2GVZA

Crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 44
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvzA00
1YBUA 4OYAA 4P2XA 4USWA 4P2FA 3G82A 1CJVB 5D0EA 1CS4B 3C14B 3C15B 1CJUA 1AZSB 3UVJA 4CLZA 4CLLA 1YBTA 4CLPA 3C16A 4OZ3A 1CS4A 2QV6A 3C14A 4P2MA 3C15A 1AZSA 1WC5A 3UVJB 4CLUA 4CLTA 3C16B 2BW7A 4OYMA 1WC6A 4OYOA 2GVZA 1CULB 5D0RA 4CLYA 2WZ1A 5D0HA 1AB8A 1TL7B 4WP3A 3MAAB 2GVZB 4USUA 4WP8A 3MR7A 1CJTB 1CULA 1FX4A 4CLFA 5D15A 1TL7A 3MAAA 3R5GA 2GVDB 5D0GA 4OYBA 4OYXA 4OYZA 1CJTA 4OYPA 1WC0A 4CLKA 4NI2B 4USTA 4CM2A 1FX2A 1U0HB 1WC3A 4CLWA 1CJKA 4OYWA 2GVDA 1Y11A 3ET6A 5IV4A 1WC1A 1YK9A 4NI2A 4WP9A 1Y10A 1U0HA 5IV3A 4CLSA 3G82B 1CJKB 2W01A 1CJVA 4CM0A 3ET6B 4OZ2A 1CJUB 4USVA 1WC4A 4OYIA 4WPAA
chains in the Genus database with same CATH superfamily
3GIKA 4A8MP 2RRAA 1V5IB 1N36J 1HFEL 3P5BP 1S0OA 4PZVA 2XSFA 2V9WA 3QSYB 3PACA 4K8RA 2IIHA 3CD5A 3TO8A 4OZ5A 4NXMF 1LWFA 1K1QA 1OMSA 1UEUA 1N33F 4RUBA 5HATA 2F4FA 5HO4A 7FD1A 3UNYA 2CVEA 2ROGA 1HMVB 2B8QA 1X4FA 2IVFB 5AJ3F 2CPZA 4C48A 2RNEA 2ERRA 5DG9A 3THTA 2KFNA 4U7CA 1Z2LA 3PM9A 2W7OA 2MY8A 3BH7B 5HSPA 4Q0BA 3R2CJ 3KUEA 2ASJA 1X4EA 2MZRA 1RAGB 2BBEA 2MZJA 3QFHA 4WCEQ 3WIUA 1Y10A 3BEGB 1L5UA 1FKPB 4B9TA 2VG5B 1HLWA 3M8QA 1LWEA 1VMBA 2RDIA 1C1BA 4UW2A 2QG9B 1F1BB 2KXNB 4OX9F 3D0HE 2B6AA 1N4LA 2KKHA 5L39A 2KM8B 4ATNA 1CSJA 2H54B 3HSZA 4OX9J 1SV5B 2XBPA 3H2VE 3IBFB 1G7CB 1F2GA 2W4DA 2VB6A 1HWLA 2YKMB 3FBBA 1CG2A 4ANCA 1S1UB 4IG3A 1S6UA 4Y34A 4CLYA 4ID5A 2RF2A 4HKQA 4FF3A 1S79A 4QPXA 1FESA 2DTJA 1IWGA 3FCVA 4IOBA 2YNGB 1UL3A 1UVMA 3M1VB 3PO4A 2BKPA 3FNNA 4HTJA 1KLMB 4WYLA 4ZLJA 1ZAVA 1UA0A 1SJ3P 3IWLA 4ZVGA 4DX6A 3GFXA 1FE4A 3Q24A 1GH8A 2V34A 3KLFA 1UW4A 4JBCA 5CCMA 4NI2A 2BACA 4JI2F 3FBFA 3DHXA 3G82B 1RTJA 2JC0A 1S4EA 4YY3F 5BXIA 4C3LA 1JXEA 3DLEB 4ZPCA 4DV4F 2N7CA 2ATLA 3X3UA 2BDPA 3SI8A 4CYUB 2LU1A 1FRIA 4Y2KA 2RS8A 2BM0A 3W2VB 1APSA 3PDNA 3AB2B 2FVQA 3C14A 2XMUA 2CQ1A 2PEBA 4P74A 4OZ0A 2DNLA 2IMOA 2OPRA 3MEGA 3I31A 4CTAA 3VAIA 1HI8A 2Z58B 3EICA 1NPRA 2ATCB 1PBAA 3EZ5A 3CD7A 1K0VA 3K89A 4KB7A 4TVAB 1HBNA 3ZTQA 2MKIA 3HHNB 3SSQA 4DPXA 5DDPC 4KO0B 2MHNA 1JX4A 5DLFA 1CBKA 3BB5A 3I55S 4AT1B 3E01A 2R8KA 2VF3A 1BMQB 2J6SA 1F6TA 4BBYA 1LW0A 3PW5A 2WW8A 1A7GE 3M2VA 3TQ1A 1Q8LA 2CQ0A 4DLEA 3H7HB 4HI2A 1JXVA 1Z2ZA 1S1VA 1VQPS 1ZOTA 3DI6B 5L46A 2DITA 3N9UC 4ZVFA 3ZZRA 2CPYA 3RGIA 1I51B 2Y0SD 5IOLA 3UI3A 2BOPA 3BQ1A 3QAEA 5H9EK 5D3GB 4K0KJ 2E5GA 5J1NA 2PMZD 1TUVA 1HARA 2DO4A 4FXWA 2UVVA 1X4BA 2U1AA 3QO9B 3UR0A 2OPPB 5HI7A 5T7LB 1IBLF 3DYAB 1WJ9A 4W92B 5CYQB 3CJRA 3GYXB 3IRXB 1TVRB 1PBUA 4DZ6A 2OPSA 1JJHA 2F65A 1VCTA 2VICA 5D6GA 3H5SA 3UN2A 4K4XA 4OI2A 1IBLJ 2V50A 4YOEA 3VQTA 4LRDA 1CULA 2BX6A 3N79A 3ONQA 1NH7A 1NK4A 4LQ9A 4F50A 1R8AA 2RQCA 3DGPA 3DLKA 1PSDA 4IH5A 3E2EA 1KR4A 1C0TA 2ASDA 4ZPTR 4L3KA 4B08A 1N56A 4DR4F 4C7QA 3MEEB 4YB1P 5J1PA 2MJUA 3LP0B 1V5VA 3N01A 5FJ4A 2H48B 1RHMB 3E51A 4N77A 2VFRA 1WACA 1R7IA 5K14B 3Q8QB 3PKMA 4LRAA 4ED5A 3QFWA 2WTFA 4AUKA 2YX1A 5E3QA 1FRKA 4K4TA 2Z2MA 1VGYA 1SQGA 2V5HG 1KFDA 4NCBA 1DJ0A 1WEZA 1VRUB 1T9XA 4PQAA 5CAAA 3Q8PB 2YNFA 4LR9A 2CQGA 2CJXB 3KFWX 1KD1T 2XZDB 2W9AA 4AQYF 2UXBJ 2D41A 1GAOA 2W2NP 1BXNA 3D4JA 2WONA 1MWYA 4CLFA 3UE2A 1RBLA 1AXQA 3QLHA 1VRQC 3NBPB 2OJ3A 1JK9B 4L73A 3TA2A 2G13A 2IVYA 3KLGB 2IJNA 1RGVA 2D3OR 3ETOA 2PEHA 2I9SA 2ZC4A 3KUHA 1TQLA 4ECWA 2DR6A 1S57A 2AV5A 3AQOA 3J80Y 1REVB 1FDDA 2WOMA 1VR6A 3FCHA 5A8RB 3KK2A 3UDVA 1O8BA 2HHHF 1IKVA 4PEOA 4ZLPA 2ZE2A 3OV7A 3I9ZA 3CPWR 3THVA 4MK9A 1NHVA 2EWHA 3IP0A 4USJC 1S1XB 1RAIB 4ECTA 5C42B 5K8MA 2BVZA 4JV1A 2HHTA 4OYMA 3CCUS 4YHHJ 4ZCMA 4LRFA 2XS2A 4XIUA 2COLA 4IG0A 5E7OB 4M8LA 4ZS6A 2QGFB 1X5TA 2HHUA 4WFZA 2LCWA 4CO5A 2HS3A 1CJTB 1ZZNA 2UXCF 2JNJA 5GAHU 2ZZTA 2CNLB 2AGOA 1FA0A 4C6AA 1B7FA 2IA0A 4ILRA 4L3NA 4BLGA 1NB2A 1RTZA 4F0KA 3EYZA 3CDWA 1IR2A 4DV2F 2WVEA 4OI0A 5EX3A 3MM8A 1OY9A 3L3CA 4OX7A 2V8HA 3KLHB 5LJ5Y 3DLLQ 4ED7A 3PR4A 4OI4A 2W9BB 1CVJA 1G4CA 4RW7B 1T9WA 3G6YA 5D78A 3ZZZA 4X4UA 1U1MA 1FK9A 1SH0A 4G1QA 5EX0A 1W2BR 3DOLA 1Q86T 2OAUA 2HMIB 1Q4RA 2BJEA 3CJKB 5T14A 4KRWA 1EKRA 3G6VA 3HHLB 4JI4F 1GEHA 3KKFA 3LW5C 3SXLA 2CNOB 2CVIA 3PV8A 1QE1B 4R8UB 2CZ4A 3G87A 1SCJB 2ZVIA 2B51A 3QZ7A 3UDCA 1WC0A 2RAQA 1TL3B 1NSPA 1RAJA 3JTNA 3RRKA 1CJKA 3UO0A 4WP9A 5BYRA 1YTYA 4EYIB 3NOGA 1P6TA 1SKSA 2EFPA 1KWMA 2OP5A 2LXUA 1RXOB 2DPJA 1VQKS 2UP1A 2RS2A 1O5JA 5CQGA 2GJ2A 1S7IA 1V3ZA 1UZHA 2YKQA 3HD2A 5EN1A 2QT7A 2AEJA 2V68A 5ETOA 1E6YA 4DCOB 2R7TA 4RLEA 3SMZA 2R7OA 4CLTA 2UVRA 3R7SB 3CE8A 2CPDA 2ADBA 2GJIA 2ILYA 3QT8A 2WVBA 4LF7J 2E9ZA 1MROB 1QTMA 2MZQA 5F0UA 3FSXA 5SZTA 2IDLA 2HRYA 1UA1A 3TZZA 1TK0A 2CNKB 2J8SA 4DR7J 2C2OB 3HVTA 2HRTA 1BUXA 4ZKAA 2A6OA 2B56A 1BQXA 4K59A 3O1LA 2DNKA 3OHBA 1EB0A 5CHCB 1KKHA 2PD1A 3TZYA 2V63A 4CCHA 3MR5A 4I1TA 3K8WA 4QR2A 1S49A 5E41A 4ECYA 3Q89A 4M5DB 3NOCA 3BBBA 4CH7A 1D8YA 2ZOFA 4QCLA 1XMQJ 3JSBA 2FD2A 5HMYA 3BJYA 4AD6A 3OVBA 3DHWC 2JX2A 2APOA 3JQKA 4C11B 5LJ3Y 1R8HA 4V19J 2KH9A 3V4IB 2DEIA 4WXOA 3MEDA 4KY3A 1CPZA 2H4YB 4IH6A 2WK4A 5KT4A 1MWQA 3QIDA 3NLCA 1Y00A 1VYAA 3AT1B 4JI7F 1LWCB 2DNGA 4QWDA 4KIAA 3OSPA 4FBTA 5E2QA 2MKSA 3A13A 4HH0A 1SI9A 4KTQA 2FY1A 1G6BA 3OL6A 1RWNB 1J5OA 3ITHA 4DPUA 4FP9A 2FJDB 4B9LA 2DISA 2W9CA 2B0GA 4DL3A 3DMJA 4P6QA 2F7VA 2LEPA 1KFSA 4CLSA 2R2SA 2V2QA 2EK1A 2RH3A 1EKSA 2IRXA 3MMBB 1NSAA 5AXKA 5ITHA 4X4RA 5KTQA 2X1FA 4I68A 4JYAJ 1FEEA 5B0GA 2ZH6A 3M6UA 2ALZA 2HHPA 2XYHB 3LF0A 2PI5A 4ZVQB 3ETMA 1BLUA 1SJ1A 2Z8QA 4FYDA 4ZCKA 4ED0A 2QA2A 3BGRA 1IBMF 1RHKB 4JV2A 3CCZA 2E66A 3N6MA 2C3UA 5KFNA 2LQBA 2GCFA 3TJ9A 4O23A 5ETVA 1SH3A 4DF8A 1EJ7L 1IBMJ 2DNOA 1JWWA 4IKAA 3C6UA 1JLEB 1QSYA 2E1PA 3VGTA 1QAJA 2HNYA 4CT9A 2AKWB 4KHPF 3LQVA 2F4VF 4OYXA 4FNHA 3JSYA 1EARA 4ECRA 3DCAA 4BHQA 1ITPA 3KG1A 2IRUA 4EU0A 3G86A 3HHEA 2KHDA 2BRLA 1WUUA 3PYDA 4DDFA 3HFVA 4ES3A 3H4DA 2HHWA 1FRLA 4ZIVA 4NLDA 3DM2B 1YKWA 1WHYA 3DLGA 1S9FA 3PX4A 1YBTA 3CC7S 2EC0A 3R5AA 4RW4A 4K2JA 2VKZG 1HA1A 3M32B 1HNIA 1IKXA 1I3OB 1WC6A 1WKKA 3GFHA 2RT3A 3RB0A 3QATA 3R7BB 5HQ8A 4LF8F 3MTJA 5KG7A 3MOJB 4EMDA 1B3TA 1RWOB 1VQ7S 3WX8A 3H5UA 1OY8A 2PC6A 2PA3A 2KTQA 1JLBB 3MR7A 1QTNB 3FKBA 3M8PB 4LF8J 3US5A 1X4CA 2DO0A 1HNVA 1UMJA 4ILLA 2VONA 3VGSA 3TAPA 3MD1A 3H20A 4G65A 4ED4A 1VQLS 5F0WA 3AODA 2DPIA 1XR6A 3M2RB 3RU0A 3Q8RB 2CQBA 1IN0A 3Q8UA 4X64J 1CJUA 3WX4A 3UVJA 1MW7A 3TW0A 4WFAQ 3BDPA 2XS5A 4LFBJ 4EGLA 2P9EA 4MFBA 3KYLA 4J9RA 1LXJA 2A3JA 3W9JA 5L1KA 5GAEU 2HWIA 1NHKL 3QJLA 1WSVA 4ZPDA 2DR9A 3DLHA 2ZH8A 2AZ3A 1RT2A 3UPFA 1VLYA 2HHXA 4YP3A 5DETA 3PHEA 2HHVA 2QMXA 4RU9A 1X8DA 4DQRA 4NLPA 2EI5A 2W2MP 3FSYA 2E7XA 2BMBA 3TA1A 5JVGQ 4OYWA 5A2QU 5LMNF 3W5YA 2VFUA 1S77D 2ZBQA 2Z56B 4OJHA 2QL7B 1DTQB 2QX0A 3GFZA 5BYQA 3NMRA 1NKBA 2RKIB 5KT6A 2DXEA 4H4KC 3BR8A 1NDPA 4ES2A 5J1EB 1CJVB 1FVSA 3CJQA 2MEWA 3DRSB 4JV5J 2CKWA 4KGZB 3C15B 3OFFA 4ITSA 4R25A 2CJQA 2J0XA 4DUYF 4LMZA 3E3XA 1XBWA 2D9PA 2HBQB 4YB6A 3CF5Q 1VBYA 5H1SV 1KVIA 1TKDA 1HNXF 2EEYA 2XZWA 2HEKA 5B0DA 1BY9A 4ZHRB 3RR7A 1C0UA 3I5CA 4ANDA 1LWFB 3GE9A 3M2UA 2I5JB 4DQPA 2PI4A 4CRJA 3ZTPA 2DKOB 1WOOA 5J2QA 3C46A 3D68A 1FEHA 5HANA 4C3MA 4C2MA 2HLTA 3GJSB 3V5RA 1EAYC 4ZLNA 4DV7J 4MMOA 1AT1B 2PSZA 4UUXA 4C8ZA 1B64A 1TKTB 2D3ZA 3IS9A 1SL0A 4HTIA 2XO6A 4GC6A 2ZJRQ 1RT5A 5KFOA 4A8YA 3OVAA 3RR8A 2HZCA 2GGPB 4RJVA 4NCAA 5DLGA 3I82A 3N6NA 5IV3A 4RUAA 2FLOA 3F73A 3CJ5A 3RB3A 1RB0A 4DPTA 3I87A 2G2OA 1RADB 2F9JA 2XY7A 3H5YA 3R6LB 4F7VA 4K4YA 3WHIA 5KFXA 2R2TA 4DI6A 4ICLA 2ABYA 1TFWA 2W4CA 1D1UA 3LWMA 4LFAF 3CVKA 1QAYA 1RT7A 1GTHA 1JLGA 1JLFA 3CB4A 2YWWA 4ZVTB 1BQNB 5DQIA 4LSLB 1U48A 4OV1A 1BHNA 3TA0A 5T41A 2FJWA 3OW2R 2JJ4D 3VAKA 2A10A 4ID5B 3SSRA 4K4UA 2MQQA 1D9FA 3R8YA 2LYVA 4R0EA 1U6BA 2P9CA 3HPOA 3D9BA 2DNMA 5I3PA 4IFVA 3DDKA 1P9QC 5GAGI 3AJDA 2JSXA 3QWUA 1N5VA 4J9MA 1RT6A 5ETLA 1QJHA 2DGVA 2EXUA 5IT0A 2K7KA 4OJGA 2DRAA 4NLVA 2M8DB 1SJ4P 1EP4A 3FK4A 1UWBB 3R5CA 1S6QA 5CYMA 4U8YA 2CQDA 2GX8A 2HG4A 3GMGA 3F41A 5JUMA 5A8KB 2VIHA 1M0SA 1FFSB 1JB0C 4F8RA 3PJWA 3PEHA 3PYFA 5E3AA 2HQ3A 2OI2A 2BRKA 4H4OB 3MEGB 4Q2MA 4M5GA 2HFUA 4JI5J 2NSBA 2HVHA 3M8WA 1OS5A 5KFJA 5RUBA 4KGKA 2LA4A 1D8ZA 3SYZA 2UUTA 3H59A 2AF6A 4C4WA 2N4CA 4HACA 5B09A 3T1HF 5KG6A 4KE5A 1S0VA 2FVPA 2VQFF 3FFIB 2Q3PA 4R5PA 3D2WA 2GC8A 3MCMA 3M2VB 1ZYQA 4DR1F 5EDWA 1VQYA 4QJVA 4P2FA 3DKDA 4PXEA 3SQGA 2HVZA 1S1VB 4ZOSA 1RWUA 3Q0AA 3G2XA 2CPXA 3H90A 4DR1J 3PW4A 5IZHA 3DC2A 2K8GA 1CQNA 3TR5A 3IM9A 3QBCA 4WYWA 4CQ1A 4ZVEA 2ACMA 3CCVS 3CO0P 1KQGB 2UVUA 1ZTTA 1U45A 3PG9A 1FX4A 1RLCL 3W66A 2LMIA 3EWGA 3BZQA 1DAXA 1IR1A 1VK3A 3W2WB 3B54A 3EZUA 1KHWA 1S72S 4USTA 4IO1A 4OZ1A 4FS2A 3V6KA 1XMBA 3FEZA 3BM7A 3OTBA 3B78A 1M1HA 2HBZB 3K7RA 4YB5A 1YRUA 4ZA1A 2DHXA 1MMDA 3BDEA 5AE2A 4DJBA 3TZWA 2MQPA 3VAGA 4M5KA 1QLNA 3GR1A 4QWCA 1DTTA 4L72B 1XK8A 3I0SB 1X9WA 1IKWA 3QRRA 4X65J 3K0JA 3QIPA 1IM6A 1XQIA 4P2SA 2B9WA 2IM2A 3MM6B 3MI7X 3GJQB 3IXQA 2YPZA 2XNRA 4E0DA 1YITS 3MM7A 1WSRA 2J76E 4ENOA 2KG0A 2P2CB 2VL1A 2WSCC 1T05A 4TLQA 3JB9k 2B8PA 4MTPA 2BJ9A 4Y2MA 3TNVA 1QUPA 4EFAC 2B4UA 2R7SA 3R1LA 1RT1A 2YKNB 4ELVA 3KJVA 1N8RT 5C2CA 3TVKA 3GZ7A 2RU9A 2W2OP 4DL7A 1SL1A 2J9DE 4K4SA 1U1QA 1H7WA 2D7SA 2J9DA 3QSIA 4DEZA 3ET6A 3A8KA 2RRBA 2ROEA 3P3DA 5C24B 5HLFA 3SQOP 5JMNA 2E1MC 1LEOA 1XR5A 5I3QA 2WOMB 2DR8A 2MXYA 3KK2B 4NRUA 4NE9C 1TL4A 3FQLA 3C8YA 2YBVA 2CJAA 1IKVB 1VHFA 3K8VA 1IM4A 2ZE2B 3C16A 4HVZA 1N5QA 2M7SA 1SKRA 3BO2A 4NYZA 4UOGA 5C7PA 2UXDF 2K1RA 3LP2A 3VALA 1OSDA 4K7QA 1QD1A 4HH1A 2E5LJ 1VQ6S 1LW2B 4DPYA 1Q7YT 3NNAA 3OLAA 1N34F 3OBIA 4EI2A 1UPPA 4ZPBA 4AXJA 2UXDJ 4IG0B 2ZZMA 1OO0B 3PJ9A 3HULA 2OFHX 2C3MA 1FFWB 3BSCA 4GC7A 1N34J 3TX8A 1D3WA 5L9XA 3BV8A 4BWJA 4EWTA 3QRPA 4M5NA 4WK3A 2VDIA 3EGWB 1S1WA 3J80U 3HX9A 4ZVRB 2AQ4A 1R0AA 4TU7A 4NZ6A 3VGVA 1RK8A 1QVGR 5C25A 2R9LA 1NDKA 3GCWP 4XDCA 1F9EB 2QIFA 4OZLA 3UDLA 3WC2A 3VZHA 1YRXA 2LEAA 1O51A 1YZ7A 2M70A 1R43A 4NLSA 2E1AA 4RWWA 2JLEA 3SSSA 2FY8A 4RWXA 1WKJA 1EHWA 4G3IA 2HWTA 3J7ZT 5D4OA 2M4MA 5E3RA 3PFOA 1HIYA 5L8RC 1GQEA 2QLXA 1VBKA 4JI3J 2YNHB 2VUGA 3T3FA 1DZ5A 3QWPA 4XDDA 1HNZF 4P52A 1RDRA 3T5KA 4M95A 1RHQB 3DNCA 2CAJA 5HBMA 5HK4A 3SCIE 3CC4S 4Q43A 1UETA 1CJKB 4TYAA 2V69A 4X4SA 5J2PB 3Q22A 5A0YA 3Q8VA 3BKUA 4TN2A 1HNWF 2NYHA 1S10A 4N56A 4F0MA 5I3UA 1VJQA 4WZMA 