4URQU

Crystal structure of ggdef domain (i site mutant) from t.maritima
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
LTGLPNRRYFFELGNRYLDLAKREGKKVFVLFVDLAGFKAINDTYGHLSGDEVLKTVSKRILDRVARSDVVARYGGDEFTILLYDMKEEYLKSLLERILSTFREPVRVENKHLSVTPNIGVARFPEDGENLEELLKVADMRMYKAKEMKVPYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Diguanylate Cyclase from Thermotoga Maritima: Insights Into Activation, Feedback Inhibition and Thermostability
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords DIGUANYLATE CYCLASE
total genus 52
structure length 154
sequence length 154
chains with identical sequence V, W, X, Y, Z
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4urqU00
2R8KA 3M9NB 2IAJA 3SFUA 4IG0A 4J9NA 2C2DA 3QGIA 5KT7A 2V9WA 2WB4A 2OPQA 3I0SA 4TYBA 2FJXA 4LQ9A 3DLKB 3KLIA 5F9NA 3KHHA 2J6SA 2VA3A 5KFSA 1RT6B 3RAQA 2YNFB 4ICLB 1LWFB 2XCPA 1HQEA 3DRSB 5KFOA 3G6YA 4K4WA 5I42A 3QLHB 2WONA 1C0UB 3TAMB 4URQU 1VRTB 2ILZA 3C6TB 4LSLA 4EO8A 3IGNA 5KFHA 1RT3B 4YR2A 5KFCA 3KLHB 4I2QB 4O44A 1FKOA 1RT3A 1DLOB 1RT4B 4YQWA 4I7FB 4ZPAA 4QWDA 3KJVA 3UR0A 2WONB 2UUTA 4F4WA 3RBDA 4B3OA 5KFFA 4KKOA 2B5JA 2R8HA 1TQLA 3RB6A 4O3NA 2XI3A 4K50A 3KK1B 5J2QB 4XO0A 1HYSA 3V4IB 2QV6A 3UPFA 3LP2B 2WK4A 3LALA 4MH8A 4QWCA 5DQHA 5DGAA 4LSNA 4O3PA 1S6QA 2JEFA 5HP1A 4U7CA 3G6VA 3GV7B 4QWBA 3BSCA 5J1EA 3BJYA 4IFYB 4IOBA 2OPPB 4DEZA 3CJ2A 4PQUA 4TN2A 4JV0A 1RYRA 1JLFB 3G6XA 4K4TA 1S1UA 2ZE2B 3H5UA 3CVKA 4RW9B 1R0AA 5KFWA 4J9LA 4NLQA 3KLHA 3CWJA 2VG5B 3DOKB 5F8HA 2JLEA 5D3GB 3HVWA 2IBKA 2I5JA 1S1WB 4DG1B 4KHRA 1TV6B 4EBDA 1GX5A 3BQ1A 3SI8A 3KK2B 1J5OA 1RT1A 3EPGA 1JLQB 4MFBA 4KO0B 2CKWA 3DOLA 4IFVB 4JV2A 1FK9A 2ZKUA 3CDWA 2HNYB 1BQNB 3DMJA 3FFIB 4KV8B 2FVRA 3KLVA 4WXWA 5KFPA 5DLGA 3HKWA 5FDLA 1KHWA 2V0NA 4WE1B 2JEGA 4EYHB 3CJ5A 3DLKA 3KLIB 4XPEA 1C1BA 3FQLA 3LP2A 4PQUB 1YVFA 3IG1A 3CIZA 3MEDB 4IG0B 3T5LA 4G1QA 3QZ8A 2JEJA 3GIKA 5HP1B 4WZMA 1QUVA 3M8PB 1RTJB 4RNHA 1S6PA 4TY8A 3ITHB 5KT4A 3QZ7A 3Q8QB 1C1BB 4O3RA 1RDRA 3NAIA 2RDJA 4F4XA 4F50A 3H98A 3H5YA 1RA7A 1T03A 3HVTB 1IKVA 1RT2A 1SUQA 3DLGA 5KG5A 2ZD1A 1JKHA 4H4OB 3MEEB 4RW4A 1BQNA 1K1SA 2IC3A 3GQCA 2E9TA 3HVAA 1LW0A 3N6LA 3MECA 4RW7A 4RNMA 4ECYA 1TKZA 1DTTB 4Y2AA 2R8JA 1NHVA 3T5KA 1JLEA 4NLOA 4RU9A 2IM3A 2XI2A 1JLGA 3E51A 5KFIA 3MFHA 3EPIA 1JLGB 1XR7A 4J9KA 4GC6A 1JLEB 2JC1A 4O4GB 3OHBA 3KK3A 4ZVGA 5DQIA 3DRSA 3MECB 2HWIA 4ZPBA 5KT2A 2YNFA 4ICLA 3DOKA 1RT6A 1HQUA 3DYAA 3QO9B 3H5XA 5J2PB 3ISND 4RW9A 3RB3A 3BQ2A 2ZE2A 1QE1B 3DI6B 1HARA 4Q0BB 5J2NB 5DG9A 1HNVA 4NLTA 4WYLA 3V81A 2WCXA 4WXOA 1S49A 3NBPA 3KHRA 2D41A 1JLCB 4IR9A 2XC9A 2CJQA 3QGGA 2EC0A 3TVKA 1JLCA 4GC7A 1HPZA 2IJFA 3FQKA 2OPSA 3LP1B 4HKQA 4IG3B 1C1CB 2IA6A 2QE5A 4XPCA 1S9GB 4Q45A 4IRKA 4ZVEA 2UUWA 3ICLA 4NZ0A 4TY9A 4ZVHA 1OS5A 3BSNA 3H5SA 1K1QA 2HMIA 3MEGA 4HYKA 1ZETA 5KFAA 3UDLA 1TVRA 4IKAA 1T94A 5DQGA 1UWBA 1IKWB 1SH3A 2YNGB 3D28A 5C25B 5HBMB 4QWAA 3GILA 2W7PA 5KFRA 3TAMA 2DPIA 1C0UA 1UWBB 2FJWA 2RKIA 3UQSA 3QLHA 5JXSA 4RW6A 5HLFB 1VRUB 3GIIA 1VRUA 3JYTA 3QYYA 4ED8A 4DG1A 2FJVA 1S1WA 5DG7A 3MEEA 5JUMA 2UVVA 4FBTA 4G3IA 1U09A 1RT7B 2BR0A 2AX1A 1ZTWA 1N5YB 4JUZA 3PZPA 1S0OA 5EDWA 3BREA 3C6UB 3OL6A 2OPSB 3T5HA 5KFZA 2HNDB 4IDKB 4EBCA 4RW4B 5KFEA 4Q8FA 1DTQB 1KLMA 3V6DA 5KFYA 4NLGA 3H4BA 1S9GA 5KFUA 4TLRA 5F8NA 1KLMB 5DGBA 3KLEA 5L1JA 2VG6A 1TKXA 2HAIA 4ECXA 1S6QB 3EZUA 4MK8A 3NL0A 4K4ZA 1S9EB 2VG6B 4K4VA 1MMLA 5CYMB 4R8UA 1HYSB 5C24B 3CJ3A 4Q0BA 2FLNA 3KK1A 3M8QA 1TL1A 5KG7A 4ED6A 3M9MB 3V81B 3MEDA 1HQUB 1W25A 2BANB 3DYAB 3N6MA 5EWGA 2XGQA 2RDIA 5F9LA 5L1IA 3KOAA 3PJWA 5KFVA 3CO9A 4ED2A 1T05A 3KLGA 4NYZA 1RT4A 3Q8SB 3OLBA 3KJVB 3I5AA 3QO9A 4I2QA 3DLEA 3RBEA 3PR4A 2ASDA 4ZMMA 2RF2A 1RT1B 4KFBA 1N6QA 2UVWA 2YNIB 1VRTA 3C6TA 1JIHA 2GC8A 5L1LA 1EP4B 2IC3B 2GIRA 3RB4A 4K4UA 1RYSA 4IFVA 2IJNA 2FLLA 2ZD1B 2B43A 1IM4A 2WOMB 4MK7A 1TKZB 3KK2A 1T03B 1J5OB 1C1CA 1FKPA 5T14A 4ED7A 4EEYA 4NLSA 2ASLA 4WFYA 2W8KA 2R2UA 1JKHB 5C5JA 3TQ1A 1EETB 1JX4A 1REVA 3MF5A 3FRZA 5C24A 2OPPA 1JLBB 5F8MA 2IAJB 4QWEA 5J1EB 4YMEA 2R2SA 1LWEA 4DL7A 2AGQA 4I2PB 1HMVA 2J6TA 4G1QB 1LW2B 3PJXA 4H54A 5DG8A 2XGPA 4K4YA 3KNAA 3DM2B 2W9BB 1QE1A 3DI6A 3M8PA 1S10A 2FVSA 5KG6A 2C22A 3KLFA 4IDKA 3OSNA 1HNVB 4ID5B 2IM1A 4ZVFA 1SV5B 2R2RA 2B5JB 4M94A 3T5JA 3JSMA 4ZHRA 4RUCA 3DOLB 1D0EA 4IRDA 1SH0A 4I7FA 4KO0A 1FKOB 2WOMA 1BQMA 4ECRA 3KMQA 4NLXA 1DTTA 5F8GA 4KKOB 1LW0B 4RW7B 3MR6A 1TV6A 3FFIA 5KG2A 3GIJA 3H40A 4B3OB 1EP4A 1S1VA 2BRLA 4ZP8A 1I6JA 3IRXB 4H4OA 1TP7A 5I3UB 2YKNB 2YKNA 4R5PB 5I3UA 1IKXB 4EO6A 4ZP6A 1JLAA 1JLFA 1S97A 2C28A 1S9FA 4NCGB 3I0SB 4DL4A 1IKYA 2VG5A 1S6PB 4MKAA 2BANA 4NLVA 3CDUA 3FSIA 4RW8B 1S1UB 4RNFA 2V4QA 4J9SA 4ECWA 4DL5A 3KHLA 4ECVA 1KHVA 1SV5A 4YR3A 3PVXA 2UVRA 1T3NA 1MU2A 5F8LA 3Q8PB 4K4XA 3V6JA 3E01B 2HNZA 4Y34A 3OL9A 3RB0A 3LAKA 2B6AB 4QPXA 3CJ4A 3MR3A 3BR9A 4KHMA 1TKTA 4QW9A 2BQRA 1DTQA 3V4IA 1C2PA 4NLRA 2W9CA 3MR2A 3G86A 2FVCA 3OL7A 2D7SA 4WE1A 4J9QA 1Z4UA 2GIQA 4H4MA 2W9AA 4Q8EA 4MFBB 2C2EA 4R5PA 1JLBA 5K14B 4F4YA 1REVB 2ATLA 4ECUA 3LAMA 1N4LA 4KV8A 1LWCB 4ED1A 1S4FA 2YNHB 5DLFA 2WHOA 