4RWWA

Crystal structure of l. monocytogenes psta in complex with cyclic-di-amp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2692 protein
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwwA01
4E98A 1V6HA 3NCQA 3DFEA 4D3GA 2XBPA 2DCLA 3AA8A 2GX8A 1PILA 2CZ4A 4USIA 2EG1A 2XG8A 2V5HG 2Z0GA 3TA1A 2ZOMA 4NYPA 1O51A 3CE8A 1Q1KA 4C3LA 4YB6A 4AFFA 3MHYA 4WK1A 3OPKA 4USHA 2NUHA 2JJ4D 3NCPA 4WK3A 2GNKA 1HWUA 1NAQA 1GNKA 1KR4A 3AA9A 1UFLA 1VHFA 2RD5C 2EG2A 1OSCA 4C3MA 4OZLA 1J2VA 3LF0A 4CNZA 4CNYA 3T9ZA 4IYQA 4CO2A 1O5JA 4OZJA 5DS7A 2O67A 5L9NA 1NH7A 2J9CA 2XULA 1NH8A 1V3RA 4RWXA 5D4NA 2PIIA 2ZFHA 5D4PA 5DRKA 3N5BA 1XK8A 3AH6A 3TA0A 4CO3A 2GW8A 3O8WA 4Y65A 4NYOA 1UKUA 3M05A 3TA2A 2O66A 4YB5A 2NS1B 3BZQA 4CO0A 1P1LA 1VFJA 4RLEA 3X3UA 4USJC 4CO4A 2J9DA 3L7PA 4RX6A 2J9DE 1UMJA 4Y6IA 4D3HA 3NCRA 1H3DA 5D4OA 4R25A 4RWWA 1QY7A 3GSDA 1NZAA 1V3SA 1UL3A 1V9OA 4OZNA 4C3KA 3HLUA 3AHPA 4ZK7M 4YB7A 2E66A 2NUUG 3O5TB 2VD3A 2XZWA 2J9EA 4CO1A 5D4LA 4CO5A
chains in the Genus database with same CATH superfamily
1X4EA 4E98A 2VB6A 1TAQA 2A3JA 4DQRA 2GA7A 2KI2A 3G8QA 4DQSA 1VQ4S 1RUSA 1X4DA 2KVIA 4RPFA 4G65A 4IH5A 1ZZFA 3M8WA 1SJRA 4TLQA 2DNGA 3GIRA 4CH1A 1S1TA 4DSJA 1HBUB 2M4MA 1CJVA 3L7UA 4P71A 4ZLNA 5LOQA 1VIOA 4RUCA 1UJ4A 4OX6A 5F8IA 2HMIB 1RTHA 4A4JA 1JXVA 2UXDJ 2OEJA 4QR0A 3KLFA 3MPDA 2OKQA 5C2GA 1NM2A 4FXWA 4HYKA 4AXJA 5ITHA 1HBOB 3EUNA 4K4UA 3LAMA 1KVJA 5BR8F 2KXNB 2BOPA 4F4ZA 4RNFA 4G1QB 5DM6Q 1NPPA 3UFCX 2DXEA 4HT7A 3RB3A 4ZP8A 2H1YA 3HLUA 1DFDA 2IY5B 1U09A 4ZPTR 1S1XA 2BV3A 1F9EB 4DV0F 4YHHF 2YX4A 1KKHA 1NLKL 4KV8A 4C8NA 3OUYB 2JEIA 1B0VA 4K4YA 3D7SB 2D3O1 4DR1F 1Z2ZA 4DFMA 3H90A 5EX0A 1KONA 1OIAA 2OD4A 3T3FA 1EZZB 2WVDA 3JAMY 1VQ7S 3GCWP 1G7CB 2C2KB 2UXBF 3TRGA 3IAM9 1NK0A 4CNYA 3OL7A 4A47A 4USVA 1HNWF 3ZO7A 3HDSA 4USKA 2PE8A 1ZTTA 1HYSA 3M1VB 1QDUB 3H20A 3Q0AA 2QA2A 4XO0A 1LEOA 3T5KA 2R9LA 2W2MP 3KYLA 2CVEA 2KZZA 5BYRA 2OUGA 3VZHA 4TU8A 3HHLA 4E2FB 3MUTP 3VTIA 2G1DA 2KYZA 3QRRA 5B0BA 1RP5A 2X1AA 3JSMB 2R7WA 4UZCA 3IS9B 4KHRA 1QY7A 4M5KA 4NLOA 4L6V3 1V3SA 2EVZA 1R6VA 1TL7A 1FTRA 4P7VA 3NOGA 4EO6A 3PIOQ 1LXJA 1S57A 2BOAA 1RHMB 1CC8A 3AA8A 2DO4A 2YWWA 5KFFA 2HFVA 3CGIA 4LR9A 3TX0A 5C24B 2VV5A 4ZDNA 1KWMA 3RBEA 1MU2A 1E6YA 4ECTA 5IFMA 2Q79A 1FKOA 2MEWA 4HEA9 1S6QA 2V2VA 4EYHB 4OYPA 3S1TA 1UVNA 2HIQA 4DUZF 1LWCB 3E51A 2JEJA 2QA1A 3HFVA 3V6DA 3DGPB 3MEGB 3DLGA 4ANCA 1T7PA 2HNYB 2G0CA 5KFIA 4PXDA 3L9ZA 3OSPA 4PXEA 3IAS9 3G8SA 3IR7B 4DEZA 2OAUA 1HQUB 1BMQB 2KFYA 2D69A 3JTNA 5LM7E 3A8EA 5B0DA 2CQDA 3NXZA 3O44A 1S1VA 4B3OA 1OYDA 1DHMA 1A0OB 2H65B 4KAIA 4ILMA 1RTDA 5DM7Q 4I2PA 5JXSA 2O01C 3NLCA 5HMXA 1X4FA 4TQSA 3R7NB 2HURA 4I4BA 4UQTA 2ZOMA 1SKWA 4GKKJ 3A3NB 3OJSA 2RU9A 2V0NA 1SJQA 2CNKB 1H7XA 1HWUA 3UVJB 3K58A 3QFHA 4OZLA 4JI1F 2IRUA 3D54A 3L4BC 1TKZA 3ZZZA 3MMBA 3M4XA 2XO6A 3HKZD 5GMDA 2B6AA 2GO8A 4YY3F 2HS3A 2Q43A 1MLAA 2YWKA 1IWGA 2HHTA 5HBMA 3JQMA 5JVGQ 3F73A 1GMWA 4WIQA 1UKUA 3UD4P 3ZXWA 2NSCA 1X60A 3C15B 4LVNP 3D0GE 1YLXA 1DTQA 4RW8B 4WCEQ 3PW7A 4QYZJ 4LSNB 2DXDA 1Q81T 3GMGA 2KFZA 2BJ1A 2C2OB 4P74A 5F3TA 4ECUA 4NLDA 5D4OA 1VQLS 4JV0A 5B7WA 3D1QA 2ZD1B 3MCSA 1B0PA 3UPFA 3UR3C 2EFQA 1H98A 4NPOA 3T5HA 4ERDA 5J1EB 1HNVB 2Y8WA 5KFLA 3CJ5A 1HKAA 3TEGA 4PCQA 3HFZB 1SQGA 3EXYA 4DU8A 2CZ4A 4FBTA 3THPA 3TA1A 1FRIA 4KR0B 2K3KA 3T1YJ 1CC7A 3EMTA 3KFWX 4YB6A 2XMKA 1FFWB 3GIMA 4DF4A 2DR5A 1G3OA 2HFSA 4Y2CA 4DX5A 2WVEA 4O3QA 1S10A 3LALA 3ENQA 2X1FA 2BKOA 1PGZA 2QE5A 2HGLA 2Z2MA 5J2PB 2KT3A 3PYEA 3SIPB 4JYAF 1P6TA 2ZOGA 4PQUB 4CM2A 1VRQC 5HO4A 5AJ3J 2DB1A 2L9DA 2RHQB 3EGWB 2VC0A 5KFTA 1EB0A 3OVSA 4TY9A 2GO9A 2N82B 2M0GB 3FEZA 4YHHJ 3CJSA 2DNNA 2FC8A 2KM8C 1H2UX 5ETTA 3C6UB 1GMVA 4Q45A 3I4HX 2FLLA 4I68A 2QT7A 1KFSA 4R5PA 2UXBJ 3DLKB 2N3OA 4N8OA 3ILJA 2C2DA 2ZH8A 4J90A 3DU6A 3DI6A 1N0VC 1PJ7A 4RW9A 4CZCA 3MHYA 3C19A 3ITHB 4ZJOA 1X4HA 2C3UA 3GJRB 1URNA 2LEPA 1VQ9S 2BKNA 5J2MA 3MMCB 1GTHA 4CNZA 1N56A 2XSJA 2V2ZA 4P2MA 3Q86A 3P3DA 2IRXA 1WEXA 1RCOB 5THWA 2H9ZA 2M70A 1PSDA 4J9KA 5C42B 4TY8A 4W4MA 4FBUA 2ZJQQ 5B0AA 4YB5A 1X4CA 2XMUA 2MZRA 3AQOA 1RKIA 1XC9A 3CJ4A 4LUBA 4Q2MA 2ATLA 2BJ8A 4IUFA 7FDRA 1UCNA 3AQPA 3CCTA 4DV6J 4OLPA 4NWBA 3WC0A 2I1RA 4DI6A 1M5PC 2FLOA 2ZC3A 1HR0J 2F63A 5KFAA 5DDOC 3NCQA 3AY0A 2XBPA 2APOA 1WG4A 3LANA 1TMJA 3TZWA 4DUZJ 2XEXA 2MY8A 2F9JA 4JV2A 2UUTA 1NAQA 1S6PA 3FBCA 1O0PA 4MFBA 4ZPWR 2A2CA 3D28A 4ECQA 1VQMS 1H0HB 4P10A 2V67A 3C6TB 1WC6A 1UWBA 1TQLA 3OTEA 5I42B 2M8DB 3H25A 3B4MA 1MSWD 5K20B 2V4JA 2JFDA 1AZSA 2FC9A 4CTAA 1PC4A 1RHRB 2IIHA 3TAMA 4EBEA 2QL7B 4F4XA 2DJWA 4IFYA 2RDJA 3CJ0A 3SV3A 1IR0A 3TJ9A 2XMTA 3J81j 4CQ1A 3F41A 5LXRA 5HLFB 4TU9A 1YRXA 3A8KA 3DLLQ 5CCLA 2XSFA 3UE2A 4ZPAA 4RL1A 2HFNA 3PX0A 3CXCR 1S1UA 1S0NA 4I6YA 1IN0A 4JI1J 3PO5A 1RU1A 3D0HE 2HVEA 4OJHA 2HWHA 3OTBA 6FDRA 4YY3J 1UTAA 1MWQA 2HHXA 4LFBF 4J9MA 3PRDA 4YR3A 3R1HA 4B3MJ 4MAKA 2GQQA 3PJXA 4DR3F 1KC8T 1NH7A 4FS2A 2DR9A 4M5NA 2GMHA 3DOLA 3K5NA 2YNHB 2GQCA 3KG1A 4X65F 3FBFA 4KO0B 2D1CA 3OTCA 2XS2A 2VKZG 4O3PA 1SKUB 2V8DA 3A8JA 3BKFA 