2FC9A

Solution structure of the rrm_1 domain of ncl protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
GSSGSSGNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords NCL protein
publication title Solution structure of the RRM_1 domain of NCL protein
rcsb
source organism Homo sapiens
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fc9A00
3CXCR 2MY8A 3CMES 5GAEU 2DITA 2DGTA 2XS7A 1VC6A 5FJ4A 1H2TZ 2MZRA 5DDRC 2MHNA 4LIRA 4A8XA 2VODA 1YJNS 1Q7YT 2NLWA 1URNA 1HD1A 2J8AA 2DH9A 1JJ4A 1DRZA 2L9WA 2G0CA 5DM6Q 3CF5Q 4YUDA 3OW2R 2F9JA 3FEXB 2MKJA 2XNQA 3G8TA 3B4DA 3CC4S 1IQTA 2JVRA 2CQCA 5LSOA 4PKDB 2DIUA 2J76E 2M70A 2CQ3A 2M4MA 5H1SV 3R1LA 3MUMP 4ERDA 3S7RA 2M2BA 4PR6A 2DNYA 2KXFA 1WHVA 2CPIA 5DDQC 1WEZA 2BOPA 2NZ4A 2ZJRQ 1RKJA 3P3DA 2RU3A 3U1LA 1DBDA 5JVGQ 1P1TA 2DO4A 2D3OR 2DNGA 2M8HA 4UQTA 4Y0FA 2FHOB 2LA6A 5HL7Q 1S79A 3G4SS 3UWTA 2RS8A 2DO0A 3CCMS 1FNXH 1L3KA 3N9UC 2MQLA 2MKHA 4U67Q 2DGVA 5GAHU 2VOOA 4WIIA 2PEHA 2LXUA 2CPXA 3BEGB 1OWXA 2JRSA 1FJCA 3S01A 2K3KA 3SDEB 1Q82T 2MXYA 2DGOA 1M5OC 1VQ4S 1JMTA 3B4MA 2KRRA 1M90T 1WF1A 2D9PA 2G1DA 3MUVP 2Q79A 4OZ0A 5DDPC 2PE8A 2J0SD 4QU6A 2DHSA 1VQ9S 3SDEA 1X4AA 3HHNB 2LXIA 1K9MT 5LJ5Y 4IOCQ 3U1MA 2MZQA 1YI2S 2DNLA 4C0OC 1S72S 2MQOA 1K8AT 2E44A 1H2VZ 1VQNS 2CQ1A 3UCUP 1D9AA 3HI9A 2YKAA 2HGLA 3CCUS 1FHTA 3CUNA 1O0PA 2MYFA 2MB0B 1U6BA 1WELA 2LYVA 3NNCA 3H2VE 1FO1A 2MQQA 1M5PC 2M9KA 2MY7A 3NS6A 4TU9A 2DGXA 3CD6S 2DIVA 3H2UB 2BZ2A 2DGQA 2SXLA 2CPYA 2YTCA 3CCES 3L3CA 1WHWA 1K73T 3G71S 1QVGR 3MD1A 2MKIA 2OJ3A 2FC8A 5IFMA 2L08A 1G2EA 2DHAA 2N3OA 1VQMS 2AD9A 1HD0A 4WKRA 1WI8A 2MZSA 1WHXA 4TLQA 3CPWR 2M0GB 2N7CA 1F9FA 1YIJS 1UAWA 2VONA 3ZZZA 3NNHA 4F25A 3ZZYA 1N54B 1UW4A 1D8ZA 3VAIA 4CH1A 4C7QA 3S8SA 4ZKAA 4YB1P 5CYJA 2CQPA 1FJEB 3G9CA 5DETA 5LJ3Y 4TU7A 5D77A 3G6ES 3UD3P 3R27A 3JB9k 3CCRS 2AYGA 5JVHQ 2XNRA 4V19X 1YITS 2GHPA 2RRAA 4RU2A 2YH0A 2M7SA 2O3DA 1SJ3P 2YWKA 4EGLA 1H2UX 2DNZA 1KD1T 5LSLA 1VBZA 2CQIA 1FJ7A 2DGWA 2F3JA 2N82B 3PIPQ 2VOPA 1X4EA 4UY8T 2MJUA 1VQ8S 2E5HA 2UP1A 4QU7A 2E5GA 2CQBA 1U1KA 5GMKa 2OSRA 1VBYA 1YJ9S 2E5JA 2KYXA 2F9DA 2XSFA 4FXWA 5IM0B 4WCEQ 1SJFA 2RQCA 2LCWA 4YOEA 3MI7X 1VBXA 2KG0A 2D9OA 3Q2TC 2FPHX 3VAJA 2B0GA 5GVQA 3IRWP 1H6KX 1SXLA 2RT3A 2LECA 2J0QD 2DHXA 4W90B 2KH9A 5IM0A 1X5OA 3S6EA 1NO8A 2RRBA 4WFBQ 1YTYA 1JJ2R 1AUDA 3BO4A 2XB2D 1WTBA 1B7FA 3UD4P 5GAGU 5MLCV 3I56S 2MKCA 3CC7S 2KT5A 1VQ7S 2LMIA 2G4BA 2DISA 3TP2A 2AYBA 3NNAA 4Z2XA 3BS9A 3US5A 2OTJS 1SJ4P 3SXLA 2I38A 1U6FA 3NS5A 2DNOA 2DHGA 2MQNA 1KC8T 2CPDA 3RW6A 2CPHA 3CCJS 1X5PA 3SMZA 4P6QA 2HYIB 1CVJA 3P6YC 2U2FA 2AYEA 2M88A 3G8SA 2CPJA 1M1KT 1M5KC 2CPFA 4C4WA 2KVIA 3PIOQ 2LEBA 1OPIA 1WG4A 2XS2A 1A7GE 1U1NA 1WEYA 1U1LA 3MOJB 1X5SA 2WBRA 1VQPS 1YHQS 1QM9A 4PRFA 1SJQA 2MZ1A 2HGMA 3I55S 2U1AA 1SJRA 5LXRA 2DH7A 3MURP 2RVJA 1N52B 2HGNA 1U1RA 2MSTA 1DHMA 2ERRA 3VAKA 1X0FA 3P49B 2KHCA 3J7ZT 1HL6A 3CCSS 3NMRA 1WG5A 1FT8A 2X1BA 1RK8A 5HO4A 3MUTP 4J5OA 1KOOA 4BS2A 3J7YU 1U1MA 4LMZA 3CTRA 2LA4A 2M8DB 2ZJPQ 2CQGA 3K0JA 1U1PA 2N3LA 1WF0A 5DM7Q 2DGSA 4QPTA 2QFJA 2JWNA 5IQQA 3G96A 2CQDA 1JJHA 2V94A 3VF0B 1Q86T 1DZ5A 4W92B 4F02A 2RUGA 1X5TA 2KN4A 2JVOA 2KXNB 1WG1A 3CULA 1ZZFA 2OIHA 2DNQA 2DNNA 1YWXA 2FC9A 4F26A 2KFYA 2KI2A 2MQMA 5BJRA 2DH8A 3UCZP 3V4MA 1WF2A 3MDFA 3CCLS 1Q81T 1FXLA 3CCVS 3P5TL 2MMYA 1N88A 1X4FA 2AYMA 2CQ0A 3VALA 4QQBA 2KG1A 3CC2S 5D78A 4CQ1A 3THPA 3R1HA 1PGZA 5ITHA 1UFWA 3MD3A 3ULHA 2YH1A 3EGZA 2KRBA 2EVZA 2X1GA 1A9NB 2RS2A 3CCQS 3BO3A 4WF9Q 1X4DA 1VQLS 2ZJQQ 1X4CA 1HA1A 2CQ4A 3TYTA 1BY9A 3LPYA 1U1QA 2MKSA 3RW7A 3DXBA 4WFNQ 2DGUA 1W2BR 2CQHA 1VC5A 2A3JA 1WWHA 3Q2SC 2FY1A 3DLLQ 1KOHA 4IUFA 4IO9Q 2DNMA 1M5VC 1X4GA 3UCGA 1R8HA 3MXHP 2KU7A 4OZ1A 2HZCA 2MPUA 3UE2A 2DK2A 2QA4S 1ZH5A 4CH0S 4Y00A 3TO8A 1U2FA 1X4BA 2OTLS 4ED5A 2GO9A 2KXHA 3LQVA 4WFAQ 1U1OA 4IOAQ 2XS5A 1WI6A 2MGZB 1NJIT 1UP1A 1OIAA 2MZTA 3VAFA 2ADCA 1N8RT 1R8PA 4M5DB 5GADU 3VAMA 3VAGA 4CIOA 2ADBA 2EK1A 3D2WA 2KM8B 2DNPA 2CPZA 5LXYA 2I2YA 2MGZA 3VAHA 1VQ5S 2HVZA 2LQ5A 2DB1A 2RNEA 2K8GA 2X1AA 2LKZA 2CJKA 1VQ6S 2MZJA 2MQPA 2CQ2A 4TU8A 1WHYA 2M52A 5DDOC 3FEYB 2DNRA 2RQ4A 4LJMA 2MKKA 5CXTA 3BO2A 2EK6A 1VQKS 2MJNA 2X1FA 4FXVA 1NU4A 1X4HA 1WEXA 2JX2A 2LEAA 1PO6A 2DNHA 5CA5A 1VC0A 3IWNC 2OSQA 1OO0B 2E5IA 3EX7B 1QVFR 1YJWS 2KM8C 2L41A 1KQSR 1P27B 2DNKA 3EGNA 1VQOS 2CPEA 1ZZNA 2QEXS 5EN1A 1XN9A 3THTA 3CMAS 2MSSA
chains in the Genus database with same CATH superfamily
