4URQU

Crystal structure of ggdef domain (i site mutant) from t.maritima
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
LTGLPNRRYFFELGNRYLDLAKREGKKVFVLFVDLAGFKAINDTYGHLSGDEVLKTVSKRILDRVARSDVVARYGGDEFTILLYDMKEEYLKSLLERILSTFREPVRVENKHLSVTPNIGVARFPEDGENLEELLKVADMRMYKAKEMKVPYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DIGUANYLATE CYCLASE
publication title Structure of a Diguanylate Cyclase from Thermotoga Maritima: Insights Into Activation, Feedback Inhibition and Thermostability
pubmed doi rcsb
source organism Thermotoga maritima
total genus 52
structure length 154
sequence length 154
chains with identical sequence V, W, X, Y, Z
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4urqU00
4G3IA 4DL7A 4NLUA 1JLQA 3HVTB 1C1BA 1RT1B 4WFZA 1T03A 2DPIA 4ECTA 3PR5B 3MFHA 4PQUA 4TQRA 3BGRB 5F8LA 2WOMB 4TQSA 2F8EX 2BQUA 2BQ3A 3UR0A 4RW7B 2AGPA 1FK9B 1RTJB 1QUVA 2VG5B 3BSNA 3RB4A 3QO9B 5F8JA 4J9MA 3GQCA 2J6TA 2ZD1A 4ECQA 3RAXA 3C6UB 4HYKA 3D28A 3CWJA 4K4WA 1QE1B 2HNYB 5J1EA 2FLLA 5KFJA 1JKHA 3NGDA 2W7OA 1HARA 3I0SA 1IKVB 1HMVA 1RTHA 3BJYA 2YNHB 5J2MB 4G1QB 3SFGA 4J9NA 4U7CA 5C5JA 1RTIA 4YR3A 4MFBA 1HQUB 4RW4B 3BSOA 3I5CA 4DL3A 2AQ4A 3OHBA 4B3OB 1K1SA 4Q45A 3OSNA 4H54A 3D5MA 4TYAA 2XCAA 4ECWA 3KLIB 2FVCA 3CVKA 1IKYA 1JLCA 5C42B 3DRSB 3UPFA 4NLDA 1RTDB 3V6DB 3KMQA 2RF2A 3QIDA 5KG0A 5KFCA 1S9EB 3KHLA 1LWEA 4ECVA 3DM2B 1HNVA 1MMLA 5KFKA 1KLMA 3DLKB 2UUTA 3M9NB 4ZVFA 3GV8B 1BQNA 1T94A 4RNNA 2JEGA 3DOLB 3G6VA 2GIRA 3ISNC 5D3GA 4PUOA 3E51A 1C2PA 2OPPB 3DOKA 4J9QA 2R8JA 2ZKUA 4I2QA 4GC6A 1S0NA 1TKXA 1GX5A 2I1RA 5JUMA 2JC0A 1JLGA 5KT6A 1RT2A 3DLEB 2VG6A 4RW8B 1C1CB 3CO9A 2D7SA 1I6JA 2DPJA 3DMJA 2OPRA 2XWYA 4QW8A 5KT4A 2FLNA 2JEJA 2IAJA 2UVVA 5L9XA 5J2NB 3PW4A 4I2PB 4YP3A 1LW2B 3IGVA 1S0MA 4J9OA 3NKYA 2C22A 5HLFA 2W9CA 2YKNA 1RAJA 4TXSA 3N6MA 4ZPCA 4RUCA 2R8GA 2YNIA 4WZMA 4K4UA 5KFTA 4RW6B 3RB0A 3V6KA 1S6QA 5KFNA 3GILA 4TN2A 4K4TA 4NZ0A 3PW2A 4O3SA 1HYSA 2I5JA 4ECSA 2ATLA 1LWCB 3KLGB 4PWDB 1S97A 4YMEA 3H5SA 3Q8SB 3E01A 2ALZA 3QGHA 3CJ4A 4MKAA 3PR4A 4XO0A 2HNDB 3DDKA 4NLSA 3OL7A 4F4WA 2HNZA 3MR5A 5EUHA 5HROA 3KK2B 4H4MA 2B43A 3KLHB 2JEIA 4JV1A 1EP4B 1S1XB 1IKWB 1NHUA 3DRPA 4KKOA 1JLQB 3CDEA 3KLFA 3RB6A 1C1BB 5EWEA 1UWBA 3CJ0A 3Q8RB 3MEEA 4IRDA 4PQUB 2ASDA 3T5KA 2J6SA 4WFYA 1QAIA 3M8QA 4XPCA 1RT6A 4TYBA 4DL5A 3H59A 3PVXA 4KV8A 3V4IB 2D41A 2RDJA 1JLFA 3I5AA 1S9FA 4WXOA 5HBMA 3HVWA 5KT7A 4R8UB 1RYSA 5KFRA 3PHEA 3OSPA 1TV6A 2B6AA 5J1EB 1D0EA 2VA3A 4RNMA 4ICLA 5K14B 1JKHB 1HPZA 2YNFA 4NLQA 4NLYA 3FRZA 3I0SB 5FDLA 2E9ZA 4TY8B 4O44A 4ZP7A 1N48A 4NCGA 4ED3A 2XGQA 2IC3A 3FFIB 4FS2A 1JLBB 1SV5B 2VG7B 1RA6A 1S9GB 3ITHB 2OH2A 3EZUA 3GIMA 4LSLA 5KFQA 1N6QA 5I3UA 4QWAA 3OLBA 1S1WB 2FVSA 4MIBA 2EC0A 4MKBA 4K4SA 4RUAA 3KNAA 1IKYB 1JLCB 2W9BB 4QWDA 4ED1A 5KFZA 3QGGA 5KFHA 4DL6A 2RF2B 2WONB 3G6YA 5DG9A 2FJVA 3JSMB 1IKXA 4WZQA 4DG1A 1SUQA 1S49A 4Y34A 1KLMB 4O4GB 1LW0A 2AX0A 4LSNA 4MH8A 3M9OB 3CJ3A 5CYMB 5F8HA 1VRUA 3CJ5A 4QWEA 5KG4A 1RT4A 2IM3A 3LP1A 3BSAA 5KG1A 4NYZA 5F8MA 4RNFA 5D3GB 4PUOB 3DOKB 1N4LA 1XR7A 4DL4A 3DI6B 4I2QB 3LP0B 3BR9A 4ZP9A 4IFYA 5KG6A 4K4VA 2GC8A 2BRLA 5C25A 1TKXB 4X2BA 4Q44A 3QLHA 5DG7A 4IDKB 5KFEA 3MTKA 1RT2B 2YNGA 2VG6B 4IH5A 4WYLA 4EEYA 4K4YA 4ID5A 4H4OA 3KJVB 2HMIA 1FKPA 2BANB 2OPRB 3LALA 3BQ2A 3TAMA 2YKMA 1RT5B 2XI3A 2XCPA 5L1JA 3MEGB 3TQ1A 5KFYA 2W8KA 3RBEA 2V4QA 1TVRA 4J9LA 4RW9B 4Q8EA 1RT7B 3ISND 4ED7A 2FLPA 1N5YB 4M95A 4KFBB 4IKAA 2W9CB 4YR2A 1K1QA 1VRTA 2YKNB 3CDUA 3ICLA 1TL1A 2YNIB 3NBPA 2W8LA 4K4ZA 1Z4UA 4IH7A 2V9WA 4ZHRA 1S6QB 1J5OA 3HKWA 4ECXA 5KFDA 5KFOA 2I5JB 5KFLA 2BE2B 2JLEA 5C24A 4QWBA 5F9LA 3MR2A 2ASJA 2AGQA 2CKWA 2B5JB 2OPQA 1EETB 4ZPBA 3H4DA 1S6PA 3H5UA 1JLEB 1JLAA 4F4YA 3IS9B 4Y2AA 1D1UA 1RT3A 2OPSB 3PJXA 4KE5A 1ZTWA 3KLEA 1R0AB 2WK4A 4MIAA 2ILYA 4I7FA 3KK3A 1QAJA 5HROB 2UVWA 4H4MB 3BGRA 3M9MB 1KHWA 2WOMA 3H4BA 3DRRA 4XPEA 3DRPB 4Q43A 4KSEB 5I42A 3QO9A 1TKZA 3MEEB 1C0UA 3HHKA 5KFSA 3H5XA 5HP1A 1RA7A 3V81B 2V4RA 3N6NA 3M8QB 4Y2CA 1RT6B 2HNYA 3H2LA 4ZVEA 5KFBA 4ZPDA 5HBMB 3M8PA 1T3NA 5KFIA 5KFFA 4DL2A 5J2MA 4IG0A 3PZPA 3IRXA 4R5PA 3MR3A 5KFGA 4ICLB 4ZVGA 1HPZB 3I0RA 2ILZA 4FS1A 4ECZA 2W7PA 5DLFA 1HQUA 5FDLB 2IBKA 4O44B 1JX4A 3DYAA 5KFAA 2R2TA 1WNEA 4B3OA 2IC3B 1IM4A 1MU2A 4EBEA 2C2RA 2HWHA 3LP2B 4IG3B 3KLVA 1TQLA 4F4ZA 5C42A 2J6UA 3UQSA 1N6QB 1RTDA 1T05B 4J9PA 4J9SA 3EPIA 1OS5A 3QYYA 5KG2A 2WRMA 4KO0A 5DG8A 1LWFA 1KHVA 1TL3A 3NAIA 3FQLA 4KHRA 1T03B 2C2DA 1S48A 1IKXB 1RYRA 4YR0A 3EPGA 2R2UA 1FKOA 4WE1A 1JIHA 1LW0B 2WB4A 2HWIA 2QE5A 4ZP6A 4KAIA 2R8KA 1RT4B 2ZD1B 4Q0BA 3LP1B 3MF5A 3FQKA 3DLEA 4R0EA 3OL8A 3NMAA 1C1CA 2CJQA 3MEDA 4RNHA 2IJNA 3CDWA 4IFYB 5KG7A 1HMVB 1RTHB 3KHGA 4IFVA 5DGBA 2FVRA 4ED2A 3QLHB 3MECA 3GIJA 2YNGB 1CSJA 3OL6A 5J2NA 1RTIB 1S1VA 1SH0A 1TP7A 4ID5B 4H4OB 4MFBB 1DLOA 2QV6A 4MK9A 1W25A 2JC1A 2YKMB 4EBDA 1YVFA 1JXLA 5KG3A 4FBUA 4KHMA 3RB3A 4IR9A 4NLVA 1TVRB 3NAHA 3HVAA 1REVA 2D3ZA 5CYQA 1S1UA 5L1LA 2ASLA 2V0NA 3BSCA 5DQIA 1VRTB 4IQXA 4WYWA 4F50A 1LWEB 3KOAA 2GIQA 3KLGA 4ED6A 4PWDA 1HNVB 3JYTA 4ZHRB 3BQ0A 3LANA 4QWCA 4QPXA 2IM1A 