2C2KB 3R27A 2BEFA 2HK3A 4PR6A 1URRA 1KLNA 2HNDA 1E6YB 1HQEA 4MKYA 1HI1A 2W1BA 1FO1A 3J7YU 3HO1A 2XSJB 2W7AA 2BABA 3ENVA 2VDHA 5H9EJ 4PXBA 1NCLA 1M1GA 4I2QA 1HQUA 4QU6A 2ZH9A 4FZVA 4OYBA 1HW8A 3DXBA 2AMCB 1X9MA 5IC6B 2IYIA 5KG2A 1DLOB 3CULA 2KYXA 3L7UA 4HHHA 2OEMA 5KFEA 4USVA 4WE1B 3S6EA 3RBDA 4DR6J 4RW6B 2KT5A 2JEIA 2PMHA 4CLZA 4MKVA 3HHDA 1HWUA 4KV8A 1UEVA 1TP7A 1H7XA 2R2RA 1SVDA 4USMA 1RTDB 5DZ6A 2XMMA 3DGVA 1J27A 2AIRB 2F3JA 1RWKB 3WQPA 4WU3A 3PTWA 2ZJQQ 3SIPB 4U67Q 3J7Z5 2Q43A 1U1OA 1RI7A 4NLUA 4IRDA 1F5CA 4QW9A 3W3SA 3DDIA 2ZH2A 1A0OB 6FD1A 2OPQA 4G6VB 4NA2A 3CCJS 2VPXB 3G6ES 2X1GA 2BJDA 2E9RX 4QYZK 2W7PA 3GSIA 2Q66A 2IFXA 1VC6A 5HJXA 4D3HA 1TELA 1PC5A 2J0QD 1R89A 2E7WA 3AQPA 1X5PA 2F5GA 3FQKA 3HHLD 4FPRA 2RUGA 4OHYA 1HBMB 3W9IA 4DS4A 2ZWOA 5F3TA 3CJTA 4QZVB 2HFSA 2P9GA 1IBKJ 2DNQA 2IYGA 3B8HA 1L3UA 5F8IA 1FJCA 2ZDPA 4MKBA 5KG4A 3H2UB 4N8OA 4PPDA 1H2TZ 4QPTA 4LF5J 4GO7X 4WIIA 1TUWA 2YWHA 4C8KA 2YKOA 4J9SA 4CWBA 3IWNC 2GQCA 4DV0J 2PGCA 4J9NA 3DOMA 4N76A 2R8JA 4HYKA 1NU4A 2IVMA 1NBEB 1YVFA 2LQ9A 1U2FA 3CJSA 4I2PB 3OL8A 2ZH7A 1FRJA 1U0HB 2HNYB 4DR2F 4XO0A 1KBRA 3EGZA 4PUOA 3RUBL 3V4MA 2MQLA 3VR1A 5FIIA 4FYVB 1RTHB 2ZEJA 2IJFA 3T1AA 2QL5B 3IAM9 2PFFB 3HFZB 2Q6CA 1UEKA 1Y5LB 4QIVA 2GQ2A 2KYZA 5LOQA 1Y5IB 1VS3A 2X51A 3KNGA 3PJXA 2HFNA 4LF1A 5DQGA 4LRCA 4KH1B 5KFPA 5DG7A 4ECUA 1PG5B 2D74B 3I96A 4URSA 1T9TA 1W26A 1TKXA 2NR0A 2R7XA 2X3DA 3QNWB 1IKYA 1GFWB 1HWIA 4KJIA 4FYXB 2VBXA 2W2PP 3KXDA 3T9ZA 2JDJA 3S1TA 4F25A 3M8YA 1FJ7A 1SKWA 4NLGA 2BJ1A 4TLRA 3OPKA 3LUYA 1X4GA 1T9VA 5ETQA 3PRVA 4A46A 1UFLA 1X0FA 2N82B 2HLUA 3MFIA 4LVOP 5B0BA 4EBEA 1T3OA 2G2YA 4NOHA 3TVYA 3E8OA 3LH2S 3MCNA 3NG8A 5SUHA 2Q1LA 4LR7A 5AE1A 3OT9A 4PG6A 5GAHI 2O67A 2BE2B 1PAEX 2FYXA 3EVMA 1RCXB 3FEYB 1URNA 1ZPWX 4DU7A 1Y3KA 2LXFA 3UVJB 1OQ6A 1VK8A 5EHHA 3ICLA 1NK5A 2AGPA 1N54B 3T5LA 1NRKA 3IFEA 1HBUA 4X4QA 3K57A 5D0RA 1XC9A 1LQ9A 1TKZA 3AH6A 2XMTA 1ZPVA 5KFKA 2RB7A 1R8PA 1RT2B 5CD4H 3FMBA 2VKRA 4P9SA 1VQMS 5G0RA 2LEBA 1KQSR 3NP5A 2H51B 2IAJB 1FX2A 2JLGA 5HQMA 1C1CB 1T03A 2GVDA 4Q5VA 2D69A 1S9GB 3HP6A 3GG0A 2ZD1A 2G0CA 2IC3A 2XI3A 4F4YA 1KTQA 3EGVA 3ZTSA 1M5HA 2DK2A 2XWYA 1R8BA 3D54A 1U1RA 5ETTA 3HT3A 1KEKA 3GU0A 3M9NB 3NS5A 2W2QP 4P2MA 2GW8A 2B9XA 1ACMB 3RB6A 1H6KX 3I6PA 2DH8A 3P45B 1VQ5S 1RT3A 3BGUA 2BA9A 2N7YA 2I2YA 4TQSA 2NQPA 3MUVP 2FJXA 2AHOB 3BF4A 4NRTA 4QIWD 2LA6A 1C0UB 1REGX 1YRTA 5F8MA 3MMCA 3W60A 2HGLA 3M30B 5J2QB 5KFWA 3NY0A 1S1TA 2GO9A 2KU7A 4KFBA 5LT5A 2E1CA 3ILIA 2EBEA 1LNQA 1Q5YA 2RE1A 3T1YJ 1BGXT 3W9HA 3T41A 1WC1A 2V8DA 4B9NA 3KJFB 3IS9B 3MM9A 4DV5J 4OI6A 1OYDA 4I6YA 3U02A 3K2YA 5JJBA 4DG1B 4DL2A 1DARA 2XMAA 1TL5A 2NCKL 2I38A 4QYRA 2VOOA 3VVUA 2LVWA 3CJ4A 1QDUB 3H4BA 4LBIA 3HI9A 3OTOJ 4DFJA 3EPIA 4QR0A 2AEFA 3JAMY 1HR0F 1OIAA 2HAFA 2DHSA 3M7VA 1WTFA 2MKJA 5K8PA 4NA3A 2D9OA 1FHTA 2Y1IA 4ICLB 4M5HA 2GVZA 1HR0J 2JFKA 4URGA 2E1RA 4DL6A 4USKA 3NWRA 2A2DA 3FDSA 4NCGA 5DJBA 1ZAWA 1U1LA 3O44A 1HMVA 1HYSA 1KONA 3G8TA 2R3VA 1MU2B 3BGFA 2Z2YB 1WDDA 4PXDA 3AA8A 1RJJA 5J2NA 4PWWA 4CH1A 1M1KT 4E2FB 3QGPA 1WG5A 2YQ1A 2YQ3A 2Z2LA 2RVJA 2C1EB 3IGNA 3D1OA 4PAAA 1T9YA 1VRTA 2EPIA 2HHSA 3N5BA 3TJ8A 1NAQA 4H4MB 3WZ0A 4LIRA 3F0NA 1X4DA 2M5YA 2O1PA 1LV5A 5F9NA 1QY7A 5A6WA 3RBZA 3H42A 1FKPA 4P72A 3UD4P 3UCZP 2ZHBA 2VG5A 1SPBP 2MHEA 2P6SA 2FVRA 1L3TA 4DQSA 2UU9F 4EZ9A 3NAHA 1NXIA 2MQNA 2GFFA 1EP4B 4Y2CA 3W5XA 2FVSA 4J91A 1YJRA 3QYYA 5IQ6A 1S6QB 2I1RA 1U2RA 3Q83A 3G9CA 1K8AT 1SV5A 2BJ3A 1TL7B 4JV0A 1R8CA 4TQRA 1PILA 3GFYA 1YDLA 3HZGA 1S1UA 2OTJS 1UVLA 2JWNA 5E3PA 4HR2A 2VC1A 3LGHA 2YNGA 3VWSA 4JI1F 4ZVHA 1KLMA 5ETPA 3GIJA 2CNNB 4ZLLA 2VQEF 4EZ6A 2Z0GA 5H9FK 4JI1J 4Q7AA 2B4OA 3G82A 5F9LA 2CIMA 3PX6A 2VQEJ 4K2XA 4ZPWR 5F8GA 3AOBA 2GO8A 2V0NA 5DM6Q 5CYJA 4IQXA 2RJZA 2RSQA 4AFFA 4Q2LA 4NXMJ 1MWZA 3LALA 4MIBA 4CYUA 3HD1A 2BUNA 1N33J 3W2VA 3C6TB 3S01A 1FE0A 2CPHA 2LP4A 5K8OA 4DSLA 3SZ2A 5AJ3J 1TAQA 2VH7A 1WELA 4LF2A 1U8WA 4ZJLA 3Q8SB 1X5OA 1HBOB 5IT9Y 2CQ2A 3MM5B 1MN7A 4CNYA 1P8GA 4KO0A 3MPWA 3WIVA 1L3SA 2E44A 4NL5A 1YIJS 2H4WB 2G1HA 2IM3A 2ZH5A 1M5SA 5HVFA 4ERDA 4ETZA 3I0RB 5M2PA 3GQCA 3JXOA 2W01A 1U1PA 2HZVA 2RDDA 2KRRA 3DXSX 4CH0S 4OZNA 4OYAA 4USWA 1DQ8A 1CC8A 3A8IA 5KFGA 2JZ5A 3DI6A 4M5LA 3ZXWA 2QN6B 3T6BA 2RILA 2V2VA 4P73A 3MCOA 3VQSA 3Q86A 5D3GA 4CO4A 4HI1A 2XTJP 5M2RA 2XY6A 3QO9A 2HNZB 2OPPA 1A9NB 2WSFC 4PXCA 5T7LA 6FDRA 2OD4A 3DYAA 3MM7B 1S0NA 3Q23A 2Y1JA 2WSEC 1KRPA 2QTWA 3RYLA 3PW2A 5CYQA 4TU8A 3IRXA 4NASA 1TVRA 4DPWA 5AXNA 1IR0A 4ECZA 4A8QA 4DU8A 4DV1F 4USIA 4IRCA 1RT1B 2DGWA 5F8HA 2ZJPQ 4EYHB 2MZSA 3HT0A 2R8HA 2BQRA 5A76A 3D3CJ 2KN4A 4JI2J 5GAEI 4ED3A 4I7FB 5IV4A 4DV1J 4F3MA 3BSNA 5KT5A 4L76A 3POTB 4YY3J 2XCPA 4DV4J 1S6PA 1T94A 3ET6B 3MEEA 3WC0A 2DEJA 2QC3A 3PW0A 5B08A 3HXMA 2MLXA 2VPZB 3NL0A 1FD2A 1XEZA 4LSZB 1BC6A 5G4DA 5K14A 3OXLA 1VBXA 3UR3C 1R6YA 4FDFA 4HLBA 3LP1B 2CPIA 2AP6A 1N5YB 3J7AN 3J7A1 5D4NA 3B4DA 3D6TB 3TARA 3C16B 3GJRB 1X60A 3SEOA 1N5SA 1VRUA 4UUWA 2VU5A 3BPDA 1F60B 2FQQB 2BANB 2DGOA 2K1RB 2MSTA 4I67A 1H3DA 3G4SS 4NLWA 1JLAA 4QQBA 4NLXA 1B4SA 4JOUA 2EG2A 1QSSA 2AZ1A 1DBDA 1YI2S 3TP2A 1V3SA 2FPHX 2V2KA 4AL6A 4KT0C 5J2MB 4ZJOA 2R7RA 3NBPA 4PYDA 2KJVA 2R2UA 2J9CA 2AJ1A 1UZDA 2B7CB 1FXDA 1JMTA 2K7JA 4ER8A 2EG1A 3KLGA 3OXGA 2OMOA 4ECSA 3LA0A 1AROP 4FS1A 3BGOP 2MQMA 4B02A 4A8KA 1NH8A 2KM8C 1AZSB 4I6WA 1HWJA 2OFGX 5C25B 5MLCV 5L1IA 1TL1B 3M6WA 2CQCA 1RTIB 1G1XA 4DSJA 5ETMA 2GIQA 1JKHB 2QLBB 2KDOA 2LDYA 3D28A 1S1XA 2VG6B 4F67A 2Z4PA 1UVNA 5HROB 1PCAA 3QGHA 4B9SA 3T19A 2RQMA 1MG7A 3HSGA 4C98A 3I56S 3DRPA 1P27B 1Q8KA 3MPDA 5M2UA 4DR3F 3MDFA 3PW7A 2Y8YA 1CJTA 4DR4J 2C3YA 4ED8A 2ZH4A 5KFFA 4OV6A 3PO5A 5HMWA 5IQQA 2HQCA 4Z37A 2JC1A 3CDBA 2RD5C 2FZCB 1YBUA 4NLYA 4QIGA 1CQMA 1TU0B 4HHUA 4MJKA 2XMWA 3KLHA 2W9BA 2WW4A 4RW7A 1SIWB 2RDJA 5KT2A 5I3UB 4X66F 3BYRA 2CUYA 4FBUA 3LGNA 3FRZA 1RQ0A 4AQYJ 1V9OA 4LIWA 3ZZOA 4F0HA 3H5XA 3C2PA 3QJPA 1NHUA 3CJKA 2FDNA 4UOFA 4UOCA 2C3OA 1HQEB 2V8PA 1RAHB 5A8WB 3CD0A 3EXYA 1LXNA 4ES1A 2CZ9A 1XTZA 2ZNYA 4UY8T 3FBCA 3MF5A 1QE1A 4R8UA 1U6FA 4Z7YA 4M5MA 4B17A 2C2EA 2JH3A 2RQ4A 1WC3A 1N48A 1FDNA 3KLIB 4I69A 1JLCB 3GV8B 2R8GA 2FJEB 4UZBA 2XHCA 2HHHJ 3I32A 3L95X 4B3MF 3I9V9 1S7HA 4BS2A 4ZP6A 3W7BA 2DHAA 4TY9A 3FMWA 3DN9A 3UQSA 2WCXA 5LM7E 1M5VC 1RSCA 1Y0HA 3O2IA 1NJZA 4OIXA 2J7KA 3UNGC 1WEXA 3ENWA 4LFCF 3TAMB 2F9DA 3ZTRA 3OR1B 1LK5A 1X9SA 2VBZA 3PRDA 2ZH1A 2KO1A 2KL8A 4OYOA 4O0NA 2H5IB 3MMAB 3K5NA 4DQIA 1TMMA 4DN0A 5KT3A 4PCQA 3OJUA 2UXCJ 3V6HA 4WFNQ 3TI0A 2PN6A 1F5BA 3N5FA 2AGQA 2CDQA 2AJFE 2ASLA 3CSKA 1MN9A 4A8XA 4IRKA 4DV2J 3GYNA 1PGZA 2I8EA 3KHHA 5ETKA 5KG5A 3CJ0A 1U24A 4ECQA 2Z2ZA 4LT6A 2BZ2A 5AXMA 3MURP 2VG7B 5FLXU 4ZN1A 4WPAA 4NLRA 2ZC3A 3CCMS 1GNKA 4M5DA 1RHUB 3R5BA 4RW9B 3IN5A 4CLLA 1T0TV 1BQMB 2KXFA 4ELUA 3FGVA 1B0VA 5MAOA 3DRXA 5IT4A 4PKDB 1PJ7A 3RW6A 1VOMA 4JI4J 2H9ZA 5AE3A 2AD9A 3V4IA 4RX6A 3IBWA 2QEXS 2E5JA 2CPFA 4GO5X 5L1JA 4ZMMA 1T7PA 3V6DB 1NDCA 4P75A 2VASA 1LWCA 4UY85 1H72C 2QFIA 3I5BA 1WORA 3D6HB 5K20B 1HPZB 1K73T 1ZH5A 3PY8A 1N6QB 2QZ8A 3DOKB 2C3PA 1Y4ZB 1FNXH 1OY6A 3O8WA 2RU3A 4RW8A 2QA4G 1YLXA 5K5MA 4PG8A 1JJ2R 2V4JB 2IY5B 2CYYA 2ZUAA 3M6VA 1M90T 4M5IA 3PIPQ 4ZPAA 1YJ7A 4ZVOB 4X4OA 1JLQB 1XWLA 4B3OB 4F04B 1K44A 4DZDA 3RB4A 2VBWA 4FF2A 1IBCB 2QFJA 3HSDA 2QYCA 3KHRA 2DCUB 1J2VA 3GLJA 1OPZA 3G71S 3P5TL 4QW8A 3NCQA 2BR0A 3MAAB 3MR6A 3O6QA 1TKXB 4EK2A 1BWVA 4C0HA 4OQJA 3THPA 1WHWA 2HW3A 1D9AA 4PQUA 5IWAF 2XI2A 3RAXA 4IR9A 1IKYB 2BOAA 4DN9A 5FDLB 2UUCF 2VFTA 1Q0NA 4F3QA 4BC9A 4J9KA 5DS7A 5L1LA 3SDEA 4PWUA 4NMLA 3MPVA 3CMES 4JP8A 4YS2A 2D3UA 2VFSA 1SC6A 2HKEA 1FXRA 3BN4A 3R6GB 2UUCJ 4A8WA 2C42A 4F4AA 1H98A 1TUGB 1Z4UA 2BXJA 2UUAF 4H4KA 1CS4B 3FUYA 3H2LA 1SUQB 1HD0A 1HHSA 2AT1B 3DM2A 1RA7A 1JNRB 1KVKA 5EGYA 1FWKA 3BSAA 4A48A 5BJRA 3HHLC 2MTLA 3D5MA 1S99A 1YGYA 2Y1LB 2HBRB 4JI7J 3M32A 3RJMB 3IR5B 3P49B 1HQ2A 1OQ3A 3MMJA 2OSQA 3NS7B 4IR1A 3IG1A 2JEGA 3OL7A 1YJVA 3ZO7A 1AYEA 1P9YA 3CXCR 2JEFA 1EQMA 1TKZB 1XR7A 4K4WA 1EETB 1GMWD 1IQZA 1JLBA 2YWFA 3MTKA 4J90A 3M8PA 3CUNA 3HMJG 4OHVA 1FRHA 2EFVA 4ZPVR 2MMYA 5G0RB 4F02A 1U6ZA 2OHDA 1KOHA 2YWGA 4O4GB 2OO4A 1T03B 1SXLA 3GP9A 3V81B 1NNDA 2ZD1B 2BV3A 5K9FA 2IMWP 2O01C 4NA1A 2CWKA 5KG3A 2QRRA 1ZTWA 3M2RA 2ZBIA 2GIFA 3IBCB 3BSOA 2WB1D 2EFNA 2MKHA 1DY3A 3OTCA 4O44A 4PWDA 1VLOA 2B4PA 1RE1B 1WF0A 1B0TA 4YN3B 3CJ3A 2FC9A 2YX4A 1K1SA 4MK8A 1F2HA 3OR2B 2D1CA 2MQOA 4OZJA 2J0WA 1U1NA 3R5JB 4UQTA 2OSRA 4KHPJ 2F4VJ 2XEXA 1BE4A 4NZ7A 3MZIA 4QIEA 2F8EX 3I4PA 1SJFA 1XNQF 4X62F 3H25A 3QT5A 3KK1B 3ADAC 5K8NA 1N0VC 4ZIWA 3R5DA 3PZPA 4KFBB 1FD8A 2AYMA 4DXLA 4DX8H 5EWFA 3J7YI 1XNQJ 4YR2A 1VQ4S 1VJWA 2WHOA 4ED1A 2RHQB 1JXLA 1FRMA 3MM9B 1P1TA 4CZCA 3M8SA 1ZM2A 4LJMA 3M9MB 4QYZJ 2RKIA 1X5SA 4DSFA 8ATCB 1N36F 5AT1B 2XGQA 1S59A 1FCAA 2QV6A 1VQNS 3DRSA 3C15A 3EVWA 1K47A 3AD7C 1TMJA 2JVRA 3QRQA 3HJFA 3OXFA 3K5PA 1KDNA 1VI7A 4QIFA 2AX1A 3M8ZA 1NSKL 5F3ZA 4DMZA 3QGIA 4ZVUB 4MAKA 1B99A 2WZ1A 2DRDA 1AB8A 1B7YB 4ZHRA 2GVZB 1FXLA 4WP8A 3AJ1A 2I5JA 4LSNA 2HS4A 2LXIA 2PFDA 4NCGB 2BQUA 4IDKB 5KFIA 4WKRA 3KK3A 1HYSB 3BO4A 3NEKA 5LSRA 4MKAA 4Q44A 1TKTA 3QJJA 4W90B 1C4AA 5B0EA 1SKUB 5GMEA 3PVXA 5DZ7A 5J2NB 2ZHOA 5KFAA 4U9RA 3Q2TC 2JHEA 4EBDA 2ZM6F 3FRYA 4A8SA 4FF4A 2G0IA 4OZ2A 2GGPA 3HM9A 2XMJA 5I42B 3LOUA 2Q79A 4WWSA 2XS7A 1PIEA 3CDEA 3AXMA 1VRTB 2DXDA 1O6XA 2ZM6J 2O3DA 4KGXB 3KMQA 2NLWA 5KFYA 1H2UX 1HHQA 3JAMU 1M5KC 3CJ8A 2YWKA 4NMXA 2L41A 1NUEA 3SBMA 3HKZD 2CQPA 3ZC4A 1S12A 5ETSA 2AJ2A 2DB1A 2VD3A 4ALZA 2AJ4A 1FERA 2YPYA 1S9EB 3GYGA 3GB0A 4YFUA 2DNPA 1BQNA 4JUZA 4LSLA 4CO0A 4I64A 4K5SA 2ZOGA 1GX5A 2MGZA 1ZA1B 1NLKL 3LWLA 4J9PA 7FDRA 1MNEA 5LMNJ 1F5AA 5HP1B 1Q7LB 4C97A 1E6VA 4KYZA 3U7JA 1YJWS 3IR6B 3NAIA 2JEJA 4IO9Q 3NGRA 1SJRA 1WG1A 2CZVC 8RUCA 2ROPA 4OFZA 3IC1A 2UV8G 2VV5A 3PXGa 1I5OB 5LMUF 1CEZA 4KBIA 4DUYJ 2BYCA 1XIQA 2DGQA 2AWZA 3JSMA 3OHAA 2AX0A 1VQ9S 2DXFA 4DV6F 4OZ3A 2CJBA 5LMUJ 1HNXJ 4FPIA 3P8BB 2RRNA 3DU5A 3PFEA 3SCKE 3OQ2A 1UWBA 4LQ3A 2FHKA 4DV6J 3KJNB 4WBFA 4NLTA 1WEYA 1EIYB 5A8KA 3CCLS 4JI6F 1MLAA 4QWAA 2ASYA 1B0PA 4WFBQ 4GVLA 1S0MA 2QMUB 3M05A 4Q0BB 4H4OA 4BC7A 2IBKA 4JI6J 1EX8A 1NK8A 4BDPA 4M94A 4B3TF 2B9YA 1HWKA 2PIIA 2EVZA 2HSEB 1NJXA 3M8QB 1LWEB 3T5JA 2JVOA 3SFGA 2OGUA 4L74A 1C1BB 2OMLA 1NPPA 1YWXA 5KFLA 