2FC9A

Solution structure of the rrm_1 domain of ncl protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
b'GSSGSSGNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NCL protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title Solution structure of the RRM_1 domain of NCL protein
rcsb
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fc9A00
3BO4A 5DDOC 5HO4A 3DLLQ 2N7CA 2DO0A 1VQOS 2ZJRQ 1U1KA 2EK1A 2KM8B 1U1RA 2I2YA 3K0JA 2CQCA 2E5JA 3TO8A 2KHCA 2YH0A 2L08A 2M0GB 1H2UX 2KT5A 4IUFA 2U2FA 2DIUA 2L41A 3UCUP 1ZZNA 2M8HA 1NU4A 1X4FA 4QPTA 3VF0B 4TU9A 2M70A 2MQNA 1DRZA 4J5OA 4TU7A 1YJ9S 2DNLA 1WF2A 5LJ5Y 3MI7X 4Y00A 4EGLA 3D2WA 2DNOA 2MQPA 3CMES 2MQLA 2CQ2A 2DGXA 1X5TA 3CMAS 2ADCA 4F26A 1U6FA 2MKIA 5IM0B 3J7ZT 3CC4S 1R8PA 3CXCR 2LECA 3HI9A 1P1TA 3UWTA 1ZZFA 4LJMA 2XSFA 2J0QD 4C0OC 2DNRA 2DNGA 1YHQS 2CQDA 2X1AA 1VQKS 5GAGU 3CCLS 2KH9A 2E44A 3NNCA 2MMYA 2HVZA 1M90T 2FPHX 2JRSA 2DNHA 3ZZYA 5DM6Q 4IO9Q 4C7QA 3G71S 1KOOA 1UP1A 3V4MA 2DNQA 2KYXA 3THPA 2MY7A 1K9MT 5GMKa 2DGSA 4ZKAA 1A9NB 2B0GA 4QU7A 3B4MA 3CPWR 2DB1A 2MQQA 2CQGA 1WHVA 4WCEQ 3US5A 1H2VZ 2CPEA 2RNEA 2M88A 1PO6A 2XS2A 2DGWA 1VC5A 2HZCA 1WG4A 3RW6A 2YKAA 5H1SV 1S72S 1M5PC 3BO3A 1RK8A 4WKRA 3Q2TC 4TU8A 3CD6S 2LA6A 1VQLS 2CQHA 3I56S 2J76E 3VALA 2LMIA 2CPFA 2LA4A 2MZTA 2GHPA 3S6EA 2RVJA 3R1HA 4IOAQ 2CQBA 1DHMA 1CVJA 2RS8A 2M8DB 1NJIT 1YTYA 2XNRA 1VQPS 1VBXA 2DGQA 4C4WA 3UD4P 3PIPQ 5DM7Q 2LEBA 2KRRA 1WEXA 3VAJA 2OJ3A 2DNMA 3CC2S 1DBDA 5CA5A 1D8ZA 1N8RT 2SXLA 3HHNB 5D78A 2CPIA 5GVQA 1YJWS 2OTLS 1G2EA 4YUDA 4OZ0A 1YIJS 1WHWA 2ZJPQ 5MLCV 5CYJA 1X4EA 2KG1A 2KVIA 2KI2A 2AYMA 1VQ8S 1R8HA 1VBYA 2MZJA 2MQMA 2AYEA 3NS5A 3VAGA 1OO0B 4WF9Q 1U1MA 2ADBA 1X4CA 2A3JA 1UW4A 1YWXA 2F9DA 4Y0FA 2ERRA 5EN1A 2MYFA 1YI2S 3UE2A 5JVGQ 1WWHA 1OPIA 2CPZA 3SDEA 3VAKA 4U67Q 2DGTA 2DHXA 2M2BA 2M4MA 1FJCA 1JJ2R 3THTA 5FJ4A 3UCZP 1W2BR 3BS9A 1XN9A 2VOPA 2CQ0A 4WIIA 2CQ1A 3B4DA 2RQCA 1YITS 2DGUA 2RS2A 1SJFA 3MXHP 5LSLA 2CQ4A 1IQTA 2D3OR 3CTRA 1VQ5S 1SXLA 4F02A 2XS5A 2CPXA 3MUVP 1VQNS 1JJHA 2L9WA 1PGZA 2OSQA 4LIRA 2J8AA 3CCSS 3FEXB 4UQTA 2JWNA 4IOCQ 2MJUA 4BS2A 4W92B 3S8SA 1U1LA 2ZJQQ 3CCVS 1QVFR 3SMZA 3G4SS 3R1LA 2MKHA 2DO4A 3J7YU 1U1OA 2F3JA 2E5HA 3CUNA 3LPYA 2KM8C 4W90B 1H2TZ 2MPUA 3NMRA 3UD3P 4WFBQ 2MZQA 1VQ4S 1Q81T 2CPYA 2MKCA 2RT3A 5DDRC 2UP1A 5CXTA 3CCES 1X4AA 2OSRA 3P49B 3EGNA 2M52A 4WFAQ 1URNA 4TLQA 1YJNS 4LMZA 5BJRA 2DHAA 1O0PA 2LYVA 1WELA 2MGZB 1ZH5A 2YTCA 1NO8A 5IM0A 2KG0A 2CPHA 2FY1A 2U1AA 5LXYA 4UY8T 2PE8A 2MXYA 2AYGA 1WF1A 1UAWA 1KD1T 1FNXH 2D9OA 1HD0A 2QEXS 2LXUA 1VC6A 5IQQA 2MGZA 4RU2A 2G4BA 2MJNA 3ULHA 1M5VC 2MZ1A 1D9AA 3R27A 2XB2D 1OIAA 1AUDA 2LKZA 2KRBA 3BEGB 3EGZA 4WFNQ 3G6ES 2Q79A 2KFYA 1WG1A 2RUGA 2FC9A 1WTBA 3DXBA 2KXNB 2XNQA 1L3KA 2E5IA 2CJKA 2VONA 5DETA 3NNHA 1WF0A 4ED5A 1HL6A 2K3KA 3IWNC 1FXLA 5LSOA 2OIHA 3L3CA 3S7RA 5JVHQ 1U2FA 2YH1A 1SJ4P 2MSSA 2DNPA 4ERDA 3G8TA 4CH0S 3G8SA 3UCGA 1X0FA 1VC0A 2XS7A 3MUMP 1OWXA 2JVRA 2DNYA 3P3DA 2N3LA 5ITHA 4F25A 2FC8A 5DDPC 1B7FA 1X4GA 2GO9A 1QVGR 3MDFA 3H2VE 1KOHA 3BO2A 1FHTA 3CCQS 1WHYA 3I55S 2MB0B 3PIOQ 1RKJA 2MHNA 3NNAA 1WHXA 2RU3A 2DH9A 2MKSA 2DHGA 5HL7Q 1X5OA 2KXHA 1QM9A 4CQ1A 2NLWA 3CULA 3CCMS 2X1BA 4P6QA 1X4BA 2DHSA 3LQVA 1Q7YT 1U1NA 1FJEB 1VBZA 4Z2XA 2HGLA 2G0CA 4PR6A 1U1QA 2X1FA 2MZRA 2JVOA 1Q82T 2M7SA 2BZ2A 1K8AT 2HYIB 2JX2A 3MURP 2BOPA 3CF5Q 2DNZA 3U1LA 4A8XA 3VAHA 1JJ4A 1HD1A 3G9CA 2DITA 2I38A 3P5TL 3VAIA 1H6KX 2E5GA 2LEAA 4YB1P 4QU6A 2MQOA 1WI6A 3CC7S 1KQSR 1WI8A 2KN4A 1F9FA 2KU7A 2WBRA 1N54B 1FT8A 3MD3A 2EK6A 2MKKA 4CH1A 2VOOA 1VQ6S 2CPJA 3MD1A 5LXRA 2EVZA 2FHOB 3H2UB 3P6YC 2CQ3A 1SJ3P 4YOEA 2N3OA 1FJ7A 3VAMA 2X1GA 2DGOA 1N52B 3TP2A 5GADU 2LQ5A 2RRAA 5LJ3Y 1SJQA 2D9PA 1M5KC 2CPDA 1FO1A 1BY9A 4QQBA 2N82B 2K8GA 5D77A 2DIVA 1VQ9S 2VODA 5IFMA 3RW7A 4PKDB 3OW2R 1Q86T 2M9KA 2QA4S 1X5SA 2O3DA 1M5OC 1X4DA 2HGMA 2NZ4A 1SJRA 2J0SD 3SDEB 1S79A 1WEZA 3U1MA 3ZZZA 1U1PA 1A7GE 3SXLA 2G1DA 4CIOA 2KXFA 1UFWA 5DDQC 3TYTA 3MOJB 2DNKA 3CCRS 2CQPA 2CQIA 2DH8A 4PRFA 5GAHU 2OTJS 2RRBA 1DZ5A 3MUTP 4M5DB 2MZSA 4FXWA 2DK2A 1WEYA 3EX7B 1VQ7S 5GAEU 1KC8T 2YWKA 2QFJA 2RQ4A 3JB9k 1X5PA 2HGNA 1X4HA 2DGVA 1N88A 3S01A 4OZ1A 3CCUS 1M1KT 3N9UC 2DH7A 2PEHA 4FXVA 1HA1A 2V94A 2MSTA 2DISA 3FEYB 3CCJS 2AYBA 1WG5A 1P27B 2MKJA 3G96A 3Q2SC 1VQMS 2F9JA 1JMTA 2LCWA 2LXIA 1K73T 3VAFA 3IRWP 4V19X 1U6BA 2AD9A 2DNNA 2MY8A 3NS6A
chains in the Genus database with same CATH superfamily