3GFYA 4KE5A 3VHQA 5IWAF 1AROP 3CF5Q 4IOCQ 2HPUA 4QBUA 3LPYA 1JNZB 2R7SA 5D8HB 3M2RB 3HHLC 1P9YA 2GVZB 1PO6A 3VVTA 2D3UA 3HSDA 2ROPA 1Q8KA 1WF2A 4FF1A 4R0JA 5DG8A 1MWYA 1RAAB 4AYBD 2LP4A 3PHEA 2DNPA 2NCKL 4QZVB 2GX8A 3EPIA 4JYAJ 1YZ7A 4ZLLA 1QAJA 4G6VB 3JAMU 3HP6A 5T41A 1KSPA 4X4RA 3TARA 3KK3B 1U1PA 2NUHA 4LF5F 3QO9A 1NCLA 2MKKA 1RT7B 1OSCA 3KUGA 2HQDA 2E1RA 4LR8A 2UZAA 2BW2A 5D4NA 2XQCA 3Q89A 2YVSA 2RE1A 2H5IB 2G2OA 2YKNA 2CJKA 5IM0A 3HK2A 2KRBA 4WBFA 1HNXJ 4OJGA 3OJUA 2GIQA 4F7VA 1FDDA 1U1LA 1QTMA 1Q86T 3GR1A 4WFZA 5CYQA 1RWNB 2NZCA 3PACA 1CLFA 1L3UA 2UU9F 4F3MA 3KDOA 1NJIT 1WDDA 2J76E 5F8MA 2Z56B 2ZWPA 3MGJA 2AYGA 4DG1A 1K1SA 3J81Y 2RJZA 2UXCF 3TUZC 4EGLA 1J5EJ 2QO3A 2V2QA 2ZJRQ 3MI7X 4NLQA 1RT1B 2KM8B 4ETXA 3LPEA 2PMHA 4K4XA 3BF4A 3PR4A 3TAQA 5G0RB 3OFEA 1W26A 2KKHA 1SJFA 1U25A 3QSYB 1XTZA 5KFGA 1FVQA 2Y9HA 1WORA 5D3GA 1YSJA 1IBLF 2DIVA 5K14B 3ZTRA 3R7SB 4HTIA 1VQYA 1U48A 1CPZA 1TL3A 3NGDA 1IWAA 1KQGB 1IKVA 1PJ5A 3G9CA 3ZNJ1 4AD6A 4X4NA 4DV3J 5JJBA 2RHSB 3HSJA 2NQPA 3FZ2A 4EYIB 2CPIA 1UL3A 3GB0A 3HJFA 5LSLA 3M32A 1W2IA 1NJYA 2CKWA 1WOOA 3RBZA 3D6TB 1QAXA 1UA1A 8RUCA 4IG0A 2F8HA 1N33F 1VHIA 2KDOA 4LF8F 4NI2B 4BS2A 1JLAB 2KRRA 1T03A 1U1NA 4FNHA 1FTCA 5HK4A 5HQ8A 3HT0A 1FDAA 2FVPA 4CLSA 4B3RF 3BYRA 5H9EK 1NUEA 4K8RA 1RAHB 3RJMB 4PUOB 3QPIA 4UT4A 1H38A 3VAMA 3CEDA 1WEZA 3MEEB 1XMQJ 2WTFA 3VALA 4N8NA 1YBTA 1RI7A 3CB4A 1N52B 4Y65A 3W5YA 3ZTQA 3W62A 4J5OA 2LCWA 2RDDA 4IG3A 1VMBA 4W92B 4PABA 2IM3A 5L46A 2AJ1A 3HVWA 1QLNA 1FNXH 2YX1A 1H74A 5GAHI 2HS0A 2OPPA 3KG0A 1RWKB 4M8LA 3JQJA 1RTHB 3MECA 1U6BA 3LTOA 4DR3J 4JV5J 3MAAA 3BO2A 3KLFB 3S6EA 1J27A 3SMZA 3JSYA 3SXLA 1N32F 2XLKA 3ZNUA 1D1UA 2Z8QA 3RRGA 1S9GA 2LFVA 2RRBA 2JWNA 5KTQA 4OFZA 3AOAA 3GR0A 4ZJLA 4UY8T 4PWDA 1O5JA 3TX8A 2F3JA 4FP9A 4KGVB 4ZOSA 4J9OA 1Y0HA 4X4VA 2PDAA 4W98A 2LQ5A 4OZ3A 2IA6A 2AHOB 3CCUS 4KV8B 3WX8A 3F56A 1FX4A 2HZCA 2GAHC 3OHAA 1QSYA 3UN2A 1CJUA 3R8YA 4Y00A 1NK9A 5JUMA 3MF5A 3FRZA 3VGVA 2DNRA 2BJ7A 1NRKA 3R5JB 3GYGA 1LXNA 2HFOA 1RBOB 3D1HA 1NHUA 2XGPA 2B4UA 3NGUA 2UUAJ 2RUSA 4MK9A 3KLIA 1F5BA 1RACB 3KXDA 2MSTA 3HHLB 2XY7A 1ZTWA 3FEYB 2AYMA 2E5IA 2E44A 4PYDA 2G4BA 3VAIA 4BLGA 1IKWA 2CPZA 4DDFA 3U7JA 4WTYA 1HD0A 4W90B 4A46A 5KFCA 3B4DA 2X1BA 4ZP6A 5J2QB 1WHYA 2QEXS 1UWAA 3CO9A 2V63A 3M2VA 2HEKA 1RAEB 3TA0A 1JLEB 2MGZB 2HQCA 2JLGA 3BGRA 2ZBPA 4NLXA 1VQOS 1MU2B 1E6YB 5IT9U 3BN4A 3FNNA 3THVA 3D68A 3M6WA 3J7AN 4QOTA 2CWKA 4PRFA 4F0KA 1GK8A 5L1IA 1S0OA 2VOPA 3ETOA 4DL4A 2E29A 2M52A 3PDNA 4IFVA 1U49A 3R3TA 4B9VA 3DLEA 2CNLB 3HHEA 2XCPA 3O6QA 2I8EA 2ROEA 1L5UA 4RJVA 1IBLJ 1EAYC 3HSZA 2WSFC 4X64F 1S5ZA 2QX0A 3CMAS 2C2RA 2W2PP 2FB0A 2J6SA 1RBAA 3ET6B 2CQPA 3SCKE 3B6BA 1CJTA 1T94A 5A8KA 5AE3A 3V4IA 5EWGA 5DJBA 1KS2A 2M8HA 4LBHA 2FY8A 4B3OB 1RSCA 2VBYA 2WVBA 5KFDA 5A8WA 1RTDB 2B51A 4I2PB 1U2FA 2ZKTA 4QWCA 3UNYA 2CIMA 2ZH2A 3WC2A 2HS4A 2FDNA 1ACMB 3R6GB 1WHVA 3K89A 4RBTA 2JH3A 1N33J 4NXMJ 2MHEA 4NLRA 2GMJA 3JYTA 3GIKA 4XDCA 5KFZA 5FDLA 2HW3A 4ES2A 1DARA 5HP1A 1VQKS 4J9VA 4OZNA 4QCLA 1K47A 4E8UA 5B08A 2HWTA 5KT4A 4OJ3A 1KTQA 3MMBB 4NYZA 5D4LA 3TZZA 1N0UA 2B4OA 5D0HA 5LMUJ 2B6AB 1WELA 1PYOB 1RB0A 4ZPCA 1IKYA 2J7UA 5HBMB 4AFFA 3KHLA 1DTQB 3AJ2A 2IMOA 4DV1F 3VAKA 4Y3CA 1WI6A 4KPCA 2DGSA 1SH2A 2XULA 3JQKA 4IQXA 3NMRA 5EDWA 3TP2A 4CLPA 1R8HA 3QAEA 5L38A 3BGFA 5KFSA 3HSGA 4LF9J 4ZVRB 2V68A 3PHTA 3N9UC 2CG8A 2ZHBA 5FD1A 2RS2A 2ZZNA 3L7PA 4C7QA 5F9NA 2ZH7A 2FHJA 2QL9B 3GSDA 3DRPA 1B70B 4OZ1A 5F9LA 1KEKA 4YFUA 4UY85 1U2RA 1UVMA 3UWTA 2CQ3A 1R0BG 3J7ZT 1RLCL 1W2BR 3DCAA 1XNRJ 3DRYA 3PR5B 4ETZA 2HFUA 3IWLA 1CULA 3TAPA 3ENWA 4ZP9A 4DL5A 1CBKA 1A9NB 3PW2A 1QJHA 2OIHA 2ZJPQ 1S97A 2VDIA 1SL1A 5IV4A 3OR1B 1Y4ZB 4K0KF 4ZVTB 1Q82T 4RWXA 4C11A 1SUQB 2LEAA 2MYFA 4R5PB 5JMNA 3DMJA 3L95X 3MZIA 1NK5A 1K44A 5T7LA 2A18A 5HATA 3PJWA 3DI6B 4RW9B 1JJCB 2CNNB 1WHWA 3MM5B 2AMCB 1WOSA 2RIJA 5E2QA 2QLWA 1GEHA 4TN2A 3NBPA 1OSDA 8ATCB 2LQ8A 5J2MB 2LXFA 2XSJB 1XWLA 2VBZA 3OLAA 5E3RA 3I5CA 2PMZD 2OFHX 3TUPA 1EETA 3W9JA 2DCLA 2E1MC 4RW6A 3MD1A 3QT5A 4IH6A 1OY8A 4ZHRA 4TY8B 3R97A 3CW2C 3T19A 2R8IA 1LKZA 1VBYA 2CVIA 2QMUB 3W2WA 2EC0A 3PJ9A 4UUXA 2HNDA 1GNKA 1YTYA 2BW7A 1TTHB 2FUG9 4IDKA 2HKEA 1S12A 2K2PA 1H73A 1ITPA 3KNGA 1Q95G 2VPXB 5DQHA 4NLVA 4LR7A 5KFMA 2BXJA 2MLZA 1S49A 2M3DA 3MUMP 3BSAA 4S0MA 2MDAA 1VQ5S 2VL1A 3ZZTA 2VKRA 2KT5A 4PZVA 2KL8A 3M05A 2LECA 2J6TA 4RLEA 3RB6A 3KJVA 3AT1B 4RNHA 1S6PB 4X64J 1KRPA 2KVQE 4MFBB 3KHHA 4CLFA 2EFVA 1FWKA 5HAOA 3BJYA 2KXFA 3NNHA 1T9TA 3ULHA 2DR7A 2V4JB 2Z0GA 1AZSB 2JDJA 2ZVSA 4NLUA 3GCXP 4DL2A 1BLUA 4DSKA 2ZBQA 2JOQA 4IFYB 1VISA 1UZHA 4DSEA 3AXKA 4U8YA 1DLOA 4K59A 4USMA 4LF2A 1WC4A 3BM7A 3MPUB 1YJWS 1C0TB 1RA7A 3M2UB 2GV1A 4Y2KA 1FRHA 2QZ8A 1S1UB 2HLTA 3ISND 4ZPDA 1N36F 5HJXA 1VC0A 2YWHA 1X7VA 2VUGA 2UP1A 1M90T 5KG7A 1YJRA 4NASA 4DPUA 2VU5A 1RU2A 1KLMB 4D3HA 3QJLA 4IR1A 2RT3A 2CQGA 1RZMA 2DNMA 2VG7A 1HFEL 4RW7B 1VC5A 1VJQA 1VRUA 3O5TB 3MAHA 2Z4PA 1AUDA 1OY6A 3VQTA 2VA3A 1PILA 2Y3YA 2DEIA 4DOZA 4R8UB 2W9BA 1NSKL 1YQHA 4FVMA 3TNVA 3FRYA 3WIUA 