXFA 3ILIA 3AA9A 3E2EA 1WSVA 2E1AA 2CA9A 1H73A 1KFDA 2EPIA 2HK3A 4OI2A 5ETSA 3JSMB 2CNNB 4QU7A 3IGNA 1PJ7A 4OHVA 1WOOA 4TY9A 2HNZA 3BKUA 1NDCA 4CTAB 3D0IE 3BBBA 4NL5A 3MR2A 3PX4A 2VG5B 3O8WA 4Y3CA 5L1LA 5CH7B 3AJDA 5KFWA 3VAMA 3U7JA 2P5VA 2ZC3A 3GSIA 2R7VA 4DR3F 1K47A 1KP6A 3QFWA 3RRHA 2BXJA 1UAWA 1T7PA 1GXTA 2XQCA 1M1KT 4Q2LA 4YUDA 3HVWA 3PZPA 2DRAA 2FVPA 2MKJA 1KN6A 3TZYA 4NMLA 3HHLA 3B8HA 3MZIA 1SVDA 4DHVA 2HNZB 2BDPA 3I4PA 3MR3A 5H9FK 1S1UB 2AQ4A 4I4BA 3EVWA 3HI9A 3IAS9 3CCLS 4Y2CA 3GP9A 1T9WA 2YKMA 3NG8A 5KFYA 5IWAF 1JWWA 4OHXA 3MMBB 4X64F 2EBEA 4LSLA 1HNIA 3DFEA 2UUAJ 3DDKA 3QIPA 3M2RA 4NEZA 2VODA 1TL7B 4LR8A 5LXRA 3L9ZA 1UFKA 2D1CA 1EQ0A 3GZ7A 2HHTA 3FGVA 4MYUA 2AIRB 2J8AA 3IMQJ 3HSJA 4ZPWR 2K7KA 2XMKA 4ANCA 1LW2A 3GIRA 4RO0A 2Q6BA 2ZUGA 2YKMB 4X4NA 2JWNA 2BYCA 1D8YA 5GADU 2AX0A 4RNOA 1S6OA 3Q23A 4LSLB 1HNIB 4CYUA 3AB2B 5A8RB 1Y5LB 2AJ4A 3Q8UA 3QIPB 3FUYA 4YR2A 5HBMB 3M8ZA 1RT4A 5CCMA 2F8EX 2EC0A 1GMWD 4OIXA 1WNEA 5C7PA 5M2RA 3ET6B 1R6VA 4K59A 4V19X 1SCJB 1FNXH 2I9SA 2AMCB 2B5JB 3ICLA 5M2UA 4EMDA 2UVRA 1BMQB 1KKHA 2XTJP 1B99A 3MTJA 4KGZB 1RT1A 4F4XA 3NAIA 1S10A 3A8EA 1SKRA 3PR5B 2WB1D 4F4WA 1S1TB 2C3MA 1HWUA 5FDLB 1NDLA 3TR5A 3G87A 1KQKA 1TKZA 1PYSB 3IS9A 3I9V9 4MIBA 2ZH3A 2CDQA 3GE9A 2CPIA 1HBMA 1SH2A 1S5ZA 2NXUA 5LL6d 4KFBA 1RXOB 4O23A 1IWAA 2HURA 4P74A 3LP0B 3Q2TC 5LMNJ 3UCZP 2R8JA 1OY8A 1RAOA 2QMUB 4ZP8A 2FHJA 1OPIA 2QIFA 1WF2A 3TX0A 3ZZTA 3TAPA 3D6HB 3KKFA 3VGVA 3AFGA 4ICLA 4YR0A 4QWBA 2DNNA 2FLOA 3MECB 1NEEA 1IUJA 2W1BA 3IS9B 2IRYA 4IRDA 4MKYA 3I0SA 2DK2A 3EVOA 3D1OA 3BEGB 3F56A 5JUMA 1U2RA 2YWWA 1D09B 1VRTB 4C8MA 4WBFA 2RVJA 3POTB 2JLGA 2POKA 3M6UA 1VQPS 4ECZA 1T05A 2UXDF 5A76A 2CPHA 2BJ9A 4B08A 5A6PA 4IRKA 2V4JB 1W2BR 1AFJA 1RLCL 5LOQA 2GMLA 1NLKL 4LFCJ 1KQSR 4NMXA 1B7YB 2IIHA 3CCSS 3KJQB 2QC3A 2VFVA 2R3VA 1M1GA 3DYAB 5LMUF 2YNGA 3D1HA 2I1RA 2B43A 2AV5A 5AJ3F 3F0NA 1AYEA 8RUCA 4QR1A 1NH8A 3GYGA 2YX7A 3K8VA 3RZAA 1T05B 3JXOA 3UR3C 2UUBF 3CDUA 1HA1A 4NI2A 2QL9B 1WTBA 1RGVA 3T3FA 1EETB 3NS7B 1U1PA 2LLZA 1XR7A 2ROEA 2VFRA 3CCWA 2V8VA 4IOCQ 1BWEA 1SQGA 3SV3A 2KJVA 3MFIA 1DTQB 4ZOSA 3B78A 2BUNA 2E5HA 4FDFA 2B9YA 5D78A 5C42B 2XY7A 3I6PA 1VIXA 3B6BA 3CMQA 1LK7A 4JI4F 3AD8C 3MM7B 3TAMB 2B7BB 3UWTA 4DR7F 2HBRB 3GWCA 1I94J 5G0RA 5J2MA 4PQUB 3T1HF 1X4DA 2J0SD 1H72C 5SZTA 1RTJA 1BY9A 4ZLJA 1TL1A 1FRKA 2OO4A 3CTRA 2R8GA 3OFEA 5CAAA 4K4VA 1FTRA 4KR0B 1Q8BA 2XGQA 4DUYJ 1NPPA 4RUHA 3SFGA 4W4MA 1TUGB 3EXCX 1TKDA 2W2OP 2CAJA 3FMWA 4DS4A 3MI7X 4B9VA 3A12A 2HBZB 1T8EA 1NB7A 1G3OA 2ACMA 1NK9A 5J2MB 3KWMA 2BR0A 2MDAA 1WC1A 3T5JA 2YKQA 2MGZA 1U1QA 2OELA 3WIUA 3SBMA 5B0FA 2X1GA 3DRPA 1N0UA 2BACA 2BKNA 2ZNZA 1C0TA 1HBNA 5L1IA 3HCXA 2JL9A 4UW2A 2F1FA 4C4WA 1HNWF 2BE2A 1OY6A 3CIMA 2XO7A 1AFIA 4TN2A 2BOPA 4M5HA 6FD1A 3DGPB 3N6LA 1O51A 4BCAA 7FDRA 4DR3J 4NZ0A 2IY5B 2XB2D 4J9MA 4RU9A 4WWSA 4C8ZA 1UJ5A 1S0NA 4MFBA 1S1VB 3CW2C 5CABA 2VL1A 3SSRA 2MGZB 2MTLA 3MEEB 4PG6A 4KBIA 1S9EA 1Z2LA 3W7BA 1WSRA 3K57A 1Q8IA 2DD8S 4PWDA 1T0TV 1WKKA 3AT1B 4RR5A 4D3HA 3D5MA 3VALA 2AGOA 1HBNB 2CQPA 1QUVA 2FY8A 1YRXA 1RA6A 4ENOA 2IM1A 2ATCB 4O3PA 5IWAJ 4P7VA 1K1QA 2W2MP 3OHBA 4Y00A 2VQEF 4X64J 2W9CA 2VONA 3J7YU 3M2UA 2D3O1 2PFDA 2WVBA 3W61A 1NPRA 2F8HA 4GMKA 4OZ1A 4ES1A 1QAIA 1S6PA 3G4SS 2AJFE 1CJTB 2QLWA 5K5MA 4HDGA 2DR8A 3PKYA 1A6LA 2KG1A 1ZAWA 1CSJA 1MG7A 2XYPB 3ILJA 1ROFA 4ER8A 3SSQA 4UOGA 9RUBA 1GMVA 3V4IB 2MHNA 2CWXA 2Z57B 2DCLA 1YDLA 2DEIA 2YWEA 4ZLNA 3I4HX 2V2VA 4XO0A 1K73T 1UJ6A 1MSWD 4C98A 3ZFVA 3GYNA 2IVFB 5J2QA 2BQUA 1LNQA 4CLWA 4OJHA 2OFHX 1RU1A 2ZFHA 3PACA 1S6UA 2OGUA 1NSQA 1J5OB 5DG8A 3JYTA 4CO2A 1XMQF 2N3OA 2HW3A 4HT5A 2C1EB 1DRZA 2N7YA 2HS3A 2J6SA 2PIIA 5I42B 3L3CA 1RBOB 2JJ4D 4MK9A 4I2PB 2WAQD 1U0SA 2YQ1A 7FD1A 3OTEA 3K8WA 3V81B 1IKWA 4LFBF 1WOSA 4R25A 1FTCA 1WELA 3VAJA 3M9MB 4ECRA 2MZ1A 5HLFB 3C6UA 1Y3KA 5T7LA 1N34F 2FVSA 1VQ4S 1NCLA 3FK4A 3DRRA 3E01A 2M8DB 4UY85 1RABB 3K7RA 1R8BA 1QTMA 4K50A 1HQUB 1NXIA 2Y0SD 4LUBA 4ZP9A 3D1QA 4QIEA 3S1TA 3BM7A 1FK9B 1SL0A 1CULA 4ZPVR 3KHHA 3WX4A 4N5SA 3K0JA 5AT1B 2R7UA 4B9TA 4NA1A 2YWFA 2QGFB 1TVRA 4B3TF 4RW9B 2LXIA 3FZ2A 3FEYB 1BLUA 3E01B 2BABA 4IG0A 3CMES 4DPYA 4JOUA 4C3MA 2CPEA 3OL7A 2UXDJ 1CULB 1U6BA 2ZBRA 3QGGA 2EW9A 1ZM2A 4P52A 4OYBA 5GMDA 4QYZJ 2HS0A 2YWHA 2W7PA 3PKMA 3G96A 4EYHB 3ONQA 3Q8SB 1IR0A 3PYGA 3SI8A 3MM8A 5A8WA 1DJ0A 5KTQA 3BGFA 3WC2A 4I6AA 3MEGB 2DGVA 2E66A 5J1EA 1VLOA 3FNNA 3AOBA 3MEDB 2IYGA 5LMUJ 3BQ2A 2IA6A 1FD2A 1R27B 2KT5A 5JVGQ 3ZZYA 4KH0B 5AJ3J 2FC8A 3GFZA 2B56A 4OYMA 1K1SA 4JB8B 2UU9F 3M8QB 2CFXA 3THVA 2DGQA 4DV3F 1Q79A 2Y8YA 2NYHA 2UUBJ 4NLDA 1LEOA 4NPOA 5LM7E 4QWAA 3LO3A 3DLGA 3MCMA 2XWYA 4WIIA 1LQ9A 5A8WB 4C6AA 3TJAA 4A8WA 2RNEA 5J1EB 4C48A 2W2NP 1E6VB 5CHCB 4LRDA 2B9XA 1U0HB 2MKHA 2EKYA 3GV5B 2FZGB 1AROP 5E0OA 5M2PA 3L09A 2E5JA 4JI4J 3OL9A 2OI2A 1FVQA 1TV6A 4DR7J 2P6TA 1GAOA 4IKAA 3PIPQ 3T1HJ 3G86A 4LVNP 1S0OA 1LW0A 1IXKA 3D2WA 2WVFA 1ZH5A 1RCXB 3H98A 3TA1A 1SPBP 1U1LA 2JC1A 3VGSA 1TKTB 4NWBA 4QIWD 2GHVC 3HVTA 4G1IA 2IPOB 4LBHA 1RTHA 3PEJA 5DGBA 1LKZA 2Q79A 2UV8G 4DV7F 4FKXA 4C11A 3G8TA 1RWPB 2A0FB 1YJWS 3W1YC 2J5AA 2IVYA 5KG6A 1FA0A 4FYVB 1RWUA 3Q8VA 1SXLA 1PGZA 2PFFB 3SQGA 3HX9A 2B9EA 2E5LF 3KNAA 5ITHA 1LOUA 3JTOA 2B3TB 4XPCA 1LXNA 3IR5B 3R97A 1D1UA 2Z8QA 1KOOA 2BQ3A 3SCLE 4DF4A 3HVTB 2W25A 3A13A 2VD3A 4KV8A 1VJWA 2JEGA 1F9FA 4AQYF 2DHGA 1HNWJ 1SV5A 2AEJA 4OFZA 2F4FA 2ZWOA 4DBQA 5HVGA 3BSAA 3TARA 3CCJS 3Q8QB 1FDDA 3AOAA 4DDFA 5D4OA 2L08A 1TAQA 1OIAA 3GR1A 3DOMA 3THPA 2Y0BB 2UUCF 4DX8H 4ECTA 2GGPB 3NLCA 3B82A 2ROPA 3UE2A 4ZPTR 1C4AA 2RILA 5U47A 2HGMA 3NKYA 4J9RA 3PV8A 1TU0B 4CQ1A 1ITPA 1IBLF 4OZ5A 2CJQA 3ENVA 3MCNA 3M05A 1S4FA 1JJ4A 4HVZA 4DQSA 3FSIA 1CJKB 4QBUA 4RKUC 3A8IA 1U26A 2IDEA 2VQEJ 3AHPA 2BJDA 4X65F 3TANA 1SJ4P 1HIYA 1RWMB 1D0EA 2IDLA 3HVAA 4KHPF 2XS5A 1OYDA 1NDPA 4CO5A 2OLWA 4KYZA 3EYZA 2PMHA 2MKSA 2GHWA 2FJBB 4FNHA 4UY8T 1Z1ZA 2LP4A 4CT8A 1G1XA 1QAJA 5KG2A 4USIA 4WFBQ 2QA4G 5EHHA 4Y2IA 3JSYA 2DO4A 5KFUA 3K5MA 4O0IA 3HK2A 1C1BA 4O44B 3PCOB 4KH1B 1KNZA 5LSOA 3C14A 4NYOA 1T11A 2OAUA 1OPZA 4YB5A 4NYPA 2CJBA 2AJ0A 1HBUB 2DHXA 4Z7CA 4QYZK 4USTA 2XI2A 1DLOA 1YVFA 1FRJA 1SJRA 1RAFB 5HP1B 5K20B 5D3GA 1FKPA 4OZ3A 2Z30B 3H42A 1GX5A 1XMQJ 3HJFA 2KO1A 2V67A 3C66A 3M2VA 4DI6A 1YG0A 2PMZD 3MM9A 1DQ9A 3BQ1A 4LQ3A 1WHYA 4LFBJ 4M5DB 5KFXA 3TZZA 4ZLLA 3MD1A 1F6TA 2EFOA 4WTYA 1M5HA 2RB7A 3GTYX 2C42A 3G71S 4EBDA 2LDYA 5L8RC 2QV6A 4G65A 4USHA 4JUZA 1N34J 1ZS6A 4GKKF 5KFAA 1FKPB 1LWEA 5KT5A 3VHQA 1F0XA 4RWWA 2F3JA 3O5TB 4P2FA 3MUVP 1HI0P 3ILOA 4Z2XA 1VBYA 1O0PA 4PKDB 2VPXB 3PO4A 3QLHB 5I3PA 1YITS 4U6PA 4L6V3 3LP1B 4WP9A 3QO9A 3P96A 3PRDA 4WE1B 2LQJA 1REVB 5ETKA 3OHAA 2C2ZB 2EXUA 3PG9A 3IRXB 1N0VC 4B3TJ 1NJWA 3UO0A 3R7BB 2CKWA 2GQ2A 3N01A 3MAHA 1UEVA 3SIPB 4J91A 4F36A 2V2ZA 1FFSB 1RU2A 4F2RA 4B3SF 2UVWA 4K8RA 5D8HB 4MJKA 1I1GA 2I38A 3K17A 1LWFA 3QO9B 2IJFA 1Q82T 2MJUA 1N88A 1H74A 4F3QA 1G6BA 1TK0A 3HD1A 5KFNA 1HW8A 2DBBA 3W64A 5C25B 3KYLA 2WSEC 1HI1A 1RZMA 1N4LA 1D3WA 2LMIA 3G8QA 4JI6F 2F40A 4QWCA 3WC0A 2V6AA 2LYVA 2Z2MA 5HSPA 3CJRA 3EGZA 2HQGA 3J81j 2PT0A 4DL3A 2FJVA 2OEKA
chains in the Genus database with same CATH topology
