2GVZA

Crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
total genus 44
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvzA00
4CM0A 3G82A 4USWA 4USTA 5IV4A 4NI2A 4OYAA 1CJVA 1CS4A 3C16B 1CJTA 4CLKA 4CM2A 4WPAA 2GVDB 1FX2A 3MAAA 1WC6A 4OYPA 1CULB 1CJKA 1FX4A 4CLYA 4CLLA 1AZSA 4WP8A 2W01A 3UVJA 4CLZA 4OYWA 4OYBA 1Y10A 1U0HB 3R5GA 4P2MA 5D0HA 3MR7A 4CLUA 4CLTA 1WC4A 1CJUA 2GVZB 3C15B 1TL7B 1CS4B 4CLSA 4CLFA 3C14B 4WP3A 3G82B 4OZ2A 4NI2B 1Y11A 1CJVB 3C16A 2GVDA 1CJTB 5D15A 4USUA 3MAAB 4OYXA 1CULA 1CJKB 4OZ3A 1WC0A 3ET6B 1AZSB 3C14A 1YBUA 1WC3A 4USVA 1WC1A 4CLWA 3UVJB 4OYMA 4P2FA 5D0GA 2BW7A 2WZ1A 1U0HA 1WC5A 2QV6A 4CLPA 1AB8A 5D0RA 4OYIA 3C15A 2GVZA 4OYOA 5D0EA 1CJUB 5IV3A 1YK9A 1TL7A 1YBTA 3ET6A 4P2XA 4WP9A 4OYZA
chains in the Genus database with same CATH superfamily
2UXDF 3GJTB 3G8SA 4EBEA 2W4PA 2IDLA 3KHRA 3MEEB 3PW7A 2MQOA 2D7SA 1KC8T 3ITHA 3MMAA 2DEJA 5KFKA 4JI2J 2V4JA 5F8HA 5DQIA 2KHDA 2K3IA 2RT3A 1NHVA 2XWYA 3G8TA 4FS2A 2MEWA 4XPEA 4AL7A 4TN2A 2CJXB 2OUGA 4DFMA 3C6UB 2CXEA 3B54A 1NB7A 3QBCA 3I96A 4CLUA 3UFCX 3Q8RB 2IM0A 2ZOMA 3GIJA 4ZCMA 3HPOA 4OQJA 4CLFA 3LGMA 1D0EA 1B7YB 2DT9A 4LSNA 5IFMA 4GKJJ 2PIIA 2K1RA 1YWXA 1R3NA 4DX6A 2OAUA 2RHQB 2JFKA 5IXUA 3DLJA 1NK4A 1F9HA 2VHGA 4EZ6A 2KFYA 4DN9A 3ET6B 3I31A 3VAIA 4ED6A 1JLAA 1O8BA 2QG9B 4OI4A 4ETXA 4F2RA 1RLDA 3G96A 4F67A 4ZP7A 1RA6A 5A8KA 2HQ3A 3BQ0A 3QYYA 2NXCA 1K73T 4IH6A 2IBOA 3LANA 2LYVA 5F9LA 5H9EK 7FD1A 1TELA 5M2RA 6AT1B 5KFZA 1WTFA 4IH5A 1N4LA 4U7CA 4C4WA 4NLRA 1FKOB 4AQYF 1R8AA 3DOMB 3VQSA 2BX6A 1ZAVA 4R8UB 1K9MT 2YKAA 1BQMA 1YG0A 2DO0A 2HS0A 4TYBA 3RBDA 1X9WA 3HSDA 3BM7A 3JTNA 2VOOA 4G1QA 3NWRA 3MFIA 1CJUA 4P52A 4AUKA 1KOHA 3H7HB 3Q8PB 3I32A 1PAEX 2VKZG 3S1TA 1T05B 3NAIA 4J91A 3D28A 3MR6A 4XDCA 1RAGB 3M30B 1KBRA 3GTYX 4FPRA 4I0WA 1C1BB 2FD2A 2ERRA 4ID5B 2DXFA 2VG7A 4NEZA 4WFBQ 3M8RA 1TUWA 3HHLC 2CWXA 3N6MA 1BMQB 2GQQA 3DLHA 2EK1A 1XNRF 1Y00A 3X3UA 1HHTP 3PXGa 2YY3A 4RW8B 1JLQB 4KJIA 5LM7E 1OQ3A 1B70B 5B0FA 3I56S 4LSZB 3HHLB 4ZPVR 3SBMA 4F3OA 2EFOA 3W2WB 4FF2A 4I2QB 2WOMA 4U95A 4DSJA 4LVOP 2I38A 4ZVPB 3J81j 1N5YB 4LT6A 4IUFA 1KWMA 3QO9B 4B9UA 2PFDA 2M3DA 4MKAA 2GIRA 5DQGA 1NSPA 4NCGB 3BJYA 4RLEA 4ZDNA 3Q8SB 2JFDA 1ZAXA 2ASJA 1MN9A 4KC5A 2E1MC 3OQ2A 4C8KA 5D3GA 4CO5A 2HVIA 3W8PA 2H65B 3C6TA 4M5DA 3PR5B 1KEKA 3OTOJ 4O44A 3P6YC 4AD6A 2CQPA 1SUQA 2L9WA 2KI2A 4M5HA 3VAFA 1N54B 1ACMB 4JI3J 5H9FK 3I0RB 3HHLD 4TY8B 1U24A 4FN5A 1KN6A 2AYMA 2XO7A 1D9DA 2VU5A 4USIA 1S1WB 4UW2A 2Q3PA 3FSIA 5KFAA 2Y0SD 1GXLA 1YZ7A 2CUYA 4RU9A 2OD4A 4QOTA 2DGXA 1NSAA 1PJ5A 2IM1A 1YRXA 3IM8A 2UU9J 1DTQA 3K5NA 2BXJA 3FDSA 5J1NA 3R2CJ 1IBLF 1XR5A 4PUOB 3QWUA 3WZ0A 2I8EA 1HNIA 2M88A 2V6AA 2YWGA 2Q66A 4WP3A 4BDPA 4DG1A 4RNNA 2QA4G 2LMIA 2XMVA 3EPGA 4NLSA 2OFHX 3DKDA 1HA1A 3T6BA 4UQTA 5IQ6A 1OS5A 1KVIA 3I4HX 3POTA 1DQ9A 2W7OA 4R25A 5DLFA 4ZN1A 2UXBF 3ET6A 2WK4A 2C3PA 2QLWA 3CJKB 1SQEA 4EYIB 2BE2B 3UI3A 3QT8A 1EETA 1JQGA 3NGRA 1F60B 4JI0F 2WONB 2HQGA 1TZ0A 1CG2A 1YJUA 5B0CA 4USMA 1PO6A 2ZM6F 5ETLA 5IC4B 5M2UA 1RTJB 3RAMA 2AZ1A 4LREA 1LWFB 1S72S 2HG4A 1Y3JA 3MMCA 4DV6J 2FVRA 1TL3B 3P4UB 3OUYA 3NWGA 3EVWA 3M8WA 4UQGA 2ZBPA 2RF2B 4EO8A 5L38A 3TJ8A 4IR9A 5D6GA 4OX6A 2AU0A 2ZH6A 4N76A 4TVAB 1FFGB 4UF4A 5F3TA 4ELUA 1LWXA 2E7WA 1DAXA 2UVUA 2IBKA 2YKOA 3IBCB 2OLWA 4KHRA 1UMJA 1KVKA 3GCWP 2HAIA 3M2UB 2IFXA 4BWMA 3BBCA 2YTCA 3R6GB 3R8YA 3L4BC 5E7OB 1RU2A 2NQPA 4BC7A 1NHUA 4ZP8A 2Y8WA 2QMUB 4ILMA 3HKZD 5CZXA 1S79A 2KT3A 1VDHA 3KKFA 5LOQA 2V2QA 1WKLA 1LV5A 3CMQA 2C3OA 3V6KA 3SYZA 1TAUA 2C1EB 2W4CA 1HFEL 4CP5A 5F3ZA 4C3KA 5GAGU 1VQ5S 1FERA 2XZWA 1NPRA 3GJSB 1WSVA 1SC1B 3NGDA 3CWJA 2OFGX 3GLJA 4P74A 3UR0A 2FYXA 2J9CA 1X5TA 3KHHA 2DIUA 2HZAA 3DYAB 4LF5F 4RW9B 4EI2A 4PRFA 3VCDA 4Z2XA 1S57A 1SH3A 3TEGA 3R5CA 1OWXA 3BH6B 1SJ1A 2ALYB 3L7UA 1N34F 4ECSA 2W2MP 2RKIB 3GZ7A 2YKMA 2DY1A 4QWBA 1U1OA 3NY0A 4ILRA 1VYAA 5D78A 1EZZB 1YSJA 4URGA 5KG0A 2AEMA 3UO0A 3MEGB 1M0SA 4DCPB 1SC4B 5IT9Y 2NREA 3M9MB 3BPSP 3WQPA 2V8VA 3KG0A 4TY8A 2P8IA 4DR7F 4ED1A 1HBMA 4QR2A 1GTEA 4L75A 3MAQA 1KD1T 1FNXH 2ZH3A 4OV1A 3SQOP 2HBZB 5C25B 3EE3A 1ICEB 1TL7B 3KG4A 2AQ4A 1FFSB 5J1EB 3R9LA 3GIKA 1VJQA 2ZH2A 1Y11A 1CJVB 3DDKA 1Q4RA 3ENWA 4ED5A 2MQMA 3MAAB 1NK6A 3ZO7A 1L3TA 5KG3A 1X31C 3JXOA 3FK4A 1TVRB 1MMLA 3QIDA 4ZJLA 3I0SB 3ISNC 5DDRC 4LJMA 2LQ8A 1U1NA 4EUVA 1YRTA 1HBNA 4Z7CA 4GKKF 1VOMA 1L3VA 1RBLA 1UJ5A 5AE1A 1T9XA 4USTA 4LIRA 2D3O1 1HHQA 5DO2A 5HROA 1NJIT 4RO0A 1JLBA 1SQFA 3W2VB 1M5HA 2ZWOA 2FDNA 3CCVS 3DGPB 2HQDA 2XY5A 2HFVA 4B3SJ 3R7SB 4JI7J 4A8FA 4L3NA 1RAIB 5KFFA 4DCOB 3AOBA 4GVBB 1I5OB 5F8LA 3DHWC 1VQ7S 2WTFA 5KFMA 4J9SA 2V50A 4DV7J 2MKSA 5EHHA 2EFNA 2CQIA 5IQQA 2R8KA 4FBTA 4DF8A 1U1RA 4E0DA 3PRBA 4ZVEA 1H7WA 3NL0A 3EPIA 3THPA 2KM8B 2ZJPQ 2DNNA 5ETPA 2G2OA 4QW9A 4NOHA 1LQ9A 4ES1A 4HDGA 2RQKA 2AHOB 3ZTPA 1CLFA 4WK1A 5DG9A 1HBUB 3IGVA 1RHQB 1PCAA 2LEAA 1KQGB 5D0HA 5I3UB 3FRZA 4FKYA 4LF4J 2CQDA 1AXQA 3O44A 2J0XA 1FTCA 2R8JA 2KYXA 1DTTA 1NZAA 4X4RA 5B7WA 4DR3J 1NDKA 4KB7A 2PFFB 4YB7A 3C46A 3OFHA 2MJNA 5DZ6A 1GTHA 1FFWB 3PR4A 4ZLPA 2CNKB 4Q2LA 4N41A 2B9XA 3DYAA 5E41A 2HHTA 3D68A 1OYEA 4OX9F 1DQAA 3TX8A 3D7SB 3RJMB 3KTQA 3CPWR 1TFYA 1BUXA 4FXWA 4DUTA 3OL9A 4ZPBA 2R7UA 2CPHA 4OJHA 5LJ3Y 4C8LA 4X4OA 3OSNA 4L72B 1S0MA 2NYIA 4LF8F 1KR4A 2B5JA 1GMUA 5RUBA 4NEYA 5A6PA 4OYBA 2R8IA 3T5KA 4R0JA 1VCTA 2DH7A 2CPXA 3TNVA 3TAMA 2QLJB 3Q86A 3A8KA 9ATCB 3PDNA 3G82B 3CTRA 2CQBA 2DRAA 4Y2KA 3Q8QB 1QTNB 2VFSA 3DRRB 3DU6A 5THWA 3LTOA 3TRGA 2OPPA 5KFJA 4ED2A 4OHYA 3RBZA 4IQXA 2FUG9 5DDPC 2FQQB 2OPRA 3QFHA 4QIGA 3BBFA 2IIHA 2Z58B 3HVWA 3TA1A 4RW6B 1HPZA 1XNQJ 4HHUA 4B3TF 4C3LA 2HQFA 5JJBA 3DCAA 3CIMA 4X66J 3NBPA 3VAGA 4YDDB 3W5YA 4CM2A 4WPAA 3FZ2A 1SH0A 2GVDB 1YHQS 2C22A 4A8YA 1DURA 5AJ3F 3BO2A 1RAAB 2LA4A 3H5SA 3IR7B 5EWGA 1X4DA 2NCKL 2E1RA 2YNGB 2DCLA 2E9TA 2EKNA 3IS9B 1NBEB 1HQUB 1AT1B 2DPIA 1SJ3P 4ZVRB 3CD0A 3GWCA 1MNEA 1NLKL 4GC6A 3TEHB 2JOQA 2BRKA 1UVMA 4PR6A 1U1LA 2IC3A 4M5GA 2FIUA 3TI0A 3T6JA 2CQCA 2BYCA 2R7WA 1JIHA 3BSNA 1MMDA 3DLKB 3HFVA 2RQMA 1H2UX 4URSA 3OW2R 4B9LA 2E1CA 4QWEA 2ZHAA 2B51A 3OVSA 1V5IB 2CJBA 3THTA 5EWFA 1PYTA 2V63A 1UW4A 5HLFA 2BKOA 2VPYB 1LXNA 4GKJF 2P9EA 3RB0A 3KMSA 3I5BA 5DDQC 2QL5B 2IY5B 2CQ4A 2AJFE 1WWHA 3W62A 4DFJA 1XWLA 4GMKA 1CULB 2PN6A 4LBHA 2MY8A 3EJMA 4CLZA 4K0KJ 2P2CB 3MM6A 3ILJA 3MPYA 2C2RA 1EQMA 5GVQA 1H0HB 4UOGA 2QSWA 1UW9A 1GAOA 4QIWD 5GAEI 5C24B 1S48A 3WC0A 4MTPA 3C16A 3J80U 1HBOB 3FEXB 2YQ0A 2HBQB 5B0DA 2OGUA 3L7OA 2CWKA 1XR6A 3MPWA 3FKBA 5J2QB 3H5UA 4ECYA 3E01A 3V2UC 4EYHB 2DHSA 4DR6F 2RILA 4JV5J 2DNYA 2MYFA 3GJQB 2JX2A 2NZCA 3MR5A 4O4GB 3B8HA 4CWBA 3NP5A 1PJ7A 3GV8B 1MU2A 3CCWA 3IP0A 4CZCA 2PMZD 3GV7B 3KLEA 1U1PA 1UTAA 2B9WA 1LWCB 4PEOA 1U6FA 1VQSA 2E66A 4RUHA 1KLNA 1Q0NA 3KJNB 2BRLA 4YDXA 1HD1A 3UVJA 2XLIA 3M6WA 3B4MA 4M94A 1F5AA 2EG1A 2NPIA 4RKUC 1FRLA 3G8QA 2VKRA 2J0SD 2C2OB 5GADU 2CJ9A 1RHJB 3OBIA 3PKMA 2AEJA 5HAOA 4B9NA 2RDIA 3UNGC 5FLXY 1NCLA 1HQEA 1TK8A 1XMOJ 2MLXA 2HHHF 4P7TA 4A8KA 3H5YA 5F8NA 4LVNP 1PYSB 1RA7A 1BQNA 2FB0A 4ZA1A 3DLEA 3DOKB 3D9BA 1RBAA 4J5OA 2QJ3A 1ULRA 2EXUA 2CJAA 2CNOB 1JJHA 3MCMA 2BOAA 1RT7B 4OX7A 4NZ6A 3M6UA 3NG8A 4DL3A 2LP4A 3EDRB 4K5RA 1URRA 4CLLA 1T94A 4QYZK 2E29A 1T9YA 4ZLJA 4DX5A 3D6MB 4ZVTB 3KK3B 2JLEA 1KQKA 4XTTA 2IYGA 1IKVB 3SZ2A 3MR7A 1TKZB 1DARA 4A8XA 3JSRA 1N6QA 4QU6A 2HRYA 4A8OA 2BQUA 4LRCA 4LF1A 4WYWA 5CD4H 2YX7A 2R7SA 2J0QD 2DRDA 1JLCB 3GSIA 3CXCR 5A76A 1KQSR 2B4VA 2MLYA 3V81A 2A1BA 2ZZMA 4ZHRA 3P5BP 3CDEA 2HW3A 2WSEC 2UUBF 3PYDA 4UY8T 3RB3A 1C0TB 4J9OA 4HACB 4LRBA 4IG0B 4HH1A 4J9KA 3FSXA 3N01A 2QZ8A 4MKVA 1HD0A 1UVLA 3SEOA 4IG3B 5LXYA 2DR7A 4PQAA 1T8EA 4A8MP 2KYZA 1JXLA 3PHTA 4FYYB 2R2UA 3FBCA 4GVLA 1VC0A 2KDOA 4I7FA 4A48A 2P5VA 1NK8A 1KDNA 4DV5J 2CG4A 3BO3A 1VJWA 5F8GA 1JX4A 4C11A 1VRTA 3FBEA 1FWKA 4ZPDA 3I55S 3TAPA 1RQ0A 3JSBA 1B4SA 1SH2A 3R7NB 5L1KA 2G2ZA 4JI1F 2NUHA 1UPPA 1JLGA 2FVQA 1HMVA 1M90T 3GMGA 4NXMJ 1QJHA 3PW0A 4ICLA 4DS4A 4IQMA 1WC1A 5B09A 2I2YA 2VDIA 3V6JA 2HRUA 3Q2SC 2R8GA 2E7VA 1EP4A 4DV6F 2F65A 2XNQA 4QU7A 4KFBA 1QD1A 1S0NA 2EC2A 4CYUB 3VQTA 4ENOA 2CZVC 2MQLA 1RWKB 4Q2MA 1IR1A 2B0GA 1C2PA 1HKAA 2IRUA 3ONQA 2J6TA 1Z2LA 4EWTA 2ZH7A 3T3FA 3BKFA 2FJBB 3I9V9 4B9VA 4HHJA 2B43A 3V4IB 3VAJA 3GE9A 2C2MB 1Q95G 4KO0A 1RWMB 2UUTA 2N82B 4CT8A 3SCKE 1IKWB 2Y1IA 4QWAA 3PO4A 4ZKAA 5AT1B 1L3SA 4MIWA 1XTZA 3FQLA 4QR1A 2JLGA 3CCQS 2MJUA 1HNXJ 2ROEA 4NRUA 1SKSA 1U6ZA 1AFJA 4M5KA 3KUGA 3TZXA 3ETMA 2UVVA 3F44A 1WF2A 2JVOA 3SDEB 3B6BA 1EKRA 3KFWX 2AT1B 1RCOB 3TARA 1RT4A 1REVA 5KT7A 1SVDA 1RACB 4LMZA 3W65A 2HWHA 3QSYB 3M32A 3H5XA 1OQ6A 2HYIB 3JQKA 2LVWA 3HHKA 2YNIA 1B0VA 3IR5B 1FRKA 2DGVA 3TZWA 4CH7A 1TV6B 3NCQA 1R8BA 1OIAA 3VGTA 3W7BA 2B7BB 3QWPA 2GVZB 1Q8IA 2ZJRQ 3M8QA 2XNRA 3HX9A 4NZ0A 2XZTB 5AE3A 3GG0A 2DNLA 4PWDA 2ZOGA 1N32J 3JQMA 4A8QA 1EAYC 3HZGA 1RHRB 3PW2A 3UWTA 4LR9A 2R7RA 1FDAA 3RAXA 4PPZA 4WTYA 2OH2A 2OP5A 2J7UA 1PJ6A 1UWBB 5FJ4A 3TUPA 1FK9B 3N6NA 3D1OA 2BA9A 4C3MA 4WXOA 4RPFA 4XO0A 1NK9A 1IKYA 3LP1B 3W9HA 2K7JA 2HHQA 2Y8YA 1W25A 4FZVA 1N8RT 1BE4A 4C8MA 1QVFR 4MKBA 3OVBA 5ADZA 1Y0HA 4EMDA 5CYMA 3KLFA 2IMOA 3W9JA 3HULA 4EFAC 4FYXB 1C0UB 3MM5A 4ZITA 3DRXA 4JI6J 1FJGF 4J9NA 2B6AB 4ZVUB 3C15B 2VFUA 4X4SA 1N52B 4NLOA 1N5VA 2X51A 4YS2A 1IXKA 2XBPA 1Y7PA 2WVFA 4OZ2A 2D3ZA 3DDNA 5IZHA 3D5MA 3JQJA 1RE1B 3LP2B 3HVAA 4W92B 4H4MB 4PWWA 3OD2A 1OY8A 3ENVA 1Q7LB 