4RWWA

Crystal structure of l. monocytogenes psta in complex with cyclic-di-amp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Lmo2692 protein
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwwA01
4OZNA 5D4LA 1UFLA 4CNZA 4NYOA 4Y6IA 1NH7A 3OPKA 2J9DA 1NH8A 2NUHA 2J9EA 1OSCA 3T9ZA 4IYQA 4USIA 4OZLA 4D3HA 4ZK7M 3HLUA 1J2VA 3LF0A 5DS7A 1O5JA 3AA8A 3L7PA 2JJ4D 3BZQA 4CO3A 4OZJA 4USHA 3GSDA 3MHYA 4YB5A 2E66A 1VFJA 1NAQA 2EG2A 2XULA 4CO2A 4Y65A 4RWWA 3AH6A 1Q1KA 4CO1A 4RX6A 4WK3A 4CO0A 1VHFA 1UMJA 3O5TB 3AA9A 2PIIA 3AHPA 1V6HA 4RWXA 1KR4A 4WK1A 1O51A 1UKUA 1H3DA 5D4NA 3N5BA 3NCRA 2Z0GA 2O66A 4YB6A 4E98A 2V5HG 5DRKA 2XZWA 2XBPA 1HWUA 2ZFHA 3NCPA 3CE8A 4C3MA 4YB7A 2DCLA 3TA0A 1XK8A 2GNKA 2CZ4A 2NS1B 2RD5C 4CNYA 4C3KA 2XG8A 4D3GA 5D4OA 3NCQA 4AFFA 4USJC 1QY7A 4R25A 3X3UA 1P1LA 2J9CA 5L9NA 4RLEA 2NUUG 3TA2A 4CO4A 2J9DE 1UL3A 2EG1A 3M05A 1V9OA 1V3SA 1NZAA 2GX8A 2VD3A 4NYPA 1PILA 3TA1A 1V3RA 3O8WA 2GW8A 1GNKA 2ZOMA 2O67A 3DFEA 4CO5A 4C3LA 5D4PA
chains in the Genus database with same CATH superfamily
1D9AA 1W7WA 4NA3A 4EO8A 1F9HA 1SIZA 2RQ4A 1RJJA 2D69A 2GO9A 1U1PA 2CPXA 2CJKA 1EP4B 1N32F 4WKRA 1AFIA 2E1CA 4KSEB 1RCXB 1S72S 5K8MA 3HM9A 4U7UK 3T1HJ 2IM1A 2R4FA 4K4SA 4IQMA 4DV1J 1HNZJ 2C42A 1WSRA 4I6WA 4KO0A 4LREA 1K0VA 2GVZB 2MQLA 2CG4A 2HNZA 2J7KA 3QBCA 3D0GE 4I6YA 1XR7A 3PXGa 3UNGC 3VAJA 4GO7X 4DFKA 2ASLA 4DR6J 4HACA 1S9GB 5ETMA 1RHQB 2B5JA 3RRKA 5GADI 3BV8A 2XGPA 1FESA 3R2CJ 2APOA 1RK8A 3NNCA 1V5VA 3GLJA 3GSDA 2F9DA 2RUSA 2CQBA 1FNMA 2MZJA 2OO4A 2EKNA 2OHDA 2R7QA 2F40A 3DOKB 2VDHA 3QMQA 4RO0A 5KTQA 2FC8A 3HKZD 4B9TA 3Q86A 3NL0A 1LXNA 3M8ZA 3V6HA 1SKWA 2QE5A 2PEBA 1UW9A 2CRLA 4IH6A 4WP3A 3ZO7A 2FVRA 5HANA 3C15B 3MECB 1T0TV 2QV6A 3MR3A 1VQ6S 4LF1A 1YIJS 3O1LA 2F1FA 1G7CB 2Z2ZA 2H51B 4N76A 5LOQA 3MM9A 2HHTA 2H3EB 4KB7A 3BPSP 1ZH5A 2CNNB 1GEHA 3KG4A 2XS7A 2HQCA 2FHJA 2Q6CA 1S79A 2B9EA 3BH7B 4LRFA 2RJZA 3V6DB 1VR6A 4ZPAA 3FEYB 3PW5A 3CIZA 1MW7A 3K8WA 1RUSA 2K2PA 1O51A 2DNOA 3M1VA 5J1PA 3ZZUA 4P74A 2NPFA 3ZZOA 1RKIA 1XERA 2BACA 3OR1B 2PN6A 4ZITA 1U2RA 4ZA1A 3MR6A 3BO3A 4CWBA 1NO8A 1QVGR 2GQCA 1S12A 3W65A 3AAWB 2HBQB 3UCGA 3DM2A 3GYNA 4OJ3A 4FNIA 4UOCA 3UVJB 4ELVA 5E0OA 1TUVA 2V2KA 3BB5A 3BEGB 1KLNA 5BR8J 2R3VA 2CNKB 3DOKA 3NBPB 1Q4RA 5L1KA 2NZCA 3CE8A 1EP4A 4R8UB 1DHMA 3BYPA 2XI2A 1S1UB 1L3SA 2UUAJ 2VPXB 4NYZA 3LGMA 2YXLA 1R6VA 3JQKA 5K20B 5KFNA 2K3KA 1FKPA 4WIIA 3SQOP 9RUBA 2GVZA 2H5IB 2ZJRQ 1JLAB 2HIYA 2Z58B 3JQJA 1UETA 4NLOA 3RJMB 3TNVA 4XK8C 5J1EA 3V4MA 3OL7A 4BDPA 4EMDA 4B3OA 1R8HA 3MEGA 4B3TF 4HHJA 2AJ4A 2HQIA 2V2ZA 1FT8A 8RUCA 1RT1A 4LF6F 1MU2B 1RAFB 4M95A 1RADB 3M8WA 3PDNA 4R25A 1M0SA 4RBVA 2DB1A 3VGTA 4J9KA 2CPJA 5A6WA 4UQGA 3CC4S 4OI0A 2VKRA 4IO9Q 2UXCF 2G9OA 4ECVA 1IKWA 2WBMA 1RACB 1TP7A 1ZBTA 4F2SA 3NGTA 1RTJB 3R8YA 2Y0SD 2GX8A 2RILA 4H4MA 1S0OA 1CC8A 1FO1A 3AT1B 5JXSA 3UPFA 3GV7B 3SDEB 3ADAC 4G1QB 4NLWA 4JI6F 3CJ3A 1S1UA 3OFEA 2GCFA 4BBYA 2DJWA 1SL1A 1XR5A 2LEAA 2BQRA 2CUYA 2DR6A 4NCGB 3AFGA 4Z2XA 1XNQF 2WRMA 3JYTB 5G0RA 4KT0C 3CJ4A 2Y1IA 5AJ3J 2L41A 3CCRS 1N36J 3C2PA 1S7IA 1DURA 1Y7PA 3MMAA 2W7AA 1YJNS 2XC9A 2Q66A 1C0TB 1RT7B 1NH7A 1GX5A 2HW3A 3E3XA 5DM6Q 3R1HA 1T03A 2RHQB 3ONQA 2CKWA 3UR0A 1WKLA 2DR7A 4LF4F 2ZH1A 2YX1A 4DJBA 3CTRA 1U6BA 2J9EA 2C22A 2ROGA 1VRQC 2CQ3A 2V8VA 3DGVA 4D3HA 5K8OA 1YGYA 4A8QA 5IM0A 3KLGB 3G4SS 2AGPA 1AA1B 1RYRA 1X4AA 5D6GA 1SBRA 4B9VA 3AA8A 3AD9C 3LTOA 5HQ8A 1N34F 4RR5A 5H9FJ 3MR7A 1BUXA 4PXEA 4W98A 2WVDA 1RBOB 2CJQA 4CLPA 2OEMA 2B9WA 1WOSA 4K4WA 5D3GB 1NK6A 4M5NA 4ANEA 1CPZA 5CAAA 2WB1D 2UU9J 2L9WA 3IWXA 2X3DA 3PJXA 5HMWA 4WYLA 3RBZA 4DUZF 4IR9A 3GYGA 4JI4J 1KOOA 5DGBA 1Q53A 3BQ2A 3TZWA 2YX7A 2BBEA 4F4AA 4EYHB 2N4CA 2QLJB 3FK4A 3SCKE 3US5A 3MGJA 3AJ1A 3IR5B 1HNIB 3PEJA 4RNOA 4DSKA 1EKSA 2VV5A 4RW7A 2EC0A 5D77A 2EI5A 3AQPA 2AD9A 1XBWA 4WZMA 2CQ2A 2OPPB 2HFVA 3DGPA 4WK3A 3KLGA 3RRGA 1X4DA 1XTZA 5JJBA 4RNNA 4IFVB 3EVMA 1DTTA 5GAHU 1NEEA 2FJDB 2C3OA 4DS5A 1KP6A 1VDHA 1T7PA 2IBKA 4ZJQA 1S76D 1S1VA 3UDEA 5D3GA 3ENQA 3QFHA 2A2CA 1VJWA 3VR1A 5BYQA 1PGZA 2V69A 4LFCJ 2HRTA 1YX2A 4KGVB 1H3DA 4LSZB 4J5OA 5HJXA 2B6AB 3M8YA 2RKIA 4OX8A 2YQ0A 2RVJA 1NK5A 1H38A 2B3TB 2FVQA 1XNQJ 1WACA 1VBZA 2MYFA 3F0NA 3GIRA 2R8JA 2NPIA 4WJBA 4MAKA 1WDDA 2IDEA 3M32A 4F3MA 1Q0NA 3C6TB 4Q5VA 2JEFA 4FF3A 4E2FB 1A7GE 2D1CA 2HVZA 2V67A 2IVYA 4HHHA 4ZHRA 5HQLA 2UUBJ 4KRWA 1S0VA 3LQVA 3TX0A 4ZCLA 1XMQF 1RT7A 2X1AA 5L8RC 4JI0F 3M8PB 5KG4A 4ITSA 2AYBA 1MWYA 4KY3A 4OYPA 4ECUA 3AY0A 3HD2A 1JJCB 2D41A 1EAYC 1B0PA 3UN5A 4FF2A 1P1TA 3P45B 3VV2B 1T05A 3I55S 3UO0A 1HLWA 4LSNB 4NEYA 4WU2A 1ZZNA 1DAXA 5MLCV 5SZTA 2EW9A 2NCKL 4YHHJ 3LO3A 4HT7A 1WOPA 2BW2A 1RWUA 4MK9A 2A3JA 2GZOA 4ZDNA 2MGZA 4QQBA 5CD4H 2R8HA 2C2ZB 4RUCA 2RDIA 5L1JA 5HP1A 2E7XA 1RT3A 3C6UA 3TA2A 5IXUA 2UUAF 4YEAA 2UXBJ 1OY8A 3UN2A 5KFQA 4FVCA 1J5EF 4I0WA 1V3SA 3CJ2A 3RU0A 2R2RA 1SH0A 5HVGA 2FLNA 2VD3A 1IBMF 3MI7X 1R0AB 2V9WA 3QFWA 1WC5A 5B0CA 4C6AA 2DNGA 3J80Y 2DR5A 1S6OA 8AT1B 4J9MA 1OS5A 2O67A 5HLFB 2YTCA 2AIRB 2NXUA 4M5JA 1JLAA 4TY9A 5J1EB 