4RWWA

Crystal structure of l. monocytogenes psta in complex with cyclic-di-amp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Lmo2692 protein
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwwA01
4USIA 5D4PA 4OZLA 1KR4A 2XBPA 3L7PA 2XG8A 2EG1A 2JJ4D 4IYQA 2NS1B 5DS7A 4Y6IA 1UMJA 3NCPA 4WK3A 1NH8A 3X3UA 4Y65A 1V3RA 2J9EA 3AH6A 1Q1KA 4CO1A 4CO2A 3N5BA 1V6HA 1O5JA 2EG2A 4C3MA 3NCQA 1VFJA 3AHPA 4CO4A 4USJC 3O8WA 1VHFA 2PIIA 2E66A 4D3HA 2J9CA 3CE8A 5D4OA 4R25A 3DFEA 2O67A 3O5TB 4C3LA 1NAQA 4WK1A 4CO5A 2ZFHA 5D4LA 3HLUA 4RWXA 5D4NA 1P1LA 2J9DE 4CNZA 4CO0A 4YB6A 4YB7A 4ZK7M 1GNKA 4YB5A 2DCLA 2GNKA 4RX6A 1V9OA 2VD3A 1UKUA 4NYPA 4OZJA 5DRKA 2GX8A 2NUHA 4AFFA 3T9ZA 3LF0A 2V5HG 4RWWA 4CNYA 1XK8A 2ZOMA 3TA2A 1J2VA 1UFLA 2J9DA 2Z0GA 3AA9A 1UL3A 3M05A 2CZ4A 4E98A 3AA8A 4OZNA 1NH7A 2RD5C 3TA0A 1V3SA 1HWUA 3OPKA 1O51A 3TA1A 2NUUG 4RLEA 4NYOA 1PILA 3BZQA 3NCRA 4D3GA 1H3DA 5L9NA 1OSCA 4USHA 2GW8A 2XZWA 3GSDA 4CO3A 4C3KA 2XULA 3MHYA 1NZAA 2O66A 1QY7A
chains in the Genus database with same CATH superfamily
1JMTA 1U25A 2AJQA 2LQ5A 2N7YA 3LP2B 2BANB 1KR4A 2VG6B 1VBKA 4PEOA 3E51A 4U8YA 1NZ8A 1KTQA 2A1BA 4OMFG 4TQRA 1ZZNA 2B3TB 5DM7Q 1U4BA 2RAQA 2PMZD 1TL4A 3OHBA 1FNXH 2OPSB 9RUBA 1YG0A 3B4MA 3OBIA 3CD0A 3H7HB 3TUIC 2MLXA 4OZ1A 5BJRA 1YVFA 4X65F 2VQEJ 3TAQA 1ICEB 2Z4PA 1E6YB 1LOUA 3C15A 3EZOA 2MZRA 1VQOS 4RUHA 2KB2A 3IS9B 3DHWC 1K47A 4A4JA 4O44A 2XB2D 4B3OB 4WFAQ 3V4IB 4OX9J 3MM6B 1JNZB 3BR8A 1HHTP 3NMRA 4DR7J 1U09A 4X64F 3JB9k 4WZMA 3GJRB 4WYWA 1VISA 2DRBA 3MEGB 2GVDA 3QQCD 4DN0A 5IQQA 2ZC4A 3DRSA 5KTQA 1KFDA 2CJ9A 1RA6A 1SIZA 5J2NB 5HMZA 3OXGA 4QCLA 3MM5A 4J91A 1QLNA 3IA0A 5AXKA 3DOLB 2XTJP 3KK2A 3DI6B 4IRCA 3RAMA 4CO4A 4CLZA 3HVRA 5KFSA 2N4DA 1MMNA 3DN9A 2DXDA 3TAMA 3TZWA 3UDVA 3MR5A 2ZKUA 3T5KA 1X4FA 2RRAA 1JXLA 1KKHA 3O44A 3ENAA 2VG5A 3OR2A 1XMQJ 4TY8B 3CCTA 2HVZA 1KFSA 5GMKa 1SIWB 1YRTA 3HHLB 1LWEA 1X0FA 1S0NA 4C3LA 2MQPA 1M5PC 4LF5J 4K59A 1LK5A 3CGIA 4WWSA 2CUYA 2YBVA 3QJPA 5G4DA 2OFGX 2A6OA 4DR7F 1HBUB 5BR8F 3ISZA 5CXTA 1NBEB 3NRBA 3T1YF 1X31C 2DO0A 2GHWA 4LFCJ 3CIZA 3PYFA 4DG1A 1KQSR 1Y0HA 4NOHA 5J1PA 3FSIA 1TQLA 2HHPA 3K2YA 1AFJA 1RSCA 1RAFB 1MU2B 2DCLA 2DR5A 4M94A 4ED5A 4ANCA 5C5JA 6FD1A 3DMJA 2YNGA 2LXUA 3I82A 1UWAA 2NQPA 2VICA 2NUHA 3ZC4A 3K5MA 2IC3A 4ZHRA 2M9KA 4JI5F 3IWNC 1R89A 1VQNS 3NS5A 5EWGA 3KUHA 1U0HA 3D6FB 5IT0A 1X4HA 2HGMA 1CJTB 1J2VA 1V5IB 4ELVA 2C2KB 1SV5B 1R0AB 2DIVA 2PA3A 3L09A 3I4PA 1TKXA 3NL0A 5ETLA 1CJVA 3BBFA 1NDLA 3M8SA 2JX2A 4QYRA 1QAIA 1S6QB 3UN3A 3ENWA 3HDSA 4HDHA 4PG6A 4DPYA 3TA0A 5KT6A 1MN7A 3QO9B 3V81B 3AY0A 4UF4A 2K2PA 1N4LA 5E3PA 4DOZA 3HX9A 3Q8YA 2ADBA 2BJDA 3UQSA 3W63A 1FTCA 4FYVB 4NX9A 4DU7A 1OYDA 2MKKA 5J2PA 4GKJJ 4IOAQ 2JFDA 4RLEA 1WJ9A 3MMBA 3ELHA 5CABA 2WOMB 2R3VA 5IV3A 1TAUA 4NZ6A 3CUNA 2AYGA 3PG9A 5LOQA 2QL9B 1R6YA 4OHXA 1TK0A 2HHHJ 4B9UA 5CD4A 4MJKA 2B4PA 1F5CA 2DD8S 2QA2A 3VAHA 4PRFA 1KOHA 4PWUA 2IA0A 1SC1B 3BKFA 5A8RA 4F7VA 2GMLA 2EBGA 4C0BA 2IM1A 2ZVSA 5KFTA 1VRTB 3GSDA 5J2PB 2BRLA 2ZM6J 3OUYA 2QL7B 3UI3A 1WDDA 1S1WA 1U6ZA 2MKYA 2XULA 1ROFA 3HZEA 3LANA 3N5FA 1NZAA 4OV6A 4J9SA 2RQMA 5C42B 1QY7A 2CQ2A 3ZNJ1 4I6WA 5ITHA 4ECUA 1VLYA 3LP0B 3DCAA 5KFOA 1QM9A 4BC7A 4BHQA 2JC0A 2MXYA 4P10A 4DSIA 3C8YA 2C3OA 2DR6A 3RZAA 3Q8PB 1VRQC 2BVZA 3DOMA 3D66A 3TZXA 1X5PA 4TKTA 2E5GA 2HLTA 3QGPA 4WFNQ 5B0EA 3A3NB 1TU0B 3U1MA 4FS2A 3GMGA 3T19A 4ECXA 3GYGA 3OFEA 2H4YB 4F8RA 1SJ4P 1V3RA 5KFWA 2YWGA 5SUHA 1T03B 1GK8A 2VBYA 4FYWB 1T3OA 1ZA2B 3NGDA 2C2ZB 5EN1A 2YKMB 3PW7A 1J5OB 1S9GA 3GYXB 4DWIA 2K1RA 1HNWF 3IS9A 1TL5A 2Q6BA 4P2XA 4B3OA 1RAGB 2XLKA 2ZWPA 2EG2A 3K8VA 3MECB 3QFWA 1XMOF 3FNNA 1UVJA 1RISA 3AXKA 3HI9A 3IWXA 2B6AA 4J5OA 4LF6J 1QJHA 1MG7A 1O8BA 2G13A 3NGTA 3HT0A 1VHFA 4ID5B 2YKMA 1TZ0A 2JLFA 4Y2AA 2F4VJ 4DFPA 4E0DA 1A0OB 2DGQA 4ECVA 5J2MA 2RNEA 5EX3A 1CPZA 3TEHB 1RHJB 4A8QA 5H9FK 2OLWA 1KNZA 4JI3F 1Z2LA 1H98A 1E6VB 4RL1A 4RWXA 3CDUA 3UD5A 3H5XA 3PKYA 1MLAA 3M8ZA 3CDBA 3C6TB 3DLKB 4YB6A 3PRVA 1F5BA 3RYLA 2ABYA 3TVKA 3OVBA 3M8PA 3IN5A 3HHEA 1IBCB 1VS3A 3SFGA 4ED4A 1N5YB 3FQKA 1UKUA 1WG1A 3LPYA 1DQAA 2YKAA 1R0CB 1PYTA 4L76A 2WBMA 3TZZA 2V4JB 4DV5F 1P6TA 2GVDB 4FBUA 3CMQA 4NMXA 2CADA 2JRSA 2ASLA 3WC0A 2ACMA 1HHQA 3CCZA 2BA9A 1TVRB 4DF8A 3UNYA 2DEJA 5RUBA 1OMSA 4M5GA 1RUSA 2BEFA 2M88A 1HNVB 2IDEA 3SSRA 1B70B 5GAHU 3TAMB 1Y10A 4LVOP 5KT3A 1KOOA 4PYDA 3M05A 3CCJS 2CZ4A 2ALYB 5A0YB 1D8ZA 4C0OC 2IMOA 2O5DA 1TL7A 2EEYA 4JOUA 4A46A 3VV2B 4DHVA 2JNJA 4YR2A 3NNAA 3OFGA 1T0TV 1JLFA 3GR1A 2D1CA 3VGSA 1SKUB 4TN2A 4IFVA 2CJXB 4UZBA 2G0IA 4NRTA 4I68A 1S5ZA 1SI9A 2XY6A 1O6XA 4G6VB 1EX8A 5D78A 2A3JA 3LAKA 5DM6Q 1SPBP 1FK9B 4USVA 2FHMA 2FLPA 3L95X 3SEOA 4PG7A 1Y3KA 4OX6A 1VC5A 4QBUA 1FXDA 3B4DA 4P71A 2XSJA 4KRWA 2VV5A 3CWJA 4KGKA 1PAEX 2UUWA 2VFVA 2DNKA 5K20B 3QMQA 4WFXA 2DRAA 4F4AA 3M8RA 1OSCA 2QC3A 2P6TA 3PYEA 1FESA 1SKRA 2Q79A 2IMWP 4PPZA 1FJCA 1ZBTA 3EGWB 5KFLA 3ETMA 3NXZA 4JI6J 3KLEA 4ED1A 1NCLA 2HWHA 2BQUA 1C4AA 1Q8IA 3EGNA 3OTDA 2FJWA 2GQQA 3EDRB 4JB8B 3C16A 3HFZB 2Z58B 1GXUA 2BXJA 