2ZD1A 2CQGA 2I5JA 1V5VA 5LSLA 4BBYA 1GMVA 1HYSA 3ILOA 1NK0A 3Q8VA 3I5CA 4NCAA 2OELA 2EEYA 5ETNA 3HVTB 4JI8F 3GCXP 4FPIA 4DV7F 1T95A 1NNDA 2MQ8A 4K2JA 1S1XB 7FDRA 1W7WA 1NSKL 3MXHP 4AT1B 3O5TB 1NSQA 2V4RA 1B0PA 2BJ9A 1HI8A 2OMOA 3M2RB 3NNCA 1BWVA 2DHXA 4LR7A 4RW7A 5MLCV 5C42B 2IRYA 1QTMA 2HS4A 2N4CA 2QO3A 2HNDA 1S1UB 2ATCB 4QJVA 4EO6A 1N36J 2AYEA 5A8RA 3V4IA 4DL2A 1S12A 3I9ZA 4IFVB 1TR0A 4MIAA 2CJQA 1RAOA 3DRPB 1VMBA 1SC3B 2MKYA 1RGVA 5KFWA 4ER8A 4O4RA 3BKTA 2M52A 2ZH4A 1FD2A 5LJ5Y 4R5PB 4NWBA 3H0PA 1WELA 1AZSB 5HMZA 1CBKA 1ZYQA 2XSJA 1YRUA 4LF4F 3M1VA 4L73A 3KOAA 4KIAA 2L08A 4LF9F 1U7LA 4ELVA 2DXEA 3UDVA 1NRKA 1VHFA 4ZOSA 2G1HA 1HNZJ 1UFKA 2DNMA 4ID8A 2H54B 4Y34A 3DLLQ 4F7VA 1X60A 2YKPA 1S5ZA 2ZDOA 4EBCA 3TO8A 3N5FA 4TNOA 2J6SA 3BV8A 2CPJA 3M05A 2Z4PA 3AQPA 1M5SA 1QSYA 2EVZA 3OHAA 2AJ4A 4OHVA 5C2GA 4NMXA 2ROPA 4YR2A 1S99A 3PIOQ 2R8HA 1IWGA 2QLXA 2JC1A 5T41A 3HKWA 2GJFA 5L46A 1Q78A 3BZQA 1RT5A 4PG5A 4DF4A 3T1YJ 1JLEB 1IKXA 2YKNA 4DX8H 4A4JA 1GEHA 2EFVA 4RR5A 3W64A 4K4YA 1D8ZA 3SFGA 2VFTA 5FD1A 2UP1A 4CLPA 4XPCA 3M7VA 2RS8A 4E98A 1ZBTA 5EWEA 1RBOB 5AXKA 4DPYA 3D6HB 3SQGB 3PG9A 2ZUAA 1K1SA 2M5YA 1UFLA 3EM1A 4KKOA 3PM9A 1MLAA 1TTHB 4XK8C 2MKJA 3NEKA 3FSYA 2WVCA 3E8OA 3O2IA 4O3NA 2ADCA 3I6PA 3H20A 2OO4A 4NLGA 5HATA 3WBZA 2KU7A 2VZ9A 4PXBA 5D4NA 4OHXA 4UOHA 1RTDA 4LFBF 3X1LB 1XNQF 2XMKA 3CCSS 4X66F 4K4VA 4ZP6A 1O51A 3BN7A 4NI2B 1RAJA 4WXWA 4FP9A 5FDLA 4H4KC 1FT8A 2LU1A 4OI1A 4PPDA 5D4PA 3UPFA 4OLOA 1JKHA 2ASDA 1NJYA 2MPUA 1JNRB 2DKOB 4W90B 3ZZUA 5CABA 3OL6A 3GG1A 4K4WA 4Q0BA 4P75A 2QN6B 3QT5A 2RU3A 1R6YA 5MAOA 2PMHA 3HVRA 3OTEA 2YH0A 5E3RA 1QAYA 3O6QA 3HSJA 3MM8B 4TKTA 1Y5NB 4Y2CA 4C98A 2HFOA 2J9DE 1QVGR 4J9UE 1K0VA 4BHQA 4P6QA 2CPDA 2XMAA 5BYSA 4NLWA 4IFYA 1UKUA 1VLYA 3GQCA 1LWEB 3TZZA 2OHDA 1BHNA 3EMTA 1H38A 1Q79A 2VQFJ 3UCZP 2W9CB 4NCBA 1SKRA 3DXBA 4YY3J 2YBVA 3QGIA 1RT1B 2VICA 3HF5A 3LWLA 3SCJE 4O3RA 4DL6A 4CT9A 4DUZF 4K0KF 2NXEA 1RLCL 2CQ2A 2XI3A 1WEXA 5I3PA 3MI7X 4YN3B 4WWSA 1U0HA 2QV6A 2RJZA 5BR8F 3OR1B 2HK3A 4OI0A 1N5SA 2V69A 4LBPA 3VALA 1SV5B 1RT3A 3QLHA 1NEEA 3Q22A 3OL8A 4OYAA 1L3UA 5JVGQ 3CULA 1BXNA 4ZIVA 1M5KC 2KG0A 3DI6B 2QL9B 1J5OB 3N0VA 1IM6A 4NYPA 3NGKA 4K8RA 3JSMB 2LA6A 3ZC4A 2GNKA 5BJRA 3QMQA 5KG5A 1WEZA 1GQEA 5J2MB 4YB1P 1NDPA 1NM2A 2AZ3A 3D6TB 5G0RB 2MGZA 2NUUG 1JB0C 4JI4J 2DBBA 5IM0A 1EKSA 3M2VB 3JB9k 1Q1KA 2YVSA 5KFLA 1RT2A 8RUCA 1FXRA 2ZEJA 5J2NB 3SSSA 3HD2A 1WDTA 1KTQA 2XGQA 3E3XA 1ZZNA 2WW8A 1FHTA 1SQGA 3MAHA 1CJKB 2C2NA 4NRTA 1FTRA 3RAQA 2CA9A 1VHIA 2LECA 5ETSA 2E9ZA 2LQ5A 1NK7A 4ZVQB 4X4TA 3ETOA 4DV2F 3R5BA 1YBTA 4DR1J 1GH8A 2DGOA 4WU2A 3H2LA 4WTOB 3NGUA 4DZ6A 4OL8A 3DMJA 4WFNQ 5LL6d 5HMYA 1XMOF 4RWWA 2RS2A 2E1PA 2GJ2A 4B3OA 2XI2A 2LDIA 1ZA2B 3DOLA 4FS1A 3C3LA 5ETKA 2HHXA 3ENAA 3UW1A 2YX1A 3U1NA 4I2PB 2AP6A 2EI5A 3NOGA 4ANEA 3CJ2A 3PACA 3PEHA 1QSSA 3ICLA 3AJ1A 2FY8A 4CI0B 2FY1A 1WTBA 2FVSA 3F56A 3ITHB 3MMAB 1R8HA 2V4JB 2BJEA 1U8WA 3OV7A 3QGGA 1KP6A 1SBRA 4RNMA 2HMIA 3MR3A 4MFBA 2V8GA 5F8JA 3LAMA 2O5DA 3AD8C 4DR2J 1FESA 4ED4A 4DX7A 3KHGA 2NR0A 3IWXA 2MXYA 4LSNB 4WE1A 2K1RB 2CQ0A 1GMWA 4ZPTR 2ACYA 3CCES 4DLGA 4PWUA 2F1FA 1RAHB 4S0MA 1VS3A 3FCWA 1JLAB 2AEFA 2N3OA 1HIYA 1S1VA 2OSQA 3M9NB 4Q45A 2JC0A 1VRUA 2D9OA 3SV3A 5A8KB 4JBCA 3CJQA 3D54A 2H4YB 2VDHA 3OL7A 1WKJA 1SL0A 2YPZA 3I5AA 1FVQA 2IVFB 2PGCA 3T5HA 2Q79A 2MZ1A 1VQ4S 1RABB 3UD5A 2BJ8A 3BEGB 4PABA 1BQMB 1DHMA 3A3NB 4OI6A 1RAEB 4JUZA 2AF6A 2FLPA 1R31A 2V34A 1KOOA 2LXUA 2M7SA 1S10A 4G1QB 3P45B 2YNFA 4X62J 1CJUB 3KLVA 4LRAA 2MKIA 2F3JA 2PEBA 1N0VC 4XDDA 3FMBA 1IR0A 5JVHQ 2QYGA 4MT1A 2CZ9A 5ETOA 5A8WA 4IO1A 4DV3J 4WP8A 1PILA 1NXIA 1UZHA 3V6DA 3R1LA 3AFGA 3HDSA 4B3MJ 3TUJC 2FPHX 2BUNA 4TU7A 3PCOB 2VC0A 2MDAA 1KLMA 3UNYA 1R8CA 5E3CA 4TQRA 3QPIA 1WUUA 4OZ1A 1H3DA 2WOMB 3KXDA 2C3YA 2D74B 4M1KA 2L3MA 4ZS6A 3MMBA 2XLKA 1YBUA 2G13A 1RKJA 1BC6A 2VIHA 3IG1A 1VQ8S 2I0XA 4F26A 1YJNS 1S9FA 3D1QA 1DBDA 3M9OB 2GAHC 1HR0J 5DM7Q 1Q7YT 5D0EA 4H4OA 3RBEA 1TL4A 1X4EA 1MG7A 3BN4A 4RNHA 5GAHU 1AA1B 5LMNJ 4DV4J 4RX6A 4OJ3A 2E5LJ 1T9TA 3RB4A 6FD1A 1I51B 3PYGA 3FQKA 5D3GB 3KMQA 4IDKA 2RMLA 3UE2A 5ETMA 2X1AA 4IYQA 3LUYA 2R4FA 3C6TB 4M5DB 2FC9A 2A0FB 1KRPA 4CO3A 4O44B 3ZZYA 1KQFB 2ZNYA 2P6SA 2HS3A 1Q81T 1DJ0A 1SUQB 4LFCF 2GZOA 1G3OA 3R5GA 3D1HA 2R42A 3U1MA 4UUXA 3DNCA 3H4DA 3MCOA 2BJ1A 4NE9C 4ZVHA 4CTAA 2H9ZA 2VG5A 3P8BB 3J7YU 4M95A 1M5VC 2JHEA 1JNZB 1WSRA 4AYBD 1UPMB 2DPJA 5T7LA 3CGIA 2B56A 3CJ0A 5ETVA 4DJBA 3ZZPA 3AA9A 2UXDJ 1DTQB 5K8OA 3AT1B 3QIPA 3CW2C 2M2BA 2OSRA 5DG7A 1RKIA 3U27A 4YUDA 1HNIB 2JSXA 4X4QA 3CJ8A 3DM2A 3OFGA 1LW2A 3E51A 5HBMA 4DG1B 2A18A 2QMXA 2IYIA 4DQIA 3MUMP 3MM7A 4K4UA 2W01A 4AXJA 1ZAWA 2KHCA 3NOCA 5JXSA 2VJVA 1O6XA 3BSAA 2FLOA 3POTB 1YJVA 2O3DA 1EJ7L 3G6VA 3MOJB 2F8MA 4TU8A 1HI0P 1EETB 1A6LA 3MF5A 4F0MA 4WFXA 1O5JA 1F5CA 2DHHA 4DN0A 4KV8A 5HJYA 1ZM2A 4QBUA 4YEAA 4KH1B 3TANA 1C1CA 4KQZA 4JI6F 1FO1A 1YDLA 3BGOP 4LSLA 3LP0A 5D0GA 3V5RA 1FRHA 1T9VA 3MMCB 4NZ7A 1F1BB 5AXMA 4IR1A 4HHHA 1VBKA 3OUYB 4USWA 5KT6A 2KFNA 4E2FB 3PFEA 3TYTA 2W9BA 1VIOA 3CF5Q 1N88A 1LXJA 3VAHA 1UEUA 4JYAJ 2H5IB 5HP1B 1VQ9S 2L9NA 2H48B 3MGJA 5LT5A 3MD1A 1AROP 2IAJA 1WHYA 4ITSA 3QRPA 4HEA9 1BQXA 3GFXA 2AJQA 5KTQA 2R7VA 3K5MA 5C2CA 2WVDA 1HWKA 1XNRJ 1FNMA 3WIVA 2HQIA 1RU1A 1U4BA 2JH3A 1XBWA 2C3UA 3WDOA 2XCPA 2L9DA 3OR2A 4X64J 2KN4A 2G1DA 3D67A 5HMXA 2HHVA 5IT4A 1FE4A 3PW4A 2WVEA 1PKUA 2J0WA 4K2XA 4ED7A 4ATNA 3A4TA 2OMLA 4Y28C 4B9SA 3FVYA 1HLWA 1K44A 3JAMY 2DR6A 2YKMB 4WYLA 2LKZA 2C2ZB 5KOWA 2J9DA 3BSOA 3D3CJ 2GO8A 1TKXA 4KAIA 1HNZF 4KBIA 3SSQA 2OTJS 1X4FA 2AGQA 1ZPVA 1OPZA 3GONA 1RB0A 3HHEA 3UQSA 1TL1A 3THVA 2CNLB 4F25A 5IS2A 1NMEB 1UA0A 3DN9A 1HBMB 3KDNA 5G4DA 3FEZA 1PC5A 2APOA 5HQLA 3MHYA 3CJ3A 1FXLA 2HNZA 4J37A 4ECTA 1RISA 1WOPA 2Y1LB 3KUHA 1XC9A 2FHKA 1Z2ZA 1OSCA 4YB6A 3AB2B 3FRYA 2DRBA 4DLEA 1HWIA 2ATLA 1S0OA 3A1YG 3H2UB 4C0BA 5FIIA 1R27B 4HI2A 1U2RA 1G1XA 1N5TA 4J9LA 1PG5B 1RTZA 3W66A 1Q8LA 1NHKL 2UUCJ 2CNNB 3DHXA 2B8PA 4HI1A 4QWDA 4Q43A 2WB4A 4CQ1A 2CADA 1R0AA 2XM3A 1HBNB 1U26A 2KXFA 2VPXB 2CDQA 3K5OA 2GA7A 2AWZA 3A8JA 1D9FA 3DFEA 3SSRA 4LQ9A 5H1SV 4RUAA 3RW6A 2DR5A 1J2VA 2ZITA 5HROB 5CXTA 1ZS6A 1NDLA 1FI4A 3CDUA 2M8HA 2GO9A 2Z2MA 1JLBB 3HJFA 2AW0A 1XR7A 1QAXA 4CO4A 1QE1A 3FNNA 5IC6B 3GSDA 2W7PA 1BD6A 1D3WA 4YR3A 4RBVA 5D0RA 3KJVA 4NL5A 1KHWA 4A8SA 4QPTA 4UTGA 3AXKA 2BZ2A 4ANDA 4ZVFA 2RIJA 3DLGA 1WHVA 4N77A 4JI0J 1NPPA 3IBWA 3PX0A 3LF0A 1YI2S 2LLZA 3W5XA 2ZM6J 5CZVA 1UAWA 4RUBA 4HL9A 1IWAA 3HT0A 4X84A 1QUPA 4IO9Q 2E5GA 2MQQA 2O66A 2PA3A 1S6QB 5F41A 1UEVA 3DRYA 4DSIA 3UN3A 3MECA 4F0KA 3DDIA 5ITHA 1W26A 5HP1A 2QIFA 1Y9OA 3CCMS 2R7TA 3IWLA 3UDCA 3D0HE 1BLUA 2NS1B 2BJ3A 1B7FA 1NB2A 2N7CA 2H3EB 4Q8FA 4LRDA 2HFSA 1GFWB 4HH0A 2FJVA 3QZ7A 3K57A 4O3OA 4FYDA 3EXYA 2RVJA 3AOAA 2V0NA 1TP7A 3P5TL 5HVHA 4ZPCA 4JOUA 2VQFF 1HWJA 1IBCB 3P96A 3CJSA 2RNEA 3H90A 5HO4A 5KG2A 1VI7A 2GHPA 4FYVB 4U7UK 1DTTB 2GAGC 3KK2A 2QE5A 1CJTA 1YIJS 1I6JA 1LOUA 2FHJA 3U7JA 2LQBA 3HO1A 4DV0F 3QFWA 2QRRA 1ZPWX 4Q8EA 4C9DA 3I4PA 1XQIA 2XSFA 3SCIE 2JLFA 1H6KX 2DNHA 4U8VA 2X7IA 1S59A 2F8HA 2XWXA 3HFKA 1X0FA 2IVMA 2OJ3A 2HNYA 1U1MA 2D9PA 2HWTA 1N56A 2LXIA 3KLHA 1H74A 3BGFA 3T1AA 4V1Ak 3NS7B 1VBYA 1Q82T 1M5PC 1J5EJ 1RWUA 4A47A 1N5QA 3HXMA 5KT2A 4K50A 5KFRA 3A3OB 1T03A 5AE2A 2YWKA 2MZJA 2B5JB 4OHWA 2L48A 3UD4P 4WU3A 2QMWA 1NKEA 1ZM3A 2J7KA 1YX2A 4JI4F 2A6MA 3N5BA 3TAMB 4KGVB 4LFAJ 1SKUB 4QCLA 2HHWA 5ETTA 3EXCX 4Y0FA 4DR7J 1UA1A 3DU5A 2HIQA 2V68A 2G4BA 4DOZA 1SPBP 4PYDA 1REGX 1SB6A 2RDJA 3IR6B 2OPPB 5CYQA 5L1JA 3F41A 2RHSB 2BW2A 1U1KA 1Y10A 7AT1B 4TXSA 3UCGA 4DR1F 1DRZA 2OPRB 1E6YA 1X5PA 3EZ5A 1HPZB 3T41A 3CB4A 3KWMA 1SL1A 2MKHA 2BBEA 5BYQA 3NBPB 2RE1A 4IRKA 2LDYA 4KHMA 3TVZA 4ED3A 4L74A 4W4MA 2CRLA 3HT3A 4LIWA 3JTPA 2OIHA 1S9GA 1I3OB 1DQ8A 3TQ1A 2YWHA 2UVWA 1FKPA 1JK9B 4ED8A 1XK8A 5CH7B 1MROA 2HHSA 2HRTA 2IC3B 2EKYA 1U2FA 2RRNA 1UJ4A 1U47A 4JV0A 2XMUA 3GJRB 5KFIA 4LF6F 3MEDA 2K06A 2XO6A 3VV2B 3GYNA 1SJFA 2V8PA 5EX0A 1WC6A 4YHHF 5K14B 1RADB 3NCRA 2H5EA 1KS2A 4DSEA 3TJAA 3HHDA 3TW0A 3T9NA 2COLA 2DISA 2LCWA 1T3OA 4DUYF 1GX6A 4C2MA 2YWWA 5HLFB 4MYTA 2KXNB 3TA0A 4I68A 3RRHA 4O3QA 3AD7C 2OPSA 1RYRA 1L5UA 3QRQA 1S6QA 1EB0A 1P6TA 2Z30B 4USUA 3QJLA 4KGXB 4NX9A 3TVYA 4ZCLA 3TR5A 3ISND 3W1YC 5IT0A 1S6UA 3PV8A 4B9TA 3U02A 3B82A 3MM6B 2CYYA 1HWUA 5L9XA 2LEPA 2AD9A 3AH6A 4C97A 1CPZA 3ILLA 1CVJA 2JL9A 3EGVA 1XN9A 5KG1A 3C16B 1SIZA 3WX8A 3VVUA 3MTJA 5IT9U 2XYHB 1X5SA 3EGNA 2ZVIA 3E01B 1WNEA 1JJ2R 2DK2A 1FJCA 2VA3A 1UWAA 1U09A 2VG6A 2GGPA 5CAAA 2OEMA 5E3PA 4KGKA 1UVJA 4HVZA 3CDBA 1XMBA 1E6VA 5J2PB 2I9SA 4WJBA 3IAS9 1GXUA 1MU2B 4K4ZA 4U96A 2XY6A 3KLEB 4ZMMA 2WVBA 3KYLA 4HTJA 1D1UA 2C3MA 1G6BA 4B3MF 1U48A 1U8SA 3UVJB 3Q23A 3AJDA 3B78A 5LMUJ 3OHBA 5F0UA 4RU2A 5I4MA 2OPQA 1UETA 2N3LA 4DWIA 1RYSA 2WHOA 3UCUP 1I94J 4QIEA 2MSTA 3AAWB 4BS2A 4I56A 3CDWA 4LF8J 2FZGB 2WBMA 4WIQA 1WI8A 2OKQA 2X1FA 5LSRA 3FGVA 1HQEB 3AHPA 2QFJA 3HHNB 3QGPA 4DSFA 2JZ5A 1JLFA 2KVQE 1HNVA 3BB5A 4DL5A 3C8YA 3PEJA 1S97A 2B8QA 1TU0B 4NXNF 4UUWA 5GAGI 5K8PA 3LPEA 5LMNF 1BQNB 3DLEB 2ZKUA 1S1TA 3H4BA 5F8IA 2X3GA 2FGOA 3MCNA 2HGNA 3T1HF 3HLUA 5DGAA 2AYBA 1ROFA 5IWAJ 3I82A 5CA5A 2MQNA 1HNWF 5F0WA 5F8MA 2ZUGA 4O0NA 2J8AA 3BGLA 2AIRB 1F2GA 2HGMA 1K47A 3JSYA 1JXEA 3G87A 4DBQA 4B3TJ 1QLNA 1G4CA 4TLRA 1C4CA 1NK5A 2HHUA 5HMWA 3KLIA 2VQEJ 4C8OA 5L8RC 1N6QB 2O67A 2GC8A 