2FC9A

Solution structure of the rrm_1 domain of ncl protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
GSSGSSGNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NCL protein
publication title Solution structure of the RRM_1 domain of NCL protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fc9A00
1WEYA 2B0GA 1KOOA 2KVIA 1N8RT 1AUDA 4OZ0A 2FPHX 3H2VE 2FY1A 2ADBA 3SXLA 2MMYA 4PR6A 2XSFA 1KC8T 3SMZA 2VODA 2MZQA 1WF1A 3V4MA 2MQMA 2KG1A 2DNHA 2F3JA 2EK6A 2CQBA 1R8PA 2Q79A 5JVHQ 2RVJA 2JVRA 2N3OA 5DDQC 2CQCA 2YKAA 4U67Q 3CCUS 2ZJQQ 2MGZA 1RK8A 2MY8A 1FT8A 2GHPA 5H1SV 3CCJS 1WHWA 5LJ3Y 2KHCA 3VAFA 2DNLA 4ED5A 1CVJA 5DETA 3UD3P 3MDFA 2DGWA 3VF0B 2M7SA 3P3DA 1SXLA 1WF2A 2MHNA 3VAHA 3U1MA 2AYBA 3N9UC 4C7QA 2M88A 1WG1A 1VQLS 2LECA 2KU7A 3CF5Q 2DGVA 1OWXA 1A7GE 3CCES 1PO6A 3K0JA 2YH0A 5DDRC 1OIAA 3MD3A 1RKJA 1K9MT 4OZ1A 2XB2D 5ITHA 2MQPA 2QA4S 1HL6A 2MJUA 3SDEB 2E44A 2CQIA 1D9AA 2CPEA 1DZ5A 1X4FA 3CPWR 2KXFA 2FC8A 2RRBA 5IM0B 4LMZA 1NO8A 2MB0B 1X5OA 2LQ5A 2CPXA 2HZCA 2M9KA 2RQ4A 4Z2XA 2DGOA 4WFAQ 3MD1A 2CQ4A 1VQNS 2VOPA 2RNEA 2RUGA 3VAMA 2EK1A 3DLLQ 3NNHA 2O3DA 1A9NB 2HVZA 3VAJA 2KH9A 1BY9A 1OPIA 5LXRA 2NLWA 2RU3A 3Q2TC 1VQ6S 1WF0A 3B4MA 2DNMA 1X0FA 2MKJA 1L3KA 1Q82T 3MXHP 2DGXA 2MQQA 2KM8B 2DISA 2YWKA 2RS8A 4IOAQ 1S79A 3B4DA 3CXCR 4IO9Q 3TYTA 2YTCA 3S8SA 3CCVS 2DNYA 1VQ7S 1FJEB 1P1TA 3J7YU 1WWHA 1YJ9S 3R1HA 2CQPA 1M5PC 3UE2A 4FXVA 2MQLA 3THPA 4CIOA 2DGQA 1VQ5S 1NU4A 2QFJA 1Q7YT 2DH8A 4CH1A 1IQTA 1XN9A 2LXUA 1H2UX 1N54B 1WTBA 2XS2A 2I2YA 2VONA 2U2FA 3CUNA 1WG4A 2JVOA 3IWNC 5HO4A 3UCZP 1X4GA 1VC6A 4PRFA 4C4WA 3TP2A 1U1QA 3BO2A 2DNGA 2WBRA 3CMES 4LIRA 3PIPQ 2GO9A 3RW6A 2CPYA 3VALA 4QU6A 2J8AA 2SXLA 2DGTA 5GADU 5GMKa 2RS2A 2MGZB 3NS6A 1X4HA 1ZZFA 4WF9Q 1SJRA 3IRWP 5CXTA 3BO3A 4RU2A 2MKCA 1OO0B 2K8GA 1FHTA 1U6FA 4WFBQ 1HD1A 1Q81T 2DHAA 4QU7A 2XNQA 1KQSR 2MY7A 2XS7A 1DRZA 1HA1A 2AYMA 5GVQA 2LCWA 4TU9A 2EVZA 2DNQA 2G0CA 5IQQA 5JVGQ 1VBXA 1ZH5A 2XS5A 2MKKA 3Q2SC 1H6KX 4WCEQ 4F26A 2E5IA 2KT5A 2X1GA 3CCRS 2A3JA 1VBYA 1QM9A 2MYFA 3UWTA 3NMRA 3CCMS 3MURP 1HD0A 3BS9A 2M0GB 3NNAA 1JMTA 5BJRA 5MLCV 4TU8A 1X5TA 3MUVP 2MKSA 5LSOA 4ZKAA 1X4DA 2DITA 4UY8T 5FJ4A 3UCUP 1DBDA 2ZJRQ 3TO8A 2BOPA 4CH0S 3THTA 2MJNA 1WI8A 2MZTA 3CC4S 2D3OR 1VC0A 2RT3A 2J0QD 1UFWA 1X4EA 3CULA 4TU7A 2DNKA 2CQDA 3SDEA 1M90T 2MZJA 4W90B 1X4BA 1VQ8S 3EGZA 4YOEA 4EGLA 1U1RA 1WEZA 3U1LA 3US5A 3I56S 2OTJS 4YUDA 3OW2R 2D9PA 1YJWS 2M52A 4TLQA 1VQPS 2NZ4A 3NNCA 2MKIA 4QPTA 3CC2S 1U1OA 1WELA 1X4AA 2KYXA 1VQ9S 3VAIA 1QVGR 2FC9A 2CPJA 1YITS 4CQ1A 3G71S 1SJFA 4A8XA 1O0PA 1YI2S 2E5GA 1U1NA 5EN1A 5D77A 5HL7Q 4M5DB 2L9WA 2JWNA 1WI6A 2D9OA 1U6BA 4F02A 1WHVA 1FXLA 4WIIA 4W92B 2RQCA 1F9FA 2MPUA 3J7ZT 2CQ1A 3S6EA 4PKDB 1N52B 2LKZA 2KXNB 3HI9A 5GAEU 1X5PA 2CQ0A 3MUMP 3CC7S 1SJ3P 2DNRA 3H2UB 2VOOA 2BZ2A 2I38A 2DHXA 2DNOA 2MXYA 1FJ7A 2JRSA 1S72S 1D8ZA 3FEXB 2OTLS 2LEAA 1H2VZ 5GAGU 2PEHA 2CPFA 3UD4P 4QQBA 3D2WA 2LXIA 1JJ4A 2DH9A 1X4CA 1JJHA 1Q86T 2DHGA 2KM8C 1SJ4P 3ZZZA 2N82B 3ULHA 2E5HA 3R27A 1FO1A 3CTRA 4F25A 5D78A 1KOHA 1NJIT 2G4BA 3BEGB 2LEBA 2ADCA 3VAKA 3CCSS 1M5OC 3P49B 2CPZA 2YH1A 2X1FA 2DH7A 2CQ2A 2JX2A 1SJQA 2U1AA 1VQOS 5LJ5Y 2HGNA 4LJMA 3MOJB 2LA6A 1YIJS 2M70A 2MKHA 3JB9k 2G1DA 3G9CA 2LMIA 3R1LA 3CCLS 4WFNQ 2OIHA 1M5KC 2MZRA 2OSRA 1QVFR 2X1AA 2DNZA 2AD9A 1M5VC 5GAHU 3CD6S 2M8DB 2DB1A 2M4MA 4IUFA 1DHMA 2LYVA 2J76E 1U1MA 1K73T 2N7CA 2UP1A 1VBZA 3MUTP 1B7FA 4Y0FA 3LQVA 2M2BA 2KFYA 1YJNS 2CQGA 2MSSA 3G8TA 2HYIB 3NS5A 2CPHA 2M8HA 1URNA 2ZJPQ 1U1LA 1UAWA 2DIUA 4ERDA 1YWXA 1R8HA 3G4SS 1U1PA 3G6ES 3CMAS 2MSTA 5DM6Q 1K8AT 2OSQA 1P27B 2DO0A 1U2FA 3I55S 3BO4A 2KRBA 4UQTA 2DGUA 1FNXH 5LXYA 1H2TZ 2DIVA 1ZZNA 2AYEA 2MQNA 1VC5A 4BS2A 3G96A 4IOCQ 1WG5A 5DDOC 2E5JA 4YB1P 2F9DA 3PIOQ 2KN4A 5DDPC 1FJCA 2XNRA 2X1BA 5IM0A 4FXWA 2DK2A 1W2BR 2DNNA 3HHNB 1YTYA 2PE8A 2N3LA 1WHXA 2CPDA 2CQ3A 1UP1A 3CCQS 4Y00A 3RW7A 3S01A 2HGMA 1N88A 5CA5A 1PGZA 1G2EA 2HGLA 3DXBA 2CPIA 4C0OC 2MZSA 3P5TL 3ZZYA 1VQ4S 2V94A 3MI7X 3L3CA 1UW4A 5LSLA 2KG0A 3P6YC 2DNPA 1KD1T 2KRRA 2L41A 2OJ3A 3FEYB 2J0SD 3EX7B 3EGNA 2DO4A 1M1KT 2CQHA 1VQKS 1U1KA 4J5OA 3LPYA 2LA4A 5IFMA 2K3KA 3S7RA 2RRAA 2FHOB 5DM7Q 2F9JA 3UCGA 2MZ1A 4P6QA 2KXHA 2CJKA 3G8SA 2L08A 2DHSA 1YHQS 2MQOA 3VAGA 4WKRA 2KI2A 2ERRA 2QEXS 2AYGA 4V19X 1X5SA 1JJ2R 1VQMS 1WHYA 1WEXA 2DGSA 5CYJA
chains in the Genus database with same CATH superfamily
