2GVZA

Crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
b'MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
total genus 44
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvzA00
4CLUA 2GVDA 4WP9A 1CJVA 3UVJB 1CJTA 1Y11A 5D0EA 1CS4A 5IV3A 1CJKB 3C16B 3ET6A 4USTA 4CLKA 4USVA 4OZ2A 2GVZB 4P2MA 4USWA 1YBTA 1CJUB 4OYXA 5D0HA 2GVDB 1TL7A 4OYWA 4CLZA 1CJVB 1CJTB 3MAAA 4CM0A 4OYZA 1WC0A 1AB8A 4WPAA 1CS4B 1AZSA 3ET6B 1WC5A 4WP3A 1U0HA 1WC4A 4OYMA 4OYBA 1YBUA 3C15A 4P2FA 1YK9A 2WZ1A 4OYAA 5D0GA 4CLSA 1TL7B 4WP8A 4USUA 4CLFA 2QV6A 3MAAB 4OZ3A 1AZSB 1WC6A 2W01A 1U0HB 4OYOA 3MR7A 1CULA 1WC3A 5IV4A 4OYIA 1FX4A 4CLPA 3G82A 3C15B 5D0RA 3R5GA 4NI2A 3C14A 4CLLA 2BW7A 3UVJA 1WC1A 1Y10A 4P2XA 4OYPA 1CULB 4CLTA 1CJKA 3C16A 4CLYA 1FX2A 2GVZA 3G82B 5D15A 4CM2A 4NI2B 4CLWA 3C14B 1CJUA
chains in the Genus database with same CATH superfamily
4JP8A 3KJQB 3RBXA 2IJFA 4DL3A 2IVMA 4TY9A 1S6QB 4LREA 3TI0A 3Q23A 1VYAA 3KMQA 1ZAVA 2MJUA 3M9MB 3PYFA 1SV5B 3SCIE 3OTBA 3J7ZT 1HQEA 3OXGA 4X66J 2RU3A 1TK5A 3K7RA 3N4WA 1NK6A 1N5YA 3JSMB 4OYBA 3DU5A 2DR5A 4EBCA 1L3VA 2YNIB 4LQ9A 4C8KA 2VU5A 4M94A 2V4RA 4Y00A 3ZZRA 5ETRA 2RF2A 1B0PA 3QT8A 5CZXA 2DGXA 2DY1A 5HK4A 4LT6A 2MPUA 1UETA 5EDWA 1YWXA 3FRZA 1TTHB 3F44A 2W4DA 2K8GA 2VG7B 2MY8A 3TVKA 4I6WA 3MOZA 1HKAA 2CQCA 5LOQA 1NEEA 2YBVA 3H5SA 2VUGA 3BSAA 4PWWA 8RUCA 1PBUA 5C2CA 4GC7A 4UUXA 2QMUB 3H98A 4PUOA 2WTFA 4J9OA 1CS4A 1EAYC 1M1GA 2R7SA 5C5JA 3CXCR 4KR0B 5H9EJ 4UOCA 2HGNA 1DARA 1IJFB 5E7OB 4P72A 2AU0A 4BDPA 2ILZA 1Q82T 2B7CB 4WPAA 2FZKB 3D28A 4DQRA 5CXTA 1HNVA 4RUBA 4OYMA 4ELTA 3DKDA 1KNZA 1RT6B 3BO3A 2HEKA 4ZN3A 4X64F 1UEVA 1F9EB 3OUYA 5D8HB 4GRSA 1XQIA 1NK8A 5F8GA 1VJWA 4DL0C 2DHAA 3VAMA 2EFQA 3GSIA 4U7UD 3PR5B 2K3IA 1I51B 4UF4A 4DL4A 2IM2A 1X60A 3FNNA 1M90T 2AF6A 5H1SV 4L74A 4XPCA 1VRTB 4FYVB 5CA5A 2XTJP 1S99A 4HT5A 5B08A 2VG5B 3OFHA 2I5JB 2ZE2B 5KFOA 4NI2B 2YX1A 2B0GA 5CABA 3Q8PB 2HHHJ 2XLIA 1M5PC 1SL2A 9ATCB 5E5NA 4LF1A 2YTCA 2CQDA 2F5GA 3W5YA 3LANA 2H5JB 4AUKA 1HFEL 3N28A 3E2EA 2MHNA 2IRXA 4RW9A 4ITSA 2IM0A 2KG1A 3FQLA 4NLQA 2D9OA 5CH7B 2B8QA 1T05B 1U0HA 3OL8A 1U1RA 3KKFA 3T1AA 3CD6S 2Z57B 1UP1A 4B9VA 1H6KX 3GONA 1G6BA 1RKJA 1D9FA 4WXOA 3RYLA 4O44A 2IA0A 3V6HA 3UW1A 4FS2A 4OYOA 3RRGA 1K73T 4J5OA 5HMZA 2FC9A 2PA3A 4ZVSB 3NMRA 2X1FA 1FFGB 3LUYA 2E1CA 2DCLA 1NXIA 3CW2C 5B0CA 2FY8A 3D6FB 1N5VA 3KOAA 3MD3A 1YHQS 2KI2A 2FVCA 2LQ8A 4BWJA 3TRGA 1RU1A 2AGPA 4Y2KA 5CZVA 4O23A 4C0HA 2FHJD 1JKHB 5LXRA 4JV2A 2MSTA 3DGVA 1UJ4A 4AYBD 1JLFA 3POTB 4DUTA 2A3JA 4AL7A 1VBZA 4N8NA 2HHSA 5T7LB 2ZEJA 1H0HB 2IHR1 2ILYA 4J9RA 5GAGU 1NJYA 2C2MB 3BO4A 3ZZ0A 2PI5A 4YHHJ 1S9FA 4DV5F 1SUQA 3QIPA 2DNLA 1RI7A 1TKDA 4BC9A 5DDQC 3NXZA 1YZ6A 2YQ3A 2RHQB 4DX8H 2YNFA 3MHYA 5J2NA 3GCXP 1JLCA 3FSXA 1R31A 3BSOA 4TYBA 1SL1A 2EBEA 3BQ0A 1NZ8A 3G4SS 1FJCA 5M2UA 1N36J 5K8OA 4NCAA 1JLEA 5A6PA 1KONA 4QIVA 1S1WB 2OO4A 3BGFA 5LMNF 4DL6A 5KT2A 2YXLA 2YKNA 1HI8A 1SC1B 4ZPAA 1TL1B 1CJKB 4CO4A 1Y4ZB 2WHOA 2C2OB 4LVOP 2M0GB 4TQRA 3NRBA 1CQNA 5GAEI 1L3KA 3OSPA 1GXUA 3SZ2A 2IAJA 4HI2A 1VI7A 1PSDA 1CVJA 4WP3A 3N0VA 4IR1A 2VC1A 5DQGA 2JEGA 1RTZA 3CTRA 3SDEB 2VODA 4CLSA 1RT4A 1SB6A 4C11B 2XSJB 2Y9HA 1SJ4P 4PYDA 1VQ5S 3J7YI 4ZVPB 4PXEA 1XIQA 3NBPB 3QGHA 2R2UA 5HVHA 3RR7A 2DR8A 3PW4A 3QT6A 2MQQA 1VR6A 3H2LA 2EWHA 3IWXA 2N4CA 2MMYA 4TN2A 2XHWA 2OPRA 2F4VJ 3DHWC 4OYPA 3C16A 2IVYA 4L76A 4C0OC 1IR1A 4UZBA 5RUBA 1T0TV 3CCUS 3RBEA 2O5DA 1X4FA 2NYHA 4LRBA 1TVRB 4XTTA 1XN9A 1LXNA 1I1GA 3FCWA 2V4JA 1GMVA 2VQFJ 2UXDF 3KLFA 3FRYA 4N41A 2QLXA 4K59A 4Z37A 1URNA 1D09B 1SIWB 4OJ1A 2NS1B 1GK8A 3ENAA 2XCPA 2OAUA 1V3ZA 2O3DA 5D4NA 3V4IB 2MHEA 2F9DA 4USIA 2VONA 1HMVA 5D4OA 3PM9A 2I0XA 1J5EF 5A8WA 1DBDA 2E9ZA 2NLWA 2ZUAA 3OR2A 1AFIA 3R8YA 2BW7A 1G1XA 4ZVUB 2CZVC 4UOFA 3E3XA 2DGQA 5KG6A 2BJDA 4ZIWA 1JNZB 1L5UA 1X7VA 2J6TA 1FWLA 2BMBA 1HQUB 2XMJA 3PHEA 4OI4A 4RBUA 3PX4A 4LF4J 1AYEA 1LK5A 4OZ2A 1CC7A 2HZCA 4UW2A 2AZ3A 3TAMB 4NEYA 2O1PA 2H4YB 2VD3A 1OPZA 1M0SA 3W9HA 5MAOA 4RWWA 5G4DA 2HVHA 2YH0A 3V6JA 4QIEA 4RNHA 1KLMA 1FXLA 4O4GB 2F9JA 3MTKA 4KFBB 3CPWR 2WVFA 4NASA 2QEXS 1UVIA 3IRWP 3Q24A 2LEBA 2MQPA 3LA0A 1FVQA 1J5OA 3BQ2A 5B09A 2LCWA 2GA7A 3M2RB 2AMCB 2GHVC 1PC4A 1RHQB 5DG9A 1F6TA 3DLGB 3K2YA 1KLNA 5IT9Y 3VWSA 1WSRA 1MG7A 3KLGA 2CQ0A 1RACB 2JHEA 2J9DA 3U1MA 2GJIA 5FIIA 4P2SA 4PG6A 3PV8A 2Z2ZA 2ZM6F 1RAGB 3RAXA 2DR7A 4DR7J 2RH3A 4YDXA 2RQMA 1JMTA 3L9ZA 4U7UK 2VFVA 2QJ3A 2VFSA 3D0GE 1GTEA 2BOAA 4DL2A 1CPZA 2B9EA 2R9LA 1WC0A 1RWWB 4OV1A 3DLKB 2IBKA 1HNZJ 2F8MA 4DUYJ 3CCES 4P73A 1F9FA 3AD8C 2WZ1A 1H38A 1SVDA 3HT3A 5IFMA 5KFZA 2MZJA 3OL7A 5IT9U 4F8RA 4F02A 4IH6A 1MN9A 4ECZA 1OY9A 3O6QA 4M5KA 3M30A 4QWEA 4RPFA 3MECA 2C3OA 1GH8A 6FDRA 2FY1A 2NPIA 1KQFB 4IG0A 3D0IE 2WB4A 1UFWA 3CJ4A 1REVA 2CUYA 1S77D 2G1HA 2VDHA 1BLUA 2HWIA 5I3UB 2H54B 5HQ8A 2CADA 4QWAA 2QA4G 1F3FA 1OYDA 2H65B 1H7WA 1SIZA 2DGTA 3CCRS 2QTWA 1IKVB 3VZIA 4DX5A 2XSFA 2OUGA 3MR6A 1YITS 2KT3A 4F0KA 1LWEA 4M5DA 3EZ5A 3MM5B 3TUJC 3HD1A 4F25A 1KBRA 2HK2A 3OXFA 4IQXA 5GVQA 1DURA 2LXIA 1UMJA 2QX0A 1XR7A 4JI3J 5LJ3Y 3UI3A 4DR3J 4DV1F 3CMAS 4CCHA 4R25A 3HFZB 2G2OA 2DO0A 3TZWA 4JI7F 2VOOA 2E5LF 3KLEB 2U2FA 2RILA 4DV3F 4C8OA 4IFVA 4C7QA 1I94F 4QWBA 3PIOQ 2KL8A 1OQ3A 5A8RB 4KB7A 4PRFA 3GR1A 4AQYJ 1LW2B 4J9LA 4CYUA 4B3MF 4V19J 2QO3A 2FZGB 3PDNA 2OP5A 2ABYA 1TAQA 2BE9B 4Y28C 4J9NA 1YZ7A 3FZ2A 2R2TA 2UU9F 4R8UB 3SQOP 1PIEA 2OFHX 1U09A 3SIPB 3SV3A 2P2CB 3QZ7A 3GU0A 3NCPA 1UZDA 4AD6A 2BRKA 3IA0A 4RKUC 2J6UA 4IFYB 1RAJA 3I82A 1XBWA 1JJ4A 3THVA 2BKNA 2HFSA 3PJWA 2YY3A 2GZOA 2VBWA 5L46A 2V6AA 1CJUB 2QA1A 3WDOA 1Y7PA 2JC1A 4F50A 1FEHA 4NRTA 1ZM9A 2M4MA 4RJVA 2IM3A 2OPSB 3D1OA 3JAMU 5AXNA 2P5VA 1KTVA 1RWMB 3FEYB 5D4PA 4WTOB 5E3PA 5T41A 1LV5A 3IN5A 2BXJA 3EVWA 1P1TA 3MMAB 5HANA 3M8PB 2C2EA 5D77A 3GYXB 1EQ0A 1N0VC 4RW7B 2ZJQQ 3I0RB 1JLQA 2AEJA 4MT1A 3OLBA 1IKWA 3C6UA 2XS2A 1C0TB 2YPYA 4P2XA 2ZH8A 1FA0A 1KOHA 5LM7E 3X1LB 3JYTB 4DPWA 3ZXWA 1DZ5A 3NEKA 4WKYA 4KHMA 3PHTA 2BUNA 2Y1RI 3ILJA 4C4WA 1LWXA 1EKSA 5HBMA 3HXMA 5HATA 2QIFA 1Q86T 1NK7A 3CSKA 4OV6A 3FSYA 3A3OB 2IC3A 2AYEA 4DBQA 3MM8A 2CNOB 1S76D 5L38A 3FBCA 4RUHA 3UR3C 2GAHC 1T9VA 3DNCA 1SJFA 2RUGA 3I96A 2LU1A 3EGZA 4USUA 1UL3A 1IVZA 2FDNA 3ISNC 3ISND 1DLOA 2HS3A 5DS7A 3LF0A 4KHPF 2C2DA 2WONB 2YWWA 2DO4A 2J9DE 4LIRA 5K8PA 1HQ2A 1AXQA 4ANEA 1QLNA 1KKHA 1NUEA 3MM7B 1SXLA 3M2UA 2UXBJ 1Q4RA 5HL7Q 5D15A 3DM2A 1RQ0A 1OSCA 1YSJA 4P7TA 2NXCA 4HVZA 4K4UA 1CJVA 1Q79A 1MU2A 1QSSA 2VG6A 4DSLA 2HQIA 3HHLC 5CHCB 4J9PA 1YIJS 4ED6A 3E8OA 3JQKA 4F3MA 1FJGJ 2DRBA 2XZTB 4CH1A 1HBOA 3EVOA 4XDDA 3BDEA 2M7SA 2R8GA 2VA3A 1HPZA 2CJBA 7AT1B 4NLDA 2DTJA 1KR4A 5G0RB 3E01A 4JI2J 1WI6A 5LSLA 1Q1KA 1WOSA 2HIYA 1VFJA 4WK1A 5FJ4A 3OFEA 4ZVQB 4KQZA 3GE9A 1P8GA 4LFBF 3D1QA 2ZH4A 3P5BP 4ILRA 3NNCA 3JTNA 3CJ0A 3UR0A 5KG5A 2Z58B 2F65A 1VBKA 3WIUA 3JQMA 1EETA 2VDIA 4C8ZA 2D69A 2CZ4A 4DV7F 3UN5A 1NKEA 2HVIA 2B4PA 4LF5J 4G1IA 2EG2A 1DTTB 2MJNA 2MYFA 1UA0A 1IKXA 4LBPA 3HMJG 4I2QA 2FVQA 1C4AA 3C2PA 3NY0A 5T14A 3QSIA 2R2SA 3AOCA 4C97A 2LYVA 4PWDA 5KFNA 1SQFA 4KGKA 1CQMA 2VIHA 2H3EB 1RAAB 1QE1B 1UWAA 3OVSA 2PA8D 2MSSA 4FYXB 3QGGA 3CCVS 2B6AB 3M9NB 1X0PA 3W66A 1HBNB 4FF1A 1T94A 2B43A 3R2DJ 4ZKAA 5KFDA 1GT8A 1F5CA 2BX6A 4TY8A 3ENWA 2W7PA 4LMZA 2Z0GA 2F8EX 2G9OA 2B51A 4Q5VA 2Z56B 3M6WA 2W7OA 3H0PA 1U26A 4NPOA 2ZBRA 3KYLA 3OBIA 4ERDA 3J7Z5 1R6YA 4TVAB 1JXEA 4L3KA 1N5QA 2W2MP 4FF3A 1XTZA 2IBOA 3QJJA 1FRJA 4DN0A 3H25A 2RKIB 4IDKA 1E6VA 2Q3PA 1RBAA 3W8PA 2OEMA 4EZ6A 2EVZA 4CWBA 4OX6A 4O3QA 5B0EA 3F73A 4J9VA 3QLHB 3G6YA 1BQXA 2BQUA 2KU7A 2R3VA 1U1OA 3MMBA 4N47A 4X64J 5DRKA 5GAGI 4DF4A 1ZM3A 4X65F 2X1BA 4IYQA 1VC0A 2B3TB 4DSKA 2CDQA 1X4EA 4DQPA 1S7HA 4K5RA 2W9BA 3CCTA 1T02A 2NREA 3F0NA 1LWCA 2L41A 1RZMA 2Y8YA 1LFPA 5B0GA 4C48A 1U1KA 2GCFA 2CA9A 1FXRA 5K5MA 3DOMA 3PEHA 4ZK7M 3EDQB 4XIUA 3W8GA 4ED8A 1K0VA 1B7FA 3TARA 3WIVA 4RL1A 2FJEB 2OGUA 4KV8A 2RS8A 3GMGA 2KRRA 3ICLA 1OYEA 2KDOA 1ZAWA 3W2VA 2VJUA 2EK1A 3K5NA 1VRTA 1F3VA 1HWIA 2FJBB 2CJAA 2I5JA 1GMUA 2WSFC 1HQEB 3C6TA 3CO0P 4Y6IA 2PN6A 2AJ2A 4ILLA 3HKZD 4OHYA 1FFSB 1N5YB 1M5KC 4DDFA 2ZJRQ 1NK4A 2GJ2A 1N56A 3T3FA 1M1HA 3NL0A 4A8MP 3PYGA 2AWZA 3SCJE 1DTQA 1MLAA 1C1CB 2MKCA 4LBIA 2R7VA 3EZOA 1T05A 2RF2B 4ILMA 3ITHA 2MKSA 1B3TA 4PXCA 2W9AA 4Y2CA 3I0SA 3J80Y 1VC5A 3L3CA 4KHRA 4XK8C 3T19A 3GIRA 3ZTQA 2XB2D 3M8QA 4ZCKA 3G71S 2L9DA 2RRAA 3SFUA 3L4BC 2YKOA 3AAWB 5EGYA 3X3UA 1WEXA 5KTQA 4OZ0A 3VHQA 1S0MA 1EHWA 3M8SA 4PUOB 3JXOA 5HO4A 1CS4B 2JL9A 2PEBA 2N3LA 2KTQA 4P10A 2D9PA 3C15A 1NB2A 2HFOA 4TU9A 1RWXB 3DLEB 5E3QA 2NXNA 3QSYB 5KFEA 1SKRA 2BM1A 4DFJA 2FVRA 4NEZA 1E6YA 1HNVB 5IWAJ 5ADZA 4DR5J 4EBDA 1VHIA 3ILOA 3L95X 5F8NA 3OUYB 2WAQD 1U4BA 2E5IA 2IYIA 2Y8WA 4W90B 4MJKA 2DPJA 3GFZA 1OS5A 2JVRA 1HNXJ 2RSQA 5SUHA 1TELA 3KLIA 5KFTA 3NLCA 3V81A 1B0TA 1WELA 3V6KA 2LEPA 1FRKA 4OX8A 4IQMA 3RB6A 3KDOA 3PR4A 2FTRA 3FCHA 4DLGA 4N7TA 4FYWB 1W2IA 1FK9A 3D2WA 4HH1A 2D3ZA 5LMNJ 3FVYA 2R7TA 2YKAA 1VK8A 3FBFA 3OQ2A 3VCDA 2A18A 4DV0F 1EB0A 2V34A 2ZBQA 5JMNA 1N6QA 1T9UA 4NRUA 2DJWA 4ZVEA 2RE1A 2F63A 4A46A 9RUBA 1ZPWX 4RW9B 1FT8A 4OX7A 3QMQA 1RCXB 3QGPA 1U0HB 2ZH9A 2XNRA 7FD1A 3CDBA 2AEFA 1IBLF 2OKQA 4O44B 4HACA 2P9CA 1S9GA 3Q8VA 4DV6F 1FE0A 3UDLA 3BR8A 4B9MA 3SSSA 2LXUA 4DL7A 4CLYA 2HVDA 4XPEA 4J37A 1HLWA 4OMFG 2LQ5A 4LRCA 4OJGA 5I3PA 4DN9A 2EI5A 1ZAXA 4DX6A 5D0EA 4FNHA 4IR9A 2KHDA 1U6ZA 1X5OA 2E1RA 2LKZA 1T3OA 2RDIA 3TZYA 4AL5A 4LRDA 2DXFA 3W65A 3GJTB 3SYZA 4Y3CA 3WC0A 3UN3A 2PSZA 4LF9J 4JI8F 1HIYA 2UXDJ 1JLFB 2VFRA 4ZLJA 2MKHA 1LWFA 3E51A 4NLYA 1WORA 1VQOS 2J7UA 1D8YA 3BYPA 3FEZA 2MZQA 1JLGA 3VGSA 2ZNZA 1S97A 1RGVA 2FVPA 3EGWB 3TX0A 1SUQB 4WKRA 3QIPB 1P6TA 2QLBB 4I64A 1KQSR 2NXJA 1FNMA 1QAIA 1J5EJ 5SZTA 1DQ9A 2MZRA 4URGA 5KOWA 1TR0A 1Q95G 1TL5A 2YNFB 5BYQA 2ZH6A 4ELUA 2QG9B 3GIJA 4YHHF 5J2NB 1HHTP 2BJ3A 2H9ZA 4DLEA 2G2ZA 3MMCA 4X2BA 1JLEB 3PEJA 4LF7F 1UCNA 3GPAA 2YKNB 2KFZA 2GO8A 2QT7A 2BE2A 2IMWP 4K4TA 1NBEB 1V9OA 1SC3B 2NPFA 1FRHA 1N36F 2WBRA 2IAJB 4NLVA 5A76A 4USMA 4ECUA 1KRPA 2QA4S 1C1BA 2FYXA 3B54A 2QN6B 2YWFA 3I9ZA 4QJVA 5GADU 1RT4B 4EO8A 4ED0A 5J2PB 3F41A 4HDHA 4FYDA 2CNLB 2QC3A 3HHLA 4DR6J 4WTYA 1KVKA 4C8LA 4QOTA 3RGIA 1SBRA 4X4RA 3LP0A 2OPRB 3DMJA 4C3KA 2R8JA 4TU7A 1CJTA 1UVNA 3BBFA 1ROFA 3Q89A 4I7FA 4MKVA 1JJHA 1MN7A 