4B3TJ 5B7WA 3CMQA 3FFIA 2I0XA 2B6AB 1OJ4A 2P8IA 3B4MA 1FRXA 3AOAA 4IUFA 2EK6A 2IDEA 3EVOA 1RKIA 1TZ0A 4LFAJ 3BS9A 4K0KF 1DQ9A 4IG3B 2YKPA 2RF2B 3AB4B 1FWLA 9RUBA 3M4XA 3D7SB 4DBQA 5F41A 1RZMA 1AUSL 3CCES 1I6JA 4F2SA 2F8HA 3DFEA 5DG8A 5GMKa 3QPIA 2DY1A 1GXUA 2G0JA 4LBHA 1TAUA 2CQHA 3IRWP 5IT9U 2FTRA 2DNNA 1AW0A 3K5OA 4LREA 3KLFB 4NI2B 2OH2A 1RTJB 3W2WA 3V6JA 1UAWA 1FVQA 2XULA 1ZM3A 4Y0FA 2P5VA 1Q78A 4DQQA 3IAS9 4OYIA 1UP1A 2OKQA 1S6PB 4ELTA 1WWHA 3AA9A 4M1KA 3C14B 2V67A 3RZAA 3GWCA 4X84A 5KFTA 1UCNA 4I6AA 2HQDA 4WKYA 3I0SA 2OPRB 2DH7A 4CTAB 3IM8A 4YMEA 2VZ9A 2WB4A 3GR0A 2W25A 3MM6A 3RAQA 4H54A 3ZFVA 1HBNB 2GNKA 3O5TB 4KPCA 5HJYA 2M8HA 4G1IA 4YUDA 5CCLA 2UXBF 3LO3A 3ENQA 5AXLA 3CMAS 3E01B 4LF4F 4DCPB 4DUTA 5KFVA 3R5GA 1LW0B 1EZZB 1JLAB 1KSPA 4ID8A 3HZEA 5F8LA 4OYPA 3T1HJ 2YKNA 1W7WA 3MECA 4LF4J 2VQFJ 4AL7A 2WVCA 1U2CA 4U6PA 1IVZA 4UT4A 2EW9A 3D0GE 3D66A 2HIYA 4TKTA 2G9OA 2E7VA 2RQKA 2Y1RI 1ROFA 5U47A 2AYGA 2V8GA 5C24A 5B0CA 2R42A 2NS1B 1UW9A 1OSCA 4XPEA 3D1QA 4NYPA 3OVSA 4IFYA 2C2ZB 3VCDA 3FBEA 1YG0A 2OPSB 1RU2A 3TANA 4YHHF 2NXNA 1CULB 2ZH3A 3BO3A 4GKJF 4O4RA 3FZ2A 1LW2A 1JIHA 3VZIA 1Q79A 3DGPB 3DLKB 4GRSA 5F8JA 2FIUA 3CGIA 1AFIA 1C0TB 3DRPB 6AT1B 5D0GA 1VIXA 4GKJJ 2MZ1A 3ILOA 4K4VA 4J7CA 4DSKA 2JRSA 2ZWPA 1NO8A 2IM1A 3RAMA 1DHMA 4OI1A 3FC9A 3U27A 2GMLA 4X4VA 1UPMB 2XGPA 4DFMA 4L6V3 4CI0B 1JNZB 3TWZA 1PKUA 4X4TA 1I94F 1Z1ZA 2PMWA 5HN0A 2NXJA 2QA4S 2WAQD 2ZHAA 2YNFB 3TUJC 3KHGA 3HLUA 1SC4B 3N0VA 3KOAA 4TNOA 1I94J 3JSRA 2L9WA 5H9FJ 2LECA 1R3NA 3UDEA 4DX7A 3UN3A 4Q8FA 5LXRA 4OLOA 4XK8C 3R1HA 3J81j 4V19X 1GK8A 3M6XA 2WONB 2A1BA 3QLHB 1FDBA 1RWWB 3L4BC 3FEXB 5HMXA 2KFYA 1KS2A 3ILJA 4J9LA 3UCUP 2N3OA 3RBXA 2YNHA 4XPCA 1BD6A 5EWGA 3EDRB 4ED6A 1VFJA 2JLFA 1RYSA 3A12A 4LF6F 2HQGA 3HCXA 4IH7A 3MOZA 4HL9A 1MMLA 5CA5A 2R8IA 3GV5B 4LF6J 5KFMA 2CADA 2D3O1 1X31C 3QT6A 3OFEA 2FHJD 2EFQA 2C22A 5J2PA 3A1YG 2IPOB 1WI8A 3A3OB 1QAXA 1F0XA 3D1HA 4AL5A 1WC5A 1NK9A 1IWAA 1RACB 2L3MA 1WOPA 2BJ8A 3CIMA 4WTYA 1Q1KA 1AFJA 3UN5A 3R2DJ 1IJFB 5KFRA 2DRBA 4U96A 5KT7A 5CXTA 1Q16B 3BH6B 2CA9A 4LF7F 1WKLA 3DU6A 2XSJA 2ZFHA 2I6WA 4CO3A 5GADU 3PR5B 2EKYA 4C8NA 4KKOA 1RBAA 4DR7F 3D3BJ 1NB7A 3IR7B 2KRBA 2AW0A 3GG1A 3O3LA 3MM8B 3TAQA 1ZAXA 1NEEA 3VF0B 3VTIA 1HW9A 4I56A 1ULRA 2Z30B 5DDOC 2QMWA 1N32F 3P4UB 3S7RA 1FK9B 1DLOA 4J9UE 1U0SA 2B4VA 4G1QB 2MKKA 1XMQF 1B70B 3EZOA 4MK7A 3DOLB 4WE1A 2VJUA 4U7UK 4B3RF 1N32J 4RW6A 2V94A 3EXCX 3ISZA 4KHMA 2MQ8A 2Y3YA 1WI6A 5CZXA 3OSNA 4N5SA 4B3RJ 3VAHA 1LKZA 4PG4A 1RTDA 3MPUB 3W8GA 2LKZA 1N52B 2H65B 4DSEA 1GMVA 4PABA 2HIQA 2QE5A 4CIOA 1S97A 3A8EA 5D77A 2W8KA 1HNZJ 3EMTA 3LPEA 1QVFR 4RR5A 3JTPA 3KLVA 4LR8A 2K3IA 4ED2A 4CLKA 1UVJA 1VDHA 4YQWA 2AEMA 1TFYA 5DM7Q 3LPYA 5IM0A 2H5JB 2CG4A 1NK7A 4B9UA 4RW8B 1HNWJ 3U1NA 5HL7Q 4P2XA 2QJ3A 2MY7A 4N41A 4F4KA 2K2PA 3NRBA 3FCWA 1GMWA 2JOQA 2BM1A 5HVGA 3TUPA 1HI0P 1R0CB 4JYAF 2B5JA 5KFZA 1R27B 1HBMA 1WTBA 4MIAA 3ISND 2U2FA 4MYUA 2FJBB 3SCLE 3HK2A 2XYGB 1U02A 3AFGA 3W5ZA 3ZTOA 5IFMA 3NGSA 1Q82T 1VIOA 4GVBA 2FGCA 3HVTB 3J81Y 4DUZF 4DWIA 2KB2A 4KSEB 1UWAA 1WF2A 4FVMA 2CPJA 2V4QA 1SC1B 3B6BA 4D3GA 1RUSA 2R7VA 3TZXA 4OJ3A 4UF4A 2BW2A 2EFOA 1RBOB 4K50A 4DUZJ 2HVEA 5HQLA 2QYGA 4CO1A 4PQUB 4QWEA 1ZS6A 2OELA 3JYTA 4NZ0A 4I2PA 4ZP8A 2DBBA 1U0HA 2LQJA 3SDEB 2CPEA 1WG4A 3BGLA 4BWMA 2GJFA 4TU9A 2CRLA 2L9DA 2CJ9A 5I4MA 4ZCLA 1UFKA 4UQGA 3HSJA 1CC7A 2XG8A 2YVSA 1ZZFA 3CEDA 1RTHA 1WOSA 1X4AA 3MEDB 3MWBA 4C8LA 4OX6A 2DGSA 4UTGA 2XHWA 4E98A 4IYQA 3UFCX 1GX6A 4J9OA 3OFHA 2WRMA 2FZGB 2H3EB 4RNMA 4B3SF 3GTYX 4RBTA 2VA2A 2DCLA 2HVDA 3MXHP 1J5OB 3A8JA 3ITHB 2YXLA 2M3DA 3LAKA 2GQQA 3DRRA 2P6TA 1XNRF 4B3SJ 3TRGA 3IG1B 9ATCB 2W9CB 2DVIA 3DMJB 5CZVA 4CM2A 4X4PA 4Y6IA 4HT7A 2MLYA 2X3GA 4CLWA 4KH0B 3CW2C 1Y11A 2IM0A 4Q8EA 1XNRJ 3LAMA 4A8FA 3OFGA 5DRKA 2J0SD 4LUBA 4Y65A 1NJYA 1K0TA 1U7LA 1Q81T 3VVTA 4HT5A 2HURA 2XNQA 5C5JA 1AA1B 4TXSA 4OHXA 2O5DA 1UJ4A 4X64F 5KG1A 3BGRB 3R3TA 2EFGA 4P71A 2BQ3A 4WJBA 1L3KA 4LFBF 2BE2A 4FVCA 3CT9A 2YTCA 2KVIA 2BE9B 5KFSA 2GHVC 4F2RA 1NKCA 4XAKA 1S4FA 2HGNA 4WFXA 3A4TA 2DIVA 3BBFA 4O44B 4PWDB 2XLIA 3C6UB 1WNEA 4ZP7A 2OEKA 2W4PA 4DSIA 5IXUA 5KOXA 1IUJA 2DNYA 1TV6A 2Y0BB 2YY3A 1FJGF 4ZN3A 2V8VA 4AE5A 2F40A 2EKNA 5KFBA 4TY8A 2VFVA 2A2CA 3KWMA 4FF1A 4DR2J 2R4FA 1FJGJ 1S6OA 1LFWA 1TK5A 2HPUA 2FVCA 1RKJA 5HAOA 2B7BB 3L7PA 1FT8A 5GMDA 2IAJA 3BR9A 1Q8BA 3ZZTA 2QO3A 4WU2A 1C1CA 3DLGB 3C3LA 2PDAA 2NUUG 4WXWA 1S9GA 3SV3A 3LANA 3OL9A 1FNMA 3CD6S 1T3NA 4O3NA 5IC4B 3ZNJ1 2HWHA 1U8SA 3K59A 1YZ6A 2E5HA 1YJTA 1VBZA 4RW4B 2RMLA 4JV5F 1HNIB 1IKXB 3OUYA 3HVAA 4JI0F 4F4ZA 1G3OA 3NS6A 2XB2D 2OIHA 2NPIA 1PYOB 2J7WA 2GAGC 4J37A 3L09A 4U95A 2MSSA 1J5EF 4JI0J 4YR0A 5E3CA 1N0UA 3DRYA 1Q5VA 1HNVB 1J5EJ 3KJQB 2G1DA 3NCPA 5LSLA 1SL2A 3AD8C 3CJ2A 2EBGA 3DDNA 4C8OA 1KC8T 4DV7F 2KFZA 2WVDA 4LSNB 1FKOA 1S76D 3H0PA 3M30A 3NNCA 2Y9HA 3KK3B 4EUVA 2POKA 4RU2A 4WZQA 1CJUB 2GA7A 4Z2XA 2FJVA 1RHRB 2AYBA 4DG1A 1FTCA 4MFBB 2ZKUA 1N88A 4J9VA 3GJTB 3CCWA 2FB0A 2J6TA 1GT8A 1WHXA 1LFPA 1YJUA 1RHJB 3RG6A 4PG5A 4DX5A 1F9HA 1UKUA 1T02A 5DDQC 4QBUA 3N4WA 5DO2A 1M5OC 4HDGA 1ICEB 5BYSA 4KGVB 3ZZYA 3NXZA 3U1LA 3LGMA 3MAQA 2MGZB 3W62A 1MU2A 4RO0A 4ZK7M 2ADCA 2WBRA 3SV4A 3Q2SC 4RUCA 4Y2IA 1KTVA 1E6VB 3BKFA 2MKYA 4MH8A 4DFPA 2X1AA 2FUG9 3BQ2A 2YNIA 4X2BA 5BR8F 1O0PA 2DNZA 4H4MA 2VPYB 1RWPB 2NXUA 2ZUGA 4K4ZA 3H98A 2QLWA 3JSMB 3OD2A 1RAEB 5BR8J 3M2UB 3UCGA 1RT4A 1GXLA 3QMQA 2FGOA 3SFUA 2C2RA 1G2EA 4LVNP 5E5NA 3QAUA 4ETXA 1HL6A 3EX7B 1KOOA 4ANEA 4YR3A 2V4RA 2J9EA 2CDRB 1NK0A 5KAKA 4JI5F 2NZ4A 1TL7A 1RT5B 2IJRA 7AT1B 2A6MA 4OYZA 2VHGA 4NWBA 4DV3F 3NGKA 2V2ZA 5L38A 3KLEA 1QM9A 1U49A 4P7TA 2A0FB 2N4DA 4DV3J 1U25A 4ZCIA 1RCOB 1FI4A 4IQMA 1VQ8S 1R0BG 1S5ZA 1FTRA 4C8YA 4QR1A 3W65A 3AHPA 2KT3A 3BREA 1FFGB 1H73A 4O0IA 1RT7B 4WTOB 2UZAA 4JB8B 3FVYA 4WF9Q 4FXDA 1JLGB 1JLFB 4FYYB 3H8YA 3Q8YA 5E0OA 3CCSS 2NSCA 2DGXA 5KFQA 3EDQB 5DGAA 2FHOB 1PYTA 3TVZA 3CTRA 3PIOQ 3C6TA 1PC4A 2DGUA 2A18A 3JQMA 3PRBA 1SJQA 4IFVB 3A3PB 4KGMA 1NZAA 4DS5A 3HKWA 2NZCA 3EGNA 3L9ZA 4L75A 1SC3B 2ZBRA 1IQTA 4C9DA 1HBOA 4PPZA 1RT6B 2ZITA 3MM5A 1KVJA 3RRGA 3U1MA 1NZ8A 1RYRA 2MLZA 4C0OC 4DPOA 2XC9A 4WIQA 3I0RA 3MR3A 3AD9C 1SIZA 2DY9A 5CYMB 2UU9J 2SXLA 3HF5A 2CQ4A 3OJSA 3MUMP 5CD4A 2JL9A 1XMOF 4X65F 2YKMA 3M9OB 1KNZA 3ULHA 2DR7A 1R31A 4HDHA 4IOAQ 3R9LA 3KTQA 5KFDA 3IO1A 1XMOJ 1DURA 5DQHA 2F1FA 2DR5A 1PJ5A 2C2DA 2GMJA 3M1VA 3D0IE 2XMVA 2AJ0A 1Y5NB 1KQKA 2M88A 2MYFA 1ZA2B 2XLKA 4RNOA 2HNZA 2UUBF 1TR0A 4HACB 1HKAA 3S8SA 4EO6A 1KQFB 1MMNA 3BBCA 2XYPB 1A6LA 4OHZA 4DCJB 2B9EA 4R5PB 3NGDA 2UUBJ 1VISA 3DLEA 4U7UD 2K3KA 3HDSA 3MECB 3SQGB 1UFWA 2X1BA 4I7FA 4O3OA 3POTA 2ILZA 4I4BA 1VQOS 3ELHA 2DH9A 2BJ7A 3VV2B 3PEJA 2QSFA 3AJ2A 4O3SA 3FJ2A 2J7UA 4X4NA 3P96A 3IWXA 3T9NA 3R7NB 3EJMA 4MYTA 3PX0A 4ECVA 1RWMB 4A47A 3LP1A 1N5YA 2C28A 3RBEA 4GMKA 2M2BA 1UVKA 4IFYB 2DHGA 2E5LF 4KPYA 3OTEA 4FN5A 1DRZA 1YQHA 1XERA 2BANA 3H40A 2FHJA 5KG0A 3NKYA 3HVWA 1NM2A 4MT1A 1PAUB 2RUSA 1H38A 3W64A 4JI8F 5JVHQ 1D9DA 1SQEA 3IGVA 2HZAA 5IS2A 4J9QA 4V1Ak 3VAFA 1ZM9A 2LFVA 4OL8A 2HYIB 5KFCA 1I1GA 4JI8J 3B82A 1ELOA 1PJ6A 2GHPA 5J2MA 2GZOA 1DTTB 2LDIA 4FXVA 2FC8A 4NYOA 2CQ3A 1IKWB 4NEZA 1D09B 4WFYA 3QIPB 1PYSB 3N28A 2AU0A 4LF9F 4CP5A 1LOUA 5D8HB 4FYWB 3CIZA 2YWEA 3GCXP 3CO9A 4IOCQ 1X7VA 1RAFB 4OHWA 2PT0A 2HK2A 3TYTA 3UD5A 3EPGA 3KDNA 4LF9J 1AZSA 4DHVA 2XY5A 1Q53A 1T05B 1WHVA 4GKKF 2RIJA 3VGUA 2QLFB 1TL1A 2NUHA 1RTIA 2YH1A 4CO2A 2J6UA 4ZJQA 1JKHA 2XO7A 3KJVB 1IXKA 1YJ9S 2NXCA 2VG6A 3CC2S 5HROA 3CCRS 3EM1A 4GKKJ 3ZNUA 4Y2AA 1P1LA 5D15A 1S48A 2CWXA 4JI3F 5KFHA 1LK7A 3T5HA 2F8MA 1YSJA 3MFHA 2NXEA 3DLJA 3LP0A 4C0BA 4OX8A 3OTDA 3KHLA 4C8MA 5HLFB 3NGTA 4OMFG 1WDTA 4M63A 2LQ5A 1K9MT 4RPFA 5CABA 4NEYA 8AT1B 5DGBA 2M0GB 5A6PA 3MD3A 4F4WA 4RNFA 4F3OA 3LP2B 4G1PA 2CG8A 3RTVA 1RP5A 2VODA 4DF4A 3AY0A 2XWXA 1U47A 2BKNA 1NK6A 1QUVA 3TQEA 3HVRA 2J5AA 2LLZA 2KXHA 1YHQS 3EE3A 2DD8S 3BKTA 2ZNZA 2VA3A 4UOHA 3A3NB 2XMKA 3G8SA 4XTTA 5A8WA 1T11A 3GPAA 2AJQA 5L9NA 1JJ4A 1BWEA 1S1WB 1REVA 2ZOMA 3W8PA 3G8QA 4F4XA 3JTOA 5A8RA 4KKOB 2CXEA 1RWXB 1V6HA 1ZETA 4USHA 3KG4A 2W24A 1R0AB 4KAIA 3DLBA 4O3RA 4MIWA 3ZZ0A 3MCSA 1FWPA 2ZBCA 3KLIA 1W25A 1JLCA 5ETNA 2XZTB 2ACYA 1FJEB 2IHR1 2KZMA 4FNIA 5B0AA 5LL6d 3IMQJ 5C42A 4DR6F 2YH0A 2ZVSA 1D0EA 2FLPA 1Q8IA 2CQIA 2MDAA 1U09A 3ILLA 4KC5A 1NDLA 5FLXY 1WD6A 2B43A 4KHRA 2R7WA 3TAMA 1VC5A 4J5OA 2IBOA 1LWXA 1OYEA 3OR1A 5D0HA 2OD6A 4RBUA 3UD3P 3I5AA 4EBCA 2HFZA 3MMAA 4DR3J 3K58A 2O66A 3MPYA 1UJ5A 5HBMB 3EUNA 4WK1A 4DR5F 1N5TA 3PKYA 1KHVA 2M52A 3D6MB 2UV8A 3QQCD 1NSQA 5HVHA 4RNNA 2J8AA 1RA6A 5A0YB 3AAWB 4DR5J 3CNQP 3NMAA 1ZBTA 1KN6A 3MGJA 1U26A 4CM0A 3MUTP 1JQGA 2GMHA 3PNIA 1AUDA 2CJKA 4DLGA 3GILA 3GONA 3PYGA 1KP6A 5IM0B 1Y7PA 4R0JA 3ZZUA 4ZDNA 3AOCA 2MKCA 4QOTA 2VG7A 2HMIA 1H2VZ 2KT2A 2HQIA 2HNDB 4X66J 1RISA 2G2ZA 2MB0B 1IBKF 4KR0B 4RW9A 2KVQE 4O3PA 3HHLA 2L48A 2B5JB 1BQMA 4N47A 3GSDA 2E5IA 1F9FA 4F36A 4B9VA 5EUHA 2YQ0A 4FKXA 1T8EA 4LF5F 2ZKTA 2DNHA 4I2QB 1HQUB 1HHTP 1RWVB 4Z7CA 1NMEB 4Y00A 1X0PA 3KUGA 1TL3A 2PE8A 1R6VA 3GIMA 4GVBB 2V9KA 4DV0F 1F3FA 1WF1A 3V6DA 2OEJA 4QU7A 3VAJA 1EQ0A 3RW7A 1DQAA 3CCQS 1HPZA 2DJWA 3AXKA 1N6QA 4B3MJ 4YB7A 2L08A 3DOKA 4O3QA 1QAIA 1ZM4A 3MEKA 3KG0A 2CJYB 4E8UA 3TUZC 3JYTB 3RRHA 4BCAA 4ZITA 4KV8B 5C2GA 3LTOA 4S0MA 2FHMA 2V4JA 2JFDA 1L3VA 3CDAA 4LFCJ 3F56A 4DOZA 4CLPA 2FLNA 4A8OA 2GAHC 1JLQA 1VQSA 3PCOB 4CLUA 4B3OA 2B3TB 4N8NA 1TK8A 4TYBA 2YX7A 3MHYA 5B0FA 2HS0A 1MROA 1RAOA 4RUHA 3C19A 3BN7A 5HMZA 1VC0A 2DIUA 2OPQB 4NPOA 5GVQA 1C4CA 3J81U 4P10A 2PA8D 4USUA 3ZZPA 2XCAA 4EEYA 3QGGA 5D4PA 3MAAA 2DNRA 1FNOA 3ENAA 2YKAA 3M8RA 3G96A 1YJNS 4Y28C 4ILMA 1HD1A 4NX9A 1YBAA 4LRBA 4Y3CA 1UTAA 4C3KA 2KHCA 3DRRB 3I4HX 1H74A 1U1KA 5FDLA 2GHWA 4UZCA 4P7VA 2HVIA 2M9KA 4OJ1A 4ZVPB 4DL4A 2NYIA 2QA1A 1UVIA 4K5RA 2QL9B 3NNHA 4C11A 1C2PA 4NXNF 3VAMA 2R7UA 3BQ0A 2V6AA 2Z57B 2L9NA 2WVFA 3K5LA 1F3VA 1XJWB 1CS4A 1SUQA 4NXNJ 3SCJE 4M5JA 3TEGA 5GAGU 2IRYA 2E9TA 2FLLA 1X4HA 4PG7A 4I0WA 3JQJA 3DOMB 1RU1A 3ISNC 4W98A 2XM3A 3FZBA 1IJEB 2Y8WA 1GMUA 1TTHB 2QSWA 2XQCA 2GIRA 3TOQA 5EWEA 1Y9OA 5E33A 5JXSA 4KQZA 1NJWA 1TV6B 2VPWB 1V3RA 2EC2A 4PUOB 1JJCB 4TY8B 5THWA 4HEA9 1MSWD 4NLQA 1EETA 2KZZA 3TUIC 1PO6A 3MMBA 1YK9A 2GV1A 2Q6BA 3TX0A 3IA0A 3TJAA 2KJWA 2LQ8A 3VHQA 4PRFA 2KI2A 2NREA 3W1YC 4O4GA 3K17A 4B9MA 3KNAA 2VJVA 2VBYA 1Y3JA 3QT7A 2E29A 2HQFA 1W2IA 3V81A 4ECXA 1DFDA 4FKYA 3NWGA 2ZDOA 1M5PC 1RLDA 2DHHA 3HJVA 3OLBA 3TEHB 3OUYB 2VC0A 4RL1A 4LBPA 4YEAA 1JLEA 1SQFA 2KG1A 3JS9A 4RBVA 4Q45A 5CH7B 5IWAJ 1SB6A 5D4LA 4RZRA 3OR2A 4A4JA 2HHQA 2XLJA 4NLOA 2FZKB 2LU2A 4W4MA 2BKOA 1NKEA 3PHTA 4EO8A 3T6JA 1UJ6A 2BE7D 2OLWA 2ZZNA 1GTEA 2OUGA 2HFOA 3CCTA 1T9UA 4F26A 3QZ8A 1SH2A 1FKOB 2C2MB 3KK1A 3T1YF 1QSLA 2UUAJ 4CDIA 3BPSP 3D6FB 4DV5F 1SBRA 4OLPA 1H0HB 5GADI 2CFXA 4HHJA 2UVWA 2K06A 4ZP9A 2G4BA 3OTOF 2IA6A 3FSIA 2F63A 2MJNA 2HGMA 3CDUA 1RABB 1HBUB 2MZTA 1FDAA 2QLJB 5FD1A 4YDXA 3V2UC 2FJAB 1NJIT 2PO4A 3GIIA 3NCRA 3P6YC 3L7OA 4AXIA 5ADZA 4RNHA 2H1YA 3N6LA 3MAHA 2OTLS 5DDRC 2DT9A 4DL5A 5LXYA 2DGTA 2W8LA 3WBZA 2MPUA 1OPIA 2GVDB 3UWTA 2ALYB 5KFUA 2IC3B 2X7IA 2HBYB 3CWJA 1OWXA 5A2QY 3PYEA 4IDKA 2AYEA 3C66A 1NPKA 2RHSB 3F44A 1WC4A 3BYPA 3GV7B 3NGUA 2N3LA 2H5EA 4U8VA 5D0EA 4URQU 2DYAA 3W61A 1GXTA 3KMSA 1U4BA 3R97A 1RT3B 5I42A 5F8NA 2YNIB 4OI3A 2WBMA 4QWBA 4AYBD 4ZVSB 3GIRA 2NPFA 2BW7A 2HFVA 3X1LB 3W63A 1VHIA 2VOPA 4RKUC 2HAIA 1CLFA 1RT4B 3MMCB 2ZBPA 3K5MA 4WP3A 3KDOA 3HHKA 1S1TB 5LSOA 4CT8A 3WDOA 5KOWA 1S9EA 1FF2A 3HFKA 2HRUA 4X62J 3D67A 4N7TA 4CNZA 1FKAF 5ETRA 1T95A 2R7QA 4DL0C 2UUWA 1DTQA 1XN9A 1RAAB 1YX2A 1Q95G 3G6XA 2C2NA 5J1EA 5HP1A 1CJVA 3MR2A 4DFKA 4YDDB 3UW1A 3KLEB 4PYAA 2GS8A