3DLGA 1TKTA 1BQNB 4NLPA 5C24B 1HNIA 2XGPA 4F4XA 1S10A 3RAQA 1NNDA 4O3QA 1S6PB 4Q8FA 1JLAB 5DQGA 4ECYA 4MK7A 1C0TA 4JV0A 4WFXA 3GIIA 1JLGB 1EP4A 1IKWA 1RT3B 5KFWA 2FVQA 4IRCA 2AGOA 1S1TA 4IH6A 3KLEB 4NLRA 5J2QA 3SI8A 2AU0A 3KK3B 4I7FB 3MR6A 4ECRA 4NLXA 4M94A 5KT2A 3DMJB 2VA2A 3DRRB 4JV2A 5KFVA 2IAJB 3QIPA 4WXWA 3T1AA 3KK1A 2C2EA 2HAIA 5F8IA 2UVUA 1DTTA 5I42B 3V4IA 5J2PA 2IJFA 4J9RA 1TKZB 4NRTA 1C0UB 4ZPAA 4GC7A 2RDIA 2ZE2A 3T19A 4R8UA 1RDRA 4LQ9A 5EWGA 5HP1B 2FVPA 2O5DA 2D3UA 5HLFB 1HQEA 5K14A 4OL8A 4TY8A 3M8PB 5F8GA 4IG0B 3IRXB 1BQMA 3FFIA 1HYSB 1JLBA 2RKIA 1SV5A 2VG7A 3IG1A 4R5PB 5KT5A 3GV5B 1S9GA 3I0RB 3ITHA 2FJXA 4ED0A 3T5HA 3PW5A 3DYAB 5F9NA 5L1IA 2FJWA 4EO6A 1S1WA 1MU2B 2XI2A 2BRKA 3E01B 3C6TA 1DTQA 4NRUA 4IRKA 4NLGA 4URQU 2W9BA 4RNOA 3PW7A 3HVTA 1SH2A 2WCXA 1RT1A 3UDLA 4EBCA 2JEFA 2HNZB 2WONA 4MK8A 4URSA 4O3PA 4TY9A 3JSMA 3G86A 4KO0B 3KLFB 4KKOB 4RW7A 4O4GA 3T5JA 1FK9A 2VG5A 1LWFB 1RTJA 1TL3B 3PJWA 1UWBB 4NLWA 5CYMA 4ZVHA 5KFUA 4Y3CA 4LQ3A 3CIZA 4J9KA 4EYIB 1SH3A 3T5LA 3C6UA 1ZTTA 4ED8A 4FBTA 1FKOB 5EDWA 4WE1B 1QE1A 3H5YA 4KV8B 3LAMA 3DI6A 3LP0A 1JLFB 4KB7A 1IKVA 1GX6A 4DEZA 4O3RA 4YQWA 2YNHA 4Q0BB 4G1QA 1N56A 4IDKA 3KHHA 4U6PA 1TV6B 2B6AB 3PW0A 3MEDB 3BREA 2YNFB 3KJVA 4RW4A 2BANA 3IGNA 4IFVB 4NCGB 2E9RX 1RT5A 3MECB 3MEGA 2IMWP 5KT3A 3V6JA 1S1VB 4O4RA 3KLIA 4JUZA 4RW9A 1DLOB 4ZMMA 4LSLB 1RT7A 3DRSA 3CJ2A 1ZETA 5I3UB 1N5YA 3OL9A 1U09A 3V6DA 4KFBA 2UVRA 3QZ7A 3BQ1A 1S9EA 4O3OA 3Q8QB 2IM2A 1REVB 3QGIA 3DM2A 4IOBA 5CYQB 1S1UB 4ZP8A 4URGA 3DLKA 3SFUA 3FSIA 4K4XA 3Q8PB 1XR5A 2C28A 2BE2A 2UUWA 5KFXA 3DOLA 4DG1B 3LAKA 1SUQB 2B5JA 3JYTB 1EETA 2OPPA 2WTFA 4IR1A 4LSNB 4K50A 2BQRA 5KFPA 1S0OA 1JLEA 1VRUB 5T14A 3DLGB 3KMSA 2R2SA 1TKTB 3IS9A 2W9AA 4EYHB 1HNIB 2OPSA 4RZRA 4RW8A 5L1KA 5DQHA 1R0AA 3H40A 3H98A 2R2RA 5C25B 1C0TB 5JXSA 4HKQA 1S4FA 4EO8A 3MFIA 2E9TA 5EWFA 1S1TB 5J2QB 3V6HA 2AWZA 4I2PA 1LW2A 2HMIB 1FKPB 3I5BA 3V81A 3TAMB 2R8HA 3OHAA 3KK1B 3QIPB 3RBDA 4TLRA 4QW9A 1DTTB 5DLGA 5DGAA 5J2PB 3KHRA 2XC9A 2WHOA 2IM0A 3TVKA 4RU9A 2ZE2B 4RW6A 5KG5A 3GYNA 2BR0A 3G6XA 3QZ8A 1HQEB 3NL0A 4O3NA 1LWCA 1TL1B 3NBPB 4KBIA 1NHVA 3IN5A 3OLAA 1J5OB 1BQMB 2RKIB 4ECUA 3IG1B 2IA6A 3LP2A 4IG3A 4NLTA 1XR6A 3N6LA 2HNDA 2OPQB 2R8IA 5KFMA 3GV7B 1T05A 2AX1A 4NLOA 3FDSA 5F8NA 3VQSA 3C6TB 3KLHA 3KK2A 1DTQB 3GIKA 1S1XA
chains in the Genus database with same CATH superfamily
2C2NA 3HVTB 1C1BA 3MFHA 5F8LA 2MZRA 2BQUA 4PG6A 3PFOA 2Q6CA 4USUA 2DNMA 4Y28C 2EFPA 1QE1B 2PC6A 1JKHA 3NGDA 2KTQA 3I0SA 4YY3J 1WC0A 2KM8B 3IC1A 2Z57B 3JTOA 1JJ2R 4KGVB 2RUGA 2OEJA 5MLCV 4ILLA 4RUBA 4NXNJ 3KMQA 2KFNA 2C3YA 5CZVA 3DOLB 1S0VA 3HO1A 2QIFA 5U47A 4X65F 2FLNA 1C4CA 3BZQA 1NDKA 3IGVA 5A0YA 5HLFA 4ZPCA 2I5JA 4PWDB 1HI0P 1QTMA 3E01A 3PR4A 4F4WA 2HNZA 4N8NA 1FJ7A 1SKUB 3T1HF 4ZVQB 3POTB 4TYBA 4DL5A 3LH2S 1JLFA 5LOQA 2E5GA 3MEKA 5FDLA 3CJQA 3CJRA 1U1OA 2ZH4A 4DR1J 5IWAF 1RA6A 4LREA 5KFQA 1NK8A 5ETKA 4HACB 1NDCA 3FMWA 2FJVA 4WZQA 1IKXA 4X4OA 4NL5A 1TTHB 2XHWA 4NYZA 5D3GB 4ZP9A 3BR9A 4IFYA 2XMMA 2ZWPA 4DSEA 4IH5A 2HURA 4LF9J 2MKSA 3SQGA 4WTYA 3VWSA 2YKMA 3CGIA 3RBEA 3NNCA 3JB9k 2W9CB 2YKNB 3R5CA 2OI2A 1FTRA 4KRWA 5KFLA 2KYZA 3R2DJ 1Y11A 4JV5F 4KE5A 3CJKA 2IJRA 4LRFA 1QAJA 4H4MB 2V4JB 1F1BB 3QO9A 3IM8A 2QLJB 2X1GA 5DDOC 3TOQA 1KTQA 4LF2A 2W01A 2GX8A 3TUJC 5IV4A 2DRAA 3KDOA 1FRHA 3NCQA 3FGVA 2KRRA 3K7RA 1RTDA 2XO6A 4W90B 3CW2C 1E6VB 1T03B 2XYGB 2C2DA 3RGIA 3K59A 5J1NA 3E3XA 4CTAB 4HHJA 1CQNA 4X64F 2YQ1A 3Q8YA 2X1FA 4CLPA 1CSJA 4ES1A 3F0NA 4NXMF 2H5JB 2OLWA 1CJKB 2MKJA 4KHMA 2E5LJ 2FYXA 1OPZA 1S1UA 2Y0SD 2V0NA 2AT1B 2RS8A 4F50A 3KOAA 2VQEF 4ED6A 3C19A 2V2ZA 5ETVA 1RHJB 1HNIA 1JLAB 4FZVA 4JV0A 1QM9A 3UN3A 4CDIA 3KK3B 4I7FB 1WORA 4L75A 5KFVA 2CPZA 5J2PA 1TAUA 1LEOA 3L09A 1QLNA 2HKEA 2RIJA 1U2RA 2VG7A 2CZVC 3KDNA 3DXBA 2L08A 1YJVA 4C8MA 4BHQA 3AJDA 2KKHA 1CJVA 3G87A 4DN0A 3HVTA 1SH2A 1I51B 3TJAA 2JHEA 2H4WB 2M8HA 2FJAB 4KKOB 3PJWA 2YX7A 1UFLA 5CYJA 4FBTA 1QE1A 3JAMU 2ZH3A 4Q0BB 2FHOB 2H65B 3M1VB 3Q89A 2W24A 1U2CA 1NB2A 4WPAA 1RT7A 1U09A 4DFKA 3RAMA 1B7FA 3ELHA 3DHWC 3DOLA 4WIQA 1SUQB 2B5JA 2AKWB 4CLZA 4TNOA 1DQAA 1H2UX 3ILIA 1R0AA 3H98A 1TL7B 3UE2A 2WVFA 1F9HA 3RBXA 5JXSA 1S4FA 3OTOF 2CQ3A 3MFIA 3D6TB 1CC7A 1UMJA 1PAEX 3BN4A 3KK1B 3KHRA 1IBMJ 1H74A 4QJVA 3MM7B 2G0IA 1WJ9A 3LF0A 5IV3A 5LMUF 3QRPA 3BPDA 2GAGC 3U1MA 1JJHA 4D3GA 3GIKA 1MWYA 9ATCB 3MMBA 2XG8A 1N5VA 2CQIA 3AFGA 1VBZA 2AGPA 2CQ4A 4UUXA 1UJ4A 1RLDA 1HMVA 1SI9A 5HJYA 1T9VA 1VQLS 2WBMA 4UY8T 1U1MA 4K0KJ 3CD5A 4L73A 4HACA 4NA1A 1B0TA 1WC5A 3SCLE 4BWMA 4P71A 1LWEA 1F5CA 1FRJA 2VFTA 3M9NB 3EUNA 1T94A 5D3GA 5HMXA 1TAQA 1IBKF 2PFFB 1O51A 2J8SA 2W9CA 2YKNA 1EHWA 1EAYC 5J1PA 1HYSA 3PW2A 1MG7A 3QGHA 4Y2KA 2AYEA 1MN9A 2XYHB 3JXOA 3KK2B 4H4MA 1VQ7S 2V4JA 1IR2A 4WFYA 2ABYA 2RDJA 3I5AA 2WVEA 1GMWD 1ZAVA 3G82B 3K5OA 1X4EA 3IWLA 2KL8A 2KT5A 2K1RB 4M5NA 3IM9A 3SEOA 1NK9A 3A3OB 1IR0A 2EC0A 2UP1A 3HFZB 5L9NA 1XK8A 2XLKA 1E6VA 3VAGA 2RF2B 3G6YA 3R6LB 4OYPA 3R27A 5CYMB 2P5VA 3AQPA 3G8TA 4CTAA 3SBMA 3KJQB 4UTGA 5AXLA 2HIQA 1RT2B 3BYPA 2RRAA 1JWWA 4BS2A 4RL1A 5B0DA 4KFBB 4DX6A 3PX4A 