4RWWA

Crystal structure of l. monocytogenes psta in complex with cyclic-di-amp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Lmo2692 protein
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwwA01
2CZ4A 4CO2A 4WK1A 1H3DA 1NH8A 1QY7A 1V9OA 1NAQA 2XULA 3TA0A 4D3GA 4Y65A 5DRKA 2VD3A 3N5BA 4NYOA 1XK8A 2JJ4D 2E66A 2NUHA 3DFEA 4CO5A 2GW8A 2XG8A 5D4PA 4C3MA 4NYPA 3T9ZA 4Y6IA 2O67A 4CO1A 2V5HG 2GX8A 4OZNA 2EG2A 4D3HA 1KR4A 1Q1KA 2XBPA 3HLUA 3NCRA 4RWWA 4CO3A 4R25A 1O51A 2GNKA 1HWUA 1VHFA 4YB5A 5D4NA 3TA2A 1GNKA 3OPKA 5L9NA 4CO4A 1V3RA 2J9DE 2ZOMA 4CNYA 4CNZA 3NCPA 3CE8A 4ZK7M 3AHPA 4USHA 4YB6A 4OZJA 3AA8A 1V6HA 1OSCA 1UMJA 4C3LA 3GSDA 5DS7A 2DCLA 2J9CA 4E98A 1J2VA 4WK3A 1UL3A 2XZWA 2RD5C 1VFJA 4C3KA 4USJC 4USIA 2EG1A 3AA9A 1P1LA 2O66A 3M05A 3NCQA 1PILA 1UFLA 1O5JA 3BZQA 4OZLA 4RWXA 4CO0A 5D4OA 5D4LA 2PIIA 4YB7A 2Z0GA 3X3UA 4IYQA 3O5TB 4RX6A 3AH6A 3L7PA 4AFFA 2J9EA 2NS1B 3LF0A 2ZFHA 3O8WA 4RLEA 1UKUA 1V3SA 3MHYA 1NH7A 1NZAA 3TA1A 2NUUG 2J9DA
chains in the Genus database with same CATH superfamily
3ADAC 4UQGA 1NRKA 2XC9A 3GFXA 3QIDA 1S7HA 3PW2A 4DCJB 4NRTA 2Y0SD 4WK1A 6AT1B 4WU3A 2H51B 4NZ0A 1NH8A 3MMJA 5F8JA 1T9UA 1A6LA 2HHPA 1NB2A 2FJDB 1R8BA 1X31C 2DT9A 3RBEA 1D3WA 5KFZA 4TLRA 3D2WA 3FBFA 1FFWB 2R9LA 2L9WA 1AFJA 2LFVA 2DRAA 1AXQA 1CBKA 1RHUB 1Z1ZA 2HFSA 2ZVIA 1EZZB 4J9KA 4B9UA 1CS4A 2LKZA 4OYXA 5KG6A 5B0BA 1JJHA 3VVTA 2HURA 2E66A 4Y2AA 3UO0A 5B08A 2NUHA 2NYHA 4Q2MA 8ATCB 3W2VB 1X4HA 1FVSA 4LF1A 1VR6A 2AGOA 3TOQA 1JLFB 1JIHA 4DLEA 2Q43A 2ATLA 2V5HG 4U7CA 2CJBA 5IT4A 2YXLA 2OD4A 3W8PA 3ZZPA 2YKAA 4CYUB 3GONA 3A8JA 2DEIA 4ZLLA 4CRJA 4PG5A 3UD4P 1U49A 2VASA 4JV2A 2X3GA 4O4GA 3LWLA 4ELUA 4F2SA 3AXMA 4TVAB 5EX3A 1U2FA 2OPSB 3R6LB 3UVJA 1WG1A 3BO2A 1ZZFA 2BE9B 3KLEB 2I9SA 3D66A 3PHTA 1XIQA 4DN9A 1N5TA 1IBMF 3A3PB 1U1RA 3FEXB 3CF5Q 1XNQJ 4WFYA 4C8NA 1CVJA 1BE4A 3QGHA 3IM9A 3BSNA 1D0EA 1APSA 1FJCA 1RA6A 1MU2B 4OZ2A 4DR1J 5DQIA 2ZVSA 3FCWA 4NLYA 4USWA 3CCMS 3AHPA 1UFKA 5KFCA 1FKPB 1RCXB 2WVFA 3BGUA 2CNKB 2KXNB 4J9NA 1HYSA 2N3LA 3BDPA 2DGOA 1HFEL 2CG8A 4J9MA 1V6HA 2UVWA 4M1KA 2JRSA 4JI2F 2XS2A 1UMJA 1O0PA 2KRBA 4OV1A 2JL9A 1N6QB 4PWDA 5CZVA 4YEAA 1UZDA 5D0HA 2OMLA 1TMJA 5KFHA 2J0XA 1N88A 2BJ3A 2FB0A 2ZH2A 2W2MP 1GXUA 4FF3A 3OL6A 1GMWA 1FI4A 3EJMA 3M6VA 3THTA 1LK7A 1CG2A 4O23A 2KKHA 5HANA 3T9NA 1I94J 2J8SA 4C8KA 5F9LA 3G82B 3AOCA 5F3ZA 3BO3A 5B0GA 1T0TV 2E5GA 2NSBA 2QA1A 3FEZA 3PDNA 3K89A 4AYBD 4MKBA 3IWNC 3C2PA 2MKCA 3CJQA 1OJ4A 4K4WA 4KV8B 3D6FB 1NJWA 5KFEA 4PYAA 4JP8A 1XMQF 2XQCA 3OR1A 1OPZA 1Z2ZA 3B4DA 4OYIA 3T6BA 3IBCB 5DM6Q 3QO9B 1IBKF 1R31A 2FJWA 3UW1A 2H4YB 4FNIA 4C0BA 3Q24A 4DV1F 2W7OA 1S1UB 1KVIA 9ATCB 4RU2A 1J5EJ 4ED5A 1PG5B 2W4PA 1MMNA 5L38A 4DFKA 2WVDA 1NDKA 2Z2MA 2B6AB 3I0RA 1V5IB 3F44A 5KFXA 5HN0A 1BQXA 2J8AA 4KE5A 3O5TB 1S1XB 4H54A 4P2XA 1VI7A 4CLZA 5ADZA 3RBDA 3BQ1A 4YN3B 2HG4A 1L3TA 1QAXA 5CYJA 1IBLF 1NK5A 2HZVA 4KHPJ 1OS5A 2AX0A 3DM2A 1JJ4A 5KG0A 4EWTA 3F41A 4USMA 5IS2A 4FF2A 2DHAA 1OY9A 2A0FB 3P6YC 1FKOB 1S6UA 1Y0HA 2FHMA 4M5DB 3KK1A 3T3FA 4FBTA 4JI0J 1N32J 3HVTA 3LH2S 4FBUA 2CQ4A 2LYVA 2YKMA 1FRKA 3KDNA 4L3KA 2KO1A 2E7WA 3EDQB 4L3NA 4F67A 3JSMA 3HHNB 1RAFB 4EUVA 2VG5B 3MWBA 1H74A 4RNFA 4ED7A 1Y3JA 3KWMA 3KK2A 5B0DA 1RHJB 3EZ5A 2HBQB 4KR0B 2HNYA 5AJ3J 4DR5J 1Q78A 4WU2A 4XIUA 1DQAA 2MKJA 4Y65A 4JV5J 1H38A 4K0KF 3GG0A 3UDLA 1ICEB 2Y8WA 2NXNA 4OX6A 4J9OA 2VD3A 4F8RA 1SC6A 1DQ9A 1VC0A 2BJ1A 2VHGA 4DDFA 3FRZA 2VL1A 3I0RB 3ITHA 2WAQD 3U27A 2ZHAA 5AE1A 2XMAA 3T19A 4DR3J 2EEYA 3D67A 1R0CB 4NI2B 2GW8A 2POKA 5F0WA 2V4RA 1VOMA 3BSAA 2I1RA 3T9ZA 4ED3A 2WSFC 3TEGA 3J7Z5 3GIRA 4F0MA 2BJ7A 2QSWA 2EG2A 1N56A 2XTJP 3TVZA 1U26A 1FF2A 2QX0A 4KQZA 3GIIA 1H2VZ 4KFBA 4ID5A 1RT7B 2D69A 4CI0B 1I51B 1VRUA 2FQQB 3S01A 1V5VA 4ZPVR 1UJ5A 2UP1A 1RKIA 2UXDJ 2HVHA 3PYFA 1U6FA 2YKNA 1YRUA 4DZ6A 1YJTA 4C8ZA 1ZS6A 1YTYA 1OYEA 2DNPA 1WF0A 3RU0A 1GNKA 2Z2ZA 4NE9C 4ECQA 1S5ZA 2EKYA 1UWBA 2C2OB 2QIFA 3B8HA 3HD1A 2R2TA 2Q79A 1D8YA 2B43A 3PFEA 2DNKA 5DLFA 2EC0A 2DNQA 4MT1A 3UCZP 3CJ3A 4AUKA 4ES3A 4QIFA 1WWHA 1DJ0A 2Y9HA 4MYTA 2R8HA 1AZSB 1C0UA 2KDOA 4M94A 4PWDB 1T3OA 2PSZA 4LSNA 4QBUA 2RDJA 2D3O1 2QA2A 5J2NA 2IBOA 3IG1A 1YBAA 2HRYA 2YX4A 1Y5NB 2LA4A 3MM9B 4PXCA 4O3OA 3U1LA 2R7VA 1BQNB 3TJAA 5DDRC 1IWAA 3A1YG 1QVFR 2MZRA 1H7XA 2RIJA 5HQLA 1UL3A 4P10A 2CQCA 4PQAA 1VRTA 5BXIA 4I4BA 2OPPA 4GKKF 3CCJS 4LF8F 4P2MA 3BR9A 3R8YA 4UUWA 2RVJA 1S9EB 3KG1A 3U02A 1S6PA 3OQ2A 1DLOA 3AA9A 4FZVA 3RJMB 1P8GA 4I7FB 2MMYA 3FMWA 3L4BC 2RS2A 3D3BJ 3J80Y 5HMZA 1VQ9S 1KDNA 2E5LF 2GHVC 5HBMA 2ALZA 3BN7A 3IG1B 3AD7C 4KGVB 3KUEA 3MXHP 3PRBA 3BO4A 3NKYA 3NCQA 4NRUA 4PZVA 2CVIA 4LSNB 4Z7YA 3TVYA 5HQ8A 4AT1B 2B4OA 5D78A 4K8RA 3G9CA 1BWEA 2OD6A 2PGCA 1SQEA 1RABB 1U09A 1LNQA 1VIXA 5IFMA 4JI3F 4LR9A 4LSZB 4LR7A 1IJFB 4IYQA 3IP0A 2EPIA 4LRCA 3CT9A 4DX5A 2XCAA 2UUCF 3CUNA 2AYGA 4FF1A 2AW0A 3AOAA 2B9EA 3FK4A 1I5OB 1TUWA 3HHDA 5DDOC 2OIHA 5E3PA 3L7OA 4QJVA 1X4GA 2CQDA 1U45A 4IQXA 1HQEB 2GZOA 1LEOA 2WHOA 3CGIA 3TA1A 4QWAA 4GC7A 4EBCA 2AJ2A 4DFPA 1ZM9A 1NU4A 