2FC9A

Solution structure of the rrm_1 domain of ncl protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
GSSGSSGNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RRM_1 domain of NCL protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords NCL protein
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fc9A00
2RVJA 4C7QA 4W92B 5GVQA 5D78A 1VBYA 5BJRA 4UY8T 1HA1A 2XSFA 3H2UB 2KXNB 2VOOA 1YWXA 3SMZA 1DHMA 2MJNA 1AUDA 2KM8B 4IO9Q 2OJ3A 1A7GE 1X4DA 3VAFA 5DDQC 2DGWA 2MKKA 3CMAS 4WIIA 1X5SA 2MSSA 1WI6A 1SJ3P 4F02A 1BY9A 2RQ4A 2U2FA 2HVZA 1U1OA 1M1KT 4IOCQ 1OWXA 2FC8A 1SJFA 3THTA 1O0PA 2DGVA 4IOAQ 2G0CA 1OPIA 2RQCA 3UD3P 1U6BA 1UFWA 2CPFA 4UQTA 1M5PC 2MGZA 2CQBA 1N88A 2CPZA 2RNEA 2MKJA 3FEXB 1OIAA 5DM7Q 2MQOA 3SDEB 2MY7A 1ZH5A 3MUTP 2KXFA 2CQHA 4W90B 3US5A 1QVFR 1JJHA 1VQ5S 3S01A 1DRZA 5CYJA 1U1QA 3NNAA 2J76E 2DNMA 2RS8A 3THPA 3K0JA 3IRWP 1H2VZ 2QA4S 2OSQA 1FXLA 3NNCA 2CPHA 3OW2R 1H2UX 2CQ1A 2A3JA 2DNKA 1W2BR 3DLLQ 2DH7A 2HGMA 2JWNA 2M8DB 1U2FA 5LJ3Y 3EGNA 2KG1A 1SXLA 2O3DA 3VAIA 1P27B 3S7RA 4EGLA 3CCJS 1VBZA 1Q82T 1JJ4A 4LIRA 4ED5A 1PGZA 3UE2A 2X1GA 3EGZA 1U6FA 1U1LA 3PIPQ 3CCUS 2LEBA 1VQNS 3R1LA 1FT8A 2M88A 2V94A 3U1LA 1VBXA 3NS5A 2M8HA 5D77A 2DHSA 4TU7A 2CQGA 3MURP 4BS2A 1WF1A 2DNPA 1KD1T 3P5TL 4U67Q 1FO1A 1Q7YT 2LA6A 2AYGA 2MQNA 2FPHX 1X4BA 1X4AA 2ADCA 5JVGQ 2EK6A 3SDEA 2JVRA 1X0FA 3BO3A 3NS6A 2XNRA 4M5DB 3ULHA 4OZ0A 1X5PA 4WFBQ 2MYFA 2MMYA 4WKRA 2KRBA 4QU6A 2LA4A 4F25A 1R8PA 2KU7A 2I38A 1R8HA 2MZJA 3P6YC 2KT5A 1SJRA 1WELA 4QPTA 1VQ7S 4A8XA 3UCGA 3CCQS 2XB2D 2E5IA 2L41A 3NNHA 1RK8A 3H2VE 3D2WA 4FXWA 2NLWA 1WHWA 2YTCA 3J7YU 4TU9A 2CPIA 1VQPS 2CPJA 5DDOC 2CPYA 2FHOB 1SJ4P 2KH9A 2MQPA 2DGOA 2CQIA 2N3LA 2DHGA 2MKSA 2RU3A 2LYVA 2M2BA 2MHNA 2VONA 3J7ZT 2DB1A 3HI9A 5GADU 4TLQA 1OO0B 5IQQA 4V19X 2CQ4A 2E5GA 4CQ1A 1G2EA 4OZ1A 4PKDB 3CCVS 1VQ6S 2M70A 2GHPA 3B4DA 5LXYA 2KVIA 2Q79A 2BOPA 3Q2TC 2FY1A 1SJQA 4WF9Q 2CPEA 2HGLA 1F9FA 2XS7A 2KYXA 2UP1A 4WCEQ 2MGZB 5DM6Q 1NU4A 2KI2A 1HL6A 2MKCA 3UCZP 1VC6A 4TU8A 3UCUP 1Q81T 3FEYB 2L9WA 2YKAA 1NJIT 5IM0B 2MZ1A 3MUMP 4YB1P 2N82B 2FC9A 2YWKA 3CD6S 2LXIA 2F3JA 2JRSA 2QFJA 4CIOA 1U1NA 4IUFA 2DITA 1WEYA 2HZCA 2MZRA 3CCSS 5GAEU 3G9CA 2PEHA 2F9JA 1K73T 1VQLS 3N9UC 2BZ2A 5EN1A 4P6QA 3G71S 2NZ4A 2OTJS 2M9KA 5IM0A 3IWNC 5JVHQ 5CXTA 1VQ9S 1M5VC 2LXUA 4RU2A 1VQOS 2DNGA 2CQCA 4Y0FA 2RRBA 5GAGU 4C0OC 2X1AA 3VAGA 2D9PA 1FHTA 2MY8A 4CH0S 2WBRA 2DNLA 5CA5A 2DNHA 4PR6A 5LSLA 2MQLA 3CC2S 2OTLS 3BS9A 1VQ4S 3MD3A 5FJ4A 2JVOA 4PRFA 1M5KC 2AYMA 3DXBA 3ZZZA 1DZ5A 2DNYA 1PO6A 3VAJA 2E44A 3UWTA 1DBDA 3R1HA 1K9MT 1JMTA 1A9NB 1YI2S 3CUNA 5H1SV 3RW7A 2M4MA 1P1TA 1UW4A 1N54B 5GMKa 1H2TZ 1WTBA 1B7FA 2DO4A 2MJUA 1FNXH 1VQMS 4QU7A 3MDFA 4WFNQ 1YIJS 3PIOQ 2VOPA 3MI7X 2CQPA 1WEZA 2E5HA 5LJ5Y 1FJEB 1U1PA 3CCES 2D3OR 2ZJQQ 3HHNB 2MQMA 4C4WA 1D9AA 3CPWR 1IQTA 2KG0A 2DNRA 3VAMA 1VQKS 1XN9A 1VQ8S 2G1DA 2LEAA 2DIVA 2DHXA 1X4FA 3CXCR 1N8RT 2LECA 2DNZA 2ERRA 2DH8A 1YHQS 3BO4A 2KHCA 2OIHA 5HL7Q 2I2YA 2CQ3A 2HYIB 3BEGB 2MKIA 1CVJA 3RW6A 3G6ES 2DO0A 2MZTA 3CCRS 2DNNA 1VC0A 1FJCA 4F26A 1S72S 2DIUA 1YJWS 3CF5Q 1KC8T 1X4HA 2HGNA 3CC7S 5GAHU 4Z2XA 2OSRA 1WEXA 1WF0A 3VALA 2VODA 2DGSA 2MZQA 4QQBA 1X5OA 2CQDA 1X4EA 1WI8A 1QVGR 2KFYA 2QEXS 1KOOA 3MOJB 5IFMA 3P3DA 2MXYA 3I56S 1D8ZA 1X5TA 4Y00A 2AYEA 2M0GB 3G4SS 2ZJPQ 2YH0A 3I55S 3L3CA 2SXLA 5ITHA 1WG5A 3LQVA 3CCMS 2XS2A 3MXHP 2MKHA 3TYTA 1Q86T 1K8AT 1WWHA 2B0GA 2RUGA 3R27A 2MQQA 1FJ7A 1L3KA 1KOHA 2K8GA 3V4MA 3VF0B 2XS5A 2F9DA 3BO2A 1HD1A 2X1FA 2N7CA 2CPXA 1N52B 1WF2A 3SXLA 1H6KX 1WHVA 5DDRC 2RS2A 1KQSR 2KN4A 2MZSA 2EK1A 4LJMA 1NO8A 3B4MA 3CC4S 2LCWA 2ZJRQ 2DH9A 5LXRA 2DISA 2MPUA 3G8TA 3VAKA 3G96A 2EVZA 5DETA 1X4CA 2CQ2A 4FXVA 2DNQA 2DNOA 3EX7B 2M7SA 3CCLS 4YOEA 1M90T 3CMES 3P49B 1UAWA 2D9OA 1YJNS 2DGTA 1VC5A 1S79A 2CJKA 3MUVP 2U1AA 2KXHA 3TO8A 2CPDA 2JX2A 1X4GA 2XNQA 2X1BA 3CTRA 3VAHA 3TP2A 4ZKAA 2DHAA 2N3OA 3MD1A 2J8AA 1U1RA 3G8SA 2MSTA 4J5OA 4YUDA 3S6EA 2K3KA 1WHXA 3LPYA 1URNA 2J0SD 1U1MA 2DK2A 1RKJA 3CULA 1WG1A 1ZZFA 1HD0A 2LKZA 2GO9A 4CH1A 1M5OC 2RRAA 5LSOA 4ERDA 1QM9A 2J0QD 2ADBA 2AYBA 1YITS 2CQ0A 2DGQA 3U1MA 1JJ2R 3NMRA 2AD9A 2PE8A 1YTYA 5MLCV 5HO4A 2YH1A 2MB0B 1WG4A 2M52A 2RT3A 5DDPC 1UP1A 2LMIA 2LQ5A 2E5JA 3ZZYA 4WFAQ 3JB9k 2L08A 1U1KA 2G4BA 2DGXA 3S8SA 3Q2SC 3UD4P 1YJ9S 2KRRA 1WHYA 1ZZNA 2DGUA 4LMZA 2KM8C
chains in the Genus database with same CATH superfamily