4FNHA 3W8GA 5D4PA 2KM8B 3LALA 3FZ2A 3GB0A 1T9TA 2VFUA 3UDCA 3RJMB 3BV8A 3HSJA 3HVAA 2DNMA 5ETVA 2KT2A 4M5LA 2PI5A 2GGPB 4NLVA 3MM8A 5SZTA 1H73A 3AJ2A 3MEEA 4DBQA 2KXNB 3NS6A 2RF2A 5I4MA 4TQSA 3WIUA 3Q22A 1HR0J 4OI3A 2OEKA 5MAOA 1NH8A 4FYYB 2MSTA 4CTAA 1PKUA 3DKDA 2L08A 4RZRA 4I6YA 5IS2A 2H3EB 1Y4ZB 1H74A 2QSFA 5LXRA 4ZVFA 2DTJA 4KH0B 1OS5A 4LF8F 1I5OB 2XYPB 1JXVA 2DGUA 2IRXA 3DGVA 1FWKA 3N5BA 4J37A 3QFHA 4MK7A 1RT5A 3CJTA 4URSA 3Q83A 2JC1A 3KJQB 1PCAA 2R7TA 2MDAA 4NLXA 3CCUS 1BC6A 2AP6A 2PFDA 1YJ7A 4FPRA 2VDHA 2YX7A 3AD7C 3FRYA 3NAHA 3A4TA 1CC7A 2L41A 4JI4F 2W4DA 3QRRA 2JWNA 2BUNA 4WTOB 1UA0A 1IKXA 3IR6B 3Q8VA 5I42A 2H51B 1TP7A 2DY1A 1Q8KA 2LU1A 3QATA 3WX8A 4F50A 2YNFB 1N6QB 2XS7A 3VTIA 4P6QA 2BX6A 1OPIA 5M2RA 1D0EA 1FHTA 3DFEA 4CRJA 4PQUA 2PFFB 4B3RF 1IKYA 5H1SV 2ZFHA 2CPZA 4Y2KA 3AOAA 4J9QA 3W61A 4IR1A 4MTPA 4DX6A 1S77D 5D4NA 4RNNA 1VK8A 2AWZA 1HBNB 4O3NA 5F0WA 4XO0A 1UTAA 3TNVA 3THVA 3JXOA 2HW3A 3IRWP 2OGUA 1K1QA 3G82B 4QQBA 2LA4A 2PMWA 3MMCA 2VPXB 2RH3A 3O2IA 1G6BA 1XJWB 1YX2A 4UW2A 2OPQA 2UUAJ 3TI0A 2VC1A 1S1TA 5HROA 3QGGA 2GJFA 4IH7A 3EX7B 2LVWA 1SC6A 4NMLA 1RI7A 3FDSA 4XTTA 4F2SA 1T7PA 2HHXA 1REGX 3M2UB 4LFBJ 5J2QB 3R5JB 4LSNA 3NNCA 3KK3B 2JEFA 1KLMB 1IJEB 2B6AB 2QV6A 4YY3J 1JLBA 2VFTA 3JS9A 1S6PA 3OR1A 4QJVA 2AYMA 4K4TA 2Y1IA 3Q23A 3RGIA 1HFEL 2XLIA 1C1BA 3EDQB 3B54A 4C2MA 1JB0C 4IR9A 1ITPA 4IUFA 3BREA 1KVIA 5ETSA 4CLYA 4ED2A 1NH7A 1UP1A 3P8BB 4LSNB 1LEOA 2VFRA 5GADI 3MCMA 1E6VA 1RKIA 3G2XA 4HEA9 3CJ4A 4IOBA 4AUKA 5KFXA 4DX7A 4QWBA 5J1EB 3IP0A 1BQNB 4ZCMA 1RTHA 2C3YA 2AYBA 1QSSA 4IH6A 1KQKA 1VQSA 3RTVA 1FDAA 3ICLA 1L3SA 4JV1A 1BGXT 4OL8A 4NLQA 1KVJA 2QMXA 4DEZA 2FTRA 1FF2A 2DXFA 1S79A 2K7KA 4DFJA 2WB4A 1RTIA 3M30A 4DR6J 3BN4A 4HT7A 2X7IA 3OLAA 4MKVA 3E2EA 4DR4F 3A8IA 1CLFA 1K0VA 5CYMB 4DU8A 1U2RA 2HGNA 4FKXA 5DLGA 4K4YA 2EFVA 3R27A 3L7OA 4RW4B 2AGOA 2JEGA 2XG8A 5F41A 2XMKA 2XSFA 5C7PA 3PR5B 2E1RA 4LRCA 1X4CA 5HP1A 1FE0A 1Q16B 4IYQA 1RTIB 2HRUA 1QE1B 3M30B 4ZJLA 7FD1A 2XQCA 5DG7A 2HYIB 4C4WA 1LNQA 4Y28C 1VLOA 2V0NA 3ZZOA 1LFPA 2C3UA 3OT9A 4Y6IA 1RAJA 1RWUA 1C4CA 4E8UA 2W2MP 2QX0A 3X3UA 3CC4S 2EPIA 3TJ9A 5E5NA 5FIIA 2CA9A 4R8UB 4LIRA 3OL8A 2UP1A 3N9UC 3OTOJ 5I3PA 4R5PA 1RTZA 3LP1B 1BWVA 1H7XA 2AEMA 1W26A 2IC3B 2B9EA 3GCWP 4CO1A 1I51B 2UVUA 3R5CA 5BYRA 2DGOA 1YIJS 4LUBA 2RILA 2CNNB 4P2SA 4DL6A 3ENQA 1RT6B 2BRKA 2AMCB 4HI2A 2XGQA 3I0RB 2HQCA 1VRTA 4CM0A 1TKXB 4NCBA 4A48A 1HW9A 2JOQA 1T9VA 2HWTA 2HQGA 3QGHA 3IWLA 4GVBA 4WPAA 2RVJA 4IG3B 2ZBCA 2ATCB 2IBOA 1CULB 2YQ0A 4MH8A 3Q8RB 2FVCA 4M5KA 3QZ7A 5T7LB 4KHRA 3J81Y 4DR5J 4ED0A 1D1UA 5H9EK 3T1YJ 2DPJA 3IFEA 2J9CA 2QFIA 2WBRA 2HNDA 4R25A 2HGLA 2IAJB 5HK4A 1JLGB 3AD9C 4KV8A 4K4XA 1BE4A 3CJRA 3AOCA 4CO5A 4X2BA 3P5BP 2BM0A 4DCPB 1XR5A 3IBCB 1XMOJ 2DH8A 2IJFA 2EFOA 2HZCA 2WVFA 2J9DE 4NE9C 4IDKB 2JH3A 3GIRA 3Q8UA 1HI8A 3GFXA 4HHHA 3CW2C 5KFIA 1LW0B 4WTYA 2O01C 1WC1A 4YB5A 4DL3A 3WC2A 4H4OB 2NSCA 2J7WA 3UCGA 4LF7J 2VBXA 4NEZA 4WIIA 3W7BA 5L1JA 4QU6A 2YKOA 2BANA 2VG6A 4MIWA 2OKQA 3FJ2A 4V19J 2NXUA 2W2OP 4KGMA 4O3QA 3ITHB 3TVYA 4F04B 4URGA 2VFSA 3MMCB 3HSGA 1NEEA 1ZAWA 3R2CJ 2GQCA 2WW8A 3UVJB 1JJ2R 3MR7A 2XNQA 4UOFA 4CYUB 1HIYA 2ATLA 1WNEA 1U26A 3J7ZT 2IM0A 1RT1A 3I31A 5AE2A 3ET6B 2YWKA 3EM1A 2D3O1 4MYTA 3SQGA 5J2QA 4USWA 4LMZA 1APSA 4DV6J 1XNQF 3CD5A 2E9TA 4JI0F 3ISNC 2XMVA 4R0JA 3TOQA 2DGXA 1RBAA 2E7XA 2JEIA 2KM8C 3KMQA 5KOXA 1M5HA 4P7TA 4KO0B 1J27A 2EK1A 2QLJB 4JYAF 4K5RA 4NPOA 4QW8A 3K7RA 3KK2B 3KHLA 3UD4P 3ZTOA 3K5LA 1YRUA 2F8HA 3EXYA 4U96A 1NKCA 5HBMB 4EYIB 2OPSA 3FEXB 4G1QB 3GWCA 4KBIA 4ZJOA 1RADB 5IOLA 5KG4A 1HI1A 3GYNA 2N82B 3TANA 2XMAA 1RHKB 3L9ZA 1JLCA 1Q7LB 1YKWA 2PO4A 3H2UB 3M8WA 3UN5A 5KFRA 4NLRA 5C42A 3KHRA 3M8QA 2C1EB 2EFGA 3HVTB 2ZC3A 4F4WA 4PWDB 2RUGA 1LWCA 4I2PA 3HF5A 3GSIA 4X84A 4OZLA 2FC9A 4NI2A 4TLQA 4NCGA 5K8MA 2XY7A 7AT1B 3D54A 3RRGA 2VBZA 2DY9A 3TW0A 3V5RA 1PAUB 3AOBA 3M2RB 3JAMY 4NLGA 2QA1A 1DTQA 1WWHA 2GAHC 1F9FA 2IDLA 1CQNA 3R7SB 5KFNA 3HPOA 2W7OA 4F4YA 1IBKJ 4GVLA 2HVIA 2VL1A 4OJGA 5KFUA 3MXHP 4DUYJ 5KFAA 5D8HB 1RWMB 3JQMA 1U1RA 2HZAA 2D69A 5HP1B 1R8BA 1FRKA 1U6FA 5D15A 4ICLB 4NCGB 4PG8A 2GAGC 1NJWA 2HG4A 3NAIA 2ZBQA 2ZOFA 4DL5A 3DRYA 3DHXA 5AXLA 5IM0A 3MM9A 1KEKA 3H90A 4UT4A 4WU2A 5F8NA 2KVQE 4YOEA 3HZGA 2UUTA 1F3VA 1P9YA 2CQ3A 1CJKA 2FIUA 1SKWA 4DUZF 1MWYA 1NSPA 2UZAA 1RT7B 2CQDA 3MTJA 3NS7B 1FJGJ 1DARA 2VKZG 4J90A 2B43A 4OZ5A 3AHPA 2Z2ZA 3ZXWA 2H5JB 2HWIA 3R8YA 2C28A 4DQIA 4LQ9A 3KLVA 3PW0A 4AE5A 3HK2A 1TAQA 3BO3A 2KZMA 5DQGA 5B0AA 2VQFJ 2JSXA 1NO8A 1V3ZA 2RRBA 3MMBB 4IFVB 2IVFB 5KG5A 1G2EA 5IQ6A 2UUBJ 2KT5A 3FMBA 1RAHB 3CJ0A 4KGXB 1WF1A 4C97A 2VOPA 3UNGC 1AB8A 1N5QA 3BH7B 1FD2A 3G8SA 2PDAA 5DQIA 2EK6A 1VIXA 1P1LA 3CJ3A 3DOLA 2NR0A 1AFIA 4O4GB 3U1LA 1HKAA 5D3GA 4ZVUB 4M8LA 1X5OA 3TZYA 1TL1B 2G4BA 4K4SA 4X64J 2UXDJ 4Y0FA 1EZZB 4LREA 3TO8A 1VBXA 4NYPA 2QA4S 3FFIB 3HMJG 4I2QA 1FXRA 2PE8A 2DGVA 4ITSA 1UVIA 2UXBJ 1YZ6A 1LXJA 4RWWA 1OWXA 3AAWB 2WONA 4LIWA 2DNRA 5KT7A 3AT1B 1KQGB 5LM7E 3TA2A 4ZLNA 3IO1A 5L9XA 4DV1F 4A8XA 3PIPQ 