3C16B 1NMEB 1OSDA 2XO7A 4TLQA 3BSNA 1RT1B 3RR8A 4HH0A 5I3QA 1EZZB 2LDIA 1N0UA 1V3SA 1VLYA 1N48A 5J1EA 2HQCA 2OSQA 1WC5A 4ZLPA 5B0FA 2V4JB 1VDHA 3KLFB 4NCGA 4ZP7A 3HKWA 2J0SD 1S57A 2VPZB 4DV4F 2J9CA 1VQ7S 4X4PA 1O8BA 1P1LA 5E3AA 4K4VA 2A2CA 2ROGA 1W7WA 5HJXA 2VQFF 4QPTA 1HMVB 1IBMF 4W92B 4I1TA 4YUDA 5ETKA 4ZCLA 2GVZA 2UUTA 5A8WB 4KY3A 2UZAA 4QR1A 4CRJA 3TVYA 3CJSA 3RAQA 3OR2B 5HMXA 1H98A 1WJ9A 3J81Y 4Q0BB 2HLTA 2HNDA 4NXNF 4IRKA 1MW7A 1Q53A 2VKZG 3U1NA 4LSNA 3R7SB 2CPDA 2ZHAA 3GR0A 1PAUB 5F8MA 3BO2A 4USJC 3OW2R 2HBZB 4NMLA 4K8RA 1KHWA 2BJ8A 1QAJA 3HCXA 4WE1A 3TNVA 3K58A 4DCPB 4F4WA 1QVFR 2XMKA 4ZCMA 4YQWA 2LP4A 1HWLA 3ISZA 4OYAA 3L7PA 4DV2F 2IPOB 4RX6A 2LECA 3S6EA 4DV1J 4OZ5A 2DVIA 5IC4B 4EFAC 2VQEF 1J27A 4JI7J 2E5LJ 1GX6A 1AUDA 3DDKA 1FWKA 3W64A 4DV3J 1A6LA 2DHHA 4A4JA 1IJEB 1KLMB 1EJ7L 1I94J 1RWOB 4KH1B 1QDUB 4ZIVA 1QVGR 4FKYA 4CLTA 2GIRA 2ZC3A 3TA2A 3CT9A 2YQ1A 1UVLA 4B3MJ 2CVIA 3UWTA 1J5OB 2WSCC 4NA3A 2HHWA 1S0OA 1A7GE 1QJHA 2GHWA 1BD6A 3BGLA 3ULHA 2BRLA 2UU9J 1RTJA 2BANA 4M5GA 4AE5A 5JVHQ 3KLGB 4CDIA 3ZTRA 1YBTA 4TXSA 3EE3A 4X4OA 1WHYA 2XWYA 2R42A 1RA7A 1KVJA 4C8YA 3IBWA 3GJQB 2RQ4A 4ZCIA 1KQGB 4BWMA 3MR2A 1EIYB 2FHMA 1JIHA 1BMQB 3K5PA 4DFKA 4KGVB 1YJWS 2R8IA 3P4UB 4PG5A 1XK8A 3PACA 2X3GA 4DR7F 4B3TF 4YB5A 3QNWB 3CCJS 1ZM4A 4Q8FA 3CJ3A 3NNHA 4NLWA 1RAHB 4C3MA 3R1HA 4RNMA 2OPSA 3BQ1A 1Q16B 3HHEA 4QW8A 2PO4A 1IN0A 2LMIA 4U9RA 3VTIA 2YWGA 4I6YA 1HNZF 3M30B 2DIVA 3MECB 1KC8T 7FDRA 1B7YB 4QYRA 4IRCA 4IG0B 4PABA 2I6WA 1REVB 2F3JA 2FLLA 2C42A 4F4KA 3SCKE 3NGSA 3KHRA 4YOEA 1G4CA 2M52A 2YQ0A 4Y2AA 2AKWB 3ILLA 3BPDA 2JEIA 2VL1A 2QYCA 4EZ9A 4DG1A 2AIRB 2OD4A 3RW7A 3PTWA 1AB8A 1U47A 5HQMA 3CJ8A 1TKZA 1LWEB 2LQ9A 4M5DB 3QFWA 2JRSA 3R6GB 3Q2TC 1B64A 1U24A 2BQRA 2FVSA 2ZC4A 1PJ6A 4ZS6A 2M2BA 2U1AA 2K7KA 2YNHA 4NLSA 1WEZA 3B4MA 4B3OA 3A4TA 3TA1A 2DRDA 1VQ4S 4QCLA 2ZHBA 3GILA 2VH7A 2CQGA 3TUPA 4I6AA 4IFVB 4J9UE 1HW9A 3DN9A 1VQYA 3M05A 3RUBL 2A2DA 5J1NA 1S4EA 4JI3F 4YY3F 2UV8G 3OJUA 4CYUB 2MZ1A 1JXLA 1FHTA 3W61A 2GGPA 1R8PA 2NXEA 4V19X 4QW9A 1U45A 4DJBA 1GXLA 3BGUA 4USTA 3ONQA 2DH9A 2OPPA 1KWMA 3CMES 1ZA1B 1IM4A 4F4XA 3NGRA 5HROA 3DDIA 4UTGA 5AE3A 1TMMA 4ZVOB 3M6VA 3A1YG 5CYQA 2V68A 2Y0BB 4IG3A 4DEZA 5HVGA 3W5XA 3CDUA 3CD7A 3G8SA 2V8GA 4DPYA 1S0VA 3H5YA 3KFWX 3BGRA 2CJKA 4DR4F 4ZPDA 1HA1A 2K2PA 2DNOA 4O3RA 1U2CA 5F8HA 2RIJA 2MQNA 2DB1A 2AYGA 1Q0NA 1WI8A 3D6MB 2J0QD 2KH9A 3D3BJ 4RW8A 2RAQA 2DNZA 1JLQB 1MMNA 2RQKA 2ZOMA 4D3HA 1WTFA 2ALYB 4ES3A 1IKWB 3C6UB 3G6ES 3QZ8A 2L48A 4FVMA 5K8MA 3C8YA 2XNQA 1PKUA 2KT5A 4DV7J 3CDAA 4PCQA 3VAIA 1BE4A 1B0VA 1NH8A 1WKKA 5HBMB 3FFIA 2EC0A 3OJSA 1WC4A 1Q8BA 1S6UA 4HYKA 2IC3B 4X4QA 4J91A 1NH7A 3T1YF 1N34F 1K1QA 3MM8B 2VASA 1DRZA 4PPDA 4YN3B 3M2VA 2ASLA 4JUZA 3OTOJ 1N4LA 2E7VA 3TUIC 3MR7A 1RHRB 4L3NA 1RHUB 5EX0A 1X9MA 3AOAA 5A0YA 4PXDA 1XMBA 2ZOFA 1F2GA 1WG1A 5E33A 1N52B 1DLOB 1VGYA 3KHLA 3LQVA 2E9TA 3BEGB 1PC5A 2IVFB 1W26A 4RNFA 3KK3A 3MDFA 4QIFA 1FXDA 2A0FB 3M2UB 5C24A 2V9WA 4ZN1A 2H48B 1BC6A 1X5TA 1IR0A 3DM2B 1FEEA 4ZPWR 2ZWPA 3W63A 3PW7A 1RE1B 1A9NB 1CJVB 3CMQA 3PX6A 3MAAA 1RK8A 1YGYA 2EFOA 3IXQA 4CIOA 5F8JA 1MU2B 5C7PA 4QYZK 3VVTA 2VG6B 4MIWA 1UJ5A 3PYEA 2AYBA 2FD2A 3BSCA 3FBBA 2UXBF 3H5UA 5U47A 4BBYA 1HBOB 4WBFA 2HHXA 3DLLQ 2HGMA 3HSGA 2QGFB 2ZDPA 2ZVIA 1M1KT 2CIMA 2IJNA 2E1AA 1HPZB 2MGZA 4F4ZA 1SJ1A 4RNOA 3QPIA 2Z2YB 4DSIA 4PPZA 3E01B 5GMEA 3KHHA 3PRDA 4KSEB 1HYSA 1T3NA 1NSAA 2DKOB 2ZZNA 1T9YA 2MLZA 3CC7S 1UPMB 2QMWA 5HAOA 3CUNA 2YWEA 3BM7A 2CPJA 3QAEA 3K57A 2HFZA 2MTLA 2MY7A 1ZETA 4ECVA 4JI2F 2HKEA 3L09A 2KFYA 1VBXA 3VAFA 4CZCA 1EETB 1X4HA 3W2WA 2EFVA 3VVUA 3QO9A 5KFGA 3DRXA 4IOAQ 4DI6A 1VLOA 4HI1A 1RT7A 3TR5A 4ED5A 4JYAF 1RTIA 1IKXB 1D8ZA 1RHKB 3K0JA 3FSIA 4I2QB 2GQ2A 3B78A 1OY6A 2V8HA 4A8KA 2W9CA 1IBCB 2QL9B 4PWDB 2A10A 3TJ9A 3PJXA 3JTPA 2DISA 1U1MA 2BQ3A 4KKOA 2ZBIA 3GTYX 1U2RA 2V2VA 2WVEA 3BPSP 1SQGA 4DUZJ 2FJXA 2YNGA 4OI3A 3NS6A 1N33F 5DGBA 1FNXH 3GQCA 4TY8B 4B9SA 4FBUA 3OTCA 1F60B 4G6VB 2V67A 4UOGA 1H74A 4ZJQA 3PJ9A 2CPHA 4NLXA 3K8WA 4J90A 1YKWA 3ZNJ1 4PZVA 1FE4A 3BH7B 4QIWD 2V63A 3EM1A 4N56A 3T41A 2WVBA 2OIHA 5L9XA 1WHVA 1Q5VA 4ZA1A 3GG0A 4DCJB 1L3TA 5KFKA 1C1CA 1WF1A 4Y2IA 3MCNA 3PVXA 2G2YA 2VF3A 3M8WA 1TUVA 5LSRA 3EVMA 4DWIA 4NZ0A 4C0BA 5B7WA 1EARA 1XR6A 1ITPA 2RDDA 2CQIA 4IDKB 1JX4A 3AA8A 1E6VB 4LQ3A 1Y5LB 3HFKA 1Y0HA 1QUPA 4ETXA 1TKTA 5F3TA 5K14A 3KJNB 3T1HF 2C3YA 5H9FJ 4DR1F 3I4PA 3ENVA 3VALA 3K59A 3MMBB 4C8NA 1DAXA 1RA6A 4HKQA 2YKPA 1AFJA 3FBEA 4OLPA 3ILIA 3DLEA 1RUSA 4X62F 2Z8QA 3OPKA 1RWUA 2W9BB 2KT2A 1LWCB 2OMOA 1NKCA 3MEDA 3GZ7A 3MEKA 5HI7A 2P9EA 2XGQA 3DOMB 1XEZA 3HK2A 5KG4A 3TAQA 2Z30B 4KV8B 4ZHRA 3DC2A 2UVRA 4DV0J 3W2VB 2ZFHA 4X4SA 4KBIA 4URSA 5CYMA 2W01A 4KO0A 2VBXA 3ZZYA 2AGQA 1HWJA 4ES1A 1RT5A 2WRMA 1EP4A 1RLDA 3C6TB 4OIXA 1HR0F 2FC8A 3T5LA 1BUXA 2ZNYA 3Q22A 1WC1A 3I87A 4OZLA 4EGLA 1IBLJ 1V3RA 1UWBA 2HG4A 5GADI 4WJBA 4X4UA 3R5CA 2SXLA 5D6GA 5F8LA 1DTQB 4DV6J 3HJFA 4A8SA 2DH7A 2GVDA 3RG6A 1RJJA 1WOPA 2VPWB 3ITHB 2HNZA 2C3UA 3DFEA 1Y9OA 4WU2A 3I0SB 2BV3A 4JI5F 3HULA 4Q8EA 3M8QB 3UPFA 2JLEA 1VC6A 4F3QA 1FFWB 1WF2A 3GLJA 4H4MA 2AD9A 3DRYA 2XZWA 2EG1A 1PJ5A 4YR3A 3OT9A 2V2QA 2XGPA 2F7VA 4JI8J 1CULA 5FLXY 2VICA 4X4VA 5E41A 3AHPA 3P5TL 3C15B 2OFGX 1LW0A 2N7YA 4MKAA 1FRXA 2QSWA 3NAIA 1E6YB 1RHJB 4ZVTB 2DH8A 2XS5A 4FKXA 2BDPA 1RT3A 3GFYA 1SC6A 4M1KA 3WC2A 4DU8A 4Y0FA 4AL6A 4U67Q 2RD5C 3HX9A 8AT1B 5HJYA 3HP6A 1LXJA 3KLIB 3HJVA 1VBYA 3V81B 3KLHA 4CTAA 5IWAF 4DR5F 3D0HE 5D0HA 6FD1A 4B3RF 2E44A 1IKYA 1SI9A 1HW8A 2JFDA 1O51A 3ZFVA 3GV8B 3OHAA 1R8AA 5FLXU 5JUMA 1FK9B 3ZTOA 2KHCA 1ULRA 4XAKA 4LF7J 1YJVA 1HNXF 2JLFA 4UZCA 2HNYA 4C2MA 2D74B 2DT9A 4E0DA 1NSPA 1N6QB 2YKMA 3IFEA 4NLPA 3KK2A 5EUHA 1BWEA 4HHJA 5ETQA 3ZZPA 3MXHP 3SMZA 3LP2A 3PY8A 4NOHA 1S4FA 1RHMB 1R7IA 4ZJLA 1NSKL 3GSDA 2GQCA 3GJRB 2DR9A 4L75A 3N79A 3GCWP 4ZJOA 4HACB 2ZD1A 2J8AA 1S9GB 4K4YA 3B8HA 3ZTSA 4LF6F 2WW4A 5LMUJ 2HSEB 3HI9A 2R2RA 2JOQA 1WTBA 2ZITA 4NA2A 1BXNA 2ZH7A 2BBEA 5J2PA 3KUEA 1UAWA 3BBCA 4DPXA 1S1XA 4EK2A 4JBCA 2ZJPQ 3K89A 3M8YA 3ZC4A 2PFDA 3FKBA 2AEMA 1HHSA 3IAS9 1L3UA 2FQQB 5KG7A 4BC7A 2DGSA 3MCSA 3SQGA 1S9EA 5ETLA 2AX0A 5ETVA 4OFZA 3VGVA 3LW5C 2NSBA 1MROA 3UO0A 1RT1A 1LWFB 3KG4A 4GKJF 3DYAA 2EKYA 4DV4J 3ETMA 4LFCF 2NUHA 5IZHA 5DM7Q 3UDCA 1JLGB 2FLPA 4ID8A 2B7BB 4HTIA 1TKXA 2HZVA 2XQCA 4LF9F 5DQIA 3HF5A 5L1JA 5AXKA 1CG2A 1IBMJ 1S6OA 1TU0B 1KOOA 4ENOA 4DFMA 4JV1A 1HWKA 1YX2A 5AXMA 3KG0A 3U1LA 5AXLA 3IG1A 2OEJA 4NXNJ 4Z2XA 2W2PP 2P9GA 3NAHA 5C25A 4I67A 4P75A 1P27B 1WOOA 3MMCB 2H1YA 3ADAC 1NJXA 4A8YA 3LP1A 3FK4A 3HD2A 4H4KC 1S7IA 1XNQF 1T9WA 5DQHA 1CBKA 3ZZUA 2KM8C 2VBYA 5ETMA 4OZ3A 4Q0BA 4PQUA 1VRUA 2BE2B 2AT1B 1MNEA 2NR0A 3RJMB 4PR6A 2OJ3A 3NMAA 1KFDA 1YRTA 3U7JA 2CVEA 3EYZA 3MUTP 3US5A 2KO1A 4DV2J 2H51B 1FD2A 5HP1A 5HMWA 4OI0A 5E0OA 2CNNB 1U6BA 5ETPA 4DOZA 2VQEJ 3UVJA 2IY5B 1YVFA 3M8ZA 3MR5A 2GMHA 2APOA 3QT7A 2X1AA 1C1BB 4CLWA 2XLKA 1D1UA 2UVWA 2HZAA 1QAXA 2KVQE 1FTRA 4ZVRB 1GXTA 4PXBA 4RZRA 2HRUA 5D3GB 3HHLB 1ZBTA 4QQBA 4UT4A 4I2PA 1PBAA 2I1RA 2EFNA 4BCAA 2HRTA 1SH2A 4LSZB 2ZVSA 2GQQA 3LP0B 3DMJB 1WDTA 2VPYB 3L7UA 1WDDA 1CJTB 4ICLA 5KFAA 4I7FB 4J9SA 3EMTA 1GFWB 1LK7A 1S72S 3MPYA 3TA0A 4DR6F 3M32A 1ZZFA 1DY3A 2BVZA 4GO5X 3MPWA 5J1EB 4Z7CA 1WWHA 4ZVGA 1RTDA 3PZPA 3LOUA 4C8MA 4ED4A 3EX7B 2V94A 4N77A 5HQLA 3M6XA 4NCGB 4OI1A 2F1FA 3BBBA 1RBOB 5A8KA 1SL0A 3R1LA 2GHPA 4B3TJ 5DGAA 4OZNA 4WWSA 5L1KA 1FKAF 2W8KA 2PDAA 3I5BA 4FF4A 1I6JA 3V4MA 2I8EA 2OTLS 2GVZB 5IOLA 4ECSA 4TKTA 1RADB 4DS4A 2J6SA 2XZDB 2HHQA 4DPUA 2V50A 2HNDB 1X9WA 4IO9Q 2UVUA 2P8IA 4LSNB 1FVSA 1L3SA 4RW6A 4EYIB 3MURP 1KEKA 3UCZP 4NLRA 4BLGA 5DDOC 4M5IA 2KVIA 4HLBA 1WC6A 4WE1B 3MFHA 5MLCV 2ZHOA 2FPHX 4CT9A 2HPUA 5D78A 3MPDA 4FF2A 1SH0A 3BKTA 3SBMA 3IR6B 4HDGA 3AJDA 2E5JA 1R0CB 1YTYA 4NYZA 4ZOSA 5FD1A 2EC2A 2V8VA 2B8PA 1VCTA 4QPXA 2DNHA 4M5NA 3LAKA 3IS9A 3HZGA 4YY3J 4USWA 5LT5A 1ELOA 2VHGA 3RW6A 4ZMMA 2XO6A 5IS2A 3T5JA 3IM9A 2AJ0A 1XWLA 3TOQA 2DNGA 2BA9A 3GFXA 4Z7YA 1WHWA 4R0EA 1RTJB 4JV0A 2MDAA 2BANB 3D66A 2KXHA 3MAHA 1PYSB 4DXLA 3OV7A 2CAJA 1XJWB 3SSQA 1NDCA 1I5OB 5E2QA 4MK9A 1RWVB 3RBZA 2NSCA 5EX3A 1X5SA 1S12A 4CO0A 3DRSA 3KNGA 2N82B 1Q8LA 1NHUA 5H9FK 1ZZNA 4K4ZA 4OJHA 3ZTPA 2HRYA 1O0PA 2G1DA 2DNKA 3SI8A 2BJ7A 2AJFE 4IH7A 2MZSA 4N5SA 2C28A 4WCEQ 3P96A 4ELVA 1NPKA 4DR4J 3N6MA 1S59A 2DYAA 3KNAA 1BWVA 3VF0B 4M95A 2OI2A 1F2HA 2XMMA 3QJLA 5KFUA 3WHIA 2D3O1 4DMZA 1U1LA 4NXMF 2C1EB 2HS0A 1NRKA 4USVA 3OD2A 1XERA 2CFXA 2CPIA 3MUVP 4OYXA 2PT0A 1N32F 2XI3A 2W25A 4LR8A 3KK1A 3AJ2A 5F8IA 4U7CA 2AJ1A 4RO0A 1JJCB 3GV5B 1SC4B 1M5HA 4FNIA 3OHBA 4X4NA 4LFAF 8ATCB 4DG1B 1KHVA 5DLGA 4P6QA 1TKZB 3EDRB 1KP6A 3Q8RB 3QFHA 3T1YJ 1N34J 5ETSA 2NQPA 1VQNS 3CCZA 2VPXB 1Z2ZA 3VQTA 1FCAA 4WFNQ 1HBUA 3H20A 2ZH3A 3I56S 2YNHB 3O2IA 2E1PA 4B3OB 3IWNC 1UKUA 2DK2A 2J76E 2QSFA 1HNWJ 1S1TA 3DLJA 1VQMS 3IGNA 4MYTA 5IV3A 4WZQA 2DRAA 3RRHA 1XMQF 2GGPB 4D3GA 1RAEB 1SKSA 3P6YC 2JFKA 1S1UA 3OLAA 2FJVA 2DBBA 3VGUA 4EWTA 3MWBA 2OPPB 1N8RT 3MAQA 1RP5A 3HSZA 1PGZA 2CJ9A 5HROB 5KT3A 3UCUP 2E7XA 3DRRA 2P6SA 4ECYA 1M5VC 2L9NA 1RCOB 1YLXA 2WVCA 5CYQB 5IT4A 1J2VA 4IG3B 2NXUA 2BM0A 2VKRA 1PJ7A 1H2TZ 2Q66A 2KZMA 4LR9A 4I69A 4F67A 3VAJA 3H7HB 1W2BR 3C14A 3K5OA 2HMIA 2MEWA 4F7VA 3BGRB 1WEYA 1YDLA 3UNYA 1S79A 4N8OA 2E1MC 2YWKA 3HHLD 4UY8T 3H42A 2YX4A 4FVCA 4MMOA 3ZO7A 1H7XA 1DJ0A 3CCSS 2ZWOA 1K1SA 3U02A 1IUJA 1LOUA 2G0IA 2QLWA 2CKWA 1KTQA 4F04B 4RW8B 2AV5A 4MTPA 3DGPA 2RDJA 1SH3A 5BR8J 2K1RA 3IMQJ 4ZVFA 3M8RA 4LUBA 2EW9A 2VBZA 4WYLA 3UD3P 1YK9A 1IR2A 1ZTTA 3MCOA 5IM0B 4JYAJ 3UNGC 1BY9A 4RWXA 5FDLA 3CWJA 2PFFB 3FFIB 2XYPB 3MM9A 4YR2A 1MSWD 4RLEA 3S8SA 5IV4A 4DPOA 3G82A 1B70B 2B9WA 2ALZA 2IRUA 1R0AA 2OPQA 4R5PA 3M2VB 4ECTA 3CJ5A 1G7CB 2XG8A 4GVLA 2IJRA 5A0YB 4B9NA 3AXKA 1N33J 1FJ7A 3LWMA 1S0NA 2IMOA 4FP9A 3A8KA 1RBLA 3LGHA 2M70A 3OTOF 2HW3A 4A8WA 5AT1B 3KK3B 4L6V3 4OZJA 2V0NA 2XBPA 1C0UA 4ED2A 2W2NP 5J1PA 1VISA 4NZ7A 1Z4UA 5C24B 3Q8QB 4HEA9 2HGLA 5AE2A 2DNYA 4H54A 4EEYA 2K7JA 2WB1D 4L72B 4PYAA 5KT5A 4LSLA 2LA4A 5KT4A 4CP5A 1K47A 2CG8A 3G8QA 3MAAB 3K5LA 2CQPA 3F56A 2YKQA 1QD1A 4K7QA 3A8IA 5EWEA 3CC4S 3DI6A 5C42A 4C9DA 3FDSA 3D9BA 2C2KB 4FZVA 2PEHA 4TNOA 2BABA 1WF0A 3HVAA 2MGZB 1RAOA 2B9XA 4FXVA 5JJBA 5KFVA 4K0KF 2F40A 4CM2A 