2FJAB 4USKA 3ILIA 3PX6A 1DLOA 2JEFA 4N8OA 3TZYA 5SUHA 1NDCA 2CVIA 1H72C 3HI9A 2BANA 4F3QA 4NLQA 2QL7B 1S4FA 1UZDA 4DL4A 3GV5B 5A0YA 4I64A 4GC7A 4RBTA 4JI2F 3V81B 3AD9C 3TUIC 4ZHRB 1LK7A 2YNHA 2PD1A 1MMNA 1VRQC 2GHWA 2UV8A 5K14A 4G65A 1Q16B 3TP2A 2PEHA 2NSBA 4O3PA 1ZM4A 1FNOA 4OX8A 2E5IA 1BY9A 4IOAQ 3JYTA 2QYCA 1OPIA 2LU2A 4YR0A 4RNFA 5I42A 2WCXA 1X4AA 3RB6A 3GYXB 4O3SA 5EX3A 2V67A 3TAQA 2DGSA 4M5JA 2WSFC 4PG6A 4CO2A 2W2NP 4I7FB 3LPYA 1RTHA 1RWOB 1VC6A 2R7QA 3LOUA 1CS4A 1S6PA 2E5HA 1TKTA 2VH7A 3Q83A 4D3GA 1FKAF 1VK8A 4C11B 1VRTB 3GYGA 4KYZA 3O3LA 3CCUS 4RL1A 2HAFA 2A10A 1B64A 2HIYA 4DV1J 3KK1A 1JLGB 2ZH5A 1ZH5A 1HMVB 2RQ4A 2IHR1 2R2TA 2DR8A 2KKHA 4MK8A 4ICLB 4CH1A 4OLPA 2R7OA 2QSFA 1ZA1B 1VIXA 1RT6A 1RTIA 1T9UA 1EP4B 4JI5J 5DRKA 4KFBB 1S9EA 3KHLA 1GNKA 1DFDA 3R5AA 3MURP 2AJ2A 1F2HA 1MSWD 1GT8A 1CEZA 3QGHA 4XIUA 4DR6J 2VFVA 3OXLA 1FRMA 5LXRA 4JYAF 4OYXA 1QDUB 1RWPB 5J2PA 1FXDA 3NRBA 2VV5A 1IBMJ 1NU4A 4CLWA 1S4EA 3US5A 2NLWA 4EZ9A 4F4KA 4KO0B 2DGQA 3M8PA 4MAKA 2BMBA 1F6TA 3BBBA 1S7IA 4Z7YA 3KLGA 4AFFA 2PE8A 4HT5A 1KKHA 4RUCA 4NPOA 2ZC3A 5HANA 4DQRA 4P7VA 3PY8A 1FDDA 4X64F 4PYAA 3IN5A 3KNGA 2CQHA 3DRSA 4FDFA 3OFFA 4KSEB 2HFZA 2AX0A 4B17A 3HSZA 1RT4B 5DJBA 4OHZA 1REVB 3AB4B 2KTQA 3A8EA 1X9SA 2W8LA 1TKDA 4P71A 3H25A 2HHHJ 3NCPA 3VR1A 2BVZA 4P2SA 3QRRA 1XJWB 3M32B 2ZE2A 2XS5A 2DR9A 9RUBA 2RB7A 3AOCA 3IRWP 2YNIB 1TK0A 3MM9A 3ZFVA 1PSDA 4OYMA 4ALZA 1IN0A 2BEFA 3K17A 3OTOF 3M8QB 2V9WA 1YJWS 2XMMA 1W2IA 2BM1A 5KFVA 4UOCA 1VQOS 3W60A 4JI3F 3PHEA 4PWDB 2Y1RI 1RSCA 4W98A 1KFDA 2V5HG 2NYHA 4DI6A 5KFDA 3PZPA 1UJ6A 4V19J 3HCXA 2XLJA 3LGHA 1PYOB 1VQPS 4K4TA 1RWNB 3KUEA 4PQUA 1APSA 1OMSA 3PJWA 3GIIA 4DS5A 3VAKA 1YBAA 4CLSA 2UU9F 2HQCA 1IKYB 1P1LA 4CNZA 2Z8QA 1PBAA 2LFVA 2PDAA 4ECXA 3CMAS 3BR8A 3MEEA 1NJWA 4I69A 2NXNA 3OJSA 2A6OA 2UXCJ 2R7XA 1TFWA 2UUCF 5LSOA 4LF2A 5CYMB 3KLFB 2UUBJ 2QA1A 4NA1A 4Y2AA 3MM5B 3BYRA 2H4WB 3C6UA 3G86A 1Q5YA 3HMJG 3B4DA 4U67Q 4ZVGA 2ZNZA 5IV3A 3N9UC 3FCHA 3IAM9 4WF9Q 4M5MA 1JMTA 2V2KA 1YQHA 3VZHA 3CC4S 1LFPA 4USHA 4RJVA 2ZH1A 5T14A 3FJ2A 4PXDA 3A13A 4G1IA 3C2PA 4OFZA 1V6HA 2O01C 3ZTOA 4OZ0A 4DSLA 4J7CA 1NH7A 2FJDB 3BDEA 1YJ9S 3SXLA 2AJ1A 2ZD1B 1F3FA 3RGIA 1HQ2A 2I5JB 4FF4A 4P2MA 2VFRA 1HYSB 4L6V3 2XQCA 3MUVP 4OJGA 5B0AA 4WBFA 5ETRA 3NS6A 4JI1J 1AYEA 2VONA 1VR6A 1MWYA 2Y9HA 4HDHA 3HSGA 4NYZA 3LAKA 1FKOA 2W25A 1RWXB 3DOMA 5FLXU 4R8UA 3PX4A 5H9EJ 5BYRA 1RCXB 1Y5IB 3IRXB 2K3KA 4NASA 1FA0A 4RW7B 4DMZA 2MSSA 5K8MA 2Z2LA 5E5NA 2HNDB 2O1PA 1IBKJ 1PC4A 1Q53A 5K8NA 1T05A 3HK2A 2M9KA 4HKQA 5A8RB 1R43A 2ASLA 3M30A 1DY3A 2ZBCA 1C1BA 3CIZA 4ID5A 3GR0A 4F50A 4YFUA 3EX7B 2DGTA 4TLQA 2KZZA 2XSJB 5KG4A 2BE7D 4RW8A 1WF1A 3M1VB 1JLQA 4CLTA 4U8YA 5CHCB 4M5IA 1F3VA 3HHLA 1VQLS 5KT3A 4JV2A 3W2WA 4OZ5A 2ZBQA 1VQYA 4BLGA 1SJ4P 4I2QA 2ZJQQ 3GILA 4MK7A 3A12A 5F9NA 1N5YA 1X9MA 3QO9A 2VF3A 3LH2S 4K4XA 4BWJA 3QSIA 3MFHA 4NCGA 4KT0C 4PCQA 1IJFB 4DQQA 3EZUA 2FGCA 3OVAA 3MTKA 4ELTA 1NPKA 4ZIWA 1FRXA 2RAQA 3IWNC 2NXUA 5IOLA 3BO4A 3W8GA 1J5EF 1LKZA 1RT5B 2MTLA 2MZRA 4OYPA 1IKXB 1M1GA 2YKNB 4EK2A 5B0BA 3JTOA 3H42A 3N6LA 1QAJA 1A9NB 1QM9A 2GFFA 1U25A 3PTWA 4PG8A 1SJQA 3IMQJ 3AA8A 4LFAF 3W3SA 4C0OC 3I0RA 4JB8B 1Q5VA 2EFPA 1U0SA 2AKWB 2GMLA 2FJWA 2DHGA 1S1WA 1RDRA 5GADI 3SV4A 5D15A 4KKOB 5HQ8A 4LRFA 5H9FJ 4IOCQ 4DQSA 4U6PA 3ULHA 1V3SA 2GS8A 5CD4A 5B08A 4USVA 3T9ZA 2B9YA 2GW8A 1RWWB 4NLPA 2MKCA 4PUOA 3MUTP 1NKCA 1RTDB 4DR4J 1ZOTA 4NMLA 1NKBA 1HW9A 3EWGA 3Q8YA 3LO3A 3IFEA 4B02A 5IV4A 1FDBA 4PG4A 3MZIA 2GMHA 2JEGA 5FDLB 4U7UD 4FXVA 5HI7A 2CJYB 3KJQB 2MHNA 2RQCA 1SJRA 1FJGJ 1X4BA 3G6YA 1JKHB 1WDDA 3MOZA 1FVSA 4I4BA 1UVNA 4X4UA 3UD3P 1P9QC 1RP5A 2XYGB 1T9WA 4Q0BB 5DETA 4DPUA 2P9GA 2WB1D 4N5SA 1RAFB 1FEHA 4X65J 5DQHA 5GAEU 3CJKA 1VQ6S 4Y2MA 2BE2A 2BQRA 4B3SF 3V4MA 1IQTA 4MIBA 4JI7F 4OZNA 2DHAA 2WONA 2B4OA 2OEJA 3EUNA 3GFYA 1JJ4A 3OXFA 1M5OC 2DH8A 3WC2A 3RU0A 1RTJA 4QZVB 1Y4ZB 3R2DJ 4JI8J 2MZSA 4IFYB 2NSCA 2XB2D 1PIEA 2JRSA 1LWFA 1CC8A 5KT5A 4ZPWR 1TL3A 1K0TA 3IRXA 4NLXA 2KM8C 4F2SA 2FHOB 3K0JA 5I3QA 2RF2A 1XIQA 3O1LA 3GPAA 3PW5A 3J7Z5 4IRCA 4NLVA 3H40A 2CVEA 1YKWA 4BCAA 4RW4B 5KFSA 5DS7A 3PRVA 4KHPJ 2EG2A 1U0HB 3ZZRA 3VVTA 3CD6S 3BS9A 2ASYA 3M2UA 5C7PA 1RT3B 3BYPA 3QLHB 3KJFB 5KG6A 2DXDA 2HGLA 4ANCA 1EHWA 5L1IA 4AXIA 2CPEA 2MZTA 4DR3F 1WI6A 1N0UA 4LF9J 1GK8A 2DGWA 2UVRA 4P2FA 2MHEA 2NZ4A 2BE9B 4L3KA 3IM9A 1U02A 2MGZB 3EGWB 5EN1A 2GJIA 4DL7A 5IM0B 2FLLA 2YQ3A 2A2DA 2CQ1A 1SIWB 1RT2B 2NPFA 3UDLA 2F4FA 3IA0A 2ALZA 4RW9A 2FJXA 3GR1A 1Q86T 2HPUA 2MZQA 4QIVA 4LF7J 5AXLA 2Q1LA 2DY9A 2C2EA 3C66A 5K5MA 5LMUF 4DDFA 2V8HA 4Y3CA 2V2VA 3HZEA 2QX0A 1VBZA 1X5OA 2RKIA 2FVCA 1D8YA 2ZKTA 1I94F 1WC4A 2F7VA 2IA0A 5A2QU 2W8KA 2GX8A 4U9RA 1TUVA 3J80Y 4B3RJ 3CCTA 3DMJB 4WFAQ 2PI4A 2XHWA 3MEGA 3AQOA 2AV5A 2I6WA 1Q8BA 3PO5A 2RH3A 1UCNA 1TUGB 1WEYA 5K9FA 2KFZA 3K5LA 4B3OB 1WG4A 4QIFA 4FVCA 1WG5A 2WRMA 4J9QA 3DOLB 4DL0C 3TX0A 5C25A 2MB0B 4WCEQ 3W5ZA 1TL7A 5D77A 1QAIA 5GMDA 4LQ3A 2KVIA 5J1EA 3L95X 1CJVA 1V3ZA 5IWAF 2BKNA 2B4UA 3RTVA 2DNKA 3M6XA 3K58A 3W61A 2I1RA 1FJ7A 3MAAA 1RHMB 5KFHA 2UUWA 1FX4A 1TVRA 3I0SA 2W9AA 5KFBA 4F8RA 3CO9A 2RSQA 1G2EA 4LFBJ 2KH9A 2QA2A 2VB6A 2CPIA 4V19X 3RR8A 2HMIB 4WKYA 4QPXA 4MFBB 3EZOA 1TMMA 4UT4A 3OFEA 2VQEF 1CSJA 1FF2A 3OJUA 4Y6IA 2HWIA 3QQCD 2ZH9A 4F4AA 4WE1B 4C8NA 1ZTWA 2VASA 4AL6A 1JWWA 3W2VA 2SXLA 1GX5A 1TMJA 3BKUA 2J5AA 3DGPA 4USJC 4RWXA 3E2EA 1S1VB 1OYDA 3VGVA 2VODA 1B3TA 3VTIA 2F4VJ 1VRUB 5GMKa 2QT7A 1MWZA 3EDQB 2DTJA 5ETQA 3NLCA 2OTLS 4DQPA 4PXCA 4GVBA 2KL8A 2VJUA 4ILLA 2WBRA 5DGBA 2JEIA 2IJRA 4EBDA 4DR5J 3ZXWA 4J9RA 4ECZA 1RJJA 5D4LA 4OZLA 4C48A 4X4VA 2VL1A 4DCJB 3IC1A 1VFJA 1YITS 3CCJS 4KGMA 4OIXA 2EBEA 2NXJA 3G6ES 5KFGA 5KFNA 1QUVA 1U49A 3H98A 2HEKA 1RHKB 1P9YA 2YNFB 4RBUA 1S49A 2XZDB 3R27A 4Q44A 1VQNS 3J7AN 2WW4A 4RW4A 2RUSA 5EGYA 1GMWD 4DFKA 4DV1F 4DUZJ 3KG1A 2YKQA 2IJFA 2Q6CA 5A8WB 3SIPB 4KY3A 5BR8J 1TK5A 1JXVA 1UFWA 5KFOA 3HFZB 3V6DB 3P49B 1HBUA 2VPWB 4MH8A 1C4AA 4JI5F 5E2QA 4QW8A 2F8EX 1NZ8A 3Q2TC 5KFTA 1WC5A 1X0PA 3QAUA 5I3UA 3AXMA 3GFHA 4C7QA 1EQ0A 2X1BA 2MQPA 4ZVOB 3JS9A 4JV5F 1SXLA 2JVRA 2IM3A 3K2YA 1KLMB 1R89A 1P8GA 5KAKA 4FVMA 4CIOA 3CO0P 5E0OA 1SC6A 1H98A 4P72A 1IBMF 5DG8A 2GMJA 3MMBB 1S7HA 3CC2S 4DPWA 3T19A 2POKA 2ZHBA 3IG1B 4FXDA 3FC9A 5U47A 1M1HA 3N79A 1S77D 3A3PB 3FEYB 1Q8KA 1U1QA 1VBXA 4H4OB 1G7CB 2C28A 1Z4UA 3BH7B 2KXHA 1IR2A 4O23A 4A8WA 4G3IA 3L09A 3QNWB 3WX4A 4F4YA 3Q24A 2WAQD 2MLZA 4M5LA 5HVFA 2XGPA 4IDKB 1AUSL 2A2CA 4P10A 4JP8A 5C5JA 4FYWB 3AODA 5HK4A 4DV2J 4TYAA 2CDRB 4K5SA 3MMJA 2GQCA 1AB8A 2Z56B 3FCVA 3PJ9A 3OXGA 1XMQJ 4X2BA 2FJEB 2IDEA 4F4XA 4Q5VA 4PKDB 3A8IA 1FWPA 3G82A 1D09B 4CTAB 1CC7A 1FRIA 4DPTA 2VG5B 2ZC4A 2AJ0A 4CDIA 1N48A 3QJPA 3DRRA 4PZVA 2RDDA 4D3HA 5AXNA 5EUHA 5T7LB 1SL2A 2N4DA 4ZJQA 3HJVA 2DB1A 1X8DA 1I1GA 3QIPB 3R7BB 5JUMA 3CEDA 1XEZA 1YZ6A 4XAKA 2C2DA 2QFIA 4RW6A 4JV1A 1NH8A 3DM2B 1WG1A 2CAJA 4KH0B 1LW2B 3ZTQA 5HBMB 2CFXA 2YXLA 3WHIA 2GVDA 2C42A 4GO7X 4B08A 3PYEA 3GIMA 3FBBA 2PI5A 2W2OP 4OZ3A 1X4HA 2YNGA 2DVIA 4WZQA 5DLGA 5L39A 1A7GE 3MM7B 2X1GA 3IS9A 1HQUA 2H51B 3CJRA 1WKKA 2DNGA 3BQ1A 1MN7A 2BW7A 2CIMA 4ZCIA 5GMEA 2V9KA 3NGTA 3D2WA 3MPUB 4OYZA 3S01A 2E44A 2F40A 2UXCF 1U2CA 1CQNA 3T5JA 2HURA 3DLKA 4OV6A 2DO4A 5KFUA 2RUGA 2VUGA 1RZMA 2DEIA 4KV8B 2JJ4D 2BM0A 3M8SA 2ZFHA 1C1CB 4DHVA 4I6YA 2J8SA 2YWFA 4LSLB 3LP0B 4KR0B 4EU0A 2GHVC 2OD6A 1OO0B 1H7XA 2UUAJ 2XG8A 2ZBRA 4N47A 3O8WA 2W7AA 4K59A 3ZNUA 4DV5F 4P73A 5CQGA 4FF3A 2KT2A 2BDPA 4ZK7M 1P1TA 2KJWA 3BR9A 3PIPQ 2W9BB 1N33J 1CULA 1FJEB 1WC0A 2BJ7A 2M0GB 3NGSA 3ZZZA 4F4WA 1HARA 1R6VA 4NXMF 2IAJB 1MWQA 3HP6A 2W1BA 4OI2A 2D41A 5C24A 2CQ3A 3D4JA 4HTIA 1O0PA 3EVOA 3BGUA 3ZTSA 5L1LA 3I87A 1HBOA 3G6XA 4HT7A 1R0BG 2XYPB 1T0TV 5J2QA 2R2SA 4CLYA 1T3NA 3FMWA 2BOPA 4OYWA 2MY7A 3VWSA 2JWNA 3OR2B 3CJ4A 1IBKF 2DNPA 4NA2A 1FWLA 4PXEA 2CJKA 2HVEA 4O4GA 2VD3A 1VK3A 2IMWP 2QTWA 2E9RX 3C14B 2R2RA 4Y00A 1FD8A 1RXOB 1WJ9A 3LA0A 1LWCA 3ELHA 3N4WA 2U2FA 3L3CA 1UP1A 1VGYA 2RD5C 2BR0A 2AMCB 4YP3A 2IPOB 1HNXF 2HFNA 3L9ZA 1VISA 2ZZTA 1ITPA 2ZOFA 4R0EA 1TKXB 2HVDA 3PJXA 2K8GA 4ED0A 2OI2A 3SMZA 4GO5X 4ERDA 5JMNA 1U45A 3BQ2A 3OLAA 2VBYA 3W9IA 3NMRA 4ECVA 3S6EA 3EVMA 1TL1B 1F9FA 4LFCJ 3NNHA 1YGYA 1R7IA 3KDOA 1K8AT 3TWZA 2KRBA 3SFUA 3DXSX 2F5GA 3MEKA 3RUBL 4MJKA 2HNZB 2YPYA 2VBXA 3DOKA 1QSLA 4DU7A 1RWVB 2DGUA 2GIFA 1IM4A 1TAQA 1WOSA 4IRDA 4CNYA 3NNAA 2IM2A 1RT7A 2HK2A 8AT1B 4I1TA 3RYLA 2C2KB 2HLUA 3C19A 2XHCA 2CPZA 3MPDA 1R8PA 1N32F 1BWEA 2EWHA 5EDWA 1VQKS 2ACMA 2FC8A 4QYRA 4GRSA 4ZN3A 3KK3A 3FZBA 1IKVA 1SCJB 2KB2A 3AJ2A 5E3QA 2BACA 1TKZA 2G0IA 5KT4A 1R0AB 1DZ5A 4QYZJ 2PO4A 3FBFA 2FVPA 2F63A 4Q7AA 2QEXS 1ZZFA 1HHSA 2IJNA 2KO1A 2P6TA 3GFZA 4IH7A 3RBXA 4CO1A 1JLCA 3BF4A 1QE1B 5KG7A 2E5JA 4HYKA 5B0GA 4DR4F 3LW5C 2HSEB 3KJVB 1C0TA 4HACA 4IG0A 4F04B 2DYAA 5CCLA 3NS5A 3MD3A 3DLGB 3ISZA 2VBWA 4DXLA 1WHWA 5KFEA 2K2PA 3CE8A 3J81U 4IG3A 4J9MA 4CRJA 2Y1JA 2DIVA 1S0VA 3L7PA 2G2YA 1W2BR 4EGLA 3SI8A 5DM6Q 2HKEA 3FUYA 2F9DA 5A2QY 3CJ5A 2EW9A 3J7A1 4AQYJ 3G71S 3ZZOA 1TQLA 5HL7Q 4MKYA 4X65F 5K20B 5HN0A 3RRGA 4OYIA 4MMOA 1BGXT 3MECB 3QT6A 2PMWA 1D9AA 3P3DA 4WK3A 3DGVA 4TQSA 3V6HA 3Q0AA 2PA8D 4ES3A 1LW0B 4YOEA 1FX2A 3VF0B 2LQ9A 2OEKA 3TJ9A 3OTBA 3NMAA 4ECWA 4URQU 1NJXA 2ZDPA 3CC7S 3OSPA 1T7PA 2Z2ZA 4CCHA 2B4PA 3UN2A 3RZAA 2XULA 4A46A 4P9SA 2UV8G 4ECRA 3R6LB 3R3TA 4CYUA 4B9MA 3OTCA 3OT9A 4ES2A 