4K8RA 2YNIA 3QGGA 1TV6B 2KL8A 3EZ5A 4PYAA 3MM9B 2LQBA 4UW2A 1JLFA 2G13A 5I3PA 1HHTP 4RWXA 2GV1A 3TVYA 3HFZB 1RTIB 2OPPA 7FD1A 2C3MA 4DR1F 3ZZUA 4H4KA 4O4RA 4WU3A 5KOXA 3HKWA 5LOQA 1WNEA 1AFIA 1S1TA 5DQIA 2PA3A 4JV0A 4KO0B 2M0GB 1H2UX 3AT1B 3LAMA 2RDDA 4CLUA 3TANA 4IUFA 3K8WA 1S4EA 1PC5A 3WBZA 5KT4A 4FYDA 4RNHA 1ZZNA 2M8HA 3VGSA 4ZN3A 1NZAA 1MU2B 1FX4A 1S7HA 2Q43A 4QPTA 1LWCA 2M70A 2J0XA 3RB0A 4DL0C 2GIRA 2ZDOA 1FE4A 4J5OA 4TU7A 1RT3B 1WUUA 3V6KA 2LDIA 4JBCA 3Q8RB 4RNNA 1FK9A 2L9DA 4LF2A 2VICA 2B7CB 4XPEA 1UVMA 4GO5X 3RBDA 4EGLA 3TVZA 1LKZA 3SCJE 5I3UB 1S9GB 2IJNA 3R5DA 4DV2F 3MEDA 3NBPB 1FE0A 1TKTB 1UCNA 2CQ2A 1HI1A 1NEEA 1RWMB 2DGXA 3IRXA 4EI2A 2IA6A 4B17A 3VZIA 5BYRA 1SL1A 1RTIA 1YJTA 4FNHA 4DSLA 2CNKB 1MMDA 3BV8A 2OI2A 1RTDA 1XTZA 4ID8A 1FJGJ 3C14B 1AT1B 5B0EA 2LECA 4KGZB 4R25A 2YNIB 3HI9A 1AZSA 2HVIA 3NCRA 4ZIWA 1CLFA 2Y1LB 2JL9A 2YQ1A 2PN6A 3FRZA 1FX2A 5KFCA 1SL2A 2BUNA 1VGYA 2CQDA 4GKJF 1VQKS 4C0BA 4URQU 3KDNA 2E44A 2B8PA 1XK8A 4L72B 5DM6Q 4DUYF 2HS4A 2FVQA 1HMVA 1Q78A 3FJ2A 5B0CA 2UUBJ 1UL3A 3HJVA 4NCBA 1IKWA 1DQ9A 1HYSB 1H0HB 2YKPA 5JJBA 2NUUG 3THPA 5GMKa 2DGSA 4ZKAA 5MAOA 1A9NB 4RBUA 3OSNA 1S76D 2ZBQA 3B4MA 4PQUA 4QU7A 1FERA 5RUBA 2UU9F 2MQQA 3M2RB 2Y1RI 4I2QA 4CO0A 4I2PA 1HYSA 1LXNA 2FZKB 4WCEQ 4GC7A 4MKYA 2CPEA 1H7WA 1WC4A 1SL0A 1RAFB 3OUYB 4PWDA 1G1XA 1Q5YA 4JI3J 3RW6A 1WG4A 3O44A 4O23A 2XQCA 3KLHA 2VH7A 3D67A 1EIYB 2R7RA 3DLBA 4IRDA 3DN9A 1JLCA 2VBXA 4TU8A 2I1RA 3ENAA 2ZWPA 3DRPA 4NLQA 1HNIB 3KOAA 2GCFA 1YK9A 2J76E 2FGOA 2LMIA 4C2MA 2LA4A 3FSYA 4IG3A 3KHGA 2W4PA 1S6PA 2YX4A 3S6EA 3KLGB 1IBLJ 1DHMA 2GZOA 4DSKA 2WVCA 4ECTA 5A0YB 3H25A 1IR2A 5GMDA 1JLFB 3MM5B 2M8DB 2VQEJ 1NDKA 2FVPA 2F8MA 1FI4A 2ACMA 3A8KA 5C2CA 3EGWB 2B51A 2DGQA 1ZBTA 3GE9A 1HBNB 4A4JA 3DLEA 3KUEA 3PIPQ 4B3RJ 2AGPA 4I4BA 4K4UA 3KFWX 3I4HX 5D15A 1Q8LA 4ZCLA 1HW9A 5C24B 2OJ3A 1IBLF 1IBKJ 5CH7B 3PY8A 5CA5A 1D8ZA 2UVUA 3PYEA 3DI6B 3AJ2A 2RQMA 3DFEA 3O1LA 3CJ4A 2XLIA 4JB8B 3SV4A 4LSNA 1YDLA 4MIBA 1YJWS 4WYWA 5M2PA 1RHUB 4KO0A 4M5HA 2ZBCA 1WHWA 3MWBA 1DY3A 3NMAA 3PTWA 1X4EA 3AJDA 4KPYA 1T94A 1WC1A 3CD6S 1WC6A 2KI2A 1CSJA 2AYMA 3DLHA 1HMVB 1NKEA 1T0TV 3MEGB 1VBYA 4C8OA 1SQGA 4DFMA 2MQMA 4KIAA 3M8YA 1Q0NA 4DPXA 1FESA 1F3VA 5A8RA 1OO0B 3VAGA 2QMUB 1XNQJ 1MW7A 2V2ZA 4DR2J 3C6UB 3LP2B 3T5JA 1U47A 1SUQA 4YDDB 3M30A 5A8KA 4X62J 2OHDA 3PX6A 3DMJB 2ADBA 1RA6A 4FVMA 2A3JA 4CWBA 2DRBA 3MCNA 3GSDA 3H4BA 1Q4RA 4B02A 3WDOA 1R89A 2XCAA 4FS2A 2DTJA 2DD8S 4OI4A 1NUEA 5HATA 1U26A 5EWGA 2BJEA 1WWHA 5E3CA 5H9EK 1NB7A 4ID5B 1C0TB 1SPBP 3LP0B 2ZE2A 4LRAA 1OPIA 3W5YA 4D3HA 1PJ6A 4AYBD 4DXLA 3HHLB 1EJ7L 3HFVA 3V81A 3MR6A 3KK2B 1WTFA 2IBKA 3NLCA 1X31C 4GVBA 4ECXA 3TA2A 3UCZP 4WTOB 4H4KC 4KKOB 1SC3B 2VOPA 1JXEA 2NXEA 4OZ5A 2CQ1A 1YITS 2RQCA 5GMEA 1UPMB 4OYBA 2HNYA 1TL7A 2A6MA 2FQQB 1R3NA 3CJ8A 3HULA 2RJZA 3GG1A 1C1CA 4NLUA 4LBHA 4ZVEA 2FGCA 3GFZA 3SQGB 3MXHP 1T11A 3OPKA 2JH3A 2C2OB 4OYXA 1S6QA 1Y5LB 1IM4A 4ZVUB 4YB6A 4EK2A 1O5JA 1JB0C 4ECQA 3DYAB 3ADAC 2BX6A 1WKKA 4KRWA 1LWEA 1J5EF 1T7PA 4NLTA 3CJ5A 3V81B 2WB4A 1YG0A 1S6PB 3BSAA 4ZLLA 3C6TA 4NCGA 4F02A 1MN7A 2AZ3A 2CPXA 4NEZA 3VGVA 3W64A 4F67A 2PFFB 2BMBA 1WDTA 2V2KA 4ILRA 2AF6A 2OSQA 2VKZG 4ZPBA 4CLKA 4C98A 4OV1A 5HN0A 1D1UA 3R2CJ 1UZDA 2GFFA 3CCSS 1LW2B 3AB2B 2FB0A 4RW7B 4UQTA 4IOCQ 2MTLA 3PG9A 2IY5B 1S1UB 1N48A 5LL6d 5E3RA 3IN5A 4IYQA 4LBPA 5J2MA 3L9ZA 1T05B 1YZ6A 1G7CB 5BR8J 2H5JB 3N6LA 1RT2A 4KV8A 1KHWA 1CJTB 7AT1B 3A8EA 2IPOB 4EUVA 3CCVS 3QIPA 1N5QA 3CDAA 5C2GA 4Q0BB 2AV5A 1WD6A 4J9RA 3ILLA 2MHEA 3MECA 1EARA 2KM8C 4PUOB 4F0MA 4WYLA 1QD1A 1NSKL 1B7YB 2XMJA 2YX7A 4W90B 2MZQA 3O3LA 4DJBA 3JAMY 1Q81T 1RDRA 2HW3A 3D28A 1VRUA 3A1YG 1TMMA 1WKLA 3IBCB 2EG1A 4U7CA 2P8IA 5A2QY 4C3LA 1X4AA 3J80U 2GJFA 2VBYA 4Q8EA 3P49B 2HVHA 2E7WA 5C24A 4OYWA 4CO4A 3OTEA 1O0PA 1ZS6A 2LYVA 5D0RA 4DV5F 3VCDA 2QL5B 3GCWP 2IM0A 3U02A 4BCAA 5D6GA 1TUWA 4C3KA 3EUNA 2YTCA 3I87A 2AZ1A 3C14A 4YEAA 3AOAA 2RDIA 1E6YB 4ZLPA 2CPHA 1Y7PA 3V6JA 4U8VA 2QRRA 4YR0A 2F7VA 3PM9A 5F0UA 2PE8A 3OR1B 2JEIA 4J9SA 1MWYA 4DN0A 2VKRA 1NK5A 4RUAA 4JI2J 1UAWA 4K4VA 4ES3A 2D9OA 3CJ0A 2YPZA 3G6XA 1I94F 2Z0GA 4Y6IA 1HD0A 2P6TA 1BMQB 1IBCB 3DRXA 5ETRA 1TAQA 4JUZA 4QWCA 3ISNC 3MM8A 1FFGB 1ZM3A 3D0GE 4J7CA 4B08A 3PDNA 2ZH9A 1B70B 4OX8A 4RU2A 3FVYA 1KFDA 4MFBB 2POKA 4HDGA 3KLHB 4OX9F 1M5VC 2EFGA 3L7UA 5ETVA 4NLWA 1TFYA 3HFKA 1D9AA 2HQGA 1OY8A 5L8RC 4JI2F 3NGDA 2VPZB 2WTFA 1OIAA 2GJ2A 1AUDA 1V3RA 1IWAA 2GVZA 4RNFA 3EGZA 4BWMA 5KG5A 4NEYA 2Q79A 4GKKJ 4JI4J 3HHLA 2J0WA 5HVFA 3E01B 3MPYA 2EC0A 2YWGA 1REVA 1V5IB 2KXNB 4WE1B 3KJNB 2VONA 1TU0B 1UETA 3FBBA 3LPEA 3ILIA 3BF4A 1J2VA 1SCJB 4G1PA 4I68A 4DPOA 1WF0A 5DETA 4L76A 3AY0A 5EWFA 3V4IA 2UUCF 4HEA9 2K3KA 3DM2B 3PW7A 1N34F 4XK8C 2ZDPA 4EO6A 2AJQA 5ETMA 1LV5A 4WZQA 2YH1A 5DO2A 1HI8A 1IKXA 2DNPA 3K5OA 3EZUA 2PA8D 4ERDA 2JHEA 3H8YA 2PIIA 2N4DA 3RAXA 4YMEA 2RKIB 1X0FA 1WSVA 4BC9A 4F4KA 1ZPVA 3OHAA 2VQFF 4E98A 2FZCB 4LF9J 4J9UE 2J9DE 2H9ZA 3AXMA 5D3GA 4YB5A 3R7SB 3BR8A 3MFHA 3UDVA 5KFRA 3M2VB 3MGJA 4A8QA 2BBEA 2NCKL 2DNYA 3P3DA 3QPIA 4CH7A 3OVAA 3K59A 5ITHA 1VYAA 3CMQA 3SQGA 4ZVFA 1B7FA 1RBOB 5D4PA 1HNVB 4N47A 4HACB 2WSFC 3I6PA 4NZ7A 4TY8A 2CNNB 3KKFA 4NLVA 4NZ0A 1KOHA 3RBXA 4O3OA 4PG4A 4DPYA 5JMNA 4GMKA 3CCQS 5CCMA 2YQ0A 4ECWA 2CADA 2FZGB 1IBKF 4QR0A 4N8NA 1U45A 4U9RA 3DM2A 1IUJA 2WONB 3R5CA 1QLNA 3D66A 2CJBA 2MKSA 3UVJA 2ZH8A 1PIEA 4QR1A 3TOQA 3QJLA 3VVUA 1S1WA 2NLWA 2ZC4A 4DV3J 3LP0A 2P9CA 4J90A 3W8GA 1GH8A 2VG6B 1X4BA 4J9NA 2PGCA 2YNHA 4M5LA 5B08A 1TK8A 1Q7YT 1Z2LA 2HVEA 3CJ2A 3IBWA 5BYSA 2GQ2A 4DFJA 4UZCA 5A76A 1JK9B 5A2QU 2GVZB 5L1KA 2C2KB 2G0CA 1KP6A 2QIFA 4DSEA 2ZH3A 1U1QA 5J1EB 3FCWA 3QAEA 2B5JA 1Q82T 