3TEGA 4ATNA 2R4FA 1NKBA 3FQKA 3T1HJ 4DR1J 3VGTA 2VOPA 3DOKA 1RAFB 1U49A 1HYSB 5GAHI 3HM9A 1IBKF 3HLUA 1OQ6A 1UFKA 4H4KA 2FZCB 3R5DA 3NS7B 2FUG9 4X62J 2HURA 1YI2S 5I42A 3ZNUA 1T9XA 3TQ1A 5KAKA 2ASDA 3W2WB 3I4HX 4YB1P 3QO9B 3QYYA 1PCAA 4P71A 3UN2A 2ZBCA 4FPIA 4FN5A 3W1YC 4JV5F 4DR2F 1NZAA 1NSQA 4ECXA 1RT7B 5DDPC 1RTIB 3HHDA 2HAFA 3PFEA 2IFXA 3UCGA 2W9CB 2D3UA 1VIXA 3SSRA 2HHPA 1VK3A 5DLFA 3MEEA 4KKOB 3BJYA 5IQ6A 3DRPA 1ACMB 2W24A 2KYXA 3CB4A 1HR0J 3HHKA 5KFIA 1KD1T 4OL8A 2WW8A 2Z4PA 2J5AA 2YNGB 1Y5IB 4Q43A 1SJRA 2YX7A 3EGVA 2HQGA 2CNKB 1RT2A 3W60A 5KFBA 1T11A 2V8PA 2PE8A 3JTOA 3FC9A 1U1QA 4DUZF 1FJEB 4PG4A 2Y0SD 5K9FA 4E98A 5B0BA 1NHVA 1OPIA 2PMWA 4WFXA 3PYDA 1CSJA 2OELA 3TX8A 4JI5J 1X4GA 2HK3A 3MM6A 1N5TA 1FKPB 5J2MA 3T9ZA 4ID5A 1ZOTA 3CE8A 2JEFA 2GFFA 4QBUA 2Q43A 3RBDA 3DXBA 1ZPVA 2B4OA 1NK0A 3GWCA 1D0EA 4ANDA 3D1HA 3BREA 3A8JA 2RB7A 1TL4A 1TK0A 2ATCB 3Q8UA 1FF2A 1TKTB 1T03A 5K14B 2KJVA 2XULA 1U7LA 1RWNB 3G6XA 1UW9A 2EFGA 1T8EA 3EZUA 3ET6A 1RDRA 2AW0A 4Q2MA 1ZM2A 2QL5B 2L3MA 4P74A 4IH5A 1UFLA 3KUHA 4BS2A 3TEHB 2K06A 3NGTA 2KXFA 1AZSA 4USHA 1HHQA 1RWKB 4YS2A 4LF2A 4CT8A 3MEDB 3CJKB 4B3RJ 3U27A 3J80U 4G1QA 2FLOA 1TL3A 1QAYA 1WKLA 4V1Ak 3BV8A 2BJ9A 3BKFA 3HFVA 2HFUA 4ZHRB 2JWNA 4KJIA 1NO8A 3ETOA 3R27A 4EI2A 4MFBA 5CYMB 3QQCD 3NNAA 3Q8SB 2CQ4A 3GJSB 4KO0B 4G3IA 1ZH5A 1RT5B 3G8TA 5F9NA 1EP4B 3H2VE 1Q8KA 1GMWD 3UQSA 3W7BA 1S1VA 4PWUA 2IDEA 2X1GA 4MIBA 3J81j 3RRKA 3NWGA 4F3OA 1GNKA 1UWBB 1SKUB 4IOCQ 3CEDA 2JZ5A 2BE7D 4OHZA 3I9V9 2GVDB 3D7SB 4B9LA 3M9OB 3CNQP 3MUMP 4CO5A 3TP2A 4K4SA 4LF6J 1QTMA 2OMLA 2HNZB 3HT0A 2XMTA 3N5BA 3HZEA 1K0TA 2GS8A 4Y34A 2HHVA 2QLFB 1GTHA 5IXUA 2HVZA 1PYOB 3B6BA 3LAMA 2FHKA 3BH6B 3DLBA 3OTEA 3KDNA 2I2YA 1TUWA 4PG7A 4YDDB 1VS3A 1WUUA 1FX4A 4H4MB 2JEJA 5J2QA 3HVTA 3VAHA 2K3KA 5KG2A 3G96A 4LR7A 4UUWA 3TUZC 2JX2A 1HD0A 2GJFA 1YJTA 3W9IA 1CULB 3H4BA 2LU2A 2XYGB 4OHVA 1UA1A 4Q44A 1GAOA 5KFSA 2V2KA 3HHNB 2XY6A 4KIAA 4GKJJ 4ED7A 1HNIA 1LW0B 5BYSA 4LF8J 4LFCJ 3MFIA 3V2UC 4RBVA 4WIIA 1SJ3P 2J7WA 3S1TA 4PG8A 1SJQA 2L08A 1UEKA 4AXJA 3THTA 2GAGC 2PGCA 4P2MA 1RT3B 4ZVHA 2ERRA 1PO6A 2YVSA 3OR1A 3R97A 2XM3A 5ITHA 3VV2B 4YEAA 4CM0A 4PAAA 4QYZJ 2Z2LA 2G13A 3KLHB 4CTAB 4P52A 4J9MA 4H4OA 2X51A 2C2RA 3B82A 1YJ9S 3PW0A 1IKYB 2XLJA 4Y65A 1SPBP 2FLNA 2P6TA 2B9YA 1FO1A 3UD5A 1Y00A 3QWUA 3TWZA 3OVAA 1XNRJ 2GNKA 5GMKa 4OYIA 1XNQJ 2B5JA 2HAIA 4UOHA 5D0RA 4LRAA 1JNRB 3AOBA 3ZZZA 4EYHB 2MLXA 1XR5A 3ELHA 2HNYB 3G87A 2DEIA 3W9JA 2YKMB 1Y10A 4YFUA 3KK2B 1EKRA 2ATLA 3KJVA 4ZPTR 3CD0A 3D6HB 4ZPCA 4ZITA 1RU2A 4LIWA 4CLUA 3AXMA 3LP2B 2C3PA 1B99A 4OX9F 1R27B 1HI0P 4E2FB 2AHOB 1VQSA 3HSJA 1CEZA 3AJ1A 1NJIT 1Y3JA 2HHUA 1RXOB 5KFJA 5K20B 2ZD1B 3HPOA 2GO9A 3H5XA 3VZHA 1TL7A 1V6HA 5DG7A 2ASJA 4RBTA 2OH2A 3N9UC 1JWWA 1NU4A 3P45B 2QFIA 2DNPA 4WF9Q 3KG1A 2JLGA 2A6OA 5HLFA 4U96A 2BZ2A 4CO1A 1S1XB 4QR2A 5DJBA 2UUCF 5C2GA 2OD6A 3T5KA 3IWLA 2DR6A 5D3GA 1HI1A 2ZZMA 5DG8A 4RW4A 4O3OA 3OTDA 5LMUF 1RB0A 2IA6A 3SQGB 1YJNS 4DL5A 1S9EB 4AXIA 3EWGA 5THWA 3NKYA 3NCQA 3RZAA 3JAMY 5CYJA 3VQSA 3CDWA 4UQGA 3MR3A 1MROB 2J0WA 1C2PA 4MK7A 1VQ9S 3LGNA 3DYAB 2UXCJ 1RKIA 2RUSA 2E9RX 2CPFA 4X4TA 4OQJA 1BQMA 3C19A 5KFYA 3TW0A 2YWHA 1TKXB 2CPEA 3FEXB 5H9EK 3I5CA 5AE1A 3CCMS 4ECWA 4FXWA 3TYTA 4IUFA 4WYWA 4PEOA 1ZYQA 3MGJA 1S10A 4P7VA 3R2CJ 1Z2LA 1YBUA 3IG1B 2ZKUA 5DZ7A 5C25B 4K50A 4YB6A 4GKKF 4GVBA 4K4XA 4NCBA 1TFYA 3NP5A 3LP1B 2WBMA 1YRXA 1X5PA 2DY9A 1MWQA 3I6PA 2DHGA 4NMXA 4KH0B 2KRBA 3UDVA 4PQUB 1VRUB 1WHXA 2XEXA 2W7AA 2BACA 1FX2A 3OVBA 4FYYB 1HD1A 4I0WA 4HTJA 1VOMA 5HP1B 1G3OA 4Y2MA 3NS5A 4GO7X 2CJYB 5HN0A 3UVJB 2N7CA 4O0IA 2G4BA 1TP7A 3J7AN 3UFCX 1KN6A 3JSRA 4MKYA 4C3LA 2D3OR 3GV7B 4MAKA 5E3CA 3PRVA 3H2UB 2DNQA 3R5AA 5KFHA 5IQQA 3QRQA 2UUAF 4UQTA 4I2PB 1XMOJ 4NZ6A 3O1LA 2M88A 4JI0J 3J81U 4ICLB 4HHUA 5KFRA 2PC6A 3GB0A 3V6DA 1U8WA 1PYTA 4MK8A 3VAKA 1RYRA 3IP0A 1H72C 1BQNA 1X9SA 5AJ3F 4K4WA 4MIAA 1U48A 3Q0AA 3N6LA 1KVIA 3M32B 3LWLA 5BYRA 4JI4F 4B3SJ 4DF8A 1RTDB 4U95A 1TV6A 3N5FA 1SQEA 3D4JA 3R6LB 1JLBA 2QZ8A 4XO0A 2MKYA 2N4DA 2ACYA 2QYGA 3FJ2A 1DQAA 3BR9A 4NLUA 2FHJA 2BOPA 1MWYA 5A8KB 1A0OB 2JVOA 4F2SA 3AODA 1IQTA 4NLTA 4XDCA 3G6VA 4NXMJ 4L73A 2MB0B 2QMXA 2V5HG 3WX4A 4I68A 4J9QA 2ASYA 3BZQA 5CD4H 3HDSA 1N32J 4F0HA 4GMKA 2B56A 5A2QY 1UEUA 1EX8A 2CPYA 3MEGA 3LO3A 3PNIA 2NCKL 1APSA 3FMWA 1V5VA 2BKOA 5EWGA 3D68A 4LFAJ 4AFFA 4JI1J 4RW6B 2MQ8A 3GIIA 1DFDA 4CQ1A 5EHHA 1UJ6A 3TANA 2CPXA 3HVWA 1FKOA 2IM1A 5L8RC 5L1IA 3K8VA 1U6FA 3K17A 4TYAA 2DEJA 3MI7X 2HS4A 3M1VA 2YH1A 3IBFB 3IRXA 2CQBA 3CCWA 2AQ4A 2CPZA 1S48A 4CLKA 5F9LA 2Y3YA 4O3NA 4NLOA 4CI0B 3FUYA 5A2QU 4HT7A 5EWFA 1NJWA 2NZCA 1F5AA 4OYWA 5CCLA 2W1BA 2DNNA 3IS9B 1EQMA 3QRPA 3NCRA 2XCAA 1S6PA 3NG8A 1RTHB 2G0JA 1XMQJ 1JLAA 1FDNA 4A8XA 1IQZA 2IRYA 2XMAA 5M2PA 1U2FA 2BKPA 5D0GA 2R7OA 2ROEA 3DOLB 2X7IA 4CNZA 5L9NA 4KPCA 3TJ8A 4RNNA 1Q81T 1HBMA 1FDAA 1LKZA 4ECRA 1OO0B 3OFGA 1OWXA 1JJ2R 3DRSB 2CQ2A 2UVVA 5IC6B 4P9SA 3PRBA 4J9KA 4KC5A 2KB2A 1S6QA 5I4MA 1HL6A 2CRLA 2W4PA 2DHSA 4F26A 5HVFA 2JJ4D 2Y1JA 1SV5A 4OHXA 5ETOA 3CULA 5KOXA 4KGXB 2ROPA 4JI6F 3WBZA 1Z1ZA 1FDDA 4CH7A 3JSMA 2CG4A 2DNMA 4FPRA 2LEAA 2C2NA 2YNIA 1VHFA 3EPGA 4B9TA 2XMUA 2W2QP 5KT6A 5BJRA 1M5OC 2POKA 1VQLS 2UUBF 2CDRB 1FRLA 4YP3A 2EBGA 3BYRA 2DNRA 2DXEA 3D5MA 2N3OA 2AZ1A 2M5YA 2PIIA 3KK1B 4O4RA 2WOMB 2VG7A 1RLCL 2KJWA 3OL9A 1B4SA 4UY85 3G86A 4QU7A 2VA2A 1AW0A 3BDPA 4RR5A 2XMVA 3MCMA 1GMWA 3PG9A 1VQ6S 5EN1A 2CQ1A 1NDPA 2DHXA 2L9WA 1WG5A 4DX7A 3QBCA 1QM9A 2QFJA 5KFWA 1S5ZA 2ZH2A 4JOUA 2XI2A 1IWAA 2OSRA 2W2OP 5IM0A 4WP9A 1HBUB 4WFYA 3DHXA 4YMEA 2EEYA 4O0NA 2XC9A 4WXWA 1ZS6A 1U1NA 2RU9A 4WFZA 1RT6A 4PKDB 4OHWA 4O3SA 1S1TB 5M2RA 4DSEA 3Q86A 3AA9A 2W8LA 2AP6A 2IDLA 1CC8A 3MF5A 1NCLA 2WVDA 2A1BA 3FZBA 1S1UB 1HNWF 1YG0A 3I32A 4QU6A 1OY8A 2VG5A 2ZE2A 4NI2A 2VV5A 5DM6Q 3DRRB 2CJQA 4F0MA 2RRBA 2VFTA 1W25A 2QRRA 2UP1A 3SCLE 4YB7A 2CQ3A 4YR0A 1Q8IA 2CQHA 3C3LA 3TZXA 3CJRA 3C14B 3LALA 5CD4A 2E5GA 4G1PA 4TU8A 2HMIB 4F36A 2G0CA 4GC6A 3MMJA 2OEKA 4K0KJ 4X66F 1U1PA 2XHCA 4ED3A 1NDLA 3DU6A 2ADBA 1K8AT 3O5TB 5F0WA 2FJDB 4FS1A 1IBKJ 2KZZA 2COLA 4FXDA 3DGPB 4HL9A 3K5MA 2F8HA 1UZHA 4ECQA 2K1RB 3NGUA 4A47A 2JDJA 3PW5A 1YJUA 3GG1A 5KFLA 4KAIA 4JV5J 4DR2J 3GYGA 2FGCA 2CZ9A 4C98A 4QR0A 1LEOA 1VQKS 4M8LA 1QSLA 5FDLB 3EGNA 3FGVA 1RABB 2E5HA 3H90A 3IBCB 3MM9B 5BR8F 3WQPA 3G82B 1JKHA 3EICA 2MQLA 5F0UA 1ICEB 4DV5J 3POTA 1R0AB 2OPQB 4R5PB 2ZOGA 1U8SA 5T7LA 2Y1LB 3KJFB 4LJMA 3AQPA 3THPA 4WU3A 3TQEA 3T6BA 3PKYA 3N01A 3G9CA 4R0JA 1AUSL 2KKHA 1VMBA 1PG5B 4X84A 4QZVB 3ENQA 4ZPBA 2QE5A 5B0DA 1XC9A 1NK5A 2DGUA 3NGKA 1KSPA 2HQDA 2EXUA 1C0UB 3P49B 2CWKA 3R9LA 1S49A 2HBRB 3NOGA 1UVKA 1FD8A 2MKKA 5KT7A 4ZP9A 2V8DA 4LSLB 2RMLA 1S1WA 3H4DA 1UVJA 2HHHF 4IO1A 1HWUA 3S01A 1PILA 1TL1A 4OI2A 3C66A 1CJKA 1F0XA 1V5IB 4DQQA 3DI6B 5C42B 3KUGA 2Q1LA 3M6UA 1WACA 4CO2A 1KQKA 1FKPA 2FGOA 3GYNA 2JSXA 4Q7AA 4CH0S 2ZZTA 3TVZA 3BKUA 3T6JA 1ZA2B 3CJ2A 1NJZA 3P8BB 3V5RA 3EUNA 1BHNA 1IWGA 5CAAA 2LQBA 3SDEA 3DOKB 1YQHA 1P9YA 4C11A 3IO1A 2XSJA 1MWZA 4O3PA 4B02A 2O01C 4OI6A 3CC2S 2ZH5A 3CO9A 3GP9A 3NBPA 4WZMA 4BHQA 1R6VA 3CDEA 5LJ5Y 1Q78A 3AB2B 2KM8B 1YJRA 1Q5YA 4DSFA 4OZ1A 4ER8A 4A8FA 1JXVA 5I42B 1VQPS 2XMWA 1NB7A 3GIKA 2GV1A 1C4CA 5DO2A 1U0SA 4KGMA 4C6AA 2NZ4A 2IIHA 4ALZA 2HYIB 1SCJB 3P3DA 4ETZA 3H59A 4B08A 1X4DA 4HR2A 3KLVA 3CJKA 2RNEA 3W3SA 1TVRA 1R8BA 3IAM9 3B4DA 3JB9k 2PMZD 3MEEB 1Y3KA 3DRPB 3EPIA 3DXSX 3H40A 3AB4B 1FWPA 2M3DA 4F2RA 3EJMA 2M8HA 4DU7A 4OJ3A 1DQ8A 2KFNA 4CLZA 1WSVA 3V4IA 3SXLA 1JLCB 1RT2B 5DETA 3O8WA 3OL6A 3JS9A 3FMBA 3TAPA 4WP8A 3OFFA 2CXEA 2UUWA 1RSCA 2J9EA 3LPEA 1REGX 2OLWA 3DCAA 3R5JB 3MM6B 2HFVA 5J2MB 3JSBA 3RB3A 4AT1B 4ID5B 2HVEA 1HQUA 2BYCA 2D7SA 2XS7A 3RTVA 3MZIA 5D4LA 4W4MA 3DLHA 3CIMA 5KFMA 4EUVA 4NYPA 2LDYA 3CD5A 3ZZOA 2MLYA 3KHGA 1R3NA 1UW4A 2BEFA 3TAMA 5A6WA 4I56A 2GMJA 1N88A 3PFOA 3O3LA 1UPPA 1O5JA 3OXLA 1JK9B 5E3RA 2DITA 2FJAB 2DIUA 4NL5A 3PKMA 1T03B 4KYZA 2HWHA 3C46A 2R7WA 3IR5B 4O4GA 3ZZTA 4KFBA 4TQSA 3ET6B 1VJQA 1LFWA 4HHHA 4ES2A 3NOCA 3R5BA 3S7RA 4FDFA 2EPIA 4P2FA 3SEOA 2ZM6J 2HWTA 3G2XA 4A8QA 3I5AA 3D67A 3M2RA 1D9DA 2ZH1A 1AZSB 2H4WB 5GAHU 3DLGA 1MMLA 5ETTA 2F4VF 1GEHA 3TZZA 2QLJB 4KPYA 5LL6d 1WD6A 4G1QB 2OHDA 1NAQA 1R0BG 5B0AA 1TL3B 1Y5NB 2LXFA 4DPTA 3WX8A 2VC0A 2XY7A 1FI4A 4M5JA 5DDRC 2KXNB 1U02A 2QL7B 2HQ3A 5JVGQ 2ZUGA 1AROP 4MFBB 3R3TA 2R8HA 1OJ4A 3TJAA 2E7WA 3W5ZA 1G2EA 2V69A 3DLKA 3NWRA 2DGWA 3I55S 1YJ7A 3HSDA 4OX9J 4RUAA 2OTJS 2RVJA 3BF4A 1D3WA 1S1VB 4CO3A 4K2XA 4QWDA 2DGVA 4IRDA 2H5EA 3JSYA 4NYOA 1KS2A 4G65A 3AT1B 4F4YA 5ETNA 2FIUA 1H3DA 1KFSA 4Q2LA 3KMSA 3CCLS 2DD8S 4KE5A 3GFHA 2NUUG 2QV6A 3RB4A 3LH2S 2AX1A 2IYGA 3LPYA 2F4FA 1K9MT 1RISA 4EBEA 1X0FA 3CF5Q 2R7UA 2B4VA 2H5IB 5I3UA 2DXDA 2UUCJ 4DZ6A 4NLGA 4NWBA 4U8YA 1TMJA 1IKVA 2ADCA 3I31A 1O6XA 2ZBPA 4NX9A 2E66A 4LF4F 5J2QB 3HVTB 1FESA 3UE2A 1TUGB 3PCOB 3MM5A 5HMYA 2UV8A 3A3NB 2D1CA 1ZTWA 1RAIB 5GAEU 1JB0C 2HBQB 2FHOB 1X4AA 1X4BA 3MOJB 1HNIB 2VJVA 2KYZA 2RHSB 3KLEA 1GQEA 2DCUB 3HVRA 3J7YU 2W4CA 5A8RA 2PMHA 3MPUB 3CJQA 1YBAA 3QWPA 5CCMA 3SV4A 3QRRA 1LW2A 3OR1B 2PD1A 3AD9C 2HLUA 1NPPA 4LF8F 1NNDA 2V2ZA 3A3PB 1TZ0A 1QY7A 3LTOA 3KTQA 1T9TA 4H4OB 5KG3A 1NPRA 4KTQA 2XWXA 1NM2A 2D41A 2O66A 4R8UA 4RU2A 3R5GA 4WFBQ 4U6PA 4CLLA 4GKKJ 4J7CA 1VQ8S 2RJZA 4IOBA 2JNJA 4IFYA 1FERA 3JQJA 4I4BA 3Q8YA 1FRMA 2R7QA 2R8KA 1QUVA 2EK6A 2B5JB 1F5BA 4QIGA 1LNQA 5KG0A 1CJUA 1PAEX 2RQCA 2VB6A 4DZDA 2WK4A 4ZP8A 1TK8A 1FNOA 3KJVB 3UDEA 5F3ZA 2WSEC 1H2VZ 2FB0A 1XNRF 4ZPVR 2MQMA 4DUYF 2B4UA 2V9KA 2AYMA 4F4AA 1HARA 3BGOP 2LA6A 1N5SA 2BJEA 2MQOA 3NGDA 3MMAA 1X31C 3M8PA 1M5SA 1KDNA 1TAUA 1AA1B 4RW7A 2C22A 2GIQA 3I0RA 2C3MA 2I38A 4M63A 1TL7B 3MD1A 4CLFA 2UUAJ 5KFCA 1FRIA 1C0TA 4ED1A 3R7NB 4LVNP 4DQSA 3QATA 1JQGA 1R43A 4EU0A 3QJPA 2J8SA 3JYTA 5HLFB 2M8DB 2PI4A 1QSYA 3AD7C 2AJQA 2Q79A 3IM8A 1T7PA 5AJ3J 1NDKA 3D3CJ 4MH8A 4RW4B 4M5MA 1SKWA 4M5HA 4JI4J 1NK9A 1K44A 3KWMA 2LVWA 4TLRA 4M5LA 1DHMA 4DFPA 1OMSA 1WG4A 1N54B 4KHPJ 2E29A 3Q83A 4MYUA 4DR3F 4ZDNA 4DS5A 3R7BB 3CJTA 4FBTA 3L7OA 3AH6A 4OYZA 2CYYA 2YPZA 3PX0A 3EXCX 1BQMB 3N6NA 5IT0A 4WK3A 3BN4A 1X8DA 2VZ9A 2WONA 2J7KA 3FCVA 4AQYF 2WCXA 2KG0A 2UXCF 1CLFA 1UTAA 2EKNA 3MM7A 4OLOA 4U8VA 3VR1A 3CVKA 1AT1B 2RRNA 2Y1IA 3IGVA 2DPIA 3BS9A 4S0MA 4GVBB 3QAUA 4EMDA 2JH3A 4K5SA 3CIZA 3RU0A 4LRFA 5L1LA 6AT1B 2LQJA 2NYIA 1Q7LB 3D6TB 4KRWA 5KFXA 4N76A 1U25A 3M7VA 1BGXT 1QTNB 4LFBJ 5K8NA 2ACMA 3SFGA 5G0RA 4EO6A 2J0XA 2LFVA 1RWPB 3UD4P 3A13A 2HHTA 2HQFA 1VRQC 1VIOA 3QT5A 1RYSA 2RT3A 4JB8B 2R7RA 4KT0C 1H73A 3PIPQ 1MMDA 1F9HA 2GMLA 4CLPA 4MKBA 3O44A 2Z2MA 4IKAA 2V4QA 4K2JA 3CCQS 1R89A 2HBYB 4ZP6A 3PXGa 3V6DB 4B9UA 1DTTA 2ZDOA 1BQNB 2Q6CA 2JC0A 4W98A 4USKA 1RTHA 3AY0A 5KFFA 3GIMA 5KFPA 2BR0A 1WKJA 1XMOF 5LSOA 4LBHA 3EXYA 5GMDA 4JI0F 1I3OB 1Y11A 1FTCA 3DOLA 1Q7YT 5L39A 1D9AA 1TV6B 1QE1A 5BXIA 3MTJA 3T5HA 4NA1A 1JLBB 1UVMA 3LGMA 5CQGA 2GC8A 2B6AA 3A12A 1IXKA 3RAMA 2ZKTA 2X3DA 3A8EA 1HBNA 2VFUA 4B3SF 3Q2SC 4JI6J 2QA2A 1P9QC 2CWXA 2I9SA 2LLZA 2KN4A 3QGIA 1FDBA 1TFWA 1F1BB 4ZLNA 2XY5A 4KGZB 2UUBJ 3MPVA 1GX5A 4URQU 3AQOA 2EFPA 3TO8A 2Q6BA 3VAGA 2A6MA 3OSNA 5DZ6A 3PW2A 5LXYA 4RUCA 4DHVA 1LQ9A 3KXDA 4WFAQ 3WZ0A 4CNYA 3DDNA 3MEGB 2RS2A 5KFQA 1URRA 2GW8A 2GX8A 4NE9C 4QWCA 3PO4A 5F41A 4RU9A 2RKIA 1H2UX 1FJGF 2WOMA 1T95A 2BW2A 3J7A1 3IC1A 1FKOB 4X65J 2HFNA 2CJXB 3D54A 3M4XA 4A48A 2BJ1A 2MKIA 1NLKL 3QLHA 4JI1F 3M1VB 4WIQA 2AGOA 1R8CA 2MZTA 4A8OA 2XYHB 3IRXB 3T9NA 1IM6A 2C2ZB 3QIDA 4ZLLA 2MXYA 4DQIA 4PQAA 4ANCA 1OIAA 5KG1A 2M9KA 3CGIA 5HSPA 4E8UA 3W62A 2O67A 1S6PB 1WC3A 1NHKL 1YRUA 2GIFA 1TQLA 1JLAB 2DGOA 2HIQA 4DCOB 3AFGA 4Q45A 4B17A 4DSJA 2R7XA 3BN7A 4LF5F 3BB5A 3IR7B 5JXSA 1HBMB 3H8YA 2MKJA 3PO5A 2AJ4A 1WNEA 3RB0A 1R8HA 3HO1A 2FJWA 1X4CA