1JLAB 4MIAA 4Y3CA 1FKPB 1RTDB 2WRMA 3BSOA 4K4SA 3DRPB 5C42B 3I5BA 5HLFA 4RW6B 4U6PA 2FVQA 5KFJA 3DRPA 5C42A 4PWDB 2R2TA 2JEIA 2V4RA 3JSMB 1NNDA 2I5JB 4ZPDA 4KFBB 1N6QB 3OL8A 2RF2B 3DLEB 4IH6A 3DRRB 4J9MA 3V6KA 4OL8A 3PW4A 3KLGB 4ZHRB 3E01A 5KG3A 3GIMA 3RAXA 1RTHB 3IS9A 3N6NA 1TKTB 4IG3A 1SH2A 3LP1A 2AX0A 2J6UA 2JC0A 1RT5B 4PUOB 1TKXB 2HNZB 1HPZB 4PUOA 4Q44A 5HROA 5CYMA 4R8UB 4KB7A 1EETA 2I1RA 1LW2A 4WZQA 2E9RX 1HMVB 4ECSA 2IM2A 4NRTA 4ECTA 2XWYA 4MK9A 2VG7B 4TXSA 4ED3A 2ALZA 3H2LA 3H59A 5J2MA 4O3OA 2OPRA 3NKYA 1S0NA 3JYTB 1DLOA 1HQEB 1LWFA 2IMWP 1C0TA 5CYQB 3T1AA 2HWHA 3BGRB 4LQ3A 4LSLB 2IM0A 2DPJA 3MTKA 1T05B 3NMAA 1D1UA 2R8GA 5K14A 1BQMB 4WYWA 3QGHA 1S1TA 3LP0B 5KFDA 3NGDA 4TQRA 1IKVB 1RT2B 3DLGB 4Q43A 4YP3A 3M9OB 3HVTA 4NLWA 4ZP9A 2FVPA 1S48A 3GYNA 4NRUA 5KFBA 4JV1A 3FDSA 1TL1B 3OHAA 5KG0A 4ECZA 4I2PA 2R8IA 2OH2A 4RNOA 4LSNB 3CDEA 4J9PA 5HROB 1CSJA 3LANA 3GV5B 2W9BA 2ILYA 1XR6A 4IH5A 5KG4A 2AGPA 4RW8A 3IG1B 5J2NA 1TL3B 3I0RA 3I5CA 2WTFA 3MFIA 5KFQA 1ZTTA 2ASJA 1RTIB 2W8LA 1IKYB 4ZP7A 4FBUA 4NCGA 5KG1A 3NBPB 4MIBA 4QW8A 3VQSA 5J2PA 4NLDA 1QAIA 1QAJA 2HNDA 4IRCA 3C6UA 2BQ3A 4IQXA 1HNIA 4O44B 1RAJA 2AWZA 4WFXA 3BGRA 5L9XA 1S1VB 5KT3A 4IH7A 3MR5A 1JLQA 2YNIA 3DDKA 3QIPB 5KFLA 4KE5A 4O4GA 4RZRA 3KK3B 4FS1A 2YNHA 4DL3A 5F8JA 1LWCA 4DL6A 1N56A 3M8QB 1TVRB 3PW5A 2VG7A 3NAHA 4H4MB 2OPQB 2XCAA 2D3ZA 4YR0A 1S9EA 2HMIB 1N48A 5KFKA 2E9ZA 1S1XB 3ISNC 3KLFB 3Q8RB 5J2MB 3T19A 3OLAA 2BE2B 2FLPA 4URSA 4IFYA 2D3UA 5EUHA 3OSPA 4M95A 3KHGA 2BE2A 2F8EX 3CJ0A 3DM2A 5F8IA 5L1KA 5KT6A 1S0MA 5KT5A 1RA6A 1MU2B 5KFMA 5KFXA 3QIDA 1N5YA 2BRKA 3ITHA 2YKMB 3IS9B 4EYIB 2BQUA 3D5MA 5KFNA 5J2QA 1XR5A 4TQSA 3V6DB 1RT7A 1S1TB 3LP0A 5EWEA 1RT5A 3DRRA 3PHEA 2W7OA 3HHKA 2UVUA 4O4RA 3QIPA 1RTHA 2HNYA 3DMJB 4Y2CA 1FK9B 4NLUA 4NLPA 1IKXA 1IKWA 5HBMA 5C25A 4EBEA 5FDLB 4J9OA 2AU0A 3IN5A 4DL2A 3V6HA 3IRXA 4ECQA 3MEGB 2RKIB 2OPRB 3H4DA 4MKBA 1JXLA 2VA2A 1WNEA 5KFTA 3IGVA 4PWDA 2YNGA 3PW2A 5D3GA 4O3QA 5I42B 2AGOA 1C0TB 1RTIA 4WFZA 5CYQA 3PW7A 4X2BA 1HNIB 1TL3A 3I0RB 1RTDA 1R0AB 3PW0A 2C2RA 1SUQB 4KSEB 4URGA 5KFGA 4TYAA 1RTJA 4ID5A 4R0EA 2B6AA 2YKMA 4TY8B 5EWFA 4FS2A 4J9RA 4ED0A 2O5DA 1GX6A 4RUAA 3GV8B 2AQ4A 4IR1A 2W9CB 4KAIA 4RNNA 4O3SA 3SFGA 3KLEB 4ZPCA 1NHUA 4F4ZA 4NLYA 3BSAA 3BQ0A 4KBIA 3KMSA 1LWEB 1S1XA 3PR5B
chains in the Genus database with same CATH superfamily
3TJ8A 2R8KA 2IAJA 2K7JA 5H9FK 3QGIA 1VQ7S 3I0SA 1LKZA 2YKPA 4TYBA 5HMXA 4N47A 1HFEL 2NSCA 3HHDA 4LQ9A 2GVZB 5A2QU 2KFNA 5ADZA 3DHXA 1EHWA 2MZSA 2YX1A 1L3UA 4DR7J 1U6ZA 5CABA 1RT6B 4RBTA 4DCPB 1E6YB 2F8MA 2YNFB 4R0JA 2XCPA 4DCJB 3G6YA 4C0HA 5I42A 3THPA 1CJTB 1R8HA 1Q8BA 3A3PB 3OT9A 3TAMB 4EO8A 1VRTB 2ILZA 2KM8C 2W4DA 4YR2A 5E3CA 1U1QA 3W60A 2HHUA 1SPBP 3Q8UA 1WEZA 1M0SA 5BR8F 1YITS 2BE9B 1MWZA 4YQWA 3R97A 4ZIVA 3SSRA 3EX7B 2FQQB 3RBDA 4Y2KA 2HK3A 1N52B 3QSIA 4KKOA 4OJGA 5FLXU 3LW5C 2B5JA 2M9KA 4YDDB 1NLKL 2XSJB 4O3NA 2XI3A 2GHWA 2L9NA 2LQ8A 8AT1B 4C11B 1U6FA 4G6VB 3SCJE 2J9DA 5K8OA 1S57A 4PPDA 4C3LA 3UPFA 1ZH5A 4MH8A 2HIYA 4C6AA 4Y6IA 3AT1B 4CO4A 3TNVA 3CULA 1HBUA 1R6YA 2VBXA 3IBFB 3OFEA 2LQJA 4U7CA 5A8RA 3BSCA 4LF6J 2C2ZB 2OPPB 3KTQA 3M8ZA 4TN2A 4KHPF 4JV0A 2ABYA 4DCOB 3BYPA 1S1UA 2R4FA 2HQIA 2H5JB 2BACA 2Y1LB 2YWKA 1HWUA 2GJIA 4FXVA 4DUYF 5KFWA 2Z57B 4OYOA 4UW2A 1V9OA 3KLHA 2OHDA 4I69A 2N4CA 3AOAA 1S6UA 2G0CA 1ELOA 2JLEA 1LNQA 4UOCA 4CNYA 1U25A 1S1WB 1RJJA 4FF2A 1XNRF 1N5QA 2VPYB 4KHRA 1GX5A 3SI8A 1J5OA 1IBLF 4Q5VA 3P3DA 1JLQB 4OX9F 3EPGA 2GJFA 1UJ4A 4ZJQA 2LMIA 1KVIA 4LRAA 3R9LA 1I94F 3JSYA 1R27B 3DOLA 4IFVB 2K1RA 2ZKUA 3VAJA 3G6XA 4JV2A 3DMJA 1VQYA 1KVJA 5ETMA 5B0EA 1VRQC 4WXWA 4F36A 3M8RA 3AQOA 3EZOA 1NCLA 4A8OA 4DV6J 4DR7F 4DPTA 1KHWA 3ZTQA 3G2XA 4EYHB 2AEFA 3C19A 2FZCB 1F5AA 2QZ8A 4OX8A 4CLKA 4K50A 1C1BA 1X4DA 1X60A 2DHXA 3LP2A 4UZCA 4DPYA 3G8TA 4IG0B 3C46A 4QR2A 1EB0A 3W63A 3LWMA 3PX4A 1K73T 4WZMA 1HWLA 1QUVA 2AEJA 2Y1JA 2VOOA 2RH3A 1RTJB 3GJQB 4XK8C 1JJCB 3ITHB 2WVDA 1T9TA 2BW7A 1RDRA 3MAAB 2VH7A 3NAIA 2FB0A 4EZ6A 2Q66A 3H5YA 1X4EA 1QSLA 3M05A 1A9NB 3VF0B 1S72S 4WTYA 1SUQA 1WKKA 3EJMA 2ZD1A 1JKHA 1RWXB 2DB1A 4RW4A 1BQNA 1BE4A 2RUSA 3MPDA 3NEKA 2ZUAA 5CAAA 3GQCA 5D4NA 1RHMB 3MECA 3N6LA 4G1PA 1DTTB 4Y2AA 3I9ZA 2N7CA 2DY1A 2R7XA 4DFKA 1FCAA 1TTHB 2CDQA 3PNIA 1YJTA 4HI1A 1MMDA 5D4OA 5KFIA 4RU9A 4GC6A 2XM3A 4C8ZA 4KGZB 3T9ZA 4O4GB 3KK3A 1HQ2A 2KU7A 4TNOA 1U48A 3DRSA 1MNEA 3VQTA 2YNFA 3D54A 1HQUA 2Z2LA 5K5MA 5DETA 5A2QY 4L74A 3ISND 3RB3A 5ETVA 4JYAJ 3ADAC 1HARA 1MWYA 4DSJA 5J2NB 5DG9A 2OTJS 4WYLA 1UEUA 4UUWA 4WXOA 4CO2A 2H5EA 3KHRA 3EYZA 4CYUA 3AY0A 2NREA 3QQCD 3QGGA 1U2CA 2ZOFA 3BB5A 1WOOA 1NDLA 1JLCA 3TVKA 3GR1A 3FUYA 5HANA 1B0TA 1FI4A 2OPSA 2VUGA 1KTQA 2EFPA 4HKQA 4C4WA 1SJ3P 2PE8A 4E8UA 1VC0A 1S9GB 2MKSA 2GS8A 4Q45A 2UUCF 2KKHA 3ICLA 2PEBA 3A3NB 1M5KC 1O6XA 3DOMA 4CLUA 4DSLA 4HYKA 2P2CB 2FJDB 1N36F 4OI2A 4OYWA 3OTDA 1U7LA 4IKAA 4BC9A 2FHJA 3CCVS 1UWBA 3MM6B 1IKWB 1SH3A 2YNGB 4OZNA 4USIA 3BPDA 2CZ4A 4CLPA 3TVZA 2W7PA 3TAMA 4A8YA 4E98A 1NJYA 1LXNA 3UQSA 5JXSA 5F0WA 5KAKA 3A4TA 5EX0A 2FZKB 3QYYA 3W66A 1YJRA 1S1WA 1MN9A 5DG7A 2JOQA 3G9CA 