2UUWA 1QAYA 4JBCA 3FSYA 2VQEF 2VDHA 3KDOA 4RNNA 1J5EF 2FPHX 1GXTA 2BABA 4DR4F 4K4XA 2VODA 2DNHA 1SC3B 2EK6A 4H54A 4NXMF 1C4CA 1NK4A 2LXFA 1X8DA 4J9MA 2DNLA 3FFIA 4ZPCA 4MFBA 2M7SA 3VAHA 3DOMB 2D1CA 3HULA 3RBEA 2LVWA 3RZAA 1A7GE 4LFBJ 1RKJA 4OZ1A 4OJ3A 2IPOB 3CPWR 1RT4A 5RUBA 2G0IA 4OJGA 2LQ5A 2BQUA 3VR1A 2HMIA 3HLUA 2E9TA 3PO5A 3NNHA 1FFWB 1HWJA 3CNQP 1HI1A 1TL7B 4ZLPA 3D28A 1FRJA 2C1EB 4MT1A 4NRUA 7AT1B 2C3PA 3DRSA 3MAHA 2AGOA 1U6ZA 3W3SA 4PAAA 1HQ2A 5HK4A 1KLMA 3KFWX 5K14B 2AV5A 4ZIWA 3J7YU 4MH8A 5GMEA 1FX2A 4ZVPB 4DR2F 3R1HA 5I42B 2R7OA 3AD8C 3CT9A 3FMWA 1FNOA 4N8OA 1EKSA 1Q5YA 4IG0A 2XZTB 2V34A 1DFDA 3R2CJ 5L1LA 2JVOA 2FVPA 2B9EA 2R7WA 4DL2A 2BM0A 3CMES 4ZVFA 2JSXA 2ASLA 3BSAA 2XZWA 3M2VB 1SJRA 3IRWP 4BWJA 2G2YA 4HH0A 2CWKA 5EGYA 1GX5A 5DQIA 4NX9A 5H9FK 2EFGA 1IVZA 4YS2A 4M8LA 4X4SA 2EVZA 4WFZA 1JLEA 4OL8A 3R5AA 5B0GA 3WHIA 5ETPA 3NAIA 1QM9A 4DOZA 2YNIA 4BHQA 4YP3A 2ZH2A 4HLBA 4R0JA 4OHXA 3CDBA 1PC4A 2J8SA 1VMBA 2CG4A 1UEKA 2HHUA 4CCHA 3O5TB 3AHPA 4U95A 1C0TA 1X4EA 4DV7F 2CQDA 3SDEA 3IR6B 3ETMA 5B0EA 2J6UA 3US5A 3N01A 3M4XA 1T8EA 1NEEA 2YNFA 1YJWS 1K0VA 3ZFVA 5J2QB 4U8YA 1S99A 5G0RA 4L76A 1JQGA 1O0PA 4RW7B 2J5AA 1LV5A 4V1Ak 1VJWA 2AEMA 1A0OB 4DPTA 4AD6A 3CJKA 2BZ2A 3Q24A 1H2VZ 2C2EA 3KK2A 2DH9A 3C6TA 2EXUA 8ATCB 2B5JA 1FKOB 4WFYA 3THVA 4RW9A 4CO4A 3RB3A 1IWGA 1W2IA 3DXSX 3TZWA 1N5VA 3GMGA 3D9BA 3NP5A 5C2GA 4USJC 4ED6A 5AXNA 3MOJB 2LA6A 4K4SA 3POTA 5A76A 4V19J 4K4ZA 1TKTA 2UP1A 3I0SA 3A1YG 1H72C 4WK3A 3NS5A 3UVJA 2UV8G 4RW4B 2WSEC 3IO1A 1UFLA 3F0NA 1U1PA 4B3TJ 2WVBA 4XDCA 3R6LB 2DGUA 1H2TZ 4NL5A 1RHQB 2KT3A 4RNOA 2IBKA 4F3OA 3DI6B 2VB6A 5GAGI 1HPZA 4HL9A 4HTIA 3I4HX 4Y00A 1KFSA 3VGTA 1NK0A 3BQ0A 2KG0A 4O44A 3MHYA 5A0YA 2PDAA 2XCPA 4F8RA 2WOMA 4U7CA 3IAM9 3OTCA 1SH0A 1RA6A 1MWZA 5D4LA 4C8NA 2W9AA 4H4KC 4DFKA 2HLUA 1S1UA 4YR0A 5LMUJ 3R8YA 4DSFA 2AYGA 4V19X 2R9LA 4O3NA 1U49A 5HSPA 3EUNA 4RWXA 2XSFA 3BKUA 3SCLE 2Y1JA 1QSSA 1DTTA 2OLWA 1AFIA 4Q8FA 2CG8A 3NCQA 3VZHA 3W9IA 2FJXA 4NLTA 3EDQB 3M8QB 5A8WB 4QPXA 4I2PB 4GVLA 1YQHA 1JLFB 3P3DA 3QJJA 3DOLB 4B3SF 1FRLA 4EYHB 2H9ZA 3H5UA 5LT5A 3CF5Q 3K0JA 3WIUA 2HHWA 1F3VA 1BGXT 5E3PA 4DV0J 2CPEA 2QL7B 2YKPA 1TZ0A 5D0HA 3T1YF 3SYZA 2B8QA 3Q8SB 2FHMA 1SC1B 1X5OA 2RQ4A 2HVEA 5A8RA 1XMOF 4Y2MA 3OFEA 3DLEA 1U2RA 1CJTA 5H9EK 3O8WA 2NCKL 2CNLB 1LFPA 1ZTTA 2H3EB 3MM9A 5EWGA 1GXUA 2WBMA 2ZUGA 5E7OB 1S79A 4IQMA 3CCVS 3T5KA 4O3PA 3QMQA 3MAAA 4QJVA 4LSLB 2UXDF 4K4YA 4FXVA 3FCHA 3CO0P 2DGQA 3ENAA 1XR7A 1H2UX 3T1AA 2ZM6F 4O4RA 2Z57B 1FJGF 3IWNC 3SIPB 4KH0B 3BJYA 1NZ8A 2ILYA 1RAOA 2XY7A 4DV6J 2FHJD 1HBUB 2UUCJ 3RW6A 2V8VA 2DGTA 3EMTA 2AX0A 2CYYA 4ZVEA 4TNOA 1BQMB 3KXDA 4JV1A 4ZCLA 4OI6A 2W25A 1GTHA 3F44A 2HHVA 2E5LF 5J2MA 4P2FA 3RRGA 2UVWA 2HAIA 2JL9A 4I2QB 3RR7A 3ZC4A 1BQXA 1XNRJ 1B0PA 1N34F 3EGVA 2WSFC 2WB1D 2AGPA 5AE3A 3C6UA 3Q23A 4NLOA 1RZMA 2EWHA 3BN4A 2J9EA 2MZTA 3AQOA 3GU0A 3LP2A 2RIJA 3Q8YA 2ATLA 4I7FA 4LR9A 2VG5A 2WONA 2YQ1A 3KHGA 4GKKF 3PHTA 3PW4A 3MMCA 4QPTA 3FUYA 2KYXA 3KJVB 1QVGR 3JYTB 6AT1B 1R89A 2HVHA 2E5GA 2L9WA 5A8KA 4W92B 1DAXA 2CQ1A 3HM9A 1TUGB 1F60B 5HJYA 3PM9A 4B3MJ 4WE1B 2DHXA 4JI6J 2HQFA 1FEEA 3NBPA 4YHHF 2LQJA 2KM8C 3OV7A 5L9NA 3Q8UA 4C97A 4X4QA 3KMQA 5AJ3J 3OTOF 5C25A 1DLOB 2BRLA 2FLLA 3CO9A 3BDEA 2XLKA 3W2VA 3HVRA 3MEEB 2OPSB 1FTCA 3QFWA 1N6QA 1LWFB 3QT5A 2WVEA 3G8TA 1UETA 3B78A 3TA0A 2KB2A 4G1PA 1WNEA 5F8JA 1LW2B 1NAQA 1U0HB 1DTQA 2HK2A 2W9CA 1RTDB 3G82A 4M95A 4DV3F 3OVAA 4CLKA 2X1BA 3EVWA 1Y0HA 2EEYA 1Q8KA 3T19A 3PDNA 3HSDA 3CGIA 3RW7A 5HMZA 1IWAA 2C2NA 2XY6A 4ZJLA 4B9UA 5F9LA 1L5UA 1UW4A 3ZXWA 3AXKA 3FEYB 3EX7B 1XNQJ 2B4VA 5KFHA 2QZ8A 4TKTA 2RSQA 3QGPA 2CVEA 4X64F 4TN2A 2GA7A 4Q0BA 2UUBF 4OZ3A 5AXMA 2C22A 1IXKA 2F4FA 4USWA 1ZAWA 4DL7A 1JLQB 1JLBA 3R5BA 1E6YA 4OX8A 3G6XA 2XGPA 2A1BA 5FDLB 2KVIA 1KWMA 1PIEA 2GX8A 2ZE2B 4P9SA 3KDNA 4RBVA 1Y3JA 3H4BA 1V9OA 4QW8A 1HIYA 2UXBF 5L8RC 1N36J 2Q79A 2C2RA 2Y8WA 3BGLA 1U02A 1JXEA 2GHPA 3GR0A 5ETTA 2UZAA 4RX6A 4HVZA 2CA9A 3MMJA 1I94J 4X62J 3CJRA 1SKWA 3QO9B 4C7QA 3Q22A 1VQLS 4RNFA 4DV1F 4DPWA 2HQCA 1OIAA 4FVCA 3A12A 1HYSB 3VGVA 1IKYB 5HP1B 3TUPA 2CQIA 5CCMA 1SL2A 2J7WA 5HVGA 4OI1A 4OV6A 4M5HA 1RADB 1TL4A 2YKNA 4FP9A 1MW7A 2CPXA 1NH7A 4LFAJ 3T6BA 1FESA 3H90A 2RUGA 1NBEB 2I1RA 3PYDA 4NA3A 5LXRA 5HLFB 1VQ6S 1RTHB 1FE0A 1KR4A 1X0FA 2JEGA 3GYGA 2GIFA 4ZVQB 2PFDA 3T9ZA 3CXCR 3TYTA 2J7KA 2W7PA 1Q78A 4TY8B 3GLJA 2R2TA 4CYUA 1WWHA 3G86A 5B08A 3UE2A 2DVIA 4MK9A 1VOMA 3TQ1A 3JQJA 1TP7A 1S7IA 4HHUA 2VG6A 2X3GA 3GV5B 5HMYA 3HHLC 5FIIA 1OY6A 3A8JA 1TV6B 4CLWA 4G1IA 1TKZB 2XMMA 4KFBB 1EP4B 4WTYA 3K8VA 2J8AA 3ZTOA 4PG5A 4ZN3A 2HFSA 3MEGA 2MGZB 2HW3A 3NS6A 3ISNC 3BO3A 4ED2A 2FVQA 1RWNB 3MM5B 2DJWA 4WYLA 2AJ4A 1F2GA 3A3OB 2XNQA 2ILZA 2HHXA 4K4WA 1BUXA 1KBRA 1H7WA 3NKYA 1U24A 2KTQA 2V8PA 2XO6A 1RA7A 3OVSA 4UTGA 3FNNA 1IKWA 2YPYA 3DM2B 3THTA 1TFYA 1R8AA 1GQEA 4B02A 2KJVA 3LH2S 4W90B 1BMQB 4HTJA 4ID5A 1WEZA 4USHA 3W2WA 2OI2A 1J5EJ 3RUBL 4EI2A 1QSYA 1SJFA 4P2MA 2YQ3A 4F02A 2I6WA 4DBQA 3KHHA 3IS9B 3ZTRA 2QMXA 1FEHA 3BGRA 3MMAA 1W7WA 2B7CB 3QFHA 2YNHA 5I3QA 2BACA 2X51A 3D2WA 2LXIA 2XZDB 1FE4A 3HP6A 4F7VA 2DHGA 2J0WA 2VKRA 2HNYA 1ROFA 3TX0A 4F4AA 4PYAA 4CO0A 4L3KA 3U7JA 4ECRA 1NHVA 1GMUA 2W4PA 1D0EA 4FBUA 3IN5A 2KO1A 4C8OA 4M5LA 1GMVA 2EPIA 1T3OA 2OSRA 2DNZA 4QIVA 3MAQA 3M2VA 3GG0A 1WOSA 4Q44A 2NYHA 2ZITA 2CQGA 2MSSA 1X9WA 5IOLA 2FD2A 5KFZA 3HK2A 3K57A 1JLAB 4WWSA 3L9ZA 2JLGA 2XEXA 2P8IA 1CBKA 5T7LB 4P74A 3HT0A 1TUWA 3DRPB 2YX4A 4DX7A 2AU0A 4BWMA 5DDOC 1HQUA 2P5VA 4F67A 1SQEA 2GJIA 3GFHA 1ZA1B 1PGZA 2ZDPA 4C0OC 4EFAC 4N8NA 4X4VA 5KFPA 3NCRA 1RHRB 4NLSA 3PNIA 4Y2CA 3MMBB 4AL6A 2LFVA 3GCXP 1FWLA 1VQKS 2LA4A 5IFMA 3Q0AA 4ZPBA 1LQ9A 1HWLA 2F9JA 1K0TA 2MZ1A 4FNHA 