3W2VB 2HHUA 1H2UX 2F8HA 1YK9A 2WK4A 2JH3A 3AOAA 4QIFA 3HJVA 4IG3A 3KLHA 4PYAA 1FWLA 1LFWA 2MEWA 1FI4A 1O0PA 3I0RA 1CVJA 1SKSA 4CM0A 5C5JA 3NGSA 4NYOA 3MCOA 4F0KA 3H59A 2RIJA 1QSYA 4NCBA 1RTIA 1QTMA 1SI9A 3RW7A 4IFYB 3TUIC 3IN5A 2C2MB 4O3QA 4ECZA 1V5IB 2EXUA 4WTOB 4DFMA 1C0UA 4ZVRB 2FVPA 4KV8A 5ETPA 1RT3B 3HLUA 2QZ8A 4LBIA 2QYGA 5ETTA 3OTEA 3OBIA 5ETRA 1Q86T 4RW8B 4X4TA 2DGQA 2K3IA 4O23A 3EZOA 4OZ2A 4DHVA 2AGOA 2HFUA 3MM7B 3BZQA 3HVAA 1UVNA 4MH8A 2E29A 2YNGB 2VQEJ 4ED5A 1JXLA 2B4VA 3VAHA 2FUG9 1X60A 1NKEA 2DGUA 4UW2A 4E8UA 5F8HA 5J1NA 1RI7A 2VKZG 5BR8F 2DPIA 1Q78A 1QD1A 5KFPA 5GAHI 4C97A 1H7WA 5F9NA 2QLWA 3K5OA 3TEHB 4A4JA 2UUBF 4N77A 3BQ0A 1AW0A 4CLUA 1U1OA 2WSCC 4NLRA 4JI2J 2F7VA 4QZVB 1Q1KA 4LBHA 1H0HB 1F5CA 3ILOA 3KTQA 1JXVA 4AD6A 2C2RA 3DCAA 2ABYA 2WVEA 1G6BA 5I42B 2VHGA 1P6TA 3CD0A 3EGVA 3PRVA 4KV8B 1PSDA 4DV5J 2BABA 1TVRA 3W66A 1SJRA 3IAM9 2RQMA 2ZOFA 5I3UA 5ETNA 1D9DA 1WNEA 1ZM3A 5KFOA 2CWKA 3PFEA 3FEXB 3PW7A 2LU1A 3FCVA 3J7YI 2ALZA 2W8LA 3RB4A 2FY1A 3CJKB 2I8EA 1Q95G 1ELOA 2E1PA 3W9HA 4BC7A 6FDRA 2XI3A 3HFKA 4KO0B 4FNHA 1B3TA 3U02A 2AZ1A 1TAQA 2HNZB 4J9VA 1DRZA 3SMZA 4RPFA 4B9LA 2NSCA 4C8LA 1FXDA 3DKDA 5HVHA 4TU9A 1YZ7A 1IBMJ 1IWGA 1OO0B 2C3PA 2OPQA 2GVDB 2ZNZA 3G8SA 5GAEI 1JLQB 1Q7LB 2VJUA 5E41A 2IBOA 5B0FA 1RT1B 3FSXA 2ADCA 4DPXA 1S0MA 5EGYA 2QEXS 1UPMB 2ASJA 4JI8J 4ZP8A 4EZ9A 3ETMA 5F0UA 3IM9A 1S1TA 3TANA 4HH0A 4FS1A 4N7TA 4F25A 2BOPA 2Y8YA 3HSZA 3ENAA 3ZTPA 4DR6F 2OJ3A 1CQMA 4OYIA 4A8YA 1NHVA 3EZ5A 4DX8H 1IBLJ 4GRSA 1JMTA 3D54A 4WFAQ 4ILMA 1TUWA 4DFPA 4P2XA 1KHWA 4MYUA 3ENWA 4K0KJ 2EK6A 1D8ZA 4ZP7A 1IKXB 2UVVA 2FZKB 2OI2A 4EO6A 1FTCA 1KONA 2OFHX 3M8PA 3OLBA 3M4XA 4KHPJ 1TL1B 2I6WA 4UT4A 4B3MF 1C0TA 3HT0A 2NXJA 4PAAA 2F65A 2AWZA 2EEYA 2GW8A 4ZLLA 1VIXA 4JOUA 3GWCA 4IRKA 2H1YA 9ATCB 4ZVOB 3CXCR 3TWZA 3DFEA 3HMJG 4DV4J 5KFGA 1K73T 2W01A 2ZC3A 2MKJA 3GE9A 5LSOA 3Q8RB 3HZGA 1NJZA 1HL6A 1FVSA 3GV5B 2BM0A 1J5EJ 2YNIB 4AQYJ 3LPEA 4CNZA 3FBCA 1L5UA 1Y10A 2PA8D 2SXLA 3FRYA 3KWMA 3L4BC 1CG2A 4UQTA 2KFYA 1NJIT 2VG6A 2E7VA 3HFZB 4ERDA 4LF6J 5ETKA 2ZH2A 2Z56B 3KFWX 2MZQA 2MKKA 4ZPVR 1CJKA 3BDEA 1J2VA 1H2TZ 3LF0A 2OPPA 3DGPB 3M6UA 4ES3A 4DX7A 1QSSA 2KKHA 1CJVA 2CPZA 1MWZA 3O6QA 5C24B 2OTLS 4JYAF 3DLBA 1LWXA 4USHA 1S1VB 3RBEA 5DM7Q 2FGCA 4M5HA 1NZ8A 4OI3A 3V4IA 4WFBQ 1G4CA 4NMXA 2HQDA 2W4PA 4Q0BB 3KG1A 1T9VA 1FTRA 1SC1B 5E3RA 3MR5A 1Y3JA 2E5JA 2D74B 1S9FA 1DTTB 1R43A 4A8FA 1BQMB 4B3SF 2PI5A 1NM2A 3CJQA 1SXLA 1C0UB 1RP5A 4NI2B 2UP1A 2HGMA 3AH6A 3G86A 3DLGA 3HJFA 5KG2A 2MGZB 1QUVA 2KRRA 3CC7S 2IM0A 3SEOA 3T19A 2ILYA 1XMOF 1MWQA 1K44A 3CGIA 4QR2A 1RKJA 3DOMA 2I5JB 1L3KA 2DK2A 3HHLA 1DTQA 4DV2J 1RHKB 5DG8A 4KTQA 5KFEA 1FRJA 1MMLA 2A18A 4F36A 3EYZA 2AEMA 1ZOTA 3BGRB 3ELHA 4DX5A 2JZ5A 1TV6A 3N0VA 1HARA 2V34A 3IMQJ 3OTOJ 2J0WA 1YJ7A 2HLTA 3FGVA 4EGLA 3SSQA 3FCWA 4ED1A 4CP5A 3MR2A 3LALA 1BWEA 5T41A 3QZ7A 3FZ2A 1WG5A 4DF4A 3MOJB 4QYZJ 2BX6A 4YR3A 2F4VJ 3SCIE 4ED4A 3A8KA 5IM0B 1LWCA 2RU9A 4DV6J 4HTJA 4PUOA 4CLSA 4JI1J 3F44A 3HO1A 1JB0C 4K7QA 3KNGA 2HQ3A 3NS6A 3PV8A 5GMDA 1YSJA 3FSYA 4ZMMA 2L9DA 4RW6A 3W9IA 2XLIA 4H4MB 2BJEA 3HP6A 1HBOB 1TKZA 4NA2A 2XM3A 3N9UC 2VC0A 2MY7A 4ZVTB 2BJ1A 1A0OB 4PG7A 4YY3F 5KT3A 3PX4A 4K0KF 3QGGA 4WIQA 4WWSA 2R2TA 1F2GA 4R5PA 2HG4A 3OTDA 1FWKA 2M52A 3TAMA 4QW8A 4F04B 2ERRA 4CZCA 4HLBA 1XMBA 3CCQS 3FBBA 5U47A 4DR1F 4IQXA 2XHCA 5GMEA 1TAUA 4DV0F 2NREA 4P10A 1TMJA 1Y5IB 4PCQA 1JIHA 1RU1A 4AFFA 5FD1A 3OVSA 2BV3A 1UFKA 2G0IA 2HNYB 1C4AA 1A6LA 3GG0A 3HHLC 3RUBL 4NE9C 5KFZA 2J5AA 4ALZA 5IWAF 1T03B 1Q7YT 4NLTA 4NZ0A 5J2PA 2HHPA 1PC5A 1U0SA 4RW9B 3M05A 3Q8PB 1R0CB 3EM1A 4ZP9A 4I7FA 3NS5A 1OQ3A 1U47A 1B0VA 1F9EB 2DHXA 2LQBA 4WBFA 2MKSA 2YKMA 5DDPC 1PILA 2BRLA 5GADU 2VH7A 3U7JA 4K4TA 3I31A 1ICEB 1HNWJ 1UVJA 3VVUA 2XMUA 3TQEA 2IM2A 5J2QA 2LKZA 4XDCA 3H98A 2PMZD 4O0NA 2CPEA 2KYZA 5FLXU 3UCUP 3E01B 5HBMA 1FD2A 2NYHA 2WOMB 1GMVA 3MEDB 1NDPA 2JNJA 1JLCB 1PAEX 2PO4A 3P5BP 4ZPDA 5F8LA 1AUSL 3ET6A 3MMCB 1NDKA 3B4DA 4ZJLA 4R8UA 7FDRA 3G71S 1YBTA 2B8PA 3EGWB 3CPWR 5FDLA 2R2UA 2DHAA 3T3FA 4P72A 2BDPA 1SPBP 3OPKA 2J9DA 4KKOA 2XEXA 3U1NA 2XWYA 4URGA 4X4UA 1NB2A 1YJ9S 2M70A 2MSSA 4KGKA 3FJ2A 4OZLA 4USIA 1DLOB 2FLLA 3I56S 3QNWB 4RNMA 4MJKA 4DLGA 2AJ1A 3NG8A 3H25A 4A47A 3KHHA 4JI3F 3EVWA 3OSPA 2VL1A 1YLXA 1VRTB 2HWTA 4ICLB 5J2NA 3CCJS 5C42B 2KM8B 2AW0A 1AYEA 2Q43A 2U2FA 1EHWA 1VOMA 2B8QA 5HO4A 2RUGA 1DQ8A 2ZNYA 2ZUGA 1JKHA 1NAQA 3RAMA 1S6PB 2BJ9A 2E5IA 2IYGA 2VDIA 3TJAA 1GFWB 4DPTA 4PG8A 3OXLA 1V3ZA 2MZSA 2F63A 3FDSA 2AX0A 3UD5A 1P8GA 3Q22A 1T9TA 3NLCA 4RUAA 3UW1A 4OI2A 4CRJA 3KK1B 1F2HA 4K4YA 2U1AA 4RWWA 2DIVA 1SL0A 3MOZA 5F8NA 4QR1A 4FPRA 2OPRB 2QRRA 4JUZA 3BGRA 3FMWA 4KPCA 4FBUA 4YB1P 3IRXA 5IT4A 3VAFA 2KZMA 2PMHA 3H42A 1X9WA 4UOGA 4LF9J 2WONA 1GXUA 4TNOA 3PY8A 2XY7A 2GC8A 3QRQA 4RUHA 3H2LA 3IR7B 3TRGA 2LA6A 4X62J 3AB2B 1JWWA 1Y4ZB 2KU7A 3M8QB 3PEHA 3PG9A 3ZTQA 1V6HA 3BJYA 3EXCX 4OX9F 5EWEA 3ITHA 4P6QA 3MAAA 5CYMB 4ICLA 1YWXA 2LA4A 4ZN1A 3TZZA 1EKRA 4QWCA 2CPFA 2XCAA 2HHHJ 2OSQA 2PMWA 4G1PA 3RAXA 2DH7A 