1TL4A 2QIFA 1U09A 3D6HB 4CP5A 1NDCA 1GH8A 1UW4A 4OQJA 1JXEA 1O8BA 2QLWA 3WX8A 3TA1A 5FJ4A 1S0OA 2MKYA 3BREA 1O51A 1U0SA 3EGNA 4IDKB 4M5DB 4RJVA 4RW4B 1R8CA 3B78A 2OSRA 5KFEA 1NK9A 1WUUA 3RBZA 3W8PA 4LR7A 3V6DA 4JI7J 4NLGA 4NMLA 3R2CJ 1R31A 4JBCA 4P73A 4TLRA 5KFUA 2VHGA 5F8NA 1R0BG 1TMMA 2VICA 2V63A 1U4BA 1AYEA 1PILA 1X5SA 2DITA 3EZUA 1S9EB 4QJVA 3M32A 4R8UA 2B3TB 3I31A 5C24B 3GJRB 4X4TA 2FLNA 3M8QA 2CJKA 2LYVA 1UVLA 5KG7A 3UWTA 2HWTA 4ED6A 3M9MB 1LOUA 2DH8A 3MEDA 1NHKL 5F9LA 2HK2A 5L1IA 3SV3A 1SKSA 4Y28C 2RILA 3CO9A 4P7TA 5KFVA 2NZCA 7FD1A 3GR0A 1AUSL 4ELVA 1XNQJ 1EQMA 2BUNA 2YWFA 1RT4A 3OLBA 2L9DA 1PSDA 1P9YA 4FF3A 2M7SA 3W2WB 1RU2A 3S7RA 2HG4A 2X3GA 3HD2A 1EP4B 2IC3B 3CEDA 3RB4A 1FNXH 4K4UA 1RYSA 3NXZA 1T03B 2LKZA 4Y65A 1FRXA 4A8SA 4EEYA 2ASLA 1YJVA 5LSLA 5FD1A 2R2UA 2LA4A 1QSSA 2FHJD 4LRDA 4UOGA 3CCSS 4DV0F 2EFGA 4X66F 5F8MA 3HFKA 3J80Y 2AQ4A 1VQKS 3RU0A 2CQCA 3M2UB 1WF2A 3TEGA 5J1EB 3U1NA 4QWEA 1OWXA 4DL7A 3W61A 1HMVA 4X4SA 2ZH6A 3QRPA 3EDRB 4DQRA 2IDEA 5AXLA 3KNAA 2B4UA 3FCWA 1X7VA 3DM2B 2XQCA 1MROA 3ZTSA 1LV5A 1HLWA 4GKJJ 2J5AA 1SVDA 2DNKA 2RIJA 5E7OB 1GK8A 1WC1A 2V2QA 3BH6B 2C22A 3KLFA 3A8EA 4IDKA 2M8HA 2JWNA 4DL0C 2HFUA 4DN9A 3GZ7A 1T05B 1F0XA 2FD2A 4ELUA 3FNNA 3BDPA 1RXOB 3MI7X 4DR3J 2HZAA 1IBCB 2KT2A 4M5NA 4IRDA 1O0PA 4I7FA 4GVLA 5E3RA 1GMVA 2D3OR 3M6XA 4EK2A 2WOMA 3LPEA 3MM7B 5AJ3F 4ECRA 1YGYA 2ZJRQ 1DTTA 1HBNA 5F8GA 2VQEF 1SC6A 4OL8A 3MMCB 1TV6A 3GIJA 4OX7A 4DV4J 4B3OB 2VONA 7AT1B 3IFEA 4ZP8A 4CT9A 1HHTP 1I6JA 1VQ8S 3KG0A 2FJBB 5I3UB 2NR0A 4KT0C 2VFRA 2YKNA 3HSZA 1IKXB 1IR0A 4OZ3A 5M2UA 3RW6A 3K5MA 4PRFA 3PYFA 3I0SB 1Y7PA 1UPPA 4DL4A 3ENVA 4NLVA 2BANA 4PPZA 1H98A 1RKJA 1Q16B 2W2PP 3PY8A 3FSIA 1EAYC 2JNJA 2RQKA 3GG1A 4ECWA 2RRBA 2AKWB 2HRYA 4OZJA 3V6JA 1QSYA 2VFUA 5F3TA 2UUBJ 4Y34A 2E5GA 3OL9A 1EJ7L 2VD3A 3O8WA 1UJ6A 3BR9A 2Y9HA 3TQEA 2OSQA 4Y0FA 1IVZA 3RZAA 1C2PA 3WC2A 4X66J 1YRXA 4FKYA 3OL7A 4PXCA 3HSDA 4RBUA 4WE1A 1SQEA 2GIQA 4H4MA 1D3WA 5B08A 2W9AA 2BM1A 3C3LA 1RB0A 1TUWA 3CXCR 2XSJA 5K14B 3CCMS 4WU3A 2MY7A 5C2GA 4DUYJ 4OI0A 2LVWA 2SXLA 5HO4A 4ECUA 3R27A 4KV8A 1LWCB 3NWRA 4ED1A 2B9EA 2EK6A 1SQFA 1UP1A 2CJBA 2E1AA 3K5OA 3MZIA 3I5BA 1WC6A 1FERA 2FC8A 3T1HJ 1U47A 1T7PA 2F65A 1D9DA 1H73A 4FYDA 2RS2A 5C42A 2EI5A 2LEAA 2R2TA 1HI0P 1RWPB 2HVHA 1NNDA 4WWSA 2KZMA 3OVBA 4ZPDA 5HMZA 1HNWJ 4KFBB 1Y0HA 5U47A 4ZPTR 4BLGA 3W2WA 4ENOA 2JLGA 2ZZNA 4YB5A 4IH6A 4LR8A 3V6KA 2RQ4A 3GJTB 3KYLA 2ZJPQ 2Q6CA 2COLA 2QO3A 2IVYA 3OXLA 3BBCA 5GADU 4IG3A 1P27B 1HI8A 4C98A 4OYAA 2J6UA 1YWXA 1GMUA 1TKXB 3TZWA 2HNZB 1HPZB 5BR8J 3G82A 2R42A 4FVCA 4PUOA 4Q44A 5ETTA 1XWLA 5E3AA 2XO6A 4DR1F 2DGWA 1XERA 2QL7B 4KB7A 2BKPA 3UI3A 2O66A 4JI6J 3CCTA 1KOHA 3GYXB 4OLPA 4QU6A 1WG1A 1BC6A 4NPOA 4DX8H 4ECSA 1VYAA 4F8RA 4B3SF 2CUYA 2M3DA 2R8JA 1OYEA 4ZCIA 2AJ0A 1RABB 3HD1A 1Q79A 2CVEA 4USTA 4JI4F 1FJGF 3M6WA 3IRWP 3DDIA 4NEZA 2NSBA 3PO5A 3JYTB 3GWCA 1DLOA 1YQHA 2XSFA 2LDIA 1C0TA 3TUJC 2UXBF 1J2VA 3SQGA 1KP6A 2RHSB 4DV2J 3AXKA 1OQ6A 2CWXA 2OLWA 3MPVA 5B0GA 3RAQA 1U2RA 3CD0A 1I94J 2AW0A 2R8GA 5K14A 1X9SA 3HM9A 4CLSA 4I67A 4EU0A 5KFDA 4HHJA 3QSYB 1SC3B 1RT2B 4Q43A 5LXRA 3WIUA 4DU8A 2VZ9A 3FGVA 3UR3C 1Y11A 2BJ1A 4CLTA 4YP3A 3OUYB 1L3SA 1RUSA 5IQ6A 2PFDA 5F41A 4CTAA 3FDSA 2AZ3A 2CADA 2NCKL 2XHWA 3Q8YA 4C97A 1UVNA 1NSKL 5KG0A 1M1GA 4CO0A 3I55S 2MSTA 2MTLA 3D6FB 3CJSA 4HTIA 4CT8A 2CJ9A 1CSJA 2PO4A 5HROB 3LANA 3OW2R 2XS7A 2BKNA 1FX2A 2MYFA 5KG4A 3ZZZA 2CQDA 1ACMB 5EN1A 5GMEA 1TL3B 4ZCKA 3R7NB 3UCZP 1ZTTA 2ASJA 2YBVA 2F5GA 2BYCA 4CYUB 3DGPA 3IXQA 3VQSA 4F2SA 3Q0AA 1YRUA 3M30B 2QLFB 2VC0A 2ZBCA 2HNDA 3DRYA 1WSVA 1HKAA 3ZZOA 1I3OB 3K5NA 3HHLC 3HULA 2ZDPA 1IJEB 4JP8A 3CD7A 4N5SA 1RAJA 1KQKA 2CJAA 2OGUA 2QL5B 2DHSA 3MCOA 3HFVA 4UOHA 3BGRA 3VTIA 5LT5A 1JLQA 1RE1B 1P9QC 3QIPB 3SDEB 2MHNA 2YTCA 5KFLA 3ULHA 1FRHA 3WZ0A 3J7AN 4O4GA 3KK3B 2H4WB 2YNHA 3D6TB 4J7CA 1LWCA 3EGWB 4DR5F 4OYXA 4DL6A 2LLZA 3MM6A 3M8QB 4NA2A 2B8QA 3PW5A 2VG7A 3NAHA 4I6AA 1M5VC 4JI4J 3IAS9 4HI2A 4QIVA 3MCNA 4ZA1A 1NKCA 1N48A 5B0FA 1PBUA 4USUA 3DOMB 1S1XB 4PG5A 3HT3A 2AD9A 1SJFA 2UXCJ 5CCMA 3Q8RB 1KSPA 1NEEA 1T3OA 4AE5A 5I3PA 3MPUB 4URSA 3IA0A 4NXMJ 1FWLA 5D0GA 4P6QA 7FDRA 5HN0A 4UY85 2V34A 4DR4J 2V8GA 2A0FB 2BBEA 2WSEC 1AUDA 4MT1A 1U1NA 2H1YA 3NY0A 3AOBA 1OYDA 4CWBA 1QAXA 2KI2A 3IO1A 2BRKA 1NXIA 3D5MA 2H54B 3L7PA 3V6DB 1O5JA 1NPRA 2CNKB 3VR1A 4ZIWA 1B4SA 1C4CA 3DRRA 3PX6A 1DQ8A 3PHEA 2X7IA 2BJ3A 2R7UA 3QIPA 3SDEA 5KTQA 1T02A 2HNYA 1N33J 3I96A 3TP2A 1JJ4A 1NJZA 4NLUA 1R7IA 1Y3KA 4NLPA 1IKWA 3FJ2A 1KOOA 4WBFA 3PM9A 4YHHF 4A8XA 4OZ0A 5LJ3Y 5CQGA 2ZM6J 2BX6A 3IN5A 1XNQF 2KG0A 3UVJB 4DL2A 3PIOQ 1HD0A 2L08A 3IRXA 4ZVPB 5G4DA 2OPRB 3H4DA 4MKBA 2VA2A 2BM0A 1OY9A 3PJ9A 2E44A 5KFTA 1NB2A 2YNGA 3OVSA 4O3QA 3PW2A 2AGOA 4OLOA 4N41A 1KWMA 2CNOB 3RBXA 3GFZA 4EUVA 3PW7A 1YRTA 4ZPWR 1RTDA 2EW9A 2DR5A 1WDDA 2C2RA 5E5NA 3X3UA 2VFSA 1UPMB 4YB6A 3M8YA 2DNNA 2ADCA 2B4OA 3C15A 1YJ9S 5KFGA 4TYAA 2MGZB 2R7RA 4R0EA 2B6AA 4LR9A 4FS2A 2IVFB 1Q81T 5IXUA 4J9RA 1D9FA 1Y5LB 2O5DA 3NOGA 3GG0A 4FKXA 3CJKB 1HWIA 2DCLA 4KAIA 2IVMA 2AF6A 3V5RA 4TU9A 1ZM2A 2MY8A 4M1KA 