3FZ2A 4EUVA 5DLGA 2B9YA 2GV1A 2DEJA 2RDIA 2YPZA 5KFOA 4RPFA 4UT4A 1LXNA 3SQGB 5CYJA 1RTZA 3UNYA 2QRRA 3DOKA 3MWBA 4C6AA 4UUWA 5K8PA 5KG4A 4JI2F 4DV7J 2VUGA 3KLGA 4RNHA 2W2MP 2CQCA 1ZS6A 4K2XA 1QTMA 2CZ4A 4O4GB 3C15A 1S0NA 3C3LA 5LJ3Y 3C2PA 3BREA 1N5YA 3M8ZA 1F5AA 2N4CA 1EAYC 4DEZA 1XBWA 2PC6A 3TRGA 2OP5A 4R25A 4X4NA 2Y1LB 1XEZA 3TA1A 4AL7A 3BR9A 3CDWA 1X4FA 4BBYA 2EG1A 3DLKB 2ZKTA 4M1KA 4RW6A 2ZBQA 3KK1A 3OTDA 4FPIA 1Z2LA 3TA2A 4DR3F 2E9ZA 2HVZA 3R7SB 1HBNB 1HMVA 1KONA 1WC3A 2OPPA 2ZUAA 1R6YA 2NSCA 5D3GA 3KLHA 5E2QA 4B9MA 1F5CA 1B7YB 2GFFA 1RBLA 3QJPA 1JNRB 1OS5A 4DFJA 4K7QA 1NJZA 4J9OA 4NCBA 2KHDA 1M5PC 3BN7A 2MQLA 1TK0A 1VQ5S 1Q16B 4QR2A 4WBFA 2HAFA 1B3TA 3H25A 4MKBA 4ITSA 1IN0A 4OZLA 2O01C 5I4MA 3GQCA 2W2NP 2XSJB 2H5JB 4C4WA 1JLGB 3D54A 2NUHA 2ZNYA 3H8YA 1VJQA 3HJVA 2QT7A 3MPUB 1ZTWA 2ZC4A 4F4YA 4AL5A 1RXOB 5K5MA 3ZZTA 4DSEA 3OXFA 1XWLA 1RT1B 2AJ1A 1SL0A 1X31C 1E6VB 3ITHA 1UVNA 2CDQA 4PQAA 3S1TA 2Y0SD 3I9ZA 1T9YA 1QD1A 3Q2SC 1HBMB 2KT5A 2FTRA 2IM0A 3MFIA 4P2SA 1JB0C 4P71A 3IM9A 4P52A 2MEWA 1PKUA 2NPFA 1DBDA 4I6YA 4USTA 1YG0A 4ZVOB 4CH0S 2N4DA 4CLLA 4DV4F 2RMLA 1GAOA 4CM0A 2FLPA 2G9OA 3NCPA 3LALA 4DX8H 3NGKA 2CDRB 2MKIA 2OMOA 3MM8B 5C24A 1DJ0A 1CJUA 4X2BA 1B0TA 1F3FA 4Y65A 4WIIA 4AQYF 4DSJA 4H4OA 2VOOA 4ZJQA 1S6QB 4B3SJ 1LWCA 3PV8A 3FEXB 2L9NA 2CWXA 1JJHA 3GB0A 4FS1A 1S9EA 3GIIA 4DWIA 4L73A 1I1GA 1SVDA 5D78A 1KOHA 2ZWOA 2JX2A 3MTJA 3OPKA 3LWMA 1F0XA 1SKUB 2CJ9A 2M70A 4O3QA 3ICLA 2YKMB 1FDDA 2QFIA 4ZPVR 3CCLS 4KGXB 1YK9A 2J6SA 2CZVC 4WU3A 3SI8A 2HNDB 3W9JA 1G4CA 1B64A 2UVUA 4ZVHA 3J7Z5 3HHEA 4ZVRB 4GRSA 3MUTP 2XMUA 5K8OA 1WACA 4LF7F 2KFYA 2PT0A 3W8GA 4JI0J 4MIAA 5HBMA 1ZPWX 1FRIA 2BQ3A 2W9BB 3G6VA 3W8PA 4RBUA 2UXDJ 2CNKB 2DRAA 2VFSA 1C1BB 4GVBA 3KUHA 2UV8A 4WP3A 3CJ5A 3V4IB 1RT5B 4DUYF 1Y10A 3SV3A 2AP6A 1HNIB 2VG7B 4S0MA 1KDNA 3P6YC 2W4DA 1RWPB 2R3VA 1WC4A 3SV4A 1GTEA 4G6VB 2HEKA 4KTQA 2RRAA 1U09A 5J1EB 4IYQA 3OL8A 3V2UC 4CT8A 2BVZA 2LP4A 3OTEA 4NYOA 4PXBA 1NJYA 2QMUB 2BM1A 4WKRA 1QTNB 1TAUA 4WE1A 1NSKL 3HFKA 5ETRA 2Y0BB 1KOOA 1N8RT 3MR2A 3SEOA 3R6GB 1LW0B 4ZP8A 5HROA 2XG8A 3JQKA 2HKEA 3ZO7A 2VH7A 1HNVA 3PW2A 1AW0A 4ED1A 1SQGA 4NWBA 3OJSA 3OHAA 3PXGa 1CVJA 1VLOA 1VK3A 2MHNA 3U1MA 3HO1A 4CRJA 1WG1A 2PMHA 2A2CA 3T9NA 4NCGB 1IBCB 1U2CA 5THWA 4PG8A 1IKVB 2IA6A 1U4BA 4NASA 3BH7B 1HWKA 4PXDA 5L1IA 4P10A 4G65A 2G2OA 1R7IA 2YX1A 3IRXA 1Q79A 4YHHJ 1Y5NB 5EX0A 4Z2XA 2FGCA 2CNNB 1NKBA 2XMJA 1OMSA 3E8OA 4DMZA 4JI5F 1QAJA 4MAKA 3HD1A 3C14B 2DCLA 1S10A 2KZZA 2MKJA 3MCNA 3KLVA 2DR7A 4NLDA 2DGXA 4DL3A 1K47A 4KQZA 2GGPA 3PX4A 4JV2A 5KFBA 3O2IA 1N5SA 5CD4H 3B4DA 2IFXA 3GV7B 4LFBF 2DNYA 2A0FB 1I51B 4OHYA 4CLZA 5C7PA 4NLYA 1RAIB 1RT3B 3KK3A 5KFIA 4HHHA 4CIOA 2BJ3A 1TKXA 4OI3A 1NU4A 2NUUG 1S7HA 3IGNA 2YY3A 2XLIA 1N54B 4DZ6A 3E01A 3CCZA 2VONA 2J9DA 1APSA 2FZGB 5A2QU 2H4YB 2HS4A 3PR4A 4DF4A 2AMCB 2V50A 2CPYA 5GADU 4DDFA 4DV3J 1KS2A 4WF9Q 4Y6IA 1KTQA 4DPYA 3FFIB 3HX9A 1KRPA 1TK8A 4MFBB 5L9XA 2XC9A 2ZBPA 4NLVA 1VBXA 3RBZA 3JSMA 3FK4A 4PWDB 2OPRA 3SFGA 2A3JA 2ROGA 2EFQA 4HDGA 5F41A 5A6PA 3BS9A 1RAFB 3OR2A 3NNAA 4X64J 1YRTA 2BBEA 4NXNF 1RT4B 2FY8A 3M8RA 4U6PA 3WBZA 4EMDA 1OQ6A 5J1NA 2HMIB 2QLFB 2YKOA 3ENWA 4EGLA 3C16A 3R9LA 2M52A 2NZ4A 3EZ5A 2QA1A 2GW8A 1RT6A 1NH8A 3DRSB 2ZOFA 3G71S 2UXBJ 2I9SA 2PD1A 3BBCA 1KLMB 2O1PA 5CABA 4JB8B 1YVFA 1CJKA 4LRCA 4M5GA 3D67A 5KFSA 4R5PA 4C48A 5IV3A 4OMFG 2DNOA 2WZ1A 1CQMA 1YJTA 4IG0B 4WU2A 1T05A 1SV5A 3ZTPA 3BPSP 4DXLA 2V2QA 2BX6A 3SFUA 1P1LA 1RYSA 2BEFA 2HS3A 2R42A 3TUZC 3CCSS 4Q7AA 3RRKA 4K4UA 2YQ0A 2L48A 1WSVA 1I3OB 2WVFA 1U25A 1C4AA 2M4MA 1YBTA 3V6DA 3A13A 4ED7A 4LR7A 2HBRB 1B7FA 3PRDA 1BHNA 2YNIB 3LPEA 2CPHA 1S4EA 4A8WA 1R8HA 1X9SA 1ZAXA 4ANCA 2GC8A 4ATNA 3G87A 3I55S 4LF4J 1R43A 2H48B 4AUKA 4KO0B 1DARA 5B0DA 1C0TB 3BGUA 2MQNA 1VC5A 1WG5A 4ZPAA 3PIOQ 3TWZA 2HQ3A 2DK2A 2YNFB 2NXNA 4UW2A 3RB0A 2N3LA 2Z56B 1IQZA 5G0RB 1CG2A 1VR6A 5CA5A 4P7VA 3CWJA 2HBQB 2CPIA 5M2PA 3EDRB 4ZPDA 4FF4A 3UNGC 3NY0A 2OPQA 4Y28C 1V3ZA 3RJMB 3CJKB 4GKJJ 3N5BA 1TL3A 4L3NA 2DPJA 2K3KA 3LP1A 2FHOB 3WC2A 3DMJA 2Y1IA 3ADAC 5IWAJ 3KK2B 3AY0A 4GO5X 3C6TB 3IR7B 2B5JB 5T41A 4RW9B 2RKIA 3SBMA 1VQMS 1VRUA 3ZZ0A 3BKTA 1RT7A 4FYDA 3IWXA 2XMWA 3AA9A 3CW2C 4HT5A 3SXLA 3NAHA 3AOCA 4JV5F 3POTB 1F1BB 2QA4G 2HHQA 2YKAA 2QMWA 4U67Q 5D0RA 4QIWD 3CDAA 1TKTB 3I0SB 5KFAA 4DG1A 4DUTA 3VF0B 3UVJB 4LF5J 2Z30B 4PXEA 3GZ7A 3QRQA 3UQSA 2Q6CA 3CCES 5LMUF 2YH0A 1N5TA 5GMDA 2COLA 3MD3A 3TZZA 2NSBA 2EBEA 3CJ8A 1HL6A 4TVAB 2VV5A 4EYIB 1B70B 3EVOA 1HPZB 1OJ4A 5DRKA 1T9WA 1FTRA 4FPRA 2EK1A 4EZ6A 1UJ5A 2E7WA 4ALZA 5KFGA 3Q2TC 1UCNA 3L95X 1KKHA 1L3KA 4BC9A 5A0YB 3T5JA 4ECQA 1XMQF 2MQQA 2JLEA 3N28A 1V5VA 2WOMB 4RWWA 2RS8A 2AEJA 3D1QA 3MEDB 4USIA 2F5GA 4UOFA 4C8ZA 3LWLA 2Y9HA 3CJTA 1PYTA 1S1UB 2P9GA 2H1YA 2UUTA 2QFJA 1RHKB 2C42A 4IDKA 3D6FB 1RQ0A 4DCPB 4X4OA 2XI3A 4K0KF 5HO4A 4ENOA 2K1RA 3DYAA 3R5DA 2CFXA 2WBRA 2A18A 2QSWA 3VGUA 4DR1J 1DTTB 3EGWB 4PUOA 4IRCA 4DL6A 4A4JA 1FWKA 4RU2A 3AH6A 2K8GA 5DGBA 2HRUA 1DQ9A 4YMEA 5KFVA 4WFBQ 1VIOA 1S1WA 1KQSR 4C8LA 4TLRA 4ANDA 