4U8VA 4WFYA 3D67A 3GIJA 1FRKA 2BDPA 2IBOA 2V69A 4F25A 5LMNF 3RTVA 3GV7B 1VK3A 3KJNB 4WTOB 1RE1B 4MJKA 3VGUA 3GFXA 2OSQA 3R5CA 5AXKA 4ZPVR 1RT6B 4FDFA 3NMAA 3J7Z5 3QNWB 1ROFA 2VFUA 5B0GA 4DR2F 1OY9A 1M1GA 3M8SA 4K4VA 3HF5A 1X4GA 5HVFA 3WZ0A 2DXFA 3I0RA 2UUWA 1UMJA 4BC7A 3UDLA 1L3SA 2VJUA 3CIZA 3QO9B 1QUPA 4ZVEA 6FD1A 4EK2A 4TYAA 1EKRA 4OX7A 2XY6A 3LP2A 3J80Y 4H54A 3EVMA 2RF2A 4F4KA 3PRVA 4TKTA 2ZBCA 1PAEX 1KFDA 5F0WA 3MFIA 2UUCJ 2F8EX 4U6PA 1NDKA 4JI5F 4LF6J 4K0KJ 2LQJA 3K5MA 1S9EA 2YKNB 3TZYA 2ZM6F 3EX7B 3TJAA 2MKSA 3Q8SB 3EGZA 2VG6A 3QWPA 5GAEI 4J9NA 5F3ZA 1A6LA 3BSOA 3OT9A 1I94F 3X1LB 4GO5X 3GWCA 1QE1A 1ZETA 5CYQB 4UZBA 2OH2A 4ED1A 2EFPA 3H40A 1ZPWX 1S79A 3UD3P 3R1LA 4OYIA 3N4WA 2VICA 1U26A 4AQYF 3CD6S 2KG0A 4LF4F 4KKOA 3O3LA 2IHR1 4M5HA 2KN4A 3M6XA 1BXNA 3V4MA 1N6QB 1FA0A 4DBQA 1TVRA 3HM9A 1LW2B 4C0HA 4NLPA 4JI2F 3W64A 3L09A 2CJYB 2LQ9A 4DS5A 3M8QA 1WOPA 3I82A 5HL7Q 1R6YA 1ZM2A 5KOXA 4N41A 2JRSA 1S4EA 3QZ7A 4PEOA 1KD1T 3PW5A 2R7RA 4OYMA 4WK1A 1FEEA 3SCJE 4LFAF 1FRJA 2L9NA 3HPOA 1BQMA 4RW4B 2DR8A 2FLNA 1C1BA 3SSQA 3FSIA 1M5OC 1S7HA 4ECYA 4IH7A 3C14B 3M32B 1NH8A 4LIRA 5CYJA 3G86A 3DDKA 4NRUA 2HHSA 3TUJC 1FD2A 2FHOB 1CJKA 4ALZA 5F8HA 4IG0B 2R8JA 3DRRA 3CJ2A 3QT6A 3W2VA 4DR5F 4O0NA 1T03B 1WI8A 2R2SA 1G2EA 2DNZA 3U02A 2W01A 2BANA 4CYUA 4KH0B 2L48A 1VQPS 4AXIA 2DGXA 3KUHA 3GQCA 1EJ7L 4HDHA 4AE5A 1QAIA 4ZN1A 1RAOA 3LA0A 1X5TA 3VZIA 3TZXA 3SQGB 3SCLE 2R7VA 2XCAA 1N36J 5JVHQ 1FD8A 3DOKA 1H72C 1RYRA 1X8DA 3Q8QB 2WZ1A 4Y2IA 5KFKA 4DFPA 4P2SA 3V5RA 4C8OA 3VQSA 4ZLPA 4I67A 2F5GA 1HPZA 4NXNF 5I4MA 3Q83A 3MECB 1EHWA 4AL6A 3MAAB 3CPWR 1P8GA 2EKYA 2FZGB 2PSZA 2W24A 3UQSA 3VAHA 4GC6A 3SSSA 2VASA 5GMKa 2W8KA 4J37A 5HJYA 3K5OA 3MDFA 1L3KA 1QVGR 3HD1A 4DV2J 5KFBA 2QLJB 3D4JA 3DU5A 5A8RB 5J1NA 3IR5B 1NJZA 2HVHA 2IJRA 4PWDB 2CPJA 2G2ZA 2J5AA 2N7CA 1LWEA 2VPYB 1VOMA 1SV5A 4ZA1A 4RBUA 3M6UA 3I9ZA 2ERRA 2OHDA 3CJRA 4M5JA 3SZ2A 3PFEA 4KY3A 4HR2A 2XO7A 3CCSS 3T1HF 1SJ1A 1F5CA 1FJGJ 2DHAA 1CJUB 4KHPJ 2UV8G 4QYZK 3TANA 2HHVA 3BS9A 4OZ0A 1U8WA 3PX4A 4QWEA 1YRTA 1R0CB 1IM4A 4UQGA 2Z58B 4L73A 5HMZA 1D09B 3JXOA 3SI8A 2GFFA 1OJ4A 1UFKA 1YHQS 1NK7A 1I5OB 3N79A 4CO4A 4OHXA 4LVOP 2R7OA 1S0VA 2RNEA 3Q8UA 2AX1A 1IJEB 4YOEA 2O5DA 3TOQA 1IKWB 2YKPA 3CCWA 3LH2S 1HBNA 3AODA 1WF0A 4AL5A 3P49B 2NUUG 1WC0A 5E5NA 4RU9A 4ILLA 1V5IB 1RTIB 3DFEA 1N8RT 1E6VA 3ZTSA 3W65A 4DHVA 1YJUA 2E1CA 3M2VB 2HNZB 2EC2A 1T02A 3M8PA 3EPGA 2DY1A 3GG0A 2O1PA 2YNFB 1REGX 2NXCA 4AQYJ 1XN9A 4NL5A 1NO8A 3VVUA 3CULA 2QSWA 1NDCA 4MK8A 4ITSA 2UUBF 1RABB 3BKTA 1U45A 1B3TA 1XK8A 4M5MA 2BM0A 3HX9A 1GXUA 4DJBA 3DLEB 1U24A 3FCHA 3O8WA 3MM9B 5ADZA 1LK7A 3QATA 2CADA 5I3PA 5E3CA 2WCXA 1M5KC 2QFIA 2HHPA 5DLGA 3G2XA 2C3PA 4X4QA 2WAQD 2DNYA 5DDRC 2CPYA 3T5JA 1CJTB 4J7CA 5A8KB 1DJ0A 3D6MB 2WB4A 4LRCA 1FRLA 2E5JA 3D5MA 2B3TB 3FUYA 2KFNA 4AUKA 2VF3A 5BXIA 2F4VF 5A8WB 2XHCA 1T11A 1C4AA 3BB5A 2MQNA 4PXCA 4X4TA 2IAJB 1VS3A 4HHHA 1BHNA 4ECZA 3D2WA 2JVOA 2V9WA 2FTRA 5DG9A 2CJXB 2HAIA 5HMYA 5FDLB 4RBVA 4OYWA 3QIPA 4I69A 4DFKA 3GJSB 3CCLS 2ZFHA 4K4TA 2ZE2A 2WONA 5CHCB 4C0OC 2ZWOA 5LT5A 3EZUA 2B0GA 3DRSA 4M5IA 3TWZA 2B5JA 1IKYB 2NS1B 3C16B 4F4AA 1RQ0A 4O3NA 3FVYA 5A2QU 2WSEC 1MROA 1I51B 4DSLA 3CJKA 3PW0A 4NZ0A 1TUVA 1XERA 2B9YA 2DGTA 1CQNA 2GCFA 3PYFA 3OSNA 2DYAA 1F6TA 1VQ8S 1J5OA 1X5PA 1L3VA 3LP0A 2KG1A 2E1PA 3NS5A 2J7WA 2B9EA 3UW1A 1I1GA 3MM7B 4C3LA 5LJ5Y 4Q44A 4EFAC 4NXNJ 1FRMA 5IOLA 5CAAA 4DWIA 1JLBA 3IMQJ 1NK6A 1PYTA 1VHFA 1OYEA 2MMYA 1IJFB 2FVQA 4O4RA 4P75A 2C2NA 4OQJA 4FF4A 5ETOA 2YKMB 3FJ2A 3LWMA 5AE1A 3LQVA 1JNRB 4H4OB 2RS8A 4NZ7A 4X66J 4ANDA 1S4FA 1SCJB 4NCGA 3AXMA 1RWUA 1TELA 1NPKA 5HQMA 3FDSA 2QMWA 3LP1B 4O4GA 2FLPA 4WKRA 2E9ZA 1RT3A 4ZVQB 5IQQA 1CULB 5EWEA 1ZA1B 1Y11A 2JHEA 3M8RA 3C3LA 1ZZNA 2C22A 2VDHA 3LW5C 3QYYA 3CSKA 2XMVA 3VAJA 2COLA 2E66A 2XZTB 4QPXA 5IC6B 2QJ3A 3DC2A 4DPXA 4C11B 2XYGB 1FF2A 2MQOA 1HI8A 1Q0NA 3DMJB 3WIVA 2KYXA 4MIWA 1NKEA 5CZXA 4HH0A 5AT1B 2KHCA 1ZOTA 2XNRA 2R7XA 2AQ4A 3EWGA 3GYXB 4QWDA 3Q23A 3PO4A 1BY9A 3QLHA 3IXQA 2IC3A 4EU0A 1Q4RA 2XS7A 2D9PA 4GRSA 1D9AA 4DQQA 2FJVA 4Q43A 3MPVA 4IRKA 3NBPB 4C9DA 2QMXA 4CLYA 3BGUA 1AFJA 2OMOA 3A3PB 2FVCA 2N4DA 4FYYB 1KLNA 4CCHA 4L76A 4HVZA 4GVLA 1EETB 2MQMA 2AGOA 4RW6B 1I6JA 4ZHRB 1Z1ZA 4I64A 3H0PA 5DETA 2R3VA 3VGTA 2HNDB 3CUNA 4IDKB 4NA1A 2HGNA 3PEHA 3RR8A 3N6MA 2OPQA 3DN9A 3MR2A 4TVAB 2F9DA 2FZCB 2V5HG 3PY8A 1XJWB 2UUBJ 3CMQA 1T95A 5F8NA 1D8ZA 1X9SA 4OL8A 2P5VA 2IBKA 1RLDA 3BH7B 4ZPBA 1TU0B 1Q5YA 3KJVB 1YJTA 4KGXB 1RT4A 1JJ4A 4CI0B 2JC0A 2GGPA 3E01A 4CWBA 1FXLA 1FKPA 3HMJG 1T05A 3BPDA 4LSZB 4G1QA 1W25A 5KT2A 2H5EA 2GW8A 3FFIA 2XNQA 2E5LF 4MMOA 3NGTA 2EXUA 2ZHAA 4LMZA 2JVRA 2DK2A 2F4VJ 4KGMA 2DGVA 3CDEA 3KMSA 2BJEA 2OTLS 4I2QA 1HWLA 2ZH9A 3AOBA 1DLOB 4V1Ak 1IUJA 2HBRB 4OYOA 1Z4UA 2B9WA 2NLWA 3H4BA 3D6FB 3HHLD 5H9FK 4OYXA 2DRBA 5K8MA 2VFSA 1SL0A 2F8MA 3B82A 4WE1A 2D3OR 3G8TA 4RUHA 2BJ9A 4LF7J 3C2PA 2BMBA 4M5GA 1D9FA 1T9YA 4IO1A 3MXHP 1B0TA 3GLJA 2EG2A 1APSA 2Q6BA 2JSXA 2FGOA 2PO4A 3CD0A 3JTOA 4ID5A 2GVDA 4B17A 3JSMA 