1RISA 3QNWB 1B0PA 2L9NA 4IH7A 5HANA 4CO1A 1F6TA 3BKTA 5F9LA 1V5VA 3BF4A 2GZOA 1Q82T 3GU0A 1JLAA 2BJ7A 3LW5C 4A8YA 2ALYB 4MIAA 3KK3A 4I7FA 2HGNA 1IUJA 4X4UA 2MXYA 4Y2IA 4AYBD 1WC3A 4KSEB 4TU7A 3MXHP 2DGQA 3NGKA 4M1KA 2KXFA 4OX9J 1PYTA 4X4TA 3MR3A 3QT7A 2OTJS 2EC2A 5KFAA 4B3OA 2D3OR 4ZVTB 2V2KA 3ULHA 3EPIA 1CEZA 5F3ZA 2HLTA 4LF6J 2VC0A 2QTWA 2CPXA 3HD1A 4PPDA 2D9OA 3RW6A 4G1PA 4Q0BA 3M1VA 2ATCB 1B99A 5M2PA 4DPYA 2Q1LA 1XNQJ 3NWGA 3HM9A 2NUUG 5DZ6A 2UXCJ 4MT1A 2D3ZA 4CT8A 3R5JB 3MHYA 3FVYA 1B7YB 4WK1A 4OJGA 3BO2A 1YZ7A 3BDEA 4EWTA 4WFXA 3R6GB 1BGXT 1SJ4P 4ECRA 5H9FK 4M94A 3FC9A 3KK1A 3D3CJ 1HD0A 2F9DA 4DV3J 1R43A 1RDRA 3MM7A 3EGZA 2O3DA 3SMZA 2ROPA 5DETA 1XJWB 1YTYA 4CNZA 1YJ9S 4R5PB 1DBDA 2GMJA 1FEEA 2MHNA 4EO6A 1WHWA 2O66A 4U96A 1NAQA 3VAMA 4WBFA 2HBQB 4USMA 4KH0B 4DSLA 4TY9A 4A8XA 1YDLA 1SC4B 4WKRA 4NLWA 1FWKA 4RO0A 5AJ3J 3P96A 1VOMA 2MKKA 4OYOA 3VV2B 3KHHA 1SJQA 3VAKA 1S12A 2OD6A 4OZJA 4ZPWR 2FIUA 3HXMA 1RGVA 5LT5A 3OL9A 3RZAA 1K0TA 2GMHA 3DNCA 3MPDA 2Y1RI 2G2ZA 1EETA 4LSNB 3HT3A 2W9AA 4DLEA 3R9LA 2UXBF 3B4MA 3HLUA 2E9TA 5J2QB 2QL9B 2WVBA 2GJFA 3NOCA 2GCFA 4S0MA 1WEZA 2XC9A 3GYNA 1KQGB 2UUCF 1QAXA 3UVJB 3OXLA 3CCVS 2QA2A 3FUYA 3N6LA 3SCJE 3K89A 3TP2A 2R8IA 4DV2J 4ZVUB 3KK2A 4NLUA 4ZK7M 4DWIA 4QOTA 4I4BA 1VC5A 4HTJA 5F8JA 2KZMA 3A4TA 2IVYA 4WF9Q 4G1QB 3NGUA 4J9NA 1OWXA 4Q45A 2F4VJ 3CCWA 3NEKA 2DJWA 2LKZA 2EG2A 2RF2A 5D4OA 3AT1B 2B3TB 1MMLA 2B0GA 4P7VA 3GJRB 4ZVFA 1S99A 2GIRA 3MPYA 1KTVA 4JI0J 5KT6A 1QD1A 2E44A 1RT2A 1UAWA 2D7SA 1AFJA 1YHQS 5E41A 4YP3A 5D4NA 3W8PA 4Z7YA 1AW0A 2XS2A 2FY8A 3CXCR 1RE1B 1X4GA 2V9KA 2WW8A 2J8AA 2ATLA 1PAUB 2LEBA 1S97A 2CQ1A 4DMZA 1H98A 1DFDA 4F2RA 2V8PA 4TU9A 2LP4A 3IBFB 1RWMB 5T7LB 2XLIA 1JLQB 3QAEA 2V94A 3V4IB 3SQOP 5ADZA 3RR7A 1IVZA 3CT9A 3RRKA 3PHEA 4QZVB 2B6AA 4B9NA 3FFIB 3GMGA 1FF2A 1YQHA 2UUAF 1K73T 3OLBA 3CJ8A 1FJGF 4CO3A 2UU9F 2G13A 2ADBA 2LQ9A 1CQMA 5CXTA 1SVDA 2DNKA 3D0IE 3MCSA 4X62J 1HFEL 1TKXB 5KFEA 2HMIA 1FKPA 3QAUA 2BABA 1NSQA 1U0HB 2XCPA 1TL5A 3M2UB 5B0BA 1Q8KA 3DN9A 1WOOA 3A8EA 1J5OA 2BE2B 4LVNP 1XQIA 3W66A 2ZJQQ 1HHQA 4C11B 3WX8A 1ZTWA 5HROB 2WOMA 4DCPB 1XNRF 2A6MA 3FBFA 1FX2A 4Y2CA 5LXYA 5IQ6A 3BR8A 2YY3A 4R5PA 1WTBA 2W7PA 1HQUA 4FP9A 2NLWA 1Y5IB 5DG8A 4OI6A 2EFQA 2F63A 5BR8J 3C8YA 3EPGA 1KVIA 1FVQA 3E8OA 3DLEA 1WACA 4LF8J 1QVGR 4C2MA 4U7UD 3ZTOA 1N34J 3J80Y 3VR1A 3TARA 3OBIA 3HHEA 2JC1A 2K3IA 2MQNA 1S72S 1Q81T 2F4FA 3C16A 2R7VA 3UO0A 1F9FA 5ETRA 4PAAA 2HQDA 2XULA 3SYZA 3EGNA 3WQPA 3ZXWA 3J7A1 4IRCA 3VVUA 3KLEB 5J2QA 4ES2A 2OEKA 2IAJB 2ZITA 4NXNF 1VYAA 2MY8A 1W7WA 3S6EA 3UD4P 5F9NA 3AOBA 3VTIA 1NK5A 3LWMA 4URSA 4P75A 1XMBA 4IO1A 4M5KA 1U1LA 4OZLA 1ZM2A 1PBAA 2NYIA 1J5EJ 2MQMA 1NSPA 3W1YC 5HK4A 1H3DA 3NCPA 4G1QA 2RHSB 1NB7A 2M0GB 2ZH8A 1HKAA 1ULRA 4IFVB 2VIHA 2DH9A 1S6UA 4O4RA 4B3SJ 4C7QA 1Y0HA 2PMZD 2RQKA 3QGIA 5CYQB 3SFUA 4Y2MA 2QYGA 2XBPA 1T7PA 2Y1LB 3B54A 2PE8A 4B3MJ 4LUBA 1BQXA 3DXSX 2ZFHA 3FMBA 2O1PA 2HIYA 3ZFVA 2P6SA 4OJ1A 2AWZA 2B4PA 4LF7F 1WI8A 4QPTA 2Q43A 1T95A 3GR1A 3G6XA 1HQEB 2CWKA 2H4YB 3NBPB 3MZIA 3ZZPA 3GV7B 5C2CA 1Y3JA 5T7LA 2RRBA 1JLQA 1WELA 4WFZA 2DPIA 4DJBA 3R7NB 1Q8BA 3PYFA 4USKA 1FT8A 3PFEA 4FF3A 2LVWA 1V3SA 3SFGA 3MCMA 5GAEI 2VZ9A 4DL3A 2M8DB 2KRBA 4NYOA 2XCAA 4F3QA 5C42B 2NQPA 3C15B 3DGVA 1NK4A 5CHCB 5H9EK 1R27B 4Z2XA 2CQGA 2OELA 5E3QA 2JX2A 1L3VA 4GC6A 1NZAA 4USWA 1TKXA 1JLGA 5CABA 1S6OA 5I3QA 2KT2A 2XWYA 1U0HA 3M8SA 1R6VA 3M2UA 4CH1A 3VAIA 3PW4A 4N5SA 1N36F 5LMNJ 1N5SA 3B4DA 2Q6BA 4RUCA 2R8GA 4IOAQ 4NMXA 1KR4A 3MM5B 3ZNJ1 3MAAB 2CDRB 4WU3A 4XO0A 4C11A 4NLSA 3NMRA 4F67A 5HROA 1Q8LA 4G1IA 2XM3A 2Y0BB 1UWBA 5FJ4A 2W7AA 4GKJJ 4KV8A 3L95X 1IWGA 3M30B 2VA3A 1KNZA 1QY7A 3FRZA 2ZH9A 3HD2A 3N9UC 1N33J 3F56A 2OH2A 2NXNA 3NOGA 5IM0B 2BJ1A 1PJ5A 5LJ5Y 2HS3A 3I4PA 3P5BP 1V6HA 1YSJA 4MKVA 4QYRA 1HLWA 4QWEA 1UCNA 3JQMA 1WG1A 1O5JA 3EGVA 1XMOF 1R0BG 5DG7A 1FFGB 2BJ9A 4ZN3A 1C4AA 1UW4A 3MEGB 3OFGA 4RW9B 2R7XA 2DNZA 1D8ZA 3OTBA 1RABB 3ICLA 1APSA 4PXBA 1Z4UA 1S6QB 4DX5A 2J9DE 4B3TJ 2ASJA 2CVEA 4L3KA 2VDIA 2OPQA 4N41A 4UT4A 4F4YA 2OPSB 2WSFC 4FXDA 3KLEA 3FBCA 3K58A 1J27A 2B9EA 1X9SA 3OXGA 4X84A 1U1NA 2H5EA 3HMJG 1VQ8S 1UZDA 4X66F 2KO1A 3HVRA 1NK7A 2VFVA 4IG3B 1K44A 3U7JA 2J7KA 4F4ZA 3UDCA 4M8LA 2HVDA 4DCOB 2ZZMA 2R2UA 2R8KA 3TZWA 2R7QA 4JI4F 4RU2A 3U02A 4A47A 1U25A 2EFNA 2NSCA 2XZTB 4IFVA 5DGBA 4F0KA 1WUUA 1WHYA 1RTIB 3HPOA 4CLFA 4MFBB 4RR5A 5KG3A 4IR9A 3E2EA 5CYQA 7FD1A 2GIQA 1FRXA 2O01C 5GVQA 4UQGA 2CAJA 3H25A 4NZ6A 4PYAA 4CLLA 4X4RA 2MGZB 1FDAA 2V68A 3ET6B 2VH7A 2KDOA 2CQBA 4DV6J 3MMJA 2GVDB 2W2NP 2VB6A 1HQEA 4TY8A 1P27B 1Y3KA 1RWUA 1SV5A 2W2QP 1R3NA 3Q2TC 2MKYA 2FLOA 4NRUA 3PW7A 3EXCX 2JEFA 1KP6A 2DYAA 3T1YJ 1FO1A 2DK2A 3D1HA 2LEPA 4B02A 1NJYA 2ZUGA 1A6LA 4LRDA 1Y00A 4UOCA 3FSXA 2AJQA 3UDVA 4DR4J 2KJVA 3PW0A 2CADA 2WAQD 4DSIA 1LFWA 2BANA 2E9RX 1AUDA 4G65A 2H48B 1YGYA 4JI6F 2A6OA 1X4HA 2O67A 2GGPB 3TI0A 3UN5A 1JNZB 3UCUP 1XR5A 3US5A 1R8AA 5GAEU 1MSWD 2VQFJ 3UNYA 1WSVA 2GJ2A 3MI7X 3X3UA 1FNOA 2JJ4D 4C48A 2OJ3A 3QIPB 3EDRB 3NNHA 1GT8A 5D0RA 3GSIA 1KLNA 2XZWA 3MM5A 3MAAA 2VOOA 4YB5A 2DNGA 2RKIB 2GQCA 1A0OB 