2WAQD 1Y3KA 2FQQB 2AEFA 5JVGQ 4F26A 1HHSA 4M5IA 3UWTA 2ZEJA 4OYBA 1UZDA 3W65A 3K59A 1H0HB 3IWLA 2ZJRQ 4DF8A 3W60A 1VC0A 1ZPVA 4DV6F 2UUCF 4TU7A 4KHRA 5A8RB 3QZ7A 3DLEB 2EFVA 1CJTB 3M30A 1Q4RA 1UA0A 2HHTA 2QYCA 2HFOA 2V69A 2RHQB 2ZH1A 2R7XA 2OELA 2FC9A 3HSGA 4JI2J 3MM9B 3ZZRA 2A6OA 1NDKA 3GYXB 3EZOA 4OV1A 2RQCA 3EZUA 1D9DA 3MAAB 4O0NA 4LBHA 5GAEU 4O3RA 5LM7E 4DLGA 1T7PA 3GJRB 1D8ZA 2OTLS 2LEAA 4DQRA 3HHKA 4OX6A 4NI2A 3Q89A 3K5LA 2FYXA 1UTAA 2R4FA 3FGVA 2RDDA 4KR0B 1UVKA 2JC0A 3GSIA 2XYPB 2K7KA 2RU9A 4Z37A 2ZOMA 4HI2A 2OD4A 2G1DA 3AXMA 2FJDB 2AKWB 4FKXA 5J2MB 3K5OA 1RLCL 1JXLA 1WC0A 1VHFA 4DR3J 3JS9A 3CD6S 2I8EA 3HCXA 4MIBA 2N7CA 4E8UA 2HWIA 1RT1A 4B3MF 2PMWA 4JI6F 2M8HA 2R7TA 4FF3A 3C6UB 1XC9A 4B9SA 2OSQA 1HBMA 1U2FA 1VRTA 3LP2B 4QR1A 4I7FB 2KFNA 2RF2A 3AFGA 2VG5B 2WONB 3I87A 5AJ3F 2W01A 5IM0A 1OYDA 1OSCA 5AT1B 1NRKA 1ELOA 3MMCB 1T11A 5D4OA 3ZZOA 3L7OA 1G2EA 4EK2A 1S6OA 5KOXA 4QYRA 2PI4A 1RKIA 5A8KB 1T03A 4ER8A 5KFWA 1CEZA 2DR9A 4B9VA 2RRNA 4LREA 4F2SA 4XPEA 4XDDA 1HNXF 2FGOA 4USUA 4G3IA 3NBPB 3TOQA 3LTOA 3MZIA 5KFKA 3NEKA 2QEXS 4OYWA 2BXJA 2AJ0A 2YNGA 3PW5A 2CRLA 1S6PA 4QIEA 4P75A 2YWHA 4MKYA 4WZMA 4OZ0A 3H2VE 2FY1A 1WF1A 5C25B 4UZCA 5DG7A 4B9TA 2E7XA 1YJ7A 1MSWD 4U7UD 1H3DA 1HFEL 3G2XA 3W2VB 5DDQC 3GE9A 1RK8A 4TYAA 4ICLA 1XNQF 1N6QB 3FRZA 1FI4A 4QZVB 5L38A 2F7VA 4J37A 1SB6A 2EFPA 3OHBA 2F4VJ 4U7UK 2M88A 4CLFA 4N5SA 1PO6A 4AQYJ 1HLWA 1QAXA 4K4VA 4BLGA 2AF6A 1DTQB 1VHIA 2W9CB 3PKYA 3G82B 1BXNA 4UF4A 3D3BJ 3UDEA 3SSQA 2NXEA 2RNEA 1N36F 3DLLQ 1N5QA 4OHZA 3LANA 3FZBA 2KH9A 3K5MA 4OFZA 2B6AA 2QG9B 2I5JA 4A47A 2Z2LA 2PMZD 3MM6A 2QL5B 1HNIA 1AROP 2E1PA 1FRXA 1CJVA 4LF8J 2YTCA 4Q0BB 1SL1A 4FKYA 2F8HA 4LF7J 5HANA 1RP5A 1PAEX 2WVDA 4OYIA 1VK8A 1AUSL 1JLBB 1X60A 1IKXA 1WTBA 5HATA 1E6YB 4XIUA 2GZOA 3ISZA 1FD8A 4DV2J 2Z4PA 1UA1A 4ETXA 3TP2A 5HQMA 5AXLA 2X3DA 4P7TA 4LIRA 3TAPA 6FD1A 1ZZFA 4Z7YA 4A48A 3WX8A 5ETLA 4QU7A 4IRKA 4EEYA 4X4TA 1HHQA 5LMNF 4CO2A 4F4XA 2MKKA 3A8EA 3TX8A 3GIRA 2B3TB 3MURP 3EVMA 4Y3CA 3GIKA 4RZRA 2FDNA 1KEKA 1AZSA 3MUVP 2MKSA 1R27B 3HSJA 4KE5A 2YKNB 2CJAA 4OYAA 2MZJA 4X4UA 1V5IB 2VFRA 4JI4J 4GC7A 2W7OA 3PFOA 1QJHA 2LQ9A 3MF5A 2CPJA 4WJBA 1GXLA 4A8XA 2F8EX 4I4BA 4IQXA 1WI6A 3W1YC 3ZTSA 3J7ZT 2IJNA 4CYUB 1N52B 3R97A 4ECVA 4FF2A 3VVTA 4DN0A 2AWZA 1EARA 5J2NA 1S59A 3UFCX 1FJ7A 4ZCKA 2QO3A 2VG6B 1TVRA 2Z0GA 4QQBA 4HDHA 3P45B 1RT3A 2P2CB 2JEJA 4LSZB 3TZYA 2I0XA 5EWEA 3M8WA 1PBUA 1S57A 1H38A 1KQFB 4WP9A 3GJTB 1VCTA 2G4BA 3IM8A 1M5OC 2YH1A 3MEGB 2O66A 1GNKA 4LJMA 3TVZA 1ULRA 1TR0A 2OMLA 4FYWB 4JI5J 1RDRA 3BGOP 4ILLA 2W1BA 1RISA 3CDUA 5KOWA 3DGPA 5B0BA 5E5NA 1NPRA 2HQDA 2GIRA 1IKWB 4PWDA 1X9MA 3H5XA 4OLPA 4BS2A 2C3MA 2Q1LA 3HXMA 1GT8A 2ZHAA 4ID5B 4E2FB 3W2WB 4DL4A 2PE8A 1S49A 3NOCA 3PRBA 1UJ4A 3S01A 4CI0B 3RG6A 4J9NA 2MZSA 1IR2A 5GADI 3MI7X 5LSLA 3FQLA 4CO1A 4I68A 1KD1T 3NOGA 1QUPA 1TL1A 1YJRA 2J0SD 4UZBA 3RBXA 1JKHA 3BGRB 3MMAB 4C0HA 2KVQE 3I4PA 2IM3A 1DY3A 3M8PA 2YNHB 2BE2B 3VZIA 2MQOA 1SIWB 1KVIA 2VDIA 1T9TA 2HNYB 1GFWB 1X5SA 4ZP6A 4QWDA 1M5SA 4DCJB 1WEXA 3FCVA 4OX9J 3M9NB 4DHVA 4KT0C 5KFNA 4EZ9A 3V81A 4NXNJ 1W26A 4YY3J 2AZ1A 4KKOA 3M6WA 3KMSA 3UI3A 5ETSA 1R8PA 3O44A 1HI0P 5SZTA 3O3LA 1D3WA 4HYKA 5IS2A 2ZBIA 4RLEA 3J81U 3VAFA 3K58A 2YWWA 1SXLA 3QYYA 4E98A 4WPAA 1FDAA 2W4CA 1RLDA 3KLIA 1KN6A 5DDRC 1UKUA 1CS4A 2H54B 1R8BA 3T3FA 5L39A 3VCDA 5IT9U 2J7UA 4DI6A 2ACYA 1Y5LB 2DCUB 3IBWA 1F5BA 1HQUB 2MB0B 2JEFA 4CWBA 1R0AA 4KO0A 1S1VA 3LGNA 2A10A 1RHUB 1SQFA 1UWBA 2DRBA 3IAS9 2R2SA 1MN7A 3C46A 5HVHA 2DTJA 1F9EB 5KAKA 1NSPA 2BYCA 2B8PA 1MROA 1VQ7S 3FEZA 4ZIVA 1FRMA 3PZPA 2CQPA 1FRKA 3THPA 2R8HA 4F3MA 3OJUA 4F3QA 2GJ2A 2Z58B 3DOKB 3GIJA 2B56A 1L3UA 3EJMA 2B51A 3PYFA 5IT9Y 3KLGB 2CXEA 3M05A 1WOOA 2MKCA 4PWUA 3C15B 1N5YB 2EC0A 2MY7A 2XS7A 5GVQA 2BJ8A 3T1HJ 2FHKA 1M1HA 5D0GA 3J81j 3F73A 4KPYA 2W7AA 4KYZA 4ZK7M 3D4JA 2MYFA 1YKWA 3TJ8A 4A8KA 1O8BA 1UPMB 5MLCV 4TU8A 5KT2A 4UY8T 2ZH3A 3OVBA 3TO8A 4RW6B 3KK1B 1J5OA 3RB4A 1UFWA 3TUIC 3EXYA 3GPAA 4LFCJ 4N77A 3HDSA 4UOGA 5IZHA 1RWWB 3BQ2A 3M32A 1HMVB 2RUSA 3L7UA 3M7VA 2OPPB 4JV5J 1O5JA 3A3NB 4MYUA 5D3GB 2KDOA 3KLHB 4DS5A 3TAMA 3PHEA 1WTFA 1F9FA 3H5YA 1Q8IA 3I5BA 5DZ7A 2ABYA 1SH2A 1SJ3P 2DNRA 1Q95G 1U7LA 1SC6A 1V3SA 1DQAA 3TEHB 3K17A 5GAGU 3MEDA 3UD4P 3I6PA 1PG5B 3DLJA 3TEGA 1P9YA 4TQSA 4F25A 1UWAA 4RUCA 3H42A 1TAQA 4TYBA 4KC5A 2CAJA 4ZHRB 4X4RA 2DRDA 4LSNA 2LQ8A 1QVFR 3UN3A 3U27A 1RU1A 5GAHU 2W8KA 3R5GA 3ITHB 3QGIA 2BE9B 4XTTA 1Y00A 2HRYA 2ZH6A 4ED3A 3OFGA 1K73T 4CLPA 1RAJA 3LQVA 2D74B 2DEIA 1YJNS 1XMQJ 4PABA 1U1LA 5FLXU 4IH5A 2PI5A 1I6JA 3W61A 4F0HA 3QAEA 9ATCB 3H7HB 4MKVA 1N32J 1UJ6A 1P27B 2GIQA 3PEJA 2IHR1 3GSDA 2IBOA 3N6MA 1PJ5A 5KG1A 2C2DA 4ZPTR 5KFUA 4O3OA 4CLSA 3CE8A 5DDPC 4P73A 1ZOTA 1QUVA 4K0KJ 1UFKA 2OGUA 3IBCB 5C24B 1UP1A 4USMA 2HGLA 1VFJA 4X65J 1CJUB 3OUYA 1XMBA 3AAWB 1RE1B 4NYZA 2DNPA 3NMAA 4WTOB 2OJ3A 2E1RA 1NHUA 3EGNA 4LVOP 5AE2A 4JI0F 4KAIA 5IT4A 4H4OB 5F3ZA 1C0UA 3RAMA 2A6MA 1LWCB 4YN3B 2XQCA 1UMJA 4B08A 1S9EB 2WRMA 1NK8A 3V6HA 5FLXY 2WW4A 1C1CA 3SZ2A 1NK6A 2GVZA 