3V6KA 3HHLA 3PRDA 4P9SA 1SIWB 2R4FA 3D66A 1S7HA 2DITA 4JOUA 4PG6A 3ZZOA 1R3NA 1R0BG 4DR3J 4YR3A 4NLWA 2B43A 4DFMA 2AJ1A 1XEZA 5K8MA 4QIWD 4WIQA 2QTWA 3JTNA 5I3QA 2B3TB 3MMBB 2HFNA 3UR3C 3NWRA 4NEYA 2GS8A 4KGKA 2BOPA 4DPXA 2BYCA 2K2PA 1T9WA 1H3DA 1YX2A 3QO9B 1W2IA 4DL7A 1WORA 2FGCA 2PI4A 4KO0A 2W4PA 4X4NA 2DGVA 2W4CA 1RWOB 4HTJA 2UV8A 4X64J 1SL2A 4ELVA 2KL8A 3DRRB 2DGOA 4RR5A 3ILJA 2BOAA 1M90T 2QV6A 1FEEA 1VS3A 2WVCA 1FCAA 4HH0A 4DV6J 1SIZA 2Z2ZA 2YY3A 4DDFA 3N01A 2DNLA 3TQ1A 1V5IB 1LWXA 2HRUA 1NNDA 4NXMJ 3FNNA 3R8YA 5EWEA 1S6UA 3CUNA 1S99A 4NCAA 1SV5B 3GE9A 4OX9F 3OVSA 4FDFA 3NS6A 1RAJA 5KG3A 3CCES 4IYQA 2HG4A 1VIOA 3M8PB 1LWCB 2YNFB 2B5JB 1QUVA 4U95A 3M30A 1RYRA 4B17A 3IGNA 3CDWA 2OFHX 4USKA 5HAOA 3NNHA 3TA2A 3ZZYA 4KHPF 2C22A 3VAIA 4ZJQA 3RRKA 4U96A 1BWVA 1N32J 4AQYJ 1D9FA 2H4WB 2HVEA 1Y00A 1OYDA 5D15A 1VRUB 3TX8A 3GSIA 2Z8QA 2DXFA 4G1PA 1XNQJ 4MJKA 3RB6A 1MROB 3PDNA 3PY8A 4DR4F 5B0GA 4LQ9A 1SPBP 1KLMA 1JLQA 4WXWA 2FGOA 5IM0B 1YBTA 5AE3A 1D3WA 1LWEA 4UOCA 4Y2CA 4HTIA 1QAYA 3IR7B 5DG8A 1SXLA 1TKDA 1WC0A 4C48A 3W2VA 3AQPA 1NO8A 4LRBA 3BO4A 1KR4A 4DSFA 3HJFA 4FF4A 5HQ8A 4ZVSB 4LF5J 2HWTA 3VR1A 3ITHA 4P7TA 1WKJA 3BS9A 1E6YB 1GQEA 4I7FB 4PCQA 4BWJA 2N4DA 3P6YC 2ZH5A 4FF2A 3BPDA 2XQCA 4I2PA 4Q45A 2YX4A 2LEBA 5A8RB 3A3OB 1OY6A 3FFIB 1WEYA 2GAGC 4GMKA 5F9NA 4JI2F 2ZH1A 8AT1B 4NLGA 1JXVA 1L3SA 3JXOA 3R6GB 4TKTA 4KC5A 4K2XA 3H98A 3OLAA 2EKYA 5KFHA 4LFCF 4F2RA 4H4OB 2HLUA 4Y6IA 4JI3J 1JJHA 3I4PA 2HQ3A 1KVKA 5KT5A 1CJUB 1I94J 5ETTA 1BLUA 3OPKA 1URRA 2AX1A 4LF6F 3A12A 1MWZA 2AJQA 3PR4A 1Q95G 1FXLA 2WW4A 4P75A 3W63A 3I5CA 4KGMA 1ITPA 4O44A 3UN5A 1PGZA 3ULHA 4IR1A 3C6TA 2YH1A 4DV4J 4DU7A 4G1IA 4HR2A 4NE9C 3TRGA 4X4QA 2GIQA 4PYDA 2A6MA 1D1UA 2F1FA 3CSKA 1TUGB 3K5PA 1TL3A 2HS0A 1WKKA 4RW8A 1SVDA 1FRXA 2W9CA 2G0IA 1J5EJ 3POTA 3V4IB 3K59A 4F3MA 3LWLA 3HVTB 2IPOB 2V69A 4MKAA 1U1OA 1VI7A 2MZTA 4C8KA 1EP4B 5FLXU 2H5EA 3OTOF 3IG1A 3HHEA 2I2YA 1IN0A 5MAOA 2MGZA 1L3UA 1C0TA 1UZDA 5C42B 4UOFA 2XMAA 4DOZA 1CBKA 2PSZA 3CCZA 2BJ7A 2AEJA 4DZ6A 1NU4A 1Y3KA 2K7KA 1WACA 1N5TA 1U8WA 5BYSA 1U0HA 2XO6A 4MYTA 2MY8A 1MSWD 4CO3A 2FVRA 5IWAJ 4ED4A 4A8XA 1JLBA 4XTTA 3IC1A 1VFJA 4RW4B 4PQUA 3CJ4A 4DR6F 1JIHA 3JAMY 3CEDA 4RUBA 3IGVA 4HKQA 3ZZRA 2W2OP 1UJ5A 1C4CA 2CQ3A 3MMAB 5H1SV 3MFIA 3F73A 1S6QA 3IM9A 1LWFA 2DR9A 2CPIA 1OY9A 5E5NA 3I0SA 2HPUA 3HZGA 3FMBA 2PC6A 1FVSA 4M1KA 1L3VA 2CPXA 2JRSA 1BMQB 3EYZA 3GU0A 5D3GA 3E01A 1M5OC 3DOKB 2R7VA 2BQUA 3MPWA 1FD8A 4ZVFA 3Q8VA 3SDEA 4PPZA 5LJ5Y 4L3NA 2W9BA 4OYBA 1PKUA 1VCTA 3PVXA 4JYAJ 2QA4G 4NLVA 2VQEF 1K8AT 2JDJA 4I1TA 4NASA 1ZPWX 1NPPA 4B08A 3M8ZA 1HI8A 3M2VA 4YB5A 1O0PA 3MF5A 3OR1A 1K1QA 3NBPA 2FJDB 3UNGC 3CD6S 2DIVA 1BHNA 1Y10A 3U7JA 4LF8F 2DY1A 2PDAA 2WRMA 2YNHB 1IWAA 2PD1A 3BH6B 1RA7A 2N3OA 5EWFA 2RILA 2UVUA 4P74A 3HK2A 4LVOP 3ZZZA 2YNIB 4FS2A 4Y2IA 2B6AA 3W65A 5LOQA 5D6GA 3I5AA 4HI2A 2HWIA 3TX0A 2ZBCA 2ZH9A 3DOLB 4ECQA 4NA3A 4YB1P 4DR7F 4QYRA 3M2RA 2VIHA 4M5NA 3DHXA 4V19X 4RU2A 1IXKA 4ZJLA 4MIWA 2DGWA 3LP2B 1Q8IA 3OFGA 4UY8T 1HWJA 3RJMB 3HD1A 5B0EA 2OSRA 5HATA 1YJ9S 3QLHB 2KYXA 2XSFA 5SUHA 2HQCA 2KYZA 2LCWA 1DFDA 4ILRA 2O66A 3PHTA 1HNXF 4EK2A 1TMMA 4M5JA 4YHHJ 3OQ2A 1NSPA 2Z58B 2GHWA 2HFOA 4DV2F 4I2QB 1KVJA 3AJ2A 2MEWA 2HW3A 3Q8YA 3PEHA 4ED2A 2IM3A 2CPDA 1R8BA 5GAGI 1NKCA 2YKOA 4HACB 3FCVA 1A7GE 2HVHA 1KP6A 4PRFA 2ZH7A 1WSRA 1S1XB 1FDAA 2EFOA 3T5JA 1HWKA 1R89A 2XMTA 3DLJA 2HWHA 1KLNA 1C0UB 4BS2A 2CADA 3F56A 3CTRA 3EGVA 2LA4A 1PCAA 3MM5B 2LDIA 3BN7A 5KFGA 1RAIB 3HFKA 2QFJA 4OHYA 1VISA 4LSZB 4DI6A 2IBKA 1WG1A 2W25A 5J2NB 2OP5A 2R7OA 3HZEA 3RBZA 2MLYA 3IN5A 1BQMA 4LFAJ 1SBRA 1GMWD 3PRBA 3CJ0A 2MLZA 4PEOA 3IM8A 3LA0A 1UWAA 3CD5A 2VA3A 4LBPA 1VC5A 1N4LA 1FK9B 4CLPA 1R8HA 3UE2A 3PV8A 1B0TA 3HDSA 3PCOB 2GC8A 3IBWA 1CJKA 3BQ2A 3M7VA 1D8YA 2IRUA 1NJIT 2ILZA 2ZITA 2YKQA 1XMOJ 1YRTA 3GJSB 2WB4A 4FF3A 4O3SA 5JXSA 4I0WA 4RJVA 3GG0A 4M95A 2IMWP 2Z2MA 2CQ2A 3KHGA 4O0NA 3QT7A 3AOAA 1SI9A 2H4YB 4LREA 4C8OA 2M5YA 3H40A 2KHDA 2WSFC 4MFBA 2AIRB 2RU9A 5G0RB 2H54B 3IMQJ 3RYLA 2NXNA 1F60B 1GAOA 3T1HF 5I4MA 4RPFA 2HNZB 2R8KA 3GFXA 2RJZA 4Y2MA 4O3QA 4DS4A 1TL1B 2UU9J 4F4XA 5KOXA 3L09A 4MT1A 3W5ZA 2XGPA 5KG5A 3KK1A 5GAEI 4FXDA 3MUMP 4PWDB 1PJ7A 4DN0A 2ZVSA 2NZCA 4W4MA 5F3TA 2ZJRQ 2VJUA 4EO8A 3A8JA 4N7TA 2O1PA 2FHOB 3CCMS 3C19A 4JI4J 3UDEA 3R5AA 5CYMB 1UWBB 5LMUF 5DJBA 5CYQB 4B9MA 3SBMA 1OSDA 1V5VA 5GMEA 1JMTA 2D9PA 5FDLB 1VR6A 2J0SD 3QGGA 2ZOGA 4UZBA 3M6UA 4GKJJ 2CJAA 1SQEA 2GGPA 3UDCA 1HMVB 2YWGA 3HPOA 2KJVA 3UDLA 2VG5B 4UTGA 2EXUA 3KG4A 2SXLA 2I9SA 2GQCA 3L3CA 1HNIB 4R0JA 1CQMA 2JOQA 4ILMA 4DN9A 3DHWC 4ANCA 1UTAA 2Q43A 1ULRA 4TXSA 1WC5A 3MECA 4Q5VA 4X66F 2DTJA 1FF2A 3NOCA 3PYFA 2Y9HA 1YGYA 4PAAA 4C7QA 4ZKAA 5I3UA 3KYLA 2KFNA 3NEKA 1H72C 3R97A 1FD2A 3ET6A 1N33F 2QT7A 1RT7A 1Z4UA 2GHPA 3M6WA 3BYPA 2CQIA 4DL3A 4LR7A 4LF7J 4K59A 5E33A 5ETQA 1X4EA 4N5SA 4QWCA 3KHLA 1PYSB 1K44A 3BQ1A 4IRKA 4ZVOB 2QMWA 3J80U 2RQCA 3DM2A 3PYGA 4EUVA 1S10A 3WIVA 3Q24A 4ECSA 2ZZNA 4J9RA 4DJBA 3HF5A 4B3SJ 3QNWB 5D4PA 5KFRA 2ABYA 2PIIA 4ZPTR 1PJ5A 1TUWA 3NNAA 4YDDB 2DCUB 3C3LA 4OJGA 3SXLA 4NZ0A 1OYEA 2CZ9A 3Q83A 3GYGA 3QGPA 3G8SA 1NK0A 1ZYQA 1QE1A 1H38A 4W98A 3DLGB 4LRDA 3BF4A 2B9YA 4ZJOA 2HGNA 2HNDA 3LH2S 1NHUA 3U02A 4CLLA 1WG5A 2RDDA 1FT8A 1WKLA 1ZA2B 4KFBA 1NXIA 5HO4A 2IJNA 3LAKA 1QLNA 3EZUA 1LXNA 2Y8YA 5KG1A 2GHVC 2JWNA 1YSJA 4EYHB 3KUGA 3AQOA 4S0MA 2KXNB 3O2IA 2OIHA 4TYBA 3MCOA 3HHKA 3IFEA 4WE1B 2CJBA 3W7BA 4UOHA 4DLEA 1FJGF 1KLMB 4B3OA 3BQ0A 1GEHA 1LWEB 2ZBIA 3ZC4A 3ENQA 1C1BB 2F40A 2FHMA 3W2VB 4DUZF 1RJJA 1R6YA 3LPYA 3BSCA 4D3GA 3ITHB 1FWLA 2KT2A 4QYZJ 3AB4B 2GW8A 5CCMA 4O3NA 4J9UE 1NJYA 4CYUB 2UVRA 1VK3A 1HQUA 3CDAA 1LQ9A 4KB7A 