2C1EB 4K2XA 4NWBA 1TK5A 2D74B 5A6PA 3MI7X 3BKUA 3BSOA 3ZTQA 4KFBB 5GAHU 4EEYA 2FZKB 4YHHF 3EUNA 3GJQB 2G1HA 5JMNA 4C8LA 3MM5A 4I67A 2LCWA 2ZUAA 2ZE2B 2DGWA 1KSPA 3OTBA 4RPFA 4DSFA 3GJSB 4EZ9A 1WKLA 1X4CA 2O1PA 1AA1B 2AEFA 4J9PA 2MQ8A 4IH5A 2VJUA 3NAHA 1VLOA 3MPVA 2LQ9A 3MTKA 4C48A 4EMDA 4LMZA 3EGNA 4M5NA 1AYEA 2QRRA 4PG4A 3W66A 1FWLA 4RW8B 4I69A 4QIWD 5JVHQ 1WUUA 1IJEB 2MZSA 1Q95G 3BBBA 1ZOTA 2V8PA 2VF3A 3CCTA 3GFZA 4DEZA 4YS2A 1YJNS 3QFWA 4IDKA 1CPZA 1IKVB 2BDPA 2HNDB 1IN0A 1FNXH 2XG8A 1RJJA 3I0SB 3D0IE 2OMOA 5D4PA 2N7CA 3EZOA 3KK2B 1O8BA 3JSMB 3CJKB 4PRFA 1GXTA 1N0VC 2VBWA 2BBEA 1HA1A 1UEUA 2GC8A 2IM0A 1CQNA 2CIMA 2C2ZB 2M9KA 3IGNA 3OFEA 4P7TA 5A8WA 1F9EB 5HVGA 3VZHA 1TL4A 4DV3J 2W9BB 2MZJA 3RR7A 2COLA 1MW7A 2N3OA 2IC3B 3DHXA 4DSIA 2C3YA 1KEKA 3OVBA 2GS8A 1O51A 1W25A 1VCTA 3DM2B 4B3RF 3MZIA 1HWUA 4OHVA 5E2QA 5A8RA 5L1LA 3MAAA 2ZD1A 2MHNA 4R5PB 2C2KB 1TKZB 3CD0A 3O44A 4ERDA 1ZM4A 1YBTA 3I5AA 2B5JA 3DNCA 3WQPA 1UA1A 4PYDA 5CYMA 3EDRB 1FKAF 3EM1A 2LDYA 3MUTP 2XMWA 4OX9F 3W2WA 2LQJA 2RILA 3J81Y 3DRSB 2QGFB 4M5HA 3QLHB 2Z2LA 4DV6J 1S10A 4U8VA 3BYPA 3HM9A 1T05B 4BBYA 1TK8A 3JXOA 1SXLA 4ZS6A 4MMOA 3IBWA 1RZMA 2DIUA 1SJRA 1RTJA 1JKHA 4JV0A 4RNHA 4FS2A 4ECVA 1KWMA 3WC0A 3BSCA 2XS5A 2BJ9A 2OEMA 4DR5F 4RO0A 4FVMA 3PY8A 1R27B 2WSEC 5C5JA 2JFDA 5F41A 2QLFB 1LW0B 1YZ7A 1Q82T 2HHTA 3G6VA 3QPIA 3OLBA 3MAHA 3HHLD 3AD9C 3PKYA 3CNQP 1YITS 4CLSA 4IR9A 3VGTA 1JLQB 4ES1A 1HW8A 1WG5A 4EZ6A 1P6TA 2OFGX 1U0HA 2FPHX 3RGIA 4M5KA 5KFTA 4F0HA 2B56A 5HATA 1P1LA 3KTQA 3BJYA 1G1XA 5F8MA 2UUAJ 2AF6A 4H4KC 4IRDA 4EBEA 1QD1A 4U95A 2M5YA 3T1YJ 2MKKA 1F5AA 1IKXB 4DXLA 3R9LA 3PO4A 1F0XA 3M8RA 5GAHI 2VFUA 1X9MA 1I1GA 2CJKA 2EW9A 2ZBRA 3DXSX 1MG7A 3BB5A 4FF4A 3QBCA 2OAUA 1FJEB 3W5XA 4ZVFA 3UD5A 4YY3F 3BQ2A 1XTZA 2P8IA 3MEEA 2E7VA 3JAMU 4DSLA 1RE1B 3AQPA 4C0HA 4CO0A 1EETB 1YG0A 2OP5A 3M30B 5D4LA 3UN5A 4CTAA 4DOZA 3MR6A 1I94F 1ROFA 2OI2A 2HMIA 4ILMA 1SH2A 2HWTA 3DRPA 2I6WA 2KJVA 3D0HE 3HSJA 3DLKB 2KYZA 2XZTB 3ILIA 3R7BB 5I3UB 3GJRB 3M8ZA 3AFGA 3O8WA 4Q45A 3KJVA 1KLNA 1TFWA 1OY8A 4JYAJ 2OPSA 3MR3A 3PFOA 4ELVA 2CDRB 2OFHX 1NDLA 3IMQJ 4H4OB 4QIVA 3P5BP 1NDCA 3PVXA 1RWVB 3N6LA 1NK8A 1SI9A 2JX2A 3BGOP 4OFZA 2EBGA 2EFGA 1JLGA 2F9JA 3ENWA 1EP4B 4JI7J 2JFKA 1HW9A 1NBEB 5C42B 4DF8A 2YWHA 2V2KA 4FXWA 1VMBA 5I3PA 2FUG9 2FLLA 4G6VB 2UUBF 1KKHA 5IWAF 1QY7A 5DM7Q 4NMLA 1HNVA 2WB4A 3EGWB 3DLEA 3DHWC 3LOUA 3NEKA 2UUWA 4MTPA 4O3NA 1R0AB 1D1UA 2J0SD 1RI7A 2I38A 2IVYA 2ZWOA 4P73A 2F40A 4WKRA 2GMHA 4XO0A 2C2EA 1B99A 4KRWA 4BC7A 3HHEA 5EWGA 3ZTPA 3K8WA 1UETA 1HBUB 4DUTA 5IQ6A 3RAQA 5LXYA 2AV5A 1AW0A 1SIZA 1TZ0A 1S97A 1RCOB 4EYIB 4DL3A 4OYZA 2OEJA 3AJDA 3FVYA 4N5SA 3V4IB 4NCGA 4C4WA 5M2PA 2ZC3A 4CQ1A 5EGYA 2Z56B 2EFOA 3H8YA 1S4FA 1FJGJ 2UXCJ 2GX8A 4NLWA 2MTLA 2A18A 2RDDA 1AROP 3EMTA 1U4BA 1NLKL 2E1CA 2I8EA 2ZH5A 2BACA 4OYBA 2KVQE 3D1HA 4EK2A 3OVAA 1X9WA 1WSVA 2MSSA 1BWVA 2ZJPQ 4CLKA 2EVZA 2V4JB 1RBOB 4MIBA 3HI9A 2G0CA 5GADI 3G6YA 3VAJA 4J5OA 2RRAA 4JI3J 4IG3B 4QPTA 2BKPA 1YI2S 1K9MT 1DTQA 1WELA 2C3OA 3W5ZA 4ZVEA 4OJGA 3HULA 2Z8QA 1D9AA 3CEDA 2J9DE 3BF4A 5T14A 3FFIB 1Y5LB 4J91A 3K5LA 1C4CA 2NXEA 3DYAA 4HT7A 1IBCB 4RR5A 3NCPA 3ONQA 1SC1B 3OTDA 5ETMA 1CULB 2AYEA 1S6QA 3K8VA 4G1QA 2HGNA 3TAPA 1VQ7S 1BGXT 1RBAA 2CWXA 2GVDB 4G1QB 3UN3A 4TU7A 1ZBTA 2UZAA 3HKWA 1KOHA 1SKUB 3SFGA 1HBNA 4FYVB 1TFYA 2CUYA 5DS7A 1LV5A 3CIMA 2DGSA 3N5FA 1RT3A 2MY7A 1CJKB 2E1PA 4DU8A 2AEJA 3C46A 3MDFA 2H1YA 2V4JA 1XMBA 4ZN3A 5FLXY 1LFWA 3SZ2A 2BQUA 5L1KA 2BR0A 1HD1A 1R43A 3MOJB 5KG4A 3QT6A 2M8HA 4BHQA 1FXRA 4IO1A 4IG0A 2GO8A 5B09A 1GQEA 2CQ3A 3FKBA 3OTOF 1MROB 2RQ4A 4DHVA 1U2RA 4MJKA 1HR0F 3NAIA 3OVSA 4KPYA 5F8HA 1JLAB 2HEKA 3CSKA 1X5PA 3ZFVA 5A8KB 4OHYA 1W2IA 3DOMA 1QUPA 4DV7F 4B3SF 4FN5A 1A9NB 2VQEF 1B7FA 3PNIA 3AOBA 3MMCA 2UXBJ 3N9UC 3M1VB 2WONB 2DY1A 3R5BA 4HACB 2KM8C 1KQGB 2BANA 3VCDA 5HLFA 1TAUA 1SJQA 4ZP6A 2YQ1A 4I6AA 3PEJA 2HFNA 5HL7Q 3FZBA 2FJVA 4DV7J 1R8CA 2QZ8A 1H72C 4LIWA 4BCAA 3KHRA 4DQQA 1BD6A 5ETKA 2HHSA 2J76E 3IGVA 1HNVB 3GCWP 3NGRA 2SXLA 2C2NA 2WK4A 2ZC4A 3PHEA 1GMVA 1PC5A 5ETVA 1T03A 3RRHA 2W01A 1QLNA 4FNHA 4LF2A 3G6ES 1VQ8S 4ZMMA 4LF4F 3WIUA 1OMSA 1RWKB 1EP4A 4LF6J 4X64J 2ZBQA 3GU0A 3JQJA 1TV6A 2FZCB 1M5VC 2XLKA 1UKUA 3OTEA 1VYAA 3P4UB 4X65J 3ZZUA 3NGDA 3M2VB 1FRXA 1GEHA 1GTEA 1LKZA 4WIQA 2VG6B 5DQHA 3KJVB 4DQSA 2K7KA 5I42B 1SJ1A 4DFJA 4DR6J 1N52B 1KP6A 3OD2A 3QIPA 4ER8A 3OJSA 3HD2A 3R5DA 4DV0J 1NO8A 1UZHA 2WW4A 3NNAA 1U1OA 1RAEB 2HQGA 3EWGA 4BWMA 1HHTP 3H5UA 1EETA 2F5GA 3M30A 4CTAB 4J7CA 5EWEA 5BYRA 2V8DA 2FHKA 3MEEB 5GMDA 2IM2A 2G4BA 3S1TA 2Z2YB 3EXCX 3KUHA 3ZZTA 3J7AN 4I6WA 4HDHA 2VBYA 4PWUA 4HT5A 3TZYA 1O6XA 2RH3A 1NUEA 2GIRA 2MJNA 5C24B 1IKXA 1HWJA 1MWQA 2IPOB 2NSCA 2PI4A 2LU1A 1FTCA 4H4MA 4JI5J 2YX1A 1OSDA 3DFEA 4USKA 1S4EA 4WP8A 4CCHA 2Q1LA 1N36J 4UY8T 2M3DA 2ZKUA 4ITSA 4Y6IA 3M2VA 1E6VB 3MTJA 4I2PB 2DHHA 4O3PA 3VR1A 5DZ7A 1IM4A 3MMBB 5DO2A 4D3HA 2DXEA 3CO0P 3CMES 2XCPA 1SJFA 2FGOA 3CVKA 2QN6B 4URSA 1LW0A 3G8TA 2XLJA 2H5JB 3HK2A 2AJFE 1QTNB 4DR2J 2LEAA 1YWXA 