4RWWA

Crystal structure of l. monocytogenes psta in complex with cyclic-di-amp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Lmo2692 protein
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwwA01
4CO1A 1V3RA 2GW8A 3AA9A 2XBPA 3LF0A 3N5BA 3TA1A 2ZFHA 2DCLA 1VHFA 2J9CA 4R25A 4C3MA 3T9ZA 1QY7A 3OPKA 2GX8A 1H3DA 3O5TB 4OZLA 1KR4A 2J9EA 2O66A 5L9NA 1O51A 1NH7A 3DFEA 4RX6A 4USJC 2J9DE 1O5JA 4C3LA 1NAQA 4CO5A 4WK3A 2RD5C 3NCQA 4USHA 1GNKA 2NUUG 4OZNA 5DRKA 3BZQA 3M05A 2XG8A 4RWWA 4YB5A 3GSDA 2V5HG 1UKUA 1XK8A 1UL3A 2ZOMA 4AFFA 4CO4A 2NUHA 4CNYA 2E66A 4Y65A 1Q1KA 5D4LA 3HLUA 3NCPA 4RLEA 1P1LA 1UMJA 4ZK7M 1VFJA 3NCRA 4YB6A 3AH6A 3L7PA 2EG2A 1J2VA 3X3UA 4YB7A 4WK1A 5D4NA 2O67A 4CO0A 2GNKA 2Z0GA 2EG1A 3AHPA 2PIIA 4NYOA 3O8WA 4USIA 2J9DA 4CO3A 1UFLA 1HWUA 4CNZA 5D4PA 1PILA 1V3SA 4IYQA 4C3KA 4RWXA 2XZWA 2NS1B 5D4OA 3TA0A 1V9OA 3CE8A 1NZAA 4E98A 1OSCA 5DS7A 2CZ4A 3MHYA 3TA2A 4NYPA 1V6HA 4D3HA 1NH8A 4OZJA 4Y6IA 3AA8A 2XULA 2VD3A 4CO2A 2JJ4D 4D3GA
chains in the Genus database with same CATH superfamily
5A0YB 4DPTA 1AUDA 3LGMA 2DTJA 1DJ0A 3QZ8A 2KVIA 4WTYA 2E7WA 1L3SA 1ICEB 5A8WB 1LWXA 4F4XA 4O23A 3BO4A 4ETZA 2CAJA 5I4MA 1T8EA 2XMMA 1C0UB 1FX4A 1HPZB 1TAQA 2BXJA 3PO5A 2HNZA 4DV3F 2J0XA 4LVNP 2YQ1A 4RW8A 5AE2A 5DLGA 2LQ5A 2J7UA 1N5TA 2ZOMA 4X4VA 3QAUA 2H51B 1NHUA 4GC6A 3LP0A 3MEKA 1S4FA 3I4PA 3H0PA 4WFZA 6FDRA 1XWLA 1FRIA 2FLLA 3PDNA 3GV7B 1TQLA 1CULB 3CCQS 1XR5A 2G1DA 5FLXY 4J91A 3H40A 4FNIA 4RW6A 3SCIE 1FWLA 2JZ5A 2XWXA 1JLBA 5HATA 2IDLA 4IR1A 3NEKA 1S9FA 3QIDA 1N8RT 4I1TA 2ZD1A 1UZDA 4DV7F 2XULA 2DNHA 5GADU 1U09A 2W2NP 3PJXA 1WJ9A 4EK2A 1QD1A 2UXDF 2EFGA 3UQSA 1C4AA 1RT4A 2VV5A 4F4KA 4KAIA 3UDEA 1K1QA 3VZHA 2C2MB 1Q8IA 1RT7B 2A2DA 4X66J 1HMVA 3MMCB 2AMCB 1GK8A 3M9NB 2RF2A 1FRJA 3OUYA 3KMSA 4M5DA 2E44A 2XMAA 2IPOB 4C0BA 3PM9A 2KJVA 1REVB 4HHJA 1VR6A 2V8PA 2E5IA 4UTGA 3M2VA 5D0RA 4TY8B 5KFGA 1BUXA 4P7VA 3D6FB 3PHEA 1JLGA 3IGVA 2VQEJ 3G6ES 3UN5A 3PW7A 2BW7A 4M5IA 5MLCV 4CH1A 1C1BB 4DR6J 4C3KA 3I0RA 1T9VA 1JIHA 4JB8B 3F44A 1X5SA 2EK6A 1BY9A 5KFOA 3GLJA 2IJRA 2HHSA 2ZZNA 3GFZA 3CD0A 3QQCD 2GW8A 2KJWA 2FHKA 2HWTA 2WB1D 1FJGJ 2LYVA 5ETMA 1N52B 4ECYA 1JXLA 2J0SD 1G1XA 4MKAA 2DKOB 1E6YB 4J9PA 3D67A 1HQEB 2OH2A 3BBCA 4LF8F 4CI0B 4QWEA 1QAJA 2FLOA 2ZNZA 5LMUF 3VTIA 3M9OB 4J9KA 5ADZA 1ZTWA 1CJTB 4ZPBA 1FK9B 4Y28C 3DLEA 1P8GA 4X4QA 1RBLA 4WZQA 2MKHA 5A8RA 4JV5F 1CJVB 3UR3C 1ELOA 3ENQA 2VA3A 3SV4A 4YB1P 2V0NA 2MZRA 3ILOA 4DL4A 4CLUA 1DLOA 2Y1IA 2BE2B 2OLWA 2V8HA 2C2RA 1BQXA 4LSNA 2SXLA 1Y3JA 3FBFA 4EFAC 3UD4P 3P6YC 1HHQA 3F56A 2H4YB 3FGVA 3CCES 3LF0A 1FEHA 1S48A 1JLCB 4IOBA 4J9RA 3WC2A 3R5GA 2CG4A 2ALZA 3GV5B 2M0GB 3CCSS 1WHYA 2YKAA 4RNOA 3KLEA 1WORA 2E7XA 1UWBA 2BJ1A 5IOLA 3W2WB 2DNOA 4R8UB 1NAQA 4IFVB 3ITHA 3RU0A 3R8YA 1NK6A 3LPEA 4NRTA 3K57A 1FI4A 4FS1A 2RDIA 3LTOA 4ECTA 4FPIA 3G6VA 4R0JA 3ISND 3BQ0A 4OHXA 1YLXA 3QWUA 1QUPA 2L41A 3QATA 5CA5A 1S9EA 3M2RA 2I1RA 2DY9A 1XNQJ 3EXYA 2PE8A 2YXLA 4C4WA 1RTHB 2MQLA 2RUGA 2PC6A 2DGOA 1VQ4S 2QIFA 3CJQA 2FJVA 1V3RA 2NZ4A 3QIPA 1HR0J 2VKRA 4PZVA 4LRAA 1WTBA 1F2HA 1GT8A 2W1BA 1HBNB 2IRXA 3CWJA 4WP3A 2OEMA 2K06A 1NH7A 1VLOA 3UPFA 2YVSA 1BQNB 3BR8A 1D1UA 1HNIB 5GAGU 2XS2A 2ACMA 1TKTB 3NCQA 3HD2A 4RWWA 4KV8A 1JLFA 3NWGA 3DXBA 3N01A 4K50A 1UWAA 4PG8A 4ZVRB 4WFAQ 1HQUB 2MHEA 1G6BA 4RLEA 1UAWA 1ZM9A 3D1HA 4X64F 1MROB 2VBXA 3TZWA 3GFYA 1NK9A 4P2SA 3O44A 4RW9A 2RH3A 5ETTA 4OYBA 2C1EB 1R0CB 4G6VB 5CYQB 5KFYA 1C4CA 1VOMA 5LXRA 3TZZA 2HHTA 5ITHA 3KLIA 3TVYA 1C1CB 1RE1B 5IQ6A 1KC8T 2HEKA 3IAM9 1LWEB 2B6AA 5K8NA 3KKFA 4WU3A 2NZCA 1MWZA 1LWCB 4HH0A 4JI5J 2UXDJ 5G4DA 4GMKA 4EEYA 4UOFA 1WEYA 4CDIA 1OJ4A 4M1KA 3N0VA 4U67Q 3BYPA 4YR3A 1TL5A 3MAQA 3DLKA 1DARA 2KM8B 3RG6A 4HI1A 3AQPA 2MGZA 2P8IA 4YEAA 4ED1A 3CJTA 2Q3PA 2K2PA 2WW8A 2RU9A 2CQPA 1GAOA 4USUA 2IY5B 2YBVA 2YPZA 2AT1B 4WFBQ 2RUSA 3AHPA 1R0AB 3OSNA 2MQQA 1X9SA 2ZOFA 3FC9A 3POTA 3OXFA 4ITSA 2XMKA 4NCGA 4NMLA 3DRYA 1RTDB 3BGRA 1KN6A 2GQCA 1SC1B 3GWCA 2DIVA 3OVAA 2A3JA 3R3TA 2I9SA 4LSLA 1VQYA 4B9LA 4M95A 2P9CA 1M1KT 4W4MA 4ZOSA 4C0OC 2FGOA 1HI8A 2IVMA 3W9HA 4EZ9A 3VALA 3MMBB 4XPCA 2QL7B 7FDRA 4CLLA 2W4DA 4LBPA 3FBEA 4UF4A 2G0JA 2YNGA 1CG2A 2Y8YA 2GJ2A 5DQGA 1FJCA 2KRRA 2B7CB 1R31A 2D9OA 5L8RC 3J81j 2LEPA 3QO9B 2W25A 5LMUJ 4ALZA 2AGQA 2QMWA 4W98A 4I0WA 3MM5B 2FJDB 2LQJA 3PV8A 3FSIA 4J9VA 5T41A 3LANA 4USIA 3CJ2A 4J9UE 1SJ1A 1RDRA 1NO8A 1XEZA 5AXKA 2UXCJ 4QW9A 5AXLA 1VIOA 4NLSA 3S01A 2BJ9A 5KOWA 2DCUB 3QT5A 4C8YA 4X4PA 1JXVA 3GYXB 4DCPB 1VRTB 3FBBA 4QIEA 4ANEA 3M8WA 3E2EA 2QLXA 4FYVB 2CQ4A 3W2VB 3ULHA 2QEXS 2QMXA 1H74A 1EARA 1S1WB 1TKXB 3K59A 2OTLS 3MAAB 1MMNA 1RK8A 4XDCA 4NL5A 4ZA1A 2QJ3A 1LW0A 5AJ3J 4B3TF 2NSCA 4TU9A 3L9ZA 5DDPC 1HBUA 5DQIA 3HT0A 2XEXA 3KLGA 1RHJB 2QZ8A 4DSKA 3A8KA 4X4TA 1BWEA 1FESA 4PCQA 3ENVA 3PXGa 2PFFB 4ECUA 1F6TA 4NYOA 4EGLA 1F5AA 1PILA 2HYIB 1PAEX 3A3NB 3JTOA 3ILJA 2VH7A 4MK7A 2O3DA 4PAAA 3HK2A 1TV6B 2ILZA 4Q2MA 5MAOA 4RBVA 2AGOA 2GZOA 4I6YA 3LP1B 2HMIB 2PN6A 4B3MF 4ZPCA 4RNMA 2H3EB 4CH7A 2H54B 4WYLA 3Q8VA 1BXNA 