1FCAA 1MN9A 2B9XA 4C7QA 1TL1A 2AV5A 3AHPA 1FE0A 5A8WA 5D78A 3PR5B 2IJFA 3W8PA 5HP1A 1VBYA 2XMVA 3RRHA 1PKUA 3AA9A 1PYOB 4FVCA 3H2UB 2KXNB 1Y5LB 3K2YA 5KFNA 3TOQA 1DHMA 3MEGB 5U47A 2BVZA 4IG0B 2YNFA 2CVIA 3D0HE 2YNGA 5J2QB 1V3ZA 2WOMA 2H51B 2YNIB 3ILOA 3VGVA 2KM8B 2C2OB 1K1SA 2VBYA 3IM9A 5L9NA 2WTFA 3VAFA 1FXDA 1APSA 1OSCA 3A8EA 4PEOA 3ZZOA 4AXJA 5KG6A 2J9EA 2DR9A 3POTA 2UUWA 1WI6A 2H54B 3QJPA 3R9LA 3N79A 4P9SA 4WU2A 1BY9A 1S6PA 1C0UB 2XHWA 2JJ4D 2LXFA 2RQ4A 2YNHA 3B54A 2PMZD 5DLFA 5H9EK 1JB0C 2KFNA 3DLEB 5FLXU 1RAAB 1S7IA 3RR8A 4NLTA 1OWXA 5L1KA 2FZKB 3AODA 2D3ZA 3CDWA 1OY8A 2GC8A 3NCPA 1FKPB 1KSPA 2ZH7A 1AROP 2ASYA 4HH0A 2RQCA 1HQUA 3TWZA 2B4VA 2ROGA 5ETSA 5B0DA 3UD3P 3CMQA 5J2PB 4ES1A 1RHUB 1G3OA 3I5CA 2W9AA 1X9WA 2CQBA 4AL5A 1Y4ZB 1N88A 2CPZA 2VBWA 2AJ0A 1F3VA 4S0MA 3HT3A 5DM7Q 3RBDA 1JLEA 1S48A 1K0VA 1HMVB 5CYQB 2XMWA 1TTHB 2MY7A 4J91A 3MUTP 4ECRA 2XY6A 4RUBA 4B9TA 2FJWA 3SYZA 1K44A 5F8JA 2HRUA 3QRRA 1HHSA 2CQHA 2XMUA 2YKOA 2NXCA 3US5A 4JI6F 5KFGA 1E6YA 4ZVEA 4USJC 2B7CB 2L3MA 3MMCA 3JSMB 5HMZA 1L3UA 1T0TV 3FC9A 4NCAA 3NNAA 2V4QA 3TUIC 2JH3A 2E29A 5HJXA 2PMHA 1BLUA 2OEKA 1FRIA 1RA6A 3FK4A 2N7YA 2WK4A 2PN6A 4CLZA 3RB6A 4NZ7A 1TZ0A 2GO8A 1RCOB 2GVZA 1FXLA 2IAJA 1DTQA 3P4UB 2H3EB 3HHKA 3DMJA 4DQPA 5KFAA 2CQ1A 4DUZJ 1B7YB 1RWVB 2F63A 3DLHA 1C1CA 2DNKA 2ZBIA 1I1GA 3E51A 4LREA 4AE5A 1FWPA 4LSLB 3M8PA 1PBUA 1B3TA 3KJNB 1PCAA 3JQKA 4TXSA 2RF2A 3CCJS 1NBEB 4H4OB 4LIRA 3QIDA 4RW8B 2KB2A 8AT1B 1NDCA 4LT6A 2EC0A 2G9OA 3HSZA 2Q66A 4DX5A 3TZYA 5A8RA 4HLBA 1FRKA 4F04B 1SKUB 2Z2YB 3D6TB 2OPSB 2V50A 3PACA 3ILIA 1UTAA 4J9LA 2HBZB 1EQ0A 4QWEA 4DUZF 2DRAA 1YGYA 3IGVA 4QWCA 1GXTA 4DPTA 1HHTP 3HX9A 2XO7A 1VQNS 2VDIA 1FT8A 2M88A 3ISND 5FIIA 5KFWA 1TK5A 5D77A 4LF5F 2NZCA 3JYTB 2VFVA 2DHSA 4A8FA 1IKVB 1VQYA 2CQGA 2OPQB 3BPSP 3K5PA 4GVBB 4USTA 5HANA 3MR3A 4IYQA 4BS2A 1LW0A 3MPWA 4YDDB 1F5BA 4MK7A 4I4BA 3P5TL 4UY85 1BQNB 4M8LA 4U67Q 4YR3A 3M9OB 4JI7J 2KZZA 3ONQA 3GJTB 5KFXA 5AXKA 4HTIA 4CH7A 4OZNA 1FNMA 1FKOB 1M5SA 2CG8A 2YQ1A 1X4BA 1X4AA 2QC3A 1SKSA 3AD9C 4JV2A 1K0TA 3EGWB 2JVRA 4WP8A 3MAHA 4QCLA 2EWHA 4EU0A 3UR3C 4NA3A 1IJEB 3IFEA 2ZH9A 3TARA 4OZ0A 4UW2A 4URGA 4LF5J 3KFWX 2BE9B 5IT4A 2MYFA 3EVOA 4WKRA 2DBBA 4WYWA 2QRRA 2QYGA 4Y34A 2IA0A 1TKTB 2LA4A 2NXUA 2FJXA 3E01A 2FJBB 2I38A 3ITHA 2MZJA 4NZ0A 3PHTA 3PRBA 1CJVB 4WE1B 4A8XA 3UCGA 4PUOB 3KMQA 2D7SA 2QE5A 3D3BJ 1UL3A 3AOAA 3FRZA 3QLHA 4USWA 4Y2CA 4U7UK 5F3ZA 5LT5A 1SL1A 5KFVA 2XB2D 2CRLA 2LU2A 4OHYA 4WBFA 3R5JB 1KDNA 1LXJA 1RWMB 2XWYA 2F5GA 2WRMA 3PCOB 2IYGA 3G87A 2C2KB 3JS9A 1GX5A 3KLGA 1ACMB 2R8GA 4TU9A 3PJ9A 2D3UA 1S10A 3JQMA 2V69A 1SJ4P 5DDOC 3SQGB 2UVUA 1ZPVA 3BREA 1Q95G 2VOOA 4ZJOA 1N6QA 3QAEA 3ZO7A 2ZBPA 1YBTA 2DHGA 2PO4A 2YWGA 4KGVB 1KLMB 2RKIB 2HZVA 4R25A 5RUBA 2RU3A 4DV5J 2OMOA 2M2BA 3FUYA 4RWXA 3EMTA 5HAOA 3AQPA 3FKBA 5IC6B 3BPDA 4FYYB 4HL9A 3UDLA 1YJUA 6FDRA 3J7ZT 4O3SA 1QUVA 4KQZA 1UWBB 4BDPA 4CDIA 3DN9A 3HI9A 5GADU 1N56A 4TLQA 2B8PA 3V4IA 2V63A 2E5GA 2NPIA 2OD4A 4RUCA 4KHRA 4F4KA 2EI5A 4B3RJ 4OL8A 1VQ6S 2HHVA 1ZM2A 1U0HB 2GHPA 2M70A 3B4DA 1U25A 3K5NA 1CLFA 2RDIA 1DLOB 4ED3A 1UZDA 1Y00A 2DTJA 2BOPA 2CNKB 1YVFA 4NMXA 3NGSA 1JLQA 1PJ7A 1F3FA 1XJWB 2CPEA 2YKPA 4UZCA 3TJ9A 3LP1B 2BKOA 5HMWA 4XPEA 1HR0J 2KYXA 1NKBA 4X4OA 4AQYJ 3UW1A 3GG1A 5HSPA 3C66A 2MGZB 1S1WA 3OBIA 3NGKA 5E3CA 3OL6A 1UPMB 3PFEA 3FFIA 2WZ1A 4MYTA 4F4ZA 4ZVTB 2KL8A 3A8JA 3CJ2A 2H5EA 1HNVB 2OEJA 4USUA 1JXVA 3UCUP 2BQUA 2FHKA 4FDFA 2L9WA 3BGUA 4I6WA 5KG2A 5IM0B 4OZ3A 2ZITA 3MEDB 4FPRA 2W9BB 3M1VB 3DGPA 1S6QA 2XZWA 3GU0A 2FC9A 3HHLC 4ZVUB 1XQIA 4YB1P 1IBKJ 5JUMA 2LXIA 4KIAA 5J2QA 2F3JA 2OO4A 4CNYA 2R7UA 2WVCA 3HT0A 4M5GA 4K2XA 4BHQA 5K20B 5KFRA 2MZRA 3O3LA 5L9XA 1Q16B 4K4ZA 5I4MA 3GQCA 1V5VA 1U49A 3DLJA 5ETKA 3M6WA 4K4TA 3VTIA 2PD1A 4CO4A 1BWVA 1LNQA 1MNEA 2EC2A 2I9SA 2WW4A 3KJQB 1IBLJ 2LVWA 4FBUA 1FKPA 5JVHQ 3KJVB 1FFSB 2B4PA 3LGMA 4NL5A 1LWEA 4O3PA 4X65F 1FX2A 2LXUA 4RU2A 1VQ9S 1QSLA 4OV6A 2W7OA 3DLGA 2OFGX 4YB5A 2CQCA 4ZOSA 4NOHA 2ACYA 4YDXA 4IOBA 4MIBA 4DQIA 5ETTA 1SI9A 2V8VA 4YY3J 4HACA 4C0OC 2X1AA 3OTBA 1RTIB 5BXIA 3SQOP 4CNZA 1TL3B 2D9PA 2HVDA 3T1AA 1KFSA 1FDAA 4A8QA 2ASLA 1T3NA 3AA8A 4CH0S 1J5EF 3PG9A 4LIWA 3OXGA 2CAJA 2BJ7A 3SIPB 5CA5A 2R3VA 3LP2B 2V9WA 1PJ5A 3AXKA 4DV6J 1MROA 3CCTA 4I2PA 4XDDA 1PYSB 2MQLA 3QSIA 1B99A 3UR0A 4I6AA 3RGIA 4CLWA 2ALYB 4DI6A 5CD4A 3KUHA 1AFIA 4LF6J 2WSEC 3HM9A 2ZOGA 3OLBA 3SCJE 5C2GA 4KFBA 1SVDA 1X8DA 1EHWA 1FRXA 1Y0HA 2IAJB 3HVTA 1NH8A 4JOUA 2CVEA 1M5KC 3M30A 2IM2A 3DMJB 4DOZA 3MM5B 2V9KA 3I9ZA 3O2IA 1NK6A 1DZ5A 4FYWB 1PO6A 2QTWA 5KT4A 2VICA 3VAJA 4RW4B 1OQ3A 3N6NA 5KG0A 3HPOA 1EP4A 2ZKUA 3EWGA 1CJKA 4ZVHA 1NK0A 5J1EB 3ET6A 1JMTA 1YI2S 1NSQA 5CYMA 3DLKB 5H1SV 1SH2A 3UDEA 2FLPA 4JI4F 2BKNA 4RW8A 2KFZA 1CC8A 4K4YA 1AUSL 3EVWA 4U9RA 1N54B 1NDPA 2XI2A 1M5OC 2B3TB 4K0KF 3D66A 5KFTA 4I0WA 1WTBA 2RH3A 4B9SA 1U24A 4WIQA 4V1Ak 1REGX 1QSYA 1G1XA 4PQUA 1RP5A 1S6OA 2QX0A 1YIJS 3HSDA 4ILMA 1AXQA 2P9EA 1W2IA 4I7FB 1BMQB 2CQPA 5LSRA 4I6YA 3TAMA 5DLGA 4NWBA 2DEJA 3L7OA 4IFVA 4GVBA 5AXMA 5L1JA 4B9VA 2IIHA 4NEYA 7AT1B 1FJEB 1U1PA 5HJYA 3D1OA 2BA9A 1RTJB 1UFKA 2GQ2A 2VQFF 3AXMA 2D3OR 2VIHA 2V34A 4C4WA 2ZWPA 4KO0B 3BSAA 1REVB 4NLYA 2R7VA 4GKKF 1HBMA 1F9EB 3MEEA 1ZBTA 2HWHA 4CTAB 2DCLA 4QW8A 3J7YI 3HKWA 3Q8SB 1TKDA 4LF9J 4LUBA 4L73A 2UUCJ 2LEAA 4QR1A 3C6TB 2DIVA 5KFQA 1VJWA 1VLOA 4PG5A 3CXCR 3DOMA 3D1HA 4CP5A 3GG0A 2MHEA 3AD8C 1N8RT 4FF3A 5HQMA 3G6YA 2HHTA 1K47A 4DV4F 4K8RA 1TL7A 4DR7F 3EXCX 2JNJA 3OFEA 1TVRA 2UVRA 1CVJA 3RW6A 1Z1ZA 1P8GA 4OYOA 3CCRS 2DO0A 5HLFB 1T9YA 2MDAA 4RU9A 4WE1A 4DV3J 1S72S 2ATLA 2QL9B 4P7TA 1QSSA 3MMBB 2AJ1A 1J2VA 2QLBB 4J9UE 1YJWS 2EXUA 2R7QA 1GH8A 4HHUA 5D4OA 2OHDA 3PRDA 