2IJRA 2UZAA 1T8EA 4A46A 2XY6A 4KBIA 2BA9A 2JX2A 2LEBA 2GHPA 1S1XA 3D1QA 3PR5B 1U24A 4J9NA 1NDKA 2C2DA 2DRAA 5KT7A 2V9WA 2ASYA 1RAAB 2WB4A 3HSGA 4X4NA 1N88A 2AEMA 4OV6A 1RWMB 3PYEA 2J6SA 5F9NA 3ELHA 4IUFA 2GA7A 4NXMF 4PG4A 1CJVA 1QJHA 2J7WA 5F3ZA 1CC8A 2XY7A 4NYPA 5LMUJ 4DR3F 3FKBA 5KFOA 3Q2TC 3QJJA 3D67A 3GFYA 4OJHA 3QLHB 3L3CA 2WONA 2V2VA 3OR2A 3P6YC 2Q3PA 3QWPA 3SQGB 2OEJA 3IGNA 4P71A 1YBUA 3O1LA 3LQVA 3CSKA 4Z7YA 1F9HA 4ZCLA 3KLHB 2ZJQQ 4DV4F 4J5OA 3KJVA 1N5TA 1GTEA 1WJ9A 5HQMA 2RHQB 1VR6A 1R43A 2XZDB 2ZHOA 3MMCA 2F63A 2YXLA 4B3OA 2WVFA 1U0HB 4DS5A 4WKRA 4JI8J 2BEFA 4C7QA 3RB6A 5E33A 3FBFA 3PRDA 2NLWA 1FXLA 1TK8A 1BUXA 2EBGA 3MR7A 3GJSB 4Z2XA 2CIMA 5J2QB 2AMCB 2DR8A 3O2IA 4XO0A 1FKAF 1RBAA 4ZN3A 2GCFA 2CPXA 2C3PA 3HLUA 4ANCA 1NO8A 4F0HA 3BGLA 3C14A 4LSNA 5THWA 2XLJA 4O3PA 1S6QA 2QFJA 2JEFA 3QAUA 5HP1A 3RRGA 1M5PC 4NZ7A 5MLCV 1FD2A 2RNEA 3KWMA 5D0RA 4V19X 1KFDA 4JI1J 4NA1A 2JSXA 1VK3A 3G96A 4F4KA 1XTZA 4DV0J 1RYRA 3F41A 4B17A 3FBEA 3H5UA 1HW8A 4C0OC 5CA5A 1PGZA 3CVKA 1VQ4S 2QA1A 2K3IA 4KGKA 4KH0B 4USHA 1TFYA 1RAEB 4B3RF 1UCNA 4NLQA 1ZZNA 1CS4A 1WKLA 3DXBA 4X4OA 3R1HA 5D3GB 3NGKA 2HSEB 2HLTA 3L4BC 1J27A 1KVKA 1TV6B 4KYZA 2M88A 3KDOA 3R5BA 2CG8A 1RT1A 2QSWA 4UQTA 3KK2B 5EHHA 1UA0A 2XNRA 3BDEA 3MUVP 5HQLA 4DR6J 4WPAA 4KO0B 3MUTP 1APSA 2CKWA 2I2YA 1BQNB 1IBLJ 2VC1A 4KV8B 3QBCA 3KLVA 4HH1A 1HBNB 2YY3A 5LM7E 3ILOA 1VC6A 3DU6A 3HKWA 4Y2IA 4KIAA 2HURA 2V0NA 4X84A 4WE1B 1WSRA 3TAPA 4M5HA 4DQQA 4FYVB 2AYGA 2JEGA 3DLKA 3KLIB 5BJRA 1HNWF 1IQTA 3P96A 4AXIA 2L41A 4DF4A 2F9DA 2V50A 3FCHA 4ZJOA 2HEKA 1YVFA 2E5JA 4EGLA 4PYDA 4L73A 3T5LA 1REGX 3QZ8A 2P9EA 1HBUB 3THVA 1VMBA 2DR9A 4TY8A 1RISA 2CYYA 3C15B 4CIOA 3QZ7A 1C1BB 5I3QA 3TAQA 2E1RA 3BBBA 3SIPB 5ETNA 3NNHA 4YDXA 3H98A 4F50A 2OEMA 4QOTA 2A6MA 4DR1J 2XULA 3R6GB 1XMBA 2GQ2A 3JQKA 3ZZPA 2KFYA 3R5GA 1GMWA 3NCPA 1RT2A 2E7VA 3M2VB 1NK8A 3ZZ0A 4H4OB 3MEEB 1OPZA 3I82A 4OZ2A 4CLLA 2OIHA 1I5OB 1UVJA 2OMOA 3NNAA 3D68A 4C8NA 2HZCA 1NU4A 3HVAA 1LW0A 4RW7A 3FBBA 4ANDA 1R8AA 2G0IA 4FPRA 4RNMA 4ECYA 3HI9A 4C8LA 5IZHA 3JB9k 1IBKJ 1Y5IB 4X2BA 1KDNA 2EK1A 2NUHA 1JLGA 1SKUB 1V3ZA 3MFHA 1U8WA 1VBXA 3ONQA 1JLEB 1VLOA 3NLCA 2F1FA 1Z2ZA 2DNZA 3EVMA 4ZVRB 4DSEA 4B3TF 2WBMA 5DQIA 3MECB 3MPWA 4OHYA 1CS4B 2V94A 1GXUA 4Y2MA 3MEKA 4Z37A 2DR6A 3QO9B 1BWVA 3C2PA 5KOXA 2FDNA 3GSIA 2ROEA 5J2PB 2MHEA 3DGPB 1OO0B 3BQ2A 2ZE2A 1FX4A 2I9SA 3DI6B 3JQMA 3BO2A 1RWUA 2E5LJ 1FHTA 3NNCA 2UXDF 5J1NA 1KR4A 2N3LA 4X65J 1T95A 3H25A 1FVQA 1S49A 1JLCB 5BYSA 1UW9A 2DKOB 3CJQA 2VB6A 3D3BJ 3A8JA 3NMRA 5GAEI 4LF4J 1T11A 2FC9A 3MPYA 3MMJA 4A8MP 2HFOA 4C3MA 1C1CB 2GMHA 2QE5A 4IRKA 4C9DA 4I6YA 2UUWA 4J9VA 2EVZA 2IHR1 1WG5A 4L6V3 4W92B 5HK4A 3H5SA 1K1QA 2CQ3A 2HMIA 4V19J 2R7TA 2VBWA 4BBYA 1IR2A 4LIWA 3OR1A 3MD3A 3UDLA 1T94A 5DQGA 5HBMB 3GILA 3GE9A 1TAUA 2EPIA 5KFRA 5GAHU 3OPKA 1C0UA 4B9UA 4KGMA 1CJUA 2RKIA 2XLKA 2QYGA 4B9TA 2MKIA 1RAOA 2O67A 2QG9B 2ZVIA 2QA4G 1VDHA 3JYTA 1KTVA 2C3UA 2P9CA 4DG1A 2XB2D 2FJVA 1KQGB 2UVVA 3MEEA 2CNLB 2F9JA 5JUMA 5IWAF 4FBTA 1RT7B 4G3IA 1VQLS 2L3MA 4BCAA 2GHVC 2GMLA 4JB8B 2EFOA 4C48A 3IMQJ 1PC4A 1ZTWA 3PZPA 1ZYQA 1N5YB 1JJHA 5EDWA 3C6UB 1TL7A 3JXOA 3LO3A 2AYEA 2HNDB 3NCQA 4F3QA 3PXGa 3OL6A 1S4EA 2D9PA 4XDDA 1DTQB 2EKNA 4P2MA 1LWXA 2KVQE 2QJ3A 1QLNA 1S9GA 1KLMB 3BGFA 5DGBA 4CH1A 3KLEA 1TKXA 4ECXA 1N0UA 1S6QB 2ZBPA 1HA1A 1L3TA 4CTAB 2VG6B 4K4VA 5IV4A 2RB7A 2HAFA 5CZVA 4EFAC 1HYSB 3KJNB 3CJ3A 3P49B 4Q2LA 3KK1A 2ZBIA 1VQSA 3UD3P 4KPYA 5LSOA 3MOZA 4JI2F 2DVIA 3AOCA 1ZM4A 3TX0A 3DYAB 1X5TA 3N6MA 4OHVA 5EWGA 2RDIA 4AUKA 3NGRA 2ZHBA 3I32A 1CBKA 4ED2A 2B8PA 3TEHB 3P45B 3ISZA 3KFWX 3OTEA 5LJ5Y 3RBEA 2ASDA 4I2QA 4ILRA 3DLEA 3BKUA 3FVYA 2QGFB 4HT7A 2RF2A 1IBMJ 1RT1B 1WC0A 2HKEA 5T41A 5GAGU 1N6QA 4Z7CA 1N8RT 1DRZA 4DSIA 3C6TA 2MQNA 3CCRS 5L1LA 4DU7A 2CZ9A 3AHPA 2Z8QA 2IJNA 4FVMA 4B02A 2B43A 1GFWB 1IM4A 2WOMB 1FVSA 3G87A 3SCIE 1RAIB 5IM0A 5D77A 4NLSA 3OFHA 1TU0B 1V6HA 2W8KA 4ILLA 1F5BA 1TZ0A 1R89A 1SJQA 5C5JA 4DV1J 1EETB 2Y8WA 3S01A 3Q24A 1REVA 1D8YA 4Q0BB 2CDRB 2VKRA 1ZA1B 2IAJB 3N5BA 3OTCA 4DPWA 1LWEA 4YMEA 2AGQA 1VISA 4I2PB 4K2XA 2GFFA 3TJAA 3ZO7A 1G3OA 1VS3A 3JAMU 1LW2B 3PJXA 4CDIA 2J8SA 4ZVTB 2F3JA 2PMHA 4FDFA 4ID8A 5KOWA 5DG8A 2XGPA 1Y3JA 3NCRA 4DR5J 1AXQA 3PEHA 2EFQA 2DYAA 4HLBA 1QE1A 4U96A 1F2HA 3ZZTA 1Y5NB 1WF1A 2Q1LA 2F8HA 2HFSA 5KG6A 2FVSA 4OX9J 3SSSA 1CLFA 4IO1A 1HNVB 3S6EA 2QL9B 4ZVFA 1U45A 4IOCQ 3K89A 1PYTA 4QIEA 3TYTA 3JSMA 3M4XA 4ZHRA 3QFHA 4ES3A 1SH0A 1NPPA 1AT1B 3VZHA 2ROPA 3IWXA 1BQMA 2OFHX 2POKA 2XZTB 5D78A 4NLXA 9ATCB 3CTRA 4KKOB 1D1UA 1Y9OA 5KG2A 1EP4A 3DCAA 2FTRA 1HNXJ 3IRXB 2DEJA 3HFZB 1NMEB 4B3MF 2Z58B 2MKKA 1SL0A 2ROGA 2QSFA 3JS9A 3MM7A 2P6SA 4LIRA 3KUGA 4JI2J 2ZBQA 4USJC 4EO6A 1DJ0A 2ACMA 2ERRA 3ZNUA 8ATCB 3OQ2A 2QYCA 1UEKA 4CLYA 1S97A 1RU1A 1L5UA 4NI2B 1S6PB 2ZH7A 1Q86T 2CQ2A 3BKFA 1T9XA 1X5PA 4BWMA 4D3GA 2UUBF 4RW8B 1S1UB 1S5ZA 4J9SA 5HJYA 5DDOC 1D09B 4DL5A 1VQ5S 1U1PA 5CXTA 4NASA 1MLAA 1P6TA 3V2UC 4K4XA 1R3NA 2E7XA 1ITPA 2PI4A 4J91A 4P2SA 1QVFR 4OIXA 2MGZA 4DQPA 2BQRA 1TKTA 2GO8A 3CW2C 2DO0A 5T7LA 3PFEA 3W5ZA 5IFMA 1LEOA 4NLRA 5IC4B 