2G2YA 3BBFA 5KT7A 2ZH5A 3FFIA 5KFXA 3M9MB 4OJ1A 5A8RB 1KOHA 1UEVA 3CNQP 2GJIA 3DLJA 2HZCA 3O44A 3R6GB 2XZWA 4OX7A 2GO8A 4LSLB 3H90A 4DG1B 3D1QA 5ADZA 5B0DA 5GMKa 1S48A 2K7JA 1HWUA 3Q8VA 1X4BA 3NCPA 3W5ZA 4QPTA 4O0IA 1NKBA 4ZPBA 4M5LA 1FRXA 1M5SA 3MM6A 3MPUB 1U45A 4GKKF 2XZDB 1UJ5A 2VQFJ 3C14A 3GIKA 1NB7A 1D9FA 3P4UB 3AOBA 3C6UB 4FYYB 3ZC4A 1UZHA 1EETB 3OL9A 4A48A 4WZQA 2GMHA 2YKNA 3W2VA 3W60A 4HI1A 1Y5LB 3CJ8A 4B3TJ 1S0NA 5D4OA 2DNNA 3BR8A 3HKWA 4ILRA 4DCOB 3DLKA 2XQCA 1EX8A 4JV5J 2CXEA 2ZBCA 4F67A 3RRHA 1VQOS 5D0HA 1H7XA 4I7FB 4USJC 3TEGA 5HJYA 2QC3A 3T5JA 3RZAA 5BXIA 2DISA 5B0GA 3GMGA 2NUUG 3R5CA 1S6UA 3PW2A 4NLGA 2W24A 1ULRA 3VGSA 1RTHA 1RWOB 4IG3B 3KLHB 4DSEA 2C28A 3R1LA 4X65F 2RMLA 3J7Z5 3DU5A 1HBOA 4Q2MA 1FCAA 1N8RT 2HLUA 1LWEA 3N79A 1AZSB 4K8RA 3CJKA 1K8AT 1UP1A 1MG7A 4QWDA 1YBAA 3FBFA 3MUVP 4EEYA 2HZVA 1VISA 3GIMA 3G8QA 1JLEB 3AODA 5IFMA 2VFSA 2WZ1A 3CDWA 1S1WA 1T94A 3H5UA 3FVYA 2M9KA 2EFQA 3CMQA 3KNAA 3ZNUA 4KFBA 4C0OC 4IO1A 4B17A 2LCWA 3W63A 4YDXA 3LH2S 5GAEU 5CD4A 1S7HA 3OL6A 3CD6S 3PNIA 2D3ZA 5AXLA 4JI7F 2NUHA 1PBUA 3UFCX 4YS2A 1VK3A 3Q8QB 4DSFA 2CAJA 4WTYA 4ZVUB 4DV2F 5AXKA 1YQHA 2PC6A 2I5JA 3TUJC 4CH0S 3VQTA 1ZETA 4LRDA 4NZ7A 1BE4A 1PYOB 1RT2B 4ZJOA 3JSRA 1QJHA 4PWDA 4DR5J 1J5OB 3DU6A 1T3NA 1WC0A 5A8WA 2VG5B 3WX8A 8ATCB 5L38A 2BJ3A 4WYWA 2R8KA 3D28A 3WC2A 4C0HA 1TK0A 2R7UA 2B9XA 2XULA 3QJLA 5KG5A 2UXDF 2OEKA 3HSGA 2E1MC 3HHLB 1KQFB 3Q0AA 4NMLA 3GZ7A 3CCVS 4ED0A 1HBNB 4OHYA 4Y65A 5CYQB 2PFFB 5IC6B 1JK9B 3MECA 1FVQA 2COLA 4Z37A 5I3UB 1WC3A 1RT4A 4Y2IA 5E2QA 1N0VC 2GS8A 2QN6B 2J7WA 1HWJA 1N34J 1DY3A 2I9SA 2W9CA 2ZD1A 1CQNA 3EUNA 3MFIA 1BD6A 3MZIA 5DDOC 1TQLA 3M2VB 3OSNA 3TQ1A 2AKWB 1UWBB 5EN1A 3R6LB 2W7PA 2ZKTA 1KVKA 1OYEA 4P9SA 3BSAA 3PX6A 1GT8A 2RRBA 2OFGX 3KHRA 5IQ6A 4DV7F 1R7IA 2J0QD 2WVFA 3I5AA 3OR2B 3A3PB 5A0YB 2VG5A 2NYIA 1MROA 4RKUC 5KFMA 4DQIA 4U95A 1U1QA 4RBTA 2GMLA 4F26A 5KFDA 3I0SB 2FPHX 1UKUA 4MIAA 5A8WB 2R8IA 5DLFA 4M94A 2KHDA 4YQWA 1S4FA 1RAGB 3BKUA 4QYRA 4LF7F 4C4WA 4LIWA 3HHDA 4DQQA 1HNIA 3NCRA 4FYXB 1XEZA 3U27A 3UWTA 5EHHA 1HBNA 3ENVA 3TJ9A 4LF5J 2RB7A 3NWRA 2M8DB 1H6KX 2WONB 4LR7A 1LWFA 2I38A 5K8PA 1X9MA 4V1Ak 2AV5A 1TL1A 2UXDJ 1UVKA 3ICLA 4DR7J 2XMVA 2E5GA 2HS3A 2JLEA 3EPGA 2G0CA 5FJ4A 2HGLA 1VYAA 3OTCA 4FYWB 2UVRA 1XK8A 1X7VA 3OT9A 3WHIA 4S0MA 4UOFA 3K57A 1NRKA 2LXIA 3EWGA 1NK4A 1OYDA 3DLHA 4LFAJ 4RU2A 4I6AA 4FBTA 2YVSA 1PG5B 2DNPA 2X3GA 3TVYA 1EQ0A 1CS4B 4RW9A 4CLLA 3HD1A 4YN3B 3E2EA 4FDFA 3KOAA 1QUPA 3BQ1A 4DV3F 3VAMA 2DGSA 5C2GA 1WTFA 2DKOB 5CCLA 3CULA 3BR9A 4LFBJ 4PQUA 3BPDA 4MKYA 4OYWA 2NSBA 3TUPA 4MIWA 4ZVPB 3JYTA 1Q81T 3HX9A 4M63A 2Y9HA 1YKWA 1HIYA 3LP0B 3QPIA 1CULB 1DBDA 4LBPA 5HMYA 1S10A 1V3RA 4GKJJ 4X4NA 3QWUA 4U96A 2MQQA 4G1QA 3G6VA 2ASDA 1X0PA 4KR0B 2YH1A 1U8WA 3RB0A 4JI6J 3IGNA 2EK1A 1VCTA 2DGVA 1HW9A 4ANCA 1UVIA 1MN9A 1FDNA 5CZVA 2F8MA 2F3JA 4AL5A 2BEFA 4H4OB 2E1AA 1NPKA 1UWAA 1CS4A 2G13A 1TL7B 3KJFB 4DN9A 3DRRA 3T1AA 4NXNF 4ZN3A 3PW0A 3LP1B 4HEA9 3PO5A 3UDLA 1YJUA 4LFBF 2DIUA 4ELTA 1HHQA 3DLGB 5KFSA 1HPZB 2OEJA 4LRCA 3FEZA 4J9RA 5IOLA 5KFKA 2UUCJ 1RGVA 1HYSA 2QFIA 1GMWA 1S6QB 1BC6A 3L7UA 1RWWB 2P2CB 4PPZA 1SQEA 1HD0A 1RHMB 3NOCA 4DDFA 3DMJA 1LWFB 4IKAA 2CYYA 1KWMA 1KVJA 4WP9A 3JQMA 4KQZA 4ZIWA 1IBKJ 1FKOB 1F60B 1WEXA 2P9CA 3ITHB 4ES2A 2KFZA 1VRUA 2E1RA 1OPZA 2ZBIA 5HN0A 1WD6A 3OVAA 1KTVA 2CZ9A 4OLOA 3FFIB 1H74A 3VTIA 4ECTA 4ECXA 4DF8A 3DRYA 3EDRB 3FC9A 4RW6B 2N3OA 1VQPS 1VQMS 2EVZA 3NOGA 4RZRA 3IWLA 3EGNA 1M1GA 3MAAB 3THTA 3RB3A 1AB8A 2V2QA 1Q5VA 3O5TB 1QAYA 1TTHB 2AZ3A 2QT7A 3AA9A 3QLHA 3CSKA 2ZH7A 3T1HF 4ECRA 5KT2A 2PSZA 4USMA 4RWXA 2WW4A 4M5DB 3PRBA 3WC0A 3I5CA 2V4JA 1KR4A 4MT1A 4DU8A 2H48B 3MF5A 4N5SA 4ZVSB 2V2VA 2JOQA 3K5MA 2AQ4A 2JLGA 1FRLA 1K0TA 1I5OB 3AXMA 1HYSB 2EWHA 2DGTA 3GP9A 4J7CA 2ZHOA 2QFJA 2Y1RI 4GO5X 4IOCQ 1N5QA 1AFJA 1Y0HA 1T95A 2V5HG 4CLTA 2P6TA 4OX6A 2W9CB 1DFDA 2XCPA 5DG9A 5HAOA 2QL5B 4C0BA 1W2IA 2DNLA 4PG4A 1B70B 2CQGA 1KD1T 5A2QY 3GV8B 2J8SA 1WHYA 1X31C 2EKYA 1E6VB 3VALA 1EIYB 3BBBA 1HNXJ 1S9GA 2GHVC 1ACMB 4M1KA 5A2QU 4DR5F 4OYZA 2IMWP 1JLCA 4C8NA 2YWGA 3VZHA 4C8KA 1S6QA 3R9LA 1RTJA 3EMTA 1IM4A 1Q8BA 2A1BA 2CQDA 1G3OA 2IRYA 4D3GA 1JLFA 2MXYA 2O1PA 4CIOA 3G87A 3HVTA 3J81j 3Q83A 3FSIA 4JV1A 3GSIA 4CLKA 2HS0A 4QWAA 4LFAF 2HQFA 2J76E 4DBQA 2V4QA 1SJ4P 1KRPA 2BZ2A 4LF4J 2FB0A 5KFFA 2J9CA 2R7OA 3GIJA 1X0FA 4ID5B 3PACA 2ZJQQ 2AHOB 2CA9A 3IR6B 2ADBA 2EBEA 1T9XA 4PPDA 3KUHA 2Y1LB 1OSDA 3UQSA 3BGOP 4NXMF 4ENOA 3MM8A 1FE0A 3E8OA 5B7WA 2VUGA 4PXBA 3RR8A 3R5DA 2OUGA 4NYPA 3TI0A 2ZH4A 2BYCA 2AF6A 5FLXY 3CD5A 2A6MA 4KFBB 1E6VA 4U7CA 2YPYA 3RBXA 2DEJA 2J8AA 2H4WB 1U1NA 4FZVA 3C66A 3TVKA 1RWKB 3NNHA 2YNHB 1JLQA 3G8TA 1PO6A 3DRPA 2CPIA 3GJRB 2E7WA 4OZNA 1UEUA 1WJ9A 2LDYA 3FUYA 3QSIA 4GMKA 4DOZA 4IDKB 4P52A 1SV5B 3IBWA 3PIOQ 1N48A 1HR0J 4F2RA 1KTQA 4PQUB 4J9PA 1RCOB 1PBAA 3VF0B 2LXFA 4U8YA 4OJGA 4V19X 4NRUA 3WBZA 1FX4A 2ZC4A 4PYDA 2C3UA 3MMJA 1H98A 1LKZA 2XMAA 4R0EA 4C8OA 3KDNA 4U67Q 5E7OB 2PI4A 3C46A 4DV0J 2XGQA 4X4RA 5L46A 4I2QA 2L9NA 4EBDA 