2CG4A 1YI2S 3D9BA 5I3PA 4FVMA 3QRQA 2MKIA 3GP9A 1RT1B 3M6XA 2BJDA 4XDDA 2OIHA 1YLXA 4DV0F 3RB4A 1SL0A 5H9FJ 2ZD1A 3UDEA 4HYKA 3D28A 3CWJA 1PO6A 4C8YA 5KFJA 2QFJA 3GB0A 5DZ7A 1ITPA 5C5JA 3I5CA 3IP0A 1Y4ZB 4H4KA 5IM0A 3DRSB 4OI3A 3W2VA 3TNVA 1S9EB 4TLQA 4NE9C 2GJIA 4ECVA 4RBVA 3TQEA 2E1RA 1BQNA 3M8WA 3GZ7A 3DU5A 4DOZA 1H72C 5JUMA 4UOHA 3WHIA 3KUEA 2DXDA 4WP8A 1GXUA 2J0QD 3FZBA 1S0MA 3ENWA 2VOPA 3V6KA 1S6QA 4LF6F 4K4TA 1N88A 3P3DA 1RQ0A 1T9WA 1Q5VA 2YBVA 1F2HA 2OFGX 2C2MB 3Q8SB 3CJTA 2FDNA 1F5BA 3R8YA 1SL1A 1XNQF 2JZ5A 5EX3A 3KLHB 4O0NA 2YH0A 1S1XB 1XMQJ 2UXCF 2OTLS 2GHWA 2EBEA 4RNMA 1AUSL 4NLQA 1RTZA 2HWTA 3A8KA 5ITHA 1Q53A 4WTOB 3OW2R 4HL9A 3TZYA 2RJZA 3BGLA 3QWPA 1PILA 3DRXA 3KNAA 2W9BB 4QWDA 1VBXA 5KFZA 4WFBQ 4Z7CA 3K2YA 2CPJA 4DV3F 1KVKA 1R8PA 4PUOB 4PYDA 2ZNYA 1U02A 5C25A 4PXDA 2EBGA 5AT1B 4V19X 4FXVA 1Q86T 3KJVB 1K47A 1N32J 2HHHJ 3BQ2A 2KVQE 2XI3A 2WVCA 4OQJA 2MMYA 4J9LA 4O0IA 1ZM9A 3KKFA 2ZKTA 2DT9A 3CDUA 1HW9A 2MY7A 3N5FA 3B8HA 2HQIA 4F8RA 5IT0A 2CKWA 2MGZA 3ET6A 2L9DA 4KGKA 2ILYA 4WKYA 5IXUA 3BGRA 2M7SA 3HSZA 4DN9A 4XPEA 3DRPB 1L3TA 1BD6A 4DR2F 1U1PA 4P52A 4KGZB 2E29A 5KFFA 1W26A 1TMJA 1HPZB 5C7PA 1WNEA 5IT4A 5A8KB 1IM4A 5THWA 1YBUA 3L7OA 2HBRB 3EX7B 4F7VA 2U2FA 3ENVA 1FXLA 1XN9A 2HQCA 3T9ZA 1S48A 3AOAA 3IBWA 1OYEA 1RT4B 3LP1B 5FLXY 3OL8A 4KT0C 1C1CA 1RAAB 2HFOA 2B9WA 3OL6A 5J2NA 2HPUA 1EARA 4JI5J 4P2XA 4DUYJ 2RQMA 4I67A 2QC3A 3IXQA 1I3OB 3J80U 2FJDB 4JI3J 3GJSB 2AJ2A 2FC9A 5DDQC 2CJBA 2RS2A 1U45A 3N01A 2WBRA 3QIPA 4WXWA 2EVZA 1M1KT 4NRTA 5EX0A 2FVPA 3QJPA 2O5DA 3PRVA 1UW9A 4L6V3 2DY9A 1WEXA 2RKIA 5KT5A 2CNLB 1S9GA 4C98A 3ADAC 1ZAXA 2FUG9 1RT1A 2WONA 2XNRA 4U95A 4LF4J 2GFFA 4O4GA 1UFWA 3HSJA 2ZJRQ 4OZ2A 3MM8A 4HEA9 3TJ9A 3H5YA 2X3DA 1WC4A 4O3RA 2KB2A 4DPUA 1U6BA 3S1TA 2NPFA 1N56A 4P7TA 4C6AA 1Q7YT 3MMAA 4BBYA 3RRHA 1S79A 4OYIA 4YS2A 1DLOB 3DRSA 5I3UB 2QMUB 4HHUA 1S9EA 3NNAA 4DG1B 2RVJA 3CD6S 5E3AA 2DTJA 1OIAA 1S0OA 1UFKA 4EYHB 1N5QA 2D3O1 1QJHA 2ZNZA 2DIUA 4HKQA 4JI7F 1S1TB 4YN3B 5CA5A 4J5OA 1WD6A 2QA4G 1R6YA 1FX4A 1WHVA 1DZ5A 4DF8A 4K2JA 3P49B 4O3NA 4KBIA 4GVBB 1SCJB 1MLAA 1T3OA 1X0FA 1WEYA 4LFAF 1RACB 3KLHA 1L3UA 4AQYF 2AYGA 1S1XA 3PR5B 2E66A 5EHHA 3BSNA 4OZNA 3HHLD 2ZH6A 4DPOA 3M32B 5K8PA 1RTHA 4LR7A 1VLOA 3W64A 4IUFA 5I4MA 2AQ4A 4N76A 5DDRC 1WG5A 5FD1A 4E0DA 5B0GA 1RWVB 3DLKB 1PJ6A 3GV8B 3TUPA 3RJMB 4PUOA 1S0NA 1MWZA 1GX5A 2WSEC 3HDSA 1RBLA 5B0AA 4PZVA 4OJ3A 1NDLA 4DS4A 1DY3A 2GVZB 4M5HA 3NKYA 1G2EA 2L41A 4QU7A 3OFFA 1RAJA 5BR8F 5A8RB 3CCSS 5KFTA 2F8MA 2OMLA 4AL6A 4ECSA 2DH7A 4LRCA 5GADI 3QATA 3MDFA 1HNZJ 2G0JA 3DRPA 4DLGA 1JJ4A 3DOMB 1S77D 1N0VC 3TAPA 5KT7A 1FRIA 1HPZA 2JLGA 1Q0NA 4D3HA 5A8KA 3NXZA 2L48A 5DJBA 3UD5A 1KD1T 2B8PA 5F0WA 1NUEA 3JSMB 4U8VA 2AX0A 1VRUA 3SIPB 1RT4A 3LP1A 2JWNA 5F8MA 2AJFE 1RAIB 4RNFA 1N4LA 3UN2A 1ZOTA 2G2OA 3TVYA 4DSJA 3A13A 3ZO7A 3NS7B 2QA1A 3MOJB 2B4VA 3LALA 3GJTB 4K4ZA 2PA8D 4PWUA 4JI2F 5KFDA 1GMUA 4QWBA 2BKNA 1GXLA 5H9EJ 1VQYA 4PWWA 4Y2AA 1NDPA 2ZEJA 3EDQB 1HWUA 1Z2ZA 1MMNA 4LRBA 3M8QB 2DNPA 1IBLJ 2HNYA 1YJRA 3LTOA 1SPBP 4UW2A 2QO3A 2IBKA 3KNGA 2HVHA 5G0RA 1PYSB 3LP2B 2IY5B 4WCEQ 4QIFA 2OHDA 5HMWA 1HBNB 4DV1F 4M63A 4OYZA 3AA8A 1JIHA 3LO3A 5BYSA 3I4HX 2VV5A 4P9SA 2ZM6F 2YWEA 1SQFA 1VQPS 1XTZA 1Q7LB 3QLHB 1R8HA 1DLOA 2CQ2A 1JXLA 4PG7A 3TZXA 3DFEA 4CLTA 3HVAA 2XTJP 3HHLA 5L1LA 2VPZB 2VBZA 4LJMA 4BDPA 1Y5NB 2IM1A 1T9XA 2BA9A 4DR6J 4O3QA 3AD7C 1VQKS 2AGOA 1S1TA 1RP5A 1G4CA 4XK8C 2CG8A 5KT2A 3BH6B 5HQLA 4JV2A 2C2EA 4P10A 4FKXA 5I42B 3CC2S 3PX6A 1NMEB 5H1SV 5HP1B 2KH9A 4OL8A 1HWKA 1BC6A 3OUYB 2J0SD 4GVBA 1PKUA 2ZH5A 1D9FA 3AAWB 1UVIA 2VDHA 3ITHA 2FJXA 2AD9A 4N8OA 1S1WA 2H5IB 3QT5A 3AB2B 4OYMA 4URQU 4AUKA 2R4FA 5KOWA 2MZJA 4ELVA 5LMNF 3AXKA 4L3NA 3WDOA 1T9UA 4ANDA 2RB7A 1N0UA 2ZH1A 4NCGB 1L3KA 1JB0C 3A8JA 4B17A 1SKRA 2DHXA 3GG1A 1REVB 4FDFA 3DLKA 4DF4A 2HFZA 2MLXA 4DS5A 1RSCA 4QQBA 5SUHA 5KAKA 1H7WA 1I1GA 5HL7Q 3MURP 3NWRA 1HR0J 1SC3B 1VS3A 5IQQA 1RBOB 2IYGA 4B3RJ 2E1PA 3D6HB 3RBDA 3KG4A 2BUNA 4NCBA 2JSXA 4BC7A 2B8QA 5A8RA 2UUBF 4DR3J 1BQMB 4ECUA 4NLTA 4YDDB 5B09A 3K5LA 3F41A 2LXFA 1NM2A 1U1RA 1UEUA 3NS5A 1VJWA 4UY85 4TQRA 1ZH5A 1FHTA 5LL6d 3BJYA 5BXIA 4EUVA 4OFZA 1P8GA 4GKKJ 3I87A 1LKZA 4FN5A 3Q8VA 4FYYB 5CZXA 4ECWA 2FVCA 4NLDA 1P9YA 2CJXB 2XYPB 2L3MA 3IR6B 3ISNC 2RD5C 2B9XA 4F04B 2RT3A 2IIHA 3CIMA 3OTDA 1FD8A 4QW8A 3O1LA 3D67A 2UVVA 1IM6A 2CPHA 2AHOB 4JYAJ 2KZZA 4DV4J 4LIWA 2ALZA 5GMDA 2Z2LA 1HBOB 2HNDB 3DDKA 3OL7A 1TELA 2APOA 3TZZA 2JNJA 1NPRA 3KLFA 1S5ZA 2XQCA 1SXLA 2KN4A 3M8QA 2OO4A 1VC0A 2HBZB 3ETOA 4I56A 2J7UA 3G71S 3A8IA 4FS2A 1JLBB 1RU1A 1KQSR 4LSLA 3GFXA 3WC2A 2FZKB 3MM9B 4K4SA 3DLJA 1JLCB 1WTFA 1HW8A 3EXYA 2MQ8A 1S49A 5KG4A 5KG1A 1T02A 4FXWA 2Y1JA 5KG6A 3O44A 4X2BA 3QLHA 4MKYA 2MPUA 3GCXP 3MWBA 3TAMA 1LWXA 1RB0A 3D4JA 1DAXA 2V4QA 4UUWA 4U67Q 8RUCA 2JVRA 1TL1A 2LFVA 2LU2A 5KFOA 2HQ3A 1B70B 3H7HB 2VL1A 1OSCA 3LA0A 1N8RT 3JSRA 1D1UA 1KDNA 1VIXA 1WOPA 3C14B 1TZ0A 4AXIA 2DR8A 1U7LA 4B9VA 2BM1A 1REGX 1PBUA 2QLBB 4ZCMA 5I42A 2JDJA 1SKSA 3MEEB 5HP1A 4AL5A 4B9UA 4NA3A 5HI7A 3CB4A 4B08A 3HX9A 2VQFF 4DFPA 3L9ZA 3UWTA 2IC3B 