chains in the Genus database with same CATH topology
4CLUA 2GVDA 4WP9A 1CJVA 3UVJB 1CJTA 1Y11A 5D0EA 1CS4A 5IV3A 1CJKB 3C16B 3ET6A 4USTA 4CLKA 4USVA 4OZ2A 2GVZB 4P2MA 4USWA 1YBTA 1CJUB 4OYXA 5D0HA 2GVDB 1TL7A 4OYWA 4CLZA 1CJVB 1CJTB 3MAAA 4CM0A 4OYZA 1WC0A 1AB8A 4WPAA 1CS4B 1AZSA 3ET6B 1WC5A 4WP3A 1U0HA 1WC4A 4OYMA 4OYBA 1YBUA 3C15A 4P2FA 1YK9A 2WZ1A 4OYAA 5D0GA 4CLSA 1TL7B 4WP8A 4USUA 4CLFA 2QV6A 3MAAB 4OZ3A 1AZSB 1WC6A 2W01A 1U0HB 4OYOA 3MR7A 1CULA 1WC3A 5IV4A 4OYIA 1FX4A 4CLPA 3G82A 3C15B 5D0RA 3R5GA 4NI2A 3C14A 4CLLA 2BW7A 3UVJA 1WC1A 1Y10A 4P2XA 4OYPA 1CULB 4CLTA 1CJKA 3C16A 4CLYA 1FX2A 2GVZA 3G82B 5D15A 4CM2A 4NI2B 4CLWA 3C14B 1CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLU A;  2GVD A;  4WP9 A;  1CJV A;  3UVJ B;  1CJT A;  1Y11 A;  5D0E A;  1CS4 A;  5IV3 A;  1CJK B;  3C16 B;  3ET6 A;  4UST A;  4CLK A;  4USV A;  4OZ2 A;  2GVZ B;  4P2M A;  4USW A;  1YBT A;  1CJU B;  4OYX A;  5D0H A;  2GVD B;  1TL7 A;  4OYW A;  4CLZ A;  1CJV B;  1CJT B;  3MAA A;  4CM0 A;  4OYZ A;  1WC0 A;  1AB8 A;  4WPA A;  1CS4 B;  1AZS A;  3ET6 B;  1WC5 A;  4WP3 A;  1U0H A;  1WC4 A;  4OYM A;  4OYB A;  1YBU A;  3C15 A;  4P2F A;  1YK9 A;  2WZ1 A;  4OYA A;  5D0G A;  4CLS A;  1TL7 B;  4WP8 A;  4USU A;  4CLF A;  2QV6 A;  3MAA B;  4OZ3 A;  1AZS B;  1WC6 A;  2W01 A;  1U0H B;  4OYO A;  3MR7 A;  1CUL A;  1WC3 A;  5IV4 A;  4OYI A;  1FX4 A;  4CLP A;  3G82 A;  3C15 B;  5D0R A;  3R5G A;  4NI2 A;  3C14 A;  4CLL A;  2BW7 A;  3UVJ A;  1WC1 A;  1Y10 A;  4P2X A;  4OYP A;  1CUL B;  4CLT A;  1CJK A;  3C16 A;  4CLY A;  1FX2 A;  2GVZ A;  3G82 B;  5D15 A;  4CM2 A;  4NI2 B;  4CLW A;  3C14 B;  1CJU A; 
#chains in the Genus database with same CATH topology
 4JP8 A;  3KJQ B;  3RBX A;  2IJF A;  4DL3 A;  2IVM A;  4TY9 A;  1S6Q B;  4LRE A;  3TI0 A;  3Q23 A;  1VYA A;  3KMQ A;  1ZAV A;  2MJU A;  3M9M B;  3PYF A;  1SV5 B;  3SCI E;  3OTB A;  3J7Z T;  1HQE A;  3OXG A;  4X66 J;  2RU3 A;  1TK5 A;  3K7R A;  3N4W A;  1NK6 A;  1N5Y A;  3JSM B;  4OYB A;  3DU5 A;  2DR5 A;  4EBC A;  1L3V A;  2YNI B;  4LQ9 A;  4C8K A;  2VU5 A;  4M94 A;  2V4R A;  4Y00 A;  3ZZR A;  5ETR A;  2RF2 A;  1B0P A;  3QT8 A;  5CZX A;  2DGX A;  2DY1 A;  5HK4 A;  4LT6 A;  2MPU A;  1UET A;  5EDW A;  1YWX A;  3FRZ A;  1TTH B;  3F44 A;  2W4D A;  2K8G A;  2VG7 B;  2MY8 A;  3TVK A;  4I6W A;  3MOZ A;  1HKA A;  2CQC A;  5LOQ A;  1NEE A;  2YBV A;  3H5S A;  2VUG A;  3BSA A;  4PWW A;  8RUC A;  1PBU A;  5C2C A;  4GC7 A;  4UUX A;  2QMU B;  3H98 A;  4PUO A;  2WTF A;  4J9O A;  1CS4 A;  1EAY C;  1M1G A;  2R7S A;  5C5J A;  3CXC R;  4KR0 B;  5H9E J;  4UOC A;  2HGN A;  1DAR A;  1IJF B;  5E7O B;  4P72 A;  2AU0 A;  4BDP A;  2ILZ A;  1Q82 T;  2B7C B;  4WPA A;  2FZK B;  3D28 A;  4DQR A;  5CXT A;  1HNV A;  4RUB A;  4OYM A;  4ELT A;  3DKD A;  1KNZ A;  1RT6 B;  3BO3 A;  2HEK A;  4ZN3 A;  4X64 F;  1UEV A;  1F9E B;  3OUY A;  5D8H B;  4GRS A;  1XQI A;  1NK8 A;  5F8G A;  1VJW A;  4DL0 C;  2DHA A;  3VAM A;  2EFQ A;  3GSI A;  4U7U D;  3PR5 B;  2K3I A;  1I51 B;  4UF4 A;  4DL4 A;  2IM2 A;  1X60 A;  3FNN A;  1M90 T;  2AF6 A;  5H1S V;  4L74 A;  4XPC A;  1VRT B;  4FYV B;  5CA5 A;  2XTJ P;  1S99 A;  4HT5 A;  5B08 A;  2VG5 B;  3OFH A;  2I5J B;  2ZE2 B;  5KFO A;  4NI2 B;  2YX1 A;  2B0G A;  5CAB A;  3Q8P B;  2HHH J;  2XLI A;  1M5P C;  1SL2 A;  9ATC B;  5E5N A;  4LF1 A;  2YTC A;  2CQD A;  2F5G A;  3W5Y A;  3LAN A;  2H5J B;  4AUK A;  1HFE L;  3N28 A;  3E2E A;  2MHN A;  2IRX A;  4RW9 A;  4ITS A;  2IM0 A;  2KG1 A;  3FQL A;  4NLQ A;  2D9O A;  5CH7 B;  2B8Q A;  1T05 B;  1U0H A;  3OL8 A;  1U1R A;  3KKF A;  3T1A A;  3CD6 S;  2Z57 B;  1UP1 A;  4B9V A;  1H6K X;  3GON A;  1G6B A;  1RKJ A;  1D9F A;  4WXO A;  3RYL A;  4O44 A;  2IA0 A;  3V6H A;  3UW1 A;  4FS2 A;  4OYO A;  3RRG A;  1K73 T;  4J5O A;  5HMZ A;  2FC9 A;  2PA3 A;  4ZVS B;  3NMR A;  2X1F A;  1FFG B;  3LUY A;  2E1C A;  2DCL A;  1NXI A;  3CW2 C;  5B0C A;  2FY8 A;  3D6F B;  1N5V A;  3KOA A;  3MD3 A;  1YHQ S;  2KI2 A;  2FVC A;  2LQ8 A;  4BWJ A;  3TRG A;  1RU1 A;  2AGP A;  4Y2K A;  5CZV A;  4O23 A;  4C0H A;  2FHJ D;  1JKH B;  5LXR A;  4JV2 A;  2MST A;  3DGV A;  1UJ4 A;  4AYB D;  1JLF A;  3POT B;  4DUT A;  2A3J A;  4AL7 A;  1VBZ A;  4N8N A;  2HHS A;  5T7L B;  2ZEJ A;  1H0H B;  2IHR 1;  2ILY A;  4J9R A;  5GAG U;  1NJY A;  2C2M B;  3BO4 A;  3ZZ0 A;  2PI5 A;  4YHH J;  1S9F A;  4DV5 F;  1SUQ A;  3QIP A;  2DNL A;  1RI7 A;  1TKD A;  4BC9 A;  5DDQ C;  3NXZ A;  1YZ6 A;  2YQ3 A;  2RHQ B;  4DX8 H;  2YNF A;  3MHY A;  5J2N A;  3GCX P;  1JLC A;  3FSX A;  1R31 A;  3BSO A;  4TYB A;  1SL1 A;  2EBE A;  3BQ0 A;  1NZ8 A;  3G4S S;  1FJC A;  5M2U A;  1N36 J;  5K8O A;  4NCA A;  1JLE A;  5A6P A;  1KON A;  4QIV A;  1S1W B;  2OO4 A;  3BGF A;  5LMN F;  4DL6 A;  5KT2 A;  2YXL A;  2YKN A;  1HI8 A;  1SC1 B;  4ZPA A;  1TL1 B;  1CJK B;  4CO4 A;  1Y4Z B;  2WHO A;  2C2O B;  4LVO P;  2M0G B;  4TQR A;  3NRB A;  1CQN A;  5GAE I;  1L3K A;  3OSP A;  1GXU A;  3SZ2 A;  2IAJ A;  4HI2 A;  1VI7 A;  1PSD A;  1CVJ A;  4WP3 A;  3N0V A;  4IR1 A;  2VC1 A;  5DQG A;  2JEG A;  1RTZ A;  3CTR A;  3SDE B;  2VOD A;  4CLS A;  1RT4 A;  1SB6 A;  4C11 B;  2XSJ B;  2Y9H A;  1SJ4 P;  4PYD A;  1VQ5 S;  3J7Y I;  4ZVP B;  4PXE A;  1XIQ A;  3NBP B;  3QGH A;  2R2U A;  5HVH A;  3RR7 A;  2DR8 A;  3PW4 A;  3QT6 A;  2MQQ A;  1VR6 A;  3H2L A;  2EWH A;  3IWX A;  2N4C A;  2MMY A;  4TN2 A;  2XHW A;  2OPR A;  2F4V J;  3DHW C;  4OYP A;  3C16 A;  2IVY A;  4L76 A;  4C0O C;  1IR1 A;  4UZB A;  5RUB A;  1T0T V;  3CCU S;  3RBE A;  2O5D A;  1X4F A;  2NYH A;  4LRB A;  1TVR B;  4XTT A;  1XN9 A;  1LXN A;  1I1G A;  3FCW A;  2V4J A;  1GMV A;  2VQF J;  2UXD F;  3KLF A;  3FRY A;  4N41 A;  2QLX A;  4K59 A;  4Z37 A;  1URN A;  1D09 B;  1SIW B;  4OJ1 A;  2NS1 B;  1GK8 A;  3ENA A;  2XCP A;  2OAU A;  1V3Z A;  2O3D A;  5D4N A;  3V4I B;  2MHE A;  2F9D A;  4USI A;  2VON A;  1HMV A;  5D4O A;  3PM9 A;  2I0X A;  1J5E F;  5A8W A;  1DBD A;  2E9Z A;  2NLW A;  2ZUA A;  3OR2 A;  1AFI A;  3R8Y A;  2BW7 A;  1G1X A;  4ZVU B;  2CZV C;  4UOF A;  3E3X A;  2DGQ A;  5KG6 A;  2BJD A;  4ZIW A;  1JNZ B;  1L5U A;  1X7V A;  2J6T A;  1FWL A;  2BMB A;  1HQU B;  2XMJ A;  3PHE A;  4OI4 A;  4RBU A;  3PX4 A;  4LF4 J;  1AYE A;  1LK5 A;  4OZ2 A;  1CC7 A;  2HZC A;  4UW2 A;  2AZ3 A;  3TAM B;  4NEY A;  2O1P A;  2H4Y B;  2VD3 A;  1OPZ A;  1M0S A;  3W9H A;  5MAO A;  4RWW A;  5G4D A;  2HVH A;  2YH0 A;  3V6J A;  4QIE A;  4RNH A;  1KLM A;  1FXL A;  4O4G B;  2F9J A;  3MTK A;  4KFB B;  3CPW R;  2WVF A;  4NAS A;  2QEX S;  1UVI A;  3IRW P;  3Q24 A;  2LEB A;  2MQP A;  3LA0 A;  1FVQ A;  1J5O A;  3BQ2 A;  5B09 A;  2LCW A;  2GA7 A;  3M2R B;  2AMC B;  2GHV C;  1PC4 A;  1RHQ B;  5DG9 A;  1F6T A;  3DLG B;  3K2Y A;  1KLN A;  5IT9 Y;  3VWS A;  1WSR A;  1MG7 A;  3KLG A;  2CQ0 A;  1RAC B;  2JHE A;  2J9D A;  3U1M A;  2GJI A;  5FII A;  4P2S A;  4PG6 A;  3PV8 A;  2Z2Z A;  2ZM6 F;  1RAG B;  3RAX A;  2DR7 A;  4DR7 J;  2RH3 A;  4YDX A;  2RQM A;  1JMT A;  3L9Z A;  4U7U K;  2VFV A;  2QJ3 A;  2VFS A;  3D0G E;  1GTE A;  2BOA A;  4DL2 A;  1CPZ A;  2B9E A;  2R9L A;  1WC0 A;  1RWW B;  4OV1 A;  3DLK B;  2IBK A;  1HNZ J;  2F8M A;  4DUY J;  3CCE S;  4P73 A;  1F9F A;  3AD8 C;  2WZ1 A;  1H38 A;  1SVD A;  3HT3 A;  5IFM A;  5KFZ A;  2MZJ A;  3OL7 A;  5IT9 U;  4F8R A;  4F02 A;  4IH6 A;  1MN9 A;  4ECZ A;  1OY9 A;  3O6Q A;  4M5K A;  3M30 A;  4QWE A;  4RPF A;  3MEC A;  2C3O A;  1GH8 A;  6FDR A;  2FY1 A;  2NPI A;  1KQF B;  4IG0 A;  3D0I E;  2WB4 A;  1UFW A;  3CJ4 A;  1REV A;  2CUY A;  1S77 D;  2G1H A;  2VDH A;  1BLU A;  2HWI A;  5I3U B;  2H54 B;  5HQ8 A;  2CAD A;  4QWA A;  2QA4 G;  1F3F A;  1OYD A;  2H65 B;  1H7W A;  1SIZ A;  2DGT A;  3CCR S;  2QTW A;  1IKV B;  3VZI A;  4DX5 A;  2XSF A;  2OUG A;  3MR6 A;  1YIT S;  2KT3 A;  4F0K A;  1LWE A;  4M5D A;  3EZ5 A;  3MM5 B;  3TUJ C;  3HD1 A;  4F25 A;  1KBR A;  2HK2 A;  3OXF A;  4IQX A;  5GVQ A;  1DUR A;  2LXI A;  1UMJ A;  2QX0 A;  1XR7 A;  4JI3 J;  5LJ3 Y;  3UI3 A;  4DR3 J;  4DV1 F;  3CMA S;  4CCH A;  4R25 A;  3HFZ B;  2G2O A;  2DO0 A;  3TZW A;  4JI7 F;  2VOO A;  2E5L F;  3KLE B;  2U2F A;  2RIL A;  4DV3 F;  4C8O A;  4IFV A;  4C7Q A;  1I94 F;  4QWB A;  3PIO Q;  2KL8 A;  1OQ3 A;  5A8R B;  4KB7 A;  4PRF A;  3GR1 A;  4AQY J;  1LW2 B;  4J9L A;  4CYU A;  4B3M F;  4V19 J;  2QO3 A;  2FZG B;  3PDN A;  2OP5 A;  2ABY A;  1TAQ A;  2BE9 B;  4Y28 C;  4J9N A;  1YZ7 A;  3FZ2 A;  2R2T A;  2UU9 F;  4R8U B;  3SQO P;  1PIE A;  2OFH X;  1U09 A;  3SIP B;  3SV3 A;  2P2C B;  3QZ7 A;  3GU0 A;  3NCP A;  1UZD A;  4AD6 A;  2BRK A;  3IA0 A;  4RKU C;  2J6U A;  4IFY B;  1RAJ A;  3I82 A;  1XBW A;  1JJ4 A;  3THV A;  2BKN A;  2HFS A;  3PJW A;  2YY3 A;  2GZO A;  2VBW A;  5L46 A;  2V6A A;  1CJU B;  2QA1 A;  3WDO A;  