chains in the Genus database with same CATH topology
1YBUA 4OYAA 4P2XA 4USWA 4P2FA 3G82A 1CJVB 5D0EA 1CS4B 3C14B 3C15B 1CJUA 1AZSB 3UVJA 4CLZA 4CLLA 1YBTA 4CLPA 3C16A 4OZ3A 1CS4A 2QV6A 3C14A 4P2MA 3C15A 1AZSA 1WC5A 3UVJB 4CLUA 4CLTA 3C16B 2BW7A 4OYMA 1WC6A 4OYOA 2GVZA 1CULB 5D0RA 4CLYA 2WZ1A 5D0HA 1AB8A 1TL7B 4WP3A 3MAAB 2GVZB 4USUA 4WP8A 3MR7A 1CJTB 1CULA 1FX4A 4CLFA 5D15A 1TL7A 3MAAA 3R5GA 2GVDB 5D0GA 4OYBA 4OYXA 4OYZA 1CJTA 4OYPA 1WC0A 4CLKA 4NI2B 4USTA 4CM2A 1FX2A 1U0HB 1WC3A 4CLWA 1CJKA 4OYWA 2GVDA 1Y11A 3ET6A 5IV4A 1WC1A 1YK9A 4NI2A 4WP9A 1Y10A 1U0HA 5IV3A 4CLSA 3G82B 1CJKB 2W01A 1CJVA 4CM0A 3ET6B 4OZ2A 1CJUB 4USVA 1WC4A 4OYIA 4WPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBU A;  4OYA A;  4P2X A;  4USW A;  4P2F A;  3G82 A;  1CJV B;  5D0E A;  1CS4 B;  3C14 B;  3C15 B;  1CJU A;  1AZS B;  3UVJ A;  4CLZ A;  4CLL A;  1YBT A;  4CLP A;  3C16 A;  4OZ3 A;  1CS4 A;  2QV6 A;  3C14 A;  4P2M A;  3C15 A;  1AZS A;  1WC5 A;  3UVJ B;  4CLU A;  4CLT A;  3C16 B;  2BW7 A;  4OYM A;  1WC6 A;  4OYO A;  2GVZ A;  1CUL B;  5D0R A;  4CLY A;  2WZ1 A;  5D0H A;  1AB8 A;  1TL7 B;  4WP3 A;  3MAA B;  2GVZ B;  4USU A;  4WP8 A;  3MR7 A;  1CJT B;  1CUL A;  1FX4 A;  4CLF A;  5D15 A;  1TL7 A;  3MAA A;  3R5G A;  2GVD B;  5D0G A;  4OYB A;  4OYX A;  4OYZ A;  1CJT A;  4OYP A;  1WC0 A;  4CLK A;  4NI2 B;  4UST A;  4CM2 A;  1FX2 A;  1U0H B;  1WC3 A;  4CLW A;  1CJK A;  4OYW A;  2GVD A;  1Y11 A;  3ET6 A;  5IV4 A;  1WC1 A;  1YK9 A;  4NI2 A;  4WP9 A;  1Y10 A;  1U0H A;  5IV3 A;  4CLS A;  3G82 B;  1CJK B;  2W01 A;  1CJV A;  4CM0 A;  3ET6 B;  4OZ2 A;  1CJU B;  4USV A;  1WC4 A;  4OYI A;  4WPA A; 
#chains in the Genus database with same CATH topology
 3GIK A;  4A8M P;  2RRA A;  1V5I B;  1N36 J;  1HFE L;  3P5B P;  1S0O A;  4PZV A;  2XSF A;  2V9W A;  3QSY B;  3PAC A;  4K8R A;  2IIH A;  3CD5 A;  3TO8 A;  4OZ5 A;  4NXM F;  1LWF A;  1K1Q A;  1OMS A;  1UEU A;  1N33 F;  4RUB A;  5HAT A;  2F4F A;  5HO4 A;  7FD1 A;  3UNY A;  2CVE A;  2ROG A;  1HMV B;  2B8Q A;  1X4F A;  2IVF B;  5AJ3 F;  2CPZ A;  4C48 A;  2RNE A;  2ERR A;  5DG9 A;  3THT A;  2KFN A;  4U7C A;  1Z2L A;  3PM9 A;  2W7O A;  2MY8 A;  3BH7 B;  5HSP A;  4Q0B A;  3R2C J;  3KUE A;  2ASJ A;  1X4E A;  2MZR A;  1RAG B;  2BBE A;  2MZJ A;  3QFH A;  4WCE Q;  3WIU A;  1Y10 A;  3BEG B;  1L5U A;  1FKP B;  4B9T A;  2VG5 B;  1HLW A;  3M8Q A;  1LWE A;  1VMB A;  2RDI A;  1C1B A;  4UW2 A;  2QG9 B;  1F1B B;  2KXN B;  4OX9 F;  3D0H E;  2B6A A;  1N4L A;  2KKH A;  5L39 A;  2KM8 B;  4ATN A;  1CSJ A;  2H54 B;  3HSZ A;  4OX9 J;  1SV5 B;  2XBP A;  3H2V E;  3IBF B;  1G7C B;  1F2G A;  2W4D A;  2VB6 A;  1HWL A;  2YKM B;  3FBB A;  1CG2 A;  4ANC A;  1S1U B;  4IG3 A;  1S6U A;  4Y34 A;  4CLY A;  4ID5 A;  2RF2 A;  4HKQ A;  4FF3 A;  1S79 A;  4QPX A;  1FES A;  2DTJ A;  1IWG A;  3FCV A;  4IOB A;  2YNG B;  1UL3 A;  1UVM A;  3M1V B;  3PO4 A;  2BKP A;  3FNN A;  4HTJ A;  1KLM B;  4WYL A;  4ZLJ A;  1ZAV A;  1UA0 A;  1SJ3 P;  3IWL A;  4ZVG A;  4DX6 A;  3GFX A;  1FE4 A;  3Q24 A;  1GH8 A;  2V34 A;  3KLF A;  1UW4 A;  4JBC A;  5CCM A;  4NI2 A;  2BAC A;  4JI2 F;  3FBF A;  3DHX A;  3G82 B;  1RTJ A;  2JC0 A;  1S4E A;  4YY3 F;  5BXI A;  4C3L A;  1JXE A;  3DLE B;  4ZPC A;  4DV4 F;  2N7C A;  2ATL A;  3X3U A;  2BDP A;  3SI8 A;  4CYU B;  2LU1 A;  1FRI A;  4Y2K A;  2RS8 A;  2BM0 A;  3W2V B;  1APS A;  3PDN A;  3AB2 B;  2FVQ A;  3C14 A;  2XMU A;  2CQ1 A;  2PEB A;  4P74 A;  4OZ0 A;  2DNL A;  2IMO A;  2OPR A;  3MEG A;  3I31 A;  4CTA A;  3VAI A;  1HI8 A;  2Z58 B;  3EIC A;  1NPR A;  2ATC B;  1PBA A;  3EZ5 A;  3CD7 A;  1K0V A;  3K89 A;  4KB7 A;  4TVA B;  1HBN A;  3ZTQ A;  2MKI A;  3HHN B;  3SSQ A;  4DPX A;  5DDP C;  4KO0 B;  2MHN A;  1JX4 A;  5DLF A;  1CBK A;  3BB5 A;  3I55 S;  4AT1 B;  3E01 A;  2R8K A;  2VF3 A;  1BMQ B;  2J6S A;  1F6T A;  4BBY A;  1LW0 A;  3PW5 A;  2WW8 A;  1A7G E;  3M2V A;  3TQ1 A;  1Q8L A;  2CQ0 A;  4DLE A;  3H7H B;  4HI2 A;  1JXV A;  1Z2Z A;  1S1V A;  1VQP S;  1ZOT A;  3DI6 B;  5L46 A;  2DIT A;  3N9U C;  4ZVF A;  3ZZR A;  2CPY A;  3RGI A;  1I51 B;  2Y0S D;  5IOL A;  3UI3 A;  2BOP A;  3BQ1 A;  3QAE A;  5H9E K;  5D3G B;  4K0K J;  2E5G A;  5J1N A;  2PMZ D;  1TUV A;  1HAR A;  2DO4 A;  4FXW A;  2UVV A;  1X4B A;  2U1A A;  3QO9 B;  3UR0 A;  2OPP B;  5HI7 A;  5T7L B;  1IBL F;  3DYA B;  1WJ9 A;  4W92 B;  5CYQ B;  3CJR A;  3GYX B;  3IRX B;  1TVR B;  1PBU A;  4DZ6 A;  2OPS A;  1JJH A;  2F65 A;  1VCT A;  2VIC A;  5D6G A;  3H5S A;  3UN2 A;  4K4X A;  4OI2 A;  1IBL J;  2V50 A;  4YOE A;  3VQT A;  4LRD A;  1CUL A;  2BX6 A;  3N79 A;  3ONQ A;  1NH7 A;  1NK4 A;  4LQ9 A;  4F50 A;  1R8A A;  2RQC A;  3DGP A;  3DLK A;  1PSD A;  4IH5 A;  3E2E A;  1KR4 A;  1C0T A;  2ASD A;  4ZPT R;  4L3K A;  4B08 A;  1N56 A;  4DR4 F;  4C7Q A;  3MEE B;  4YB1 P;  5J1P A;  2MJU A;  3LP0 B;  1V5V A;  3N01 A;  5FJ4 A;  2H48 B;  1RHM B;  3E51 A;  4N77 A;  2VFR A;  1WAC A;  1R7I A;  5K14 B;  3Q8Q B;  3PKM A;  4LRA A;  4ED5 A;  3QFW A;  2WTF A;  4AUK A;  2YX1 A;  5E3Q A;  1FRK A;  4K4T A;  2Z2M A;  1VGY A;  1SQG A;  2V5H G;  1KFD A;  4NCB A;  1DJ0 A;  1WEZ A;  1VRU B;  1T9X A;  4PQA A;  5CAA A;  3Q8P B;  2YNF A;  4LR9 A;  2CQG A;  2CJX B;  3KFW X;  1KD1 T;  2XZD B;  2W9A A;  4AQY F;  2UXB J;  2D41 A;  1GAO A;  2W2N P;  1BXN A;  3D4J A;  2WON A;  1MWY A;  4CLF A;  3UE2 A;  1RBL A;  1AXQ A;  3QLH A;  1VRQ C;  3NBP B;  2OJ3 A;  1JK9 B;  4L73 A;  3TA2 A;  2G13 A;  2IVY A;  3KLG B;  2IJN A;  1RGV A;  2D3O R;  3ETO A;  2PEH A;  2I9S A;  2ZC4 A;  3KUH A;  1TQL A;  4ECW A;  2DR6 A;  1S57 A;  2AV5 A;  3AQO A;  3J80 Y;  1REV B;  1FDD A;  2WOM A;  1VR6 A;  3FCH A;  5A8R B;  3KK2 A;  3UDV A;  1O8B A;  2HHH F;  1IKV A;  4PEO A;  4ZLP A;  2ZE2 A;  3OV7 A;  3I9Z A;  3CPW R;  3THV A;  4MK9 A;  1NHV A;  2EWH A;  3IP0 A;  4USJ C;  1S1X B;  1RAI B;  4ECT A;  5C42 B;  5K8M A;  2BVZ A;  4JV1 A;  2HHT A;  4OYM A;  3CCU S;  4YHH J;  4ZCM A;  4LRF A;  2XS2 A;  4XIU A;  2COL A;  4IG0 A;  5E7O B;  4M8L A;  4ZS6 A;  2QGF B;  1X5T A;  2HHU A;  4WFZ A;  2LCW A;  4CO5 A;  2HS3 A;  1CJT B;  1ZZN A;  2UXC F;  2JNJ A;  5GAH U;  2ZZT A;  2CNL B;  2AGO A;  1FA0 A;  4C6A A;  1B7F A;  2IA0 A;  4ILR A;  4L3N A;  4BLG A;  1NB2 A;  1RTZ A;  4F0K A;  3EYZ A;  3CDW A;  1IR2 A;  4DV2 F;  2WVE A;  4OI0 A;  5EX3 A;  3MM8 A;  1OY9 A;  3L3C A;  4OX7 A;  2V8H A;  3KLH B;  5LJ5 Y;  3DLL Q;  4ED7 A;  3PR4 A;  4OI4 A;  2W9B B;  1CVJ A;  1G4C A;  4RW7 B;  1T9W A;  3G6Y A;  5D78 A;  3ZZZ A;  4X4U A;  1U1M A;  1FK9 A;  1SH0 A;  4G1Q A;  5EX0 A;  1W2B R;  3DOL A;  1Q86 T;  2OAU A;  2HMI B;  1Q4R A;  2BJE A;  3CJK B;  5T14 A;  4KRW A;  1EKR A;  3G6V A;  3HHL B;  4JI4 F;  1GEH A;  3KKF A;  3LW5 C;  3SXL A;  2CNO B;  2CVI A;  3PV8 A;  1QE1 B;  4R8U B;  2CZ4 A;  3G87 A;  1SCJ B;  2ZVI A;  2B51 A;  3QZ7 A;  3UDC A;  1WC0 A;  2RAQ A;  1TL3 B;  1NSP A;  1RAJ A;  3JTN A;  3RRK A;  1CJK A;  3UO0 A;  4WP9 A;  5BYR A;  1YTY A;  4EYI B;  3NOG A;  1P6T A;  1SKS A;  2EFP A;  1KWM A;  2OP5 A;  2LXU A;  1RXO B;  2DPJ A;  1VQK S;  2UP1 A;  2RS2 A;  1O5J A;  5CQG A;  2GJ2 A;  1S7I A;  1V3Z A;  1UZH A;  2YKQ A;  3HD2 A;  5EN1 A;  2QT7 A;  2AEJ A;  2V68 A;  5ETO A;  1E6Y A;  4DCO B;  2R7T A;  4RLE A;  3SMZ A;  2R7O A;  4CLT A;  2UVR A;  3R7S B;  3CE8 A;  2CPD A;  2ADB A;  2GJI A;  2ILY A;  3QT8 A;  2WVB A;  4LF7 J;  2E9Z A;  1MRO B;  1QTM A;  2MZQ A;  5F0U A;  3FSX A;  5SZT A;  2IDL A;  2HRY A;  1UA1 A;  3TZZ A;  1TK0 A;  2CNK B;  2J8S A;  4DR7 J;  2C2O B;  3HVT A;  2HRT A;  1BUX A;  4ZKA A;  2A6O A;  2B56 A;  1BQX A;  4K59 A;  3O1L A;  2DNK A;  3OHB A;  1EB0 A;  5CHC B;  1KKH A;  2PD1 A;  3TZY A;  2V63 A;  4CCH A;  3MR5 A;  4I1T A;  3K8W A;  4QR2 A;  1S49 A;  5E41 A;  4ECY A;  3Q89 A;  4M5D B;  3NOC A;  3BBB A;  4CH7 A;  1D8Y A;  2ZOF A;  4QCL A;  1XMQ J;  3JSB A;  2FD2 A;  5HMY A;  3BJY A;  4AD6 A;  3OVB A;  3DHW C;  2JX2 A;  2APO A;  3JQK A;  4C11 B;  5LJ3 Y;  1R8H A;  4V19 J;  2KH9 A;  3V4I B;  2DEI A;  4WXO A;  3MED A;  4KY3 A;  1CPZ A;  2H4Y B;  4IH6 A;  2WK4 A;  5KT4 A;  1MWQ A;  3QID A;  3NLC A;  1Y00 A;  1VYA A;  3AT1 B;  4JI7 F;  1LWC B;  2DNG A;  4QWD A;  4KIA A;  3OSP A;  4FBT A;  5E2Q A;  2MKS A;  3A13 A;  4HH0 A;  1SI9 A;  4KTQ A;  2FY1 A;  1G6B A;  3OL6 A;  1RWN B;  1J5O A;  3ITH A;  4DPU A;  4FP9 A;  2FJD B;  4B9L A;  2DIS A;  2W9C A;  2B0G A;  4DL3 A;  3DMJ A;  4P6Q A;  2F7V A;  2LEP A;  1KFS A;  4CLS A;  2R2S A;  2V2Q A;  2EK1 A;  2RH3 A;  1EKS A;  2IRX A;  3MMB B;  1NSA A;  5AXK A;  5ITH A;  4X4R A;  5KTQ A;  2X1F A;  4I68 A;  4JYA J;  1FEE A;  5B0G A;  2ZH6 A;  3M6U A;  2ALZ A;  2HHP A;  2XYH B;  3LF0 A;  2PI5 A;  4ZVQ B;  3ETM A;  1BLU A;  1SJ1 A;  2Z8Q A;  4FYD A;  4ZCK A;  4ED0 A;  2QA2 A;  3BGR A;  1IBM F;  1RHK B;  4JV2 A;  