5C2CA 4N41A 1BHNA 1MLAA 4QYZK 1IWAA 1YDLA 2QA4S 4K4ZA 3LA0A 2A10A 2RHSB 3M30B 5CYQA 2CJYB 2VBYA 1RTZA 5D8HB 3GJSB 2YKPA 1SC3B 2YKQA 1RHUB 3PM9A 4CYUA 3W61A 4AL6A 2JSXA 2BXJA 2GJFA 2M8HA 4Z7YA 1U1LA 4DR7F 2BQ3A 2OGUA 3ULHA 1FFGB 4JYAJ 1F3FA 3DOMB 1M90T 4K5RA 1F5AA 2AU0A 1E6YB 5DO2A 1OIAA 1VK8A 2V63A 1KDNA 2DY1A 5K14B 4DL6A 3DHWC 3NKYA 2MY8A 3MCMA 3MPDA 4ECYA 4RX6A 2OIHA 4NLXA 2FGOA 3O2IA 4B9SA 3DDKA 4Y2MA 4DFJA 3POTB 2AMCB 3GFYA 2Z2MA 2BW7A 2AYGA 2HS4A 1PJ5A 4MKVA 2N4DA 3G96A 4UOHA 2FJEB 2KT2A 1RAOA 5IC4B 3V4IB 2GGPB 2VZ9A 3S01A 4MK7A 2IM3A 2QG9B 4PEOA 2FZCB 1T3OA 2D7SA 3Q8SB 3BO2A 5C25A 4DQRA 4TKTA 5F3TA 3W8GA 5L1LA 5D4NA 3DOLB 1FDDA 4NLSA 5KG0A 2BJ8A 5IT0A 2I1RA 3M2UA 5B0AA 5A6PA 1W26A 2IJRA 2Z0GA 2O66A 3NGUA 3PTWA 4I2QB 4ETXA 3EVOA 5C42A 3UI3A 1M1KT 1HQUB 2NZ4A 3H7HB 4HHUA 4O4GB 1AZSA 4M5MA 2JFKA 2B56A 1WC1A 3CCTA 3D68A 3DC2A 1VJQA 4TYAA 1XR6A 1FERA 2DCLA 2ZVSA 5BJRA 3MFHA 1DARA 4DR2J 2FDNA 2CZ4A 2ILZA 2V94A 2RD5C 4NEZA 1F5BA 4MYTA 5E3CA 5KFYA 4Q44A 3J7AN 4MFBB 2B9YA 3NS7B 2DNKA 1YITS 4O44B 3A8IA 1ROFA 4C9DA 2KYXA 2UUCF 1R89A 1KC8T 2IC3A 1F0XA 3IS9B 4B3OB 1LW2B 2ZEJA 1JLBB 4F50A 3PFOA 4F0HA 4FPIA 2A2DA 1WORA 4MKAA 3R5JB 5B0EA 1B7YB 5I3PA 1NSQA 2FY8A 5E3QA 4DCPB 1N4LA 3F41A 2HNYA 4OZ1A 4MTPA 4ZP6A 4ED7A 3EGZA 1S9EB 2VQFF 3NXZA 1QAIA 3QRRA 3BBCA 4DEZA 2W4DA 2ZUAA 4AXIA 2CQPA 4YY3J 3KJVA 4IRCA 4RU9A 1GQEA 4K2JA 5KOWA 1NZAA 2KM8C 3GCWP 1QDUB 1JLGB 1KHVA 3CEDA 2VB6A 4QR0A 2HBRB 7AT1B 3DRRB 1RWPB 1XIQA 3DN9A 3BSOA 4DLEA 3SDEA 3DRSA 1Q5YA 2HAIA 2V8PA 3DYAB 5D0EA 4UF4A 5ETOA 1KQSR 5EDWA 4BLGA 3SSRA 3OR1A 1TZ0A 2DGWA 4JV0A 2QO3A 4NXMJ 3I6PA 1FDAA 3OTOF 4O44A 2HVIA 4ID5A 3C14B 2DCUB 4RW4B 3M32B 5DQIA 2BE7D 2MHEA 3V2UC 2ZD1B 4EK2A 1K9MT 1SKRA 4EZ6A 2FJAB 4CDIA 4IOAQ 2GHWA 3SQGB 5THWA 3DOLA 2MQOA 1Q79A 3D6FB 2IA6A 3HSDA 2CQ1A 1S9EA 4LF9F 2VBXA 4ZVFA 1FWPA 2M7SA 1GAOA 2G2OA 1GH8A 2JVOA 4IOBA 2BE2B 4KE5A 5HL7Q 4Q0BA 1G2EA 1APSA 1YRTA 4ETZA 2Z8QA 1I6JA 4BHQA 4OZJA 4NOHA 2XNRA 1SJ1A 2C2KB 4FN5A 3QGHA 2V4JB 3KUGA 4OHZA 4OYBA 5C24A 1S1XB 3ZZTA 3W2WB 3WQPA 4LF8J 1OQ6A 1TR0A 1Z4UA 2E66A 2MQ8A 3BM7A 3M2RB 5D0RA 3SCJE 2CZVC 3KLEA 2C2NA 2HAFA 3TR5A 4X4SA 3M9NB 5CXTA 1TVRB 2GJ2A 4A8MP 4ED2A 2VA2A 4OQJA 4X2BA 1U4BA 5IQQA 5G4DA 3OR2A 2QJ3A 4DQSA 2GQ2A 1UVLA 2E5HA 4RL1A 3J7ZT 3HHKA 3AD8C 2G2ZA 2QLFB 2WW8A 2DO0A 4KBIA 3JAMY 2E5LJ 3LWMA 2Q3PA 2ZH6A 2OLWA 3B6BA 1R31A 1WI6A 3H5SA 1L3VA 2Y8WA 3K59A 1LW0A 3TX8A 4QWEA 4DSLA 3GTYX 3I82A 3Q2SC 2XO6A 2RRAA 2XLJA 3BO4A 1S6PA 2CJXB 4WK1A 5F3ZA 3IXQA 2ZM6F 3B78A 1IKYA 2YKOA 2CVEA 3NP5A 1S1XA 5DQHA 4DV5F 2VOOA 5AJ3F 3R7BB 3I0RB 5HVFA 1FRHA 1RWXB 4ZLJA 3MMBB 2IVMA 2K7KA 2HMIB 2JC1A 3GPAA 1XC9A 1VBKA 1IXKA 2Q79A 4Z7CA 1S49A 3THVA 4DMZA 1GX6A 4X64J 4X4PA 3M8SA 2D9PA 3GFHA 2R42A 2PDAA 3NAHA 3UDVA 5F0WA 2XBPA 2RU3A 2X1FA 3HZEA 4I68A 1HD1A 2ZFHA 3ZZPA 5HQMA 4X65J 5EUHA 3W2WA 2VFVA 3UCZP 1IR2A 1S99A 4WFYA 2B7CB 2W2OP 2UXCJ 3DLKB 2GNKA 4DN0A 1QVFR 2IRXA 1FF2A 3TUZC 2VPWB 2H5EA 4P2FA 2AEJA 2VOPA 4NASA 4P71A 1TKDA 4FYDA 1X4HA 2FZGB 5ETQA 1X5OA 3VVTA 3HVRA 3CO0P 3LP0A 4DR1J 1F6TA 3CDAA 1IR1A 3ZTSA 4FS2A 2XYPB 1TL3A 2HHQA 1KS2A 4TLQA 4Y00A 3X3UA 3X1LB 4OLPA 4ZCIA 2MHNA 3MCSA 3PHTA 2WSFC 2QSFA 3KK3B 2YWEA 3OFHA 3N6MA 1HWIA 2JC0A 4H4OA 3MEDA 1KSPA 2DR8A 1REVA 4M5GA 2LEBA 2JEJA 4JI0J 2ZZNA 1VC5A 4EBCA 2NQPA 1RAIB 2CJ9A 3RGIA 3RBDA 2HBYB 2YH0A 4DXLA 1M5PC 1IVZA 2H5JB 4TN2A 4UY8T 1LK7A 1URNA 4ZHRB 3A1YG 1VQ9S 3A8JA 2ZOMA 4I2PB 1LEOA 2IDLA 4ED8A 2ASYA 4PXCA 3MURP 3HPOA 1FNXH 2XYHB 1N33F 1LK5A 4J37A 2UVUA 1HNVA 2M5YA 3Q24A 4A8WA 2D3O1 2IY5B 3D6MB 4WCEQ 3FBEA 3BSCA 5E5NA 2HIQA 4FVMA 2XLKA 3JSMA 1OY9A 1TKXB 1TFYA 5H9EJ 4P7VA 1EETA 4IR1A 3T5HA 3MXHP 2QX0A 5CQGA 1NKCA 3T9ZA 2NLWA 3D2WA 1WTBA 1R8BA 4Q2LA 3Q23A 1YTYA 1O8BA 2QIFA 1ZA2B 4LT6A 1JJ4A 3P6YC 5LJ5Y 4LMZA 1NJWA 4B08A 4V19J 2V4RA 3L7PA 1HI8A 3PVXA 1LOUA 1VHIA 3HVTB 3VAGA 2DNRA 1FJCA 2J7UA 2UV8A 3QT6A 1EZZB 2QA2A 2YNGA 1NMEB 1RYSA 4KGMA 2LEPA 4O3NA 5GAGI 1RABB 3M6VA 3QT7A 2O5DA 4LF2A 4X4VA 4EWTA 3IRXB 2FLPA 4LRAA 4QWBA 2BOAA 4UZBA 3POTA 1BGXT 1TELA 2AJFE 4DZDA 2O3DA 4DWIA 1K1QA 1FRKA 2WAQD 3CJTA 2N7YA 4P75A 4LQ3A 1YBUA 3CB4A 1TL4A 3IM8A 4LVOP 4A8KA 2L08A 3AJ2A 1ZA1B 4ANDA 1D3WA 2IJFA 2R9LA 1WHVA 3T41A 4QW9A 5C25B 4JP8A 4PG6A 4F3QA 4KHRA 4CO0A 4X4QA 1RQ0A 4QBUA 1XN9A 3BKTA 4QU7A 3CD7A 2F4FA 4O3PA 3KK1A 3V6KA 3M6XA 1RU2A 2W1BA 2QYCA 3W62A 2MLXA 1IQTA 1TL5A 4WFNQ 3KK2B 3FRZA 2GAGC 2X7IA 1YRUA 1SUQA 3LP2A 3PYEA 4KYZA 5L39A 3N5BA 4FKXA 1U7LA 1TK8A 1RAEB 1RWNB 3I32A 3ZTOA 4PWDB 2CQ4A 4URSA 2WTFA 2AYEA 5M2RA 4F4WA 4CM2A 2C3YA 2WBRA 3CCES 1HNWF 2N7CA 1X4GA 2VG6B 1JJHA 5ETSA 2JEGA 3QQCD 2VFUA 3L7OA 3KKFA 1N5VA 3VCDA 1PJ7A 1N5TA 2XSFA 5DDRC 2QA4G 5MAOA 2HVHA 3TVZA 3JSMB 1RDRA 3UD3P 4WFXA 1X4FA 1OPIA 2LU2A 2AJ0A 4C3MA 3TZXA 3MUTP 2HHSA 3DHXA 2VJVA 3MMAB 4QIVA 3BH6B 4U6PA 2RT3A 1M1HA 2ZE2B 3I5BA 4RJVA 5KFBA 2ROPA 3QZ8A 1L3TA 4OL8A 1NHUA 2HEKA 4HVZA 1VQSA 1QSLA 1C1BA 1X8DA 4USKA 1SIWB 1T9WA 3BREA 2PEHA 2JRSA 1UAWA 2DXDA 4OV6A 4B3RJ 4Y2AA 4DPUA 4UZCA 2ZBPA 4LR9A 