4FN5A 1N6QB 3KXDA 4RNNA 2UUWA 2ZHAA 5JMNA 4RBVA 4BDPA 2J7WA 1WHYA 4PABA 3KKFA 2MKKA 5AE2A 4RWWA 2EK6A 3AODA 1X4HA 2BE9B 1PG5B 1VC0A 5T14A 2ACMA 2VBWA 1U45A 3EPIA 5J2MA 1RBOB 3D6HB 4AL6A 1T11A 4OLPA 4USJC 2P9CA 3MR2A 2IFXA 4NZ6A 5IT9Y 2FJEB 3MM8A 5DDRC 1TAUA 1RLCL 2H5JB 3FZBA 1VQYA 3FSXA 5KFVA 3C6UA 2XTJP 2J0WA 2Y1LB 3B4DA 3CC4S 4RW7B 4OYZA 2M70A 2M4MA 2ZDPA 3B8HA 1NDPA 4LRCA 4L74A 4YFUA 1WEZA 4DSLA 1RKJA 5F8IA 3PW4A 4RW8B 3MR6A 1TK0A 3VZHA 2ZWOA 4N8NA 3E8OA 3K8WA 2W9CB 1LEOA 2LA6A 5HL7Q 3A8EA 2QA2A 3B78A 4DFKA 1XIQA 2OEJA 2E1PA 2F4VF 5EX3A 2AT1B 3L7OA 1WC6A 4X4TA 2QGFB 2HHHF 4QU6A 1HWIA 1XERA 1OS5A 1JK9B 2UXDF 2RB7A 4JV1A 2FJAB 3U1MA 1L5UA 1I51B 3GJQB 4LR9A 3BGRB 1GXUA 1VIXA 1DLOA 1BQXA 2BKOA 3PYEA 1BC6A 3CCUS 1FHTA 4ZLPA 1KFDA 1Q1KA 5A8KA 2W7OA 1JNZB 1PIEA 5HROA 2VDIA 2PGCA 2NXJA 5IFMA 3KFWX 2AD9A 2XMUA 1UA1A 3AA8A 1FVQA 2VONA 2NCKL 3JSMB 4QZVB 5F8NA 1TTHB 1U2CA 3IBFB 2HRYA 5LMNF 1LWFB 3LWMA 4FKYA 3SCKE 2BM0A 2GIFA 2IHR1 1JLCA 2FLOA 3LO3A 5F3ZA 4OI1A 4FYXB 3T3FA 2WW8A 2JSXA 2OFGX 1VQ8S 4KRWA 2ZBQA 3G8QA 5A2QU 5B7WA 2QX0A 5D3GB 4ZPBA 2IY5B 4DSJA 2IJRA 3KOAA 2B0GA 4B9SA 3IRXB 3MR3A 4DX8H 1B7FA 1U6ZA 2KT5A 1BQNA 9ATCB 1WDTA 2DISA 2GMHA 4DR4J 4JI5F 4HVZA 2O67A 2RSQA 1G7CB 1RHRB 3OR1B 4DSIA 2DHGA 1S0OA 4DL0C 2ZE2A 2DJWA 2Z57B 4ITSA 1KDNA 4QW9A 4JB8B 2EG1A 4ZN3A 3MEEB 2AGPA 1U1LA 1QM9A 1FTRA 4ER8A 2CWXA 4IOBA 2JNJA 4OI4A 2B6AB 2KHCA 1HL6A 1JJCB 5CAAA 4G3IA 5B08A 3M2RB 5ETLA 4Z7CA 2FVPA 2FHJA 2BRKA 3LTOA 1NLKL 4QPTA 2C3OA 4IDKA 2V94A 2ZFHA 2H9ZA 2DH8A 3TVKA 5D4LA 1REVA 2V9WA 2PMHA 4A8WA 4FKXA 2ZD1A 2ROPA 4A8OA 4L3KA 3UVJA 4WF9Q 1X4DA 4LFCJ 1VQLS 4FPIA 1U1QA 1Y5NB 3RW7A 1W2BR 2AEFA 4ED1A 3DMJB 1S48A 1WWHA 4PWUA 4AYBD 2HHQA 4LF6J 3FVYA 4H54A 2FLNA 2V0NA 2IIHA 4FBUA 2AGOA 2ATCB 4CT9A 4F36A 4ED6A 3FBBA 1N5YA 1NRKA 3MGJA 4HEA9 1UP1A 2D41A 1OIAA 3JQMA 1R6VA 4CO0A 4C11A 1S76D 5B0FA 3TJAA 1GTHA 5D0GA 1XWLA 5KFAA 1RACB 4AUKA 2FB0A 4A46A 2K06A 2CJQA 2LEAA 1RYSA 3I9ZA 5F8GA 3IWNC 4B9VA 4PG7A 2ROGA 2L41A 2J6SA 1VQOS 2JC1A 3K58A 4IG0A 1HQEA 1BQMB 2DGTA 5B0AA 2APOA 1QUPA 1RHKB 1Q7YT 1T0TV 4ZA1A 1UFLA 2R8HA 1IKVB 1REGX 5DG9A 2A1BA 2QLFB 3VCDA 5LT5A 2JVRA 3QPIA 4ID8A 4ZDNA 1VRTB 4ETZA 5GMDA 3DOMB 1WC4A 4MTPA 3JSRA 2NS1B 3NCRA 2C2RA 4UZCA 4UQTA 3UWTA 2CYYA 3C14B 3CJQA 5L9NA 1CJKB 4DR6J 3K5NA 4CI0B 4NXNF 2Y1JA 1U09A 3F41A 1WTFA 2NREA 1QTNB 5L38A 1PBAA 2PE8A 4NCGA 4K4VA 5EGYA 3P4UB 4B3TJ 3HHNB 4C3LA 4TYAA 2ZOFA 1W26A 2LQ9A 4C0OC 2I5JB 1S72S 3OR2B 3RBXA 4RW6A 3WC2A 1KHVA 3W1YC 5U47A 4E2FB 4LSLA 1RP5A 4JI8J 5HBMB 1U6BA 1RHJB 4LF1A 4MFBB 2M9KA 2DGXA 3H2UB 2BZ2A 1S59A 2CIMA 4O0IA 3OJUA 3AD7C 1FE4A 4CLFA 4C2MA 5HLFA 4PXCA 1RCXB 3KLEA 1IJFB 3NGTA 1SCJB 4DFPA 1U4BA 2P6SA 3LALA 4P7VA 1VQMS 3HD2A 2WONA 1WUUA 1CC8A 1RTDB 4HL9A 3DLHA 3A13A 3BDPA 2HBRB 1N34J 1UAWA 1Y0HA 3AOCA 1HLWA 1VOMA 1YKWA 5HQMA 1RE1B 4F25A 1U49A 4Y2KA 1T7PA 1MU2A 4DL4A 1G1XA 1FTCA 1TZ0A 3FUYA 2Y3YA 1HPZA 2H51B 3EVWA 3DXSX 4DBQA 1DQ8A 5L1JA 3J7YI 4HYKA 3PNIA 2A18A 4C0HA 1U2RA 1FJ7A 4URSA 4HH1A 4K4WA 5AXNA 1VK8A 1FFGB 5J1EB 5A8WA 3D0HE 1IR0A 3B82A 4JI7F 3I0RB 5GVQA 3IRWP 3HVRA 4L6V3 3ZTPA 4ZN1A 1R8AA 2GGPB 3DC2A 2BJ3A 4MIAA 1NDKA 3TUJC 4Z2XA 2LQBA 3IR5B 5J1NA 3P45B 3FK4A 4RLEA 2K1RA 4TLRA 1LXJA 1G4CA 2F5GA 2JHEA 3CJKA 1N0VC 3TEGA 4WP9A 2IRXA 5HMYA 2COLA 1HNXJ 4KAIA 3K5OA 1UETA 3MECB 2B7CB 3AD8C 3PACA 4N47A 1PILA 2V63A 1EQMA 1RWMB 2XBPA 4IFYA 1SUQA 5I3UB 2B9EA 4CH7A 3E51A 3R7NB 4MKVA 4J9MA 1U1PA 2C1EB 2CDRB 1R31A 5D0HA 2K3IA 3G96A 1IKWA 2HMIB 4W92B 2OPSA 3CJSA 3CULA 2IA6A 2R2TA 3DRXA 2I6WA 2UUCJ 1HFEL 2VG7A 3MM7B 2R8JA 3W2WB 2KZZA 1JWWA 1BXNA 4FYVB 3DM2B 1LKZA 5ITHA 4K0KF 3NAHA 3M32B 3EVMA 3QMQA 1WDDA 2ZJQQ 4CO4A 2DRDA 5E3AA 4C8LA 4KYZA 2XG8A 4WFNQ 2VUGA 3C16B 3OJSA 1JKHA 3BGOP 5IQ6A 5AJ3J 1CG2A 3BKUA 4IO9Q 3IS9B 3TA0A 3H25A 2Y0BB 3H5YA 2HZCA 2E1AA 3Q89A 3C8YA 3K5LA 1WOPA 2OTLS 4DL5A 1PC5A 1PAUB 2V67A 1S6PA 1QE1B 3LQVA 5M2PA 4NL5A 1N8RT 3ISND 1WNEA 3NCQA 4HHHA 4A8FA 4CO1A 4PXEA 3D6TB 3VQSA 4TNOA 1F9HA 2E5LJ 2X1AA 2MQ8A 2MQPA 2EW9A 2GJ2A 1PBUA 2Z30B 4QOTA 1JLGB 4AXJA 5DZ6A 2BE2A 5M2UA 1LNQA 3OSNA 4MH8A 1XJWB 4NZ7A 2IAJA 3CWJA 7FDRA 4I4BA 5KFLA 2XMKA 3MHYA 3T6JA 2AMCB 2C2MB 2BRLA 5CD4H 1RT1A 3EDRB 2P8IA 1FWPA 3LP0A 1HD1A 5KT3A 1VLYA 4OQJA 2OLWA 4P2XA 3MPDA 2HSEB 3G8TA 4OI2A 3H59A 5B09A 5KFSA 2PEBA 4EFAC 1S4FA 2WBMA 1G6BA 1AZSB 1S9FA 3SI8A 4EI2A 3LUYA 3MM9B 1DURA 4H4MB 2HIQA 1NK9A 3DGPB 3L4BC 1WOOA 1P1TA 5KFIA 2G1HA 1RWWB 1FE0A 4ZP6A 1X9MA 3CVKA 2ZKTA 1B3TA 5T7LB 3A4TA 3Q8PB 2Q3PA 2FJXA 2WTFA 3HCXA 1RQ0A 1FRMA 1FKOB 2W8KA 1Q82T 3M8QA 4NLQA 3DRSA 3N79A 1VQSA 3CJ8A 2G1DA 4OZ0A 4PWWA 2DHSA 3HP6A 2PN6A 5F8JA 3DGVA 5GAHI 1TV6A 1RXOB 1IKYA 2FLLA 2E44A 3BR9A 1S1WA 5T41A 1VQNS 1D9AA 4I56A 4YMEA 4WKYA 4AE5A 1RTHA 4NLSA 4LF4F 3PX4A 3AXKA 3NNCA 5J2MB 2ASJA 1CJVB 4DR5J 2LQJA 1HNZF 4DX5A 3VGUA 3O6QA 1HHTP 1AT1B 3QYYA 2RDIA 1B0PA 5K9FA 1TVRA 4R5PA 2M0GB 3DYAA 3MCSA 1RTIA 3G82A 2V2VA 2VL1A 3HFZB 1O51A 5LJ3Y 4LRAA 3CCRS 2VICA 3HT0A 3W3SA 3VHQA 3SSSA 1M1GA 2R8GA 3NGDA 3NG8A 4X66J 2VOPA 5E7OB 7FD1A 4K5RA 