3CCZ A;  2E66 A;  3N6M A;  2C3U A;  5KFN A;  2LQB A;  2GCF A;  3TJ9 A;  4O23 A;  5ETV A;  1SH3 A;  4DF8 A;  1EJ7 L;  1IBM J;  2DNO A;  1JWW A;  4IKA A;  3C6U A;  1JLE B;  1QSY A;  2E1P A;  3VGT A;  1QAJ A;  2HNY A;  4CT9 A;  2AKW B;  4KHP F;  3LQV A;  2F4V F;  4OYX A;  4FNH A;  3JSY A;  1EAR A;  4ECR A;  3DCA A;  4BHQ A;  1ITP A;  3KG1 A;  2IRU A;  4EU0 A;  3G86 A;  3HHE A;  2KHD A;  2BRL A;  1WUU A;  3PYD A;  4DDF A;  3HFV A;  4ES3 A;  3H4D A;  2HHW A;  1FRL A;  4ZIV A;  4NLD A;  3DM2 B;  1YKW A;  1WHY A;  3DLG A;  1S9F A;  3PX4 A;  1YBT A;  3CC7 S;  2EC0 A;  3R5A A;  4RW4 A;  4K2J A;  2VKZ G;  1HA1 A;  3M32 B;  1HNI A;  1IKX A;  1I3O B;  1WC6 A;  1WKK A;  3GFH A;  2RT3 A;  3RB0 A;  3QAT A;  3R7B B;  5HQ8 A;  4LF8 F;  3MTJ A;  5KG7 A;  3MOJ B;  4EMD A;  1B3T A;  1RWO B;  1VQ7 S;  3WX8 A;  3H5U A;  1OY8 A;  2PC6 A;  2PA3 A;  2KTQ A;  1JLB B;  3MR7 A;  1QTN B;  3FKB A;  3M8P B;  4LF8 J;  3US5 A;  1X4C A;  2DO0 A;  1HNV A;  1UMJ A;  4ILL A;  2VON A;  3VGS A;  3TAP A;  3MD1 A;  3H20 A;  4G65 A;  4ED4 A;  1VQL S;  5F0W A;  3AOD A;  2DPI A;  1XR6 A;  3M2R B;  3RU0 A;  3Q8R B;  2CQB A;  1IN0 A;  3Q8U A;  4X64 J;  1CJU A;  3WX4 A;  3UVJ A;  1MW7 A;  3TW0 A;  4WFA Q;  3BDP A;  2XS5 A;  4LFB J;  4EGL A;  2P9E A;  4MFB A;  3KYL A;  4J9R A;  1LXJ A;  2A3J A;  3W9J A;  5L1K A;  5GAE U;  2HWI A;  1NHK L;  3QJL A;  1WSV A;  4ZPD A;  2DR9 A;  3DLH A;  2ZH8 A;  2AZ3 A;  1RT2 A;  3UPF A;  1VLY A;  2HHX A;  4YP3 A;  5DET A;  3PHE A;  2HHV A;  2QMX A;  4RU9 A;  1X8D A;  4DQR A;  4NLP A;  2EI5 A;  2W2M P;  3FSY A;  2E7X A;  2BMB A;  3TA1 A;  5JVG Q;  4OYW A;  5A2Q U;  5LMN F;  3W5Y A;  2VFU A;  1S77 D;  2ZBQ A;  2Z56 B;  4OJH A;  2QL7 B;  1DTQ B;  2QX0 A;  3GFZ A;  5BYQ A;  3NMR A;  1NKB A;  2RKI B;  5KT6 A;  2DXE A;  4H4K C;  3BR8 A;  1NDP A;  4ES2 A;  5J1E B;  1CJV B;  1FVS A;  3CJQ A;  2MEW A;  3DRS B;  4JV5 J;  2CKW A;  4KGZ B;  3C15 B;  3OFF A;  4ITS A;  4R25 A;  2CJQ A;  2J0X A;  4DUY F;  4LMZ A;  3E3X A;  1XBW A;  2D9P A;  2HBQ B;  4YB6 A;  3CF5 Q;  1VBY A;  5H1S V;  1KVI A;  1TKD A;  1HNX F;  2EEY A;  2XZW A;  2HEK A;  5B0D A;  1BY9 A;  4ZHR B;  3RR7 A;  1C0U A;  3I5C A;  4AND A;  1LWF B;  3GE9 A;  3M2U A;  2I5J B;  4DQP A;  2PI4 A;  4CRJ A;  3ZTP A;  2DKO B;  1WOO A;  5J2Q A;  3C46 A;  3D68 A;  1FEH A;  5HAN A;  4C3M A;  4C2M A;  2HLT A;  3GJS B;  3V5R A;  1EAY C;  4ZLN A;  4DV7 J;  4MMO A;  1AT1 B;  2PSZ A;  4UUX A;  4C8Z A;  1B64 A;  1TKT B;  2D3Z A;  3IS9 A;  1SL0 A;  4HTI A;  2XO6 A;  4GC6 A;  2ZJR Q;  1RT5 A;  5KFO A;  4A8Y A;  3OVA A;  3RR8 A;  2HZC A;  2GGP B;  4RJV A;  4NCA A;  5DLG A;  3I82 A;  3N6N A;  5IV3 A;  4RUA A;  2FLO A;  3F73 A;  3CJ5 A;  3RB3 A;  1RB0 A;  4DPT A;  3I87 A;  2G2O A;  1RAD B;  2F9J A;  2XY7 A;  3H5Y A;  3R6L B;  4F7V A;  4K4Y A;  3WHI A;  5KFX A;  2R2T A;  4DI6 A;  4ICL A;  2ABY A;  1TFW A;  2W4C A;  1D1U A;  3LWM A;  4LFA F;  3CVK A;  1QAY A;  1RT7 A;  1GTH A;  1JLG A;  1JLF A;  3CB4 A;  2YWW A;  4ZVT B;  1BQN B;  5DQI A;  4LSL B;  1U48 A;  4OV1 A;  1BHN A;  3TA0 A;  5T41 A;  2FJW A;  3OW2 R;  2JJ4 D;  3VAK A;  2A10 A;  4ID5 B;  3SSR A;  4K4U A;  2MQQ A;  1D9F A;  3R8Y A;  2LYV A;  4R0E A;  1U6B A;  2P9C A;  3HPO A;  3D9B A;  2DNM A;  5I3P A;  4IFV A;  3DDK A;  1P9Q C;  5GAG I;  3AJD A;  2JSX A;  3QWU A;  1N5V A;  4J9M A;  1RT6 A;  5ETL A;  1QJH A;  2DGV A;  2EXU A;  5IT0 A;  2K7K A;  4OJG A;  2DRA A;  4NLV A;  2M8D B;  1SJ4 P;  1EP4 A;  3FK4 A;  1UWB B;  3R5C A;  1S6Q A;  5CYM A;  4U8Y A;  2CQD A;  2GX8 A;  2HG4 A;  3GMG A;  3F41 A;  5JUM A;  5A8K B;  2VIH A;  1M0S A;  1FFS B;  1JB0 C;  4F8R A;  3PJW A;  3PEH A;  3PYF A;  5E3A A;  2HQ3 A;  2OI2 A;  2BRK A;  4H4O B;  3MEG B;  4Q2M A;  4M5G A;  2HFU A;  4JI5 J;  2NSB A;  2HVH A;  3M8W A;  1OS5 A;  5KFJ A;  5RUB A;  4KGK A;  2LA4 A;  1D8Z A;  3SYZ A;  2UUT A;  3H59 A;  2AF6 A;  4C4W A;  2N4C A;  4HAC A;  5B09 A;  3T1H F;  5KG6 A;  4KE5 A;  1S0V A;  2FVP A;  2VQF F;  3FFI B;  2Q3P A;  4R5P A;  3D2W A;  2GC8 A;  3MCM A;  3M2V B;  1ZYQ A;  4DR1 F;  5EDW A;  1VQY A;  4QJV A;  4P2F A;  3DKD A;  4PXE A;  3SQG A;  2HVZ A;  1S1V B;  4ZOS A;  1RWU A;  3Q0A A;  3G2X A;  2CPX A;  3H90 A;  4DR1 J;  3PW4 A;  5IZH A;  3DC2 A;  2K8G A;  1CQN A;  3TR5 A;  3IM9 A;  3QBC A;  4WYW A;  4CQ1 A;  4ZVE A;  2ACM A;  3CCV S;  3CO0 P;  1KQG B;  2UVU A;  1ZTT A;  1U45 A;  3PG9 A;  1FX4 A;  1RLC L;  3W66 A;  2LMI A;  3EWG A;  3BZQ A;  1DAX A;  1IR1 A;  1VK3 A;  3W2W B;  3B54 A;  3EZU A;  1KHW A;  1S72 S;  4UST A;  4IO1 A;  4OZ1 A;  4FS2 A;  3V6K A;  1XMB A;  3FEZ A;  3BM7 A;  3OTB A;  3B78 A;  1M1H A;  2HBZ B;  3K7R A;  4YB5 A;  1YRU A;  4ZA1 A;  2DHX A;  1MMD A;  3BDE A;  5AE2 A;  4DJB A;  3TZW A;  2MQP A;  3VAG A;  4M5K A;  1QLN A;  3GR1 A;  4QWC A;  1DTT A;  4L72 B;  1XK8 A;  3I0S B;  1X9W A;  1IKW A;  3QRR A;  4X65 J;  3K0J A;  3QIP A;  1IM6 A;  1XQI A;  4P2S A;  2B9W A;  2IM2 A;  3MM6 B;  3MI7 X;  3GJQ B;  3IXQ A;  2YPZ A;  2XNR A;  4E0D A;  1YIT S;  3MM7 A;  1WSR A;  2J76 E;  4ENO A;  2KG0 A;  2P2C B;  2VL1 A;  2WSC C;  1T05 A;  4TLQ A;  3JB9 k;  2B8P A;  4MTP A;  2BJ9 A;  4Y2M A;  3TNV A;  1QUP A;  4EFA C;  2B4U A;  2R7S A;  3R1L A;  1RT1 A;  2YKN B;  4ELV A;  3KJV A;  1N8R T;  5C2C A;  3TVK A;  3GZ7 A;  2RU9 A;  2W2O P;  4DL7 A;  1SL1 A;  2J9D E;  4K4S A;  1U1Q A;  1H7W A;  2D7S A;  2J9D A;  3QSI A;  4DEZ A;  3ET6 A;  3A8K A;  2RRB A;  2ROE A;  3P3D A;  5C24 B;  5HLF A;  3SQO P;  5JMN A;  2E1M C;  1LEO A;  1XR5 A;  5I3Q A;  2WOM B;  2DR8 A;  2MXY A;  3KK2 B;  4NRU A;  4NE9 C;  1TL4 A;  3FQL A;  3C8Y A;  2YBV A;  2CJA A;  1IKV B;  1VHF A;  3K8V A;  1IM4 A;  2ZE2 B;  3C16 A;  4HVZ A;  1N5Q A;  2M7S A;  1SKR A;  3BO2 A;  4NYZ A;  4UOG A;  5C7P A;  2UXD F;  2K1R A;  3LP2 A;  3VAL A;  1OSD A;  4K7Q A;  1QD1 A;  4HH1 A;  2E5L J;  1VQ6 S;  1LW2 B;  4DPY A;  1Q7Y T;  3NNA A;  3OLA A;  1N34 F;  3OBI A;  4EI2 A;  1UPP A;  4ZPB A;  4AXJ A;  2UXD J;  4IG0 B;  2ZZM A;  1OO0 B;  3PJ9 A;  3HUL A;  2OFH X;  2C3M A;  1FFW B;  3BSC A;  4GC7 A;  1N34 J;  3TX8 A;  1D3W A;  5L9X A;  3BV8 A;  4BWJ A;  4EWT A;  3QRP A;  4M5N A;  4WK3 A;  2VDI A;  3EGW B;  1S1W A;  3J80 U;  3HX9 A;  4ZVR B;  2AQ4 A;  1R0A A;  4TU7 A;  4NZ6 A;  3VGV A;  1RK8 A;  1QVG R;  5C25 A;  2R9L A;  1NDK A;  3GCW P;  4XDC A;  1F9E B;  2QIF A;  4OZL A;  3UDL A;  3WC2 A;  3VZH A;  1YRX A;  2LEA A;  1O51 A;  1YZ7 A;  2M70 A;  1R43 A;  4NLS A;  2E1A A;  4RWW A;  2JLE A;  3SSS A;  2FY8 A;  4RWX A;  1WKJ A;  1EHW A;  4G3I A;  2HWT A;  3J7Z T;  5D4O A;  2M4M A;  5E3R A;  3PFO A;  1HIY A;  5L8R C;  1GQE A;  2QLX A;  1VBK A;  4JI3 J;  2YNH B;  2VUG A;  3T3F A;  1DZ5 A;  3QWP A;  4XDD A;  1HNZ F;  4P52 A;  1RDR A;  3T5K A;  4M95 A;  1RHQ B;  3DNC A;  2CAJ A;  5HBM A;  5HK4 A;  3SCI E;  3CC4 S;  4Q43 A;  1UET A;  1CJK B;  4TYA A;  2V69 A;  4X4S A;  5J2P B;  3Q22 A;  5A0Y A;  3Q8V A;  3BKU A;  4TN2 A;  1HNW F;  2NYH A;  1S10 A;  4N56 A;  4F0M A;  5I3U A;  1VJQ A;  4WZM A;  2C2K B;  3R27 A;  2BEF A;  2HK3 A;  4PR6 A;  1URR A;  1KLN A;  2HND A;  1E6Y B;  1HQE A;  4MKY A;  1HI1 A;  2W1B A;  1FO1 A;  3J7Y U;  3HO1 A;  2XSJ B;  2W7A A;  2BAB A;  3ENV A;  2VDH A;  5H9E J;  4PXB A;  1NCL A;  1M1G A;  4I2Q A;  1HQU A;  4QU6 A;  2ZH9 A;  4FZV A;  4OYB A;  1HW8 A;  3DXB A;  2AMC B;  1X9M A;  5IC6 B;  2IYI A;  5KG2 A;  1DLO B;  3CUL A;  2KYX A;  3L7U A;  4HHH A;  2OEM A;  5KFE A;  4USV A;  4WE1 B;  3S6E A;  3RBD A;  4DR6 J;  4RW6 B;  2KT5 A;  2JEI A;  2PMH A;  4CLZ A;  4MKV A;  3HHD A;  1HWU A;  4KV8 A;  1UEV A;  1TP7 A;  1H7X A;  2R2R A;  1SVD A;  4USM A;  1RTD B;  5DZ6 A;  2XMM A;  3DGV A;  1J27 A;  2AIR B;  2F3J A;  1RWK B;  3WQP A;  4WU3 A;  3PTW A;  2ZJQ Q;  3SIP B;  4U67 Q;  3J7Z 5;  2Q43 A;  1U1O A;  1RI7 A;  4NLU A;  4IRD A;  1F5C A;  4QW9 A;  3W3S A;  3DDI A;  2ZH2 A;  1A0O B;  6FD1 A;  2OPQ A;  4G6V B;  4NA2 A;  3CCJ S;  2VPX B;  3G6E S;  2X1G A;  2BJD A;  2E9R X;  4QYZ K;  2W7P A;  3GSI A;  2Q66 A;  2IFX A;  1VC6 A;  5HJX A;  4D3H A;  1TEL A;  1PC5 A;  2J0Q D;  1R89 A;  2E7W A;  3AQP A;  1X5P A;  2F5G A;  3FQK A;  3HHL D;  4FPR A;  2RUG A;  4OHY A;  1HBM B;  3W9I A;  4DS4 A;  2ZWO A;  5F3T A;  3CJT A;  4QZV B;  2HFS A;  2P9G A;  1IBK J;  2DNQ A;  2IYG A;  3B8H A;  1L3U A;  5F8I A;  1FJC A;  2ZDP A;  4MKB A;  5KG4 A;  3H2U B;  4N8O A;  4PPD A;  1H2T Z;  4QPT A;  4LF5 J;  4GO7 X;  4WII A;  1TUW A;  2YWH A;  4C8K A;  2YKO A;  4J9S A;  4CWB A;  3IWN C;  2GQC A;  4DV0 J;  2PGC A;  4J9N A;  3DOM A;  4N76 A;  2R8J A;  4HYK A;  1NU4 A;  2IVM A;  1NBE B;  1YVF A;  2LQ9 A;  1U2F A;  3CJS A;  4I2P B;  3OL8 A;  2ZH7 A;  1FRJ A;  1U0H B;  2HNY B;  4DR2 F;  4XO0 A;  1KBR A;  3EGZ A;  4PUO A;  3RUB L;  3V4M A;  2MQL A;  3VR1 A;  5FII A;  4FYV B;  1RTH B;  2ZEJ A;  2IJF A;  3T1A A;  2QL5 B;  3IAM 9;  2PFF B;  3HFZ B;  2Q6C A;  1UEK A;  1Y5L B;  4QIV A;  2GQ2 A;  2KYZ A;  5LOQ A;  1Y5I B;  1VS3 A;  2X51 A;  3KNG A;  3PJX A;  2HFN A;  4LF1 A;  5DQG A;  4LRC A;  4KH1 B;  5KFP A;  5DG7 A;  4ECU A;  1PG5 B;  2D74 B;  3I96 A;  4URS A;  1T9T A;  1W26 A;  1TKX A;  2NR0 A;  2R7X A;  2X3D A;  3QNW B;  1IKY A;  1GFW B;  1HWI A;  4KJI A;  4FYX B;  2VBX A;  2W2P P;  3KXD A;  3T9Z A;  2JDJ A;  3S1T A;  4F25 A;  3M8Y A;  1FJ7 A;  1SKW A;  4NLG A;  2BJ1 A;  4TLR A;  3OPK A;  3LUY A;  1X4G A;  1T9V A;  5ETQ A;  3PRV A;  4A46 A;  1UFL A;  1X0F A;  2N82 B;  2HLU A;  3MFI A;  4LVO P;  5B0B A;  4EBE A;  1T3O A;  2G2Y A;  4NOH A;  3TVY A;  3E8O A;  3LH2 S;  3MCN A;  3NG8 A;  5SUH A;  2Q1L A;  4LR7 A;  5AE1 A;  3OT9 A;  4PG6 A;  5GAH I;  2O67 A;  2BE2 B;  1PAE X;  2FYX A;  3EVM A;  1RCX B;  3FEY B;  1URN A;  1ZPW X;  4DU7 A;  1Y3K A;  2LXF A;  3UVJ B;  1OQ6 A;  1VK8 A;  5EHH A;  3ICL A;  1NK5 A;  2AGP A;  1N54 B;  3T5L A;  1NRK A;  3IFE A;  1HBU A;  4X4Q A;  3K57 A;  5D0R A;  1XC9 A;  1LQ9 A;  1TKZ A;  3AH6 A;  2XMT A;  1ZPV A;  5KFK A;  2RB7 A;  1R8P A;  1RT2 B;  5CD4 H;  3FMB A;  2VKR A;  4P9S A;  1VQM S;  5G0R A;  2LEB A;  1KQS R;  3NP5 A;  2H51 B;  2IAJ B;  1FX2 A;  2JLG A;  5HQM A;  1C1C B;  1T03 A;  2GVD A;  4Q5V A;  2D69 A;  1S9G B;  3HP6 A;  3GG0 A;  2ZD1 A;  2G0C