1KD1T 3NNCA 8RUCA 3HSDA 1VBYA 1ZA2B 3NBPA 1JKHB 4O44A 2OPQA 4LIRA 2Y0BB 2CYYA 2RKIA 4B3OA 1RTHA 2ZUGA 3I32A 4LFAF 2VOOA 2LXIA 9RUBA 3DI6A 1ZYQA 2FJXA 2C42A 5LMNJ 2P5VA 3FRYA 3RBXA 4CNYA 2K1RA 5JVGQ 1Q8LA 4NLDA 5FDLA 4HACA 4DX6A 2P2CB 3W2WB 4L72B 3M1VA 5HMXA 3KLGB 3JB9k 1PYSB 2PD1A 2X3DA 4U67Q 1PYTA 3CCUS 5DG7A 2G2OA 2K3KA 1UJ4A 3FCHA 1RDRA 3DOMB 2UVVA 1IQTA 2XMJA 2CQIA 1JLAA 5L46A 4DSJA 3V6JA 3CW2C 1F2HA 1Y4ZB 2DCUB 3C6TB 7FDRA 3MAAB 4A8MP 2R7WA 4GVBB 2W2OP 5IWAJ 3CJ4A 1CJUB 3HXMA 3IRXA 4U6PA 2ADBA 1WEYA 4E98A 2G0IA 2DY9A 1Q16B 2DNLA 2M52A 2RRBA 3HVWA 4FPIA 1EB0A 1WC6A 3ICLA 2DTJA 3LTOA 5CZXA 2W9BA 2C3UA 3KHLA 1ZTTA 3HHLB 4J9UE 2I5JB 4L73A 4QW9A 3HT3A 2VJVA 3T1HF 2QEXS 4IKAA 4QU6A 2JNJA 5SUHA 3ZC4A 1LFPA 4WCEQ 1HNIA 4NLPA 1X0FA 3H5XA 3FZ2A 4Y2KA 1X7VA 5I3QA 1M1HA 1IKVA 1WC0A 2O5DA 3KJQB 1WKJA 4GVLA 4DL2A 3DLLQ 2GVDA 3VZIA 3IXQA 1S1VA 4Q0BA 5KFKA 1KNZA 5KFAA 3SQGB 1CULA 4RW9B 3J7ZT 1REGX 2W7PA 2DB1A 5IZHA 1PILA 2DBBA 4RU9A 4YUDA 3VAIA 4EI2A 5E7OB 2HHXA 1RTZA 1XEZA 4RWXA 2V63A 3TQEA 5LJ3Y 3MEDB 1IBKJ 5FIIA 2RUSA 3W9IA 4CH7A 3ETMA 3H4DA 1N5QA 1RK8A 4OYMA 2QL9B 2ZE2A 5BR8F 2KYXA 2V8HA 3VAHA 4MKVA 1TL5A 4ECXA 4P72A 2XYHB 1TL7B 1IR1A 1ZZNA 4ETZA 2AIRB 5LXRA 5KFMA 3ZO7A 4ZLPA 3RRKA 1FD8A 1QE1A 4QYRA 3CULA 2G2YA 4F3MA 1YJVA 1P27B 1ZAVA 3JS9A 4NCAA 2M70A 4Z7CA 6FD1A 2L9NA 1IBLJ 2BE7D 3G8QA 1L3UA 2DVIA 4LREA 4CM2A 1S0VA 2ACMA 3QGPA 4X4RA 1FK9A 3SMZA 4CLLA 4ED6A 1HQEA 4A8SA 4OZ0A 2CJAA 4LRFA 5J1PA 1K73T 4W90B 2B4VA 2VH7A 3CJ0A 3P5TL 2KFNA 2BJDA 4G65A 5AJ3F 2HYIB 5HMYA 1EQ0A 2MKYA 3KNAA 1B0PA 1RHRB 3Q86A 2X1GA 2X1AA 4LVOP 1TL1A 2GAHC 5H9FJ 3DI6B 4KBIA 4L6V3 1WF2A 5LM7E 5J2PB 1UW9A 2MLXA 3S7RA 4B3OB 3I55S 2RS8A 3NBPB 2XO7A 5D77A 1WEZA 1N5SA 3L09A 5HBMB 3V6DA 1PO6A 3PRDA 4V1Ak 4ZPCA 2OELA 1VQPS 1JLGB 2QMWA 2WVBA 1DLOB 4NLXA 3R2DJ 2H9ZA 2W9AA 3GP9A 2DNNA 1ZAXA 2D9OA 3DRRB 1KFDA 3ZTRA 5C2CA 5F9NA 1U2CA 3ILOA 4OZ3A 4QR2A 2VQFF 4RW7A 1Q1KA 1YLXA 2YVSA 1EAYC 2E1MC 2EC2A 2IMWP 2UUBJ 2L41A 3ENAA 4YHHJ 4X66F 2F7VA 1HBOA 3H2UB 5D8HB 3KLIB 5L8RC 3FMBA 3F56A 4TN2A 4DL5A 5LL6d 2PI5A 3KMQA 3MAQA 2Q3PA 4ECYA 5D4NA 2K8GA 1VHFA 1SH0A 1Z4UA 2B7CB 3D68A 4RW4B 4ZJQA 5HSPA 3OW2R 2HVIA 4DMZA 2HBRB 4ZVTB 3CO9A 1PBAA 4EGLA 5RUBA 3R5GA 3V6KA 5H9EK 2QL5B 3QZ8A 4B3TJ 4P75A 3ZZ0A 5I42A 1FHTA 3DLBA 2I2YA 3E8OA 1U24A 1SL1A 3IAS9 3FBCA 2YKPA 3NWGA 5E3CA 1RT4A 1FFSB 4IOAQ 2F8HA 2R7TA 3DLGA 4GO7X 2IRUA 3M8YA 4O3QA 2DITA 2DXDA 4N76A 1VC5A 1U6ZA 2BOPA 3PW5A 2DNYA 4GKKJ 2LEPA 1VDHA 1I3OB 1A0OB 2K3IA 5HI7A 1VRUB 5H9EJ 1LXNA 3TQ1A 3NS5A 1QDUB 3VVUA 1T94A 1YDLA 2NCKL 2XZWA 4O0NA 4DL7A 2W24A 3GIKA 1RP5A 3W7BA 2K2PA 4LJMA 3J7A1 2YKOA 1R89A 2Q6CA 3WZ0A 3H2LA 2HWIA 4KIAA 4OQJA 4Q2LA 5KT6A 3RTVA 1N5YB 5AE2A 3IA0A 1Y10A 4OLOA 4A8XA 5HROB 1K8AT 2VB6A 2KG1A 2EWHA 2LA6A 2LU2A 2MQMA 3FDSA 4IO9Q 3I6PA 3HVRA 1TUVA 3PRVA 3R5CA 4DSEA 4JI8F 1JNZB 2D1CA 3C14A 3IS9B 5M2UA 1R8HA 1LOUA 3EPIA 5J1NA 3PYDA 3BZQA 1QSLA 2YX7A 2ZD1B 2HVDA 4QCLA 5A8RB 3K7RA 5F8NA 2XMMA 2C28A 1T9YA 4ED2A 2FHJD 4B9VA 1YKWA 5GAEI 1ZETA 4LR8A 2MDAA 2IC3A 2YTCA 4WPAA 1ZTWA 5DQGA 2HGLA 4PR6A 4DR3F 4WFXA 1Q81T 3LP1A 4KKOB 2V6AA 3LF0A 2ZFHA 3TJ8A 4TQRA 3OTOJ 2YKMB 3H5YA 4Y2CA 1UJ6A 1NK0A 4URQU 2DPIA 2W2NP 3R5JB 1SPBP 2CDQA 3Q8QB 4Y2IA 5K8PA 3PZPA 4M5DA 3OL9A 3IR6B 1SKSA 4ZDNA 1AUSL 2BKOA 2F8MA 1HBNB 2CA9A 3UDVA 4HYKA 1X9SA 3LGMA 1VQNS 1HL6A 1RT2B 4F25A 4UW2A 2HNDA 4B3RJ 3KHGA 1FWKA 1VS3A 2DHSA 3D6MB 5CXTA 1QSYA 1BXNA 2IVMA 1XR6A 5DDPC 5SZTA 1S6QB 3RAXA 1YX2A 1F6TA 2NREA 2FY8A 4PG8A 2MZ1A 3EXYA 3G2XA 1V9OA 3FFIA 3H42A 4FKXA 5F3TA 2HHWA 1B4SA 1NNDA 3Q8VA 3M8SA 2GFFA 2HRUA 3A13A 3TA0A 2B51A 5KFFA 4DF4A 2GMLA 4CDIA 4KSEB 4F02A 1S1UA 4A46A 1LWEB 2K7JA 4NYZA 3V5RA 4BLGA 4YFUA 5DGAA 1BLUA 3HJFA 4N56A 1RWWB 3N5BA 2IAJA 3B54A 1EX8A 3OR1B 4DUYJ 3W9JA 1YHQS 4PPDA 2B7BB 1GTHA 2NQPA 2ZBPA 2BX6A 3L7UA 1W2BR 4NA2A 1U6BA 3PX0A 3LANA 3UPFA 1HWIA 4NYPA 4C0OC 2ASDA 1HBMA 3GR0A 2O67A 1LW2B 4NCGB 2I0XA 2QLWA 1KR4A 5CH7B 1HHSA 2FIUA 2WBRA 5E33A 2CPHA 3PW4A 4KAIA 2V8GA 4AXJA 4E2FB 3AJ1A 4RWWA 4NXMJ 5DLGA 1ZM3A 2VC1A 3ULHA 5B7WA 2GMJA 3W9HA 4C11B 2QA4G 1L3VA 2ZZNA 4W92B 3MF5A 1X4EA 4ZPTR 3VV2B 3FC9A 2A3JA 2HS0A 2JSXA 2EI5A 4ZCKA 2RT3A 4K5RA 1NHUA 2FVQA 2JOQA 2QYGA 2CPFA 4U9RA 4USVA 2C2RA 4C9DA 3CE8A 5F8GA 3OBIA 4DV6F 3HHKA 2MYFA 4DR7J 5CCLA 3CMQA 5A76A 3RR8A 2ZOFA 1FERA 1MU2A 4B9NA 4K4SA 2OTJS 2AT1B 2NXCA 2PMZD 3O3LA 3I87A 4S0MA 1DTTB 4I2QA 2MEWA 4TXSA 4CWBA 2OPPB 4X62F 2JEJA 1X0PA 4IRCA 2YQ0A 2V67A 1CC8A 3UVJB 2E44A 3DLKA 1BUXA 3MCOA 1Q53A 3WIVA 4OI6A 2D3OR 1FA0A 3DRPB 3GYNA 1FDBA 5HVFA 5KG7A 2KH9A 3EE3A 4CYUA 4CM0A 4LBHA 2HMIB 3FUYA 4O4RA 1XWLA 4DCOB 1FJ7A 3G6XA 2VZ9A 2IVFB 3WBZA 1JLFA 1RACB 1UWAA 2JHEA 2D7SA 1SUQB 1KS2A 1RAJA 2L3MA 3DN9A 4KH1B 4B17A 5KT3A 4LF9J 4OI3A 2CVEA 2DGTA 5J2PA 2AJ4A 5LOQA 4C11A 3MCNA 3P8BB 2MZTA 3M8WA 4M5JA 2VQFJ 3WC2A 3V2UC 4OL8A 3CC2S 1UFLA 4JBCA 3IR7B 5C2GA 1HI0P 4RUAA 4HDGA 2OPRA 4C97A 1RAOA 3W65A 1G3OA 2WW8A 2BKNA 3RB4A 4USUA 1RHMB 2IHR1 1HNWF 2CADA 1UVMA 3Q2SC 2W8LA 2YKNB 2DGXA 2J9EA 