4URQU

Crystal structure of ggdef domain (i site mutant) from t.maritima
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
LTGLPNRRYFFELGNRYLDLAKREGKKVFVLFVDLAGFKAINDTYGHLSGDEVLKTVSKRILDRVARSDVVARYGGDEFTILLYDMKEEYLKSLLERILSTFREPVRVENKHLSVTPNIGVARFPEDGENLEELLKVADMRMYKAKEMKVPYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Diguanylate Cyclase from Thermotoga Maritima: Insights Into Activation, Feedback Inhibition and Thermostability
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords DIGUANYLATE CYCLASE
total genus 52
structure length 154
sequence length 154
chains with identical sequence V, W, X, Y, Z
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4urqU00
2YNHA 3HVTB 1DLOA 3ITHB 4J9NA 2FJWA 1C0TB 4URSA 3GQCA 4ZP9A 3QIPA 4NLSA 5DLGA 4IQXA 5KG7A 1RT6A 3PHEA 1ZTWA 3NMAA 2XGQA 4EBEA 5KT7A 3KLHB 1VRUA 5C24A 1RT3B 1S6PA 2HNDB 1S4FA 4NLYA 1N5YB 2R2RA 3V81B 3RAQA 4K4UA 1JLEA 3H98A 4O3PA 4IRDA 4PWDB 3TAMA 2YNFA 3I5BA 4XPCA 4WE1B 1S9EA 4ZPAA 3IG1A 1JKHB 4RW8A 1LWEA 3KLEA 3T5JA 2W9BB 3N6LA 4JUZA 5KFFA 3UQSA 3NBPA 4RUCA 3MR6A 1KLMB 4ECYA 2FVSA 3RB4A 4J9KA 4NLGA 3TAMB 1JLCA 2YNGA 1J5OB 2YKNA 4O4GA 4RW8B 1LWFB 4G1QA 5C24B 1D1UA 2RKIA 3HHKA 1N4LA 3M8QB 1S1XB 2GC8A 5KFLA 4O3SA 1FK9B 5C25B 4RNHA 4ZVEA 1JLBA 4WYWA 4J9MA 4WZMA 3DLKA 3EPIA 4F50A 3KLGB 4J9QA 5CYMB 1KLMA 3CVKA 3NL0A 5KG1A 1TKZA 3C6UA 3V6KA 4DL2A 3BSAA 1N6QB 2IM3A 4NRUA 3UR0A 3MR2A 2EC0A 4IR9A 5I3UB 3DOLA 5EUHA 3V6JA 1NNDA 3LALA 1ZTTA 3PW5A 3CJ5A 4WXOA 3V81A 4ED0A 5DGAA 4WFYA 2IC3B 2UUWA 4DL3A 5I42B 3RB0A 2I1RA 2XI3A 3DLKB 3DRSA 4KBIA 4ZP8A 3H5YA 3GIKA 1QAJA 2FVRA 3BR9A 5KFNA 4PUOB 3E01B 3NGDA 2E9TA 2UVVA 4ZMMA 2WOMA 3SFGA 5KG6A 1HARA 3M9OB 4ID5B 3V6HA 4ED3A 4IFYB 3V4IB 3DOLB 3H4DA 3DLGB 1S1TA 2R2SA 2ASDA 2JEFA 1HQEB 2ZE2A 1S1UA 1SH3A 3MR3A 2BANA 4KSEB 3GV5B 3N6NA 2QV6A 3PJXA 4NLOA 1TL1A 5KFUA 5J2QA 2FLNA 3Q8QB 4RNFA 2VG5B 2D7SA 3FRZA 4Y3CA 4PQUB 3I5AA 2I5JA 1LWCB 1S0MA 5KFVA 3OLAA 1FK9A 3ISND 2XCPA 1RYRA 4HYKA 4WFXA 5C25A 5KG2A 1RT5A 4I2PB 3C6TB 4H4OB 4XO0A 3NAHA 4NLVA 5J2QB 4DL4A 3BSOA 2J6TA 4U7CA 3IN5A 4KB7A 1S1UB 4EYIB 3QO9A 2R8KA 1OS5A 3H59A 3OHAA 1TKTB 5KFQA 2VA3A 1KHWA 3KMQA 1TP7A 3QIDA 2FVQA 5KG3A 3M8PA 4NRTA 3D28A 5F8LA 1MU2B 3FFIB 5F8MA 3KHLA 5L1LA 2ILZA 5EWGA 3CJ3A 3H2LA 4ECVA 1BQMA 1SV5A 3DM2B 2C2EA 1RTIB 1QUVA 1S9GA 2D3UA 2WOMB 4O3RA 1TV6B 3DI6B 5L1JA 1S1VA 2WONB 4I7FB 3OL7A 3KLFA 4PUOA 2ASJA 1R0AB 1K1QA 4ZHRB 1FKPA 4QW8A 3ISNC 4TN2A 5KFMA 3JSMA 4O3NA 3QZ7A 3I0SA 1IKVB 3PR5B 4IRCA 1RA7A 1RT7B 4MIAA 4NLTA 2UVUA 2JEGA 4DL5A 1GX6A 2D41A 3DRRA 4WE1A 5L1KA 2YNFB 1S9EB 4J9PA 1N6QA 4JV2A 2IJNA 1T05B 1RT1B 3DMJA 4LQ9A 3RBEA 1R0AA 5HROB 1S9FA 4M95A 2JLEA 1HNVA 5J1EB 1S1WB 3PJWA 4URGA 3E01A 4FS2A 4H4OA 2OPSB 3GILA 3KNAA 3QIPB 3HKWA 1U09A 4RUAA 1D0EA 1VRTA 1SUQB 5F8GA 3CDWA 3M8QA 2BQ3A 4ECQA 5KFPA 2FVPA 3N6MA 3BQ1A 2B6AA 3I5CA 4IFVA 3G6VA 1T05A 1SH0A 3RAXA 1RT2A 2OPRA 3QYYA 4KV8A 4NLWA 4URQU 5F9LA 4GC7A 2BRKA 3LP2A 4R0EA 1RTHA 1LW2B 1UWBB 2IM2A 4TLRA 5J2PA 5KFGA 1TL3B 5KG4A 4ECZA 4RW7A 1JLEB 5DQGA 1IKYA 1W25A 2BE2B 4Q0BB 4IFVB 3LAMA 4IDKB 4QWBA 1RTJB 4K4YA 1RAJA 3DI6A 1RT5B 4I2PA 5KFZA 4YR2A 2BQRA 1JLQA 5T14A 3Q8RB 3GIMA 2XI2A 5FDLA 3T19A 5DQHA 4RNNA 5L1IA 2YNIA 1C0UA 1LW0B 4J9SA 2ILYA 2OPPA 2YNHB 5KT3A 3IRXA 2RDJA 4ED7A 3GYNA 3LP1A 1WNEA 4Q0BA 3KK1B 4IR1A 5KFRA 2WHOA 1LW2A 1UWBA 2YKNB 3LP2B 4O4GB 5DQIA 2IAJA 4NZ0A 3KHRA 1JX4A 4R5PB 5F8IA 4RU9A 4QW9A 3FFIA 4ZPCA 1EP4A 4MFBB 2OPQA 3VQSA 3MEGB 1JXLA 3IRXB 3CO9A 5KFBA 2W9AA 2HNYB 2WRMA 3KK3B 2GIQA 4F4XA 2AGPA 4TQRA 2OPPB 3BGRA 2FVCA 4KKOA 3GIIA 1REVB 3QLHB 5HP1B 1HYSB 4ZHRA 3BREA 2DPIA 4PWDA 3CDEA 4J9LA 3IGNA 2HNZB 1FKPB 4ICLA 2E9ZA 5J2MA 1TV6A 1VRUB 2B43A 2IC3A 3SFUA 3KJVB 1S1VB 2WONA 4I7FA 1T94A 1N48A 1N5YA 4K4SA 2YNGB 4Q8FA 5KFWA 3CJ2A 2HWIA 3BGRB 1BQNB 4KKOB 3G86A 4LSLB 1I6JA 3GV7B 2CJQA 2AU0A 2JC1A 2CKWA 3OL8A 4RW9A 5EDWA 5C5JA 2W9CA 3FDSA 2VG6B 4TYBA 4NLDA 2YKMB 4IG0A 1DTTB 2W7PA 2JEJA 3DRPA 2JEIA 4O3OA 3DLGA 4XPEA 3KLGA 3M9NB 4ED8A 1S97A 1C0UB 3QO9B 2AX0A 3MFHA 2OPSA 4EO8A 2QE5A 4ID5A 3LP1B 2DPJA 3KJVA 4MK9A 2RF2B 1RT3A 1S1XA 4IH7A 2YNIB 1S1WA 4Y34A 1QE1A 5DG8A 1FKOB 5F8NA 1C1BA 3CWJA 5L9XA 2O5DA 3RB3A 1T03A 1BQMB 3DM2A 3MF5A 1LWCA 1RTIA 1S9GB 1TVRB 3V6DA 3QZ8A 2AX1A 1RT4B 4JV0A 4YQWA 1RYSA 4IH6A 3IGVA 4O3QA 1DTTA 5EWFA 4H54A 2W9BA 3MTKA 5JXSA 1RTHB 5KFIA 3PW2A 2OPQB 2R8HA 5C42A 4R8UB 1HMVB 3DOKB 5F9NA 3BQ0A 3JSMB 3I0SB 5K14A 1TVRA 4DG1B 2R2UA 4QWEA 5DLFA 2HMIB 4MK7A 4NLQA 3NKYA 5D3GB 1QE1B 3BJYA 4NYZA 3IS9B 1IKXA 3MECB 4EO6A 4G3IA 1TQLA 3KLIA 4TY8B 4RNMA 1XR6A 4ZVHA 5CYQB 3KLHA 1LW0A 4ED1A 1RDRA 1RTDA 4K4ZA 4M94A 4ICLB 4GC6A 2W8LA 5KFKA 1XR7A 3CIZA 3BQ2A 2FJXA 5K14B 3DYAA 4DG1A 2VG7A 1EETB 4O44B 3OL6A 1JLGA 5KG5A 4WXWA 2R8IA 3HVTA 3ITHA 1QAIA 4F4YA 2D3ZA 2AWZA 4QWDA 3IS9A 4HKQA 3DLEA 1Z4UA 2BANB 1HQUB 5HBMA 3NAIA 1MMLA 1EP4B 4MFBA 5DGBA 4J9OA 2C28A 1S1TB 2UVWA 5EWEA 5F8JA 2IAJB 4ED6A 3KOAA 3JYTA 4R5PA 4IH5A 4NLUA 4ZP6A 4QPXA 3KHHA 2B6AB 5JUMA 4F4ZA 2ASLA 4YP3A 3C6TA 4QWAA 5KFHA 2J6UA 1HNIB 3DDKA 3MEDB 3DYAB 4TQSA 3KLVA 3V6DB 2C22A 