1ROFA 3QGGA 2E9ZA 3PNIA 1RWPB 3D1QA 4PZVA 2OH2A 3RRGA 3NEKA 2FZCB 1WF0A 3KHLA 1T11A 2VODA 2DGSA 1T3OA 1N6QB 4CLPA 3LGNA 2AGPA 1V9OA 3TW0A 4QBUA 4V19J 1TMMA 1QD1A 2EPIA 5I42A 3C15B 1KOOA 2ZBQA 5IC4B 4ECSA 3BDPA 4ZLNA 2W2PP 1NJZA 4ZN3A 1QAIA 5AJ3F 1RQ0A 2VJUA 2ZNYA 1NLKL 3N4WA 3P3DA 2FTRA 4Q7AA 5A2QY 5CH7B 1X5TA 3I56S 2Y1JA 5ETPA 1NJWA 2HK2A 1WNEA 1HYSA 2RDDA 4C2MA 4WFXA 3MR5A 4N76A 3J80Y 2ZOFA 4OJ3A 1XNQJ 1XNRF 1H98A 2GZOA 1U0HA 4C11A 3BR9A 4ZK7M 1WG5A 3LWMA 4P72A 3CCMS 3OSPA 2HQIA 4TQSA 2MKHA 2W1BA 4JI8J 3MTJA 4LF2A 4NYZA 2KVQE 2Z58B 2P5VA 2MQQA 3MF5A 3CDAA 3ZZTA 1L3KA 1XMOF 1GXLA 1KOHA 2K8GA 3V4MA 3VF0B 3ELHA 3V6KA 1DQ9A 1R7IA 2A1BA 2E7XA 2RQKA 3D0GE 4U8VA 2XO6A 1ZS6A 3DM2A 3FFIB 4ID5A 1N52B 3B8HA 1WHVA 5ETVA 3H42A 2RS2A 3J7A1 3NKYA 1FRMA 1VHIA 3PYEA 4I64A 2H48B 3AT1B 3KJFB 1N5YA 2MZSA 1MWYA 1DQAA 2XHCA 2GIFA 3H98A 3HHDA 3OQ2A 3OXFA 3QO9A 2JEGA 3DGPB 3HVWA 3MGJA 2QZ8A 1Q5YA 2J7UA 1RT7B 2H1YA 4W4MA 5F9NA 2FLOA 4RUHA 1B0TA 2W25A 3VVTA 4ED1A 2E5LF 1N0UA 5HVFA 1MSWD 4IDKA 4ZITA 4L74A 2EVZA 3FGVA 3VQTA 4TNOA 2C3UA 4X65J 1SH3A 2KJVA 2DNQA 3B6BA 4OI2A 1LWCA 1F1BB 3Q23A 3T1HJ 3HO1A 2W2QP 3QATA 1Q8KA 2M7SA 2IJNA 5C42B 2XYPB 3SV3A 1N48A 2OMLA 1WOSA 1YX2A 1YJNS 3I0RB 3OXLA 3IG1B 4B08A 4F4XA 4JI5J 4LFBJ 3DOKA 1XIQA 1QAJA 2XZDB 3W5ZA 1GMVA 1LWEB 3VVUA 4RJVA 1CPZA 5EWEA 2BM0A 1HBUA 2O66A 1LW2A 1DTTA 2EW9A 2CPDA 1KEKA 1BWEA 2B6AA 2HURA 4C0BA 3TNVA 4XPCA 3AY0A 2XM3A 1WDTA 3KLHB 1I94J 3QZ7A 3GP9A 2RRNA 5H9FJ 2DHAA 1XBWA 4ZMMA 2JFKA 3GCWP 2G0IA 3OR1B 5KFFA 3CDUA 4Q0BB 1TK8A 3KLIB 4HT7A 5GAEI 4RR5A 3OVBA 4KC5A 3LP2A 2VA2A 2VG6B 3PKMA 4O3OA 4X64J 1NJYA 1C0TB 1S1VB 3GSIA 2Q1LA 4LBIA 4L6V3 4DV2J 1JLGB 2X7IA 2V4RA 1AYEA 2H9ZA 2BJEA 1NK5A 4DR6J 1RKJA 1WACA 1HNWF 2E9TA 2FJVA 3D6MB 3NL0A 1NK8A 1HD0A 5HMYA 2LKZA 2IYIA 2O01C 2JHEA 4P2XA 5KOXA 5BR8F 2VQEF 2J0QD 1RWNB 4F0MA 3FMBA 2JLEA 2HFUA 3MMAB 1R6YA 2DGQA 3U1MA 1FE4A 3M05A 2QSFA 5D4NA 2GX8A 1FNOA 2IA6A 4KGKA 3FQLA 3ET6B 1D8YA 1RT3A 4FVMA 3UN2A 2VG5B 2M52A 3KK3A 4OX7A 4J37A 4ZVGA 1QDUB 2OPPA 4ECUA 2LMIA 4NCGA 2LQ5A 3EICA 4WFYA 4DEZA 1U1KA 1S0VA 3QFHA 2FJEB 3C8YA 3CJKA 2DVIA 2XGPA 1RAFB 3EPIA 4DF4A 2IHR1 3Q2SC 1YJ9S 5D3GB 4JV5F 2GIRA 1H0HB 3J7Z5 4LMZA 1YZ7A 1WKJA 1U26A 2RVJA 5KAKA 1S6UA 1R8AA 2KM8C 2ZH2A 4K4UA 5EDWA 2BXJA 4Y6IA 4NLSA 3ENVA 5C24A 2D3O1 3TVYA 5GADI 2GMJA 2NSCA 1S4FA 4ZJLA 4FKYA 4I7FA 4PYDA 5F41A 1C1BB 1LOUA 3GYGA 7FDRA 1VDHA 2APOA 2YKNB 4H4MB 3OL8A 4NA1A 4DSLA 3IBCB 1KP6A 2MJNA 4CO1A 4GRSA 4DV5F 1RTJA 2FB0A 3MAAA 1AUDA 1I3OB 5G0RB 4ECWA 2HIYA 2BW7A 4IO9Q 2MLYA 1X4DA 3N6MA 3R5CA 2HNZB 5DDQC 1FTCA 3KYLA 2OEMA 2BABA 4WIIA 3RYLA 1EARA 1X5SA 2MSSA 2V67A 4J9PA 1BC6A 1IBCB 2YKMA 4EUVA 1J27A 2GW8A 5IT9U 2HVZA 2ZDOA 3NBPB 2LFVA 2VU5A 5B09A 3OTOJ 4NE9C 4WTOB 1CULB 3LA0A 3NOGA 4X84A 1SJFA 3H20A 1T05A 1JLBB 1S4EA 5L1IA 4IOAQ 1EIYB 3HHLB 4O4GA 4X62J 4C8KA 1CBKA 4QR0A 5ETMA 1U6BA 1UFWA 3RRKA 4K4WA 4UQTA 2AP6A 4E0DA 4QZVB 3KG0A 3C14B 1M5PC 4HHHA 4PG8A 4LFBF 1KVKA 5D4LA 4JI7F 4P73A 3W1YC 1UEUA 1NUEA 1RAHB 1HIYA 4OYXA 3RTVA 2XY5A 4HR2A 2EFQA 2WVFA 4ICLB 5C7PA 3NXZA 2IY5B 1FESA 1M1HA 3ZZ0A 1HWUA 1VYAA 4HDGA 4UOGA 3DYAA 1T02A 5IWAJ 4USKA 2UU9F 5KFPA 4GKJF 4PAAA 1QY7A 4W90B 4NI2A 4ZIWA 4NXMF 2E1PA 3H0PA 1UJ6A 2QLFB 4H4KC 4ZP8A 8RUCA 3KK2B 3TX0A 1WORA 3EZUA 3HD1A 4C8OA 4IH5A 4DX6A 3V6DA 1DRZA 3JAMY 1U1QA 1SL2A 3R5GA 1DQ8A 1G4CA 2J76E 3BGRA 5ADZA 2WSFC 2QSWA 3THPA 3EGVA 1H2VZ 1S1TB 3IMQJ 1KBRA 1XMQF 4JI3J 2VASA 3NNCA 2HQCA 2PEBA 3P45B 2NUUG 4HVZA 2KDOA 3GFZA 4RW9A 1HBOA 1LFWA 1RDRA 4BWJA 5KTQA 3F73A 2C2DA 1F2HA 3LO3A 4NXNF 1HNWJ 2A3JA 3SFGA 1GXUA 4OFZA 2E7VA 3FQKA 1TUGB 3GZ7A 5T7LA 4AL6A 3QIPA 5E5NA 4MT1A 1UEVA 2JWNA 3CWJA 4N7TA 4EBCA 2M8DB 4IQXA 1R3NA 3HF5A 2C42A 3HZEA 3I32A 2HIQA 1PG5B 3PYFA 5AXNA 2O3DA 4ZP7A 3ISNC 2UXDF 2DEIA 3MM7B 3ZTSA 4EGLA 1VBZA 4ED5A 1JJ4A 3EM1A 1RU1A 3KLFB 2R9LA 1S0OA 5HMXA 1PGZA 4DSJA 2X1GA 2B9EA 5D0RA 4XIUA 1OY9A 2D69A 3A4TA 4ED8A 4RNMA 3KK1B 2HFOA 4RO0A 3MECB 4EMDA 3RB4A 2HS0A 4XO0A 4YHHJ 3OR2A 3CCUS 1VK8A 1AB8A 1RBLA 4QIWD 4JI0J 3IR5B 2GJ2A 2V94A 2W4CA 1X9MA 6FD1A 3DNCA 3GR1A 1C2PA 2ZH4A 2AJQA 1RAJA 4TU7A 4P71A 1NPRA 4LF1A 1S9GB 2DNPA 2E7WA 2OKQA 4KV8B 1RWWB 3V81B 2FDNA 1XC9A 2P6SA 1N4LA 1UVMA 2VC1A 2ZVIA 4RX6A 5DJBA 4IDKB 2CIMA 3BDEA 1UPPA 5DZ7A 4CLUA 4HTJA 4U8YA 3QRQA 3L4BC 2LA6A 2RIJA 5LL6d 3E8OA 4DN0A 3GSDA 2FPHX 4IH7A 4WFZA 4ZVQB 9ATCB 1H7WA 3Q8UA 3KDOA 3KLEB 5CYQA 5DS7A 4M5IA 3ZTPA 1RADB 5F8MA 3KLVA 4ELTA 2AT1B 2K3IA 2UXBF 2Q6CA 5C42A 3ZZPA 2ZM6F 3BO3A 1U45A 1HNIA 4Q44A 3ZTRA 3I0RA 1ZAWA 3FBEA 4M5DB 1X5PA 4WFBQ 5KT2A 1VK3A 2GGPA 2ILYA 2JLFA 1Y5IB 2KRBA 3CCWA 5A0YA 1CS4A 3E2EA 4QU6A 3BSOA 1HBUB 4KBIA 3MM9B 4F25A 1LW2B 1DTTB 1OY6A 1U6ZA 2D41A 4USMA 4X64F 3UO0A 4JI2J 2IM1A 2HNYB 4QPTA 1YJ7A 3BN4A 3PDNA 4DV2F 1AFJA 1NDLA 2HFVA 3GONA 2AW0A 2E5IA 2L41A 3M4XA 3NNHA 3CJSA 5ETLA 1RK8A 3H2VE 5D4PA 2B51A 1C1CB 1WHWA 1HWIA 2FJDB 1ZYQA 1UW9A 5HP1B 1KVJA 1CJTB 2BJDA 3JSBA 4RNNA 3J7YU 1HBNB 1VOMA 3H8YA 3ZNJ1 1RWOB 1S1VA 1S57A 4OYBA 4B02A 2BANB 2K1RA 4DV0J 1Q8IA 3MFIA 1Z2LA 