3BO4A 3HKWA 3I0SA 4C2MA 2CFXA 1MN9A 1VRUB 3ZZUA 5CD4A 5ETLA 1QSLA 1VLOA 1FCAA 3GG1A 1M5SA 1R8CA 3TVKA 5K9FA 4X4PA 3FEXB 3QGGA 4DL3A 4ECWA 3CCES 3EDRB 1X4AA 4OI3A 4R0EA 2LVWA 4I6AA 3RZAA 3RAMA 2QLXA 2Z2LA 3FCVA 4Z7CA 2AEFA 1JXEA 1LV5A 3QRQA 1IKXA 5H9EJ 1U6FA 1U1KA 4CO5A 2PFDA 2VQEF 1LFWA 1RWMB 3BGOP 2ZITA 5B0CA 4OHVA 2OPSB 3EGVA 2ZDPA 1LWCA 4O44A 2MLYA 4ID8A 3MEGA 1GT8A 4ZN3A 1LWXA 4M94A 3UNGC 2R8GA 1XR7A 3LP2B 3NEKA 3PCOB 5EGYA 2IDLA 5E41A 2GHVC 3UCGA 1RWVB 3M30A 3W9HA 3IC1A 1IBKF 3W5ZA 1S9EB 3I96A 2D7SA 4EMDA 2EWHA 4LSLA 5K5MA 2BUNA 4BHQA 1Y7PA 4EEYA 5J2NB 5KT7A 3GV8B 4DR4F 2CJBA 2X7IA 2BE9B 2XI2A 3TQ1A 2EI5A 1GMWD 3UVJA 3RW6A 3M7VA 2IPOB 1FHTA 5GAGU 4FYVB 2GZOA 3J7A1 4YEAA 5HVHA 1N5SA 2ZVIA 4M5LA 1EIYB 1UJ6A 1RWWB 5A6PA 1QD1A 4FNIA 4KKOB 4QR2A 4NX9A 4KGZB 3KG4A 1UVLA 1U0SA 3PZPA 1TVRB 4PPZA 1WG1A 3WX4A 3CDWA 5FLXY 3M8QB 3DGVA 4OV6A 4C8YA 3RGIA 5IZHA 1JXLA 3AJ1A 2OTJS 4L75A 5EUHA 5J1EA 1MMDA 1HNVA 2EFGA 2EKNA 3G6YA 3I32A 3LOUA 1TV6A 1HI0P 2W25A 2Q1LA 4PAAA 3EZ5A 1NSAA 1FX2A 4YR0A 1S59A 3IA0A 1TKTB 1BQMB 1S9FA 1C1BB 3V6KA 2W2QP 3FKBA 1T9XA 3MURP 4P9SA 4CM0A 5M2RA 1YGYA 3N6NA 2IMWP 3MOJB 1JWWA 1CJKB 2F1FA 5BR8J 2ZEJA 1KOHA 3DRRB 3CJTA 4V19X 3W2VB 1MMNA 3OVAA 2C2MB 2YNGB 2OGUA 3EGNA 5F0UA 5F8LA 2FJWA 1YG0A 4URQU 2AJFE 5L1KA 3IO1A 4DV0J 2ZBIA 2DIUA 1BWVA 4CYUB 2NXNA 2YH0A 3OTDA 4DR1J 5DRKA 1R3NA 5KFNA 3W63A 3B8HA 1H2VZ 1SIWB 1SQEA 1KVKA 2LYVA 3TJ8A 2CDRB 4Q2LA 1X5SA 1XMOF 1V5VA 4ZS6A 4C0BA 1ZAWA 2DPJA 3N01A 1FESA 3RBXA 1HNWJ 3OQ2A 4J9QA 4OYZA 5GAEU 2DGUA 3KTQA 1HBMA 1V9OA 3AB4B 3UR0A 3DOKB 2HAFA 4JI8F 2GC8A 1LWFA 3DDIA 2XWYA 4EBCA 4ENOA 5LL6d 2FQQB 4B3TF 3MMCA 4M95A 1HPZB 5KAKA 2POKA 3GZ7A 1SC1B 2QG9B 4KTQA 4C98A 1R0AA 4X4OA 4N56A 3NG8A 5DGAA 2PT0A 3I31A 2I6WA 1MNEA 2HFZA 4ICLA 4TYBA 4ZVHA 1MG7A 3A4TA 1AT1B 3U27A 1U1QA 3GONA 5I3UA 2IFXA 1S1WA 4Q8EA 3VAFA 3KHRA 5IT9Y 2HK3A 3IGNA 2OP5A 1WG5A 4OI2A 3H2LA 2WBRA 3U1LA 2PEHA 2VQEJ 1WUUA 4C8MA 2PA8D 4M5DA 4K2XA 5DZ7A 2DPIA 2ACYA 3LGNA 3ONQA 3G87A 1ZS6A 3K59A 1UAWA 1JLQB 4P73A 2H4YB 4QJVA 2HBZB 4CH0S 5BYQA 4WP3A 1FWPA 2DHGA 2OMLA 4ZMMA 4DU7A 4KFBB 3RRKA 1PC5A 4C8KA 3PYDA 2XC9A 2XMJA 3C6TA 1UPPA 4FXVA 3GYNA 4F3QA 3POTB 2JJ4D 3KK2A 3W1YC 2QGFB 4FXDA 1DRZA 2ABYA 2H3EB 4DCOB 3MR3A 2CAJA 1DQ9A 2W4DA 5DLFA 3IN5A 1TL5A 2VPWB 4RNMA 1A7GE 2FJBB 4H4KA 4LFCF 4DR4J 2A2DA 4PKDB 3ICLA 4RO0A 5KFOA 4URGA 4WFNQ 4JI3F 1E6VB 2W4CA 2VG5A 2CG4A 2WBMA 2ZUGA 1EKSA 2NYIA 4F3OA 2MSSA 1K1QA 4DV4F 3M8PB 1U02A 2NPFA 3T9NA 4MH8A 3CDUA 1F5AA 3MFHA 3BBBA 3DYAB 5EWFA 2NPIA 2JLEA 4KPYA 4I1TA 3KOAA 4OHZA 2RH3A 4JI0F 3QFWA 4FF2A 4USHA 1WSVA 3OFHA 2MJNA 2EBGA 2Y0SD 4OI6A 4KO0A 4NMLA 3S01A 4X4SA 4LQ9A 4ED5A 1NNDA 1N48A 1JLCA 2HRYA 3OXFA 1F0XA 3M2RA 1FI4A 2FJEB 2P6TA 3DLHA 2YY3A 3SQOP 4PR6A 1Q78A 3ZZOA 3NL0A 4WZMA 4JP8A 1HHTP 1YJVA 1GTEA 3HVTA 1VI7A 4PG5A 1K73T 2V34A 2IM0A 5DDPC 4WFAQ 3RU0A 4LRBA 1K0VA 1YI2S 3SEOA 2AWZA 1KVIA 3RW7A 2MPUA 1REVA 4ZIWA 4OHYA 1U8SA 3G82A 2LA4A 2G1HA 4P72A 4DMZA 2VBWA 2WONB 2YKOA 4P2FA 1EQ0A 2H51B 1Q5VA 1QTNB 2B5JB 3JSRA 2DH8A 1XR6A 3D3CJ 1D9DA 3ZZYA 1XMBA 2QLFB 1JQGA 3M8YA 1MROB 4Z2XA 5KFWA 1S77D 3PV8A 1RISA 4Q7AA 3CJKB 2J8SA 3OD2A 4XDDA 4KGKA 1OPIA 4NZ6A 3LP0B 1X0PA 3P6YC 4K50A 1HW9A 3BZQA 3NS7B 1WHXA 4NA3A 1T8EA 3EM1A 3QAUA 4DV5F 2WRMA 2VHGA 2BEFA 1TFYA 4CLZA 3NCRA 2XI3A 1NB2A 1VDHA 1T9VA 3ETMA 3CT9A 3BSNA 2XZWA 1PIEA 3W60A 4NCGB 1DBDA 5G0RA 3I55S 2K8GA 4NYPA 1SC4B 4O4GB 1RT3B 5ETRA 4FYWB 2FD2A 2VBXA 5K14A 4WK3A 4LBPA 4JI7F 5C2CA 3MMJA 2MY7A 3GFHA 1YBUA 4QIWD 2B4PA 4KT0C 2LU2A 2IVFB 5KOWA 2A6MA 4PXBA 2C1EB 3ILIA 2C42A 3G6VA 1RGVA 1K8AT 1TR0A 4QU6A 2LMIA 4NYOA 4K4WA 1YIJS 4DUYF 3MEDA 2UVRA 4F4WA 1L3TA 3FZBA 4GKKF 5M2UA 4WP9A 3K5PA 4MKAA 2NR0A 5AXLA 2CJAA 1RT2B 5D0EA 2YQ0A 1U2CA 5L1LA 2F7VA 3QLHB 2IC3B 4YUDA 4DCJB 4WYLA 2VD3A 3NGKA 2XMWA 2QA4S 2GQ2A 1HL6A 4ZVUB 1UW9A 1FFSB 3MCOA 1GH8A 3DRXA 4LRFA 2BQRA 5I3QA 4LIWA 3MR7A 1RT5A 1PBAA 1IQTA 1WACA 1T9WA 5GVQA 2MLXA 2JEFA 1RHKB 2W1BA 2HVIA 5KG5A 1T3OA 2OEMA 5FLXU 2GHPA 1YITS 2HLUA 2PD1A 4DV4J 4TXSA 3CCRS 2OPQB 3SDEA 1HWJA 4CO3A 4DLGA 2E5HA 1S1TB 4LFBJ 1VGYA 1NEEA 3OFGA 3UO0A 4A8XA 1GXLA 2OO4A 3P8BB 4OMFG 1CJVB 2JFKA 2Y0BB 1F1BB 3T1YF 2CPHA 4F50A 2HBQB 3TI0A 1FJ7A 3PYGA 4JI0J 4RZRA 1RHUB 3RB0A 1U47A 2LLZA 2PC6A 5G4DA 4K5RA 4A48A 4N76A 1YJ7A 2HBYB 1RT4B 3UN3A 1MMLA 4C3KA 4DCPB 4X65J 2ZUAA 4X84A 4DL0C 4HKQA 3T41A 2A0FB 2GGPB 2CPEA 2ZH6A 3E01B 4ZP7A 4D3GA 1HHSA 1FKPB 5IWAJ 1T05B 5AJ3F 4ZCLA 3EE3A 3FFIB 5KG2A 4ZKAA 3R6LB 3ZZRA 2CXEA 3KMQA 3F44A 1N5YA 1S1XB 4I2QB 3GILA 2B9XA 2YXLA 4DX7A 4FYDA 4DN9A 4DPTA 2BQUA 2CDQA 4ED0A 4DLEA 2YQ1A 3QBCA 1WNEA 1QVFR 4DV7F 5KFRA 5L9XA 2G2YA 1X4BA 4LF5J 4WE1B 1B7YB 1JLGA 5CA5A 3FC9A 5HI7A 1YK9A 1ZBTA 1HYSB 2VJVA 5U47A 1R89A 1M1KT 4CLUA 2C2EA 1UW4A 3W66A 1VQ6S 5A76A 1UEVA 4ID5B 2C28A 2KU7A 2GVDB 2I9SA 4E0DA 1X0FA 3I0SB 1Q7LB 4A8WA 1C1CA 4NEZA 2Z2YB 3GPAA 3P4UB 1Q1KA 5J2QA 2V8VA 1TL7B 4MT1A 1URRA 4M1KA 4MKYA 2UU9J 2GNKA 4CIOA 1KR4A 4RR5A 1JLEA 2MGZA 3ISZA 3FGVA 1TP7A 1FWLA 3BN7A 2CPDA 4RNNA 