2IM1A 2W25A 1RT7A 3EVMA 3BS9A 4HLBA 4LF5J 5LSLA 2V2VA 2ASLA 4LFBF 1GX5A 2V68A 4F3OA 2HW3A 3MPWA 4HEA9 4ZPWR 3P49B 4ECWA 2M88A 4NMXA 2W9CA 3QLHA 1HQUA 1XK8A 3HFVA 1FNOA 1TTHB 4NI2A 3HHLC 1RSCA 2RAQA 4DU7A 2ZNZA 4J9RA 5E3AA 2EFNA 4TNOA 3ITHB 4B3SJ 3FQLA 3F73A 4QR0A 1M0SA 1CLFA 3QT7A 3H40A 4DS4A 5KT7A 2XNRA 2O01C 4RW9A 1OPIA 3Q8YA 4X4OA 1RAHB 2C2DA 3R1LA 1NMEB 1S1VB 3LGNA 4R5PA 5LMUF 4ECUA 1B7YB 5KFSA 1N0UA 2B4UA 3LAKA 1N5YA 2HNYB 2QMUB 5JXSA 2CPYA 2CJ9A 2BYCA 3TZXA 1WDTA 2VG5A 4A4JA 4DCPB 3MFIA 2BM1A 1PIEA 5T7LB 3C16A 5HO4A 2GGPB 4Q7AA 1MWYA 4U7UD 1HIYA 1GXLA 1RAAB 2H65B 2QE5A 3JSRA 4M95A 1FJGF 4M5IA 2CRLA 1IXKA 2GGPA 2NLWA 2CNOB 3M6WA 4LUBA 2VBXA 3Q83A 5KFLA 1S12A 1VBKA 2HS4A 2YH0A 1OYDA 3N01A 3PCOB 1RLDA 4P52A 2A10A 2H48B 2N7YA 2CNNB 4IDKB 5EUHA 3WHIA 5C7PA 4PKDB 3C6TA 4R8UB 1VIOA 3SV4A 3TI0A 2DR5A 2UVUA 4IR1A 2B9WA 2V34A 3QFHA 5ETRA 3C14B 1NSKL 3IS9A 3M9NB 2VFTA 1UA0A 1DARA 4YOEA 4JB8B 4KB7A 2ABYA 1MWZA 3D9BA 3D7SB 2ROEA 2XGPA 3HKZD 2HQIA 5THWA 4RBTA 3CCLS 2UV8G 2GO9A 4UF4A 1YJ9S 1NK6A 4WBFA 1S48A 3FBBA 2ROGA 3ENQA 4I1TA 4DPXA 4C2MA 4HI2A 3K59A 2R8GA 2DD8S 3OSPA 1RYRA 1TQLA 3PJ9A 1URRA 1FRHA 3MUMP 5A2QY 1D9FA 4C3LA 3MCMA 3I96A 1FD2A 3PR4A 4RW6A 1VK3A 3UCGA 2F4VJ 4JUZA 3MMBA 3TAMA 1X60A 3VF0B 4I2PA 4XDCA 3DDIA 2BUNA 2HFZA 1FO1A 2R7OA 4LQ9A 5ETTA 1SB6A 1WACA 2XEXA 3NOCA 1FX4A 1M5KC 3TWZA 5CABA 1R7IA 3SEOA 4H4MB 2DNMA 4DG1B 3VGVA 3R3TA 4DR2F 4K0KJ 3NMAA 2IYGA 2WOMA 4JOUA 1XBWA 2CQHA 1U0SA 2V4QA 2KVIA 4I0WA 5EHHA 4LT6A 4OX7A 2R42A 3D5MA 4MYUA 2QT7A 2R4FA 3DRYA 4RW4A 2Y8YA 1F9HA 2GJ2A 1R6VA 5KT5A 3M4XA 5DETA 2J0QD 2GJFA 1S9FA 4I7FA 5ETSA 1S6PB 1JMTA 1W7WA 5HQMA 3QSYB 3AD8C 2F9DA 1U1PA 1NPPA 3TEHB 2W4DA 4I2QB 3DRRA 2AKWB 3Q2TC 2RQCA 5KFBA 1N34F 4USTA 2L48A 1ZPWX 4DV4F 1Y3KA 2JLGA 1T3NA 1KOOA 2DO4A 5KOXA 3OR2B 4ZPBA 5IV3A 4J9LA 1BQNA 3WDOA 4P2FA 2VC0A 5KFYA 2F4VF 3DDKA 1JJCB 1HNXJ 2N4DA 1EKSA 1KONA 3TO8A 4DR6F 3P3DA 2R7XA 2RNEA 4NEZA 2KU7A 1YGYA 3TAQA 2NPIA 3LGHA 1FVQA 4P2SA 4CZCA 1RWPB 1FDDA 2HHHJ 4MK7A 2J6TA 4ZHRB 4PCQA 1C0UB 2GCFA 5ETOA 2MQQA 3UFCX 3VGUA 3I9V9 5GAGI 1TL1B 8AT1B 3CMAS 1KN6A 1IR2A 2X1BA 3D1QA 3FSXA 4DV3F 3VALA 1WSRA 4OIXA 4DV2F 2HQFA 1F3VA 3CDBA 2J7WA 1FXLA 1R8AA 2D9PA 4A8QA 1NJYA 2NYIA 2A6MA 1FESA 1FE0A 5ETLA 2JEGA 1G6BA 4PXEA 2C2MB 1FK9B 3GR1A 2MKIA 1PYOB 3QATA 5DGBA 3FSIA 2FVCA 2MZQA 3ZXWA 1RU2A 4FDFA 4IG0B 4DI6A 1WI8A 1QVGR 2XO6A 1QE1B 5GADU 2DPJA 2CG4A 3E01B 5IT9U 2VONA 1LWFB 3C6UA 1TL7A 1UW4A 4ED1A 5IT9Y 4ANDA 3O6QA 4E0DA 3NS6A 4U96A 2RE1A 4ZVSB 1CJKA 3SV3A 2OH2A 3M8PA 1VRQC 3MGJA 1F2GA 1H98A 1VK8A 1RU1A 4FXDA 2KM8B 3MEDA 1GH8A 3LUYA 3N6NA 5GVQA 3GB0A 4CLYA 3HLUA 2XSJB 4C6AA 4CO3A 1IVZA 2E1AA 3DDNA 3QRRA 1OY6A 2IMOA 2CQGA 2O3DA 2YWGA 3KFWX 3LW5C 3SQGA 2FJAB 3QJPA 4DR4J 1YJUA 3UDCA 1CC7A 1JLCB 2DH8A 3TVKA 3HX9A 2UUCJ 1JLEB 4Z2XA 3DYAB 2DNHA 3P96A 1TR0A 2ZOMA 3HZEA 4LFBJ 4LFAJ 1DTQB 5HK4A 2RSQA 2YWFA 1M5OC 4J90A 4OI0A 4G3IA 3T1YF 3LP1B 3QGGA 4IOBA 4KKOA 2VA2A 2OEKA 5K14A 2CAJA 3KK1B 3T5KA 2BZ2A 4CLPA 2CJYB 1CJUA 3BPSP 3ISNC 3M9MB 4GKJF 2QYCA 2DCLA 3SSSA 3SSQA 4MK8A 4WFBQ 1S59A 1Q5YA 4KTQA 1T9VA 1X4FA 1SKWA 4HVZA 2IDLA 3V4IA 1UVJA 2YNIA 1RWOB 3B82A 4IFVB 4B9LA 1R3NA 4UOCA 1N8RT 2UVRA 1QJHA 3ZTSA 3C19A 3RRGA 4DV5F 3KLGA 3LPYA 5D0EA 1OQ3A 4DZDA 5FDLB 2MXYA 4UUXA 2KXHA 2CFXA 3JQMA 1FXDA 2IM3A 3PG9A 3PEHA 3FEYB 5KG1A 1YQHA 3QO9A 4P7VA 2H3EB 1RTHB 1HWLA 3BYRA 2VKZG 2YY3A 2ZBCA 4DPYA 2ATCB 2QL7B 4NLVA 5CYQA 4ZP7A 3W5YA 1FRJA 4KV8A 2GHPA 4NASA 3SDEB 4CLTA 4CLUA 3TZZA 3IC1A 4O0IA 3CCQS 4G1PA 3SCKE 2ASJA 3M2UB 2FDNA 4X62J 1EARA 1C4AA 4UOHA 1REVA 3J7YI 2LECA 1EHWA 4OZLA 5D3GB 3BR8A 5IC4B 6FDRA 1F5CA 1SH3A 4X4TA 1FEHA 3D0GE 4DL6A 1CJTA 4F2RA 2Z0GA 2BABA 3G82A 4K5SA 2R7RA 4HR2A 4H4OA 3GIJA 1WD6A 4LF7F 3V4MA 1S1TB 3MEGA 1K1SA 3OXFA 4MAKA 2WSCC 1HMVA 4LFCJ 3ZNJ1 4DLGA 3D6TB 5KFGA 2HHVA 1U25A 2R3VA 2RHQB 2HQ3A 4BWJA 1S6OA 2BW7A 4A8OA 2FTRA 1NSPA 4HHUA 4NLTA 4NZ7A 4AXIA 3LP0A 3PACA 2GAGC 3AQOA 4KO0B 4IRKA 1VJQA 2PA3A 3ZTOA 4ILLA 5L1IA 4KGZB 3CWJA 1HBOB 4I56A 5G0RB 3THPA 2IA0A 2HAIA 3M9OB 4GC6A 2E9TA 1NAQA 3GJTB 3UCUP 4NLSA 3Q8PB 5CD4A 1HNWJ 1HMVB 2LQBA 2YNFA 4KHMA 3JAMY 3SCLE 4P6QA 3KJFB 1XMOF 1T95A 1U0HB 1OQ6A 3UWTA 1LQ9A 5DRKA 1JLQA 2GQQA 5L1JA 1FNMA 3OFFA 4JI6J 3A8EA 2JC0A 3GFYA 1SL0A 5B0AA 3VAMA 2QV6A 2YBVA 5M2RA 3MR5A 1UCNA 1H73A 4CT8A 3M2UA 3OXLA 1HPZA 4C3MA 3ZNUA 3L95X 2ACYA 3DCAA 3SSRA 3KHHA 1OO0B 3SDEA 4AE5A 1PCAA 5AXMA 2R8KA 1JQGA 3LP2B 1RTJB 4X66J 5KG5A 1HQ2A 4ES2A 2B8QA 2UU9J 4ENOA 3NCRA 2J6SA 1C1BA 3QSIA 3DRSA 2BANB 3KG4A 5HJXA 1T9XA 2BXJA 2CPDA 3AY0A 4TY8B 1N34J 2LXFA 2ZZTA 3RAMA 1HLWA 5CYMB 2BQRA 3NS7B 5BJRA 1FCAA 2YNIB 4IFVA 4X84A 3PXGa 4CO4A 3H7HB 5A8KA 3C15A 1OIAA 2KG0A 3KOAA 1Q79A 3H5SA 4ZK7M 5D6GA 3GLJA 4FVCA 1UEVA 4GMKA 2C22A 4LQ3A 1FRIA 3AB4B 1SJ3P 2FYXA 1C0TA 5B0CA 1G4CA 1GMWD 3I82A 3AA8A 2OSRA 2V94A 3CTRA 1QUVA 1RTDB 4CH0S 1OSCA 1RWXB 2FZGB 4DX7A 3HDSA 3CJ2A 3VWSA 3PJWA 4PAAA 1NK9A 2CQPA 1WOOA 3JTNA 1Q0NA 1NB7A 2PMHA 1ZA1B 5A8WB 4QIGA 1XJWB 3CJKA 3SCJE 1H0HB 2V50A 2YNHB 