A;  2IC3 A;  2XI3 A;  4F4Y A;  1KTQ A;  3EGV A;  3ZTS A;  1M5H A;  2DK2 A;  2XWY A;  1R8B A;  3D54 A;  1U1R A;  5ETT A;  3HT3 A;  1KEK A;  3GU0 A;  3M9N B;  3NS5 A;  2W2Q P;  4P2M A;  2GW8 A;  2B9X A;  1ACM B;  3RB6 A;  1H6K X;  3I6P A;  2DH8 A;  3P45 B;  1VQ5 S;  1RT3 A;  3BGU A;  2BA9 A;  2N7Y A;  2I2Y A;  4TQS A;  2NQP A;  3MUV P;  2FJX A;  2AHO B;  3BF4 A;  4NRT A;  4QIW D;  2LA6 A;  1C0U B;  1REG X;  1YRT A;  5F8M A;  3MMC A;  3W60 A;  2HGL A;  3M30 B;  5J2Q B;  5KFW A;  3NY0 A;  1S1T A;  2GO9 A;  2KU7 A;  4KFB A;  5LT5 A;  2E1C A;  3ILI A;  2EBE A;  1LNQ A;  1Q5Y A;  2RE1 A;  3T1Y J;  1BGX T;  3W9H A;  3T41 A;  1WC1 A;  2V8D A;  4B9N A;  3KJF B;  3IS9 B;  3MM9 A;  4DV5 J;  4OI6 A;  1OYD A;  4I6Y A;  3U02 A;  3K2Y A;  5JJB A;  4DG1 B;  4DL2 A;  1DAR A;  2XMA A;  1TL5 A;  2NCK L;  2I38 A;  4QYR A;  2VOO A;  3VVU A;  2LVW A;  3CJ4 A;  1QDU B;  3H4B A;  4LBI A;  3HI9 A;  3OTO J;  4DFJ A;  3EPI A;  4QR0 A;  2AEF A;  3JAM Y;  1HR0 F;  1OIA A;  2HAF A;  2DHS A;  3M7V A;  1WTF A;  2MKJ A;  5K8P A;  4NA3 A;  2D9O A;  1FHT A;  2Y1I A;  4ICL B;  4M5H A;  2GVZ A;  1HR0 J;  2JFK A;  4URG A;  2E1R A;  4DL6 A;  4USK A;  3NWR A;  2A2D A;  3FDS A;  4NCG A;  5DJB A;  1ZAW A;  1U1L A;  3O44 A;  1HMV A;  1HYS A;  1KON A;  3G8T A;  2R3V A;  1MU2 B;  3BGF A;  2Z2Y B;  1WDD A;  4PXD A;  3AA8 A;  1RJJ A;  5J2N A;  4PWW A;  4CH1 A;  1M1K T;  4E2F B;  3QGP A;  1WG5 A;  2YQ1 A;  2YQ3 A;  2Z2L A;  2RVJ A;  2C1E B;  3IGN A;  3D1O A;  4PAA A;  1T9Y A;  1VRT A;  2EPI A;  2HHS A;  3N5B A;  3TJ8 A;  1NAQ A;  4H4M B;  3WZ0 A;  4LIR A;  3F0N A;  1X4D A;  2M5Y A;  2O1P A;  1LV5 A;  5F9N A;  1QY7 A;  5A6W A;  3RBZ A;  3H42 A;  1FKP A;  4P72 A;  3UD4 P;  3UCZ P;  2ZHB A;  2VG5 A;  1SPB P;  2MHE A;  2P6S A;  2FVR A;  1L3T A;  4DQS A;  2UU9 F;  4EZ9 A;  3NAH A;  1NXI A;  2MQN A;  2GFF A;  1EP4 B;  4Y2C A;  3W5X A;  2FVS A;  4J91 A;  1YJR A;  3QYY A;  5IQ6 A;  1S6Q B;  2I1R A;  1U2R A;  3Q83 A;  3G9C A;  1K8A T;  1SV5 A;  2BJ3 A;  1TL7 B;  4JV0 A;  1R8C A;  4TQR A;  1PIL A;  3GFY A;  1YDL A;  3HZG A;  1S1U A;  2OTJ S;  1UVL A;  2JWN A;  5E3P A;  4HR2 A;  2VC1 A;  3LGH A;  2YNG A;  3VWS A;  4JI1 F;  4ZVH A;  1KLM A;  5ETP A;  3GIJ A;  2CNN B;  4ZLL A;  2VQE F;  4EZ6 A;  2Z0G A;  5H9F K;  4JI1 J;  4Q7A A;  2B4O A;  3G82 A;  5F9L A;  2CIM A;  3PX6 A;  2VQE J;  4K2X A;  4ZPW R;  5F8G A;  3AOB A;  2GO8 A;  2V0N A;  5DM6 Q;  5CYJ A;  4IQX A;  2RJZ A;  2RSQ A;  4AFF A;  4Q2L A;  4NXM J;  1MWZ A;  3LAL A;  4MIB A;  4CYU A;  3HD1 A;  2BUN A;  1N33 J;  3W2V A;  3C6T B;  3S01 A;  1FE0 A;  2CPH A;  2LP4 A;  5K8O A;  4DSL A;  3SZ2 A;  5AJ3 J;  1TAQ A;  2VH7 A;  1WEL A;  4LF2 A;  1U8W A;  4ZJL A;  3Q8S B;  1X5O A;  1HBO B;  5IT9 Y;  2CQ2 A;  3MM5 B;  1MN7 A;  4CNY A;  1P8G A;  4KO0 A;  3MPW A;  3WIV A;  1L3S A;  2E44 A;  4NL5 A;  1YIJ S;  2H4W B;  2G1H A;  2IM3 A;  2ZH5 A;  1M5S A;  5HVF A;  4ERD A;  4ETZ A;  3I0R B;  5M2P A;  3GQC A;  3JXO A;  2W01 A;  1U1P A;  2HZV A;  2RDD A;  2KRR A;  3DXS X;  4CH0 S;  4OZN A;  4OYA A;  4USW A;  1DQ8 A;  1CC8 A;  3A8I A;  5KFG A;  2JZ5 A;  3DI6 A;  4M5L A;  3ZXW A;  2QN6 B;  3T6B A;  2RIL A;  2V2V A;  4P73 A;  3MCO A;  3VQS A;  3Q86 A;  5D3G A;  4CO4 A;  4HI1 A;  2XTJ P;  5M2R A;  2XY6 A;  3QO9 A;  2HNZ B;  2OPP A;  1A9N B;  2WSF C;  4PXC A;  5T7L A;  6FDR A;  2OD4 A;  3DYA A;  3MM7 B;  1S0N A;  3Q23 A;  2Y1J A;  2WSE C;  1KRP A;  2QTW A;  3RYL A;  3PW2 A;  5CYQ A;  4TU8 A;  3IRX A;  4NAS A;  1TVR A;  4DPW A;  5AXN A;  1IR0 A;  4ECZ A;  4A8Q A;  4DU8 A;  4DV1 F;  4USI A;  4IRC A;  1RT1 B;  2DGW A;  5F8H A;  2ZJP Q;  4EYH B;  2MZS A;  3HT0 A;  2R8H A;  2BQR A;  5A76 A;  3D3C J;  2KN4 A;  4JI2 J;  5GAE I;  4ED3 A;  4I7F B;  5IV4 A;  4DV1 J;  4F3M A;  3BSN A;  5KT5 A;  4L76 A;  3POT B;  4YY3 J;  2XCP A;  4DV4 J;  1S6P A;  1T94 A;  3ET6 B;  3MEE A;  3WC0 A;  2DEJ A;  2QC3 A;  3PW0 A;  5B08 A;  3HXM A;  2MLX A;  2VPZ B;  3NL0 A;  1FD2 A;  1XEZ A;  4LSZ B;  1BC6 A;  5G4D A;  5K14 A;  3OXL A;  1VBX A;  3UR3 C;  1R6Y A;  4FDF A;  4HLB A;  3LP1 B;  2CPI A;  2AP6 A;  1N5Y B;  3J7A N;  3J7A 1;  5D4N A;  3B4D A;  3D6T B;  3TAR A;  3C16 B;  3GJR B;  1X60 A;  3SEO A;  1N5S A;  1VRU A;  4UUW A;  2VU5 A;  3BPD A;  1F60 B;  2FQQ B;  2BAN B;  2DGO A;  2K1R B;  2MST A;  4I67 A;  1H3D A;  3G4S S;  4NLW A;  1JLA A;  4QQB A;  4NLX A;  1B4S A;  4JOU A;  2EG2 A;  1QSS A;  2AZ1 A;  1DBD A;  1YI2 S;  3TP2 A;  1V3S A;  2FPH X;  2V2K A;  4AL6 A;  4KT0 C;  5J2M B;  4ZJO A;  2R7R A;  3NBP A;  4PYD A;  2KJV A;  2R2U A;  2J9C A;  2AJ1 A;  1UZD A;  2B7C B;  1FXD A;  1JMT A;  2K7J A;  4ER8 A;  2EG1 A;  3KLG A;  3OXG A;  2OMO A;  4ECS A;  3LA0 A;  1ARO P;  4FS1 A;  3BGO P;  2MQM A;  4B02 A;  4A8K A;  1NH8 A;  2KM8 C;  1AZS B;  4I6W A;  1HWJ A;  2OFG X;  5C25 B;  5MLC V;  5L1I A;  1TL1 B;  3M6W A;  2CQC A;  1RTI B;  1G1X A;  4DSJ A;  5ETM A;  2GIQ A;  1JKH B;  2QLB B;  2KDO A;  2LDY A;  3D28 A;  1S1X A;  2VG6 B;  4F67 A;  2Z4P A;  1UVN A;  5HRO B;  1PCA A;  3QGH A;  4B9S A;  3T19 A;  2RQM A;  1MG7 A;  3HSG A;  4C98 A;  3I56 S;  3DRP A;  1P27 B;  1Q8K A;  3MPD A;  5M2U A;  4DR3 F;  3MDF A;  3PW7 A;  2Y8Y A;  1CJT A;  4DR4 J;  2C3Y A;  4ED8 A;  2ZH4 A;  5KFF A;  4OV6 A;  3PO5 A;  5HMW A;  5IQQ A;  2HQC A;  4Z37 A;  2JC1 A;  3CDB A;  2RD5 C;  2FZC B;  1YBU A;  4NLY A;  4QIG A;  1CQM A;  1TU0 B;  4HHU A;  4MJK A;  2XMW A;  3KLH A;  2W9B A;  2WW4 A;  4RW7 A;  1SIW B;  2RDJ A;  5KT2 A;  5I3U B;  4X66 F;  3BYR A;  2CUY A;  4FBU A;  3LGN A;  3FRZ A;  1RQ0 A;  4AQY J;  1V9O A;  4LIW A;  3ZZO A;  4F0H A;  3H5X A;  3C2P A;  3QJP A;  1NHU A;  3CJK A;  2FDN A;  4UOF A;  4UOC A;  2C3O A;  1HQE B;  2V8P A;  1RAH B;  5A8W B;  3CD0 A;  3EXY A;  1LXN A;  4ES1 A;  2CZ9 A;  1XTZ A;  2ZNY A;  4UY8 T;  3FBC A;  3MF5 A;  1QE1 A;  4R8U A;  1U6F A;  4Z7Y A;  4M5M A;  4B17 A;  2C2E A;  2JH3 A;  2RQ4 A;  1WC3 A;  1N48 A;  1FDN A;  3KLI B;  4I69 A;  1JLC B;  3GV8 B;  2R8G A;  2FJE B;  4UZB A;  2XHC A;  2HHH J;  3I32 A;  3L95 X;  4B3M F;  3I9V 9;  1S7H A;  4BS2 A;  4ZP6 A;  3W7B A;  2DHA A;  4TY9 A;  3FMW A;  3DN9 A;  3UQS A;  2WCX A;  5LM7 E;  1M5V C;  1RSC A;  1Y0H A;  3O2I A;  1NJZ A;  4OIX A;  2J7K A;  3UNG C;  1WEX A;  3ENW A;  4LFC F;  3TAM B;  2F9D A;  3ZTR A;  3OR1 B;  1LK5 A;  1X9S A;  2VBZ A;  3PRD A;  2ZH1 A;  2KO1 A;  2KL8 A;  4OYO A;  4O0N A;  2H5I B;  3MMA B;  3K5N A;  4DQI A;  1TMM A;  4DN0 A;  5KT3 A;  4PCQ A;  3OJU A;  2UXC J;  3V6H A;  4WFN Q;  3TI0 A;  2PN6 A;  1F5B A;  3N5F A;  2AGQ A;  2CDQ A;  2AJF E;  2ASL A;  3CSK A;  1MN9 A;  4A8X A;  4IRK A;  4DV2 J;  3GYN A;  1PGZ A;  2I8E A;  3KHH A;  5ETK A;  5KG5 A;  3CJ0 A;  1U24 A;  4ECQ A;  2Z2Z A;  4LT6 A;  2BZ2 A;  5AXM A;  3MUR P;  2VG7 B;  5FLX U;  4ZN1 A;  4WPA A;  4NLR A;  2ZC3 A;  3CCM S;  1GNK A;  4M5D A;  1RHU B;  3R5B A;  4RW9 B;  3IN5 A;  4CLL A;  1T0T V;  1BQM B;  2KXF A;  4ELU A;  3FGV A;  1B0V A;  5MAO A;  3DRX A;  5IT4 A;  4PKD B;  1PJ7 A;  3RW6 A;  1VOM A;  4JI4 J;  2H9Z A;  5AE3 A;  2AD9 A;  3V4I A;  4RX6 A;  3IBW A;  2QEX S;  2E5J A;  2CPF A;  4GO5 X;  5L1J A;  4ZMM A;  1T7P A;  3V6D B;  1NDC A;  4P75 A;  2VAS A;  1LWC A;  4UY8 5;  1H72 C;  2QFI A;  3I5B A;  1WOR A;  3D6H B;  5K20 B;  1HPZ B;  1K73 T;  1ZH5 A;  3PY8 A;  1N6Q B;  2QZ8 A;  3DOK B;  2C3P A;  1Y4Z B;  1FNX H;  1OY6 A;  3O8W A;  2RU3 A;  4RW8 A;  2QA4 G;  1YLX A;  5K5M A;  4PG8 A;  1JJ2 R;  2V4J B;  2IY5 B;  2CYY A;  2ZUA A;  3M6V A;  1M90 T;  4M5I A;  3PIP Q;  4ZPA A;  1YJ7 A;  4ZVO B;  4X4O A;  1JLQ B;  1XWL A;  4B3O B;  4F04 B;  1K44 A;  4DZD A;  3RB4 A;  2VBW A;  4FF2 A;  1IBC B;  2QFJ A;  3HSD A;  2QYC A;  3KHR A;  2DCU B;  1J2V A;  3GLJ A;  1OPZ A;  3G71 S;  3P5T L;  4QW8 A;  3NCQ A;  2BR0 A;  3MAA B;  3MR6 A;  3O6Q A;  1TKX B;  4EK2 A;  1BWV A;  4C0H A;  4OQJ A;  3THP A;  1WHW A;  2HW3 A;  1D9A A;  4PQU A;  5IWA F;  2XI2 A;  3RAX A;  4IR9 A;  1IKY B;  2BOA A;  4DN9 A;  5FDL B;  2UUC F;  2VFT A;  1Q0N A;  4F3Q A;  4BC9 A;  4J9K A;  5DS7 A;  5L1L A;  3SDE A;  4PWU A;  4NML A;  3MPV A;  3CME S;  4JP8 A;  4YS2 A;  2D3U A;  2VFS A;  1SC6 A;  2HKE A;  1FXR A;  3BN4 A;  3R6G B;  2UUC J;  4A8W A;  2C42 A;  4F4A A;  1H98 A;  1TUG B;  1Z4U A;  2BXJ A;  2UUA F;  4H4K A;  1CS4 B;  3FUY A;  3H2L A;  1SUQ B;  1HD0 A;  1HHS A;  2AT1 B;  3DM2 A;  1RA7 A;  1JNR B;  1KVK A;  5EGY A;  1FWK A;  3BSA A;  4A48 A;  5BJR A;  3HHL C;  2MTL A;  3D5M A;  1S99 A;  1YGY A;  2Y1L B;  2HBR B;  4JI7 J;  3M32 A;  3RJM B;  3IR5 B;  3P49 B;  1HQ2 A;  1OQ3 A;  3MMJ A;  2OSQ A;  3NS7 B;  4IR1 A;  3IG1 A;  2JEG A;  3OL7 A;  1YJV A;  3ZO7 A;  1AYE A;  1P9Y A;  3CXC R;  2JEF A;  1EQM A;  1TKZ B;  1XR7 A;  4K4W A;  1EET B;  1GMW D;  1IQZ A;  1JLB A;  2YWF A;  3MTK A;  4J90 A;  3M8P A;  3CUN A;  3HMJ G;  4OHV A;  1FRH A;  2EFV A;  4ZPV R;  2MMY A;  5G0R B;  4F02 A;  1U6Z A;  2OHD A;  1KOH A;  2YWG A;  4O4G B;  2OO4 A;  1T03 B;  1SXL A;  3GP9 A;  3V81 B;  1NND A;  2ZD1 B;  2BV3 A;  5K9F A;  2IMW P;  2O01 C;  4NA1 A;  2CWK A;  5KG3 A;  2QRR A;  1ZTW A;  3M2R A;  2ZBI A;  2GIF A;  3IBC B;  3BSO A;  2WB1 D;  2EFN A;  2MKH A;  1DY3 A;  3OTC A;  4O44 A;  4PWD A;  1VLO A;  2B4P A;  1RE1 B;  1WF0 A;  1B0T A;  4YN3 B;  3CJ3 A;  2FC9 A;  2YX4 A;  1K1S A;  4MK8 A;  1F2H A;  3OR2 B;  2D1C A;  2MQO A;  4OZJ A;  2J0W A;  1U1N A;  3R5J B;  4UQT A;  2OSR A;  4KHP J;  2F4V J;  2XEX A;  1BE4 A;  4NZ7 A;  3MZI A;  4QIE A;  2F8E X;  3I4P A;  1SJF A;  1XNQ F;  4X62 F;  3H25 A;  3QT5 A;  3KK1 B;  3ADA C;  5K8N A;  1N0V C;  4ZIW A;  3R5D A;  3PZP A;  4KFB B;  1FD8 A;  2AYM A;  4DXL A;  4DX8 H;  5EWF A;  3J7Y I;  1XNQ J;  4YR2 A;  1VQ4 S;  1VJW A;  2WHO A;  4ED1 A;  2RHQ B;  1JXL A;  1FRM A;  3MM9 B;  1P1T A;  4CZC A;  3M8S A;  1ZM2 A;  4LJM A;  3M9M B;  4QYZ J;  2RKI A;  1X5S A;  4DSF A;  8ATC B;  1N36 F;  5AT1 B;  2XGQ A;  1S59 A;  1FCA A;  2QV6 A;  1VQN S;  3DRS A;  3C15 A;  3EVW A;  1K47 A;  3AD7 C;  1TMJ A;  2JVR A;  3QRQ A;  3HJF A;  3OXF A;  3K5P A;  1KDN A;  1VI7 A;  4QIF A;  2AX1 A;  3M8Z A;  1NSK L;  5F3Z A;  4DMZ A;  3QGI A;  4ZVU B;  4MAK A;  1B99 A;  2WZ1 A;  2DRD A;  1AB8 A;  1B7Y B;  4ZHR A;  2GVZ B;  1FXL A;  4WP8 A;  3AJ1 A;  2I5J A;  4LSN A;  2HS4 A;  2LXI A;  2PFD A;  4NCG B;  2BQU A;  4IDK B;  5KFI A;  4WKR A;  3KK3 A;  1HYS B;  3BO4 A;  3NEK A;  5LSR A;  4MKA A;  4Q44 A;  1TKT A;  3QJJ A;  4W90 B;  1C4A A;  5B0E A;  1SKU B;  5GME A;  3PVX A;  5DZ7 A;  5J2N B;  2ZHO A;  5KFA A;  4U9R A;  3Q2T C;  2JHE A;  4EBD A;  2ZM6 F;  3FRY A;  4A8S A;  4FF4 A;  2G0I A;  4OZ2 A;  2GGP A;  3HM9 A;  2XMJ A;  5I42 B;  3LOU A;  2Q79 A;  4WWS A;  2XS7 A;  1PIE A;  3CDE A;  3AXM A;  1VRT B;  2DXD A;  1O6X A;  2ZM6 J;  2O3D A;  4KGX B;  3KMQ A;  2NLW A;  5KFY A;  1H2U X;  1HHQ A;  3JAM U;  1M5K C;  3CJ8 A;  2YWK A;  4NMX A;  2L41 A;  1NUE A;  3SBM A;  3HKZ D;  2CQP A;  3ZC4 A;  1S12 A;  5ETS A;  2AJ2 A;  2DB1 A;  2VD3 A;  4ALZ A;  2AJ4 A;  1FER A;  2YPY A;  1S9E B;  3GYG A;  3GB0 A;  4YFU A;  2DNP A;  1BQN A;  4JUZ A;  4LSL A;  4CO0 A;  4I64 A;  4K5S A;  2ZOG A;  1GX5 A;  2MGZ A;  1ZA1 B;  1NLK L;  3LWL A;  4J9P A;  7FDR A;  1MNE A;  5LMN J;  1F5A A;  5HP1 B;  1Q7L B;  4C97 A;  1E6V A;  4KYZ A;  3U7J A;  1YJW S;  3IR6 B;  3NAI A;  2JEJ A;  4IO9 Q;  3NGR A;  1SJR A;  1WG1 A;  2CZV C;  8RUC A;  2ROP A;  4OFZ A;  3IC1 A;  2UV8 G;  2VV5 A;  3PXG a;  1I5O B;  5LMU F;  1CEZ A;  4KBI A;  4DUY J;  2BYC A;  1XIQ A;  2DGQ A;  2AWZ A;  3JSM A;  3OHA A;  2AX0 A;  1VQ9 S;  2DXF A;  4DV6 F;  4OZ3 A;  2CJB A;  5LMU J;  1HNX J;  4FPI A;  3P8B B;  2RRN A;  3DU5 A;  3PFE A;  3SCK E;  3OQ2 A;  1UWB A;  4LQ3 A;  2FHK A;  4DV6 J;  3KJN B;  4WBF A;  4NLT A;  1WEY A;  1EIY B;  5A8K A;  3CCL S;  4JI6 F;  1MLA A;  4QWA A;  2ASY A;  1B0P A;  4WFB Q;  4GVL A;  1S0M A;  2QMU B;  3M05 A;  4Q0B B;  4H4O A;  4BC7 A;  2IBK A;  4JI6 J;  1EX8 A;  1NK8 A;  4BDP A;  4M94 A;  4B3T F;  2B9Y A;  1HWK A;  2PII A;  2EVZ A;  2HSE B;  1NJX A;  3M8Q B;  1LWE B;  3T5J A;  2JVO A;  3SFG A;  2OGU A;  4L74 A;  1C1B B;  2OML A;  1NPP A;  1YWX A;  5KFL A;  4B3T J;  5B7W A;  3CMQ A;  3FFI A;  2I0X A;  2B6A B;  1OJ4 A;  2P8I A;  3B4M A;  1FRX A;  3AOA A;  4IUF A;  2EK6 A;  2IDE A;  3EVO A;  1RKI A;  1TZ0 A;  4LFA J;  3BS9 A;  4K0K F;  1DQ9 A;  4IG3 B;  2YKP A;  2RF2 B;  3AB4 B;  1FWL A;  9RUB A;  3M4X A;  3D7S B;  4DBQ A;  5F41 A;  1RZM A;  1AUS L;  3CCE S;  1I6J A;  4F2S A;  2F8H A;  3DFE A;  5DG8 A;  5GMK a;  3QPI A;  2DY1 A;  1GXU A;  2G0J A;  4LBH A;  1TAU A;  2CQH A;  3IRW P;  5IT9 U;  2FTR A;  2DNN A;  1AW0 A;  3K5O A;  4LRE A;  3KLF B;  4NI2 B;  2OH2 A;  1RTJ B;  3W2W A;  3V6J A;  1UAW A;  1FVQ A;  2XUL A;  1ZM3 A;  4Y0F A;  2P5V A;  1Q78 A;  4DQQ A;  3IAS 9;  4OYI A;  1UP1 A;  2OKQ A;  1S6P B;  4ELT A;  1WWH A;  3AA9 A;  4M1K A;  3C14 B;  2V67 A;  3RZA A;  3GWC A;  4X84 A;  5KFT A;  1UCN A;  4I6A A;  2HQD A;  4WKY A;  3I0S A;  2OPR B;  2DH7 A;  4CTA B;  3IM8 A;  4YME A;  2VZ9 A;  2WB4 A;  3GR0 A;  2W25 A;  3MM6 A;  3RAQ A;  4H54 A;  3ZFV A;  1HBN B;  2GNK A;  3O5T B;  4KPC A;  5HJY A;  2M8H A;  4G1I A;  4YUD A;  5CCL A;  2UXB F;  3LO3 A;  3ENQ A;  5AXL A;  3CMA S;  3E01 B;  4LF4 F;  4DCP B;  4DUT A;  5KFV A;  3R5G A;  1LW0 B;  1EZZ B;  1JLA B;  1KSP A;  4ID8 A;  3HZE A;  5F8L A;  4OYP A;  3T1H J;  2YKN A;  1W7W A;  3MEC A;  4LF4 J;  2VQF J;  4AL7 A;  2WVC A;  1U2C A;  4U6P A;  1IVZ A;  4UT4 A;  2EW9 A;  3D0G E;  3D66 A;  2HIY A;  4TKT A;  2G9O A;  2E7V A;  2RQK A;  2Y1R I;  1ROF A;  5U47 A;  2AYG A;  2V8G A;  5C24 A;  5B0C A;  2R42 A;  2NS1 B;  1UW9 A;  1OSC A;  4XPE A;  3D1Q A;  4NYP A;  3OVS A;  4IFY A;  2C2Z B;  3VCD A;  3FBE A;  1YG0 A;  2OPS B;  1RU2 A;  3TAN A;  4YHH F;  2NXN A;  1CUL B;  2ZH3 A;  3BO3 A;  4GKJ F;  4O4R A;  3FZ2 A;  1LW2 A;  1JIH A;  3VZI A;  1Q79 A;  3DGP B;  3DLK B;  4GRS A;  5F8J A;  2FIU A;  3CGI A;  1AFI A;  1C0T B;  3DRP B;  6AT1 B;  5D0G A;  1VIX A;  4GKJ J;  2MZ1 A;  3ILO A;  4K4V A;  4J7C A;  4DSK A;  2JRS A;  2ZWP A;  1NO8 A;  2IM1 A;  3RAM A;  1DHM A;  4OI1 A;  3FC9 A;  3U27 A;  2GML A;  4X4V A;  1UPM B;  2XGP A;  4DFM A;  4L6V 3;  4CI0 B;  1JNZ B;  3TWZ A;  1PKU A;  4X4T A;  1I94 F;  1Z1Z A;  2PMW A;  5HN0 A;  2NXJ A;  2QA4 S;  2WAQ D;  2ZHA A;  2YNF B;  3TUJ C;  3KHG A;  3HLU A;  1SC4 B;  3N0V A;  3KOA A;  4TNO A;  1I94 J;  3JSR A;  2L9W A;  5H9F J;  2LEC A;  1R3N A;  3UDE A;  4DX7 A;  3UN3 A;  4Q8F A;  5LXR A;  4OLO A;  4XK8 C;  3R1H A;  3J81 j;  4V19 X;  1GK8 A;  3M6X A;  2WON B;  2A1B A;  3QLH B;  1FDB A;  1RWW B;  3L4B C;  3FEX B;  5HMX A;  2KFY A;  1KS2 A;  3ILJ A;  4J9L A;  3UCU P;  2N3O A;  3RBX A;  2YNH A;  4XPC A;  1BD6 A;  5EWG A;  3EDR B;  4ED6 A;  1VFJ A;  2JLF A;  1RYS A;  3A12 A;  4LF6 F;  2HQG A;  3HCX A;  4IH7 A;  3MOZ A;  4HL9 A;  1MML A;  5CA5 A;  2R8I A;  3GV5 B;  4LF6 J;  5KFM A;  2CAD A;  2D3O 1;  1X31 C;  3QT6 A;  3OFE A;  2FHJ D;  2EFQ A;  2C22 A;  5J2P A;  3A1Y G;  2IPO B;  1WI8 A;  3A3O B;  1QAX A;  1F0X A;  3D1H A;  4AL5 A;  1WC5 A;  1NK9 A;  1IWA A;  1RAC B;  2L3M A;  1WOP A;  2BJ8 A;  3CIM A;  4WTY A;  1Q1K A;  1AFJ A;  3UN5 A;  3R2D J;  1IJF B;  5KFR A;  2DRB A;  4U96 A;  5KT7 A;  5CXT A;  1Q16 B;  3BH6 B;  2CA9 A;  4LF7 F;  1WKL A;  3DU6 A;  2XSJ A;  2ZFH A;  2I6W A;  4CO3 A;  5GAD U;  3PR5 B;  2EKY A;  4C8N A;  4KKO A;  1RBA A;  4DR7 F;  3D3B J;  1NB7 A;  3IR7 B;  2KRB A;  2AW0 A;  3GG1 A;  3O3L A;  3MM8 B;  3TAQ A;  1ZAX A;  1NEE A;  3VF0 B;  3VTI A;  1HW9 A;  4I56 A;  1ULR A;  2Z30 B;  5DDO C;  2QMW A;  1N32 F;  3P4U B;  3S7R A;  1FK9 B;  1DLO A;  4J9U E;  1U0S A;  2B4V A;  4G1Q B;  2MKK A;  1XMQ F;  1B70 B;  3EZO A;  4MK7 A;  3DOL B;  4WE1 A;  2VJU A;  4U7U K;  4B3R F;  1N32 J;  4RW6 A;  2V94 A;  3EXC X;  3ISZ A;  4KHM A;  2MQ8 A;  2Y3Y A;  1WI6 A;  5CZX A;  3OSN A;  4N5S A;  4B3R J;  3VAH A;  1LKZ A;  4PG4 A;  1RTD A;  3MPU B;  3W8G A;  2LKZ A;  1N52 B;  2H65 B;  4DSE A;  1GMV A;  4PAB A;  2HIQ A;  2QE5 A;  4CIO A;  1S97 A;  3A8E A;  5D77 A;  2W8K A;  1HNZ J;  3EMT A;  3LPE A;  1QVF R;  4RR5 A;  3JTP A;  3KLV A;  4LR8 A;  2K3I A;  4ED2 A;  4CLK A;  1UVJ A;  1VDH A;  4YQW A;  2AEM A;  1TFY A;  5DM7 Q;  3LPY A;  5IM0 A;  2H5J B;  2CG4 A;  1NK7 A;  4B9U A;  4RW8 B;  1HNW J;  3U1N A;  5HL7 Q;  4P2X A;  2QJ3 A;  2MY7 A;  4N41 A;  4F4K A;  2K2P A;  3NRB A;  3FCW A;  1GMW A;  2JOQ A;  2BM1 A;  5HVG A;  3TUP A;  1HI0 P;  1R0C B;  4JYA F;  2B5J A;  5KFZ A;  1R27 B;  1HBM A;  1WTB A;  4MIA A;  3ISN D;  2U2F A;  4MYU A;  2FJB B;  3SCL E;  3HK2 A;  2XYG B;  1U02 A;  3AFG A;  3W5Z A;  3ZTO A;  5IFM A;  3NGS A;  1Q82 T;  1VIO A;  4GVB A;  2FGC A;  3HVT B;  3J81 Y;  4DUZ F;  4DWI A;  2KB2 A;  4KSE B;  1UWA A;  1WF2 A;  4FVM A;  2CPJ A;  2V4Q A;  1SC1 B;  3B6B A;  4D3G A;  1RUS A;  2R7V A;  3TZX A;  4OJ3 A;  4UF4 A;  2BW2 A;  2EFO A;  1RBO B;  4K50 A;  4DUZ J;  2HVE A;  5HQL A;  2QYG A;  4CO1 A;  4PQU B;  4QWE A;  1ZS6 A;  2OEL A;  3JYT A;  4NZ0 A;  4I2P A;  4ZP8 A;  2DBB A;  1U0H A;  2LQJ A;  3SDE B;  2CPE A;  1WG4 A;  3BGL A;  4BWM A;  2GJF A;  4TU9 A;  2CRL A;  2L9D A;  2CJ9 A;  5I4M A;  4ZCL A;  1UFK A;  4UQG A;  3HSJ A;  1CC7 A;  2XG8 A;  2YVS A;  1ZZF A;  3CED A;  1RTH A;  1WOS A;  1X4A A;  3MED B;  3MWB A;  4C8L A;  4OX6 A;  2DGS A;  4UTG A;  2XHW A;  4E98 A;  4IYQ A;  3UFC X;  1GX6 A;  4J9O A;  3OFH A;  2WRM A;  2FZG B;  2H3E B;  4RNM A;  4B3S F;  3GTY X;  4RBT A;  2VA2 A;  2DCL A;  2HVD A;  3MXH P;  1J5O B;  3A8J A;  3ITH B;  2YXL A;  2M3D A;  3LAK A;  2GQQ A;  3DRR A;  2P6T A;  1XNR F;  4B3S J;  3TRG A;  3IG1 B;  9ATC B;  2W9C B;  2DVI A;  3DMJ B;  5CZV A;  4CM2 A;  4X4P A;  4Y6I A;  4HT7 A;  2MLY A;  2X3G A;  4CLW A;  4KH0 B;  3CW2 C;  1Y11 A;  2IM0 A;  4Q8E A;  1XNR J;  3LAM A;  4A8F A;  3OFG A;  5DRK A;  2J0S D;  4LUB A;  4Y65 A;  1NJY A;  1K0T A;  1U7L A;  1Q81 T;  3VVT A;  4HT5 A;  2HUR A;  2XNQ A;  5C5J A;  1AA1 B;  4TXS A;  4OHX A;  2O5D A;  1UJ4 A;  4X64 F;  5KG1 A;  3BGR B;  3R3T A;  2EFG A;  4P71 A;  2BQ3 A;  4WJB A;  1L3K A;  4LFB F;  2BE2 A;  4FVC A;  3CT9 A;  2YTC A;  2KVI A;  2BE9 B;  5KFS A;  2GHV C;  4F2R A;  1NKC A;  4XAK A;  1S4F A;  2HGN A;  4WFX A;  3A4T A;  2DIV A;  3BBF A;  4O44 B;  4PWD B;  2XLI A;  3C6U B;  1WNE A;  4ZP7 A;  2OEK A;  2W4P A;  4DSI A;  5IXU A;  5KOX A;  1IUJ A;  2DNY A;  1TV6 A;  2Y0B B;  2YY3 A;  1FJG F;  4ZN3 A;  2V8V A;  4AE5 A;  2F40 A;  2EKN A;  5KFB A;  4TY8 A;  2VFV A;  2A2C A;  3KWM A;  4FF1 A;  4DR2 J;  2R4F A;  1FJG J;  1S6O A;  1LFW A;  1TK5 A;  2HPU A;  2FVC A;  1RKJ A;  5HAO A;  2B7B B;  3L7P A;  1FT8 A;  5GMD A;  2IAJ A;  3BR9 A;  1Q8B A;  3ZZT A;  2QO3 A;  4WU2 A;  1C1C A;  3DLG B;  3C3L A;  2PDA A;  2NUU G;  4WXW A;  1S9G A;  3SV3 A;  3LAN A;  3OL9 A;  1FNM A;  3CD6 S;  1T3N A;  4O3N A;  5IC4 B;  3ZNJ 1;  2HWH A;  1U8S A;  3K59 A;  1YZ6 A;  2E5H A;  1YJT A;  1VBZ A;  4RW4 B;  2RML A;  4JV5 F;  1HNI B;  1IKX B;  3OUY A;  3HVA A;  4JI0 F;  4F4Z A;  1G3O A;  3NS6 A;  2XB2 D;  2OIH A;  2NPI A;  1PYO B;  2J7W A;  2GAG C;  4J37 A;  3L09 A;  4U95 A;  2MSS A;  1J5E F;  4JI0 J;  4YR0 A;  5E3C A;  1N0U A;  3DRY A;  1Q5V A;  1HNV B;  1J5E J;  3KJQ B;  2G1D A;  3NCP A;  5LSL A;  1SL2 A;  3AD8 C;  3CJ2 A;  2EBG A;  3DDN A;  4C8O A;  1KC8 T;  4DV7 F;  2KFZ A;  2WVD A;  4LSN B;  1FKO A;  1S76 D;  3H0P A;  3M30 A;  3NNC A;  2Y9H A;  3KK3 B;  4EUV A;  2POK A;  4RU2 A;  4WZQ A;  1CJU B;  2GA7 A;  4Z2X A;  2FJV A;  1RHR B;  2AYB A;  4DG1 A;  1FTC A;  4MFB B;  2ZKU A;  1N88 A;  4J9V A;  3GJT B;  3CCW A;  2FB0 A;  2J6T A;  1GT8 A;  1WHX A;  1LFP A;  1YJU A;  1RHJ B;  3RG6 A;  4PG5 A;  4DX5 A;  1F9H A;  1UKU A;  1T02 A;  5DDQ C;  4QBU A;  3N4W A;  5DO2 A;  1M5O C;  4HDG A;  1ICE B;  5BYS A;  4KGV B;  3ZZY A;  3NXZ A;  3U1L A;  3LGM A;  3MAQ A;  2MGZ B;  3W62 A;  1MU2 A;  4RO0 A;  4ZK7 M;  2ADC A;  2WBR A;  3SV4 A;  3Q2S C;  4RUC A;  4Y2I A;  1KTV A;  1E6V B;  3BKF A;  2MKY A;  4MH8 A;  4DFP A;  2X1A A;  2FUG 9;  3BQ2 A;  2YNI A;  4X2B A;  5BR8 F;  1O0P A;  2DNZ A;  4H4M A;  2VPY B;  1RWP B;  2NXU A;  2ZUG A;  4K4Z A;  3H98 A;  2QLW A;  3JSM B;  3OD2 A;  1RAE B;  5BR8 J;  3M2U B;  3UCG A;  1RT4 A;  1GXL A;  3QMQ A;  2FGO A;  3SFU A;  2C2R A;  1G2E A;  4LVN P;  5E5N A;  3QAU A;  4ETX A;  1HL6 A;  3EX7 B;  1KOO A;  4ANE A;  4YR3 A;  2V4R A;  2J9E A;  2CDR B;  1NK0 A;  5KAK A;  