2MZQA 4YB6A 5CZVA 3M2UA 3RAQA 3D6MB 5E33A 2JVRA 2VIHA 4R0EA 2DKOB 1YGYA 3HZGA 2HBYB 1R31A 5DETA 1L3SA 2V63A 4DPXA 2AJQA 1B99A 3QWPA 2HNZA 1WF2A 3CCTA 3GFXA 5C42A 3M6VA 1KHWA 5HBMB 2V5HG 5IT0A 1Y9OA 1SKSA 4UOCA 1JNZB 3TUJC 4DQQA 5GAEI 3MECA 2GHWA 3NGTA 5LL6d 2NZCA 1D9AA 2G0JA 4GVBB 1W25A 1JLCA 3O6QA 2KXFA 2RRBA 3Q83A 2JDJA 4B3RF 5KT3A 4ILRA 4P72A 1YDLA 2NLWA 1SC4B 4H4KA 3B4MA 3M1VA 1LFWA 3BYPA 1Z1ZA 4YB5A 1G3OA 2NXUA 3BSCA 4NLXA 4IO9Q 2EC2A 2ASJA 3TVYA 4EO8A 2Q6BA 3JSYA 4N7TA 2V4RA 4LRFA 2F8MA 1YZ6A 1YJ9S 4WZQA 1S12A 3B54A 1ZM9A 1YBAA 2E1CA 3GTYX 2OEJA 4CH1A 1JX4A 5A6WA 5F8LA 2AJFE 3C66A 1Q8LA 3D0HE 2XLJA 5HROB 4OZJA 1OSDA 2HIYA 1HNVB 4QU6A 2Z2YB 2VA3A 1XJWB 1IBKJ 5GMKa 1X4HA 3ETOA 5IQ6A 2QTWA 1FHTA 3H2LA 3KLFA 2HQGA 2YWGA 4G1QA 2R2RA 3PX6A 1ZH5A 2XWYA 3T41A 2IMWP 4WCEQ 3CCRS 1VBYA 4XPCA 1VDHA 1HD0A 2M0GB 1HNXJ 2GVDA 3GIMA 3IRXB 2IC3A 2BOPA 1UL3A 2VFUA 3MPWA 2D3OR 4CM2A 1S76D 5KFMA 3HJFA 4KRWA 1VQ8S 4DCOB 5KFDA 2OTJS 4YUDA 3O1LA 2OUGA 4C3KA 3DRRA 2GGPB 1YI2S 5D77A 5DQHA 4UUXA 4IR1A 3D7SB 2KXNB 1NPKA 1DQ8A 4R8UA 1AT1B 2CJXB 3KK3B 4I6WA 1LNQA 1TKXB 2I38A 4K59A 4IRDA 2BKNA 4QWAA 4URSA 3QT8A 1JJ4A 3E01B 2OAUA 3H40A 5ADZA 4IG3A 1WD6A 2DR8A 1FO1A 3HMJG 1RU2A 2NR0A 3PJWA 5CYMA 1FF2A 4N47A 1OYEA 4DPUA 2FVSA 5JXSA 4X84A 3OTBA 1SIZA 4Q43A 3LF0A 2HURA 4RU9A 2LDYA 2LMIA 2Q3PA 3MGJA 4BC7A 2MZRA 4B9LA 4WFXA 2M8DB 3PW7A 1DHMA 4ZA1A 2IVMA 2VF3A 2WTFA 4O3SA 3JSMB 3KG0A 4Y0FA 5JUMA 2M2BA 4HACA 2OPRB 2V4JA 3D6HB 1WORA 3KKFA 2ZJPQ 3IG1A 3T5HA 4ANEA 2ZH7A 3OR2B 2MSTA 2ZKUA 5ETMA 1WDTA 1L3VA 5HJXA 3J7AN 2ZVSA 3AT1B 5F8MA 1ZZNA 4CTAA 2E5JA 3C16B 3QNWB 4XAKA 2JJ4D 2FUG9 1RT6B 4Y2KA 1MNEA 4RW8A 4U9RA 1IR1A 3HKZD 2V94A 1CJKB 1VQYA 2HFZA 4DSKA 4R5PB 1U1KA 1OPZA 4LBPA 3CJ3A 3ZNJ1 4P6QA 1T05B 2IAJA 1SV5B 5LMNJ 3HVTA 2YVSA 3MTKA 4LF4F 2BW2A 2CKWA 4ZMMA 2O67A 5SUHA 4AFFA 1WEYA 4QIFA 2B0GA 2QLJB 1EKRA 1ACMB 3GWCA 3IC1A 4CZCA 2C2OB 4WXOA 4MKAA 3KNAA 3PCOB 4J9RA 4YDDB 1HKAA 5L1JA 3AA8A 1WDDA 5HVFA 4NCAA 3J7A1 2MY8A 2ZC3A 2R8JA 1KP6A 3V6DB 5EWFA 1LXJA 3FSXA 4QCLA 1H7XA 4ED8A 4GKJF 2KJWA 3MDFA 2V4QA 3BSNA 2RILA 4DV5F 5IWAF 3EM1A 1HW9A 2DGVA 5CCLA 4NYPA 4PZVA 1HARA 2D3UA 1EJ7L 1ZAVA 3BH6B 1QE1A 4DFMA 3JQMA 4KH1B 2O5DA 1FD2A 3IMQJ 1VQNS 2VOPA 3CD5A 1BWEA 4WXWA 2QA2A 1P6TA 4W98A 4IFVA 2WHOA 2BANA 5IC6B 5D4PA 1D1UA 2OPQB 3LA0A 4RKUC 4LF5F 1TL3B 3RU0A 1BD6A 3LP1B 3DMJB 3NL0A 3QWUA 3S8SA 1UEVA 5K9FA 1NB2A 4ES3A 1D8YA 5EX3A 1U8WA 4B9NA 4NZ6A 1SBRA 1LWEB 2RKIB 2LU1A 1VRUB 1PSDA 1XN9A 2BE2A 1RT7B 4LIWA 2I2YA 2H51B 2XHCA 3DU6A 4CDIA 2J6TA 2RDJA 4J9QA 1ITPA 4TQRA 1RWVB 3RTVA 2WW8A 4WKYA 4MMOA 1FA0A 3KNGA 3OR1A 5KT4A 2QLXA 2YKQA 2NREA 1UVLA 1OO0B 1NDCA 5IV4A 1GMWD 3G6YA 4GMKA 4DG1B 2AYMA 2KYZA 4ZOSA 1MWQA 3I9V9 5IQQA 1S1TA 3GYNA 4Z7CA 3OQ2A 3UR0A 5D4NA 4URQU 2CJYB 2LLZA 1R0BG 1FKAF 2HWTA 1T9UA 1U45A 4I56A 5KT6A 2ZBCA 1CULA 3J7YI 3UPFA 2FJBB 4OHVA 1XERA 4DR1F 4OYOA 3M2RB 2VFTA 4I69A 1U1RA 4J9VA 3U1LA 2XTJP 3OW2R 4JI3J 3OLAA 4CLTA 3BPDA 2N7YA 3CC2S 1VQ9S 2XY5A 4K5SA 4NMLA 4ZITA 3NS7B 3HHLA 1SUQA 2LKZA 2AJ2A 2CQ0A 1TU0B 4LQ3A 3CC7S 3HVWA 2P9EA 3NGUA 3JTPA 3D1HA 4IDKB 4PWWA 2XBPA 1RTIA 3HSZA 2K1RB 3DYAB 3PACA 3R27A 3H4DA 1D9FA 1KNZA 3UDCA 2ADCA 4PUOB 1TMMA 1BC6A 2X1FA 3VTIA 2IYGA 2FJWA 3DFEA 1S1WB 2QIFA 2X1AA 2ZH9A 1M5VC 3DRYA 4NLPA 3C8YA 2ZD1A 2E9RX 2HYIB 2UVVA 1AA1B 1M0SA 2DIUA 3NWGA 5KT5A 3DHWC 2UUAF 2UXCF 1NXIA 1LK5A 1HBOA 3H0PA 1RAEB 3M30B 4WP8A 3M9MB 5KFCA 1WKLA 4FXWA 5KFEA 1WKKA 3GONA 2CPDA 2CQ3A 3DLGA 3GCWP 5K20B 5DQGA 2B4UA 1JIHA 1B4SA 3ET6A 1HW8A 4FNIA 2V6AA 4YB7A 1N33F 3LPYA 2X7IA 1RWUA 5CH7B 3G8SA 4NI2B 4O0IA 3QJLA 1MMNA 4YR3A 2ERRA 3MM7A 1KVJA 4ECTA 2DXFA 2FVRA 2MLXA 3ILIA 5ETKA 2MQMA 4TY9A 4C11A 5KT7A 1H98A 3PFEA 1MU2B 4UQGA 3HFVA 2ALZA 3LOUA 4ZHRA 5KFQA 4A8FA 1F9HA 3R7NB 3CMQA 3PVXA 4ED5A 5I3UA 3UD3P 3TR5A 4ZDNA 2IRUA 3W7BA 4ZCIA 2CIMA 4PG4A 1BE4A 2V2VA 2WSCC 4OI2A 1RHMB 3RR8A 2QV6A 2LECA 2FJEB 1IJFB 1VLYA 1MLAA 3HZEA 5CYQA 4C0BA 1HQEB 1JWWA 1VRTB 2MJUA 3ENQA 2RF2B 4Q8EA 2VZ9A 4OHWA 2FC8A 5IM0B 4RUAA 4NOHA 4WFAQ 3WIVA 2RAQA 2RE1A 3VAMA 1D09B 2VJUA 4DN9A 2RU3A 3OLBA 4ECSA 1WF0A 4F2RA 1T03B 5CZXA 2V2ZA 2DISA 1R6VA 2F4VF 3P5BP 3HFZB 4KJIA 5I3PA 5GAHI 4KV8A 2ZH5A 3NLCA 4H4MA 4D3GA 2C3YA 2HHHF 2HPUA 3Q8QB 4ZLJA 5F0UA 3PX0A 3LO3A 2VPYB 1S9GA 1Q7LB 4DZDA 2YNGB 3QSIA 1BQNA 1NM2A 3MOZA 1NSAA 2LXUA 3EPGA 4EBCA 1S6PB 3Q8RB 5LSRA 2EG2A 1WG4A 3MPYA 1VC6A 4M94A 3BO2A 2C3OA 4DQPA 3PIPQ 2J9DE 3SSRA 1RGVA 2RS2A 1REVA 1NKEA 1S1XB 4ICLB 2ROPA 3D0GE 4QYZJ 3A4TA 4LF8F 1N0VC 4FF1A 4QBUA 3AQPA 3MR7A 3N6NA 1T0TV 2XS5A 4KBIA 3M9OB 4M5NA 2Z8QA 1NDLA 4RR5A 5C5JA 3OT9A 4NLGA 4DV2F 2GQ2A 2LQBA 3CC4S 2QL9B 2J0QD 5D6GA 2CADA 1UPPA 3EGZA 1I5OB 3M6UA 1PCAA 2B6AB 2I5JB 1TFWA 4U8VA 3MM6B 4JOUA 3QATA 5EN1A 2YBVA 1CJVB 3KJFB 1U0SA 1WHVA 1LEOA 1K44A 2KT2A 3MUMP 4LF9F 2JRSA 3CJSA 2ZHBA 1IKXB 4NMXA 1Z2ZA 3AD7C 1Q86T 1KSPA 2FIUA 4NEYA 3ZZZA 3ULHA 4NEZA 5J2PA 5D0EA 1NZAA 2CZ9A 8RUCA 4JP8A 3B82A 2LEBA 4JI4F 2RH3A 2XMKA 2B9XA 2H5IB 1S9FA 2NXJA 4NLUA 1RT2A 1SJQA 3OD2A 5B0AA 2GQQA 1K1QA 1M5KC 