3TZWA 4XO0A 3R9LA 2C3MA 1S7IA 4UOGA 2XZWA 4DV1F 4EEYA 3PYDA 2HURA 2RRBA 1AUDA 3CC7S 5KFEA 8ATCB 5DG7A 4RNHA 4CRJA 4FYYB 2OTJS 4E8UA 5KAKA 2D3O1 1W25A 5A8KB 4ZP8A 1QSSA 2NSBA 3P5BP 1TFYA 2ZOMA 1CVJA 1YVFA 1ZAXA 4C3MA 4EZ6A 5HROB 5BR8F 3RB3A 5F9LA 2XS2A 2Y0SD 2CAJA 4CP5A 3VWSA 4WFXA 4ECTA 2ZC3A 2ZNZA 2RVJA 2ERRA 2VBZA 3CCSS 5GADI 1KOOA 4RW9A 3EZ5A 2O01C 3MR5A 3HXMA 1Q86T 4B3RF 1IBLJ 2AQ4A 3LGMA 2JEJA 4NYPA 4IH7A 5KFYA 1C2PA 4KTQA 1TL5A 4R8UA 1UEKA 3GV8B 1HBOA 3W60A 1HBUA 4NCBA 4Y3CA 4YR2A 5KFTA 3ILOA 3Q8SB 4NMLA 4AXIA 2RS2A 1J5OA 3RAXA 2FVQA 2QLXA 2XYPB 1X4CA 3UW1A 1EHWA 4WK1A 1FNMA 3FRYA 1BQNB 4DV7F 4LT6A 4TN2A 1ZM9A 2QN6B 5IS2A 3RB0A 3CDBA 1FJGJ 1KSPA 3AJDA 2GFFA 2QA4S 1RAOA 3QRQA 4Y00A 4KQZA 2RKIA 3GR0A 3CJ3A 1UVMA 2JZ5A 4MKBA 1B4SA 3M6XA 1AROP 2RH3A 4RKUC 1S1TB 2WOMA 5L1KA 1HW9A 3OUYA 3IP0A 4EBEA 1NMEB 2DNRA 1UVIA 4MK8A 5CQGA 5H9FJ 2DR7A 1WEXA 3JAMU 4IDKB 1YJWS 4J9KA 1FRLA 2AF6A 3PX0A 4FBTA 5EN1A 2GJIA 3D54A 3CMAS 4CZCA 2G13A 4AL7A 2BACA 3M8SA 5ETKA 5ADZA 3VGTA 2MHNA 4U8YA 4LIRA 4RL1A 2IJFA 3QZ7A 2J8AA 2Q6BA 2DH9A 3ZZ0A 2J7KA 4YUDA 3UVJB 1HR0F 2MKJA 3C46A 2MKYA 3KUEA 1EJ7L 3CW2C 4ECRA 2CQCA 3O5TB 3SYZA 4K4YA 1T05A 4ZHRB 1NJWA 5E41A 2VASA 3DDNA 3QSYB 1EB0A 2YWFA 4NI2B 4TQSA 4KE5A 3ILLA 3V81A 2M8HA 2PT0A 3OHBA 1T9YA 2LU1A 4NLPA 1LW0A 4QYZK 3SFGA 2LXUA 2HQDA 4X65F 1DTTB 3B4MA 4C11B 2RDJA 4IG3A 2GVDA 1X9WA 1DARA 4DCPB 4I67A 1SH0A 2VBYA 1NK6A 1SL0A 2YKMA 3WDOA 1IBKF 1E6VA 2CQ1A 4DR3F 2HGLA 2HHXA 5K14A 1Q8KA 2MYFA 4ZLNA 2X3DA 1HQEB 2DGQA 2NR0A 2HHHJ 2NUHA 3ISZA 3GV5B 2DHAA 7AT1B 4YY3J 2CG8A 1HIYA 5F0UA 1UKUA 3CPWR 2E9TA 3KWMA 1HWLA 4Y65A 2UUTA 3H7HB 4OHXA 4X64F 4HHUA 5KFOA 2VG6B 4J90A 3UD3P 3JB9k 5JVHQ 2FDNA 4CDIA 3MCMA 1SJ3P 4EGLA 4OZ5A 4OZLA 2VFRA 4DV6F 3TAMA 4Y34A 2F8HA 2UP1A 4QU7A 2CQBA 5GMKa 1F0XA 4ED3A 1N56A 4NXMF 2RMLA 3TJ8A 1SB6A 4NLRA 1X8DA 2XLKA 1APSA 2D9OA 5AXMA 3WZ0A 3BH7B 4KGVB 4NCGB 2GA7A 2CZ4A 1HI1A 3S6EA 4Q7AA 3PO5A 4UT4A 2G9OA 2WSEC 4RW6B 1UJ4A 3M1VA 2CJXB 2CVEA 3K57A 3GWCA 4YEAA 3US5A 5HVGA 3DDIA 1SJ4P 1ZM2A 3L7UA 5DZ7A 1HHQA 1ZETA 3MAAB 1KC8T 4DPYA 5HP1B 3QQCD 2HYIB 2W01A 2U2FA 2AYEA 5HLFB 3PIOQ 3KLEB 1IBMF 3GCXP 3SCJE 1WG4A 6AT1B 1N32F 1U1NA 1XNRJ 3MOJB 1I6JA 3RBEA 2FTRA 2PFFB 2ZZMA 4OJ3A 1SJRA 1ZPVA 2ZNYA 1XNQF 3BM7A 3WX4A 5L8RC 1Z1ZA 4JI5J 4F0MA 5HMWA 3W5YA 3KK2A 2XMWA 1MU2B 2P2CB 4L76A 2Q66A 2X1BA 2GMLA 1RK8A 2P9EA 4ZP9A 4GKKJ 1AUSL 3HHLD 4YB7A 3NCPA 1UVKA 1DZ5A 2AGQA 3V4MA 3DLEB 2BQRA 4X4PA 1S9EA 4KV8A 4OYOA 4DL2A 3P5TL 2RIJA 2WB1D 4LF5F 2UUBJ 1JNRB 2HNYA 3R7SB 3R1HA 1SH2A 3BR8A 3ENWA 3BO3A 3MZIA 1Q5YA 1SKSA 2BEFA 5HVHA 3SQGB 1NK4A 5HMXA 4QWEA 3A8KA 2NYIA 3CCTA 4K4UA 1M0SA 2CQHA 2W2QP 1S1VA 5CZVA 2Y1RI 2VFVA 4WJBA 2WVFA 4DSKA 1KTQA 5ETVA 3CJKB 3IR6B 1AA1B 5I42B 4CH0S 4WFAQ 1QTMA 4IOAQ 1IM4A 2IVYA 3TWZA 4WFYA 4JI1J 2YKPA 4PPDA 2CPZA 2LKZA 1R0AA 4Q0BA 1VQ6S 2CJKA 4JV2A 3EM1A 1SUQB 4M5DA 2UVWA 4ZIWA 1AW0A 5A0YB 2OH2A 4OYPA 4UUXA 5FD1A 2J5AA 3U27A 5K20B 2RF2B 2VG7B 2HHWA 3CMES 4BBYA 3FBEA 1RI7A 2VODA 1YJNS 5ETRA 4OYMA 2Y1IA 3ETMA 2WSCC 3QT6A 1BE4A 1S1UA 4XPEA 1T03B 3PKMA 1RUSA 1GX6A 2GQQA 1J5EF 1Q8BA 4C98A 4CNYA 2B8QA 5HI7A 4DG1B 2XY6A 1WHVA 4J9LA 2A6OA 2RU3A 3U1LA 3MMBA 2IC3A 2FVSA 3OT9A 4PYAA 2E9RX 5AT1B 1LK5A 4RU9A 3JTOA 2RS8A 2JLEA 2XSJA 3QO9A 4HT7A 2K3KA 3JSYA 1VQ4S 2KRRA 2XLJA 1R7IA 4P2MA 3DRRA 4ZVUB 2P5VA 1NSQA 2E66A 3GJTB 3CMQA 3OFHA 4P73A 1GNKA 2BE2B 3WC0A 4JI0J 3EMTA 2KDOA 4NXNJ 1K0TA 2AHOB 2IAJB 3ILIA 3KHRA 4QR0A 1MN7A 3VZIA 2FY8A 1WHWA 3TZYA 4OV6A 4WFZA 3GSDA 1G2EA 1Y11A 4PUOA 3LP0B 2OGUA 4DV0J 4A4JA 2EI5A 1YIJS 3O8WA 1HWUA 4FNIA 3HVAA 4GC6A 3UQSA 1SKWA 3T1YJ 2HZVA 3UN3A 3KLHA 2CQPA 3KTQA 2XWYA 1X7VA 2XM3A 2BJ8A 4U7CA 4DXLA 2RRAA 1PJ6A 3TI0A 2HVIA 5J1PA 1G3OA 3MPVA 2E5HA 4DV3J 5ETSA 3R5DA 2D74B 1MROA 4M5LA 2RUSA 3M05A 2F9DA 4FXWA 1RT6B 3Q2TC 2G0JA 2B8PA 4MK9A 2ZM6J 5KFNA 2RT3A 2VPXB 2KH9A 5IM0A 5K8OA 1F5BA 5L39A 2XWXA 2MKCA 5DRKA 1F6TA 2HHSA 1VQ7S 1S1WB 2E1CA 1D9DA 1V3ZA 4ECYA 2B4UA 1FFWB 1RTHB 2B4VA 3NS5A 2DNOA 3NWGA 3ENAA 4P2SA 3TUZC 2RE1A 4FYWB 2CPHA 2ILYA 2ZH4A 2KVIA 2LP4A 4I7FA 1KS2A 2VPZB 1MG7A 3GR1A 1TVRB 2B9WA 3G6VA 4DF8A 5EWGA 2DH7A 5A8RA 4DX7A 4P52A 4RUHA 3G82B 5E3QA 1SH3A 4ATNA 2I1RA 3J7YU 1U1MA 4OZNA 4M63A 5DM7Q 2V8GA 2GIRA 4I6AA 2JVOA 1HNVB 4USHA 2DNNA 1PSDA 2FC9A 4U7UD 5KG6A 4H4OA 2Q6CA 2WK4A 4IH6A 2DHHA 1XC9A 1CJUA 3CC2S 5ETNA 4CQ1A 4EYIB 1FERA 1HA1A 2CQ4A 1OQ3A 2MKSA 2XY7A 4FF1A 4AT1B 4JI6J 3G86A 4G1QA 2CUYA 4F3OA 3KDOA 4ZCIA 3GFHA 1LW2A 4X62J 4CTAB 1M5VC 4PXBA 3UCGA 2VFSA 1U2FA 2V4RA 2XYGB 5DQGA 2V68A 3IAM9 4BLGA 4LR8A 5DS7A 3HVTA 1N5SA 2DY9A 3VAMA 3Q8RB 2F4FA 3BV8A 4ICLB 3MWBA 3V6JA 4M5IA 2L9DA 3VAHA 4NRTA 5IT9U 3UPFA 4LFBF 3KJVA 3EGWB 3PW2A 2EC0A 5E3PA 2M52A 5IT4A 2YPYA 4J9PA 4LFAF 5F41A 4RW9B 1T95A 2O5DA 2BX6A 3GYNA 2P6TA 3LOUA 1CEZA 5I3PA 5HMZA 5E3CA 2DNKA 1SKRA 2CPEA 2MSSA 4QR2A 2HQFA 3J7A1 3KMQA 1CULB 3MOZA 1RU2A 3W66A 4OX8A 2AJ4A 3MM6A 2XS7A 2W2PP 2VV5A 1CPZA 3B54A 1OQ6A 3DCAA 1N0UA 3OLBA 4X4RA 1NSAA 5EHHA 4XDDA 4M8LA 1BWEA 4OZ2A 4DV5F 1YQHA 1RT4A 4U8VA 3VVUA 2IA0A 