5D4PA 4LF5F 1N6QB 3I55S 3M2RB 4OI2A 3EZOA 2MSTA 2ZVSA 4YR0A 4ELUA 3I32A 4ZP6A 4KAIA 5HMYA 1M1GA 4R0EA 2G2YA 1OPIA 1TFWA 1IQTA 1TP7A 4H4OB 4MK9A 4FPRA 2OSRA 1REVA 3W63A 5A6WA 1FDNA 5FLXU 4Q2LA 1HNVB 1VK8A 2LXUA 1NNDA 2E7WA 1JJCB 4ECYA 4PXCA 1IKWA 4HVZA 3M05A 3DU6A 2AU0A 2MZQA 2N4DA 1FRLA 2IJFA 2HGMA 4GC7A 2RDIA 2V50A 5A8WB 5JMNA 4B9LA 5K14A 1FRKA 2VKRA 1BQMA 2CXEA 2XNQA 2LQ8A 4OZ5A 4OYXA 4DU7A 1MU2B 1U8WA 4JI8J 3M7VA 3O3LA 2PFDA 2AJ0A 1RWXB 2AIRB 1NJZA 1X5TA 2HW3A 3G86A 1U1QA 2DO4A 6FD1A 3DI6A 1GX6A 3UCGA 3BREA 2YNFB 3MUMP 1Z1ZA 3IGNA 1RT5A 1NHKL 4X65J 1YZ6A 1N5YA 4KIAA 3AA9A 3JTNA 2IM2A 1MROB 2I0XA 3IR7B 3PKMA 2C28A 2HHSA 3BGFA 2WTFA 4K50A 3LWLA 1JLEA 2VU5A 3T6BA 5E0OA 4MYUA 5DQHA 1YIJS 1Q1KA 3ZZ0A 2B7CB 3RRGA 3T1HJ 2KM8C 1GTEA 2AW0A 3OHAA 1DHMA 4ALZA 4DQRA 3D6MB 1U2FA 2OMOA 1OY8A 2DRBA 2BE7D 3IG1B 2JVOA 3TUZC 1HBOA 2C3MA 2HNDA 5IWAJ 2IVFB 2AX1A 3J81Y 3ZZRA 3FDSA 5LXRA 2YKQA 1HNXF 4K5SA 5AE3A 3OR2B 2HHHF 3QSYB 1RAFB 4RW7B 4CZCA 1QUVA 3D66A 5D6GA 4NWBA 2EKYA 1FNMA 2VPWB 1ZS6A 1X9WA 3ZZZA 2DR7A 1I94J 2A2CA 3MM9A 3H8YA 6FDRA 1JLCA 2ZDOA 2BW7A 3UPFA 2XEXA 2DGXA 1OYDA 3KHLA 5A2QY 3DM2B 1VMBA 2DD8S 1YJ7A 1IJFB 3OV7A 3PXGa 3G6VA 2OPPB 4OI0A 2HZCA 3PV8A 3MPVA 4HT7A 2I1RA 3CUNA 4JV5J 1BMQB 1S7HA 3OR1B 5L9XA 1ZYQA 4CO2A 2W2MP 2KJWA 5G4DA 3IWXA 3N6MA 4WZMA 4K4UA 1AYEA 2XMWA 4J7CA 2C42A 2SXLA 2BJ3A 1ZZNA 2VICA 1NHUA 2BVZA 2VJVA 3MEEA 1QAIA 1VBYA 2BDPA 4R8UB 1RYSA 1VQOS 1BHNA 2E9ZA 1WSRA 2IC3A 4X64J 2Z58B 4JI3F 4W4MA 1N6QA 4NXMJ 4LFCF 3S01A 4ED1A 3PO4A 2WZ1A 2OKQA 4MH8A 2DGTA 2YKAA 3TO8A 2VQEJ 5F8HA 4Q5VA 2E5IA 3W7BA 3DOKB 1XR7A 3LP0B 3G8SA 4EEYA 4OI1A 4H4OA 3TANA 3PNIA 4PG8A 5L1JA 2XMTA 1RLCL 5LSRA 4M95A 1G3OA 2B7BB 2AEFA 2NXJA 3L7PA 3DKDA 4TU8A 2AGQA 3H5UA 3IS9B 2PIIA 1RU2A 1FJEB 3FJ2A 2RAQA 5D0HA 2QSWA 3H20A 4OX7A 3SXLA 2UVWA 4CO0A 2EG1A 1LXJA 4Q43A 4HLBA 4NASA 1YRUA 2X3GA 4C0OC 4ECZA 4ICLB 5DLFA 3BBFA 1SKWA 3PIOQ 3VCDA 2W1BA 1MU2A 5E33A 4P2MA 4WP9A 1QSYA 2WRMA 3FQLA 3KJFB 1YG0A 2HWIA 2CYYA 2CIMA 5CCMA 1RZMA 3EVMA 1MWQA 2DEJA 3MMCB 3VAJA 1PYOB 3OTOJ 3MM6B 3HSGA 1YVFA 1X5OA 4NLVA 1MROA 2MLZA 1CS4B 4OIXA 3U27A 2HVIA 4PWDA 5LMUJ 1G1XA 4KYZA 2XGPA 4PG4A 4OJHA 2DHGA 2LLZA 3CCLS 2HRTA 4I1TA 4NLRA 3POTA 3R7SB 1TK5A 4HR2A 3DMJB 2DIVA 2HAIA 2AP6A 2MYFA 2Y8YA 4LQ9A 3THPA 1DARA 2A0FB 5HSPA 4IG0B 3GV5B 3IG1A 3K17A 2FJWA 4A8FA 1ICEB 2XI2A 4IRKA 2KYXA 4OI4A 3OR2A 4EBCA 4MK8A 4FF4A 4RW7A 3HSDA 1LWFB 3RTVA 1UVNA 3BM7A 1YX2A 2AZ1A 3D0GE 4ED8A 2CUYA 2W2OP 2IRYA 5JVGQ 1YWXA 3PYEA 5HMZA 5K20B 1TV6B 1NRKA 1M5KC 1ZM4A 3TRGA 1SBRA 3R1LA 4LF1A 1S1VB 5K8OA 1IBKJ 4ZITA 3BQ1A 3W5ZA 3DM2A 1XEZA 5IC4B 1EZZB 2D69A 1ACMB 2OPPA 1DQ9A 1RAOA 1PGZA 4DQSA 1TKTB 1RWWB 2GNKA 3BPSP 3GTYX 2CA9A 3HJFA 2GA7A 2XO7A 3I5BA 1SL2A 2GAHC 5DGAA 5DLGA 2YVSA 2COLA 2ZE2B 2HHPA 4CQ1A 4ANEA 1R89A 3RYLA 4CH7A 2XS7A 2PD1A 3GPAA 4P6QA 2KT3A 1XR6A 4OZ1A 2DXFA 1OQ3A 1S76D 3C6TB 1UVKA 2KXHA 1T03A 3D54A 4OX8A 3AQOA 3VVTA 1X8DA 3PDNA 3SDEB 3EGWB 4N47A 2DCUB 2RUSA 5J2MB 4NI2B 5HVGA 1CJKA 2QN6B 1KQFB 2DHSA 2PI5A 3DDIA 1C2PA 2NXCA 3DOKA 1EQ0A 3K5NA 1F3FA 5LSOA 4DI6A 2DPJA 4ETZA 1M5VC 4I2PB 2RHQB 5JJBA 2VBWA 3FCWA 4PQAA 5KFNA 5ETNA 5EN1A 4O3SA 1VBKA 3KLGB 2A18A 4YMEA 4CIOA 3CJ4A 3MAHA 5E2QA 5DO2A 2VONA 2MTLA 2BV3A 1EP4B 4KKOA 1NCLA 4C3KA 5EWEA 4IRDA 4HDHA 2QLFB 4LMZA 5ETLA 3H59A 4RX6A 1S9FA 4WXOA 3V2UC 1KBRA 4DSKA 5J1EB 4ICLA 3CC7S 2YQ0A 4DR6F 4CO4A 4DDFA 4M5IA 3GIMA 3K57A 4MIBA 3OT9A 4J9UE 1CPZA 3MD3A 4DL6A 1VFJA 1SUQA 2BOAA 2MKHA 1TL7A 3BBBA 4IDKB 3J7YI 4K4YA 5B7WA 2RE1A 4GRSA 2R7TA 1HWJA 1IQZA 2RMLA 1V5IB 3HFKA 2H1YA 1CS4A 3TEHB 5BYRA 1K1QA 3GG0A 1FNXH 2OUGA 2C3UA 1WC1A 2V2QA 3FCVA 4ECXA 3WZ0A 3H4DA 1UJ5A 3KFWX 4OV1A 3MOZA 4YHHF 3HHKA 3V81B 4ZVPB 4EU0A 1RT6B 5C2GA 4ED4A 2KXNB 1HWIA 4IG0A 1S59A 4CWBA 4ILMA 2ILZA 1RHRB 4UQTA 2R2TA 1Q5YA 3FSYA 3JQKA 4CO5A 1T05B 4J9PA 2EKNA 1UA1A 3QYYA 1M1HA 1LWFA 1KHVA 1T11A 4LBIA 1LW0B 5HQMA 2DXEA 9RUBA 1RHUB 2UXBJ 4LFBF 5E7OB 1SH0A 1S1VA 2MJNA 3M8YA 4ZJLA 1X7VA 1DRZA 3NAHA 1SJRA 3CMQA 3TX8A 4IQXA 5HATA 3MPWA 3Q23A 1ROFA 2UUCJ 3BQ0A 4OLOA 1TKTA 4JI1J 1S10A 4AE5A 1NPPA 3R3TA 1VQNS 1KRPA 3GYXB 5IT9Y 2DRDA 2F65A 4P72A 2ZE2A 2DVIA 3G82A 4CNYA 5HLFB 1X5SA 1ZZFA 4ZCIA 2K1RA 3IR5B 1GH8A 3TA0A 3E01B 3C6TA 4AT1B 4PCQA 2WCXA 2HNZB 4UF4A 4O3PA 5DDPC 2I2YA 1TL3B 5CYMA 2DNRA 3SDEA 2XMKA 2VASA 1JLFB 3AJ2A 1NK0A 3HK2A 4CYUB 3OJSA 1GEHA 4NI2A 1F3VA 7AT1B 4CP5A 4KFBA 4C8OA 3A12A 2R7WA 4NMLA 2JFDA 1UEKA 3T3FA 1YRTA 1IJEB 2NXUA 5T14A 2D9PA 3DLGB 4I69A 1NJIT 1X5PA 2NPIA 3DCAA 1C0TB 2QL7B 4I2PA 3JTPA 2UXDF 4TLRA 4YDXA 2YWKA 3N28A 3TVKA 5T41A 3SV4A 3RU0A 3NL0A 3CO0P 2DGVA 1RWNB 3B6BA 2YQ3A 2R7RA 3MCOA 5KFMA 2UUAJ 2P8IA 2OD4A 1FVSA 4DL7A 4HH0A 3BEGB 2XB2D 2H3EB 2VBYA 1Q16B 4RBUA 2CQDA 1FTCA 2UU9J 1RTJB 3QO9B 4LIRA 4OMFG 1NKCA 3RAXA 2IA0A 5J1EA 1FXDA 2W7OA 2LDYA 3J81U 3OVSA 2F7VA 3I9ZA 4DXLA 3TW0A 3W5YA 1WDTA 1G6BA 3CVKA 1RTDB 1XWLA 5KFCA 4DR5J 1VQ5S 4FPIA 4DR7J 3GJQB 3B78A 2ZJPQ 3E51A 1RHQB 2R8JA 1KSPA 5DRKA 3EE3A 3HI9A 2JEJA 5A2QU 3GCWP 1XNRJ 3FRYA 4DUZF 1R7IA 2QMWA 4LR8A 3CULA 1NPKA 4RW6B 3RB0A 3G2XA 4NZ0A 3J7YU 1GQEA 