1Q82T 4K50A 1SC4B 3SYZA 1M90T 4ANDA 3FSXA 4KPCA 1QAJA 2GFFA 3QAEA 5KFYA 1NB2A 4B9NA 1FRHA 1IKYB 3MM5B 4ZVOB 4DXLA 5F0UA 4Q2MA 2IAJA 2W7AA 5KFHA 1TKDA 2Y8YA 1NSQA 1UETA 2BOAA 3BM7A 3LA0A 2Z30B 4C7QA 1UJ5A 2YNHA 1RBOB 3R6GB 2Y1JA 4EI2A 5I3UB 1HWLA 1MROA 1RT3A 1U2FA 4RW8B 3QRQA 3MMAA 4WE1B 4QYZJ 5CYQA 4C8MA 2JVOA 4TY8A 4WU3A 2E7VA 2C3PA 3DLEB 4QIGA 5DDRC 3KHHA 2DPIA 4B17A 2MHEA 3HKWA 2CFXA 1YQHA 3JQJA 4PABA 5K8OA 1R0AA 2CQHA 1PC4A 1QAXA 2CG8A 3QT6A 2XMTA 4TYAA 3OJUA 3J80U 1UJ4A 2VG7B 2YPZA 4DSLA 5CZXA 4B3TJ 2HSEB 1VRUA 4EBDA 4B3SJ 3D28A 2MY7A 2ZH3A 2XNRA 1DQ8A 3QT5A 3MGJA 1WSRA 3C16B 2NXNA 4AXIA 4DLEA 1PG5B 3RR7A 1R8CA 4C3KA 5HVHA 4OZ0A 2HHQA 3DOKA 4OI2A 2MKIA 1RWKB 2RDIA 4PQUB 3TWZA 2BKNA 3KJFB 1IXKA 3KHGA 3POTB 1YJNS 4R0EA 3MM7B 1EHWA 4FF4A 4AD6A 2J6SA 2EW9A 1R31A 2H4WB 1YBAA 3M8QB 2ZVIA 2BE9B 3LOUA 1S7HA 4ZPTR 4YR3A 3MPVA 4F02A 1A7GE 1L3UA 3D6HB 2IRYA 5CYJA 5A8WB 3MURP 2DNZA 5K9FA 5GAGI 1N88A 1N0UA 1N52B 2OO4A 3CJQA 1WEZA 3CJ2A 3H8YA 3T6BA 5J1EA 2DNYA 3P96A 3ZTRA 2ZJPQ 1SC3B 2WW4A 4K0KJ 1Q1KA 2HFUA 4CO2A 4NEYA 2AZ1A 2FD2A 1U1PA 5IC4B 1L3TA 2Q43A 2B7BB 2W9CA 4IRDA 4JI1F 2F5GA 3NP5A 1XWLA 1RTDB 5GMEA 1IKVB 2DK2A 1HNXJ 2DEIA 4XAKA 5DGBA 4X62F 4F0HA 1ZS6A 2DJWA 3OR1B 2VODA 5FD1A 5L38A 3D5MA 4ZCIA 2J5AA 1QAYA 2IYGA 1VDHA 2MZJA 1F1BB 2R2RA 4DQSA 1K44A 3UPFA 2AJ4A 4HLBA 1SH3A 2QYCA 4MAKA 3ZTQA 4CH1A 3KJVB 2R7RA 3CCRS 4BWMA 4Q5VA 4ER8A 4RW4A 4PWDA 4M5DB 1R3NA 2HVEA 3QJJA 3ZZZA 3KUGA 2E9RX 2ZUAA 1S9GB 4ZPWR 4UOGA 4BBYA 2AJ0A 3C3LA 5CAAA 5B7WA 2P8IA 4I0WA 4B08A 3K0JA 5LL6d 3IR7B 4NASA 4Q0BA 3CCES 1JLEA 1S4EA 3N0VA 1F0XA 5GAEI 2VH7A 1K0TA 3NOGA 3MMJA 3HJVA 1HWKA 4DQRA 3OQ2A 3M2VA 1GX6A 1VMBA 1N5TA 1WOPA 2EFNA 4DUYF 2C3MA 1S1VA 4USUA 4A8MP 1D9AA 4OX8A 1FCAA 4ZCLA 3QIPA 1VJQA 4BCAA 3NGKA 5KFQA 3CPWR 4DMZA 2XI2A 2E1AA 4OZJA 3RBXA 1Y7PA 5J2MB 3I0RA 4L72B 2O3DA 5HMYA 2APOA 4DQQA 5D6GA 2RHQB 3LF0A 4C8OA 3DU6A 3PY8A 2GQ2A 1VQLS 3W5ZA 2J7UA 3MEKA 1IQZA 4K4UA 2ZOMA 1XEZA 2M3DA 3OTBA 3MAHA 1HNZJ 1ZOTA 2J9DA 1U1MA 1SQEA 3H98A 3C6TA 4H54A 1Q79A 2R7QA 3QIPB 1PJ6A 1WACA 2UVRA 2HBQB 3TX8A 4IFYB 5KFKA 2XSJB 3CXCR 3ADAC 4YUDA 1UL3A 2M5YA 3DI6A 1U8SA 2CQBA 2I0XA 1F3FA 2FHKA 2MYFA 5A8KA 1T05A 2BYCA 1TUVA 2KRRA 3F0NA 4RBTA 4CDIA 2W25A 2ILZA 3CCWA 3SQOP 2V50A 2FZCB 3D3BJ 1DZ5A 1LQ9A 3GFYA 3V6JA 1TELA 3D6TB 2V4RA 1RYRA 1RCXB 4ZDNA 1B0PA 1H2UX 1NK0A 1YHQS 1LW0A 3D6MB 4DPXA 4BDPA 4DUTA 2CG4A 1QTMA 4UTGA 4LFAF 2I6WA 4LFAJ 3F73A 3BQ0A 4HH0A 2WHOA 2ZZMA 4IO9Q 3BO4A 1XERA 4KYZA 4ZN1A 8ATCB 5ETMA 1KP6A 2LKZA 3OVAA 3B78A 2K06A 1N33F 3S6EA 3PW2A 3MPDA 4K2JA 2KL8A 3DDKA 3DMJB 1UWBA 4OYXA 1YTYA 3DLLQ 2OTLS 2LQ8A 3OUYB 3CDAA 1UA1A 1QD1A 1H6KX 2BACA 4P73A 2VF3A 3AJ1A 2NREA 1I94F 2EKYA 3SCLE 3PNIA 4YY3F 4DR2F 3G82A 2YX1A 3HSZA 1I6JA 4DCJB 3R5DA 2DHXA 1M5VC 3MR2A 2C2EA 2E5JA 2IPOB 3CO0P 4RJVA 3UD3P 3IRXA 5KAKA 3RB3A 3N01A 4C8NA 5HAOA 1U1NA 2HK3A 2F3JA 4O4RA 4RW7B 4B9LA 3HHDA 2HKEA 3KK3A 1HBOA 2KXFA 2OHDA 5B0BA 3S7RA 5JJBA 2G9OA 3HFKA 4FN5A 3DM2A 4IH5A 4JV0A 4QWAA 2VPWB 2RU3A 1V6HA 2PSZA 1BUXA 3TQ1A 2CPXA 3KG0A 5EWFA 4NA2A 5LT5A 2O1PA 5CCMA 5ETTA 3MEEB 2QLBB 2KXHA 3OTCA 1S9EA 4DSJA 2RS2A 2OUGA 2QLWA 3DYAB 4B3RJ 3MECA 1KONA 1U0HB 1WHXA 2I38A 4USJC 1PYOB 3NWRA 2PIIA 5CQGA 4JI8J 2EFPA 1QVFR 2GZOA 4JI2F 5IWAF 3CE8A 5E7OB 1RWXB 1TKTB 1Q8BA 3POTA 1U49A 1LW2B 2QL5B 2WVDA 1KHVA 2VPYB 3RW7A 3MUTP 1U1LA 4M5NA 3CC7S 2JL9A 2DB1A 1EETA 3J81U 3KLHA 3VQSA 3QO9A 4HI1A 4EBEA 1WC6A 3KLIB 3OXFA 4OV1A 4V19X 3ZZRA 3N79A 3DDIA 1NPRA 4P7VA 4LQ3A 5L1KA 2ILYA 3DOMB 4N8NA 4YB7A 4K4WA 4ZK7M 4A8YA 3GFHA 3DLKA 2PN6A 4B9SA 4OYWA 2CPDA 2BBEA 1IM4A 1XR6A 4LF8J 4F3OA 2V2ZA 1FRXA 2DH7A 5DRKA 2GVZB 1SJFA 3G6VA 4ZLLA 3D9BA 3FBBA 4I2PB 4U9RA 2CXEA 4FXWA 1UEVA 1MWZA 1S6UA 1SBRA 3H59A 4L3KA 5B0GA 3TQEA 2GJIA 3IGNA 4CLKA 4CNYA 3R1HA 3M9OB 3DRRB 2DHHA 4ED7A 5K14B 3BPDA 2XO6A 4DX8H 3PIOQ 3W2VB 1CSJA 1EARA 2HAIA 3P3DA 2VASA 3MDFA 5KT2A 3KTQA 1SH2A 2FHJD 3Q89A 5DZ7A 4OIXA 1UFWA 2CJAA 1M1GA 4CH0S 1HNVA 5AXMA 2KFYA 2W2PP 3WQPA 4PUOB 4OZNA 2E9ZA 5G0RB 1FERA 1GTEA 3VALA 1IBLJ 2W9BA 2MTLA 1FTRA 1GMUA 4PXBA 1IR1A 1T9UA 3SDEA 1F9EB 1REVA 3T1HF 1SL0A 1PO6A 3MEDB 3N28A 4O44B 3UDEA 4F0MA 3V4IA 4NCAA 2N4CA 1N6QA 2BJ1A 2AHOB 4RUBA 2NPFA 1NKBA 3KG4A 3VHQA 2UV8G 4Y2IA 3FVYA 2YVSA 4DV4F 5T7LA 1RJJA 1R27B 5IC6B 1Z2ZA 3DRSB 4HTIA 3NBPB 4D3GA 4Z7CA 1H3DA 2AYEA 9ATCB 2G1HA 3DRXA 1JLAA 5A6WA 3NGUA 5AJ3F 4F4XA 4GKJF 3F41A 2P9CA 2KKHA 2YKNB 4UZCA 3LP2A 1VQ5S 4UY8T 1QSYA 2GW8A 1RA7A 3PXGa 4DV3J 1LWCB 2F9JA 4H4KA 3GV7B 3LWMA 1JLQA 2FUG9 3D0IE 3EPGA 1J5EF 3PJWA 1WSVA 2R7UA 3OTEA 4DZDA 2C2OB 2JLEA 2AKWB 1BY9A 3CEDA 2CRLA 3G96A 1E6YA 4B3MJ 2MKJA 4NLOA 1JLAB 3GG1A 2DITA 1U47A 5ETOA 4DV1J 3OHAA 1RCOB 4O3RA 2VA3A 3EGVA 1EQMA 1BLUA 4ZPVR 3KLFB 1IR0A 1FDDA 1G4CA 2CKWA 3MPWA 4Q43A 3G9CA 4QYZK 1Q81T 3RUBL 4J9PA 3T5LA 5D0EA 3MWBA 3O6QA 4I7FA 3R9LA 1RBLA 1HYSB 3MAQA 5D0RA 4IOCQ 1S99A 2RUSA 3BBBA 2DBBA 3NEKA 5D0HA 2XY5A 4FF3A 3GTYX 4OI4A 2MJUA 2HNDB 2SXLA 2YNGB 4CLSA 4RNOA 5CZVA 3PYGA 1N0VC 4N5SA 1DTTA 4DV0J 1HQUA 1AUDA 