5ETQA 2DO0A 2V9WA 2ZHBA 2HVZA 4YP3A 2KRRA 4C8YA 2G2ZA 4DBQA 3HFZB 1ZM2A 2PFDA 2FC8A 2ZM6J 3HJVA 3W1YC 3HO1A 1PC4A 4PXBA 3MM8A 4USJC 1CSJA 1RWNB 2IFXA 3DMJA 1AB8A 4Y2MA 5IQQA 4F4YA 3TUZC 1P9QC 4JI8J 2Z4PA 1NK4A 2ASYA 3ILJA 2VICA 1WC1A 1S72S 5ETPA 5FLXU 4DSKA 1SC4B 5GAGU 2M2BA 3IWLA 1VQKS 1RKJA 5E41A 2OO4A 2YWWA 4KH0B 4ATNA 1RQ0A 2XHWA 4ZITA 4RNOA 3IN5A 4RBVA 3C6UB 1O5JA 3CJTA 3MM5B 4JI1F 3E01A 2ERRA 1QAYA 4IOCQ 1C0TB 3TZWA 2J0WA 1RAGB 2CPXA 1BMQB 4RZRA 1VC6A 1TKTB 4IFYB 2FHJA 3ISND 3GV8B 2AQ4A 2DRDA 4L75A 3BPDA 2FHOB 5EWFA 4UTGA 3GZ7A 4WF9Q 2XHCA 3N0VA 4N47A 1HKAA 2XNQA 4NL5A 3ZZZA 4F4XA 2AGQA 4B3MF 2Y1LB 1RGVA 3H98A 4OYWA 4RUHA 4TY8A 4A8YA 2PA8D 1FEEA 1YRXA 2GA7A 2ZITA 4ELTA 3K2YA 2XS7A 4YQWA 3G4SS 1K47A 1I6JA 1FFGB 2CQ1A 4OJ3A 3SBMA 1N36F 1Y5IB 3MURP 2XY5A 1FRMA 1RT1B 2HHQA 4ZHRA 4QU7A 3CIZA 3QGIA 1K44A 3NGUA 2DNZA 2DR8A 4V19X 5DZ6A 3SIPB 4YR3A 4OYOA 1HPZB 4ZVGA 4WE1A 4AD6A 2DGQA 1OWXA 3DGPB 1BY9A 4IQMA 3J80U 2WBMA 1BC6A 1F9FA 5D0GA 1FWPA 3MM6A 1L3KA 1WG4A 3OR2A 1Y7PA 2BVZA 4HHHA 4TKTA 3RYLA 1XERA 1S0NA 4V19J 1R6YA 1U47A 4U7UK 1S9EA 2KJWA 2RJZA 4TYAA 3GFHA 3GYGA 3FJ2A 2MGZB 1HNZF 1GT8A 2F63A 1VRTB 4K4ZA 4QWCA 2BA9A 4MFBA 2NXUA 1A7GE 4LF5F 2EBEA 1WF1A 1NDPA 3FSYA 5CCMA 2NPFA 2VQEJ 1NHVA 1V3ZA 1ELOA 2CZ9A 2W2QP 1ZH5A 2WVCA 3T1AA 4EO8A 3IRWP 2ZNYA 4DV1J 2ZDPA 2BE2B 2JVOA 1B0VA 3PYGA 1YVFA 4Z37A 2CZVC 4LBIA 4DV2J 4MIAA 1T7PA 1XNRJ 3JSBA 2VODA 1CJVB 2E5JA 3BH7B 4N77A 1UEKA 2KFYA 2GNKA 1KHWA 2HBZB 4HH1A 4LF7J 4YB5A 3TA2A 1KTQA 4NLRA 5HP1B 1RT5A 3PJXA 4M5GA 2VG6A 4DR7F 1V3RA 1DURA 1P1TA 2IIHA 5ETNA 3T1HJ 2DR7A 3QRPA 4LF6F 1DHMA 1UWBB 3DOKA 3H59A 3M32B 5J2MA 5B0EA 2DR9A 4LFCF 1NCLA 2HS3A 3GPAA 3D6HB 2FY1A 3KDOA 3NGSA 1WORA 2KHCA 4ZVUB 1J5OB 5CA5A 2XSFA 1REVB 4M8LA 1U7LA 3MR7A 2U2FA 2F65A 1RXOB 4RKUC 4DV0F 2KT5A 2OSQA 2XWXA 2EXUA 4PG7A 4LRBA 2J9CA 4OJ1A 2KFZA 4HL9A 2HKEA 1DBDA 3QAEA 2HQCA 2VFSA 1HHQA 2BW2A 4AQYJ 5BR8J 4GRSA 1C1CB 2A6OA 2DGVA 2XZDB 2RD5C 3MM7A 2RU3A 3MMCB 1DRZA 4DQPA 1GX6A 1JNRB 4ZP8A 2OGUA 2LQ8A 2EG1A 2YH1A 3O2IA 3BREA 3K17A 1MMLA 2LQ5A 4ZCMA 3JSYA 2JH3A 1TKZA 3US5A 1WHWA 2PE8A 2E7XA 4TLQA 1VQLS 1N5VA 2CXEA 2OKQA 2B9XA 2E9ZA 4AL5A 4JI2J 3SQOP 4UT4A 5IM0A 3CJ8A 1H6KX 2JC1A 3HF5A 4JI5F 4WKYA 3M05A 2Z57B 3G96A 2B9YA 1RT6A 3LPEA 3GQCA 4GKJJ 1MNEA 4EFAC 2QFIA 3FGVA 2W4CA 3OFHA 1Q4RA 4FPRA 4WTOB 3M7VA 3C16B 2KZMA 3CDEA 2EK6A 3AXKA 4F4AA 2NZCA 3L7PA 4AFFA 2QTWA 4I64A 3GWCA 3I0SA 4ETXA 2ZJQQ 2XI3A 3KK3B 2DK2A 3KLHB 3OTCA 1B0TA 1NEEA 1KBRA 4K59A 1M90T 3V6HA 1V3SA 1F5BA 1HWKA 4C98A 1NH7A 2PEBA 3PYEA 1WJ9A 5F0UA 1FT8A 2OUGA 3RW6A 4OI4A 3OJUA 2XM3A 3ENVA 4TQSA 4OZ1A 2RU9A 4N41A 2W9CB 2LDIA 3I9ZA 4Q44A 1RYSA 4HKQA 3E3XA 4QQBA 4H4KA 2MQOA 2WVEA 3HMJG 3GSIA 4XAKA 3LWMA 5CHCB 3CCSS 1XQIA 3N6MA 4F26A 1W26A 3MD1A 5EN1A 1JB0C 2F4FA 3U7JA 2AJ1A 5LMUJ 2KT2A 4FP9A 4NCBA 4FYDA 1KQSR 3HZGA 4ECRA 1IR0A 2Y1IA 1Q86T 3N28A 3R6GB 4HHJA 2ZZMA 2EFPA 2ZWPA 4X4QA 3ZZYA 4Y0FA 4WXWA 4DUZF 3JTPA 3JYTB 3TNVA 1CQMA 2Z58B 4QZVB 1HBUA 3UR0A 2CPEA 1WHVA 3H90A 4OZNA 2NR0A 5D15A 5DG8A 4K4UA 1TVRB 4LVNP 4ZPAA 1RWMB 3DU6A 4UZCA 3D3CJ 5L9XA 3MPDA 2XBPA 2EFVA 3D28A 3UE2A 3WX4A 1N6QA 2VA3A 2VOPA 3DLEB 4F0KA 1TKXA 1KFSA 4F36A 5LSRA 2F1FA 2H5IB 1NK7A 2DIVA 3MEKA 4BC9A 5AT1B 5C42A 1Z2LA 4YDXA 3GV5B 4DX8H 5A0YB 5B0FA 5L9NA 4JI6F 2C3PA 2VPXB 4LRDA 4K2JA 1UPMB 4A8FA 4ALZA 3UNYA 4CNZA 3QZ7A 3MPUB 2RQKA 2HZAA 2FLNA 3ZZRA 2KI2A 1S76D 3LALA 1X5TA 5I3UA 1WC3A 2KB2A 3TYTA 5C25A 1JK9B 2AYMA 3POTA 2WB1D 2RHSB 3BN4A 1X4AA 2JWNA 3MR2A 4URGA 4QOTA 3W61A 2Q6BA 3K0JA 2AX1A 4XTTA 2IBKA 2LP4A 4WP9A 2E9RX 2XB2D 3HPOA 4B08A 2MY8A 3IO1A 1H2TZ 1TKDA 4QYZJ 2ROPA 1DAXA 3NLCA 2RUGA 5A6WA 2PFFB 3RB0A 3UDEA 2BMBA 1TKXB 2MPUA 4NA1A 1YRTA 1VQ4S 3PTWA 4NLGA 1SV5B 4N8NA 4FS1A 2M7SA 5KFRA 2WOMB 3N4WA 4LBPA 1LXJA 1ULRA 4K4XA 3NXZA 3OFGA 2XYGB 1AT1B 3CJSA 1M1GA 4DPOA 4F7VA 1IBMJ 3FBEA 4OYPA 1UP1A 5J2MB 3P45B 1NZ8A 2VUGA 4WXOA 1WOPA 2R2UA 2DXFA 1ACMB 1S0MA 4RW6B 4ED8A 3TW0A 1VLYA 1YIJS 2R7QA 1AFIA 4YR0A 4KGKA 1S77D 5KFVA 4K4VA 1Q5VA 2HQDA 1SL2A 3MCSA 5HMWA 2LEBA 1U02A 4N7TA 2PIIA 4NA3A 4YB7A 5D4OA 5GMEA 5K8MA 3CCRS 4ZVRB 5KFIA 2OJ3A 3M8QB 3K5OA 1WOSA 2D3ZA 4L74A 1NJZA 2NS1B 2VIHA 5BYSA 4LF8J 5GAEU 4NZ6A 3CDUA 3DXBA 3W63A 2DHXA 2ZH4A 2HBYB 2A1BA 2XMUA 2HK3A 2NUUG 1S0OA 1PAEX 1N4LA 3CPWR 2QLXA 1BQMA 3C8YA 2XMTA 5U47A 2E5LJ 3D1OA 4FYWB 4R8UA 5IOLA 4O3RA 1JLBB 2QLJB 3ET6A 2DH9A 1RT2A 4P9SA 4CO2A 1JXVA 5HJYA 4RNMA 1VBZA 1PBUA 4R0JA 2YKQA 2KHDA 3SXLA 3QYYA 4GO5X 4NXMF 3R1HA 1J27A 3TP2A 3PIOQ 2AJQA 2BQ3A 4X4VA 3B6BA 2BJ8A 2P9GA 4C8MA 3RW7A 1XR7A 5KT4A 1EJ7L 2NXJA 3G87A 4AQYF 1JXLA 1WTBA 4NLUA 2AD9A 3GCXP 2MKHA 4OLPA 1RT6B 2BJEA 2C3MA 2W7AA 2AJ0A 1QAIA 3CDAA 5AXLA 3G71S 5IM0B 3KKFA 3ETOA 1YJRA 2JJ4D 1JLBA 2GQ2A 3ET6B 1KTVA 3IR5B 4PABA 3W8GA 4HTIA 3W64A 3MD3A 2NZ4A 3SI8A 1S1WA 4WYWA 2N4CA 3CDWA 3BKFA 1KC8T 1S57A 3UN2A 2UXBF 1G2EA 3V81B 4ZP9A 2B6AA 4JI0F 3IAM9 1TL3B 2QJ3A 3AB2B 3H4BA 1Q7YT 2H4WB 2XMKA 4PEOA 2A2CA 3MUVP 2Q66A 4UOFA 5HROA 5FJ4A 1UTAA 2VU5A 3OUYB 3U1NA 1H7WA 1XR5A 