2DNOA 1SI9A 2AGOA 4KPYA 2L41A 5L9NA 2LEBA 5CYJA 4X4NA 4N7TA 3KK2B 1CJTB 1ZETA 3GB0A 1V9OA 2BQ3A 1N36F 4ZP9A 2GCFA 2F9JA 4HR2A 1OSDA 2XS7A 2ROGA 2A3JA 2HBYB 4FNIA 3C14A 5KFCA 2EFQA 4KHPF 4NLDA 3CD7A 3D6FB 2DITA 1UL3A 3MCSA 1FRJA 2GIQA 2EC0A 2LQJA 1UEKA 4FF1A 3NAHA 1IKWA 2HNYB 1RI7A 3KLHB 4IKAA 4CLKA 2UZAA 4MK9A 2D3OR 3TA2A 3HM9A 1FE0A 3CD5A 5KFXA 4WFYA 1VC5A 1T03B 3SDEA 1PBUA 3SCLE 4ZVSB 3K59A 1ZTTA 3CDAA 3IO1A 3PYFA 3VAMA 2D1CA 1YJ7A 2ZZNA 3PVXA 1Y5LB 1LK5A 2B3TB 1OY6A 3VGUA 2W2QP 3PFOA 4F3MA 1PAUB 3ZZTA 1KSPA 4KTQA 3QATA 4LF7F 2FHJD 2YWEA 4YMEA 2EK6A 2KJVA 3S7RA 1TV6A 2JEJA 4H54A 5CYQB 3T1YF 3K7RA 3PRDA 4QR0A 3R1HA 2GVZA 4OYOA 1H73A 1YJRA 4QQBA 3K5PA 1E6YB 2XCAA 1IBLJ 3D0IE 1LNQA 5GAHI 2HBRB 4B3RF 3BSCA 1KONA 4PAAA 1AFIA 3CMES 2AX1A 1KVJA 3CCLS 5M2PA 3MR2A 5CCMA 4ZLLA 4TU9A 4ZLNA 1UWBA 1S9GB 1WHXA 1FK9A 1FKPB 3WIUA 1B99A 3ZNJ1 1MROB 3ADAC 2GV1A 5DDOC 3LP1A 2UXBJ 3BGRB 1NUEA 2H1YA 2M70A 3MEDB 3OTDA 1ZM9A 3J7YI 4G1PA 4WZMA 4KE5A 1WF0A 1C0UA 3K8VA 4HLBA 4EEYA 2AGPA 2B6AA 1T11A 3RW7A 3C15A 4KPCA 1IQZA 3G2XA 4P2XA 4F0HA 2IA6A 4AL5A 1HW8A 3LGNA 2OPSB 3Q8UA 2EBGA 1HI1A 1OJ4A 3LP2A 3RR7A 3M6VA 2IRXA 3S8SA 4H4MA 4J9PA 3BDPA 2QLBB 1V3RA 4RNOA 2U1AA 4CO0A 4G6VB 3M8YA 4OMFG 4WFZA 2XY7A 3DLBA 5HJXA 2V4QA 3UDEA 2IVYA 1FCAA 1J27A 4I67A 3PKYA 2F4VF 2CZ4A 3EICA 2XEXA 1WD6A 1LW0A 3JAMU 3CUNA 2G9OA 3PNIA 1S76D 2DNRA 1LFWA 2DNQA 4NLTA 1WOOA 3HVTA 2Z2YB 3CT9A 2BJDA 1B0TA 3NXZA 2PSZA 1FDNA 4DR5F 5B0EA 5HSPA 4TY9A 4AE5A 1S1XA 1SKWA 2Y3YA 4DZDA 5J1PA 3RRKA 2GQ2A 3EGZA 8ATCB 1QY7A 2Z57B 1WC3A 4YY3F 2CG8A 3M2RA 2VG6B 1M1KT 5C42A 2XMTA 2GGPB 1P27B 4I6WA 3QJJA 4O0IA 1S1UA 4FKXA 1E6VB 1XERA 2DCUB 4K4SA 1RUSA 4DV0J 1X7VA 1ELOA 3T5LA 4RZRA 2BV3A 4DFPA 2HVZA 4IFVA 2V94A 4F36A 3DRPA 2W4DA 3K8WA 3ZZ0A 1WORA 3D0GE 3OPKA 4K7QA 2R3VA 4LF5J 4R5PA 2J6UA 2HZCA 1AZSA 3EYZA 1S6OA 2FHMA 4FBUA 1IJEB 5D4OA 1PGZA 2Q6BA 4DEZA 1N34J 5HVGA 1URNA 2OPQB 4OJ1A 2VA2A 2J7WA 3G4SS 1CQMA 4UY85 2KZMA 3FFIB 1AUDA 1KNZA 4LUBA 1WACA 3LQVA 4NLYA 2XMJA 4QWCA 1JLFB 4DPOA 1HNVB 5E33A 2EPIA 3U1LA 2WZ1A 2W2PP 3F0NA 2J9EA 4C0HA 4OZJA 2XTJP 4M5NA 1YK9A 5KFPA 3CSKA 1S1TB 4UZCA 3W63A 4I6AA 2VOPA 4M63A 2MMYA 2HLTA 3VGSA 2QGFB 2H5JB 3BREA 3H59A 1MW7A 5KFQA 1H2TZ 4ZCKA 3GU0A 4N8NA 1JLEA 3HD1A 1UVIA 2DNZA 2CKWA 2W24A 3QAEA 2ZWPA 1VLOA 1XMQF 1NAQA 3H2VE 3R5DA 4C8YA 1YLXA 2J76E 3KLIB 5HQMA 3CCZA 1FEEA 3M8ZA 4GKKJ 2JNJA 3KNAA 3SQGA 2WSCC 1T02A 2Z0GA 2X3DA 4NYOA 4DU8A 3D66A 1DLOB 2BANB 5KFYA 3UR3C 2FZKB 3BGRA 5A0YB 2P9CA 1EX8A 2Y0BB 4YB5A 3IBFB 2YNHB 2AYGA 3D3BJ 4LF6J 5E3AA 2XMWA 3IGNA 4J90A 3N28A 2B7CB 2V8DA 3CCRS 1YTYA 4NI2A 4YHHJ 1YVFA 4NLUA 1KHVA 2YQ1A 2BABA 3ENQA 4DR2F 1HWLA 2ZHOA 3JYTB 4M8LA 4DPXA 1Z1ZA 5I42B 4DUYJ 2ZBIA 1IUJA 2R9LA 2QC3A 4C6AA 3QZ8A 3TQEA 2LXFA 4H4KA 1IVZA 1RTHB 3TOQA 4PG7A 2HFUA 3LWMA 2BKPA 1CS4B 1S6PB 1TKTB 3RG6A 5DZ7A 2B9EA 3MWBA 3MM8A 2RRAA 1A0OB 4NA3A 3CVKA 3DC2A 1R0CB 1U6BA 3KK1B 1KTVA 2KT5A 4ZJOA 4Z37A 2YH1A 2FTRA 2K7KA 2D3UA 2V2ZA 2UUAF 1RT6B 2VC1A 1RHUB 1RTIB 3VZIA 3R97A 3CNQP 1LWEA 3F73A 4KRWA 1S9EB 2RU9A 1OY9A 2XC9A 4CM0A 3M4XA 4CH0S 1KFSA 2CPYA 2W9CA 2DH9A 4N56A 3K89A 2VBZA 4X62F 1N33F 4J9VA 3VHQA 2PT0A 1UVKA 1RT1A 3Q89A 2EFGA 2HHPA 3MDFA 2ZVSA 2DD8S 2E1AA 3NKYA 4DV3F 3OR1A 4L76A 5BXIA 3M8PB 1K1QA 1NJZA 3R5JB 4OX9J 4BC9A 2VG7B 4C8ZA 4LR8A 3OLBA 1YJTA 1SV5A 3KLGB 1LEOA 2D69A 3GIRA 4UOFA 3CJTA 3DI6A 1EARA 1J5OA 4OI3A 3JSMA 2HZVA 3ZTRA 4UZBA 2M8DB 4IOBA 2YX4A 3UN5A 5J2MA 1H2VZ 4ETZA 2ILYA 3J81Y 1HL6A 3DRSB 4ECUA 3LALA 3FFIA 5G0RA 2MKKA 2ILZA 4X4PA 2VPZB 4ECQA 4WIIA 2JDJA 3H8YA 4Y2IA 4F4ZA 3M2VA 1Y3KA 1RK8A 1HR0F 4KGZB 1L3KA 5J2NA 2ADBA 4DSKA 3MPVA 2QA4S 4DV4F 4FNHA 1GXTA 2E5LF 1CJKA 2ZE2B 4NXNJ 5A6WA 2M4MA 3MM9B 2E7XA 2PC6A 2CPFA 3AY0A 1X4CA 1F9EB 1VQMS 3T1HJ 3IXQA 4LBIA 2FLNA 2N7YA 3J7ZT 4F02A 1AW0A 4MYUA 3TUZC 2HVHA 2KRRA 1HNWJ 1NO8A 2ZH8A 2FZCB 2G0JA 5D8HB 5KOXA 5SZTA 1EIYB 2G0CA 4WKRA 2QLFB 2ABYA 1F5BA 6FDRA 4ZPAA 4YQWA 5AJ3J 1X4GA 3TVKA 3GP9A 2XS2A 2Q43A 1JJCB 3QT7A 2KG1A 1F0XA 4Y65A 4PQUB 4I2PA 4E8UA 2RRBA 1TL5A 2DJWA 3G9CA 3BPDA 4WP9A
chains in the Genus database with same CATH topology
4CM0A 3G82A 4USWA 4USTA 5IV4A 4NI2A 4OYAA 1CJVA 1CS4A 3C16B 1CJTA 4CLKA 4CM2A 4WPAA 2GVDB 1FX2A 3MAAA 1WC6A 4OYPA 1CULB 1CJKA 1FX4A 4CLYA 4CLLA 1AZSA 4WP8A 2W01A 3UVJA 4CLZA 4OYWA 4OYBA 1Y10A 1U0HB 3R5GA 4P2MA 5D0HA 3MR7A 4CLUA 4CLTA 1WC4A 1CJUA 2GVZB 3C15B 1TL7B 1CS4B 4CLSA 4CLFA 3C14B 4WP3A 3G82B 4OZ2A 4NI2B 1Y11A 1CJVB 3C16A 2GVDA 1CJTB 5D15A 4USUA 3MAAB 4OYXA 1CULA 1CJKB 4OZ3A 1WC0A 3ET6B 1AZSB 3C14A 1YBUA 1WC3A 4USVA 1WC1A 4CLWA 3UVJB 4OYMA 4P2FA 5D0GA 2BW7A 2WZ1A 1U0HA 1WC5A 2QV6A 4CLPA 1AB8A 5D0RA 4OYIA 3C15A 2GVZA 4OYOA 5D0EA 1CJUB 5IV3A 1YK9A 1TL7A 1YBTA 3ET6A 4P2XA 4WP9A 4OYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CM0 A;  3G82 A;  4USW A;  4UST A;  5IV4 A;  4NI2 A;  4OYA A;  1CJV A;  1CS4 A;  3C16 B;  1CJT A;  4CLK A;  4CM2 A;  4WPA A;  2GVD B;  1FX2 A;  3MAA A;  1WC6 A;  4OYP A;  1CUL B;  1CJK A;  1FX4 A;  4CLY A;  4CLL A;  1AZS A;  4WP8 A;  2W01 A;  3UVJ A;  4CLZ A;  4OYW A;  4OYB A;  1Y10 A;  1U0H B;  3R5G A;  4P2M A;  5D0H A;  3MR7 A;  4CLU A;  4CLT A;  1WC4 A;  1CJU A;  2GVZ B;  3C15 B;  1TL7 B;  1CS4 B;  4CLS A;  4CLF A;  3C14 B;  4WP3 A;  3G82 B;  4OZ2 A;  4NI2 B;  1Y11 A;  1CJV B;  3C16 A;  2GVD A;  1CJT B;  5D15 A;  4USU A;  3MAA B;  4OYX A;  1CUL A;  1CJK B;  4OZ3 A;  1WC0 A;  3ET6 B;  1AZS B;  3C14 A;  1YBU A;  1WC3 A;  4USV A;  1WC1 A;  4CLW A;  3UVJ B;  4OYM A;  4P2F A;  5D0G A;  2BW7 A;  2WZ1 A;  1U0H A;  1WC5 A;  2QV6 A;  4CLP A;  1AB8 A;  5D0R A;  4OYI A;  3C15 A;  2GVZ A;  4OYO A;  5D0E A;  1CJU B;  5IV3 A;  1YK9 A;  1TL7 A;  1YBT A;  3ET6 A;  4P2X A;  4WP9 A;  4OYZ A; 
#chains in the Genus database with same CATH topology
 2UXD F;  3GJT B;  3G8S A;  4EBE A;  2W4P A;  2IDL A;  3KHR A;  3MEE B;  3PW7 A;  2MQO A;  2D7S A;  1KC8 T;  3ITH A;  3MMA A;  2DEJ A;  5KFK A;  4JI2 J;  2V4J A;  5F8H A;  5DQI A;  2KHD A;  2K3I A;  2RT3 A;  1NHV A;  2XWY A;  3G8T A;  4FS2 A;  2MEW A;  4XPE A;  4AL7 A;  4TN2 A;  2CJX B;  2OUG A;  4DFM A;  3C6U B;  2CXE A;  3B54 A;  1NB7 A;  3QBC A;  3I96 A;  4CLU A;  3UFC X;  3Q8R B;  2IM0 A;  2ZOM A;  3GIJ A;  4ZCM A;  3HPO A;  4OQJ A;  4CLF A;  3LGM A;  1D0E A;  1B7Y B;  2DT9 A;  4LSN A;  5IFM A;  4GKJ J;  2PII A;  2K1R A;  1YWX A;  1R3N A;  4DX6 A;  2OAU A;  2RHQ B;  2JFK A;  5IXU A;  3DLJ A;  1NK4 A;  1F9H A;  2VHG A;  4EZ6 A;  2KFY A;  4DN9 A;  3ET6 B;  3I31 A;  3VAI A;  4ED6 A;  1JLA A;  1O8B A;  2QG9 B;  4OI4 A;  4ETX A;  4F2R A;  1RLD A;  3G96 A;  4F67 A;  4ZP7 A;  1RA6 A;  5A8K A;  2HQ3 A;  3BQ0 A;  3QYY A;  2NXC A;  1K73 T;  4IH6 A;  2IBO A;  3LAN A;  2LYV A;  5F9L A;  5H9E K;  7FD1 A;  1TEL A;  5M2R A;  6AT1 B;  5KFZ A;  1WTF A;  4IH5 A;  1N4L A;  4U7C A;  4C4W A;  4NLR A;  1FKO B;  4AQY F;  1R8A A;  3DOM B;  3VQS A;  2BX6 A;  1ZAV A;  4R8U B;  1K9M T;  2YKA A;  1BQM A;  1YG0 A;  2DO0 A;  2HS0 A;  4TYB A;  3RBD A;  1X9W A;  3HSD A;  3BM7 A;  3JTN A;  2VOO A;  4G1Q A;  3NWR A;  3MFI A;  1CJU A;  4P52 A;  4AUK A;  1KOH A;  3H7H B;  3Q8P B;  3I32 A;  1PAE X;  2VKZ G;  3S1T A;  1T05 B;  3NAI A;  4J91 A;  3D28 A;  3MR6 A;  4XDC A;  1RAG B;  3M30 B;  1KBR A;  3GTY X;  4FPR A;  4I0W A;  1C1B B;  2FD2 A;  2ERR A;  4ID5 B;  2DXF A;  2VG7 A;  4NEZ A;  4WFB Q;  3M8R A;  1TUW A;  3HHL C;  2CWX A;  3N6M A;  1BMQ B;  2GQQ A;  3DLH A;  2EK1 A;  1XNR F;  1Y00 A;  3X3U A;  1HHT P;  3PXG a;  2YY3 A;  4RW8 B;  1JLQ B;  4KJI A;  5LM7 E;  1OQ3 A;  1B70 B;  5B0F A;  3I56 S;  4LSZ B;  3HHL B;  4ZPV R;  3SBM A;  4F3O A;  2EFO A;  3W2W B;  4FF2 A;  4I2Q B;  2WOM A;  4U95 A;  4DSJ A;  4LVO P;  2I38 A;  4ZVP B;  3J81 j;  1N5Y B;  4LT6 A;  4IUF A;  1KWM A;  3QO9 B;  4B9U A;  2PFD A;  2M3D A;  4MKA A;  2GIR A;  5DQG A;  1NSP A;  4NCG B;  3BJY A;  4RLE A;  4ZDN A;  3Q8S B;  2JFD A;  1ZAX A;  2ASJ A;  1MN9 A;  4KC5 A;  2E1M C;  3OQ2 A;  4C8K A;  5D3G A;  4CO5 A;  2HVI A;  3W8P A;  2H65 B;  3C6T A;  4M5D A;  3PR5 B;  1KEK A;  3OTO J;  4O44 A;  3P6Y C;  4AD6 A;  2CQP A;  1SUQ A;  2L9W A;  2KI2 A;  4M5H A;  3VAF A;  1N54 B;  1ACM B;  4JI3 J;  5H9F K;  3I0R B;  3HHL D;  4TY8 B;  1U24 A;  4FN5 A;  1KN6 A;  2AYM A;  2XO7 A;  1D9D A;  2VU5 A;  4USI A;  1S1W B;  4UW2 A;  2Q3P A;  3FSI A;  5KFA A;  2Y0S D;  1GXL A;  1YZ7 A;  2CUY A;  4RU9 A;  2OD4 A;  4QOT A;  2DGX A;  1NSA A;  1PJ5 A;  2IM1 A;  1YRX A;  3IM8 A;  2UU9 J;  1DTQ A;  3K5N A;  2BXJ A;  3FDS A;  5J1N A;  3R2C J;  1IBL F;  1XR5 A;  4PUO B;  3QWU A;  3WZ0 A;  2I8E A;  1HNI A;  2M88 A;  2V6A A;  2YWG A;  2Q66 A;  4WP3 A;  4BDP A;  4DG1 A;  4RNN A;  2QA4 G;  2LMI A;  2XMV A;  3EPG A;  4NLS A;  2OFH X;  3DKD A;  1HA1 A;  3T6B A;  4UQT A;  5IQ6 A;  1OS5 A;  1KVI A;  3I4H X;  3POT A;  1DQ9 A;  2W7O A;  4R25 A;  5DLF A;  4ZN1 A;  2UXB F;  3ET6 A;  2WK4 A;  2C3P A;  2QLW A;  3CJK B;  1SQE A;  4EYI B;  2BE2 B;  3UI3 A;  3QT8 A;  1EET A;  1JQG A;  3NGR A;  1F60 B;  4JI0 F;  2WON B;  2HQG A;  1TZ0 A;  1CG2 A;  1YJU A;  5B0C A;  4USM A;  1PO6 A;  2ZM6 F;  5ETL A;  5IC4 B;  5M2U A;  1RTJ B;  3RAM A;  2AZ1 A;  4LRE A;  1LWF B;  1S72 S;  2HG4 A;  1Y3J A;  3MMC A;  4DV6 J;  2FVR A;  1TL3 B;  3P4U B;  3OUY A;  3NWG A;  3EVW A;  3M8W A;  4UQG A;  2ZBP A;  2RF2 B;  4EO8 A;  5L38 A;  3TJ8 