2ZVIA 5DGAA 4RW4A 1NZAA 4B3MJ 2EFQA 1GK8A 4ID5B 3N6MA 4PR6A 3G6XA 2EBGA 4FYDA 5JVGQ 3MMAA 4K5SA 4OYAA 3G87A 1RT5A 3N28A 4WU2A 3CDUA 1I3OB 4LUBA 4B9NA 4YDXA 3N9UC 1U02A 3ETOA 2VOOA 2PEHA 1YK9A 2RKIB 3W9HA 4K2JA 1FJCA 1IVZA 4RNOA 2HZAA 2HFVA 4JP8A 1EETB 4WP3A 4P10A 2WOMB 2BJEA 1X4AA 3MTKA 3QAUA 2FJVA 3A3NB 1Q78A 5F8LA 2JC0A 1KEKA 1N5QA 3PEJA 4LRFA 2YKAA 2F8MA 5IC6B 4RO0A 3FZ2A 3VGSA 3W8PA 2UU9F 1RWUA 3H2VE 2MQQA 3M9NB 3RR8A 4I68A 3MEDA 1RSCA 2YTCA 2XGQA 4N8OA 4DWIA 3D3CJ 3G71S 3P96A 2BKPA 1AYEA 4K4SA 1R8CA 4F4AA 3SEOA 3DRPB 1EAYC 2PI5A 4LF4J 1T05B 3CGIA 3SIPB 4JI4F 1GXTA 5KT2A 2YNIA 1T3OA 1HHSA 3QJPA 2CFXA 1EKSA 2B4OA 1SL1A 3T9ZA 1H2UX 1LW0B 5LSLA 1VBZA 3M2UB 1KWMA 2F3JA 4KIAA 4GKJF 1TL7A 2V8PA 2VFTA 2EFNA 2QMUB 3J7Z5 4CLKA 5JJBA 3PJXA 4DQQA 4UF4A 3LP2A 2DD8S 2R7RA 3CT9A 2ZEJA 2KG0A 2NPFA 3QLHA 2LECA 4W90B 4U9RA 1YTYA 2XB2D 3LF0A 5MLCV 3N4WA 2FUG9 2Z56B 4ALZA 4K8RA 2C2KB 3OVAA 3THVA 2HLTA 3KK3B 2I38A 1U6FA 4I2QA 1HYSB 3RW6A 1FRJA 3SSRA 1JXLA 1NKEA 4C8NA 5KT4A 1CS4B 4DV1J 4P72A 1VQPS 2V9KA 3ZTQA 3RAQA 4F67A 4O4GA 1K0VA 3I55S 2JFDA 3NOGA 4HACA 3MMCB 5C2CA 3BYRA 3FDSA 1CC7A 1UFKA 4LF7F 3P49B 2EFVA 1R27B 1S1XA 1PYOB 5IOLA 2QLWA 4NLTA 4ECXA 2C2OB 3X1LB 1RADB 2XMMA 3FBFA 2QL5B 3Q0AA 5D8HB 5LL6d 4J9NA 5BJRA 5J2PB 3MDFA 1XR5A 2HFSA 1Q81T 1O6XA 2UVVA 1S12A 4OX6A 2ZC4A 5J2NA 1IKXA 4OZJA 2CNKB 4AD6A 4BC9A 3MR7A 3CCQS 1NZ8A 1VBKA 2BMBA 1JLEB 2E7WA 3D4JA 1RTJB 3M1VB 1FESA 4MMOA 1HBMA 5K8PA 2GO8A 1DQ9A 3D1OA 4DR2J 1T94A 1FK9A 3TO8A 3NAIA 4ED5A 3QJJA 2OEKA 4KT0C 4C6AA 2AJ2A 5GADU 3OVBA 2ZH6A 2UXBJ 5HVFA 2BA9A 3KLGB 2DB1A 4M94A 1HBNA 2K8GA 1NHKL 1MMNA 1B7YB 2V50A 4LJMA 1RAAB 3N6NA 2M3DA 3HKZD 2OPPA 5E3RA 2HFUA 3R2CJ 2JX2A 1O5JA 3HHLB 5CA5A 1QVFR 2QZ8A 1ZZNA 1FRIA 5ETMA 3OXFA 4G65A 2OD6A 4KV8B 1FNOA 1VC6A 4I69A 4TY8A 3FEXB 3GILA 5K8NA 3IO1A 2HNZA 1UPMB 5LSOA 1TL1A 3BSAA 4KGXB 1ACMB 1MN9A 4ERDA 3RR7A 2W7PA 2VU5A 4KGZB 2DBBA 4KO0B 3EICA 1DBDA 3Q23A 2DO4A 2AV5A 2D3OR 4PWDA 1X60A 4K7QA 4ILLA 1D0EA 1UJ6A 4ZVPB 3N5BA 2V8HA 4U67Q 5A76A 4WIIA 3W8GA 4QR1A 4ZPAA 4WK3A 1YJ7A 3T5LA 1TAQA 4CLZA 2H48B 2VZ9A 2OHDA 3OFFA 2MXYA 1RAGB 2VKZG 5CYMA 1WF1A 3MUVP 2Q79A 1CSJA 5CYQA 1TK5A 2E9ZA 2OKQA 1R0AB 3UD5A 2C2DA 4NWBA 2UXCJ 3J81Y 2MZQA 1K47A 4IQXA 4IRDA 3R5CA 4J91A 3LGNA 3G6YA 5H9FK 1P8GA 1HMVA 1SC4B 4X65J 1TR0A 3IWLA 1XMQJ 3M30B 2CPYA 1YDLA 2ZKUA 4C9DA 3BN4A 2OJ3A 3GCWP 4QJVA 1VYAA 2L08A 1H74A 3CD7A 4F8RA 3TAPA 4DCOB 1WI8A 2MZSA 1S1UB 3HULA 1HNIA 1GXLA 3FSIA 1B64A 1F9FA 1IBKJ 4CWBA 1ZM3A 4DPOA 3NGKA 4TU7A 4DFJA 2QSFA 3N5FA 3ZZUA 2IC3B 4OI3A 4ES1A 1RLDA 4WXOA 1JLQB 2M7SA 2J9DE 4C0BA 2BVZA 2XSJB 3Q8UA 4CLUA 3GG1A 1FWKA 2E5GA 2GVZA 2BJ9A 1MMDA 4NLDA 3CIZA 4DPWA 3E3XA 3MTJA 5KT6A 3VAJA 4J9OA 1H6KX 2BE7D 5HJXA 1DQAA 2XI2A 3KLIA 3NS7B 3QWPA 4Z37A 3UD4P 3I56S 2V2KA 2VPYB 2X7IA 4DZDA 1RBLA 2R7TA 3RB4A 4I2PB 3T1AA 4ZLLA 2VQFF 1F5CA 3CCJS 2W8LA 3KJFB 3NGRA 4O3PA 3HLUA 4IO1A 4JV5J 1FDBA 2J9CA 2CPFA 4PG5A 5M2RA 3QRRA 4DR1J 4PUOB 2VB6A 2RQKA 2D7SA 5EDWA 1EX8A 1SJQA 2VH7A 1QY7A 2ZH3A 2V2QA 2U1AA 3QBCA 4ZP7A 1NK7A 3KJQB 3OD2A 3DLGA 1DHMA 1FFSB 3EXYA 4EWTA 4GVBA 2KO1A 2R7QA 3KLHB 3FCHA 2XULA 2EPIA 4LMZA 4RNFA 1RISA 3D28A 2CQDA 1IR1A 1IBMJ 3PR5B 2KN4A 5HANA 5DQIA 3PX6A 4O44B 2V8VA 3BJYA 1MNEA 3C6TB 3VGVA 1N88A 2WVDA 3F44A 2AYMA 2XLIA 2ALYB 4WE1A 3QWUA 1NH8A 3TNVA 3EXCX 1UFWA 4QWDA 1TL3B 2QE5A 2QRRA 1W7WA 2VC0A 2Z0GA 2XHWA 4PZVA 4ZVEA 4XPCA 1C1BA 2XZTB 3CJ2A 3GZ7A 5D4NA 3R6LB 3POTB 2UUAF 4WU3A 1Z2LA 1NHVA 2HRTA 2JJ4D 1Q7LB 1X0PA 2H1YA 2MPUA 3FSYA 3IG1B 5IV3A 2QIFA 4IQMA 3SQOP 2MGZB 1C0TB 2ADCA 3TUIC 3F0NA 1S0NA 4EBCA 4CYUA 2EBEA 2EK1A 3CD0A 1HARA 3ZNUA 2KM8B 2GNKA 2FQQB 2LQ5A 2W4DA 1ZTTA 3PM9A 1UCNA 1DJ0A 4PXDA 1N6QA 3CJTA 1U0HB 2MJNA 2QSWA 2IRYA 1R0CB 1S49A 4UW2A 1JX4A 2IM2A 2QEXS 3PFEA 3QIPA 1F3FA 3THTA 4A8SA 2AZ1A 1JLBB 4ZVRB 3LPEA 1UPPA 3BSOA 3QFWA 4PQUB 2ZBPA 2BUNA 1K1SA 1FRKA 3GIRA 5LSRA 3GB0A 2ZHOA 4GRSA 4Y28C 2N7YA 3CF5Q 4OLOA 1N36F 4OX9J 1ZTWA 3ZTOA 4OX7A 1S6QB 4KKOA 1FDNA 2KZMA 4PKDB 2NXEA 3I0SB 2Z2LA 3R1LA 4IRCA 1V3RA 3UR0A 4G1QB 2DNYA 3S1TA 3R7BB 2DXDA 5G4DA 1LW2B 4RW7A 4DF4A 4X4OA 2Z2YB 3PJ9A 1RHQB 3G4SS 3JTPA 4KHPJ 4WYLA 2LVWA 2HHVA 1T9UA 3E01B 1HQ2A 4O4RA 2MKHA 1WJ9A 4K50A 2R9LA 2G2OA 3SDEB 3GP9A 2W9BB 1NH7A 1SKUB 2V2ZA 1T3NA 4USMA 2LXIA 3KJVB 1K9MT 3D3BJ 2X3GA 3E2EA 3M2VB 1GT8A 4L75A 2D3UA 3NBPB 2HQGA 1HNWF 3BGRA 2FZKB 3TVYA 2W2MP 2R7WA 5HK4A 1M5PC 1Y5LB 2WHOA 3MM6B 2XO7A 2BW2A 1WSVA 1Y9OA 4R25A 1DTQA 1WHXA 2IBOA 3M8WA 2FHJD 1U0SA 1FX4A 5C24A 1OJ4A 5IV4A 1RT4B 2HS4A 4ZCMA 4CH1A 2B7BB 4ZK7M 1TL4A 4X84A 1Q79A 2V6AA 1FJEB 2ZH8A 1NM2A 4RBUA 3JSMA 1IWGA 3GV7B 4E98A 4JI2J 1ELOA 3CDEA 4RNMA 2AX0A 1RT5B 3NP5A 3FEZA 1FRHA 3KG0A 4B3TF 2N82B 2D69A 1U1KA 2CXEA 2GZOA 5E0OA 1P6TA 3FQLA 4NYZA 4NPOA 2F8EX 2HAIA 2YX7A 1M1HA 3L9ZA 4JI8F 2ALZA 2RRNA 2YQ1A 2DHXA 4DLGA 3TVZA 2KJWA 1H7WA 2JEFA 2N4CA 4TY9A 4MKYA 1TELA 3IRXA 3PJWA 3WHIA 5E2QA 2PA3A 2MQNA 1N34F 3K89A 2UZAA 3MEDB 3T6BA 4WZQA 1M5KC 4USWA 2CPJA 3NKYA 1GFWB 4FPRA 2DXEA 1X5SA 3OHAA 4ZITA 2ZWPA 2HGMA 3L95X 3JQKA 