2U1AA 1D8YA 4PWWA 4RW7A 2LECA 4LFCF 4N56A 4I7FB 3MD1A 4F3QA 1VFJA 4F4KA 4YR0A 2DGSA 2OELA 1RTHB 4TU7A 2GO9A 4U7UK 2KRBA 2WB1D 2MMYA 3JYTA 4JI4J 2F8MA 2HAFA 2HIYA 3H5UA 4PQAA 4EO6A 3OJSA 1DTTB 1XMQF 2HZVA 2DKOB 1KWMA 2YNHB 3KXDA 3KLEB 1KLNA 2CQPA 2O67A 4M5JA 5DZ6A 1MROB 3ZTSA 4CLWA 3G71S 3KNGA 2V94A 1RLCL 4FDFA 1D9FA 1TL7B 1W7WA 2ZHBA 3DGPA 5EUHA 3JTNA 2Q1LA 1S0OA 1YSJA 4ZVSB 3ILLA 2NLWA 4LF9J 3QPIA 4HR2A 2IVMA 5D77A 2KO1A 4AT1B 3I55S 4YFUA 3KKFA 2LEPA 1TL1A 4G65A 3VR1A 2M4MA 4WKRA 3X1LB 3BKUA 1HBNA 2FJEB 2JHEA 2CJKA 4WIQA 4L6V3 1L3VA 2WCXA 2J0WA 1QUPA 2GV1A 3QWPA 1M0SA 4DJBA 3G6ES 1WF2A 3D7SB 4DFKA 4LR9A 5GMDA 1CJTA 3OLBA 1RYSA 4ED8A 1L5UA 2J0SD 1BWEA 2AEFA 3MAAB 1HMVA 1TV6A 3BGUA 3GR0A 3I87A 3IBWA 4YDXA 3T9ZA 3W2WB 4DPOA 3OSNA 2KZZA 4R8UA 1HBMB 2DNHA 2FB0A 2OD6A 4TYBA 4B02A 1ZM9A 4O3OA 1BQXA 5HROB 1XN9A 2AW0A 4K7QA 4RU9A 1BHNA 1S6QA 2LXIA 3CJ8A 1S9EB 1T9YA 2XYGB 3PJXA 1YDLA 1MMDA 5KG0A 2HMIB 2YNIA 3KUEA 2ASDA 1N33J 5LXYA 1WOOA 1UZDA 2KN4A 5B0CA 1UPPA 2FC8A 3QWUA 3VQTA 4A8OA 5HO4A 1UZHA 2HURA 1IQTA 1S6PB 1ACMB 3AA8A 5LMUF 1C0TA 3AB4B 1LW2A 4QR1A 4X4OA 3J80Y 1YJVA 3PHEA 3OPKA 3TUPA 4AL7A 1FI4A 1VQ6S 1FDNA 1WI6A 2COLA 4DV2J 2XO7A 2XCAA 1XBWA 3C14B 4G1IA 1YJWS 3PO5A 3J7A1 2XHWA 4IO1A 1GMWA 3OXLA 4RU2A 2QLFB 2ZH1A 3OFHA 3PV8A 1YJTA 4K4VA 5B09A 2C42A 3BZQA 5KG1A 4KJIA 1B0VA 1RT1B 2WSCC 2ROGA 2ZNYA 3BO2A 1RT5B 3HKZD 3B8HA 3SIPB 4DPTA 4WKYA 1RP5A 3HP6A 8AT1B 5LMNF 2PT0A 1SH0A 1DY3A 2DGTA 4ZLJA 2GCFA 4IQXA 1IBMJ 4ICLA 4WP8A 1S1TB 2YWWA 1QTNB 2EC2A 2W01A 1VGYA 2AZ3A 2BJEA 2N7CA 3ONQA 2A18A 4O4GA 1UVNA 1T05B 4B9TA 2UXBF 1WHWA 1BD6A 1DRZA 1HNIB 1CJKB 1FNMA 2FJXA 3LUYA 4ZVQB 5DS7A 1N34F 4TLRA 1SB6A 2D3ZA 2MSSA 3BYPA 5T41A 1EKRA 2V34A 5D0GA 2B7CB 4CYUA 5L46A 1ZPVA 5DJBA 4UOHA 3NWGA 5J2NA 4ETZA 3SCKE 2Y8WA 3G86A 3TX0A 3PZPA 2R8IA 2PC6A 2IJRA 2Y1RI 5ADZA 4TXSA 2EVZA 2DR7A 1FXLA 4FF1A 1EQ0A 1BQMA 2MGZB 3PRBA 1K73T 4OZ2A 3GU0A 1H72C 1FJEB 2ZBPA 2IRUA 4YN3B 3WHIA 1B99A 5KFCA 2KDOA 3B82A 1CJUB 1AXQA 2A10A 2WVEA 1URNA 3KNAA 1DTQB 3C15B 3MTKA 3ETOA 4AL6A 4FYDA 4NA1A 3JSMA 4RW9B 5HATA 2NXCA 4AYBD 3C6UA 2YKQA 2KVIA 1S59A 3I0SA 5KG2A 5F3TA 4LF6F 3NKYA 3UN2A 5I3UA 1RT3B 3MEGA 4Q0BB 1UW4A 1SUQB 4IG0B 4J9LA 2IVYA 3AXMA 1QUVA 2E5IA 3M32A 4DR5F 2V2KA 3RBZA 1HNXF 4FXDA 2R4FA 3EMTA 2B51A 1NAQA 1HWIA 2V6AA 3K89A 4RPFA 4A8WA 2B5JA 3QAUA 4QIWD 3U27A 3VAFA 1B3TA 4KIAA 5LJ5Y 4S0MA 2OSRA 4J9UE 3CCVS 1NDCA 1X4GA 2P9EA 3CO9A 2VUGA 4CI0B 5EDWA 2WK4A 4HH1A 1IVZA 1I94J 3HD1A 3BS9A 4NLYA 3MZIA 3PTWA 3SCIE 1RT2A 2GIRA 3IR5B 4ZP6A 5A6PA 4C98A 3RG6A 4M63A 3VGVA 1T9XA 4U7CA 1EP4B 3Q2SC 3BSNA 4NXMJ 4X4QA 3JAMU 3MCNA 4Y3CA 3LP1A 4YQWA 2ZH8A 4DR1J 1OJ4A 2QGFB 1FVQA 4PG5A 2VQEF 1RWNB 3OD2A 4LT6A 4ZPDA 5C24B 2B9XA 4JI3J 2XZTB 3MCSA 2KHCA 4C48A 2I5JB 5KFPA 1IBMF 1D9DA 1YITS 2AEJA 3FQLA 1RAAB 5IT4A 1Y3JA 1RWVB 3BR9A 2MKSA 1FEEA 4MK8A 4QWDA 1ELOA 3BDEA 2W8LA 5D3GB 3TYTA 1FRLA 1VBYA 4GVBB 2ZZNA 3NOCA 2OIHA 2CPEA 2CPIA 1FKAF 1VQKS 1GQEA 4OZ3A 3DXBA 2NPIA 1V3SA 2A2CA 5KFEA 4HHUA 3DLGA 5K5MA 4TNOA 4DR6F 1NUEA 2OH2A 3BN7A 4CH7A 1D09B 4DQPA 1FX2A 4KSEB 1W25A 2VHGA 2FJVA 3I32A 4DV7J 3D2WA 4NXNJ 4KB7A 4UQTA 2HFZA 2XMJA 3D1OA 4DV3F 3KJVA 4PYAA 4MIBA 2HFOA 2P5VA 3P6YC 1VCTA 1YZ7A 3C66A 4ILRA 4Y2MA 2ZD1B 1D3WA 3Q86A 3I5AA 4OHWA 1DURA 5AE1A 2RDJA 3PX4A 3PX6A 1GTHA 2XZWA 2OPRA 2IFXA 1OPZA 2UXCF 4ZPAA 4DCOB 2JZ5A 4XIUA 5JMNA 2QIFA 3I96A 4ZOSA 4N76A 5GADU 4E2FB 1FFWB 2MQ8A 3FFIA 4MKBA 2RSQA 3TARA 1AW0A 2MEWA 2CZ9A 2XBPA 3L7PA 1AT1B 1WORA 1X9WA 1T03A 4X4RA 2DVIA 2Q66A 2W9BB 2QLXA 2IM2A 4QIVA 5KG6A 2CWXA 3AODA 4LF7F 2YQ1A 1F5AA 2RT3A 1UVLA 3T5HA 3FGVA 3TAPA 1RHQB 5HJXA 4ERDA 2MZ1A 4GKKF 2H54B 2DISA 1QVGR 1FWPA 1HBOB 5KFVA 4ZP7A 4NRUA 4EWTA 2I1RA 2J9EA 3CJSA 5BR8J 1U2CA 1N32F 1EIYB 2BKOA 4BC9A 1ZAVA 1ZTTA 2KJVA 3BGLA 5FLXU 3M8YA 3R1LA 2OAUA 2HS4A 1Q95G 2CJBA 5F8IA 1Y5IB 1O5JA 2W7PA 4DSKA 2IY5B 4C3MA 3CIMA 4ZPCA 5A8WA 3BF4A 5EGYA 1HA1A 4X4TA 4ECTA 2BMBA 2CPYA 2KYZA 3O8WA 3M2VB 3TUJC 3UVJA 5C2GA 1RZMA 1IR2A 3RAXA 1UW9A 2GJ2A 3CF5Q 2AF6A 2UVVA 4Q2LA 2GIFA 1N32J 2UV8A 3Q2TC 4C8ZA 2K1RB 5L1LA 4DUZJ 1REVB 2XHCA 3VZIA 5D4OA 4ECRA 4ELUA 1EETB 3J7YI 2Y0BB 1B7YB 2CJQA 3CTRA 2W24A 3AFGA 3GFZA 4IQMA 5HQLA 4CWBA 1UPMB 3MR6A 3SSSA 2AU0A 4JI7F 1WD6A 3GZ7A 1KQFB 5KT5A 3KJNB 4GRSA 2OPQB 3LH2S 3BKTA 4LF2A 2GS8A 3OTOF 1X4DA 4CNZA 3VAMA 5MLCV 1X60A 1NK6A 3R97A 1R0BG 1TVRA 2L9WA 1U02A 4P74A 4IFYA 1RWWB 3VF0B 3W5YA 3MR3A 2BM1A 4X65J 1YI2S 2CVIA 2EI5A 4M5IA 3EPIA 1IKWB 5HANA 1HQUB 3CMES 2XS2A 1Z4UA 2GNKA 1V9OA 4UUXA 3RU0A 1ZM2A 1BQMB 2B9WA 4RUAA 2R2UA 4PCQA 1Q8LA 4FKYA 3WZ0A 5IT9U 2FHJA 2HNYA 3WDOA 1GMVA 1MU2A 3QSYB 1S97A 3PEJA 2WTFA 3IGVA 2LCWA 1ULRA 5B0DA 4PXDA 3NGSA 5B08A 2R7WA 2VONA 4RW9A 3IRXB 1VR6A 2DHGA 2FJBB 3RR8A 3KLFA 2KT3A 4K5SA 4EYHB 3HJFA 3T41A 4LSZB 3EICA 4NWBA 4OYAA 2HPUA 1RDRA 1S1XA 2M8HA 5IZHA 3AQOA 5DQHA 5KFJA 4E98A 1DFDA 3TP2A 2D9PA 4BWJA 4Y34A 2I5JA 4EK2A 2X1FA 3H2LA 2XMMA 3HHLA 1WG4A 4OYPA 2QEXS 4DR2J 1O51A 2J7KA 4O3PA 2E44A 1S76D 3GV5B 2R2SA 2QZ8A 1CS4B 1PBUA 2E5HA 