1FERA 1LXNA 2V6AA 3SV4A 2J6TA 1JXLA 5F3TA 2CQIA 4IG0A 2W4PA 3AQOA 2E1AA 4QR2A 1TKZB 1GT8A 4LSNA 2HRTA 4CH1A 2I6WA 3MCSA 4KRWA 3TR5A 3U02A 4DFMA 2VONA 4IQMA 1U02A 4TYAA 1OMSA 1T7PA 1CQNA 2BUNA 1MN7A 3RU0A 5IQQA 3DU5A 2HMIA 4V19X 1TR0A 2Z30B 3CDEA 3HK2A 3QT5A 4OZ1A 4PKDB 2VG7B 3DLEA 4YS2A 4UF4A 2HS4A 1RT3B 4DR5J 2AEJA 2VG5A 3KK3B 3MM8A 3AOCA 1Y7PA 1RBAA 2OPPB 4OV1A 2FY1A 3GE9A 2HGLA 4OYPA 1Q7LB 3T1YF 3SSSA 1F9FA 5KT7A 4URQU 2XS7A 1XERA 4QJVA 1QE1B 3BGOP 5J2PA 4OYWA 2IM0A 3T1HF 2VD3A 1IWAA 1RHMB 4QIGA 2AQ4A 3BKFA 3KNGA 2BJ3A 4NLPA 4WU3A 4TU8A 2XI3A 4J9OA 3L95X 2IC3B 3ENWA 4JBCA 4M5HA 2UUAJ 1B0VA 1CSJA 4O0NA 1RU2A 2YVSA 2DPIA 3R7NB 4FXDA 1MWZA 3DFEA 4H4MA 4J9MA 3GIJA 3WHIA 2W2NP 3NLCA 4G6VB 1LKZA 1UJ4A 1TELA 2YWHA 3DXSX 2YWKA 3MR7A 1CJUB 1RT6A 4KAIA 4MFBA 5J2MB 2QFJA 4PXBA 1CJVA 2HNZA 4KE5A 3BQ2A 2CFXA 2DITA 4YB6A 2HZCA 1U1NA 1N36J 3JQJA 1WOPA 4P7VA 2LDYA 3HLUA 3W2VB 4B3OB 2YKMB 3TVZA 1K73T 1VQLS 3DCAA 1N5TA 1EAYC 3N9UC 3VHQA 3S1TA 5J2NB 5A8KB 4E8UA 2DR7A 3KLGB 3IAS9 4P6QA 1S1UA 1VCTA 2XQCA 1KR4A 3IWXA 4M63A 1T05B 1HPZA 1EB0A 4CO5A 2M9KA 2ZD1A 3FZBA 2VBXA 1Q78A 3NGUA 4WJBA 2JOQA 3OHBA 4JV1A 3CJRA 2ZWOA 3C6UA 4URSA 5HVGA 5CXTA 3AJ1A 2YX1A 1QAXA 4OZJA 4J90A 4OYMA 2DNGA 4H4OA 3FSIA 3TI0A 4ZVSB 2OI2A 3F0NA 1FKAF 1NPKA 2CADA 2EBGA 4ATNA 4ZCIA 2EG1A 4JP8A 3BB5A 3VAGA 1JNZB 2K06A 2PI4A 1UWBA 1TFYA 4ZHRA 3QRPA 3VGTA 2KTQA 2R2UA 3BV8A 4KGZB 3R2DJ 1Q53A 3FCHA 3DYAB 3WX4A 1SB6A 2ZZMA 5C25B 4OJGA 1O8BA 1R8CA 4NI2B 5K8PA 3G2XA 2DNHA 3GIIA 3QGPA 3ETMA 1LK7A 3PEHA 3EXYA 3CC2S 1NMEB 2M5YA 3AB2B 1U2CA 2YPYA 3BH6B 4RW6B 4C3KA 2OTLS 2WONB 3BS9A 2HQDA 4C9DA 2JC1A 1LFPA 2O5DA 2AMCB 2VUGA 2A18A 3CW2C 4ED6A 3NGTA 4TKTA 5KFYA 4FN5A 3VZHA 3RBZA 5FDLB 3WIVA 3OHAA 2EEYA 2AX1A 2I0XA 4WTYA 1HNVA 4AYBD 4DSFA 2DNYA 2IRUA 2EFNA 4F50A 2EG2A 1JJCB 5DO2A 4F7VA 2LQ9A 1DBDA 4ZPBA 1K9MT 1A9NB 4Y3CA 3U7JA 2FJAB 2WW8A 5F8HA 1HNZF 5CQGA 3RR7A 4KH0B 4DQQA 1XTZA 2M4MA 1P1TA 2HQFA 1UW4A 2OPRA 2VPXB 2Z56B 3J81j 2GHVC 5B08A 2LQJA 1PC5A 1G6BA 5F0UA 2B43A 4Z37A 1UA0A 4X4VA 2MJUA 4Z7YA 2G2OA 3HZGA 1VQMS 4QU7A 1FTRA 5AXLA 3QSYB 4WFNQ 3C3LA 1KHVA 2V0NA 3IM8A 4F0HA 4JI1F 1U8SA 1FK9A 2P6TA 3PYDA 2VOPA 3MI7X 1RBOB 1XMBA 3M2RA 4X4NA 1SQEA 4NRUA 4Q2LA 2WHOA 1BXNA 4USIA 3O44A 1UETA 4HKQA 1Z4UA 3ISZA 1YG0A 3BYPA 3OFGA 4Y2MA 4ETXA 3EPGA 3QJLA 1IM4A 2IVMA 3A8KA 3DLGB 2MQMA 1S0MA 3HHNB 5ETRA 3KUGA 1RAEB 1IQTA 1BQMA 1HWJA 2W01A 1AT1B 2W8KA 2DNRA 3VAMA 1EETB 1XN9A 4WK3A 3KLEA 1VQ8S 3HHEA 1TL3A 3TUZC 1IJFB 4FYXB 1TFWA 1U8WA 1X31C 2YY3A 4NASA 3OSNA 1RI7A 1HI0P 5G4DA 2DNZA 3PJXA 3QYYA 1A6LA 1NZ8A 4G1QA 4DV7J 2KHCA 3M8WA 5HL7Q 1MROB 1FDNA 4I2PB 3J81U 3HVAA 3D5MA 1DLOA 1S12A 3A1YG 5DZ6A 2HYIB 3BEGB 1ZAVA 4MJKA 4B3SJ 3AFGA 1EZZB 2MZTA 2ZE2B 2DR6A 4Q45A 1XMQJ 2HNYA 3H4DA 4JI3F 4LF8J 1GX6A 2YX7A 3Q8RB 1SQFA 3Q8PB 4NLGA 4DCPB 4ECZA 5EX3A 4DPOA 3CJ0A 3L9ZA 1YQHA 4LSZB 2HHPA 2HLTA 2R7RA 4NYPA 1XEZA 1JWWA 3PW5A 4PYAA 1X4HA 2B8QA 2IDLA 3GB0A 4HEA9 4XTTA 5B0GA 3I4HX 4Z2XA 5GAHU 2RDJA 2YWWA 3JSYA 1CJKB 3TUJC 2C2MB 3MM6A 1NRKA 2K1RB 1SJ1A 2BANA 3ZTOA 2N4CA 2CJAA 4TN2A 3K58A 4QQBA 1X5OA 2CQDA 2P9CA 2LQBA 3KTQA 5F8GA 3MPDA 1ZM3A 4G65A 1Y3KA 1GTHA 2XCAA 2KFYA 1QVGR 2QEXS 4DR5F 3UDVA 2OD6A 3NWRA 1EX8A 5AE2A 1GEHA 3OFHA 4Y65A 3GPAA 4L3KA 4JI0F 2R8HA 4MTPA 1VR6A 2AYEA 1OYEA 4IG3A 2ZC3A 1R0AA 1VJQA 2M0GB 4WK1A 1F6TA 2HMIB 2Y8WA 4RBTA 2HAIA 4NLRA 3W2WB 1NHKL 2ZZNA 2C3PA 3I55S 2CWKA 2SXLA 1GK8A 1WC4A 3TAMB 4F2SA 1P9QC 3IRXB 3LW5C 1WKLA 5KFKA 1Q86T 1A0OB 1U2RA 5JJBA 2B0GA 3R27A 2I8EA 4TY8B 4YB7A 4DPXA 5THWA 3IGNA 3NGDA 5HROB 1FJ7A 4QYZJ 1EJ7L 4DFJA 1HD1A 4KO0A 3HSGA 4NEZA 2ZHBA 1HBMB 3MEEB 4KGMA 5EUHA 4B9UA 1HNZJ 1V5IB 2ZKTA 5LMNJ 3QBCA 2J9DE 2PI5A 2RQMA 2X1FA 3DRRB 3SXLA 1WC3A 1N5SA 2C3YA 2IC3A 3RAXA 2A6MA 3HVRA 2N4DA 2BJ1A 1VIXA 2BMBA 1P6TA 4LJMA 1LWXA 1VRQC 3JTOA 3NMAA 1ZPWX 1ZM9A 4GKKJ 2DISA 3Q83A 2MPUA 5B7WA 3CJ8A 5KFCA 2L9NA 1NKCA 2DRDA 3G8TA 1DFDA 3GLJA 4X4TA 1VRTB 1Q1KA 3VAKA 1KS2A 1NJXA 1NB7A 4ELUA 1OPZA 3G96A 2HBQB 3RB0A 5DRKA 2MTLA 5DETA 2XYHB 4K5SA 2CQ2A 4R5PB 4DR2J 4RW7B 3RG6A 3GMGA 1D0EA 2RSQA 4YN3B 2VF3A 1FFWB 5J2NA 2W8LA 1M90T 4YOEA 2ZH3A 4PWDA 1NEEA 2GJFA 4HI2A 3T5HA 2DGTA 3FCVA 1HLWA 3PYGA 2RHSB 4NYOA 5GAGI 2UZAA 2GQCA 4J9RA 3OLAA 1AW0A 5IV4A 1EP4B 3BJYA 4BWMA 3TZZA 3CD5A 2U1AA 3I87A 1HQEB 2L9DA 2W9CA 4DS5A 3UNYA 3PW0A 1M1GA 3HSJA 3TO8A 1WC5A 2JX2A 2VFUA 4KKOA 4YHHF 1N5VA 4CWBA 3VAHA 4EFAC 4NLOA 1RE1B 2B4UA 1VRUB 3JTNA 4ZCLA 3TQ1A 4B3SF 3O6QA 2N3OA 1T95A 3MD1A 2CWXA 4DPYA 3BQ0A 2J8AA 4PXEA 2R2RA 2QA1A 4F67A 4P2SA 1DY3A 3PJWA 3AJDA 4RUAA 3A3PB 1S9EA 2RB7A 3LTOA 4CYUA 4C8LA 4PUOA 3LPYA 1WHXA 4H4KA 2ASJA 2R7SA 1U1MA 1RWKB 2DK2A 2FZGB 2HEKA 2YWEA 4DCOB 4H54A 1WG1A 3M8QA 4CO2A 4PXDA 2Q3PA 5AE3A 4Q8EA 2VB6A 4DPUA 1TP7A 2GO9A 2DXDA 4P10A 3W8GA 1V3SA 2AU0A 4ERDA 2AYBA 1J5EJ 3N28A 1RHKB 1F60B 1IKXA 4RL1A 2NPFA 1MMLA 2PE8A 4CI0B 2I5JB 5MLCV 1HWLA 1JKHA 4U7CA 4BC7A 5HO4A 5C2CA 3OL9A 2MB0B 1WG4A 1HR0F 3J7AN 3NG8A 4WPAA 1GAOA 1HW8A 3M8SA 1YBAA 2FGCA 2E5JA 4WFAQ 4OI4A 4KYZA 1VMBA 2DGXA 3W7BA 4ZN1A 