1NBEB 1RWVB 3SZ2A 4OIXA 1GMVA 4U7UK 1UVNA 3MEEA 3AFGA 2AJFE 1N48A 1F5AA 2CNNB 1Z2ZA 1NDCA 1XTZA 1NSKL 4KPYA 2M8DB 2XI3A 3AAWB 3OTOJ 2HS3A 2HBQB 1JQGA 3V6DA 5IQQA 1O8BA 2DRBA 3VF0B 4XDCA 5D0EA 1IJEB 1Q53A 4HDGA 3MCNA 1YWXA 4MYUA 3SV4A 1TL7B 3DN9A 4C8YA 3JSBA 1S9GA 4CLYA 2MMYA 2J6TA 4KH1B 3W62A 3HSDA 5IZHA 4C97A 1X31C 3MD3A 2FD2A 4F3QA 2EVZA 2X1GA 2BDPA 2LDYA 1TU0B 1NCLA 1BY9A 2DPJA 4NLYA 2DEJA 2V34A 3DLLQ 4TQRA 1F2GA 3PW7A 2IVMA 2NSCA 1QD1A 4F7VA 3MEGA 1NJZA 3DMJA 3FMWA 5RUBA 4OZ1A 1ZH5A 1X4BA 4CCHA 2OPQA 2GO9A 4OYXA 2ASYA 3T19A 4ELUA 2HK3A 4O4GB 1VJQA 4HLBA 2VF3A 3TARA 4WZMA 5LXYA 4NLXA 1KONA 1F3VA 3K8VA 1IQZA 2UUCF 5DDOC 5DO2A 3V6HA 4LBHA 4XAKA 4IKAA 4I6WA 3FRZA 2YVSA 1UMJA 1PO6A 5FIIA 1S97A 4M5KA 5C5JA 2OPRA 4F4YA 1SC6A 4RZRA 3EGNA 2HEKA 2R42A 3R5BA 3GIJA 4V1Ak 5AXLA 2VQEJ 5FJ4A 1IKXB 3WBZA 1H2TZ 1F2HA 1U8SA 2E29A 2XZDB 2XYHB 3W61A 4LFBJ 4DCJB 1YJTA 2W2NP 5AJ3F 4HDHA 2YKNA 5DM6Q 3KK1B 2K7JA 1AB8A 5THWA 4CLWA 1GMWA 4LF8J 1IQTA 1IKVA 5B0CA 2H5IB 2YWHA 2QYGA 5C7PA 1HBMB 2CNOB 2R7SA 5DDQC 4J37A 3EUNA 3UFCX 3P3DA 4ZMMA 4GO7X 1OY8A 1FKAF 1VRTA 4FS1A 3FCWA 2R2UA 1S0MA 3DOMA 2E5LF 1VGYA 2BM1A 2DO0A 1RU1A 4QPXA 4DQIA 4DR7J 1RA6A 3J81j 1T9TA 4DV5J 1OWXA 3S01A 3C14A 1EARA 2RQMA 4ECWA 3O3LA 4J9QA 3MPYA 2R8IA 1HBNB 1LV5A 4ANEA 2EWHA 1YI2S 3PO4A 1T8EA 2OPPB 2LFVA 3UCUP 2RHQB 4MK7A 1Y5IB 3GLJA 1TK8A 2I5JA 1WELA 3OR2A 2IMOA 4P71A 2G2ZA 2MY7A 2HVDA 1IUJA 4ZPVR 5HBMA 2QJ3A 2OUGA 3MD1A 4DV2J 2EFGA 1QVGR 3HSGA 1TMJA 3GYXB 5KFUA 4TY8B 4QIVA 2VKRA 5KFJA 3UNYA 2J9DA 5CCLA 2NPIA 3HJVA 3ET6B 1RT7B 1RTDA 3S8SA 5B0BA 3TUPA 3KUHA 3BREA 3OTEA 3G9CA 2YQ3A 5DETA 1FKPA 2C2EA 2OO4A 3G6ES 3R27A 3J7AN 2KKHA 3U1NA 1A0OB 2EG2A 3HKWA 1KD1T 2AWZA 4M5MA 2CRLA 3PIPQ 1RZMA 3KG1A 3QT8A 3SFUA 2PMZD 3H8YA 2BV3A 2F7VA 3PRVA 2HHUA 4QW8A 1X9SA 1QSLA 3MI7X 3RZAA 4USUA 4OFZA 4ZVHA 5J1EA 1PC4A 5F8MA 2I8EA 3T5HA 2I0XA 4Q44A 4DR5F 4N56A 5GAGU 3Q22A 4EZ9A 2HBYB 3DDKA 3I0RA 1KRPA 1S6OA 1TUVA 3KNGA 2QA1A 1S5ZA 1YJVA 2BANA 4P6QA 2DEIA 2IM1A 4YN3B 1QAIA 4IFVA 2X51A 1JLAA 4Y2AA 1YHQS 2WBRA 2HNDB 2JLGA 2VBXA 4KFBB 5LXRA 3MURP 1RAEB 1U26A 3NY0A 4MAKA 4A8YA 3J7ZT 1U48A 2ZJPQ 3K0JA 4AFFA 4OJHA 3PTWA 1TQLA 5ETPA 1B70B 2XHCA 4LBIA 2QL7B 4B3OB 1NDLA 2KFYA 4ES2A 1VHIA 5BYRA 3EE3A 2GVZB 3AB2B 3CCVS 2HMIA 3T9NA 3VALA 1AFJA 3OL6A 1UVJA 3OXGA 2J8SA 1IBCB 3R3TA 1DAXA 3MM7A 2W24A 3W2WA 4WP8A 3KDNA 3KLIB 3BSNA 1HW8A 1KQFB 3QZ8A 4DUYF 1PYTA 4FZVA 3M32A 4GO5X 3T1HJ 3W9IA 1UEUA 4USVA 3KMSA 4UQGA 3PFOA 4CLSA 3C16A 4DS5A 4KY3A 2IDLA 3JYTA 4N77A 4K4ZA 1HQUB 1SJ1A 3IS9A 1JXEA 3H5UA 4B9LA 4YP3A 2J9EA 2DYAA 2DKOB 4OV1A 5H9EJ 1RAFB 1NB7A 3CNQP 2J7UA 2ADBA 3AA9A 1I5OB 1IBLF 4KHRA 1XR6A 4GVBB 5KFBA 1GMUA 3FEYB 2RQ4A 5LMUJ 5CXTA 4BWMA 3ZTRA 1GTEA 3DLKA 3T5KA 3TJ9A 4CNZA 3I82A 1ROFA 1OO0B 2E5IA 2R7XA 1CLFA 5FLXY 3IAS9 3MM8B 1JLGA 2GCFA 4Q43A 1U7LA 2NQPA 2ZHBA 2GJFA 5GAEU 3OFEA 3C6UB 4XIUA 4HHJA 2NLWA 1URNA 1DRZA 1M5SA 2F9JA 1Q4RA 2MTLA 3HO1A 4HI1A 4J9SA 1VDHA 3FJ2A 1Y3JA 4XK8C 5BYQA 3G2XA 3CJRA 3AJ1A 2A0FB 3KHHA 2YXLA 2H65B 1EKRA 2M2BA 3M4XA 4OI0A 2QG9B 4TVAB 1AZSA 4F2SA 3HVWA 1S77D 1S79A 5A6WA 3AY0A 4ZVGA 3MM9A 3HSZA 1I1GA 4H4MA 3DGPA 2WVEA 2DRAA 1N33J 3ICLA 3FQKA 5DGBA 4M5HA 5T7LA 1U25A 4NYOA 1RAHB 1FKOA 1DLOB 5KG2A 4ECVA 2NXCA 2FIUA 4Q2MA 2MQOA 1H2VZ 3B6BA 3O44A 2MB0B 2QC3A 1BUXA 3QIPB 3MEKA 3PW5A 4NOHA 1TKTA 4BC7A 2FC8A 4CO5A 2RHSB 2HAFA 1F1BB 1CJVA 4KJIA 2V5HG 6FD1A 5L9XA 2N7CA 1OPZA 2CWKA 4L72B 1WC3A 4KKOB 3ONQA 3BB5A 3X3UA 2OD4A 4F0HA 3GPAA 2NYHA 2KTQA 1JLCB 4F50A 1CJTA 1YJRA 2AEMA 4USIA 3GTYX 4ED7A 2AYGA 2XNRA 1ZM4A 5EUHA 2C2NA 2O3DA 1DY3A 3PW0A 4ANDA 2CG4A 6FDRA 2LXFA 4H4KC 1VBYA 5F0WA 2CVIA 1VBXA 4F0KA 2V4JA 2FPHX 4B9UA 4LF2A 2J0XA 4J7CA 4ENOA 3QATA 1YJUA 2ZE2B 1QAJA 2G4BA 5F8HA 3LP1A 1LFWA 4CO2A 3C66A 4CM2A 4YY3F 5KG4A 4KR0B 1UA0A 4DUZJ 5KFQA 2KT3A 5KFPA 3OXLA 3HX9A 3SMZA 1QJHA 5CH7B 1RHMB 3FBCA 1RWKB 4EMDA 2KB2A 2VDHA 3RRGA 5C25A 4P2FA 3C2PA 3D1HA 1DTQB 4LF9F 4ED0A 1Y7PA 5J2QA 2LQ8A 5C24B 2XY5A 1B99A 5D0RA 3R5JB 1H7XA 3ADAC 1FDDA 5KFKA 2VQFJ 2W7AA 1U24A 4ZVTB 2CQGA 4KH0B 2CA9A 1NUEA 4DUTA 1REVB 1IM6A 3KLFA 4F02A 3H42A 3MFHA 1KQKA 3I6PA 4F26A 2MQMA 3UCZP 2ZD1B 4EBDA 1NK8A 1H0HB 3DU6A 4B9TA 2KG1A 3EGZA 2KRBA 4CT8A 3D6MB 2PFDA 2UV8G 4BHQA 4DPUA 2HBZB 1MW7A 2DGUA 2H3EB 3QIDA 1XNRF 2E7VA 3H20A 1N5YB 4OMFG 5L46A 1X4GA 1S0VA 3BGUA 3IWXA 1YRUA 3OV7A 5ETOA 2KXHA 2DR8A 1NK5A 2OEMA 4GKKF 2XS5A 2FVCA 1YLXA 1R8PA 4C8MA 3M9OB 4ECZA 4RX6A 3D2WA 3PG9A 1VQ5S 3OL8A 2UUAJ 4F04B 4RWXA 2GX8A 1S1TA 3C15A 3BO2A 2F4VJ 3FKBA 2L48A 4IG0B 2UUBF 2JEIA 2D1CA 3V6DB 1NB2A 4LSNA 2OSQA 1D09B 1ZOTA 9RUBA 2UXDJ 2Z4PA 2C2ZB 1XN9A 1RT3A 4EO6A 2V8DA 1S9GB 2R3VA 2GAHC 3TZXA 3I5BA 2IYIA 2L9WA 3I87A 1HKAA 4DPTA 2E1MC 3MPUB 3D0IE 2XEXA 3RG6A 5HJYA 2B56A 2VHGA 2J6UA 4A47A 3DI6A 3S7RA 5KFFA 4JI1F 3MEGB 3HHDA 4ZHRA 5D4OA 1C1CA 4Y0FA 3BKFA 3CB4A 4NI2A 1JB0C 3DNCA 3ZZPA 1V6HA 2OPQB 1FNXH 4DX6A 2GV1A 2MQLA 5LM7E 1N36J 5LMNJ 3MAQA 1KN6A 2L9NA 3CE8A 3EZOA 1XK8A 1UVLA 3D7SB 2JLFA 2DVIA 1DTTA 4LSLB 1RGVA 5CD4A 2XCPA 2CNLB 4O3RA 2YNGA 3H0PA 