4J9QA 2R7UA 1SKRA 3R27A 1D8ZA 2CPJA 2Y3YA 3ISZA 4TY9A 2A2DA 2IJFA 1MMDA 5KFJA 2ZH1A 3RB3A 2E5IA 3H20A 2X7IA 2IA6A 1UPPA 2BEFA 2RB7A 4DR4F 1YK9A 2R2RA 3W3SA 1J5OA 1LWXA 2HFOA 3BV8A 4USHA 3RUBL 2IY5B 2CJQA 4OMFG 1VBXA 3DLGB 2JLEA 4KY3A 2FLPA 1RT4B 2OPRB 1K0VA 3DOKB 1VHIA 1TK0A 1DQ8A 2KXFA 3EICA 3EVOA 3TUPA 2CWKA 3E51A 5HP1A 3CD5A 3HP6A 1XNRF 3KXDA 4IUFA 4Y28C 4DV4J 3R2CJ 1SV5A 2IRYA 3BH6B 2GVZB 1CJVA 2X51A 1Y9OA 1SUQA 4FYYB 1X5SA 4WK3A 2JDJA 1F1BB 3DOLB 4DPUA 5JJBA 1PJ6A 3DKDA 3CCVS 2YNGA 1NSAA 4K4YA 3EGZA 1VFJA 3LQVA 4ILRA 4NLOA 1LWCA 1VJWA 2RDIA 3OT9A 4KHRA 4F4ZA 2APOA 3KLIA 2ZOGA 4USIA 2HAFA 4JI4J 4BDPA 1IKYB 2HLUA 5E5NA 3FQKA 3POTB 5JUMA 2VPYB 3QMQA 3QQCD 3I56S 5C25B 3GIMA 5KFWA 4DV5J 4RW7B 4OX9J 1YJWS 1E6YB 1Q8BA 3CB4A 4ZOSA 4MH8A 1DTTA 1E6YA 2R8JA 2MGZA 2P6SA 3KMSA 3VHQA 4ZVQB 2CQ0A 4O4GB 3ZZOA 1IKYA 3VQSA 2DGUA 3MM6B 2UV8A 2W8KA 1QSSA 4B9MA 1IM6A 1F60B 2RRNA 2W1BA 1LWCB 1S9GA 3DGPA 2CQBA 3GE9A 1MN9A 2HVEA 1IKWA 3G86A 3MM9A 3QNWB 5KFPA 1DY3A 3NWRA 3K5NA 3V6DB 1U1NA 2AYBA 1T11A 3DOLA 1EKRA 5J2NB 2HRTA 2MQLA 1J5EF 3SYZA 1FDNA 3W2VA 2GVZA 4PPZA 4ANCA 1FTRA 1AZSA 1ZAWA 1RBLA 3PM9A 4XPCA 5KG2A 4F4WA 1SJ4P 1RADB 4RLEA 4CH1A 3MHYA 2HIYA 1CS4B 1X5OA 3OHAA 3I4PA 2UUAF 1NJXA 3TANA 3O1LA 3RZAA 2OHDA 4DPWA 1NPKA 5KFNA 2HLTA 2CZ4A 4X4PA 2B3TB 1RLCL 1FX2A 4EO6A 4YMEA 4RNNA 3HFKA 3MFHA 1HI8A 3K5PA 4Y34A 1YJ7A 1LW2A 1Y00A 4Y00A 4Q5VA 3I5CA 2MLZA 1HBMB 3QWUA 4JV1A 2H5EA 1NM2A 2J5AA 4OI1A 3A8KA 2BV3A 4ID5B 3PIPQ 4IH7A 3T5LA 2DRBA 4DQRA 3T5HA 1X8DA 4AL6A 2CJXB 2IAJB 3RG6A 3A8IA 5DJBA 4DR1F 3AT1B 1U1QA 1XC9A 1RISA 1TU0B 3WX8A 5KAKA 3L9ZA 2ZH3A 1NKCA 4RJVA 3NL0A 1PKUA 3ELHA 1NPRA 1LWEA 2XYPB 4M63A 2P9EA 5H9FK 1TELA 3JQKA 4EYHB 4JYAF 2KTQA 2U1AA 1TL3A 2RQMA 4CO5A 4HTJA 4B02A 1KRPA 2YWEA 4OJHA 1VQYA 3TUIC 2KN4A 1UFWA 3NGTA 4B9SA 4UZBA 1RUSA 4KHPF 4EBDA 2RF2B 3JTOA 4QIEA 4DPTA 3PKMA 3QT8A 1URNA 2J7KA 3LO3A 1KLMB 3MOZA 2E1RA 4R25A 3VGSA 3R7NB 1RTIA 2BM0A 4W4MA 2YWKA 4B9TA 4PUOA 3Q22A 1WKKA 1Y11A 2I5JA 4QWBA 1KQKA 3UQSA 4WFAQ 2DNRA 3CXCR 2ZH6A 2HZCA 1XN9A 4OHXA 5BYQA 3HVTB 2VFVA 4CT9A 1RAIB 3L3CA 3CCES 4ED4A 5KFDA 2V2QA 1FKOA 4NXNJ 2QSFA 3Q89A 1PAUB 2HGMA 3PX4A 4QYZK 4YB6A 1RHKB 2G1DA 5MAOA 4K4TA 4KGXB 1HI1A 2DH7A 4OHZA 3H2VE 3S8SA 3C3LA 2UXCF 2HNZB 3C15B 5L39A 5J2QA 3GSDA 3TRGA 1S1XA 5K9FA 2CKWA 1U48A 1YBUA 3NNHA 2HFVA 3K58A 2V69A 2WZ1A 3HSGA 4LSLB 1RA7A 4CLFA 3CCWA 1SQGA 3PW0A 3NOGA 1C1BB 3KLEA 4ZKAA 3PV8A 2VV5A 3SCIE 1U1LA 2IRXA 2AHOB 3M2RA 4DJBA 3KYLA 2CNLB 2VDHA 3F0NA 3Q8UA 1IUJA 4O44B 4OV6A 3TX8A 5K8OA 2K06A 1QTMA 4ICLA 2ILYA 4U8YA 5J1EB 1N33J 4C7QA 4BS2A 3OHBA 1HNXF 5D0RA 4F3QA 4NLQA 5IT0A 2E5HA 3B4MA 4WP3A 4YB1P 2IJRA 1EQMA 1RWUA 3BBFA 3KNGA 1L5UA 2BOAA 5CQGA 3IFEA 4ZVHA 2CPZA 2MJUA 3M6UA 2O66A 3GG1A 4ZJLA 5GMKa 3M32A 4ED0A 4E8UA 4CP5A 1GK8A 4QR1A 2AMCB 1T9TA 2W2PP 4TU8A 2FLOA 2YNFB 4PXDA 1RT5B 1K1QA 2IDEA 2PN6A 4L76A 4MKAA 7AT1B 4ECTA 4DFMA 1XMOJ 3TJ9A 2ZKTA 1B70B 1SBRA 3ILLA 4WWSA 2HIQA 2AZ1A 2DHGA 2DISA 3BKTA 4RX6A 4WJBA 5G0RA 3RBZA 4A47A 1U1KA 1X4BA 4PQUB 2AGPA 1HD0A 1KHVA 4X4UA 2YPZA 2CPIA 1FRLA 2G9OA 1FKPA 1HYSB 3KJNB 3LP0B 5AE3A 1KVJA 2PC6A 4UY85 2WRMA 3UNGC 4P71A 3EZUA 1M5PC 2JEFA 1NJIT 1NZAA 3GYXB 2FJEB 5KT2A 2J9DA 2V0NA 1PJ7A 3T5JA 2GHWA 4MFBB 1TMMA 2MKSA 2HFUA 3DGVA 3QT5A 2WCXA 1PJ5A 1SQFA 2KL8A 2PMWA 1S1TA 2YPYA 3BGRB 1R8PA 1Q8IA 1WI6A 3NRBA 4J37A 4ZJOA 4ZLJA 2MQPA 3EPGA 1H3DA 2QFJA 4DS5A 2XMVA 4QW8A 1CJTB 3HVAA 1NSQA 2XULA 4DQIA 1S49A 2DJWA 3HT0A 2GQCA 5A0YA 1D09B 2GJIA 3T6JA 3TX0A 4YDDB 1S7IA 3TARA 1RHQB 1SVDA 5D3GA 4WE1B 2UXDF 1SIWB 4RBUA 2ZH9A 3OXGA 4KJIA 1T03B 1VQ5S 1GAOA 3T41A 2BRKA 4DN0A 5DDQC 5J1EA 4Q8FA 1XNQF 5CYQB 3KLVA 2JZ5A 4NYOA 3M6XA 5EX0A 4JI4F 1R0BG 2XY6A 1RT1A 1FE4A 3M2RB 3OLAA 4B3MJ 1TVRA 4OZ5A 4RUCA 1D9DA 2R7SA 4XDDA 3VAFA 3BGLA 4FXVA 4EU0A 3I31A 1LK5A 5HLFB 3LA0A 4ID8A 2V2ZA 3AODA 4TU9A 2XGQA 1JX4A 2FVPA 2JVRA 3C66A 3JYTA 3GMGA 4QPXA 1KVKA 3Q8RB 3OL8A 2WTFA 4PWWA 1X4DA 5KOWA 4XPEA 4WYLA 5J2QB 2J6UA 2MB0B 1VQ6S 4Q8EA 2HNZA 3R5AA 4ZPDA 3OSNA 2ZM6F 4X2BA 4RL1A 4K50A 1UVKA 1MROA 2V9KA 2VG7A 2AU0A 1H2UX 1TKTA 1B64A 3VAGA 3OPKA 2QC3A 5G4DA 3UR3C 2FJBB 3NG8A 2VFRA 2AZ3A 5HAOA 2ALYB 4ZVOB 3Q0AA 4C8OA 2GIFA 4OZJA 2D3UA 1NKBA 2HHHF 2LVWA 2MHEA 1KLMA 2RMLA 4HI1A 2AWZA 4I68A 3H25A 2OTLS 4N8OA 1CEZA 3DMJB 3IBFB 5K5MA 3HCXA 4ZCLA 2YQ3A 2QLBB 5T41A 2KZZA 4WZMA 2P6TA 1JLCA 1WC4A 3VQTA 1GMUA 2PEHA 2RF2A 3BDEA 1IQZA 1S99A 3H0PA 5CD4H 3KLHA 4Q0BB 3KK3A 4KC5A 5KTQA 3VAKA 1J2VA 2DYAA 2QA4S 3RB6A 3TR5A 3J81j 3GILA 1HNIB 2GV1A 4J9SA 1UVLA 5H1SV 5LMNF 3HHLA 1WNEA 5E3QA 4IG3A 2JEIA 3DLJA 2HPUA 5F8LA 3AJ2A 3Q8SB 2ILZA 1LWFA 2Z30B 4R0EA 1RTDA 1EIYB 3QAUA 1NHKL 3UI3A 2EFQA 3GV7B 1NXIA 3KUGA 3EYZA 3IRXB 3LAMA 1N48A 4GVBA 2ZH8A 3PR5B 2VG7B 4Q43A 4DL0C 4ZN1A 2KT3A 3TUJC 1T9WA 2DKOB 3FNNA 1U8WA 1T02A 2OLWA 3CCZA 5KG3A 4QWEA 2XWYA 1WDDA 2Y1JA 4M5MA 1TUGB 1T8EA 3CJ5A 1YZ6A 2IJNA 3IWXA 5HVHA 3MM7B 2N82B 1WHXA 2FVRA 2MLYA 3KLFA 1C1CA 1VISA 2HK2A 3I5BA 2K1RB 4ZCIA 2H54B 3AH6A 2AEMA 2PO4A 1IWGA 3MPYA 4LF9F 4JV5F 3D4JA 