4KYZA 2IM1A 4DV5J 2UXCJ 4DV6F 1Q53A 1IKXB 2M5YA 1NJWA 1FKOB 3VV2B 3GE9A 1HR0F 4H4KC 1S6QB 2OLWA 1YVFA 3UN5A 2E7WA 2MZJA 3G6XA 1NHKL 1WKKA 3H5UA 5AXNA 2IM2A 2V50A 4O44B 3BDEA 4JI4F 2P2CB 3V6DB 1BGXT 4WJBA 3KLHA 3DLGB 4HL9A 1HWKA 4ED3A 4O3RA 4JI7J 2DH7A 2HQGA 2DRAA 3T6JA 1HNIA 3ET6A 2D9OA 4O0IA 2JL9A 1Q8BA 3KJFB 5DGBA 4PWUA 3CMES 2B8QA 3M30B 4I7FA 2P9GA 1S1VB 3HHDA 2W2OP 4HHUA 2RILA 3BSCA 1BUXA 4B08A 4Y28C 1BC6A 4QIVA 1LNQA 2RD5C 2U1AA 4LSLB 4DUYJ 2N4CA 3V6JA 2W4PA 4P2XA 4UUWA 4QWBA 3BKUA 2GIFA 1HA1A 4B9SA 3R5BA 3UCZP 9RUBA 1TK0A 4ZVPB 3UDEA 4PG6A 4BBYA 4LF8J 1SL2A 1SI9A 2LXIA 5KFHA 5F41A 2FY1A 1M0SA 3BDPA 2JX2A 2DGOA 1TUWA 4YMEA 3KLEA 4B3RJ 1TKZB 5MLCV 3SYZA 4J9SA 3KK1A 4USJC 4OYBA 3HCXA 2CNOB 2QRRA 3D66A 1S76D 2WW8A 3MPYA 2A1BA 4WPAA 3UDVA 2IDEA 4B3MF 4FF3A 2AJ2A 3OVBA 4PG7A 1SH3A 2XTJP 5DZ6A 3Q8VA 3V6HA 1KQKA 1F60B 2FHJD 3HXMA 5D15A 3NWRA 4RU2A 1B99A 4GVBA 2CWXA 3D1OA 1TAUA 4CT9A 2YNIA 1TV6B 7FD1A 1ZA2B 4KQZA 2P9CA 4WZQA 2E9RX 4PYAA 1RAIB 4HHJA 5IXUA 4Q8FA 5L9NA 4FZVA 4RUAA 2RRAA 3I4PA 2OPRA 2R2TA 3IGVA 3HT3A 5K8NA 4JOUA 1JB0C 1F9HA 4K2JA 2FVRA 1N32J 5CZVA 3NAHA 4YN3B 1RJJA 2ADCA 2C3YA 2DT9A 4CO0A 3M9NB 2R7UA 2ZC4A 3R5DA 4UOGA 1FNMA 4ED8A 3LO3A 2DRDA 2ZH1A 1R8AA 1NXIA 2AGQA 1U7LA 3OTOF 4DR6F 4DF8A 5KFUA 4URSA 3NAIA 5HVGA 2PA3A 1XIQA 3BR9A 9ATCB 1U1OA 4DL7A 1KOOA 3OR1A 4KHMA 5AE2A 3HHNB 2Z30B 1FNOA 1R8BA 1Q79A 1SUQA 1X31C 4DV7J 3AAWB 1HNXF 2DD8S 2VC1A 2QTWA 3MM8A 5KG3A 3VAGA 1JJ2R 4TNOA 5E33A 2NREA 3H2VE 1HBMB 4XK8C 4K7QA 1YBAA 3OL8A 3K7RA 1DY3A 2NYHA 3TR5A 1IR1A 3MM5A 3E2EA 1LWFB 2KZMA 3G4SS 2AP6A 1KHVA 1R7IA 1IR2A 1J5EF 2Q66A 1Y3JA 4B9LA 3MR6A 2JC1A 2H5JB 5L1JA 1R0AB 4KJIA 2V8GA 4U96A 2BZ2A 3NY0A 3M6VA 3CD7A 3Q2SC 1B7FA 2GHWA 1VRTA 3R9LA 4F04B 4ICLB 4ZVOB 1RTJA 2YKAA 2YQ3A 4DN0A 3CWJA 5I3UB 2C3MA 4GKJF 4CT8A 3N6LA 3OL6A 4DZDA 4F26A 1S1WB 3HO1A 1WD6A 2L9WA 2GIRA 2YWEA 3LGHA 1U0HA 5GMEA 2LEBA 3UD5A 2I5JA 1H6KX 3AD7C 3FQKA 2PGCA 2X3DA 3H7HB 2N7YA 3T1AA 1M5HA 4JBCA 4BWMA 3OHBA 4DV3F 4M5DB 1S6UA 3T9ZA 1GAOA 1IVZA 2Q3PA 2VFRA 1NBEB 3K8VA 4JI4J 4KC5A 3RYLA 3KDNA 3IFEA 2BE2A 1KHWA 4CLWA 5D4PA 3PTWA 1LFPA 4I0WA 4FKXA 4OX9F 2AIRB 4USTA 3ZZPA 1PG5B 4IRDA 4C8ZA 3TQEA 1P27B 3NOCA 1JLFA 4L3KA 1UWBB 1X9MA 3VR1A 3KK2B 4NA2A 3JB9k 1AYEA 4CTAB 4K4SA 4WFXA 3TAMB 3W8GA 1YDLA 2BJ3A 3QMQA 1AW0A 5D6GA 1UEUA 1G4CA 4A8SA 2FJDB 4ZVSB 2QV6A 4FVCA 2YX7A 4USIA 4ANEA 1XMQF 4NCBA 4ZVGA 1C0TA 1O51A 3M2UA 4NLSA 2P6SA 2V2KA 3QGIA 3WHIA 2KB2A 2VG5B 5GAGI 4IOAQ 2OJ3A 1UVIA 2WK4A 1JMTA 1XEZA 3AJDA 3MMAA 2XMAA 2LXUA 2FJXA 2AKWB 3OXGA 1KLMA 1WJ9A 4PPDA 2PIIA 2R7QA 3Q8RB 3VWSA 3H59A 1S6OA 5ETVA 1TK5A 2NZ4A 4FPIA 4F67A 4DX6A 4RW7A 5A2QY 3FQLA 4A8KA 1H2TZ 4JV5F 4C48A 2YPYA 3DLJA 4KH1B 4DV1J 1ELOA 3C46A 3MWBA 3DOLB 2ASDA 2LDIA 4XAKA 4R8UA 2BYCA 2WHOA 1XQIA 3MM6A 4F02A 4WF9Q 3AHPA 3MTKA 5F8GA 2M9KA 4FYXB 1JLCB 3TW0A 2EFOA 4Q5VA 1BQNA 2PEBA 4DFJA 3ENAA 3QT7A 3BPSP 1U1MA 3MCMA 1CSJA 3RG6A 1QM9A 2DCUB 4B9MA 2CJQA 4NLGA 3HVAA 1WSRA 1RT6A 3FSXA 3V81A 2MJUA 2WB1D 4FN5A 4K5SA 3B54A 3WBZA 2AYEA 2ILYA 1TUGB 1NPRA 2MKIA 4OZJA 3HVTB 4IQMA 3IRWP 2ZNYA 4EZ9A 2F40A 2FPHX 2J9CA 3IRXA 4Y34A 5HSPA 3ADAC 1RAFB 3R5GA 3OTOJ 4DR6J 4NLYA 5T14A 5IC4B 3AH6A 2J0XA 4BC9A 1REVB 4MKVA 1N34F 3G82B 2CQ0A 3RAQA 4I6WA 2RQMA 1SB6A 4NOHA 1P9QC 2UUAF 2HHHF 2I2YA 1ZAXA 4QWAA 2W2NP 2WOMA 2DGQA 1H7WA 4GO7X 3QGHA 1NSPA 2PI4A 1MN7A 3QQCD 3SCIE 4B9NA 5IM0B 1KTVA 4B02A 3CDBA 4NE9C 3RB4A 4Y2AA 4HI1A 3J7YI 4O23A 3JTPA 1GQEA 2HHUA 2GMLA 4HDGA 2CQBA 3PRBA 3QZ8A 3DHXA 2DNKA 2HQFA 1HQ2A 1JX4A 4OI1A 3CTRA 4DG1B 3NS6A 5C5JA 4KB7A 1C0UA 5GADI 5KG6A 2PMWA 4B3SF 1IBMF 4EO8A 2LKZA 4CO2A 1FK9A 4NLWA 4LRAA 2HWIA 1WKLA 2WVFA 3E3XA 3KUEA 3UCUP 1WF1A 2KH9A 1R43A 1Q7YT 1NZ8A 1N6QA 3MEKA 1S7IA 2WW4A 4RKUC 3SFUA 1LW2A 2YWFA 4EZ6A 5H9FJ 3FBEA 2XMMA 2AX0A 2O66A 5BYSA 4GKJJ 3BGLA 1GX6A 1SC3B 1SC6A 1EARA 3BQ1A 5D3GB 2V4QA 4UOCA 3HVRA 2R7TA 2FZKB 3IG1A 4QIFA 1TL3B 4MK7A 4ZLJA 1ULRA 1IKVB 2EK6A 1TMMA 4A8MP 2FGCA 4RW4A 2EBEA 3KKFA 5SUHA 3ZC4A 4FKYA 3UDCA 4V19J 1LOUA 3HI9A 2G0JA 3C14A 3DXBA 1YKWA 5B0EA 4Z37A 3MEDB 4OI4A 4OX9J 1F2GA 3DHWC 2E9TA 3P5BP 2VH7A 3QSIA 2LA6A 1OWXA 1N5VA 2NSBA 4U7UD 4NXMF 4ZJQA 3ELHA 4IYQA 1D3WA 1UP1A 4DS4A 2O67A 2ZH3A 3V2UC 1LQ9A 3CJ8A 2DITA 4Y2MA 3TEHB 3CIMA 2CQCA 2AEJA 2QLBB 5EN1A 3L3CA 5LMUF 1TL1A 2E7XA 4QW8A 4DR7F 3KJQB 3AB2B 3HZGA 2J9DE 5DDQC 2LQBA 1RT5B 3PW4A 3IBFB 3MUVP 2QC3A 3MD3A 2ZBRA 3H5YA 1FXRA 3SQGA 1ZH5A 4YP3A 2ZH4A 1S48A 1YJ9S 2YTCA 3NGSA 1RDRA 2EPIA 4CO1A 1GMUA 3GJTB 3OV7A 3P5TL 3OBIA 4IG3B 2VODA 4DQPA 3SDEB 3MAQA 2N3LA 3SSRA 4CRJA 5C7PA 2OPPB 4LF9F 2KT2A 1HQEA 2ROGA 1B4SA 1SIZA 3D0IE 2Z57B 3H5SA 5KG1A 4NMXA 5KFXA 3HULA 1IQZA 4XTTA 5E3PA 2OSRA 4Y0FA 1Y5IB 1X5OA 2UV8A 5E3AA 5C25A 1S9GB 1WC3A 5A8RA 2RQCA 1F3VA 4L72B 3QWUA 1FXDA 3A8IA 3PFOA 2DHXA 1XNRF 2FIUA 5LMNJ 4P6QA 4PG4A 4KSEB 2NXJA 8AT1B 1N5YB 1Q8LA 1R27B 1YJNS 1NU4A 4H4MA 1VJWA 3CO0P 3IWNC 1RWXB 4FPRA 4U7CA 2K1RA 1Y5LB 2V9KA 4DR2J 2IA0A 2ASYA 4BWJA 3C8YA 1WKJA 1UJ5A 4P7TA 2A6OA 3LWLA 1U6ZA 2M88A 4U7UK 1UETA 