A;  4IR9 A;  5D6G A;  4OX6 A;  2AU0 A;  2ZH6 A;  4N76 A;  4TVA B;  1FFG B;  4UF4 A;  5F3T A;  4ELU A;  1LWX A;  2E7W A;  1DAX A;  2UVU A;  2IBK A;  2YKO A;  3IBC B;  2OLW A;  4KHR A;  1UMJ A;  1KVK A;  3GCW P;  2HAI A;  3M2U B;  2IFX A;  4BWM A;  3BBC A;  2YTC A;  3R6G B;  3R8Y A;  3L4B C;  5E7O B;  1RU2 A;  2NQP A;  4BC7 A;  1NHU A;  4ZP8 A;  2Y8W A;  2QMU B;  4ILM A;  3HKZ D;  5CZX A;  1S79 A;  2KT3 A;  1VDH A;  3KKF A;  5LOQ A;  2V2Q A;  1WKL A;  1LV5 A;  3CMQ A;  2C3O A;  3V6K A;  3SYZ A;  1TAU A;  2C1E B;  2W4C A;  1HFE L;  4CP5 A;  5F3Z A;  4C3K A;  5GAG U;  1VQ5 S;  1FER A;  2XZW A;  1NPR A;  3GJS B;  1WSV A;  1SC1 B;  3NGD A;  3CWJ A;  2OFG X;  3GLJ A;  4P74 A;  3UR0 A;  2FYX A;  2J9C A;  1X5T A;  3KHH A;  2DIU A;  2HZA A;  3DYA B;  4LF5 F;  4RW9 B;  4EI2 A;  4PRF A;  3VCD A;  4Z2X A;  1S57 A;  1SH3 A;  3TEG A;  3R5C A;  1OWX A;  3BH6 B;  1SJ1 A;  2ALY B;  3L7U A;  1N34 F;  4ECS A;  2W2M P;  2RKI B;  3GZ7 A;  2YKM A;  2DY1 A;  4QWB A;  1U1O A;  3NY0 A;  4ILR A;  1VYA A;  5D78 A;  1EZZ B;  1YSJ A;  4URG A;  5KG0 A;  2AEM A;  3UO0 A;  3MEG B;  1M0S A;  4DCP B;  1SC4 B;  5IT9 Y;  2NRE A;  3M9M B;  3BPS P;  3WQP A;  2V8V A;  3KG0 A;  4TY8 A;  2P8I A;  4DR7 F;  4ED1 A;  1HBM A;  4QR2 A;  1GTE A;  4L75 A;  3MAQ A;  1KD1 T;  1FNX H;  2ZH3 A;  4OV1 A;  3SQO P;  2HBZ B;  5C25 B;  3EE3 A;  1ICE B;  1TL7 B;  3KG4 A;  2AQ4 A;  1FFS B;  5J1E B;  3R9L A;  3GIK A;  1VJQ A;  2ZH2 A;  1Y11 A;  1CJV B;  3DDK A;  1Q4R A;  3ENW A;  4ED5 A;  2MQM A;  3MAA B;  1NK6 A;  3ZO7 A;  1L3T A;  5KG3 A;  1X31 C;  3JXO A;  3FK4 A;  1TVR B;  1MML A;  3QID A;  4ZJL A;  3I0S B;  3ISN C;  5DDR C;  4LJM A;  2LQ8 A;  1U1N A;  4EUV A;  1YRT A;  1HBN A;  4Z7C A;  4GKK F;  1VOM A;  1L3V A;  1RBL A;  1UJ5 A;  5AE1 A;  1T9X A;  4UST A;  4LIR A;  2D3O 1;  1HHQ A;  5DO2 A;  5HRO A;  1NJI T;  4RO0 A;  1JLB A;  1SQF A;  3W2V B;  1M5H A;  2ZWO A;  2FDN A;  3CCV S;  3DGP B;  2HQD A;  2XY5 A;  2HFV A;  4B3S J;  3R7S B;  4JI7 J;  4A8F A;  4L3N A;  1RAI B;  5KFF A;  4DCO B;  3AOB A;  4GVB B;  1I5O B;  5F8L A;  3DHW C;  1VQ7 S;  2WTF A;  5KFM A;  4J9S A;  2V50 A;  4DV7 J;  2MKS A;  5EHH A;  2EFN A;  2CQI A;  5IQQ A;  2R8K A;  4FBT A;  4DF8 A;  1U1R A;  4E0D A;  3PRB A;  4ZVE A;  1H7W A;  3NL0 A;  3EPI A;  3THP A;  2KM8 B;  2ZJP Q;  2DNN A;  5ETP A;  2G2O A;  4QW9 A;  4NOH A;  1LQ9 A;  4ES1 A;  4HDG A;  2RQK A;  2AHO B;  3ZTP A;  1CLF A;  4WK1 A;  5DG9 A;  1HBU B;  3IGV A;  1RHQ B;  1PCA A;  2LEA A;  1KQG B;  5D0H A;  5I3U B;  3FRZ A;  4FKY A;  4LF4 J;  2CQD A;  1AXQ A;  3O44 A;  2J0X A;  1FTC A;  2R8J A;  2KYX A;  1DTT A;  1NZA A;  4X4R A;  5B7W A;  4DR3 J;  1NDK A;  4KB7 A;  2PFF B;  4YB7 A;  3C46 A;  3OFH A;  2MJN A;  5DZ6 A;  1GTH A;  1FFW B;  3PR4 A;  4ZLP A;  2CNK B;  4Q2L A;  4N41 A;  2B9X A;  3DYA A;  5E41 A;  2HHT A;  3D68 A;  1OYE A;  4OX9 F;  1DQA A;  3TX8 A;  3D7S B;  3RJM B;  3KTQ A;  3CPW R;  1TFY A;  1BUX A;  4FXW A;  4DUT A;  3OL9 A;  4ZPB A;  2R7U A;  2CPH A;  4OJH A;  5LJ3 Y;  4C8L A;  4X4O A;  3OSN A;  4L72 B;  1S0M A;  2NYI A;  4LF8 F;  1KR4 A;  2B5J A;  1GMU A;  5RUB A;  4NEY A;  5A6P A;  4OYB A;  2R8I A;  3T5K A;  4R0J A;  1VCT A;  2DH7 A;  2CPX A;  3TNV A;  3TAM A;  2QLJ B;  3Q86 A;  3A8K A;  9ATC B;  3PDN A;  3G82 B;  3CTR A;  2CQB A;  2DRA A;  4Y2K A;  3Q8Q B;  1QTN B;  2VFS A;  3DRR B;  3DU6 A;  5THW A;  3LTO A;  3TRG A;  2OPP A;  5KFJ A;  4ED2 A;  4OHY A;  3RBZ A;  4IQX A;  2FUG 9;  5DDP C;  2FQQ B;  2OPR A;  3QFH A;  4QIG A;  3BBF A;  2IIH A;  2Z58 B;  3HVW A;  3TA1 A;  4RW6 B;  1HPZ A;  1XNQ J;  4HHU A;  4B3T F;  4C3L A;  2HQF A;  5JJB A;  3DCA A;  3CIM A;  4X66 J;  3NBP A;  3VAG A;  4YDD B;  3W5Y A;  4CM2 A;  4WPA A;  3FZ2 A;  1SH0 A;  2GVD B;  1YHQ S;  2C22 A;  4A8Y A;  1DUR A;  5AJ3 F;  3BO2 A;  1RAA B;  2LA4 A;  3H5S A;  3IR7 B;  5EWG A;  1X4D A;  2NCK L;  2E1R A;  2YNG B;  2DCL A;  2E9T A;  2EKN A;  3IS9 B;  1NBE B;  1HQU B;  1AT1 B;  2DPI A;  1SJ3 P;  4ZVR B;  3CD0 A;  3GWC A;  1MNE A;  1NLK L;  4GC6 A;  3TEH B;  2JOQ A;  2BRK A;  1UVM A;  4PR6 A;  1U1L A;  2IC3 A;  4M5G A;  2FIU A;  3TI0 A;  3T6J A;  2CQC A;  2BYC A;  2R7W A;  1JIH A;  3BSN A;  1MMD A;  3DLK B;  3HFV A;  2RQM A;  1H2U X;  4URS A;  3OW2 R;  4B9L A;  2E1C A;  4QWE A;  2ZHA A;  2B51 A;  3OVS A;  1V5I B;  2CJB A;  3THT A;  5EWF A;  1PYT A;  2V63 A;  1UW4 A;  5HLF A;  2BKO A;  2VPY B;  1LXN A;  4GKJ F;  2P9E A;  3RB0 A;  3KMS A;  3I5B A;  5DDQ C;  2QL5 B;  2IY5 B;  2CQ4 A;  2AJF E;  1WWH A;  3W62 A;  4DFJ A;  1XWL A;  4GMK A;  1CUL B;  2PN6 A;  4LBH A;  2MY8 A;  3EJM A;  4CLZ A;  4K0K J;  2P2C B;  3MM6 A;  3ILJ A;  3MPY A;  2C2R A;  1EQM A;  5GVQ A;  1H0H B;  4UOG A;  2QSW A;  1UW9 A;  1GAO A;  4QIW D;  5GAE I;  5C24 B;  1S48 A;  3WC0 A;  4MTP A;  3C16 A;  3J80 U;  1HBO B;  3FEX B;  2YQ0 A;  2HBQ B;  5B0D A;  2OGU A;  3L7O A;  2CWK A;  1XR6 A;  3MPW A;  3FKB A;  5J2Q B;  3H5U A;  4ECY A;  3E01 A;  3V2U C;  4EYH B;  2DHS A;  4DR6 F;  2RIL A;  4JV5 J;  2DNY A;  2MYF A;  3GJQ B;  2JX2 A;  2NZC A;  3MR5 A;  4O4G B;  3B8H A;  4CWB A;  3NP5 A;  1PJ7 A;  3GV8 B;  1MU2 A;  3CCW A;  3IP0 A;  4CZC A;  2PMZ D;  3GV7 B;  3KLE A;  1U1P A;  1UTA A;  2B9W A;  1LWC B;  4PEO A;  1U6F A;  1VQS A;  2E66 A;  4RUH A;  1KLN A;  1Q0N A;  3KJN B;  2BRL A;  4YDX A;  1HD1 A;  3UVJ A;  2XLI A;  3M6W A;  3B4M A;  4M94 A;  1F5A A;  2EG1 A;  2NPI A;  4RKU C;  1FRL A;  3G8Q A;  2VKR A;  2J0S D;  2C2O B;  5GAD U;  2CJ9 A;  1RHJ B;  3OBI A;  3PKM A;  2AEJ A;  5HAO A;  4B9N A;  2RDI A;  3UNG C;  5FLX Y;  1NCL A;  1HQE A;  1TK8 A;  1XMO J;  2MLX A;  2HHH F;  4P7T A;  4A8K A;  3H5Y A;  5F8N A;  4LVN P;  1PYS B;  1RA7 A;  1BQN A;  2FB0 A;  4ZA1 A;  3DLE A;  3DOK B;  3D9B A;  1RBA A;  4J5O A;  2QJ3 A;  1ULR A;  2EXU A;  2CJA A;  2CNO B;  1JJH A;  3MCM A;  2BOA A;  1RT7 B;  4OX7 A;  4NZ6 A;  3M6U A;  3NG8 A;  4DL3 A;  2LP4 A;  3EDR B;  4K5R A;  1URR A;  4CLL A;  1T94 A;  4QYZ K;  2E29 A;  1T9Y A;  4ZLJ A;  4DX5 A;  3D6M B;  4ZVT B;  3KK3 B;  2JLE A;  1KQK A;  4XTT A;  2IYG A;  1IKV B;  3SZ2 A;  3MR7 A;  1TKZ B;  1DAR A;  4A8X A;  3JSR A;  1N6Q A;  4QU6 A;  2HRY A;  4A8O A;  2BQU A;  4LRC A;  4LF1 A;  4WYW A;  5CD4 H;  2YX7 A;  2R7S A;  2J0Q D;  2DRD A;  1JLC B;  3GSI A;  3CXC R;  5A76 A;  1KQS R;  2B4V A;  2MLY A;  3V81 A;  2A1B A;  2ZZM A;  4ZHR A;  3P5B P;  3CDE A;  2HW3 A;  2WSE C;  2UUB F;  3PYD A;  4UY8 T;  3RB3 A;  1C0T B;  4J9O A;  4HAC B;  4LRB A;  4IG0 B;  4HH1 A;  4J9K A;  3FSX A;  3N01 A;  2QZ8 A;  4MKV A;  1HD0 A;  1UVL A;  3SEO A;  4IG3 B;  5LXY A;  2DR7 A;  4PQA A;  1T8E A;  4A8M P;  2KYZ A;  1JXL A;  3PHT A;  4FYY B;  2R2U A;  3FBC A;  4GVL A;  1VC0 A;  2KDO A;  4I7F A;  4A48 A;  2P5V A;  1NK8 A;  1KDN A;  4DV5 J;  2CG4 A;  3BO3 A;  1VJW A;  5F8G A;  1JX4 A;  4C11 A;  1VRT A;  3FBE A;  1FWK A;  4ZPD A;  3I55 S;  3TAP A;  1RQ0 A;  3JSB A;  1B4S A;  1SH2 A;  3R7N B;  5L1K A;  2G2Z A;  4JI1 F;  2NUH A;  1UPP A;  1JLG A;  2FVQ A;  1HMV A;  1M90 T;  3GMG A;  4NXM J;  1QJH A;  3PW0 A;  4ICL A;  4DS4 A;  4IQM A;  1WC1 A;  5B09 A;  2I2Y A;  2VDI A;  3V6J A;  2HRU A;  3Q2S C;  2R8G A;  2E7V A;  1EP4 A;  4DV6 F;  2F65 A;  2XNQ A;  4QU7 A;  4KFB A;  1QD1 A;  1S0N A;  2EC2 A;  4CYU B;  3VQT A;  4ENO A;  2CZV C;  2MQL A;  1RWK B;  4Q2M A;  1IR1 A;  2B0G A;  1C2P A;  1HKA A;  2IRU A;  3ONQ A;  2J6T A;  1Z2L A;  4EWT A;  2ZH7 A;  3T3F A;  3BKF A;  2FJB B;  3I9V 9;  4B9V A;  4HHJ A;  2B43 A;  3V4I B;  3VAJ A;  3GE9 A;  2C2M B;  1Q95 G;  4KO0 A;  1RWM B;  2UUT A;  2N82 B;  4CT8 A;  3SCK E;  1IKW B;  2Y1I A;  4QWA A;  3PO4 A;  4ZKA A;  5AT1 B;  1L3S A;  4MIW A;  1XTZ A;  3FQL A;  4QR1 A;  2JLG A;  3CCQ S;  2MJU A;  1HNX J;  2ROE A;  4NRU A;  1SKS A;  1U6Z A;  1AFJ A;  4M5K A;  3KUG A;  3TZX A;  3ETM A;  2UVV A;  3F44 A;  1WF2 A;  2JVO A;  3SDE B;  3B6B A;  1EKR A;  3KFW X;  2AT1 B;  1RCO B;  3TAR A;  1RT4 A;  1REV A;  5KT7 A;  1SVD A;  1RAC B;  4LMZ A;  3W65 A;  2HWH A;  3QSY B;  3M32 A;  3H5X A;  1OQ6 A;  2HYI B;  3JQK A;  2LVW A;  3HHK A;  2YNI A;  1B0V A;  3IR5 B;  1FRK A;  2DGV A;  3TZW A;  4CH7 A;  1TV6 B;  3NCQ A;  1R8B A;  1OIA A;  3VGT A;  3W7B A;  2B7B B;  3QWP A;  2GVZ B;  1Q8I A;  2ZJR Q;  3M8Q A;  2XNR A;  3HX9 A;  4NZ0 A;  2XZT B;  5AE3 A;  3GG0 A;  2DNL A;  4PWD A;  2ZOG A;  1N32 J;  3JQM A;  4A8Q A;  1EAY C;  3HZG A;  1RHR B;  3PW2 A;  3UWT A;  4LR9 A;  2R7R A;  1FDA A;  3RAX A;  4PPZ A;  4WTY A;  2OH2 A;  2OP5 A;  2J7U A;  1PJ6 A;  1UWB B;  5FJ4 A;  3TUP A;  1FK9 B;  3N6N A;  3D1O A;  2BA9 A;  4C3M A;  4WXO A;  4RPF A;  4XO0 A;  1NK9 A;  1IKY A;  3LP1 B;  3W9H A;  2K7J A;  2HHQ A;  2Y8Y A;  1W25 A;  4FZV A;  1N8R T;  1BE4 A;  4C8M A;  1QVF R;  4MKB A;  3OVB A;  5ADZ A;  1Y0H A;  4EMD A;  5CYM A;  3KLF A;  2IMO A;  3W9J A;  3HUL A;  4EFA C;  4FYX B;  1C0U B;  3MM5 A;  4ZIT A;  3DRX A;  4JI6 J;  1FJG F;  4J9N A;  2B6A B;  4ZVU B;  3C15 B;  2VFU A;  4X4S A;  1N52 B;  4NLO A;  1N5V A;  2X51 A;  4YS2 A;  1IXK A;  2XBP A;  1Y7P A;  2WVF A;  4OZ2 A;  2D3Z A;  3DDN A;  5IZH A;  3D5M A;  3JQJ A;  1RE1 B;  3LP2 B;  3HVA A;  4W92 B;  4H4M B;  4PWW A;  3OD2 A;  1OY8 A;  3ENV A;  1Q7L B;  2ZD1 A;  2CQG A;  2I5J A;  1V5V A;  5LSL A;  4BBY A;  1GMV A;  1HYS A;  3ILO A;  1NK0 A;  3Q8V A;  3I5C A;  4NCA A;  2OEL A;  2EEY A;  5ETN A;  3HVT B;  4JI8 F;  3GCX P;  4FPI A;  4DV7 F;  1T95 A;  1NND A;  2MQ8 A;  4K2J A;  1S1X B;  7FDR A;  1W7W A;  1NSK L;  3MXH P;  4AT1 B;  3O5T B;  1NSQ A;  2V4R A;  1B0P A;  2BJ9 A;  1HI8 A;  2OMO A;  3M2R B;  3NNC A;  1BWV A;  2DHX A;  4LR7 A;  4RW7 A;  5MLC V;  5C42 B;  2IRY A;  1QTM A;  2HS4 A;  2N4C A;  2QO3 A;  2HND A;  1S1U B;  2ATC B;  4QJV A;  4EO6 A;  1N36 J;  2AYE A;  5A8R A;  3V4I A;  4DL2 A;  1S12 A;  3I9Z A;  4IFV B;  1TR0 A;  4MIA A;  2CJQ A;  1RAO A;  3DRP B;  1VMB A;  1SC3 B;  2MKY A;  1RGV A;  5KFW A;  4ER8 A;  4O4R A;  3BKT A;  2M52 A;  2ZH4 A;  1FD2 A;  5LJ5 Y;  4R5P B;  4NWB A;  3H0P A;  1WEL A;  1AZS B;  5HMZ A;  1CBK A;  1ZYQ A;  2XSJ A;  1YRU A;  4LF4 F;  3M1V A;  4L73 A;  3KOA A;  4KIA A;  2L08 A;  4LF9 F;  1U7L A;  4ELV A;  2DXE A;  3UDV A;  1NRK A;  1VHF A;  4ZOS A;  2G1H A;  1HNZ J;  1UFK A;  2DNM A;  4ID8 A;  2H54 B;  4Y34 A;  3DLL Q;  4F7V A;  1X60 A;  2YKP A;  1S5Z A;  2ZDO A;  4EBC A;  3TO8 A;  3N5F A;  4TNO A;  2J6S A;  3BV8 A;  2CPJ A;  3M05 A;  2Z4P A;  3AQP A;  1M5S A;  1QSY A;  2EVZ A;  3OHA A;  2AJ4 A;  4OHV A;  5C2G A;  4NMX A;  2ROP A;  4YR2 A;  1S99 A;  3PIO Q;  2R8H A;  1IWG A;  2QLX A;  2JC1 A;  5T41 A;  3HKW A;  2GJF A;  5L46 A;  1Q78 A;  3BZQ A;  1RT5 A;  4PG5 A;  4DF4 A;  3T1Y J;  1JLE B;  1IKX A;  2YKN A;  4DX8 H;  4A4J A;  1GEH A;  2EFV A;  4RR5 A;  3W64 A;  4K4Y A;  1D8Z A;  3SFG A;  2VFT A;  5FD1 A;  2UP1 A;  4CLP A;  4XPC A;  3M7V A;  2RS8 A;  4E98 A;  1ZBT A;  5EWE A;  1RBO B;  5AXK A;  4DPY A;  3D6H B;  3SQG B;  3PG9 A;  2ZUA A;  1K1S A;  2M5Y A;  1UFL A;  3EM1 A;  4KKO A;  3PM9 A;  1MLA A;  1TTH B;  4XK8 C;  2MKJ A;  3NEK A;  3FSY A;  2WVC A;  3E8O A;  3O2I A;  4O3N A;  2ADC A;  3I6P A;  3H20 A;  2OO4 A;  4NLG A;  5HAT A;  3WBZ A;  2KU7 A;  2VZ9 A;  4PXB A;  5D4N A;  4OHX A;  4UOH A;  1RTD A;  4LFB F;  3X1L B;  1XNQ F;  2XMK A;  3CCS S;  4X66 F;  4K4V A;  4ZP6 A;  1O51 A;  3BN7 A;  4NI2 B;  1RAJ A;  4WXW A;  4FP9 A;  5FDL A;  4H4K C;  1FT8 A;  2LU1 A;  4OI1 A;  4PPD A;  5D4P A;  3UPF A;  4OLO A;  1JKH A;  2ASD A;  1NJY A;  2MPU A;  1JNR B;  2DKO B;  4W90 B;  3ZZU A;  5CAB A;  3OL6 A;  3GG1 A;  4K4W A;  4Q0B A;  4P75 A;  2QN6 B;  3QT5 A;  2RU3 A;  1R6Y A;  5MAO A;  2PMH A;  3HVR A;  3OTE A;  2YH0 A;  5E3R A;  1QAY A;  3O6Q A;  3HSJ A;  3MM8 B;  4TKT A;  1Y5N B;  4Y2C A;  4C98 A;  2HFO A;  2J9D E;  1QVG R;  4J9U E;  1K0V A;  4BHQ A;  4P6Q A;  2CPD A;  2XMA A;  5BYS A;  4NLW A;  4IFY A;  1UKU A;  1VLY A;  3GQC A;  1LWE B;  3TZZ A;  2OHD A;  1BHN A;  3EMT A;  1H38 A;  1Q79 A;  2VQF J;  3UCZ P;  2W9C B;  4NCB A;  1SKR A;  3DXB A;  4YY3 J;  2YBV A;  3QGI A;  1RT1 B;  2VIC A;  3HF5 A;  3LWL A;  3SCJ E;  4O3R A;  4DL6 A;  4CT9 A;  4DUZ F;  4K0K F;  2NXE A;  1RLC L;  2CQ2 A;  2XI3 A;  1WEX A;  5I3P A;  3MI7 X;  4YN3 B;  4WWS A;  1U0H A;  2QV6 A;  2RJZ A;  5BR8 F;  3OR1 B;  2HK3 A;  4OI0 A;  1N5S A;  2V69 A;  4LBP A;  3VAL A;  1SV5 B;  1RT3 A;  3QLH A;  1NEE A;  3Q22 A;  3OL8 A;  4OYA A;  1L3U A;  5JVG Q;  3CUL A;  1BXN A;  4ZIV A;  1M5K C;  2KG0 A;  3DI6 B;  2QL9 B;  1J5O B;  3N0V A;  1IM6 A;  4NYP A;  3NGK A;  4K8R A;  3JSM B;  2LA6 A;  3ZC4 A;  2GNK A;  5BJR A;  3QMQ A;  5KG5 A;  1WEZ A;  1GQE A;  5J2M B;  4YB1 P;  1NDP A;  1NM2 A;  2AZ3 A;  3D6T B;  5G0R B;  2MGZ A;  2NUU G;  1JB0 C;  4JI4 J;  2DBB A;  5IM0 A;  1EKS A;  3M2V B;  3JB9 k;  1Q1K A;  2YVS A;  5KFL A;  1RT2 A;  8RUC A;  1FXR A;  2ZEJ A;  5J2N B;  3SSS A;  3HD2 A;  1WDT A;  1KTQ A;  2XGQ A;  3E3X A;  1ZZN A;  2WW8 A;  1FHT A;  1SQG A;  3MAH A;  1CJK B;  2C2N A;  4NRT A;  1FTR A;  3RAQ A;  2CA9 A;  1VHI A;  2LEC A;  5ETS A;  2E9Z A;  2LQ5 A;  1NK7 A;  4ZVQ B;  4X4T A;  3ETO A;  4DV2 F;  3R5B A;  1YBT A;  4DR1 J;  1GH8 A;  2DGO A;  4WU2 A;  3H2L A;  4WTO B;  3NGU A;  4DZ6 A;  4OL8 A;  3DMJ A;  4WFN Q;  5LL6 d;  5HMY A;  1XMO F;  4RWW A;  2RS2 A;  2E1P A;  2GJ2 A;  4B3O A;  2XI2 A;  2LDI A;  1ZA2 B;  3DOL A;  4FS1 A;  3C3L A;  5ETK A;  2HHX A;  3ENA A;  3UW1 A;  2YX1 A;  3U1N A;  4I2P B;  2AP6 A;  2EI5 A;  3NOG A;  4ANE A;  3CJ2 A;  3PAC A;  3PEH A;  1QSS A;  3ICL A;  3AJ1 A;  2FY8 A;  4CI0 B;  2FY1 A;  1WTB A;  2FVS A;  3F56 A;  3ITH B;  3MMA B;  1R8H A;  2V4J B;  2BJE A;  1U8W A;  3OV7 A;  3QGG A;  1KP6 A;  1SBR A;  4RNM A;  2HMI A;  3MR3 A;  4MFB A;  2V8G A;  5F8J A;  3LAM A;  2O5D A;  3AD8 C;  4DR2 J;  1FES A;  4ED4 A;  4DX7 A;  3KHG A;  2NR0 A;  3IWX A;  2MXY A;  4LSN B;  4WE1 A;  2K1R B;  2CQ0 A;  1GMW A;  4ZPT R;  2ACY A;  3CCE S;  4DLG A;  4PWU A;  2F1F A;  1RAH B;  4S0M A;  1VS3 A;  3FCW A;  1JLA B;  2AEF A;  2N3O A;  1HIY A;  1S1V A;  2OSQ A;  3M9N B;  4Q45 A;  2JC0 A;  1VRU A;  2D9O A;  3SV3 A;  5A8K B;  4JBC A;  3CJQ A;  3D54 A;  2H4Y B;  2VDH A;  3OL7 A;  1WKJ A;  1SL0 A;  2YPZ A;  3I5A A;  1FVQ A;  2IVF B;  2PGC A;  3T5H A;  2Q79 A;  2MZ1 A;  1VQ4 S;  1RAB B;  3UD5 A;  2BJ8 A;  3BEG B;  4PAB A;  1BQM B;  1DHM A;  3A3N B;  4OI6 A;  1RAE B;  4JUZ A;  2AF6 A;  2FLP A;  1R31 A;  2V34 A;  1KOO A;  2LXU A;  2M7S A;  1S10 A;  4G1Q B;  3P45 B;  2YNF A;  4X62 J;  1CJU B;  3KLV A;  4LRA A;  2MKI A;  2F3J A;  2PEB A;  1N0V C;  4XDD A;  3FMB A;  1IR0 A;  5JVH Q;  2QYG A;  4MT1 A;  2CZ9 A;  5ETO A;  5A8W A;  4IO1 A;  4DV3 J;  4WP8 A;  1PIL A;  1NXI A;  1UZH A;  3V6D A;  3R1L A;  3AFG A;  3HDS A;  4B3M J;  3TUJ C;  2FPH X;  2BUN A;  4TU7 A;  3PCO B;  2VC0 A;  2MDA A;  1KLM A;  3UNY A;  1R8C A;  5E3C A;  4TQR A;  3QPI A;  1WUU A;  4OZ1 A;  1H3D A;  2WOM B;  3KXD A;  2C3Y A;  2D74 B;  4M1K A;  2L3M A;  4ZS6 A;  3MMB A;  2XLK A;  1YBU A;  2G13 A;  1RKJ A;  1BC6 A;  2VIH A;  3IG1 A;  1VQ8 S;  2I0X A;  4F26 A;  1YJN S;  1S9F A;  3D1Q A;  1DBD A;  3M9O B;  2GAH C;  1HR0 J;  5DM7 Q;  1Q7Y T;  5D0E A;  4H4O A;  3RBE A;  1TL4 A;  1X4E A;  1MG7 A;  3BN4 A;  4RNH A;  5GAH U;  1AA1 B;  5LMN J;  4DV4 J;  4RX6 A;  4OJ3 A;  2E5L J;  1T9T A;  3RB4 A;  6FD1 A;  1I51 B;  3PYG A;  3FQK A;  5D3G B;  3KMQ A;  4IDK A;  2RML A;  3UE2 A;  5ETM A;  2X1A A;  4IYQ A;  3LUY A;  2R4F A;  3C6T B;  4M5D B;  2FC9 A;  2A0F B;  1KRP A;  4CO3 A;  4O44 B;  3ZZY A;  1KQF B;  2ZNY A;  2P6S A;  2HS3 A;  1Q81 T;  1DJ0 A;  1SUQ B;  4LFC F;  2GZO A;  1G3O A;  3R5G A;  3D1H A;  2R42 A;  3U1M A;  4UUX A;  3DNC A;  3H4D A;  3MCO A;  2BJ1 A;  4NE9 C;  4ZVH A;  4CTA A;  2H9Z A;  2VG5 A;  3P8B B;  3J7Y U;  4M95 A;  1M5V C;  2JHE A;  1JNZ B;  1WSR A;  4AYB D;  1UPM B;  2DPJ A;  5T7L A;  3CGI A;  2B56 A;  3CJ0 A;  5ETV A;  4DJB A;  3ZZP A;  3AA9 A;  2UXD J;  1DTQ B;  5K8O A;  3AT1 B;  3QIP A;  3CW2 C;  2M2B A;  2OSR A;  5DG7 A;  1RKI A;  3U27 A;  4YUD A;  1HNI B;  2JSX A;  4X4Q A;  3CJ8 A;  3DM2 A;  3OFG A;  1LW2 A;  3E51 A;  5HBM A;  4DG1 B;  2A18 A;  2QMX A;  2IYI A;  4DQI A;  3MUM P;  3MM7 A;  4K4U A;  2W01 A;  4AXJ A;  1ZAW A;  2KHC A;  3NOC A;  5JXS A;  2VJV A;  1O6X A;  3BSA A;  2FLO A;  3POT B;  1YJV A;  2O3D A;  1EJ7 L;  3G6V A;  3MOJ B;  2F8M A;  4TU8 A;  1HI0 P;  1EET B;  1A6L A;  3MF5 A;  4F0M A;  4WFX A;  1O5J A;  1F5C A;  2DHH A;  4DN0 A;  4KV8 A;  5HJY A;  1ZM2 A;  4QBU A;  4YEA A;  4KH1 B;  3TAN A;  1C1C A;  4KQZ A;  4JI6 F;  1FO1 A;  1YDL A;  3BGO P;  4LSL A;  3LP0 A;  5D0G A;  3V5R A;  1FRH A;  1T9V A;  3MMC B;  4NZ7 A;  1F1B B;  5AXM A;  4IR1 A;  4HHH A;  1VBK A;  3OUY B;  4USW A;  5KT6 A;  2KFN A;  4E2F B;  3PFE A;  3TYT A;  2W9B A;  1VIO A;  3CF5 Q;  1N88 A;  1LXJ A;  3VAH A;  1UEU A;  4JYA J;  2H5I B;  5HP1 B;  1VQ9 S;  2L9N A;  2H48 B;  3MGJ A;  5LT5 A;  3MD1 A;  1ARO P;  2IAJ A;  1WHY A;  4ITS A;  3QRP A;  4HEA 9;  1BQX A;  3GFX A;  2AJQ A;  5KTQ A;  2R7V A;  3K5M A;  5C2C A;  2WVD A;  1HWK A;  1XNR J;  1FNM A;  3WIV A;  2HQI A;  1RU1 A;  1U4B A;  2JH3 A;  1XBW A;  2C3U A;  3WDO A;  2XCP A;  2L9D A;  3OR2 A;  4X64 J;  2KN4 A;  2G1D A;  3D67 A;  5HMX A;  2HHV A;  5IT4 A;  1FE4 A;  3PW4 A;  2WVE A;  1PKU A;  2J0W A;  4K2X A;  4ED7 A;  4ATN A;  3A4T A;  2OML A;  4Y28 C;  4B9S A;  3FVY A;  1HLW A;  1K44 A;  3JAM Y;  2DR6 A;  2YKM B;  4WYL A;  2LKZ A;  2C2Z B;  5KOW A;  2J9D A;  3BSO A;  3D3C J;  2GO8 A;  1TKX A;  4KAI A;  1HNZ F;  4KBI A;  3SSQ A;  2OTJ S;  1X4F A;  2AGQ A;  1ZPV A;  1OPZ A;  3GON A;  1RB0 A;  3HHE A;  3UQS A;  1TL1 A;  3THV A;  2CNL B;  4F25 A;  5IS2 A;  1NME B;  1UA0 A;  3DN9 A;  1HBM B;  3KDN A;  5G4D A;  3FEZ A;  1PC5 A;  2APO A;  5HQL A;  3MHY A;  3CJ3 A;  1FXL A;  2HNZ A;  4J37 A;  4ECT A;  1RIS A;  1WOP A;  2Y1L B;  3KUH A;  1XC9 A;  2FHK A;  1Z2Z A;  1OSC A;  4YB6 A;  3AB2 B;  3FRY A;  2DRB A;  4DLE A;  1HWI A;  2ATL A;  1S0O A;  3A1Y G;  3H2U B;  4C0B A;  5FII A;  1R27 B;  4HI2 A;  1U2R A;  1G1X A;  1N5T A;  4J9L A;  1PG5 B;  1RTZ A;  3W66 A;  1Q8L A;  1NHK L;  2UUC J;  2CNN B;  3DHX A;  2B8P A;  4HI1 A;  4QWD A;  4Q43 A;  2WB4 A;  4CQ1 A;  2CAD A;  1R0A A;  2XM3 A;  1HBN B;  1U26 A;  2KXF A;  2VPX B;  2CDQ A;  3K5O A;  2GA7 A;  2AWZ A;  3A8J A;  1D9F A;  3DFE A;  3SSR A;  4LQ9 A;  5H1S V;  4RUA A;  3RW6 A;  2DR5 A;  1J2V A;  2ZIT A;  5HRO B;  5CXT A;  1ZS6 A;  1NDL A;  1FI4 A;  3CDU A;  2M8H A;  2GO9 A;  2Z2M A;  1JLB B;  3HJF A;  2AW0 A;  1XR7 A;  1QAX A;  4CO4 A;  1QE1 A;  3FNN A;  5IC6 B;  3GSD A;  2W7P A;  1BD6 A;  1D3W A;  4YR3 A;  4RBV A;  5D0R A;  3KJV A;  4NL5 