2W9CA 5JVGQ 4JI0F 4KTQA 3G86A 1JMTA 1TL7B 2FVCA 2ZOGA 4JV5F 2BJ8A 3LPYA 2C2EA 4CRJA 1JLBA 1X9WA 4F4YA 1REVB 2MSSA 3GLJA 1MMNA 1RWOB 2ALYB 1QAYA 1AA1B 2XEXA 4M8LA 3M2RB 2NXCA 2GGPB 1S4FA 4M5MA 4N8OA 5DLFA 2DH7A 4Y3CA 1FKPB 4ITSA 2WRMA 1RTDB 3MDFA 4K4SA 5C42B 5AXKA 3NWGA 4RW6B 4U6PA 2CQ4A 2VFTA 5KFJA 3DRPA 4PWDB 2V4RA 2KHDA 4I4BA 3JSMB 3T1YJ 3BH7B 5GAEU 2ZOMA 4M5IA 3TR5A 3OL8A 1B99A 1FTCA 2RF2B 1IBKF 4YOEA 2DJWA 4J9MA 4M5KA 3D0IE 3PW4A 2A18A 1X8DA 3SSQA 2QA2A 4OHZA 4ZHRB 3RAXA 4C8YA 1FA0A 2DR7A 3QJLA 3KNGA 3HP6A 4A47A 1A0OB 3LP1A 2HFNA 2H4YB 3BV8A 4OMFG 3NS6A 1N32F 3L7UA 3WBZA 3VAKA 4PYAA 2AHOB 5ETKA 2OUGA 2HGLA 2MZJA 2M8DB 2DNYA 3CCWA 1HI1A 3D6MB 4WZQA 2E5IA 4K8RA 1RGVA 1V5IB 2IM2A 4NRTA 2XS2A 2AJQA 2X1GA 1ZS6A 2DGXA 2V5HG 4MK9A 4PCQA 2AYMA 4JI6F 1VJWA 1WACA 1WELA 1QD1A 2MQPA 4X4RA 1NK7A 5J2MA 1DAXA 2GW8A 4KRWA 2JVRA 3NKYA 3P5BP 4NCAA 1S0NA 3PKMA 3MOJB 5GADI 3GFXA 3CIMA 1LWFA 3ZC4A 1IJFB 2IMWP 5CYQB 2EKYA 2YKQA 3AXMA 2ZH5A 3THTA 1EKRA 2BABA 3MTKA 5D6GA 2VOPA 1CQMA 2CQHA 3I4HX 2HQCA 1PYSB 1WC3A 1L3KA 2NUUG 3GCWP 4L75A 2X1AA 1XMQJ 4K5RA 4LFAJ 2J7UA 3A3OB 4MJKA 3R7SB 4DUTA 1UFLA 3SCKE 4U7UD 2UXBJ 4WYWA 2H65B 3NGDA 1S1TA 2MQMA 4UQGA 4DWIA 2LXUA 3SBMA 3W5XA 3CJ8A 2CJYB 4RWWA 2ZH4A 2KZZA 1CULA 2MZRA 2QN6B 2Y1RI 1S48A 4ZP9A 1TUGB 3W1YC 3M32B 4DX6A 2F4VJ 4A48A 1M1HA 3OFGA 5A8RB 4OZLA 2ZKTA 3UDVA 2R8IA 2CPIA 3KG4A 1IXKA 3CDEA 3KJQB 2XMJA 5DZ6A 2AIRB 2OH2A 2JLFA 2W2OP 4A8WA 4D3HA 1XR6A 4J37A 3J7A1 2LQ5A 5HMWA 1RAFB 4DV5F 1H2UX 2MB0B 3K0JA 4H4KA 1RWVB 4KH1B 2J0SD 2CNNB 1Q7LB 1YJWS 1JWWA 2WTFA 3MFIA 3SYZA 5K8PA 1RTIB 1Z2LA 3K5LA 4NCGA 3NBPB 1BMQB 1QAIA 2B7CB 4NLDA 5J2PA 1FDAA 5C7PA 1RBLA 2C2KB 5HL7Q 1X4GA 4O44B 1RACB 1S7IA 2J9CA 1GEHA 1P1TA 2AWZA 2ZNZA 2HHSA 3EMTA 4DSFA 4WFXA 3KUHA 4ER8A 3BO3A 5L9XA 1S1VB 2ZFHA 4IH7A 4KY3A 4XDCA 4WU2A 3A12A 2YNIA 3MR5A 3DLBA 4LBPA 4L3KA 4PR6A 2KB2A 2KRRA 2FPHX 4LFCF 4ZOSA 4RZRA 4DBQA 4LF7F 3IBCB 4BC7A 2XMMA 3CJTA 5F8JA 3FZBA 4FPIA 2HBRB 2KT5A 1N56A 1GTHA 1QTMA 4MYUA 2V2ZA 1TVRB 3LTOA 3TVYA 4X64J 2UXCF 3BN7A 2XTJP 1IUJA 3Q2SC 1UFKA 2UU9J 3L95X 3M1VB 3MD1A 1WORA 3ISNC 4ES2A 4DR4F 3CDBA 1WD6A 3OLAA 3J7ZT 3EVWA 3TJ9A 4LT6A 2D3UA 3R5CA 2A6OA 2F8EX 3CJ0A 3DM2A 3NG8A 4J90A 5F8IA 1HW9A 3L9ZA 5KT5A 2BVZA 2LQBA 5KFXA 4CO3A 1LK7A 5D4LA 4HEA9 1SC1B 2XMAA 1N5YA 4WKYA 2BXJA 1CULB 2BQUA 1NH8A 2DXDA 2PD1A 1RADB 3BYRA 1V5VA 2LEPA 5A6PA 3LP0A 1T9VA 5EWEA 4O0IA 3AD8C 2D9OA 2V8DA 4O4RA 1RTHA 3PTWA 1V3RA 2H51B 3DMJB 4NL5A 1D9AA 5IV3A 1M5OC 1FK9B 1S7HA 4H4KC 1IKXA 2EG2A 5GAHI 5HBMA 3DKDA 2W7AA 5MAOA 4EBEA 4FNHA 1NJWA 3W9IA 1S77D 3V6HA 2PT0A 2MDAA 2DGOA 1X4HA 2KXFA 1KQFB 5SUHA 3MEGB 4ECQA 2HW3A 3C66A 1JXLA 2ZM6F 2PA3A 1WNEA 1N54B 1ZM3A 1GAOA 1U6BA 3MMAA 3NOCA 3H8YA 2F4FA 4K0KJ 4L3NA 1Q4RA 3I0RB 3T9NA 1WHWA 3VGVA 5HVGA 1R0AB 2PA8D 3AODA 3N79A 4LRCA 2NQPA 1RWNB 3U1MA 2AT1B 2Q43A 1SUQB 1LXJA 1WOSA 4NOHA 2CQBA 4KSEB 3TO8A 3V4MA 1JXVA 1RTJA 2F7VA 5AXMA 4URGA 1UA1A 4YB7A 1RKIA 3PKYA 4ED0A 1GX6A 4IR1A 3GV8B 4DV1F 2MLZA 4I0WA 5FIIA 1U49A 2U2FA 4MIWA 2GVDB 3SFGA 4PWUA 4RPFA 5K20B 4K7QA 3ETMA 1NB7A 2N7YA 3AFGA 2GQCA 4NLYA 3BSAA 4F4ZA 1PKUA 3BQ0A 3ILLA 2M5YA 3KMSA 2WSFC 2XMTA 1LWEB 4MIBA 1TMJA 1B3TA 2HHHJ 3SFUA 4IG0A 2ZUGA 4AL7A 3CJRA 2OPQA 1X31C 2V2KA 1TAQA 1E6VA 2XY5A 2VQEJ 5E2QA 1WWHA 5GMKa 2VA3A 1OQ3A 2M2BA 1VC5A 3BO4A 1FDDA 1RTZA 3U7JA 2QA4S 2B9WA 4ICLB 1LWFB 4K4WA 1AZSB 1HQEA 3DRSB 4C8KA 3AAWB 3CO0P 1C0UB 1ULRA 2H9ZA 3C6TB 4LSLA 5KFHA 4U8VA 2EFNA 4PXDA 3MWBA 5G0RA 5ETRA 4F3OA 1OSCA 2I38A 4I2QB 1RT3A 4N8NA 4O44A 2VQFJ 4ZPAA 2G2OA 3BSOA 3IP0A 1AROP 3UR0A 4B3MJ 2WONB 1RP5A 3OR2B 3P5TL 4UT4A 3OFFA 4NZ6A 4PG6A 4WK3A 1VI7A 3H90A 4WFAQ 1CG2A 2R8HA 4KJIA 3UD5A 2WVBA 3QNWB 3J7Z5 3VVUA 1Y4ZB 1PAUB 3KK1B 3W62A 2VJUA 1FD8A 4CLWA 4A8FA 4ELTA 2V6AA 1NAQA 3LALA 4CO1A 5DQHA 3UCUP 2VJVA 2Z2YB 3DDNA 3GV7B 1FF2A 4FXDA 2QT7A 3HZEA 4QWBA 3N01A 4IFYB 2E7WA 3BJYA 4DEZA 4PQUA 2HVZA 3C8YA 4CLFA 1RLCL 1JK9B 1JLFB 4CO5A 3K8VA 3M1VA 4RW9B 3WC0A 1R0AA 3HK2A 1RK8A 2LDYA 3QPIA 3K8WA 1XIQA 2JDJA 3AB2B 4J9LA 5H9EK 4LRFA 5H9EJ 3CWJA 4NI2A 2HIQA 4LF5J 1FTRA 1WI8A 2GAGC 3H7HB 4AYBD 2IBKA 1GT8A 2EG1A 1QDUB 1F60B 2VL1A 2XZWA 1YBTA 2DIUA 1CVJA 4QYZJ 2FLOA 3NS5A 4I64A 2RSQA 4USVA 1FK9A 4OJ3A 3TX8A 3QMQA 4DS4A 1DHMA 2FVRA 3Q23A 5KFPA 4K2JA 5FDLA 3A8KA 2HGMA 3GIRA 3HZGA 4RWXA 1VIXA 2CPYA 4N56A 5HAOA 4KGXB 4XPEA 5I4MA 3FQLA 4GO7X 4TU7A 1NSQA 2NXEA 5DM7Q 4PQUB 1VOMA 1H0HB 3CIZA 1Q8IA 3MEDB 4N77A 4TU8A 4X62F 2LFVA 4FXWA 3S8SA 3GIKA 5HP1B 4EMDA 3M8PB 2QEXS 2MKCA 1DBDA 4RNHA 4DXLA 1S6PA 5KT4A 3Q8QB 4DLGA 1T9WA 1FESA 4ATNA 1NDPA 1RWKB 2XMKA 4UOFA 1WKJA 1YZ7A 2KG1A 2RDJA 1Q7YT 4O3RA 4F4XA 5L8RC 1L3VA 1T03A 2DNOA 2KHCA 4RKUC 3T3FA 3D3CJ 3HVTB 2B4VA 4LFBF 2MMYA 3QFWA 3MCSA 3WQPA 3HCXA 5CD4A 2YKAA 2IC3A 3UNYA 2LU2A 2QLJB 3R7BB 3JTPA 2W2MP 3MAHA 3PEJA 1YK9A 3BKTA 4P7VA 2VF3A 1H7XA 5EX3A 3JSRA 5A0YA 1JLEA 4NLOA 1JQGA 3VZIA 4S0MA 3E51A 3ZXWA 2AZ1A 4J9KA 1JLGB 1XR7A 3K2YA 2JC1A 2GVZA 2ATCB 2PGCA 3M2RA 4KR0B 3TI0A 4ZVGA 2P9GA 2X1BA 5KT2A 3W64A 4ZPBA 4ICLA 1RT6A 3B54A 3PV8A 2HZVA 2BJDA 3W2VB 3QT8A 2VDIA 2LU1A 2IFXA 