2QN6B 4CO5A 4Y2CA 5AT1B 1HNVB 3U7JA 4WTOB 1RLDA 2KVQE 1WDDA 3NNHA 5A2QY 3FMBA 5B09A 4DLEA 2W2OP 2YKPA 2Q6BA 4NRUA 3AY0A 4KGMA 4DX5A 1U02A 4KT0C 1YHQS 4KQZA 4WFNQ 4RW7B 4PXDA 3OTOJ 1YWXA 4JI2J 5HAOA 1RB0A 2W4PA 3M32B 4ICLB 4QCLA 1AB8A 4I2PA 3AB4B 2HFZA 4QIVA 3MR5A 2BABA 3HPOA 2IHR1 2OGUA 2J7KA 3VHQA 4N8NA 4J9QA 1PYSB 3TOQA 5KT6A 4WF9Q 1YKWA 1LWFA 2GVZA 1S5ZA 1D9FA 2B5JB 1HYSB 3UE2A 2V8VA 2RS2A 1WHVA 3CF5Q 3BREA 4YY3F 5HVFA 3BKFA 5EWEA 2OD4A 1RHMB 3L7UA 5IC4B 3BZQA 3CULA 2DGQA 1TKZB 3C15B 3OJSA 4MIBA 2GAGC 5H9FJ 5DDRC 3RAMA 3K17A 1ZH5A 3DCAA 1QDUB 3AOAA 2E29A 1RISA 2XHCA 3I5AA 3ADAC 3R5DA 1TK0A 3OR1B 1LK7A 1G4CA 4FVCA 3W1YC 2AYMA 3HVTA 3KHLA 3SMZA 1CULA 2B43A 2PMHA 4FYWB 3VGUA 2GFFA 1RHRB 1SKSA 4LSZB 2QLFB 4OYWA 3BGFA 4KHPF 3EVMA 5KFRA 4RUAA 3NNAA 2QV6A 2WZ1A 3S6EA 4IRDA 1EETA 2DXDA 2KYZA 1W26A 4GRSA 1VK3A 2UVUA 3MR3A 4MT1A 1H6KX 2I8EA 3DLHA 1QUVA 3VVTA 2BR0A 2APOA 3DDIA 2V63A 4ZHRB 3UN2A 4TYAA 1AZSB 4DR2F 2QFJA 1RABB 3EYZA 5KFLA 1LXJA 3FEZA 4HL9A 2H5EA 4G1QB 3BO3A 4U7CA 4NCAA 1GMVA 3Q22A 1F1BB 3HLUA 4KFBA 2EEYA 3M30B 1Q8KA 2O1PA 1ZS6A 2J0QD 1VFJA 1PJ6A 3T5JA 4LUBA 2LEAA 3MEEB 3QGHA 1H2VZ 3UDCA 3IP0A 4DSIA 4OHZA 1NDCA 1TFWA 1XBWA 1ZPWX 3PRVA 4O4RA 3HKZD 5LSLA 3MTKA 2ZE2B 3VVUA 3OFFA 2ZVSA 2YTCA 4KO0A 4F67A 4OQJA 2JEJA 5DLFA 3IS9A 4LR8A 3S1TA 3IGNA 1T03B 4ZITA 3QPIA 4CYUA 1FFSB 2AEFA 5M2PA 4J9OA 2IM2A 2ILYA 3BS9A 2OPQB 3M8RA 2WOMB 1EIYB 4Q2LA 3IAS9 5SUHA 4JV2A 3NAIA 1FERA 2AW0A 5CZXA 2ZH2A 5CYMB 1UP1A 2FLPA 1FK9A 2EBEA 4ANDA 3MOJB 5CH7B 2BJ7A 3KG4A 3KK1B 3QFWA 1HWLA 1BWVA 5E41A 1HL6A 3DRSA 1NK4A 5I42A 5DO2A 5L1KA 1CS4B 1VC0A 1R6YA 3D3CJ 3MM9A 4ED4A 1CJUA 4P74A 4IG0B 5ETOA 2UZAA 1VBKA 1VQSA 1SJFA 3KHHA 2F65A 1L5UA 1ACMB 2NREA 3KHGA 3NNCA 4K5RA 5AXMA 1DAXA 1SC4B 3MECB 3GILA 4PXCA 4IDKB 5IT9Y 3DI6B 3KDOA 3PKYA 2HHQA 4NZ7A 3CDAA 4K4VA 1LNQA 1CJKA 4NI2A 4QWBA 4DSLA 2W9AA 4J7CA 4B3MJ 1RUSA 2M7SA 5KFZA 1KTQA 4JI1F 4JYAF 1R7IA 1Q1KA 1TL3B 1W2IA 3RYLA 2DNRA 4JI4F 1TTHB 5THWA 4L74A 5ETSA 5GMDA 2HBQB 4GC7A 3W9JA 2DH9A 1EKSA 3QRRA 3K58A 3NGTA 4I2QB 2BJ3A 1B3TA 3JYTA 5H9FK 1RHQB 1IQTA 5D6GA 2ABYA 4ZDNA 4C9DA 4E98A 2C22A 3PTWA 2MLZA 4O44B 4CO1A 1FKOA 3W60A 4DR4F 1WC3A 3CMES 5K20B 3DRRA 3FFIA 3MWBA 2R3VA 4K4UA 3R7SB 4WIQA 2PI4A 3UCZP 4CLFA 3CCVS 2I6WA 2HHWA 3I0SA 1QE1A 3N6NA 3QT6A 2KT2A 3KXDA 2GV1A 4F0HA 2LU1A 4U8YA 4B9UA 4YY3J 2D3ZA 4CLTA 1XERA 4ED5A 1JLEB 4HH1A 1RAOA 2A0FB 4O4GA 2CUYA 1KFSA 1VRUB 3HVAA 1JK9B 2CQCA 1VGYA 1U45A 3VQTA 3M2UB 1N54B 1F3FA 3NGRA 3JSRA 1HW9A 3PX0A 1J5EF 2V4JA 1S1VA 3BBFA 3H5XA 5B08A 4DV0F 2W9BA 4NZ0A 3R1HA 3P5TL 1M90T 3HSDA 5EHHA 4O0IA 1QAXA 3NAHA 5C24A 1S12A 5JXSA 2LDIA 4KJIA 2FGCA 1GH8A 1YIJS 1NSPA 2XY6A 2J9CA 5L1IA 3FSXA 4ZN1A 4KGKA 2GC8A 4ELTA 5KG1A 2DHGA 3GV8B 1MMDA 3BDEA 5C42B 5SZTA 4G3IA 3K5OA 1KLMB 3MM8A 4GVLA 1JLQB 2DXEA 2FHMA 4IO1A 2YKNA 1RTJA 5HMYA 2EXUA 3UDLA 4RUBA 2R2RA 2C2ZB 2DHAA 3BEGB 1IKVB 2CVIA 3NGUA 1N6QB 4OI1A 1T7PA 1MU2A 2H65B 3IBWA 3X1LB 3HJFA 1MN9A 4ILLA 5BYRA 2ZBRA 3DDNA 1S7IA 4F25A 3PR5B 3FQKA 2HNDA 2XY5A 1U25A 5A6PA 1B70B 5M2UA 4BC9A 2N7YA 2Y8WA 2GHPA 4Y6IA 3BO2A 4DL0C 2CJKA 3V6KA 5FDLB 1R3NA 3CCTA 2MEWA 4FDFA 1YITS 5F8GA 3MR6A 5GAHI 4V19J 2KZMA 3WC0A 3MD3A 2DGTA 4NEYA 1PC5A 2ZUGA 3N6LA 3KFWX 1RWXB 2IYGA 1K44A 4RUCA 1J5OB 2IRUA 2GHWA 4AFFA 2KDOA 1W2BR 4DR1F 3CO9A 4NXMJ 2MQMA 1NK7A 1KEKA 1HNWJ 5D4LA 4X2BA 4ZPAA 4LBHA 4WE1B 1QVGR 3QO9A 5DDOC 3UNYA 1RKJA 4EO6A 2DRBA 4YB7A 2DD8S 2ZDOA 1Q16B 5L39A 5AXNA 1TMJA 1UFLA 2DR9A 5D3GB 1S6PA 2KXFA 2D41A 4A8FA 5EDWA 2OP5A 1PG5B 3BQ1A 4DEZA 2YY3A 3EZOA 5IWAJ 3J7YU 1JMTA 3TYTA 5AE3A 1FA0A 1RTZA 1EQMA 5HSPA 2QL9B 4ZCMA 5L38A 2EK1A 1H3DA 5KFQA 2UUBF 1WSRA 1SVDA 1WG5A 2IC3A 3UVJA 3EGVA 1FEEA 3I4HX 3GFXA 2OPRA 1SB6A 3D6TB 4G1PA 1S1WA 5CYJA 2Z56B 2V69A 1H72C 1S79A 3DOMB 4CTAA 2L9DA 3UWTA 1P6TA 3KNAA 3R9LA 4N41A 3JSMA 1S6QA 4FZVA 2R7XA 1TL1B 1Z2LA 1QAIA 2Y1RI 4ZVEA 3M8QB 3I5BA 3VAHA 3TNVA 3BF4A 1NXIA 4JI4J 1U1QA 1RWPB 4IFYA 1LFPA 2DHHA 4OJ3A 3H2VE 3DYAB 3GZ7A 3B6BA 4DCOB 4UY8T 4OLOA 3DU5A 4YDDB 5CD4A 1SKWA 3QJPA 4PXEA 5FJ4A 2ZITA 3MMAA 3ZFVA 4CT8A 4OYMA 3P45B 5CHCB 1RA7A 2GMJA 3LP1A 4PYDA 4DU8A 2ZOGA 3IMQJ 4LREA 5B0CA 4DR4J 2GCFA 5C2CA 5E0OA 1A0OB 3DRPB 3US5A 3TI0A 4IOAQ 3MM6B 3DOKA 2HW3A 1CC7A 5HL7Q 4DL2A 5KG7A 2KI2A 4WIIA 1F5CA 1CQMA 3R5CA 3LQVA 2MLXA 1XN9A 5GADI 3JS9A 2VICA 3Q2TC 2EVZA 3LP2A 3QLHA 2KFZA 3DKDA 3AXMA 1NNDA 2OPSA 1KDNA 1B7FA 5DM7Q 2I5JB 3R2CJ 2GO9A 2ZH1A 2F3JA 2VG7A 1BGXT 4K4TA 2RDJA 2B7BB 5J1EA 1YJ9S 4AXJA 3T1HJ 4DPXA 3BGOP 3RBXA 4DS5A 3H98A 1WC4A 3DM2A 1QSLA 1FKPA 2FVPA 3D2WA 4J90A 3PO4A 2NCKL 3OHAA 2WVDA 3IN5A 4I6WA 4DV2F 2CRLA 4RW8B 4DV0J 5IM0A 2IM3A 1VIXA 3TAPA 2R7VA 1FNXH 4Y0FA 4YP3A 2B5JA 2XB2D 4AL6A 4OYOA 3GFHA 3LP0B 2WSCC 3MFIA 5F8HA 2GQ2A 4Q8EA 3OL7A 1B4SA 1RWKB 1GNKA 4JI8F 1U0SA 3C66A 3U1LA 3ZTRA 4USMA 1XK8A 1IN0A 4FYXB 2JC1A 1P27B 2ZHOA 1FWKA 2YQ3A 3IR5B 1M1GA 4HYKA 4TLQA 3EDQB 4RW6B 5B0EA 1JLBB 1RADB 1SJRA 4DR5F 2ZD1B 2UUTA 3LGNA 3PNIA 3A3PB 2OFGX 2CQ0A 1KS2A 1I1GA 1WDTA 5F0WA 3ZXWA 5KFEA 3KDNA 2VDIA 