4RW6B 4ZCMA 4KT0C 4Z7YA 2W01A 1R0CB 1HNVA 3MM6A 1X8DA 4HVZA 1NK6A 1QAJA 2N7YA 4LQ3A 3U1LA 3PW5A 1KHVA 2K1RA 3DDKA 5HAOA 3G9CA 4N7TA 5GAHI 1RHMB 1HD1A 1TKXA 3FBFA 1X0PA 3FMWA 4Y2IA 2WK4A 4DQPA 3MHYA 5KFJA 5CD4A 4IR1A 3FZ2A 3RR8A 4DUZJ 2AJ4A 2AMCB 1VHFA 3BREA 3EPGA 5FD1A 2Y1IA 2LEAA 2CJAA 1V9OA 3CWJA 3KLIA 4YB1P 1RI7A 1X60A 3MMAB 4YY3J 2A10A 2HLUA 4DV6J 1OQ6A 2CZVC 4A8KA 4B9MA 3HK2A 4ENOA 1UVLA 3AHPA 3QLHA 3KDOA 3PFEA 2WBRA 4KB7A 1FT8A 5F41A 1KVJA 3DRRA 1TVRB 4X4RA 1YJRA 1ZYQA 3MF5A 2VOOA 1LQ9A 3TZYA 4HT7A 3SSSA 3D6TB 2GIFA 5LXRA 2V5HG 2FLOA 3HHDA 4RKUC 2CQ3A 3LO3A 3QGHA 2VG7B 5M2RA 4USIA 3KHHA 1IWGA 2VUGA 2IM1A 2N3OA 5KG7A 4AQYJ 2D41A 2YY3A 3KLIB 3PW4A 2H51B 1EQMA 1PAUB 3ILOA 4GKKF 5C25A 1DTTB 2ZH1A 1H74A 2M5YA 2X1GA 4I6WA 3J7Z5 3W2WB 2K06A 2B7BB 3R7BB 4Q0BA 3WQPA 3GZ7A 3ZZ0A 3HHEA 2D9PA 3FSIA 2D3O1 1U48A 4ZS6A 2IM3A 2WBMA 2X3DA 1DLOB 2Z8QA 3HX9A 3IGVA 3MCSA 3O8WA 4LBIA 4QQBA 2N82B 3PKYA 4B3TJ 4JI6J 2J9DA 1R8CA 5K14B 1NK4A 3KNAA 1S48A 3DNCA 3OUYA 3AD9C 4DQRA 1KLMB 3PJXA 2FVCA 1PILA 2M9KA 2XMMA 3JXOA 4PXDA 1HQEB 4A47A 2BW7A 2QA4S 3D3CJ 3GFYA 1SC1B 4V19J 1RT7B 1TR0A 1X4DA 3I5AA 2LVWA 1GQEA 1SJRA 5KFVA 2NZ4A 2OPQA 4YB7A 3P96A 4ZVQB 1BQNB 2HQ3A 3SDEB 2WVBA 3W62A 3W2WA 4R0JA 1NJYA 5HVGA 2A6OA 3VVTA 1U1PA 4DR5F 3I32A 2HFUA 1P6TA 1RAGB 1UFWA 1YKWA 1E6VB 3CIMA 1TKDA 3D1QA 2FHJA 2FTRA 3CDWA 4QOTA 2HWIA 5KFFA 2CNLB 1RQ0A 1KBRA 2CQIA 2DH8A 4PG8A 4S0MA 4DFPA 2IM2A 5GAHU 4DV5J 1NM2A 4NASA 3HF5A 4FYWB 3HO1A 1RCOB 5CYMB 5KOWA 1NK9A 1RYSA 1HR0J 4ZPTR 5ADZA 1S9FA 4J9KA 4TVAB 4DLGA 2JOQA 2OUGA 1VQ7S 1YJUA 2FYXA 3NWGA 5DGBA 2RQ4A 2HGNA 4NLRA 2W2NP 3KJFB 3HT0A 4OJHA 1RWXB 3S01A 4OZ1A 1SIWB 3QZ7A 2NS1B 3DCAA 4CRJA 4K4ZA 1VJWA 4IDKB 5B0BA 1DARA 2LFVA 3A13A 2HFZA 3CDUA 1KDNA 3NG8A 1NXIA 2V63A 7FDRA 4USWA 4DV1J 3UN2A 1IBMJ 4JI7F 1M0SA 2XCPA 3NOCA 5L38A 2V94A 3GWCA 5JUMA 3FEYB 3LWMA 1TKXB 1X7VA 2BEFA 3CCJS 2HHHJ 4ED6A 3E8OA 4X66F 3MEKA 2RE1A 3MR2A 5E7OB 2A2DA 3OXLA 5FDLB 1JMTA 3CJTA 2LXIA 4KFBA 4YDXA 4JI8F 3HPOA 2HHQA 2O67A 3JS9A 1U6BA 1SUQB 3BYPA 4UOCA 2DNNA 2AW0A 4RW7A 3JSRA 3U7JA 3BO4A 4FPRA 2Q6BA 3Q89A 2DR6A 4RUHA 2DO0A 3DLGB 1VIOA 2ZJRQ 2EK1A 3K0JA 2I2YA 1XBWA 2IVFB 1QTNB 4DUTA 1D8YA 2PD1A 3DOMA 2BJ1A 3RAMA 3MCMA 4UOGA 5KFWA 3KG0A 4WTYA 1AROP 5DQGA 2L08A 2KT2A 1LEOA 3UO0A 1NH8A 3M6UA 2XM3A 1TL3B 1BHNA 1TL1A 1WOSA 2J7WA 5T7LA 1NU4A 2OFGX 1JLGB 1FKOA 2I5JB 4M5KA 1M1GA 5AXMA 1X4FA 4FF1A 4FXDA 1Z4UA 2ZHAA 3HZGA 1EB0A 2MQNA 3BKUA 1TFWA 4RO0A 2QA1A 4N8OA 2FLPA 2F65A 2R8IA 3NY0A 4PXBA 3J7A1 2F8HA 4JI5F 2YXLA 3N6MA 5LJ5Y 4KHPJ 1GNKA 4OJ3A 5GADI 5IT9U 4I2PB 3DRSA 3V6DB 3D9BA 2AEMA 2OEJA 1UA1A 2E9TA 3VZHA 4ZA1A 3TAMA 1IKYA 3H42A 3N5BA 1UVIA 3CMES 1LOUA 2MQLA 3LGMA 4CO1A 1SKWA 2BA9A 5LMNJ 2R3VA 2G2ZA 2HURA 2QMXA 1W25A 4NX9A 5KFSA 5CABA 1HLWA 4O3RA 3KMSA 4KGVB 1T9YA 2CJQA 3VGUA 2DR9A 2OPRB 5ETTA 3CC4S 2EFVA 3CXCR 4MKBA 2B9WA 1P1TA 3DGVA 4LJMA 4P73A 1HPZB 3CGIA 4ZJLA 1FRLA 2EI5A 2R7SA 2DNRA 2DNGA 2X1AA 5GAGU 5A8RB 4CI0B 3DRRB 3UPFA 2KH9A 3NNCA 4DMZA 2BJ3A 2FPHX 2JRSA 3UDLA 4KHRA 3BPDA 3DDIA 2XZDB 4C7QA 4LFAF 5KFIA 4QYZJ 1HWUA 1MLAA 3K58A 1QSSA 1Y10A 1UP1A 1WOOA 4AXJA 4DSFA 2DNQA 4P71A 1FVSA 4ED8A 1K9MT 4PUOA 2B0GA 4WBFA 1IKYB 3UR0A 3CPWR 3SV3A 3T1HF 1JXVA 3QIPB 5DG7A 2RMLA 1HQEA 1FK9B 1UJ6A 2WB1D 1T02A 3ZTOA 3BM7A 2QLWA 2RNEA 2F4VF 4NLOA 3T1YF 4KJIA 1FDDA 2M88A 4UT4A 1Y11A 4DCJB 1NBEB 2DGWA 4B3OB 1VC5A 4JV2A 2HZCA 1L3TA 2YKAA 5DS7A 1M5PC 4CLLA 3T9ZA 2B5JB 3BO3A 3RB3A 4ZPAA 4RBTA 2BACA 1MU2A 3GILA 2Y0BB 2CQHA 3I56S 3QRPA 5E41A 1GFWB 5FJ4A 4ZMMA 1BLUA 3D5MA 3GR1A 3HLUA 4FYVB 4QBUA 2MLXA 4JI0F 4ELUA 1Q53A 3CNQP 3DOMB 3R5GA 3MMJA 2KDOA 2GNKA 2VF3A 3OR2A 5F8IA 1U49A 4E2FB 2I0XA 3C15A 5U47A 4IOAQ 1EKSA 1WDDA 4ZVRB 1U4BA 1WC5A 1J27A 1DTQB 2HRTA 4K4TA 3JSMA 2IA0A 3X1LB 5ETLA 3R7NB 3M8PB 5I3QA 3B6BA 1TKZA 4NPOA 4ZP8A 1AW0A 2F40A 1VQPS 4I6YA 2OMLA 3CE8A 2LEBA 1FVQA 1YGYA 2KRRA 3B82A 3OLBA 4OYZA 4LVNP 4B9VA 4F50A 4MK8A 2PI5A 3GJRB 1N8RT 2QYGA 1FKOB 1JLGA 3FSXA 5IC4B 5KFUA 4NYZA 4TY9A 3TI0A 3T6BA 2X51A 4M8LA 3M8QB 3PJWA 3PXGa 1CQNA 5KG3A 4WK1A 4I67A 5MLCV 4LF6F 5CYJA 2KG1A 3J7AN 1F0XA 2KVIA 1NDPA 2R2RA 2ZH5A 2VFSA 2K7JA 3ILJA 2ZH6A 3R8YA 3DKDA 4L73A 4JI6F 1PSDA 1BXNA 2R7XA 5EWEA 2AYEA 3LF0A 2KZMA 2DRAA 4J9VA 2CZ4A 3MOZA 4WF9Q 1IR0A 5HVHA 5HBMB 4LFBF 2BKNA 2CRLA 4B3SF 4MJKA 4Z37A 3PACA 5F9NA 4LF5J 2Y9HA 4ED7A 2RQKA 2BVZA 1FEEA 2W9BB 5IXUA 4LF6J 4F2SA 4OI0A 1RT6A 2F9DA 2L3MA 2OPRA 2R4FA 2VD3A 3BBBA 4ALZA 4JI0J 2XC9A 1TL5A 5EX0A 5JVGQ 4CO2A 4MIAA 6FD1A 2FHMA 4LFCJ 1BWEA 4Q45A 2NYHA 3HD2A 2NYIA 2P9EA 1S6OA 3D54A 4PAAA 2CPZA 3IGNA 1I51B 3IG1B 4M5IA 4LF5F 1TUVA 4LF4F 1LW0B 1YBUA 3MPUB 2DGTA 2M4MA 2W2PP 2W7AA 3ITHA 4QZVB 5LM7E 4FYXB 3CO9A 1JJ2R 2UU9J 4OV6A 3BS9A 4DQQA 4ZK7M 1XN9A 5SZTA 2V8VA 5KFBA 2OO4A 1VOMA 4WIIA 4NRTA 4C48A 3TAQA 2NXNA 4ZP9A 4LFCF 4NLSA 3BJYA 1TELA 4OHWA 3UNYA 5IWAF 2IVYA 1RP5A 3NCQA 2RS2A 2BDPA 3KHLA 2KB2A 3PX4A 1B64A 3QGIA 1U8SA 2F63A 2CQ4A 5AE1A 4LF4J 1IQTA 1VQSA 4ECVA 1C0UA 3PHTA 3ZFVA 4K7QA 4OJ1A 3GG0A 4PZVA 3ENQA 4ED1A 3IR7B 2D69A 2HBRB 4MMOA 