1PJ5A 4RW9A 3VAHA 1VQ9S 2PMZD 1X0FA 4OZ5A 2OTLS 3UDCA 2HVIA 1WDTA 1MROB 2BJEA 4DV7F 1PC5A 3US5A 3BBFA 4NLTA 5BYRA 5D15A 2WCXA 1VBKA 4N7TA 2RU9A 1H72C 2D41A 3OXGA 3PACA 2DGTA 1JNRB 2CJQA 4LJMA 3FRYA 2CQ0A 2XC9A 4IR9A 2EC0A 3R5DA 1FDBA 2ZH3A 2HHQA 2J9DE 2Z4PA 4UZBA 3CCJS 2GAHC 1VBZA 3LP1B 3UN3A 4IYQA 4DV6F 4USMA 2NYHA 3R6LB 4C11A 2IRXA 4XPCA 2W2NP 4MYTA 4TY9A 1FFGB 5DZ7A 1IN0A 2IRYA 4USKA 3CPWR 3BSNA 1UVMA 4DFJA 1SJ4P 2YQ1A 3K57A 2HFZA 5IT9U 3F0NA 5KFAA 3ILIA 2A10A 4LBHA 5C25B 3D28A 5CYJA 4QWAA 3J81Y 2J7KA 4W98A 2DPIA 2FJWA 4GKKF 3QLHA 4RW6A 2KTQA 5HLFB 1ZAVA 1VRUB 3EE3A 3GIIA 4K59A 6AT1B 4ED8A 4OYBA 4ILMA 3LGHA 3QRQA 4U95A 2RJZA 3VWSA 2LXIA 4DV3F 1U1RA 5LOQA 3RUBL 5B0DA 1EIYB 3TA0A 3MHYA 1RBOB 3KUEA 1S12A 3CD6S 5JVHQ 3IR6B 5K9FA 2KRBA 4DX5A 4Q8FA 2PEHA 2LECA 3MAAA 1AB8A 2H3EB 1KLMA 2R7QA 3AJDA 4X4QA 4ERDA 3H4BA 3BN4A 4OX6A 1XMQF 2VG6A 2HAIA 2XNQA 1D8ZA 2FZGB 4ZJLA 3NL0A 2G1DA 2YX7A 1HL6A 4K4ZA 1XJWB 1CC7A 1MMLA 3NP5A 1XC9A 3NGSA 1FEHA 4ZVQB 4Q0BA 5BYQA 3CCQS 2R7WA 4PZVA 1HQUB 1GXLA 1W25A 2BANB 3FEYB 1VFJA 4LF2A 3PJWA 4PXBA 1TKDA 2DGVA 4JI8F 2ZWOA 4LRBA 1TELA 4NYZA 3Q8SB 3KJVB 1TK0A 2HLUA 2QC3A 3RJMB 3D4JA 4FN5A 3CB4A 4KFBA 4PABA 2UVWA 2YNIB 4TLQA 1JIHA 4F2RA 1OPIA 2B9YA 2GIRA 2XYGB 3Q86A 2C2MB 2ZD1B 3AH6A 3KG1A 4P2XA 2WVCA 2PSZA 4QU7A 1HR0J 2B0GA 2AJ4A 1FNOA 1KKHA 2KYZA 5A0YB 5DDPC 3TW0A 1YIJS 5B0BA 1J5OB 1F3FA 3BGOP 3GYGA 2ZEJA 4WFYA 2XLIA 4DUZJ 3H42A 3UD4P 2CPJA 1V3SA 3LUYA 1VQNS 1JKHB 4DPOA 3F44A 2DNQA 1JX4A 4EZ9A 2NYIA 3MF5A 3ET6A 2WW8A 1FJ7A 3T41A 1QUPA 3AD7C 4TKTA 5F8HA 2MXYA 2R2SA 5L38A 2W4PA 3FSXA 2MPUA 4LFCJ 1G1XA 3C14B 3CNQP 3MM9A 1SKWA 3KKFA 1NUEA 2BW2A 2G2ZA 2Z2ZA 3DHWC 1S10A 4HACA 2IMOA 2HPUA 3OSNA 3GCXP 4FZVA 4ID5B 2IM1A 5E0OA 1FXDA 1SV5B 2N4DA 3BM7A 2M4MA 4M94A 1U02A 2CA9A 3POTB 3ZZRA 4CQ1A 4ETZA 4KO0A 1FKOB 1PO6A 3KMQA 2ZH1A 1FT8A 3R5JB 5LMNF 2RRAA 1U0HA 1UETA 2DGQA 1LW0B 2V9KA 2WAQD 4RW7B 3FFIA 3MR6A 2BOAA 2OAUA 2Y0SD 2ZHAA 1S1VA 2B51A 2BRLA 3VAMA 1FJEB 3ZTOA 4RUHA 1TP7A 4V1Ak 5K8NA 3R2DJ 4JOUA 1HHQA 1B0PA 3HSJA 2R7VA 5B7WA 3GONA 5L39A 4RO0A 4AQYF 4ZP6A 1JLAA 1HNXF 2DHAA 5HI7A 1JLFA 2UP1A 2C28A 3N0VA 1S9FA 4RLEA 2VQFF 2XYPB 3DU5A 1KNZA 2VG5A 5A6WA 3TOQA 1GNKA 2G1HA 4LF4F 3HHEA 4PQAA 2VODA 3O5TB 1XQIA 2V69A 2DISA 1K8AT 4ECVA 1KHVA 4YR3A 3EVOA 2YWGA 1T3NA 1MU2A 4OYPA 5IWAJ 3Q8PB 1PYOB 3E01B 4DR2F 2FJAB 4DHVA 4PG8A 1NH7A 4OYMA 3VGUA 4QPXA 5A8KB 1NK5A 3CJ4A 4JV5J 1DARA 4OHWA 3FMBA 1KONA 4AL6A 1NSPA 4J9UE 2NPIA 4MMOA 4OYZA 1RCXB 1WI6A 4LBIA 3U27A 4J9QA 1HNZF 4Q8EA 1HBOA 3N28A 4GVBB 4MFBB 1VHIA 1VHFA 4R5PA 2DNHA 3UDEA 2VFVA 5IQQA 3LWLA 2JZ5A 3LAMA 4IQMA 2IA0A 1WC4A 1C4AA 2YNHB 2GGPA 1JLAB 4F3MA 2CG4A 3DRPB 3SZ2A 3O44A 5HLFA 2G4BA 4LF1A 4X65F 5IT9Y 1S59A 2FVQA 5AE1A 2VKZG 2YPZA 2JEIA 1UJ5A 3AA9A 2VASA 1VQMS 5BXIA 1CEZA 2G9OA 3MUMP 2NXJA 2DH9A 1NZAA 2C3OA 4M63A 3RW7A 2BV3A 4DZ6A 3DRRB 2E1PA 2N3OA 3OJSA 2E1CA 1X4BA 1X4CA 2G13A 3POTA 3E01A 5KG3A 1KRPA 3GIMA 5DDQC 3HVRA 1NJXA 1SI9A 3IR5B 3IS9A 4PAAA 3MM5A 4M5LA 4NA3A 4YFUA 1UFWA 1FWPA 1TKTB 3VGSA 1W2BR 2C3YA 4I56A 3D66A 2F40A 2JC0A 2Z2MA 3PDNA 1RT5B 1DQAA 2D3O1 3DNCA 1SQGA 3P4UB 3R3TA 2ZH8A 4XIUA 4UY8T 4QBUA 4KQZA 5CYMA 2R9LA 4NMXA 4OV1A 1NK6A 2MQOA 4DFPA 2APOA 1HMVB 2CPZA 3MCMA 4ECTA 3GP9A 3C16A 5HQ8A 2VG7B 2QLBB 2ALZA 1FE0A 3H2LA 3H59A 4F04B 3K59A 3QWUA 2OPRA 4B9MA 1NM2A 1JNZB 3QT5A 1VBYA 2R7OA 2LQ9A 2CQ1A 1AZSA 1HQEB 5ETSA 5D0HA 3T1AA 4I1TA 3W5YA 1NPKA 2XMWA 2HBZB 4CM2A 4LSLB 2IM0A 1U1MA 4LQ3A 1Q0NA 4K0KF 1U1KA 4UUXA 1FJCA 2Y8YA 4NXNF 4ED5A 3D0GE 1LFPA 4QYRA 1R6VA 4LVOP 3MXHP 4LF5F 3QGHA 4PXEA 3CD5A 2UXDJ 2I0XA 4MKYA 2WB1D 1IKVB 3DLGB 2M0GB 3ZNJ1 4AD6A 3MURP 3OVAA 3HVTA 5CZXA 3CMES 4BHQA 6FDRA 3NS7B 1FRJA 2QTWA 4IO9Q 9RUBA 2FVPA 3GYNA 4NRUA 4MTPA 4AT1B 2WVEA 1IM6A 5KFBA 4JV1A 2DNLA 1TL1B 4PG7A 5E41A 3BEGB 4FYYB 4I2PA 4MAKA 1M90T 1DFDA 4J9PA 3JTNA 2VDHA 3DN9A 3BZQA 2VBYA 1RLDA 4WIIA 2CVIA 3GV5B 4LSZB 4P72A 3FZ2A 3O6QA 2W9BA 1NK0A 4WP3A 1CJKB 2DCUB 2IPOB 5AE2A 1M5SA 1H74A 3M7VA 4KGVB 2BMBA 2OELA 3SMZA 5J2NA 3I5CA 5KFQA 1FNMA 3KDNA 2HQ3A 2W8LA 4ZP7A 2HBYB 2I6WA 4FYWB 3CCES 3EXYA 4FBUA 4ZLPA 3W2VA 3BGUA 6FD1A 1RCOB 1H3DA 3C6UA 3HJVA 2MQQA 4UF4A 3HMJG 3ENWA 4OFZA 2HQDA 4QCLA 4JI5F 2D74B 4TVAB 5LL6d 3S1TA 1B70B 1VIOA 2MLYA 5F0UA 2G2YA 2HQGA 3G8QA 5KT3A 1I1GA 3TRGA 1KD1T 4XAKA 4JI3F 2OP5A 2HRUA 4KE5A 3WX4A 4X64F 2Z30B 4DL3A 2UU9F 1XMOJ 4LFBJ 4O0NA 1G4CA 1Q8LA 5D0EA 3D1HA 3OTBA 2CAJA 2DRDA 3B4MA 2ZITA 3BPSP 4H4MB 3JAMY 1N5VA 2D3ZA 3B8HA 4USWA 5DO2A 2XCAA 4CH0S 1NKEA 5ETQA 5KFKA 1KFSA 2E9ZA 4DN0A 3QT7A 1YG0A 1ZM9A 3F56A 5H9FJ 2FLPA 2P6TA 4QIWD 3OSPA 3IM8A 4M95A 3KHGA 2BE2A 1MN7A 1BGXT 4Q2MA 1YHQS 2VIHA 2BJ7A 3PYDA 4DPXA 5KT6A 1VGYA 5LMUF 1YJNS 1EZZB 1ZZFA 1H7WA 5KFMA 1S0MA 4JI7F 4R25A 4LMZA 2NZ4A 2OKQA 4IOAQ 3IS9B 4EYIB 3W65A 5KFNA 2DXEA 5J2QA 1XR5A 4TQSA 2V67A 3HHLA 3IC1A 4CH7A 1NK4A 1RT5A 1MW7A 2E66A 2ZNYA 3P8BB 4ZITA 2CXEA 3W7BA 1DQ9A 1FRMA 3HF5A 2HHXA 4Y2CA 2UUAJ 2E29A 2GJ2A 5C25A 2LCWA 3EWGA 2O1PA 2AU0A 3AD9C 3H2UB 1FE4A 3B6BA 3O3LA 3K5PA 2J8AA 4CNZA 3H20A 3E3XA 3IGVA 2DHHA 2DNMA 5D3GA 4WFBQ 1WEXA 2OEKA 