1JLGB 2HNZA 2ZD1A 4PQUA 5KFOA 3OHBA 3EPGA 4Y2AA 4EBDA 3Q8PB 3GV8B 1HNVB 5J1EA 1IKYB 1RTJA 2BE2A 4ZPDA 3H4BA 3LP0B 1T3NA 4KE5A 2WCXA 4K4XA 2IM1A 3QGGA 5KT4A 1IM4A 3JYTB 1ZETA 3H5XA 1JLAA 4OL8A 3RB6A 1DLOB 3CDUA 3G6XA 4ECUA 2ZE2B 5HLFA 5I3UA 4MH8A 3PZPA 4RW6A 2YKMA 4IG0B 4WYLA 3DOKA 4KO0A 2V4RA 4ECSA 2AGQA 2B5JB 4IG3B 1TKZB 3C6UB 3OLBA 4RW9B 1GX5A 1NHUA 3TVKA 2W9CB 2W7OA 5DG7A 3OSPA 1DTQA 3MEEA 3MR5A 2FJVA 1VRTB 4TYAA 4TY9A 2V4QA 2HWHA 2WB4A 1KHVA 4X2BA 1EETA 1CSJA 2J6SA 4K50A 1FKOA 4MKAA 5J2NB 3BSCA 3HVWA 4Q44A 4EEYA 4NLRA 5I42A 3KK3A 2RF2A 3H40A 3OL9A 4I2QB 2HNYA 4RW4A 1S6QA 3H5SA 1J5OA 2JC0A 1RT1A 3DMJB 4FBTA 4G1QB 2F8EX 1TL3A 1N56A 4RNOA 2AGOA 3DRRB 1JLCB 2C2RA 1DTQB 3MEEB 3MFIA 4ECRA 4ECWA 1XR5A 4Y2CA 4R8UA 5C42B 3BSNA 1RT7A 2ZKUA 3M8PB 3PW7A 3KK1A 1JLFB 5KFYA 2WK4A 4F4WA 3PW4A 3CJ0A 1HQEA 2FLPA 4DL7A 1BQNA 3T5KA 2BRLA 4YR3A 4LSLA 1JLBB 5KFEA 2V9WA 4FBUA 4IFYA 4ECTA 4QWCA 1S6QB 1RTDB 2IBKA 3LP0A 2ZD1B 3H5UA 4I2QA 4NLPA 1IKWA 4RW4B 3T1AA 2HAIA 4ZVGA 4ED2A 2R8GA 3KLFB 1IKXB 3MECA 3Q8SB 4B3OB 3LAKA 1C1CB 2I5JB 4ZPBA 4TXSA 4JV1A 1S10A 1HYSA 2IM0A 2UUTA 2RDIA 4ECXA 5KFAA 3FQLA 4ZVFA 2VG5A 5KFDA 1JLFA 3QGHA 2R8JA 2UVRA 2XCAA 4KHMA 3DLEB 5DG9A 2XWYA 2VA2A 2E9RX 4Q43A 1TKTA 4FS1A 3UPFA 5KFCA 4KHRA 1TKXB 3V4IA 3PVXA 5KT6A 3T5HA 4B3OA 1C1CA 5CYMA 3T5LA 4IRKA 3RBDA 1S49A 2IJFA 1JIHA 5J2NA 4EBCA 4IKAA 3ICLA 2IA6A 4KAIA 4NCGA 2HMIA 1TKXA 3KK2A 4MKBA 2FLLA 2XGPA 4K4TA 4ZP7A 4Q8EA 3NBPB 1TL1B 4KO0B 3KMSA 4RW6B 2B5JA 4IG3A 2XC9A 3M9MB 1IKVA 1RT2B 2OPRB 1JLAB 4KV8B 5KG0A 3I0RA 5HLFB 1HPZA 3PR4A 2ATLA 3LANA 5KFXA 1RT4A 2OH2A 3OSNA 4NCGB 2ALZA 4U6PA 1REVA 3QLHA 3KK2B 2WTFA 3GIJA 5HP1A 4DEZA 1S6PB 1C0TA 2HNDA 2W8KA 3TQ1A 4IOBA 5KFJA 3KHGA 3KLIB 4TY8A 1HNIA 3MEDA 1S48A 4H4MA 5CYQA 1S0NA 2IMWP 1MU2A 4Q45A 2VG6A 5HROA 3QGIA 2BR0A 5D3GA 1HPZB 3DRPB 4LQ3A 5F8HA 5KT5A 1RA6A 4KFBA 4WZQA 2C2DA 3UDLA 2V0NA 4H4MB 1HQUA 1SH2A 5HBMB 3IG1B 2BQUA 1LWEB 1SUQA 3KLEB 2VG7B 4O44A 4YMEA 3CJ4A 2R2TA 3HVAA 4LSNB 1JLQB 4RZRA 3SI8A 1C1BB 4NLXA 5FDLB 5KFTA 5KFSA 1YVFA 4K4WA 1T03B 3FQKA 3DRSB 1K1SA 4IDKA 4YR0A 4MIBA 5J2MB 4MK8A 4EYHB 4DL6A 2AQ4A 4O4RA 1IKWB 1NHVA 3D5MA 1RT6B 1LWFA 2RKIB 5J2PB 5KT2A 1C2PA 2GIRA 3E51A 4RW7B 3I0RB 4J9RA 4LSNA 3G6YA 1S0OA 4KFBB 1SV5B 1HMVA 3FSIA 3PW0A 3MEGA 4WFZA 4K4VA 1JKHA 3EZUA
chains in the Genus database with same CATH superfamily
4MMOA 5ITHA 2BM1A 1R8BA 2YNHA 1DLOA 2UXDJ 4URSA 4DN9A 2XO6A 4FYYB 4NLSA 3GE9A 1RWVB 5FIIA 4CM0A 4IQXA 1FF2A 1H74A 3M2RB 3N5FA 3PHEA 3OXGA 3MM6B 2MZSA 1N5VA 4USJC 4OYPA 5U47A 3CJKA 4BLGA 1UVIA 1FNOA 1S4FA 4NLYA 3UCGA 2VHGA 3V81B 3RAQA 3MPWA 3QWUA 4DJBA 1TZ0A 3H98A 4IRDA 2QT7A 2KTQA 3D66A 3FCWA 3D9BA 4QIGA 5GAHI 4XPCA 1HNXJ 4B3RF 3MCNA 5ETRA 4BC7A 4ZPAA 2QLBB 2AW0A 2C2EA 1SKRA 1R31A 2GGPB 2MB0B 9RUBA 4AQYF 2E5HA 2HFUA 2MEWA 1X0PA 4I6YA 3NBPA 3UQSA 5KFFA 1KLMB 2IA0A 2PEHA 2MMYA 5F3TA 4RUCA 3RB4A 1XBWA 3GP9A 4J9KA 1HNXF 2LDIA 2F63A 1NKCA 4KPYA 2LXFA 2PIIA 1M1GA 2MKYA 2HBRB 4AQYJ 2F4FA 3RG6A 1PJ7A 2DR9A 4C48A 2RKIA 3HHKA 5IQ6A 4C7QA 4CH7A 5KFLA 3QMQA 1F9EB 3IBFB 4DSKA 4NOHA 4L76A 2XMMA 4YN3B 5C25B 4X4QA 4WYWA 1BE4A 2ZH4A 1U1PA 3BBFA 2LQJA 2NSCA 3QAUA 4WZMA 2QLXA 2OD6A 1LK7A 2K3KA 3VGVA 1J5EF 2J0XA 2R42A 2ZEJA 3KLGB 4F50A 4GO7X 3ZTRA 2HGNA 2QX0A 3PTWA 5LT5A 2OD4A 2ZH7A 1KNZA 3UN2A 2E1AA 2R9LA 4DV3J 1K0TA 4OIXA 2K7JA 2PA3A 4EZ6A 2BYCA 4NRUA 3FSXA 4O0NA 3BO2A 5I3UB 3EZOA 2CUYA 5EUHA 1F5BA 3TA0A 4JI5F 5ETTA 2VKZG 1K9MT 3JAMY 2BABA 2ZHOA 1PJ6A 3CSKA 4YDDB 1F3FA 1ICEB 3GJRB 3OPKA 3EVOA 4LF5J 4TU8A 4ED0A 2GJIA 2PE8A 2UUWA 5I42B 2H5EA 2ZH3A 2OO4A 2XI3A 3DLKB 4KBIA 4ZP8A 5B0CA 2D3OR 1NJWA 2DNYA 3TQ1A 1OMSA 1P8GA 2HFVA 2WW4A 4YB1P 4IO9Q 4E2FB 4PUOB 3NGDA 5HVFA 4YS2A 2E9TA 2P6SA 4ZMMA 3M9OB 3SFGA 3V6HA 2LXUA 3CIMA 3OXFA 2KL8A 1FD2A 3H4DA 1S1TA 1VJWA 2QA1A 3KDNA 1HBNA 1RBAA 2R2SA 2JEFA 4DV7F 1S1UA 3NCPA 3THTA 1RCXB 2UU9F 2B56A 4GVBA 2ZZMA 3PJXA 4NLOA 4NA2A 2DH9A 4LF6J 1CJVA 1UKUA 5KFUA 5J2QA 4HDHA 4FKYA 2J76E 1RAEB 4OJ1A 4ZVRB 4TU7A 1NSKL 1WF2A 4OJ3A 1WORA 2VG5B 1VQ9S 4FF3A 1N32J 2AYEA 5G0RB 4Y3CA 3M7VA 5KFVA 3OLAA 1FK9A 3ISND 1S0NA 4HYKA 2FPHX 1RT5A 2AEJA 4XO0A 1EKSA 4OX9J 4FZVA 5IT0A 4X4TA 2KFNA 1HA1A 2XNRA 4MKYA 3G9CA 1VQMS 2XQCA 3EUNA 4ZCLA 1GEHA 1A6LA 3PEJA 3SXLA 3VCDA 3G96A 4DR2F 2R4FA 1PBUA 1TKTB 5KFQA 2BKOA 3KMQA 3A8EA 4RBVA 4HHJA 2VH7A 2FVQA 1NPPA 3JTPA 2DIUA 3NOCA 1I5OB 4NRTA 1MU2B 4TKTA 3KUHA 5F8MA 3KHLA 2VOOA 3QGPA 4A8KA 4QYZJ 5EWGA 2IY5B 4B3SF 1SXLA 2LMIA 1U24A 2VPYB 5DS7A 1R6VA 3SQOP 3TNVA 1BQMA 1SV5A 2XZTB 3UW1A 3D0GE 3W8GA 1RTIB 1RHKB 4DXLA 4N76A 1FDAA 2ZUAA 2WOMB 1QAYA 3AB2B 1XIQA 2F3JA 4LFAJ 1FX4A 4CLTA 3HSDA 2I8EA 2B8PA 3VGSA 4CDIA 2WSCC 1DY3A 2VBZA 4R25A 1X9SA 4LFBF 2DCLA 4DFKA 2OGUA 1CQNA 4O3NA 1WG5A 2BDPA 3T9NA 2HFOA 3PR5B 5MLCV 3A3NB 1YBAA 3MM9B 3G87A 3MUTP 3CMAS 1UFLA 2UVUA 1J5EJ 2HQ3A 4K4VA 2D41A 3RAMA 4PG6A 3QJJA 1NRKA 1UETA 3HHEA 1SVDA 4P6QA 2JLGA 2F40A 5L1KA 1KOOA 2YX4A 4EU0A 3NP5A 2IFXA 2CJBA 4LBHA 5K8PA 5IWAF 2RU3A 3QJLA 1K73T 1TFWA 1AB8A 4FXVA 1R0AA 3MXHP 4M95A 3VHQA 1QSLA 3JSBA 5J1EB 1S1WB 1Y7PA 4F0KA 4URGA 4KY3A 3GFHA 1V3ZA 