4DUYJ 4JV1A 5L46A 1RLDA 1V3ZA 3RBZA 3ZO7A 3E2EA 3NGTA 1DURA 2D3UA 2HAIA 1Q16B 4P2XA 4BC7A 5B0GA 3OJSA 3MUVP 1PGZA 2ZNZA 1T03B 2J8AA 4LREA 5K8MA 4Q44A 1RU2A 1WOPA 5CYQB 1KQKA 3W9HA 4LF8J 4M94A 5F0WA 4BS2A 3CCTA 2FJAB 2WAQD 3QBCA 2KJWA 3MZIA 4X4TA 4JV5J 3DMJA 1SKSA 2M3DA 2VFRA 5FDLA 2BABA 4RW8B 1U1LA 2K2PA 2ACYA 2B4VA 1JKHB 1U6ZA 1DLOA 3GJQB 1QVFR 3G4SS 2JC1A 4A8MP 3NAIA 2OLWA 3J7YU 4FDFA 2RRNA 4WP9A 3SZ2A 2W9AA 1U1OA 3B8HA 3VAKA 3CUNA 2ALZA 4HTJA 2QMWA 1S59A 1HKAA 2GHVC 4FF2A 3UD3P 1VQ4S 2HIYA 4QR2A 4LF1A 4WXOA 3TJ9A 3K5LA 3GFHA 1IKWB 3JSBA 2LLZA 4F4XA 2K1RB 4I56A 3HHKA 5IWAJ 3CCES 2Q6CA 4LRCA 1W26A 4PYDA 4WFAQ 1YJNS 2GQQA 3LP1A 5DLGA 4USHA 4LMZA 5EUHA 2EKYA 2DHAA 4RZRA 4DS5A 1WELA 3OL9A 1HI0P 3DHWC 3DLEB 4DZ6A 1NO8A 2GAHC 3GPAA 3M4XA 1UMJA 3AODA 2KG0A 4WFBQ 5KTQA 4EFAC 2J5AA 2FY1A 1S6UA 5LXYA 4DV0F 2XMWA 3MAAB 4AUKA 5D0HA 2BANB 4WFYA 4J9OA 4NLYA 1S1VA 2MXYA 4M5JA 1WF1A 3DOKA 3M1VA 1NCLA 9RUBA 4KH0B 5FLXU 3QO9A 4PG7A 1JX4A 2DR7A 1FHTA 3I9ZA 4U96A 1IKVA 1QDUB 1EETB 4NOHA 3CJQA 2W4CA 1IM6A 1C0UB 1UW9A 2R7QA 4KE5A 4C0HA 4YR3A 2ROEA 5J2PA 3EJMA 4DSIA 4ELTA 1NK8A 5IQQA 2CDRB 1CJUA 5THWA 3MM6B 5DJBA 2MJNA 1DQAA 2HQDA 3A3OB 1LWFB 2YPYA 4DV0J 1ACMB 1S77D 3B54A 1EQ0A 1L5UA 4DN9A 4X64F 3PFOA 2D3ZA 3WZ0A 5HMYA 1XNRJ 2YKMA 2ZKUA 5KFOA 1SH0A 2B9XA 3NOGA 5DRKA 1RYRA 1BWVA 2KRBA 1QE1B 2LKZA 4H54A 1S0NA 3WC0A 4USMA 1VLOA 3PNIA 5A6WA 1HNWF 4RNMA 1U02A 3KK3B 2DXFA 1GMUA 1RAJA 4CLYA 1FKPB 4AL6A 2FC9A 3EICA 4G1QB 5IC6B 3DLGA 4ICLA 1ZTWA 3D1OA 3MAAA 2IYIA 5J2QA 3POTB 2BQ3A 2FJEB 4TN2A 2VG7A 2RILA 2FJBB 1SVDA 4DR1J 3T1YJ 4P2MA 1FTCA 2VDIA 4ED5A 2HHPA 3DLJA 1ZM4A 4LF8F 2DXDA 5LSOA 1U24A 1D9FA 1NSAA 2VG5A 2OIHA 4A8FA 3H5UA 2C28A 3Q86A 2XMAA 2BKOA 4IH6A 4M1KA 3J80Y 1SJ4P 1FDBA 1FD8A 3HSZA 3EVWA 2C2ZB 4UOHA 1RU1A 3LGNA 4CH0S 4DLEA 1AYEA 4O3SA 1JLBA 8AT1B 3GQCA 3G8SA 4HHJA 4HTIA 3UCGA 3JYTB 4KTQA 4ED2A 1HR0F 5KFGA 3M8SA 3Q8UA 5E3PA 1F5CA 1K1QA 1J5EJ 3DC2A 4Q2MA 3P4UB 2JVRA 2FJXA 4X4PA 2HFVA 2O01C 4DX8H 2F1FA 1FWLA 1JNRB 1JLBB 3QT7A 2GO9A 2BR0A 3TJAA 1CEZA 4F3MA 2A0FB 1O8BA 3MTJA 4QWAA 2PO4A 2I6WA 3BBCA 1SV5A 3UN3A 3OFFA 4XAKA 1SI9A 4PPZA 5J1NA 1RKJA 2OH2A 1CVJA 2E5LF 2XHWA 1JWWA 5DGAA 4JOUA 1WHXA 4WPAA 5J2PB 1NDLA 2A18A 4CLPA 2FIUA 3GIIA 4O0IA 4QYRA 1T03A 4Y2KA 1QM9A 3POTA 4KBIA 4DPUA 3VV2B 1F60B 2YKNA 2DT9A 3CD0A 4TYBA 3CCMS 2FVRA 4P6QA 3BGUA 4OYPA 3G82B 1YZ7A 2VPYB 3NAHA 1HWKA 1LWEB 1NLKL 1I94J 2KFNA 2YWHA 3HD1A 4Z2XA 3GYXB 4O4GB 2BQUA 2HGLA 4F4YA 5K8OA 5E2QA 1RABB 3QAUA 4B3SJ 4NMLA 3H0PA 4DV2J 1SQFA 3TUPA 2JVOA 1PAEX 3EWGA 2M7SA 1GXTA 2BZ2A 2MDAA 2ZVIA 3C6UA 5HBMA 3X3UA 1JIHA 4TY8B 3T5HA 1K8AT 2JX2A 1KTVA 2V68A 4D3GA 2J6TA 4AL7A 3CF5Q 3GFXA 5BYQA 4FKXA 1CJVB 3V2UC 3E3XA 3MEGA 3NRBA 5CCLA 3HVRA 5AT1B 2B4UA 2BV3A 5ETSA 3N4WA 2Q1LA 2G4BA 1MN9A 1PJ5A 5J2NA 4JI3F 4LSLB 2J8SA 5KFQA 3VAIA 1HARA 2W25A 2LQJA 3UW1A 2XSJA 4X2BA 1RSCA 4ID5A 4TKTA 2XY7A 3G87A 1XMQJ 3M9OB 2YKQA 4DZDA 1ROFA 1JLQB 3AXKA 4B9NA 2YX1A 4IG0B 2AEFA 4NL5A 3GV8B 2MQOA 4ECRA 2HZVA 3IR6B 2WSEC 3A12A 1WI8A 2KN4A 2YWEA 1S0MA 2UUCJ 2KU7A 2BM1A 5KFHA 1KSPA 3KLEA 4NLDA 5L39A 3PRDA 4CH1A 4F3QA 1N34J 3R6GB 1XR5A 1W7WA 3K7RA 3SQOP 3HM9A 2XO7A 2R42A 2DYAA 4KGXB 1PCAA 4GC6A 4ETZA 5DZ7A 2R8GA 1T3OA 3QSIA 4YOEA 3FMBA 1P9YA 2W2QP 4CLSA 4F4ZA 1RHJB 4CYUA 1T9XA 3FBEA 3M9NB 4B3MJ 2Z30B 2B9YA 2YVSA 3CT9A 3VAMA 1TL4A 2DGOA 1N52B 3ONQA 4HHUA 4ZPWR 1R31A 5GADU 3AD8C 2UXBJ 2ALYB 2RRAA 1K0TA 3RTVA 2UVRA 1NAQA 4OHZA 3PR4A 5KFTA 3RG6A 2IYGA 4P52A 4JV5F 2AT1B 4MK7A 4EBEA 1XR6A 3DXSX 2CIMA 1CJKA 3HVTB 3Q8SB 2ZBPA 5IFMA 4C11B 2ZZMA 3RW7A 1RBLA 4K4SA 4FZVA 4UUXA 3OTOJ 2CG8A 3MM8B 4UY85 1RCXB 2DEIA 2Y0SD 4FYYB 4O4GA 3RRHA 2WHOA 3PJ9A 4GO7X 4J91A 3ZTSA 1F6TA 3A8JA 3G2XA 3QYYA 5KG0A 4QPXA 4XO0A 3K5MA 2C2RA 1H3DA 4ETXA 4YFUA 3OL6A 4HH1A 3N6NA 4P7TA 4B3RF 2JLFA 1HQUB 2JNJA 3AA8A 3QWUA 2C3YA 3ZZZA 1A7GE 1DAXA 3M6WA 2ZFHA 2ZBIA 5IV3A 1F3FA 4EMDA 3QMQA 2HHUA 4C97A 2NXUA 3GIKA 3D6HB 2A1BA 3EGVA 2HRYA 1FFSB 3TYTA 4YP3A 1UA0A 2I8EA 3IO1A 2CQPA 3CCRS 4XDDA 2H4WB 5HROB 1XJWB 3PRBA 1V5VA 4RJVA 4FVCA 4E8UA 3RYLA 2IRXA 3MUTP 1KVKA 2CNOB 3I31A 3LP1B 2DVIA 3ZTPA 4DOZA 2W7PA 4F0HA 2XZWA 1R0AB 3KUGA 1WEYA 4ECUA 4ER8A 2C2NA 1KC8T 2KFZA 1IXKA 1NNDA 1NDCA 2R8HA 4F4AA 3H5SA 1X4HA 2DGVA 4QIGA 1YLXA 4Q2LA 1YBTA 2V8GA 4IG0A 4WXWA 3WX4A 3AOBA 3CCUS 3M2UB 3W7BA 3R5BA 3I82A 1X9WA 2DH7A 2PEHA 3M8QA 3M9MB 1OMSA 2IJRA 2IRYA 2L48A 4E0DA 2YNFA 1HA1A 2E1PA 4R8UB 2OEKA 3QT8A 1N5YA 5H9FJ 2YWFA 3TUZC 3BDPA 4NLXA 2IHR1 2HHTA 3SCKE 4RU9A 3VQTA 3HXMA 1B0TA 3LAKA 1HWLA 1VQMS 2AGOA 2ZH2A 5KFAA 5CAAA 5L1IA 1RLCL 1YSJA 2H65B 3I9V9 3IRWP 2C2EA 4V19X 2KTQA 2R7UA 1P9QC 5KFMA 2G0IA 2AD9A 4DL3A 1TKZB 3LALA 3VWSA 4NCAA 1MSWD 3I55S 5B7WA 2D7SA 4LT6A 2RB7A 3V4IB 2HMIB 1ZAXA 1TL1B 5T7LB 3EVMA 4K59A 3JSMB 3IA0A 4EU0A 5L9NA 1VQOS 1HNWJ 4FKYA 1U1KA 3C15B 2KM8B 1U1RA 1XR7A 2CQCA 3PO4A 2E5JA 2N4CA 2QGFB 2YNHB 3FGVA 3OFGA 3OXFA 4DX5A 5B0FA 3KLGA 3KLFB 2V2VA 3RRGA 2CKWA 1RT5A 1Y0HA 4KYZA 2YKNB 2KT5A 2U2FA 2DIUA 2OPQB 3GMGA 4DX6A 4Y34A 3TAMB 3HJFA 2UXCF 4I0WA 1YTYA 3ETMA 