4JV5F 4M95A 3ILOA 3TUZC 2HFVA 1DJ0A 3ULHA 3DYAA 3BEGB 3IM9A 3SZ2A 3FSYA 3BJYA 2CQGA 2RIJA 2V8DA 4WFYA 4CIOA 1L3KA 1RT2B 4WFZA 5C25B 4HACA 2ZHAA 4RR5A 3GE9A 4HVZA 2KHDA 4MKAA 2OMOA 3U1NA 5L9NA 3Q0AA 1FA0A 4WF9Q 4X4NA 4USHA 2WOMA 4FPIA 1LWXA 1X8DA 7FDRA 4W98A 4GC6A 4OI1A 2V9WA 2KTQA 2ZHOA 4K4ZA 1FWLA 1U0SA 3CVKA 2XM3A 1Y5LB 1P1TA 1KBRA 2XMUA 4WJBA 2B56A 1N54B 2PA8D 3FBCA 3V4MA 1WEYA 2WRMA 1FRJA 5A8RB 4ENOA 3M9NB 4G3IA 3DOKB 1GXTA 1NSAA 2C2RA 2AQ4A 4IRKA 3E3XA 4RO0A 3P49B 2HK2A 4BS2A 2W2QP 4FZVA 1H7WA 1VQ4S 2IJNA 3UE2A 3B6BA 3JSRA 4OFZA 3M9MB 1OY6A 1OY8A 3NCPA 3EUNA 2OEMA 1IWGA 1S72S 3IC1A 4ILMA 3M1VA 4NLWA 4Y65A 5ETQA 1RT6A 3GCXP 4ES2A 4FVMA 1YJ9S 1NXIA 1HMVB 1TV6B 4DR3J 2AV5A 1LV5A 1DLOB 4O23A 2V63A 2CDRB 2G2ZA 1IKXB 4G1PA 5HL7Q 1HBMA 1FRIA 3H20A 1DAXA 3QGIA 1RGVA 5F8LA 1NSKL 4I2QB 2EFQA 4PAAA 3ZZPA 2B0GA 5HMXA 4U67Q 3OL6A 4U7UD 3DDNA 2RRNA 1IKVA 1M5OC 2VU5A 5GAGU 1G7CB 2C22A 1R8HA 2HQIA 2J6TA 3GJQB 2LMIA 4H4MB 2RMLA 2XWXA 3ILJA 1T02A 4OHVA 3UFCX 2NXEA 3KFWX 2F4VF 3LP0A 1S9FA 2GVZA 1JNRB 1Q4RA 2CNOB 4OJHA 1TL3B 3LO3A 4CT8A 3OL7A 3ZFVA 2EWHA 1UWBB 4I64A 1JIHA 3MF5A 1MW7A 3KLGB 1NK9A 3GIIA 2G2OA 1PJ7A 3GIMA 1HNWJ 2RS8A 4RNFA 4EUVA 3PHTA 4WP3A 1RK8A 2H5IB 2WSEC 3V6HA 1GNKA 4Q7AA 5B0FA 2RE1A 2B4VA 1YJRA 3M6VA 2KI2A 4O0NA 4RX6A 5KFMA 4GC7A 2UVWA 2VD3A 1YK9A 2QTWA 3DU5A 1X4AA 1N56A 2FJAB 2X1BA 3A3PB 1RXOB 5LMNJ 1VRUB 4HHJA 1JQGA 4Q44A 2YXLA 4J9MA 1WKKA 3Q24A 1X0PA 2BOPA 1JXEA 2AJFE 3BBCA 2LU2A 3J7YU 4X4UA 3OVSA 3AJDA 2CIMA 1UFLA 2OI2A 1VBZA 2EC0A 4ZCKA 4EMDA 2CAJA 3AA9A 2V68A 3E01A 2ZH4A 2YH1A 3M2RA 1YJUA 3CMAS 3GIKA 3GQCA 4ZIVA 2I9SA 5JUMA 2FQQB 4CQ1A 3W1YC 3W66A 1Y00A 2JEJA 4LF4J 1WKJA 4DF4A 3HHKA 4DX5A 5E41A 2KH9A 1CBKA 3MFIA 3KOAA 2DNQA 4JI0J 5HJYA 3E8OA 3Q8QB 4RW6B 2OMLA 2RKIB 2J8SA 3TA1A 3UWTA 4ATNA 1WHYA 4DDFA 4UQGA 4W4MA 1BMQB 2RDDA 4EFAC 1F6TA 4NYOA 3CJKA 1MSWD 4DLGA 3BDPA 1C1BB 2NCKL 3NCRA 2DT9A 5K8PA 4A47A 2GHVC 1HQEB 2IM3A 5AE3A 2UU9J 1Y5NB 4NLPA 1RTDA 1RU1A 3IG1A 2GMJA 3D68A 3H2VE 3T5JA 1SJ3P 2K3IA 3UR0A 6FDRA 5K8NA 3T1AA 1WDTA 1OYEA 3DGPB 4K2XA 2H9ZA 3MEDA 2HNYB 3VVUA 4NXNF 4PXCA 1R8AA 3CJKB 3SXLA 2O66A 4DV7F 1NKEA 3NMAA 4NL5A 1TMJA 3I5CA 3PDNA 1R6VA 4YEAA 3K5OA 2ZUGA 4LSLA 3DXSX 2G1DA 4R5PB 4M5DA 1MN9A 4H4KC 1S12A 2A6MA 2DRDA 2FZGB 4P2MA 1ZETA 1WI8A 2HHSA 3US5A 4M5HA 4XK8C 1LWFA 1SXLA 3V81A 2H1YA 2CDQA 1FEHA 1YLXA 1U8WA 2LA6A 3D1QA 4DN9A 2HBYB 3M6UA 4FVCA 4HL9A 1RQ0A 2YKPA 5K14A 5LJ3Y 4CM2A 1UMJA 4WK3A 4CLUA 1OIAA 3MOZA 4URQU 5L8RC 1CEZA 2LQJA 4P9SA 5A76A 1RHMB 3M4XA 2M7SA 3IMQJ 4DZ6A 2OSQA 6AT1B 2VJVA 1T11A 2BW7A 3T9NA 2LLZA 1GFWB 3UW1A 3PKMA 1FKOA 3H0PA 1ZA1B 3L3CA 2F65A 2XI3A 4YP3A 2J0XA 3ISND 3SDEB 4JV2A 2BQ3A 1RTJB 1SJRA 4YS2A 4HYKA 3R6LB 4QR2A 2OPRB 4ELTA 1VIOA 2R9LA 3QRPA 3OSPA 3KG1A 4I6AA 1KD1T 5E3RA 1WC4A 2G0CA 2ZBRA 3D0HE 3HHLD 4ID8A 4CLTA 2QFJA 1VQ8S 4DV0F 4WXOA 3K17A 4HDGA 2D9OA 3ILIA 1GT8A 4KFBB 4FS1A 4Z7YA 3EZ5A 1TFWA 2E66A 2J6UA 3A1YG 3J7AN 5J1NA 2HQFA 1X5SA 3HULA 3OFFA 4WFBQ 3W2WA 4Q8FA 2FHOB 1FO1A 2W4CA 5I42B 2MQNA 2UUBF 3DLHA 1WC5A 4C9DA 1HLWA 4IG3A 4PPDA 2VQFF 4RNMA 2IA6A 4K0KF 2BKPA 1K1SA 2F40A 2RF2B 2MY8A 2MQLA 1U45A 2QT7A 3O3LA 3W65A 4ED3A 1N36F 2ZD1A 3KLIA 5KFZA 4MKYA 2RU9A 3MPYA 3D67A 1MMLA 1U1OA 2R7SA 1T95A 3G87A 1NRKA 3BGOP 4ZVRB 1JK9B 2CNKB 5M2PA 2VJUA 1Q86T 3IM8A 3KLGA 4ZHRB 3H4DA 3NG8A 5E3CA 1V5VA 2GX8A 2ZOGA 2WAQD 3VGUA 3FBFA 5C24A 4Z2XA 5BXIA 1N5VA 1OO0B 2IHR1 3BSAA 4LRDA 4GKKJ 3FKBA 3R7BB 2W8KA 4X4PA 2ZKTA 3UO0A 1T8EA 3PYDA 4W92B 2LDYA 2X1GA 2DXEA 2DCUB 1Y11A 2RQKA 3LTOA 3QT7A 5U47A 3WX4A 2KFNA 3HM9A 3VVTA 5E33A 5E2QA 1FFGB 1TKZA 4WBFA 4B3SF 4HKQA 5CHCB 2K7JA 2N3OA 1N34J 4EZ6A 3ZZ0A 5FJ4A 1HPZA 4A8SA 1AUSL 4HTJA 5BYQA 3GILA 3DLEA 4EGLA 3HD2A 1FFSB 2EXUA 3AD8C 4J7CA 5GVQA 2LXFA 4MK9A 2YWEA 3PFOA 4F2RA 1ZZFA 2MLYA 4BLGA 1C1CA 1GEHA 1NHUA 2NUUG 3CB4A 4XPCA 4UOCA 4TU9A 3G6YA 1IKWA 1PILA 3THPA 5LSOA 1AA1B 2CQ0A 2Z8QA 5DETA 2DNPA 2MKHA 3MCOA 2D3OR 2MLZA 3K59A 3L7UA 1WTBA 1AZSB 3QT8A 3PX0A 3NLCA 3R2DJ 2YX4A 2UU9F 2ZWOA 2NZ4A 3GP9A 1BQNA 3NBPA 3MM7A 4LR7A 1LWEB 4ZVEA 1RT4A 1C1CB 2H48B 4FNIA 4KO0A 3CULA 4CO3A 1KDNA 2B5JB 1VQ9S 1RAOA 2A2DA 2VKRA 3W60A 4PKDB 1WEXA 1R43A 4DPWA 2K3KA 4GO5X 4JI5J 3VZHA 3HFVA 3U02A 4JP8A 2DR9A 4B9VA 1ZH5A 2L9NA 1U24A 4C8YA 1NLKL 1IBLF 1FKPB 1S1UB 1SJ1A 1WUUA 2M0GB 3ENVA 2ZEJA 5DG8A 5LMUJ 4JI7J 1UCNA 4LSLB 3NNHA 1JKHA 5M2UA 2VDIA 1TK8A 2XC9A 3HHLC 4NXMF 3EVOA 3KDNA 2BDPA 1ZTWA 2P9GA 4J9RA 1T9WA 4J9VA 2F8EX 4PR6A 1PSDA 4JI8F 4QR0A 2KJWA 1C0TB 4OJ1A 2ZDOA 1JWWA 3M7VA 1G1XA 1N36J 5JVHQ 1VQPS 4LBIA 1U7LA 4XDCA 2VOOA 1SCJB 2WVBA 1HQEA 3JSBA 1LFWA 5JVGQ 3MI7X 4ZP8A 1ZYQA 4N41A 3NCQA 1CC8A 3ZZYA 4X62J 1FNOA 4LR8A 3IG1B 2LP4A 3V6KA 4DG1B 2OPPA 1LK7A 1VQMS 3L4BC 5LSRA 2J0QD 2HLUA 3J7Z5 2VBWA 3DRRA 1RU2A 4DL0C 4TY9A 4N8OA 3VCDA 2BW2A 2D3UA 3A8EA 3MM6A 3THTA 4ZVGA 1NJXA 2OD4A 4KGZB 4N7TA 2KG1A 2MGZA 2BQRA 3FUYA 4LF1A 4NLSA 2E1MC 2LYVA 4WK1A 4ECQA 2XZDB 2ADCA 3M6XA 4CCHA 1S1VB 3MOJB 5HMWA 2R42A 4LJMA 3D0GE 3KMSA 2YWFA 4AL5A 4OX9F 4JI2J 3P45B 3JSMB 