A;  1KHW A;  4A8S A;  4QPT A;  4UTG A;  3AXK A;  2BZ2 A;  4AND A;  4ZVF A;  2RIJ A;  3DLG A;  1WHV A;  4N77 A;  4JI0 J;  1NPP A;  3IBW A;  3PX0 A;  3LF0 A;  1YI2 S;  2LLZ A;  3W5X A;  2ZM6 J;  5CZV A;  1UAW A;  4RUB A;  4HL9 A;  1IWA A;  3HT0 A;  4X84 A;  1QUP A;  4IO9 Q;  2E5G A;  2MQQ A;  2O66 A;  2PA3 A;  1S6Q B;  5F41 A;  1UEV A;  3DRY A;  4DSI A;  3UN3 A;  3MEC A;  4F0K A;  3DDI A;  5ITH A;  1W26 A;  5HP1 A;  2QIF A;  1Y9O A;  3CCM S;  2R7T A;  3IWL A;  3UDC A;  3D0H E;  1BLU A;  2NS1 B;  2BJ3 A;  1B7F A;  1NB2 A;  2N7C A;  2H3E B;  4Q8F A;  4LRD A;  2HFS A;  1GFW B;  4HH0 A;  2FJV A;  3QZ7 A;  3K57 A;  4O3O A;  4FYD A;  3EXY A;  2RVJ A;  3AOA A;  2V0N A;  1TP7 A;  3P5T L;  5HVH A;  4ZPC A;  4JOU A;  2VQF F;  1HWJ A;  1IBC B;  3P96 A;  3CJS A;  2RNE A;  3H90 A;  5HO4 A;  5KG2 A;  1VI7 A;  2GHP A;  4FYV B;  4U7U K;  1DTT B;  2GAG C;  3KK2 A;  2QE5 A;  1CJT A;  1YIJ S;  1I6J A;  1LOU A;  2FHJ A;  3U7J A;  2LQB A;  3HO1 A;  4DV0 F;  3QFW A;  2QRR A;  1ZPW X;  4Q8E A;  4C9D A;  3I4P A;  1XQI A;  2XSF A;  3SCI E;  2JLF A;  1H6K X;  2DNH A;  4U8V A;  2X7I A;  1S59 A;  2F8H A;  2XWX A;  3HFK A;  1X0F A;  2IVM A;  2OJ3 A;  2HNY A;  1U1M A;  2D9P A;  2HWT A;  1N56 A;  2LXI A;  3KLH A;  1H74 A;  3BGF A;  3T1A A;  4V1A k;  3NS7 B;  1VBY A;  1Q82 T;  1M5P C;  1J5E J;  1RWU A;  4A47 A;  1N5Q A;  3HXM A;  5KT2 A;  4K50 A;  5KFR A;  3A3O B;  1T03 A;  5AE2 A;  2YWK A;  2MZJ A;  2B5J B;  4OHW A;  2L48 A;  3UD4 P;  4WU3 A;  2QMW A;  1NKE A;  1ZM3 A;  2J7K A;  1YX2 A;  4JI4 F;  2A6M A;  3N5B A;  3TAM B;  4KGV B;  4LFA J;  1SKU B;  4QCL A;  2HHW A;  5ETT A;  3EXC X;  4Y0F A;  4DR7 J;  1UA1 A;  3DU5 A;  2HIQ A;  2V68 A;  2G4B A;  4DOZ A;  1SPB P;  4PYD A;  1REG X;  1SB6 A;  2RDJ A;  3IR6 B;  2OPP B;  5CYQ A;  5L1J A;  3F41 A;  2RHS B;  2BW2 A;  1U1K A;  1Y10 A;  7AT1 B;  4TXS A;  3UCG A;  4DR1 F;  1DRZ A;  2OPR B;  1E6Y A;  1X5P A;  3EZ5 A;  1HPZ B;  3T41 A;  3CB4 A;  3KWM A;  1SL1 A;  2MKH A;  2BBE A;  5BYQ A;  3NBP B;  2RE1 A;  4IRK A;  2LDY A;  4KHM A;  3TVZ A;  4ED3 A;  4L74 A;  4W4M A;  2CRL A;  3HT3 A;  4LIW A;  3JTP A;  2OIH A;  1S9G A;  1I3O B;  1DQ8 A;  3TQ1 A;  2YWH A;  2UVW A;  1FKP A;  1JK9 B;  4ED8 A;  1XK8 A;  5CH7 B;  1MRO A;  2HHS A;  2HRT A;  2IC3 B;  2EKY A;  1U2F A;  2RRN A;  1UJ4 A;  1U47 A;  4JV0 A;  2XMU A;  3GJR B;  5KFI A;  4LF6 F;  3MED A;  2K06 A;  2XO6 A;  3VV2 B;  3GYN A;  1SJF A;  2V8P A;  5EX0 A;  1WC6 A;  4YHH F;  5K14 B;  1RAD B;  3NCR A;  2H5E A;  1KS2 A;  4DSE A;  3TJA A;  3HHD A;  3TW0 A;  3T9N A;  2COL A;  2DIS A;  2LCW A;  1T3O A;  4DUY F;  1GX6 A;  4C2M A;  2YWW A;  5HLF B;  4MYT A;  2KXN B;  3TA0 A;  4I68 A;  3RRH A;  4O3Q A;  3AD7 C;  2OPS A;  1RYR A;  1L5U A;  3QRQ A;  1S6Q A;  1EB0 A;  1P6T A;  2Z30 B;  4USU A;  3QJL A;  4KGX B;  4NX9 A;  3TVY A;  4ZCL A;  3TR5 A;  3ISN D;  3W1Y C;  5IT0 A;  1S6U A;  3PV8 A;  4B9T A;  3U02 A;  3B82 A;  3MM6 B;  2CYY A;  1HWU A;  5L9X A;  2LEP A;  2AD9 A;  3AH6 A;  4C97 A;  1CPZ A;  3ILL A;  1CVJ A;  2JL9 A;  3EGV A;  1XN9 A;  5KG1 A;  3C16 B;  1SIZ A;  3WX8 A;  3VVU A;  3MTJ A;  5IT9 U;  2XYH B;  1X5S A;  3EGN A;  2ZVI A;  3E01 B;  1WNE A;  1JJ2 R;  2DK2 A;  1FJC A;  2VA3 A;  1UWA A;  1U09 A;  2VG6 A;  2GGP A;  5CAA A;  2OEM A;  5E3P A;  4KGK A;  1UVJ A;  4HVZ A;  3CDB A;  1XMB A;  1E6V A;  5J2P B;  2I9S A;  4WJB A;  3IAS 9;  1GXU A;  1MU2 B;  4K4Z A;  4U96 A;  2XY6 A;  3KLE B;  4ZMM A;  2WVB A;  3KYL A;  4HTJ A;  1D1U A;  2C3M A;  1G6B A;  4B3M F;  1U48 A;  1U8S A;  3UVJ B;  3Q23 A;  3AJD A;  3B78 A;  5LMU J;  3OHB A;  5F0U A;  4RU2 A;  5I4M A;  2OPQ A;  1UET A;  2N3L A;  4DWI A;  1RYS A;  2WHO A;  3UCU P;  1I94 J;  4QIE A;  2MST A;  3AAW B;  4BS2 A;  4I56 A;  3CDW A;  4LF8 J;  2FZG B;  2WBM A;  4WIQ A;  1WI8 A;  2OKQ A;  2X1F A;  5LSR A;  3FGV A;  1HQE B;  3AHP A;  2QFJ A;  3HHN B;  3QGP A;  4DSF A;  2JZ5 A;  1JLF A;  2KVQ E;  1HNV A;  3BB5 A;  4DL5 A;  3C8Y A;  3PEJ A;  1S97 A;  2B8Q A;  1TU0 B;  4NXN F;  4UUW A;  5GAG I;  5K8P A;  3LPE A;  5LMN F;  1BQN B;  3DLE B;  2ZKU A;  1S1T A;  3H4B A;  5F8I A;  2X3G A;  2FGO A;  3MCN A;  2HGN A;  3T1H F;  3HLU A;  5DGA A;  2AYB A;  1ROF A;  5IWA J;  3I82 A;  5CA5 A;  2MQN A;  1HNW F;  5F0W A;  5F8M A;  2ZUG A;  4O0N A;  2J8A A;  3BGL A;  2AIR B;  1F2G A;  2HGM A;  1K47 A;  3JSY A;  1JXE A;  3G87 A;  4DBQ A;  4B3T J;  1QLN A;  1G4C A;  4TLR A;  1C4C A;  1NK5 A;  2HHU A;  5HMW A;  3KLI A;  2VQE J;  4C8O A;  5L8R C;  1N6Q B;  2O67 A;  2GC8 A;  2FJA B;  4USK A;  3ILI A;  3PX6 A;  1DLO A;  2JEF A;  4N8O A;  3TZY A;  5SUH A;  1NDC A;  2CVI A;  1H72 C;  3HI9 A;  2BAN A;  4F3Q A;  4NLQ A;  2QL7 B;  1S4F A;  1UZD A;  4DL4 A;  3GV5 B;  5A0Y A;  4I64 A;  4GC7 A;  4RBT A;  4JI2 F;  3V81 B;  3AD9 C;  3TUI C;  4ZHR B;  1LK7 A;  2YNH A;  2PD1 A;  1MMN A;  1VRQ C;  2GHW A;  2UV8 A;  5K14 A;  4G65 A;  1Q16 B;  3TP2 A;  2PEH A;  2NSB A;  4O3P A;  1ZM4 A;  1FNO A;  4OX8 A;  2E5I A;  1BY9 A;  4IOA Q;  3JYT A;  2QYC A;  1OPI A;  2LU2 A;  4YR0 A;  4RNF A;  5I42 A;  2WCX A;  1X4A A;  3RB6 A;  3GYX B;  4O3S A;  5EX3 A;  2V67 A;  3TAQ A;  2DGS A;  4M5J A;  2WSF C;  4PG6 A;  4CO2 A;  2W2N P;  4I7F B;  3LPY A;  1RTH A;  1RWO B;  1VC6 A;  2R7Q A;  3LOU A;  1CS4 A;  1S6P A;  2E5H A;  1TKT A;  2VH7 A;  3Q83 A;  4D3G A;  1FKA F;  1VK8 A;  4C11 B;  1VRT B;  3GYG A;  4KYZ A;  3O3L A;  3CCU S;  4RL1 A;  2HAF A;  2A10 A;  1B64 A;  2HIY A;  4DV1 J;  3KK1 A;  1JLG B;  2ZH5 A;  1ZH5 A;  1HMV B;  2RQ4 A;  2IHR 1;  2R2T A;  2DR8 A;  2KKH A;  4MK8 A;  4ICL B;  4CH1 A;  4OLP A;  2R7O A;  2QSF A;  1ZA1 B;  1VIX A;  1RT6 A;  1RTI A;  1T9U A;  1EP4 B;  4JI5 J;  5DRK A;  4KFB B;  1S9E A;  3KHL A;  1GNK A;  1DFD A;  3R5A A;  3MUR P;  2AJ2 A;  1F2H A;  1MSW D;  1GT8 A;  1CEZ A;  3QGH A;  4XIU A;  4DR6 J;  2VFV A;  3OXL A;  1FRM A;  5LXR A;  4JYA F;  4OYX A;  1QDU B;  1RWP B;  5J2P A;  1FXD A;  3NRB A;  2VV5 A;  1IBM J;  1NU4 A;  4CLW A;  1S4E A;  3US5 A;  2NLW A;  4EZ9 A;  4F4K A;  4KO0 B;  2DGQ A;  3M8P A;  4MAK A;  2BMB A;  1F6T A;  3BBB A;  1S7I A;  4Z7Y A;  3KLG A;  4AFF A;  2PE8 A;  4HT5 A;  1KKH A;  4RUC A;  4NPO A;  2ZC3 A;  5HAN A;  4DQR A;  4P7V A;  3PY8 A;  1FDD A;  4X64 F;  4PYA A;  3IN5 A;  3KNG A;  2CQH A;  3DRS A;  4FDF A;  3OFF A;  4KSE B;  2HFZ A;  2AX0 A;  4B17 A;  3HSZ A;  1RT4 B;  5DJB A;  4OHZ A;  1REV B;  3AB4 B;  2KTQ A;  3A8E A;  1X9S A;  2W8L A;  1TKD A;  4P71 A;  3H25 A;  2HHH J;  3NCP A;  3VR1 A;  2BVZ A;  4P2S A;  3QRR A;  1XJW B;  3M32 B;  2ZE2 A;  2XS5 A;  2DR9 A;  9RUB A;  2RB7 A;  3AOC A;  3IRW P;  2YNI B;  1TK0 A;  3MM9 A;  3ZFV A;  1PSD A;  4OYM A;  4ALZ A;  1IN0 A;  2BEF A;  3K17 A;  3OTO F;  3M8Q B;  2V9W A;  1YJW S;  2XMM A;  1W2I A;  2BM1 A;  5KFV A;  4UOC A;  1VQO S;  3W60 A;  4JI3 F;  3PHE A;  4PWD B;  2Y1R I;  1RSC A;  4W98 A;  1KFD A;  2V5H G;  2NYH A;  4DI6 A;  5KFD A;  3PZP A;  1UJ6 A;  4V19 J;  3HCX A;  2XLJ A;  3LGH A;  1PYO B;  1VQP S;  4K4T A;  1RWN B;  3KUE A;  4PQU A;  1APS A;  1OMS A;  3PJW A;  3GII A;  4DS5 A;  3VAK A;  1YBA A;  4CLS A;  2UU9 F;  2HQC A;  1IKY B;  1P1L A;  4CNZ A;  2Z8Q A;  1PBA A;  2LFV A;  2PDA A;  4ECX A;  3CMA S;  3BR8 A;  3MEE A;  1NJW A;  4I69 A;  2NXN A;  3OJS A;  2A6O A;  2UXC J;  2R7X A;  1TFW A;  2UUC F;  5LSO A;  4LF2 A;  5CYM B;  3KLF B;  2UUB J;  2QA1 A;  4NA1 A;  4Y2A A;  3MM5 B;  3BYR A;  2H4W B;  3C6U A;  3G86 A;  1Q5Y A;  3HMJ G;  3B4D A;  4U67 Q;  4ZVG A;  2ZNZ A;  5IV3 A;  3N9U C;  3FCH A;  3IAM 9;  4WF9 Q;  4M5M A;  1JMT A;  2V2K A;  1YQH A;  3VZH A;  3CC4 S;  1LFP A;  4USH A;  4RJV A;  2ZH1 A;  5T14 A;  3FJ2 A;  4PXD A;  3A13 A;  4G1I A;  3C2P A;  4OFZ A;  1V6H A;  2O01 C;  3ZTO A;  4OZ0 A;  4DSL A;  4J7C A;  1NH7 A;  2FJD B;  3BDE A;  1YJ9 S;  3SXL A;  2AJ1 A;  2ZD1 B;  1F3F A;  3RGI A;  1HQ2 A;  2I5J B;  4FF4 A;  4P2M A;  2VFR A;  1HYS B;  4L6V 3;  2XQC A;  3MUV P;  4OJG A;  5B0A A;  4WBF A;  5ETR A;  3NS6 A;  4JI1 J;  1AYE A;  2VON A;  1VR6 A;  1MWY A;  2Y9H A;  4HDH A;  3HSG A;  4NYZ A;  3LAK A;  1FKO A;  2W25 A;  1RWX B;  3DOM A;  5FLX U;  4R8U A;  3PX4 A;  5H9E J;  5BYR A;  1RCX B;  1Y5I B;  3IRX B;  2K3K A;  4NAS A;  1FA0 A;  4RW7 B;  4DMZ A;  2MSS A;  5K8M A;  2Z2L A;  5E5N A;  2HND B;  2O1P A;  1IBK J;  1PC4 A;  1Q53 A;  5K8N A;  1T05 A;  3HK2 A;  2M9K A;  4HKQ A;  5A8R B;  1R43 A;  2ASL A;  3M30 A;  1DY3 A;  2ZBC A;  1C1B A;  3CIZ A;  4ID5 A;  3GR0 A;  4F50 A;  4YFU A;  3EX7 B;  2DGT A;  4TLQ A;  2KZZ A;  2XSJ B;  5KG4 A;  2BE7 D;  4RW8 A;  1WF1 A;  3M1V B;  1JLQ A;  4CLT A;  4U8Y A;  5CHC B;  4M5I A;  1F3V A;  3HHL A;  1VQL S;  5KT3 A;  4JV2 A;  3W2W A;  4OZ5 A;  2ZBQ A;  1VQY A;  4BLG A;  1SJ4 P;  4I2Q A;  2ZJQ Q;  3GIL A;  4MK7 A;  3A12 A;  5F9N A;  1N5Y A;  1X9M A;  3QO9 A;  2VF3 A;  3LH2 S;  4K4X A;  4BWJ A;  3QSI A;  3MFH A;  4NCG A;  4KT0 C;  4PCQ A;  1IJF B;  4DQQ A;  3EZU A;  2FGC A;  3OVA A;  3MTK A;  4ELT A;  1NPK A;  4ZIW A;  1FRX A;  2RAQ A;  3IWN C;  2NXU A;  5IOL A;  3BO4 A;  3W8G A;  1J5E F;  1LKZ A;  1RT5 B;  2MTL A;  2MZR A;  4OYP A;  1IKX B;  1M1G A;  2YKN B;  4EK2 A;  5B0B A;  3JTO A;  3H42 A;  3N6L A;  1QAJ A;  1A9N B;  1QM9 A;  2GFF A;  1U25 A;  3PTW A;  4PG8 A;  1SJQ A;  3IMQ J;  3AA8 A;  4LFA F;  3W3S A;  4C0O C;  3I0R A;  4JB8 