3RR7A 1HFEL 1N34F 2AYGA 1PIEA 2BJ7A 3IBWA 2B9EA 3KNAA 3L9ZA 1HBMB 3BKTA 1U09A 2V6AA 4LBIA 5B0AA 2P9CA 5B0GA 3E2EA 1F3VA 1BC6A 3M8QA 4Q2LA 5DDQC 1RB0A 3BO4A 3F56A 3N6MA 4UTGA 1WOSA 2FY8A 2WVDA 3AOAA 1PKUA 1WDTA 1U7LA 2CQ4A 2VFVA 4CO2A 4ED5A 1SH0A 4KV8A 1O0PA 2MYFA 4OYOA 3MUMP 4W92B 2NXEA 2H4WB 3LP2A 3OQ2A 4NCAA 5E0OA 1M5KC 4JI4F 3NNHA 3UN3A 3DHXA 5KFGA 4HHUA 5ETSA 3A13A 1HWLA 1FESA 4Q0BB 2EXUA 1F5AA 5HQLA 4KGXB 4I2PA 2CQCA 1MMDA 3HLUA 4I4BA 2WVBA 2ZUGA 4M1KA 4CLUA 4KHPF 2Z2YB 4LF9J 1LW0B 2UUAF 1U48A 1H38A 4NYOA 2C2NA 3DU5A 3GFYA 4ZITA 3LP1A 2HIYA 1HR0J 4DR6J 1RHJB 4Q0BA 1IN0A 1RTZA 4HACA 5KFRA 2J8AA 1UWBA 2SXLA 2NXCA 3MM7A 3PIPQ 1PG5B 2XO7A 5THWA 3KHRA 4N5SA 3U1MA 1OIAA 2HSEB 4AL5A 3GPAA 5F8IA 5IXUA 3L7OA 1BGXT 5DO2A 4QW9A 4UT4A 2H9ZA 3IR7B 1HR0F 2OSQA 3VQSA 3MEGB 2V2KA 2F1FA 2F8MA 5B0EA 5KFBA 2KZZA 1WKKA 3QFHA 4F4XA 3THVA 2YWWA 1AFIA 4TQRA 3GIIA 2JOQA 3BGRA 3VAJA 4FNHA 3MHYA 5HP1B 1TL7A 3PCOB 1FA0A 1TTHB 2IBOA 3TVYA 3M4XA 5CCLA 2QG9B 2QLFB 4G6VB 2DPIA 4PWDA 2E9ZA 1SC3B 2O67A 1DHMA 2IC3A 1N5YA 2GIFA 3SFUA 5HSPA 3MI7X 1GAOA 5A76A 1JB0C 1RISA 3NRBA 1NCLA 4B3MF 2KHCA 4FVCA 2ZJQQ 3CJ2A 5G0RA 5KAKA 2ZH6A 1DRZA 5IOLA 4YY3F 2G2YA 5GMEA 2NYIA 2EFVA 1UJ5A 4QYRA 1E6VB 5HK4A 4RW9A 2FHOB 1Q1KA 5C5JA 1XMOF 2DBBA 2VG6B 1IBCB 2PFFB 4ZPWR 2DD8S 5E3CA 3TAPA 2YKMB 4IG0A 1DTTB 4ELUA 4CP5A 5DETA 2Y0BB 3AQPA 4ED8A 5D0RA 4L3KA 3J7YU 3QO9B 4PKDB 2OPSA 4NZ7A 4RJVA 3IM8A 2FLOA 3ZTPA 1RUSA 2ZWOA 4MK9A 1FWPA 3BO3A 1GXTA 2YVSA 1IBKF 2NXJA 4BCAA 2DNNA 1RT3A 2VD3A 1S1XA 3ZNJ1 4C3MA 4A8SA 2YNIB 1VBKA 1SBRA 4ZVSB 1FKOB 2PSZA 1CQMA 2A10A 2O5DA 5L9XA 3DM2A 3W62A 1LWCA 2RQMA 1FNMA 1RCOB 1RTIA 1TVRB 2WB1D 3AXMA 3MM5A 5A0YB 1RYSA 1NAQA 3TO8A 3VAGA 1B7FA 3OTOJ 1YBUA 4FVMA 2W9BA 1WDDA 1QY7A 1RTHB 2MLXA 4U8YA 3S8SA 2QTWA 2HRUA 2R8HA 1HMVB 4C8OA 3D6HB 4V1Ak 2UXCF 3ETOA 3JSMB 3I0SB 3NNAA 3THPA 4DG1B 2R2UA 3MMCA 3I31A 3PNIA 3R5DA 4W98A 1QE1B 1OY8A 2A1BA 5D3GB 1RJJA 4NYZA 1NJXA 3IS9B 1IKXA 4EO6A 5DDOC 1TQLA 4G1IA 5GAGI 4RNMA 2DGOA 4DSIA 3M6WA 1RDRA 1LOUA 1TU0B 1WSRA 3R6LB 4DV5J 4M94A 3P5TL 2LA4A 2RHSB 4HTJA 2W8LA 2ZHAA 4C3KA 2KI2A 2OEJA 2YWHA 1HWIA 1NZ8A 2RUGA 3CIZA 3DYAA 4YDXA 1DQAA 5K14B 1TMMA 1JLGA 3BSNA 4WXWA 2R8IA 3HVTA 2EG1A 3ITHA 1QAIA 3HXMA 2AWZA 4QWDA 1AFJA 1R0CB 2YWGA 2CNLB 2VODA 1RAFB 3M6VA 2UUAJ 4MFBA 5DGBA 2C28A 4ED6A 1OSDA 3KOAA 5M2RA 2UU9J 5E3QA 2NSBA 4ZP6A 3LTOA 4L6V3 3R7NB 2QGFB 4M8LA 4ZLLA 1U49A 4YP3A 4C97A 4QWAA 3I55S 4E98A 4S0MA 3DDKA 2C22A 4GVLA 3KLVA 2BACA 3N5BA 3TZZA 1RABB 1RKIA 2ZD1A 2ZNYA 2RQCA 1YSJA 5M2PA 4N56A 1OSCA 3ULHA 4PQUA 5D4OA 4WKRA 3CJRA 3GV8B 4JOUA 1HNVB 2BE2A 4M5IA 3AXKA 4NXMF 1GMUA 3LP0B 4IYQA 4KE5A 3MOZA 3JQMA 4IOCQ 1X0FA 3DNCA 3PACA 1IM4A 5B09A 4QU7A 1Y5NB 1ZETA 1FEHA 1T9YA 1DLOB 3H25A 4LIRA 5I3UA 4RW6A 4WYLA 4ECSA 1WJ9A 3DOKA 3PG9A 4KO0A 2AGQA 2DVIA 1WG4A 1HNWJ 2Y8YA 4MJKA 2R7WA 3OLBA 2H48B 2BE9B 2KT3A 1GX5A 2W9CB 3TVKA 4DV6J 4LF4J 2APOA 1DTQA 3MEEA 2W2OP 2W01A 1VRTB 4JV5J 5LXRA 4TY9A 2BXJA 2HEKA 1QM9A 3K5OA 3UFCX 2R7OA 1CSJA 2IIHA 5EGYA 4LF4F 4MKAA 2YKOA 4XK8C 2KVIA 2G13A 1J27A 2AF6A 2MZQA 5B0FA 3W66A 4EEYA 2WVCA 2VJVA 4JV5F 4F4KA 3CCZA 2HNYA 4I2QB 2Z56B 1S6QA 1IQZA 1FT8A 1J5OA 2YXLA 3K5PA 1M5PC 1VGYA 3N79A 4FBTA 1V9OA 1N56A 2E5GA 3BGUA 1IBKJ 1MROB 4M5JA 1DTQB 3HI9A 3MEEB 4XIUA 3OUYA 4F8RA 1UFWA 1XR5A 3AJDA 4Y2CA 4NMLA 1ZM3A 4OI0A 2X1BA 1HLWA 3KK1A 3BDPA 1R7IA 3TUIC 2HGMA 4DWIA 4M5DA 2FLPA 1BQNA 3OFGA 4JI2F 2RU9A 2V9WA 1U2FA 5KFEA 3G4SS 2CG8A 2DNMA 4IFYA 4P2XA 1EARA 1S6QB 1KVKA 3W5ZA 3LP0A 2ZD1B 3E8OA 3H5UA 3P5BP 4I2QA 4NLPA 3P45B 2HAIA 4YEAA 3RU0A 2CZVC 3UNGC 1WI6A 1FERA 2EKYA 5ETNA 3OJSA 3CCRS 1SIWB 2HHPA 4Q5VA 1VIXA 4J9VA 4B3OB 4DV0J 2OLWA 4OI3A 3JTNA 2XYGB 4U7UK 1NEEA 1S10A 4JV1A 1MWYA 3HFKA 3VGUA 3HD1A 1JJHA 3DXSX 4AL7A 1D09B 4ECXA 5KFAA 1YWXA 3W2WB 2VG5A 5KFDA 3X3UA 1L3UA 5HJYA 4DFJA 3NGRA 2E5LF 2FY1A 4CO1A 4USHA 3Q2SC 5GMKa 1WI8A 4X4SA 1N8RT 5G4DA 1UPPA 4PXBA 2HHTA 4FS1A 2K1RA 3TANA 4NXNJ 5FJ4A 3P4UB 1QD1A 3HHLC 3N9UC 3MWBA 5KT6A 3T5HA 1U6BA 2V4JA 2E7XA 4IRKA 3SDEB 4NL5A 1VI7A 1S49A 1T11A 3RBDA 4B3RJ 3D67A 4ZN1A 3PEHA 4EUVA 1WACA 3R5JB 1KQFB 3T1HJ 1REGX 1CJKA 4N8NA 4DQSA 2AP6A 4DUYJ 2ADBA 2IA6A 1U2RA 3UVJB 3CMES 4KPCA 4K4TA 3OVSA 1T0TV 3FCHA 5AXKA 4OMFG 1TL1B 4B9TA 1YKWA 3FEXB 1X5TA 2RRBA 3M9MB 2WBMA 1Q7LB 1H0HB 1S79A 4HLBA 1IKVA 1T9VA 4ID8A 4BDPA 4DSLA 5A0YA 2XLKA 3I0RA 2VBYA 4DL0C 3PR4A 4DPWA 2HPUA 4DV1F 2ATLA 4B9LA 4ENOA 5GAEI 4K0KJ 4Z7YA 1FRLA 3T6JA 3GB0A 3Q23A 3DLBA 4C8NA 2DXFA 3OSNA 2YWEA 4NX9A 2ALZA 4I56A 1FWKA 1U25A 1FNXH 4F2RA 3GIJA 1T7PA 3ZZOA 3LH2S 4OZ5A 4QIEA 2MHNA 3H20A 1VK8A 3QPIA 4DEZA 4YUDA 5JVGQ 2KFZA 5KFJA 1NO8A 1KN6A 2GX8A 3CGIA 1S48A 4H4MA 5A2QU 2K2PA 1TMJA 5D0GA 1NK5A 2A3JA 1N36F 3SEOA 2VG6A 1ITPA 5HROA 2BR0A 2FJBB 4CTAB 1UFKA 1IXKA 1X31C 5GADI 1CJUB 3ZFVA 4OI1A 3PW0A 2G1HA 5F8HA 1FJCA 3QT6A 2XG8A 4UOCA 1OQ3A 1RA6A 2GCFA 2M52A 3NCRA 4BBYA 5K8MA 5KT5A 2RQKA 5JVHQ 2EFQA 1UTAA 1LWXA 3AOCA 4W90B 3IG1B 1AA1B 2YWKA 1WWHA 2HQDA 3A4TA 4CZCA 2XTJP 1XJWB 3HVRA 3CJ4A 4USKA 2RB7A 1Q0NA 5FDLB 2XULA 1SIZA 5KFSA 1YVFA 3CD7A 4TVAB 1T03B 1KQSR 