3AB2B 1RT4B 4P75A 4J9NA 2DNPA 5A8KB 2HVHA 4QWDA 5F3ZA 2AYBA 2GJIA 1HMVB 2FY8A 2MB0B 3CGIA 3MUTP 4DV6J 2D9PA 4L3KA 2RRBA 5IV3A 2ZH6A 4ED8A 2Z2MA 1TVRA 4C3MA 1SIWB 3IBCB 2P6TA 3OUYB 1XMBA 1XQIA 1QLNA 2B56A 2FQQB 2W7OA 1NPKA 4IRKA 3OFGA 5J2NA 4Q44A 2V68A 4ZHRA 4EU0A 1V5VA 2UVRA 3Q8YA 3KLFA 1OIAA 2JSXA 3T1YF 1I6JA 2E9TA 3HFKA 3B8HA 5HJXA 2HBZB 1BD6A 4OYIA 4OYXA 1IBMF 2DGUA 3ISNC 4PG4A 3I0RB 2EBGA 4A8KA 2JC0A 5B0AA 1QM9A 3PRBA 3A12A 4ER8A 5M2RA 4CH0S 2KT5A 1EP4A 1S72S 3ZC4A 2I0XA 3OFEA 3DNCA 4CLWA 4UT4A 1G3OA 4CWBA 2ZJPQ 3HHDA 1I3OB 4KSEB 2HK2A 3AA8A 2RT3A 3FCWA 4L72B 4BBYA 3W8PA 2KFNA 4KH0B 3HI9A 2JVOA 3ZTQA 3SSRA 4ZVGA 3C3LA 4LFBJ 2MDAA 4HHUA 4FF1A 3DFEA 1YJNS 3OVSA 5KFHA 3DLEB 3GTYX 2ROEA 2WOMA 1N36J 5F8LA 5A8RB 1F9FA 2XG8A 4OYPA 3R5BA 4NLWA 5KG4A 2CFXA 4YFUA 3W66A 2M4MA 3GSIA 1DLOB 1SPBP 2LA4A 2XZTB 3AD9C 4LSNB 1YJVA 1S9GA 4CZCA 3MR7A 3G82B 5HROA 3UR0A 3NWRA 4LF2A 1KQGB 2DEJA 3NKYA 3FEYB 4PRFA 1XC9A 2PGCA 5D15A 3H59A 5C2GA 4RWXA 3C8YA 5KOXA 1RA6A 4M5KA 1IKWA 4DR7F 3CIMA 4M5NA 2VD3A 4ZJOA 4GKKF 4ZVHA 3KLEB 4TXSA 5F41A 1UWBB 4A8XA 1JJ4A 2GQQA 2Z8QA 2EFPA 3PW5A 2M52A 2Y9HA 3OW2R 2PEHA 4PUOA 1NHVA 3VGVA 1NSKL 3GONA 2AQ4A 4AYBD 4ED2A 2F40A 5B0GA 3S7RA 1CQNA 3M2RB 1UW4A 1APSA 1Z2ZA 1UA1A 4I69A 3C6TB 5JVHQ 5HMWA 1HQ2A 4WP8A 3EZUA 4RUHA 5DZ7A 4WP9A 4YB6A 3K89A 5DG7A 1S10A 2GNKA 1U8SA 2EG1A 2UUCJ 3K7RA 4MYUA 2XS7A 3M8SA 2KYXA 3PIOQ 1HNZF 1AROP 4Q0BA 4JUZA 2OELA 1LOUA 3BDPA 4PPZA 3A8EA 2DBBA 1TKDA 2N82B 2HZCA 4DL7A 4NCBA 2OAUA 3M6XA 4M5LA 2A10A 2XSJA 1X5TA 4KV8B 2KXNB 1JLFB 5K14A 1AXQA 1DHMA 5EUHA 1IKYA 2LMIA 3J7A1 4B3OA 2LCWA 4GKJF 4A8YA 2AJQA 4YB5A 3G86A 1IWGA 1WC6A 4LF7J 2MJNA 1N5VA 2ZBIA 2V2KA 2CADA 4DDFA 4N56A 4RW9B 2G2YA 3LO3A 1KQKA 4IO9Q 1RAJA 3ETMA 4BC7A 4P2MA 2KHDA 2GIFA 3IR6B 2BRKA 4F3OA 4L76A 3L7PA 1RWVB 3KLIB 3H5UA 2VFTA 3LUYA 3HSGA 4DR5J 2B6AB 2RAQA 1GQEA 5C7PA 1FDNA 2HQDA 2DR7A 3TA2A 1VQKS 1TL4A 4YOEA 3PKMA 2LLZA 4P9SA 4Y2AA 2B4UA 1GMUA 5J1NA 3ELHA 2PT0A 3AA9A 2J8AA 2V94A 4ZVQB 3DLKB 1FXDA 4ZMMA 3OPKA 1SJ3P 2GX8A 2MGZB 4R0EA 2HKEA 8AT1B 1RLCL 2COLA 5C42A 2GIQA 3GMGA 1VQLS 1X9MA 1PJ7A 1JNRB 3CMQA 3BN7A 2C28A 1VHIA 3GR1A 3OL9A 2BEFA 4PG7A 2J8SA 3G6YA 4ZPTR 1AA1B 1KKHA 1T94A 3T1YJ 2J0WA 1YJRA 2CPHA 3POTB 4F8RA 1PSDA 4DSEA 4LRDA 9RUBA 4KGXB 1F2GA 2NXEA 3KOAA 1HLWA 4Q43A 3BGRB 2G2OA 3H90A 1U48A 1NDPA 5D4NA 1WF1A 4U95A 3TP2A 4LSLB 5I3QA 5G0RA 2CPJA 1VMBA 3IFEA 3B78A 2MJUA 2ZWPA 5HMXA 3A1YG 2BKOA 1RAGB 2W2PP 5KG3A 1X0PA 2DNGA 3RRKA 1Q79A 4CRJA 1U7LA 3JAMY 3PG9A 4Z7CA 4J37A 2YWHA 1AUSL 4UW2A 4DR3F 4UOCA 2DHSA 4C0HA 2YNGB 3NRBA 4ZCIA 2NXCA 3GB0A 3U1NA 2MHNA 4YN3B 1N34F 1OMSA 3EJMA 4ILMA 1R0BG 4DS4A 3BR9A 4RBTA 2N3OA 3VF0B 3CJ5A 4OV6A 4ID8A 5KFUA 3IWNC 1KRPA 3DMJA 3SXLA 2X1BA 4LRBA 2DJWA 3CVKA 1SV5A 3JB9k 2R8GA 4PQUA 4K4SA 3MCNA 5F9LA 1HWJA 3OBIA 1F9HA 3ILLA 2OPPA 2HQGA 3CCWA 2GGPB 3VAFA 2CQGA 4C8NA 1WKJA 4X4OA 1Q82T 2VA2A 3T41A 3G4SS 4X4UA 2PSZA 4ZP6A 3FNNA 3TO8A 4ELVA 3FRZA 3Q2SC 4D3GA 1HNXF 4DFJA 2YWKA 3W62A 2OFHX 1KOHA 4OZ0A 4C97A 3NXZA 2RU3A 2AJ4A 1LW0B 3MAHA 2ZM6J 2IA6A 3D7SB 1HBUB 2H48B 4C98A 1RAIB 3KLGB 2VFSA 3NOGA 3V81B 4HVZA 4ECWA 3T5LA 2NUUG 5GAHU 4IUFA 3AOBA 3M05A 4K59A 1Q81T 1GEHA 1GMWA 3IWLA 3BQ2A 4Z7YA 2ALYB 2F8MA 1N33J 3R5JB 2CQHA 4EZ6A 4F2SA 4KKOA 1XR7A 4E2FB 2R2SA 1W25A 2EC0A 3VAIA 3M8QA 1PAUB 5H9EJ 4JI3F 2VF3A 2UV8G 1IKXA 1HIYA 3QBCA 1DQAA 4CNZA 1KLNA 2GHVC 2R9LA 3VGSA 4AE5A 1U4BA 2ZZMA 1RU2A 3PJWA 1HNZJ 4F2RA 4KIAA 3CDWA 3ZZUA 2ZH3A 3NY0A 1YBAA 2P9GA 2EFVA 3MM7B 3D1OA 4RR5A 2XSFA 4FS2A 1O51A 1RACB 3SDEA 1SL2A 4JV0A 1O5JA 1X4FA 3J7ZT 3HX9A 3H42A 2HQIA 5EN1A 3V5RA 3IG1B 2F7VA 4GKJJ 2LA6A 4LF6F 4CO4A 1TMMA 1MMLA 2KN4A 3H4DA 1Q95G 3B4MA 2E9RX 3MCMA 4DX7A 2JLEA 1NRKA 1TUGB 4I2PB 1LV5A 2M9KA 1UEKA 2M3DA 4K4ZA 1A7GE 5DG9A 4KBIA 1RP5A 3G6XA 5BXIA 4IH5A 2RQMA 4N77A 1ZA1B 2BMBA 1LWFB 2GVZB 4QW8A 2KG0A 1XNRF 4ZVPB 4LF4F 3SIPB 3UD3P 4B02A 3R97A 3HKWA 2ASJA 2IBOA 1KHWA 5KT2A 3KG0A 2CQ2A 4DFPA 4PABA 3MGJA 4X4NA 3OR2B 1WC0A 3SV3A 2MXYA 4B9MA 1PYOB 1UVJA 2C42A 1NPRA 3W65A 3VAMA 2F1FA 2XO6A 5IT0A 5DRKA 5FD1A 1S4EA 1HBOA 4C8LA 5IZHA 5KFKA 1WWHA 2V8GA 4L3NA 3VAJA 2XLIA 3KJVA 3BPDA 3HHLA 1WUUA 3HVTB 1WG4A 2QLJB 1ZYQA 3WBZA 5GAEI 1MG7A 4EBCA 4V1Ak 1K73T 1LEOA 3SFGA 1J2VA 4UUXA 3W5YA 3NGSA 2E1AA 3HZGA 1IBCB 2N7CA 2QYCA 4MTPA 2JDJA 2HWIA 2YKQA 2OMOA 4CQ1A 5KFSA 1EETB 3P8BB 5IC6B 3BM7A 2ROGA 2UP1A 3IXQA 3N5FA 2PEBA 1P9YA 5A8KA 3JQKA 5IV4A 2HRYA 5EWFA 4KGZB 2D69A 3CCLS 1N5YA 1VHFA 3D5MA 1NDKA 3N28A 4LFCF 1SI9A 3FVYA 1KBRA 3MZIA 2W7PA 4Q7AA 3H7HB 4DR3J 2DGXA 2OUGA 3G8SA 4B3SF 4KFBB 1B64A 4DPWA 3DOLA 2POKA 1N34J 3EM1A 1U1PA 2MSTA 5LT5A 3NS6A 1XJWB 2DO4A 2BOPA 4LFAJ 3GG1A 1B7YB 1DTQB 1RKIA 3MDFA 4H4MB 1BE4A 4F04B 2F63A 5FLXU 3W9IA 1CSJA 1KQFB 4KO0B 3P3DA 2L08A 2ZH5A 1N0UA 2R7RA 2V4RA 3IS9B 4NYZA 4CO3A 3OLAA 4DX6A 5E2QA 4CYUB 1PIEA 3MTJA 3CUNA 2V67A 3FZ2A 5KFMA 2QE5A 2AZ3A 4M94A 1CLFA 5DGAA 2F9JA 3CEDA 1M5PC 1V6HA 2DNZA 5KFVA 1ZM2A 2ZC4A 3I87A 5H9EK 2YWWA 4MFBA 3GG0A 4K5SA 1UFWA 3BH7B 1ULRA 2E7VA 4DUTA 2XS5A 4ZPDA 2Q1LA 1X5OA 3HF5A 3ZZTA 3PEJA 3Q8RB 1HI0P 1NKCA 4H54A 1Q0NA 2F5GA 1NCLA 3DRSB 5I42B 3U27A 2WHOA 1Q8LA 4NA3A 4O3RA 3I55S 3GPAA 4ERDA 3UCGA 3MM9B 2HLTA 2OHDA 1KD1T 1CJUB 5KFPA 1OO0B 4QR1A 1A6LA 2BBEA 3G82A 2B0GA 3FDSA 4OHYA 4ECVA 1VDHA 4WJBA 1IJFB 5B7WA 1WHWA 3CDEA 5HVGA 2MZTA 2Y3YA 1JJHA 3MURP 2VPZB 3UDVA 2PD1A 2AYGA 1CJKB 4NI2B 4U7UK 3U1MA 3NOCA 5T7LA 3FCVA 2XO7A 1R8PA 3QJJA 1YTYA 3S8SA 4WKYA 3O2IA 4HACA 2AP6A 1D9AA 1SBRA 3WZ0A 2B4OA 4L73A 2DHXA 2AIRB 3GIJA 1M5OC 4Y65A 2CNKB 1F0XA 3C6TA 3JYTB 1L3KA 4Q5VA 3IA0A 1X5PA 4LF6J 3WX4A 1HD1A 3I96A 1CVJA 1X4GA 3C6UA 2HRUA 1FKOB 2E1RA 4XO0A 2BM1A 4QQBA 1F60B 3DRRB 2VFRA 1KOOA 4OJGA 3FFIB 2IMOA 3UW1A 1ZAWA 2G13A 5DS7A 4GVBA 3VAKA 3SBMA 2DNLA 3QSIA 2PFDA 5BR8F 3MMJA 3I0SB 1QE1B 4EBEA 2V9KA 2CJYB 2IBKA 2VC0A 1XNRJ 2NQPA 3GIKA 4AL7A 2CQDA 4M5MA 3ZZZA 4WWSA 1BHNA 4OIXA 1VC5A 1FD8A 7AT1B 3IWXA 1W7WA 4DV3J 1H0HB 2HHUA 2O66A 1JNZB 3TQEA 2ZVIA 2LU2A 2PDAA 3I82A 1KVIA 1Q8BA 5K8PA 4O4GB 4CP5A 1XTZA 4H4OA 2BQ3A 3GSDA 2LVWA 3QJLA 2R42A 2H1YA 2YKMA 4B3RF 2V4JB 3T19A 1S1VB 2FVRA 1QSSA 1WNEA 3BBBA 3UCUP 1K47A 3MXHP 2W9BB 3FRYA 3KJFB 3QWPA 3AH6A 3TANA 1Q7LB 4DQPA 1SUQA 3AAWB 2B9YA 1GTEA 2EKYA 5C24B 1UEUA 3Q89A 2IAJA 1RWWB 2N3LA 1Y11A 3HVWA 1RAEB 2Z2ZA 2V8DA 5HQMA 4DV7J 1AYEA 3FCHA 2UVWA 3J80Y 3W3SA 2LQ9A 1Y00A 4P72A 2HZAA 4EWTA 5C5JA 1UA0A 4TLRA 4IG3A 5IS2A 4DPOA 5F8JA 1UZHA 3MM8B 3OHBA 2YKNB 4F0MA 1RTJB 2BUNA 4W90B 3Q8SB 4K2JA 2CA9A 1RU1A 3SQOP 3ET6A 4Y2IA 2A18A 2QTWA 5HANA 3JTPA 1FDAA 2WVCA 4LFCJ 2G0CA 3FJ2A 4CT9A 5DGBA 1MU2B 5EX3A 4BWJA 3F73A 4UZCA 2YWGA 2CDRB 4M8LA 4B3SJ 1K9MT 2OO4A 4K7QA 3MEDA 1IM4A 4A48A 3J7YI 4BWMA 2WCXA 1RT1A 4Y34A 4DHVA 2HNDB 3DLBA 1JKHA 1VS3A 1RT3A 4ED6A 4UY85 1FO1A 3NGKA 1OYEA 2MZ1A 5HP1A 2PI5A 2RILA 2HQFA 4C11A 3GIMA 3L09A 3QFHA 4EBDA 3TJAA 1IR2A 3CJ8A 2CPIA 4NASA 1Q78A 3PEHA 4JBCA 4FBTA 3PY8A 4O3SA 4BLGA 4OX8A 4ECXA 2OSRA 3NGDA 2R2TA 2AEJA 2C3YA 2BX6A 4QIWD 4HT5A 2WK4A 3M9MB 1SQEA 2CKWA 2C3UA 4LF8J 1F9EB 3MUVP 1GX5A 2VBYA 1EHWA 2QRRA 2DR6A 2B4VA 5JMNA 4FXWA 1XR6A 4R5PA 2YPYA 4NXNF 1Q5YA 1KP6A 1YG0A 2OD6A 1RBOB 1YJTA 4TU7A 2N4CA 4JV5J 4UOGA 1QTMA 3CC7S 1S6PB 3WIUA 3IM9A 3ZNJ1 3OV7A 4ZP7A 2EG2A 4TKTA 2ZWOA 1NZ8A 2HFUA 4CIOA 1FXLA 3AJDA 4FKYA 1XMOF 2GGPA 3NBPA 3EWGA 2ASDA 2CYYA 1B99A 4P73A 4ED0A 2VL1A 2IDEA 2IC3B 5E3PA 3UVJB 1HW8A 3G87A 3E51A 2OI2A 3TZXA 3OFHA 2OPRB 3GCXP 3DGPA 2XYHB 2XCAA 4LIRA 3SYZA 3H5YA 1Y5LB 5BYQA 1YJ7A 2RQKA 2XI2A 5IQQA 3V4IA 2DGVA 4J5OA 3CCZA 3D6MB 4CTAB 1NJZA 4K2XA 1RBAA 4USWA 2VZ9A 3GJRB 3JSMB 1S6QB 3GYNA 3NMRA 3V81A 3RB6A 2VFUA 4X4SA 3D28A 2RRAA 1RXOB 2V5HG 2LXUA 2VU5A 4WBFA 4UZBA 3U02A 2E66A 3ZTSA 1TAUA 1RCXB 4XPEA 3BJYA 4IFYB 1GMWD 2KG1A 3K5LA 1FE4A 2G1HA 3QZ7A 1NB2A 3KUEA 2Z0GA 2CPXA 4PR6A 2CNNB 2I38A 3MMAB 1FTRA 2VQEF 4OX6A 1BLUA 3MPYA 2GAHC 4DV5F 2K7JA 5KFNA 4CM0A 3VAGA 1WHXA 3TZYA 2WVEA 5KFDA 3ZO7A 2KH9A 3IBFB 3DOKB 4I56A 4B9SA 2ZH9A 2HS3A 2HNYA 2AHOB 2FTRA 5BR8J 3MM7A 2YNFA 3AQOA 4YR0A 4HI2A 4PXBA 3TAMA 3M8PA 3FEXB 2H5IB 4KHMA 2ZJQQ 1DURA 2RJZA 3LP2B 3QLHB 3MF5A 3PYGA 1VQ6S 5J2PA 4LF1A 1N32F 2OPSB 3IG1A 2HIYA 3TVZA 1NSAA 4M5HA 2VG7B 4X64J 1OQ6A 1LKZA 3HHEA 4ENOA 2XHWA 2X3GA 2AJFE 5HI7A 4WZMA 5J1EB 2ZH8A 2E5GA 1YDLA 3DM2B 1OQ3A 3TARA 1U2CA 2QGFB 3GR0A 1FKPB 2CXEA 2HQ3A 5CCMA 2J6UA 5IM0B 4F4ZA 3CMAS 2MMYA 5HLFA 2NPIA 1SQFA 3KK3B 2LFVA 4OV1A 1DTTA 2QYGA 1H73A 3RW6A 2ASYA 2HURA 1X4BA 3T6JA 2VBZA 3SSQA 9ATCB 1EB0A 4MIWA 1DZ5A 5I3UA 2AF6A 4HKQA 3OR2A 1U6BA 3OT9A 3IRXA 2DNYA 4PYAA 2LQ8A 3TQ1A 2GA7A 2XGQA 3CO0P 1I94F 1X31C 5A2QU 1ZZNA 2FD2A 1FRXA 1T9XA 1O0PA 4NLQA 4NLOA 5KG6A 3PIPQ 2MQNA 1QVFR 4X84A 2BKNA 3HHLD 3CD7A 1FDBA 4ZVUB 2VQFF 5KAKA 3BSOA 4IH7A 4MJKA 2V9WA 4B9VA 4QWAA 2PIIA 2X1GA 1VQ7S 5LMNF 1TVRB 1XNQF 5DQHA 2XNQA 2EKNA 3Q8UA 4WFXA 1MWYA 3NG8A 1UCNA 2AD9A 1OWXA 1HBMA 1OY6A 2JJ4D 2HFSA 4MMOA 3R27A 1UFKA 4WU2A 5J2NB 3RR7A 5KFTA 2DRAA 1TL7A 3MPUB 3HSZA 3KLFB 5E33A 2D74B 2AX0A 4K4XA 3OQ2A 3V6DA 1Q53A 2HK3A 3PVXA 1HFEL 2FYXA 5DDQC 2ZZTA 2R7TA 4C6AA 2JVRA 4XK8C 4DL3A 2ZH4A 1SIZA 1R8HA 4JP8A 1LQ9A 1EP4B 4UQGA 4RL1A 3KUHA 5CXTA 4DFKA 3L7OA 4MAKA 1U1RA 2D3UA 3D0GE 1DTQA 1TZ0A 3SCLE 2VG5A 1U1OA 2LXIA 4H4MA 4NXNJ 2KL8A 5EX0A 5D8HB 3EPGA 1M5KC 4Z2XA 3PHTA 5GAEU 4WFYA 4FP9A 3CC4S 2FZGB 4M5JA 1HWIA 2V2ZA 1HA1A 1V3SA 3P96A 4DG1A 2E5HA 2FUG9 4DZDA 2VPXB 2NSBA 1XMOJ 3LPYA 3ZZRA 3KYLA 4OZJA 4I67A 2HVZA 5HO4A 3OJUA 1VYAA 3Q23A 3CJ4A 2DK2A 2HHPA 2JLFA 1YGYA 3VZIA 2AYEA 3UO0A 1NJWA 3KLHA 2YNIA 4ANCA 2PMZD 3GJQB 3KK2B 2DYAA 2XM3A 3TUZC 4DF4A 4B3TJ 4WK3A 3JSYA 4JI5F 2AZ1A 2IYIA 4LBIA 1S9GB 3TUJC 5HROB 2ADBA 1PBUA 4P2FA 2XNRA 2VB6A 4HDHA 4DMZA 2G0IA 3RB3A 5F8NA 5U47A 4F4WA 5DG8A 1ZETA 1WSVA 3H20A 4LIWA 3THPA 1C2PA 2DH8A 2DPIA 1IKWB 2HBYB 2F8HA 4TN2A 3RAXA 2CWXA 2IVYA 4PWUA 1NJIT 4KB7A 5D4PA 4MKYA 3QRPA 2CQBA 1NSQA 4PQAA 2XMTA 2E5LF 3QT8A 4PUOB 4Y00A 1JLAA 4DV5J 2W9CA 4CLSA 2C2OB 3EE3A 4OZ1A 5IXUA 3W61A 2HFOA 1AFJA 5GMEA 4G1IA 2B9XA 1VQ5S 1ROFA 4USJC 1JQGA 1R43A 2CQ1A 1S99A 2MKYA 2AU0A 2GMHA 1NHKL 2LQBA 1X4EA 4ELUA 1TUWA 5J2QA 