1BUXA 3BGOP 4C8LA 5EUHA 4QIEA 2XY7A 5AXMA 4C3MA 4PQUB 2ASDA 4KPCA 1RT6A 2YWWA 4PRFA 4FYVB 1HNWF 1RAEB 4P73A 1BE4A 1K9MT 1TMMA 2VG7B 1BWVA 3EZUA 4AL7A 2DY1A 3IO1A 1CJVB 1Q79A 4MKBA 1KC8T 2UZAA 2B9YA 3PCOB 1TR0A 1LW0A 3GFZA 4LSNA 3M9OB 4UOGA 1KFDA 1U24A 4OX6A 2CRLA 4YY3F 4DBQA 2ZHOA 1SIZA 1UPMB 4WYLA 5L39A 4JI8F 4L74A 2CJAA 1A9NB 1LOUA 4CLWA 1RT7B 1Y10A 2R7UA 1LXNA 2MQLA 3UVJA 5K8NA 2V9WA 2FPHX 2YXLA 5F3TA 5L8RC 3MR2A 2FHKA 4RBTA 2B5JB 2Z4PA 4NOHA 2E1CA 1YJWS 1R0AB 2GMLA 4ZPTR 3SCKE 3AHPA 5KFBA 2E1AA 3CTRA 3I82A 1T3NA 3DLLQ 3PJ9A 4ZVGA 3OPKA 5E5NA 2KFZA 1CULB 4EFAC 4JB8B 5KG2A 3MMBB 1TL3A 1H2TZ 2VFRA 1RYRA 3SSSA 2WB4A 4B9MA 4EK2A 1U48A 2QE5A 3ZNUA 1O8BA 2QZ8A 4CYUA 3CCTA 4CT9A 1HMVB 3CCMS 4DR1F 3GFYA 3I31A 4CCHA 4EBDA 4LF7J 3T41A 2X7IA 2ASLA 3UI3A 2HRUA 4NPOA 3BS9A 1ZA2B 1LWEB 3BYRA 2ZC4A 4QWCA 2HFSA 3DLGA 1OY6A 3VF0B 2YTCA 1GXTA 2ERRA 3UD3P 4LF9F 4MK7A 1C0TA 3GIIA 5KFWA 1I94F 3SI8A 1UP1A 2LU1A 2E5JA 4KQZA 2HHWA 3V4IA 4FF2A 4J9RA 3ILOA 1RI7A 2H9ZA 3O2IA 4CLUA 3M8PB 3W2WB 1HHSA 1HYSB 3FFIA 4USTA 3DLBA 5D8HB 2WB1D 4UZCA 3I9V9 2KI2A 1MW7A 3IAS9 1BLUA 4DZDA 5E3CA 4U7UK 1RTJA 4ZVHA 1WF2A 3QJJA 2ZHBA 4EMDA 3N79A 3BDPA 2QT7A 5KT3A 3ZTQA 3CC4S 1X4CA 2W2PP 2G1DA 3EZ5A 2EK1A 1N36J 3CMES 2HK2A 4IOBA 4LVOP 1FFSB 1CG2A 2BE2A 2A10A 2GQQA 3JYTB 1X4AA 3OD2A 1AFIA 4CM0A 3H40A 3UR3C 2OSQA 2JOQA 2Z56B 3TEGA 4F0MA 2E5LF 3DC2A 2CQ0A 2R8HA 1HI8A 4X4SA 4RW6A 2N3LA 3D2WA 4FYXB 2YWFA 2Z2YB 1KVJA 3RW7A 5ETPA 4USHA 4F4KA 3H2VE 2CZ4A 4NLOA 3VQSA 4YEAA 4G3IA 3HZEA 4PQUA 1FK9B 2VG5B 4IOCQ 4J9MA 2J6TA 2CPFA 3C6UB 3R5AA 2FLLA 1HARA 2RU3A 4CLKA 1XMOJ 3PRDA 1UZHA 3NGRA 4B3OB 2VBXA 4H54A 3PHTA 4I6AA 2RSQA 3V6DB 4OHVA 2BJ8A 3HFVA 5KFKA 3WIVA 2Y3YA 4A46A 2JEGA 3U1LA 1FKAF 3EMTA 4DX7A 2NS1B 3EYZA 1QSSA 4F0HA 1JQGA 4FVCA 2IAJA 4K8RA 1EIYB 2F1FA 1LW2B 2LA4A 3ENAA 1LK7A 2M88A 4GMKA 4WJBA 3ILJA 1ELOA 4H4KC 1NH7A 3GILA 4GVLA 4J91A 1D09B 2RQ4A 4X66J 1BXNA 1N54B 2R7SA 2B4OA 1PJ7A 3FKBA 4MKAA 1EX8A 3W3SA 4ZVOB 5F41A 2Y8WA 3W9JA 2JEIA 2HFUA 1D8YA 3RB6A 4ZPVR 3GE9A 2EPIA 4LRAA 3Q8RB 3T5KA 1IBMF 4ZKAA 4XPCA 4K7QA 2KG0A 3LPEA 4JOUA 3P4UB 2L9WA 2ZBIA 3PRBA 4JI4J 1R8CA 4O23A 1CULA 2DNNA 1URNA 4OYBA 3QGGA 4WFNQ 1J2VA 1KLMB 2RH3A 2F9JA 2MEWA 3CJ5A 1QSLA 3CD0A 2BRLA 2C3PA 3KXDA 4K0KF 3TQ1A 2W8KA 4E98A 4QR2A 3NBPA 2W8LA 2PSZA 3AJ1A 1EETB 2J9EA 5BYQA 2HEKA 4OHZA 3D1QA 3M9MB 1NLKL 1KHWA 2MQPA 4P2SA 2C2OB 2WSCC 3N6NA 4ZVEA 4DV7J 2GIFA 3M8PA 3W2WA 2VHGA 3PZPA 2K2PA 3Q83A 2XSJB 1X60A 2XMUA 1JX4A 2G1HA 4RWXA 3W9HA 2E5HA 1AROP 2AYBA 5C42A 4JI6J 3C15A 1OMSA 4ZOSA 3OTEA 3O8WA 3UW1A 4QBUA 4USIA 2CJQA 4HTIA 3L3CA 5ETSA 1T9TA 3NG8A 2YNGB 1B4SA 4QR1A 1NU4A 2C2KB 4G6VB 2MKCA 2D1CA 2LDIA 3JYTA 1N5TA 3LANA 3CD7A 1JXVA 3KG1A 1X4DA 4PG5A 2CVIA 3CCQS 4Q8FA 4P74A 3MD1A 2FHMA 1RT3B 4IH6A 2YKOA 4ELTA 3P8BB 2VA2A 3Q8UA 3VHQA 5GMEA 3W60A 2N4CA 4DV0J 2RU9A 3M30A 2IDEA 3NLCA 4KH1B 2K3KA 3J7ZT 1LK5A 3D7SB 1FDDA 3PW5A 3HULA 5IT9U 4WFAQ 4RNOA 3TAQA 1M90T 2V6AA 4KO0B 3ISZA 3K5PA 1FK9A 2VG5A 3NY0A 2EFVA 4EYIB 3C6UA 4FF1A 3PY8A 2CJYB 4OX9F 3PKYA 2B6AB 3MEDB 2G0CA 3R1HA 2YX1A 3MEGA 1CJTB 5AXKA 4RW9A 4ZMMA 3V5RA 3KJNB 3V6DA 2DGWA 3QZ7A 3VGUA 5F0UA 4ILRA 3CEDA 4A4JA 4AFFA 1UVLA 5CCLA 4IR1A 2BQRA 5KFPA 1YJNS 3KMSA 1Q8IA 4N77A 1HBUB 2OPSA 2LYVA 2MJUA 4K2XA 4JP8A 3BBCA 1B64A 3P5TL 1P6TA 5FIIA 3JSBA 1LW2A 2HMIB 1FKPB 4OYAA 5ETQA 3K8WA 2YKPA 4CRJA 2WHOA 2IM0A 3QZ8A 3IN5A 1J5OB 4WK3A 4IG3A 4OZ0A 1LFPA 1PCAA 5F8NA 1KKHA 1ZM3A 4ECTA 2HHQA 2E7VA 2WOMB 4C8KA 2FZCB 1CVJA 4K4WA 4QCLA 2VFSA 5HN0A 1TK8A 1VIOA 1NO8A 2CNOB 1RTIA 4MFBA 1HQUB 2CJKA 4X4PA 2RRNA 4M5GA 3D5MA 1B0VA 4USVA 4DV5J 1KLMA 1Q95G 5AJ3F 4C0BA 3K8VA 2I9SA 2NREA 2JC0A 3DLEB 2Q66A 1I6JA 2BZ2A 2I38A 4R0JA 4YB6A 2GVDA 1F2GA 4ZJOA 4DR2J 2AEJA 2KVIA 3GONA 7FDRA 3S7RA 4LBPA 4ID8A 1GMWA 2EFGA 5GAGI 3M6UA 3C16B 1L5UA 2F3JA 3TYTA 2P9EA 2XWXA 2ZVIA 4FNHA 2AF6A 3PEJA 3MR5A 2FY1A 2IPOB 2BJEA 1TUWA 3NGTA 3RBZA 1WF0A 2VPYB 3A1YG 2Z8QA 1VHFA 2W25A 5KFRA 3OJUA 4NZ7A 2RILA 1RAHB 1FWLA 2XSJA 3VGSA 4Y6IA 4ZP7A 3VAFA 2VD3A 4JI1F 3W8GA 4DV2F 2K06A 2GGPA 4QYZK 2HSEB 2PA3A 2IHR1 4RUAA 1YITS 2RDDA 4NX9A 3MPUB 1W2IA 1I5OB 5ETMA 1OY9A 3M4XA 1D9DA 1OO0B 2BE9B 2YNGA 1P1LA 2P2CB 2F4VF 4CM2A 2KFYA 1P9QC 3VALA 4RWWA 1WG4A 1VHIA 1OJ4A 2QA4S 1R31A 2Z30B 1NH8A 1UETA 5DS7A 2ZHAA 3VGVA 3NS6A 4JI0F 3GFHA 4RPFA 1RT3A 3KYLA 3ZZYA 4M5JA 3H4BA 2XMAA 5D15A 5CD4A 2GHVC 3IWNC 4OYWA 4ZLJA 4FYWB 5HBMB 5KFIA 4MIWA 3H42A 3ILLA 4MTPA 1DURA 2A2DA 3D3BJ 4C97A 3KLVA 1ZA1B 1O0PA 3UQSA 3H0PA 4GO7X 1H73A 5CH7B 3M8RA 2PGCA 1VLYA 4KO0A 3SSQA 2YX4A 4Y65A 3FBBA 2UV8G 3MAQA 4HH1A 1NJXA 3NMAA 3MEDA 3CDWA 1FXRA 4KHPJ 2LEAA 1CJTA 4JI7J 1AXQA 3PEHA 1W25A 4QIVA 4DPWA 1VQ4S 1UKUA 3Q2SC 3RB3A 4FBUA 4XTTA 3AD9C 2ACYA 3DGPB 1H2VZ 2IRXA 1QTNB 1U8SA 4X62F 1URRA 1VI7A 2HK3A 1HBUA 3C66A 2OEMA 2CZ9A 1UVJA 3LPYA 1JLGB 4LFAJ 2FVQA 4AQYJ 1F5AA 5ETTA 2YPYA 3OQ2A 4QIGA 1IWAA 1TKZB 1C0UB 1W2BR 2WVDA 1K0VA 4DR5F 2N3OA 3I96A 2J9DA 4DR7F 2FGCA 4A8WA 3HHLC 3T5HA 2ZBCA 3PIPQ 2MDAA 2OFHX 3WBZA 1VK3A 2MB0B 2W9BA 2HFNA 1UWBB 1ZTTA 4U8YA 4KV8B 3THVA 2QG9B 4YQWA 2HFVA 2KHCA 3OXFA 1WDDA 3KJVA 