1DQ9A 1M1HA 3FCHA 4L74A 1HD1A 2G2YA 3QLHA 1S57A 2OFHX 4KGVB 1RHRB 2V8HA 3GLJA 4WCEQ 1I1GA 1WC3A 1F2GA 1YBUA 3H42A 3AB2B 3BGRB 3W8PA 1M1KT 2X3DA 3I9ZA 4N47A 1VJWA 1UVKA 4QPTA 4DFMA 4OHZA 2J76E 1NHVA 1U1KA 5BYSA 4OYOA 2ZH9A 1RAEB 1WKLA 2V5HG 4RNHA 3K57A 2LEBA 3CDWA 2FLNA 2DNOA 5HLFB 4KHMA 3N4WA 1C2PA 4NLUA 4QIEA 4C11A 5L1IA 4DR3F 2BJ3A 4C8LA 1TUGB 2ROEA 2Y3YA 3S8SA 1WTFA 2F7VA 2Z0GA 4FP9A 2M2BA 5KFGA 1SVDA 1H0HB 2QMUB 3GIJA 5A0YA 3PO4A 1S0VA 5F9NA 4USKA 1OY9A 3PR4A 2U2FA 4K8RA 1CJUA 3GONA 4CP5A 4OLOA 1SQGA 3BSOA 2E5LF 2YNIB 5KFFA 3MD3A 3N6LA 2BE7D 1X7VA 4L73A 1C0UB 2DHSA 5ETPA 3S1TA 1JLGA 2CNLB 2L48A 1HWUA 1K9MT 3P5TL 1CS4A 2XMWA 1DLOA 4LBPA 3T3FA 4QOTA 3SI8A 1M5KC 1IN0A 2H65B 4ZPBA 3RB4A 5KFDA 3CCMS 1HYSA 2CPFA 1J5EJ 3PJ9A 2FJDB 3R5BA 4IG0A 4JBCA 4KE5A 4U95A 2R8HA 4DS5A 1OSDA 1NJZA 2DNGA 5HVFA 4X66J 3RAQA 2AGPA 2CWKA 4ID5A 4Z37A 1GX5A 1CJVB 1RAIB 3O1LA 2MQMA 3ZZTA 3K5NA 3JTPA 1VC6A 2RHSB 1N8RT 2QSWA 4ETXA 5HQMA 3S01A 2E5LJ 1I3OB 2C2MB 1WC0A 3OV7A 1KN6A 2HS3A 2AJ1A 1HW8A 2HRYA 3HHNB 2WSFC 8RUCA 1UEKA 3QYYA 2HRTA 3U7JA 1N5SA 1CVJA 3RB6A 3ITHA 1Q5VA 2FVRA 1Q5YA 2DYAA 2I2YA 5E3QA 3MAAA 2CYYA 2LQBA 4CLLA 1QSLA 2P2CB 2Z2LA 1HHSA 1JLCB 2V9KA 3WBZA 1NMEB 3VAKA 4WP9A 3CJ5A 2Z57B 4WYLA 4YDDB 3T1HJ 1NK7A 4Q8EA 1P27B 3M8PB 2EG1A 4A8KA 4P72A 4OI0A 4UUWA 2ZNZA 3KDOA 2ZJQQ 2DO4A 3W62A 2HHUA 1HPZB 2HVDA 2FGCA 2V8PA 1U6BA 4NZ7A 2NYHA 4KAIA 3G6XA 4ZIWA 1HD0A 5FDLA 5L39A 3CCSS 1R8PA 3TEGA 4ANEA 1TK5A 4KY3A 2JFKA 1RACB 2J8AA 3BB5A 4ECSA 1HNZF 3BQ1A 2L9DA 3AH6A 3EZUA 3G8QA 3TVZA 2AD9A 4NA3A 4F26A 1SL1A 1K8AT 3NY0A 4B9MA 2DH9A 1GMWD 3D3CJ 4PXEA 1HL6A 3WIVA 2X3GA 3SV3A 3A13A 1KVKA 2A0FB 2G0JA 2C2NA 4F25A 4ZMMA 2RQCA 3BQ2A 3TJAA 1U48A 3SCJE 4C8KA 2BJ7A 3LPEA 5FDLB 3E01B 4H4MA 4ZJQA 2KU7A 3FK4A 2XCPA 3LQVA 4L3NA 4QWCA 1S48A 3EJMA 4DI6A 5F8JA 4CT9A 2R2TA 1S10A 4QZVB 4OYZA 4J9KA 2K8GA 3IAS9 1A9NB 3W9JA 2XYHB 2DIUA 4MIAA 2DHAA 1NK5A 1FD8A 1NM2A 3MFHA 3K5PA 3JSYA 1J5OA 3EE3A 3EGZA 1YGYA 5IXUA 3MUMP 1NB7A 2QE5A 1A6LA 2RKIA 3UDLA 4X4SA 5EX0A 3I9V9 3HXMA 4NLTA 3EYZA 1HQ2A 1S1WB 2MPUA 2PEBA 3HLUA 4RBUA 5D4LA 2WZ1A 5H9EJ 1VHIA 4DL2A 4RBVA 5IWAJ 4U8VA 2FGOA 2ASYA 3ZO7A 2B8PA 2QO3A 4CO0A 4USMA 3PEHA 5H9FJ 5HVGA 3FEZA 2HQ3A 3I6PA 1HBUA 4O3SA 1TFYA 2PI4A 2Z2YB 3BPSP 4UY85 3SFUA 3VAIA 3EVMA 2LFVA 2LEAA 1X4BA 2MKCA 3W9HA 2QYGA 4DPUA 3I56S 5IM0B 1X9MA 2CQIA 2POKA 1JLFB 2NZCA 2YPYA 5E0OA 5CCLA 1VYAA 5CYMA 1XC9A 1B7FA 1F60B 5T14A 5JXSA 1JLQB 2M52A 3FRZA 5I3QA 1HARA 3RB0A 2QJ3A 4LVNP 4V1Ak 4DL7A 3H25A 3OW2R 3PRDA 5G0RA 5F3ZA 2OEJA 3CCLS 2OPPB 2R7VA 2ZH6A 1PYSB 4OLPA 2F9DA 1RB0A 5C25A 3KK1A 1NU4A 3C6UB 2WONB 2X1AA 2N3LA 4KKOA 2XLJA 2E7WA 3FCWA 1IWAA 1T3NA 1H38A 3OL9A 3QJLA 5CH7B 2GA7A 1FRMA 3GPAA 4J9OA 4AQYF 1SL2A 1FDBA 4QU7A 3A8JA 2RD5C 3HSDA 4DSFA 3PVXA 2CVEA 1ZPWX 1NDKA 2RB7A 3QSIA 4RW6A 4I67A 1SUQA 2UUCJ 2GIQA 3HO1A 3CT9A 4M5MA 3EVWA 2Q3PA 2VB6A 2Q6CA 4ZS6A 4C0HA 2YKNA 1C0UA 4M1KA 1XNRF 1Q7YT 5KG7A 3C19A 3I5BA 4KKOB 1SJQA 2M70A 1VOMA 4JI6F 5A8KB 2FVSA 3DLBA 2FPHX 2L3MA 1R7IA 4FXVA 5KOWA 1S1XB 3HT3A 2MZQA 3LGNA 1UAWA 1NK8A 2LQ9A 4B3TF 1KTVA 4ED6A 2UUCF 1KRPA 4F3MA 4GMKA 2CPJA 4MT1A 3RW6A 2QG9B 2HVHA 2HIQA 4YHHJ 3GG0A 3EWGA 5DDQC 1PC5A 4USTA 2UXDF 3I0SB 4USIA 5THWA 2R7OA 2R8KA 3V6DB 4MMOA 4LFBF 2ZZTA 1F9HA 2CZVC 5ETNA 4ZITA 2GMHA 2VG5B 2XWYA 3OR2B 4DS4A 3CD6S 1ZM4A 4P52A 2FVPA 4HACB 4ZN3A 2NS1B 4X4VA 2ROPA 2UUAF 2R7XA 1IM6A 3FC9A 3HCXA 2I8EA 1Z1ZA 4OI6A 3RRHA 3BSCA 1EJ7L 1H2TZ 2BE2B 2HEKA 3UCZP 4OHYA 1JJCB 2FY8A 3HVWA 3FCVA 3PFEA 1BXNA 4EZ9A 3CC2S 2D41A 2Z56B 3M2UA 5HSPA 5F8GA 4DSEA 2MHNA 1UVMA 4P75A 1CG2A 3AQPA 3PW5A 3DLGB 1JX4A 2E1PA 5HQ8A 4ECYA 1Q0NA 1DHMA 1MNEA 1OQ6A 4DR1F 1XIQA 2V67A 2D74B 4DV5J 1WOSA 4PZVA 5DGAA 4KPYA 3FZBA 3F56A 3JYTB 4ZKAA 2VG7A 2GGPA 2F63A 1RT4B 2FZKB 3KWMA 4LRBA 3SMZA 3H40A 2OJ3A 4I56A 2NXJA 4KT0C 1S7IA 2DR8A 2DNNA 3CNQP 1FK9A 2CQCA 3SQGB 2W9CB 1T94A 1S6OA 4RKUC 2E1CA 4GO7X 1SV5A 2MZSA 3JQKA 3T6JA 5IT9Y 2ZBIA 2AIRB 3DM2B 3ZNUA 4I1TA 1GAOA 1RLDA 3W9IA 4FF2A 3O5TB 4U6PA 1W2IA 4CLPA 4CLFA 2GHPA 5IFMA 4DL4A 2HNZB 4MYUA 2W2NP 1SKSA 2HHWA 2QRRA 5E3AA 1QDUB 1W2BR 2V69A 1RWOB 5A2QY 1KC8T 4KHPJ 1RKJA 2NYIA 2V2QA 5ETKA 5HBMA 5KG3A 1WF0A 3N6NA 1U1QA 1X5TA 2VC0A 2BZ2A 2MQQA 5LSLA 1F2HA 5HN0A 1HR0F 2MB0B 2V8GA 1PJ5A 2MZTA 1FJGF 3W2VA 2ZJRQ 2WVCA 2EKNA 2VPZB 3QNWB 2HNZA 1YRXA 1RE1B 3HVTA 3SBMA 1NJIT 2JVRA 1VK3A 4NZ0A 3KLHB 4FBTA 1RABB 2YTCA 3LGMA 2HS0A 2RQ4A 4A8FA 3V2UC 4JI1J 5F8MA 4CTAB 1FT8A 4ZA1A 1PBAA 2XGPA 1VQYA 1XK8A 2YY3A 1S4FA 4QIFA 3FMWA 4YHHF 2F1FA 4LBHA 4DV4J 5HI7A 1FKPA 1S1UA 2ZDPA 3UR3C 4JUZA 3GV8B 2B4UA 2OP5A 4YB1P 4F67A 2KG0A 1FJ7A 3BH6B 5C2CA 1IBKF 1KHWA 1TR0A 1ZAXA 4CZCA 3MUVP 1LXNA 1RHUB 1UFKA 2EBEA 3GJTB 5CA5A 2FY1A 4Q45A 1B0TA 1JLEB 4EBCA 4TU8A 1XNRJ 3CDEA 2B4OA 1TMMA 1HI0P 3H4BA 3DRPB 4HT5A 1EKSA 3A12A 2V2VA 4F0KA 1KS2A 1NNDA 5F9LA 5DDOC 2M8DB 3W3SA 4EU0A 3UCUP 3QZ8A 2DGWA 3BGRA 3I4HX 4PUOA 1AZSA 3R5GA 3C2PA 1FE4A 1RT7A 2BABA 1OQ3A 2AX1A 4KFBA 4KQZA 3F44A 2CPHA 3DC2A 1LWFB 3M6WA 3PCOB 2MQOA 2KYXA 2R8JA 1WG5A 