2XMVA 2ZBQA 5KTQA 1N32J 2KM8C 3FQLA 3MD1A 5JVGQ 4Q0BB 4ED7A 2AWZA 1S7HA 5EWGA 2OJ3A 1TR0A 2O67A 4A47A 2FLNA 2DGWA 1ITPA 2AJ2A 4U9RA 1WKKA 2VOOA 4IYQA 2JEGA 3PRDA 2MKSA 1SCJB 2XSJB 4JI0F 5K14B 1G2EA 2CZ4A 5CAAA 5LOQA 4FNHA 4HT7A 1IKYB 3PJ9A 2UXCF 2HGNA 4B3OB 4LMZA 1X4AA 4HTJA 5IT9U 1H38A 2H5JB 3DDKA 3HJVA 2VODA 4R25A 2QA1A 2Y0BB 1R8BA 1GXUA 1X4DA 4QZVB 1NK8A 4OZNA 2QC3A 2W7AA 4F4AA 5L46A 1DQ9A 2EI5A 1X9WA 2MQPA 4FXVA 1UETA 1I94J 2HG4A 1YX2A 2CNLB 5JUMA 5AJ3F 2VFVA 4NX9A 3QGPA 1P1LA 1DBDA 1U1MA 1RYSA 3GQCA 1P1TA 2A1BA 2HWHA 3CCUS 1B0TA 4JI7F 1NJXA 4HTIA 4KHPJ 2B8PA 2VQFJ 2FHJA 1M1HA 4Z37A 2W8KA 1Y9OA 4F7VA 3IR7B 1KSPA 1T9UA 3MCOA 5LMNJ 2C3PA 1RT2A 5H1SV 2YNHA 1MN7A 3DLGA 5GVQA 5C25A 3DHWC 4QOTA 5ETNA 5JJBA 1Q5VA 2GJFA 5LXYA 5KFFA 4QYZJ 2XC9A 1U1LA 1RT5B 3SI8A 4N47A 4A8SA 4DR2J 3OTBA 4ZP9A 4O3QA 4I4BA 4QPXA 4RU9A 1BQMA 2XWYA 3RTVA 1V3ZA 5ETVA 1Y0HA 2QT7A 2QMUB 4X4RA 1AFIA 1NM2A 4DX8H 5G0RB 3P5BP 3L4BC 1XMQF 4ILRA 1Z4UA 3D0IE 3E01A 1C0TA 4YQWA 5CZVA 4F3QA 1ZPVA 4CO0A 3BYRA 2OEKA 1OSDA 2J9DA 4FF2A 4NLVA 5D4OA 3OTOF 1VI7A 4JI2F 3BV8A 3SQGA 1H2UX 3J7Z5 1F3VA 2FC8A 2K1RA 4RW4B 2RRNA 4FYDA 2VG6A 4LR7A 2P5VA 4WXWA 3LGHA 3SCKE 1VK8A 3PFEA 3HHNB 2J6SA 3RUBL 3FMWA 2YX7A 2QA4S 3M8ZA 3DMJB 4CLZA 3C16A 2ZH7A 2JFDA 3EICA 2HLUA 3F41A 3B82A 3FK4A 4LT6A 4O3PA 1SV5B 2MQOA 4PQUB 1U0HA 4OI0A 4BS2A 1SJ4P 1SC3B 3T6BA 2J6TA 2LEBA 1DQ8A 4U7UD 1UL3A 1URNA 3M1VB 3MPVA 2OPPB 1T11A 1S1TA 3BSCA 1WEZA 4PWDB 1FF2A 1T3OA 1X7VA 2M70A 3GYGA 5ETLA 1UPMB 3SFUA 3RAQA 3CD5A 4NLGA 1BC6A 4IQXA 4N8OA 3MEGA 2EFOA 1WF2A 4IKAA 3B4DA 3DGVA 1L3TA 1J27A 3GJTB 4NOHA 4YDXA 2RKIA 2KT3A 3RGIA 2AJ1A 4IR9A 1HARA 4PEOA 1EAYC 1IUJA 1NU4A 3OXGA 2HQCA 2ERRA 3CW2C 1SXLA 1FTCA 2E5LJ 4ID5B 4WKRA 4I7FA 4ECSA 2BQRA 3H2UB 3RRGA 3B54A 3SEOA 3H4BA 4KKOB 2R7SA 3BN4A 2NR0A 1IWAA 4JI1J 4JYAJ 3DXSX 4B9TA 1Q86T 1N5QA 1S1XA 1RCOB 1IKXB 3Q24A 1VQ8S 1S0VA 2CPYA 2ZDPA 4F36A 3HFZB 3LOUA 1T02A 2B9EA 5HQ8A 4ZK7M 4QIGA 3CJSA 2DO0A 4WXOA 4DUZF 1XIQA 2PMWA 1YVFA 3DRXA 2JL9A 3KLVA 3Q83A 3MPDA 3TA0A 1FX2A 3QT7A 2A6MA 3H5SA 2BJDA 4USTA 1NK0A 1SQGA 4MK8A 2W2QP 3NLCA 3SDEB 5F8MA 2J7WA 3LWLA 4JI0J 4ES1A 4DUYF 1YZ6A 4PPDA 2GVDA 1E6VA 2WTFA 3I32A 1JJCB 4ZLNA 3KTQA 1S59A 4OJ1A 3N9UC 4ZKAA 5T14A 3DU6A 4ZPVR 4TQRA 1RAFB 1IQZA 2MSSA 5IT4A 3K5PA 4DL6A 1UTAA 2NUHA 2JH3A 4AD6A 6FD1A 2F4VF 3CJ3A 1FRMA 4E0DA 4QYZK 2CNOB 4P6QA 3PYEA 5KFJA 3RBDA 1DY3A 1J5EJ 4XDDA 3TUIC 2G4BA 1VQPS 2DT9A 1D3WA 3FSYA 1ZOTA 3PW4A 3P49B 4QU7A 2HPUA 3VCDA 1PJ5A 3EZ5A 3KK3A 1RTIB 4JI7J 3M6UA 1KONA 1I51B 2EFQA 1WC1A 3A3OB 4XAKA 2MKIA 2YWFA 2BANA 3D6HB 4FBUA 3DLJA 3RB4A 3LAKA 1HBOB 1IXKA 3H8YA 3KJVB 3HHLB 1YJWS 1RT6A 2DNMA 3J7AN 2OMLA 5KFIA 2JNJA 1M0SA 5HN0A 2MLYA 1M5SA 3VV2B 1S1UA 1ZA2B 3GE9A 2K8GA 3W64A 3LW5C 1VQMS 3K2YA 1T0TV 1U26A 2KRBA 2Q79A 1MW7A 3D54A 2C2DA 3KNGA 2FJAB 5LM7E 3TRGA 2E1PA 3ZZOA 1XMQJ 2R7OA 4NLRA 1T05B 3QYYA 1U2FA 4NLXA 2V2QA 4YR2A 3Q0AA 2N4DA 1N5YB 5HBMA 4UQTA 3C14A 3ETOA 1FNMA 3CJKA 3OL6A 3PFOA 2DB1A 3DOLB 3ZNUA 3LH2S 3K8VA 4ZVSB 5ETPA 4U96A 2DGSA 2LKZA 2WVFA 3K8WA 4J9MA 4K8RA 3CDBA 5A0YA 4USKA 2YWEA 2NXJA 3PR4A 4DR1J 3CD6S 2GMLA 5A8WA 1PO6A 4LJMA 5DETA 2RS8A 1VC6A 3HDSA 4JI6F 5AE1A 1C0UA 1F5BA 1WELA 4DF8A 4DOZA 1HPZA 2DEIA 2BQUA 2FJWA 5CABA 3ZTPA 2VHGA 2NYIA 2JWNA 4EO8A 4QWCA 3Q8PB 2XZDB 4AQYF 1L3VA 2MTLA 2QG9B 4PKDB 1OY8A 1YRTA 3EGZA 2YH1A 3KG1A 3MPWA 3W63A 2C2NA 2K3KA 3PYFA 2AX1A 5EGYA 4MFBB 4XIUA 1M5VC 4U8VA 2CJBA 4EMDA 2Q6CA 2DPJA 1S6UA 3NS7B 3UI3A 2IFXA 4ZVFA 1UJ6A 4DU7A 2UUBJ 1OYDA 2VIHA 2M2BA 2R2UA 3O5TB 4DI6A 5L9NA 1TFYA 3H2LA 2VKZG 2BW2A 3KK2A 2AGPA 2DXFA 3DHXA 1VBZA 4E8UA 3RRHA 3LALA 4FYYB 1P9QC 4A8OA 2RDDA 3PX4A 1WEXA 4IH6A 2P6SA 2KFYA 2JLGA 1RT7A 3KWMA 3MMCA 2E1CA 1ZAXA 3HXMA 1NB7A 1Y10A 3JTNA 4P10A 4EI2A 4F4YA 4NLYA 3O3LA 1Y5IB 4OI4A 4NE9C 1ZZFA 3FBCA 2L9WA 1HWUA 1REVA 3DC2A 1CC8A 3G71S 4OHWA 3IRWP 4TY8A 5T7LB 4ES2A 4DUZJ 4DPUA 4MH8A 5D77A 5HJYA 2ATCB 3OD2A 1NH8A 2IM1A 4HACB 1MNEA 2MZJA 1S76D 2ATLA 4DPYA 1C1BA 2B4PA 5LSOA 1K8AT 2F8EX 3BKTA 4HR2A 2UUAF 1SH3A 3ZZYA 2MKCA 2RQ4A 4RNFA 4DQQA 4DUYJ 4YS2A 1K0VA 2L9NA 4UUWA 2MY8A 5LL6d 1ZAVA 5L9XA 2WAQD 4A8WA 2W4CA 1LXNA 3RBZA 2YX1A 3AJ1A 1RJJA 4H4KC 1VQOS 3C6UB 2B9WA 5LJ5Y 3I56S 5KT3A 4N7TA 1E6YA 3OSPA 2WBRA 4DV1F 1HQEA 2AJ0A 2BE9B 2OIHA 2OTJS 4NXMF 1HNWF 2HFVA 2CZ9A 2HAFA 2F4VJ 4GVBB 4NWBA 2DNQA 2WONB 3RJMB 3GU0A 1CJTA 1CEZA 2UU9F 5D0EA 2YH0A 3EVOA 2W01A 2R7QA 1RHKB 1EQ0A 5DM6Q 4BHQA 1CJVA 4DV2J 3HT3A 3CB4A 3HSJA 2ROPA 1PBAA 2Y0SD 2QA4G 3PX6A 5IWAF 2RMLA 4I64A 2C2KB 2BE2A 1YBUA 1QAYA 4H4OB 3T9ZA 5DZ6A 3G8TA 2NPFA 2YKMB 5E3CA 2IA0A 4JI8J 1NLKL 3AJ2A 5KT5A 4DN0A 3K5NA 3G8QA 3N6MA 1BMQB 1JLCA 1SUQB 2HSEB 5F9NA 2IAJB 2JRSA 2EPIA 1N56A 2R7UA 3W2WA 3CTRA 4R8UA 4NLPA 1AT1B 4IQMA 4IFVA 4ED3A 2BM0A 2V2VA 2B3TB 2C2EA 3EDRB 4IG3B 4C8OA 2BYCA 1VQNS 3MFHA 4C7QA 1S6OA 4WYWA 2RSQA 4ZJLA 1R27B 4Y3CA 3CCJS 3PCOB 3ET6B 1WACA 3CJRA 3E8OA 2FJBB 2FHJD 1WF0A 4OHVA 1ZM3A 3PYDA 2CQ3A 5I3PA 2HS4A 2KO1A 2XY7A 1X4CA 4RPFA 3ONQA 2BACA 4QYRA 2BDPA 1RTHA 2VONA 2AEMA 