2KDOA 3FQKA 3DRSB 4MAKA 4YR0A 2B7BB 1QSSA 1IJFB 2W4DA 4FKXA 1IKWB 4L75A 1RT6B 3QWPA 1LWFA 2JFDA 3BGLA 3TA1A 3MM6A 4QPTA 5B7WA 3BGOP 5J2PB 2LCWA 5KT2A 2GIRA 2KVQE 2L3MA 2L9DA 4RW7B 2FGOA 1VQNS 3A1YG 4J9RA 4B3TF 5AXMA 4KFBB 1YJNS 3AD9C 4C11B 1G4CA 1T9TA 2GW8A 4ER8A 4LBPA 3V2UC 2L41A 1KSPA 2KM8C 1Q86T 2RS2A 1D9FA 3MEGA 2VOPA 2ZJPQ 1GXUA 1GFWB 4C3LA 3EZUA 1YJRA 5E5NA 4LRBA 2WVFA 4CIOA 1SL1A 3HVTB 2Q79A 3ITHB 3PHTA 1VMBA 3VF0B 4J9NA 1GH8A 1MROA 4ZP9A 4NMXA 3QIPA 5DLGA 2CQGA 1VQPS 3KJNB 3NG8A 1YIJS 3W9JA 2MQNA 3S7RA 2Q6BA 1ZBTA 3T1YJ 1VRUA 5C24A 1RT3B 1S6PA 4NXNF 4K4UA 1JMTA 2X51A 3U1NA 2MDAA 3RTVA 4LR8A 3S6EA 1TL7B 5C2GA 2G2ZA 2Y1RI 3SBMA 2Z58B 4O3PA 4ES2A 4UZBA 3HT0A 3TAMA 5IC4B 2NPIA 2IVMA 3KKFA 4WE1B 3T1YF 2J6UA 4QZVB 3WC0A 2N4CA 2V50A 4P52A 3IXQA 3CMQA 3SCKE 2PMZD 2W9BB 2LQ8A 3MR6A 4ECYA 2Z2MA 4MYUA 2RQ4A 4TU9A 4CWBA 1ZZFA 2FHMA 4RWWA 2DNKA 1JLCA 2QN6B 3LF0A 3TAMB 4CLPA 4IOAQ 2P8IA 4A47A 1Q8LA 5AJ3J 3D68A 4P10A 4O4GA 1LWFB 2VDHA 4G1QA 1RE1B 4L74A 4QIVA 5EX3A 1F0XA 4KH1B 5E33A 5C24B 3M8QB 3NS7B 1GT8A 1S1XB 2GC8A 1FK9B 2E5JA 3O5TB 1CC8A 4OZ0A 3HD2A 1NK7A 4ZVEA 1JLBA 1U8SA 3CC2S 2A0FB 2YBVA 2JDJA 3B78A 2BMBA 1JXEA 3RBXA 2L9WA 1B99A 4ZVUB 5GMDA 4GKJJ 4P7TA 5KG1A 1BD6A 2ALYB 3NL0A 1PJ5A 1TKZA 3AB4B 3V6KA 4IUFA 1RGVA 2EC0A 3KXDA 2GJFA 1EQMA 3OFEA 4YB6A 4ZVOB 3T6BA 4PR6A 2XY6A 2KG1A 4DR5F 1DAXA 1SPBP 4WXOA 4B9MA 2J9DE 1HHSA 1CS4B 4R0JA 4WFYA 2IC3B 1KTQA 3IM9A 4FPIA 4DL3A 1SJ3P 2QZ8A 4U67Q 3MAQA 3GLJA 4UW2A 2HIQA 2CPFA 2EKNA 2BEFA 4ZJOA 5I4MA 3GIKA 4A8YA 1Y11A 2I38A 3VWSA 1FE4A 3M1VA 3BR9A 4K5SA 5KFNA 4LF5F 2V67A 1Q79A 4BC9A 1KD1T 3IAM9 5A6PA 1FD8A 1L3VA 3DU6A 2UVVA 1QVFR 2VC0A 2WOMA 3BS9A 3G8QA 4ED3A 4JI6F 4DQQA 1U02A 3RYLA 3V4IB 1IWAA 4RU2A 3EE3A 1ZA2B 3DLGB 4JP8A 1N52B 1BMQB 1UWAA 1PAEX 4PQAA 2ASDA 2ZE2A 2N82B 2QA4G 4HT5A 3QT5A 2C2KB 1SH3A 2CQ3A 2CZ4A 3S01A 4JI6J 1VS3A 1SJRA 1U0HA 5IV3A 3G8SA 2FLNA 3Q8QB 4BS2A 3WC2A 3FRZA 3SSRA 1N0VC 3TZWA 2LVWA 4USIA 5A8RA 3W9IA 2I5JA 1LWCB 1YX2A 2XCPA 4I2PB 3MEKA 2XEXA 2UXDF 3BPSP 3GFXA 1CJTA 1XMQF 4C0BA 4KGVB 5CHCB 1LFWA 3CDAA 5J2QB 1FCAA 3TA2A 4K59A 2D74B 7FDRA 4DL4A 1NZAA 1X4DA 4I68A 4CCHA 4KB7A 1LNQA 1S1UB 3BM7A 2XMAA 1FTRA 1U47A 3QO9A 2R8KA 4DPOA 4ERDA 1N33F 3H59A 1X4EA 2MKKA 1VQ8S 1SJ4P 2VA3A 1UVNA 1VC5A 2ZVIA 3QIDA 2B3TB 5KG3A 1IJEB 3HPOA 3PXGa 4DFPA 1T9XA 1T95A 2RRAA 5HJXA 2ILZA 4PG7A 2HFNA 2KM8B 4ECVA 1FWLA 4KT0C 1JJ2R 2VBWA 1S9GA 1Q8KA 3LOUA 5D4NA 2DB1A 1ZAVA 3ZXWA 1S57A 3K5LA 4A8FA 5L1JA 3SV3A 1NK8A 3U7JA 2ZITA 3KLFA 4PUOA 1YLXA 3ILJA 2QL9B 2P6TA 4PXDA 3NMRA 1H2TZ 5I3PA 4E8UA 2JVRA 3ISNC 3FEYB 4OLPA 1X9WA 1HHQA 2IDLA 1NJZA 1IKVB 2G9OA 3FK4A 1VIOA 1CJVB 2P5VA 3OTDA 1AYEA 3TJ8A 4IRCA 1P9YA 2OTJS 2HRTA 4QU6A 1RHUB 4MIAA 5DM6Q 2MGZA 3VV2B 4LF1A 1TK0A 3ZZUA 2ZZTA 3KG0A 1NKEA 2JVOA 1UVJA 2HS3A 2R7XA 2Z8QA 3FJ2A 4JBCA 4DV3F 1B0VA 1WOOA 2MKJA 3NGSA 4LQ9A 3RBEA 1ZOTA 3QRPA 4CT9A 3H2VE 2JLEA 4DS5A 3W3SA 2MSTA 1UVKA 1KP6A 1JXVA 2YX7A 3NLCA 2A18A 3HJVA 3MPDA 3OVBA 2VPZB 1J2VA 1URNA 1RSCA 3QIPB 2VDIA 2AHOB 1VRTA 3R3TA 2YQ0A 2LA6A 4PG5A 5F8GA 3CC7S 4MKVA 5KFPA 3BBBA 2HURA 4C98A 2X1AA 1N54B 5LMNF 2B6AA 2HFZA 3I5CA 4O0IA 4JB8B 1RBOB 2FIUA 4F25A 1G6BA 3G6VA 4LVOP 2M2BA 2V4RA 2A6OA 3PFOA 5AXNA 2PO4A 4NLWA 1EZZB 3QYYA 4URQU 5F9LA 2NREA 2H5IB 4R0EA 4DR4F 2IM2A 1LW2B 1W2BR 4TLRA 4K2XA 5L46A 1ZM9A 1M5VC 1TL3B 3TUJC 3NOGA 1WC4A 4RW7A 4CO0A 2DO4A 4FP9A 1W25A 2BE2B 4P2FA 2IHR1 5AE3A 1SC6A 2DNHA 2JFKA 4IDKB 2OAUA 2VBXA 4I0WA 2B9WA 4QWBA 2LYVA 3PIOQ 1OYEA 1RAJA 3N0VA 3BN7A 1N5TA 1R89A 1RT5B 2BQRA 1TKDA 3RUBL 1JLQA 5T14A 3VVTA 3Q8RB 2CJ9A 1G7CB 2XI2A 5FDLA 1C4AA 5KTQA 1C0UA 4DPYA 4WIIA 5CA5A 1SQGA 2YNHB 2AJQA 3IRXA 1U1QA 3MMAA 1WNEA 2HRYA 3O2IA 4M63A 8AT1B 3KK1B 1GK8A 4IR1A 4O4GB 4TNOA 3MD3A 5ETKA 4OX9F 1MN9A 3K8VA 4R5PB 3SSSA 3GG1A 1S7HA 5IS2A 1MLAA 2Z2ZA 5CZVA 4RU9A 4DS4A 2ZM6F 4RO0A 2CQPA 2KH9A 2RD5C 1Y10A 4NA1A 4DMZA 3QRQA 2LXIA 2C3YA 4LMZA 2R7UA 2AEFA 1JXLA 3IRXB 2HK2A 4OYZA 4JYAF 2HNYB 2WRMA 2B7CB 2GIQA 1PC5A 2OPPB 4KKOA 1KLNA 3QLHB 1F2HA 1HYSB 4ZHRA 3UD3P 4WU3A 2HNZB 4JYAJ 3MPUB 4ICLA 2J7UA 3HFVA 1IUJA 1TV6A 1VRUB 3KJVB 4K4SA 2FYXA 5K8NA 1T94A 4OYBA 2YNGB 3M32B 3SQGA 2A6MA 1YJ7A 4U95A 2HWIA 2DGUA 1BQNB 4DZ6A 4UQGA 5HO4A 2ROEA 1YJTA 3PDNA 1EQ0A 2XMJA 3LA0A 2JC1A 2H65B 3G8TA 3I56S 1SL2A 2EFGA 5EDWA 2ZC4A 3FDSA 3PY8A 2CJYB 2DCUB 3HF5A 2W7PA 1WC1A 3D4JA 3WIVA 3KLGA 1Z2LA 2BJEA 4WFBQ 2DR5A 1S97A 4ES1A 2FZCB 3U02A 4DSFA 1NUEA 3BN4A 5RUBA 1FDNA 4EO8A 3JQKA 2NXNA 4ID5A 1VYAA 3KJVA 2JWNA 3NS5A 3G82B 3ELHA 4F67A 1UEUA 4IH7A 4YHHJ 4CLSA 1QE1A 4Y00A 5DG8A 1YJ9S 4RLEA 2O66A 2U2FA 4LRDA 3CWJA 1T03A 1FEEA 4DQIA 1E6YA 4ELVA 3QZ8A 2AX1A 2K1RB 4JV0A 2YPZA 1WF1A 4IH6A 4X62F 4EZ9A 2R7SA 4X64F 1HIYA 2VQFJ 3NWRA 4WF9Q 4G65A 4DR3J 4DV2J 5L38A 3CCSS 1URRA 4H54A 2YH1A 2KRRA 4U9RA 2IPOB 5A6WA 5JXSA 5KFIA 3EYZA 5C42A 4R8UB 3SCLE 1Q78A 2CDQA 1AXQA 5F9NA 3BQ0A 4X62J 5LMUF 3IBCB 2YTCA 3KTQA 1MWZA 2GQQA 2HVEA 1E6YB 5K14A 4OZJA 2EK6A 4KH0B 3NKYA 4CTAA 4N41A 3FGVA 4G3IA 3KLIA 2XS7A 1XR6A 2IDEA 2V2QA 4I1TA 4Y65A 4ZVHA 1X60A 2FC8A 4RBTA 3ZZTA 5KOWA 5LMUJ 2CJKA 3OUYB 3U27A 