1KVIA 1SUQA 1RXOB 2BKPA 4J9VA 3UD4P 1WHYA 5EWGA 4MK9A 3W62A 2HG4A 2V2KA 4DZ6A 2FIUA 2BACA 2L48A 3MCMA 3MMBA 3WQPA 1ZTTA 1CC7A 2KHDA 5GVQA 5A6WA 1VBKA 4BCAA 1RT1A 3L7UA 2BQRA 5D8HB 2HHWA 4B3TJ 2GA7A 1TKXB 5BJRA 1FK9B 1HA1A 1F0XA 2LEPA 2XSFA 4AT1B 3UN5A 4M95A 2AJ2A 2K7JA 4AFFA 3VV2B 1YWXA 2CJXB 3V5RA 1D9FA 1T9VA 5DQHA 1DURA 2FY8A 2MLZA 4G1PA 4P52A 4LF7F 1RHQB 2AX0A 4B3MF 3KHRA 2XEXA 4ZP6A 2FYXA 4OLOA 3RZAA 1LWFA 5L39A 2KZMA 3C15A 1YK9A 3CMAS 3K17A 4ZVOB 4X2BA 4M94A 3UVJA 1TAQA 1TL1B 1WUUA 3FBCA 5MAOA 1S76D 1WDDA 1OQ6A 2FVQA 4Q0BA 1U1OA 3OTEA 2HNDA 4QW9A 2C1EB 1O51A 4IOCQ 1FEHA 2R42A 4KPYA 1PJ6A 1BE4A 2WVBA 5L8RC 3G6VA 1O0PA 1FRJA 2R2SA 1I94F 1JLGA 2DGVA 4MKYA 1EKSA 5CCLA 1OPIA 3H90A 2HFSA 2CNLB 3LP0B 4OZ2A 3OUYB 2CPFA 5A76A 5KT5A 2BR0A 5ETOA 3BSNA 2YNGB 1HI1A 3ENAA 1H72C 5E3RA 2WOMB 4DMZA 3PEJA 5HQ8A 2BX6A 2MKJA 3K57A 4LFAF 3JSRA 4Q2MA 4ED0A 1RA7A 3L09A 1ZZNA 4OI6A 2MQOA 4C8YA 3SDEB 4ZDNA 1ZH5A 3BBCA 3SCKE 1C0UA 3UQSA 4O0IA 2KXFA 5E3AA 1ZA1B 4OLPA 5K14B 5CABA 1QVFR 1JJHA 2H4YB 3QAUA 4A8OA 4ZLLA 2YQ3A 4NLUA 4GKJJ 2DD8S 3BZQA 3PM9A 3PX6A 1VQ5S 3S01A 2XWXA 2UXCF 1IKYA 5CYJA 4BLGA 2PGCA 2RS8A 3CO9A 3CJKB 3K0JA 2OELA 2XGQA 3IRWP 3SI8A 4LFCF 4Y2KA 3AJ2A 1Y3JA 3T41A 3W5XA 1LK5A 1JLCB 2QA4G 2OSQA 2CPHA 2ZHOA 4MAKA 4OX6A 2DT9A 4MIAA 2B4OA 2IBOA 2QL5B 3CT9A 1H2UX 3HKZD 4I69A 5C24B 4CM2A 1S0NA 1F2GA 1BHNA 1YKWA 1SV5A 3IS9B 3H40A 3LUYA 3QGHA 1W2BR 3DLLQ 4NLVA 3IRXA 1U2FA 3IG1A 5LJ3Y 2DR8A 2KG1A 2XYGB 3DOKB 2UV8A 3N01A 5IOLA 1UKUA 4JUZA 3SSQA 1P27B 3S7RA 5KFSA 5HROA 3C2PA 3CB4A 3MMCB 3JSMA 3KUEA 3RAMA 1UJ5A 4LFCJ 5DQIA 1IR1A 5E3PA 1U1LA 1VQSA 2B6AB 3GYNA 2XLJA 4UUXA 3MOZA 4R8UA 2GVZB 3I4PA 1DTQB 3MZIA 2LEBA 4FBTA 4I1TA 2AZ1A 3NBPA 3R1LA 2WAQD 2OGUA 3CEDA 1Q8BA 3GTYX 4OHXA 3PXGa 3W61A 1VBXA 2ZH6A 1CULA 2V2QA 3KLIA 3KOAA 3GCXP 4JI8F 5F8LA 1NHVA 1Q8LA 4LSLA 1FA0A 3OL7A 3ZZRA 3TZXA 3MURP 1D1UA 4HI1A 3DRSB 1KD1T 1FDDA 3IBWA 4M5KA 1IBLF 1FO1A 4K0KJ 1Q7YT 4J9KA 1QTNB 4L3NA 2AYGA 3H25A 4DFKA 3HULA 2EK6A 2NXJA 3W60A 4ICLA 5JVGQ 1RUSA 4NLDA 1X0FA 3ADAC 4CLFA 5KT6A 3NS6A 2XNRA 5CHCB 2E66A 1XR5A 2XLKA 3PRVA 4LVNP 1S1XB 5HQLA 3K8VA 3TEHB 4LBHA 1RACB 2MMYA 3D28A 2EFOA 2A6OA 1IKVA 2OPQA 1HQEA 3DRPB 4L75A 2W9CB 2H5IB 2KU7A 1L3VA 5GMDA 1GNKA 3SZ2A 2CZ9A 2KT5A 5JXSA 5ETNA 1KWMA 1VQ7S 1SC4B 2LP4A 3BR8A 3NAIA 4PG6A 3IO1A 3CCQS 5D3GA 1S99A 2BRLA 3T6JA 3Q24A 4PPZA 2JEIA 1U7LA 1KQFB 3KHHA 4WZQA 4DLGA 3D2WA 1FFGB 3LOUA 4K5RA 3W65A 2RILA 3D54A 4ECTA 5BYQA 1TL5A 1WD6A 2LQ8A 2F1FA 1S9EB 4CYUB 2CPIA 4ZVRB 3AB4B 3QWUA 1YRXA 2CPJA 3MAQA 4DR7J 3W64A 3MM7A 4KH1B 4D3HA 4LF4F 2F8EX 1TU0B 2DGOA 3KG4A 3VGSA 5C5JA 3PTWA 4A8MP 1Y11A 5SUHA 5AJ3J 4ER8A 3I0SA 1B64A 1G7CB 1DARA 2JFDA 2XBPA 4I68A 2LYVA 1MU2A 2MHNA 4HH1A 4J9QA 2VPWB 3EE3A 2BE2A 3OR2B 3Q86A 3M8YA 3BBBA 3OVSA 1IKXB 2HRYA 2IVYA 3CCVS 2F4VF 3M1VA 1KQGB 1VGYA 1RAGB 2RHQB 5LXYA 2EBEA 3DGVA 4PQAA 1IBMJ 4LF4J 1H7XA 3SQGA 3GWCA 1SJQA 3I96A 1SKRA 4WF9Q 1NPPA 3OD2A 3FVYA 1Y10A 2ZDPA 2UP1A 4NRTA 1YBUA 3EJMA 1KLMA 3GFHA 4WCEQ 3QZ8A 2IBKA 2WSCC 4B17A 1NU4A 2KI2A 2H65B 1VC6A 3BF4A 3H5UA 1J5OB 3R97A 4A4JA 2IFXA 2EFVA 1D3WA 1JXEA 4FKXA 4X62F 4DFPA 1NDKA 1HNIB 2PT0A 5M2PA 2Y0SD 1UFLA 2O1PA 1N5QA 2POKA 3K89A 3W9IA 3FEYB 3DDKA 3M2UB 3PR4A 1Q81T 1V6HA 1UWAA 2YBVA 2MZ1A 1VI7A 1W25A 3KJVA 5HK4A 2VHGA 3BSCA 2DRBA 2FQQB 5DG8A 1CS4B 3Q8QB 1YRUA 2B9YA 2RAQA 2GVDB 2WVDA 5B0EA 1NHUA 1FDBA 4LRDA 1LWFB 2JRSA 2HVIA 3LP1A 4CIOA 1IM6A 3HP6A 4DUYJ 2WB1D 1WEYA 2XMJA 2P9GA 4LRBA 5IQ6A 1S1TA 1RSCA 1S1WB 3GILA 2ABYA 3UVJB 2F9JA 1NKEA 1KLNA 1YRTA 3G9CA 2BZ2A 1GMWA 4Q8FA 4MKAA 1QAYA 2MEWA 1CJTA 1RTDB 2NZ4A 2GIQA 4YR2A 2OTJS 5IM0A 4F3MA 4FS2A 4EO6A 4JI6J 3IWNC 3GIRA 3LPEA 4DR3F 1T8EA 2HHQA 4ZPCA 1WC1A 5KG7A 2YQ0A 2G2ZA 2RJZA 2VKZG 4A47A 4FS1A 1M5VC 1N32J 4LSNB 1U48A 3A3NB 3ILJA 4LBPA 2EKYA 2C22A 4HYKA 4Y0FA 2QLJB 2RRBA 4O3RA 2EFPA 3HVTB 3SCLE 3W9HA 3IN5A 2FD2A 4JI4J 1XR7A 1PIEA 2J6UA 3ZZUA 4DL5A 3MM5A 3KK1A 3FBBA 1GFWB 2B7BB 2J8SA 3QT7A 3R5DA 4BBYA 2MY8A 3G82B 2ZH5A 2ZHAA 1FHTA 1RJJA 1FI4A 3WIUA 4DXLA 1SPBP 2GMLA 5K14A 1V3RA 5J1EA 4N41A 3H59A 1IVZA 3CNQP 1JX4A 3KMSA 4PR6A 2D74B 2Z2ZA 5LSLA 2FLLA 1VQPS 1IKYB 4N77A 3R3TA 3H5XA 2R8IA 2VFTA 3V6HA 2DY1A 4ITSA 1QE1A 3ZFVA 3V81A 1VQ4S 4DL3A 4C3LA 4DUYF 3MD3A 1WTFA 1PBAA 1JLCA 5FJ4A 4B9MA 1RHJB 3M6VA 4DSKA 3DXBA 4HACB 2W7AA 5B0FA 1SKWA 4PQUB 3ZZZA 3HXMA 2XSJA 3FNNA 1B4SA 5K8NA 3OW2R 5IT9Y 4W98A 3PW4A 2DCUB 5ETQA 2UUCF 1S5ZA 2W2MP 2AJFE 1T9WA 1QLNA 3RAQA 3H2LA 4A46A 5A0YB 2R7WA 3CUNA 4EBDA 5M2RA 3OJUA 4YY3F 3RW7A 2DYAA 2ZM6J 3T5LA 4HT5A 2UUAF 2K2PA 4O4RA 5HATA 1RAIB 1H2TZ 2W2OP 4B3OA 3O8WA 5L38A 1JLAB 2H5JB 2HKEA 4QOTA 4CM0A 3M30B 2UV8G 4DN9A 1Y5NB 5HN0A 4DWIA 4DF8A 4DG1B 3PIOQ 1R8BA 4DQSA 7FD1A 4JV0A 2YXLA 4KGXB 4DSIA 1WEZA 2G1HA 3RJMB 4C0HA 2E5HA 1PAEX 1RCXB 3DRSA 1YJVA 5HLFA 2QYCA 3RB3A 4F8RA 4C8NA 2ZJQQ 1RZMA 2CYYA 5CCMA 4K7QA 1TKZA 2VZ9A 1D9AA 3CPWR 2KG0A 2DXFA 2COLA 2XMKA 3D0IE 3ZNUA 5D15A 2G1DA 4WXWA 3OTOF 3T9NA 3TANA 2DHXA 4GO5X 5IXUA 5LMNF 1X4FA 5EX0A 1VIOA 3GR0A 2LECA 2GQQA 1B0PA 1S1XA 2DY9A 3B82A 