1PAUB 2C2KB 2C2ZB 2HBRB 3D6FB 1GFWB 2XYGB 5IC4B 1QTNB 4ZVQB 4ZVOB 2CJXB 1I3OB 1SC4B 1RHQB 2QL7B 3R7BB 3P4UB 4DCJB 3KJFB 2XYPB 1SC1B 3KJQB 1RWMB 1RHRB 2CNKB 3SIPB 1RWKB 2P2CB 2FQQB 2Y1LB 1NMEB 1RHKB 1QDUB 1RWNB 3D6MB 5IC6B 4ZVUB 1ICEB 1RWWB 1RWXB 2CJYB 3D6HB 3KJNB 2CNNB 2H65B 1RHMB 3GJSB 4ZVTB 2H5JB 1IBCB 3EDQB 3R7SB 2QL9B 2H4WB 1BMQB 3R6GB 2HBZB 2H5IB 1RE1B 2H54B 2CNLB 2H4YB 3GJTB 2XZDB 2XYHB 2Y0BB 3NS7B 1PYOB 2HBYB 2CNOB 3IBCB 4ZVPB 1RWOB 1F9EB 4DCPB 4ZVRB 4JB8B 3R5JB 3R7NB 4DCOB 2C1EB 2C2OB 3R6LB 2XZTB 1SC3B 2H51B 3RJMB 1I51B 1RWPB 3P45B 1RWVB 2H48B 4ZVSB 2HBQB 2QLJB 4LSZB 2QLFB 2QL5B 2QLBB 3IBFB 2DKOB 2C2MB 3GJRB 3QNWB 3GJQB 1RHJB 1RHUB 3EDRB 5K20B 2CDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAU B;  2C2K B;  2C2Z B;  2HBR B;  3D6F B;  1GFW B;  2XYG B;  5IC4 B;  1QTN B;  4ZVQ B;  4ZVO B;  2CJX B;  1I3O B;  1SC4 B;  1RHQ B;  2QL7 B;  3R7B B;  3P4U B;  4DCJ B;  3KJF B;  2XYP B;  1SC1 B;  3KJQ B;  1RWM B;  1RHR B;  2CNK B;  3SIP B;  1RWK B;  2P2C B;  2FQQ B;  2Y1L B;  1NME B;  1RHK B;  1QDU B;  1RWN B;  3D6M B;  5IC6 B;  4ZVU B;  1ICE B;  1RWW B;  1RWX B;  2CJY B;  3D6H B;  3KJN B;  2CNN B;  2H65 B;  1RHM B;  3GJS B;  4ZVT B;  2H5J B;  1IBC B;  3EDQ B;  3R7S B;  2QL9 B;  2H4W B;  1BMQ B;  3R6G B;  2HBZ B;  2H5I B;  1RE1 B;  2H54 B;  2CNL B;  2H4Y B;  3GJT B;  2XZD B;  2XYH B;  2Y0B B;  3NS7 B;  1PYO B;  2HBY B;  2CNO B;  3IBC B;  4ZVP B;  1RWO B;  1F9E B;  4DCP B;  4ZVR B;  4JB8 B;  3R5J B;  3R7N B;  4DCO B;  2C1E B;  2C2O B;  3R6L B;  2XZT B;  1SC3 B;  2H51 B;  3RJM B;  1I51 B;  1RWP B;  3P45 B;  1RWV B;  2H48 B;  4ZVS B;  2HBQ B;  2QLJ B;  4LSZ B;  2QLF B;  2QL5 B;  2QLB B;  3IBF B;  2DKO B;  2C2M B;  3GJR B;  3QNW B;  3GJQ B;  1RHJ B;  1RHU B;  3EDR B;  5K20 B;  2CDR B; 
#chains in the Genus database with same CATH topology
 2XSF A;  1BGX T;  2GJI A;  2C2D A;  1VFJ A;  2UU9 J;  2QYG A;  2VA2 A;  3OTC A;  4DV3 J;  4G1Q B;  5K8O A;  3FSX A;  4LRE A;  4RBU A;  3HMJ G;  2BQR A;  3D4J A;  5IC6 B;  4XK8 C;  2FGC A;  4HEA 9;  5ETL A;  1VC5 A;  2RS8 A;  4RNF A;  3CJT A;  3UN3 A;  3JS9 A;  3Q83 A;  4ZN3 A;  4RW6 A;  2MY7 A;  2W2P P;  3DM2 B;  5D4P A;  4AUK A;  4AXJ A;  1UVI A;  3BQ0 A;  4WF9 Q;  2YKN B;  4EBC A;  4RBV A;  1ZAV A;  3BB5 A;  1DY3 A;  4FXV A;  5MAO A;  5HRO A;  3DLB A;  1TK5 A;  1YSJ A;  1WKL A;  3HHL C;  2KVQ E;  4DCO B;  5L46 A;  2J76 E;  4ZPA A;  1WHW A;  5L9X A;  2CUY A;  4NE9 C;  2MZT A;  5AXM A;  1C1C A;  2P9E A;  3I0R A;  4DV7 J;  1J5E F;  2UXC F;  1H0H B;  1IKY A;  4CRJ A;  1UZH A;  5IM0 A;  3MPU B;  1X0P A;  4XAK A;  1H7W A;  2QL7 B;  3K5L A;  3UN5 A;  3KK1 A;  4CM2 A;  2MLY A;  5EN1 A;  3IAM 9;  1NAQ A;  4CNZ A;  4WXO A;  3LAN A;  4NLW A;  1YBT A;  2VG6 B;  5SUH A;  2B6A A;  2I6W A;  2VZ9 A;  2ZM6 F;  2E5L J;  4YDD B;  2VJU A;  4F0M A;  5HO4 A;  1Y5N B;  2G1D A;  1P9Y A;  5JVH Q;  4P72 A;  1C1C B;  1UPP A;  3CC7 S;  4OX7 A;  2KXH A;  1RE1 B;  4J9L A;  3I0R B;  2HBY B;  4AQY J;  1XBW A;  1IKY B;  3KLF A;  3CD0 A;  2LQ5 A;  1JKH A;  1QAX A;  3BN7 A;  2P8I A;  5K14 A;  3CCZ A;  1RK8 A;  2D3Z A;  1ZET A;  2VPY B;  5GAH U;  4DSE A;  1VQK S;  2ADC A;  2UUC J;  4K5S A;  3DHW C;  4FS2 A;  1RTD A;  4V1A k;  2CZ9 A;  2CJ9 A;  3PO5 A;  4JI1 F;  1G7C B;  4A8K A;  2VDI A;  3GIM A;  2MQP A;  4I2Q B;  3BDE A;  2ZH6 A;  2APO A;  3T1Y F;  1RYR A;  4CH0 S;  2BJE A;  1IBL J;  5I3U A;  2QN6 B;  3PYE A;  3A3P B;  5KFL A;  2BRK A;  5KFT A;  2ZZN A;  1PIL A;  4Z37 A;  3D6M B;  2ILZ A;  3QT5 A;  1ZM9 A;  1I5O B;  5D77 A;  3FQL A;  4X65 J;  3TA0 A;  4PUO A;  3FCH A;  2CXE A;  3IR6 B;  5IV3 A;  4KHP J;  2H54 B;  1RTD B;  2IFX A;  3EM1 A;  3FBB A;  2MQO A;  1IQZ A;  4DQR A;  2A6O A;  3TVZ A;  2VA3 A;  3FFI B;  1DAR A;  3N9U C;  1HL6 A;  5JMN A;  2LXU A;  2F5G A;  1YQH A;  3VVU A;  2RUS A;  3OUY A;  3KLE A;  2M52 A;  4O3N A;  3OFF A;  1WWH A;  2IBO A;  2ZD1 B;  4F7V A;  1P8G A;  3DNC A;  2VKZ G;  3HLU A;  2XS2 A;  2K1R B;  1S57 A;  1RT5 A;  3GMG A;  2A10 A;  3HJV A;  1OY9 A;  4ZPC A;  4NZ7 A;  3C8Y A;  4WKY A;  3LWL A;  4HAC A;  3CDE A;  4X4S A;  3BO4 A;  3FBC A;  1X4G A;  2J7U A;  2HHH F;  3RW6 A;  2B4V A;  4DFJ A;  2AJQ A;  5CCL A;  3KLI A;  2KFY A;  1N6Q A;  1WOP A;  4OJG A;  5F3T A;  1NSP A;  2J7W A;  3PW0 A;  2X1F A;  4ZVF A;  3HM9 A;  4LR7 A;  2AX1 A;  2QA4 S;  1R7I A;  4IQX A;  4JV5 J;  1NJZ A;  2XLK A;  2W9A A;  5KFH A;  1UZD A;  1MU2 B;  2XEX A;  1CJV A;  4PWU A;  5IS2 A;  3M9O B;  4LR9 A;  3G82 B;  4N7T A;  4P10 A;  2YNF B;  3LPE A;  2GO8 A;  4WZM A;  1RIS A;  1K44 A;  3LW5 C;  4IFV A;  1N6Q B;  1YBA A;  3UR0 A;  1FRM A;  3KUE A;  4FKY A;  3B4D A;  1PYT A;  4O3S A;  2IAJ A;  3MAA A;  1YJN S;  5DRK A;  4HI1 A;  2YKO A;  2M0G B;  3W5Y A;  3W66 A;  1KR4 A;  3VWS A;  4QWD A;  4RX6 A;  5B09 A;  1QSS A;  3LUY A;  4MT1 A;  1S9G B;  4DL5 A;  3K59 A;  1RAH B;  4C0H A;  2O3D A;  1B64 A;  3TYT A;  4YB7 A;  2R4F A;  4YHH F;  4IFV B;  2Z0G A;  3TA2 A;  2PGC A;  1PC5 A;  1UVK A;  4B3S J;  2BBE A;  4ECU A;  2CZV C;  2DNH A;  2ZH7 A;  4QW8 A;  4EU0 A;  4H4O B;  5CD4 A;  1VK3 A;  4C3K A;  2AF6 A;  5HJY A;  5E7O B;  1TMM A;  1FKO B;  2CRL A;  1TL3 A;  2H48 B;  4LT6 A;  5IT4 A;  3EZ5 A;  3N6M A;  1XK8 A;  2IM2 A;  4YME A;  5F0W A;  3PJ9 A;  1HMV A;  4IR9 A;  3DOK A;  4WPA A;  3H4B A;  3OJU A;  4LRC A;  2ZHB A;  3IA0 A;  5I3Q A;  5E3Q A;  2HEK A;  2MZS A;  1RDR A;  4R0E A;  1MMD A;  4JI6 J;  3W63 A;  1S7H A;  1F3F A;  1H2T Z;  2RRN A;  1ZM4 A;  4FF1 A;  4WFX A;  2CG8 A;  2UVV A;  4GVB A;  2EG2 A;  5LT5 A;  5BJR A;  3MDF A;  3O44 A;  4DXL A;  1IWG A;  2BJ3 A;  3QZ7 A;  1HI8 A;  2NXC A;  4RUA A;  1Q16 B;  4OYZ A;  2PSZ A;  5A0Y A;  2DPJ A;  3VAF A;  4HR2 A;  2QSF A;  4NCA A;  1RT2 A;  4IDK B;  3PYF A;  4HTJ A;  2IJN A;  2HND B;  4TY8 A;  3Q8R B;  3MAQ A;  5KFR A;  4EEY A;  1FE4 A;  1E6Y A;  2R7O A;  3AJ2 A;  3NEK A;  3GSD A;  5HMY A;  5D0E A;  2CQ4 A;  1NDK A;  1RAD B;  2V0N A;  5CYQ B;  4G3I A;  3A3O B;  2ZJQ Q;  1PG5 B;  1B3T A;  1SBR A;  2QLJ B;  3MD3 A;  2U1A A;  1PO6 A;  2DB1 A;  3CWJ A;  3I5A A;  2FC9 A;  3D6F B;  3BF4 A;  4W92 B;  1EHW A;  5D0R A;  2K2P A;  4IOA Q;  5A0Y B;  3TP2 A;  2EFG A;  3DI6 B;  2MQQ A;  4OX6 A;  5F8G A;  1FRI A;  2GAH C;  3DU5 A;  3TEG A;  4NLY A;  3KDO A;  1KDN A;  3W62 A;  2JFD A;  1R8P A;  5E3R A;  2Y8W A;  1GMU A;  2DGX A;  3KJV B;  2RDJ A;  1J5E J;  2UXC J;  1LK5 A;  3KNG A;  1XR5 A;  1N5Y B;  1U47 A;  2DNZ A;  4FBU A;  3QJJ A;  1VQN S;  2H5J B;  1IVZ A;  5K9F A;  4CLL A;  2ZH9 A;  2G0C A;  2M7S A;  1KHW A;  5KG1 A;  4DL0 C;  3SCJ E;  2U2F A;  3R5A A;  2M3D A;  2KZZ A;  3D7S B;  2ZM6 J;  1M5P C;  1SJQ A;  3C6T A;  2HFU A;  3OLA A;  5HQ8 A;  1N5T A;  2RKI B;  2FD2 A;  1KWM A;  3ISZ A;  4DG1 B;  2L9D A;  4UQG A;  3GJR B;  2XMM A;  4OV1 A;  2C2K B;  2RS2 A;  3MM6 B;  4X4U A;  5IC4 B;  3M6W A;  2FJW A;  2HHU A;  1OWX A;  1I3O B;  2Y1R I;  1S97 A;  1SKU B;  4FPR A;  1IM4 A;  4PEO A;  3I32 A;  3FJ2 A;  1EQM A;  3NNC A;  3OJS A;  1XER A;  1U1N A;  2DHS A;  2LKZ A;  4DR4 F;  4ZK7 M;  1HPZ A;  4O0N A;  5E3C A;  3DLH A;  