1Y7P A;  2JC1 A;  4F50 A;  1FEH A;  4NRT A;  1ZM9 A;  2M4M A;  4RJV A;  2IM3 A;  2OPS B;  3D1O A;  3JAM U;  5AXN A;  2P5V A;  1KTV A;  1RWM B;  3FEY B;  5D4P A;  4WTO B;  5E3P A;  5T41 A;  1LV5 A;  3IN5 A;  2BXJ A;  3EVW A;  1P1T A;  3MMA B;  5HAN A;  3M8P B;  2C2E A;  5D77 A;  3GYX B;  1EQ0 A;  1N0V C;  4RW7 B;  2ZJQ Q;  3I0R B;  1JLQ A;  2AEJ A;  4MT1 A;  3OLB A;  1IKW A;  3C6U A;  2XS2 A;  1C0T B;  2YPY A;  4P2X A;  2ZH8 A;  1FA0 A;  1KOH A;  5LM7 E;  3X1L B;  3JYT B;  4DPW A;  3ZXW A;  1DZ5 A;  3NEK A;  4WKY A;  4KHM A;  3PHT A;  2BUN A;  2Y1R I;  3ILJ A;  4C4W A;  1LWX A;  1EKS A;  5HBM A;  3HXM A;  5HAT A;  2QIF A;  1Q86 T;  1NK7 A;  3CSK A;  4OV6 A;  3FSY A;  3A3O B;  2IC3 A;  2AYE A;  4DBQ A;  3MM8 A;  2CNO B;  1S76 D;  5L38 A;  3FBC A;  4RUH A;  3UR3 C;  2GAH C;  1T9V A;  3DNC A;  1SJF A;  2RUG A;  3I96 A;  2LU1 A;  3EGZ A;  4USU A;  1UL3 A;  1IVZ A;  2FDN A;  3ISN C;  3ISN D;  1DLO A;  2HS3 A;  5DS7 A;  3LF0 A;  4KHP F;  2C2D A;  2WON B;  2YWW A;  2DO4 A;  2J9D E;  4LIR A;  5K8P A;  1HQ2 A;  1AXQ A;  4ANE A;  1QLN A;  1KKH A;  1NUE A;  3MM7 B;  1SXL A;  3M2U A;  2UXB J;  1Q4R A;  5HL7 Q;  5D15 A;  3DM2 A;  1RQ0 A;  1OSC A;  1YSJ A;  4P7T A;  2NXC A;  4HVZ A;  4K4U A;  1CJV A;  1Q79 A;  1MU2 A;  1QSS A;  2VG6 A;  4DSL A;  2HQI A;  3HHL C;  5CHC B;  4J9P A;  1YIJ S;  4ED6 A;  3E8O A;  3JQK A;  4F3M A;  1FJG J;  2DRB A;  2XZT B;  4CH1 A;  1HBO A;  3EVO A;  4XDD A;  3BDE A;  2M7S A;  2R8G A;  2VA3 A;  1HPZ A;  2CJB A;  7AT1 B;  4NLD A;  2DTJ A;  1KR4 A;  5G0R B;  3E01 A;  4JI2 J;  1WI6 A;  5LSL A;  1Q1K A;  1WOS A;  2HIY A;  1VFJ A;  4WK1 A;  5FJ4 A;  3OFE A;  4ZVQ B;  4KQZ A;  3GE9 A;  1P8G A;  4LFB F;  3D1Q A;  2ZH4 A;  3P5B P;  4ILR A;  3NNC A;  3JTN A;  3CJ0 A;  3UR0 A;  5KG5 A;  2Z58 B;  2F65 A;  1VBK A;  3WIU A;  3JQM A;  1EET A;  2VDI A;  4C8Z A;  2D69 A;  2CZ4 A;  4DV7 F;  3UN5 A;  1NKE A;  2HVI A;  2B4P A;  4LF5 J;  4G1I A;  2EG2 A;  1DTT B;  2MJN A;  2MYF A;  1UA0 A;  1IKX A;  4LBP A;  3HMJ G;  4I2Q A;  2FVQ A;  1C4A A;  3C2P A;  3NY0 A;  5T14 A;  3QSI A;  2R2S A;  3AOC A;  4C97 A;  2LYV A;  4PWD A;  5KFN A;  1SQF A;  4KGK A;  1CQM A;  2VIH A;  2H3E B;  1RAA B;  1QE1 B;  1UWA A;  3OVS A;  2PA8 D;  2MSS A;  4FYX B;  3QGG A;  3CCV S;  2B6A B;  3M9N B;  1X0P A;  3W66 A;  1HBN B;  4FF1 A;  1T94 A;  2B43 A;  3R2D J;  4ZKA A;  5KFD A;  1GT8 A;  1F5C A;  2BX6 A;  4TY8 A;  3ENW A;  2W7P A;  4LMZ A;  2Z0G A;  2F8E X;  2G9O A;  2B51 A;  4Q5V A;  2Z56 B;  3M6W A;  2W7O A;  3H0P A;  1U26 A;  4NPO A;  2ZBR A;  3KYL A;  3OBI A;  4ERD A;  3J7Z 5;  1R6Y A;  4TVA B;  1JXE A;  4L3K A;  1N5Q A;  2W2M P;  4FF3 A;  1XTZ A;  2IBO A;  3QJJ A;  1FRJ A;  4DN0 A;  3H25 A;  2RKI B;  4IDK A;  1E6V A;  2Q3P A;  1RBA A;  3W8P A;  2OEM A;  4EZ6 A;  2EVZ A;  4CWB A;  4OX6 A;  4O3Q A;  5B0E A;  3F73 A;  4J9V A;  3QLH B;  3G6Y A;  1BQX A;  2BQU A;  2KU7 A;  2R3V A;  1U1O A;  3MMB A;  4N47 A;  4X64 J;  5DRK A;  5GAG I;  4DF4 A;  1ZM3 A;  4X65 F;  2X1B A;  4IYQ A;  1VC0 A;  2B3T B;  4DSK A;  2CDQ A;  1X4E A;  4DQP A;  1S7H A;  4K5R A;  2W9B A;  3CCT A;  1T02 A;  2NRE A;  3F0N A;  1LWC A;  2L41 A;  1RZM A;  2Y8Y A;  1LFP A;  5B0G A;  4C48 A;  1U1K A;  2GCF A;  2CA9 A;  1FXR A;  5K5M A;  3DOM A;  3PEH A;  4ZK7 M;  3EDQ B;  4XIU A;  3W8G A;  4ED8 A;  1K0V A;  1B7F A;  3TAR A;  3WIV A;  4RL1 A;  2FJE B;  2OGU A;  4KV8 A;  2RS8 A;  3GMG A;  2KRR A;  3ICL A;  1OYE A;  2KDO A;  1ZAW A;  3W2V A;  2VJU A;  2EK1 A;  3K5N A;  1VRT A;  1F3V A;  1HWI A;  2FJB B;  2CJA A;  2I5J A;  1GMU A;  2WSF C;  1HQE B;  3C6T A;  3CO0 P;  4Y6I A;  2PN6 A;  2AJ2 A;  4ILL A;  3HKZ D;  4OHY A;  1FFS B;  1N5Y B;  1M5K C;  4DDF A;  2ZJR Q;  1NK4 A;  2GJ2 A;  1N56 A;  3T3F A;  1M1H A;  3NL0 A;  4A8M P;  3PYG A;  2AWZ A;  3SCJ E;  1DTQ A;  1MLA A;  1C1C B;  2MKC A;  4LBI A;  2R7V A;  3EZO A;  1T05 A;  2RF2 B;  4ILM A;  3ITH A;  2MKS A;  1B3T A;  4PXC A;  2W9A A;  4Y2C A;  3I0S A;  3J80 Y;  1VC5 A;  3L3C A;  4KHR A;  4XK8 C;  3T19 A;  3GIR A;  3ZTQ A;  2XB2 D;  3M8Q A;  4ZCK A;  3G71 S;  2L9D A;  2RRA A;  3SFU A;  3L4B C;  2YKO A;  3AAW B;  5EGY A;  3X3U A;  1WEX A;  5KTQ A;  4OZ0 A;  3VHQ A;  1S0M A;  1EHW A;  3M8S A;  4PUO B;  3JXO A;  5HO4 A;  1CS4 B;  2JL9 A;  2PEB A;  2N3L A;  2KTQ A;  4P10 A;  2D9P A;  3C15 A;  1NB2 A;  2HFO A;  4TU9 A;  1RWX B;  3DLE B;  5E3Q A;  2NXN A;  3QSY B;  5KFE A;  1SKR A;  2BM1 A;  4DFJ A;  2FVR A;  4NEZ A;  1E6Y A;  1HNV B;  5IWA J;  5ADZ A;  4DR5 J;  4EBD A;  1VHI A;  3ILO A;  3L95 X;  5F8N A;  3OUY B;  2WAQ D;  1U4B A;  2E5I A;  2IYI A;  2Y8W A;  4W90 B;  4MJK A;  2DPJ A;  3GFZ A;  1OS5 A;  2JVR A;  1HNX J;  2RSQ A;  5SUH A;  1TEL A;  3KLI A;  5KFT A;  3NLC A;  3V81 A;  1B0T A;  1WEL A;  3V6K A;  2LEP A;  1FRK A;  4OX8 A;  4IQM A;  3RB6 A;  3KDO A;  3PR4 A;  2FTR A;  3FCH A;  4DLG A;  4N7T A;  4FYW B;  1W2I A;  1FK9 A;  3D2W A;  4HH1 A;  2D3Z A;  5LMN J;  3FVY A;  2R7T A;  2YKA A;  1VK8 A;  3FBF A;  3OQ2 A;  3VCD A;  2A18 A;  4DV0 F;  1EB0 A;  2V34 A;  2ZBQ A;  5JMN A;  1N6Q A;  1T9U A;  4NRU A;  2DJW A;  4ZVE A;  2RE1 A;  2F63 A;  4A46 A;  9RUB A;  1ZPW X;  4RW9 B;  1FT8 A;  4OX7 A;  3QMQ A;  1RCX B;  3QGP A;  1U0H B;  2ZH9 A;  2XNR A;  7FD1 A;  3CDB A;  2AEF A;  1IBL F;  2OKQ A;  4O44 B;  4HAC A;  2P9C A;  1S9G A;  3Q8V A;  4DV6 F;  1FE0 A;  3UDL A;  3BR8 A;  4B9M A;  3SSS A;  2LXU A;  4DL7 A;  4CLY A;  2HVD A;  4XPE A;  4J37 A;  1HLW A;  4OMF G;  2LQ5 A;  4LRC A;  4OJG A;  5I3P A;  4DN9 A;  2EI5 A;  1ZAX A;  4DX6 A;  5D0E A;  4FNH A;  4IR9 A;  2KHD A;  1U6Z A;  1X5O A;  2E1R A;  2LKZ A;  1T3O A;  2RDI A;  3TZY A;  4AL5 A;  4LRD A;  2DXF A;  3W65 A;  3GJT B;  3SYZ A;  4Y3C A;  3WC0 A;  3UN3 A;  2PSZ A;  4LF9 J;  4JI8 F;  1HIY A;  2UXD J;  1JLF B;  2VFR A;  4ZLJ A;  2MKH A;  1LWF A;  3E51 A;  4NLY A;  1WOR A;  1VQO S;  2J7U A;  1D8Y A;  3BYP A;  3FEZ A;  2MZQ A;  1JLG A;  3VGS A;  2ZNZ A;  1S97 A;  1RGV A;  2FVP A;  3EGW B;  3TX0 A;  1SUQ B;  4WKR A;  3QIP B;  1P6T A;  2QLB B;  4I64 A;  1KQS R;  2NXJ A;  1FNM A;  1QAI A;  1J5E J;  5SZT A;  1DQ9 A;  2MZR A;  4URG A;  5KOW A;  1TR0 A;  1Q95 G;  1TL5 A;  2YNF B;  5BYQ A;  2ZH6 A;  4ELU A;  2QG9 B;  3GIJ A;  4YHH F;  5J2N B;  1HHT P;  2BJ3 A;  2H9Z A;  4DLE A;  2G2Z A;  3MMC A;  4X2B A;  1JLE B;  3PEJ A;  4LF7 F;  1UCN A;  3GPA A;  2YKN B;  2KFZ A;  2GO8 A;  2QT7 A;  2BE2 A;  2IMW P;  4K4T A;  1NBE B;  1V9O A;  1SC3 B;  2NPF A;  1FRH A;  1N36 F;  2WBR A;  2IAJ B;  4NLV A;  5A76 A;  4USM A;  4ECU A;  1KRP A;  2QA4 S;  1C1B A;  2FYX A;  3B54 A;  2QN6 B;  2YWF A;  3I9Z A;  4QJV A;  5GAD U;  1RT4 B;  4EO8 A;  4ED0 A;  5J2P B;  3F41 A;  4HDH A;  4FYD A;  2CNL B;  2QC3 A;  3HHL A;  4DR6 J;  4WTY A;  1KVK A;  4C8L A;  4QOT A;  3RGI A;  1SBR A;  4X4R A;  3LP0 A;  2OPR B;  3DMJ A;  4C3K A;  2R8J A;  4TU7 A;  1CJT A;  1UVN A;  3BBF A;  1ROF A;  3Q89 A;  4I7F A;  4MKV A;  1JJH A;  1MN7 A;  3C16 B;  1NME B;  1OSD A;  2XO7 A;  4TLQ A;  3BSN A;  1RT1 B;  3RR8 A;  4HH0 A;  5I3Q A;  1EZZ B;  2LDI A;  1N0U A;  1V3S A;  1VLY A;  1N48 A;  5J1E A;  2HQC A;  2OSQ A;  1WC5 A;  4ZLP A;  5B0F A;  2V4J B;  1VDH A;  3KLF B;  4NCG A;  4ZP7 A;  3HKW A;  2J0S D;  1S57 A;  2VPZ B;  4DV4 F;  2J9C A;  1VQ7 S;  4X4P A;  1O8B A;  1P1L A;  5E3A A;  4K4V A;  2A2C A;  2ROG A;  1W7W A;  5HJX A;  2VQF F;  4QPT A;  1HMV B;  1IBM F;  4W92 B;  4I1T A;  4YUD A;  5ETK A;  4ZCL A;  2GVZ A;  2UUT A;  5A8W B;  4KY3 A;  2UZA A;  4QR1 A;  4CRJ A;  3TVY A;  3CJS A;  3RAQ A;  3OR2 B;  5HMX A;  1H98 A;  1WJ9 A;  3J81 Y;  4Q0B B;  2HLT A;  2HND A;  4NXN F;  4IRK A;  1MW7 A;  1Q53 A;  2VKZ G;  3U1N A;  4LSN A;  3R7S B;  2CPD A;  2ZHA A;  3GR0 A;  1PAU B;  5F8M A;  3BO2 A;  4USJ C;  3OW2 R;  2HBZ B;  4NML A;  4K8R A;  1KHW A;  2BJ8 A;  1QAJ A;  3HCX A;  4WE1 A;  3TNV A;  3K58 A;  4DCP B;  4F4W A;  1QVF R;  2XMK A;  4ZCM A;  4YQW A;  2LP4 A;  1HWL A;  3ISZ A;  4OYA A;  3L7P A;  4DV2 F;  2IPO B;  4RX6 A;  2LEC A;  3S6E A;  4DV1 J;  4OZ5 A;  2DVI A;  5IC4 B;  4EFA C;  2VQE F;  1J27 A;  4JI7 J;  2E5L J;  1GX6 A;  1AUD A;  3DDK A;  1FWK A;  3W64 A;  4DV3 J;  1A6L A;  2DHH A;  4A4J A;  1IJE B;  1KLM B;  1EJ7 L;  1I94 J;  1RWO B;  4KH1 B;  1QDU B;  4ZIV A;  1QVG R;  4FKY A;  4CLT A;  2GIR A;  2ZC3 A;  3TA2 A;  3CT9 A;  2YQ1 A;  1UVL A;  4B3M J;  2CVI A;  3UWT A;  1J5O B;  2WSC C;  4NA3 A;  2HHW A;  1S0O A;  1A7G E;  1QJH A;  2GHW A;  1BD6 A;  3BGL A;  3ULH A;  2BRL A;  2UU9 J;  1RTJ A;  2BAN A;  4M5G A;  4AE5 A;  5JVH Q;  3KLG B;  4CDI A;  3ZTR A;  1YBT A;  4TXS A;  3EE3 A;  4X4O A;  1WHY A;  2XWY A;  2R42 A;  1RA7 A;  1KVJ A;  4C8Y A;  3IBW A;  3GJQ B;  2RQ4 A;  4ZCI A;  1KQG B;  4BWM A;  3MR2 A;  1EIY B;  2FHM A;  1JIH A;  1BMQ B;  3K5P A;  4DFK A;  4KGV B;  1YJW S;  2R8I A;  3P4U B;  4PG5 A;  1XK8 A;  3PAC A;  2X3G A;  4DR7 F;  4B3T F;  4YB5 A;  3QNW B;  3CCJ S;  1ZM4 A;  4Q8F A;  3CJ3 A;  3NNH A;  4NLW A;  1RAH B;  4C3M A;  3R1H A;  4RNM A;  2OPS A;  3BQ1 A;  1Q16 B;  3HHE A;  4QW8 A;  2PO4 A;  1IN0 A;  2LMI A;  4U9R A;  3VTI A;  2YWG A;  4I6Y A;  1HNZ F;  3M30 B;  2DIV A;  3MEC B;  1KC8 T;  7FDR A;  1B7Y B;  4QYR A;  4IRC A;  4IG0 B;  4PAB A;  2I6W A;  1REV B;  2F3J A;  2FLL A;  2C42 A;  4F4K A;  3SCK E;  3NGS A;  3KHR A;  4YOE A;  1G4C A;  2M52 A;  2YQ0 A;  4Y2A A;  2AKW B;  3ILL A;  3BPD A;  2JEI A;  2VL1 A;  2QYC A;  4EZ9 A;  4DG1 A;  2AIR B;  2OD4 A;  3RW7 A;  3PTW A;  1AB8 A;  1U47 A;  5HQM A;  3CJ8 A;  1TKZ A;  1LWE B;  2LQ9 A;  4M5D B;  3QFW A;  2JRS A;  3R6G B;  3Q2T C;  1B64 A;  1U24 A;  2BQR A;  2FVS A;  2ZC4 A;  1PJ6 A;  4ZS6 A;  2M2B A;  2U1A A;  2K7K A;  2YNH A;  4NLS A;  1WEZ A;  3B4M A;  4B3O A;  3A4T A;  3TA1 A;  2DRD A;  1VQ4 S;  4QCL A;  2ZHB A;  3GIL A;  2VH7 A;  2CQG A;  3TUP A;  4I6A A;  4IFV B;  4J9U E;  1HW9 A;  3DN9 A;  1VQY A;  3M05 A;  3RUB L;  2A2D A;  5J1N A;  1S4E A;  4JI3 F;  4YY3 F;  2UV8 G;  3OJU A;  4CYU B;  2MZ1 A;  1JXL A;  1FHT A;  3W61 A;  2GGP A;  1R8P A;  2NXE A;  4V19 X;  4QW9 A;  1U45 A;  4DJB A;  1GXL A;  3BGU A;  4UST A;  3ONQ A;  2DH9 A;  2OPP A;  1KWM A;  3CME S;  1ZA1 B;  1IM4 A;  4F4X A;  3NGR A;  5HRO A;  3DDI A;  