4PWDA 1E6YA 1C0TB 4WFZA 3HT0A 1GXTA 3C16B 4WIQA 1X9MA 1TL3A 4ZPVR 2ZH2A 2QRRA 1H2TZ 1IWGA 1R8BA 3OXFA 4JI1F 1ZOTA 2EFVA 2UV8A 1XBWA 2XS5A 2EEYA 4L76A 1YTYA 1BQXA 4UTGA 2ZC4A 3HHNB 3D1OA 4TY8B 1FWKA 1PJ7A 1WHYA 2PI5A 2UV8G 4I68A 4RUAA 1R8PA 4C8OA 2W9CB 1RAGB 4HDHA 1OSDA 3RRKA 4QYZK 1TR0A 2BE7D 2GVDA 2IBOA 3W9HA 2EC2A 2PC6A 5M2RA 2CPFA 1U2FA 2X51A 1GMWD 3MTJA 3M9NB 3M2UA 2ZC3A 1T0TV 5IS2A 4KPCA 3G6ES 2FJXA 3QT6A 3OUYA 1B64A 1WOPA 3DLKB 3KLIA 3KHHA 2ZWPA 3CE8A 2A2DA 2NXNA 5KFSA 2L48A 3TZZA 4AL5A 3GTYX 2W4CA 4HHHA 5ETPA 2GX8A 1UVIA 4HH0A 1UWAA 2DHGA 2OD6A 1FRKA 2VPWB 3MMAB 5HVHA 3I9V9 3FK4A 2G0JA 4URQU 1CJTA 1RT3B 5LMNJ 2DGUA 2M70A 3MM8B 3N5FA 5KFCA 4QIGA 5G0RB 5HVFA 1VQOS 1FKOA 1DLOB 1RT4B 4QWDA 2JFDA 4I7FB 2O3DA 3ENQA 3T6JA 2UUTA 1T9YA 4F4WA 5KFFA 3M30A 1N33F 1NZ8A 3FBCA 2LA6A 2E1MC 2KDOA 2YWWA 3DGVA 1TQLA 3PHTA 4AQYJ 4B08A 1HBOB 3A8IA 3FEZA 2DNRA 2FUG9 4BS2A 2VPZB 2AP6A 3JTOA 4XTTA 1HYSA 1YBAA 3LF0A 3V4IB 1PAEX 2QV6A 3ZFVA 3LP2B 3FEXB 2MQ8A 2WK4A 5HJXA 4QWCA 5DGAA 4OZ1A 4DMZA 1F9FA 4DFMA 3G6VA 2HBQB 3BF4A 1W26A 3DLLQ 5J1EA 2DEIA 4IOBA 3CJ2A 3OD2A 1Q1KA 5CHCB 1HIYA 1KEKA 3LA0A 2ZZTA 2RDDA 3MM9B 4GRSA 2KH9A 4K4TA 4B3TJ 2ZE2B 1XNRJ 4LF6F 1YZ6A 2PMWA 3UE2A 1JB0C 4L72B 2VG5B 3DOKB 2X3DA 4RUBA 4C0BA 4HHUA 3HVWA 8RUCA 2JL9A 2B56A 2I5JA 3D9BA 4B9VA 2PN6A 2RUGA 4DG1B 3RR8A 1WC5A 2DO4A 4EBDA 2MJUA 4NYOA 3BQ1A 4GKJF 3T1YF 2HHWA 1XK8A 4P75A 3CT9A 4AXJA 2WZ1A 4GVBA 4MFBA 2XBPA 3CF5Q 4E0DA 2RD5C 3QRRA 2CRLA 3CDWA 4P9SA 2HNYB 3FFIB 4AFFA 2DNPA 3LH2S 3TANA 3J81j 4DF8A 5DLGA 4X4VA 3UN2A 1RI7A 3HJFA 4B9LA 2AV5A 1SBRA 1S0VA 3JQJA 4LF8F 4CI0B 3CJ5A 1Z1ZA 3D7SB 4ED4A 4X62J 4OI1A 1N32J 1FRIA 1RWWB 4FNIA 4P2FA 2D1CA 3FCVA 3OBIA 4RNOA 3IG1A 5A8WA 2XHCA 4F4AA 4G1QA 2JEJA 5CH7B 1HWJA 1QM9A 4Y00A 3CC2S 2WBRA 2NPFA 3PO4A 3R8YA 1X4FA 2JVOA 3NRBA 1VJQA 5H1SV 1F2GA 3NGUA 3JSBA 3HDSA 4HL9A 3PIPQ 2HVEA 3Q89A 2C2NA 3B82A 1RA7A 3KJFB 5IT4A 5SZTA 5B0AA 4U9RA 3ZTPA 1IKVA 3DLGA 3DLJA 3J80U 2QFIA 5KG5A 3MMBB 3WIVA 2R3VA 3AQPA 4NE9C 1K1SA 3I4PA 1H2VZ 1VK8A 2E9TA 2JFKA 4U7UK 2BOPA 2X1FA 1WG4A 2D69A 1TKZA 3TA2A 1IWAA 1FRLA 4GMKA 1NHVA 2Q79A 3GB0A 5J1PA 3T5KA 2IM3A 2XI2A 3EPIA 2YKOA 2A1BA 1VQPS 1D0EA 1H38A 1AFJA 2RQMA 3OHBA 1K0VA 2FHKA 1K9MT 2HWIA 5ITHA 4QPTA 4QR0A 2FHMA 3DOKA 3DYAA 2F4VF 2L9WA 3H5XA 1ZAWA 3UCGA 1IR1A 1UMJA 4NXNJ 1YJ7A 1QVGR 3KXDA 1QE1B 1MWQA 2OO4A 5JMNA 3Q22A 2OJ3A 1HNVA 3V81A 1TFWA 1N34J 1S6OA 3MAQA 3T1HF 4JYAF 4DR6F 1UZDA 3NBPA 4DV5J 2HHVA 3X1LB 3CDAA 4DI6A 2GQQA 4N76A 2VV5A 4GC7A 2UUCJ 1HPZA 2IDLA 4ZLNA 4RX6A 3SEOA 1CPZA 2KJWA 4OJ1A 4W4MA 2IJFA 3FQKA 1DY3A 1F3VA 4CLZA 4IG3B 2CFXA 3GSDA 4QZVB 1SL1A 5CD4H 2V8HA 2KXNB 1QTNB 2IA6A 3IR7B 3HPOA 3GU0A 4ZVEA 3UNGC 2IYIA 4NZ0A 3IWLA 4LF8J 2RAQA 3M6VA 3PRBA 4ZVHA 1OS5A 1YLXA 4WF9Q 1ZA2B 2YX4A 1JJ2R 2MQLA 3MEGA 4DQSA 1WEYA 4ANEA 2KL8A 2RE1A 5AXNA 2W2QP 2CWKA 3EUNA 1ZETA 1UL3A 1Y10A 1TVRA 3EM1A 1RHJB 2Y3YA 3DFEA 2GZOA 1BWEA 1LFWA 1HHSA 1Y00A 1UWBB 5JJBA 4DV3J 4JI5J 2DGSA 2B9XA 1RHQB 3HX9A 1VRUA 3VV2B 3F73A 4B3SJ 2C1EB 3QGPA 3MMBA 2HS0A 4FF4A 4OI4A 2BR0A 2K3KA 2OFGX 2J9EA 1MG7A 3HHLB 2W01A 4F67A 1Q8KA 2AX1A 1X4AA 4JUZA 2DIVA 2HHHF 1J5EF 1RHRB 3T5HA 2OPSB 2MKHA 3BS9A 5KFZA 5B09A 4EBCA 3CMAS 1EQ0A 1KN6A 3M2VA 5T7LB 1SCJB 3FSYA 5B0CA 3CCLS 5KFYA 2Y0BB 2ZH9A 4NX9A 4YS2A 3TUIC 4DV2F 3G82B 3MGJA 4MKVA 5L1JA 5AT1B 4MK8A 2CZVC 2HFVA 1PCAA 2NXUA 4RBVA 2XMVA 5CYMB 4GO5X 1DZ5A 3LOUA 1W2IA 3ET6B 4HT5A 3Q83A 4OI3A 2B4PA 1TL1A 3DXSX 4QR1A 1WHXA 5HATA 2BKOA 3OV7A 3V81B 2XGQA 3KOAA 3I56S 4ZVOB 1A6LA 2EBEA 2CPEA 2AJ2A 1T05A 1F9EB 3CC7S 1BY9A 3KLGA 1HD1A 3I5AA 3QO9A 4B9SA 1EARA 1P1LA 3PR4A 1K0TA 4ZMMA 2V4JA 2MZQA 3LGMA 5EGYA 2QMWA 3RAMA 2DBBA 2U1AA 1HR0F 4QIFA 1VRTA 3TZXA 2GC8A 3VGTA 2QMXA 2C42A 2KT3A 2E5HA 4IFVA 2IYGA 5DDRC 2FLLA 3EXCX 2PIIA 3J7YI 4LF9F 1YX2A 3HKZD 4K5SA 4MK7A 4HDGA 1TKZB 4YEAA 3KK2A 4WK1A 1C1CA 4NWBA 1FKPA 5T14A 3RTVA 4ED7A 3CC4S 4OI6A 2MZTA 4KHPJ 1CJKA 2MZ1A 4WFNQ 4BWJA 5HMYA 3TQ1A 4JI0J 1BLUA 4C8MA 3FRZA 1OJ4A 2OPPA 1JLBB 1XN9A 3N4WA 5C24A 1U8SA 3U02A 5A76A 1F6TA 1A7GE 3ZTRA 2J6TA 2YH1A 2IY5B 2XYHB 2FIUA 5HSPA 4G1QB 2FGCA 4H54A 2AJFE 4ZS6A 4WTOB 4K4YA 2RRNA 3G71S 1BXNA 2W9BB 1XMOF 5C2CA 3DI6A 3M8PA 3G8SA 3G4SS 2HGNA 3SCLE 2DTJA 4PWWA 4F0KA 2H5IB 4P74A 3A13A 3BR8A 1NRKA 1SIZA 4FYXB 5E3QA 5GMDA 4F26A 2B5JB 2R2RA 1Q53A 5AJ3J 1AFIA 3CCZA 1LQ9A 1ZAXA 3T5JA 4O23A 1HBMB 1ICEB 5GVQA 3ZZUA 1I51B 3DOLB 3UN5A 4F25A 3TUZC 4EWTA 4RUCA 1VLYA 2VBZA 5IC6B 4ETXA 3H40A 4QQBA 2RU3A 2GMJA 1PJ6A 5D4PA 3UO0A 3H2VE 2N82B 4H4OA 4RL1A 3VAIA 2ZVSA 2YKNB 1W7WA 1SC4B 3OR1B 1S99A 4LVNP 4R5PB 3L09A 5I3UA 2CPHA 2HHPA 2EXUA 2RMLA 1F1BB 4X4UA 4DSKA 4ZLLA 4P52A 2DK2A 1Q5VA 4NCGB 4RU2A 2UUAF 1IKYA 4MKAA 2H48B 1NJIT 1PG5B 3AA8A 4M5JA 4E2FB 4YHHJ 3CDUA 5ETOA 2KFZA 3HO1A 2DD8S 1IBMF 3H0PA 4DR2J 4RNFA 3L7OA 1SIWB 2V4QA 1WF0A 4WP9A 3KHLA 1SV5A 2OI2A 2GIFA 3PVXA 2LXFA 2UVRA 5F8LA 2Z0GA 3ZZYA 1TK5A 4LF9J 3B4DA 3W3SA 1SJ1A 2BZ2A 2GNKA 2HNZA 2V68A 3OTOF 1X5OA 2C3MA 2B6AB 3LAKA 3J7YU 3MR3A 3RB0A 4PEOA 1NBEB 1PBAA 4KHMA 4QW9A 1DTQA 3MM5B 4FF1A 2KVIA 3V4IA 2J0WA 2LP4A 1Q5YA 3MR2A 