3MCS A;  2HZC A;  4JI1 J;  1G4C A;  2DXD A;  2UXB F;  1FCA A;  4IH7 A;  2GV1 A;  3KK3 B;  2D9O A;  3T1Y J;  3KFW X;  2HQD A;  4ETX A;  4CLU A;  1OO0 B;  2NXN A;  4ID5 B;  4TNO A;  2G2Z A;  3SYZ A;  1K8A T;  1VQ5 S;  2W8L A;  2NCK L;  4IG3 A;  2HNY A;  2RJZ A;  4A8O A;  1NND A;  2DXE A;  3MPW A;  1RTI B;  3OQ2 A;  4K4T A;  2DNY A;  2F7V A;  2YXL A;  4RL1 A;  3BSO A;  1RAA B;  4F3O A;  1RUS A;  5KAK A;  3NY0 A;  1HNV A;  2QLF B;  3NBP A;  1CG2 A;  3LGN A;  3FRZ A;  2OPP B;  3DLK A;  4M5I A;  3SDE B;  5ADZ A;  4DPT A;  1SJ3 P;  4F2S A;  5B7W A;  1RHQ B;  4ECQ A;  3I9Z A;  4DX7 A;  2HFV A;  1UVJ A;  4LFA F;  1XC9 A;  2CVE A;  1WHX A;  1S6Q A;  4KHM A;  1T03 B;  1S48 A;  3AY0 A;  4AXI A;  4M5J A;  1WDD A;  4A8X A;  2XMW A;  4CO1 A;  2XSJ B;  4ZCI A;  2KRB A;  5KT4 A;  3PX0 A;  1IKV A;  3TW0 A;  5H1S V;  3H40 A;  3NGK A;  4I0W A;  1KLM A;  4X62 F;  5CA5 A;  2M2B A;  2HHH J;  3NMR A;  4YFU A;  2BKP A;  4B3O A;  5C24 B;  4K2J A;  1TFW A;  3BO3 A;  1MMN A;  4X4V A;  1WC3 A;  3CIZ A;  2OPS B;  2JHE A;  3R1L A;  4LF2 A;  1B0V A;  1S6Q B;  4KKO A;  5D6G A;  1XMO F;  2AYB A;  4A47 A;  4PQA A;  1OSC A;  4M94 A;  4H4M A;  2W8K A;  1ZYQ A;  4IO9 Q;  4HKQ A;  1PIE A;  2RD5 C;  4DMZ A;  4URS A;  3GII A;  1S1W B;  1EB0 A;  3MMC A;  1VC0 A;  1CC8 A;  1DTT B;  3GIK A;  1GFW B;  2LA4 A;  2PDA A;  5GAE U;  4DPX A;  4JI7 F;  1IKV B;  2AD9 A;  2YNH B;  4OYX A;  2JLE A;  2AW0 A;  4FS1 A;  3UDL A;  4L74 A;  3OR2 A;  1UFW A;  2P9G A;  2G2Y A;  4B3O B;  4ILL A;  3T1A A;  4HDH A;  3BR9 A;  3HT0 A;  1NHU A;  4MAK A;  1RT6 A;  5H9F J;  3B4M A;  1L3T A;  3OTD A;  2QO3 A;  3K2Y A;  4Y6I A;  3VGT A;  4NCG B;  1R0B G;  4ZHR A;  2ABY A;  1LWC B;  4WCE Q;  1ZPV A;  3FRY A;  4JI0 F;  2ZBP A;  2OPQ A;  5GAG I;  5A8K A;  3OR1 A;  2QEX S;  2XNR A;  3MMC B;  2RUG A;  1SUQ B;  3QID A;  3BGR A;  3ILL A;  5DM7 Q;  1WTF A;  1D8Z A;  4MIA A;  4ZDN A;  1EIY B;  4YHH J;  1RTZ A;  2KT3 A;  1HBO A;  2GS8 A;  1XNQ F;  3H4D A;  3GG1 A;  2XGP A;  4UTG A;  4WK1 A;  1RT6 B;  3TJ8 A;  2ASJ A;  1T9X A;  3G6X A;  4JV1 A;  1S0M A;  1CJU A;  3SMZ A;  1FJG F;  2WB4 A;  1KTV A;  2M4M A;  2V94 A;  5KFM A;  1F60 B;  3MTK A;  2OPQ B;  1JLG B;  2RF2 A;  1OQ6 A;  5AXK A;  4RZR A;  3OR1 B;  1WC0 A;  4OJ1 A;  4RPF A;  1OSD A;  4CO4 A;  3EGV A;  4DV1 F;  4JYA F;  2CQ2 A;  2ZBQ A;  3RGI A;  3M8W A;  3VZI A;  1HQE A;  2HQI A;  4I7F A;  4HHJ A;  3NXZ A;  2DH9 A;  1JXE A;  1NZA A;  1JXV A;  1S99 A;  3LAK A;  1CPZ A;  2G4B A;  1FDA A;  2H4Y B;  3TZW A;  1CC7 A;  1UKU A;  1RI7 A;  3R3T A;  3N5F A;  4TXS A;  2VOO A;  4YDX A;  4DSK A;  5HQL A;  5JXS A;  3CGI A;  1PJ6 A;  4KGM A;  2OTL S;  2H51 B;  1FRH A;  1S0V A;  5ETR A;  4I67 A;  2OPR A;  3BBF A;  4NA3 A;  2AGP A;  2KU7 A;  2BJ7 A;  1DAX A;  4U7C A;  4P73 A;  4CH1 A;  1JLF A;  1VBZ A;  2MZQ A;  5AE1 A;  4TU9 A;  3SFU A;  4B9U A;  1S9F A;  4J9Q A;  2GMJ A;  1Q7L B;  2GIQ A;  4Q7A A;  1SC6 A;  4RBT A;  3WZ0 A;  1YGY A;  3BGL A;  2YPZ A;  2W9B B;  2O66 A;  5DQG A;  3H20 A;  3N79 A;  3IO1 A;  3VAH A;  2AYG A;  3EIC A;  3ZZZ A;  4ZA1 A;  2H65 B;  8AT1 B;  4C97 A;  4LSN B;  3JSM A;  1X4E A;  3OW2 R;  2IMW P;  3R1H A;  3HSD A;  3PFO A;  2KM8 B;  2GVD A;  2XBP A;  4DFK A;  2XMT A;  3LOU A;  3DRX A;  1CQM A;  4NAS A;  1NM2 A;  4URG A;  1RWO B;  1VQS A;  4DUT A;  1B0P A;  1V3R A;  4YN3 B;  4NLQ A;  4X2B A;  4QR2 A;  2DEJ A;  4LJM A;  1WKJ A;  2DHH A;  3OPK A;  2W4D A;  4KSE B;  4PG5 A;  3OTO F;  4LSZ B;  4ZS6 A;  2GQQ A;  2E5I A;  6AT1 B;  3U27 A;  5AE2 A;  1VLY A;  2WBM A;  3EGW B;  5K8P A;  1IKX B;  5KFI A;  2R42 A;  3UI3 A;  5B0B A;  1XMB A;  3ZZR A;  3P6Y C;  4DQP A;  2W4P A;  4LMZ A;  3ZZ0 A;  4OMF G;  3SCI E;  2HVZ A;  3GCX P;  2E1C A;  2GVD B;  3HT3 A;  1EX8 A;  2YVS A;  2H3E B;  2G9O A;  4U9R A;  1HHQ A;  2L41 A;  1SIZ A;  1S1U A;  1VHF A;  2EFP A;  2OSR A;  2FZK B;  5HAN A;  4OX9 F;  1IBK F;  2ERR A;  1HD0 A;  5ETN A;  1P1T A;  2YY3 A;  3TQE A;  2YWG A;  3TJ9 A;  3N28 A;  3CUL A;  3MMB A;  2MY8 A;  1BWV A;  4DR4 J;  3QT6 A;  3W2V B;  1HR0 F;  1UL3 A;  1S1X B;  4QYR A;  4NLS A;  2UXB J;  2KJW A;  1Q1K A;  4LIW A;  1TL7 A;  4Y28 C;  2XZT B;  4HLB A;  3H5Y A;  4R0J A;  4OYA A;  4GO7 X;  2YWK A;  4EUV A;  3GV8 B;  3R27 A;  4PPD A;  1UVM A;  3ZTO A;  3J7Z 5;  5JJB A;  1GNK A;  1JLA B;  3CXC R;  4ZVO B;  2KRR A;  3KLH B;  3KLG B;  2XS7 A;  1GXL A;  1SL2 A;  5J2P A;  2FZC B;  3QJP A;  1QVG R;  3IP0 A;  3VF0 B;  4I68 A;  2ZNY A;  5E41 A;  1V6H A;  4QIG A;  5A8R A;  3RG6 A;  5I4M A;  3EVM A;  4FBT A;  3CJ5 A;  4NCB A;  5HBM A;  4YB6 A;  3AB4 B;  4G1P A;  1X60 A;  5MLC V;  2YQ3 A;  4MKA A;  4LFA J;  1UP1 A;  1KVJ A;  3ET6 A;  1IBC B;  2MYF A;  3D6T B;  1S7I A;  2CPF A;  1JLE B;  1JX4 A;  2ALY B;  2B5J A;  2X3G A;  4ZIW A;  6FDR A;  2ZE2 B;  4OZL A;  1UJ4 A;  2Z56 B;  3NGS A;  4ECW A;  5J2P B;  4USK A;  4CLK A;  1L3V A;  4B3R F;  5J1N A;  3R6L B;  3GFX A;  4RW7 A;  5IT9 U;  2HBQ B;  4X62 J;  2PE8 A;  1S1T A;  3IXQ A;  4R8U B;  2QL5 B;  3CD6 S;  1B0T A;  2JEF A;  4GRS A;  5FDL A;  4MK8 A;  3SV4 A;  1NZ8 A;  1RBA A;  2BJ1 A;  5KFG A;  4CM0 A;  5IT9 Y;  2JEJ A;  1GH8 A;  1FE0 A;  3CO9 A;  1GK8 A;  3UDC A;  3G2X A;  3OSN A;  1C0U A;  4M5M A;  1XMO J;  2DNO A;  1L5U A;  4M5L A;  1WF1 A;  4ED1 A;  1REG X;  1RWK B;  4MKV A;  3KHL A;  3LP0 A;  2I8E A;  1I6J A;  4CT9 A;  3PW7 A;  4QR0 A;  1YLX A;  1S49 A;  4LIR A;  2EFQ A;  2L48 A;  1M5K C;  2OMO A;  4LF8 F;  4YY3 F;  4JI7 J;  4EO8 A;  1FWL A;  1JJH A;  1WOR A;  4I69 A;  4RW7 B;  1TEL A;  4NZ6 A;  3BGU A;  4ATN A;  4QPT A;  2AEF A;  2F8M A;  3MEC A;  4FZV A;  1ZA2 B;  4I1T A;  1V9O A;  2OEJ A;  3QWP A;  2JNJ A;  3NCQ A;  4PYD A;  1R89 A;  3C2P A;  2YBV A;  4IH5 A;  5FII A;  4PAA A;  4J37 A;  1T9T A;  3CCU S;  1HHT P;  1C0U B;  1FX4 A;  2HVI A;  1VRT A;  3M1V B;  4F4A A;  1BC6 A;  4JI0 J;  2BAN B;  2OD6 A;  3VTI A;  4X66 F;  3POT A;  2EVZ A;  1M5V C;  3C15 B;  4A4J A;  2JH3 A;  3HDS A;  2Q66 A;  2V4J A;  1EKS A;  2Q43 A;  5KFO A;  3S8S A;  3JQM A;  1FXR A;  1SIW B;  3PW4 A;  1Q8L A;  1XNQ J;  5B0C A;  1PJ5 A;  2RAQ A;  2X51 A;  1YJU A;  2DVI A;  4QPX A;  3DYA A;  3N4W A;  1X0F A;  1MNE A;  2GNK A;  3PIO Q;  4WZQ A;  4UF4 A;  1NB2 A;  2W7A A;  2ZHO A;  4LF1 A;  2XZD B;  4LF9 F;  3CJ4 A;  2ASY A;  3AAW B;  4DV1 J;  4JYA J;  5T14 A;  2UVU A;  3W5X A;  1EET A;  2V8H A;  5KG3 A;  4DV4 F;  2P6S A;  3IFE A;  2DY9 A;  2E7W A;  3BDP A;  3TWZ A;  4QZV B;  2VOP A;  1U6F A;  5L38 A;  3DXS X;  1RWV B;  1KQG B;  2RU3 A;  3UCG A;  1LXJ A;  1RAG B;  1DTQ A;  2XI3 A;  2K3I A;  1VHI A;  3DDN A;  2CDR B;  1V5V A;  4PCQ A;  4EGL A;  5C42 A;  1XJW B;  1UW9 A;  1N54 B;  2J7K A;  3CCV S;  1SQE A;  2G13 A;  3MM7 A;  3TAM A;  2A2C A;  1OJ4 A;  3KJF B;  3U1N A;  5ETV A;  1G2E A;  4PQU A;  3LP2 A;  2B0G A;  4QW9 A;  2GJ2 A;  2DO0 A;  3P3D A;  4I64 A;  4AND A;  4ELT A;  2KB2 A;  3CJ0 A;  3OXF A;  2VKR A;  4L3K A;  1WJ9 A;  3I5C A;  3HUL A;  3KTQ A;  4EI2 A;  4C8L A;  1TKX A;  2L9W A;  4YB1 P;  2MKI A;  2VG7 B;  4Y34 A;  3CC2 S;  2OP5 A;  1VQ9 S;  1M0S A;  3W5Z A;  1UEK A;  