1LWEB 3BGLA 2V8GA 5HATA 3DRSB 1R27B 3S1TA 2XTJP 2RS8A 3ZZRA 1WKKA 4EI2A 2KFNA 4WXOA 2AJQA 3T5LA 3GG1A 2VPYB 3OXGA 2DHGA 3MEEB 4ZCKA 1V9OA 4ZOSA 1YJWS 1R0AA 5D78A 1JLEA 2GHPA 4FP9A 4ER8A 2B4PA 3HK2A 5A76A 4YR2A 3W8PA 1U2FA 3PHEA 4RW4A 4Y34A 4OMFG 1X4CA 2DGOA 2KN4A 2MJNA 3OXFA 5EX3A 4O3OA 3S6EA 1TMMA 1QLNA 3SZ2A 2CPDA 5AE2A 1VS3A 3D67A 4L72B 1QAXA 1R0BG 2R7TA 2HHHF 3R7SB 4RNHA 2IAJA 2H9ZA 3THPA 1S59A 2DH9A 4GVBA 5B0BA 3MAHA 2MZ1A 1BLUA 3M9OB 3H4BA 4C8MA 2ZBRA 4ED6A 2AEFA 4JI7J 2LMIA 5K8NA 4EYIB 1HMVB 3D7SB 1LWCB 5LJ3Y 4HYKA 3B8HA 4PUOB 3QO9A 4LUBA 1NK0A 5D15A 1UVMA 2M2BA 2DGXA 2GVDA 4FF4A 3UVJA 4UUXA 3H8YA 4IYQA 4ZK7M 3J81U 3GQCA 3DXBA 2HNDB 4URQU 5DS7A 2KJVA 3CDBA 2QL7B 1GMWD 2GGPA 2PFDA 4J9NA 2BMBA 3N28A 2IC3B 1Y9OA 3IS9A 1B99A 5CH7B 5K5MA 2WB4A 4CO3A 4CLZA 2DPJA 3FQLA 1PIEA 4B3SJ 2LFVA 3SYZA 1NSPA 2BKPA 4ZS6A 4DPOA 4AYBD 2XS5A 1WF0A 3ZZYA 1WEYA 1VFJA 3JB9k 1UJ6A 1VMBA 3IA0A 5DG7A 3CCSS 1KQGB 4O3SA 3TZYA 4J91A 4NRTA 1VRUB 4DSIA 1J27A 3W5XA 3QRPA 1LW0B 1SC6A 3D0IE 1IUJA 4U8VA 5AXMA 1NSAA 2DXFA 1BXNA 5IS2A 3K2YA 4U9RA 1UJ4A 3NY0A 4FF1A 4A8SA 1FX2A 2OTJS 4O4GA 4CO1A 3PYFA 3CJSA 3HFVA 4QJVA 4OZ0A 4DV1F 2KXHA 1FD8A 3BN7A 3M2VA 3NEKA 4IDKA 2MQPA 1UA0A 2CQIA 2E9RX 1FXLA 3VAIA 3QJJA 4DL4A 3W9JA 2BKNA 1U09A 1XQIA 3Q8YA 3T6BA 5F8GA 1U1RA 2LQ9A 2V68A 3K58A 3G82B 1RTDB 1VQKS 1VLOA 4Y2KA 2E44A 1CJKB 1LQ9A 3CCWA 2EFVA 3ET6B 3MM9B 3D6HB 3HT3A 4QU6A 5F8MA 2WHOA 3LPYA 1T9YA 4QOTA 5DJBA 3B54A 3DMJB 3M8RA 4BS2A 3NMAA 1NCLA 2DEIA 3IP0A 4YMEA 3V81B 2RRNA 1SJFA 2KT3A 1SB6A 3MTKA 2YNFA 5IV4A 1XWLA 2HFNA 2MQNA 4IFYA 4CT8A 3VGUA 1JLGA 4NCAA 5A8KB 5KFVA 4KPYA 1HMVA 2P6SA 3HSJA 2CG8A 4DZ6A 3PKYA 4GC7A 1VRTA 1CJUA 1MMDA 4J90A 3CMAS 4O3RA 2C2EA 3QAUA 4QCLA 1H73A 2VA3A 2KVIA 1BQXA 2ZOGA 3MPVA 4DUTA 4B9MA 2RDDA 4E0DA 4JI3J 4G3IA 2HNDA 2KXFA 4CLFA 1WG1A 1X9SA 2BANA 1I1GA 1REVB 5LSRA 4YHHF 4FKYA 4AL7A 3W7BA 2IPOB 4OYMA 2Z57B 1T9UA 3HCXA 1GXLA 4WXWA 5KG1A 1GMUA 1CULA 4K2XA 2Q6BA 2OSRA 2HQGA 1SQFA 3FZBA 5I4MA 2DTJA 1P1LA 3T5KA 3TAQA 4CLYA 3RTVA 4KGZB 2RAQA 1B64A 2YNFB 3LW5C 2J9DE 3GFZA 4AQYF 1WUUA 1N88A 5H9EK 1VBXA 3AQOA 3I9ZA 1P27B 3ZZ0A 1KLMB 4PABA 2H65B 1TFWA 4DV4F 2W2QP 2Q1LA 3PYGA 2XZTB 1YI2S 1FFWB 3I4PA 5KG6A 5AE1A 5LSLA 4USUA 1HQUA 1RA6A 1UPPA 3LGNA 1HQ2A 2AJ2A 5J2MB 3JXOA 5L1IA 2KG1A 3N5FA 3J80U 4C3LA 2B6AA 4P2MA 4W4MA 4ELUA 2XMMA 2G4BA 5M2PA 3I0SA 4NWBA 4HH1A 1CSJA 2H4YB 2UVWA 4L73A 4I67A 4CTAB 2DITA 3IBFB 2OPSB 1RISA 2MTLA 2QMXA 1BQNB 3MUMP 4DV7J 2DR9A 2J6SA 3SFUA 2XS2A 3QJPA 3IO1A 3KJQB 1XNRF 5E3PA 4HI2A 3CCLS 1Y11A 2QMUB 1WG4A 5H9FK 3MM6B 1EJ7L 3G6ES 1NNDA 3D6TB 1VGYA 2VFRA 3I87A 3K5LA 2ZWOA 1O5JA 2IJNA 2RKIB 3K0JA 3MTJA 3D1OA 1ZAWA 2XO7A 3LAKA 3KYLA 5F41A 5HROB 4ZVGA 3GIIA 2ZHAA 4TVAB 3B4MA 3FNNA 5EWFA 1SC4B 1SCJB 1RZMA 2YQ1A 3K17A 4KC5A 1RB0A 4YB5A 2HHWA 2OMOA 3KUEA 4OYAA 4OYXA 3PW4A 1F1BB 4Y0FA 1Y5NB 2ZBQA 2V9KA 4YFUA 3KMQA 2N82B 3FKBA 1FA0A 1JNZB 2VQEF 2QLBB 3CDUA 2X1GA 3UR3C 3MPYA 4M5DA 1U8SA 2VU5A 3IBCB 3JSBA 1T02A 3PCOB 3OD2A 4K59A 3GB0A 5AT1B 5KFIA 3HXMA 1U24A 2IVFB 1JNRB 3N6NA 4LF7J 3UNYA 5K14A 5I42A 2MKYA 4KH1B 2FQQB 2OKQA 4C7QA 3EXYA 5LMNJ 2AX1A 2K06A 3NGRA 3KLFA 2HMIA 3DNCA 3MD3A 3AHPA 4TY8B 3EDQB 4Y28C 3MAQA 3UE2A 2J6UA 1ZM2A 2LVWA 1TKXA 5HLFA 1F3VA 2B0GA 4OV1A 2HHVA 5KFAA 1ZM4A 2KO1A 2DY9A 3IFEA 2VICA 3UD4P 2LYVA 3IWNC 2O01C 5KG7A 1S1WB 2DNQA 4EU0A 1SJ3P 1RWMB 3CW2C 2ZWPA 1WSVA 4MK8A 4J9SA 1S97A 1IR0A 4TXSA 1HBMA 3LP1A 3J81Y 2VC1A 4E98A 2PA3A 3HHEA 5EX0A 1W25A 2UUTA 1YRXA 5LMUJ 1N5YA 4CYUB 1JQGA 3A13A 1UW4A 1RWVB 1VC6A 4CTAA 4DUZJ 4G6VB 1RLDA 3QAEA 4USTA 5LM7E 3D66A 2DHHA 4H54A 2VIHA 2BKOA 3R7NB 3OV7A 2YNIA 1KFDA 5GAGU 1J5OA 4F4KA 2FVCA 3DLEA 3FCHA 4X84A 4ZVHA 2LP4A 3K5NA 1ZYQA 4LF8F 2WSEC 2ACMA 3TAMB 5KT4A 3NRBA 2IIHA 3F56A 3H2VE 3IC1A 5T7LB 3H5YA 2DD8S 5E33A 2B4UA 3MEEA 3NCQA 4GVBB 1TU0B 3A8EA 3BN4A 1ZS6A 2FJBB 2NXNA 3CWJA 4RNFA 3KJVB 2DBBA 5KT5A 3MM8B 2YWFA 4RW8A 3MWBA 5ETVA 5KG3A 4AXJA 5RUBA 2BR0A 1XNRJ 5CYJA 3OJSA 2FHOB 4DPWA 4GC6A 3LUYA 2DRAA 1RT6A 1UL3A 4RBUA 1HBMB 2EG1A 6FD1A 1WC4A 3DRPB 3K7RA 1FK9B 2FTRA 1FEEA 3SFGA 3RR7A 3VGVA 1WELA 2B4OA 3M2UB 5J2MA 4DSJA 1N33J 2LXUA 5GVQA 2IMOA 2C2DA 4BWJA 1HKAA 3G6YA 3KHGA 3LP2B 3TP2A 3JS9A 5HMXA 5ITHA 2BANB 2C3MA 3H40A 2HVDA 1MROB 2CJBA 5HI7A 5KFJA 2MKCA 3AB4B 4X66J 4K4UA 2VBZA 5HBMB 1TV6B 2QTWA 5DLGA 2C2OB 3WX4A 1LW2A 3DYAA 3K5PA 2HFSA 4LFCF 3HF5A 4NLYA 4OHVA 1KKHA 3D3BJ 1VQ4S 5LL6d 1W2BR 2KT5A 2JFDA 4JI5F 2ZDOA 3Q2TC 1FJ7A 4Y6IA 3PJWA 2W4CA 2YWKA 5CZXA 2F5GA 1IKVB 4DPYA 2RS2A 4KAIA 1FNOA 5JUMA 3W64A 3WZ0A 3B82A 2BRKA 4DUYF 2DXEA 2AGQA 4B3RF 1RT6B 5LMNF 4ECSA 1CLFA 3LGHA 1GK8A 2RF2B 3C16A 5KOXA 4HTIA 3RAQA 5KFTA 1XJWB 2HRUA 2R7WA 2K8GA 2KRBA 3AXKA 4KH0B 4KHMA 2XY6A 1IBCB 4UUWA 4DCJB 3OVBA 4KGXB 1U25A 2R7VA 1VQNS 4PZVA 2AYMA 1FE4A 3M30A 5KAKA 5HSPA 3IAS9 4JI4F 3MHYA 3PR4A 3CDEA 3JTPA 2IA0A 3KHLA 1LNQA 3D4JA 3DLEB 3M2RA 1C1CB 2ZZMA 2XMJA 5LXRA 3R2DJ 1WF2A 3OUYB 1Q8IA 3EJMA 4L6V3 4JI1F 2H54B 3L3CA 1I94J 2X1BA 1NDCA 2MLZA 6AT1B 3DDIA 4QPXA 4KJIA 1U2CA 2OH2A 