3PRVA 2D7SA 5IM0B 1Z4UA 2JHEA 4M5GA 1KQSR 4OYIA 1P8GA 3DC2A 4ZCMA 3TUPA 1LK5A 4DX7A 2ATLA 4DPUA 1SXLA 4LREA 1N4LA 2KYXA 4B3RJ 4ZKAA 3EDQB 1OMSA 2WHOA 3VAGA 1BD6A 4MIAA 4DV7J 4HVZA 1H6KX 1OY6A 2WW4A 1U26A 2MLXA 1T9UA 2V8PA 2W24A 2CJXB 5GAGI 2Y1IA 3I87A 3E2EA 2K2PA 1CJVB 2W1BA 2A2CA 1OIAA 2I5JB 4CCHA 3HHLD 4YB1P 1N6QB 2K8GA 2V4JB 5IT0A 1AW0A 3DLEB 3GMGA 2FHOB 3PX0A 1Q95G 3EGVA 2DRBA 2KJVA 1B7FA 1KS2A 2I8EA 4B9NA 3KLGB 1HBMA 1NSAA 3K58A 2AYBA 1RTHB 3N6NA 1URNA 2VPXB 2AJ1A 2JRSA 4X4PA 1SH2A 3SV4A 2FY8A 2AX0A 3CJKA 1N36J 1TL5A 4CM0A 4WCEQ 4PUOB 2V8VA 4C3KA 2YWHA 2HHTA 3LGNA 4ALZA 2KM8B 3D2WA 5HROA 2YQ3A 2EWHA 4YN3B 4R8UB 4YY3J 1EETA 2RT3A 2IIHA 1Q78A 2I1RA 2NS1B 2MEWA 1LW2A 2HVDA 2K7KA 2HYIB 3VAFA 1N5SA 2MKJA 2YQ0A 4LF7J 2E9RX 2QLXA 2XWYA 4RR5A 3NGTA 4WP8A 4TXSA 2XO7A 4ED3A 4A8KA 1U1OA 2IRUA 3MM8A 1M1KT 1FXRA 4C2MA 1WTBA 3T6BA 4O3OA 5RUBA 2ZZMA 1KBRA 2ZBRA 1UVKA 5L9NA 2FY1A 3PCOB 1FEEA 3WHIA 4WJBA 1FJGJ 2FJEB 3W9JA 2ZDOA 3OTOJ 4NEYA 2GV1A 2HWHA 2J0QD 3BGRB 3ILJA 1MSWD 2YVSA 4DZDA 5L46A 2DPJA 1UEVA 3NMAA 2R7SA 1WTFA 3K17A 2DY9A 1YJUA 2CQPA 1KC8T 2P8IA 3A1YG 1EKSA 3VALA 1G2EA 1BQMB 1RHUB 5K8MA 3W8GA 3LP0B 3PYGA 5IOLA 4FP9A 4TQRA 1GQEA 2QMUB 1E6VB 3M9OB 1SB6A 4NLWA 1U1LA 2RS8A 2KO1A 3RG6A 1RZMA 2B7BB 1OY8A 3M6UA 4ZVSB 3OHAA 3IBWA 4DLEA 4ECZA 3QJPA 2M52A 4LSNB 5CCLA 4G1IA 3EICA 1FDNA 2ILYA 3IM9A 1RAHB 3PFOA 1URRA 2J0XA 3DRXA 4IH5A 3VVTA 2AGPA 1K44A 3QAEA 4RW8A 3IG1B 5A8WB 4ZLJA 3SQOP 2KXHA 3I0RA 3M8WA 3CMQA 2XG8A 1YI2S 1IKYB 3CUNA 3IAM9 1ROFA 5KG1A 1ZPWX 4QW8A 4DJBA 4ZK7M 1QAJA 4YUDA 2W25A 4M5DA 4IRCA 4HR2A 5FLXY 1QY7A 1NKBA 2BQ3A 1CQNA 2WSCC 4IQXA 1HNIA 4GKKJ 4W90B 4ES1A 3K7RA 3J81U 1YDLA 4A8QA 1RHKB 3SXLA 2CQIA 1HWKA 5LXYA 4YY3F 4U67Q 3VCDA 3DDKA 3UVJA 3PG9A 2QX0A 3FC9A 4FS1A 1UTAA 1RQ0A 4ZVUB 4PKDB 1RSCA 5M2PA 2DT9A 4JI3J 1S76D 3EGZA 3AB4B 2K06A 1BHNA 1TUVA 3I6PA 2A3JA 2XWXA 3TWZA 2RQCA 2OPQB 5ETLA 1KLNA 4YR0A 1S9EA 2HMIB 4A4JA 2BDPA 3VHQA 3OJUA 2MJNA 2FYXA 2HQFA 4DOZA 3KLFB 5J2MB 3T19A 1Q82T 4HACB 4U8YA 2BE2B 2JJ4D 1YSJA 3ENAA 5DRKA 3TZYA 2PFFB 1G6BA 4IFYA 5EUHA 1J5EJ 1G7CB 3E8OA 5DS7A 3AJ2A 3ETOA 5L1KA 2BJ9A 2JH3A 4LFAF 1RA6A 1MU2B 4KC5A 2KN4A 3QIDA 4HTJA 2CPDA 2RVJA 3ITHA 2YKMB 1N0VC 3R5AA 3N9UC 3DLHA 2HS3A 1R0CB 1RT7A 2E5LF 3R1LA 1S1TB 1SKRA 5DM6Q 4BDPA 4F0MA 3RR7A 1IQZA 2XMUA 3RRHA 5E3PA 2DNGA 2W7OA 1WHVA 1B7YB 1M5HA 3HHKA 2YH0A 1K47A 2VU5A 2ADBA 1FO1A 1N34F 3HXMA 2UVUA 4CZCA 3U1LA 2ACYA 2K1RB 2OD4A 1VCTA 3RGIA 3AJ1A 2CQGA 2P5VA 3EZ5A 1F5CA 2DXFA 2J76E 1FFWB 5AE3A 4F02A 5FDLB 3M8SA 4J9OA 2GO9A 5LSRA 1S79A 1ZBTA 5D8HB 5DJBA 2Z56B 3D0HE 1SL2A 3Q8VA 4I6WA 1CJUB 2RKIB 3FMWA 1VQ6S 1ZPVA 1UZHA 4F7VA 4DUZF 5I42B 1EX8A 3GPAA 5CYQA 1RTIA 1YKWA 1HNIB 4DDFA 3UW1A 2FGOA 2YPYA 3WDOA 2OMLA 3UFCX 4ZN1A 4Q7AA 3PW0A 1PIEA 2C2OB 2O01C 4DQIA 1X0PA 2Q6BA 2HRTA 3CGIA 1HNZJ 4NCBA 3IWNC 2YWEA 4ID5A 5EWFA 5A8KA 2YKMA 4OHXA 1FFSB 1UAWA 3QATA 1SJRA 3TARA 1XEZA 2HS4A 3RYLA 4EI2A 4RNNA 4O3SA 3GFHA 4LUBA 3KLEB 4ZPCA 4P10A 1NHUA 3CCUS 4G65A 1DURA 4ZDNA 1UKUA 2PDAA 1B0VA
chains in the Genus database with same CATH topology
2R8KA 2IAJA 2K7JA 3QGIA 1VQ7S 3I0SA 1LKZA 2YKPA 4TYBA 5HMXA 4N47A 1HFEL 2NSCA 3HHDA 4LQ9A 2KFNA 5ADZA 3DHXA 2MZSA 2YX1A 1L3UA 1U6ZA 1RT6B 4RBTA 1E6YB 2F8MA 2YNFB 4R0JA 2XCPA 3G6YA 5I42A 4C0HA 3RAQA 3THPA 1R8HA 1Q8BA 3TAMB 4EO8A 1VRTB 2ILZA 2KM8C 2W4DA 4YR2A 5E3CA 1U1QA 1WEZA 1M0SA 5BR8F 1YITS 1MWZA 4YQWA 3SSRA 3EX7B 3RBDA 4Y2KA 1N52B 4OJGA 4KKOA 3LW5C 2B5JA 2M9KA 4YDDB 2XSJB 4O3NA 2XI3A 2GHWA 2L9NA 4C11B 1U6FA 4G6VB 3SCJE 2J9DA 5K8OA 4PPDA 4C3LA 3UPFA 1ZH5A 4MH8A 4Y6IA 4CO4A 3TNVA 3CULA 1HBUA 1R6YA 2VBXA 3OFEA 4U7CA 2LQJA 5A8RA 3BSCA 2OPPB 3KTQA 4TN2A 4KHPF 4JV0A 2ABYA 3G6XA 1S1UA 2R4FA 2HQIA 4DUYF 2BACA 2YWKA 1VC6A 1HWUA 2GJIA 4FXVA 5KFWA 4UW2A 1V9OA 3KLHA 4I69A 2N4CA 5F8HA 1S6UA 2G0CA 1ELOA 2JLEA 4FF2A 4UOCA 4CNYA 1U25A 1S1WB 1RJJA 1XNRF 1N5QA 2VPYB 4KHRA 1GX5A 3SI8A 1J5OA 1IBLF 4Q5VA 3P3DA 1JLQB 4OX9F 3EPGA 1KVIA 1UJ4A 2LMIA 1I94F 3JSYA 1R27B 3DOLA 4IFVB 2K1RA 2ZKUA 3VAJA 4JV2A 3DMJA 1VQYA 1KVJA 5B0EA 3M8RA 4WXWA 3AQOA 4A8OA 4DR7F 1KHWA 4EYHB 1F5AA 2QZ8A 4OX8A 1C1BA 1X4DA 3LP2A 2DHXA 3G8TA 4IG0B 3C46A 4QR2A 3LWMA 3PX4A 1K73T 4WZMA 1HWLA 1QUVA 2VOOA 2Y1JA 2RH3A 1RTJB 4XK8C 3ITHB 1RDRA 3NAIA 2VH7A 2FB0A 4EZ6A 2Q66A 3H5YA 1X4EA 1QSLA 3M05A 1A9NB 3VF0B 1S72S 4WTYA 1SUQA 2ZD1A 1JKHA 2DB1A 4RW4A 1BQNA 3GQCA 5D4NA 3N6LA 3MECA 4G1PA 1DTTB 4Y2AA 3I9ZA 2N7CA 2R7XA 4DFKA 1FCAA 2CDQA 3PNIA 5KFIA 1YJTA 4HI1A 1MMDA 5D4OA 4RU9A 4GC6A 4C8ZA 3T9ZA 4O4GB 3KK3A 2KU7A 4TNOA 1U48A 3DRSA 1MNEA 3VQTA 2YNFA 3D54A 1HQUA 2Z2LA 5K5MA 5DETA 5A2QY 3ISND 3RB3A 1HARA 1MWYA 4DSJA 5J2NB 5DG9A 2OTJS 4WYLA 1UEUA 4UUWA 4WXOA 4CO2A 2H5EA 3KHRA 3EYZA 2NREA 3AY0A 3QGGA 2ZOFA 3BB5A 3TVKA 1JLCA 3GR1A 1B0TA 2OPSA 2VUGA 1KTQA 2EFPA 4HKQA 4C4WA 1SJ3P 2PE8A 4E8UA 1VC0A 1S9GB 2MKSA 4Q45A 2UUCF 2KKHA 3ICLA 1M5KC 3DOMA 4DSLA 4HYKA 2FJDB 1N36F 4OI2A 3OTDA 1U7LA 4IKAA 4BC9A 2FHJA 3CCVS 1UWBA 3MM6B 1IKWB 1SH3A 2YNGB 4OZNA 4USIA 2W7PA 2CZ4A 4IO9Q 3TVZA 4A8YA 3TAMA 1NJYA 4E98A 1LXNA 3UQSA 5JXSA 5F0WA 5KAKA 5EX0A 3QYYA