1Q5Y A;  3VGU A;  3ZNU A;  4BLG A;  5FD1 A;  3OBI A;  4ILR A;  2V68 A;  3DLJ A;  1K0T A;  2HHW A;  4TLR A;  3CMA S;  2HFS A;  4TQR A;  4OZJ A;  1EZZ B;  5HVF A;  4IQM A;  3QBC A;  1PSD A;  1ZTW A;  4WP3 A;  2WSC C;  4WJB A;  3M8Y A;  5KT7 A;  3LP2 B;  2ZDP A;  2HK2 A;  2KFN A;  4U8Y A;  2HPU A;  3GON A;  5D0G A;  2D69 A;  4OI3 A;  4EO6 A;  5J2N B;  1RHU B;  5FLX U;  4Q8E A;  1TKX B;  3LGH A;  1UWB A;  2GQC A;  1F3V A;  2J0X A;  1UVN A;  3ITH B;  3HHL D;  3J7Z T;  2YNI B;  1HYS B;  4A8F A;  5FLX Y;  3F73 A;  3BH6 B;  1JLQ B;  2V50 A;  2WOM B;  1IBM F;  1ZPW X;  2FLN A;  2JVO A;  1N33 F;  3DGP A;  2VBW A;  1YJT A;  4OYO A;  2V34 A;  3NNA A;  5ETM A;  4ED4 A;  1RHM B;  3E51 A;  9ATC B;  2V2K A;  1S1V A;  4AYB D;  3MEE A;  3LA0 A;  3CJK B;  3GIJ A;  3EE3 A;  1FEH A;  2FGO A;  1UWB B;  3H7H B;  1EAY C;  4UUW A;  4DX5 A;  3R5J B;  4OX9 J;  3Q8Y A;  1IBK J;  2B8P A;  3D0H E;  3ZTR A;  4X4P A;  4EWT A;  3IBW A;  2OHD A;  5BR8 F;  2B4P A;  2CJA A;  2E29 A;  2I5J B;  3SEO A;  3GJQ B;  1HR0 J;  3EDR B;  4AE5 A;  2OSQ A;  3WHI A;  2HHS A;  3IWN C;  5KOW A;  1NK6 A;  2N82 B;  2MLX A;  3EMT A;  1QSY A;  1CJT A;  2HHX A;  3DLE B;  2ROG A;  1Y9O A;  2J0W A;  1DHM A;  5HAO A;  5B0E A;  3ISN D;  3ELH A;  2R8I A;  1R8C A;  4ZVH A;  4PXD A;  3C16 B;  1RWN B;  1WD6 A;  3TAQ A;  2AKW B;  2CPZ A;  2ZKU A;  3OD2 A;  4DSI A;  4E0D A;  3V4I A;  3CCM S;  5HN0 A;  3UCU P;  4N76 A;  4H4K C;  2ZWP A;  4K0K F;  4DV0 F;  1N36 F;  3L7U A;  4CLT A;  4PG8 A;  3IM8 A;  1W7W A;  1U1M A;  1YIJ S;  2VU5 A;  3OV7 A;  4TKT A;  2GMH A;  3ZZP A;  4FYY B;  2VV5 A;  4ZVR B;  2YKP A;  2BV3 A;  4B9L A;  1J5O A;  3KLV A;  3RBD A;  3RAX A;  2DR7 A;  4CP5 A;  4NX9 A;  2VQF F;  2GO9 A;  3IBF B;  5IXU A;  5I42 A;  2HQ3 A;  2FHO B;  2B4O A;  1RB0 A;  2YX1 A;  1P1L A;  4I2P A;  2F63 A;  2DGU A;  2QMW A;  3V81 A;  1VBX A;  3K5N A;  5EUH A;  4B3R J;  5C2C A;  4ZMM A;  3I56 S;  5E33 A;  1AUS L;  5HLF A;  1CS4 B;  5DDO C;  4C7Q A;  2R7R A;  4DV2 F;  3Q89 A;  1OMS A;  2XNQ A;  2V4R A;  1X9W A;  1V3Z A;  4QQB A;  2RRA A;  1Z2Z A;  5HJX A;  2BJ8 A;  3NL0 A;  4PAB A;  1HQU A;  4CLS A;  1VOM A;  8ATC B;  1B70 B;  5EGY A;  3AJ1 A;  1A0O B;  3EZO A;  2NRE A;  4CLF A;  4WKR A;  2KG0 A;  5FJ4 A;  4N41 A;  1FK9 A;  1FFW B;  3W65 A;  4LF8 J;  4HYK A;  2WVD A;  4YY3 J;  2KT2 A;  4KGX B;  3NMA A;  2E44 A;  1VQ6 S;  2NPF A;  3OT9 A;  2VBZ A;  3M8P B;  2OKQ A;  1H38 A;  5K8M A;  1N5S A;  4RW9 A;  1Y5I B;  1KVK A;  4O4G B;  3B54 A;  3I82 A;  1QSL A;  4ZJL A;  1VIS A;  3Q0A A;  2L9N A;  2RDD A;  2EBG A;  2UUW A;  2GW8 A;  1N5Q A;  2X1A A;  3BO2 A;  4RWX A;  4JV2 A;  4X66 J;  2V8G A;  1TUV A;  1VIO A;  4IFY B;  1D9F A;  2ZKT A;  1GMW A;  4IH6 A;  5KFZ A;  4FPI A;  3V2U C;  2BA9 A;  1VMB A;  3GFY A;  3G9C A;  3MOJ B;  4WU3 A;  1U8W A;  2DRD A;  4UOH A;  2HKE A;  1HLW A;  3MEG A;  5ETO A;  3MR5 A;  4IRC A;  1W2I A;  3MED A;  5IOL A;  1F9E B;  3H2U B;  3CB4 A;  2KDO A;  1D9D A;  4TU8 A;  3PJW A;  3IRW P;  3D67 A;  2EK1 A;  3AD7 C;  3I31 A;  3MGJ A;  1UW4 A;  2N7C A;  3M8Q A;  1U4B A;  2JVR A;  3HSZ A;  5EWE A;  4LF9 J;  2RRB A;  4EZ6 A;  2KZM A;  1S72 S;  1HKA A;  4DV4 J;  1F2G A;  5F9L A;  1MWQ A;  3UVJ B;  4ED3 A;  4R5P A;  3DRY A;  4K4X A;  1NPK A;  1E6V A;  1XN9 A;  1NME B;  4ECY A;  3M6V A;  1L3U A;  4H54 A;  3UW1 A;  4OX8 A;  1KC8 T;  3R5C A;  1U0H A;  2QRR A;  2DNK A;  4GKJ F;  4JI5 F;  2HGL A;  2EG1 A;  4WTO B;  3FQK A;  4ZVE A;  3WQP A;  2VFU A;  2D74 B;  4PXE A;  5DQI A;  3QMQ A;  3OVS A;  1HW9 A;  4USV A;  3EDQ B;  4DL2 A;  2LQ8 A;  3MM5 B;  3D66 A;  2LXF A;  1KQF B;  5KG0 A;  4WFA Q;  3R6G B;  4AL6 A;  1YZ7 A;  4ZPD A;  2YKA A;  2C28 A;  1TKT A;  2FIU A;  3DKD A;  1N48 A;  2K8G A;  2EFN A;  1SC3 B;  2Z2Z A;  5E5N A;  5EX0 A;  1WC4 A;  4R5P B;  4DZ6 A;  3KMS A;  3PX6 A;  1CBK A;  2LEA A;  3H2V E;  4U96 A;  3ENQ A;  1VRU B;  2G0J A;  2YTC A;  4J9V A;  1LWX A;  3HZE A;  1AXQ A;  2ZHA A;  2BRL A;  3RW7 A;  1YX2 A;  1JB0 C;  3JB9 k;  1NJI T;  4DN0 A;  1Q4R A;  2OH2 A;  2M5Y A;  2VHG A;  1HFE L;  3BR8 A;  3P49 B;  1UEU A;  2ZEJ A;  1HD1 A;  3RAQ A;  3EXY A;  4ZVU B;  2G1H A;  5KT3 A;  4AT1 B;  1EP4 B;  2H1Y A;  1DBD A;  1JLB B;  2DPI A;  1L3K A;  4TVA B;  1IBM J;  3M8R A;  2Z2L A;  1N33 J;  1ZOT A;  2XY6 A;  2C3U A;  2W01 A;  4S0M A;  3KG0 A;  2CNO B;  2QLX A;  1W25 A;  3US5 A;  4Z7Y A;  4Q0B B;  3T6J A;  4ECS A;  4CWB A;  1RAE B;  2C2O B;  2GGP A;  4ZP6 A;  1QM9 A;  2J6U A;  3IN5 A;  1YRU A;  1VJQ A;  3JTN A;  4M5K A;  3NCR A;  5A2Q U;  3MEK A;  2BOA A;  2SXL A;  5F8L A;  2ZZM A;  2D41 A;  1ZM3 A;  5IV4 A;  1FF2 A;  2RQK A;  5A2Q Y;  3PJX A;  5CXT A;  1U48 A;  4B17 A;  4DL6 A;  1UWA A;  4P75 A;  1CJK A;  2VB6 A;  5F3Z A;  5BR8 J;  4RUB A;  2P2C B;  3N0V A;  3MPV A;  2EFV A;  2IRX A;  2Y1L B;  2F4V F;  5KFQ A;  2G0I A;  1U1K A;  1KLN A;  3OSP A;  2R7Q A;  5ETP A;  1HQ2 A;  3UQS A;  3BYR A;  5IZH A;  4N56 A;  4DR5 F;  2KVI A;  2HG4 A;  3QSI A;  4LBP A;  3T6B A;  4LRB A;  2XZW A;  3EWG A;  4ELV A;  1DQA A;  1B4S A;  2DR6 A;  3VV2 B;  4MK7 A;  4U95 A;  1VR6 A;  2CIM A;  3RB6 A;  1GT8 A;  2MKY A;  1Y00 A;  3WIV A;  2ZH2 A;  4O44 A;  1DUR A;  4KHR A;  4HHU A;  4K0K J;  4DV0 J;  1N36 J;  2XY5 A;  2V5H G;  1X5S A;  3NWG A;  1S4E A;  2AZ3 A;  4YEA A;  3RAM A;  3EPG A;  1SKS A;  4OI0 A;  4FXD A;  3HHL B;  1HBU A;  1Y4Z B;  4A8S A;  4WU2 A;  1ZAX A;  5HP1 A;  2WCX A;  2BE7 D;  3OVA A;  5HI7 A;  3Q8P B;  1BD6 A;  1HNX F;  2V2Q A;  4RU2 A;  3WDO A;  4TYB A;  1R43 A;  2VQF J;  2DJW A;  2HWT A;  4FYW B;  1OQ3 A;  2J8S A;  4E98 A;  4C9D A;  5KFD A;  2PMW A;  3HHD A;  4HI2 A;  1RWW B;  2MQL A;  3CJQ A;  2A18 A;  5EDW A;  4M5D A;  1KHV A;  2MEW A;  3GIL A;  4RNN A;  3M2R B;  1URN A;  4ZCL A;  4WFZ A;  1M90 T;  3RB3 A;  3VQS A;  4DX6 A;  4DV2 J;  4MH8 A;  4UT4 A;  2EI5 A;  4LF6 F;  3M7V A;  2AT1 B;  3AOD A;  3CDA A;  1XNR F;  1LW2 B;  2C2E A;  1NU4 A;  3OXL A;  4Y0F A;  5G4D A;  1NK8 A;  3QGI A;  2ZH5 A;  3DOL A;  2BW2 A;  1KVI A;  1P27 B;  3HPO A;  3FEZ A;  3OL8 A;  3T9Z A;  2CPJ A;  3QLH A;  3KDN A;  2UZA A;  4DV5 F;  3LP1 A;  4CYU B;  3MUT P;  3EZU A;  4WE1 A;  3TRG A;  4YS2 A;  2HFN A;  1REV A;  2QG9 B;  1TTH B;  1RT4 B;  4GC7 A;  4MIW A;  3IRX A;  4DWI A;  5F8I A;  4NRU A;  3L95 X;  2FTR A;  3CVK A;  4NYZ A;  1YBU A;  2X1B A;  5DDR C;  3BH7 B;  3F44 A;  2HLT A;  1U25 A;  2MZJ A;  4BC7 A;  3AXM A;  1K0V A;  1RWX B;  1IJF B;  4PXB A;  4W98 A;  2VJV A;  2LCW A;  4U8V A;  1NK0 A;  2CG4 A;  4L76 A;  4ZVT B;  2AP6 A;  3RB0 A;  3DOL B;  1RT1 B;  3R5G A;  3OFG A;  3HXM A;  4KE5 A;  2J9D E;  2NXJ A;  1IM6 A;  3GCW P;  2C3Y A;  2HFO A;  4K5R A;  5F8M A;  2KM8 C;  2BKO A;  3TVY A;  4AL5 A;  1YK9 A;  2YH1 A;  5D15 A;  4C8K A;  2QMX A;  2JZ5 A;  2NZC A;  5C25 A;  2FVC A;  1TKZ B;  3NGR A;  2ZH4 A;  1VBK A;  1HBM B;  4ZVS B;  3RBE A;  3FMB A;  1UET A;  4KFB B;  3QPI A;  4OZ0 A;  4WFN Q;  2BW7 A;  2DT9 A;  4Q44 A;  2AJ2 A;  2OJ3 A;  1APS A;  2YX4 A;  5BYQ A;  2Y9H A;  3LF0 A;  1RHR B;  3GB0 A;  1RAC B;  4ED6 A;  4G1Q A;  3U1L A;  4ICL B;  3BPD A;  