1OMSA 2FLOA 3C15A 1UZDA 3MM5B 3C16B 1IKYB 1UMJA 4YUDA 2VODA 1YZ6A 5BYRA 2WCXA 3SV4A 4NL5A 5HROA 1YHQS 2KL8A 4B9NA 2GA7A 3CCMS 4W92B 1H2VZ 2UUWA 2LQ5A 3AOCA 2ZITA 4X62F 3OJUA 2HBZB 1C4CA 3L9ZA 5A0YA 1TL7A 4EUVA 1CBKA 4LRBA 3OTBA 4PWWA 1LFPA 2BE2A 3PX0A 1NPRA 3CO9A 4X66F 2XMTA 3O3LA 5AE3A 3A3NB 3PR5B 1UTAA 2DO4A 4MKBA 1WDTA 1S5ZA 3OUYA 3KLVA 2JL9A 3Q8UA 4B3MJ 1R8PA 3ILJA 1OWXA 2V8HA 4O4RA 3DDNA 2ACYA 3KLEB 1HPZA 2ATCB 4IH5A 3KG0A 3D0HE 4KKOB 3DI6A 5IV3A 2HFOA 4CT9A 2HKEA 3H20A 4ZPTR 4WPAA 1U1KA 1U6FA 3TA0A 1FXRA 2NS1B 1AT1B 4F7VA 1EARA 3AJDA 1Y3KA 2YKNB 3N01A 2IAJB 1KEKA 4K4XA 3PO4A 1ZTWA 1U02A 3HDSA 1LXJA 1X5SA 3GYXB 4ZKAA 1Y00A 5HK4A 2RDJA 4NZ6A 5JVGQ 3VHQA 3KK3A 4DX6A 4F4YA 5F8JA 5ETLA 5G0RB 3QO9B 3S7RA 1WI8A 3QT8A 1S57A 4M5IA 2RE1A 1T05B 3ILLA 5K9FA 2FC9A 2CPYA 4JI8F 2CWXA 2Z2LA 1IN0A 2W2MP 2KH9A 4K5SA 1NJXA 2E9ZA 2LQJA 4AT1B 4JI5J 1UCNA 3NGKA 5F9LA 2UV8G 2HWIA 1FDBA 2Y1JA 1Q16B 4WP8A 2BA9A 4Y3CA 3IRWP 3O8WA 2HPUA 4J9UE 2GAHC 5T7LA 3UDCA 4G65A 1WKJA 4N8NA 5LXYA 2RSQA 4TLRA 4NX9A 4CO5A 2VF3A 3R5GA 4IUFA 2MZTA 1HFEL 3U1MA 1YVFA 2P9EA 1M5VC 2YKAA 2ZM6J 4ZVEA 4FYVB 1M5HA 1G1XA 3WIUA 1NU4A 1IQZA 3P3DA 3GJTB 4CH7A 3ISNC 2ZJPQ 1Q82T 1X5TA 1LV5A 4ZPCA 1NH8A 2HURA 1CJUB 4QIEA 4OZ3A 1P9YA 2IYIA 4A8XA 1RT5A 2XWXA 1NXIA 2HRYA 3M1VB 3QWPA 1PCAA 2MSTA 4JB8B 2QMWA 1UFWA 1DQAA 2ZZTA 3LAMA 4XTTA 1TL3B 4YOEA 1N56A 4R5PB 1HWKA 2YY3A 1AROP 2Y0BB 5KFUA 2KG0A 4I69A 3DXSX 2G1HA 5A8RA 1BY9A 1HHSA 1T11A 3F73A 1DZ5A 2YX4A 4U7UD 2EFOA 2FIUA 2EG2A 3IG1A 3R5BA 4M8LA 5FIIA 1CC7A 3ZXWA 3SI8A 3VQSA 3PIPQ 3R5AA 2RQCA 2ATLA 3IGVA 2F9JA 3MPWA 1X5PA 1FJGF 5IT9U 1PJ6A 2J0XA 4OZ5A 2KTQA 2P5VA 2HFZA 3G82A 1RTDA 3W3SA 2HWHA 5KFCA 4RW7B 2CFXA 2DT9A 1RT4B 4PKDB 3VZIA 1HI0P 2CIMA 2CDRB 3V5RA 4PXDA 1NUEA 2JDJA 4WE1B 1RAJA 4C2MA 3KLIB 4J9QA 4ATNA 1L3UA 4F0MA 4DUYJ 4OHWA 2YQ3A 3DRXA 2MKHA 3VWSA 2OD4A 1U6ZA 2HGNA 4PR6A 2B5JB 3E51A 4J9OA 1RA7A 2CNOB 4YDDB 2LDIA 4L3KA 1UA1A 2OPSA 1HR0F 5KFWA 5J2QB 1D0EA 2ROEA 2DYAA 3C8YA 3NNAA 3TJ8A 2JX2A 1HW8A 4I4BA 4DI6A 5F8IA 2FD2A 2E5LF 1CJTB 1WF1A 1XMOJ 1NJYA 3WIVA 4B9UA 2MMYA 3EE3A 5CHCB 2BVZA 2V8DA 1Z1ZA 2KXNB 2W8KA 4J9LA 2CPHA 3TOQA 4YP3A 4NCGA 4XO0A 3ILIA 4PQAA 2K1RA 2VG7B 3QIDA 4B02A 1OJ4A 3CF5Q 2L3MA 5DRKA 1FRIA 2PE8A 3T9NA 1BMQB 4C98A 1N0UA 1RBLA 4WKYA 3J7YU 2FJXA 5IT9Y 1FJGJ 2ZKUA 2FHMA 5E3AA 3NWGA 4P2SA 4DL7A 2UU9F 1JLBA 1DLOA 2FHKA 2M0GB 3MCNA 2QA1A 4XAKA 3QIPB 2UXBF 1T8EA 1MNEA 3R3TA 2ZH8A 1IM6A 3R97A 1GTHA 3K89A 3N4WA 4FXVA 5C7PA 3T1YJ 2MQMA 3BKFA 1NPPA 3ZNJ1 4LSNA 3L95X 1FEHA 3W1YC 1RTIB 2JWNA 1FKAF 3PYDA 2XG8A 2YWWA 3SIPB 2R7XA 1FK9A 2MDAA 5M2UA 3N6LA 3CIMA 3OL8A 2DNYA 2XSJA 3H2UB 4F4XA 1TKZB 3PJ9A 1F9FA 1BQNA 1D09B 2VASA 5KFHA 4NA1A 1RTHB 5L9NA 4RLEA 1YJVA 2N3LA 3QT5A 3SV3A 2HVEA 1O6XA 2PT0A 2QL9B 2EC2A 4UTGA 5SUHA 1M5OC 2K1RB 1SKUB 2VG7A 4NXNJ 2JHEA 3BDPA 1VQ7S 1XMQJ 2DRBA 1Z2LA 3NBPA 2DNMA 2GFFA 1GXTA 4LIRA 4WFZA 4C11A 2KDOA 4L74A 1NHKL 1Z2ZA 2W2NP 2ZE2A 3KDOA 3D9BA 1ZPWX 3TA1A 1MU2A 2ZH3A 2I0XA 4I56A 1IBLF 1RHRB 4JBCA 2IRUA 3V81A 1FKPB 3H5XA 2NXCA 1HWLA 1YJTA 3JTOA 3CJ0A 2V6AA 3TYTA 3CCUS 1NK9A 4IH7A 1MSWD 2D9OA 3QYYA 1IKWB 2IHR1 1R8CA 2HZAA 1Q8LA 2KHCA 1I51B 4F8RA 1UWBA 4OX9J 2NR0A 2XMWA 2BJDA 3EZUA 2GIFA 1MN7A 4CH1A 1AXQA 4ED3A 4F3OA 2GMJA 2KB2A 4TYBA 2QGFB 5IWAJ 1R3NA 4LSLA 4DG1A 1REGX 4HDGA 4XPCA 2BQUA 4KHPF 2W25A 2D3UA 1JLFB 1KBRA 1FRMA 1HQEB 1GTEA 1NDLA 2FYXA 2VPZB 3M6WA 4X4OA 3DLLQ 4ZPWR 1QE1A 3MM5A 4ZVQB 3BGUA 2C1EB 3G9CA 3HVWA 3A4TA 4F02A 2XYGB 3GJQB 3IG1B 2JJ4D 4MIBA 4CLWA 3M7VA 2OP5A 2XSJB 4ES1A 5DZ7A 2LQ8A 1RAHB 4H4KA 4IG0B 4P7TA 3U1LA 3C6TA 5B09A 1N6QA 1B7FA 4DR2F 3JSYA 3CC2S 4USWA 4MFBA 2HK3A 3Q89A 2KI2A 3QGIA 2Z30B 4OI6A 1R6YA 1CJVB 1HBUB 1ZM9A 4ZIVA 3ETOA 5IZHA 3NGDA 3KMSA 4DR3F 2L48A 4NLDA 5LMUF 1VQ5S 1I3OB 4HT5A 4X64F 4OJHA 1U48A 2VONA 1MMNA 1RT5B 2QSWA 5HMZA 1S4EA 2Z2YB 1WOOA 2LECA 2CQ0A 2M4MA 2RQKA 3ZTRA 3OFGA 4OYOA 3GCXP 1NK7A 2FHJD 1HNZF 2MJUA 3JAMU 1HQEA 2PGCA 5I3QA 4K4VA 2PIIA 3AD7C 4HKQA 3OHAA 1CJTA 2B43A 2YNHA 4NI2A 2GIRA 4DL5A 2CADA 1SH3A 3BF4A 4TQSA 3MD1A 4IG0A 1NLKL 4WU3A 1RXOB 1VQ8S 1VQLS 3MMCA 1U26A 4ID8A 3CMES 4XDDA 4LQ9A 2CQCA 4H4KC 4I1TA 4DS4A 3OLAA 1R8AA 4HDHA 4CI0B 1PYSB 1TK5A 2D3OR 1QE1B 2ZVIA 4UY85 1S77D 4IFVA 2HK2A 2DNHA 2EFGA 4YB6A 4ZLPA 1I94F 2BUNA 4USVA 3NMRA 1PAUB 1SJQA 2G0JA 3FQKA 1HHTP 2YWHA 1SH2A 4WE1A 2OD6A 1NK8A 3SQGA 5BYSA 2Z4PA 4DR3J 3CT9A 4ZLNA 2FJWA 1WWHA 2AT1B 4Q45A 3CUNA 3H0PA 1KNZA 2EPIA 3T6JA 3ISZA 2J0SD 5J2NB 2BM1A 4MMOA 3C3LA 4WF9Q 1CEZA 1N5SA 4TU8A 4PWUA 4Y2CA 3PKMA 4QIWD 2DNZA 2MZRA 1M5KC 2WVBA 1RHJB 2XHWA 1TUGB 1A9NB 5JMNA 3J7A1 3TW0A 5L9XA 1EB0A 4OI1A 3OHBA 3BYRA 1P9QC 1TKTB 3UN3A 3TAPA 2MLYA 1C1BB 3SSSA 2GV1A 1NSKL 1RT2A 1ZAXA 1IKVA 1URRA 1WC6A 4C11B 4I2PA 4PG5A 4Q43A 3GONA 5JVHQ 3RB6A 4C8ZA 5CA5A 4FXDA 4CO4A 3GR0A 4EBEA 2MB0B 4W90B 3D1HA 5EWGA 2V0NA 3CJ5A 1QAJA 3QIPA 3GU0A 1RAAB 1VC0A 1SVDA 3SCLE 4AUKA 1ITPA 1RE1B 2GIQA 4DQPA 1QTNB 1QM9A 4G1IA 3SXLA 4LF5F 2P9GA 2KZZA 5CYMA 1GNKA 3H4DA 4OHXA 1JJ2R 1U0HA 5KFRA 2XNQA 2W9BB 3OW2R 