1WTFA 1JLGB 2DKOB 1Y9OA 2MKYA 1N34J 1CG2A 1PKUA 3LAKA 2AJ0A 3CNQP 2HHHJ 3FMBA 4P52A 3KLIB 4JUZA 5KFPA 1V3RA 4QIGA 4JI5J 2AJ4A 2DNLA 2MKHA 2VQFF 2ZM6J 3FSYA 4MKBA 5HQLA 3E8OA 3IBCB 1C1CB 3KNAA 2W9CA 2FYXA 3GFZA 2ZZMA 1P1LA 1I94J 2XZDB 3NNCA 5RUBA 1RTIA 1OO0B 1FDNA 3OLBA 3KWMA 3H4DA 3RUBL 1T9UA 3CVKA 4HI2A 4LF1A 2HNZA 2ZH5A 4PG8A 4EUVA 1TKXA 2MQ8A 2VPZB 3BGRB 4DX8H 4B3SJ 1IBMJ 2HGMA 2YNFA 1RADB 3S7RA 1ICEB 2C3OA 1SQFA 4LF4J 5K8PA 2EW9A 3OR2A 4LJMA 2F65A 5AXMA 4CDIA 2L3MA 2ALYB 4AL7A 4IFVB 3PEJA 4JI2J 3CJ3A 4BCAA 1NJXA 3MM9A 3BO3A 2K3IA 3KLHB 2KHDA 1FT8A 4OHWA 4PQAA 4HACA 5A0YA 4TU7A 3N5BA 1HNIB 4DL6A 4DQIA 2B43A 4G1IA 4LFAJ 2CUYA 2RQ4A 4K4ZA 1NDPA 3V4IB 3SBMA 4ER8A 4I7FB 4ED6A 2AT1B 4TQRA 3ZFVA 2J7KA 1KNZA 1P1TA 5ETPA 4F0MA 2AZ1A 1PBUA 5D78A 4OJ1A 2IAJA 3DLBA 2IYIA 1VQSA 1SKRA 4N47A 2HQ3A 4DZ6A 3K57A 1HI1A 4CP5A 4M63A 1BE4A 5HROA 3JYTB 2KXHA 2RKIA 4DR5J 1JJHA 4QPTA 4YB1P 3CE8A 1GXTA 1HARA 5HP1B 4IO9Q 4ECVA 1FKAF 1YX2A 6AT1B 1AUSL 3KLEB 2CRLA 4ZITA 3KLGA 3KK1B 1N4LA 3W8PA 2MQQA 4ELTA 3IR6B 1J2VA 1AFIA 2QL5B 1PCAA 4DR7J 1GX5A 1HMVA 3C16A 4O3OA 3C66A 7AT1B 2YKQA 3DDNA 1LK5A 3WQPA 3T5LA 2RB7A 1TFWA 1IM6A 4LQ3A 2VZ9A 1W7WA 2CQ2A 1FJCA 1KP6A 1ZYQA 3EVWA 5EHHA 4HLBA 2D41A 1RAJA 4GVBB 3P45B 3CC4S 5KT5A 4Q0BA 4UW2A 4A8YA 2J6UA 2YNIB 3MM7A 1DTTA 2XYHB 3QGPA 1UVKA 3H42A 4ZK7M 2MQPA 2GS8A 3R5AA 3BREA 1EX8A 4C6AA 3DOMA 1CS4A 3ENVA 3DM2A 3IP0A 2BJDA 2OPRB 2YKMA 1XBWA 1SBRA 4H4OA 2OELA 1UPMB 3DRPB 3K2YA 5MAOA 2V8HA 4ECSA 1SH0A 2V6AA 5KFEA 1VC6A 1QAYA 2RUGA 1DAXA 2M7SA 2OD6A 3LP1A 3M9OB 3U1MA 3TO8A 5LSRA 4WXOA 2ZDOA 1HWIA 2QSFA 2YH1A 2RSQA 1XNQF 3VF0B 4OZ2A 4O3SA 1KQSR 1GFWB 3I56S 2K06A 3D3BJ 4OYAA 3T1HJ 2UUCF 1VBXA 3T6BA 4LF6F 4PWWA 1FERA 1Y00A 2BE7D 4OI0A 2XYPB 1NZAA 4CH7A 5J1PA 2B7BB 1OQ3A 3MM8B 1EP4A 1QUVA 5T7LB 2HRTA 3S8SA 2V8PA 3N5FA 4J9PA 3I87A 1Y5NB 2HG4A 5EX3A 2ILZA 1X9WA 1TK8A 3J81U 1RBLA 1AA1B 2MB0B 1D0EA 2ASJA 2VQFJ 2CQ1A 3K17A 2CQIA 5M2PA 1LW0A 1UA0A 2U2FA 4ED4A 1WWHA 1KQFB 4X62F 1NB7A 2J0SD 2QIFA 1VBKA 2XHWA 4C3MA 2IYGA 1RCXB 4ECXA 1NHVA 1JKHA 5LSOA 2B7CB 1NKCA 2RAQA 2R4FA 3BBFA 4FS1A 4N5SA 3R2DJ 4G1PA 5CYMA 1QSSA 1VRTB 1TKDA 2DH9A 3ILLA 3W2WB 1RTJB 1UEKA 1ZAVA 1U1RA 2DGWA 1HLWA 3BR8A 3RBDA 3TA2A 4L3NA 1U0HB 2HRUA 2MZ1A 2I5JB 5KG0A 3BBCA 4Y6IA 1HBUA 1YRUA 4DPWA 4F2RA 1C2PA 1TZ0A 2HMIA 2CZ9A 4YQWA 3THTA 3HJVA 4WKYA 2MQLA 2RDIA 1O8BA 1V6HA 4JI6F 4YDXA 4N7TA 2BE2B 2OI2A 3R27A 3OXLA 1HBOA 4UTGA 2YWGA 2HHWA 3OPKA 5BJRA 2Q6CA 5IT4A 1JLFB 2AZ3A 4OX8A 1MWZA 3NRBA 3R7BB 5FIIA 2DY9A 4KRWA 1HHQA 4MIAA 1K0TA 3NP5A 2JNJA 4U9RA 5LJ3Y 4RUBA 2AU0A 3OUYA 3BH6B 4U95A 2C2ZB 4WU2A 1M5VC 3MPWA 2PI5A 4IOBA 2BR0A 1NSQA 4WYWA 2DBBA 1HNZF 3AD9C 3US5A 1DQ8A 3A1YG 4ELVA 1VLYA 1BWEA 2J0WA 2B56A 3BQ0A 2I38A 3EJMA 2A10A 4IRCA 1HD1A 3Q8YA 2DO0A 3I5BA 1VBZA 1KBRA 1UVJA 3M1VA 2ATCB 4C97A 3CCQS 4QU7A 3QRPA 4QW9A 3MMAB 4EBDA 3BEGB 3JS9A 2Y1LB 4J9RA 3DKDA 5ETNA 4USWA 5ETMA 4OV1A 5B0FA 3RR7A 2VG7B 3IS9A 2QFJA 4YS2A 1S99A 5L39A 1Z2LA 3HHKA 2PN6A 1NKBA 4F8RA 4ES3A 3MOZA 3W5XA 3MM6B 4DV2F 3W61A 2W9BB 3OFFA 3I6PA 2EEYA 1N5QA 3GSIA 2XGQA 3MR5A 3PIPQ 2HZVA 4A8OA 5CD4H 1FJEB 4NCAA 4HH1A 2DTJA 1BQNB 3VCDA 1PYSB 4JB8B 3FBBA 1VIXA 5C24A 1WTBA 3TVZA 2ADBA 3MCNA 2D74B 4NEYA 4XPEA 3X3UA 4U67Q 3I5AA 1UZDA 3H2UB 3V81B 2OPSA 1HW8A 2UVWA 5DQIA 2XLJA 1FJGF 4X4UA 4CLTA 2AV5A 4I56A 1FEHA 4KHPF 3GTYX 3JSBA 2YPZA 3OL9A 3D9BA 3DGPA 3K5LA 2DISA 3IRXB 2D3ZA 2RVJA 4F4YA 2HNYA 2JLFA 3I0RB 2NXEA 3NWGA 2ZNZA 1ZM3A 1WC1A 1XNQJ 1Q8IA 2CQ4A 1HQUA 5IS2A 5K8OA 2K7KA 2G13A 4GMKA 2RF2B 2GAGC 1SXLA 1RXOB 1PJ6A 2WOMB 4C4WA 3GP9A 4B9TA 3AD8C 1UFWA 1S72S 3K0JA 5KFVA 4MYUA 2OEKA 2B4VA 2DNOA 2GJIA 5J2NA 2VG6B 2G0IA 2W8LA 3G71S 1DURA 5HN0A 1QE1B 2Y8YA 4WWSA 4XPCA 1H3DA 2L41A 3CCMS 1C0UB 1SPBP 2AD9A 2CQHA 4X62J 1FK9B 4QIEA 2HVDA 2HIYA 3CC2S 2HQIA 1ZM4A 1BD6A 2YBVA 1AB8A 3C15A 3PX6A 5F8JA 3O1LA 4RW8A 4LSNA 4KIAA 3D6HB 4YR2A 5L8RC 3QT8A 1FFGB 3QJJA 2ZD1A 2QN6B 1WDTA 1IBCB 3HD2A 4YDDB 3IG1B 2E5GA 2X3GA 1SJ3P 3BYPA 5D0GA 1VK8A 5DO2A 1RAGB 1TKTA 1K9MT 1R31A 4MYTA 4DUTA 4DSFA 2R2RA 5KFYA 3H98A 1G1XA 2AW0A 4WXWA 4JI6J 1RWOB 2J9DA 1YWXA 2ZHOA 4N77A 4RX6A 3EYZA 3DXSX 4UF4A 2DEJA 4UOFA 5J2PA 2R42A 2VFTA 3K8WA 2QA4G 3Q24A 1FRXA 4Z7YA 3O2IA 2MZTA 4PQUA 2RU3A 2XS5A 2WSCC 3AOCA 3TUIC 5D77A 2HZAA 1JK9B 4ED2A 3PM9A 2YNGA 4J9LA 1HIYA 2E5LJ 3CC7S 1T3NA 2XG8A 1M1HA 4NLTA 2BANB 1NDLA 1OPZA 3NNAA 5B09A 1TL1B 3NCPA 1YZ6A 4GC7A 2ZKUA 3C6UA 2UVUA 4HT5A 3CD5A 1HNZJ 4DPYA 5IV3A 1OQ6A 3A13A 2CJ9A 1RA6A 3DLKA 1S0MA 2Z2ZA 1ZM9A 3G6ES 4DXLA 3ITHA 3J7YU 3EICA 3IM9A 2SXLA 3ZZ0A 5CH7B 2Y1RI 3CCZA 3RRHA 3SFGA 4BDPA 1HQEB 4USUA 4LREA 2EK1A 5LXYA 1RWPB 5GADU 3GV5B 2NXUA 2M2BA 2KTQA 2XY5A 1R8PA 2J9EA 2DNQA 1NK4A 2OFGX 2QYGA 3A12A 5C42A 2XWXA 1WC5A 3UI3A 4X66F 2H48B 1RYSA 5C25B 1WEYA 3EDQB 2LU1A 4ECRA 2E7VA 2KJVA 2QYCA 2W9AA 4ED7A 5HMWA 1V3ZA 3EVOA 2JEGA 4OZ5A 1ZPVA 3GJQB 1DZ5A 3IWXA 2MKJA 1RTZA 3EXCX 3BQ2A 1LWEB 2AJQA 1VQNS 1I3OB 5A6WA 4KBIA 1SV5B 3L7OA 3ZTOA 3NKYA 2J8AA 4H4MB 2FHMA 2KO1A 5ETSA 5KFJA 3M8ZA 2K1RB 