1XR7A 1Q7YT 3TWZA 2FJXA 3BQ2A 5HQ8A 4C9DA 4PXEA 2ZC3A 3ZTQA 4O44B 4DG1A 1S59A 2M88A 3OL6A 4OZ2A 5KG5A 3J81Y 3JS9A 5F41A 4ZDNA 2JH3A 1NLKL 2C2OB 4Y2MA 2G2OA 4DPTA 1X4BA 3C16A 3KG1A 4KHPJ 1RHRB 2BANB 1FJ7A 1WC0A 1DJ0A 5HL7Q 1WHYA 2H51B 2Z4PA 4EWTA 1EP4B 1QUPA 4J9OA 3ONQA 1NSQA 3SCIE 1XNQJ 2AYMA 4F3MA 4DR6F 4GRSA 4KYZA 3JYTA 4IH5A 1HW9A 2VPXB 4DUZJ 5IT4A 2FD2A 1Y9OA 4G1PA 4NLUA 4QPXA 1S0VA 2B6AB 1Q8BA 2DKOB 2HLUA 2XHCA 2ZVSA 3HULA 2HVHA 3C16B 4QCLA 4J9PA 1FVSA 2QMUB 4QYZK 3DYAB 2HNZA 3MPYA 4OZNA 1M90T 1NB7A 2Q66A 1UZHA 1Z1ZA 4Z2XA 1NDKA 1WTFA 1MN7A 2N4DA 3K59A 1RTJA 4DN0A 3HK2A 2UUCJ 3QGGA 1U1NA 3G6ES 4DV6F 2HHQA 8RUCA 4OL8A 1RAOA 1E6VA 1JLAA 3K89A 4XTTA 4KGZB 3CDUA 4OHZA 4OX6A 1WSVA 3A8JA 3J7ZT 2OI2A 2GHPA 3K2YA 2BJ9A 4MH8A 3PZPA 1U1KA 4DPXA 4B3MJ 1M5HA 3CCUS 1Q95G 2DNPA 3NEKA 4E0DA 3RR8A 3EDRB 2CQDA 3R5AA 1DBDA 3ZZPA 4DU8A 1HBOA 4DZDA 1Y4ZB 3MR5A 3OSPA 1YDLA 5D8HB 2BKNA 1BY9A 2V4QA 3CB4A 2F5GA 2HWHA 2KKHA 3GJQB 4QR0A 1UW9A 2J6SA 4ALZA 3AY0A 1FKOA 3IP0A 3A3PB 2MJUA 5J2NB 3DXBA 4ZJQA 5LSLA 1W26A 4NLRA 2QO3A 3MOJB 1WF0A 3KWMA 5HAOA 3H2UB 2AZ3A 1SJQA 2F8EX 1B0TA 1TL3A 1CLFA 3US5A 4RNOA 2OHDA 2RSQA 1NJIT 2AGOA 4YFUA 4JI1F 4N8OA 4Q2MA 2HHHJ 4ECWA 3NGKA 4R8UA 5C42B 3MM9A 1DQ8A 1FRKA 1JLFB 5KFYA 4WCEQ 1Y3JA 3AA8A 2ZOGA 1HQEA 4X64J 1D8YA 4OZ3A 2OUGA 4C4WA 2VKRA 4DV2F 1R8CA 3MAAA 4EK2A 1JLBB 4FBUA 3CXCR 4ECTA 1L5UA 3EDQB 1QVGR 1U6FA 4C8MA 4ED2A 4LRAA 3QQCD 5HQMA 3MECA 2LU1A 1FDBA 3HO1A 1YQHA 3LAKA 3POTB 1WUUA 5JJBA 1FXRA 2I5JB 2V34A 3D7SB 2H5JB 1HYSA 3K5MA 2E5LJ 2AZ1A 3MMBA 4X66F 1P6TA 1KBRA 3ZTOA 3FQLA 3NGTA 1T8EA 4PWWA 2EFPA 3WDOA 3CCLS 2EK1A 2CPJA 2LFVA 5DZ7A 2CWXA 3DLEB 5DG9A 4KIAA 2CWKA 4P2MA 2FB0A 5E2QA 1BQXA 2DY1A 1SC1B 2MHEA 1D9AA 2QRRA 3AA9A 4KHRA 1WELA 1TKXB 1QDUB 2CVIA 1VQYA 2LLZA 1LFPA 3V4IA 5SUHA 4X4NA 2EG2A 3OTCA 3BEGB 1C1CA 2NCKL 5CYMA 2VUGA 1LQ9A 1RLDA 3PV8A 2IJFA 3JSRA 1F9FA 2X3DA 2LQ9A 3ICLA 3ZTSA 1RADB 4NCGA 2HMIA 2CPHA 1HNZJ 2HG4A 2AJ1A 3VVUA 2W7AA 1H2UX 3ZNUA 2OMOA 3I96A 5L39A 2UZAA 4HI1A 4IG3A 2CYYA 2IRXA 1NK9A 4WTYA 1A7GE 3QAEA 3PYDA 2UV8G 2HS4A 4J90A 4KV8B 3UD4P 2HHSA 2QL7B 4J37A 2CDRB 3UPFA 3ENVA 2MGZB 4RX6A 4DR1F 2DT9A 4MYTA 3C8YA 2ZHBA 5BYRA 3LANA 3M05A 4CO4A 1UAWA 3DRYA 4F26A 1RT4A 4DQPA 4NCGB 1VRQC 1REVA 5ETPA 3KK2B 1GTEA 4GKJF 2PC6A 3VZHA 3SZ2A 2KT5A 3BV8A 4U7UD 2HNDA 1C0TA 1FRIA 2MSSA 2NZ4A 3TZYA 4TY8A 1HNIA 2D1CA 2R7QA 3MEDA 2B4UA 3C14B 4GVBB 3AT1B 2HVIA 1MU2A 2QYGA 1K8AT 1XWLA 1RP5A 3G2XA 4MTPA 2ZDPA 4EFAC 1VC6A 1ULRA 5D3GA 1HPZB 2EFNA 4ITSA 3W5YA 2ZH8A 2VF3A 3W8PA 2QSWA 3B8HA 1CVJA 3GYXB 4XDDA 2GO8A 2YY3A 2GVZB 3D3CJ 2WSEC 3BYPA 3UDLA 4H4MB 1HQUA 1NJYA 3RRGA 4C8ZA 2GA7A 2KZMA 4NZ6A 2VG7B 4YMEA 2HBQB 1DURA 2V68A 3SSQA 2XSJB 3AD8C 3ZZRA 5L9NA 3SI8A 2CPZA 3M1VB 3VAIA 1LV5A 2VFUA 4LF8J 1TUVA 2I0XA 4FF4A 5F8JA 4OJGA 5J2MB 3J80Y 4JI2J 1TFYA 3OR2B 1VQ4S 1NHVA 4IQMA 3FMWA 2FGCA 2NYHA 2OMLA 3GONA 4X4OA 2WSFC 1ACMB 4FYXB 4ZKAA 4ZPVR 5K5MA 3I0RB 4EI2A 3ISZA 2GZOA 1S0OA 4ZVTB 1AUSL 4DR7F 2HZVA 1O51A 2YQ3A 4RPFA 2B4VA 3UR3C 5H9EJ 1O6XA 2XMVA 1N88A 1U0HB 1PYTA 2WZ1A 1X4CA 1I94J 4C8YA 2HHVA 1DFDA 3OBIA 3KUEA 1RHQB 3FC9A 1VCTA 4F7VA 3P96A 3D54A 1Y5IB 4NWBA 3HT3A 1K0VA 1U1MA 1AT1B 4Z7CA 1RWXB 4DUTA 2DRAA 2VQEF 1C0TB 3GQCA 2AKWB 4F0MA 1FFGB 3CD5A 3CDBA 1Q8IA 3R7SB 4UY85 4KJIA 1IQTA 3HHDA 2KB2A 2H1YA 4LR9A 1XTZA 1RT6A 3TUPA 5IT9Y 3LWMA 1M1KT 2G1DA 4EBEA 3CT9A 2OSRA 1N5YB 1HKAA 2HNDB 4V19J 1XNRF 1U26A 2R2RA 1XERA 2V9KA 2DNQA 3Q22A 1SKUB 4PWDB 1RAAB 2OFHX 2YNFA 4NYPA 1FI4A 2DNGA 2ZBQA 2UUBF 4C0HA 5EX0A 2MLYA 3IG1A 3NGUA 1JKHB 1H7WA 4DU7A 3VAHA 1LWEA 3KLEA 1FJGJ 3HZEA 1DZ5A 3HMJG 4NASA 4JUZA 1T02A 2IMOA 4PWUA 3GFZA 1T9WA 1RWWB 3ADAC 2MXYA 2J0SD 3KJQB 2CPXA 2OEKA 1RWOB 1NK4A 2F65A 2QL5B 2H54B 3G82A 1A0OB 2CADA 4K8RA 3K5NA 4LFBJ 2VU5A 5BYSA 2PEBA 5E7OB 2XYPB 3FBCA 2CA9A 2V69A 4DR1J 3FBFA 1KR4A 1NDLA 1X8DA 2HK3A 3EWGA 4RNHA 4K0KF 4J9MA 3ZZ0A 2U1AA 1DQ9A 1RU2A 3NS6A 1YJUA 4J9QA 3W2VB 1Q53A 5CYMB 5F8NA 4JI5J 4CYUA 1KLMA 3C46A 3K57A 3CVKA 3TARA 2FDNA 1OY9A 3C6UA 3EM1A 3BSAA 1N6QB 4K7QA 1M0SA 5IM0B 2DITA 3DHWC 3DOLA 2QC3A 3SQGB 3K17A 3MMJA 4OYXA 2XLJA 3PW5A 4UOHA 3V81A 3CJTA 5BJRA 3D0IE 5A8KB 3CE8A 2J9EA 5HANA 4UUWA 3D1QA 3CNQP 2YWFA 3DRSA 1KKHA 3KFWX 4NEZA 1LEOA 3H5YA 3CCES 3UCZP 1SQEA 6FDRA 1U8WA 2BJDA 2OKQA 1QAJA 3PKYA 2B9XA 2FZKB 3E01B 2PGCA 5GADU 3M30A 4F0HA 3L3CA 4AXJA 1HARA 1JQGA 1RWKB 4OZLA 4B17A 2DR8A 4ZN3A 2YH0A 1LXJA 1WOPA 2MY8A 2V5HG 1HQEB 1N32F 1HI8A 3WQPA 1EKRA 4WFAQ 1UEKA 3MR3A 2BANA 4KSEB 2HZCA 3W9HA 3GV5B 3N6NA 3H42A 1TL5A 2JZ5A 3GCXP 1L3TA 1GMWD 2J8SA 1MNEA 3M2VA 3Q8UA 2D7SA 5GAEU 3ENQA 4PYAA 1SL0A 3EVMA 2HKEA 4PQUB 2ACMA 3I5AA 2AJFE 1RYRA 2BJ8A 1I6JA 4WFXA 1UP1A 4XAKA 4Y28C 5HVGA 3BSOA 4A8QA 2J6TA 3TQEA 2AJ2A 2ZM6J 4WTOB 4U7CA 3D0HE 4TLQA 1U1LA 4KQZA 1Q81T 4FXDA 5DQGA 3IWXA 4FYWB 1PC4A 4EYIB 4K5RA 1OS5A 1XNRJ 4DF4A 2CPIA 5IFMA 2AT1B 1WC6A 2KG0A 4GKKJ 1F2GA 2JNJA 2QA2A 4NCBA 2MPUA 2FHKA 1Y3KA 2GHWA 2K06A 1GTHA 2RNEA 4OX7A 2J9CA 1B7YB 2CQIA 3FFIB 3DOMB 4UOFA 3WX4A 4DOZA 5L1LA 1RKJA 1SI9A 3CJ3A 2JHEA 4HDGA 1CJUA 2BM0A 2AD9A 4GKKF 2FHJD 1U0SA 