4Q7AA 2CQPA 5E3RA 4Y0FA 4EZ9A 3QGPA 1ZETA 2OGUA 2UVRA 3Q8QB 3CNQP 3QSIA 2HGLA 2UUWA 1ZBTA 4LF8F 2FJBB 4Z37A 3MTJA 5L1KA 2R2RA 1N34F 2XZDB 1OSDA 3AD8C 3FEXB 2ZZNA 1DTTB 3RR8A 1UVMA 4I6WA 3VGTA 3DRYA 4F2SA 2BR0A 2BBEA 1SIWB 4A8QA 2J7WA 2OPQB 2CPYA 3Q22A 3PO5A 4WP3A 1DTQB 4C8NA 1CBKA 1R0CB 4R25A 1X0PA 3W9IA 5GAGU 3WX4A 3UR0A 1WKKA 2DKOB 2X1BA 3ZC4A 3GQCA 1FA0A 3BB5A 2QLXA 1IKVB 4RJVA 3KTQA 4ZLPA 4QU6A 3OSNA 4XDCA 3VQTA 1X9MA 1D3WA 2MLYA 5KG0A 2V8VA 2J0XA 2ZH7A 1S7IA 2QEXS 2DBBA 1J5EF 4RNNA 2CPIA 4JI2J 3LUYA 4DUTA 3GIRA 3OTCA 2POKA 3CO9A 2PMWA 4B3SF 3HZGA 3R5GA 1M5PC 5CAAA 1SJ3P 3EVWA 4W92B 4A8OA 2IYIA 3F44A 1LWCB 4B3MF 2FHJD 1RJJA 1TU0B 1PC5A 2B43A 1NJWA 3KG0A 4W98A 2M9KA 2ZC3A 4DV1J 2J6SA 3U1NA 1FJCA 3PVXA 1NSAA 2D41A 1CC8A 2KU7A 3HVWA 5HBMA 5GMKa 1NZ8A 3SV3A 2ZM6J 1FWPA 4TY8B 2HZVA 2BMBA 1N48A 4ED3A 2VUGA 3HT0A 1VQMS 1SV5B 1GMVA 1U49A 2XHCA 2DNYA 5I3UA 1F60B 2FVSA 4FNIA 3HP6A 1IKYB 5GAHI 1A7GE 4BLGA 3QT6A 4DG1A 4Y34A 3CJ3A 4KTQA 4I2QB 3C3LA 3CSKA 3BKFA 2JRSA 2BANB 1QDUB 1PIEA 3CPWR 1T8EA 1LV5A 5IFMA 4IKAA 3DGPA 3KUGA 1WOSA 3R5BA 2MZ1A 2BKPA 3QFWA 1VQ9S 4ZPBA 1RK8A 1AZSB 4HI2A 2AJ4A 3M2VB 2CJ9A 1TKZA 1C0UA 1NKEA 3M32A 3BGUA 3ETMA 3H2LA 4ZPDA 2HAFA 2K8GA 2HVZA 4FS1A 5DM6Q 3QWUA 2FB0A 2LQJA 4EBEA 4NCAA 1VGYA 3R5DA 1NEEA 2J6UA 2OAUA 4OV6A 4DZ6A 4X4QA 4GKJF 4E2FB 3TA1A 1HBMB 2H54B 1X31C 1RAGB 4AD6A 2ROGA 2LQBA 2ZD1B 4I64A 3AXMA 3PTWA 4KGXB 1N33F 2H51B 3IMQJ 4RKUC 2FVRA 4ED2A 3QMQA 2GVZA 2YWGA 2G4BA 1IXKA 1TVRB 1KQKA 3W2VB 2UUBJ 1JNRB 4QPXA 1BQNB 1AB8A 4ES3A 5C24B 4F4XA 1FE4A 2BM0A 4FYDA 4PKDB 5D0EA 3H90A 3QPIA 3FZ2A 3DRRB 3T1AA 3DOMA 1JK9B 1DTTA 2HHTA 4PPZA 2CPDA 1NSKL 3T19A 3X1LB 2PT0A 2DISA 1SQEA 4B3TF 2CPEA 2FD2A 4YUDA 8ATCB 4OHYA 4ED0A 3CCUS 2QX0A 1RKJA 5L1IA 1IBCB 4YB7A 4DFJA 1PC4A 1DTQA 3UDLA 2HHXA 3FCHA 3JSMA 2HQFA 2P9CA 4DPTA 5KFUA 4PEOA 4LQ3A 4ITSA 3T5LA 1SJ1A 3LAMA 1IN0A 4F3OA 1IKVA 2FHJA 4DEZA 4J90A 2R9LA 2C2ZB 1UJ6A 4DQPA 3N4WA 4ED5A 5M2RA 1VQSA 3TX0A 5K5MA 1V9OA 4URGA 5D78A 5LSLA 1RWOB 3ZZOA 4MYTA 3ZTRA 5CQGA 3ZZUA 2VODA 2M52A 1HD1A 5LJ3Y 5RUBA 2J76E 3TA2A 5IOLA 5C25B 1RWPB 2VFUA 3QT8A 3FNNA 2LXIA 4YOEA 2V8DA 1X4FA 1SQGA 5HVHA 1LWCA 1H6KX 3OLAA 2I6WA 3LP2A 4OLPA 1LNQA 4EGLA 4PXEA 1U6FA 1HBNA 2PO4A 3PYGA 4DV6F 3H2UB 3BGRB 4ZCLA 2BQ3A 1DJ0A 1ZPWX 2AJ1A 4MMOA 4ZJQA 3W65A 2P6TA 1YK9A 1EB0A 2HG4A 2YNHB 3R97A 5IC6B 3Q86A 1KS2A 4A8KA 3TUIC 4IO9Q 3BH7B 2F8HA 3RG6A 3KLIB 3HKZD 1IKYA 3HJVA 1PG5B 2Y9HA 2ZBPA 2IFXA 3T1YF 3G96A 3L4BC 2FJEB 4MAKA 5AXNA 1VDHA 3AH6A 4DV7F 1T9YA 2EWHA 4K5RA 4I2QA 4ANCA 4DR4F 1GFWB 4RW8B 1FFWB 2GHPA 1C1CB 2K7KA 5GAHU 2EI5A 3PX0A 2PDAA 3C46A 4N7TA 5J2NB 2HHUA 3IAM9 4J9OA 2C22A 3OUYA 2RNEA 4TN2A 2A1BA 2ZH2A 4J9VA 1AZSA 2LQ5A 4LF5J 5JVHQ 3M2VA 3UNGC 3PYDA 2VPXB 3CDEA 2HBYB 4KR0B 3WC0A 5L46A 4C3LA 3N5BA 2LMIA 1G7CB 1D0EA 3PM9A 1XIQA 3BO3A 3D68A 4HI1A 4NCGA 1SC6A 2XGQA 1S9GB 4OHXA 2C1EB 4P2FA 1M5HA 4V19J 3LQVA 3K0JA 4PR6A 2WONB 5DG9A 1HBMA 4O4GB 1WWHA 1FD2A 3MM8B 4DL4A 2Z0GA 4ZVRB 1EJ7L 4QIWD 2VG6B 1VISA 3MMAB 2R42A 3P45B 1WC6A 4DHVA 2N82B 4XIUA 2VJUA 3QFHA 3NGSA 5KFYA 2FC8A 1TVRA 4Q8EA 5A6PA 2GV1A 4UZBA 3DDNA 4I6YA 3MUVP 2PI4A 2JH3A 5C24A 1UTAA 4C0HA 1DQ8A 4IQMA 4HT5A 1VRQC 2B4UA 3DRRA 4ZVSB 4L72B 2YPZA 1VCTA 2GO9A 5HJXA 2MSSA 2JLFA 2V8HA 2XS5A 1P1TA 5KFGA 2ZOFA 2DNHA 2NYHA 4O44B 2XY5A 1E6YB 2DH8A 1U4BA 3CJSA 8AT1B 3LGHA 3DLHA 2CWXA 1XMQF 3T6JA 4C8ZA 2IBOA 2HQGA 2N7YA 1FE0A 2ZBQA 4ERDA 1V3ZA 3F73A 2IJNA 3GWCA 2JFKA 1RTHB 3A3NB 4ZLNA 2F40A 1BY9A 1VC6A 4ID5B 2GW8A 3IFEA 2U1AA 3MUTP 3IBCB 3GLJA 5DQIA 4DSFA 4QYZJ 1U6ZA 1VRTB 4WYWA 1EKRA 3J7AN 4ZHRB 4NLPA 2AEMA 3G4SS 1RWKB 1S6PB 2J5AA 5EGYA 2CNNB 1HNXJ 1N32F 3MR6A 3Q0AA 4NLXA 5ETOA 3M6VA 4LSZB 2DR5A 2UVUA 3MCNA 4DV5F 1VJQA 1L3SA 3NP5A 3CF5Q 2D3UA 3V4MA 4I0WA 3ZTPA 3IRXB 1JLBA 1UA0A 2DGSA 3OFEA 5K8MA 4BCAA 4DQIA 4EZ6A 3D0HE 3AY0A 1SH3A 4WE1B 2CFXA 4ZS6A 4KB7A 3QJLA 2R3VA 2YNHA 2ROEA 5CD4H 4PABA 1FDBA 1HIYA 4ZDNA 2GO8A 2IMWP 2EW9A 2HS4A 1LQ9A 3KLIA 4JUZA 4F26A 1RCXB 3UCZP 1YRXA 4TKTA 4DPXA 2XLJA 2IDLA 4QR0A 3Q8PB 4IYQA 3LAKA 1VRUB 3CMAS 1WKLA 2QJ3A 3G8QA 4RW8A 3C14A 1GK8A 1X4BA 3CE8A 2W4DA 4EO8A 2C3OA 5EWFA 1T0TV 3V6HA 2ZOGA 4ZIVA 4BC9A 3SZ2A 3W62A 4JI5F 4QW9A 3CCZA 4JBCA 1JMTA 4RU9A 4DUYF 5HQ8A 4KGMA 3EJMA 2E1MC 1XC9A 2XSFA 3CDAA 2R7OA 1B3TA 1RHKB 1FERA 3M2RA 3M8ZA 2FTRA 4LFCJ 1RADB 2F8EX 4ECQA 3AOCA 2BACA 1MNEA 1Z2LA 2HNYB 4DFMA 1M0SA 4U7CA 4ZA1A 4RW4B 5G0RB 2MZTA 4LF4F 3QIDA 3VAHA 1Y9OA 1HNVA 1QVFR 1NXIA 2ZDPA 4ATNA 2NZ4A 3G9CA 2PMHA 2D74B 2VG6A 1K8AT 1YBAA 1FEHA 3EVOA 3I56S 3KUHA 5A8WA 3EM1A 4WWSA 4TXSA 3B82A 3HHLB 1RHMB 2DNOA 4L76A 4ZIWA 1FESA 4DU8A 4KHPF 2M3DA 1H38A 4F02A 3C2PA 2B56A 4WU2A 3JS9A 4NA2A 5HVFA 2BEFA 3JSYA 2M70A 1JXEA 4NLYA 2YNFA 4O44A 4A8SA 1E6YA 3MGJA 3BO4A 3ITHB 1Y7PA 1CLFA 1S1WB 2FGOA 4CI0B 2K7JA 5B0EA 5LM7E 5KFHA 2DO0A 2HZAA 3CCRS 2DGOA 4KC5A 4RLEA 2GC8A 3QQCD 1AT1B 4ID5A 1SC1B 2LCWA 2OPRB 2G9OA 4CLYA 4F4AA 4ED7A 3G6ES 4Q2MA 4YB1P 4YR2A 1VRTA 1NKBA 2YNIB 4ZHRA 2EFOA 1S6PA 1UL3A 5B0FA 2WK4A 4E8UA 2CDQA 3NCRA 2MHEA 2AV5A 2V2VA 3L7UA 5KFSA 1RA7A 2AMCB 1TKDA 3IRXA 4DL2A 2LA6A 