3W9H A;  1XTZ A;  4KRW A;  4DU7 A;  3NGT A;  2JEI A;  4N77 A;  4OZ2 A;  2DXF A;  3GJS B;  3I0S B;  1YZ6 A;  4IO1 A;  3H25 A;  1NSK L;  4FVC A;  3RRK A;  2F65 A;  4LBI A;  2CYY A;  1Q78 A;  4XIU A;  1VQM S;  2VAS A;  4HHH A;  3DM2 A;  1NBE B;  3FBF A;  4GVL A;  4CLZ A;  1KOH A;  3CC4 S;  2YKN A;  2QA2 A;  4GKJ J;  4JI5 J;  4RW8 A;  4P6Q A;  3GR0 A;  3UD4 P;  4J9K A;  4ANE A;  1TZ0 A;  2ZJR Q;  3CCQ S;  1CQN A;  2V8P A;  1GX6 A;  1KSP A;  3CJ8 A;  5F8N A;  1R31 A;  2AWZ A;  1AW0 A;  4DR1 F;  2LEP A;  3HHN B;  4OYI A;  2J9C A;  1NKE A;  3M9N B;  4FYX B;  1TK8 A;  3HHE A;  2A1B A;  5DGA A;  4LF7 F;  4PRF A;  4KY3 A;  4M5G A;  1YTY A;  3CJ2 A;  3V6K A;  1FI4 A;  2YNG B;  1HWK A;  5A6W A;  3W60 A;  3DC2 A;  2Z58 B;  3EUN A;  4RNH A;  2KYX A;  1FXL A;  3UDV A;  5DZ7 A;  4QIV A;  1TMJ A;  4RW8 B;  2VG6 A;  3K89 A;  4NI2 B;  2HVH A;  1WEY A;  5DLG A;  1XWL A;  4RJV A;  1ULR A;  3MR7 A;  2BX6 A;  5AE3 A;  1HHS A;  4CO3 A;  3H2L A;  1UTA A;  1RSC A;  1NHV A;  3T5H A;  3R2C J;  5CD4 H;  3RBZ A;  3TEH B;  1FT8 A;  3CDW A;  3DXB A;  4HH1 A;  2MSS A;  5F41 A;  4ZJQ A;  2ZVI A;  3IWX A;  5GVQ A;  2NSC A;  2LEC A;  5G0R B;  2FJA B;  1F5C A;  2XLJ A;  1FHT A;  1WI6 A;  2Q3P A;  4FVM A;  2ZOG A;  5B0G A;  2J9D A;  2HWI A;  1RTJ B;  2FHK A;  1TAU A;  2CQB A;  1JJC B;  1CVJ A;  1TL1 B;  4NXN F;  5CZX A;  2M70 A;  4LF4 F;  1FDN A;  4I2Q A;  1KBR A;  5KFB A;  2COL A;  4ZP7 A;  4DF8 A;  2MQN A;  3G8S A;  1HNZ F;  1Y0H A;  1ZZN A;  1VQY A;  2PEB A;  2XMU A;  4DEZ A;  1MLA A;  3N5B A;  2HZV A;  3BRE A;  2JC0 A;  1MRO A;  4M63 A;  5CYM A;  3UNY A;  2F4V J;  2R2S A;  4W90 B;  2XYH B;  1JQG A;  4F0H A;  1H6K X;  1QE1 A;  2RQ4 A;  1FNO A;  1V3S A;  4DR5 J;  1X5P A;  3MUM P;  3RRG A;  3FFI A;  5F9N A;  2GJF A;  3DRP B;  5KFV A;  1C0T B;  2BE2 B;  4OI6 A;  2B4U A;  4LRF A;  3D3B J;  4PZV A;  3LGM A;  5IFM A;  3PEH A;  2ZD1 A;  1ZTT A;  1Q95 G;  5KFK A;  5K8N A;  5GMK a;  3A3N B;  2RH3 A;  4L3N A;  4ED0 A;  2K06 A;  2F9J A;  4KB7 A;  2K1R A;  4IUF A;  1FRX A;  1MRO B;  2WON A;  5CYM B;  1R8H A;  4MFB B;  2NPI A;  2DGT A;  2I0X A;  5BYR A;  1QE1 B;  3D9B A;  1QDU B;  2E1P A;  2ZUA A;  1PBU A;  1S9E B;  2AZ1 A;  5HMW A;  1WAC A;  2ZBC A;  4PWD B;  3OXG A;  2C2N A;  4OI1 A;  3MCO A;  1AZS A;  4DZD A;  5DO2 A;  1HNX J;  2E7X A;  3CJS A;  1N5V A;  4D3G A;  1U8S A;  1EAR A;  3IG1 A;  2XO6 A;  5KFP A;  2BZ2 A;  3GJT B;  5CQG A;  3M4X A;  1VQO S;  3NOC A;  2HIQ A;  3IR7 B;  3CUN A;  1R0C B;  4DPU A;  2FY1 A;  3CD5 A;  2W9C B;  3M2U B;  3FZB A;  3W3S A;  1EKR A;  1Q86 T;  1NKB A;  1FFG B;  2OUG A;  1MU2 A;  2E7V A;  1FD8 A;  2WON B;  4FYD A;  1YJ9 S;  2N4D A;  3SSS A;  1S6P B;  4C0O C;  2DIS A;  2HRY A;  2HHQ A;  4Q5V A;  2XWX A;  1NK7 A;  3MPD A;  3V5R A;  4LF6 J;  3AQP A;  3G82 A;  1SL1 A;  4J9S A;  4ED5 A;  2WK4 A;  2YNF A;  4F26 A;  4USM A;  2Y1J A;  7AT1 B;  2XYG B;  1SB6 A;  1AZS B;  3MPY A;  1XNR J;  1MW7 A;  2ASD A;  4WK3 A;  4YP3 A;  4LF5 F;  5DQH A;  2FB0 A;  1GXU A;  4M8L A;  4A46 A;  3KG4 A;  1VS3 A;  4NLO A;  2LFV A;  3IG1 B;  1VDH A;  1FRL A;  4EFA C;  4RUC A;  1NJX A;  4DV5 J;  4TQS A;  2CVI A;  3QQC D;  1U45 A;  2GZO A;  4EBE A;  2E5G A;  1HWI A;  5J2Q B;  3ZC4 A;  2N3L A;  1S9G A;  1FNM A;  3A4T A;  3W9J A;  4O3Q A;  5DM6 Q;  1ELO A;  1S59 A;  4P9S A;  4Q45 A;  3NNH A;  2D9P A;  2A2D A;  4H4K A;  2H5I B;  2DCU B;  3JYT B;  2PC6 A;  2FJD B;  1MWZ A;  2RML A;  5DZ6 A;  2ZBI A;  4GKK J;  2CQD A;  3Q2S C;  3QRQ A;  2VFS A;  5AXL A;  2E9T A;  3ULH A;  1NRK A;  4RNM A;  3O1L A;  2H9Z A;  3DGV A;  2NLW A;  2EK6 A;  2KXN B;  4H4O A;  1IKW B;  4M1K A;  3ZZO A;  1MN7 A;  3I55 S;  4FN5 A;  3IC1 A;  4J9U E;  3JSB A;  1FKO A;  2QLB B;  5KG7 A;  5F0U A;  2XCP A;  3KUG A;  4C0B A;  2R9L A;  3QYY A;  4LRA A;  1FWK A;  2Q6C A;  3C6U B;  5T7L B;  1S79 A;  2R7X A;  2IM0 A;  1YKW A;  1SC4 B;  5DDQ C;  3HFK A;  2NSB A;  3DRR B;  3P5B P;  1RKJ A;  3LPY A;  3N6N A;  2CNK B;  2KKH A;  1RLD A;  2AYE A;  5KOX A;  4DLE A;  1Y3J A;  3AH6 A;  4XDC A;  1WHV A;  1OYE A;  3BV8 A;  1IR2 A;  4KT0 C;  5THW A;  4USW A;  1HWL A;  1KON A;  2C2R A;  5GAH I;  2R7W A;  1XIQ A;  4E2F B;  2G2O A;  1FEE A;  2C3P A;  1TVR B;  3ZNJ 1;  2DGS A;  1FJ7 A;  2IHR 1;  4K4U A;  1RT7 A;  4IDK A;  1JIH A;  2K3K A;  2HND A;  4IG0 B;  2DH8 A;  4U7U K;  4DSF A;  5HK4 A;  3NGU A;  5E3P A;  3UNG C;  3JQJ A;  2C2M B;  5CYQ A;  3GYX B;  4AD6 A;  3C3L A;  1Q53 A;  2HRU A;  4AFF A;  1YJV A;  2IM3 A;  3PHE A;  4CCH A;  3K5P A;  2HWH A;  4DCJ B;  1JMT A;  4KIA A;  3KUH A;  5CZV A;  2DGW A;  1U49 A;  3KOA A;  3DI6 A;  3R5D A;  4J90 A;  4DR1 J;  3MM8 B;  2D7S A;  3TZX A;  3QAU A;  1RT7 B;  2PA3 A;  2OTJ S;  3CE8 A;  3T5L A;  4A8Y A;  3R9L A;  4LF7 J;  1MWY A;  2O01 C;  3KJV A;  1FXD A;  3M6X A;  1N5Y A;  3D68 A;  1IQT A;  3D28 A;  1H2V Z;  3MF5 A;  4GO5 X;  2CQI A;  3H0P A;  5HAT A;  1LFP A;  4PYA A;  4PR6 A;  3R7N B;  5KFC A;  2RHQ B;  3CD7 A;  3ZO7 A;  3G6V A;  4ZPB A;  2NUH A;  1WG5 A;  3CO0 P;  2UV8 A;  3DLG B;  1M1H A;  1MML A;  4PG7 A;  3V4M A;  3LAL A;  2RKI A;  3QNW B;  4BDP A;  3RBX A;  1FER A;  3VQT A;  4ED8 A;  4DG1 A;  2CJX B;  1WEX A;  2FLL A;  1X4A A;  3MM6 A;  3FDS A;  4UOF A;  3JAM U;  3ZXW A;  3LAM A;  1TV6 B;  3LTO A;  3DU6 A;  3S01 A;  5EWG A;  3K5O A;  2VC1 A;  4DS5 A;  3S7R A;  3JAM Y;  1LW0 B;  2LEB A;  5DDP C;  1BHN A;  4QCL A;  1DQ8 A;  2WBR A;  2FDN A;  4JV0 A;  3DMJ A;  4NXN J;  2D3U A;  3T41 A;  4LF4 J;  4CLP A;  1RTH B;  4ID8 A;  3AOC A;  1SJF A;  3KK3 A;  1O6X A;  1FWP A;  3I96 A;  5DS7 A;  2R7S A;  2BEF A;  4C11 B;  3FVY A;  1HNZ J;  1U02 A;  4ZVP B;  4ID5 A;  2HLU A;  4JI8 F;  2RHS B;  4ECV A;  4DN9 A;  3RB4 A;  3I87 A;  1RTI A;  3S6E A;  1RKI A;  1X8D A;  1RJJ A;  1RA7 A;  1S12 A;  1X4B A;  2KYZ A;  3SQG B;  2B7C B;  4F67 A;  2JX2 A;  1QLN A;  3UDE A;  3KHR A;  1J27 A;  2KHC A;  2MST A;  1YJ7 A;  3DMJ B;  2OPP A;  3SDE A;  4ELU A;  5L1J A;  3L7O A;  2QZ8 A;  2ZOF A;  5IT0 A;  4KV8 B;  3CCR S;  2LQ9 A;  4Q2M A;  1SV5 B;  2QFI A;  3TVK A;  4QWE A;  1FES A;  2VC0 A;  3CCE S;  4FF2 A;  5KFF A;  2DNQ A;  3G6Y A;  1N8R T;  2R2R A;  2V63 A;  4USJ C;  1T03 A;  3DLL Q;  4K4W A;  3DOM B;  4UZC A;  3ZTP A;  2HZA A;  1QUP A;  4ALZ A;  2XSJ A;  4OZN A;  4LVO P;  1T95 A;  3GFH A;  1KRP A;  3MMA A;  3P8B B;  3A8J A;  2PI4 A;  3GLJ A;  2AGQ A;  1R3N A;  4GC6 A;  4BBY A;  3RJM B;  5C24 A;  4CO0 A;  2E1M C;  4F4K A;  4F02 A;  4OYW A;  3J81 U;  4BS2 A;  2OPS A;  4Y65 A;  4B02 A;  2KL8 A;  1T9V A;  3Q22 A;  3J81 Y;  3V6J A;  2D3O R;  4NEY A;  1H7X A;  5KG5 A;  2KTQ A;  1S1W A;  2XHC A;  1DTT A;  4DUZ F;  3JSR A;  4FP9 A;  1IJE B;  4ZIT A;  4J9N A;  2J6T A;  2OML A;  4CI0 B;  5T41 A;  2YNH A;  2NS1 B;  2LDI A;  3MMA B;  3DHX A;  1U7L A;  3WBZ A;  1IN0 A;  2DHA A;  3VZH A;  2KH9 A;  2ALZ A;  4TU7 A;  1NO8 A;  4LF5 J;  4ZIV A;  4JV5 F;  3TOQ A;  1C1B B;  2QYC A;  3NGD A;  4DL7 A;  3C14 B;  4NCG A;  4YR3 A;  3PHT A;  4V19 J;  1LWC A;  4LQ9 A;  3FCW A;  1BQM A;  3QT7 A;  3CPW R;  1D9A A;  2Y3Y A;  2ZDO A;  1SUQ A;  3GU0 A;  2QFJ A;  