3MAHA 2OPRB 1WC1A 3ISNC 2LYVA 4AQYF 2WONB 4WWSA 2QO3A 3ZNJ1 2DR5A 3TR5A 1K73T 3DRYA 4D3HA 4DMZA 4OYIA 4WYWA 3N0VA 2HFZA 1RWXB 3BGLA 2YKNB 4ED8A 3M8RA 4PQAA 1RT2A 2IYGA 3L7PA 1HPZB 1Q8LA 4RUAA 1HNWJ 1JLFA 2BJ1A 3Q8QB 3HM9A 3JQJA 4NA1A 1KKHA 4H4KA 4WTOB 2YWKA 1Q0NA 3A3PB 5A8WB 2VG6A 2HK2A 3K17A 2JEGA 8RUCA 4DHVA 1XR7A 2A10A 4QIFA 5KFCA 4ECUA 2FJBB 3I31A 4JI0F 4OJ1A 3HFVA 4V19J 2WAQD 3MMJA 3KNAA 2J0QD 1JJ2R 1WTBA 2A2DA 4QCLA 3H5XA 2K1RB 4FP9A 1UL3A 4DV0F 4NLUA 1VMBA 3D68A 3PXGa 3J80Y 1MWYA 4C8ZA 2VD3A 1M1KT 2ZH2A 3T1YF 4JI3F 2QFIA 3MAAA 1XQIA 5HP1A 5KT7A 4DQSA 1RHUB 1TKZA 1YRXA 2WZ1A 1I94F 4IFYB 5HN0A 3NRBA 2ZBRA 3BBFA 1QSYA 2Q1LA 2XMVA 3A1YG 1U1RA 2MSTA 4I6YA 3VAKA 1X0FA 5CHCB 4M5GA 3TEHB 2KFZA 1IKWB 2LLZA 3W5XA 4DV3F 4J5OA 4QBUA 4DV4F 1FKPB 2OPSB 2F65A 1UZHA 5C2GA 1TKXA 3HMJG 2ZM6F 2HHPA 3CIMA 4OZ3A 3D9BA 4O23A 2XCAA 3D5MA 2AZ3A 4F4KA 3CCLS 2AKWB 4MIBA 1X4FA 2QLJB 2EC2A 1H73A 2EFPA 2OI2A 4QQBA 4RBTA 2LU2A 3THPA 2DCLA 3N6LA 3DLEA 3OTCA 4KBIA 3BDEA 2WCXA 1A9NB 1U47A 1JKHB 1RB0A 3AOBA 1MLAA 3TYTA 4DL6A 2C42A 4YS2A 4FNHA 2FZGB 4GC7A 1HI0P 1WD6A 2IM0A 3Q2SC 1QDUB 2FY1A 4G6VB 3SQGA 3FGVA 3EPGA 1S6PB 4O3OA 2KU7A 5JUMA 4YQWA 2BANB 2DK2A 1EIYB 2XMJA 4IFVB 1JLAB 2E1RA 2LEPA 4USTA 3TOQA 2F63A 5I42A 5IXUA 4PG8A 2NUUG 4KSEB 3V2UC 4N76A 2CDQA 3QRPA 2Y8WA 1T9XA 2RNEA 5IWAF 3VQTA 3TW0A 2BQ3A 4A8KA 2X1FA 1VQKS 2RAQA 4Q8FA 4URGA 2VC1A 3QGIA 4CLTA 3VV2B 3GONA 1RT1B 1SV5A 1R43A 2CZVC 2AJ0A 5KFMA 1S4EA 2C3PA 5A0YA 1ZBTA 4JI6F 2R2SA 1RCOB 2MZRA 3M8PA 1LWCA 2YNFA 1M5HA 2B5JA 2MDAA 2RF2A 2A2CA 4L73A 1JJ4A 3A8IA 4X62F 3BPSP 3OW2R 1T02A 3I9V9 2XNQA 2ZUGA 5KG7A 1T9VA 2B9XA 3OBIA 2DIUA 5KFXA 3AD9C 3ENVA 1T03A 4ZVQB 5L1IA 2NZ4A 3IBCB 3W9JA 3J81U 3TA1A 1VRUA 3JYTB 4DG1A 3SCLE 4UUWA 2ROEA 4JYAF 4F4WA 4AL5A 3M8QB 3RU0A 1L3KA 3DRSB 4ZCLA 3VVTA 2GQ2A 4CM0A 3BEGB 3KJNB 1RDRA 1TFWA 1ZS6A 1EQ0A 4FVMA 1TV6B 5DDPC 1IKYB 1FA0A 1AFIA 1RBAA 4IOCQ 3I4HX 2ASLA 4UY85 2E7XA 2QL9B 3RRHA 3KLVA 3DLKB 3D6FB 3K7RA 1CQNA 3JS9A 4JI7J 1BGXT 1E6YA 4QWBA 1FX2A 3AHPA 2BR0A 1XBWA 4R5PB 3DYAB 4B3MF 3FFIA 1RTIB 1HD0A 3K5MA 1KQGB 4TLQA 3PZPA 1OSCA 2RD5C 3EDQB 5KTQA 1UW4A 4J9VA 4ES3A 2FHKA 4ZPCA 5CYJA 2V4QA 1VHFA 1P9YA 4QWAA 5D77A 4C3KA 4Q2LA 4HT5A 3SCIE 4YHHF 1YITS 2YH0A 4RUCA 2ACYA 2YX1A 4EU0A 3ZXWA 4QIEA 3WX8A 2MJUA 1NEEA 3ZZTA 3M8YA 3OTDA 1FXDA 4Z7YA 3LW5C 1Y4ZB 1YZ7A 4WCEQ 1SJFA 4YOEA 1PAEX 3GFYA 1RT6A 4WFBQ 2D3ZA 3SV3A 2HHTA 4N41A 3NL0A 5DLFA 1WOSA 2LMIA 3QGHA 3DU5A 3GFZA 4K0KJ 5A2QY 3CCWA 5AE1A 5CZXA 4DU8A 1X5PA 3V4IA 4OHZA 3DLBA 2IVFB 2DT9A 1TKTB 4K4TA 2WVBA 5KFDA 2VJVA 3QSIA 2POKA 2JH3A 2NXUA 1EP4A 3WQPA 2MZ1A 3D0GE 2OMLA 4X2BA 1N52B 1RABB 3D1QA 5C42A 1EZZB 3NMRA 1ZAVA 5BXIA 4DSEA 3MUTP 2ZDOA 1GH8A 4A48A 2YBVA 2GMJA 1CJTB 1V9OA 2B4PA 2FZCB 2N3LA 4NRUA 1WF0A 3BBBA 2DGSA 1N5VA 1KNZA 1RKIA 3TANA 4ZCKA 4R8UB 4E0DA 1X5TA 2HIYA 1HBOB 2DNQA 1V3SA 4ZPDA 1HBUB 4BCAA 3RTVA 1J5OB 1HNVA 2CQ0A 4NEZA 1J27A 3O1LA 2YWWA 4DEZA 1J2VA 2V4JB 1C4AA 2AP6A 3IXQA 5B0DA 1UEVA 3GJRB 3R5GA 3DKDA 2ZUAA 3DXBA 1XMOF 4OI6A 2XC9A 3LP1B 2A3JA 3RUBL 1KOHA 2PA8D 4IUFA 3TQEA 3NXZA 4ZPWR 3UN2A 3MXHP 2HQIA 4B02A 3M6VA 1B0VA 4CTAA 1MMLA 2CKWA 1IR2A 5C25B 2B51A 3RBDA 3OUYB 3VAFA 1QAXA 3EJMA 4DUYJ 5J2QB 2FYXA 2ZZTA 3DOKA 4CIOA 5A6PA 3OSPA 4WBFA 2HVZA 3CO0P 1S57A 2BXJA 4NMXA 4TU8A 2R7UA 1NPRA 4ELTA 2YWEA 4ICLA 3AT1B 4KHMA 3NGUA 5IT0A 4DQRA 4LVNP 4FXVA 3DFEA 2QYCA 2AU0A 5KG0A 3KLFB 3EX7B 3EVOA 5KFZA 2BJDA 4ETXA 3CXCR 1H98A 4Q8EA 4LQ3A 2YNHA 1KFSA 3QFHA 4URQU 1FI4A 4ZS6A 3HHLC 3HSJA 4YB6A 1CULA 2G0CA 4DR2F 1KVIA 3K2YA 1OMSA 1VLOA 3CO9A 3RAMA 1HNZJ 1TP7A 4NX9A 2W9AA 1L3TA 2J76E 3V81B 3DOLA 4X4UA 3CJ5A 4YR0A 2KXFA 3BGFA 2KVQE 4A8QA 3LGHA 4JBCA 2UXBF 4IH5A 2DNGA 3ELHA 2BBEA 4ID5A 1Q16B 5GAHU 4IG3B 3T41A 2GVDB 3FC9A 1ICEB 1ZA1B 4NLOA 3BBCA 2JL9A 2CJ9A 2YKMB 1VQ9S 5H9EK 1E6VB 4JV0A 2BKNA 3C15B 1EETA 4I64A 3I32A 5K14B 2OMOA 3ZTSA 5EX0A 4R0EA 3H5SA 3HI9A 2MHEA 3Q86A 4LSNB 3TZZA 1SC1B 2BABA 1AXQA 1FO1A 2C28A 1RT3B 4LIWA 3ZO7A 4TU9A 4OL8A 3LANA 3PKYA 3GIKA 2MKIA 5K5MA 3BKTA 1NJXA 1ZAWA 4WKRA 1VJWA 4IR9A 3EWGA 3RGIA 1KHWA 2L3MA 2PO4A 4GVLA 5CABA 3HT3A 1N54B 1D8ZA 3P8BB 1NAQA 5BR8J 2AW0A 4ZIVA 3H90A 1C0UA 2R2RA 3DI6B 3DRPA 2OAUA 2HKEA 1LFPA 4OHWA 5DQHA 3MM5A 4JUZA 3QAEA 2C3YA 3TAMB 1C1CB 2CJYB 1BD6A 2JFKA 1YZ6A 4KPCA 2DNZA 4B3SF 1YBAA 2UXCF 3I96A 1LOUA 2C3UA 4K4XA 2E5JA 1YBUA 3WIUA 3W64A 3M2UA 2DPIA 4A8MP 4QIGA 4B3RJ 3ZFVA 2IDEA 4WPAA 1X5OA 1XMQF 4U6PA 1VRQC 3VTIA 3H4BA 3D67A 2YNGB 3TP2A 2AYBA 2VA2A 3OTBA 2PMWA 3NLCA 3NMAA 2BW7A 3UDVA 4DQPA 2M88A 4C4WA 3KK3A 4DV7J 1HYSA 2ATLA 1OPIA 1XMBA 4WTYA 3KK2B 1RTZA 2VPWB 1SQFA 3BZQA 1RT2B 1MWQA 2EKNA 1CS4A 3PHEA 3QJLA 4OYWA 1JLFB 2YQ0A 1P9QC 4ZLJA 1Q5VA 4NA2A 1RWNB 3MMCA 3OL7A 2W1BA 1KTVA 4X4VA 3GIMA 1YG0A 1UW9A 1S9EB 4PG4A 1NKBA 2RUGA 1ZZFA 4LF9J 3OL9A 3TAQA 2HNYB 2KI2A 1WF2A 4FVCA 1RWPB 3GQCA 5G0RA 1A6LA 3NGSA 5D78A 5J2PA 3UI3A 2P9GA 2VFUA 2QLBB 1NPKA 2ASDA 1LK7A 5DLGA 1S1VB 2MLXA 1SQGA 3AH6A 3QT5A 4JV5F 3GIIA 2EEYA 3AXMA 2FLPA 2G2YA 3LAMA 4F4ZA 4DR1F 1F9EB 5AXKA 3UO0A 1JLEA 1FXRA 1P1LA 2DNMA 2QMXA 5SZTA 1HR0J 5HSPA 2DR6A 1RTJA 1KBRA 4X4SA 5HQLA 1FEHA 3IA0A 1UWBA 1WI6A 3V5RA 1TKZB 3H4DA 4Q0BB 2OELA 4M5DB 3VAGA 2DNPA 5FDLA 3H2LA 2MZJA 2FJWA 4ZOSA 3KLGA 1GX5A 3M9MB 1SC3B 4OHVA 3SSQA 3GMGA 2YPZA 2DNHA 1TKXB 2VG5A 3R2DJ 2KM8C 1KQSR 5KOWA 1P27B 5KFWA 5L1LA 5IC4B