1N48A 1RT5A 1FKAF 3HULA 3MEDB 4CLPA 4KC5A 5E7OB 4ZP8A 1RT1B 4MK9A 4WCEQ 1MWQA 2J9DE 1X0FA 5L1JA 1JKHB 5F8IA 1RT3B 2FJEB 3UNGC 3D4JA 2DNNA 4XTTA 1HBNA 5HP1B 1FRKA 1U47A 1IBMJ 1NKBA 4OYZA 2QFIA 4C11B 3D0HE 2MYFA 1RI7A 2BA9A 5ETKA 1QSYA 1BQNA 2KU7A 4DSJA 1HNIA 1GXTA 1V5IB 1UMJA 1TKTA 4JI6J 4P71A 4M5GA 2A6OA 2O5DA 1S49A 2P2CB 3GIRA 1VLYA 1DFDA 4KYZA 2LECA 1YBTA 1HWKA 1KVKA 3C2PA 1OY9A 1UVLA 3W7BA 1HQUA 4AQYJ 4DJBA 1IJEB 1OPZA 1MROA 3D66A 3VQSA 4FF4A 2OSQA 1YRUA 1IR0A 3T1HF 5K8OA 5KT4A 4RW4A 2Q66A 2IRYA 2XBPA 4OX9F 3ILIA 4LF9F 2QO3A 5CYQA 3ISZA 4R5PB 2C3MA 2CPEA 3R1LA 2RNEA 3EPIA 2RVJA 4TY9A 1SKRA 2VPWB 4Q45A 4KPCA 1T9YA 3W5XA 4KGVB 4K4YA 1C1CA 3QGGA 4DBQA 5KG5A 2RHSB 3W5ZA 4EYIB 2M8HA 1LWEA 4B9NA 2XCPA 3BSNA 2VJUA 3AXKA 3CNQP 3H25A 1LWCA 1FFGB 4NLTA 4CLYA 3M1VA 5HQLA 3OL8A 2OKQA 1X60A 4F26A 3NBPB 4F3MA 2QX0A 4PWDA 1WOPA 2KB2A 2WSFC 4L6V3 2FVSA 4P2XA 5F3TA 4ECZA 1YJUA 5ETQA 1TP7A 2W8LA 2O01C 3O6QA 3DGPB 1H2TZ 3GIIA 4DR7J 2FPHX 3V4IB 2CDQA 3W8GA 4YUDA 4JV1A 3JAMU 3TUPA 4GKKJ 2VOPA 1S0MA 3CE8A 2WW4A 4ZN3A 3HZEA 4BDPA 2GIRA 2JEFA 1R0AA 4O3NA 1NMEB 1RAHB 5D0GA 3FKBA 4NA2A 3QGIA 5A6WA 4ID5A 2DIUA 4DV6F 1X8DA 4C8KA 2HHVA 1KR4A 4GO5X 1RTDA 4KR0B 2W24A 4NEZA 1FXRA 2CPFA 2YQ0A 2HZVA 3HHKA 2UUAJ 2ZNYA 1SH2A 4YHHF 2IJFA 2LXFA 3R2DJ 1H7XA 3I9V9 4ZLJA 2DRDA 1IVZA 1FFWB 5L1LA 4FF3A 1U24A 3MMBA 3HHLC 4FKXA 2CVEA 3MR2A 2CG8A 2KZZA 1D0EA 1OS5A 4TU8A 4DV1J 5RUBA 4ZVOB 2KHCA 4HEA9 1URRA 4L75A 2FZKB 2NXNA 5IFMA 2BJEA 2HNYB 2LP4A 3M4XA 3F0NA 4QPTA 3UFCX 1HKAA 1KVJA 2YNFB 2G9OA 2UU9J 1VQ9S 1UPPA 3MM5A 3TAMB 1LW2B 3M8PB 3HFVA 5KFAA 2HHXA 3E3XA 5J2MB 2K7KA 4EYHB 5J2PB 4OL8A 4X65F 2JX2A 1SL0A 4PG5A 2XGPA 4ZPWR 3TJ9A 4LFBF 3J81Y 1KWMA 1VRTA 4OMFG 3NS5A 1B0PA 2H9ZA 1JB0C 1N36F 1K0TA 3W2VA 3GCWP 2HVEA 2ZEJA 3HD1A 1AW0A 5HLFB 4RO0A 1TKXA 2FVCA 1DTTB 3MAAA 1RSCA 4A46A 4ZLPA 3BGLA 4F0KA 1R6VA 4ZCKA 2IVFB 3ZZPA 2H4WB 3R7BB 3WIVA 1VRQC 2ZKUA 4MKBA 2HHHF 2PA8D 2WRMA 1M5HA 3LWMA 1D09B 5I3UB 4TNOA 3L95X 3EUNA 1IR1A 2JFKA 1RTIA 3IRXB 1WI8A 3HM9A 1TU0B 1UJ4A 1FCAA 4M63A 4GO7X 4ZVTB 2E1MC 4DCJB 1HI1A 2FC9A 2R7WA 4JOUA 4UOHA 1MSWD 2L3MA 1UVMA 1NJYA 5D0HA 4FN5A 3HP6A 4MIAA 2BOAA 2R8IA 4HDGA 4W92B 2DISA 7FD1A 1TV6A 4AT1B 1WD6A 4OZ3A 1SH0A 2U2FA 4RNNA 1KFDA 2W2MP 2HMIA 8RUCA 1Y3KA 3J81U 4ATNA 3WX8A 3M8YA 2Z2LA 2XLJA 1GFWB 4YMEA 3CIZA 1S0OA 1RYRA 1FRHA 1Y5NB 2XYGB 1YI2S 5K5MA 1HNVA 1I5OB 4HLBA 2FVQA 3RW7A 3MUMP 1HBMB 2VASA 1T05A 2XYPB 4I68A 5HVHA 1TL7B 2XMUA 2QL5B 4DZ6A 2UUCF 1IM6A 2BRLA 1RWOB 2DR8A 2RHQB 2LDYA 3V4MA 4KE5A 1RGVA 3T1AA 5CD4H 3THTA 3TJ8A 4RW7A 3EX7B 3V6DB 2BJ8A 5B0DA 4OI3A 2HRTA 4LF5F 5D78A 2FB0A 2WSEC 2J5AA 2DCLA 3G2XA 3KJNB 3M32A 4ICLA 1PKUA 2FHOB 4KHRA 1EZZB 2UXBF 3QMQA 1PC4A 4KRWA 4LF9J 4OX9J 2CJQA 5K9FA 2HNZB 1WC5A 1N4LA 2WB4A 4MYTA 2WVBA 1SC6A 2VG5B 4PWWA 2D3O1 2VC1A 2VBWA 2FZCB 1JWWA 1WOSA 1FNOA 2PA3A 1FRLA 1HYSA 1D8ZA 3CC2S 2Z4PA 3I5CA 1FJ7A 1RQ0A 2KKHA 3L3CA 4LF7F 2DNKA 4DG1B 3VWSA 2HAIA 4HHHA 4OJHA 4B17A 1TKZA 1FVQA 3C15A 3KJQB 4A4JA 3TX8A 2E5JA 4DQIA 1H98A 2M5YA 1VCTA 1Y4ZB 3V6HA 2L48A 4ZIWA 2NS1B 3A8JA 3OR1A 2ZHBA 3T5KA 1HNXJ 1V9OA 1CPZA 2ZUAA 2VJVA 1H7WA 3KLHB 1VJQA 2YNIB 2X3DA 2C3OA 4D3HA 2X1AA 3C46A 4X62F 3THVA 1WTFA 2WBMA 2CJAA 2A2CA 3QRQA 4LRFA 1LK5A 2JHEA 2Z58B 4ZLLA 4ZCLA 3I31A 2V34A 2HGMA 1UW9A 2FY1A 3OLBA 4K0KF 3TEGA 2X1FA 2KXHA 2RQCA 4F50A 2U1AA 4G65A 3EGWB 3TVKA 2NYHA 6AT1B 2RF2B 4ZS6A 3K5MA 4M5DB 2BE7D 5KT7A 3M7VA 4DQRA 4YHHJ 1OPIA 5KFWA 4Y2MA 3M2VB 2G2ZA 1FT8A 4JI3J 2Y1JA 2KTQA 1AZSA 4LR9A 3CT9A 3T3FA 5B0BA 2ACYA 1JLGB 3R5AA 2B51A 4LRCA 4WK1A 4ZJQA 1HHTP 1KHVA 4G1QA 1JLAB 4RJVA 2W9CB 2E9ZA 3LAMA 2RE1A 1O8BA 1N88A 4ECRA 3N4WA 3AODA 3M30A 4FPRA 2DR5A 3UD5A 1D8YA 3GJSB 2NLWA 1NZAA 3WDOA 3VR1A 1ZTTA 4URGA 3MEEA 4FVMA 2B8QA 3JQMA 4CLKA 2CQIA 1GXLA 2HGLA 2XTJP 3ZZ0A 2ZE2A 3D68A 5J2QB 2HS0A 3Q86A 3RB0A 1RAAB 2D1CA 4X65J 2XI3A 1T03A 2R8JA 1FVSA 2EFNA 2R8HA 4QJVA 1YSJA 1KTVA 3OTDA 1JXEA 4LQ9A 2OPQA 4ZIVA 3RBEA 4AL5A 1TUVA 3JXOA 2UV8A 4RZRA 1IBLF 3FUYA 2V6AA 3AD7C 4LVOP 4USVA 4DN9A 8ATCB 2WONA 5CYMA 3O1LA 2AKWB 3WQPA 1O6XA 4LF4J 3D3BJ 4PG6A 2F4FA 2XZWA 3MOZA 3TR5A 4Q8FA 1EKRA 3KK1A 2HHHJ 2CJXB 3BB5A 3A8IA 1TELA 1CS4A 1GTHA 3I6PA 3AT1B 3IM8A 2QSFA 5KFBA 4DWIA 3EXCX 5GAGI 1QY7A 4IG0A 1QTNB 1K1SA 3AFGA 2JEIA 2RIJA 4J9SA 4Y2KA 3V2UC 3SCJE 4C3LA 3LA0A 3NP5A 2ZM6F 2ZC3A 1S0NA 2XMJA 3ITHB 3EMTA 3MECA 1U1NA 2Z57B 4DV4F 4IDKA 1UJ5A 2MQ8A 3DI6A 5E5NA 2EW9A 2XLKA 3V6JA 1U2RA 5KFCA 3ZTOA 5E3QA 3P4UB 1N33F 3M6WA 1UVIA 2CZVC 4NLUA 3RR8A 1S9EB 3MI7X 3X3UA 4J9LA 3OTCA 5KG0A 1FDDA 1RT2B 1FJEB 4URSA 1TL3A 4P7TA 2YNHB 2ZBCA 3DLGB 1IBKF 3TWZA 1UVKA 2IM0A 1NEEA 1A9NB 4P52A 5C25B 2D3OR 3HO1A 3G9CA 1OSCA 2UVVA 2M8DB 4ETXA 1VISA 5BYSA 3EGNA 2BKPA 2HFNA 1U8WA 4I2QA 3QIPB 4FXDA 2PO4A 1L3UA 2FJXA 2MPUA 1RHUB 3M6VA 4AUKA 2Z30B 5BJRA 1BQMB 4ECQA 1R8AA 4LF5J 3D9BA 2ZKTA 3A13A 2VUGA 4O44A 4URQU 4QBUA 2CWKA 1NPPA 2V4QA 2I2YA 2UXBJ 4I6AA 1QJHA 3E01B 3JQJA 1PYTA 1C0TB 2V50A 2DH7A 1REGX 1WG1A 2DY1A 1JJ2R 3N79A 4LQ3A 2ASLA 2FDNA 3NCRA 3SQGB 1Y7PA 