1QUVA 1VK3A 4CRJA 4DLEA 2UXBJ 2FJAB 2YPYA 4BWMA 4USVA 4B9UA 1TV6B 3DI6B 2KO1A 4OZ1A 3J81U 1S1VA 1YK9A 2P9EA 3EGVA 4I7FB 2MZRA 1QJHA 3GCWP 1KTVA 3OTBA 5HVHA 4ZHRB 1FKPA 3I4HX 2UXBF 4WWSA 3R8YA 3W63A 3JSMA 2EPIA 1RLCL 3QZ7A 3W61A 5GAHU 4LFAF 1HWKA 3BYRA 4HTIA 8ATCB 5D15A 1XK8A 1U1RA 3MM8A 1SKWA 4NLTA 2ZH2A 1LKZA 4DL5A 1GX6A 1UL3A 2DNRA 2RH3A 2WBRA 3EVWA 6AT1B 5DM7Q 2M7SA 2YNFB 3ILOA 3JTOA 4C11A 2QMWA 1QTNB 2VPWB 2IJNA 3M2UA 3WHIA 4HI2A 1T05B 4JV2A 3DMJA 5E3RA 1X9MA 5DDPC 5HROB 1S9FA 2ACYA 4N47A 2J7WA 1HNVA 2QJ3A 2PDAA 3KDOA 1SJFA 2XWXA 3EXYA 4CLFA 4FS2A 3SYZA 1KVIA 4H4OA 2OPSB 3GILA 1YZ7A 3D6MB 4I67A 1CJKB 2CFXA 1ZS6A 3H90A 3DGVA 3X1LB 4X84A 4RUAA 1D0EA 2DHSA 3B4DA 1SUQB 2FVPA 2CNKB 4ECQA 4L72B 4C8LA 5AE1A 3EXCX 5LL6d 1ZPWX 4ZLJA 2CZ9A 1T05A 1HD1A 2KXNB 1T3OA 2VV5A 5AT1B 2OPRA 3CPWR 3IO1A 3R5GA 4GC7A 3EZ5A 4OJHA 3O8WA 1JLEB 2QYCA 2AJ0A 2V2VA 1GMWA 1IKYA 1WEYA 3M6UA 4QIWD 2EW9A 4IFVB 1HD0A 4DV7J 1L3SA 1RTJB 2FZGB 4FF1A 2L9NA 3KYLA 3DI6A 3PYGA 3QBCA 5KFZA 5D0EA 4Y2IA 3TJ9A 4YR2A 4JI4J 4DR4J 1TR0A 3W64A 2HVZA 2V8HA 2WVEA 3T19A 5L1IA 3Q86A 4J9SA 2OPPA 3OFHA 4CLWA 3VTIA 5KT3A 1JJCB 4ED7A 3TW0A 3GYNA 1S99A 6FD1A 4OLOA 5T7LB 1LW2A 3IR6B 5H9FK 4DCPB 2LEAA 4OV6A 3I82A 2IAJA 4NZ0A 3MCOA 4U96A 5DQIA 2EEYA 5J1PA 3TEHB 3RZAA 1JX4A 5B08A 3UO0A 1HWUA 1MW7A 3FFIA 5HMXA 1V3SA 4ZPCA 1U1OA 1EP4A 2F4VF 4PG8A 2OPQA 5LSOA 3D2WA 1T9UA 2CPEA 3CO9A 5F0UA 5GVQA 3MMAB 3FBBA 2W9AA 4QR2A 2KJWA 3KK3B 5AXLA 2M0GB 2FVCA 3DKDA 4FYDA 1REVB 4NXMJ 3BREA 2DHAA 3CDEA 4J9LA 4YY3J 1FXDA 2J5AA 3IGNA 4CNYA 2Y1LB 4FNIA 3TUZC 2M70A 1HHTP 1B64A 1ZPVA 2B43A 2VFTA 1CPZA 2WONA 1N48A 3CW2C 2GV1A 5I3QA 2YX1A 3OT9A 4NPOA 5HMYA 1JWWA 4FF2A 2J0WA 3MD1A 4KKOB 3HHNB 3BDEA 3D1HA 3HFZB 3GV7B 2CJQA 3F44A 2AU0A 2CKWA 2W9CA 3MAHA 2LP4A 4TYBA 1RXOB 3MM8B 4NLDA 1TUGB 5BYQA 2XZWA 3DRPA 4YB5A 1IWGA 1TL4A 1W2IA 4P75A 3IWNC 1VFJA 1C0UB 1PAUB 1X4AA 2E66A 3ENAA 3I9ZA 4UZCA 5ETMA 3MFHA 3HZGA 2YKPA 3R1HA 2QE5A 1RWNB 4LVNP 3PYEA 1XMOJ 2XMUA 2XNQA 2DH8A 2MKHA 2C1EB 4OI2A 2HHWA 3VAKA 2DR7A 2DGTA 1C1BA 2BKPA 2A2DA 2DGVA 3ETMA 4JI8F 4YB7A 4CNZA 4USMA 3MF5A 5A8RB 1X7VA 3RB3A 3KUGA 4YQWA 4A48A 4CLLA 1X4HA 3MURP 1ELOA 3IGVA 3QNWB 4ANDA 4O3QA 2CQ0A 1NDPA 3I87A 4CQ1A 4JI8J 4F3OA 3PW2A 3MTKA 1TUWA 2COLA 2OPQB 5D77A 4Y0FA 2KN4A 3DOKB 2MQ8A 4F02A 1HWJA 5D4PA 4ZS6A 4DV5F 1TVRA 2E1RA 1VHFA 3MM5B 4ZJLA 5BR8F 4QWEA 2C42A 5DLFA 2VICA 1R8PA 4DV0F 2M3DA 2BA9A 1VLOA 3MECB 4ED1A 1IR0A 2CQBA 3HP6A 5CYQB 3KLHA 1LW0A 2XYHB 1VQLS 4K4ZA 2UXCJ 3HSGA 4ICLB 3ZO7A 4GC6A 5KFKA 3K58A 1YITS 4OX8A 3MR7A 4BHQA 4CLKA 3P6YC 1UA1A 3EX7B 3D6TB 2VG7A 2IYGA 2BJ3A 2AYBA 3K8WA 2BX6A 1G3OA 5HMZA 2DY9A 2W24A 5IC6B 3IS9A 2OEMA 4P2SA 2GVZA 4ETXA 2O01C 4HKQA 5HBMA 3GIRA 4LF9F 2MQMA 3QSIA 3GJSB 2UVWA 2C3UA 2DHGA 4FYVB 1PBAA 5H1SV 3DC2A 3UN5A 4X65F 4R5PA 1YHQS 2V2ZA 2EI5A 4AFFA 3CCQS 2CQ2A 4N77A 5C7PA 4F4ZA 4UUXA 1EX8A 2LEBA 2D69A 1CJTB 4TQSA 4X65J 2J7KA 1JLGB 2DR6A 4PXCA 4DUZF 3QT8A 2V8VA 1OPIA 5E41A 1WEXA 1YG0A 3EPGA 3OR1B 4EBDA 1VR6A 3Q8PB 2QFIA 5CXTA 2K8GA 1CULB 2ROGA 1N5SA 5J1EA 1KEKA 1P1TA 4ZPDA 1X4GA 3H4BA 1HNWF 4A8XA 1T3NA 1R3NA 2WCXA 2P9GA 2IM1A 3B54A 3DLJA 4K4XA 2DJWA 2W2QP 2DXEA 1JK9B 2ZBPA 3MMCB 3UE2A 3RB6A 1VBZA 2G4BA 2CXEA 2ZNZA 2ZE2B 5HLFA 3UDEA 1HL6A 1VQ7S 2YKMA 2MY7A 3HX9A 1FFWB 1OPZA 2GQCA 4IG0B 3WZ0A 4D3HA 3RRKA 2B5JB 2ZFHA 3HJFA 3C6UB 4AUKA 4HACB 4RW9B 2W7OA 2FJVA 1UEVA 1KONA 3WBZA 1RAGB 4WIQA 4TYAA 1KHVA 1CEZA 3JQJA 1Q5YA 2CIMA 3PW7A 4LFCF 4PG4A 1N36J 4Q44A 3FCVA 4F04B 4JI7F 1X4FA 2C3MA 2BV3A 2RF2A 1L3KA 1R43A 4RW4A 4QWCA 3OL9A 1IVZA 2E44A 1RT1A 3I32A 4OI4A 4PEOA 4C6AA 2FTRA 1Y0HA 2EFOA 1DARA 3HM9A 2K7KA 4YHHF 3DRRB 2GJ2A 2RS8A 3ZZZA 2C2RA 2DHXA 4ECRA 1RT7A 1JNRB 3BR8A 2XBPA 3CO0P 3L4BC 3T1HF 2GHVC 1RAHB 4QR1A 3T41A 4F36A 2WK4A 3CJ8A 4F4WA 2AMCB 2J0QD 4KR0B 4DR3F 3LPEA 3QATA 4PPZA 4YR3A 2HHHF 4ZLNA 1BUXA 3PX6A 3EMTA 4CI0B 2E29A 2IBKA 2CPYA 1NSAA 3GWCA 3KJFB 1IKWA 4RW4B 1XN9A 5BXIA 4ZVGA 3UNYA 2R8GA 3KLFB 3Q8SB 2MZJA 4LJMA 2EC2A 4DSJA 2V94A 3AOBA 1FRJA 4ZPBA 1HW8A 2HZAA 2IJRA 4TXSA 3K0JA 1ZM2A 2IM0A 1SJ1A 2RDIA 2XS2A 3M2VB 3CUNA 1H6KX 1JLFA 2VFSA 3FKBA 3QGHA 2R8JA 1S4EA 2XCAA 3Q83A 4P73A 2VA2A 2E9RX 2C3OA 3GSIA 4Q43A 1NK6A 2HBYB 3I9V9 3MUVP 5KFCA 2IVYA 2DNZA 2N7YA 3PVXA 1SKSA 4B3OA 3L7PA 3R97A 5SZTA 3CJKB 1YZ6A 3NXZA 3T5LA 1HNZF 3PJ9A 2RE1A 2UUBJ 5J2NA 1U45A 5IV4A 1V6HA 3GR0A 4IKAA 1TK8A 1EIYB 3NNCA 3P49B 1RAIB 1W7WA 4KAIA 4NEYA 1TKXA 2JJ4D 4M5GA 4MKBA 2XSJA 4PAAA 4AD6A 4ZP7A 3CC4S 4CH0S 5LJ3Y 3CJQA 1GMVA 4O3SA 3KMSA 4Z37A 5AJ3F 2B5JA 4LF7F 2D9OA 3CCTA 1B70B 5M2UA 2QEXS 1RT2B 4B9NA 1JLAB 2UUCF 1WG1A 1VDHA 3Q8VA 4HHHA 5HLFB 2MLZA 3TJAA 1HPZA 3FZ2A 3L95X 4ZCKA 3LPYA 2DGXA 1VOMA 2DEJA 3IFEA 1AUDA 1FE0A 3POTA 4B3TJ 3R2CJ 4OYMA 3UDVA 5KOXA 4DI6A 3KG4A 1A9NB 3CD0A 4QJVA 2CNOB 1APSA 3QLHA 2WTFA 4CH1A 5AE2A 2B51A 2W8KA 1S6PB 1HI1A 4RL1A 2MKSA 2XMWA 1FX2A 3SMZA 1I3OB 3KHGA 4KTQA 1EB0A 5CD4H 3M8RA 1NH7A 2RHQB 3OFFA 3SIPB 2MQQA 3GU0A 2IMWP 4LFCJ 4OQJA 3JAMU 4Q45A 4QOTA 1XEZA 1V3RA 1TAUA 5LM7E 3BBCA 3DRPB 1UJ4A 2J9DA 3VAFA 4KFBA 1OWXA 5A2QY 2C2DA 4LF8F 2HVDA 4B08A 1QAXA 