2F4VF 2MPUA 3VAKA 4CCHA 5A8KA 4CQ1A 3P96A 2CDQA 3R27A 3HHNB 2P8IA 4GKJF 3MEGB 1N54B 3HI9A 3P5TL 3JTNA 5D4PA 2PD1A 5D4LA 1UFLA 3QSYB 1ZZFA 3FMBA 1H72C 3QATA 3ZFVA 1IJFB 4BCAA 5CABA 2B7BB 2R7RA 2W9AA 2VBWA 4OIXA 2M88A 2J6TA 1VLYA 4NPOA 4OI4A 4BWMA 1OSCA 1KFSA 2DRDA 2G1DA 1K1SA 2RH3A 4BC9A 4DU7A 1NBEB 3CCZA 2W7OA 1WHXA 3KLIA 4L3NA 2ALYB 3OQ2A 5KFLA 5T14A 4JI2F 1KVIA 2OMLA 2DVIA 3TO8A 2JLFA 3LOUA 3HULA 3PZPA 4Q7AA 3V6DA 1D1UA 1PKUA 2W2PP 4TU7A 2CJAA 5LT5A 2EFPA 3I9V9 3T1YF 3BGFA 4P73A 1HNXF 3KJNB 4OFZA 4I64A 2YBVA 3MDFA 4YR0A 2I2YA 2E9TA 4HACB 1PYTA 4HR2A 2CQHA 4EFAC 2MKIA 5DGAA 2GQQA 1Q8KA 3ZZZA 2ZHBA 4CO2A 1IBKF 3K8VA 3KXDA 4LVNP 3KLFB 4PRFA 2RNEA 2R2SA 4F4ZA 2XY5A 3DI6B 1E6YA 2WVCA 3SBMA 3DM2B 1SUQB 2XMKA 3BSNA 3HHLD 3QLHB 1JKHB 1B4SA 4L76A 1BQMA 3MEKA 4L75A 7FD1A 3GR1A 1VHFA 3CJRA 4XIUA 4M5KA 2ZDPA 3TARA 1N6QB 3D3CJ 3S8SA 2DH8A 1AUDA 5KT6A 2OPRA 3A3OB 2VFTA 1OY6A 1SQGA 2B51A 3PRDA 4TY8A 3L09A 2HYIB 3OFFA 4HL9A 3RW6A 3C19A 2YPZA 2F8EX 5D0GA 1SL2A 1DTQB 3W5YA 1RBAA 2RF2A 1WEZA 4ECQA 1N36F 5AXNA 4ECWA 2LLZA 1HBUA 2QLXA 4DL3A 2A6OA 4N56A 5B08A 1HNVB 5DQGA 4IRDA 3M8QA 4NLQA 3LANA 1DJ0A 4DL2A 3GILA 5DETA 1U0HB 1DQ9A 4LR8A 4NLVA 2W9BA 3P49B 1K47A 2AP6A 2BJ7A 4ZCMA 1C2PA 1U1MA 1ZTTA 4N8OA 1FHTA 4C8YA 3A12A 2Y3YA 1U49A 3E01A 2XB2D 2KVQE 1D8YA 4K50A 3G6XA 4R0JA 3EX7B 4YB7A 4GKKJ 4JV2A 2KJWA 1B0TA 1JXEA 2UZAA 3P8BB 4N47A 1SV5A 1C1CA 2X51A 2CVIA 4AE5A 4DR4F 1RLCL 2JVRA 4CNYA 2YKMB 4DL0C 1HI1A 5FDLB 4C3KA 2OELA 2ZH9A 4DV3J 3I96A 4A46A 5H1SV 4XPEA 3EPIA 1YG0A 2R7SA 1FKOA 4A8OA 4Q8EA 4JV5F 2HHXA 4KIAA 3WDOA 1N52B 3MM7A 4FXWA 1JX4A 3D5MA 2WOMA 2M3DA 1VBYA 1KLMA 5DDQC 5J2PB 1QY7A 3QGPA 3NAIA 5DZ6A 4DR4J 1N5YB 2BE9B 1N32J 3V6JA 1HA1A 2A0FB 1WHWA 2FJVA 2R8GA 3G2XA 4LJMA 4Q8FA 3CVKA 2EBGA 3I4HX 2DHSA 2IFXA 1RSCA 2EFNA 3LWLA 4ILLA 4NLUA 1BWVA 2JEIA 1KN6A 2CNLB 2NXEA 2OAUA 3RG6A 1ZAVA 3ISND 5CCMA 2OPQB 1FJEB 2FVSA 1ZPVA 4NLPA 1IJEB 1X4EA 2POKA 4RUBA 1VQYA 1KQKA 1EQMA 4TQRA 4DV6F 4QIGA 1PC4A 5HP1B 2V50A 4C48A 1TKTA 2HSEB 3KK2A 3EICA 1FFSB 1UEKA 3BS9A 4GVLA 3GFXA 1YJRA 1S1TB 1VIOA 3RYLA 1VI7A 3MMBA 1IKXA
chains in the Genus database with same CATH topology
1D9AA 4NA3A 4EO8A 1SIZA 2RQ4A 1RJJA 2GO9A 1U1PA 2CPXA 2CJKA 1EP4B 1N32F 4WKRA 1AFIA 4KSEB 1S72S 5K8MA 3HM9A 4U7UK 2IM1A 2R4FA 4K4SA 4IQMA 2C42A 4I6WA 4KO0A 1K0VA 2MQLA 2CG4A 2HNZA 2J7KA 4I6YA 3D0GE 3PXGa 1XR7A 3UNGC 3VAJA 4DFKA 4GO7X 2ASLA 5GADI 1S9GB 3RRKA 2B5JA 2XGPA 1FESA 2APOA 1RK8A 3NNCA 3GSDA 2F9DA 2CQBA 1FNMA 2MZJA 2OO4A 2R7QA 3DOKB 3QMQA 2F40A 4URGA 5KTQA 2FC8A 3HKZD 4B9TA 3NL0A 1LXNA 1SKWA 2QE5A 4IH6A 2CRLA 2FVRA 3MECB 2QV6A 3MR3A 1VQ6S 1YIJS 3O1LA 2F1FA 1G7CB 4N76A 3MM9A 2HHTA 4KB7A 1ZH5A 2XS7A 3KG4A 2FHJA 2Q6CA 1S79A 2RJZA 3V6DB 4ZPAA 3FEYB 3PW5A 3CIZA 1MW7A 3K8WA 2K2PA 1O51A 2DNOA 3M1VA 5J1PA 3ZZUA 2NPFA 3ZZOA 1RKIA 1XERA 2BACA 3OR1B 2PN6A 1U2RA 4ZA1A 3MR6A 3BO3A 1NO8A 1QVGR 2GQCA 3AAWB 3UCGA 3DM2A 3GYNA 4OJ3A 4FNIA 4UOCA 4ELVA 5E0OA 1TUVA 2V2KA 3BB5A 3BEGB 1KLNA 3NBPB 3DOKA 1Q4RA 3CE8A 1EP4A 4R8UB 1DHMA 1L3SA 2XI2A 1S1UB 2VPXB 4NYZA 3LGMA 5KFNA 2K3KA 1FKPA 4WIIA 2ZJRQ 1JLAB 4NLOA 3TNVA 5J1EA 1UETA 3OL7A 4BDPA 4B3OA 4XK8C 3V4MA 1R8HA 3MEGA 4B3TF 4HHJA 2AJ4A 2HQIA 1FT8A 1RT1A 4LF6F 1MU2B 4M95A 3PDNA 4R25A 1M0SA 4RBVA 2DB1A 4J9KA 2CPJA 5A6WA 4UQGA 3CC4S 4OI0A 2VKRA 4IO9Q 2UXCF 2G9OA 4ECVA 1IKWA 2WBMA 1TP7A 4F2SA 1ZBTA 1RTJB 2Y0SD 2GX8A 2RILA 4H4MA 1S0OA 1CC8A 1FO1A 3UPFA 5JXSA 3GV7B 3SDEB 4G1QB 4NLWA 4JI6F 3CJ3A 1S1UA 3OFEA 2GCFA 4BBYA 2DJWA 1SL1A 1XR5A 2LEAA 2BQRA 4Z2XA 4NCGB 1XNQF 2WRMA 3JYTB 5G0RA 4KT0C 3CJ4A 2Y1IA 2L41A 3CCRS 3C2PA 1DURA 1Y7PA 3MMAA 2W7AA 1YJNS 2XC9A 2Q66A 1C0TB 1RT7B 1NH7A 1GX5A 2HW3A 3E3XA 5DM6Q 3R1HA 1T03A 3UR0A 3ONQA 2CKWA 2DR7A 4LF4F 2ZH1A 2YX1A 4DJBA 3CTRA 1U6BA 2J9EA 2C22A 2ROGA 2CQ3A 1NJIT 2V8VA 4D3HA 5K8OA 1YGYA 4A8QA 5IM0A 3KLGB 3G4SS 2AGPA 1RYRA 4B9VA 1X4AA 5D6GA 1SBRA 3AA8A 1N34F 5HQ8A 5H9FJ 4PXEA 2CJQA 4K4WA 2B9WA 1NK6A 5D3GB 1CPZA 2WB1D 2L9WA 3IWXA 3PJXA 5HMWA 4DUZF 4WYLA 4IR9A 1KOOA 5DGBA 1Q53A 3BQ2A 2YX7A 2BBEA 4EYHB 2N4CA 3US5A 3SCKE 3MGJA 3AJ1A 3IR5B 1HNIB 3PEJA 4RNOA 4DSKA 2VV5A 4RW7A 2EC0A 5D77A 2EI5A 3AQPA 2AD9A 1XBWA 2CQ2A 2OPPB 3DGPA 4WK3A 3KLGA 3RRGA 1X4DA 1XTZA 5JJBA 4RNNA 4IFVB 5GAHU 1DTTA 1NEEA 2FJDB 2C3OA 4DS5A 1T7PA 2IBKA 1S76D 1S1VA 5D3GA 3ENQA 2A2CA 1VJWA 3VR1A 5BYQA 1PGZA 1H3DA 4J5OA 2B6AB 4OX8A 2RKIA 4C8YA 1H38A 2RVJA 1NK5A 2B3TB 2FVQA 1WACA 1VBZA 2MYFA 2R8JA 2NPIA 4WJBA 4MAKA 4F3MA 4Q5VA 3M32A 4FF3A 3C6TB 2JEFA 1A7GE 2D1CA 2HVZA 4ZHRA 2IVYA 4KRWA 1S0VA 3LQVA 4ZCLA 1XMQF 1RT7A 2X1AA 5L8RC 4JI0F 3M8PB 5KG4A 4ITSA 2AYBA 1MWYA 1CEZA 4ECUA 3AY0A 2D41A 1B0PA 4FF2A 1P1TA 1T05A 3I55S 4LSNB 4WU2A 1ZZNA 1DAXA 5MLCV 5SZTA 2EW9A 3LO3A 4HT7A 2BW2A 1RWUA 4MK9A 2A3JA 2MGZA 4ZDNA 4QQBA 5CD4H 2R8HA 4RUCA 5HP1A 2RDIA 5L1JA 2UUAF 2E7XA 1RT3A 3C6UA 3TA2A 5IXUA 4YEAA 5KFQA 4FVCA 1J5EF 4I0WA 1V3SA 3CJ2A 3RU0A 2R2RA 1SH0A 2FLNA 2VD3A 1IBMF 3MI7X 1R0AB 2V9WA 5B0CA 2DNGA 3J80Y 2DR5A 1S6OA 4J9MA 5HLFB 1OS5A 2O67A 2YTCA 2NXUA 