4UTG A;  5AE3 A;  1TMM A;  4ZVO B;  3M6V A;  3A1Y G;  5CYQ A;  2V68 A;  2Y0B B;  4IG3 A;  4DEZ A;  5HVG A;  3W5X A;  3CDU A;  3CD7 A;  3G8S A;  2V8G A;  4DPY A;  1S0V A;  3H5Y A;  3KFW X;  3BGR A;  2CJK A;  4DR4 F;  4ZPD A;  1HA1 A;  2K2P A;  2DNO A;  4O3R A;  1U2C A;  5F8H A;  2RIJ A;  2MQN A;  2DB1 A;  2AYG A;  1Q0N A;  1WI8 A;  3D6M B;  2J0Q D;  2KH9 A;  3D3B J;  4RW8 A;  2RAQ A;  2DNZ A;  1JLQ B;  1MMN A;  2RQK A;  2ZOM A;  4D3H A;  1WTF A;  2ALY B;  4ES3 A;  1IKW B;  3C6U B;  3G6E S;  3QZ8 A;  2L48 A;  4FVM A;  5K8M A;  3C8Y A;  2XNQ A;  1PKU A;  2KT5 A;  4DV7 J;  3CDA A;  4PCQ A;  3VAI A;  1BE4 A;  1B0V A;  1NH8 A;  1WKK A;  5HBM B;  3FFI A;  2EC0 A;  3OJS A;  1WC4 A;  1Q8B A;  1S6U A;  4HYK A;  2IC3 B;  4X4Q A;  4J91 A;  1NH7 A;  3T1Y F;  1N34 F;  1K1Q A;  3MM8 B;  2VAS A;  1DRZ A;  4PPD A;  4YN3 B;  3M2V A;  2ASL A;  4JUZ A;  3OTO J;  1N4L A;  2E7V A;  3TUI C;  3MR7 A;  1RHR B;  4L3N A;  1RHU B;  5EX0 A;  1X9M A;  3AOA A;  5A0Y A;  4PXD A;  1XMB A;  2ZOF A;  1F2G A;  1WG1 A;  5E33 A;  1N52 B;  1DLO B;  1VGY A;  3KHL A;  3LQV A;  2E9T A;  3BEG B;  1PC5 A;  2IVF B;  1W26 A;  4RNF A;  3KK3 A;  3MDF A;  4QIF A;  1FXD A;  2A0F B;  3M2U B;  5C24 A;  2V9W A;  4ZN1 A;  2H48 B;  1BC6 A;  1X5T A;  1IR0 A;  3DM2 B;  1FEE A;  4ZPW R;  2ZWP A;  3W63 A;  3PW7 A;  1RE1 B;  1A9N B;  1CJV B;  3CMQ A;  3PX6 A;  3MAA A;  1RK8 A;  1YGY A;  2EFO A;  3IXQ A;  4CIO A;  5F8J A;  1MU2 B;  5C7P A;  4QYZ K;  3VVT A;  2VG6 B;  4MIW A;  1UJ5 A;  3PYE A;  2AYB A;  2FD2 A;  3BSC A;  3FBB A;  2UXB F;  3H5U A;  5U47 A;  4BBY A;  1HBO B;  4WBF A;  2HHX A;  3DLL Q;  2HGM A;  3HSG A;  2QGF B;  2ZDP A;  2ZVI A;  1M1K T;  2CIM A;  2IJN A;  2E1A A;  1HPZ B;  2MGZ A;  4F4Z A;  1SJ1 A;  4RNO A;  3QPI A;  2Z2Y B;  4DSI A;  4PPZ A;  3E01 B;  5GME A;  3KHH A;  3PRD A;  4KSE B;  1HYS A;  1T3N A;  1NSA A;  2DKO B;  2ZZN A;  1T9Y A;  2MLZ A;  3CC7 S;  1UPM B;  2QMW A;  5HAO A;  3CUN A;  2YWE A;  3BM7 A;  2CPJ A;  3QAE A;  3K57 A;  2HFZ A;  2MTL A;  2MY7 A;  1ZET A;  4ECV A;  4JI2 F;  2HKE A;  3L09 A;  2KFY A;  1VBX A;  3VAF A;  4CZC A;  1EET B;  1X4H A;  3W2W A;  2EFV A;  3VVU A;  3QO9 A;  5KFG A;  3DRX A;  4IOA Q;  4DI6 A;  1VLO A;  4HI1 A;  1RT7 A;  3TR5 A;  4ED5 A;  4JYA F;  1RTI A;  1IKX B;  1D8Z A;  1RHK B;  3K0J A;  3FSI A;  4I2Q B;  2GQ2 A;  3B78 A;  1OY6 A;  2V8H A;  4A8K A;  2W9C A;  1IBC B;  2QL9 B;  4PWD B;  2A10 A;  3TJ9 A;  3PJX A;  3JTP A;  2DIS A;  1U1M A;  2BQ3 A;  4KKO A;  2ZBI A;  3GTY X;  1U2R A;  2V2V A;  2WVE A;  3BPS P;  1SQG A;  4DUZ J;  2FJX A;  2YNG A;  4OI3 A;  3NS6 A;  1N33 F;  5DGB A;  1FNX H;  3GQC A;  4TY8 B;  4B9S A;  4FBU A;  3OTC A;  1F60 B;  4G6V B;  2V67 A;  4UOG A;  1H74 A;  4ZJQ A;  3PJ9 A;  2CPH A;  4NLX A;  3K8W A;  4J90 A;  1YKW A;  3ZNJ 1;  4PZV A;  1FE4 A;  3BH7 B;  4QIW D;  2V63 A;  3EM1 A;  4N56 A;  3T41 A;  2WVB A;  2OIH A;  5L9X A;  1WHV A;  1Q5V A;  4ZA1 A;  3GG0 A;  4DCJ B;  1L3T A;  5KFK A;  1C1C A;  1WF1 A;  4Y2I A;  3MCN A;  3PVX A;  2G2Y A;  2VF3 A;  3M8W A;  1TUV A;  5LSR A;  3EVM A;  4DWI A;  4NZ0 A;  4C0B A;  5B7W A;  1EAR A;  1XR6 A;  1ITP A;  2RDD A;  2CQI A;  4IDK B;  1JX4 A;  3AA8 A;  1E6V B;  4LQ3 A;  1Y5L B;  3HFK A;  1Y0H A;  1QUP A;  4ETX A;  1TKT A;  5F3T A;  5K14 A;  3KJN B;  3T1H F;  2C3Y A;  5H9F J;  4DR1 F;  3I4P A;  3ENV A;  3VAL A;  3K59 A;  3MMB B;  4C8N A;  1DAX A;  1RA6 A;  4HKQ A;  2YKP A;  1AFJ A;  3FBE A;  4OLP A;  3ILI A;  3DLE A;  1RUS A;  4X62 F;  2Z8Q A;  3OPK A;  1RWU A;  2W9B B;  2KT2 A;  1LWC B;  2OMO A;  1NKC A;  3MED A;  3GZ7 A;  3MEK A;  5HI7 A;  2P9E A;  2XGQ A;  3DOM B;  1XEZ A;  3HK2 A;  5KG4 A;  3TAQ A;  2Z30 B;  4KV8 B;  4ZHR A;  3DC2 A;  2UVR A;  4DV0 J;  3W2V B;  2ZFH A;  4X4S A;  4KBI A;  4URS A;  5CYM A;  2W01 A;  4KO0 A;  2VBX A;  3ZZY A;  2AGQ A;  1HWJ A;  4ES1 A;  1RT5 A;  2WRM A;  1EP4 A;  1RLD A;  3C6T B;  4OIX A;  1HR0 F;  2FC8 A;  3T5L A;  1BUX A;  2ZNY A;  3Q22 A;  1WC1 A;  3I87 A;  4OZL A;  4EGL A;  1IBL J;  1V3R A;  1UWB A;  2HG4 A;  5GAD I;  4WJB A;  4X4U A;  3R5C A;  2SXL A;  5D6G A;  5F8L A;  1DTQ B;  4DV6 J;  3HJF A;  4A8S A;  2DH7 A;  2GVD A;  3RG6 A;  1RJJ A;  1WOP A;  2VPW B;  3ITH B;  2HNZ A;  2C3U A;  3DFE A;  1Y9O A;  4WU2 A;  3I0S B;  2BV3 A;  4JI5 F;  3HUL A;  4Q8E A;  3M8Q B;  3UPF A;  2JLE A;  1VC6 A;  4F3Q A;  1FFW B;  1WF2 A;  3GLJ A;  4H4M A;  2AD9 A;  3DRY A;  2XZW A;  2EG1 A;  1PJ5 A;  4YR3 A;  3OT9 A;  2V2Q A;  2XGP A;  2F7V A;  4JI8 J;  1CUL A;  5FLX Y;  2VIC A;  4X4V A;  5E41 A;  3AHP A;  3P5T L;  3C15 B;  2OFG X;  1LW0 A;  2N7Y A;  4MKA A;  1FRX A;  2QSW A;  3NAI A;  1E6Y B;  1RHJ B;  4ZVT B;  2DH8 A;  2XS5 A;  4FKX A;  2BDP A;  1RT3 A;  3GFY A;  1SC6 A;  4M1K A;  3WC2 A;  4DU8 A;  4Y0F A;  4AL6 A;  4U67 Q;  2RD5 C;  3HX9 A;  8AT1 B;  5HJY A;  3HP6 A;  1LXJ A;  3KLI B;  3HJV A;  1VBY A;  3V81 B;  3KLH A;  4CTA A;  5IWA F;  4DR5 F;  3D0H E;  5D0H A;  6FD1 A;  4B3R F;  2E44 A;  1IKY A;  1SI9 A;  1HW8 A;  2JFD A;  1O51 A;  3ZFV A;  3GV8 B;  3OHA A;  1R8A A;  5FLX U;  5JUM A;  1FK9 B;  3ZTO A;  2KHC A;  1ULR A;  4XAK A;  4LF7 J;  1YJV A;  1HNX F;  2JLF A;  4UZC A;  2HNY A;  4C2M A;  2D74 B;  2DT9 A;  4E0D A;  1NSP A;  1N6Q B;  2YKM A;  3IFE A;  4NLP A;  3KK2 A;  5EUH A;  1BWE A;  4HHJ A;  5ETQ A;  3ZZP A;  3MXH P;  3SMZ A;  3LP2 A;  3PY8 A;  4NOH A;  1S4F A;  1RHM B;  1R7I A;  4ZJL A;  1NSK L;  3GSD A;  2GQC A;  3GJR B;  2DR9 A;  4L75 A;  3N79 A;  3GCW P;  4ZJO A;  4HAC B;  2ZD1 A;  2J8A A;  1S9G B;  4K4Y A;  3B8H A;  3ZTS A;  4LF6 F;  2WW4 A;  5LMU J;  2HSE B;  3HI9 A;  2R2R A;  2JOQ A;  1WTB A;  2ZIT A;  4NA2 A;  1BXN A;  2ZH7 A;  2BBE A;  5J2P A;  3KUE A;  1UAW A;  3BBC A;  4DPX A;  1S1X A;  4EK2 A;  4JBC A;  2ZJP Q;  3K89 A;  3M8Y A;  3ZC4 A;  2PFD A;  3FKB A;  2AEM A;  1HHS A;  3IAS 9;  1L3U A;  2FQQ B;  5KG7 A;  4BC7 A;  2DGS A;  3MCS A;  3SQG A;  1S9E A;  5ETL A;  2AX0 A;  5ETV A;  4OFZ A;  3VGV A;  3LW5 C;  2NSB A;  1MRO A;  3UO0 A;  1RT1 A;  1LWF B;  3KG4 A;  4GKJ F;  3DYA A;  2EKY A;  4DV4 J;  3ETM A;  4LFC F;  2NUH A;  5IZH A;  5DM7 Q;  3UDC A;  1JLG B;  2FLP A;  4ID8 A;  2B7B B;  4HTI A;  1TKX A;  2HZV A;  2XQC A;  4LF9 F;  5DQI A;  3HF5 A;  5L1J A;  5AXK A;  1CG2 A;  1IBM J;  1S6O A;  1TU0 B;  1KOO A;  4ENO A;  4DFM A;  4JV1 A;  1HWK A;  1YX2 A;  5AXM A;  3KG0 A;  3U1L A;  5AXL A;  3IG1 A;  2OEJ A;  4NXN J;  4Z2X A;  2W2P P;  2P9G A;  3NAH A;  5C25 A;  4I67 A;  4P75 A;  1P27 B;  1WOO A;  3MMC B;  2H1Y A;  3ADA C;  1NJX A;  4A8Y A;  3LP1 A;  3FK4 A;  3HD2 A;  4H4K C;  1S7I A;  1XNQ F;  1T9W A;  5DQH A;  1CBK A;  3ZZU A;  2KM8 C;  2VBY A;  5ETM A;  4OZ3 A;  4Q0B A;  4PQU A;  1VRU A;  2BE2 B;  2AT1 B;  1MNE A;  2NR0 A;  3RJM B;  4PR6 A;  2OJ3 A;  3NMA A;  1KFD A;  1YRT A;  3U7J A;  2CVE A;  3EYZ A;  3MUT P;  3US5 A;  2KO1 A;  4DV2 J;  2H51 B;  1FD2 A;  5HP1 A;  5HMW A;  4OI0 A;  5E0O A;  2CNN B;  1U6B A;  5ETP A;  4DOZ A;  2VQE J;  3UVJ A;  2IY5 B;  1YVF A;  3M8Z A;  3MR5 A;  2GMH A;  2APO A;  3QT7 A;  2X1A A;  1C1B B;  4CLW A;  2XLK A;  1D1U A;  2UVW A;  2HZA A;  1QAX A;  2KVQ E;  1FTR A;  4ZVR B;  1GXT A;  4PXB A;  4RZR A;  2HRU A;  5D3G B;  3HHL B;  1ZBT A;  4QQB A;  4UT4 A;  4I2P A;  1PBA A;  2I1R A;  2EFN A;  4BCA A;  2HRT A;  1SH2 A;  4LSZ B;  2ZVS A;  2GQQ A;  3LP0 B;  3DMJ B;  1WDT A;  2VPY B;  3L7U A;  1WDD A;  1CJT B;  4ICL A;  5KFA A;  4I7F B;  4J9S A;  3EMT A;  1GFW B;  1LK7 A;  1S72 S;  3MPY A;  3TA0 A;  4DR6 F;  3M32 A;  1ZZF A;  1DY3 A;  2BVZ A;  4GO5 X;  3MPW A;  5J1E B;  4Z7C A;  1WWH A;  4ZVG A;  1RTD A;  3PZP A;  3LOU A;  4C8M A;  4ED4 A;  3EX7 B;  2V94 A;  4N77 A;  5HQL A;  3M6X A;  4NCG B;  4OI1 A;  2F1F A;  3BBB A;  1RBO B;  5A8K A;  1SL0 A;  3R1L A;  2GHP A;  4B3T J;  5DGA A;  4OZN A;  4WWS A;  5L1K A;  1FKA F;  2W8K A;  2PDA A;  3I5B A;  4FF4 A;  1I6J A;  3V4M A;  2I8E A;  2OTL S;  2GVZ B;  5IOL A;  4ECS A;  4TKT A;  1RAD B;  4DS4 A;  2J6S A;  2XZD B;  2HHQ A;  4DPU A;  2V50 A;  2HND B;  1X9W A;  4IO9 Q;  2UVU A;  2P8I A;  4LSN B;  1FVS A;  1L3S A;  4RW6 A;  4EYI B;  3MUR P;  1KEK A;  3UCZ P;  4NLR A;  4BLG A;  5DDO C;  4M5I A;  2KVI A;  4HLB A;  1WC6 A;  4WE1 B;  3MFH A;  5MLC V;  2ZHO A;  2FPH X;  4CT9 A;  2HPU A;  5D78 A;  3MPD A;  4FF2 A;  1SH0 A;  3BKT A;  3SBM A;  3IR6 B;  4HDG A;  3AJD A;  2E5J A;  1R0C B;  1YTY A;  4NYZ A;  4ZOS A;  5FD1 A;  2EC2 A;  2V8V A;  2B8P A;  1VCT A;  4QPX A;  2DNH A;  4M5N A;  3LAK A;  3IS9 A;  3HZG A;  4YY3 J;  4USW A;  5LT5 A;  1ELO A;  2VHG A;  3RW6 A;  4ZMM A;  2XO6 A;  5IS2 A;  3T5J A;  3IM9 A;  2AJ0 A;  1XWL A;  3TOQ A;  2DNG A;  2BA9 A;  3GFX A;  4Z7Y A;  1WHW A;  4R0E A;  1RTJ B;  4JV0 A;  2MDA A;  2BAN B;  3D66 A;  2KXH A;  3MAH A;  1PYS B;  4DXL A;  3OV7 A;  2CAJ A;  1XJW B;  3SSQ A;  1NDC A;  1I5O B;  5E2Q A;  4MK9 A;  1RWV B;  3RBZ A;  2NSC A;  5EX3 A;  1X5S A;  1S12 A;  4CO0 A;  3DRS A;  3KNG A;  2N82 B;  1Q8L A;  1NHU A;  5H9F K;  1ZZN A;  4K4Z A;  4OJH A;  3ZTP A;  2HRY A;  1O0P A;  2G1D A;  2DNK A;  3SI8 A;  2BJ7 A;  2AJF E;  4IH7 A;  2MZS A;  4N5S A;  2C28 A;  4WCE Q;  3P96 A;  4ELV A;  1NPK A;  4DR4 J;  3N6M A;  1S59 A;  2DYA A;  3KNA A;  1BWV A;  3VF0 B;  4M95 A;  2OI2 A;  1F2H A;  2XMM A;  3QJL A;  5KFU A;  3WHI A;  2D3O 1;  4DMZ A;  1U1L A;  4NXM F;  2C1E B;  2HS0 A;  1NRK A;  4USV A;  3OD2 A;  1XER A;  2CFX A;  2CPI A;  3MUV P;  4OYX A;  2PT0 A;  1N32 F;  2XI3 A;  2W25 A;  4LR8 A;  3KK1 A;  3AJ2 A;  5F8I A;  4U7C A;  2AJ1 A;  4RO0 A;  1JJC B;  3GV5 B;  1SC4 B;  1M5H A;  4FNI A;  3OHB A;  4X4N A;  4LFA F;  8ATC B;  4DG1 B;  1KHV A;  5DLG A;  4P6Q A;  1TKZ B;  3EDR B;  1KP6 A;  3Q8R B;  3QFH A;  3T1Y J;  1N34 J;  5ETS A;  2NQP A;  1VQN S;  3CCZ A;  2VPX B;  1Z2Z A;  3VQT A;  1FCA A;  4WFN Q;  1HBU A;  3H20 A;  2ZH3 A;  3I56 S;  2YNH B;  3O2I A;  2E1P A;  4B3O B;  3IWN C;  1UKU A;  2DK2 A;  2J76 E;  2QSF A;  1HNW J;  1S1T A;  3DLJ A;  1VQM S;  3IGN A;  4MYT A;  5IV3 A;  4WZQ A;  2DRA A;  3RRH A;  1XMQ F;  2GGP B;  4D3G A;  1RAE B;  1SKS A;  3P6Y C;  2JFK A;  1S1U A;  3OLA A;  2FJV A;  2DBB A;  3VGU A;  4EWT A;  3MWB A;  2OPP B;  1N8R T;  3MAQ A;  1RP5 A;  3HSZ A;  1PGZ A;  2CJ9 A;  5HRO B;  5KT3 A;  3UCU P;  2E7X A;  3DRR A;  2P6S A;  4ECY A;  1M5V C;  2L9N A;  1RCO B;  1YLX A;  2WVC A;  5CYQ B;  5IT4 A;  1J2V A;  4IG3 B;  2NXU A;  2BM0 A;  2VKR A;  1PJ7 A;  1H2T Z;  2Q66 A;  2KZM A;  4LR9 A;  4I69 A;  4F67 A;  3VAJ A;  3H7H B;  1W2B R;  3C14 A;  3K5O A;  2HMI A;  2MEW A;  4F7V A;  3BGR B;  1WEY A;  1YDL A;  3UNY A;  1S79 A;  4N8O A;  2E1M C;  2YWK A;  3HHL D;  4UY8 T;  3H42 A;  2YX4 A;  4FVC A;  4MMO A;  3ZO7 A;  1H7X A;  1DJ0 A;  3CCS S;  2ZWO A;  1K1S A;  3U02 A;  1IUJ A;  1LOU A;  2G0I A;  2QLW A;  2CKW A;  1KTQ A;  4F04 B;  4RW8 B;  2AV5 A;  4MTP A;  3DGP A;  2RDJ A;  1SH3 A;  5BR8 J;  2K1R A;  3IMQ J;  4ZVF A;  3M8R A;  4LUB A;  2EW9 A;  2VBZ A;  4WYL A;  3UD3 P;  1YK9 A;  1IR2 A;  1ZTT A;  3MCO A;  5IM0 B;  4JYA J;  3UNG C;  1BY9 A;  4RWX A;  5FDL A;  3CWJ A;  2PFF B;  3FFI B;  2XYP B;  3MM9 A;  4YR2 A;  1MSW D;  4RLE A;  3S8S A;  5IV4 A;  4DPO A;  3G82 A;  1B70 B;  2B9W A;  2ALZ A;  2IRU A;  1R0A A;  2OPQ A;  4R5P A;  3M2V B;  4ECT A;  3CJ5 A;  1G7C B;  2XG8 A;  4GVL A;  2IJR A;  5A0Y B;  4B9N A;  3AXK A;  1N33 J;  1FJ7 A;  3LWM A;  1S0N A;  2IMO A;  4FP9 A;  3A8K A;  1RBL A;  3LGH A;  2M70 A;  3OTO F;  2HW3 A;  4A8W A;  5AT1 B;  3KK3 B;  4L6V 3;  4OZJ A;  2V0N A;  2XBP A;  1C0U A;  4ED2 A;  2W2N P;  5J1P A;  1VIS A;  4NZ7 A;  1Z4U A;  5C24 B;  3Q8Q B;  4HEA 9;  2HGL A;  5AE2 A;  2DNY A;  4H54 A;  4EEY A;  2K7J A;  2WB1 D;  4L72 B;  4PYA A;  5KT5 A;  4LSL A;  2LA4 A;  5KT4 A;  4CP5 A;  1K47 A;  2CG8 A;  3G8Q A;  3MAA B;  3K5L A;  2CQP A;  3F56 A;  2YKQ A;  1QD1 A;  4K7Q A;  3A8I A;  5EWE A;  3CC4 S;  3DI6 A;  5C42 A;  4C9D A;  3FDS A;  3D9B A;  2C2K B;  4FZV A;  2PEH A;  4TNO A;  2BAB A;  1WF0 A;  3HVA A;  2MGZ B;  1RAO A;  2B9X A;  4FXV A;  5JJB A;  5KFV A;  4K0K F;  2F40 A;  4CM2 A;  3TEG A;  4ATN A;  2R4F A;  1NKB A;  3FQK A;  3T1H J;  4DR1 J;  3VGT A;  2VOP A;  3DOK A;  1RAF B;  1U49 A;  1HYS B;  5GAH I;  3HM9 A;  1IBK F;  3HLU A;  1OQ6 A;  1UFK A;  4H4K A;  2FZC B;  3R5D A;  3NS7 B;  2FUG 9;  4X62 J;  2HUR A;  1YI2 S;  5I42 A;  3ZNU A;  1T9X A;  3TQ1 A;  5KAK A;  2ASD A;  3W2W B;  3I4H X;  4YB1 P;  3QO9 B;  3QYY A;  1PCA A;  4P71 A;  3UN2 A;  2ZBC A;  4FPI A;  4FN5 A;  3W1Y C;  4JV5 F;  4DR2 F;  1NZA A;  1NSQ A;  4ECX A;  1RT7 B;  5DDP C;  1RTI B;  3HHD A;  2HAF A;  3PFE A;  2IFX A;  3UCG A;  2W9C B;  2D3U A;  1VIX A;  3SSR A;  2HHP A;  1VK3 A;  5DLF A;  3MEE A;  4KKO B;  3BJY A;  5IQ6 A;  3DRP A;  1ACM B;  2W24 A;  2KYX A;  3CB4 A;  1HR0 J;  3HHK A;  5KFI A;  1KD1 T;  4OL8 A;  2WW8 A;  2Z4P A;  2J5A A;  2YNG B;  1Y5I B;  4Q43 A;  1SJR A;  2YX7 A;  3EGV A;  2HQG A;  2CNK B;  1RT2 A;  3W60 A;  5KFB A;  1T11 A;  2V8P A;  2PE8 A;  3JTO A;  3FC9 A;  1U1Q A;  4DUZ F;  1FJE B;  4PG4 A;  2Y0S D;  5K9F A;  4E98 A;  5B0B A;  1NHV A;  1OPI A;  2PMW A;  4WFX A;  3PYD A;  1CSJ A;  2OEL A;  3TX8 A;  4JI5 J;  1X4G A;  2HK3 A;  3MM6 A;  1N5T A;  1FKP B;  5J2M A;  3T9Z A;  4ID5 A;  1ZOT A;  3CE8 A;  2JEF A;  2GFF A;  4QBU A;  2Q43 A;  3RBD A;  3DXB A;  1ZPV A;  2B4O A;  1NK0 A;  3GWC A;  1D0E A;  4AND A;  3D1H A;  3BRE A;  3A8J A;  2RB7 A;  1TL4 A;  1TK0 A;  2ATC B;  3Q8U A;  1FF2 A;  1TKT B;  1T03 A;  5K14 B;  2KJV A;  2XUL A;  1U7L A;  1RWN B;  3G6X A;  1UW9 A;  2EFG A;  1T8E A;  3EZU A;  3ET6 A;  1RDR A;  2AW0 A;  4Q2M A;  1ZM2 A;  2QL5 B;  2L3M A;  4P74 A;  4IH5 A;  1UFL A;  3KUH A;  4BS2 A;  3TEH B;  2K06 A;  3NGT A;  2KXF A;  1AZS A;  4USH A;  1HHQ A;  1RWK B;  4YS2 A;  4LF2 A;  4CT8 A;  3MED B;  3CJK B;  4B3R J;  3U27 A;  3J80 U;  4G1Q A;  2FLO A;  1TL3 A;  1QAY A;  1WKL A;  4V1A k;  3BV8 A;  2BJ9 A;  3BKF A;  3HFV A;  2HFU A;  4ZHR B;  2JWN A;  4KJI A;  1NO8 A;  3ETO A;  3R27 A;  4EI2 A;  4MFB A;  5CYM B;  3QQC D;  3NNA A;  3Q8S B;  2CQ4 A;  3GJS B;  4KO0 B;  4G3I A;  1ZH5 A;  1RT5 B;  3G8T A;  5F9N A;  1EP4 B;  3H2V E;  1Q8K A;  1GMW D;  3UQS A;  3W7B A;  1S1V A;  4PWU A;  2IDE A;  2X1G A;  4MIB A;  3J81 j;  3RRK A;  3NWG A;  4F3O A;  1GNK A;  1UWB B;  1SKU B;  4IOC Q;  3CED A;  2JZ5 A;  2BE7 D;  4OHZ A;  3I9V 9;  2GVD B;  3D7S B;  4B9L A;  3M9O B;  3CNQ P;  3MUM P;  4CO5 A;  3TP2 A;  4K4S A;  4LF6 J;  1QTM A;  2OML A;  2HNZ B;  3HT0 A;  2XMT A;  3N5B A;  3HZE A;  1K0T A;  2GS8 A;  4Y34 A;  2HHV A;  2QLF B;  1GTH A;  5IXU A;  2HVZ A;  1PYO B;  3B6B A;  3LAM A;  2FHK A;  3BH6 B;  3DLB A;  3OTE A;  3KDN A;  2I2Y A;  1TUW A;  4PG7 A;  4YDD B;  1VS3 A;  1WUU A;  1FX4 A;  4H4M B;  2JEJ A;  5J2Q A;  3HVT A;  3VAH A;  2K3K A;  5KG2 A;  3G96 A;  4LR7 A;  4UUW A;  3TUZ C;  2JX2 A;  1HD0 A;  2GJF A;  1YJT A;  3W9I A;  1CUL B;  3H4B A;  2LU2 A;  2XYG B;  4OHV A;  1UA1 A;  4Q44 A;  1GAO A;  5KFS A;  2V2K A;  3HHN B;  2XY6 A;  4KIA A;  4GKJ J;  4ED7 A;  1HNI A;  1LW0 B;  5BYS A;  4LF8 J;  4LFC J;  3MFI A;  3V2U C;  4RBV A;  4WII A;  1SJ3 P;  2J7W A;  3S1T A;  4PG8 A;  1SJQ A;  2L08 A;  1UEK A;  4AXJ A;  3THT A;  2GAG C;  2PGC A;  4P2M A;  1RT3 B;  4ZVH A;  2ERR A;  1PO6 A;  2YVS A;  3OR1 A;  3R97 A;  2XM3 A;  5ITH A;  3VV2 B;  4YEA A;  4CM0 A;  4PAA A;  4QYZ J;  2Z2L A;  2G13 A;  3KLH B;  4CTA B;  4P52 A;  4J9M A;  4H4O A;  2X51 A;  2C2R A;  3B82 A;  1YJ9 S;  3PW0 A;  1IKY B;  2XLJ A;  4Y65 A;  1SPB P;  2FLN A;  2P6T A;  2B9Y A;  1FO1 A;  3UD5 A;  1Y00 A;  3QWU A;  3TWZ A;  3OVA A;  1XNR J;  2GNK A;  5GMK a;  4OYI A;  1XNQ J;  2B5J A;  2HAI A;  4UOH A;  5D0R A;  4LRA A;  1JNR B;  3AOB A;  3ZZZ A;  4EYH B;  2MLX A;  1XR5 A;  3ELH A;  2HNY B;  3G87 A;  2DEI A;  3W9J A;  2YKM B;  1Y10 A;  4YFU A;  3KK2 B;  1EKR A;  2ATL A;  3KJV A;  4ZPT R;  3CD0 A;  3D6H B;  4ZPC A;  4ZIT A;  1RU2 A;  4LIW A;  4CLU A;  3AXM A;  3LP2 B;  2C3P A;  1B99 A;  4OX9 F;  1R27 B;  1HI0 P;  4E2F B;  2AHO B;  1VQS A;  3HSJ A;  1CEZ A;  3AJ1 A;  1NJI T;  1Y3J A;  2HHU A;  1RXO B;  5KFJ A;  5K20 B;  2ZD1 B;  3HPO A;  2GO9 A;  3H5X A;  3VZH A;  1TL7 A;  1V6H A;  5DG7 A;  2ASJ A;  4RBT A;  2OH2 A;  3N9U C;  1JWW A;  1NU4 A;  3P45 B;  2QFI A;  2DNP A;  4WF9 Q;  3KG1 A;  2JLG A;  2A6O A;  5HLF A;  4U96 A;  2BZ2 A;  4CO1 A;  1S1X B;  4QR2 A;  5DJB A;  2UUC F;  5C2G A;  2OD6 A;  3T5K A;  3IWL A;  2DR6 A;  5D3G A;  1HI1 A;  2ZZM A;  5DG8 A;  4RW4 A;  4O3O A;  3OTD A;  5LMU F;  1RB0 A;  2IA6 A;  3SQG B;  1YJN S;  4DL5 A;  1S9E B;  4AXI A;  3EWG A;  5THW A;  3NKY A;  3NCQ A;  3RZA A;  3JAM Y;  5CYJ A;  3VQS A;  3CDW A;  4UQG A;  3MR3 A;  1MRO B;  2J0W A;  1C2P A;  4MK7 A;  1VQ9 S;  3LGN A;  3DYA B;  2UXC J;  1RKI A;  2RUS A;  2E9R X;  2CPF A;  4X4T A;  4OQJ A;  1BQM A;  3C19 A;  5KFY A;  3TW0 A;  2YWH A;  1TKX B;  2CPE A;  3FEX B;  5H9E K;  3I5C A;  5AE1 A;  3CCM S;  4ECW A;  4FXW A;  3TYT A;  4IUF A;  4WYW A;  4PEO A;  1ZYQ A;  3MGJ A;  1S10 A;  4P7V A;  3R2C J;  1Z2L A;  1YBU A;  3IG1 B;  2ZKU A;  5DZ7 A;  5C25 B;  4K50 A;  4YB6 A;  4GKK F;  4GVB A;  4K4X A;  4NCB A;  1TFY A;  3NP5 A;  3LP1 B;  2WBM A;  1YRX A;  1X5P A;  2DY9 A;  1MWQ A;  3I6P A;  2DHG A;  4NMX A;  4KH0 B;  2KRB A;  3UDV A;  4PQU B;  1VRU B;  1WHX A;  2XEX A;  2W7A A;  2BAC A;  1FX2 A;  3OVB A;  4FYY B;  1HD1 A;  4I0W A;  4HTJ A;  1VOM A;  5HP1 B;  1G3O A;  4Y2M A;  3NS5 A;  4GO7 X;  2CJY B;  5HN0 A;  3UVJ B;  2N7C A;  4O0I A;  2G4B A;  1TP7 A;  3J7A N;  3UFC X;  1KN6 A;  3JSR A;  4MKY A;  4C3L A;  2D3O R;  3GV7 B;  4MAK A;  5E3C A;  3PRV A;  3H2U B;  2DNQ A;  3R5A A;  5KFH A;  5IQQ A;  3QRQ A;  2UUA F;  4UQT A;  4I2P B;  1XMO J;  4NZ6 A;  3O1L A;  2M88 A;  4JI0 J;  3J81 U;  4ICL B;  4HHU A;  5KFR A;  2PC6 A;  3GB0 A;  3V6D A;  1U8W A;  1PYT A;  4MK8 A;  3VAK A;  1RYR A;  3IP0 A;  1H72 C;  1BQN A;  1X9S A;  5AJ3 F;  4K4W A;  4MIA A;  1U48 A;  3Q0A A;  3N6L A;  1KVI A;  3M32 B;  3LWL A;  5BYR A;  4JI4 F;  4B3S J;  4DF8 A;  1RTD B;  4U95 A;  1TV6 A;  3N5F A;  1SQE A;  3D4J A;  3R6L B;  1JLB A;  2QZ8 A;  4XO0 A;  2MKY A;  2N4D A;  2ACY A;  2QYG A;  3FJ2 A;  1DQA A;  3BR9 A;  4NLU A;  2FHJ A;  2BOP A;  1MWY A;  5A8K B;  1A0O B;  2JVO A;  4F2S A;  3AOD A;  1IQT A;  4NLT A;  4XDC A;  3G6V A;  4NXM J;  4L73 A;  2MB0 B;  2QMX A;  2V5H G;  3WX4 A;  4I68 A;  4J9Q A;  2ASY A;  3BZQ A;  5CD4 H;  3HDS A;  1N32 J;  4F0H A;  4GMK A;  2B56 A;  5A2Q Y;  1UEU A;  1EX8 A;  2CPY A;  3MEG A;  3LO3 A;  3PNI A;  2NCK L;  1APS A;  3FMW A;  1V5V A;  2BKO A;  5EWG A;  3D68 A;  4LFA J;  4AFF A;  4JI1 J;  4RW6 B;  2MQ8 A;  3GII A;  1DFD A;  4CQ1 A;  5EHH A;  1UJ6 A;  3TAN A;  2CPX A;  3HVW A;  1FKO A;  2IM1 A;  5L8R C;  5L1I A;  3K8V A;  1U6F A;  3K17 A;  4TYA A;  2DEJ A;  3MI7 X;  2HS4 A;  3M1V A;  2YH1 A;  3IBF B;  3IRX A;  2CQB A;  3CCW A;  2AQ4 A;  2CPZ A;  1S48 A;  4CLK A;  5F9L A;  2Y3Y A;  4O3N A;  4NLO A;  4CI0 B;  3FUY A;  5A2Q U;  4HT7 A;  5EWF A;  1NJW A;  2NZC A;  1F5A A;  4OYW A;  5CCL A;  2W1B A;  2DNN A;  3IS9 B;  1EQM A;  3QRP A;  3NCR A;  2XCA A;  1S6P A;  3NG8 A;  1RTH B;  2G0J A;  1XMQ J;  1JLA A;  1FDN A;  4A8X A;  1IQZ A;  2IRY A;  2XMA A;  5M2P A;  1U2F A;  2BKP A;  5D0G A;  2R7O A;  2ROE A;  3DOL B;  2X7I A;  4CNZ A;  5L9N A;  4KPC A;  3TJ8 A;  4RNN A;  1Q81 T;  1HBM A;  1FDA A;  1LKZ A;  4ECR A;  1OO0 B;  3OFG A;  1OWX A;  1JJ2 R;  3DRS B;  2CQ2 A;  2UVV A;  5IC6 B;  4P9S A;  3PRB A;  4J9K A;  4KC5 A;  2KB2 A;  1S6Q A;  5I4M A;  1HL6 A;  2CRL A;  2W4P A;  2DHS A;  4F26 A;  5HVF A;  2JJ4 D;  2Y1J A;  1SV5 A;  4OHX A;  5ETO A;  3CUL A;  5KOX A;  4KGX B;  2ROP A;  4JI6 F;  3WBZ A;  1Z1Z A;  1FDD A;  4CH7 A;  3JSM A;  2CG4 A;  2DNM A;  4FPR A;  2LEA A;  2C2N A;  2YNI A;  1VHF A;  3EPG A;  4B9T A;  2XMU A;  2W2Q P;  5KT6 A;  5BJR A;  1M5O C;  2POK A;  1VQL S;  2UUB F;  2CDR B;  1FRL A;  4YP3 A;  2EBG A;  3BYR A;  2DNR A;  2DXE A;  3D5M A;  2N3O A;  2AZ1 A;  2M5Y A;  2PII A;  3KK1 B;  4O4R A;  2WOM B;  2VG7 A;  1RLC L;  2KJW A;  3OL9 A;  1B4S A;  4UY8 5;  3G86 A;  4QU7 A;  2VA2 A;  1AW0 A;  3BDP A;  4RR5 A;  2XMV A;  3MCM A;  1GMW A;  3PG9 A;  1VQ6 S;  5EN1 A;  2CQ1 A;  1NDP A;  2DHX A;  2L9W A;  1WG5 A;  4DX7 A;  3QBC A;  1QM9 A;  2QFJ A;  5KFW A;  1S5Z A;  2ZH2 A;  4JOU A;  2XI2 A;  1IWA A;  2OSR A;  2W2O P;  5IM0 A;  4WP9 A;  1HBU B;  4WFY A;  3DHX A;  4YME A;  2EEY A;  