2VBYA 4B3RJ 3EXCX 2VKZG 2DB1A 3QRPA 1G1XA 4LF2A 1HNZJ 2WCXA 5AE1A 2JH3A 3KLEA 3FQKA 1URNA 2EI5A 4EU0A 1JXVA 2W2PP 1AZSB 4BCAA 2XYGB 5DM6Q 2B7BB 1FNXH 2AYEA 3VV2B 5HN0A 4QWEA 4ZLLA 2KN4A 1W2BR 2FJAB 1QY7A 1KVKA 4J7CA 1WHXA 2PFFB 2EW9A 3GILA 4M5MA 1T95A 2ATCB 9RUBA 2ZZTA 2POKA 4KB7A 1R0CB 4RL1A 4B3OA 1NMEB 5J2NB 3CIZA 1Y11A 2V8DA 1T9XA 2V8HA 4U96A 2DD8S 2W24A 1TVRB 1RWKB 1FK9B 4IFYA 1RBOB 2K7JA 3IR5B 3N4WA 3QLHA 3QIDA 4IOCQ 2E1AA 1EETA 1AUDA 4ILMA 2ADBA 4N41A 1L3TA 4PR6A 4ECWA 4ECUA 1KC8T 3V4MA 4AT1B 2KG1A 2HFUA 1FKPA 4JV0A 1YLXA 2QX0A 3DGVA 2RVJA 2N3OA 1DURA 2VL1A 3CCUS 5E3QA 5KFJA 3LP0A 4CLYA 4NA2A 2XMVA 3DGPB 2R2UA 3P8BB 3PO4A 3DDIA 2MTLA 2HS0A 2GMJA 3BZQA 4PQUA 3FBEA 2OO4A 5EDWA 4DR6J 1K9MT 4KGMA 4OX9F 2JC1A 3HVAA 1VIXA 3D0IE 4YY3F 2H5EA 1ICEB 2B4OA 3PYGA 1CPZA 3QSYB 3CD0A 2UVRA 5F8IA 2ZDOA 4OX7A 3UN2A 5DGAA 3L4BC 2BR0A 6FDRA 1YBUA 4PG6A 3D3CJ 5HQ8A 1WOPA 2BJ9A 1RTJA 5A2QY 2CVIA 1TL1B 2IDEA 2C2ZB 2YWKA 4J91A 1JKHB 2GQCA 3CEDA 4M5DA 4IOAQ 3I0RA 2YWFA 3M8PB 4KY3A 1FJEB 1P1TA 2JOQA 4FYYB 3FCWA 3Q86A 1IJEB 2XS2A 1IBMJ 4I6AA 3V81B 4IR9A 3MR6A 3CUNA 4KKOB 5G4DA 3OL7A 5K8NA 2G13A 2GO9A 4K50A 4KHPF 2ZBRA 3MR5A 1FRHA 2ZFHA 3R7BB 1YX2A 1AYEA 1HA1A 2AIRB 4X66F 2LCWA 3GR1A 3I5AA 3GFYA 4PYDA 3KLIB 7FD1A 3BV8A 4HR2A 4QOTA 3KUGA 1CS4B 4DR5J 1LOUA 4KGVB 4FBTA 2W2OP 1X4DA 2B43A 4F0MA 1VBKA 5L1KA 4J9LA 1R0AB 1S0MA 1S1VB 1M90T 1RJJA 2EKNA 5F8NA 1U8SA 4TXSA 3I56S 1UWBB 4XO0A 5B0CA 1VS3A 1RAAB 4L72B 5KG3A 2VICA 4CQ1A 5FD1A 3W64A 2AHOB 3JAMU 3T1HF 2JWNA 3A8KA 5DG8A 3D66A 1IBLF 1FXLA 1MROB 4PXCA 1M1GA 1S77D 3HI9A 1TTHB 2XGQA 4I1TA 2MXYA 3K5NA 3A3PB 2CPFA 4DV5J 3DKDA 5CAAA 1WUUA 2D3ZA 5KFLA 1U48A 4LFCF 1LWEA 2VC0A 1NJIT 2V0NA 1Q5VA 1VQOS 2OHDA 5LJ5Y 3UW1A 1YIJS 2ZZNA 5F8GA 2OIHA 4LRAA 5L46A 1LWXA 4AE5A 5BR8J 4IUFA 1NPPA 3H98A 2IY5B 5T14A 1YRUA 4JI7F 4ZS6A 2GJFA 2VPWB 3JAMY 1MG7A 3DOMA 2F63A 3P96A 2KFZA 3PG9A 2RD5C 3MPVA 5F0WA 2DO0A 3N0VA 4KPCA 3BO4A 3OL6A 2KRBA 3MEKA 1WKJA 4DR7F 3W66A 4DX6A 5LXYA 1FXDA 1J5OB 4JYAF 4RJVA 4NLQA 3QGHA 4YB1P 3NRBA 2VQEJ 3M32B 3OXLA 2D41A 4DR4J 3M2RA 4K5RA 2HBZB 4PG7A 3RB6A 2HZVA 3OFHA 1XIQA 3TAQA 4O23A 3P5TL 2LU2A 1TL7A 3TAMB 1GEHA 4NXMJ 2A2DA 1UVMA 2DO4A 4QWCA 5BYSA 5JJBA 2F65A 4LT6A 3GG1A 5K14A 3TARA 1NK7A 1N32F 2KXHA 2MLZA 2DHSA 5I42A 1XQIA 2PA8D 3TJAA 2KI2A 4GC6A 5KFXA 3PJXA 1N48A 4MK8A 3HD2A 2C28A 1NJXA 3ILLA 3PEHA 2KL8A 2MMYA 1CSJA 3BSOA 1REGX 2PIIA 3DDKA 4LSNB 4OJHA 4X65F 2CQBA 1FNMA 2JHEA 2VA2A 2BMBA 3EPIA 5H1SV 2KHCA 4OZNA 2VQFF 4D3HA 3CJ2A 3M8SA 4JI8F 2V9WA 5ETNA 2K06A 2KU7A 3QIPB 1OWXA 2Q66A 4K4TA 4DR2J 1EQMA 5ITHA 5DO2A 3JSBA 2GHVC 2UU9F 1FERA 1Q1KA 2BJDA 1NHKL 3MD1A 1MMDA 4RBTA 2P9CA 1ZBTA 2CUYA 2HZAA 4M5KA 4NLWA 3AODA 4A8QA 1F6TA 1RAHB 3OUYB 5J2QA 2F1FA 3ELHA 3QT7A 3FBFA 4RW7A 4ZLNA 1C0UB 4FYVB 5AXKA 3TNVA 2XULA 1ZETA 2FZCB 2BDPA 3WDOA 2KZMA 3RBDA 1KQKA 2R7RA 4A46A 4L6V3 3EWGA 5J1PA 4USVA 1N56A 4FDFA 3R5JB 4LUBA 1TKDA 3BB5A 1C1CB 3UR3C 5HI7A 2U2FA 2UUAJ 2UXCJ 2GVZB 3LW5C 1FKOA 4LF1A 1SI9A 3M2UB 2SXLA 2G1HA 4BDPA 1CC7A 4USKA 2DBBA 3VQSA 1FFSB 4DL0C 4YEAA 2XCAA 1R3NA 3HHLD 4I67A 1Q81T 2DHAA 2HNZB 5C42B 3KG4A 5H9FJ 1MU2A 4A8YA 3I32A 2DY9A 4DQSA 4KHMA 2E5IA 3ISND 4RUBA 3MECB 4C9DA 1CQNA 3NMRA 4RW4A 1N33J 2P6TA 4DL5A 1VQSA 3VVUA 2C2MB 3EICA 2PA3A 2HFNA 1JLCB 3CJ4A 2XHWA 5HAOA 1XR5A 4WK1A 1HQEA 4C98A 3TVKA 5F3TA 1O6XA 4F50A 3DI6A 2HK3A 2E1MC 1X4BA 1H73A 3VWSA 1IBKF 1EB0A 2VBZA 2D9PA 2HRTA 2IA0A 2GAHC 2QLBB 3M1VB 1UZHA 5KG5A 1UVIA 2DXDA 3LGHA 5JMNA 3GV8B 3KOAA 2BRKA 1RSCA 1U1NA 2AQ4A 5HL7Q 3N6LA 2ACMA 3DLHA 3AJDA 1JJCB 4IH6A 2VBXA 1HR0F 1NK5A 1X4CA 1WC5A 1SJ4P 3PTWA 4CH7A 5K8MA 2LEPA 1P8GA 2BJ7A 3JSRA 3CSKA 3KLFB 1GK8A 4G1QB 4F4ZA 2BA9A 4K8RA 2E7VA 4ECYA 1S1XA 2LYVA 4NE9C 1YJUA 3MCSA 5HMXA 3RGIA 1YSJA 3M8QA 5A8WA 3KHLA 4I2PA 1JLFA 4JI1F 3DOLA 4ZVTB 1YWXA 2MQ8A 3UO0A 1SCJB 2GVDB 2VBWA 3HPOA 3CVKA 3W62A 2HHHJ 2IC3B 1OY9A 5B7WA 4DLEA 2BOAA 3G96A 5EHHA 5KG0A 2VC1A 2F9DA 1T02A 5DG9A 4LF6F 3HHNB 1YTYA 2C2KB 3AOAA 1WC1A 3E2EA 2HGMA 3DRRB 4DSIA 5ETVA 3FKBA 4NZ0A 3F56A 3L3CA 4Q2MA 2DR5A 2AX1A 2IIHA 2KRRA 4R8UB 1IM6A 4WYWA 3SSSA 4J5OA 1PYOB 4F4WA 5DM7Q 2GO8A 5DJBA 5B0FA 3UDVA 4CP5A 3W9HA 2BV3A 3ZZUA 2XI2A 3KUEA 4LSLA 3OXGA 4IG3B 4ZJOA 4HKQA 5C2CA 3E3XA 3GJQB 3LUYA 1UW9A 2DGSA 5CYMB 2V68A 5MAOA 3T1YJ 3OSPA 1NCLA 3SMZA 3EYZA 2F3JA 1HBUA 1XMOJ 5JVHQ 4ZVSB 2FB0A 1S48A 2ZJQQ 1FT8A 1BQMA 2BJEA 4OQJA 1S0VA 5KFFA 1EX8A 3R2DJ 3SCJE 4HACB 1WJ9A 2DGWA 2V4JB 3H5SA 4I2QA 3IG1B 4ELTA 1C2PA 2JFKA 3OSNA 3I82A 3B6BA 1ZYQA 4NZ7A 2D7SA 2VJVA 1NJWA 2RB7A 5IC4B 4LF9J 1PILA 4CTAB 3KTQA 2HQIA 2AZ3A 2ZM6J 4DUZF 1IUJA 5BXIA 2M9KA 1FJGJ 2HZCA 1YZ7A 2IRXA 4ED4A 2AT1B 4RW8B 2JFDA 1A9NB 1ZM2A 1BY9A 1OPIA 4MJKA 2BKPA 2K3IA 4DS4A 4Q2LA 3KJVA 5H9EJ 1Q82T 5EUHA 2KM8B 3JYTA 1S6UA 2E5LJ 2VD3A 1BWVA 1FVQA 4M63A 4OI0A 2NS1B 4AXIA 3OL9A 2IAJB 1GMWA 3HVTB 3AJ1A 3UD5A 3ZTQA 1FVSA 1N34J 3CIMA 3D68A 3SCIE 1Q7YT 3D5MA 3NGDA 3IP0A 2L9DA 2F40A 1FK9A 2V8GA 1R8CA 1KLNA 4C8YA 1X4GA 4Y34A 2DNGA 2J9CA 4YQWA 1A6LA 5KFRA 1SKRA 3FVYA 3TQEA 2Z2MA 4GKKJ 2ZZMA 