3FUYA 1FXDA 2RH3A 4ZP7A 2YKOA 3VF0B 4DPTA 2W8KA 1JNZB 1HNZJ 4DV6F 3C3LA 2JJ4D 3J81Y 4QIWD 1K1SA 1FJCA 1HWJA 4U7UD 1YJ9S 5K14A 4ZPCA 3WHIA 4ZCKA 2Y8YA 4O3PA 5KFDA 1PYOB 3MI7X 4HACA 1LXJA 2UUWA 4YR2A 1EETA 3ZZRA 5CQGA 4Y00A 1KNZA 3W60A 1NHKL 2DNOA 1DTQA 2HQIA 4CTAA 4OI3A 3MMCA 5EX3A 3T3FA 2XULA 3MPWA 2QLFB 3IMQJ 1S97A 4I6AA 2FLLA 3R9LA 1RAOA 3GJSB 2ADCA 5C25B 3Q8PB 1HHSA 3D6MB 2IVMA 1RWOB 2WW8A 3MMBA 1QJHA 1RWNB 3F56A 1Q8KA 3WIVA 1LK7A 2WOMB 2MKIA 1DFDA 2V69A 1R8PA 3T6JA 4NA1A 2XSFA 1C4CA 1V3SA 2H3EB 5A8KB 2J0QD 4C0OC 1B0VA 1RTJB 1T9UA 1S7IA 1YHQS 2E5LJ 4P9SA 3HDSA 4N56A 3CCLS 3KLEB 4KGKA 2MMYA 4KQZA 5KFYA 4Z7CA 5J1PA 1M90T 3ZZYA 5AJ3J 1N36F 1VISA 4NA3A 2HBZB 1V6HA 2Z58B 3G71S 3W65A 2ZZTA 2W2MP 3JQMA 4LRDA 5ETKA 3V4MA 4EWTA 2KJVA 2GQCA 4PXCA 2ZWOA 4G1QA 4C3MA 4TQRA 3ZZOA 4IDKA 1RISA 1HFEL 3SCIE 4C8LA 1UWAA 3JTOA 3I5CA 5J2NB 4PPDA 1J5OB 3BDEA 1WHVA 3PCOB 4OFZA 3US5A 3KMQA 2HNZB 2ZZNA 3QIDA 1PO6A 2J9CA 1R0AA 2UXDJ 2YBVA 4X4VA 1S72S 5AXLA 4RW6A 4ZVSB 5H1SV 5CYMA 3Q2TC 2B6AA 4B9UA 2LA6A 1S57A 3A4TA 3E51A 2HRUA 1SC4B 1GX6A 4L75A 4R0EA 5K8NA 4RW9B 2YQ3A 3OVSA 2BQRA 2HWHA 3VALA 1CBKA 1REGX 5HANA 3IM8A 2FHKA 3UFCX 4NCGB 2GHPA 2XI2A 2EFQA 1XMOJ 2CQBA 1S1VB 1F9HA 5HMZA 2W7OA 4L3KA 1S5ZA 4O3NA 3CDBA 3L7PA 2QSFA 1D3WA 3NEKA 1KKHA 1XQIA 4A48A 3J7YI 4EO8A 4DV1F 1NJIT 2E29A 4Y2MA 4ZLNA 5HQMA 3I0SB 4K2JA 4MYUA 5G0RB 5T14A 1VBXA 1M5HA 5DM7Q 1RT4B 3MM7B 3Q83A 2B4OA 1R27B 1PYTA 1SV5B 4OZ2A 4F0KA 4ELVA 1VLYA 4N77A 3VAJA 3IR5B 1RWKB 2DNMA 4OZNA 1DBDA 4LRFA 4RLEA 5CHCB 4RWWA 5EHHA 4LF7J 2AEJA 3QRRA 3V6HA 4B3MF 2CPIA 1GAOA 4J9QA 4PXEA 4HDHA 3HKZD 1AA1B 1FTRA 3QT5A 4IFYB 4OZ0A 4CLWA 2C2DA 3R2DJ 1RT5B 1Y5NB 3AA9A 4JYAF 4EBCA 3Q8QB 2ZJPQ 1RTHB 3T1HJ 1DTTA 2DHHA 1JXLA 3QFWA 4DWIA 3C8YA 1UVJA 3QJPA 2EWHA 2HS3A 2OPPB 3C19A 3BKTA 1Q79A 1R8HA 1CJVA 2VBZA 2MZJA 4LQ9A 3NS5A 4ATNA 1AUSL 1Y3JA 3R97A 4OLOA 2VQFJ 2EFNA 3FC9A 3UNGC 4LR8A 1U1MA 1HPZA 1SBRA 2OFHX 2VG5B 3CD7A 3L09A 4CDIA 3RBEA 1NK0A 1TQLA 3OL8A 4DL4A 4CP5A 4YHHF 2WOMA 2JFKA 4Y0FA 1FNOA 1SC6A 1ZTTA 3FQLA 2MYFA 5EN1A 3H40A 5I4MA 1Y5IB 1QAIA 1QTMA 3TUJC 4MTPA 1FDAA 2RUSA 4WE1A 4X65J 4IO1A 2WW4A 1BC6A 1RT1A 2AQ4A 3D7SB 4DR6F 8RUCA 3TRGA 1FFWB 3N5FA 4M63A 4NZ6A 4LSNB 1FRKA 2ZUAA 2RHQB 4LSLA 2M2BA 1QY7A 2P5VA 2VASA 2HNDB 3UVJB 5GAGI 4K4YA 1WSRA 1N5TA 1FA0A 4IKAA 1QE1A 5IT0A 4EYIB 4DL6A 1W2BR 4FF3A 3MEEB 4OYMA 4WP8A 1Z2ZA 3BSCA 4USUA 2JLEA 1N32F 2DY9A 1ZM9A 1EKRA 2OAUA 4P7VA 2FHJD 4DHVA 4ZITA 3MFIA 5F8JA 4G1IA 3CVKA 3SSRA 1SJFA 5H9FK 1AFJA 3LWLA 3M8PA 4AXIA 5LSLA 1U25A 1K0VA 2E66A 2GA7A 4DQIA 2D3OR 3W3SA 3G6VA 5L1JA 2VA3A 1IKVB 4OYAA 1UJ5A 4WFZA 3PHEA 4WIQA 1OSDA 4ZVHA 2F8EX 2WSCC 1UZHA 4ZOSA 1SXLA 1GMWA 5DQHA 1NJWA 1VQ5S 3WC2A 2NQPA 1VQNS 1DJ0A 1HQUA 2L9WA 3AOCA 2LQ9A 5HI7A 4CYUB 2IMOA 1LK5A 4LIRA 5KFLA 4DR4F 3M8WA 1X9SA 2BE2A 3ZNJ1 5I42A 2DCLA 2MJUA 4DBQA 3CJKB 2XBPA 4QW9A 2ZM6F 4H4MA 2R7OA 4KFBB 2VFUA 4W92B 3IFEA 3OFHA 2BJDA 1L3SA 4AD6A 2R7TA 4OQJA 1N0UA 1H72C 2MKYA 2V34A 3ENWA 1IR1A 3OTDA 1A6LA 5T41A 3DLKA 4HT5A 4ZVGA 3SMZA 1S4FA 2QC3A 2HHSA 2AJ2A 2VPXB 2DPIA 2DO4A 4NXNF 4ICLB 1MROB 3BGRA 4PQUB 3O6QA 5SUHA 1C4AA 2CFXA 2E5HA 2F3JA 3E01A 3LPYA 4ZPVR 3J81U 3PX0A 1F2GA 3LW5C 1RTHA 2UV8G 4OYOA 4YN3B 4P74A 1DQ8A 1F5BA 4WU2A 3UR3C 5HQLA 2CPYA 1RWVB 1YJVA 2OD6A 3AH6A 2R2SA 4IRCA 4M95A 2RT3A 4KC5A 4CLFA 4OLPA 1JLEA 3HT3A 3N01A 4O44A 3VGTA 4CNZA 1XEZA 3EGNA 3KJVA 2DJWA 2M52A 1XC9A 3K8VA 2V4JB 1NH7A 4TLQA 2Q3PA 3SBMA 3PR5B 3A3NB 2NSCA 3VR1A 1RBAA 3SFUA 2VIHA 2W8LA 1TVRA 3G86A 5CZXA 1YRUA 2BJ8A 1RTDB 2E9ZA 1UTAA 4V1Ak 3LANA 4DPWA 4DEZA 4HYKA 2GVDB 1M5SA 2QSWA 2V8HA 2VPWB 3QO9B 2U1AA 5HMXA 4K0KF 1KWMA 1S0OA 4UY8T 1S1XB 2AYGA 4ZP6A 3MAQA 2E7VA 1S9GA 1BQXA 5JXSA 4CO3A 5GAEI 5IV4A 5HLFB 1FNXH 1KD1T 1QSLA 2UVWA 4IG3B 2LQ8A 4N76A 3QRQA 4GKJJ 1RT7A 3BH7B 2BYCA 5D4NA 5AE2A 2ZM6J 1OYDA 4DV7J 1JLAB 2IFXA 2QEXS 3M8ZA 1M1HA 4QIFA 2H4YB 4PABA 2E1AA 2XLJA 1RKIA 1UFLA 2IIHA 3DOLA 3ULHA 3AQOA 3UDCA 5ETPA 3Q22A 4ZVTB 1RACB 3MCOA 3F73A 5AJ3F 2QYCA 4IFVA 2ZKTA 1WKJA 1WJ9A 3I0RA 5ETQA 3K5NA 1N36J 1WC0A 2XB2D 2HNZA 3QQCD 4TLRA 2DR5A 3MTKA 4ZN1A 4PEOA 4F36A 1N56A 3M2VA 2W4DA 4OZ3A 4MKVA 2JFDA 1N33J 4ES1A 4M5GA 2QA2A 2ILZA 1WG1A 2QL7B 2RUGA 2CUYA 2CJ9A 2KHDA 5G4DA 4ANEA 2IMWP 3DXBA 3QWPA 2HFNA 3U1NA 1I5OB 4B9LA 2BANA 2BXJA 4PG6A 2XNQA 1L3KA 2CJKA 3OFEA 4H4OB 3H98A 4C8NA 3PO5A 3QSYB 5D8HB 5KT7A 3SI8A 3A8IA 3NNHA 3H90A 1UWBB 2VFVA 4ZPDA 3SYZA 2WONA 2XZTB 2HPUA 3Q0AA 1FXLA 3BGFA 4FN5A 4ZIVA 2VBWA 3NGSA 4DV4F 2J9EA 2QFIA 3PEJA 1NB2A 2CDQA 3S7RA 4R5PA 2R8JA 4JI7J 3SIPB 2J6SA 2O5DA 4QJVA 2EXUA 2MSSA 1MNEA 4MH8A 4NLGA 2QT7A 3AD7C 1XMBA 2HBQB 3CSKA 5J2QB 2BOAA 3EVOA 2KO1A 4J9PA 4C9DA 3AQPA 4OHYA 2R7VA 4DU8A 4UF4A 2XS7A 1U8WA 1GK8A 3MUMP 4HL9A 2ZUGA 1RAIB 1N6QA 1OWXA 1T9TA 2D74B 2DEJA 3JQKA 3SCLE 2OELA 2W1BA 3M2UA 2GW8A 4HI1A 2HBYB 5D4LA 2JSXA 2P6SA 3O5TB 3NGRA 1H38A 4Y28C 5EDWA 3H5YA 3RB4A 2HIQA 4M5NA 1CG2A 1RADB 4EBDA 2I9SA 4P10A 2ZOGA 4F25A 5DDPC 2H5IB 1QVGR 3MDFA 3H2VE 5LMNF 4EZ6A 4IQXA 3OTBA 4B9TA 1TL7B 4AL5A 2OEMA 3RZAA 3FFIA 2Y3YA 