4LBIA 3F0NA 4DSIA 5H1SV 1EQMA 1JLQA 4LT6A 3TYTA 2DNHA 3N28A 1RHJB 2ACMA 3HZEA 4KFBA 3Q8PB 3W7BA 4QQBA 2G9OA 4RWWA 2VONA 2MXYA 2FVSA 3B78A 3RAXA 1N5TA 3FK4A 3POTA 3OW2R 5I42A 2DR6A 4EI2A 1CEZA 2O3DA 5IQ6A 1IBKJ 2HK2A 2X1GA 2IRYA 3CJQA 3H5XA 2AEMA 2BX6A 2IJFA 2W7OA 1HBNB 2XB2D 2GJ2A 5HLFA 3LUYA 2W9CB 1RK8A 2VOOA 1FO1A 5CQGA 2FHKA 2P9EA 1BQXA 3QIDA 3Q22A 2K7JA 2H54B 2HYIB 2ALZA 2R2UA 1TKXB 2J0QD 4XIUA 2VIHA 2E1AA 2IJNA 2HHQA 2DHHA 4LRDA 3G96A 3WDOA 3CCVS 4OIXA 2BRKA 3DYAA 1O6XA 3U1NA 2R8HA 3OR2B 3N0VA 1OS5A 4ZIVA 5GAHU 2BQ3A 2IVMA 4MIBA 4DPOA 3PKMA 2UXDF 1OMSA 2YNHA 1NK8A 4RNOA 3PKYA 2MTLA 3GU0A 3CDAA 3ZTPA 2BA9A 1C4CA 4HACB 5A0YB 2Y1JA 2ASLA 4ATNA 2EG1A 2DHSA 2BRLA 1KDNA 2LDYA 2I0XA 1SJ4P 3GIIA 3FMWA 5KT6A 3HFKA 3W3SA 2VA2A 1UFLA 3ISNC 2GVZA 3P96A 3LF0A 2KJWA 1SVDA 1F3FA 4ELUA 2CYYA 1RHQB 4ZVFA 3ILOA 3EZOA 2UVVA 4F36A 4NRTA 2L08A 1Q16B 2W7AA 3I9V9 1FE0A 4WFBQ 5CCMA 5E3QA 2XLIA 5HROB 3KK3A 2RKIB 4C8LA 3PNIA 3QIPB 1VFJA 2AGPA 2MZQA 3BV8A 2CPFA 1RT7A 4QYRA 2BBEA 4LF7F 2BACA 1FE4A 2AYBA 3KLGB 1N54B 2HSEB 4ZCMA 4F0HA 2ZE2B 5CXTA 4L74A 1FDBA 4YB7A 1HMVB 3DRSB 4QR1A 1SKSA 5FJ4A 1KN6A 1DQAA 4JV1A 2MKCA 1RKJA 2V4RA 4AT1B 2F4FA 2BABA 4OLOA 1XMOJ 4WIIA 2IVYA 4EWTA 4WU3A 2MHNA 3AFGA 5KG4A 4ILRA 1T0TV 3DNCA 2EFNA 5SZTA 3MTJA 1CVJA 1NMEB 2HVZA 4JI8J 4Q0BB 1J5OB 2XM3A 4ES1A 4IKAA 5DS7A 4B3TJ 1DTTB 4X2BA 4UOHA 4F2SA 3NGRA 2PFFB 2MZSA 3DOMB 1CS4B 4CLLA 3DM2B 1JLBB 5HANA 3M9MB 1RT1A 4ZCIA 3PXGa 3CCJS 2AF6A 2RQKA 2B8PA 5KT3A 2V94A 4A8QA 1F9FA 3KLVA 3TVYA 5DG7A 2JZ5A 2R8KA 4J9UE 3R2CJ 4HTJA 2VFVA 1AXQA 2CA9A 3LGMA 3W9IA 4MTPA 4ZCKA 1IXKA 2ZOFA 3J80U 1D8YA 1VYAA 2GJFA 1F2HA 2H4WB 1VR6A 1G6BA 2X51A 5D0RA 2DVIA 3KHGA 3VGSA 3QJPA 1MW7A 4CLKA 3SV4A 2ZZTA 3AA9A 5E7OB 3IM8A 2BM1A 4TLRA 1JIHA 1Y10A 2CZVC 5CABA 2Y1IA 5E0OA 1TL4A 1EP4B 2W7PA 1RT2A 1B64A 4NI2A 5ETKA 1JLAA 1CQMA 4J91A 3Q2TC 2BKPA 2RRNA 2BVZA 2WVCA 1Y3KA 5ETQA 1VCTA 2RMLA 2FJAB 3FCWA 3A3OB 2P8IA 4PUOA 1LW0B 4R25A 3PVXA 5KFQA 4G3IA 1XR5A 4LFCJ 1N88A 5IT0A 1JKHB 1PAUB 4IR9A 1U4BA 3MEEA 2CPXA 4B9UA 4A8FA 1FVSA 3IBWA 3H8YA 3PG9A 5DQGA 5CYMB 4WP8A 4JI3J
chains in the Genus database with same CATH topology
3I5CA 1X4EA 2PMZD 4E98A 2VB6A 2OFHX 5LL6d 3OV7A 3P5TL 4B3TF 1TAQA 1EETA 2DCLA 2A3JA 2E1MC 3MMCA 2GA7A 3OBIA 4IG3B 4RW6A 4DQRA 4M95A 2KI2A 3G8QA 1HPZB 3MD1A 2VODA 4DQSA 4DQPA 5KAKA 2POKA 4IH6A 3SDEB 3MAQA 1VQ4S 3GZ7A 2N3LA 4ZHRA 1X4DA 4TY8B 3SSRA 2KVIA 3T19A 4IH5A 4KTQA 2R8IA 4C98A 1LKZA 1ZZFA 2CVIA 1R0AA 1SJRA 2OPPB 3W2WA 1VBYA 2EC0A 4X4OA 4LF9F 4N56A 2KT2A 3NG8A 1HQEA 4UUXA 4TLQA 5DGAA 2DNGA 2HNDA 1GNKA 2PT0A 3I31A 1YTYA 2ROGA 4CH1A 2FUG9 4IDKA 1S1TA 1SIZA 4DSJA 3D0IE 1HBUB 2M4MA 3H5SA 5KG1A 1MNEA 2HFZA 4ICLA 5KFXA 2K2PA 4TYBA 3KNGA 1IQZA 5E3PA 2OSRA 2VPXB 4ZVHA 5DQHA 4NLVA 4Y0FA 1VIOA 3U27A 1Y5IB 4RUCA 1UJ4A 4OX6A 5F8IA 1U1QA 5I3UA 5KFMA 2IFXA 2HMIB 1RTHA 2BXJA 1X5OA 4A4JA 1S1WA 1S49A 2M3DA 2UV8A 3MUMP 5E3AA 5C25A 3BSAA 1S9GB 3VAFA 4QR0A 4Q8EA 3KLFA 3KHRA 2MDAA 1VQ5S 2VL1A 5IT9Y 3ZZTA 2VKRA 2KT5A 5A8RA 2RQCA 2OKQA 3IGNA 2OP5A 1WG5A 4L72B 4OI2A 3H2LA 4FXWA 3QWUA 1FXDA 2WBRA 3M05A 4HYKA 2LECA 4AXJA 5ITHA 3PFOA 3U1LA 2DHXA 2PEHA 1XNRF 4C8MA 1HBOB 2J6TA 4RLEA 3EUNA 3RB6A 3KJVA 4K4UA 3LAMA 2FIUA 2PA8D 4RNHA 4P6QA 4PG4A 1KVJA 4M5DA 4K2XA 4KSEB 5BR8F 2KXNB 2BOPA 4F4ZA 1S6PB 4RNFA 1Q8LA 1N5YB 1R27B 4G1QB 1YJNS 2DPIA 1NU4A 4H4MA 5DM6Q 1VJWA 2ACYA 3UFCX 3LGNA 3ONQA 1KRPA 4HT7A 3IWNC 4MFBB 3KHHA 3K59A 3RB3A 1UAWA 4ZP8A 4FPRA 2EFVA 4U7CA 3HLUA 1JLQB 2K1RA 4QJVA 1DFDA 3BJYA 1Y5LB 2KXFA 3NNHA 4CH0S 5BYQA 3ULHA 1U09A 2V9KA 4ZPTR 1S1XA 2BV3A 2IA0A 2ASYA 4BWJA 3C8YA 2DHGA 2OMLA 4ZMMA 1UJ5A 4DV0F 2DR7A 4YHHF 4P7TA 2YX4A 4KFBB 4KV8A 4C8NA 3OUYB 2V4JB 3RRKA 1PC5A 2JEIA 2Z0GA 3LWLA 4C8KA 1U6ZA 2JDJA 2ZVSA 4NLUA 1B0VA 2M88A 4U7UK 4K4YA 2XC9A 4DR1F 1Z2ZA 2XMJA 1UETA 3C6TA 4FXVA 4DFMA 4DL2A 3GYNA 1BLUA 4DSKA 5EX0A 4F3QA 1KONA 2JOQA 3POTB 4IFYB 1WTFA 1JLGB 4DSEA 1OIAA 2JJ4D 1Y9OA 2OD4A 3KK2A 3T3FA 3JAMY 1DLOA 4K59A 1VQ7S 1CG2A 4FXDA 1DRZA 1G7CB 2UXBF 2ABYA 3TRGA 3IAM9 3LAKA 1NK0A 3MR3A 2AJ0A 1DQ9A 3BM7A 4CNYA 2W4DA 3OL7A 1YJWS 4A47A 1HNWF 3FMBA 3HDSA 1C0TB 5DLFA 4LF5F 2PE8A 3IN5A 1RA7A 1TL5A 3M2UB 1ZTTA 3KLIB 2VPWB 2GV1A 4Y2KA 4RNMA 1HYSA 3M1VB 4JUZA 1A7GE 1FRHA 2FJBB 3H20A 4H4KA 4LFCF 5KFPA 1V3RA 2A2DA 4QIGA 4PKDB 3Q0AA 2AJ4A 2QZ8A 2QA2A 3ICLA 2DNLA 5KFOA 4XO0A 3T5KA 1S1UB 2HLTA 2MKHA 3ISND 4URGA 4ZPDA 2R9LA 1N36F 2VQFF 3KYLA 3FSYA 4MKBA 1VC0A 4WFNQ 2CVEA 4JI3F 1E6VB 3E8OA 2KZZA 2YWHA 1X7VA 2VUGA 2W4CA 5BYRA 2UP1A 3VZHA 4TU8A 1C1CB 2VG5A 3KNAA 2W9CA 3HHLA 2CG4A 1M90T 2WBMA 2ZUGA 3GFZA 2ZZMA 1P1LA 3MUTP 3VTIA 5KG7A 2G1DA 3NNCA 2KYZA 2NYIA 1YJRA 1RTIA 5B0BA 1RP5A 2X1AA 3JSMB 4F3OA 1OO0B 2MSSA 1FDNA 3OLBA 1KLMB 2R7WA 1K1QA 3KWMA 4D3HA 3IS9B 3QJLA 4DV4F 3H4DA 3M8PB 4IR1A 2RT3A 2NPFA 3T9NA 4KHRA 1QY7A 4MH8A 2CQGA 4NLOA 3CVKA 4L6V3 1V3SA 4HI2A 2DNMA 2EVZA 2HNZA 3CDUA 2ZH5A 2VG7A 1F5AA 1FTRA 1HFEL 4PG8A 4RW7B 4EUVA 3MFHA 4P7VA 1VC5A 4ECZA 1TKXA 4EO6A 1VRUA 2VPZB 3O5TB 3BGRB 3MAHA 3PIOQ 1LXJA 