2P9CA 4OX8A 3OL7A 1UVIA 4G1IA 4AL7A 3K5MA 2E29A 4MIWA 2RKIB 3OV7A 4I6YA 3W60A 4DL4A 1R0AA 2OPQB 2BRLA 2M4MA 3LP2A 4UQTA 1C2PA 3W62A 3MMAA 4FKYA 2DNGA 4NOHA 4X64F 2QMXA 1HR0J 4FYXB 4B3TF 1K0TA 3PW7A 4NPOA 1MN7A 3NGKA 3DRXA 1IKWB 2ZHOA 3NP5A 4OHWA 2ZH7A 3QJJA 1S9GB 2M0GB 3D54A 2R2SA 1E6VA 5KFOA 2MSTA 4ECZA 1N54B 4MKYA 1BHNA 4X4SA 2G13A 2MQNA 3BGRA 3EGVA 1M1KT 4DWIA 2LMIA 4ZVPB 4D3GA 3IM8A 5LSOA 5LT5A 4ANEA 4KYZA 3VTIA 1WTFA 5ITHA 3PX6A 2QO3A 1B3TA 3QRQA 5C24A 4WZQA 1SC3B 4WTYA 3I4HX 3HSZA 1U8SA 4HH0A 1N33F 1GFWB 1Q7LB 4OYAA 3UD3P 3A12A 3MECA 2YNGB 4X4NA 3CD6S 4KO0A 2M8DB 2BE2A 1VQSA 4O3SA 1VQOS 3MECB 3U1MA 2Y1RI 3GTYX 2VKRA 5FD1A 1L3SA 3B78A 4WIIA 3PO5A 1QM9A 3BQ0A 1PGZA 3NMRA 4PQUA 4IH6A 1XMQJ 1WHYA 2D41A 4CO1A 1G7CB 4DUZJ 4M5LA 3BGFA 2JLFA 2PDAA 5CAAA 2R8IA 2VPWB 4YR2A 4NEYA 2F3JA 3QIPB 4QWDA 4DG1A 4WFNQ 3K57A 3CD7A 4A8KA 2ZJRQ 1M5HA 1DFDA 5F8IA 3CC7S 3MEGB 2L9DA 3EVWA 4RUBA 4WFZA 3DLHA 2F8EX 1MLAA 3QJLA 2G0JA 2FC9A 2GIQA 3KG0A 1UAWA 5IXUA 3TAMB 1TV6B 3THVA 4PG6A 5AXNA 4F04B 4OI2A 3S6EA 7FD1A 4A48A 3EX7B 2FVSA 1HARA 2UU9F 1UVNA 5MLCV 1JJ2R 2VPZB 1F3FA 1S79A 2B4PA 4KGMA 2PT0A 3A4TA 3MMAB 3NY0A 2UUTA 1RB0A 1PSDA 3A3OB 1TP7A 4ICLB 4P74A 3J81U 4F50A 2B8PA 4Y3CA 2VDIA 1M5SA 3E2EA 3A3NB 5DG9A 2AP6A 1N32F 1T05A 1QAJA 3OUYA 4YY3J 3CJRA 4LRAA 3R7SB 4LSLA 3KLFB 2LXUA 2WONA 2LLZA 3AAWB 4JI1J 3V81A 5E3RA 2J7UA 1ZPVA 1AUDA 2FD2A 2B5JB 5KFUA 4KPCA 4J9VA 1MSWD 1JWWA 4W98A 2DNOA 4ZIVA 1S1WB 2ZDOA 2ZBIA 4IFYA 2DEJA 2ZEJA 5I4MA 3Q23A 3DC2A 4C3KA 1DZ5A 4CLWA 4DUYF 2DR6A 4NXNF 1FDAA 1YSJA 3R97A 2X1FA 4TYBA 2VBZA 5K14B 3DU5A 2EK1A 4MK9A 2L08A 1U1MA 3FCVA 4JI7F 1RT3B 3J7YU 1Q8KA 4KT0C 5K20B 2HWHA 3G8SA 4ECSA 5T7LA 1RTIB 4PUOB 5IV4A 2CQ2A 2EKNA 1SCJB 1JXEA 1WC5A 1KQFB 2XY7A 1JLEA 2XLIA 3MM8B 5A2QU 5K8NA 1BQMB 2IYIA 3QWPA 4XK8C 4ZLNA 3X3UA 2ADCA 4LF4J 1ITPA 4RW8A 4F4KA 5EDWA 5AXKA 4CIOA 4A8WA 4K7QA 5IC6B 3BBCA 2XI2A 3N79A 1P9YA 2HHUA 4X65F 1VQMS 2XSJA 2YNHA 4UOGA 4NX9A 4ZA1A 2HSEB 2B0GA 2FGCA 3SFUA 5LJ5Y 1HNZJ 3X1LB 5KFQA 1NKEA 3BEGB 1HQUB 2QG9B 3BM7A 3M8PB 1VGYA 3M8QA 3CC4S 1WEXA 4ZIWA 2V8VA 5E0OA 1TAQA
chains in the Genus database with same CATH topology
4UQGA 1NRKA 2XC9A 3GFXA 3QIDA 1S7HA 3PW2A 4NRTA 2Y0SD 4WK1A 4WU3A 4NZ0A 1NH8A 3MMJA 5F8JA 1A6LA 2HHPA 2FJDB 1R8BA 2DT9A 3RBEA 1D3WA 5KFZA 4TLRA 3D2WA 2R9LA 2L9WA 1AFJA 2DRAA 1AXQA 1Z1ZA 4B9UA 4J9KA 4JI5F 5KG6A 2LKZA 5B0BA 1JJHA 2E66A 4Y2AA 5B08A 2NUHA 4Q2MA 3W2VB 1X4HA 1FVSA 2AGOA 3TOQA 1JLFB 1JIHA 4DLEA 2Q43A 2ATLA 2V5HG 4U7CA 2CJBA 5IT4A 2OD4A 3ZZPA 2YKAA 1U49A 4PG5A 3UD4P 2VASA 4JV2A 2X3GA 4O4GA 3LWLA 4ELUA 4F2SA 5EX3A 3PKMA 1U2FA 2OPSB 1WG1A 3BO2A 1ZZFA 3KLEB 2I9SA 4DN9A 1IBMF 1N5TA 1U1RA 3FEXB 3CF5Q 4WFYA 4C8NA 1CVJA 3QGHA 1D0EA 1FJCA 3BSNA 1APSA 1RA6A 1MU2B 2UXBF 5DQIA 2ZVSA 4NLYA 3CCMS 3AHPA 5KFCA 1FKPB 2KXNB 3BGUA 1HYSA 4J9NA 2N3LA 3BDPA 2DGOA 1HFEL 4J9MA 1V6HA 4M1KA 2JRSA 4JI2F 2XS2A 1UMJA 1O0PA 2KRBA 4OV1A 2JL9A 1N6QB 4PWDA 5CZVA 4YEAA 2OMLA 5KFHA 2J0XA 1N88A 2FB0A 2ZH2A 1GXUA 4FF3A 3OL6A 3M6VA 3THTA 1CG2A 1LK7A 4O23A 2KKHA 3T9NA 4C8KA 5F9LA 5F3ZA 3BO3A 5B0GA 2E5GA 3PDNA 2NSBA 2QA1A 3FEZA 4AYBD 4MKBA 3C2PA 2MKCA 4K4WA 4KV8B 1NJWA 5KFEA 1XMQF 3OR1A 1OPZA 1Z2ZA 3B4DA 3T6BA 5DM6Q 3QO9B 1IBKF 1R31A 2FJWA 3UW1A 4FNIA 4C0BA 3Q24A 4DV1F 2W7OA 1S1UB 1KVIA 4RU2A 4ED5A 2W4PA 1MMNA 5L38A 4DFKA 2Z2MA 3I0RA 2B6AB 3F44A 5KFXA 5HN0A 1BQXA 2J8AA 4KE5A 3O5TB 1S1XB 4H54A 5ADZA 1VI7A 3RBDA 3BQ1A 1L3TA 2HG4A 1QAXA 5CYJA 1IBLF 1NK5A 1OS5A 2AX0A 3DM2A 1JJ4A 5KG0A 4EWTA 3F41A 5IS2A 4FF2A 2DHAA 3P6YC 1FKOB 1S6UA 1Y0HA 2FHMA 4M5DB 3KK1A 3T3FA 4FBTA 3HVTA 3LH2S 4FBUA 2CQ4A 2LYVA 2YKMA 1FRKA 2KO1A 2E7WA 4L3NA 4F67A 3JSMA 3HHNB 4RNFA 2VG5B 3MWBA 1Y3JA 3KWMA 3KK2A 5B0DA 3EZ5A 4KR0B 2HNYA 1Q78A 4WU2A 4XIUA 1DQAA 2MKJA 4Y65A 1H38A 4K0KF 3GG0A 3UDLA 4OX6A 4J9OA 2VD3A 4F8RA 1SC6A 1DQ9A 1VC0A 4DDFA 3FRZA 2VL1A 3I0RB 3ITHA 2WAQD 3U27A 2ZHAA 5AE1A 1M5OC 3T19A 2UVWA 2GW8A 2POKA 5F0WA 2V4RA 1VOMA 3BSAA 2I1RA 3T9ZA 4ED3A 2WSFC 3J7Z5 2QSWA 2EG2A 1N56A 3TVZA 1U26A 1FF2A 4KQZA 3GIIA 1H2VZ 4KFBA 4ID5A 1RT7B 4CI0B 1VRUA 3S01A 4ZPVR 1UJ5A 2UP1A 1RKIA 2HVHA 1U6FA 2YKNA 1YRUA 1YJTA 4C8ZA 1YTYA 2DNPA 1WF0A 3RU0A 1GNKA 4ECQA 3KNAA 2QIFA 2EKYA 1UWBA 3B8HA 2R2TA 2Q79A 2B43A 3PFEA 2DNKA 5DLFA 2EC0A 2DNQA 3UCZP 3CJ3A 4AUKA 4ES3A 4QIFA 1WWHA 1DJ0A 4MYTA 2R8HA 1C0UA 2KDOA 4M94A 4PWDB 1T3OA 2PSZA 4LSNA 4QBUA 2RDJA 2QA2A 5J2NA 2IBOA 3IG1A 1YBAA 2HRYA 2YX4A 1Y5NB 2LA4A 3MM9B 4PXCA 4O3OA 3U1LA 2R7VA 1BQNB 5DDRC 3A1YG 1QVFR 2MZRA 1H7XA 2RIJA 1UL3A 2CQCA 4PQAA 1VRTA 4I4BA 2OPPA 4GKKF 3CCJS 4LF8F 3BR9A 4UUWA 2RVJA 1S9EB 3KG1A 3U02A 1S6PA 3OQ2A 1DLOA 3AA9A 4FZVA 1P8GA 4I7FB 2MMYA 3FMWA 2RS2A 3J80Y 5HMZA 1VQ9S 2E5LF 2GHVC 5HBMA 2ALZA 3BN7A 3IG1B 3MXHP 3PRBA 3BO4A 3NKYA 3NCQA 4NRUA 2CVIA 4LSNB 5HQ8A 3TVYA 3G9CA 2B4OA 5D78A 1BWEA 2OD6A 2PGCA 1SQEA 1U09A 1VIXA 5IFMA 4JI3F 1IJFB 4IYQA 2EPIA 2UUCF 3CT9A 2XCAA 3CUNA 4FF1A 2AW0A 5DDOC 3HHDA 2OIHA 5E3PA 3L7OA 4QJVA 1X4GA 2CQDA 1U45A 1HQEB 3CGIA 2WHOA 4QWAA 3TA1A 4GC7A 4EBCA 