3BO2A 2HHVA 2G9OA 1FCAA 4FS1A 5J1EA 1VIXA 3J81j 3NCPA 2MB0B 5HROA 3HZEA 4KKOA 5IQ6A 4QW8A 2GJIA 1KRPA 1N5VA 2I5JA 1S0VA 5FIIA 2DHGA 4CLTA 1SH2A 3W9IA 5HL7Q 5KT2A 3DGPB 4LVOP 2XMTA 4CQ1A 4JYAJ 4MKAA 4L6V3 4OJGA 3TA1A 1RT1B 3TEGA 2V4QA 1S1XA 1HBUB 2F4FA 2H54B 3KWMA 4DR3J 4ED0A 1XIQA 2DHSA 1U1NA 1S49A 1YRXA 2EG2A 1GX5A 2GVDA 4FBTA 3KK1B 3ZNUA 4USTA 1B4SA 1GEHA 1HNIA 5A8WA 1IQZA 1S6QB 2PMWA 1KS2A 2AWZA 3GCXP 1HW8A 4PR6A 5HQ8A 4CCHA 2EFOA 1HNXF 2VB6A 3HSDA 2AX1A 2MZRA 1HBMA 2HQCA 5F8HA 4XIUA 2O66A 5F8LA 3TZXA 1NKCA 3D4JA 1GXUA 3R6LB 2HYIB 2A2CA 4X64J 2P9GA 4KY3A 2BOPA 4DR7F 1RAAB 2Z2MA 2AJFE 4A8XA 1JJ4A 2FLNA 1KTQA 1T95A 3M8RA 5KG6A 2ZD1B 1H6KX 3AAWB 3IC1A 1NK7A 3BGRB 3DU5A 2HFOA 2DBBA 3CEDA 3H7HB 3ZTRA 4I7FA 3C16A 3R5AA 3DI6A 1WI6A 4RNOA 1UEKA 4USKA 1OS5A 1E6YA 1F9FA 1RTZA 2AIRB 3D6FB 3EMTA 3PKMA 4HLBA 3HVWA 1N54B 4DL2A 2EK6A 2PMHA 3KNGA 2GAGC 1RT4A 3MM7A 1AXQA 1ZOTA 1VQ6S 1RTJA 3I4PA 4W98A 4A8OA 4ZHRB 1PBUA 2BW2A 2EBGA 3KYLA 2EVZA 3H2UB 5CYQA 3L4BC 1SB6A 5KG1A 1ULRA 4ED4A 3GIJA 3P6YC 2EW9A 3NP5A 4NLPA 5A6PA 1IVZA 2V6AA 5IOLA 5L1LA 2CWKA 3F0NA 5A0YA 1I3OB 5C7PA 3GB0A 4DSJA 1FJ7A 1PG5B 1I6JA 3K89A 3TP2A 3KK3A 1FJGF 3F44A 1PJ7A 3MMCB 1ICEB 4IQMA 1O51A 1TK0A 2AX0A 1SJQA 5E33A 5LMUF 1M5KC 1JLCB 2CPDA 3V6DA 2ZC3A 3M32B 4KV8B 2K8GA 4OZLA 5D77A 1Y3KA 3CJ3A 1U7LA 4DR7J 4J9LA 4MFBA 4B3OA 4F2RA 1GMVA 5AXKA 3BPSP 4Y2AA 1Q86T 4Q8FA 4K50A 3C2PA 5A8WB 1X5SA 2EC2A 1FRJA 1Q5VA 2O3DA 2PT0A 4O3QA 5LSRA 3QATA 1XWLA 2HGMA 3RB6A 3W63A 1CPZA 2J0SD 1NHVA 1RZMA 2BM0A 3G82A 5LMUJ 5KFNA 2QL9B 2MLZA 1PKUA 1WEZA 2K7KA 4ILLA 3SXLA 4ES2A 3NS7B 2XI3A 2G1DA 4F4WA 4AE5A 2KXFA 4FP9A 1R7IA 2W24A 2Y1JA 2UUAF 3EYZA 1NKBA 3MOJB 2DNKA 1C2PA 1U0SA 8ATCB 1FRMA 1FWKA 1YBAA 1HQ2A 4QYZK 2OTJS 1T8EA 2W2OP 2V50A 1DZ5A 3M30B 2K3IA 1Q8BA 3OLAA 2XYHB 2HNYB 5G0RA 1VMBA 1CC7A 4M5DB 2DPJA 2V4JA 2V8DA 1VK8A 3ISZA 3EX7B 3EXYA 4IH5A 4Q5VA 1JLEB 2YWKA 3RGIA 2QFJA 2PI4A 2UUAJ 1X5PA 2XMVA 4L74A 1I1GA 2Z2YB 4UTGA 1UKUA 4TQSA 2XEXA 5DG8A 4R8UA 3TUIC 1G6BA 3JTPA 2R8KA 1VCTA 4USJC 3N9UC 2NR0A 1SKUB 3KUHA 1NMEB 4LFBJ 1TKTA 3FRYA 1H73A 1N6QB 1TTHB 3R3TA 2RKIA 4FXVA 4BWJA 3JYTA 1XMQF 5C5JA 2HVDA 3BSNA 2MSTA 2DISA 2HHXA 3PZPA 2AYBA 2FJVA 4C8ZA 5HJXA 4ITSA 4B9SA 2IAJB 2OKQA 3Q8YA 2JEGA 1WG5A 4RW8A 1K73T 4X4NA 4P72A 4H4MB 3GJTB 4UOFA 4YS2A 3OVBA 4OHVA 1BUXA 2EFPA 2MY8A 5I42B 2CWXA 3HCXA 5DDOC 5HO4A 1AB8A 3DLLQ 2N7CA 1OSCA 3ET6B 1NRKA 1CS4A 5D4OA 4OX7A 1REVB 3KK1A 3JAMU 4PQAA 3IP0A 3R5JB 4OHXA 3OR2B 3C6TB 5HK4A 1BQMA 2XMUA 3TO8A 2KHCA 2YH0A 3FKBA 4WK3A 3ETOA 5KFZA 2VFTA 1MWZA 2GMJA 3DU6A 2RF2B 4NI2B 3TARA 1CQMA 3UCUP 2L41A 3K2YA 4HI2A 2XO6A 4DR2F 1TV6A 2NZCA 2QLXA 1C1CB 2IBOA 3AFGA 2Z57B 1NSQA 4A8YA 4TU9A 2BRKA 1RA7A 3S1TA 3TJ8A 1DRZA 2G2OA 1H98A 2XWXA 2GC8A 2ZBRA 2OD4A 4P75A 3BYRA 2FJWA 2DNLA 1WF2A 2IAJA 3OTOF 3EM1A 4DU7A 2B56A 1OY6A 1N0VC 3BB5A 5CZVA 2QE5A 3GV7B 3CB4A 4F7VA 3KHRA 1VK3A 3OBIA 2R2UA 1N5YB 2B4PA 3LA0A 5F8MA 3V5RA 3MM5A 3KLVA 1GMWD 2WCXA 3D2WA 2R2TA 1LWXA 2E1MC 1PC4A 2NSBA 2MQPA 4N5SA 3BZQA 3D3BJ 1X5TA 4URGA 2HK2A 4P2SA 1UJ4A 1MMLA 2JDJA 3ENVA 3CMAS 1KLNA 2J6UA 1QUPA 4F26A 1YVFA 3PYGA 2P2CB 4NYOA 2X3GA 2Z2LA 4IOBA 3B78A 5LT5A 1U2RA 4KR0B 1U6FA 2UXBF 3GYNA 1VBKA 5IM0B 3HMJG 3J7ZT 5F3ZA 3FCHA 1EHWA 3FNNA 1ZA2B 4KGMA 1ZZFA 5ETOA 1GTHA 2RAQA 3T19A 3UWTA 2V4RA 3AB4B 3RRKA 3LGHA 2VQEF 3T5KA 2VJUA 3MPDA 2V0NA 4PWDB 3QT6A 3FZBA 1VJQA 1T9VA 4HR2A 2HVZA 1K44A 4IO9Q 2DNHA 1VI7A 3D68A 1O6XA 4DCPB 1EAYC 3MMBB 2C3OA 2G0JA 4RX6A 3U27A 3BQ2A 2MQ8A 3C16B 1KOOA 2GIQA 4F04B 4QWDA 4DR3F 4C8YA 1RHQB 3IAS9 1L3UA 5F3TA 2KYXA 1HBOA 1RAEB 4I1TA 2MY7A 5C42A 2QA4G 1SKRA 1U09A 4IR9A 2XSJB 4CTAB 1PBAA 3IS9A 1CULB 4LSZB 4CT9A 2DB1A 4GVLA 2CQGA 6FDRA 3PW2A 1S9EB 3M6XA 3LTOA 1H2VZ 3OXGA 3C66A 3JTNA 2HQFA 4K4XA 4RBVA 5KFXA 2C22A 2XS2A 2QX0A 1HBNA 3MR7A 3SFGA 1GT8A 1RK8A 2B9EA 2OMOA 1VFJA 3IWLA 3LUYA 3TA0A 3TR5A 4DDFA 3GIRA 4NE9C 4ECZA 4EYHB 1VQLS 3UDEA 1Q95G 4X4UA 2QZ8A 3UQSA 2XGPA 2CPFA 2MZTA 3NL0A 4PWUA 1YX2A 4A8WA 2RVJA 5B0AA 3ZTQA 5IS2A 1URRA 3HHLC 4TYAA 3OJUA 5K8PA 2NXCA 2J7UA 3R1HA 3OR1A 2VDHA 4HHHA 1FD2A 2RS8A 1Q1KA 1SH3A 1BQNA 4U7UK 2HSEB 1TK5A 5I3UA 4F8RA 2HHWA 3KG4A 3MM9A 4ZJQA 1MMNA 1OJ4A 2B6AB 3MR3A 2UXCJ 2IC3A 2HAFA 4ZHRA 2XNRA 1MG7A 1RE1B 2EBEA 4DL5A 1VDHA 2RSQA 3UD4P 1HNZF 4C4WA 4KH1B 3T1AA 3H5XA 3Q23A 1WEXA 2C2MB 2FDNA 2LU2A 3P5BP 5BR8F 3QJJA 3CJRA 1G3OA 1Y9OA 3L7OA 4GRSA 3CC2S 2SXLA 3GR0A 3HHNB 1BGXT 5D78A 3HSJA 5GVQA 1CULA 1KR4A 3ICLA 1HWIA 2OTLS 2V8PA 1G2EA 4YUDA 2GMLA 1F9EB 4MT1A 4WZMA 5IT9Y 2MEWA 2RF2A 4NI2A 5E3AA 1YIJS 3LH2S 2H5EA 4A8SA 2E1CA 1SIZA 2ZD1A 3PV8A 3O2IA 3KLFA 4ZVOB 2ASDA 1VQ8S 2Y8WA 3HHLD 5HP1B 1CC8A 1ZM2A 3PYDA 3IXQA 2LXFA 4URSA 2H48B 3DLKB 1IKXB 2UXDF 1FRXA 3MR5A 4M5DA 3IAM9 4OI2A 1JJCB 1OQ3A 5J2MB 2WVFA 1AZSB 3EZOA 1IBMF 1X4CA 4LR7A 1UW4A 2ZNYA 1YWXA 2HFSA 5EGYA 4LRBA 2ERRA 2AHOB 2CXEA 2GMHA 2HZAA 2XTJP 4WJBA 3UE2A 4X66J 1YI2S 1XMOF 4A46A 3GTYX 1NHUA 4RUBA 1NPPA 4C6AA 1OPZA 4JP8A 1EZZB 3SEOA 3H4DA 2ZH7A 4BBYA 3HP6A 2FD2A 2AU0A 4X4QA 4LIWA 3SDEA 2UV8A 4X84A 3W5ZA 5KT5A 