3EZOA 1TV6B 2DH8A 3DI6A 4NLQA 2ERRA 3DRYA 3D4JA 1UVLA 2OIHA 2OLWA 1RAOA 2CQ3A 4EWTA 4IH6A 3RUBL 3VQSA 3OVAA 5F8IA 3MM8B 4X4SA 4ZPWR 1IR0A 4AXIA 1PSDA 4OI3A 2DNNA 4PWWA 3UFCX 1VC0A 3UN3A 5KFOA 3PW2A 4LR9A 4F26A 2ZOMA 3PV8A 1RYSA 2MLXA 2DIUA 5A8WB 4I67A 2C3OA 2WB4A 4CTAA 1XMOJ 4DR4F 5L46A 4HDHA 2QMXA 1ZM4A 2CDQA 2RE1A 4TLRA 4FPIA 4ANDA 1RTHB 2V4JB 3WZ0A 4RNOA 4P2FA 4NXMJ 3P8BB 4B3MJ 4UZBA 2IMWP 2VFRA 3MEGA 2ZFHA 4D3GA 4UTGA 3MCNA 4OYIA 2MZQA 3JTPA 1NH7A 1SH0A 3G8QA 1X4EA 1WI8A 1UVKA 1NK9A 1IKWB 2YNIA 2H4WB 2XZTB 1X7VA 2OPRB 2UUTA 5CZXA 1CJUA 2NCKL 4MFBB 5E33A 3T6BA 2XC9A 4CLLA 5J2MA 3K8WA 2IMOA 1RT2A 1MU2B 1S59A 3DM2B 5IFMA 2MXYA 3V6JA 4F3OA 4QYRA 1N32F 2Q6BA 4LQ3A 4F4WA 3W2VA 4I2QB 2MKYA 5E0OA 2UU9J 1ICEB 4ZLPA 3CJ5A 2PC6A 3QO9B 4FNIA 3G4SS 3X3UA 3L3CA 1K1QA 3M2RB 2NQPA 5ITHA 1MMDA 3LQVA 4DBQA 2XS2A 1S1UB 3NCRA 2FHMA 1O5JA 3SFUA 1K8AT 1HQUB 1WWHA 2ZD1B 4DV3F 2RUGA 2GNKA 1IBKF 2GS8A 4DLEA 1XK8A 1E6VA 1T9UA 1U09A 2J5AA 1X60A 3W5YA 2HFNA 3BO2A 3MPUB 4OX9F 4DR1J 1TUWA 4OHVA 5GMEA 1ULRA 5J1PA 1YDLA 1HMVA 1J5OA 4N47A 2IRXA 4QYZK 1XWLA 4OI1A 1XR6A 3OTCA 4QIVA 2PIIA 4N56A 4EYIB 1KN6A 4X66J 4U95A 2KJWA 4ZHRB 4ECVA 2E9RX 1FXRA 4GVLA 4A8WA 3HFZB 4F36A 4K4VA 5HBMB 1NO8A 3TRGA 4C11B 3B4MA 3R6GB 4X4PA 3CC4S 1WC0A 4ID8A 2ZJRQ 2C2RA 3ZC4A 1RYRA 3D68A 4L72B 4CLTA 2BEFA 5EWFA 3PO4A 1AA1B 3KDNA 5H9FK 1RT5B 4IR1A 3TVKA 4DU8A 2Z4PA 1X4CA 4USHA 1QTMA 3EDQB 1FRHA 1OYDA 2DNOA 3I31A 4I56A 5KFEA 3EX7B 2ASDA 1KONA 4ID5B 2JLGA 4DR2F 2C2NA 2DKOB 3D67A 2IVFB 1UAWA 2D9OA 3PW7A 2VG6A 4IKAA 1F5AA 4ZIVA 4DDFA 3CD7A 1SL0A 4DJBA 4AUKA 3Q8VA 2AWZA 2C3MA 1BGXT 3PZPA 2CJKA 2RF2B 4Q43A 2ROPA 3RBXA 2FLNA 3X1LB 4RNFA 3UI3A 3FSXA 4DL6A 2B5JB 3LH2S 3I9V9 2KXHA 3R7SB 2XNQA 4ZPAA 5F0WA 5T41A 1RHRB 2G0JA 1M0SA 2X1BA 3I5AA 3T9ZA 2OPSA 4EI2A 4NCBA 4Y2AA 3IR6B 2ILZA 3HHLD 4LR8A 4P75A 4ZKAA 4NX9A 1RT4B 4IG3B 3GJSB 3A3OB 5H9EJ 5LM7E 1S6PB 3LWLA 1U1RA 3ZTQA 3TJAA 4C8ZA 2YNHB 3G8SA 4DV0F 4RPFA 4IRDA 2E1RA 2MSTA 4J5OA 4F4YA 3MEKA 3W9JA 2AZ3A 4YUDA 3S6EA 5K8OA 5A2QU 1S97A 2PDAA 4EZ6A 4KTQA 1URNA 4DR4J 3D6FB 3EDRB 1WJ9A 1LW0B 2HFZA 1RLCL 2J0SD 4HHJA 3J80U 1ITPA 3FMWA 4JI2F 3HJFA 4DX7A 2NSBA 1EKRA 3I5BA 4AQYF 2BRKA 2XMTA 4CZCA 2IM3A 2V5HG 4PPDA 4LF6F 1BQMB 3SCIE 1P9YA 3MPVA 3CIZA 1VLYA 2XTJP 5LSOA 1YZ6A 2ZZTA 2RRAA 4CT9A 1JLEB 2XSJB 3CSKA 4ETZA 2CQ0A 1F9HA 1YITS 1R27B 4UUWA 4Q5VA 1JJ2R 3NMRA 2KYZA 2PFFB 2AD9A 2CDRB 3SSRA 1YTYA 4Y28C 2CZ4A 4DX8H 4ECYA 4ED7A 4ZP9A 3KG1A 4ALZA 5F9LA 3M7VA 2WCXA 4WKYA 4ELVA 3H4BA 3T1YJ 3MAAB 5I3UB 5K5MA 5G0RA 3ZZYA 3JB9k 3CE8A 3ITHB 2L08A 3LF0A 4MYUA 1GMWD 2AEFA 5K9FA 5K8MA 4RBVA 3IBFB 4G1IA 3NOCA 4FYVB 3WX8A 2XG8A 3S8SA 5KFDA 4IFYA 4DV1F 2DGUA 4DU7A 3QJJA 3QWPA 2HQGA 1H74A 4RW7A 4MK8A 3K5OA 3VZIA 4W92B 5KFHA 4M5JA 1IUJA 2YX4A 1FD8A 2HLUA 4DG1A 2R4FA 4NLWA 4UY8T 1VFJA 2XULA 3MMAA 1R31A 3CJQA 2YPZA 4PXCA 2B56A 1I5OB 3OPKA 4CLKA 4E98A 3HFVA 3M8PB 4U96A 4CO3A 3SMZA 2LU1A 5HVHA 4N8OA 1Q4RA 4R0EA 3LALA 1QJHA 4UQGA 1KQKA 4RKUC 2V2VA 3C14A 1N0VC 5BR8J 2VQEJ 4ANCA 1HARA 1KNZA 4FNHA 2HVEA 1R0BG 1A7GE 4LQ9A 2PMWA 4Z7CA 2F8MA 3DDIA 3JAMU 3T3FA 5A8RB 2DGWA 3HDSA 5AT1B 2MKKA 1D9DA 3L7PA 4K50A 4X4UA 1SJ3P 4OX8A 2CKWA 3D3CJ 4WP9A 2XLIA 1I51B 4ECXA 4F02A 2CXEA 2GFFA 3W63A 2U2FA 8ATCB 2W7PA 4JYAJ 1BQXA 4ECQA 1R0AB 2OFHX 3W3SA 4OIXA 1TV6A 3DI6B 1M1KT 2HQ3A 2FC8A 3TZWA 3THTA 5KOWA 3KK2A 3LAKA 1FJGJ 1C1BA 1UEKA 3CCZA 3ICLA 4M5NA 3V6DB 4IO1A 3N5FA 3TUPA 2G0CA 3D9BA 2KT3A 2B9WA 1CEZA 1BQNA 3CO0P 2BBEA 1PYTA 3DDNA 2MGZA 1I6JA 2PA3A 2RNEA 2UUBF 2Y3YA 3AH6A 2KKHA 1OIAA 2V68A 3FEXB 3QQCD 4LRCA 4MH8A 4C3MA 5JMNA 4JI5F 2M3DA 4EBEA 1O6XA 2QMWA 2ALZA 1RTHA 2V4JA 3IP0A 5T14A 1JK9B 4QWAA 3QIPB 3MR2A 4RBUA 1T03A 1FWKA 1JKHB 1TQLA 2P8IA 3AAWB 1NAQA 1NCLA 3TQEA 3PO5A 4DZDA 1H73A 1JLBA 2ZNZA 3KXDA 4MKBA 4WYLA 5E7OB 3TEGA 2LLZA 1IKWA 3KLFA 1MLAA 5LMUJ 1IWGA 4USVA 3N5BA 2DNMA 2NR0A 2W24A 2UUBJ 4KHMA 4RLEA 2CJ9A 2DJWA 1L3TA 2ACMA 2R2TA 1LEOA 4L76A 1N34J 3KNAA 1EQMA 2QA4S 3FSYA 4LRFA 2KT2A 9RUBA 3KKFA 1NM2A 4R5PA 4QIEA 2IJRA 3PY8A 4JYAF 2BJ9A 4PG4A 3MR6A 2NXEA 4MIWA 2DH7A 2ZBRA 2HGMA 3QFWA 4CLYA 3M6XA 3THVA 2UXBJ 3EGNA 2GAGC 1SXLA 1FVQA 4QWBA 1BUXA 5KG4A 2VFSA 3CVKA 3H5YA 2J7KA 1Z2ZA 2QA2A 3BN7A 2QMUB 3VAIA 1E6VB 1Q82T 1IQZA 3AOBA 1LV5A 4YQWA 3GIMA 1RLDA 4YEAA 3OTDA 3QMQA 3UE2A 3E3XA 4EZ9A 4QWDA 5AE1A 3EGZA 2FVCA 3GYXB 1HKAA 1U6FA 4LVOP 4KKOB 3KHGA 3PIPQ 4DL7A 1RTIA 2JSXA 1TUVA 2P2CB 2QO3A 4FZVA 2W4DA 3K5LA 3TAPA 2A2DA 4OYZA 2XY7A 2FVPA 2CJYB 3ILLA 1SC3B 2AIRB 1HI8A 1H3DA 1GTEA 5A6PA 4TY9A 2OUGA 4M5DA 4WXOA 1W7WA 2HNDB 3U1LA 4DV1J 4WZMA 3NS5A 4ILRA 3GJRB 2M8HA 3N6LA 5HBMA 4C8MA 5T7LB 1MWQA 3V2UC 4F3QA 3I6PA 4FP9A 2AF6A 3EUNA 3PKYA 1X9SA 4JB8B 4EEYA 2F4VJ 3M32B 1WF1A 1SC1B 3OUYA 1KKHA 1S9FA 1RT5A 4DPWA 3OV7A 1IN0A 2MQNA 3JXOA 3MFHA 4C97A 1N33F 4GO7X 1IR2A 2ADCA 1RISA 2V8GA 4TYBA 2FHJA 3SDEA 4CRJA 2J0XA 4ED4A 3FBFA 3UPFA 4B9NA 4EYHB 1B70B 4RW4A 1FX4A 2G2YA 2JEJA 4OMFG 4LR7A 4EO8A 1HFEL 2QLWA 2J0WA 3C16B 3DOLB 4M5MA 4OQJA 1BD6A 1KHWA 3ULHA 3MEDA 2W9BA 4QPXA 3DLKA 2I5JA 1S6QB 3U27A 