3D1OA 2ACMA 2HYIB 1OQ6A 2HWHA 2OP5A 1TQLA 1HNZF 2MZSA 2IRUA 3OVAA 2Z2MA 5BJRA 1YJTA 4KPYA 3O6QA 1OS5A 1VR6A 4KHRA 3NAIA 2V69A 2Y1IA 4WE1A 2AYMA 2Z2ZA 2I8EA 3MF5A 1TFYA 3VZIA 4RNHA 5KG7A 2V67A 3KHGA 4UOFA 3OR1A 3P6YC 5E3PA 2QV6A 3R2CJ 2E7XA 4NEZA 2A3JA 2P9GA 2V5HG 3GSDA 1V3RA 5MAOA 2J9CA 2QSFA 3QBCA 2VKZG 3GYGA 2N7CA 4WIIA 4X4VA 3I6PA 1EKSA 2EK6A 2UV8A 5DQGA 3TR5A 1H7XA 2M2BA 2XMVA 1SJFA 5F8IA 2VC1A 4ZPAA 3GR0A 5D4LA 4R8UA 5EWGA 4ER8A 2AZ3A 5IZHA 2RQCA 2BYCA 5F8GA 5KTQA 1RXOB 1KONA 4DX8H 4ZN1A 3I0RB 3W61A 2PN6A 3DYAB 3JAMY 4I68A 3CDBA 5IS2A 3W5XA 1GNKA 1O6XA 4EI2A 1ZAWA 1U47A 4USJC 3KLFB 2GS8A 1VQ6S 2M4MA 1IBLF 1TL4A 2CQHA 3IA0A 4NEYA 1FKOB 5EDWA 2DITA 3LP0A 1R8BA 3BV8A 4U6PA 1U0SA 3BN7A 3RUBL 4RW4A 1FI4A 1AA1B 3MECB 4KJIA 3V6JA 1BWEA 1XERA 3FEZA 4LSLB 2X51A 3CJ2A 1HWLA 2YWHA 4A8MP 5HAOA 4O3OA 4K4XA 3ONQA 5KFXA 2QFIA 3PG9A 4MJKA 2DHAA 2YH1A 2ZOMA 3IS9A 4RZRA 2W4CA 2V63A 1YJUA 4M5LA 4OZ3A 2DCLA 1TUGB 1YKWA 4K59A 2LECA 3TAMB 3TWZA 2FQQB 5KG5A 4FKYA 1TL1B 1NHVA 4DQQA 2PEBA 2IA6A 2KG1A 4F36A 2ZUAA 4X4NA 2CNKB 1RUSA 4TQSA 1MMDA 3FK4A 1SB6A 1CJUB 3ZZTA 2Q3PA 3ZTSA 3HHDA 2EXUA 1ZPVA 3DHXA 4GO5X 3MMCA 1RBAA 1HL6A 4M5DB 4YR3A 3MM6A 3BSOA 3OHBA 1K1SA 4ZLLA 1UWAA 4TYAA 5D0GA 1S4EA 3CCJS 3SCIE 1NBEB 2UUTA 1GAOA 1GTHA 2QL5B 4J9QA 2DNQA 2ZKUA 2ZBRA 3DMJA 2OPRA 5AE2A 5KT4A 4XAKA 3S8SA 1TUVA 4YHHJ 1KEKA 2YNIA 2HHVA 4F25A 4B9SA 3TVZA 2NUHA 3H5SA 2DGUA 5SZTA 5D77A 4JV1A 1HR0F 2IVMA 1IKWB 2EEYA 1C1BB 4B3RF 3CJ0A 2J0WA 3J81j 3HHNB 3HF5A 1F9EB 3OSPA 1TV6A 5K14B 1JKHB 1RCOB 3I0SB 4DR3F 3T9NA 2NZCA 5B08A 2F5GA 4LFBJ 4QWAA 2Q79A 1IR1A 1HQ2A 3THTA 2BW2A 2FZGB 5GADU 2IM3A 3LOUA 4N56A 3BSAA 1RKIA 2HVEA 5M2UA 3DI6B 4K4VA 4LT6A 4Q44A 3OFHA 3MTKA 4GKKF 4DL0C 3FBEA 4AXJA 3HCXA 1RT5B 3PACA 2M5YA 3ISND 5A0YB 2FLPA 1N5YB 1HHTP 1Q4RA 3HKWA 4C4WA 3OVBA 2I5JB 2JLEA 3UFCX 2HS0A 1NK6A 3O5TB 1UEVA 1JLEB 3A3PB 3PJXA 1KOHA 3Q24A 3IRWP 4M5MA 2ADCA 1U1KA 2HLUA 3BKUA 4C9DA 3H5XA 2V4RA 3R7BB 3QRRA 1Y5LB 4ENOA 5J2MA 1FCAA 4JYAF 3TJ8A 1YBTA 1F0XA 4DV4F 3I0RA 5KOXA 4B9TA 5FDLB 3DYAA 2QLWA 1S57A 2V34A 2C2RA 2ZZTA 1QUPA 1PSDA 4J9SA 2X1AA 1WHXA 2NXEA 4NYPA 2HRYA 2XY6A 4ETXA 2DB1A 1IKXB 1KN6A 1TK0A 1FKOA 2DR9A 4BWJA 1H0HB 3FQKA 4HDGA 4OHWA 2KHDA 3EWGA 4IFYB 3MECA 3GIJA 2DNLA 1WKJA 3SQGB 2YKMB 4RUHA 4LBHA 2UXDJ 5L38A 3BSCA 4HHHA 6AT1B 1KFSA 3KLGA 4V1Ak 2NCKL 4CH0S 3K5MA 2NSBA 3RAQA 1XBWA 2JL9A 1EP4A 3J7Z5 1FJGJ 2BOPA 3CJKB 4Y00A 2ASYA 1WF1A 2QGFB 2IMOA 2MQQA 2GQ2A 2MQOA 3D6FB 3LGNA 2NR0A 3VZHA 3JQJA 2QYCA 4U9RA 2BRKA 2QMXA 4NLGA 4F3MA 3WIUA 1Q78A 2CQCA 4DCJB 3T5JA 4Y3CA 1CJUA 3CIZA 4J9KA 4J37A 1WI6A 1M5SA 2BKOA 4TVAB 3SSRA 1HI1A 3N0VA 2PEHA 4IDKA 1U26A 4M5DA 3EICA 2QRRA 3M6WA 1FRMA 1KWMA 3LGMA 5A76A 4CLSA 4KY3A 2DR6A 1D9AA 4ZP8A 1S1UB 4DUZJ 2BXJA 3FSIA 3AB4B 2V8GA 1N52B 4ZCKA 5HO4A 2ZWOA 4LR9A 3NRBA 2R2SA 1HNIB 1QAYA 1UPPA 5DM7Q 2XMJA 2W4PA 3KWMA 3FEYB 4YFUA 3V81A 1MN7A 3MR7A 4A48A 5B0CA 5J2PB 2B51A 1HA1A 2DHHA 2WW4A 3ENQA 3AODA 5K9FA 1HNWJ 3CCES 5AE1A 1M5OC 2DEIA 2VF3A 2BX6A 1T05A 1KOOA 1EQMA
chains in the Genus database with same CATH topology
2MKIA 2KXHA 3HVTB 1C1BA 1RT1B 1T03A 4R25A 1X0PA 3M6XA 3D54A 3MFHA 2BJDA 5GAGU 4OX8A 3WX4A 5F8LA 2MZRA 4XDDA 2BQUA 3AQOA 2OIHA 3UR0A 1X8DA 3PDNA 4PG6A 4DV0F 3RB4A 3PFOA 1SL0A 2Q6CA 2X1BA 3ZC4A 5H9FJ 3GQCA 2DNMA 2ZD1A 1FA0A 4Y28C 3SDEB 4HYKA 2EFPA 3D28A 3BB5A 2QLXA 1QE1B 2PC6A 3CWJA 3EGWB 5KFJA 2QFJA 1PO6A 3GB0A 1JKHA 3NGDA 2KTQA 4N47A 3I0SA 1IKVB 3KTQA 2DCUB 5J2MB 2KM8B 3IC1A 5C5JA 4ZLPA 3JTOA 3I5CA 1JJ2R 4QU6A 1Y4ZB 3OSNA 2RUGA 4H4KA 4XDCA 5MLCV 5IM0A 4ILLA 3VQTA 1KQFB 1X9MA 3DRSB 2DHSA 4OI3A 3KMQA 1D3WA 3W2VA 2KFNA 5KG0A 2V8VA 1S9EB 3TNVA 2J0XA 4TLQA 2C3YA 2PI5A 2GJIA 4ECVA 4RBVA 2ZH7A 2QEXS 2DBBA 2E1RA 5CZVA 1BQNA 1J5EF 4RNNA 2CPIA 3GZ7A 3DOLB 3DU5A 3LUYA 1S0VA 1C2PA 3DOKA 4DOZA 3OTCA 3K5NA 5LSOA 2POKA 5JUMA 3HO1A 2QIFA 3CO9A 5U47A 2DPJA 4X65F 4ETZA 2FLNA 1C4CA 1GXUA 4B3SF 3HZGA 1M5VC 3BZQA 4I2PB 1M5PC 1SJ3P 3IGVA 3FZBA 2J0QD 5A0YA 1S0MA 3ENWA 5HLFA 4W92B 4ZPCA 2VOPA 4A8OA 2IYIA 3F44A 2VBWA 5JJBA 4PQAA 3V6KA 1S6QA 5KFNA 4LF6F 4K4TA 4O3SA 5EN1A 1N88A 3P3DA 1RQ0A 2I5JA 1LWCB 4B3MF 3KLGB 2A18A 4PWDB 1HI0P 2OFGX 2FHJD 4YMEA 1QTMA 3Q8SB 3E01A 4CIOA 3CJ4A 2FDNA 3PR4A 1RJJA 1F5BA 3MAHA 5E2QA 5DO2A 2VONA 1SL1A 4F4WA 1XNQF 1PC5A 2HNZA 4N8NA 1FJ7A 2BV3A 2JZ5A 5EX3A 2B43A 3KLHB 3KG0A 1NJWA 2YH0A 1EP4B 1S1XB 3T1HF 4KKOA 3POTB 4C3KA 5EWEA 2UXCF 2OTLS 4IRDA 4HDHA 2M9KA 2ZC3A 2J6SA 3U1NA 4LMZA 2GHWA 1FJCA 4TYBA 4DL5A 3H59A 3PVXA 2D41A 3LH2S 1JLFA 4RX6A 1S9FA 1CC8A 2KU7A 2EBEA 3HVWA 4WXOA 5HBMA 3V2UC 5GMKa 3SV3A 2E5GA 4DSKA 5J1EB 4RNMA 4ICLA 3MEKA 4NLQA 3CC7S 5FDLA 2HWTA 4TY8B 1N48A 4ED3A 1U1OA 2VUGA 5ITHA 2ZH4A 4DR6F 1Q53A 4CO4A 1SV5B 1VQMS 1U49A 4DDFA 5IWAF 1RA6A 3OW2R 4HL9A 3GIMA 2RJZA 5KFQA 2DNYA 3BGLA 5I3UA 3QWPA 1F60B 1NK8A 3K57A 1PILA 2FVSA 4MIBA 4FNIA 3DRXA 3HP6A 4C8YA 3KNAA 1CPZA 1IKYB 5GAHI 2W9BB 4QWDA 3MD3A 1VBXA 5KFZA 1A7GE 4DL6A 3FMWA 4WFBQ 3K2YA 2FJVA 1VFJA 2CPJA 1IKXA 4WZQA 4DG1A 1SUQA 4Y34A 4DV3F 4X4OA 4NL5A 3CJ3A 4KTQA 2XHWA 1R8PA 4NYZA 5D3GB 4PUOB 2MKHA 2ZNYA 3BR9A