2CG4A 2DY1A 2NUHA 4USVA 4BHQA 1G4CA 2DHXA 3TZWA 3DYAA 4RUCA 2HS0A 2JLGA 3THTA 3DRSB 2NPIA 1KN6A 2WRMA 1KLMA 4CM0A 2CQ0A 3GV5B 1YRTA 2RD5C 4FF4A 3B4DA 5KAKA 2DGUA 3FFIB 3LOUA 4C8KA 3K17A 4TXSA 4LF7F 3W5XA 5KT3A 3TX0A 1Q7LB 5B09A 4DL7A 2MLYA 3I5BA 4G3IA 2R7WA 1RJJA 2UVVA 2W9CA 3PYFA 3NGKA 4OMFG 1WACA 1R43A 2D1CA 2HNDA 3P8BB 4IH7A 1W2IA 3KJQB 2YNGB 4JI4F 2PDAA 3DRYA 1B99A 3CTRA 3IG1A 4U67Q 4FBUA 2GO8A 3DOKB 4WKRA 2XS5A 2UUTA 2JEFA 3T41A 2VU5A 1HBUA 1JJHA 1Z1ZA 5K5MA 1NJZA 1N4LA 4OI6A 2VHGA 2R9LA 4EEYA 5F9LA 3DRPB 4L3NA 5IZHA 1KVIA 3FEXB 4X4SA 1NPKA 2ZEJA 2JWNA 3G96A 4U95A 3THVA 3OD2A 2C3PA 3KXDA 4NXMF 3CCWA 2Z2ZA 1SJ1A 4F3OA 2PC6A 4UUWA 4Y2CA 3S8SA 4MAKA 5ETNA 2ZJQQ 1C1BA 3FQKA 4OX9J 1NSPA 2HKEA 1RB0A 3M32A 2CVEA 4Q7AA 2APOA 2MKHA 3M2RA 4I2QB 4QIEA 3GP9A 4X65F 3R1LA 3DDNA 4W4MA 4DG1A 5AE3A 2QN6B 4UZBA 2NXJA 1WORA 2BJ9A 1H2TZ 2MPUA 4PG5A 3TW0A 2GX8A 3NMRA 3W8PA 4OL8A 2KVQE 3Q24A 2ZH4A 2MKCA 1UPPA 2XMKA 2LU1A 3FBCA 2DCUB 2OGUA 3T9NA 5E5NA 5DDRC 2UP1A 3RR7A 5CXTA 1NPRA 1N32J 1ITPA 4ZCIA 2V9WA 2YKMB 3M05A 3T5LA 1U0HB 2OSRA 5B0DA 3OHBA 1URNA 1C1BB 1TZ0A 3Q8VA 2XHCA 3DOLB 5BJRA 2F5GA 2C1EB 1CJUB 2QG9B 1D0EA 2MGZB 3CDEA 1XERA 2ZOMA 3JSYA 1ZH5A 1S10A 3CJKA 2PEBA 5IM0A 2VJVA 3BQ0A 4YHHJ 1JLAA 4DUZF 1UWBA 3RU0A 3N79A 9ATCB 2HK3A 2ATCB 5AXNA 1E6VA 1EX8A 4Q43A 3CO0P 2AGQA 1JLQA 3IBFB 2VG6A 3M1VB 4KPCA 4DV3F 3IRXB 1EP4B 3H59A 2ZOFA 2BE9B 1FKPA 5KT6A 3FDSA 3DGPA 4DR4J 1APSA 2RU9A 1KONA 3BN7A 3TEHB 2GGPA 4LF9F 4MIWA 3PEHA 2LXUA 5DLFA 1VC6A 2RIJA 3UI3A 2ROPA 4DF4A 2MGZA 2G2YA 1TP7A 3I0RB 1B3TA 2C3UA 1T9WA 2KZZA 4OX6A 1D9DA 3KTQA 3BN4A 2MZ1A 4MYTA 4ILMA 1U0HA 2HLTA 3R27A 4DCOB 2CJYB 4RPFA 4RW4B 4NMXA 2QV6A 1VS3A 2HG4A 4GVBB 3BEGB 3FEZA 3EXCX 1P8GA 2JEJA 4WFNQ 2RDJA 2XGQA 1QAXA 1S1TB 2KFYA 4K2XA 4WFXA 3G6ES 3BKFA 1BQMB 2WVEA 4XDCA 2F4VJ 4ZJOA 1WTBA 3BH6B 1RWPB 3CD5A 3L95X 1HBOB 1RWWB 5C42B 3CJSA 4RR5A 1CS4B 3KG1A 3OTCA 3OT9A 2E5IA 5HSPA 4YY3F 4QCLA 3W66A 1ZAWA 1D09B 3TQ1A 3ZZTA 2DKOB 3W1YC 3W9JA 2JZ5A 1QSYA 1HL6A 2QTWA 3A3PB 2JC0A 5KFKA 4ECSA 1VR6A 3IWNC 4BLGA 2W9BA 2CZ9A 2CYYA 3K5PA 3W2VB 3IWXA 1R6VA 4XPCA 1R6YA 3L3CA 1S1UA 5JVHQ 1U2FA 1S99A 5F8GA 1VRQC 4ANDA 1OYEA 4DX7A 4K5SA 3F41A 1P1LA 3BR9A 3I96A 4O44B 4CLZA 3G8TA 2B3TB 1Y00A 3H20A 3MMAA 4AQYF 5HP1A 2YNFB 1FXRA 1VC0A 4G65A 4NXNJ 3NKYA 3GYGA 4Y65A 1LFPA 1JQGA 4OIXA 2ASYA 2BRLA 2E7XA 2CVIA 1TAUA 4K5RA 3D0IE 3MECB 3MEDB 3NBPA 2AJ1A 3UD5A 4DV7F 5HLFA 1OY9A 2XYGB 1YJ7A 3DHXA 4LUBA 1ZETA 2L9NA 3TAPA 4JI1F 1LNQA 2N3LA 2IDEA 3GLJA 4AFFA 2FC8A 4DG1B 4OI1A 1X4GA 2O1PA 3G6YA 3N28A 4FNIA 3EDQB 4B3TF 2KKHA 2QJ3A 4LR9A 4DF8A 2Z4PA 3N0VA 3EPIA 2PMZD 3CW2C 5KG4A 2FUG9 3ZXWA 1TMJA 1WHYA 5K20B 1LFWA 5KG2A 5E3QA 3PIOQ 3MEEA 1SQEA 4XTTA 2MHNA 3H2LA 3NNAA 2RU3A 2DH9A 4DQSA 3D0HE 4NWBA 3TX8A 1N33F 5KFEA 1X5OA 2BJ7A 4H4OA 2KXHA 2UUBF 1H7XA 3BSOA 3CULA 2HEKA 4OZJA 3RAQA 4K0KJ 1GTEA 2NREA 2X1BA 3MAHA 2X7IA 4KSEB 2HHHF 1VQYA 2PFDA 1YQHA 3LQVA 1FJEB 4QIVA 1VBZA 1UEVA 1MWQA 2DXEA 2VZ9A 2XY6A 4JI8J 1UVNA 2ZITA 3VQSA 2ASJA 1RUSA 5DZ6A 4RW4A 4TNOA 1FWPA 4ZLJA 2COLA 2X1FA 4IFVB 4UQGA 4C11A 4ECYA 1HIYA 4DS4A 1UFKA 3WIUA 2B8QA 1VRTB 3MURP 3SSQA 1GXLA 2DNZA 3RJMB 3K57A 1VRUB 3VAHA 2XY5A 4QWEA 2DITA 3OQ2A 2I38A 2QO3A 5BXIA 5FLXY 1ZA1B 3P5TL 3TZZA 2V2QA 1LW0A 3FCVA 4ANCA 4O0NA 4ED3A 4JI1J 3P45B 2E5GA 2KT3A 1IJEB 2CA9A 2ZE2B 3NWRA 2EEYA 1KEKA 2DR8A 4U8YA 3CCZA 2KYZA 3OV7A 2G1HA 3GONA 4DR5J 4QU6A 3HSGA 4PCQA 1BD6A 3GU0A 3QNWB 1FEHA 3CC7S 1KQSR 3PW0A 1RHKB 4Y3CA 1RT2B 3WX8A 1F2HA 2FVSA 5D0EA 4R5PB 1B0PA 3MD3A 4G6VB 2MKKA 3OSPA 2RHSB 2ATLA 2GHWA 3ISND 1FRHA 3W2VA 2HWTA 2LP4A 5E0OA 1T3NA 1R8BA 1F5AA 1Y4ZB 2CPJA 5L9XA 4NRUA 3I0SA 3MD1A 4CT8A 2FHOB 2BE2B 1TUGB 2UZAA 3GSIA 3NGUA 3KJVB 2OPSA 1R8AA 2BE7D 2XYPB 2ZVSA 1SJ3P 2Q66A 4I7FB 2IRUA 2AKWB 3ZZPA 5DG9A 4RL1A 1QAYA 4I64A 1ZPWX 2EKNA 1FNMA 2VL1A 3QZ8A 1K47A 2YNGA 5F8NA 1RWUA 2FJDB 2ZHOA 3HVAA 1NZ8A 4FPIA 2LQ5A 4WWSA 2H1YA 2ROGA 3D1HA 5LJ3Y 3EDRB 4DI6A 2V9KA 4RW9A 4K4WA 4N41A 4NA2A 2ASLA 1FDNA 3CIZA 2IDLA 2XWYA 1X9MA 4BDPA 3JQJA 4NXMJ 1VRTA 4CM2A 1FO1A 2AJ0A 1BY9A 1CJTA 3BBFA 1KQFB 1JKHA 5D0GA 3ZC4A 2DIVA 1VQ9S 2VV5A 2PSZA 1LWFA 4IRKA 2BKPA 1WC3A 1XNQF 2VODA 1RT3A 3G8QA 4PKDB 1T05A 2OP5A 3M7VA 1KQGB 4LFAJ 3RUBL 1CJKB 1F1BB 3HVTA 3OW2R 4EZ9A 2ILYA 4X62F 1FKAF 2CAJA 2IJFA 1IN0A 4I69A 4DV4J 1L3VA 3OL7A 1J5OA 1M5OC 3C46A 1LW2A 1R0BG 4CNYA 4HKQA 5M2UA 2GGPB 1RGVA 3TQEA 1TL3A 2C42A 4X4OA 3QGPA 6AT1B 2QLJB 1S79A 3QFHA 3TWZA 1EP4A 2E9RX 3U1MA 4YQWA 1S1WB 4CIOA 1FF2A 2EPIA 5DDQC 4DFKA 3BGLA 1RXOB 3FK4A 3ET6A 4M5MA 5IT4A 2W9CB 4J37A 2VC0A 4AT1B 4DR6J 4PRFA 1U2CA 2OPSB 3M6VA 2HMIA 1Q8IA 2AP6A 1N5SA 2RRBA 3TNVA 3BGOP 3UN5A 2ZHBA 1HNXJ 1S12A 1ZAVA 4C8MA 3LP2A 3BQ1A 1RAHB 1RHRB 1A0OB 2GS8A 2MZSA 4FXWA 5H9EJ 2DK2A 2VA2A 3TVKA 2FY8A 4MK9A 5GAEU 2YWWA 3QLHB 2NPFA 1FRIA 3NXZA 2WVDA 3JB9k 1KFSA 4ZVPB 3EE3A 4JI5J 4KHPF 1S9EA 2CJXB 3PRVA 5CD4H 4P2FA 1N88A 5K9FA 2B43A 3KK2A 3ITHB 3MPVA 1M1KT 1NJXA 3IS9B 5D3GB 2VC1A 2E1RA 3AJ1A 2Z56B 2QLBB 4OYIA 1C0TA 4U6PA 4IFYA 2ABYA 1MROA 4J9MA 4NYPA 4CO5A 1UEUA 3W61A 2XLKA 2DRDA 1VHIA 4KHMA 3IM9A 1XNRF 4PWWA 4KAIA 3ELHA 3PVXA 4ZDNA 1UVKA 4WKYA 1ELOA 1RT6B 1P27B 1PYSB 2LDYA 1HHQA 2MKJA 2F9JA 3Q2SC 2LCWA 4HH0A 4QWBA 3VTIA 5HJYA 5HMWA 1QUVA 2J7KA 2WZ1A 3VAFA 2V67A 5KFPA 3GIMA 3VHQA 1LWCB 1IJFB 1BE4A 1HBMB 2IC3B 4WP3A 2XG8A 4CZCA 2LEPA 3NS6A