2ZVSA 1KTVA 2CNNB 4YP3A 3M9NB 2B5JA 4LF8F 1DJ0A 1R8PA 2AHOB 1S9GA 3CJTA 4DR6F 2ZBCA 1YLXA 1R8HA 4X4RA 4P2MA 4CCHA 3P6YC 1SJRA 1WELA 3TA2A 2V8HA 4K4SA 2HHUA 3Q8YA 3GV8B 4WP3A 4ZCKA 1RT4A 3MHYA 2VH7A 4AL7A 2Z2MA 1D09B 4NMLA 4K4XA 4RWWA 4FXWA 2NLWA 1SV5B 4OHZA 1RT1B 4GMKA 4Y2IA 3IS9A 3ZXWA 5BYSA 2YTCA 3IA0A 4DV7F 4ENOA 1XNRJ 2ATCB 2Y1IA 4IFVB 5DGBA 4NA2A 1WSRA 5CAAA 4M1KA 2IDEA 4J9NA 2CPYA 2FHOB 4UOFA 2F8HA 1FEEA 2KH9A 1UA1A 3FEZA 5B0BA 2MQPA 3F41A 3WC0A 4OZLA 3Q89A 2N3LA 2IRYA 3MM9A 4K2JA 4MMOA 1RWUA 2YKQA 3BGLA 2MKSA 1NK7A 3BH7B 4JV5J 4KR0B 5FLXY 4DL4A 5IWAF 1ZETA 4N8NA 2XCPA 1T94A 2CA9A 5KFBA 4NLXA 4ES3A 3DOMB 5KFMA 1C4CA 2DB1A 3G6XA 1OO0B 2CQ4A 4CQ1A 2VPZB 1G2EA 1VHFA 3GFXA 4ZCMA 1TL7B 1VISA 1LQ9A 1HBNA 2KVIA 2Q79A 2X51A 3K7RA 3DRXA 5IV3A 3Q2TC 1H38A 1S77D 2CUYA 1RT6B 2QV6A 3R7BB 5I3UA 2BW2A 4F2RA 4YR0A 2Y8YA 3LP0A 4PWUA 4XAKA 2CZVC 4IFYB 2DHHA 2JC0A 3VR1A 5DM6Q 2MKCA 1FF2A 1HL6A 1NSKL 3IWLA 4KFBB 4EK2A 5IZHA 3UCZP 3FCWA 5A8KA 3TAQA 4O23A 2FHJD 3VWSA 1NK4A 4ILLA 2Z0GA 2CG4A 4FF1A 1HPZB 2YKAA 1JLFB 1NJIT 3MUMP 4DQRA 1ZA2B 3C46A 2VG7A 4GC6A 2HBYB 2N82B 3C6UB 2LDIA 4UT4A 1U47A 5CYMB 3DRPA 2RU9A 3CJ3A 2WBMA 3VGUA 2UVWA 3CD6S 3TJ8A 3GV5B 3WBZA 2RD5C 2QG9B 1MG7A 2GHWA 4IUFA 3ENQA 2HHXA 1SQGA 5BYRA 1HNXF 4DSEA 4M5LA 3CCSS 5GAEU 2PEHA 2Z8QA 4NZ6A 5CZVA 2BJ8A 2UXCJ 4KY3A 3R2CJ 3PVXA 5EN1A 3G71S 4K59A 3T5JA 5IT0A 5IS2A 2VBZA 2A2CA 4YMEA 2HBRB 4RW6A 3GIKA 4R0JA 2O67A 1HHQA 2Y9HA 3R6LB 1RGVA 1VQOS 3R8YA 5L1LA 2GAHC 4C48A 3NY0A 2EKNA 1REVA 5LMUF 1SIWB 3I82A 3DKDA 5FDLA 5GAGU 5GAHI 1T9XA 2Y1RI 1AZSB 3T19A 3B78A 3OFFA 4CLSA 2XMAA 4R8UB 3C6TA 2BQ3A 2E5LJ 1N5YB 1FRLA 2HHHJ 2WBRA 3CD0A 1HQ2A 2DNLA 2G13A 1T03B 4ZJQA 1JIHA 1YJTA 4NPOA 2FVRA 1HWKA 2VKRA 3UNGC 5KT3A 3AD7C 2D1CA 1U4BA 3G86A 1NB2A 4XDCA 1TVRB 5KG3A 2UXDJ 2HPUA 3M2VB 4O44A 2V8DA 1RB0A 5EGYA 1R43A 3DC2A 4DS4A 4ZS6A 4KPCA 3H7HB 2JVOA 3CDBA 4DV4J 4DCJB 2HK3A 1HNXJ 2AYMA 1KRPA 4PRFA 3GFYA 2V2ZA 1L3SA 3NP5A 2QL7B 2NUHA 1R89A 3DHWC 4OZ5A 1GMUA 4B3TF 1JQGA 3QT6A 1S7HA 2E44A 3DHXA 3UWTA 2DXEA 5C25A 2NREA 2BM1A 3BGFA 2Q43A 3R1HA 5KFZA 4ZPDA 3EZ5A 2IPOB 3D7SB 4J9SA 4A8YA 1XNQF 3BKTA 4BC9A 3KLHA 2DR5A 5I42B 2Y0BB 2WONA 3HD2A 4A48A 1HW9A 1P1LA 3TA1A 5GMKa 2C28A 2UVVA 2RMLA 1OJ4A 1B7FA 1W26A 2HVHA 2Z2LA 2DO4A 2A0FB 1FNXH 1HYSB 4OYAA 3PHEA 4DR3J 2F4FA 2DPJA 3MDFA 4A8KA 3HFKA 2JDJA 2HHHF 3UDCA 4U6PA 1N33J 2Z57B 4G1QB 1C0TA 2R7OA 2CNOB 1Q79A 3J81Y 2V8PA 3K59A 4O3QA 3WC2A 5LJ5Y 5D0HA 3M32A 2J6SA 3W66A 4TVAB 3CGIA 2PA8D 2YNFB 3CCES 1QUPA 4ZPVR 5KFIA 3TA0A 3PX4A 2R8JA 3I0SB 3MTKA 2QFIA 3EVMA 3IXQA 2QLXA 1VQKS 1PC4A 3POTB 2HSEB 1WC6A 3P5BP 5D0EA 4AD6A 2VJVA 1CQMA 3G82A 1RKIA 2BE2B 5KFJA 2F7VA 1UZHA 1KTQA 2HS3A 5E3QA 2AGOA 3C16A 3DOLA 3MM6B 1YJRA 2BDPA 2FGOA 1YHQS 2BE7D 3BO4A 1Q5VA 1FD2A 4J7CA 1MW7A 5E41A 2HWTA 3Q22A 1URRA 1U0SA 4NCGB 4A8SA 1N36F 2I2YA 2MKIA 2A10A 1RT7A 1CG2A 3CJ4A 2NXNA 1ZAXA 3G6ES 3LAMA 1N34F 5F8NA 1FJCA 4ZLJA 3F44A 3NS7B 4IRCA 3QPIA 1S49A 2HWIA 5LOQA 2OP5A 1WKKA 3PX0A 4KJIA 2GJIA 3SBMA 4OJ1A 1EETA 5I3PA 1LWCB 4DHVA 3CF5Q 3HCXA 2VDHA 1KC8T 1L5UA 3W2WA 2X3DA 1PILA 2HGNA 3CC7S 3T5KA 1DAXA 4PG7A 2YKNA 2OSRA 2VV5A 5KFUA 1WEXA 2E1CA 4OI0A 2VPYB 1WOOA 3M2UA 3VALA 1VS3A 3NCQA 2AEMA 5KG1A 1SC6A 4TY8A 5D6GA 1E6YB 2J9CA 2ZH8A 2HZAA 1T9TA 2C2ZB 2JL9A 2YWFA 3O1LA 4C98A 2GVDA 4ANEA 1Q0NA 3WDOA 3MWBA 2ZE2A 4FF2A 4ZPTR 1MMNA 3MOJB 2OAUA 2NS1B 1TK0A 2PFDA 1D8ZA 1NSPA 1JLAA 1UCNA 4Y00A 1ELOA 1JNRB 4LRAA 4B9LA 4KB7A 5B0CA 3Q0AA 3OR1A 2X3GA 2ZJPQ 2QGFB 2YH0A 2PSZA 2K7KA 1GQEA 5FD1A 4ZVFA 3ETOA 4U7UD 1RTDA 4G3IA 3M9MB 4ZVPB 3MXHP 3HHLA 4O4GB 3TYTA 3HMJG 3TX8A 3H5SA 1ZTWA 3GV7B 3BYRA 3K5MA 2ZH1A 3NWGA 4X4QA 3IC1A 2WVEA 1WSVA 2EFGA 2VL1A 3C19A 3MCOA 4QIFA 2KO1A 4OJHA 2XS5A 4O3NA 1TMJA 2F9DA 3UD5A 3N0VA 4IR9A 1F5CA 5HI7A 1OS5A 2OJ3A 4DR1F 5D0GA 2N7CA 1ZOTA 1WF2A 2CPXA 4IRKA 1H6KX 4PABA 5DQGA 5DDRC 4DUTA 1KQSR 1UVNA 2MQ8A 4FYDA 2KN4A 3QT8A 1NZAA 4X66F 1M5HA 2J7WA 1JLFA 1NNDA 1R6VA 2EK1A 3CIMA 3O5TB 4KSEB 4DL0C 4F4AA 3PFOA 2ZUAA 5I3QA 3JYTA 5DG7A 2LCWA 3RBEA 2DH9A 5LXRA 4NXNJ 3BGRB 6AT1B 3NGRA 2E1MC 2QT7A 2F65A 3EYZA 4DV6F 4TQRA 1SIZA 3BKUA 2FUG9 4ES2A 4UOCA 5E2QA 3MPYA 1RTZA 3MMJA 1FKOA 4FXVA 1HBOB 1RABB 4RW9B 5SZTA 3IR7B 3OT9A 3DRRA 2BYCA 3CCLS 3A12A 2FVSA 5KFLA 2RUSA 3CMES 2R8KA 4LFAJ 3P49B 3LGHA 3FDSA 2QN6B 1IXKA 5B0AA 5EHHA 1VC5A 2R7TA 2HAFA 1S79A 3DLBA 2AGQA 3FJ2A 2XMMA 3P96A 4RZRA 1UVJA 3MUVP 1TKTA 3NRBA 3IAM9 3R5AA 2GMHA 3E01B 2BV3A 4UOHA 3M8ZA 1X4GA 3BQ1A 3VCDA 3CTRA 2GCFA 3QNWB 1RT2B 1VRTA 3MECA 3QLHB 3TP2A 2QIFA 2CJQA 1SCJB 2ZC4A 1AZSA 4DL2A 4WWSA 4I2QA 2AKWB 4OHWA 3M8RA 3R5BA 4XK8C 4MKVA 4ZA1A 3FZ2A 4KHPJ 2R7XA 4YFUA 3BM7A 4OX9J 4PWDB 1X0PA 3FRYA 1PAUB 4KT0C 3D6HB 2F40A 2K3KA 3DU6A 4KV8A 1FJGF 2HHSA 2BOAA 2I1RA 3F56A 3M2VA 4O44B 2JZ5A 4C6AA 3KWMA 1SUQB 3CULA 3M6UA 4ED2A 1SBRA 1Y9OA 3GJQB 1ZZFA 4LF7J 4GC7A 1TAUA 2RKIA 4CT8A 2Y1LB 4P74A 4FF4A 2HW3A 3A13A 1C4AA 5CD4H 2VQFJ 3QGIA 5KG5A 1QM9A 1VRUA 2ZEJA 2NYIA 4E2FB 2CJBA 3A8IA 2ADBA 1FVSA 3SEOA 1TKXA 4KHPF 2GV1A 1TL4A 4LF9F 1OSDA 4CO0A 1FWLA 4N5SA 3V4IB 4PCQA 2ROEA 4JI1J 2NYHA 1IBMF 1UVIA 1R0CB 2GGPB 3NAHA 2C2EA 2YH1A 3U1NA 4F0KA 5DG9A 5J1NA 3LANA 2VC0A 2RT3A 4RNHA 1UP1A 5DDPC 1JLQB 2JEFA 2G4BA 2J9DA 1KFDA 1YSJA 3HJVA 2VA3A 1NSAA 1NXIA 1UMJA 2ZUGA 5DGAA 2KRRA 3OJSA 2AJ4A 2QJ3A 5M2UA 3M8QB 3BBFA 4B3RF 1RWXB