3ENAA 4KTQA 3PW0A 3CXCR 2K1RB 2VG6B 3EVWA 3Q8QB 3UN3A 3J80U 2BV3A 5KG2A 1JLEA 1U6ZA 4OX7A 3ICLA 1VRUA 3BGUA 2XQCA 3C16B 4K4WA 3ENWA 2ZHAA 2CPDA 2R8KA 2Z2YB 3M2UA 2F9DA 4DLGA 3IC1A 1SJQA 2GS8A 3TA1A 2Q43A 2HBRB 3BPSP 1U0HB 5FIIA 4NLDA 4MKVA 1VJWA 4X62J 2IJNA 4DSFA 4OI2A 4OYAA 1S1TB 5CCLA 4TQSA 4DL5A 1R89A 4K0KJ 1N0VC 4V19X 4QIFA 3TX0A 4C8MA 1S97A 1DRZA 4H4KA 4KY3A 1CBKA 4KPYA 4DXLA 1JX4A 1ZM4A 3MEGB 2QA2A 1G7CB 4TVAB 1KLMA 4NPOA 5B0FA 1JLQA 2FIUA 2CJ9A 4QR2A 2RKIB 4CCHA 3BKUA 5KFXA 2CPZA 2QLBB 4O0NA 1IKVA 1U6FA 3CPWR 1X4HA 1N6QA 3CCRS 1EJ7L 1NBEB 1S57A 5E3RA 1RWMB 2DVIA 1WKLA 1ZBTA 4NCGB 4I7FB 3R6GB 4CM2A 1YRXA 1T9TA 3FZBA 4QU6A 2YKOA 3N5BA 4C48A 1FWPA 3JSBA 2ZFHA 1T95A 2MZSA 1KNZA 2XMWA 4X66F 1S1XB 5HMZA 2R4FA 1RWUA 2J9EA 4RU2A 2AV5A 1RZMA 1S77D 3BH6B 1YZ7A 4RX6A 5FDLA 5LSRA 1B0VA 4TYBA 1VBXA 3KHRA 4DFMA 4OZ2A 1Q4RA 2X51A 2MZQA 4S0MA 1T3NA 1GX6A 2M88A 5CQGA 2EC2A 4LFAF 4DR6F 4C2MA 1U1KA 3TAQA 1SL1A 4N5SA 1J5OA 4RNHA 4EUVA 3TEHB 1IBLJ 2K3IA 2HVIA 3KMQA 1PCAA 4WE1A 1HHSA 2GVDB 1E6VB 5A76A 1VBYA 3K0JA 2OEJA 1T9WA 3MHYA 3OTEA 4OFZA 4NYPA 1FJGF 1LW2A 5E3AA 3OVBA 3QSYB 1UEVA 3TW0A 2CIMA 5D3GA 2VDHA 5J2MA 3R6LB 3NL0A 4OZLA 5K8MA 2YX4A 2EWHA 1TK5A 4OI6A 3R7NB 1LFWA 1WOOA 2MKKA 4B3RJ 4ES3A 1UKUA 3MCSA 4IRCA 1N5SA 4NA1A 2IIHA 4CNYA 4RBUA 1UVNA 4DV4J 4U6PA 3HMJG 3DLLQ 3AOCA 4N76A 3BSAA 5HK4A 3DOMA 4A8QA 1FHTA 5GMKa 3HVRA 4A8MP 1NKEA 3CSKA 1WI6A 4IOCQ 1YK9A 2BANB 1R8CA 3DN9A 1NUEA 1TL1A 2VPYB 2HVDA 4NMXA 2ADCA 2ZJRQ 4QR0A 1RT6B 3D1QA 1IBKJ 3QAEA 4CO2A 4C8ZA 4NZ6A 1YQHA 4RKUC 2ZBPA 1EX8A 1S1UB 2J76E 4B08A 4F02A 3A4TA 2P9EA 3CJ0A 3QNWB 1Z1ZA 3DYAA 4KH1B 5LJ3Y 2D7SA 2X7IA 3NMAA 4O3OA 2UUWA 2BVZA 2Y1LB 5J1PA 1FD2A 4OLPA 2RD5C 1TK8A 2GO8A 4USHA 2IMWP 2NXUA 3CDUA 1PGZA 3G96A 3VGTA 5ETRA 3RZAA 4WPAA 3AD8C 3PW2A 2QLWA 2HIQA 3DRPA 3NCPA 3PZPA 3MM6A 1FE0A 3SSSA 5HBMB 3GP9A 3WHIA 3C14B 1U49A 4BCAA 4AXIA 4OZ5A 1SKUB 5F0UA 1RWNB 2RB7A 1D9DA 1HD0A 3CJKB 2QSWA 2MY7A 3O8WA 3IO1A 2DITA 3OXLA 3KUGA 2JOQA 3T9NA 1NDLA 3PACA 3SZ2A 1NK5A 1KQSR 1HR0F 1MLAA 3I9ZA 3C19A 4DQSA 3CCMS 2MKJA 2I5JA 1Q7YT 3HCXA 3T5HA 5DJBA 2BZ2A
chains in the Genus database with same CATH topology
5C5JA 5AE3A 5A0YB 1UA0A 1S76D 1AUDA 2ATLA 4TLRA 4IG3A 5IS2A 3LGMA 1FA0A 2DTJA 1DJ0A 4DPOA 5F8JA 1C1BA 3QZ8A 2KVIA 3MM8B 4WTYA 2E7WA 3OHBA 2B4PA 1L3SA 5LSOA 1K8AT 2F8EX 2YKNB 4ZCMA 1RTJB 2BUNA 5A8WB 4F4XA 5L38A 4W90B 4O23A 2EK1A 3Q8SB 3BO4A 1H3DA 4ETZA 5KFQA 2UUBF 2UUAF 1SH3A 4Y2IA 3ZZYA 1WG5A 2MKCA 2RQ4A 5I4MA 2IC3A 2A18A 1T8EA 2XMMA 1C0UB 4RNFA 1HPZB 4DQQA 3JTPA 1TAQA 1FDAA 1FEEA 2BXJA 3PO5A 2HNZA 4DV3F 3I4HX 3GFXA 2J0XA 1K0VA 2L9NA 4LVNP 4UUWA 2MY8A 2OPRA 5LL6d 1ZAVA 5L9XA 1SB6A 2G0CA 3FJ2A 4CT9A 5DGBA 4RW8A 1MU2B 2WAQD 5AE2A 4G1PA 4A8WA 1S1WA 5CYJA 2W4CA 1LXNA 5EX3A 4BWJA 3F73A 5DLGA 1S79A 2LQ5A 2YWGA 4M8LA 2YX1A 3AJ1A 1RJJA 4H4KC 1K9MT 2J7UA 1VQOS 3C6UB 4CTAA 1N5TA 2L9DA 2ZOMA 4X4VA 2B9WA 5LJ5Y 3UWTA 1P6TA 3QAUA 3I56S 2OO4A 3MEDA 3KNAA 1NHUA 1IM4A 4A48A 5KT3A 3J7YI 4BWMA 4GC6A 2WCXA 3LP0A 3MEKA 1RT1A 4Y34A 4DHVA 2HNDB 1S4FA 3JSMA 1JKHA 1E6YA 1S6QA 3OSPA 2WBRA 3I4PA 4FZVA 3DLBA 4DV1F 1HQEA 1VS3A 1RT3A 4WFZA 2AJ0A 4ED6A 4UY85 2OIHA 2R7XA 6FDRA 2OTJS 1TL1B 1FO1A 1XWLA 3NGKA 4NXMF 1HNWF 1Z2LA 1FRIA 2FLLA 1QAIA 2Y1RI 4ZVEA 3M8QB 3I5BA 2MZ1A 5HP1A 3VAHA 3TNVA 3PDNA 3GV7B 2PI5A 3BF4A 2RILA 4NWBA 2DNQA 2WONB 4C11A 3GIMA 1TQLA 3L09A 3CCQS 4EBDA 1XR5A 1U1QA 1CEZA 2UU9F 2YH0A 2G1DA 5FLXY 4IFYA 2R7QA 1LFPA 3H40A 4FNIA 4RW6A 3SCIE 2JZ5A 2XWXA 1JLBA 4OJ3A 3H2VE 4IR1A 5DM6Q 4BHQA 2CPIA 1S9FA 3DYAB 3QIDA 1N8RT 3GZ7A 1Q78A 3HT3A 4UY8T 4I1TA 2ZD1A 3CB4A 4OLOA 3DU5A 4YDDB 3PEHA 1SKWA 2ROPA 4DV7F 2XULA 2DNHA 4JBCA 4FBTA 3PY8A 4O3SA 4OX8A 5GADU 1U09A 2Y0SD 4PXEA 2QA4G 3QJPA 4ECXA 5FJ4A 2ZITA 3MMAA 3ZFVA 3PX6A 4CT8A 2OSRA 3PJXA 5IWAF 3NGDA 2RMLA 5CHCB 1RA7A 4I64A 2EFGA 2UXDF 2R2TA 2BE2A 2GMJA 2C3YA 3LP1A 1QAYA 3UQSA 4H4OB 4QIWD 1C4AA 2WK4A 2ZOGA 1RT4A 4HT5A 3T9ZA 1SQEA 3M9MB 2VV5A 2CKWA 4F4KA 2C3UA 4KAIA 3G8TA 2NPFA 2YKMB 5B0CA 5E3CA 2GCFA 3MUVP 2IA0A 1GX5A 2VBYA 1K1QA 2QRRA 5E0OA 3VZHA 3AJ2A 3DRPB 3US5A 3TI0A 2B4VA 1Q8IA 4IOAQ 3MM6B 5KT5A 1RT7B 2A2DA 3DOKA 1HMVA 3MMCB 2HW3A 4FXWA 1CC7A 4DN0A 3K5NA 5HL7Q 3G8QA 4DL2A 5KG7A 1XR6A 2KI2A 3M9NB 4R5PA 2RF2A 4WIIA 1FRJA 3OUYA 3N6MA 1JLCA 1F5CA 1SUQB 3KMSA 4M5DA 4NXNF 1CQMA 2E44A 1YG0A 2OD6A 5F9NA 3R5CA 4C0BA 1YJTA 4TU7A 2IAJB 2JRSA 2N4CA 3PM9A 2EPIA 2KJVA 3LQVA 1N56A 1REVB 4HHJA 1XN9A 2E5IA 2R7UA 1QTMA 3CC7S 3M2VA 3W2WA 5GADI 3CTRA 4R8UA 1S6PB 4NLPA 4TY8B 5KFGA 3Q2TC 2EVZA 4IQMA 3LP2A 3QLHA 4IFVA 4ED3A 2KFZA 2BM0A 4P7VA 3OV7A 3PHEA 4ZP7A 2EG2A 1JLGA 1NNDA 2OPSA 3IGVA 4TKTA 1B7FA 5DM7Q 4CIOA 2I5JB 3G6ES 2B3TB 1FXLA 2C2EA 1XMOF 2GO9A 2ZH1A 2F3JA 2VG7A 1BGXT 5MLCV 3PW7A 4IG3B 4C8OA 2BYCA 4CH1A 1VQNS 3MFHA 2GGPA 4C7QA 1C1BB 3NBPA 1S6OA 4WYWA 4K4TA 4C3KA 2RDJA 2ASDA 3I0RA 2CYYA 2B7BB 4ED0A 5J1EA 2RSQA 1JIHA 1YJ9S 4AXJA 1R27B 4DS5A 2VL1A 3F44A 3H98A 4Y3CA 3DM2A 3CCJS 1X5SA 2EK6A 1WACA 1QSLA 1FKPA 2IC3B 5E3PA 3E8OA 1BY9A 5KFOA 3D2WA 2FVPA 