4TY9A 2HHUA 1JLAA 5J1EB 3W2VB 1H2UX 2F8HA 2WK4A 4QIFA 2JH3A 4IG3A 3KLHA 1LFWA 3I0RA 1O0PA 1CVJA 1SKSA 5C5JA 4NYOA 1QSYA 3H59A 2RIJA 4NCBA 1RTIA 1QTMA 1SI9A 3RW7A 4IFYB 3TUIC 3IN5A 4O3QA 4ECZA 4DFMA 2FVPA 1C0UA 4KV8A 1RT3B 3HLUA 2QZ8A 3OTEA 3OBIA 1Q86T 4RW8B 4X4TA 2DGQA 2K3IA 4O23A 4DHVA 2AGOA 3MM7B 4K4UA 3BZQA 3HVAA 1UVNA 4MH8A 2E29A 2YNGB 4ED5A 1JXLA 2B4VA 3VAHA 2FUG9 1NKEA 2DGUA 4UW2A 4E8UA 5F8HA 5J1NA 1RI7A 2VKZG 5BR8F 2DPIA 1Q78A 5KFPA 5GAHI 4C97A 1H7WA 5F9NA 2QLWA 3K5OA 4A4JA 2UUBF 1AW0A 4N77A 3BQ0A 1U1OA 2WSCC 4NLRA 2F7VA 4QZVB 1Q1KA 1H0HB 1F5CA 3KTQA 2C2RA 3DCAA 2ABYA 1G6BA 5I42B 3CD0A 1P6TA 4KV8B 1PSDA 2BABA 1TVRA 1SJRA 3IAM9 2RQMA 2ZOFA 5I3UA 1D9DA 1WNEA 1ZM3A 5KFOA 3PFEA 3PW7A 3FEXB 2ALZA 2LU1A 3J7YI 2FY1A 2W8LA 3RB4A 3CJKB 2I8EA 1ELOA 4BC7A 6FDRA 2XI3A 3HFKA 4KO0B 4FNHA 3U02A 4B9LA 1TAQA 2HNZB 1DRZA 3SMZA 2NSCA 4C8LA 1FXDA 4TU9A 2C3PA 1OO0B 2OPQA 2ZNZA 3G8SA 5GAEI 1JLQB 1Q7LB 5E41A 2IBOA 5B0FA 1RT1B 3FSXA 2ADCA 1S0MA 5EGYA 2QEXS 2ASJA 4ZP8A 4EZ9A 5F0UA 1S1TA 3TANA 4HH0A 4FS1A 4F25A 2BOPA 4DR6F 2OJ3A 1CQMA 4A8YA 1NHVA 3EZ5A 4DX8H 4WFAQ 1JMTA 3D54A 4ILMA 4DFPA 1KHWA 4MYUA 3ENWA 2EK6A 1D8ZA 4ZP7A 1IKXB 4EO6A 1FTCA 1KONA 2OFHX 3M8PA 3OLBA 3M4XA 1TL1B 4B3MF 1C0TA 2AWZA 2GW8A 1VIXA 4JOUA 3GWCA 4IRKA 3CXCR 3DFEA 3HMJG 5KFGA 1K73T 1NJZA 2ZC3A 2MKJA 3GE9A 5LSOA 3Q8RB 3HZGA 1X9MA 1HL6A 1FVSA 3GV5B 2BM0A 2YNIB 4CNZA 1L5UA 2PA8D 3FRYA 2SXLA 3KWMA 1CG2A 4UQTA 2KFYA 2VG6A 4ERDA 2ZH2A 2MKKA 3KFWX 2MZQA 4ZPVR 3BDEA 4ES3A 1J2VA 1H2TZ 3LF0A 2OPPA 3M6UA 4WZMA 1QSSA 2KKHA 2CPZA 1MWZA 3O6QA 5C24B 2OTLS 4JYAF 3DLBA 4USHA 1S1VB 3RBEA 5DM7Q 2FGCA 4OI3A 3V4IA 4WFBQ 2W4PA 4Q0BB 3KG1A 5E3RA 1FTRA 1S9FA 3MR5A 1Y3JA 2E5JA 2D74B 1DTTB 1R43A 4A8FA 1BQMB 4B3SF 2PI5A 1SXLA 1C0UB 1RP5A 2UP1A 2HGMA 3AH6A 3G86A 3DLGA 5KG2A 1QUVA 2KRRA 3CC7S 2IM0A 3SEOA 3T19A 2ILYA 1XMOF 3CGIA 3HJFA 4QR2A 1RKJA 3DOMA 2I5JB 1L3KA 2DK2A 3HHLA 1DTQA 5DG8A 4KTQA 5KFEA 1FRJA 1MMLA 2A18A 3EYZA 1ZOTA 3BGRB 2JZ5A 1TV6A 3N0VA 1HARA 2J0WA 2HLTA 3FGVA 4EGLA 3SSQA 4ED1A 3MR2A 3LALA 1BWEA 5T41A 3QZ7A 3FZ2A 1WG5A 4DF4A 3MOJB 4QYZJ 1FJ7A 3SCIE 5IM0B 1LWCA 2RU9A 4PUOA 4HTJA 3F44A 3HO1A 1JB0C 3KNGA 2HQ3A 3NS6A 3PV8A 4ZMMA 1YSJA 3FSYA 2XLIA 2L9DA 4RW6A 3HP6A 1APSA 4H4MB 2BJEA 1HBOB 1TKZA 4NA2A 3N9UC 2VC0A 2MY7A 4YY3F 4PG7A 4K0KF 5KT3A 3PX4A 3QGGA 2R2TA 1F2GA 4R5PA 2HG4A 3OTDA 2M52A 2ERRA 3TAMA 4QW8A 4CZCA 4HLBA 1XMBA 3CCQS 4DR1F 5U47A 4IQXA 1TAUA 4DV0F 2NREA 1Y5IB 4PCQA 1JIHA 4AFFA 3OVSA 5FD1A 2BV3A 2HNYB 3HHLC 1C4AA 1A6LA 3GG0A 5KFZA 1T03B 2E1CA 4ALZA 2J5AA 5IWAF 1Q7YT 4NLTA 4NZ0A 5J2PA 2HHPA 1PC5A 4RW9B 3M05A 3Q8PB 4ZP9A 4I7FA 3NS5A 1OQ3A 1U47A 1B0VA 2LQBA 2DHXA 2YKMA 2MKSA 5DDPC 1PILA 2BRLA 5GADU 2VH7A 3U7JA 4K4TA 3I31A 1UVJA 2XMUA 2IM2A 5J2QA 2LKZA 4XDCA 3H98A 2PMZD 3UCUP 2CPEA 2KYZA 3E01B 5HBMA 1FD2A 2WOMB 5EHHA 4YR3A 3MEDB 1JLCB 2PO4A 4ZPDA 5F8LA 3MMCB 3B4DA 7FDRA 4R8UA 3G71S 3EGWB 3CPWR 5FDLA 2R2UA 2DHAA 3T3FA 2BDPA 3OPKA 2J9DA 4KKOA 2XEXA 3U1NA 2XWYA 4X4UA 1YJ9S 2M70A 2MSSA 4KGKA 3FJ2A 4OZLA 4USIA 1DLOB 2FLLA 3I56S 4RNMA 4MJKA 4DLGA 2AJ1A 3NG8A 3H25A 4A47A 3KHHA 4JI3F 3OSPA 2VL1A 1VRTB 2HWTA 4ICLB 5J2NA 3CCJS 5C42B 2KM8B 2AW0A 2Q43A 2U2FA 5HO4A 1VOMA 2RUGA 1DQ8A 2ZNYA 2ZUGA 1JKHA 1NAQA 3RAMA 1S6PB 2E5IA 2IYGA 4PG8A 3OXLA 1V3ZA 2MZSA 3FDSA 2AX0A 1P8GA 3Q22A 4K4YA 3NLCA 4RUAA 3UW1A 4OI2A 3KK1B 2U1AA 4RWWA 2DIVA 1SL0A 3MOZA 5F8NA 4QR1A 4FPRA 2OPRB 2QRRA 4JUZA 3BGRA 3FMWA 4FBUA 4YB1P 3IRXA 5IT4A 3VAFA 2KZMA 2PMHA 1X9WA 2WONA 1GXUA 4TNOA 3PY8A 2XY7A 2GC8A 4RUHA 3H2LA 3IR7B 3TRGA 2LA6A 1JWWA 3AB2B 1Y4ZB 2KU7A 3M8QB 3PEHA 3BJYA 1V6HA 3EXCX 4OX9F 5EWEA 3ITHA 4P6QA 5CYMB 4QWCA 4ICLA 1YWXA 2LA4A 2CPFA 2XCAA 2OSQA 4G1PA 3RAXA 2DH7A 5KT7A 2ZH5A 3FFIA 5KFXA 3M9MB 4OJ1A 5A8RB 1KOHA 1UEVA 3DLJA 2GJIA 3O44A 2HZCA 4OX7A 5B0DA 2XZWA 5GMKa 2GO8A 4LSLB 4DG1B 3D1QA 5ADZA 1S48A 2K7JA 1HWUA 1NKBA 1X4BA 3NCPA 4O0IA 4QPTA 4GKKF 4ZPBA 1FRXA 1M5SA 3MM6A 1U45A 1UJ5A 1NB7A 3GIKA 1D9FA 3C6UB 3ZC4A 1EETB 3OL9A 4A48A 4WZQA 2GMHA 2YKNA 3W2VA 4HI1A 1Y5LB 1S0NA 5D4OA 2DNNA 3BR8A 3HKWA 4ILRA 3DLKA 2ZBCA 4F67A 3RRHA 1VQOS 1H7XA 4I7FB 4USJC 3T5JA 3RZAA 2DISA 5B0GA 3GMGA 2NUUG 3R5CA 1S6UA 3PW2A 4NLGA 2W24A 1ULRA 1RTHA 4IG3B 3KLHB 4DSEA 2C28A 3R1LA 4X65F 2RMLA 3J7Z5 3DU5A 1HBOA 4Q2MA 1FCAA 1N8RT 2HLUA 1LWEA 3N79A 3CJKA 1K8AT 1UP1A 4QWDA 1YBAA 3MUVP 4EEYA 3GIMA 3G8QA 1JLEB 5IFMA 2VFSA 3CDWA 1S1WA 1T94A 3H5UA 3FVYA 2M9KA 2EFQA 3KNAA 4KFBA 4C0OC 4IO1A 4B17A 2LCWA 4YDXA 3LH2S 5GAEU 1S7HA 3OL6A 3CD6S 3PNIA 2D3ZA 5AXLA 4JI7F 2NUHA 3UFCX 1VK3A 3Q8QB 4DSFA 4WTYA 4DV2F 5AXKA 1YQHA 2PC6A 2I5JA 3TUJC 4CH0S 3VQTA 1ZETA 4NZ7A 1RT2B 3JSRA 1QJHA 4PWDA 1J5OB 3DU6A 1T3NA 5A8WA 2VG5B 5L38A 4WYWA 2R8KA 3D28A 3WC2A 4C0HA 1TK0A 2R7UA 2B9XA 2XULA 3QJLA 5KG5A 2UXDF 2E1MC 3HHLB 1KQFB 3Q0AA 4NMLA 3GZ7A 3CCVS 4ED0A 1HBNB 4OHYA 4Y65A 5CYQB 2PFFB 5I3UB 1JK9B 3MECA 1FVQA 2COLA 4Z37A 1L3TA 1RT4A 4Y2IA 5E2QA 1N0VC 2J7WA 1HWJA 2I9SA 2W9CA 2ZD1A 1CQNA 3EUNA 3MFIA 1BD6A 3MZIA 5DDOC 1TQLA 3M2VB 3OSNA 3TQ1A 1UWBB 5EN1A