4DSJ A;  1DLO B;  5D4N A;  3NCP A;  4BWJ A;  4ILM A;  2CPD A;  2F9D A;  1U24 A;  4OHZ A;  5D3G B;  4K4Z A;  4X4T A;  4DJB A;  2KN4 A;  1PC4 A;  1Y11 A;  3J7A N;  3M2V B;  4NLV A;  2XMV A;  2FPH X;  1KD1 T;  5KFE A;  2QA1 A;  2W24 A;  3MM9 B;  4B3M F;  4ZVQ B;  1HAR A;  5KFS A;  2R7T A;  2PO4 A;  2XG8 A;  3AQO A;  2R8K A;  1SH0 A;  4U7U D;  2GVZ A;  3E8O A;  2XMA A;  2ZIT A;  2V69 A;  3EJM A;  1FJE B;  1JLG A;  1BQM B;  3QRP A;  2AU0 A;  2Y1I A;  4KTQ A;  2LQB A;  2VFT A;  1VQL S;  1LWE B;  4CZC A;  4FNI A;  2VIC A;  2CPY A;  3D0G E;  4DFM A;  5DJB A;  2FVQ A;  1QAY A;  5CYJ A;  1AA1 B;  4QIF A;  3R2D J;  2JLF A;  2WRM A;  5DG7 A;  1T9Y A;  1T02 A;  1UA0 A;  2IJR A;  2GVZ B;  3DN9 A;  2RT3 A;  2A6M A;  3QT8 A;  1T3O A;  2HIY A;  2GA7 A;  1X7V A;  4XDD A;  2NQP A;  4URQ U;  2CPX A;  4CLY A;  2B9W A;  3X3U A;  2VDH A;  1A9N B;  1WC6 A;  2V9K A;  2GCF A;  2PA8 D;  3BSC A;  2NUU G;  3A8K A;  3LH2 S;  5D4L A;  3HD2 A;  2DIT A;  2M8H A;  1LWF B;  3ZZU A;  2W9B A;  1WG1 A;  3NS5 A;  4EYI B;  2ZZT A;  3K58 A;  4OI4 A;  4ES2 A;  4HL9 A;  3H5S A;  5DLF A;  4DPW A;  4N8O A;  4YQW A;  1IR1 A;  3QWU A;  2CNL B;  2IBK A;  3RU0 A;  4LSN A;  1URR A;  4JI3 F;  2JRS A;  4CNY A;  1AT1 B;  5ETQ A;  1J2V A;  4J9O A;  2XHW A;  4DR6 F;  3HP6 A;  3RTV A;  3TUP A;  1NKC A;  2UP1 A;  4N8N A;  4F3M A;  2IC3 A;  4F4Z A;  5L39 A;  4O4R A;  4RLE A;  3J80 U;  1H3D A;  1RHJ B;  2CQC A;  4ZN1 A;  4I56 A;  5L1K A;  5DG9 A;  1KS2 A;  2KFZ A;  3J80 Y;  1NHK L;  2C3O A;  1IKX A;  3P4U B;  1WUU A;  4UOC A;  4FF3 A;  3VCD A;  4Y2M A;  4KO0 A;  4CIO A;  3PYD A;  4YOE A;  1FDB A;  1JLC A;  4ZLP A;  3PTW A;  4B9M A;  2K7J A;  4PG4 A;  4RW6 B;  3ETM A;  5KFJ A;  5LJ3 Y;  4ETZ A;  4C2M A;  3BKF A;  4QU6 A;  3D54 A;  2IC3 B;  1WDT A;  1NUE A;  4OHY A;  4X4Q A;  3TNV A;  3R7S B;  2IMO A;  5HRO B;  3OL6 A;  3HFV A;  2WW4 A;  1RYS A;  3VAG A;  1AUD A;  1SJ1 A;  2P9C A;  1PAE X;  1ZA1 B;  1SI9 A;  1VRQ C;  5GAE I;  3TX8 A;  3PRV A;  3W2V A;  3IM9 A;  4KO0 B;  2AHO B;  4X4O A;  1S1X A;  3HHK A;  2VH7 A;  1JLC B;  3ENW A;  4X4R A;  3IGV A;  4JI2 F;  1BXN A;  3ETO A;  3RUB L;  2O1P A;  3MR6 A;  5IM0 B;  2E9Z A;  3JTP A;  3QSY B;  2FYX A;  4JI8 J;  2J9E A;  3KK1 B;  4KAI A;  3QAE A;  3I5B A;  1H2U X;  3ISN C;  2GFF A;  3CT9 A;  1F2H A;  3LWM A;  1VQ7 S;  3KMQ A;  1LFW A;  1SC1 B;  2R2T A;  1JLA A;  1NK5 A;  2NR0 A;  5F8H A;  1FVS A;  3KLH A;  3KLG A;  2B6A B;  5ETT A;  4DPO A;  1MN9 A;  2FJE B;  2HVE A;  2VBX A;  3ZTQ A;  1QD1 A;  1TQL A;  3UN2 A;  2IYI A;  5GME A;  1X4C A;  4EZ9 A;  1QVF R;  4P71 A;  4E8U A;  1UCN A;  3KLF B;  5LJ5 Y;  1JKH B;  4HTI A;  4ZCK A;  1O5J A;  3GV7 B;  2FVR A;  5K14 B;  2WTF A;  2QTW A;  3VR1 A;  5E2Q A;  1JLE A;  1C4C A;  4B9N A;  2ZE2 A;  2EC2 A;  4IOB A;  4NXM F;  5B08 A;  1DZ5 A;  2NYI A;  1W26 A;  2ZJP Q;  4DR2 F;  4DFP A;  1JJ2 R;  4A48 A;  4OV6 A;  3AD9 C;  2DKO B;  1R8A A;  4J9P A;  3FCV A;  1VI7 A;  2M9K A;  3SZ2 A;  5L9N A;  1PAU B;  4OYP A;  4R8U A;  5D0H A;  3L7P A;  2MQM A;  5I3U B;  4P2S A;  2ACY A;  1XEZ A;  1RP5 A;  4QOT A;  1RAI B;  4U67 Q;  3LQV A;  3AA8 A;  1C2P A;  5RUB A;  4KGK A;  3NWR A;  1YWX A;  2CZ4 A;  2NZ4 A;  4UQT A;  2ZH8 A;  4NLG A;  3FC9 A;  3H5U A;  3FBE A;  2X3D A;  4PUO B;  2NXE A;  4TYA A;  2HSE B;  2HHV A;  2ILY A;  4CH7 A;  1O8B A;  4DUZ J;  1BUX A;  3H5X A;  4P2X A;  3H90 A;  4C8O A;  2PEH A;  2V8D A;  2OD4 A;  3OUY B;  3KLE B;  3O3L A;  2MJN A;  2HMI A;  4X84 A;  4C3L A;  3PDN A;  3HSG A;  2ATL A;  2AEM A;  3P45 B;  3M1V A;  1F1B B;  2BE9 B;  3HO1 A;  4ED2 A;  1RT5 B;  5IQQ A;  4F50 A;  2HRT A;  1QY7 A;  1SH3 A;  1VGY A;  1ZZF A;  5DET A;  1U2C A;  1YI2 S;  3KK2 A;  2BAN A;  3T9N A;  4NA2 A;  4J7C A;  1KFS A;  2O5D A;  3VVT A;  3O6Q A;  4HAC B;  3C15 A;  2ASL A;  2I2Y A;  5LSL A;  2W7O A;  3BYP A;  3OVB A;  1UPM B;  4PWW A;  1FKA F;  3VAK A;  3UFC X;  2GC8 A;  3KLI B;  4WIQ A;  3OLB A;  2XCA A;  3QAT A;  5B0D A;  2HMI B;  4MTP A;  4ECX A;  3V6H A;  4B3M J;  1YHQ S;  2CQH A;  4UZB A;  3SQO P;  1YRT A;  1TFY A;  4DQQ A;  4JBC A;  4BHQ A;  1VCT A;  1T94 A;  1CJV B;  4BWM A;  5HMZ A;  3BGO P;  3UD5 A;  4WP8 A;  3KK2 B;  3HKZ D;  1YJR A;  4HT7 A;  4Q43 A;  3SCK E;  3BPS P;  4NLT A;  2IRU A;  4IR1 A;  1BQN A;  4FF4 A;  5KT6 A;  4K4Y A;  4F0K A;  1F5B A;  2DNL A;  2WZ1 A;  1N32 F;  1UA1 A;  1X5T A;  2MKC A;  1T9U A;  5B0A A;  4OLP A;  5KT2 A;  2IAJ B;  3MAA B;  5H9E J;  4KGV B;  3W9I A;  2FLP A;  4BC9 A;  2HGN A;  3NOG A;  1F5A A;  3W2W A;  3BSN A;  1FJG J;  2LVW A;  2VBY A;  4AL7 A;  4F4Y A;  2E1R A;  2MPU A;  2XMJ A;  4OLO A;  2YQ0 A;  1X4F A;  2AJ1 A;  3NS6 A;  4NOH A;  1BQN B;  2W4C A;  2CQG A;  3DCA A;  2GHP A;  2N4C A;  1X4H A;  1GEH A;  4KQZ A;  1EJ7 L;  2GIF A;  2DR5 A;  2VG7 A;  3QFH A;  2H5E A;  3MWB A;  1XR6 A;  3Q86 A;  1CLF A;  2EEY A;  4CDI A;  3IBC B;  3W2W B;  2FUG 9;  1K9M T;  1PKU A;  1TL3 B;  5AXN A;  4G6V B;  5EX3 A;  1HMV B;  5HVH A;  4DQI A;  4KPC A;  1S77 D;  2LU2 A;  1FJC A;  1M5S A;  2MZR A;  3DOK B;  3PW5 A;  1UVL A;  3EGN A;  3OFH A;  1UMJ A;  2RQC A;  4JI3 J;  5LSR A;  2JOQ A;  3U1M A;  2Q1L A;  2VUG A;  1A7G E;  5J2N A;  3KHG A;  4DV6 F;  5HQM A;  4DR6 J;  2VPZ B;  4ZKA A;  4GVB B;  4O3R A;  2HS4 A;  2CAD A;  3ITH A;  3G6E S;  2YNI A;  2VPW B;  3BJY A;  1HYS A;  2FQQ B;  4Y2A A;  2FHM A;  2QE5 A;  1RAJ A;  1JLQ A;  3M30 A;  3H59 A;  2HVD A;  2WOM A;  1RCO B;  2B8Q A;  2ZVS A;  4WYW A;  2OEM A;  2DNM A;  5GAD I;  2HHP A;  1U6Z A;  1RT2 B;  4TY8 B;  3R8Y A;  1E6Y B;  1PYO B;  3IWL A;  3DDI A;  2DH7 A;  3C46 A;  2LU1 A;  3CJK A;  3CED A;  2HQF A;  4IYQ A;  3PXG a;  4K7Q A;  3CJ3 A;  2DNR A;  3JQK A;  2V4Q A;  2HAI A;  3FSY A;  1RQ0 A;  4ZJO A;  4ERD A;  5GAG U;  1NSA A;  3OTO J;  3M30 B;  1VK8 A;  2XM3 A;  1R6Y A;  2HFZ A;  2GAG C;  4NRT A;  5LXY A;  4ITS A;  2I5J A;  4QJV A;  1VQ8 S;  3BKT A;  1QTN B;  3Q24 A;  3PFE A;  2BVZ A;  2MQ8 A;  3PY8 A;  1L3S A;  2GX8 A;  3DRS A;  3QZ8 A;  1OS5 A;  3W8G A;  1TUW A;  3HFZ B;  4JI2 J;  3DLE A;  1Q8K A;  3UD3 P;  1N56 A;  5C5J A;  3D3C J;  2ZOM A;  2CWK A;  3PNI A;  4OHW A;  4P7T A;  2GIR A;  1RBL A;  3C16 A;  1JNR B;  5E3A A;  2O67 A;  2FJX A;  1SQF A;  2QSW A;  4HH0 A;  2QX0 A;  2YH0 A;  2DYA A;  3EX7 B;  3VAI A;  1P6T A;  2KHD A;  4WYL A;  3C6T B;  4MYT A;  2MHE A;  2DTJ A;  1NJY A;  4DCP B;  3RR7 A;  1P9Q C;  3GPA A;  3DRS B;  5BYS A;  2DRB A;  1Y10 A;  4ES3 A;  1PBA A;  2QJ3 A;  2OFG X;  4TLQ A;  1M5O C;  2BM1 A;  5EWF A;  2A3J A;  1X9S A;  3HF5 A;  3NAH A;  2DY1 A;  3CSK A;  4NXM J;  3L4B C;  1WG4 A;  1HPZ B;  4DR2 J;  2DNP A;  2PN6 A;  1GTH A;  4WXW A;  2UUA F;  4XTT A;  3T19 A;  2HQC A;  5J1P A;  5IQ6 A;  4UUX A;  2CJY B;  1CS4 A;  2L3M A;  2V9W A;  2EKN A;  4RW4 A;  1QJH A;  4A8Q A;  2IVM A;  2Z4P A;  3M32 A;  4ED7 A;  3QGP A;  3ZTS A;  2HAF A;  1T3N A;  2CQ0 A;  2CJK A;  2X7I A;  4IG3 B;  2HNY B;  1BQX A;  3BS9 A;  3PRB A;  5H9E K;  2R8H A;  4M5N A;  2MB0 B;  4PPZ A;  1B7F A;  4NLR A;  3KG1 A;  1HNV B;  3NBP B;  2MXY A;  3CCT A;  3TO8 A;  1LV5 A;  2ZH1 A;  3DLK B;  