2FJBB 2FHJD 1HW8A 1WF0A 3PO4A 3E51A 4OHVA 2HHSA 1ZM3A 3OHAA 2CQ3A 3IN5A 2ZZNA 3OFHA 4I6WA 2OPRB 2HS4A 3GFZA 3CD0A 5I3PA 2GW8A 3DGPA 2XCAA 4LIRA 4DV2F 2CRLA 2KJWA 4RW8B 3H5YA 3SYZA 5IM0A 2IM3A 2KO1A 2FHKA 1VIXA 1Y5LB 2HWTA 2WB1D 5BYQA 2XY7A 3TAPA 2RQKA 1X4CA 2XI2A 5IQQA 3V4IA 2R7VA 2DGVA 4J5OA 3CCZA 3ONQA 2BACA 2LYVA 4QYRA 2BDPA 1RTHA 1FNXH 4Y0FA 4YP3A 2B5JA 2XB2D 4AL6A 2VONA 4CTAB 1N48A 1N52B 4ECYA 1NJZA 4K2XA 1JXLA 1RT5A 1FKAF 2J0SD 3MEDB 3GFHA 1G1XA 4KC5A 5E7OB 4MKAA 3LP0B 4ZP8A 1RT1B 4MK9A 4WCEQ 2VZ9A 2J9DE 1X0FA 2WSCC 3JSMB 1JKHB 1E6YB 1S6QB 3MFIA 5L1JA 5F8HA 4J9PA 2GQ2A 3GYNA 3NMRA 1HQEB 5F8IA 2OH2A 4Q8EA 1RT3B 2FJEB 3OL7A 3V81A 4LF8F 3UNGC 4CI0B 3RB6A 1GNKA 4QWEA 4JI8F 2VFUA 2DNNA 3C66A 4X4SA 3U1LA 1QAJA 1HBNA 5HP1B 1FRKA 2FLOA 3D28A 1U47A 2RRAA 2ZNZA 2V5HG 5LMUF 1NKBA 1XK8A 1IN0A 3VTIA 3M9OB 4J9KA 5ADZA 2JC1A 1P27B 2LXUA 4C11B 1ZTWA 4ZPBA 3D0HE 2MYFA 1RI7A 2E66A 3U02A 1TAUA 1FK9B 2BA9A 2ZHOA 2YQ3A 3IR5B 4Y28C 4XPEA 1QSYA 3DLEA 1BQNA 1P8GA 2KU7A 4IFYB 3BJYA 4HYKA 4X4QA 2KG1A 4TLQA 4DSJA 1HNIA 1GXTA 4RW6B 4WZQA 1UMJA 5B0EA 3K5LA 2MKHA 1TKTA 5A8RA 1JLBB 1FE4A 4JV5F 2O5DA 3QZ7A 1S49A 3UR3C 1SJRA 4DR5F 2ZD1B 1ELOA 3ENQA 2VA3A 1VLYA 1DFDA 3SV4A 2UUTA 4YB1P 2V0NA 2Z0GA 2MZRA 3LGNA 3PNIA 2CPXA 4PR6A 2LECA 1HWKA 2OFGX 4DL4A 2I38A 3MMAB 3C2PA 1UVLA 1FTRA 3W7BA 1HQUA 2CQ0A 1KS2A 2VQEF 1I1GA 1DLOA 4OX6A 2Y1IA 1BLUA 2BE2B 5F0WA 5KFEA 4DJBA 3MPYA 2OLWA 3AB2B 2V8HA 1IJEB 4DV5F 1RT4B 2C2RA 1OPZA 1BQXA 4LSNA 4J9NA 2K7JA 1MROA 2SXLA 5KFNA 1Y3JA 3VQSA 4FF4A 4EFAC 2DNPA 3UD4P 2OSQA 1YRUA 1IR0A 5A8KB 3P6YC 3VAGA 3T1HF 2HVHA 5K8OA 5KT4A 3F56A 4QWDA 3FGVA 1WHXA 4RW4A 5KFDA 5F3ZA 3CCES 2KH9A 2AYBA 2Q66A 2GJIA 3DOKB 1HMVB 4I56A 2IRYA 2XBPA 3CGIA 3LF0A 3MUTP 2D9PA 2HS3A 2ZH9A 2HNYA 2RRBA 4OX9F 4LF9F 1FEHA 2ZH6A 4ED8A 2Z2MA 2QO3A 5CYQA 1S48A 3ISZA 1TVRA 2FTRA 4C3MA 1SIWB 4R5PB 2C3MA 2CPEA 2P6TA 3OUYB 1XMBA 1JLCB 3MM7A 4IOBA 3R1LA 4J9RA 3WC2A 2YNFA 3AQOA 2CG4A 4YR0A 4HI2A 2RNEA 4PXBA 3GV5B 3EPIA 3TAMA 2ALZA 1QLNA 2RVJA 4TY9A 2B56A 2M0GB 3M8PA 2W7OA 1WHYA 2VPWB 3FEXB 4Q45A 3CCSS 1SKRA 2YKAA 4RNOA 4K4YA 3KLEA 2E7XA 1UWBA 1C1CA 3QGGA 3W2WB 4IRKA 2DNOA 4DBQA 3OFGA 4R8UB 4KHMA 5KG5A 5J2NA 1NAQA 4Q44A 2ZJQQ 1DURA 2RJZA 4EYIB 3LP2B 3QLHB 4IFVB 2M8HA 3MF5A 4ZHRA 4EU0A 3ITHA 1LWEA 2UVRA 4B9NA 3KLFA 1OIAA 2JSXA 3RU0A 1VQ6S 5J2PA 3T1YF 1NK6A 4NRTA 1I6JA 1N32F 2XCPA 2OPSB 3IG1A 3BSNA 3H25A 3K57A 1LWCA 2E9TA 3HFKA 3B8HA 4FS1A 2RDIA 4NLTA 3M1VA 3TVZA 4ECTA 2VG7B 1BD6A 3G6VA 3OL8A 2OKQA 1OQ6A 1LKZA 3ISND 4R0JA 4F26A 3HHEA 3NBPB 3BQ0A 1IBMF 4OHXA 2XHWA 4F3MA 2X3GA 2DGUA 3ISNC 3QWUA 4PG4A 1QUPA 2AJFE 2KB2A 3I0RB 2EBGA 5HI7A 2L41A 4PWDA 4WZMA 5J1EB 2ZH8A 2WSFC 2E5GA 4L6V3 4A8KA 2FVSA 2JC0A 5B0AA 3DM2B 1OQ3A 3TARA 1QM9A 3GR0A 5CA5A 5F3TA 1S9EA 3PRBA 1FKPB 3M2RA 2I1RA 4ECZA 1YJUA 5M2RA 4CH0S 2HQ3A 2KT5A 5CCMA 1TP7A 1EP4A 1S72S 2W8LA 2O01C 3ZC4A 3EXYA 2PE8A 3O6QA 1H2TZ 2I0XA 2J6UA 3GIIA 5IM0B 3OFEA 4F4ZA 3CMAS 2FPHX 2MMYA 3V4IB 2CDQA 5HLFA 2NPIA 4YUDA 4JV1A 3KK3B 3DNCA 4OV1A 1DTTA 4C4WA 1RTHB 1G3OA 2VOPA 1S0MA 2MQLA 2RUGA 3CE8A 3RW6A 2ZJPQ 3HHDA 2ASYA 2PC6A 1X4BA 2DGOA 4KSEB 3T6JA 1VQ4S 3AA8A 3HZEA 2RT3A 2VBZA 3SSQA 4BDPA 2QIFA 4L72B 4BBYA 2GIRA 2JEFA 1R0AA 2FJVA 1V3RA 2NZ4A 4O3NA 2KFNA 3QIPA 2VKRA 1WTBA 4MIWA 3HI9A 1DZ5A 1GT8A 5I3UA 2JVOA 2AF6A 4NA2A 3QGIA 1HBNB 3SSRA 4ZVGA 5A6WA 4HKQA 4ID5A 2DIUA 3OR2A 1U6BA 4DV6F 3C3LA 1X8DA 2IRXA 3IRXA 4C8KA 2HHVA 1KR4A 2DNYA 3CWJA 4GO5X 2MDAA 1RTDA 4KR0B 1NH7A 4FF1A 2W24A 3DFEA 3UPFA 3OVSA 1YJNS 2YVSA 1FXRA 5KFHA 2CPFA 3DLEB 1BQNB 3TQ1A 3BR8A 2GA7A 2ROEA 1D1UA 1HNIB 2XGQA 5GAGU 2XS2A 2WOMA 3HHKA 1TKTB 5F8LA 3NCQA 5A8RB 1I94F 2ZNYA 1SH2A 1F9FA 4YHHF 1ZZNA 2XG8A 2FD2A 1FRXA 4RWWA 2IJFA 2LXFA 1O0PA 4KV8A 1JLFA 3R5BA 4NLWA 3NWGA 4NLQA 3DXBA 4NLOA 5KG6A 3N01A 5KG4A 3PIPQ 4K50A 2CFXA 4YFUA 4PG8A 2M4MA 1H7XA 3I9V9 4WFAQ 2MQNA 1HQUB 1DLOB 1QVFR 2LA4A 5L1LA 2MHEA 4X84A 1G6BA 1U24A 4RLEA 3HHLD 3MMBA 4FF3A 1UAWA 1ZM9A 3CD7A 1FDBA 4LSNB 1YJVA 1S9GA 3D1HA 2CVEA 3HHLC 4CZCA 4X64F 1MROB 3MR2A 2VQFF 5HROA 5KAKA 3BSOA 2KZZA 2VBXA 3UR0A 1D0EA 1KQGB 1OS5A 4TU8A 4IH7A 3NKYA 2KHCA 3FEYB 3GFYA 4MJKA 1NK9A 2V9WA 4B9VA 4PRFA 4HEA9 4P2SA 3O44A 4QWAA 1URRA 2PIIA 1XC9A 2PGCA 4RW9A 2RH3A 2X1GA 3H59A 5IFMA 2BJEA 2HNYB 4RWXA 3C8YA 3M4XA 4G6VB 5CYQB 5KFYA 5KOXA 5LMNF 1VQ7S 1TVRB 1XNQF 4QPTA 3UFCX 5DQHA 1C4CA 1RA6A 2XNQA 1VOMA 5LXRA 1KVJA 1IKWA 2YNFB 2G9OA 4DR7F 1VQ9S 3MM5A 4WFXA 3TAMB 2HHTA 1LW2B 1MWYA 3NG8A 3M8PB 3CIMA 2AD9A 1OWXA 1HBMA 2VD3A 3KLIA 3TVYA 5ITHA 2JJ4D 4ZVHA 4GKKF 3KLEB 4TXSA 4MMOA 5F41A 3R27A 5KFAA 1UWBB 1C1CB 4WU2A 5IQ6A 5J2NB 1KC8T 3RR7A 5KFTA 4A8XA 2DRAA 2HHXA 3IAM9 3E3XA 1JJ4A 2GQQA 1LWEB 2B6AA 5K8NA 3KLFB 2Z8QA 5J2MB 5E33A 2K7KA 4EYHB 2D74B 3KKFA 5J2PB 2EFPA 4WU3A 3PW5A 2M52A 4OL8A 4X65F 2JX2A 2AX0A 1MWZA 1LWCB 1SL0A 3OW2R 4PG5A 4K4XA 3OQ2A 4HH0A 2PEHA 5G4DA 4GMKA 1NHVA 4PUOA 2XGPA 3V6DA 1Q53A 3PVXA 4ZPWR 1HFEL 4EEYA 1WEYA 5DDQC 4LFBF 4M1KA 3N0VA 3J81Y 2AQ4A 2R7TA 4U67Q 1VRTA 4AYBD 4OMFG 4YR3A 1TL5A 3MAQA