chains in the Genus database with same CATH topology
1FCAA 2B9XA 4C7QA 1TL1A 2AV5A 3AHPA 1FE0A 5A8WA 5D78A 3PR5B 2IJFA 5HP1A 1VBYA 2XMVA 3RRHA 3AA9A 4FVCA 3H2UB 2KXNB 1Y5LB 3K2YA 5KFNA 3TOQA 1DHMA 3MEGB 5U47A 2BVZA 4IG0B 2YNFA 2CVIA 3D0HE 2YNGA 5J2QB 1V3ZA 2WOMA 2KM8B 2YNIB 2WTFA 1K1SA 2VBYA 3VAFA 5L9NA 1APSA 1FXDA 1OSCA 3A8EA 3ZZOA 4AXJA 5KG6A 2J9EA 2DR9A 3POTA 2UUWA 1WI6A 3QJPA 3N79A 4WU2A 1BY9A 1S6PA 1C0UB 2XHWA 2JJ4D 2LXFA 2RQ4A 2YNHA 2PMZD 5DLFA 2KFNA 1JB0C 3DLEB 3RR8A 4NLTA 1OWXA 5L1KA 3NCPA 2D3ZA 3CDWA 2GC8A 1FKPB 1KSPA 2ZH7A 1AROP 2ASYA 4HH0A 2RQCA 1HQUA 2B4VA 2ROGA 5B0DA 3UD3P 5J2PB 4ES1A 1G3OA 3I5CA 2W9AA 1X9WA 2CQBA 4AL5A 1Y4ZB 1N88A 2CPZA 2VBWA 2AJ0A 3HT3A 5DM7Q 3RBDA 1JLEA 1S48A 1K0VA 1HMVB 5CYQB 2XMWA 2MY7A 4ECRA 3MUTP 2XY6A 4B9TA 2FJWA 3SYZA 5F8JA 2HRUA 1HHSA 2CQHA 2XMUA 2YKOA 3US5A 4JI6F 5KFGA 1E6YA 4ZVEA 4USJC 2B7CB 2L3MA 3MMCA 3JSMB 5HMZA 1L3UA 4NCAA 3NNAA 2V4QA 3TUIC 2JH3A 2E29A 2PMHA 1BLUA 1FRIA 1RA6A 2N7YA 2WK4A 2PN6A 3RB6A 4NZ7A 1TZ0A 2GO8A 1FXLA 2IAJA 1DTQA 3HHKA 3DMJA 4DQPA 5KFAA 2CQ1A 3DLHA 1C1CA 2DNKA 2ZBIA 1I1GA 3E51A 4AE5A 4LSLB 3M8PA 4TXSA 2RF2A 3CCJS 4H4OB 4LIRA 3QIDA 4RW8B 2KB2A 4LT6A 2EC0A 2G9OA 2Q66A 5A8RA 4HLBA 1FRKA 2OPSB 3PACA 4J9LA 4QWEA 4DUZF 2DRAA 1YGYA 3IGVA 4QWCA 1GXTA 1HHTP 3HX9A 2XO7A 1VQNS 1FT8A 2M88A 3ISND 5FIIA 5KFWA 1TK5A 5D77A 4LF5F 3JYTB 2VFVA 2DHSA 4A8FA 1IKVB 1VQYA 2CQGA 2OPQB 3MR3A 3K5PA 4BS2A 4IYQA 1LW0A 3MPWA 4YDDB 1F5BA 4MK7A 4I4BA 3P5TL 4UY85 1BQNB 4M8LA 4U67Q 4YR3A 3M9OB 2KZZA 3ONQA 5KFXA 5AXKA 4HTIA 4CH7A 4OZNA 1FNMA 1M5SA 1FKOB 1SKSA 4JV2A 1X4BA 1X4AA 1K0TA 3EGWB 2JVRA 4QCLA 3MAHA 2EWHA 4EU0A 3UR3C 4NA3A 1IJEB 3IFEA 2ZH9A 3TARA 4OZ0A 4UW2A 4URGA 3KFWX 5IT4A 2MYFA 4WKRA 2DBBA 4WYWA 2QRRA 4Y34A 2IA0A 1TKTB 2LA4A 2NXUA 2FJXA 3E01A 2FJBB 2I38A 3ITHA 2MZJA 4NZ0A 3PRBA 3KMQA 4WE1B 4A8XA 3UCGA 4PUOB 2D7SA 2QE5A 3FRZA 1UL3A 3QLHA 4Y2CA 5LT5A 5F3ZA 2XB2D 4U7UK 2UXBF 5KFVA 2CRLA 2LU2A 4OHYA 1LXJA 2XWYA 2WRMA 2IYGA 1GX5A 3KLGA 2R8GA 4TU9A 2D3UA 1SJ4P 5DDOC 3SQGB 2UVUA 1ZPVA 3BREA 1N6QA 3QAEA 2PO4A 2DHGA 2YWGA 1KLMB 2RKIB 4R25A 2RU3A 2OMOA 2M2BA 4RWXA 4CNZA 4N76A 3AQPA 6FDRA 3J7ZT 4HL9A 3UDLA 4O3SA 1YJUA 1QUVA 4KQZA 1UWBB 4BDPA 3DN9A 3HI9A 5GADU 1N56A 4TLQA 3V4IA 2E5GA 2NPIA 2OD4A 4RUCA 4KHRA 4F4KA 2EI5A 1VQ6S 2HHVA 1ZM2A 2M70A 2GHPA 3B4DA 3K5NA 1U25A 1CLFA 2RDIA 1DLOB 4ED3A 1Y00A 2DTJA 2BOPA 1YVFA 1JLQA 2CPEA 2YKPA 4XPEA 3LP1B 5HMWA 2KYXA 4X4OA 3UW1A 3GG1A 3C66A 2MGZB 1S1WA 3OBIA 3NGKA 5E3CA 3OL6A 3PFEA 3FFIA 4MYTA 3CJ2A 2H5EA 1HNVB 3UCUP 2BQUA 2FHKA 4I6WA 2L9WA 3BGUA 5KG2A 5IM0B 2ZITA 3MEDB 4FPRA 2W9BB 3M1VB 3DGPA 1S6QA 2XZWA 4YB1P 2FC9A 3HHLC 5JUMA 2LXIA 4KIAA 5J2QA 2F3JA 2OO4A 4CNYA 2R7UA 4K2XA 4BHQA 5KFRA 2MZRA 3O3LA 5L9XA 1Q16B 4K4ZA 5I4MA 3GQCA 1U49A 3DLJA 3M6WA 4K4TA 3VTIA 2PD1A 4CO4A 1MNEA 2I9SA 2LVWA 4FBUA 1FKPA 5JVHQ 3KJVB 2B4PA 3LGMA 4NL5A 1LWEA 4O3PA 4X65F 2LXUA 4RU2A 1VQ9S 1QSLA 2W7OA 3DLGA 2OFGX 4YB5A 2CQCA 4ZOSA 4NOHA 2ACYA 4YDXA 4IOBA 4MIBA 4DQIA 1SI9A 2V8VA 4C0OC 2X1AA 3OTBA 1RTIB 1TL3B 2D9PA 1KFSA 3T1AA 1FDAA 4A8QA 2ASLA 1T3NA 3AA8A 4CH0S 1J5EF 4LIWA 3OXGA 5CA5A 3LP2B 2V9WA 1MROA 3CCTA 4I2PA 4XDDA 2MQLA 3UR0A 4I6AA 1AFIA 2WSEC 3HM9A 2ZOGA 3OLBA 3SCJE 4KFBA 1X8DA 1Y0HA 1FRXA 2IAJB 1M5KC 3HVTA 1NH8A 4JOUA 2CVEA 3M30A 2IM2A 3DMJB 4DOZA 3MM5B 2V9KA 3I9ZA 3O2IA 1NK6A 1DZ5A 1PO6A 5KT4A 3VAJA 4RW4B 1OQ3A 3N6NA 5KG0A 3HPOA 1EP4A 2ZKUA 4ZVHA 1NK0A 5J1EB 1JMTA 1YI2S 5CYMA 3DLKB 5H1SV 1SH2A 2FLPA 4JI4F 4RW8A 2KFZA 1CC8A 4K4YA 4U9RA 1N54B 4K0KF 2XI2A 2B3TB 5KFTA 4I0WA 1WTBA 2RH3A 4B9SA 1U24A 1QSYA 1G1XA 4PQUA 1RP5A 1S6OA 1YIJS 4ILMA 1AXQA 2P9EA 1W2IA 4I7FB 2CQPA 5LSRA 4I6YA 3TAMA 5DLGA 4NWBA 3L7OA 4IFVA 4B9VA 5AXMA 5L1JA 1FJEB 1U1PA 3D1OA 2BA9A 1RTJB 2GQ2A 2VQFF 2D3OR 4C4WA 4KO0B 3BSAA 1REVB 4NLYA 2R7VA 4GKKF 1HBMA 3MEEA 4CTAB 1ZBTA 2HWHA 3J7YI 2DCLA 4QW8A 1TKDA 3HKWA 3Q8SB 4LUBA 2LEAA 4QR1A 3C6TB 2DIVA 5KFQA 1VJWA 4PG5A 3CXCR 3DOMA 3D1HA 1N8RT 3GG0A 2MHEA 2HHTA 4FF3A 3G6YA 4DV4F 4DR7F 3EXCX 2UVRA 3OFEA 1TVRA 1CVJA 3RW6A 1Z1ZA 1P8GA 3CCRS 2DO0A 5HLFB 2MDAA 4RU9A 4WE1A 1S72S 2ATLA 4P7TA 1QSSA 3MMBB 2AJ1A 1J2VA 1YJWS 2R7QA 1GH8A 5D4OA 3PRDA 1ROFA 3QGGA 2E9ZA 3PNIA 3D1QA 3RRGA 2OH2A 3KHLA 1WF0A 2VODA 2DGSA 1T3OA 1N6QB 3LGNA 2AGPA 1V9OA 3TW0A 4QBUA 4V19J 2EPIA 5I42A 4ECSA 1KOOA 3BDPA 1NJZA 1QAIA 5AJ3F 1RQ0A 2ZNYA 3N4WA 3P3DA 4Q7AA 2FTRA 5A2QY 3I56S 5CH7B 1X5TA 2Y1JA 1NJWA 1HYSA 1WNEA 4C2MA 3MR5A 4WFXA 3J80Y 2ZOFA 4OJ3A 1XNRF 1H98A 4C11A 3BR9A 4ZK7M 1WG5A 3LWMA 3CCMS 3OSPA 2HQIA 4TQSA 2MKHA 3MTJA 4NYZA 2P5VA 2MQQA 3MF5A 3CDAA 3ZZTA 1L3KA 1XMOF 1GXLA 1KOHA 2K8GA 3V4MA 3VF0B 3V6KA 1DQ9A 1R7IA 2A1BA 2E7XA 2RQKA 3D0GE 3DM2A 3FFIB 4ID5A 1N52B 3B8HA 1WHVA 2RS2A 3J7A1 3NKYA 1FRMA 4I64A 1N5YA 2MZSA 1MWYA