4DFPA 1TK5A 4B3RF 1ZM9A 1NU4A 4K2XA 4NWBA 2D74B 5A6PA 3MI7X 3BSOA 4KFBB 5GAHU 4EEYA 4YHHF 3EUNA 4C8LA 3MM5A 4I67A 2LCWA 2ZE2B 2DGWA 1KSPA 3OTBA 4DSFA 4EZ9A 1X4CA 2O1PA 4J9PA 4IH5A 3NAHA 3MPVA 2LQ9A 3MTKA 4LMZA 3EGNA 2QRRA 4PG4A 4RW8B 4I69A 4QIWD 5JVHQ 2MZSA 1IJEB 4I1TA 3V6HA 4DEZA 1ZOTA 3CCTA 3GFZA 1CPZA 4IDKA 1IKVB 2BDPA 2HNDB 1IN0A 1FNXH 2XG8A 1RJJA 3I0SB 3D0IE 2OMOA 5D4PA 2N7CA 3KK2B 1O8BA 3JSMB 3CJKB 4PRFA 1GXTA 1N0VC 2VBWA 2BBEA 1HA1A 1UEUA 2GC8A 2IM0A 1CQNA 2CIMA 2M9KA 3IGNA 3OFEA 4P7TA 5A8WA 3RR8A 3VZHA 1TL4A 3RR7A 2W9BB 2MZJA 2COLA 1MW7A 2N3OA 2IC3B 3DHXA 4DSIA 2C3YA 1KEKA 3OVBA 1O51A 1W25A 3DM2B 3MZIA 1HWUA 4OHVA 5E2QA 5A8RA 5L1LA 2ZD1A 2MHNA 4R5PB 1TKZB 3CD0A 3O44A 4ERDA 1ZM4A 3I5AA 2B5JA 3DNCA 1UA1A 5CYMA 1FKAF 2LDYA 3MUTP 2XMWA 4OX9F 3W2WA 2LQJA 2RILA 3J81Y 3DRSB 3QLHB 2Z2LA 1S10A 1T05B 4BBYA 1TK8A 1SXLA 4ZS6A 4MMOA 3IBWA 2DIUA 1SJRA 1RTJA 1JKHA 4JV0A 4RNHA 4FS2A 4ECVA 3WC0A 3BSCA 2XS5A 4DR5F 4FVMA 3PY8A 1R27B 2WSEC 5C5JA 2JFDA 5F41A 1LW0B 1Q82T 2HHTA 3G6VA 3QPIA 3OLBA 3MAHA 3HHLD 1YITS 3PKYA 4IR9A 4LF9F 4ES1A 1JLQB 4EZ6A 1HW8A 1WG5A 1P6TA 2OFGX 2FPHX 3KTQA 1G1XA 5KFTA 2B56A 1P1LA 3BJYA 5F8MA 2AF6A 4H4KC 4IRDA 4EBEA 2M5YA 2MKKA 1F5AA 1IKXB 3PO4A 1F0XA 3M8RA 5GAHI 2VFUA 1X9MA 1I1GA 2CJKA 2EW9A 3DXSX 3BB5A 4FF4A 2OAUA 1FJEB 4ZVFA 4YY3F 3BQ2A 1XTZA 3MEEA 3AQPA 4C0HA 4CO0A 1EETB 1YG0A 2OP5A 3M30B 5D4LA 4CTAA 4DOZA 3MR6A 1I94F 2AYGA 1ROFA 2HMIA 4ILMA 1SH2A 2HWTA 3DRPA 2KJVA 3D0HE 3DLKB 2KYZA 5I3UB 2KTQA 3O8WA 4Q45A 1KLNA 1TFWA 3KJVA 2OPSA 3MR3A 3PFOA 4ELVA 2OFHX 4QIVA 3PVXA 4H4OB 1NK8A 3N6LA 1SI9A 2JX2A 4OFZA 2EBGA 2EFGA 1JLGA 2F9JA 3ENWA 1EP4B 2JFKA 1HW9A 5C42B 4DF8A 2YWHA 2V2KA 4FXWA 1VMBA 5I3PA 2FUG9 2FLLA 4G6VB 2UUBF 5IWAF 1QY7A 5DM7Q 4NMLA 1HNVA 2WB4A 3EGWB 3DLEA 3DHWC 3LOUA 4O3NA 2UUWA 4MTPA 1R0AB 1D1UA 2J0SD 1RI7A 2I38A 2IVYA 2F40A 2GMHA 4XO0A 2C2EA 4KRWA 4BC7A 3HHEA 5EWGA 3K8WA 1UETA 1HBUB 5IQ6A 3RAQA 5LXYA 2AV5A 1AW0A 1SIZA 1TZ0A 1S97A 4EYIB 4DL3A 3FVYA 3V4IB 4C4WA 4N5SA 4NCGA 5M2PA 2ZC3A 4CQ1A 5EGYA 2EFOA 3H8YA 1S4FA 2GX8A 4NLWA 2A18A 1U4BA 1AROP 2E1CA 2I8EA 2ZH5A 2BACA 3OVAA 3D1HA 1X9WA 2MSSA 2ZJPQ 2EVZA 2V4JB 4MIBA 3HI9A 2G0CA 5GADI 3G6YA 2RRAA 4J5OA 4IG3B 4QPTA 1K9MT 1YI2S 1DTQA 1WELA 2C3OA 4ZVEA 4OJGA 2Z8QA 1D9AA 3CEDA 2J9DE 3BF4A 5T14A 3FFIB 1Y5LB 3K5LA 1YJNS 1C4CA 3DYAA 4HT7A 3NCPA 3ONQA 3OTDA 2HHXA 2AYEA 1S6QA 3K8VA 4G1QA 2HGNA 3TAPA 1VQ7S 1BGXT 4G1QB 4TU7A 1ZBTA 2UZAA 3HKWA 1KOHA 3SFGA 1HBNA 1TFYA 5DS7A 1LV5A 3CIMA 2DGSA 3N5FA 1RT3A 2MY7A 3C46A 3MDFA 2V4JA 1XMBA 5FLXY 3SZ2A 1LFWA 2BR0A 2BQUA 5L1KA 1R43A 3MOJB 5KG4A 2M8HA 4BHQA 1FXRA 4IO1A 4IG0A 2GO8A 5B09A 1GQEA 2CQ3A 1HR0F 3OTOF 1MROB 2RQ4A 4DHVA 1U2RA 4MJKA 4KPYA 3NAIA 3OVSA 5F8HA 1JLAB 3CSKA 1X5PA 3ZFVA 5A8KB 4OHYA 1W2IA 3DOMA 1QUPA 4B3SF 1A9NB 4FN5A 2VQEF 1B7FA 3PNIA 3MMCA 3N9UC 3M1VB 2WONB 3R5BA 2KM8C 1KQGB 2BANA 3VCDA 5HLFA 1SJQA 4ZP6A 4I6AA 3PEJA 2HFNA 5HL7Q 3FZBA 2FJVA 1R8CA 2QZ8A 4LIWA 4BCAA 3KHRA 4DQQA 1BD6A 2HHSA 2J76E 3IGVA 1HNVB 2SXLA 2WK4A 2ZC4A 3PHEA 1PC5A 1T03A 3RRHA 1QLNA 4FNHA 3G6ES 1VQ8S 4ZMMA 4LF4F 1EP4A 1TV6A 1M5VC 1UKUA 3OTEA 3NGDA 3ZZUA 3M2VB 1FRXA 1GTEA 1LKZA 2VG6B 5DQHA 3KJVB 4DQSA 2K7KA 5I42B 1SJ1A 4DFJA 1N52B 3QIPA 3OJSA 3R5DA 1NO8A 3NNAA 1U1OA 4BWMA 1HHTP 3H5UA 1EETA 3M30A 4CTAB 5EWEA 5BYRA 2V8DA 2FHKA 3MEEB 2IM2A 2G4BA 3S1TA 3EXCX 3ZZTA 4I6WA 4HDHA 2VBYA 4PWUA 4HT5A 2RH3A 2GIRA 2MJNA 5C24B 1IKXA 1HWJA 2NSCA 2PI4A 2LU1A 1FTCA 4H4MA 2YX1A 1OSDA 3DFEA 4CCHA 2Q1LA 4UY8T 2M3DA 2ZKUA 4ITSA 4Y6IA 3M2VA 1E6VB 3MTJA 4I2PB 4O3PA 3VR1A 1D8YA 3CMES 1IM4A 3MMBB 5DO2A 4D3HA 2XCPA 1SJFA 2FGOA 3CVKA 4URSA 1LW0A 3G8TA 2XLJA 3HK2A 2AJFE 2LEAA 1YWXA 1KD1T 3NNCA 1VBYA 3NBPA 1JKHB 4O44A 2OPQA 4LIRA 2CYYA 2RKIA 4B3OA 1RTHA 2ZUGA 3I32A 4LFAF 2VOOA 2LXIA 3DI6A 1ZYQA 2FJXA 2C42A 2P5VA 3FRYA 4CNYA 2K1RA 5JVGQ 1Q8LA 4NLDA 5FDLA 5HMXA 3W2WB 4L72B 3M1VA 3KLGB 3JB9k 2PD1A 4U67Q 3CCUS 5DG7A 3FCHA 2K3KA 1UJ4A 1RDRA 2UVVA 1IQTA 2XMJA 2CQIA 1JLAA 4DSJA 3V6JA 1Y4ZB 2DCUB 3C6TB 7FDRA 4A8MP 2R7WA 3CJ4A 3HXMA 3IRXA 4U6PA 2ADBA 1WEYA 4E98A 2RRBA 1Q16B 2DNLA 2M52A 3HVWA 3ICLA 5CZXA 2DTJA 2W9BA 2C3UA 3KHLA 1ZTTA 3HHLB 2I5JB 4QW9A 3HT3A 3T1HF 2QEXS 4IKAA 4QU6A 5SUHA 3ZC4A 1LFPA 4WCEQ 1HNIA 4NLPA 1X0FA 3H5XA 3FZ2A 4Y2KA 1X7VA 5I3QA 1IKVA 2O5DA 4DL2A 4Q0BA 3DLLQ 3VZIA 3IXQA 1S1VA 5KFKA 1KNZA 5KFAA 3SQGB 4RW9B 3J7ZT 2W7PA 2DB1A 5IZHA 1PILA 2DBBA 4RU9A 4YUDA 3VAIA 5E7OB 1XEZA 4RWXA 5LJ3Y 3MEDB 5FIIA 3H4DA 4CH7A 1N5QA 1RK8A 2ZE2A 5BR8F 2KYXA 2V8HA 3VAHA 1TL5A 4ECXA 1ZZNA 1HD1A 4ETZA 5LXRA 5KFMA 4ZLPA 3RRKA 1FD8A 1QE1A 4QYRA 3CULA 4F3MA 1YJVA 1P27B 1ZAVA 4NCAA 2M70A 6FD1A 2L9NA 3G8QA 1L3UA 2DVIA 1S0VA 3QGPA 4X4RA 1FK9A 3SMZA 4ED6A 4A8SA 1HQEA 4OZ0A 2CJAA 5J1PA 1K73T 4W90B 2B4VA 2VH7A 3CJ0A 3P5TL 2KFNA 2BJDA 5AJ3F 2HYIB 5HMYA 1B0PA 2X1GA 2X1AA 4LVOP 1TL1A 5H9FJ 3DI6B 4KBIA 4L6V3 1WF2A 5J2PB 3S7RA 4B3OB 3I55S 2RS8A 3NBPB 2XO7A 5D77A 1WEZA 1N5SA 3L09A 5HBMB 3V6DA 1PO6A 3PRDA 4ZPCA 1VQPS 1JLGB 2QMWA 1DLOB 4NLXA 2H9ZA 2W9AA 2DNNA 1ZAXA 2D9OA