1WKLA 2D9PA 1SH2A 4HEA9 2I9SA 4OV1A 5HBMB 2EWHA 9ATCB 1LWEB 1SUQA 3BH7B 3UD5A 4O44A 3KLEB 1UA0A 4DPUA 3UVJA 2AJ4A 2D3O1 1TELA 1YBTA 1JLQB 2BOAA 1VLYA 1C1BB 5KFTA 3W1YC 1HBUB 4K4WA 1NB2A 1IBLF 1H72C 1KWMA 1LXNA 3NCQA 4IDKA 2RUSA 4MIBA 4EYHB 4MK8A 2AQ4A 2F9DA 3MCMA 4O4RA 4USTA 4FXWA 3CCMS 2DIVA 4WK3A 2YKAA 5ETQA 2G0JA 1C2PA 3JB9k 2CG4A 2DGWA 3PX0A 4LF6F 1IR1A 2JL9A 1SV5B 1C4CA 4A4JA 3FMBA 3LGHA 4J5OA 2VONA 3ET6A 3QSYB 2DYAA 1MMNA 1UMJA 1RI7A 2L08A 4WFZA 2CJAA 2KYZA 3VR1A 1RHMB 3HDSA 2RMLA 4LT6A 4RW8B 3R1LA 4NI2B 1Q82T 3A12A 1D3WA 2HWTA 3BKFA 1WC3A 5EN1A 3Q8YA 2Z30B 2FJWA 1K44A 3OJUA 1I94F 4PABA 3PFEA 3LW5C 4A46A 5KG7A 1I51B 2GMJA 3Q2TC 1Q16B 1ZTWA 3NMAA 2XGQA 3OVAA 5KT7A 3KLHB 2QLJB 3DGPB 1N33J 2HHUA 2PI4A 1FRMA 1ZAXA 4ZVPB 1V5VA 3GG0A 4PRFA 2W2PP 1FJGF 1JLEA 4RBUA 1NHKL 2XS5A 3A8IA 3I5BA 1FKAF 5DRKA 1S9EA 4WP8A 1NDCA 2DXDA 2ZDOA 4NI2A 4RW8A 1PO6A 1FRHA 1UZDA 1HQ2A 2V8GA 1F1BB 1H2VZ 1R8AA 3IWLA 4DUYF 3T5JA 1V5IB 3N6LA 2M8DB 1GNKA 1CBKA 7AT1B 2G0CA 2QMXA 1UW4A 4GMKA 3SV4A 4OHVA 4NLGA 2RAQA 3W2WA 2P2CB 3IA0A 3DDNA 5T7LA 2YNGA 4X4RA 2EBEA 4MT1A 2YKNA 3W60A 1J5OB 1VQOS 2NS1B 4LF7J 1D1UA 3FUYA 1N4LA 1KVJA 3EGNA 1X5OA 2Y1IA 2Q3PA 3ZZYA 1VC0A 3IR5B 1K47A 4DLGA 1YJVA 4WU2A 2OP5A 3CJSA 2MKIA 2MQPA 1S5ZA 4B02A 3DLKA 3EPIA 3QT7A 3SDEA 1WEZA 3FRYA 2OIHA 2A2CA 4M5DB 1S6UA 5HMWA 2XY7A 1Q4RA 3GSDA 3C2PA 3QRRA 1G1XA 4FDFA 4HH0A 2ZZNA 2PN6A 4OYAA 1RACB 3VGTA 4DL2A 2IM3A 3UR0A 3BF4A 3MR2A 4IR9A 3V6JA 2IRYA 1NNDA 2M5YA 2GFFA 2ZWPA 1B0PA 3BH6B 3C19A 1KOHA 3LALA 4M5MA 3CJ5A 4OYIA 4Y2KA 3U1LA 1ZTTA 1KRPA 1AROP 3K7RA 5DGAA 5L8RC 1NSPA 3RB0A 3Q24A 2I1RA 4UOGA 4P72A 2X1GA 3UDCA 2PT0A 3S1TA 3VAMA 1RQ0A 3ILIA 3TAQA 3R5CA 2GQ2A 1P1LA 3O44A 2FVRA 1FDDA 3HSJA 4LREA 4OYWA 2E7WA 3PX4A 1XMBA 2ADCA 5KG6A 2ZOMA 4ID5B 5HN0A 2UV8A 4IFYB 3PO4A 2UP1A 2QSFA 3DOLB 3ET6B 2Z0GA 3M8YA 2B8QA 5LOQA 1P9QC 2Y8WA 1EHWA 2IRUA 2DTJA 2QV6A 1UJ6A 1TL1A 2AEMA 4DSEA 2LQBA 2ZH5A 3RRHA 2DRBA 2ERRA 2XSFA 4DR7J 3DCAA 1B3TA 2HQGA 4RNFA 2KXFA 1JNZB 4C0OC 1VBYA 1VQSA 1S0MA 2C2ZB 5CQGA 3R9LA 4F4AA 5C25A 3H0PA 2B9YA 5KG2A 3C6TB 1M5SA 3BGFA 4H4OB 3NAHA 4DX7A 4NLVA 2Q43A 4DX5A 2VQEJ 3D6FB 3AH6A 4LSZB 2C2MB 4AT1B 3AJ1A 2IYIA 4B9SA 1SQFA 3IN5A 3H7HB 2K3IA 5T41A 4P71A 1B4SA 1XQIA 2JX2A 4X4PA 4QBUA 3OHAA 1PYSB 3RBZA 4A8MP 1KHWA 2BW2A 1TP7A 1XMQJ 4M5KA 3FNNA 5LSRA 3M8PA 3RW6A 3D28A 5CABA 3CCJS 5F8LA 2Z57B 1BXNA 2VB6A 4DR2J 1YI2S 4OHYA 1N0UA 3DRXA 3R7BB 4AE5A 1BWEA 3H2LA 1ZM4A 1EJ7L 2NXUA 2X7IA 1Y5LB 3DM2B 4L3NA 4DHVA 3N01A 1WHXA 3GJTB 2KYXA 4ILRA 3TOQA 2D3UA 4O3RA 3J80U 1YTYA 5LJ5Y 3OV7A 2WONB 2BUNA 3CEDA 3OL7A 4B3SJ 1CC7A 2ASJA 1R0AB 1K1QA 2V8PA 3JXOA 4P74A 4ILMA 4QW8A 4TN2A 2GVDB 5KFMA 1IM6A 3M2UB 2R7RA 3I0SA 1I1GA 1ZH5A 3CCVS 3W7BA 1RA7A 3AD7C 3DOMA 1RT7B 2VZ9A 2W4PA 2HGLA 3AHPA 1R27B 2JEGA 1F6TA 2BOPA 3DRRA 2MZTA 4WE1A 2PFDA 3EICA 3PYFA 1S9EB 3PRBA 4M5HA 1N6QA 4WPAA 4I64A 4PYDA 1RT1B 4I69A 3L09A 7FD1A 1H98A 1KFDA 2EBGA 3AQOA 5K8OA 3QJPA 2ATCB 3CTRA 1WHWA 3PJWA 2RILA 2FJEB 2CVEA 3E01A 1H73A 3N28A 3TVZA 4CM2A 4HH1A 4DX8H 2V63A 3BB5A 5IWAJ 5LMNJ 1VQKS 1RWUA 3HKWA 3M8ZA 2C3PA 1U2CA 4RKUC 5F3ZA 1LK5A 3CDWA 2BQ3A 3R6GB 3BQ1A 1PILA 3FZBA 4IFVA 4AXIA 2XLIA 2ZBRA 1UCNA 2O3DA 4ATNA 1N34J 3O3LA 4USUA 3RAXA 1RT2A 2H4YB 2R7VA 4L73A 1UVMA 2BRKA 1FO1A 4ZVQB 1RTHA 1UWBB 3MM7B 4AL6A 3UI3A 5J2PA 5KG4A 5GAGU 2B4PA 4ECZA 3D3BJ 4CYUB 2DGSA 1ZA1B 2HAFA 4USWA 1F9HA 2JRSA 3LAMA 2QLWA 2KRBA 2AV5A 4DBQA 4K4YA 3PRDA 4YOEA 1YRTA 3DN9A 4ZCIA 3GIMA 5DQHA 4RNNA 2NUHA 2R7TA 2YNIA 3IRWP 2ILYA 2OELA 2QFJA 1CS4A 3LGMA 5DZ6A 1OQ6A 2HQFA 2PMHA 5K20B 5A8KA 2RDJA 1ROFA 1KS2A 2Z2LA 4M5LA 1NPKA 3B82A 2WHOA 2YKNB 3LP2B 2GMHA 1FVQA 3GMGA 2CPDA 1AW0A 1KDNA 3HHLD 4QIFA 3RJMB 4MFBB 3MZIA 2G0IA 3IAS9 1PCAA 2ZJRQ 1FHTA 2M4MA 2W4CA 2VL1A 2XZDB 2FHJA 1O5JA 3CF5Q 2AGPA 4ED4A 1CG2A 1HBMA 1RWPB 2GAHC 1TAQA 3SCJE 2HS0A 2DNLA 4LF2A 2L48A 4CO3A 1FKPB 3OR2A 2B4OA 4NE9C 5J2MA 2HFSA 3DGPA 4A8WA 1S1VB 1KQGB 4I7FA 5H9FJ 1RBLA 4X4UA 2RIJA 5KFWA 4Q8FA 5IT9U 3BGRB 2I6WA 2GMLA 1VHIA 2VJUA 3G86A 4LSLB 3OL8A 3WX8A 2ABYA 2H3EB 3A8KA 3I6PA 3TP2A 3HSZA 2Y1JA 2FC9A 2POKA 2ASYA 4PZVA 5D0HA 2CNNB 2RT3A 2JEJA 2JEIA 3B6BA 1UPMB 3ENWA 3DLGA 4O3OA 4XPEA 3N4WA 3M9NB 4JI7J 2AX0A 3MTJA 2EVZA 2LQ5A 1NH8A 2OFGX 4IO1A 4LRFA 3D1OA 2HQCA 4K2JA 2IVFB 2BVZA 2QA4S 2Y3YA 3LP1B 2DPJA 3C3LA 3M32A 1MSWD 2RF2B 5ETOA 2GNKA 1OY6A 1YRUA 3GR1A 5DDRC 1S1WA 4OFZA 1X5PA 4Y34A 2DNOA 5MAOA 3OTOF 2VQFF 5F0WA 1KC8T 4OI6A 3Q89A 4JI1J 2XB2D 4JI0F 1HBUA 1BQMB 1S9GB 4LIWA 3Q0AA 3W5XA 3V6DA 3R2DJ 1RT4B 3MPVA 3FSYA 4KRWA 3FVYA 1DTTA 2BW7A 2KT2A 1AZSB 2CJXB 2GGPA 5EWFA 4JI3J 1S6OA 2QIFA 4JI0J 1OYDA 3EJMA 4RWXA 2HYIB 2DHHA 5DJBA 3J81j 1M5OC 3LWLA 4ANEA 2BE7D 2GVDA 2DRDA 3FEZA 4F2SA 2RRNA 3V4MA 3T3FA 2HMIB 2XM3A 3C15B 1VQ5S 4MK7A 4NLQA 3PKMA 1RU1A 4JI3F 4ZA1A 4ZIWA 4H4KC 3BJYA 4MIWA 2OJ3A 2RVJA 2NLWA 4TY8B 2I2YA 1R6YA 1G2EA 2E7VA 2Q6CA 1RTDA 4V19X 2XMTA 5BR8J 4LR7A 1X5SA 1O8BA 5CZXA 1VJQA 2BJ1A 2E5IA 3DFEA 5IQQA 3O6QA 1EETB 2MKCA 5J1NA 1XNQF 2E1MC 2KJVA 4XDCA 1H3DA 2D3ZA 2MZ1A 4F4YA 3PM9A 2CAJA 2MQLA 3DLEA 1Z4UA 1S77D 2W25A 1HQUB 