2VIH A;  2M88 A;  2LA6 A;  1WF0 A;  3M8P A;  4RW4 B;  3E3X A;  1ZBT A;  2JSX A;  2FHJ D;  3QGH A;  3M32 B;  3KXD A;  4MMO A;  2CQ3 A;  4O4G A;  4C8N A;  2RE1 A;  2WVC A;  2Z2Y B;  4L73 A;  3FKB A;  2JFK A;  3PVX A;  3ENA A;  1VYA A;  3PW2 A;  4F25 A;  2CQ1 A;  2MLZ A;  1HWJ A;  4PXC A;  2QT7 A;  1X5O A;  3CNQ P;  4O3O A;  1Q5V A;  2HYI B;  4IFY A;  2XUL A;  3NP5 A;  1KLM B;  1WI8 A;  1UFL A;  1Z4U A;  3RYL A;  4I6Y A;  1V5I B;  1U1R A;  2H4W B;  3CDB A;  2WVE A;  2WW8 A;  4WFY A;  3HVR A;  4K2X A;  3MMJ A;  4MKB A;  4J5O A;  2DR9 A;  2JDJ A;  1Y7P A;  1BE4 A;  3MUR P;  4KKO B;  5BXI A;  2B51 A;  3MHY A;  2ZC4 A;  1R0A A;  4DL4 A;  1PCA A;  5LMN F;  4H4M B;  3MXH P;  4DU8 A;  4L72 B;  3M8S A;  4XPE A;  4I6W A;  3T5K A;  3R5B A;  4F8R A;  4OL8 A;  3NRB A;  1SKW A;  3A1Y G;  2WHO A;  3FEX B;  3OR2 B;  1Q0N A;  1U09 A;  1N32 J;  3TI0 A;  3AXK A;  5HL7 Q;  4N47 A;  2PD1 A;  3GG0 A;  3O2I A;  1WEZ A;  1S76 D;  3MFH A;  3UVJ A;  2RSQ A;  1RHK B;  1VC6 A;  1KTQ A;  5KG4 A;  4ZHR B;  2XC9 A;  4L75 A;  3KJN B;  2OIH A;  1R0A B;  3W8P A;  2C22 A;  2RQM A;  3TUZ C;  4KPY A;  1X9M A;  3HZG A;  1FO1 A;  1X31 C;  3BZQ A;  5A8K B;  1JXL A;  1CEZ A;  3J7A 1;  4F04 B;  1AB8 A;  3BGR B;  3V6D A;  1RT3 A;  4KJI A;  5C2G A;  4DLG A;  2DIV A;  2J0Q D;  1JNZ B;  3MM5 A;  2DGO A;  3P5T L;  4ZCM A;  4DOZ A;  4LFC F;  4Q8F A;  2WSF C;  3C19 A;  1HBO B;  3OTB A;  3TQ1 A;  2UUT A;  4C8Y A;  2BMB A;  2ADB A;  4P2M A;  1CJU B;  4JP8 A;  4OQJ A;  3HKW A;  4KC5 A;  4DSL A;  1XQI A;  2R2U A;  2RF2 B;  1VRU A;  2RDI A;  5HMX A;  2EWH A;  3X1L B;  3THT A;  1NH7 A;  2PI5 A;  3QJL A;  1Q7Y T;  1ACM B;  1DFD A;  1WC5 A;  3V6D B;  1RT3 B;  3J7Y I;  2RU9 A;  4Y2K A;  4K4S A;  3H8Y A;  2MMY A;  2AYM A;  1U1O A;  3WX8 A;  1HQE B;  1U2F A;  1GTE A;  1ICE B;  3PR4 A;  4I7F B;  4M95 A;  1F9H A;  4DV6 J;  3PM9 A;  2RIJ A;  4OJ3 A;  1TL5 A;  2VF3 A;  3RR8 A;  3EPI A;  2IA0 A;  1EP4 A;  2E9R X;  4NLU A;  2MKK A;  3BN4 A;  3F41 A;  1JLB A;  4EK2 A;  3SXL A;  3GQC A;  2XLI A;  2DIU A;  1I94 F;  2BM0 A;  1TL4 A;  2KI2 A;  4ZVG A;  1H98 A;  2OPR B;  1GQE A;  1I51 B;  2DNG A;  2W2Q P;  1Q81 T;  4Q0B A;  4NLP A;  3ADA C;  1NK4 A;  3UPF A;  3QRR A;  4A8M P;  2YPY A;  3BBC A;  4USU A;  4FXW A;  3CF5 Q;  3TUJ C;  3TUI C;  1JLF B;  4CTA A;  3MOZ A;  1TP7 A;  1JK9 B;  2VG5 A;  4NLX A;  1N52 B;  4DUY F;  5F8J A;  1TR0 A;  1KEK A;  4B9S A;  3U02 A;  1FX2 A;  2KXF A;  3ILI A;  3AA9 A;  3E2E A;  1WSV A;  2E1A A;  2CA9 A;  1H73 A;  1KFD A;  2EPI A;  2HK3 A;  4OI2 A;  5ETS A;  3JSM B;  2CNN B;  4QU7 A;  3IGN A;  1PJ7 A;  4OHV A;  1WOO A;  4TY9 A;  2HNZ A;  3BKU A;  1NDC A;  4CTA B;  3D0I E;  3BBB A;  4NL5 A;  3MR2 A;  3PX4 A;  2VG5 B;  3O8W A;  4Y3C A;  5L1L A;  5CH7 B;  3AJD A;  5KFW A;  3VAM A;  3U7J A;  2P5V A;  2ZC3 A;  3GSI A;  2R7V A;  4DR3 F;  1K47 A;  1KP6 A;  3QFW A;  3RRH A;  2BXJ A;  1UAW A;  1T7P A;  1GXT A;  2XQC A;  1M1K T;  4Q2L A;  4YUD A;  3HVW A;  3PZP A;  2DRA A;  2FVP A;  2MKJ A;  1KN6 A;  3TZY A;  4NML A;  3HHL A;  3B8H A;  3MZI A;  1SVD A;  4DHV A;  2HNZ B;  2BDP A;  3I4P A;  3MR3 A;  5H9F K;  1S1U B;  2AQ4 A;  4I4B A;  3EVW A;  3HI9 A;  3IAS 9;  3CCL S;  4Y2C A;  3GP9 A;  1T9W A;  2YKM A;  3NG8 A;  5KFY A;  5IWA F;  1JWW A;  4OHX A;  3MMB B;  4X64 F;  2EBE A;  4LSL A;  1HNI A;  3DFE A;  2UUA J;  3DDK A;  3QIP A;  3M2R A;  4NEZ A;  2VOD A;  1TL7 B;  4LR8 A;  5LXR A;  3L9Z A;  1UFK A;  2D1C A;  1EQ0 A;  3GZ7 A;  2HHT A;  3FGV A;  4MYU A;  2AIR B;  2J8A A;  3IMQ J;  3HSJ A;  4ZPW R;  2K7K A;  2XMK A;  4ANC A;  1LW2 A;  3GIR A;  4RO0 A;  2Q6B A;  2ZUG A;  2YKM B;  4X4N A;  2JWN A;  2BYC A;  1D8Y A;  5GAD U;  2AX0 A;  4RNO A;  1S6O A;  3Q23 A;  4LSL B;  1HNI B;  4CYU A;  3AB2 B;  5A8R B;  1Y5L B;  2AJ4 A;  3Q8U A;  3QIP B;  3FUY A;  4YR2 A;  5HBM B;  3M8Z A;  1RT4 A;  5CCM A;  2F8E X;  2EC0 A;  1GMW D;  4OIX A;  1WNE A;  5C7P A;  5M2R A;  3ET6 B;  1R6V A;  4K59 A;  4V19 X;  1SCJ B;  1FNX H;  2I9S A;  2AMC B;  2B5J B;  3ICL A;  5M2U A;  4EMD A;  2UVR A;  1BMQ B;  1KKH A;  2XTJ P;  1B99 A;  3MTJ A;  4KGZ B;  1RT1 A;  4F4X A;  3NAI A;  1S10 A;  3A8E A;  1SKR A;  3PR5 B;  2WB1 D;  4F4W A;  1S1T B;  2C3M A;  1HWU A;  5FDL B;  1NDL A;  3TR5 A;  3G87 A;  1KQK A;  1TKZ A;  1PYS B;  3IS9 A;  3I9V 9;  4MIB A;  2ZH3 A;  2CDQ A;  3GE9 A;  2CPI A;  1HBM A;  1SH2 A;  1S5Z A;  2NXU A;  5LL6 d;  4KFB A;  1RXO B;  4O23 A;  1IWA A;  2HUR A;  4P74 A;  3LP0 B;  3Q2T C;  5LMN J;  3UCZ P;  2R8J A;  1OY8 A;  1RAO A;  2QMU B;  4ZP8 A;  2FHJ A;  1OPI A;  2QIF A;  1WF2 A;  3TX0 A;  3ZZT A;  3TAP A;  3D6H B;  3KKF A;  3VGV A;  3AFG A;  4ICL A;  4YR0 A;  4QWB A;  2DNN A;  2FLO A;  3MEC B;  1NEE A;  1IUJ A;  2W1B A;  3IS9 B;  2IRY A;  4IRD A;  4MKY A;  3I0S A;  2DK2 A;  3EVO A;  3D1O A;  3BEG B;  3F56 A;  5JUM A;  1U2R A;  2YWW A;  1D09 B;  1VRT B;  4C8M A;  4WBF A;  2RVJ A;  3POT B;  2JLG A;  2POK A;  3M6U A;  1VQP S;  4ECZ A;  1T05 A;  2UXD F;  5A76 A;  2CPH A;  2BJ9 A;  4B08 A;  5A6P A;  4IRK A;  2V4J B;  1W2B R;  1AFJ A;  1RLC L;  5LOQ A;  2GML A;  1NLK L;  4LFC J;  1KQS R;  4NMX A;  1B7Y B;  2IIH A;  3CCS S;  3KJQ B;  2QC3 A;  2VFV A;  2R3V A;  1M1G A;  3DYA B;  5LMU F;  2YNG A;  3D1H A;  2I1R A;  2B43 A;  2AV5 A;  5AJ3 F;  3F0N A;  1AYE A;  8RUC A;  4QR1 A;  1NH8 A;  3GYG A;  2YX7 A;  3K8V A;  3RZA A;  1T05 B;  3JXO A;  3UR3 C;  2UUB F;  3CDU A;  1HA1 A;  4NI2 A;  2QL9 B;  1WTB A;  1RGV A;  3T3F A;  1EET B;  3NS7 B;  1U1P A;  2LLZ A;  1XR7 A;  2ROE A;  2VFR A;  3CCW A;  2V8V A;  4IOC Q;  1BWE A;  1SQG A;  3SV3 A;  2KJV A;  3MFI A;  1DTQ B;  4ZOS A;  3B78 A;  2BUN A;  2E5H A;  4FDF A;  2B9Y A;  5D78 A;  5C42 B;  2XY7 A;  3I6P A;  1VIX A;  3B6B A;  3CMQ A;  1LK7 A;  4JI4 F;  3AD8 C;  3MM7 B;  3TAM B;  2B7B B;  3UWT A;  4DR7 F;  2HBR B;  3GWC A;  1I94 J;  5G0R A;  5J2M A;  4PQU B;  3T1H F;  1X4D A;  2J0S D;  1H72 C;  5SZT A;  1RTJ A;  1BY9 A;  4ZLJ A;  1TL1 A;  1FRK A;  2OO4 A;  3CTR A;  2R8G A;  3OFE A;  5CAA A;  4K4V A;  1FTR A;  4KR0 B;  1Q8B A;  2XGQ A;  4DUY J;  1NPP A;  4RUH A;  3SFG A;  4W4M A;  1TUG B;  3EXC X;  1TKD A;  2W2O P;  2CAJ A;  3FMW A;  4DS4 A;  3MI7 X;  4B9V A;  3A12 A;  2HBZ B;  1T8E A;  1NB7 A;  1G3O A;  2ACM A;  1NK9 A;  5J2M B;  3KWM A;  2BR0 A;  2MDA A;  1WC1 A;  3T5J A;  2YKQ A;  2MGZ A;  1U1Q A;  2OEL A;  3WIU A;  3SBM A;  5B0F A;  2X1G A;  3DRP A;  1N0U A;  2BAC A;  2BKN A;  2ZNZ A;  1C0T A;  1HBN A;  5L1I A;  3HCX A;  2JL9 A;  4UW2 A;  2F1F A;  4C4W A;  1HNW F;  2BE2 A;  1OY6 A;  3CIM A;  2XO7 A;  1AFI A;  4TN2 A;  2BOP A;  4M5H A;  6FD1 A;  3DGP B;  3N6L A;  1O51 A;  4BCA A;  7FDR A;  4DR3 J;  4NZ0 A;  2IY5 B;  2XB2 D;  4J9M A;  4RU9 A;  4WWS A;  4C8Z A;  1UJ5 A;  1S0N A;  4MFB A;  1S1V B;  3CW2 C;  5CAB A;  2VL1 A;  3SSR A;  2MGZ B;  2MTL A;  3MEE B;  4PG6 A;  4KBI A;  1S9E A;  1Z2L A;  3W7B A;  1WSR A;  3K57 A;  1Q8I A;  2DD8 S;  4PWD A;  1T0T V;  1WKK A;  3AT1 B;  4RR5 A;  4D3H A;  3D5M A;  3VAL A;  2AGO A;  1HBN B;  2CQP A;  1QUV A;  2FY8 A;  1YRX A;  1RA6 A;  4ENO A;  2IM1 A;  2ATC