4O0N A;  2XC9 A;  4WXW A;  1ZS6 A;  1U1N A;  2RU9 A;  4WFZ A;  1RT6 A;  4PKD B;  4OHW A;  4O3S A;  1S1T B;  5M2R A;  4DSE A;  3Q86 A;  3AA9 A;  2W8L A;  2AP6 A;  2IDL A;  1CC8 A;  3MF5 A;  1NCL A;  2WVD A;  2A1B A;  3FZB A;  1S1U B;  1HNW F;  1YG0 A;  3I32 A;  4QU6 A;  1OY8 A;  2VG5 A;  2ZE2 A;  4NI2 A;  2VV5 A;  5DM6 Q;  3DRR B;  2CJQ A;  4F0M A;  2RRB A;  2VFT A;  1W25 A;  2QRR A;  2UP1 A;  3SCL E;  4YB7 A;  2CQ3 A;  4YR0 A;  1Q8I A;  2CQH A;  3C3L A;  3TZX A;  3CJR A;  3C14 B;  3LAL A;  5CD4 A;  2E5G A;  4G1P A;  4TU8 A;  2HMI B;  4F36 A;  2G0C A;  4GC6 A;  3MMJ A;  2OEK A;  4K0K J;  4X66 F;  1U1P A;  2XHC A;  4ED3 A;  1NDL A;  3DU6 A;  2ADB A;  1K8A T;  3O5T B;  5F0W A;  2FJD B;  4FS1 A;  1IBK J;  2KZZ A;  2COL A;  4FXD A;  3DGP B;  4HL9 A;  3K5M A;  2F8H A;  1UZH A;  4ECQ A;  2K1R B;  3NGU A;  4A47 A;  2JDJ A;  3PW5 A;  1YJU A;  3GG1 A;  5KFL A;  4KAI A;  4JV5 J;  4DR2 J;  3GYG A;  2FGC A;  2CZ9 A;  4C98 A;  4QR0 A;  1LEO A;  1VQK S;  4M8L A;  1QSL A;  5FDL B;  3EGN A;  3FGV A;  1RAB B;  2E5H A;  3H90 A;  3IBC B;  3MM9 B;  5BR8 F;  3WQP A;  3G82 B;  1JKH A;  3EIC A;  2MQL A;  5F0U A;  1ICE B;  4DV5 J;  3POT A;  1R0A B;  2OPQ B;  4R5P B;  2ZOG A;  1U8S A;  5T7L A;  2Y1L B;  3KJF B;  4LJM A;  3AQP A;  3THP A;  4WU3 A;  3TQE A;  3T6B A;  3PKY A;  3N01 A;  3G9C A;  4R0J A;  1AUS L;  2KKH A;  1VMB A;  1PG5 B;  4X84 A;  4QZV B;  3ENQ A;  4ZPB A;  2QE5 A;  5B0D A;  1XC9 A;  1NK5 A;  2DGU A;  3NGK A;  1KSP A;  2HQD A;  2EXU A;  1C0U B;  3P49 B;  2CWK A;  3R9L A;  1S49 A;  2HBR B;  3NOG A;  1UVK A;  1FD8 A;  2MKK A;  5KT7 A;  4ZP9 A;  2V8D A;  4LSL B;  2RML A;  1S1W A;  3H4D A;  1UVJ A;  2HHH F;  4IO1 A;  1HWU A;  3S01 A;  1PIL A;  1TL1 A;  4OI2 A;  3C66 A;  1CJK A;  1F0X A;  1V5I B;  4DQQ A;  3DI6 B;  5C42 B;  3KUG A;  2Q1L A;  3M6U A;  1WAC A;  4CO2 A;  1KQK A;  1FKP A;  2FGO A;  3GYN A;  2JSX A;  4Q7A A;  4CH0 S;  2ZZT A;  3TVZ A;  3BKU A;  3T6J A;  1ZA2 B;  3CJ2 A;  1NJZ A;  3P8B B;  3V5R A;  3EUN A;  1BHN A;  1IWG A;  5CAA A;  2LQB A;  3SDE A;  3DOK B;  1YQH A;  1P9Y A;  4C11 A;  3IO1 A;  2XSJ A;  1MWZ A;  4O3P A;  4B02 A;  2O01 C;  4OI6 A;  3CC2 S;  2ZH5 A;  3CO9 A;  3GP9 A;  3NBP A;  4WZM A;  4BHQ A;  1R6V A;  3CDE A;  5LJ5 Y;  1Q78 A;  3AB2 B;  2KM8 B;  1YJR A;  1Q5Y A;  4DSF A;  4OZ1 A;  4ER8 A;  4A8F A;  1JXV A;  5I42 B;  1VQP S;  2XMW A;  1NB7 A;  3GIK A;  2GV1 A;  1C4C A;  5DO2 A;  1U0S A;  4KGM A;  4C6A A;  2NZ4 A;  2IIH A;  4ALZ A;  2HYI B;  1SCJ B;  3P3D A;  4ETZ A;  3H59 A;  4B08 A;  1X4D A;  4HR2 A;  3KLV A;  3CJK A;  2RNE A;  3W3S A;  1TVR A;  1R8B A;  3IAM 9;  3B4D A;  3JB9 k;  2PMZ D;  3MEE B;  1Y3K A;  3DRP B;  3EPI A;  3DXS X;  3H40 A;  3AB4 B;  1FWP A;  2M3D A;  4F2R A;  3EJM A;  2M8H A;  4DU7 A;  4OJ3 A;  1DQ8 A;  2KFN A;  4CLZ A;  1WSV A;  3V4I A;  3SXL A;  1JLC B;  1RT2 B;  5DET A;  3O8W A;  3OL6 A;  3JS9 A;  3FMB A;  3TAP A;  4WP8 A;  3OFF A;  2CXE A;  2UUW A;  1RSC A;  2J9E A;  3LPE A;  1REG X;  2OLW A;  3DCA A;  3R5J B;  3MM6 B;  2HFV A;  5J2M B;  3JSB A;  3RB3 A;  4AT1 B;  4ID5 B;  2HVE A;  1HQU A;  2BYC A;  2D7S A;  2XS7 A;  3RTV A;  3MZI A;  5D4L A;  4W4M A;  3DLH A;  3CIM A;  5KFM A;  4EUV A;  4NYP A;  2LDY A;  3CD5 A;  3ZZO A;  2MLY A;  3KHG A;  1R3N A;  1UW4 A;  2BEF A;  3TAM A;  5A6W A;  4I56 A;  2GMJ A;  1N88 A;  3PFO A;  3O3L A;  1UPP A;  1O5J A;  3OXL A;  1JK9 B;  5E3R A;  2DIT A;  2FJA B;  2DIU A;  4NL5 A;  3PKM A;  1T03 B;  4KYZ A;  2HWH A;  3C46 A;  2R7W A;  3IR5 B;  4O4G A;  3ZZT A;  4KFB A;  4TQS A;  3ET6 B;  1VJQ A;  1LFW A;  4HHH A;  4ES2 A;  3NOC A;  3R5B A;  3S7R A;  4FDF A;  2EPI A;  4P2F A;  3SEO A;  2ZM6 J;  2HWT A;  3G2X A;  4A8Q A;  3I5A A;  3D67 A;  3M2R A;  1D9D A;  2ZH1 A;  1AZS B;  2H4W B;  5GAH U;  3DLG A;  1MML A;  5ETT A;  2F4V F;  1GEH A;  3TZZ A;  2QLJ B;  4KPY A;  5LL6 d;  1WD6 A;  4G1Q B;  2OHD A;  1NAQ A;  1R0B G;  5B0A A;  1TL3 B;  1Y5N B;  2LXF A;  4DPT A;  3WX8 A;  2VC0 A;  2XY7 A;  1FI4 A;  4M5J A;  5DDR C;  2KXN B;  1U02 A;  2QL7 B;  2HQ3 A;  5JVG Q;  2ZUG A;  1ARO P;  4MFB B;  3R3T A;  2R8H A;  1OJ4 A;  3TJA A;  2E7W A;  3W5Z A;  1G2E A;  2V69 A;  3DLK A;  3NWR A;  2DGW A;  3I55 S;  1YJ7 A;  3HSD A;  4OX9 J;  4RUA A;  2OTJ S;  2RVJ A;  3BF4 A;  1D3W A;  1S1V B;  4CO3 A;  4K2X A;  4QWD A;  2DGV A;  4IRD A;  2H5E A;  3JSY A;  4NYO A;  1KS2 A;  4G65 A;  3AT1 B;  4F4Y A;  5ETN A;  2FIU A;  1H3D A;  1KFS A;  4Q2L A;  3KMS A;  3CCL S;  2DD8 S;  4KE5 A;  3GFH A;  2NUU G;  2QV6 A;  3RB4 A;  3LH2 S;  2AX1 A;  2IYG A;  3LPY A;  2F4F A;  1K9M T;  1RIS A;  4EBE A;  1X0F A;  3CF5 Q;  2R7U A;  2B4V A;  2H5I B;  5I3U A;  2DXD A;  2UUC J;  4DZ6 A;  4NLG A;  4NWB A;  4U8Y A;  1TMJ A;  1IKV A;  2ADC A;  3I31 A;  1O6X A;  2ZBP A;  4NX9 A;  2E66 A;  4LF4 F;  5J2Q B;  3HVT B;  1FES A;  3UE2 A;  1TUG B;  3PCO B;  3MM5 A;  5HMY A;  2UV8 A;  3A3N B;  2D1C A;  1ZTW A;  1RAI B;  5GAE U;  1JB0 C;  2HBQ B;  2FHO B;  1X4A A;  1X4B A;  3MOJ B;  1HNI B;  2VJV A;  2KYZ A;  2RHS B;  3KLE A;  1GQE A;  2DCU B;  3HVR A;  3J7Y U;  2W4C A;  5A8R A;  2PMH A;  3MPU B;  3CJQ A;  1YBA A;  3QWP A;  5CCM A;  3SV4 A;  3QRR A;  1LW2 A;  3OR1 B;  2PD1 A;  3AD9 C;  2HLU A;  1NPP A;  4LF8 F;  1NND A;  2V2Z A;  3A3P B;  1TZ0 A;  1QY7 A;  3LTO A;  3KTQ A;  1T9T A;  4H4O B;  5KG3 A;  1NPR A;  4KTQ A;  2XWX A;  1NM2 A;  2D41 A;  2O66 A;  4R8U A;  4RU2 A;  3R5G A;  4WFB Q;  4U6P A;  4CLL A;  4GKK J;  4J7C A;  1VQ8 S;  2RJZ A;  4IOB A;  2JNJ A;  4IFY A;  1FER A;  3JQJ A;  4I4B A;  3Q8Y A;  1FRM A;  2R7Q A;  2R8K A;  1QUV A;  2EK6 A;  2B5J B;  1F5B A;  4QIG A;  1LNQ A;  5KG0 A;  1CJU A;  1PAE X;  2RQC A;  2VB6 A;  4DZD A;  2WK4 A;  4ZP8 A;  1TK8 A;  1FNO A;  3KJV B;  3UDE A;  5F3Z A;  2WSE C;  1H2V Z;  2FB0 A;  1XNR F;  4ZPV R;  2MQM A;  4DUY F;  2B4U A;  2V9K A;  2AYM A;  4F4A A;  1HAR A;  3BGO P;  2LA6 A;  1N5S A;  2BJE A;  2MQO A;  3NGD A;  3MMA A;  1X31 C;  3M8P A;  1M5S A;  1KDN A;  1TAU A;  1AA1 B;  4RW7 A;  2C22 A;  2GIQ A;  3I0R A;  2C3M A;  2I38 A;  4M63 A;  1TL7 B;  3MD1 A;  4CLF A;  2UUA J;  5KFC A;  1FRI A;  1C0T A;  4ED1 A;  3R7N B;  4LVN P;  4DQS A;  3QAT A;  1JQG A;  1R43 A;  4EU0 A;  3QJP A;  2J8S A;  3JYT A;  5HLF B;  2M8D B;  2PI4 A;  1QSY A;  3AD7 C;  2AJQ A;  2Q79 A;  3IM8 A;  1T7P A;  5AJ3 J;  1NDK A;  3D3C J;  4MH8 A;  4RW4 B;  4M5M A;  1SKW A;  4M5H A;  4JI4 J;  1NK9 A;  1K44 A;  3KWM A;  2LVW A;  4TLR A;  4M5L A;  1DHM A;  4DFP A;  1OMS A;  1WG4 A;  1N54 B;  4KHP J;  2E29 A;  3Q83 A;  4MYU A;  4DR3 F;  4ZDN A;  4DS5 A;  3R7B B;  3CJT A;  4FBT A;  3L7O A;  3AH6 A;  4OYZ A;  2CYY A;  2YPZ A;  3PX0 A;  3EXC X;  1BQM B;  3N6N A;  5IT0 A;  4WK3 A;  3BN4 A;  1X8D A;  2VZ9 A;  2WON A;  2J7K A;  3FCV A;  4AQY F;  2WCX A;  2KG0 A;  2UXC F;  1CLF A;  1UTA A;  2EKN A;  3MM7 A;  4OLO A;  4U8V A;  3VR1 A;  3CVK A;  1AT1 B;  2RRN A;  2Y1I A;  3IGV A;  2DPI A;  3BS9 A;  4S0M A;  4GVB B;  3QAU A;  4EMD A;  2JH3 A;  4K5S A;  3CIZ A;  3RU0 A;  4LRF A;  5L1L A;  6AT1 B;  2LQJ A;  2NYI A;  1Q7L B;  3D6T B;  4KRW A;  5KFX A;  4N76 A;  1U25 A;  3M7V A;  1BGX T;  1QTN B;  4LFB J;  5K8N A;  2ACM A;  3SFG A;  5G0R A;  4EO6 A;  2J0X A;  2LFV A;  1RWP B;  3UD4 P;  3A13 A;  2HHT A;  2HQF A;  1VRQ C;  1VIO A;  3QT5 A;  1RYS A;  2RT3 A;  4JB8 B;  2R7R A;  4KT0 C;  1H73 A;  3PIP Q;  1MMD A;  1F9H A;  2GML A;  4CLP A;  4MKB A;  3O44 A;  2Z2M A;  4IKA A;  2V4Q A;  4K2J A;  3CCQ S;  1R89 A;  2HBY B;  4ZP6 A;  3PXG a;  3V6D B;  4B9U A;  1DTT A;  2ZDO A;  1BQN B;  2Q6C A;  2JC0 A;  4W98 A;  4USK A;  1RTH A;  3AY0 A;  5KFF A;  3GIM A;  5KFP A;  2BR0 A;  1WKJ A;  1XMO F;  5LSO A;  4LBH A;  3EXY A;  5GMD A;  4JI0 F;  1I3O B;  1Y11 A;  1FTC A;  3DOL A;  1Q7Y T;  5L39 A;  1D9A A;  1TV6 B;  1QE1 A;  5BXI A;  3MTJ A;  3T5H A;  4NA1 A;  1JLB B;  1UVM A;  3LGM A;  5CQG A;  2GC8 A;  2B6A A;  3A12 A;  1IXK A;  3RAM A;  2ZKT A;  2X3D A;  3A8E A;  1HBN A;  2VFU A;  4B3S F;  3Q2S C;  4JI6 J;  2QA2 A;  1P9Q C;  2CWX A;  2I9S A;  2LLZ A;  2KN4 A;  3QGI A;  1FDB A;  1TFW A;  1F1B B;  4ZLN A;  2XY5 A;  4KGZ B;  2UUB J;  3MPV A;  1GX5 A;  4URQ U;  3AQO A;  2EFP A;  3TO8 A;  2Q6B A;  3VAG A;  2A6M A;  3OSN A;  5DZ6 A;  3PW2 A;  5LXY A;  4RUC A;  4DHV A;  1LQ9 A;  3KXD A;  4WFA Q;  3WZ0 A;  4CNY A;  3DDN A;  3MEG B;  2RS2 A;  5KFQ A;  1URR A;  2GW8 A;  2GX8 A;  4NE9 C;  4QWC A;  3PO4 A;  5F41 A;  4RU9 A;  2RKI A;  1H2U X;  1FJG F;  2WOM A;  1T95 A;  2BW2 A;  3J7A 1;  3IC1 A;  1FKO B;  4X65 J;  2HFN A;  2CJX B;  3D54 A;  3M4X A;  4A48 A;  2BJ1 A;  2MKI A;  1NLK L;  3QLH A;  4JI1 F;  3M1V B;  4WIQ A;  2AGO A;  1R8C A;  2MZT A;  4A8O A;  2XYH B;  3IRX B;  3T9N A;  1IM6 A;  2C2Z B;  3QID A;  4ZLL A;  2MXY A;  4DQI A;  4PQA A;  4ANC A;  1OIA A;  5KG1 A;  2M9K A;  3CGI A;  5HSP A;  4E8U A;  3W62 A;  2O67 A;  1S6P B;  1WC3 A;  1NHK L;  1YRU A;  2GIF A;  1TQL A;  1JLA B;  2DGO A;  2HIQ A;  4DCO B;  3AFG A;  4Q45 A;  4B17 A;  4DSJ A;  2R7X A;  3BN7 A;  4LF5 F;  3BB5 A;  3IR7 B;  5JXS A;  1HBM B;  3H8Y A;  2MKJ A;  3PO5 A;  2AJ4 A;  1WNE A;  3RB0 A;  1R8H A;  3HO1 A;  2FJW A;  1X4C A; 
#chains in the Genus database with same CATH homology
 4CLU A;  2GVD A;  4WP9 A;  1CJV A;  3UVJ B;  1CJT A;  1Y11 A;  5D0E A;  1CS4 A;  5IV3 A;  1CJK B;  3C16 B;  3ET6 A;  4UST A;  4CLK A;  4USV A;  4OZ2 A;  2GVZ B;  4P2M A;  4USW A;  1YBT A;  1CJU B;  4OYX A;  5D0H A;  2GVD B;  1TL7 A;  4OYW A;  4CLZ A;  1CJV B;  1CJT B;  3MAA A;  4CM0 A;  4OYZ A;  1WC0 A;  1AB8 A;  4WPA A;  1CS4 B;  1AZS A;  3ET6 B;  1WC5 A;  4WP3 A;  1U0H A;  1WC4 A;  4OYM A;  4OYB A;  1YBU A;  3C15 A;  4P2F A;  1YK9 A;  2WZ1 A;  4OYA A;  5D0G A;  4CLS A;  1TL7 B;  4WP8 A;  4USU A;  4CLF A;  2QV6 A;  3MAA B;  4OZ3 A;  1AZS B;  1WC6 A;  2W01 A;  1U0H B;  4OYO A;  3MR7 A;  1CUL A;  1WC3 A;  5IV4 A;  4OYI A;  1FX4 A;  4CLP A;  3G82 A;  3C15 B;  5D0R A;  3R5G A;  4NI2 A;  3C14 A;  4CLL A;  2BW7 A;  3UVJ A;  1WC1 A;  1Y10 A;  4P2X A;  4OYP A;  1CUL B;  4CLT A;  1CJK A;  3C16 A;  4CLY A;  1FX2 A;  2GVZ A;  3G82 B;  5D15 A;  4CM2 A;  4NI2 B;  4CLW A;  3C14 B;  1CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...