3AD9C 2FJVA 4DU8A 5CXTA 2QN6B 1Q8BA 1DLOA 3W5YA 2H4WB 4YFUA 3BBBA 1HD1A 3KJNB 2XWXA 3T5LA 4LRDA 2DNQA 2YXLA 3MEEA 4ZVGA 2OPSA 4PPZA 5LOQA 2HWHA 4FS2A 1LWFA 4HEA9 2X1GA 2NQPA 1HNWF 1P9QC 3CCMS 4K2JA 3VGSA 1QE1B 4ZP7A 5E41A 3UCUP 3NG8A 1LW2A 5E3RA 1U0HA 2E66A 3DC2A 2MJNA 2RT3A 1RTDA 2DNKA 3J80U 4AYBD 3UN5A 4YOEA 3BQ1A 2FLOA 4IFVB 4TLQA 2BANB 3LAKA 3OTOJ 4Q45A 2QSFA 2PO4A 2OFGX 2IYIA 3M6XA 2J0XA 1RYRA 1GH8A 4ID8A 2ASDA 4XK8C 4ECZA 3UDLA 3MCOA 4OJ1A 4NPOA 2EFNA 4PKDB 2DR6A 2R7SA 3K5PA 2W8LA 3AB2B 4NA1A 4B17A 3K2YA 1PC5A 2YX7A 2P6SA 5BYQA 2HLTA 1IR0A 3CTRA 1JLQA 4HI1A 4OYXA 3LAMA 3RAXA 3B8HA 2HHSA 4Q5VA 3BEGB 3FJ2A 3CJQA 5FDLA 3P49B 4JI3F 3OR1B 4OYZA 4PEOA 2DH7A 2CQ2A 4ZCMA 2ZE2A 3U1NA 1HI8A 2HGNA 2MKHA 1SJ1A 1JK9B 3J80Y 4C3MA 1AFJA 4IO1A 4F0KA 1S1TB 3DU5A 1KHVA 4EO6A 3QO9A 3IBFB 3D6TB 2NPIA 4F04B 2OKQA 2D3O1 2UUBJ 1CULB 3IA0A 2V9KA 1HYSA 1IKYA 4NLRA 5HP1A 2DIVA 1YRXA 4KGKA 2R7VA 2HG4A 2DNNA 2JZ5A 2M3DA 2PN6A 3RYLA 3PKMA 4ETZA 4E0DA 1N88A 3WX4A 1FX4A 4FXDA 2VPXB 5HLFA 4KHPJ 3QAUA 3IGVA 1RTHA 1FWPA 1VI7A 2ZH4A 3HHLB 1SUQB 4MIWA 3MPDA 1WSRA 1XTZA 1QSLA 3CCWA 3S7RA 4CNZA 3JTNA 2ZWPA 3UCGA 2VHGA 5M2UA 1ZM4A 4HH1A 4X66J 4HHJA 4IKAA 4TY8A 4UY85 3OFFA 3J81Y 2IM1A 1RTIB 4DV1J 4FN5A 4DJBA 1NUEA 1WHYA 3N79A 3W63A 4L75A 2IDLA 2OEMA 4LVNP 4F36A 1O51A 1TV6A 3ENVA 1TKZA 2DY1A 4KFBA 1EP4A 3HT3A 1Y5IB 4CT9A 1TUVA 2GS8A 2WVCA 4PCQA 2MGZA 5U47A 3CDEA 1JLEB 2NYIA 3MM5A 1WHWA 2ZD1B 1FCAA 2IVFB 2AYBA 7FDRA 3N9UC 3WC0A 4DFPA 4LQ9A 1IBLJ 3MCMA 4WIQA 3M8YA 4ZPWR 2GAGC 2H65B 3MR3A 1AXQA 4J9UE 3TW0A 2MQPA 2QA4S 1HBOB 3SDEB 2E44A 3F41A 1DZ5A 4OYPA 2HHPA 4LMZA 3DM2A 2DGOA 5HMWA 4Y2AA 2CQ4A 3DLGB 5E0OA 4QW9A 4CLUA 2XM3A 5KG2A 1NNDA 2DNMA 3C19A 3ET6B 2CNOB 2ROEA 1ZM3A 5IXUA 2MDAA 1OQ3A 3CD7A 1K1SA 3N5FA 4B3TF 4ZP9A 3R5CA 3NXZA 1MN9A 3KWMA 3CJ0A 4OI4A 1BLUA 3IS9A 4LBIA 4J9SA 2HFVA 4MK7A 2FLNA 4JI7J 3FBCA 3JTOA 3X3UA 2DH8A 2K2PA 3MM7B 2GNKA 4KIAA 3PY8A 1MMLA 2WB4A 3H20A 1HHTP 1QDUB 3PYEA 1UEUA 1X0PA 3UCZP 2CJQA 3TI0A 4EWTA 4DR7J 4JYAJ 2E29A 2HIQA 3VALA 4C11B 1MWYA 2Y1RI 4KGZB 1NDPA 2R8IA 1Z4UA 3EE3A 4QYZK 1VGYA 5I3UB 1ZA2B 3BM7A 2RJZA 1RCXB 1DRZA 4TU9A 4L74A 1RACB 3NGRA 3JXOA 4X4PA 3X1LB 1H6KX 5DS7A 5CYQB 5KFYA 1VYAA 1AB8A 1PBAA 3I5CA 4FZVA 3KYLA 4DPOA 2B9WA 4DU7A 3HF5A 4J9PA 5E3CA 1JLAA 5BJRA 3QIPA 3KG1A 5FJ4A 1RWOB 5T7LA 1KFDA 1Q0NA 2Y8YA 1WI8A 1FFGB 3RRHA 3CULA 4IH7A 3HHDA 3V6KA 3DRPA 1RB0A 4RUHA 3IXQA 1RCOB 4O44B 1VQPS 2DPIA 1NK9A 3GFZA 2L3MA 1U1OA 1WELA 1X4AA 2FHJA 3VAIA 2OH2A 2D9OA 2HVDA 4C8KA 4OZ5A 4KV8B 1RWXB 2CJBA 4H4MB 2VU5A 2XO7A 2V2KA 3FRYA 3DDNA 2R8KA 3MMBA 2MKYA 3VHQA 1X5PA 3K8WA 4DV0F 2VQFJ 3H2UB 3BR8A 4AXJA 4C2MA 2ZH8A 3E51A 1S9GB 1BQNB 5KTQA 3KJQB 3FC9A 4JI8J 4ELVA 4LR8A 4DSLA 3VQTA 3GJSB 2IJFA 3Q8PB 3SQGA 2LDIA 2CPZA 4ED0A 2UU9J 1REVB 2OD6A 2U1AA 1XR6A 1PJ7A 2W2QP 3NWRA 1N0UA 3JB9k 2XYHB 3G9CA 5BYRA 1IM4A 5D15A 2AD9A 4P2XA 2WK4A 3A8IA 2J76E 4RO0A 4CNYA 1U1MA 4O4GA 1QAIA 1NB7A 5HQLA 2B4PA 1J27A 4I0WA 5KG6A 4A8SA 3PRVA 2QC3A 3G8QA 3G4SS 3FMBA 2M5YA 1KTVA 2XMAA 2BKOA 5DZ6A 1RWMB 2MHEA 2Y3YA 3WQPA 2QJ3A 3DLKA 1S97A 1FJCA 2G2ZA 1PAUB 1F2HA 3DN9A 2HSEB 2ZOGA 2GMHA 5ETOA 3DXBA 3L09A 1Y4ZB 1VQ4S 5KG7A 2JNJA 2ZVIA 1HBNA 1HNZF 1TL5A 1XNRF 2RQKA 4M5JA 2L41A 2QLWA 4UOHA 5CQGA 4URGA 1TQLA 2CQHA 2PEBA 3QT6A 4FYXB 5M2RA 4LRBA 4C8MA 1GX6A 1PJ6A 1RABB 1VRQC 1YHQS 3V6JA 2PGCA 2KKHA 3BYRA 3D1OA 1B0VA 1Q53A 1KQGB 2GMLA 5J2PB 3ILOA 4GO7X 5ETQA 2RQMA 2XSJA 1RT2B 3L7PA 1JLGA 2C3UA 1OY8A 3ZZPA 1TELA 5B09A 1S5ZA 2AW0A 4CO5A 3LGMA 3CCJS 1RBAA 1TMJA 3KLEB 2EBGA 3DHXA 3ILJA 1E6VA 1EIYB 1NSQA 1U47A 3CB4A 4N56A 2XB2D 2IM2A 1YJVA 3W5XA 1URRA 3TJ9A 1XK8A 1V3RA 2JEIA 4FVMA 1WC6A 2YWEA 3FDSA 1T3NA 3PR5B 1HR0J 3ONQA 1NO8A 4RNMA 2VPZB 2IRYA 5D8HB 3IFEA 4ZN1A 3WZ0A 5KFTA 1RHJB 2HVIA 2O3DA 4IOBA 2BJ1A 3VAJA 4J90A 1X7VA 1HWUA 2R7QA 4ECXA 3QRRA 3MM8A 4EBEA 3MXHP 2DHHA 4B3OB 1LK7A 3KHRA 3FBBA 4QWBA 1S4FA 5F8HA 3R3TA 3DNCA 4I64A 4IFYB 3DCAA 1V6HA 2Z2ZA 4DR6F 3HKWA 3BF4A 3PW0A 2BW7A 2DYAA 3QLHB 3AOBA 1S6QA 4JI1J 4MYTA 1IQTA 3MFHA 1UVJA 1EETB 1NKCA 3I31A 1CC8A 3TANA 4PRFA 1U1QA 2D69A 4PPDA 1FKPB 2BQRA 4YDXA 4DV4J 3AB4B 1RUSA 1NLKL 2NXCA 1TK5A 2Q43A 2OEKA 2QYGA 4LF6J 2R8GA 3OBIA 3LP0B 3I96A 1CLFA 3BDPA 2JLFA 4ZVUB 2YKMA 1U6FA 3QGGA 2OFHX 1RI7A 2HNDA 2ZHOA 3DRXA 2G0CA 3TZXA 4PQUB 3ZNUA 4DQIA 1QLNA 4CO3A 3QZ8A 2IJRA 1IBMF 1JMTA 1X5TA 5LSOA 4ES2A 4ZKAA 2DITA 2W9BA 3W5ZA 2QGFB 1T9VA 4MTPA 1C1BA 3K89A 2BE7D 3PJ9A 3BKFA 4C3LA 2APOA 3BGFA 4W4MA 3V4IA 1RT5A 3NNCA 2DT9A 1RTJB 1FDNA 3V5RA 1I94F 4OIXA 4F4KA 4X62F 1YITS 4M5DB 2VG7A 4N76A 3I0RB 1U6BA 4OYMA 4JUZA 2ALYB 2MPUA 3S6EA 3SQOP 3QPIA 1EQ0A 4DR5F 5J1EA 1S0OA 4A8OA 1S72S 2DXEA 4ELUA 2PEHA 4A8MP 1N4LA 2PSZA 3Q8VA 4LFAF 2V67A 3NGSA 2N82B 4NRTA 2E5HA 1G6BA 3DLBA 2QE5A 4OLOA 4HT7A 3VAKA 2AGQA 5CHCB 2VFVA 3FSIA 4DUYJ 4DUZJ 1LW0A 3R1LA 4WFNQ 3K7RA 1LKZA 3BBFA 2RHSB 1SPBP 4Y2IA 2MLYA 3GP9A 1U26A 1VBZA 1G7CB 2IVYA 4QIGA 1T94A 4ES1A 3T6JA 2XMTA 5F9NA 1UAWA 4ERDA 4EBDA 5DLFA 3G6ES 1H74A 4NCGA 3CMAS 2VASA 1K8AT 1RAGB 2FVCA 5CD4A 4QR0A 2ASYA 1IKVA 4UQTA 1EHWA 5E3AA 2BUNA 2XNRA 2EFOA 2R7UA 1J2VA 1EZZB 3U02A 1SH3A 1FDBA 2ZNZA 3H59A 3CCQS 2IMOA 8AT1B 1Y7PA 3QQCD 5BR8F 3SCKE 3ZZYA 4DX5A 3C14A 2EKYA 1HWIA 1M5HA 3QBCA 1M1KT 4YR2A 3P4UB 1FXRA 4OZ2A 2CJKA 3AJ2A 2L08A 2GCFA 1VISA 3VAGA 4J9KA 1HNWJ 1JJ2R 2FZKB 4KSEB 1PYSB