chains in the Genus database with same CATH topology
1HQEA 4QR2A 3V6KA 1BQMB 3J7A1 3HHLA 3PRDA 1SIWB 2NQPA 2R4FA 3KMQA 2ZHBA 3MOZA 4OX8A 1S7HA 5GAEU 2DITA 2AJ4A 3MM6A 2DGTA 2XS7A 4JOUA 3OFEA 4PG6A 5B0AA 3C6UB 4XIUA 2VV5A 4HHJA 2APOA 1QUPA 3ZZOA 1R3NA 1Q7YT 1CPZA 2NLWA 1URNA 1DRZA 1OQ6A 1UFLA 4ZA1A 4YR3A 1IKVB 3DCAA 4NLWA 2R8HA 2B43A 1M5SA 1N0UA 5DG9A 4DFMA 3OLBA 2F9JA 4X4RA 2AJ1A 1Q4RA 1XEZA 5EHHA 5K8MA 4QIWD 3HO1A 4XDDA 2A1BA 4HI1A 4M8LA 3JTNA 4J9SA 4DV5F 1BWEA 1YQHA 3FJ2A 5I3QA 1Y3JA 4XK8C 5BYQA 2B3TB 1RT4A 3VCDA 5LT5A 2JVRA 2IA0A 3AJ1A 3MMBB 2HFNA 3UR3C 3KHHA 5DGAA 4RW4A 3QPIA 4ID8A 4ZDNA 1NZAA 2EFQA 1VRTB 4ETZA 4ID5B 2M2BA 3M4XA 3N6MA 4OI0A 4PR6A 4MTPA 3G6XA 3JSRA 4KGKA 2EBGA 2NS1B 2BOPA 4FYDA 3NCRA 5JVGQ 2BYCA 3MMAA 4K5SA 2C2RA 2K2PA 4F2SA 1H3DA 4UQTA 3QO9B 1RT5A 3HVWA 3N28A 1S77D 4WU2A 1S79A 3CDUA 5A6WA 4LUBA 2CYYA 3UWTA 1W2IA 3AY0A 4DL7A 4B9NA 4YDXA 4ZVGA 2FGCA 3MM9A 2PI4A 1I1GA 2W4PA 4H4MA 4KO0A 3N9UC 5L9NA 4X4NA 3DGPA 2DGVA 3ETOA 2VOOA 2PEHA 3K5NA 2RKIB 2W4CA 4HTJA 4CI0B 2UV8A 2Y1JA 4NXNF 1SL2A 1FJCA 2DRAA 1U09A 4ELVA 4RNOA 3F41A 3DRRB 3ICLA 3FQKA 5DGBA 1WTFA 2DGOA 2NREA 1EETB 5T7LA 1U25A 4NYOA 5L38A 1M90T 2QV6A 2WOMB 1FEEA 1VS3A 2PE8A 1FCAA 4NCGA 2BJEA 1FKOA 4HH0A 4K4VA 1X4AA 5EGYA 1DLOB 1SIZA 3HHNB 2YY3A 4C3LA 3MTKA 4TYAA 5KG2A 4DDFA 3QAUA 4ECVA 3N01A 2FJVA 1Q78A 2ZOFA 5F8LA 2JC0A 2LQ9A 2DNLA 1KEKA 2FIUA 4Q2MA 1N5QA 2I5JB 4C0OC 3TQ1A 1S72S 3OR2B 2HRUA 2MQOA 1NNDA 3PEJA 1H2VZ 3FNNA 4RW6A 3WC2A 1KHVA 2YKAA 5U47A 4LSLA 1RP5A 5EWEA 1S6UA 2F8MA 1S99A 5HBMB 3CUNA 4NCAA 3O44A 2MB0B 3FZ2A 1U6BA 2UU9F 1RWUA 1SV5B 3GE9A 4OX9F 3OVSA 3H2VE 3QIPB 2MQQA 3M9NB 3RR8A 4MFBB 2M9KA 3MEKA 3NS6A 4I68A 2DGXA 1RAJA 3PW5A 3MEDA 3H2UB 2BZ2A 5KG3A 2CIMA 2YTCA 2XGQA 4N8OA 4O0IA 4IYQA 4NOHA 3OJUA 3CCES 4DWIA 1FE4A 4C2MA 3G71S 2HG4A 1TKTA 4BC7A 5HLFA 4PXCA 3P96A 2FC8A 4CO5A 1VIOA 3KLEA 1IJFB 3M8PB 4DFPA 1LWCB 2YNFB 2B5JB 1U4BA 2P6SA 3LALA 4P7VA 1VQMS 4KJIA 1QUVA 2WONA 4K4SA 1R8CA 3M30A 1RYRA 1CC8A 2V5HG 1RTDB 4HL9A 4B17A 3DLHA 3IGNA 3CDWA 3SEOA 6FD1A 5L9XA 3BDPA 2N7CA 1OPZA 4L72B 2OFHX 1UAWA 1Y0HA 3DRPB 3NNHA 1VOMA 4KKOB 4F25A 3ONQA 3TA2A 3ZZYA 4Y2KA 3BB5A 1U49A 1T7PA 2PI5A 3X3UA 2C22A 4KHPF 3VAIA 1MU2A 2OD4A 4DL4A 3CGIA 1T05B 1G1XA 4JI4F 3RRKA 1GXTA 2KTQA 1FTCA 5KT2A 1TZ0A 2YNIA 1D9FA 1T3OA 1JLCB 1HHSA 4F50A 1YJRA 3QJPA 2CFXA 1HPZA 4USIA 4ED7A 2AYGA 1Y00A 1VRUB 2B4OA 3TX8A 2XNRA 1SL1A 3DXSX 4DBQA 2Z8QA 1DQ8A 4G1PA 5L1JA 1ZM4A 5EUHA 4MJKA 3T9ZA 3RB6A 1MROB 2O3DA 3J7YI 3PDNA 4HYKA 1H2UX 1LW0B 5LSLA 3PNIA 2A18A 4C0HA 1VBZA 1U2RA 1FJ7A 3M2UB 3PY8A 2F3JA 3PW0A 4URSA 4HH1A 4KIAA 4DR4F 4GKJF 4K4WA 5AXNA 2VFTA 2CG4A 5B0GA 2EFNA 1VK8A 3J7Z5 6FDRA 4LQ9A 5JJBA 3PJXA 2LXFA 5J1EB 4DQQA 1KLMA 1JLQA 4H4KC 4WXWA 5F0WA 1VBYA 5A8WA 2FGOA 3D0HE 5IM0B 5AE3A 3LP2A 1D3WA 1IR0A 2DD8S 3B82A 1LWEA 2CVIA 3CT9A 2R7RA 4JI7F 1VBXA 2KG0A 2V4JA 2FPHX 2NPFA 4UOCA 4Y2CA 3I0RB 4HTIA 5GVQA 3IRWP 4B9UA 1QAYA 3IR7B 5DG8A 1SXLA 3HVRA 3QLHA 1TKDA 2J0XA 4L6V3 2LECA 4W90B 3W2VA 3AQPA 4U9RA 1NO8A 1YTYA 3BO4A 2XB2D 1KR4A 1R8AA 3LF0A 4DSFA 1YJUA 5MLCV 3HJFA 4FF4A 2GGPB 3N4WA 5HQ8A 2FUG9 3DC2A 2ZE2B 2HWTA 3VR1A 4ALZA 1QAJA 5F8HA 2G4BA 4MIAA 3LP1A 1LFWA 3ITHA 3TUJC 4P7TA 4Z2XA 4CO2A 3BS9A 3C66A 2LQBA 4YY3F 3IR5B 3OVAA 5J1NA 3THVA 2HLTA 1E6YB 5KG4A 3KK3B 2I38A 4KR0B 1U6FA 4I2QA 1UA0A 1HYSB 1GQEA 4I7FB 4RLEA 2K1RA 4TLRA 3RW6A 1LXJA 1FRJA 5KFQA 2KT3A 5KFPA 3OXLA 2JHEA 3HX9A 4PCQA 1QJHA 5CH7B 3CJKA 3SMZA 3SSRA 4BWJA 2N4DA 1N0VC 3P6YC 2ZH5A 1JXLA 4FF2A 1NKEA 2IRXA 5HMYA 2KB2A 4C8NA 2COLA 4I2PA 4Q45A 2YX4A 5KT4A 2LEBA 3RRGA 5A8RB 4KAIA 5C25A 3FFIB 3K5OA 1WEYA 3C2PA 1VQPS 2V9KA 1UETA 3RAQA 4F67A 3D1HA 1DTQB 4O4GA 4GMKA 4ED0A 4LF9F 5F9NA 3MECB 2B7CB 4JI2F 2ZH1A 1K0VA 3I55S 3PACA 1Y7PA 2JFDA 4N47A 5J2QA 4NLGA 5C24B 1PILA 3MMCB 1L3SA 2XY5A 3FDSA 4TKTA 1CC7A 4KC5A 4K2XA 4LF7F 3P49B 1H7XA 2XBPA 2EFVA 4IFYA 1SUQA 1R27B 3H98A 3OLAA 1S1XA 1FDDA 5KFKA 5I3UB 2W7AA 4CH7A 2EKYA 3E51A 2QLWA 4NLTA 1U24A 4J9MA 4ECXA 5KFHA 2CQGA 1U1PA 1R31A 4LFCF 4F2RA 4H4OB 2HLUA 2K3IA 4Y6IA 3X1LB 3G96A 1REVB 1JJHA 3I4PA 1IKWA 2XMMA 3KLFA 2HMIB 4W92B 4F02A 2HQ3A 3Q0AA 2OPSA 5KT5A 3MFHA 3CULA 5D8HB 2IA6A 1KQKA 5LL6d 3I6PA 1BLUA 4F26A 4J9NA 2MQMA 3OPKA 5BJRA 1URRA 5J2PB 3UCZP 2AX1A 3DRXA 2R2TA 2ZD1B 3MDFA 1HFEL 2VG7A 4EBDA 1MWZA 3MM7B 4LF6F 1NK8A 1H0HB 1XR5A 3DU6A 3PR4A 2R8JA 2AJQA 1Q81T 1FXLA 2UVVA 3W2WB 2KZZA 4OX6A 1JWWA 2ZC4A 5J2NA 1IKXA 3I5CA 4B9TA 2KG1A 4KGMA 4OZJA 3DM2B 4O44A 1PGZA 1LKZA 5ITHA 4K0KF 3NAHA 3ULHA 4IR1A 3C6TA 2YH1A 4BC9A 3M32B 2KRBA 4CT8A 3EGZA 3CCQS 3QMQA 4G1IA 3TRGA 4X4QA 2UV8G 2ZJQQ 4BHQA 4CO4A 2GIQA 1D1UA 1JLEB 5E3AA 4C8LA 1MW7A 2XG8A 4WFNQ 2F1FA 3CSKA 2DGUA 2VUGA 2E7WA 3K5PA 1TL3A 1RTJB 3M1VB 3QIDA 1XNRF 2HS0A 3OJSA