B;  4O3P A;  5IWA J;  4P7V A;  1K1Q A;  2W2M P;  3OHB A;  4Y00 A;  2VQE F;  4X64 J;  2W9C A;  2VON A;  3J7Y U;  3M2U A;  2D3O 1;  2PFD A;  2WVB A;  3W61 A;  1NPR A;  2F8H A;  4GMK A;  4OZ1 A;  4ES1 A;  1QAI A;  1S6P A;  3G4S S;  2AJF E;  1CJT B;  2QLW A;  5K5M A;  4HDG A;  2DR8 A;  3PKY A;  1A6L A;  2KG1 A;  1ZAW A;  1CSJ A;  1MG7 A;  2XYP B;  3ILJ A;  1ROF A;  4ER8 A;  3SSQ A;  4UOG A;  9RUB A;  1GMV A;  3V4I B;  2MHN A;  2CWX A;  2Z57 B;  2DCL A;  1YDL A;  2DEI A;  2YWE A;  4ZLN A;  3I4H X;  2V2V A;  4XO0 A;  1K73 T;  1UJ6 A;  1MSW D;  4C98 A;  3ZFV A;  3GYN A;  2IVF B;  5J2Q A;  2BQU A;  1LNQ A;  4CLW A;  4OJH A;  2OFH X;  1RU1 A;  2ZFH A;  3PAC A;  1S6U A;  2OGU A;  1NSQ A;  1J5O B;  5DG8 A;  3JYT A;  4CO2 A;  1XMQ F;  2N3O A;  2HW3 A;  4HT5 A;  2C1E B;  1DRZ A;  2N7Y A;  2HS3 A;  2J6S A;  2PII A;  5I42 B;  3L3C A;  1RBO B;  2JJ4 D;  4MK9 A;  4I2P B;  2WAQ D;  1U0S A;  2YQ1 A;  7FD1 A;  3OTE A;  3K8W A;  3V81 B;  1IKW A;  4LFB F;  1WOS A;  4R25 A;  1FTC A;  1WEL A;  3VAJ A;  3M9M B;  4ECR A;  2MZ1 A;  5HLF B;  3C6U A;  1Y3K A;  5T7L A;  1N34 F;  2FVS A;  1VQ4 S;  1NCL A;  3FK4 A;  3DRR A;  3E01 A;  2M8D B;  4UY8 5;  1RAB B;  3K7R A;  1R8B A;  1QTM A;  4K50 A;  1HQU B;  1NXI A;  2Y0S D;  4LUB A;  4ZP9 A;  3D1Q A;  4QIE A;  3S1T A;  3BM7 A;  1FK9 B;  1SL0 A;  1CUL A;  4ZPV R;  3KHH A;  3WX4 A;  4N5S A;  3K0J A;  5AT1 B;  2R7U A;  4B9T A;  4NA1 A;  2YWF A;  2QGF B;  1TVR A;  4B3T F;  4RW9 B;  2LXI A;  3FZ2 A;  3FEY B;  1BLU A;  3E01 B;  2BAB A;  4IG0 A;  3CME S;  4DPY A;  4JOU A;  4C3M A;  2CPE A;  3OL7 A;  2UXD J;  1CUL B;  1U6B A;  2ZBR A;  3QGG A;  2EW9 A;  1ZM2 A;  4P52 A;  4OYB A;  5GMD A;  4QYZ J;  2HS0 A;  2YWH A;  2W7P A;  3PKM A;  3G96 A;  4EYH B;  3ONQ A;  3Q8S B;  1IR0 A;  3PYG A;  3SI8 A;  3MM8 A;  5A8W A;  1DJ0 A;  5KTQ A;  3BGF A;  3WC2 A;  4I6A A;  3MEG B;  2DGV A;  2E66 A;  5J1E A;  1VLO A;  3FNN A;  3AOB A;  3MED B;  2IYG A;  5LMU J;  3BQ2 A;  2IA6 A;  1FD2 A;  1R27 B;  2KT5 A;  5JVG Q;  3ZZY A;  4KH0 B;  5AJ3 J;  2FC8 A;  3GFZ A;  2B56 A;  4OYM A;  1K1S A;  4JB8 B;  2UU9 F;  3M8Q B;  2CFX A;  3THV A;  2DGQ A;  4DV3 F;  1Q79 A;  2Y8Y A;  2NYH A;  2UUB J;  4NLD A;  1LEO A;  4NPO A;  5LM7 E;  4QWA A;  3LO3 A;  3DLG A;  3MCM A;  2XWY A;  4WII A;  1LQ9 A;  5A8W B;  4C6A A;  3TJA A;  4A8W A;  2RNE A;  5J1E B;  4C48 A;  2W2N P;  1E6V B;  5CHC B;  4LRD A;  2B9X A;  1U0H B;  2MKH A;  2EKY A;  3GV5 B;  2FZG B;  1ARO P;  5E0O A;  5M2P A;  3L09 A;  2E5J A;  4JI4 J;  3OL9 A;  2OI2 A;  1FVQ A;  1TV6 A;  4DR7 J;  2P6T A;  1GAO A;  4IKA A;  3PIP Q;  3T1H J;  3G86 A;  4LVN P;  1S0O A;  1LW0 A;  1IXK A;  3D2W A;  2WVF A;  1ZH5 A;  1RCX B;  3H98 A;  3TA1 A;  1SPB P;  1U1L A;  2JC1 A;  3VGS A;  1TKT B;  4NWB A;  4QIW D;  2GHV C;  3HVT A;  4G1I A;  2IPO B;  4LBH A;  1RTH A;  3PEJ A;  5DGB A;  1LKZ A;  2Q79 A;  2UV8 G;  4DV7 F;  4FKX A;  4C11 A;  3G8T A;  1RWP B;  2A0F B;  1YJW S;  3W1Y C;  2J5A A;  2IVY A;  5KG6 A;  1FA0 A;  4FYV B;  1RWU A;  3Q8V A;  1SXL A;  1PGZ A;  2PFF B;  3SQG A;  3HX9 A;  2B9E A;  2E5L F;  3KNA A;  5ITH A;  1LOU A;  3JTO A;  2B3T B;  4XPC A;  1LXN A;  3IR5 B;  3R97 A;  1D1U A;  2Z8Q A;  1KOO A;  2BQ3 A;  3SCL E;  4DF4 A;  3HVT B;  2W25 A;  3A13 A;  2VD3 A;  4KV8 A;  1VJW A;  2JEG A;  1F9F A;  4AQY F;  2DHG A;  1HNW J;  1SV5 A;  2AEJ A;  4OFZ A;  2F4F A;  2ZWO A;  4DBQ A;  5HVG A;  3BSA A;  3TAR A;  3CCJ S;  3Q8Q B;  1FDD A;  3AOA A;  4DDF A;  5D4O A;  2L08 A;  1TAQ A;  1OIA A;  3GR1 A;  3DOM A;  3THP A;  2Y0B B;  2UUC F;  4DX8 H;  4ECT A;  2GGP B;  3NLC A;  3B82 A;  2ROP A;  3UE2 A;  4ZPT R;  1C4A A;  2RIL A;  5U47 A;  2HGM A;  3NKY A;  4J9R A;  3PV8 A;  1TU0 B;  4CQ1 A;  1ITP A;  1IBL F;  4OZ5 A;  2CJQ A;  3ENV A;  3MCN A;  3M05 A;  1S4F A;  1JJ4 A;  4HVZ A;  4DQS A;  3FSI A;  1CJK B;  4QBU A;  4RKU C;  3A8I A;  1U26 A;  2IDE A;  2VQE J;  3AHP A;  2BJD A;  4X65 F;  3TAN A;  1SJ4 P;  1HIY A;  1RWM B;  1D0E A;  2IDL A;  3HVA A;  4KHP F;  2XS5 A;  1OYD A;  1NDP A;  4CO5 A;  2OLW A;  4KYZ A;  3EYZ A;  2PMH A;  2MKS A;  2GHW A;  2FJB B;  4FNH A;  4UY8 T;  1Z1Z A;  2LP4 A;  4CT8 A;  1G1X A;  1QAJ A;  5KG2 A;  4USI A;  4WFB Q;  2QA4 G;  5EHH A;  4Y2I A;  3JSY A;  2DO4 A;  5KFU A;  3K5M A;  4O0I A;  3HK2 A;  1C1B A;  4O44 B;  3PCO B;  4KH1 B;  1KNZ A;  5LSO A;  3C14 A;  4NYO A;  1T11 A;  2OAU A;  1OPZ A;  4YB5 A;  4NYP A;  2CJB A;  2AJ0 A;  1HBU B;  2DHX A;  4Z7C A;  4QYZ K;  4UST A;  2XI2 A;  1DLO A;  1YVF A;  1FRJ A;  1SJR A;  1RAF B;  5HP1 B;  5K20 B;  5D3G A;  1FKP A;  4OZ3 A;  2Z30 B;  3H42 A;  1GX5 A;  1XMQ J;  3HJF A;  2KO1 A;  2V67 A;  3C66 A;  3M2V A;  4DI6 A;  1YG0 A;  2PMZ D;  3MM9 A;  1DQ9 A;  3BQ1 A;  4LQ3 A;  1WHY A;  4LFB J;  4M5D B;  5KFX A;  3TZZ A;  4ZLL A;  3MD1 A;  1F6T A;  2EFO A;  4WTY A;  1M5H A;  2RB7 A;  3GTY X;  2C42 A;  3G71 S;  4EBD A;  2LDY A;  5L8R C;  2QV6 A;  4G65 A;  4USH A;  4JUZ A;  1N34 J;  1ZS6 A;  4GKK F;  5KFA A;  1FKP B;  1LWE A;  5KT5 A;  3VHQ A;  1F0X A;  4RWW A;  2F3J A;  3O5T B;  4P2F A;  3MUV P;  1HI0 P;  3ILO A;  4Z2X A;  1VBY A;  1O0P A;  4PKD B;  2VPX B;  3PO4 A;  3QLH B;  5I3P A;  1YIT S;  4U6P A;  4L6V 3;  3LP1 B;  4WP9 A;  3QO9 A;  3P96 A;  3PRD A;  4WE1 B;  2LQJ A;  1REV B;  5ETK A;  3OHA A;  2C2Z B;  2EXU A;  3PG9 A;  3IRX B;  1N0V C;  4B3T J;  1NJW A;  3UO0 A;  3R7B B;  2CKW A;  2GQ2 A;  3N01 A;  3MAH A;  1UEV A;  3SIP B;  4J91 A;  4F36 A;  2V2Z A;  1FFS B;  1RU2 A;  4F2R A;  4B3S F;  2UVW A;  4K8R A;  5D8H B;  4MJK A;  1I1G A;  2I38 A;  3K17 A;  1LWF A;  3QO9 B;  2IJF A;  1Q82 T;  2MJU A;  1N88 A;  1H74 A;  4F3Q A;  1G6B A;  1TK0 A;  3HD1 A;  5KFN A;  1HW8 A;  2DBB A;  3W64 A;  5C25 B;  3KYL A;  2WSE C;  1HI1 A;  1RZM A;  1N4L A;  1D3W A;  2LMI A;  3G8Q A;  4JI6 F;  2F40 A;  4QWC A;  3WC0 A;  2V6A A;  2LYV A;  2Z2M A;  5HSP A;  3CJR A;  3EGZ A;  2HQG A;  3J81 j;  2PT0 A;  4DL3 A;  2FJV A;  2OEK A; 
#chains in the Genus database with same CATH homology
 1PAU B;  2C2K B;  2C2Z B;  2HBR B;  3D6F B;  1GFW B;  2XYG B;  5IC4 B;  1QTN B;  4ZVQ B;  4ZVO B;  2CJX B;  1I3O B;  1SC4 B;  1RHQ B;  2QL7 B;  3R7B B;  3P4U B;  4DCJ B;  3KJF B;  2XYP B;  1SC1 B;  3KJQ B;  1RWM B;  1RHR B;  2CNK B;  3SIP B;  1RWK B;  2P2C B;  2FQQ B;  2Y1L B;  1NME B;  1RHK B;  1QDU B;  1RWN B;  3D6M B;  5IC6 B;  4ZVU B;  1ICE B;  1RWW B;  1RWX B;  2CJY B;  3D6H B;  3KJN B;  2CNN B;  2H65 B;  1RHM B;  3GJS B;  4ZVT B;  2H5J B;  1IBC B;  3EDQ B;  3R7S B;  2QL9 B;  2H4W B;  1BMQ B;  3R6G B;  2HBZ B;  2H5I B;  1RE1 B;  2H54 B;  2CNL B;  2H4Y B;  3GJT B;  2XZD B;  2XYH B;  2Y0B B;  3NS7 B;  1PYO B;  2HBY B;  2CNO B;  3IBC B;  4ZVP B;  1RWO B;  1F9E B;  4DCP B;  4ZVR B;  4JB8 B;  3R5J B;  3R7N B;  4DCO B;  2C1E B;  2C2O B;  3R6L B;  2XZT B;  1SC3 B;  2H51 B;  3RJM B;  1I51 B;  1RWP B;  3P45 B;  1RWV B;  2H48 B;  4ZVS B;  2HBQ B;  2QLJ B;  4LSZ B;  2QLF B;  2QL5 B;  2QLB B;  3IBF B;  2DKO B;  2C2M B;  3GJR B;  3QNW B;  3GJQ B;  1RHJ B;  1RHU B;  3EDR B;  5K20 B;  2CDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...