chains in the Genus database with same CATH topology
2YNIA 3QGGA 1TV6B 3EZ5A 3MM9B 2LQBA 4UW2A 1JLFA 2G13A 5I3PA 1HHTP 4RWXA 2GV1A 3TVYA 1RTIB 2OPPA 7FD1A 2C3MA 4DR1F 3ZZUA 4H4KA 4O4RA 4WU3A 5KOXA 3HKWA 1WNEA 1AFIA 1S1TA 5DQIA 2PA3A 4JV0A 4KO0B 2M0GB 1H2UX 3LAMA 3TANA 4IUFA 3K8WA 3WBZA 1PC5A 5KT4A 4FYDA 4RNHA 1ZZNA 2M8HA 1NZAA 1MU2B 1S7HA 2Q43A 4QPTA 1LWCA 2M70A 2J0XA 3RB0A 4DL0C 2GIRA 2ZDOA 1FE4A 4J5OA 4TU7A 1RT3B 3V6KA 2LDIA 4JBCA 3Q8RB 4RNNA 1FK9A 2L9DA 2B7CB 4XPEA 1UVMA 4GO5X 3RBDA 4EGLA 3TVZA 1LKZA 3SCJE 5I3UB 1S9GB 2IJNA 3R5DA 4DV2F 3MEDA 3NBPB 1FE0A 1TKTB 2CQ2A 5HLFB 1HI1A 1NEEA 2DGXA 3IRXA 4B17A 3VZIA 5BYRA 1SL1A 1RTIA 1YJTA 4FNHA 4DSLA 1MMDA 1RTDA 1XTZA 4ID8A 5B0EA 2LECA 4R25A 2YNIB 3HI9A 2HVIA 3NCRA 1CLFA 2JL9A 2PN6A 3FRZA 1SL2A 5KFCA 4GKJF 2BUNA 1VGYA 2CQDA 1VQKS 4C0BA 4URQU 2E44A 1XK8A 4L72B 5DM6Q 4DUYF 2HS4A 1HMVA 1Q78A 3FJ2A 5B0CA 1HYSB 1UL3A 2R7XA 4NCBA 1IKWA 1DQ9A 1H0HB 2YKPA 5JJBA 2NUUG 3THPA 5GMKa 2DGSA 4ZKAA 5MAOA 1A9NB 4RBUA 3OSNA 1S76D 3B4MA 4PQUA 4QU7A 1FERA 2UU9F 2MQQA 3M2RB 2Y1RI 4I2QA 4CO0A 4I2PA 1HYSA 1LXNA 4WCEQ 4GC7A 4MKYA 2CPEA 1H7WA 1SL0A 3OUYB 4PWDA 1G1XA 3RW6A 1WG4A 3O44A 4O23A 3KLHA 2VH7A 3DLBA 2R7RA 4IRDA 3DN9A 1JLCA 2VBXA 4TU8A 2I1RA 3DRPA 4NLQA 1HNIB 3KOAA 2GCFA 2J76E 2FGOA 2LMIA 4C2MA 2LA4A 3FSYA 4IG3A 3KHGA 2W4PA 1S6PA 2YX4A 3S6EA 3KLGB 1DHMA 4DSKA 4ECTA 5A0YB 3H25A 1JLFB 3MM5B 2M8DB 2FVPA 2F8MA 1YTYA 3EGWB 2B51A 2DGQA 1ZBTA 3GE9A 1HBNB 4A4JA 3DLEA 3PIPQ 2AGPA 4I4BA 4K4UA 3KFWX 3I4HX 1Q8LA 4ZCLA 1HW9A 5C24B 2OJ3A 1IBLF 5CH7B 3PY8A 5CA5A 1D8ZA 2UVUA 3DI6B 3AJ2A 2RQMA 3DFEA 3O1LA 3CJ4A 2XLIA 3SV4A 4LSNA 4MIBA 1YJWS 4WYWA 5M2PA 4KO0A 2ZBCA 1WHWA 3MWBA 3NMAA 1X4EA 4KPYA 1T94A 2KI2A 1CSJA 2AYMA 3DLHA 1HMVB 1NKEA 3MEGB 1VBYA 4C8OA 4DFMA 2MQMA 4KIAA 3VAGA 1FESA 5A8RA 1OO0B 1MW7A 3C6UB 3LP2B 3T5JA 1U47A 1SUQA 4YDDB 3M30A 5A8KA 3PX6A 3DMJB 2ADBA 1RA6A 4FVMA 2A3JA 2DRBA 3GSDA 3H4BA 1Q4RA 4B02A 3WDOA 1R89A 2XCAA 4FS2A 2DTJA 2DD8S 4OI4A 1U26A 5EWGA 2BJEA 1WWHA 5E3CA 1NB7A 4ID5B 1C0TB 3LP0B 2ZE2A 4D3HA 1OPIA 4AYBD 3HHLB 3V81A 3MR6A 3KK2B 1WTFA 2IBKA 3NLCA 4ECXA 3TA2A 3UCZP 4H4KC 4KKOB 2VOPA 1JXEA 4OZ5A 2CQ1A 1YITS 2RQCA 2HNYA 5G0RB 1R3NA 4NLUA 3T5HA 2RJZA 3GG1A 1C1CA 4ZVEA 2FGCA 3GFZA 3SQGB 3MXHP 3OPKA 1TKDA 2JH3A 1S6QA 1Y5LB 1IM4A 4YB6A 1O5JA 1JB0C 4ECQA 3DYAB 4KRWA 1J5EF 1LWEA 4NLTA 3CJ5A 3V81B 2WB4A 1YG0A 1S6PB 3BSAA 4F02A 3C6TA 4NCGA 2CPXA 2PFFB 4F67A 2V2KA 4ILRA 2AF6A 2OSQA 2VKZG 4ZPBA 1D1UA 4C98A 4OV1A 5HN0A 2GFFA 3CCSS 1LW2B 3AB2B 2FB0A 4RW7B 4UQTA 4IOCQ 1S1UB 1N48A 5LL6d 5E3RA 3IN5A 4IYQA 5J2MA 1T05B 1G7CB 3N6LA 1RT2A 4KV8A 1KHWA 3CCVS 3A8EA 4EUVA 3QIPA 1N5QA 3CDAA 4Q0BB 2AV5A 1WD6A 4J9RA 2MHEA 3MECA 2KM8C 4PUOB 4WYLA 2YX7A 2XMJA 4W90B 2MZQA 3O3LA 4DJBA 3JAMY 1Q81T 1RDRA 2HW3A 3D28A 1VRUA 3A1YG 2EG1A 4U7CA 5A2QY 4C3LA 1X4AA 2VBYA 4Q8EA 3P49B 2HVHA 2E7WA 5C24A 4CO4A 3OTEA 1O0PA 2LYVA 4DV5F 3VCDA 5D6GA 2IM0A 3U02A 4BCAA 4C3KA 3EUNA 2YTCA 3I87A 4YEAA 2RDIA 1E6YB 4ZLPA 2CPHA 1Y7PA 3V6JA 2QRRA 4YR0A 2F7VA 3PM9A 5F0UA 2PE8A 3OR1B 2JEIA 4J9SA 1MWYA 4DN0A 2VKRA 1NK5A 4RUAA 4K4VA 1UAWA 4ES3A 2D9OA 3CJ0A 3G6XA 1I94F 2Z0GA 4Y6IA 1HD0A 2P6TA 3DRXA 4QWCA 4JUZA 1TAQA 3ISNC 3MM8A 1ZM3A 3D0GE 2ZH9A 4B08A 3PDNA 4RU2A 4OX8A 2G4BA 3FVYA 1KFDA 4MFBB 2POKA 4HDGA 3KLHB 4OX9F 1M5VC 2EFGA 4NLWA 1TFYA 3HFKA 1D9AA 5L8RC 4JI2F 3NGDA 2VPZB 2WTFA 1OIAA 2GJ2A 1AUDA 1V3RA 4RNFA 3EGZA 4BWMA 5KG5A 2Q79A 3HHLA 2J0WA 3E01B 3MPYA 2EC0A 2YWGA 1REVA 2KXNB 4WE1B 2VONA 1UETA 4I68A 4F4KA 3BF4A 1J2VA 4G1PA 4DPOA 5DETA 1WF0A 2UUCF 5EWFA 3AY0A 3V4IA 4HEA9 2K3KA 3DM2B 3PW7A 1N34F 4XK8C 2ZDPA 4EO6A 2AJQA 1LV5A 4WZQA 2YH1A 5DO2A 1HI8A 1IKXA 2DNPA 3K5OA 3EZUA 2PA8D 4ERDA 2JHEA 3H8YA 2PIIA 2N4DA 3RAXA 4YMEA 2RKIB 1X0FA 4BC9A 1ZPVA 3OHAA 2VQFF 4E98A 5D3GA 2J9DE 2H9ZA 4YB5A 3BR8A 3MFHA 5KFRA 3M2VB 3MGJA 4A8QA 2BBEA 2DNYA 3P3DA 3QPIA 4CH7A 3OVAA 3K59A 5ITHA 3SQGA 1B7FA 4ZVFA 5D4PA 1HNVB 4N47A 2WSFC 3I6PA 4NZ7A 4TY8A 3KKFA 4NLVA 4NZ0A 2FVQA 1KOHA 4ECWA 4O3OA 4PG4A 1L3UA 2E1CA 4GMKA 3CCQS 5CCMA 2DR7A 1IBKF 1FHTA 4QR0A 4N8NA 1U45A 4U9RA 3DM2A 1IUJA 2WONB 3R5CA 1QLNA 2CJBA 2MKSA 2ZH8A 4QR1A 3TOQA 3QJLA 1S1WA 2NLWA 2ZC4A 3LP0A 2P9CA 1GH8A 2VG6B 1X4BA 4J9NA 2PGCA 2YNHA 5B08A 1TK8A 1Q7YT 1Z2LA 3CJ2A 3IBWA 4DFJA 5BYSA 2GQ2A 1JK9B 5L1KA 2G0CA 2QIFA 4DSEA 2ZH3A 1U1QA 5J1EB 3QAEA 2B5JA 1Q82T 4RW6B 4ZCMA 4KT0C 1QAJA 1HNVA 3MM6A 1X8DA 4HVZA 1NK6A 2N7YA 4LQ3A 3U1LA 3PW5A 1KHVA 2K1RA 3DDKA 1HD1A 3G9CA 5GAHI 1TKXA 1X0PA 3FMWA 4Y2IA 2WK4A 4DQPA 3MHYA 5KFJA 4IR1A 3FZ2A 3RR8A 2AJ4A 2Y1IA 1VHFA 3BREA 3EPGA 5FD1A 2LEAA 2CJAA 1V9OA 3CWJA 3KLIA 4YB1P 1RI7A 3MMAB 2A10A 2HLUA 1OQ6A 2CZVC 4A8KA 4B9MA 3HK2A 1UVLA 3AHPA 3QLHA 3PFEA 2WBRA 4KB7A 1FT8A 5F41A 1KVJA 3DRRA 1TVRB 4X4RA 1YJRA