4LF4F 5EWEA 4MFBA 2HHVA 3CD7A 4OYIA 1XMBA 1XR7A 4EEYA 2W1BA 3RRKA 3GJSB 3N6MA 4C11B 5GAHI 2HHHF 1B4SA 1GXLA 2PD1A 3DRPA 2QMWA 3IXQA 4L75A 4NLDA 1N48A 2V8VA 4F36A 3MHYA 3RBEA 4YMEA 4N77A 4NI2B 4JYAJ 3G4SS 2P6SA 3W5XA 2C2DA 1WHVA 2V4JA 4WXWA 3Q8SB 2ALZA 1GH8A 5CD4H 3M32B 4DV2F 4XPEA 1RWPB 5FLXY 1Q78A 3SV4A 3FBEA 4MFBB 1VQ7S 4W90B 2VZ9A 4LRFA 1AYEA 2JJ4D 3IAM9 1YBTA 3KK1B 3H5YA 3QLHB 1JKHB 4DV6F 1M5SA 4ZVHA 3G8TA 1XNQJ 2D7SA 2Z2MA 1KLMA 2ZH2A 3V6DA 2DNLA 3MMAB 3R5AA 2NSBA 4WE1A 5CYQB 3CCQS 1NK4A 2ASJA 3VWSA 1EAYC 4KH1B 3LAMA 4QWEA 4J9NA 4KR0B 4TVAB 2W4PA 3CSKA 2BJ9A 4KHPF 3M1VB 3DNCA 3TJ8A 2HQDA 1EP4A 3R3TA 2QN6B 3TRGA 4EO8A 2JLGA 1PIEA 2HBZB 2YH0A 2HBRB 4C6AA 1N5YA 4FYXB 4ALZA 2FLOA 1TKZB 4ES1A 4PG4A 4QW9A 2GO8A 2AJ2A 1QE1A 1URRA 1Q53A 2CQ1A 3SSQA 1NDPA 1TTHB 4LRAA 5GAEU 1VI7A 4O0IA 3BYRA 2ZH5A 2ZH7A 5F8HA 4OYBA 5IV4A 2FVQA 4I69A 3C46A 5AT1B 2FYXA 3J81j 1FVSA 3RBDA 1XQIA 1IJFB 2HHTA 3PACA 1TUWA 4ZVTB 1B64A 4D3HA 5EHHA 5DG9A 1UEUA 4NYZA 4LF9F 2IBKA 1FKOB 4ES3A 2IIHA 2LDIA 1PGZA 4RW8A 2YNFA 3A3OB 4LF5F 4ECWA 5DDPC 3R7NB 1MWQA 1NHKL 2AX0A 3KYLA 1ZM3A 3MPUB 3DLJA 2ACYA 2FDNA 1TKTA 5KFBA 2FLLA 3ZTPA 2BE2A 2KFZA 2W9AA 2HFSA 3VAGA 3MM8B 4OX7A 4QPXA 4WZQA 1DBDA 1CULA 3BGFA 5ETRA 2VA2A 2X51A 2AT1B 2H5EA 3PM9A 4Y00A 1IUJA 3NGRA 1SQFA 2HMIA 4ZP9A 2RJZA 2BJ8A 4ECZA 4DR4J 2CJYB 3IBFB 4AXJA 5HLFA 4ILLA 4AFFA 1WELA 1XTZA 4KV8B 2ZE2B 1CQMA 3D1HA 4KC5A 2PMHA 2ZITA 3FEYB 3LGHA 3VGTA 4ZLPA 1KSPA 1JJHA 3K58A 2XEXA 3W64A 1AROP 4IKAA 3PW4A 3D4JA 3LW5C 4IDKA 2QA4G 1VC0A 2Y1LB 2ZM6F 1NPPA 2MJNA 1RTJA 2B8QA 4G1QA 5A2QU 1JLBB 2V4QA 1X9SA 1NJYA 1O0PA 1P8GA 2GC8A 1S49A 2JDJA 2ZE2A 1YWXA 2HFNA 3MM9B 4P2FA 2UXCJ 2BV3A 4OYMA 3TR5A 3EXCX 4X66F 4B3MF 4OJ3A 1FX4A 3A8KA 1TL3A 2XS5A 4JV5J 1NPKA 1EB0A 1HWJA 1G3OA 1JJ4A 3ZZUA 2YQ3A 1X4EA 3K8WA 3LWLA 1H2VZ 1P9QC 4I4BA 2CQ4A 2B9YA 2PEHA 3ET6A 3QIDA 1UJ6A 4OQJA 4RUCA 4AQYJ 5DLFA 3QBCA 1Y9OA 1LKZA 5AJ3J 2AGQA 2R8GA 5DO2A 2VIHA 2E29A 2BR0A 1HNIA 2PGCA 2Y0SD 1S0MA 2OTJS 2YWHA 3C14A 4KTQA 5KT4A 3JTOA 2IYIA 2F4FA 4XDDA 3H5SA 4Y2CA 4F4ZA 2ERRA 2Y9HA 5AXNA 3P4UB 4ZVPB 4H4OA 3VAJA
chains in the Genus database with same CATH topology
1JMTA 1U25A 2AJQA 2LQ5A 2N7YA 3LP2B 2BANB 1KR4A 2VG6B 3E51A 4TQRA 1KTQA 2A1BA 4OMFG 1ZZNA 1U4BA 2B3TB 5DM7Q 1FNXH 2PMZD 3OHBA 1TL4A 2OPSB 1YG0A 3B4MA 3OBIA 3CD0A 3TUIC 4OZ1A 5BJRA 1YVFA 4X65F 3TAQA 2Z4PA 1E6YB 1LOUA 2MZRA 1VQOS 4RUHA 2KB2A 3IS9B 3DHWC 4A4JA 4B3OB 4O44A 2XB2D 4WFAQ 3V4IB 3MM6B 1JNZB 3BR8A 1HHTP 3NMRA 1U09A 4X64F 3JB9k 4WZMA 4WYWA 2DRBA 3MEGB 4DN0A 5IQQA 2ZC4A 3DRSA 5KTQA 1KFDA 2CJ9A 1RA6A 1SIZA 5J2NB 5HMZA 3OXGA 4QCLA 3MM5A 1QLNA 3IA0A 5AXKA 3DOLB 3KK2A 3DI6B 4IRCA 3RAMA 4CO4A 5KFSA 2N4DA 1MMNA 3DN9A 3TAMA 3T5KA 3MR5A 2ZKUA 1X4FA 2RRAA 1JXLA 3O44A 2VG5A 3OR2A 4TY8B 3CCTA 2HVZA 1KFSA 5GMKa 1SIWB 1YRTA 3HHLB 1LWEA 1X0FA 1S0NA 4C3LA 2MQPA 1M5PC 4K59A 1LK5A 3CGIA 3QJPA 5G4DA 2OFGX 4DR7F 1HBUB 5BR8F 3ISZA 5CXTA 3NRBA 3T1YF 2DO0A 2GHWA 3CIZA 4DG1A 1KQSR 1Y0HA 4NOHA 5J1PA 3FSIA 1TQLA 2HHPA 3K2YA 1AFJA 2DCLA 1MU2B 2DR5A 4M94A 4ED5A 5C5JA 6FD1A 3DMJA 2YNGA 2LXUA 3I82A 2NQPA 2NUHA 3ZC4A 3K5MA 2IC3A 4ZHRA 2M9KA 4JI5F 3IWNC 1R89A 1VQNS 3NS5A 5EWGA 5IT0A 1X4HA 2HGMA 1J2VA 4ELVA 1SV5B 1R0AB 2DIVA 2PA3A 3L09A 3I4PA 1TKXA 3NL0A 3M8SA 2JX2A 4QYRA 1QAIA 1S6QB 3ENWA 3HDSA 4HDHA 4PG6A 5KT6A 3TA0A 3V81B 3QO9B 3AY0A 2K2PA 1N4LA 5E3PA 4DOZA 3HX9A 2ADBA 2BJDA 3UQSA 1FTCA 4NX9A 2MKKA 5J2PA 4IOAQ 2JFDA 4RLEA 3MMBA 1TAUA 2WOMB 4NZ6A 3CUNA 2AYGA 4OHXA 1R6YA 1TK0A 4B9UA 4MJKA 2B4PA 1F5CA 2DD8S 2QA2A 3VAHA 4PRFA 1KOHA 4PWUA 2IA0A 5A8RA 2GMLA 2EBGA 4C0BA 2IM1A 2ZVSA 5KFTA 1VRTB 3GSDA 5J2PB 2BRLA 3OUYA 3UI3A 3LANA 1S1WA 1U6ZA 3HZEA 2XULA 1ROFA 3N5FA 4J9SA 4EYIB 1NZAA 2RQMA 5C42B 1QY7A 2CQ2A 5ITHA 4I6WA 4ECUA 1VLYA 3LP0B 3DCAA 5KFOA 1QM9A 4BC7A 4BHQA 2JC0A 2MXYA 4DSIA 3C8YA 2C3OA 3RZAA 3Q8PB 2BVZA 3DOMA 1X5PA 4TKTA 2E5GA 2HLTA 3QGPA 4WFNQ 5B0EA 3U1MA 4FS2A 3GMGA 3T19A 4ECXA 3OFEA 4F8RA 1SJ4P 1V3RA 2YWGA 5SUHA 1T03B 5EN1A 2VBYA 1T3OA 3NGDA 2YKMB 3PW7A 1J5OB 1S9GA 3GYXB 4DWIA 2K1RA 1HNWF 3IS9A 1TL5A 2Q6BA 4B3OA 2XLKA 2EG2A 3K8VA 3MECB 1XMOF 3FNNA 1UVJA 1RISA 3HI9A 3IWXA 2B6AA 4J5OA 1QJHA 1O8BA 2G13A 1VHFA 4ID5B 2YKMA 1TZ0A 2JLFA 4Y2AA 4DFPA 4E0DA 2DGQA 4ECVA 5J2MA 2RNEA 5EX3A 1CPZA 4A8QA 2OLWA 1KNZA 4JI3F 1Z2LA 1H98A 1E6VB 4RWXA 3CDUA 3H5XA 3PKYA 3CDBA 3C6TB 3DLKB 4YB6A 1F5BA 3RYLA 2ABYA 3TVKA 3OVBA 3M8PA 3IN5A 3HHEA 1VS3A 3SFGA 1N5YB 3FQKA 1UKUA 1WG1A 3LPYA 1DQAA 2YKAA 2WBMA 4DV5F 2V4JB 4FBUA 1P6TA 2JRSA 2ASLA 3WC0A 3CCZA 2BA9A 1TVRB 4DF8A 2M88A 1HNVB 3SSRA 5GAHU 3TAMB 4LVOP 5KT3A 1KOOA 3M05A 3CCJS 2CZ4A 5A0YB 1D8ZA 4C0OC 2IMOA 2O5DA 4JOUA 4A46A 4DHVA 4YR2A 3NNAA 3OFGA 1JLFA 3GR1A 2D1CA 4TN2A 4IFVA 4NRTA 4I68A 1SI9A 2XY6A 4G6VB 5D78A 2A3JA 3LAKA 5DM6Q 1FK9B 2FHMA 2FLPA 3L95X 3SEOA 4PG7A 1Y3KA 4OX6A 1VC5A 4QBUA 1FXDA 3B4DA 2XSJA 4KRWA 2VV5A 3CWJA 4KGKA 2VFVA 2UUWA 1F2GA 2DNKA 2DRAA 3QMQA 4WFXA 3M8RA 1OSCA 1SKRA 2P6TA 1FESA 2Q79A 2IMWP 4PPZA 1FJCA 1ZBTA 3EGWB 5KFLA 3KLEA 4ED1A 2BQUA 