4DX8H 3DYAB 5EWFA 2NPIA 2JLEA 2HGMA 2Z4PA 4KPYA 2YNFA 1AUDA 4I1TA 1CC8A 3KOAA 3VQTA 3AA8A 2VA3A 1PILA 2DO4A 3S7RA 5KFFA 2C3OA 3CGIA 4OHZA 4DOZA 4R8UB 5C24B 2W9BA 2VV5A 5K8PA 2RH3A 4JI0F 1YQHA 2EW9A 4ZDNA 3RBEA 3OR2A 4LJMA 1MU2A 1E6YA 4FVMA 3TNVA 3FRYA 4FF2A 4USHA 3OFHA 4WFYA 4ECTA 2MJNA 5AXMA 2EBGA 3GIJA 2Y0SD 1FRKA 4OI6A 2L3MA 4KO0A 5IFMA 2IBOA 2BDPA 4NMLA 2Q79A 1FKOA 3S01A 4AL7A 4IFVB 3PEJA 4HEA9 4X4SA 1S6QA 4LQ9A 4F25A 4EYHB 3CJ3A 5LMNF 3S1TA 4ED5A 3RTVA 4BCAA 3GV7B 1NNDA 3MM9A 1NJXA 1N48A 3BO3A 1VK3A 1JLCA 2HRYA 2K3IA 3OXFA 3KLHB 1UVNA 2KHDA 1FT8A 4MJKA 2HIQA 4DUZF 1F0XA 3M2RA 3GFXA 2OSQA 1LWCB 4OHWA 3E51A 4PQAA 3R5CA 2JEJA 5AXKA 2QA1A 4ZPVR 5A0YA 4TU7A 1RT6B 2FJEB 2P6TA 3V6DA 3N5BA 1HNIB 3MEGB 3NMAA 3J7Z5 4DL6A 3DLHA 2B43A 4DQIA 3DLGA 2YY3A 1T7PA 1ROFA 2VFUA 5B0GA 4G1IA 4DR2F 2HNYB 4PR6A 2G0CA 5KFIA 4PXDA 3OSPA 4PXEA 3M8SA 4K4VA 2RQ4A 1Q78A 3ZZOA 3HF5A 4K4ZA 3IAS9 1X4GA 3G8SA 3V4IB 3NL0A 4I7FB 3IR7B 4ED6A 4DEZA 3WZ0A 4WZMA 2OAUA 3I0RA 2UUWA 1UMJA 4BC7A 4TQRA 3UDLA 3ZFVA 1HQUB 1L3SA 2J7KA 1HHTP 2KFYA 3CIZA 3QO9B 1KNZA 3JTNA 1P1TA 3A8EA 5B0DA 2CQDA 1QUPA 1YJVA 4ZVEA 6FD1A 1GTEA 4TYAA 3HVTA 3O44A 1VI7A 4PG5A 1S1VA 5D78A 1K73T 4OJ1A 2IAJA 1DHMA 3DLBA 4B3OA 2IM0A 5DDPC 2IYIA 4OX7A 4WFAQ 2XY6A 1VQSA 4KAIA 3LP2A 3RU0A 4ILMA 3J80Y 4H54A 1SKRA 2RF2A 4F4KA 1RTDA 1K0VA 4TKTA 4N47A 2ZBCA 1YI2S 3SEOA 5DM7Q 2HQ3A 3K57A 1KFDA 2AWZA 4I2PA 5JXSA 2O01C 1KVIA 5F0WA 3RW7A 3NLCA 1HI1A 3MFIA 2MPUA 5HMXA 1REVA 1X4FA 4M63A 1U8SA 4TQSA 4OHYA 2F8EX 2LA4A 4U6PA 5HROA 3JYTB 2KXHA 2RKIA 4JI5F 1JJHA 4QPTA 4I4BA 4UQTA 2ZOMA 2LQJA 1SKWA 4YB1P 3CE8A 1GXTA 4DMZA 3K5MA 1HARA 1S9EA 2VBWA 2WONB 2YKNB 2YKOA 2ZM6F 3EX7B 4IO9Q 4ECVA 5HP1B 3OJSA 1FKAF 2RU9A 2MKSA 2V0NA 3Q8SB 2B5JB 1SJQA 3EGZA 2VG6A 3QWPA 2CRLA 5GAEI 3KLEB 4J9NA 3JSRA 1H7XA 1HWUA 5F3ZA 2DH8A 1A6LA 1XR6A 3KLGA 3KK1B 3BSOA 1N4LA 3K58A 2MQQA 1I94F 1D9DA 4ELTA 3ZZYA 1XMBA 3X1LB 3IR6B 4OZLA 4GO5X 1J2VA 3GWCA 1QE1A 1AFIA 1MROB 1ZETA 5CYQB 4Z2XA 1GX5A 4JI1F 1HMVA 2OH2A 5KFWA 1S77D 2IRUA 3D54A 4O3OA 3PV8A 1RISA 3C66A 1TKZA 3ZZZA 4Q7AA 2YKQA 3MMBA 3CJKB 3M4XA 4ED1A 3DDNA 2EFPA 1LK5A 3H40A 3HKZD 3T5LA 4XDDA 2B6AA 2GO8A 4KGKA 2RB7A 4YY3F 2HS3A 1TFWA 1ZPWX 1OPIA 4NZ6A 1S79A 4LQ3A 2Q43A 2VZ9A 2YWKA 3UD3P 2CQ2A 3R1LA 2HHTA 5HBMA 1FJCA 3N4WA 5JVGQ 3LP0B 3F73A 1U26A 1UKUA 1ZYQA 1X0PA 3UD4P 3P6YC 4K50A 5EHHA 2NSCA 4AQYF 4HLBA 1HW9A 4LVNP 3D0GE 3BZQA 3CD6S 2D41A 1DTQA 4RW8B 4WCEQ 3PW7A 4QYZJ 1WHXA 4LSNB 4NA3A 2KG0A 1T8EA 1RAJA 4LF4F 3QAUA 4KKOA 4DV5F 3O3LA 2IHR1 1Q81T 2WRMA 3GMGA 3CC4S 2KFZA 2KN4A 1TFYA 5KT5A 4Q0BA 3M6XA 3NCRA 5F3TA 4ECUA 4NLDA 4UW2A 5D4OA 3V4MA 4A8YA 1N6QB 2J6UA 2YNIB 1FA0A 4JV0A 2XI3A 4DBQA 1VQLS 1TVRA 3MM7A 5B7WA 3D1QA 2ZD1B 3HM9A 1DTTA 3MCSA 1B0PA 3QGPA 3UPFA 3UR3C 2EFQA 1UVKA 1H98A 1LW2B 4C0HA 4NLPA 3CT9A 4NPOA 4JI2F 3L09A 4ZK7M 2MQPA 3BSNA 3T5HA 4ERDA 3R5AA 2LQ9A 3BREA 4DS5A 3M8QA 5J1EB 3I82A 2XZWA 1HNVB 3DOMA 5HL7Q 1R6YA 1ZM2A 3DM2A 3CJ5A 3ENVA 5KFLA 4PCQA 4NCGB 3EXYA 1DBDA 5G0RA 2CZ4A 5KOXA 2BJDA 4N41A 2JRSA 2OPRB 3THPA 2YKMA 3I55S 4FBTA 1XBWA 1SBRA 2K8GA 3TA1A 1FRIA 4H4OA 2K3KA 4KR0B 1CC7A 4NYPA 3DRPB 3K2YA 4O4GB 5MAOA 3KFWX 2V8HA 4YB6A 3QZ7A 4ECSA 2XMKA 1KD1T 3PW5A 1SH0A 2R7RA 3GIMA 4WK1A 5KFEA 1RT3B 1VC6A 1FEEA 1QAYA 4DF4A 2RUGA 2DR5A 3SCJE 4LFAF 2FD2A 1G3OA 2VBXA 5K14A 4WK3A 1FRJA 4Y2CA 1DAXA 2M7SA 2OD6A 3LP1A 4JI7F 2L9NA 3MMJA 3HPOA 4O3QA 3M9OB 1S10A 1BQMA 4RW4B 2MY7A 3LALA 3ENQA 3U1MA 2DR8A 2X1FA 3GFHA 2FLNA 3TO8A 1PGZA 4QIWD 2B4PA 2QE5A 5LSRA 4KT0C 1C1BA 2HGLA 2LU2A 2Z2MA 5J2PB 2KT3A 4WXOA 3SSQA 4JYAF 3FSIA 1P6TA 1M5OC 2IVFB 1S7HA 4ECYA 5KOWA 2ZDOA 2ZOGA 4PXBA 4IH7A 1HWIA 4PQUB 2QSFA 3M32B 1NH8A 2YH1A 2RSQA 2C42A 4LIRA 3G86A 5CYJA 3DDKA 1XNQF 3VF0B 4NRUA 3G6VA 2HHSA 5HO4A 2DB1A 2L9DA 3EGWB 3TUJC 1RGVA 4O3SA 1K8AT 2VC0A 1KQSR 1FD2A 2FHOB 5KFTA 3I56S 1TR0A 4ALZA 5F8HA 4IG0B 4QU6A 2R8JA 2LMIA 4NYOA 4K4WA 3OVSA 4TY9A 1YIJS 2UUCF 2GO9A 3CJ2A 3DRRA 2N82B 2M0GB 4DUYF 3MEDA 3FEZA 2UVRA 1VBXA 3W2VA 3T6BA 4DR5F 4LF6F 4F4WA 1L3TA 3FZBA 1T03B 4GKKF 1WI8A 5M2UA 3K5PA 4MKAA 2NR0A 5AXLA 1FERA 2DNNA 2CJAA 2R2SA 2FC8A 2KM8C 1Y00A 1G2EA 1RT2B 2DNZA 1H2UX 4OI0A 3U02A 2BANA 5L1LA 3C6UB 1NZAA 4CH7A 2F7VA 5J1PA 4Q45A 3QLHB 3I4HX 2FLLA 2B7BB 2IC3B 1OQ3A 4I68A 4YUDA 2QT7A 3MM8B 1EP4A 1QUVA 5T7LB 4WYLA 2L48A 2VD3A 4AXIA 1VQPS 3NGKA 1KFSA 2DGXA 3S8SA 4J9PA 3N5FA 2XMWA 4R5PA 3DLKB 2N3OA 4N8OA 3I87A 3GQCA 2C2DA 2ZH8A 2QA4S 4HDHA 4AE5A 2GQ2A 1QAIA 1HL6A 3DU6A 1Y5NB 2HG4A 5EX3A 2ILZA 1X9WA 1TK8A 1X5TA 3DI6A 3VZIA 1N0VC 4RW9A 3DRXA 1GH8A 4CZCA 2BQRA 5I3QA 2MB0B 3SQGB 1D0EA 3SCLE 3MHYA 2ASJA 4LIWA 3ITHB 2R7VA 2XCAA 1X4HA 2CQ1A 1RT5A 2CQIA 2C3UA 5M2PA 1IQTA 1LW0A 1WACA 1UA0A 5JVHQ 2U2FA 1FD8A 1WWHA 5GVQA 1KQFB 4X62F 1NB7A 1URNA 2J0SD 2LEPA 2QIFA 1VQ9S 2JEFA 2XHWA 4C3MA 2IYGA 3DOKA 2HVIA 5J2MA 5KG5A 1RYRA 1T3OA 3MMCB 4ECXA 1NHVA 1JKHA 1GTHA 1X8DA 2B7CB 2GHPA 5LSOA 1NKCA 4CNZA 2R4FA 1YITS 3Q8QB 4FS1A 2XSJA 1N56A 4N5SA 2HLUA 4G1PA 2PD1A 4Y2IA 5CYMA 5KFKA 1QSSA 4TXSA 3P3DA 2IRXA 1VRT<