4JI5 F;  2NZ4 A;  1TL7 A;  1RT5 B;  2IJR A;  7AT1 B;  2A6M A;  4OYZ A;  2VHG A;  4NWB A;  4DV3 F;  3NGK A;  2V2Z A;  5L38 A;  3KLE A;  1QM9 A;  1U49 A;  4P7T A;  2A0F B;  2N4D A;  4DV3 J;  1U25 A;  4ZCI A;  1RCO B;  1FI4 A;  4IQM A;  1VQ8 S;  1R0B G;  1S5Z A;  1FTR A;  4C8Y A;  4QR1 A;  3W65 A;  3AHP A;  2KT3 A;  3BRE A;  1FFG B;  1H73 A;  4O0I A;  1RT7 B;  4WTO B;  2UZA A;  4JB8 B;  3FVY A;  4WF9 Q;  4FXD A;  1JLG B;  1JLF B;  4FYY B;  3H8Y A;  3Q8Y A;  5E0O A;  3CCS S;  2NSC A;  2DGX A;  5KFQ A;  3EDQ B;  5DGA A;  2FHO B;  1PYT A;  3TVZ A;  3CTR A;  3PIO Q;  3C6T A;  1PC4 A;  2DGU A;  2A18 A;  3JQM A;  3PRB A;  1SJQ A;  4IFV B;  3A3P B;  4KGM A;  1NZA A;  4DS5 A;  3HKW A;  2NZC A;  3EGN A;  3L9Z A;  4L75 A;  1SC3 B;  2ZBR A;  1IQT A;  4C9D A;  1HBO A;  4PPZ A;  1RT6 B;  2ZIT A;  3MM5 A;  1KVJ A;  3RRG A;  3U1M A;  1NZ8 A;  1RYR A;  2MLZ A;  4C0O C;  4DPO A;  2XC9 A;  4WIQ A;  3I0R A;  3MR3 A;  3AD9 C;  1SIZ A;  2DY9 A;  5CYM B;  2UU9 J;  2SXL A;  3HF5 A;  2CQ4 A;  3OJS A;  3MUM P;  5CD4 A;  2JL9 A;  1XMO F;  4X65 F;  2YKM A;  3M9O B;  1KNZ A;  3ULH A;  2DR7 A;  1R31 A;  4HDH A;  4IOA Q;  3R9L A;  3KTQ A;  5KFD A;  3IO1 A;  1XMO J;  1DUR A;  5DQH A;  2F1F A;  2DR5 A;  1PJ5 A;  2C2D A;  2GMJ A;  3M1V A;  3D0I E;  2XMV A;  2AJ0 A;  1Y5N B;  1KQK A;  2M88 A;  2MYF A;  1ZA2 B;  2XLK A;  4RNO A;  2HNZ A;  2UUB F;  1TR0 A;  4HAC B;  1HKA A;  3S8S A;  4EO6 A;  1KQF B;  1MMN A;  3BBC A;  2XYP B;  1A6L A;  4OHZ A;  4DCJ B;  2B9E A;  4R5P B;  3NGD A;  2UUB J;  1VIS A;  3DLE A;  4U7U D;  2K3K A;  3HDS A;  3MEC B;  3SQG B;  1UFW A;  2X1B A;  4I7F A;  4O3O A;  3POT A;  2ILZ A;  4I4B A;  1VQO S;  3ELH A;  2DH9 A;  2BJ7 A;  3VV2 B;  3PEJ A;  2QSF A;  3AJ2 A;  4O3S A;  3FJ2 A;  2J7U A;  4X4N A;  3P96 A;  3IWX A;  3T9N A;  3R7N B;  3EJM A;  4MYT A;  3PX0 A;  4ECV A;  1RWM B;  4A47 A;  3LP1 A;  1N5Y A;  2C28 A;  3RBE A;  4GMK A;  2M2B A;  1UVK A;  4IFY B;  2DHG A;  2E5L F;  4KPY A;  3OTE A;  4FN5 A;  1DRZ A;  1YQH A;  1XER A;  2BAN A;  3H40 A;  2FHJ A;  5KG0 A;  3NKY A;  3HVW A;  1NM2 A;  4MT1 A;  1PAU B;  2RUS A;  1H38 A;  3W64 A;  4JI8 F;  5JVH Q;  1D9D A;  1SQE A;  3IGV A;  2HZA A;  5IS2 A;  4J9Q A;  4V1A k;  3VAF A;  1ZM9 A;  2LFV A;  4OL8 A;  2HYI B;  5KFC A;  1I1G A;  4JI8 J;  3B82 A;  1ELO A;  1PJ6 A;  2GHP A;  5J2M A;  2GZO A;  1DTT B;  2LDI A;  4FXV A;  2FC8 A;  4NYO A;  2CQ3 A;  1IKW B;  4NEZ A;  1D09 B;  4WFY A;  3QIP B;  1PYS B;  3N28 A;  2AU0 A;  4LF9 F;  4CP5 A;  1LOU A;  5D8H B;  4FYW B;  3CIZ A;  2YWE A;  3GCX P;  3CO9 A;  4IOC Q;  1X7V A;  1RAF B;  4OHW A;  2PT0 A;  2HK2 A;  3TYT A;  3UD5 A;  3EPG A;  3KDN A;  4LF9 J;  1AZS A;  4DHV A;  2XY5 A;  1Q53 A;  1T05 B;  1WHV A;  4GKK F;  2RIJ A;  3VGU A;  2QLF B;  1TL1 A;  2NUH A;  1RTI A;  2YH1 A;  4CO2 A;  2J6U A;  4ZJQ A;  1JKH A;  2XO7 A;  3KJV B;  1IXK A;  1YJ9 S;  2NXC A;  2VG6 A;  3CC2 S;  5HRO A;  3CCR S;  3EM1 A;  4GKK J;  3ZNU A;  4Y2A A;  1P1L A;  5D15 A;  1S48 A;  2CWX A;  4JI3 F;  5KFH A;  1LK7 A;  3T5H A;  2F8M A;  1YSJ A;  3MFH A;  2NXE A;  3DLJ A;  3LP0 A;  4C0B A;  4OX8 A;  3OTD A;  3KHL A;  4C8M A;  5HLF B;  3NGT A;  4OMF G;  1WDT A;  4M63 A;  2LQ5 A;  1K9M T;  4RPF A;  5CAB A;  4NEY A;  8AT1 B;  5DGB A;  2M0G B;  5A6P A;  3MD3 A;  4F4W A;  4RNF A;  4F3O A;  3LP2 B;  4G1P A;  2CG8 A;  3RTV A;  1RP5 A;  2VOD A;  4DF4 A;  3AY0 A;  2XWX A;  1U47 A;  2BKN A;  1NK6 A;  1QUV A;  3TQE A;  3HVR A;  2J5A A;  2LLZ A;  2KXH A;  1YHQ S;  3EE3 A;  2DD8 S;  3BKT A;  2ZNZ A;  2VA3 A;  4UOH A;  3A3N B;  2XMK A;  3G8S A;  4XTT A;  5A8W A;  1T11 A;  3GPA A;  2AJQ A;  5L9N A;  1JJ4 A;  1BWE A;  1S1W B;  1REV A;  2ZOM A;  3W8P A;  3G8Q A;  4F4X A;  3JTO A;  5A8R A;  4KKO B;  2CXE A;  1RWX B;  1V6H A;  1ZET A;  4USH A;  3KG4 A;  2W24 A;  1R0A B;  4KAI A;  3DLB A;  4O3R A;  4MIW A;  3ZZ0 A;  3MCS A;  1FWP A;  2ZBC A;  3KLI A;  1W25 A;  1JLC A;  5ETN A;  2XZT B;  2ACY A;  1FJE B;  2IHR 1;  2KZM A;  4FNI A;  5B0A A;  5LL6 d;  3IMQ J;  5C42 A;  4DR6 F;  2YH0 A;  2ZVS A;  1D0E A;  2FLP A;  1Q8I A;  2CQI A;  2MDA A;  1U09 A;  3ILL A;  4KC5 A;  1NDL A;  5FLX Y;  1WD6 A;  2B43 A;  4KHR A;  2R7W A;  3TAM A;  1VC5 A;  4J5O A;  2IBO A;  1LWX A;  1OYE A;  3OR1 A;  5D0H A;  2OD6 A;  4RBU A;  3UD3 P;  3I5A A;  4EBC A;  2HFZ A;  3MMA A;  4DR3 J;  3K58 A;  2O66 A;  3MPY A;  1UJ5 A;  5HBM B;  3EUN A;  4WK1 A;  4DR5 F;  1N5T A;  3PKY A;  1KHV A;  2M52 A;  3D6M B;  2UV8 A;  3QQC D;  1NSQ A;  5HVH A;  4RNN A;  2J8A A;  1RA6 A;  5A0Y B;  3AAW B;  4DR5 J;  3CNQ P;  3NMA A;  1ZBT A;  1KN6 A;  3MGJ A;  1U26 A;  4CM0 A;  3MUT P;  1JQG A;  2GMH A;  3PNI A;  1AUD A;  2CJK A;  4DLG A;  3GIL A;  3GON A;  3PYG A;  1KP6 A;  5IM0 B;  1Y7P A;  4R0J A;  3ZZU A;  4ZDN A;  3AOC A;  2MKC A;  4QOT A;  2VG7 A;  2HMI A;  1H2V Z;  2KT2 A;  2HQI A;  2HND B;  4X66 J;  1RIS A;  2G2Z A;  2MB0 B;  1IBK F;  4KR0 B;  4RW9 A;  2KVQ E;  4O3P A;  3HHL A;  2L48 A;  2B5J B;  1BQM A;  4N47 A;  3GSD A;  2E5I A;  1F9F A;  4F36 A;  4B9V A;  5EUH A;  2YQ0 A;  4FKX A;  1T8E A;  4LF5 F;  2ZKT A;  2DNH A;  4I2Q B;  1HQU B;  1HHT P;  1RWV B;  4Z7C A;  1NME B;  4Y00 A;  1X0P A;  3KUG A;  1TL3 A;  2PE8 A;  1R6V A;  3GIM A;  4GVB B;  2V9K A;  4DV0 F;  1F3F A;  1WF1 A;  3V6D A;  2OEJ A;  4QU7 A;  3VAJ A;  1EQ0 A;  3RW7 A;  1DQA A;  3CCQ S;  1HPZ A;  2DJW A;  3AXK A;  1N6Q A;  4B3M J;  4YB7 A;  2L08 A;  3DOK A;  4O3Q A;  1QAI A;  1ZM4 A;  3MEK A;  3KG0 A;  2CJY B;  4E8U A;  3TUZ C;  3JYT B;  3RRH A;  4BCA A;  4ZIT A;  4KV8 B;  5C2G A;  3LTO A;  4S0M A;  2FHM A;  2V4J A;  2JFD A;  1L3V A;  3CDA A;  4LFC J;  3F56 A;  4DOZ A;  4CLP A;  2FLN A;  4A8O A;  2GAH C;  1JLQ A;  1VQS A;  3PCO B;  4CLU A;  4B3O A;  2B3T B;  4N8N A;  1TK8 A;  4TYB A;  2YX7 A;  3MHY A;  5B0F A;  2HS0 A;  1MRO A;  1RAO A;  4RUH A;  3C19 A;  3BN7 A;  5HMZ A;  1VC0 A;  2DIU A;  2OPQ B;  4NPO A;  5GVQ A;  1C4C A;  3J81 U;  4P10 A;  2PA8 D;  4USU A;  3ZZP A;  2XCA A;  4EEY A;  3QGG A;  5D4P A;  3MAA A;  2DNR A;  1FNO A;  3ENA A;  2YKA A;  3M8R A;  3G96 A;  1YJN S;  4Y28 C;  4ILM A;  1HD1 A;  4NX9 A;  1YBA A;  4LRB A;  4Y3C A;  1UTA A;  4C3K A;  2KHC A;  3DRR B;  3I4H X;  1H74 A;  1U1K A;  5FDL A;  2GHW A;  4UZC A;  4P7V A;  2HVI A;  2M9K A;  4OJ1 A;  4ZVP B;  4DL4 A;  2NYI A;  2QA1 A;  1UVI A;  4K5R A;  2QL9 B;  3NNH A;  4C11 A;  1C2P A;  4NXN F;  3VAM A;  2R7U A;  3BQ0 A;  2V6A A;  2Z57 B;  2L9N A;  2WVF A;  3K5L A;  1F3V A;  1XJW B;  1CS4 A;  1SUQ A;  4NXN J;  3SCJ E;  4M5J A;  3TEG A;  5GAG U;  2IRY A;  2E9T A;  2FLL A;  1X4H A;  4PG7 A;  4I0W A;  3JQJ A;  3DOM B;  1RU1 A;  3ISN C;  4W98 A;  2XM3 A;  3FZB A;  1IJE B;  2Y8W A;  1GMU A;  1TTH B;  2QSW A;  2XQC A;  2GIR A;  3TOQ A;  5EWE A;  1Y9O A;  5E33 A;  5JXS A;  4KQZ A;  1NJW A;  1TV6 B;  2VPW B;  1V3R A;  2EC2 A;  4PUO B;  1JJC B;  4TY8 B;  5THW A;  4HEA 9;  1MSW D;  4NLQ A;  1EET A;  2KZZ A;  3TUI C;  1PO6 A;  3MMB A;  1YK9 A;  2GV1 A;  2Q6B A;  3TX0 A;  3IA0 A;  3TJA A;  2KJW A;  2LQ8 A;  3VHQ A;  4PRF A;  2KI2 A;  2NRE A;  3W1Y C;  4O4G A;  3K17 A;  4B9M A;  3KNA A;  2VJV A;  2VBY A;  1Y3J A;  3QT7 A;  2E29 A;  2HQF A;  1W2I A;  3V81 A;  4ECX A;  1DFD A;  4FKY A;  3NWG A;  2ZDO A;  1M5P C;  1RLD A;  2DHH A;  3HJV A;  3OLB A;  3TEH B;  3OUY B;  2VC0 A;  4RL1 A;  4LBP A;  4YEA A;  1JLE A;  1SQF A;  2KG1 A;  3JS9 A;  4RBV A;  4Q45 A;  5CH7 B;  5IWA J;  1SB6 A;  5D4L A;  4RZR A;  3OR2 A;  4A4J A;  2HHQ A;  2XLJ A;  4NLO A;  2FZK B;  2LU2 A;  4W4M A;  2BKO A;  1NKE A;  3PHT A;  4EO8 A;  3T6J A;  1UJ6 A;  2BE7 D;  2OLW A;  2ZZN A;  1GTE A;  2OUG A;  2HFO A;  3CCT A;  1T9U A;  4F26 A;  3QZ8 A;  1SH2 A;  1FKO B;  2C2M B;  3KK1 A;  3T1Y F;  1QSL A;  2UUA J;  4CDI A;  3BPS P;  3D6F B;  4DV5 F;  1SBR A;  4OLP A;  1H0H B;  5GAD I;  2CFX A;  4HHJ A;  2UVW A;  2K06 A;  4ZP9 A;  2G4B A;  3OTO F;  2IA6 A;  3FSI A;  2F63 A;  2MJN A;  2HGM A;  3CDU A;  1RAB B;  1HBU B;  2MZT A;  1FDA A;  2QLJ B;  5FD1 A;  4YDX A;  3V2U C;  2FJA B;  1NJI T;  2PO4 A;  3GII A;  3NCR A;  3P6Y C;  3L7O A;  4AXI A;  5ADZ A;  4RNH A;  2H1Y A;  3N6L A;  3MAH A;  2OTL S;  5DDR C;  2DT9 A;  4DL5 A;  5LXY A;  2DGT A;  2W8L A;  3WBZ A;  2MPU A;  1OPI A;  2GVD B;  3UWT A;  2ALY B;  5KFU A;  2IC3 B;  2X7I A;  2HBY B;  3CWJ A;  1OWX A;  5A2Q Y;  3PYE A;  4IDK A;  2AYE A;  3C66 A;  1NPK A;  2RHS B;  3F44 A;  1WC4 A;  3BYP A;  3GV7 B;  3NGU A;  2N3L A;  2H5E A;  4U8V A;  5D0E A;  4URQ U;  2DYA A;  3W61 A;  1GXT A;  3KMS A;  1U4B A;  3R97 A;  1RT3 B;  5I42 A;  5F8N A;  2YNI B;  4OI3 A;  2WBM A;  4QWB A;  4AYB D;  4ZVS B;  3GIR A;  2NPF A;  2BW7 A;  2HFV A;  3X1L B;  3W63 A;  1VHI A;  2VOP A;  4RKU C;  2HAI A;  1CLF A;  1RT4 B;  3MMC B;  2ZBP A;  3K5M A;  4WP3 A;  3KDO A;  3HHK A;  1S1T B;  5LSO A;  4CT8 A;  3WDO A;  5KOW A;  1S9E A;  1FF2 A;  3HFK A;  2HRU A;  4X62 J;  3D67 A;  4N7T A;  4CNZ A;  1FKA F;  5ETR A;  1T95 A;  2R7Q A;  4DL0 C;  2UUW A;  1DTQ A;  1XN9 A;  1RAA B;  1YX2 A;  1Q95 G;  3G6X A;  2C2N A;  5J1E A;  5HP1 A;  1CJV A;  3MR2 A;  4DFK A;  4YDD B;  3UW1 A;  3KLE B;  4PYA A;  2GS8 A; 
#chains in the Genus database with same CATH homology
 1YBU A;  4OYA A;  4P2X A;  4USW A;  4P2F A;  3G82 A;  1CJV B;  5D0E A;  1CS4 B;  3C14 B;  3C15 B;  1CJU A;  1AZS B;  3UVJ A;  4CLZ A;  4CLL A;  1YBT A;  4CLP A;  3C16 A;  4OZ3 A;  1CS4 A;  2QV6 A;  3C14 A;  4P2M A;  3C15 A;  1AZS A;  1WC5 A;  3UVJ B;  4CLU A;  4CLT A;  3C16 B;  2BW7 A;  4OYM A;  1WC6 A;  4OYO A;  2GVZ A;  1CUL B;  5D0R A;  4CLY A;  2WZ1 A;  5D0H A;  1AB8 A;  1TL7 B;  4WP3 A;  3MAA B;  2GVZ B;  4USU A;  4WP8 A;  3MR7 A;  1CJT B;  1CUL A;  1FX4 A;  4CLF A;  5D15 A;  1TL7 A;  3MAA A;  3R5G A;  2GVD B;  5D0G A;  4OYB A;  4OYX A;  4OYZ A;  1CJT A;  4OYP A;  1WC0 A;  4CLK A;  4NI2 B;  4UST A;  4CM2 A;  1FX2 A;  1U0H B;  1WC3 A;  4CLW A;  1CJK A;  4OYW A;  2GVD A;  1Y11 A;  3ET6 A;  5IV4 A;  1WC1 A;  1YK9 A;  4NI2 A;  4WP9 A;  1Y10 A;  1U0H A;  5IV3 A;  4CLS A;  3G82 B;  1CJK B;  2W01 A;  1CJV A;  4CM0 A;  3ET6 B;  4OZ2 A;  1CJU B;  4USV A;  1WC4 A;  4OYI A;  4WPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...