2HWHA 1C4AA 1Q8IA 3EGNA 3OTDA 2FJWA 2GQQA 3G6VA 4FNHA 1GXUA 2BXJA 2KM8B 5D4PA 3LALA 3FZ2A 3GB0A 2VFUA 3UDCA 3HVAA 2DNMA 2KT2A 2PI5A 2GGPB 4NLVA 3MM8A 5SZTA 3AJ2A 3MEEA 4DBQA 2KXNB 3NS6A 2RF2A 5I4MA 4TQSA 3Q22A 4OI3A 5MAOA 1NH8A 2MSTA 4CTAA 4RZRA 2L08A 4I6YA 5IS2A 1Y4ZB 2QSFA 5LXRA 4LF8F 4ZVFA 2DTJA 1OS5A 3N5BA 2DGUA 2IRXA 4J37A 4MK7A 1RT5A 4URSA 2JC1A 2R7TA 2MDAA 4NLXA 3CCUS 1BC6A 2AP6A 4FPRA 2YX7A 3NAHA 3FRYA 2L41A 1CC7A 4JI4F 2W4DA 2JWNA 2BUNA 1UA0A 1IKXA 3IR6B 5I42A 1TP7A 2LU1A 4F50A 1N6QB 2XS7A 2YNFB 3VTIA 4P6QA 1OPIA 5M2RA 1D0EA 1FHTA 3DFEA 4PQUA 2PFFB 4B3RF 1IKYA 5H1SV 2ZFHA 2CPZA 4Y2KA 4J9QA 4IR1A 1S77D 4MTPA 5D4NA 4RNNA 1VK8A 2AWZA 1HBNB 4O3NA 5F0WA 4XO0A 3TNVA 3THVA 2HW3A 3IRWP 1K1QA 4QQBA 2LA4A 3MMCA 2VPXB 2RH3A 3O2IA 1G6BA 4UW2A 2OPQA 3TI0A 2VC1A 1S1TA 5HROA 3QGGA 3EX7B 4IH7A 2LVWA 1SC6A 4NMLA 1RI7A 3FDSA 4F2SA 2HHXA 1T7PA 3M2UB 5J2QB 4LSNA 3NNCA 3KK3B 2JEFA 1KLMB 1IJEB 2B6AB 2QV6A 1JLBA 2VFTA 1S6PA 3OR1A 4QJVA 2AYMA 4K4TA 2Y1IA 3Q23A 1HFEL 2XLIA 1C1BA 4C2MA 1JB0C 4IR9A 4IUFA 3BREA 1KVIA 4ED2A 1NH7A 1UP1A 4LSNB 2VFRA 5GADI 1E6VA 1RKIA 4HEA9 3CJ4A 4IOBA 4AUKA 5KFXA 5J1EB 4QWBA 1BQNB 4ZCMA 1RTHA 2C3YA 2AYBA 1QSSA 4IH6A 1KQKA 1VQSA 3RTVA 1FDAA 3ICLA 1L3SA 4JV1A 1BGXT 4OL8A 4NLQA 1KVJA 2QMXA 4DEZA 2FTRA 1FF2A 2K7KA 1S79A 4DFJA 2WB4A 1RTIA 3M30A 3BN4A 4HT7A 3OLAA 3E2EA 4DR4F 1K0VA 1CLFA 5CYMB 1U2RA 2HGNA 5DLGA 4K4YA 2EFVA 3R27A 3L7OA 4RW4B 2AGOA 2JEGA 2XG8A 5F41A 2XMKA 2XSFA 3PR5B 2E1RA 5HP1A 1X4CA 1FE0A 1Q16B 4IYQA 1RTIB 1QE1B 2HRUA 3M30B 7FD1A 2HYIB 5DG7A 4C4WA 4Y28C 2V0NA 3ZZOA 1LFPA 2C3UA 4Y6IA 1RAJA 1RWUA 1C4CA 4E8UA 3X3UA 3CC4S 2EPIA 5E5NA 5FIIA 4R8UB 4LIRA 3OL8A 2UP1A 3N9UC 5I3PA 4R5PA 3LP1B 2IC3B 1H7XA 4CO1A 2UVUA 3R5CA 5BYRA 2DGOA 1YIJS 4LUBA 2RILA 4P2SA 4DL6A 3ENQA 1RT6B 2BRKA 4HI2A 2XGQA 3I0RB 1VRTA 1TKXB 4NCBA 4A48A 1HW9A 2JOQA 2HWTA 3QGHA 3IWLA 4DL7A 2RVJA 4IG3B 2ZBCA 2IBOA 3QZ7A 3Q8RB 4MH8A 2FVCA 5T7LB 4KHRA 3J81Y 4ED0A 2DPJA 3IFEA 2J9CA 2WBRA 2HNDA 4R25A 2HGLA 2IAJB 1JLGB 4KV8A 4K4XA 4CO5A 4X2BA 2BM0A 1XR5A 2DH8A 2IJFA 2EFOA 2HZCA 2J9DE 4IDKB 2JH3A 1HI8A 3GFXA 5KFIA 1LW0B 4WTYA 2O01C 4YB5A 4DL3A 3WC2A 4H4OB 2NSCA 2J7WA 3UCGA 2VBXA 4WIIA 3W7BA 5L1JA 4QU6A 2YKOA 2BANA 2VG6A 4MIWA 2OKQA 3FJ2A 4V19J 2NXUA 4KGMA 4O3QA 3ITHB 3TVYA 4URGA 2VFSA 3MMCB 1NEEA 1ZAWA 2GQCA 2WW8A 1JJ2R 2XNQA 2ATLA 1WNEA 1U26A 3J7ZT 2IM0A 1RT1A 3I31A 5AE2A 2YWKA 4LMZA 1APSA 4MYTA 3SQGA 5J2QA 1XNQF 2E9TA 3CD5A 4JI0F 3ISNC 2XMVA 4R0JA 3TOQA 2DGXA 2E7XA 2JEIA 2KM8C 3KMQA 5KOXA 1M5HA 4P7TA 4KO0B 2EK1A 4JYAF 4K5RA 4NPOA 4QW8A 3K7RA 3KK2B 3KHLA 3UD4P 3K5LA 1YRUA 2F8HA 3EXYA 1NKCA 5HBMB 2OPSA 3FEXB 4G1QB 3GWCA 4KBIA 5KG4A 1HI1A 3GYNA 2N82B 3TANA 1JLCA 1Q7LB 2PO4A 3H2UB 5KFRA 4NLRA 5C42A 3KHRA 3M8QA 2EFGA 3HVTB 2ZC3A 4F4WA 4PWDB 2RUGA 1LWCA 4I2PA 3HF5A 4X84A 4OZLA 2FC9A 4TLQA 5K8MA 4NCGA 2XY7A 3D54A 3RRGA 2VBZA 3TW0A 3V5RA 3M2RB 3JAMY 4NLGA 2QA1A 1DTQA 1WWHA 2W7OA 1F9FA 1CQNA 5KFNA 3HPOA 4F4YA 2HVIA 2VL1A 4OJGA 5KFUA 3MXHP 5KFAA 5D8HB 1U1RA 5HP1B 1R8BA 1FRKA 1U6FA 4ICLB 4NCGB 4PG8A 1NJWA 2HG4A 3NAIA 2ZOFA 4DL5A 3DRYA 3DHXA 5AXLA 5IM0A 3MM9A 1KEKA 4WU2A 5F8NA 4YOEA 3HZGA 2UUTA 2CQ3A 2FIUA 1SKWA 4DUZF 1MWYA 2UZAA 1RT7B 2CQDA 3MTJA 1DARA 2VKZG 4OZ5A 2B43A 3AHPA 2HWIA 2C28A 4DQIA 4LQ9A 3KLVA 3PW0A 4AE5A 3HK2A 1TAQA 3BO3A 2KZMA 5DQGA 5B0AA 2JSXA 1NO8A 1V3ZA 2RRBA 3MMBB 4IFVB 2IVFB 5KG5A 1G2EA 5IQ6A 2KT5A 3FMBA 3CJ0A 1WF1A 4C97A 2VOPA 3UNGC 1N5QA 1FD2A 3G8SA 2PDAA 5DQIA 2EK6A 1VIXA 1P1LA 3CJ3A 3DOLA 2NR0A 1AFIA 4O4GB 3U1LA 5D3GA 4M8LA 1X5OA 4K4SA 1TL1B 2G4BA 4Y0FA 1VBXA 3TO8A 4NYPA 2QA4S 3FFIB 3HMJG 4I2QA 1FXRA 2PE8A 2DGVA 4ITSA 1UVIA 1LXJA 4RWWA 1OWXA 3AAWB 2WONA 4LIWA 2DNRA 5KT7A 1KQGB 3TA2A 3IO1A 5L9XA 4DV1F 4A8XA 3PIPQ 1Q82T 4K50A 3SYZA 1M90T 3FSXA 1QAJA 2GFFA 3QAEA 5KFYA 4B9NA 1FRHA 1IKYB 3MM5B 5F0UA 4Q2MA 2IAJA 2W7AA 5KFHA 1TKDA 1UETA 3BM7A 4C7QA 1UJ5A 2YNHA 2Y1JA 5I3UB 1HWLA 1MROA 1RT3A 1U2FA 4RW8B 3MMAA 4WE1B 4QYZJ 5CYQA 4C8MA 2JVOA 4TY8A 4WU3A 2C3PA 3DLEB 4QIGA 5DDRC 3KHHA 2DPIA 4B17A 2MHEA 3HKWA 2CFXA 1YQHA 5K8OA 1R0AA 2CQHA 1PC4A 1QAXA 4TYAA 3OJUA 2XMTA 1UJ4A 2VG7B 4DSLA 5CZXA 1VRUA 4EBDA 3D28A 2MY7A 2ZH3A 2XNRA 1DQ8A 3MGJA 4DLEA 4AXIA 3RR7A 1R8CA 4C3KA 4OZ0A 2HHQA 3DOKA 4OI2A 2MKIA 2RDIA 4PQUB 1IXKA 3KHGA 3POTB 1YJNS 4R0EA 3MM7B 4FF4A 2J6SA 2EW9A 1R31A 3M8QB 1YBAA 3LOUA 4ZPTR 4F02A 1S7HA 4YR3A 3MPVA 1A7GE 1L3UA 2IRYA 5CYJA 5A8WB 3MURP 2DNZA 5K9FA 5GAGI 1N88A 1N0UA 1N52B 2OO4A 5J1EA 1WEZA 3CJ2A 3H8YA 3T6BA 2DNYA 3P96A 2ZJPQ 1Q1KA 4CO2A 2FD2A 1U1PA 1L3TA 2Q43A 2B7BB 2W9CA 4IRDA 4JI1F 3NP5A 1XWLA 1RTDB 1IKVB 2DK2A 4XAKA 5DGBA 4X62F 2DJWA 3OR1B 2VODA 5FD1A 5L38A 3D5MA 4ZCIA 2J5AA 1QAYA 2IYGA 2MZJA 2R2RA 4DQSA 3UPFA 2AJ4A 4HLBA 1SH3A 2QYCA 4MAKA 4CH1A 3KJVB 2R7RA 3CCRS 4BWMA 4Q5VA 4PWDA 4RW4A 4M5DB 1R3NA 3QJJA 3ZZZA 2E9RX 1S9GB 4ZPWR 4BBYA 2AJ0A 3C3LA 3K0JA 5B7WA 4I0WA 4B08A 4Q0BA 5LL6d 3IR7B 3CCES 1JLEA 3N0VA 1F0XA 5GAEI 2VH7A 1K0TA 3MMJA 1HWKA 4DQRA 3OQ2A 3M2VA 1GX6A 1VMBA 1N5TA 2EFNA 4DUYF 4A8MP 2C3MA 1S1VA