3A3OB 1UVLA 3KNGA 3IC1A 4DQRA 1WTBA 3OW2R 1VBXA 3NAIA 4RUHA 1MMLA 3QFWA 4CLZA 4N7TA 1S1TB 1KFSA 2NZCA 2XHWA 5EWEA 2IAJB 5B0DA 5IM0A 1HI0P 2NUUG 2LKZA 1WHVA 4HL9A 2NR0A 2XMKA 3KHHA 2LECA 5JUMA 1M1HA 1XC9A 2F9JA 1OJ4A 2ASLA 3C14A 3C6TA 1FTCA 2Q1LA 4KGMA 1HNIB 3MEDB 4Q7AA 5KFHA 3RGIA 1MWQA 3V6DB 2BZ2A 2HQIA 2HBZB 1OO0B 1U4BA 5KFOA 5D78A 3UWTA 2WW8A 4ZIVA 3OHBA 4DV4J 4Y2AA 3MAAB 1NXIA 4P9SA 2N3LA 4RUBA 4WBFA 1IKYB 3R27A 2M9KA 2XY5A 3GYGA 4PCQA 4DV1J 5FD1A 5KT4A 2AIRB 3JYTB 3H5XA 3C15A 1TK5A 3AJ2A 3G6XA 4ECUA 3O1LA 2HLTA 4UQTA 1P27B 2O1PA 2FQQB 3F73A 3AAWB 5K9FA 1PSDA 3HCXA 4IG3B 1TKZB 4DDFA 4LQ3A 1NHUA 3RW7A 2PI5A 5DG7A 2JLFA 1F5CA 1BLUA 2LEPA 3F41A 3ZC4A 1SC4B 3M8SA 4D3GA 2WB4A 4ZCMA 2RJZA 3H8YA 1EETA 1MG7A 3OR1A 4C2MA 3EGZA 4WK1A 2RDDA 4OHXA 4X2BA 4K50A 4BWJA 1S72S 1NKBA 1ZAWA 1FRXA 3BSCA 3HHLA 2DK2A 3HVWA 5LXYA 4HT7A 1RWMB 5I42A 3KK3A 3H40A 4HVZA 2V4JB 3H5SA 4CT8A 2JC0A 1RZMA 3DMJB 2GAGC 1WC5A 2PD1A 4G1QB 1YGYA 1R0BG 4Y6IA 5JMNA 2KU7A 3GZ7A 4P7VA 3TI0A 1S7IA 1JLCB 1Q5VA 3T9ZA 3TEGA 1HBOB 1FJEB 3MFIA 1WD6A 1FFSB 2W1BA 2ZKUA 3M8PB 2R3VA 2PMWA 1AZSA 5ETLA 2NPFA 4ETZA 5CYJA 3PW4A 1QTMA 3CJ0A 1HBNB 4DCJB 4DL7A 5CD4A 3T5KA 2BRLA 3W65A 4LSLA 1ZYQA 3ILLA 3NY0A 2VASA 2JSXA 4U8VA 3PO5A 4WP3A 3OXLA 4J9UE 3T1AA 1U6ZA 4X66J 3BKUA 1IBMF 2WAQD 3OD2A 5C2CA 1IKXB 1PGZA 3CULA 5A8WA 4H4KA 4X4VA 3DDIA 2E1CA 1C1CB 5HI7A 5EHHA 2ROPA 3E3XA 4LUBA 2W2NP 4A8OA 3P3DA 1F60B 4I6WA 4CLYA 2UUTA 3B4MA 5B0BA 2KFYA 3J7A1 3OTEA 4ZVFA 2VC1A 3CD6S 1KQKA 1QLNA 2CQ1A 4KC5A 2UVRA 3IMQJ 4KHMA 4DF8A 2XWYA 4RR5A 4FPRA 1SCJB 1TKTA 3I4PA 3WIUA 3MMBB 2DISA 2X3GA 3J7YI 3VALA 2F4VJ 5A8WB 2YKQA 4F3QA 1IR2A 1N5QA 2B0GA 1JJ4A 1GXLA 1JIHA 4J91A 2DGQA 1CULA 5FLXU 4EBCA 1H7XA 1PYOB 3FBEA 1NM2A 2VIHA 1S12A 4ZLPA 2Y0SD 2F8HA 2HW3A 2W2MP 3KK2A 1BHNA 2PA8D 4ZPTR 2XGPA 2FLLA 4B9VA 5FLXY 3CCWA 4WP9A 1S76D 3F0NA 5ADZA 4Q8EA 2DO0A 3NBPB 3J7Z5 3TYTA 4OHWA 4DV4F 2MJNA 1BWVA 2DH7A 4KO0B 5E3AA 4RW6B 4WJBA 1EAYC 5ETVA 4W4MA 2XC9A 5IZHA 1QSYA 2GO9A 1WKJA 2MTLA 2OPRB 4I6AA 3HKZD 3AFGA 1Y00A 3MDFA 5KG0A 4CO5A 1R8HA 3V5RA 2LU2A 3L7UA 3DLLQ 2E1PA 3EGWB 1NBEB 3TX0A 3M30B 1VQ6S 3VZIA 5KFXA 3HHLB 4M5NA 3J7AN 2OH2A 3LUYA 3M8WA 3MGJA 5CH7B 4AYBD 4ZK7M 4U6PA 5HP1A 3LO3A 4O23A 5H9EK 3LQVA 4NA3A 5CAAA 2GS8A 3DLHA 3VQTA 3LGNA 4IOBA 5HATA 1Z2ZA 3KLIB 4DX6A 2DEIA 5CCMA 2CRLA 2FVSA 2BBEA 2FUG9 5CYQA 3M2RA 4ILLA 2NQPA 1NMEB 2ZH1A 2FJDB 2V8DA 4WKYA 4KGKA 4FN5A 3QGIA 4DR5J 2OTLS 1NU4A 3UCUP 3NWGA 2ZBCA 4C8KA 1VISA 3AODA 3TR5A 2YQ1A 2CQHA 4ES3A 1ZZNA 4LRCA 4EGLA 4WZQA 3BZQA 1D8ZA 4UF4A 1RK8A 2V0NA 2X1FA 3TZXA 2HHXA 2BQUA 2KXHA 3PRVA 2KHDA 4DCOB 3G71S 2F7VA 4ZOSA 4ANCA 2R2TA 3HVAA 4DFMA 1D9DA 4HR2A 4LSNB 4QQBA 1FXLA 4UY8T 4J7CA 5D6GA 4RZRA 2ZOFA 4NLXA 3P8BB 3MCSA 1YJWS 4EMDA 4ELTA 2LDYA 1SB6A 1YRXA 1K1SA 4DL6A 3R5BA 3C66A 4WFNQ 3D5MA 2Y9HA 2VFRA 2N3OA 2RKIB 3BPDA 1RTDB 3E51A 3TX8A 2ZKTA 2M8HA 5E3PA 3TRGA 1IBMJ 4LSNA 3G6YA 1IBLJ 2ZBIA 1HMVA 1NK0A 2ZH9A 3M6XA 5D4LA 3FSIA 1GQEA 1NPRA 4PPDA 2MQOA 2N7CA 1JKHA 4GO5X 3W2VA 3GTYX 3JSYA
chains in the Genus database with same CATH topology
4MMOA 5ITHA 2BM1A 1R8BA 2YNHA 1DLOA 4URSA 4DN9A 4NLSA 3GE9A 5FIIA 4IQXA 1FF2A 3M2RB 3N5FA 3PHEA 3OXGA 3MM6B 2MZSA 1N5VA 4USJC 5U47A 3CJKA 1UVIA 1FNOA 1S4FA 4NLYA 3UCGA 3V81B 3RAQA 3MPWA 3QWUA 4DJBA 1TZ0A 3H98A 4IRDA 2QT7A 2KTQA 4QIGA 4XPCA 5GAHI 4B3RF 4BC7A 4ZPAA 2AW0A 1SKRA 1R31A 2GGPB 2MB0B 4AQYF 2E5HA 1X0PA 4I6YA 3NBPA 3UQSA 5KFFA 1KLMB 2IA0A 2PEHA 2MMYA 5F3TA 4RUCA 3RB4A 1XBWA 4J9KA 1KC8T 1HNXF 2LDIA 1NKCA 4KPYA 2LXFA 2PIIA 2DR9A 2RKIA 3HHKA 5IQ6A 4C7QA 4CH7A 5KFLA 3QMQA 4DSKA 4NOHA 4X4QA 2XMMA 5C25B 1U1PA 4WYWA 2ZH4A 2LQJA 2NSCA 3QAUA 4WZMA 2QLXA 2OD6A 1LK7A 2K3KA 1J5EF 2J0XA 3KLGB 4F50A 4GO7X 2HGNA 5LT5A 2ZH7A 2OD4A 1KNZA 2E1AA 2R9LA 1K0TA 4OIXA 2K7JA 2PA3A 4EZ6A 2BYCA 4NRUA 3FSXA 3BO2A 5I3UB 3TA0A 5EUHA 1F5BA 4JI5F 2VKZG 1K9MT 3JAMY 2BABA 2ZHOA 3CSKA 4YDDB 3OPKA 4TU8A 4ED0A 2GJIA 2PE8A 2UUWA 5I42B 2H5EA 2ZH3A 2OO4A 2XI3A 3DLKB 4KBIA 4ZP8A 5B0CA 2D3OR 1NJWA 2DNYA 1P8GA 4YB1P 4IO9Q 4PUOB 3NGDA 2E9TA 2P6SA 4ZMMA 3M9OB 3SFGA 3V6HA 2LXUA 3CIMA 3OXFA 1FD2A 3H4DA 1S1TA 1VJWA 2QA1A 2R2SA 1HBNA 2JEFA 4DV7F 1S1UA 3NCPA 3THTA 2UU9F 2B56A 2ZZMA 3PJXA 4NLOA 4NA2A 2DH9A 1UKUA 5KFUA 5J2QA 3RR7A 4HDHA 4OJ1A 2J76E 4TU7A 1WF2A 4OJ3A 4FF3A 2VG5B 1VQ9S 2AYEA 5G0RB 4Y3CA 5KFVA 3OLAA 1FK9A 3ISND 1S0NA 4HYKA 2FPHX 1RT5A 4XO0A 4FZVA 5IT0A 4X4TA 2KFNA 1HA1A 2XNRA 4MKYA 3G9CA 1VQMS 3EUNA 4ZCLA 1A6LA 3PEJA 3SXLA 3VCDA 3G96A 4DR2F 2R4FA 1TKTB 5KFQA 3KMQA 3A8EA 4RBVA 4HHJA 2VH7A 2FVQA 3JTPA 2DIUA 4NRTA 1MU2B 4TKTA 5F8MA 3KHLA 2VOOA 3QGPA 4A8KA 4QYZJ 5EWGA 4B3SF 1SXLA 2LMIA 1U24A 2VPYB 5DS7A 3PKYA 3TNVA 3UW1A 1BQMA 1SV5A 3VAKA 2C2EA 3D0GE 4N76A 1RTIB 1FDAA 2WOMB 1QAYA 3AB2B 2F3JA 2I8EA 2WSCC 2VBZA 4R25A 1X9SA 4LFBF 2DCLA 4DFKA 1CQNA 4O3NA 1WG5A 2BDPA 3T9NA 2HFOA 3PR5B 5MLCV 1YBAA 3MM9B 3MUTP 3CMAS 1UFLA 2UVUA 4K4VA 2HQ3A 2D41A 3RAMA 4PG6A 3QJJA 1NRKA 1UETA 3HHEA 4P6QA 2JLGA 5L1KA 2F40A 1KOOA 2YX4A 4EU0A 3NP5A 2IFXA 2CJBA 5K8PA 5IWAF 2RU3A 3QJLA 1K73T 1TFWA 1R0AA 4FXVA 3MXHP 4M95A 1QSLA 3JSBA