chains in the Genus database with same CATH topology
2UUWA 2C28A 1QAYA 4JBCA 3FSYA 1C1CA 3SZ2A 1KOOA 2VQEF 1NJXA 1NK6A 4LFBF 4RNNA 1J5EF 1N8RT 3PEHA 3MR2A 2FPHX 3SEOA 1GXTA 2MMYA 2BABA 4DR4F 4K4XA 2VODA 2MZQA 1LW0B 4ZP8A 5HROA 2XG8A 4YB6A 1CSJA 3BSOA 2PIIA 3DDKA 5CZVA 2DNHA 4LSNB 4OJHA 2EK6A 3M2UA 4X65F 3RAQA 2CQBA 2VH7A 4H54A 5E33A 1FNMA 1HNVA 3PW2A 1AW0A 2JVRA 2JHEA 4ED1A 2VA2A 4NXMF 4R0EA 1C4CA 1YGYA 3EPIA 3HZGA 4NWBA 1NK4A 3OJSA 2LXFA 1X8DA 5H1SV 4J9MA 2KHCA 4OZNA 3OHAA 2DNLA 3PXGa 3FFIA 1CVJA 1R31A 5DETA 1L3SA 2VQFF 4ZPCA 1VK3A 2AJQA 3QWPA 2M7SA 2HNZA 1WF2A 2MHNA 3CCTA 3GFXA 4MFBA 4D3HA 5C42A 3VAHA 3U1MA 3CJ2A 3M6VA 3HO1A 1KHWA 3M8SA 4JI8F 1WG1A 2D1CA 2PMHA 5HBMB 2V9WA 3RBEA 2A2CA 2LVWA 3RZAA 3T9NA 4NCGB 2KU7A 2V5HG 3QIPB 1OWXA 1A7GE 5IT0A 1Y9OA 1SKSA 2Q66A 4UOCA 4K4TA 1JNZB 3TUJC 5THWA 4DQQA 5GAEI 4PG8A 1IKVB 1RKJA 2IA6A 3MECA 4OZ1A 2GHWA 1U4BA 5ITHA 5LL6d 1HWKA 4PXDA 5L1IA 4OJ3A 1D9AA 5DO2A 3JSBA 2GHVC 1R7IA 3CPWR 1W25A 2UU9F 2YX1A 1RT4A 1JLCA 3O6QA 2KXFA 1FERA 1Q79A 3IRXA 2RRBA 1Y5NB 5EX0A 1Q1KA 4OJGA 2BJDA 2LQ5A 2BQUA 4Z2XA 2FGCA 3VR1A 2HMIA 3MD1A 1MMDA 3HLUA 4RBTA 2P9CA 2JDJA 2XMJA 1NKBA 5KT3A 4B3RF 2E9TA 1ZBTA 3E8OA 3PO5A 4ILRA 4DMZA 3NNHA 4NLWA 4JI5F 1HWJA 1QAJA 4A8QA 1HI1A 3OUYB 4MAKA 2NLWA 4ZLPA 1UVNA 3D28A 1FRJA 5J2QA 2DCLA 1S10A 4NRUA 4H4KA 3B4MA 3M1VA 2KZZA 2MKJA 2F1FA 3KLVA 2C3PA 1LFWA 3DRSA 2DR7A 4NLDA 2DGXA 3MAHA 1Z1ZA 4DL3A 4KQZA 4YB5A 2GGPA 2AGOA 1G3OA 1U6ZA 2NXUA 3PX4A 4JV2A 5KFBA 3W3SA 3BSCA 3O2IA 1N5SA 4RW7A 5CD4H 1C0UB 4NLXA 3B4DA 4IO9Q 2IFXA 1KLMA 5AXKA 3KFWX 5K14B 3GV7B 2AV5A 2ASJA 3TNVA 3TVYA 2DNYA 4EO8A 2XULA 1ZETA 2Q6BA 3JSYA 2BDPA 2V4RA 3WDOA 3J7YU 2F8MA 4MH8A 4DR2F 4OHYA 1YJ9S 3R1HA 4WZQA 2KZMA 5I42B 2R7OA 4NLYA 1RT3B 3KK3A 5KFIA 3CT9A 3FMWA 1ZM9A 3RBDA 1KQKA 4CIOA 1TKXA 4A46A 2R7RA 1YBAA 4OI3A 2E1CA 1FNOA 4L6V3 1NU4A 4N8OA 2NUUG 4IG0A 1S7HA 3IGNA 5J1PA 4CH1A 2YY3A 2XLIA 1N56A 1JX4A 1N54B 4LUBA 1TKDA 3BB5A 1C1CB 3UR3C 3E01A 5A6WA 5HI7A 3CCZA 2VONA 1DFDA 2J9DA 5F8LA 5L1LA 1APSA 2U2FA 2AJFE 2JVOA 2FVPA 2R7WA 3C66A 3LW5C 1Q8LA 4DL2A 3D0HE 2XLJA 1FKOA 2HS4A 5HROB 4OZJA 3PR4A 4DF4A 2BM0A 3CMES 1SI9A 3M2UB 4ZVFA 2CPYA 4MK8A 1OSDA 2JSXA 1HNVB 2SXLA 2ASLA 4QU6A 3BSAA 5GADU 2VA3A 4DDFA 5GMKa 4BDPA 1CC7A 1KS2A 2XZWA 1X4HA 3ETOA 2DBBA 3M2VB 1SJRA 3VQSA 4Y6IA 3IRWP 4WF9Q 4DL0C 4BWJA 4YEAA 2XCAA 4HH0A 5EGYA 1KTQA 1R3NA 5IQ6A 1GX5A 3H2LA 3HHLD 5DQIA 1FHTA 4NX9A 3FFIB 4I67A 3KLFA 3HX9A 2EFGA 1Q81T 2DHAA 1KRPA 1TK8A 2YWGA 4MFBB 4G1QA 2HNZB 5C42B 3KG4A 5L9XA 5H9FJ 4M8LA 2R2RA 1MU2A 4X4SA 2EVZA 4A8YA 2XC9A 3PX6A 4WFZA 4NLVA 1JLEA 3I32A 1VBXA 1ZH5A 4OL8A 3JSMA 3R5AA 2XWYA 4DQSA 2IMWP 5B0GA 4WCEQ 4PWDB 4KHMA 2E5IA 3ISND 2OPRA 3SFGA 2A3JA 3CCRS 2ROGA 3NAIA 1VBYA 1QM9A 2EFQA 4XPCA 3MECB 4HDGA 4DOZA 1CQNA 2YNIA 4BHQA 4YP3A 5F41A 2ZH2A 3NMRA 4C9DA 1HD0A 4HLBA 4RW4A 4R0JA 5A6PA 3BS9A 4OHXA 2P6TA 4DL5A 2M0GB 1PC4A 1VQSA 3CDBA 3OR2A 3NNAA 1VMBA 1YRTA 3GIMA 2CG4A 2BBEA 2PA3A 2HFNA 1RT4B 4NXNF 1JLCB 3CJ4A 2HHUA 4CCHA 3IRXB 3O5TB 3M8RA 3AHPA 4U6PA 2IC3A 2XHWA 3WBZA 2BOPA 1XR5A 1UL3A 1OQ6A 2VFUA 4WK1A 3MPWA 1HQEA 5J1NA 2D3OR 1C0TA 1X4EA 1S76D 2HMIB 4DV7F 4C98A 3TVKA 5F3TA 4F50A 2CQDA 3SDEA 3DI6A 3IR6B 5KFMA 3HJFA 2YKOA 4KRWA 2E1MC 1X4BA 3VWSA 3ENWA 1IBKF 1VQ8S 5B0EA 4EGLA 2J6UA 5KFDA 3US5A 3N01A 2OTJS 2VBZA 3M4XA 4YUDA 2D9PA 1T8EA 1NEEA 2IA0A 2M52A 2YNFA 1YJWS 1K0VA 2NZ4A 3ZFVA 3EZ5A 5J2QB 2QA1A 3M1VB 3O1LA 2GW8A 1RT6A 1NH8A 3DRSB 1S99A 5G0RA 4C3KA 5KG5A 1UVIA 2ZOFA 3DRRA 3G71S 3GV8B 3KOAA 1O0PA 2BRKA 2GGPB 1YI2S 1U1NA 2AQ4A 5D77A 5HL7Q 5DQHA 2I9SA 4RW7B 2J5AA 1LV5A 3N6LA 2PD1A 1KLMB 2O1PA 1VJWA 1YVFA 4UUXA 3DLHA 4IR1A 2KXNB 1DQ8A 4R8UA 3CJKA 5KFSA 4R5PA 3KK3B 4I6WA 2BZ2A 3Q24A 1TKXB 4OMFG 2I38A 2DNOA 1CQMA 4K59A 4IH6A 1YJTA 4IRDA 4IG0B 4WU2A 1H2VZ 4QWAA 4URSA 2VBXA 2C2EA 1HR0F 3KK2A 1T05A 1JJ4A 1NK5A 1SV5A 2DH9A 1X4CA 3E01B 3C6TA 2OAUA 3H40A 2B5JA 5ADZA 4IG3A 1WD6A 1SJ4P 2DR8A 1FKOB 3SFUA 1FO1A 4WFYA 3HMJG 1P1LA 3THVA 4RW9A 4CO4A 2NR0A 3PJWA 3RB3A 1RYSA 5CYMA 4CH7A 1FF2A 1W2IA 2HS3A 3DXSX 4N47A 3TUZC 3CCSS 5K8MA 1N5VA 3GMGA 2FVSA 3NP5A 2LEPA 4Q7AA 1P8GA 4USJC 3RRKA 4K4UA 5JXSA 4ED6A 4X84A 3JSRA 5AXNA 3MOJB 2LA6A 1SIZA 3OTBA 2L48A 4Q43A 3LF0A 4K4SA 4RU9A 3POTA 2LDYA 2LMIA 2Q3PA 3CSKA 3MGJA 3KLFB 4BC7A 2MZRA 4B9LA 4WFXA 4G1QB 1U25A 4F4ZA 4V19J 1C4AA 2M8DB 2BA9A 3PW7A 2M4MA 1DHMA 4K4ZA 4ZA1A 1TKTA 3V6DA 4ECYA 1S1XA 2IVMA 2LYVA 4ED7A 1YJUA 3MCSA 2WTFA 4O3SA 5HMXA 3JSMB 2UP1A 3KG0A 1YSJA 1B7FA 4Y0FA 3M8QA 3I0SA 5A8WA 5JUMA 3KHLA 3A1YG 2M2BA 4I2PA 2OPRB 3PRDA 4WK3A 2V4JA 3NS5A 1JLFA 2YNIB 4JI1F 3DOLA 3KKFA 2CPHA 2ZJPQ 3IG1A 2UV8G 4RW4B 3T5HA 2WSEC 1YWXA 4A8WA 1R8HA 2ZH7A 3OR2B 3IO1A 1UFLA 1X9SA 1ZAXA 1U1PA 2VBWA 3HPOA 3CVKA 2MSTA 2GC8A 2ZKUA