B;  1Q5V A;  2EFP A;  1U0S A;  2AKW B;  2GML A;  2FJW A;  2DHG A;  1S1W A;  1RDR A;  5GAD I;  3SV4 A;  5D15 A;  4KKO B;  5HQ8 A;  4LRF A;  5H9F J;  4IOC Q;  4DQS A;  4U6P A;  3ULH A;  1V3S A;  2GS8 A;  5CD4 A;  5B08 A;  4USV A;  3T9Z A;  2B9Y A;  2GW8 A;  1RWW B;  4NLP A;  2MKC A;  4PUO A;  3MUT P;  1NKC A;  1RTD B;  4DR4 J;  1ZOT A;  4NML A;  1NKB A;  1HW9 A;  3EWG A;  3Q8Y A;  3LO3 A;  3IFE A;  4B02 A;  5IV4 A;  1FDB A;  4PG4 A;  3MZI A;  2GMH A;  2JEG A;  5FDL B;  4U7U D;  4FXV A;  5HI7 A;  2CJY B;  3KJQ B;  2MHN A;  2RQC A;  1SJR A;  1FJG J;  1X4B A;  3G6Y A;  1JKH B;  1WDD A;  3MOZ A;  1FVS A;  4I4B A;  1UVN A;  4X4U A;  3UD3 P;  1P9Q C;  1RP5 A;  2XYG B;  1T9W A;  4Q0B B;  5DET A;  4DPU A;  2P9G A;  2WB1 D;  4N5S A;  1RAF B;  1FEH A;  4X65 J;  5DQH A;  5GAE U;  3CJK A;  1VQ6 S;  4Y2M A;  2BE2 A;  2BQR A;  4B3S F;  3V4M A;  1IQT A;  4MIB A;  4JI7 F;  4OZN A;  2DHA A;  2WON A;  2B4O A;  2OEJ A;  3EUN A;  3GFY A;  1JJ4 A;  3OXF A;  1M5O C;  2DH8 A;  3WC2 A;  3RU0 A;  1RTJ A;  4QZV B;  1Y4Z B;  3R2D J;  4JI8 J;  2MZS A;  4IFY B;  2NSC A;  2XB2 D;  1PIE A;  2JRS A;  1LWF A;  1CC8 A;  5KT5 A;  4ZPW R;  1TL3 A;  1K0T A;  3IRX A;  4NLX A;  2KM8 C;  4F2S A;  2FHO B;  3K0J A;  5I3Q A;  2RF2 A;  1XIQ A;  3O1L A;  3GPA A;  3PW5 A;  3J7Z 5;  4IRC A;  4NLV A;  3H40 A;  2CVE A;  1YKW A;  4BCA A;  4RW4 B;  5KFS A;  5DS7 A;  3PRV A;  4KHP J;  2EG2 A;  1U0H B;  3ZZR A;  3VVT A;  3CD6 S;  3BS9 A;  2ASY A;  3M2U A;  5C7P A;  1RT3 B;  3BYP A;  3QLH B;  3KJF B;  5KG6 A;  2DXD A;  2HGL A;  4ANC A;  1EHW A;  5L1I A;  4AXI A;  2CPE A;  2MZT A;  4DR3 F;  1WI6 A;  1N0U A;  4LF9 J;  1GK8 A;  2DGW A;  2UVR A;  4P2F A;  2MHE A;  2NZ4 A;  2BE9 B;  4L3K A;  3IM9 A;  1U02 A;  2MGZ B;  3EGW B;  5EN1 A;  2GJI A;  4DL7 A;  5IM0 B;  2FLL A;  2YQ3 A;  2A2D A;  2CQ1 A;  1SIW B;  1RT2 B;  2NPF A;  3UDL A;  2F4F A;  3IA0 A;  2ALZ A;  4RW9 A;  2FJX A;  3GR1 A;  1Q86 T;  2HPU A;  2MZQ A;  4QIV A;  4LF7 J;  5AXL A;  2Q1L A;  2DY9 A;  2C2E A;  3C66 A;  5K5M A;  5LMU F;  4DDF A;  2V8H A;  4Y3C A;  2V2V A;  3HZE A;  2QX0 A;  1VBZ A;  1X5O A;  2RKI A;  2FVC A;  1D8Y A;  2ZKT A;  1I94 F;  1WC4 A;  2F7V A;  2IA0 A;  5A2Q U;  2W8K A;  2GX8 A;  4U9R A;  1TUV A;  3J80 Y;  4B3R J;  3CCT A;  3DMJ B;  4WFA Q;  2PI4 A;  2XHW A;  3MEG A;  3AQO A;  2AV5 A;  2I6W A;  1Q8B A;  3PO5 A;  2RH3 A;  1UCN A;  1TUG B;  1WEY A;  5K9F A;  2KFZ A;  3K5L A;  4B3O B;  1WG4 A;  4QIF A;  4FVC A;  1WG5 A;  2WRM A;  4J9Q A;  3DOL B;  4DL0 C;  3TX0 A;  5C25 A;  2MB0 B;  4WCE Q;  3W5Z A;  1TL7 A;  5D77 A;  1QAI A;  5GMD A;  4LQ3 A;  2KVI A;  5J1E A;  3L95 X;  1CJV A;  1V3Z A;  5IWA F;  2BKN A;  2B4U A;  3RTV A;  2DNK A;  3M6X A;  3K58 A;  3W61 A;  2I1R A;  1FJ7 A;  3MAA A;  1RHM B;  5KFH A;  2UUW A;  1FX4 A;  1TVR A;  3I0S A;  2W9A A;  5KFB A;  4F8R A;  3CO9 A;  2RSQ A;  1G2E A;  4LFB J;  2KH9 A;  2QA2 A;  2VB6 A;  2CPI A;  4V19 X;  3RR8 A;  2HMI B;  4WKY A;  4QPX A;  4MFB B;  3EZO A;  1TMM A;  4UT4 A;  3OFE A;  2VQE F;  1CSJ A;  1FF2 A;  3OJU A;  4Y6I A;  2HWI A;  3QQC D;  2ZH9 A;  4F4A A;  4WE1 B;  4C8N A;  1ZTW A;  2VAS A;  4AL6 A;  1JWW A;  3W2V A;  2SXL A;  1GX5 A;  1TMJ A;  3BKU A;  2J5A A;  3DGP A;  4USJ C;  4RWX A;  3E2E A;  1S1V B;  1OYD A;  3VGV A;  2VOD A;  1B3T A;  3VTI A;  2F4V J;  1VRU B;  5GMK a;  2QT7 A;  1MWZ A;  3EDQ B;  2DTJ A;  5ETQ A;  3NLC A;  2OTL S;  4DQP A;  4PXC A;  4GVB A;  2KL8 A;  2VJU A;  4ILL A;  2WBR A;  5DGB A;  2JEI A;  2IJR A;  4EBD A;  4DR5 J;  3ZXW A;  4J9R A;  4ECZ A;  1RJJ A;  5D4L A;  4OZL A;  4C48 A;  4X4V A;  2VL1 A;  4DCJ B;  3IC1 A;  1VFJ A;  1YIT S;  3CCJ S;  4KGM A;  4OIX A;  2EBE A;  2NXJ A;  3G6E S;  5KFG A;  5KFN A;  1QUV A;  1U49 A;  3H98 A;  2HEK A;  1RHK B;  1P9Y A;  2YNF B;  4RBU A;  1S49 A;  2XZD B;  3R27 A;  4Q44 A;  1VQN S;  3J7A N;  2WW4 A;  4RW4 A;  2RUS A;  5EGY A;  1GMW D;  4DFK A;  4DV1 F;  4DUZ J;  3KG1 A;  2YKQ A;  2IJF A;  2Q6C A;  5A8W B;  3SIP B;  4KY3 A;  5BR8 J;  1TK5 A;  1JXV A;  1UFW A;  5KFO A;  3HFZ B;  3V6D B;  3P49 B;  1HBU A;  2VPW B;  4MH8 A;  1C4A A;  4JI5 F;  5E2Q A;  4QW8 A;  2F8E X;  1NZ8 A;  3Q2T C;  5KFT A;  1WC5 A;  1X0P A;  3QAU A;  5I3U A;  3AXM A;  3GFH A;  4C7Q A;  1EQ0 A;  2X1B A;  2MQP A;  4ZVO B;  3JS9 A;  4JV5 F;  1SXL A;  2JVR A;  2IM3 A;  3K2Y A;  1KLM B;  1R89 A;  1P8G A;  5KAK A;  4FVM A;  4CIO A;  3CO0 P;  5E0O A;  1SC6 A;  1H98 A;  4P72 A;  1IBM F;  5DG8 A;  2GMJ A;  3MMB B;  1S7H A;  3CC2 S;  4DPW A;  3T19 A;  2POK A;  2ZHB A;  3IG1 B;  4FXD A;  3FC9 A;  5U47 A;  1M1H A;  3N79 A;  1S77 D;  3A3P B;  3FEY B;  1Q8K A;  1U1Q A;  1VBX A;  4H4O B;  1G7C B;  2C28 A;  1Z4U A;  3BH7 B;  2KXH A;  1IR2 A;  4O23 A;  4A8W A;  4G3I A;  3L09 A;  3QNW B;  3WX4 A;  4F4Y A;  3Q24 A;  2WAQ D;  2MLZ A;  4M5L A;  5HVF A;  2XGP A;  4IDK B;  1AUS L;  2A2C A;  4P10 A;  4JP8 A;  5C5J A;  4FYW B;  3AOD A;  5HK4 A;  4DV2 J;  4TYA A;  2CDR B;  4K5S A;  3MMJ A;  2GQC A;  1AB8 A;  2Z56 B;  3FCV A;  3PJ9 A;  3OXG A;  1XMQ J;  4X2B A;  2FJE B;  2IDE A;  4F4X A;  4Q5V A;  4PKD B;  3A8I A;  1FWP A;  3G82 A;  1D09 B;  4CTA B;  1CC7 A;  1FRI A;  4DPT A;  2VG5 B;  2ZC4 A;  2AJ0 A;  4CDI A;  1N48 A;  3QJP A;  3DRR A;  4PZV A;  2RDD A;  4D3H A;  5AXN A;  5EUH A;  5T7L B;  1SL2 A;  2N4D A;  4ZJQ A;  3HJV A;  2DB1 A;  1X8D A;  1I1G A;  3QIP B;  3R7B B;  5JUM A;  3CED A;  1XEZ A;  1YZ6 A;  4XAK A;  2C2D A;  2QFI A;  4RW6 A;  4JV1 A;  1NH8 A;  3DM2 B;  1WG1 A;  2CAJ A;  4KH0 B;  1LW2 B;  3ZTQ A;  5HBM B;  2CFX A;  2YXL A;  3WHI A;  2GVD A;  2C42 A;  4GO7 X;  4B08 A;  3PYE A;  3GIM A;  3FBB A;  2PI5 A;  2W2O P;  4OZ3 A;  1X4H A;  2YNG A;  2DVI A;  4WZQ A;  5DLG A;  5L39 A;  1A7G E;  3MM7 B;  2X1G A;  3IS9 A;  1HQU A;  2H51 B;  3CJR A;  1WKK A;  2DNG A;  3BQ1 A;  1MN7 A;  2BW7 A;  2CIM A;  4ZCI A;  5GME A;  2V9K A;  3NGT A;  3D2W A;  3MPU B;  4OYZ A;  3S01 A;  2E44 A;  2F40 A;  2UXC F;  1U2C A;  1CQN A;  3T5J A;  2HUR A;  3DLK A;  4OV6 A;  2DO4 A;  5KFU A;  2RUG A;  2VUG A;  1RZM A;  2DEI A;  4KV8 B;  2JJ4 D;  2BM0 A;  3M8S A;  2ZFH A;  1C1C B;  4DHV A;  4I6Y A;  2J8S A;  2YWF A;  4LSL B;  3LP0 B;  4KR0 B;  4EU0 A;  2GHV C;  2OD6 A;  1OO0 B;  1H7X A;  2UUA J;  2XG8 A;  2ZBR A;  4N47 A;  3O8W A;  2W7A A;  4K59 A;  3ZNU A;  4DV5 F;  4P73 A;  5CQG A;  4FF3 A;  2KT2 A;  2BDP A;  4ZK7 M;  1P1T A;  2KJW A;  3BR9 A;  3PIP Q;  2W9B B;  1N33 J;  1CUL A;  1FJE B;  1WC0 A;  2BJ7 A;  2M0G B;  3NGS A;  3ZZZ A;  4F4W A;  1HAR A;  1R6V A;  4NXM F;  2IAJ B;  1MWQ A;  3HP6 A;  2W1B A;  4OI2 A;  2D41 A;  5C24 A;  2CQ3 A;  3D4J A;  4HTI A;  1O0P A;  3EVO A;  3BGU A;  3ZTS A;  5L1L A;  3I87 A;  1HBO A;  3G6X A;  4HT7 A;  1R0B G;  2XYP B;  1T0T V;  5J2Q A;  2R2S A;  4CLY A;  1T3N A;  3FMW A;  2BOP A;  4OYW A;  2MY7 A;  3VWS A;  2JWN A;  3OR2 B;  3CJ4 A;  1IBK F;  2DNP A;  4NA2 A;  1FWL A;  4PXE A;  2CJK A;  2HVE A;  4O4G A;  2VD3 A;  1VK3 A;  2IMW P;  2QTW A;  2E9R X;  3C14 B;  2R2R A;  4Y00 A;  1FD8 A;  1RXO B;  1WJ9 A;  3LA0 A;  1LWC A;  3ELH A;  3N4W A;  2U2F A;  3L3C A;  1UP1 A;  1VGY A;  2RD5 C;  2BR0 A;  2AMC B;  4YP3 A;  2IPO B;  1HNX F;  2HFN A;  3L9Z A;  1VIS A;  2ZZT A;  1ITP A;  2ZOF A;  4R0E A;  1TKX B;  2HVD A;  3PJX A;  2K8G A;  4ED0 A;  2OI2 A;  3SMZ A;  4GO5 X;  4ERD A;  5JMN A;  1U45 A;  3BQ2 A;  3OLA A;  2VBY A;  3W9I A;  3NMR A;  4ECV A;  3S6E A;  3EVM A;  1TL1 B;  1F9F A;  4LFC J;  3NNH A;  1YGY A;  1R7I A;  3KDO A;  1K8A T;  3TWZ A;  2KRB A;  3SFU A;  3DXS X;  2F5G A;  3MEK A;  3RUB L;  4MJK A;  2HNZ B;  2YPY A;  2VBX A;  3DOK A;  1QSL A;  4DU7 A;  1RWV B;  2DGU A;  2GIF A;  1IM4 A;  1TAQ A;  1WOS A;  4IRD A;  4CNY A;  3NNA A;  2IM2 A;  1RT7 A;  2HK2 A;  8AT1 B;  4I1T A;  3RYL A;  2C2K B;  2HLU A;  3C19 A;  2XHC A;  2CPZ A;  3MPD A;  1R8P A;  1N32 F;  1BWE A;  2EWH A;  5EDW A;  1VQK S;  2ACM A;  2FC8 A;  4QYR A;  4GRS A;  4ZN3 A;  3KK3 A;  3FZB A;  1IKV A;  1SCJ B;  2KB2 A;  3AJ2 A;  5E3Q A;  2BAC A;  1TKZ A;  2G0I A;  5KT4 A;  1R0A B;  1DZ5 A;  4QYZ J;  2PO4 A;  3FBF A;  2FVP A;  2F63 A;  4Q7A A;  2QEX S;  1ZZF A;  1HHS A;  2IJN A;  2KO1 A;  2P6T A;  3GFZ A;  4IH7 A;  3RBX A;  4CO1 A;  1JLC A;  3BF4 A;  1QE1 B;  5KG7 A;  2E5J A;  4HYK A;  5B0G A;  4DR4 F;  3LW5 C;  2HSE B;  3KJV B;  1C0T A;  4HAC A;  4IG0 A;  4F04 B;  2DYA A;  5CCL A;  3NS5 A;  3MD3 A;  3DLG B;  3ISZ A;  2VBW A;  4DXL A;  1WHW A;  5KFE A;  2K2P A;  3CE8 A;  3J81 U;  4IG3 A;  4J9M A;  4CRJ A;  2Y1J A;  2DIV A;  1S0V A;  3L7P A;  2G2Y A;  1W2B R;  4EGL A;  3SI8 A;  5DM6 Q;  2HKE A;  3FUY A;  2F9D A;  5A2Q Y;  3CJ5 A;  2EW9 A;  3J7A 1;  4AQY J;  3G71 S;  3ZZO A;  1TQL A;  5HL7 Q;  4MKY A;  4X65 F;  5K20 B;  5HN0 A;  3RRG A;  4OYI A;  4MMO A;  1BGX T;  3MEC B;  3QT6 A;  2PMW A;  1D9A A;  3P3D A;  4WK3 A;  3DGV A;  4TQS A;  3V6H A;  3Q0A A;  2PA8 D;  4ES3 A;  1LW0 B;  4YOE A;  1FX2 A;  3VF0 B;  2LQ9 A;  2OEK A;  3TJ9 A;  3OTB A;  3NMA A;  4ECW A;  4URQ U;  1NJX A;  2ZDP A;  3CC7 S;  3OSP A;  1T7P A;  2Z2Z A;  4CCH A;  2B4P A;  3UN2 A;  3RZA A;  2XUL A;  4A46 A;  4P9S A;  2UV8 G;  4ECR A;  3R6L B;  3R3T A;  4CYU A;  4B9M A;  3OTC A;  3OT9 A;  4ES2 A;  2DNO A;  1SI9 A;  2AGO A;  4KPY A;  2L41 A;  5L9N A;  2LEB A;  5CYJ A;  4X4N A;  4N7T A;  3KK2 B;  1CJT B;  1ZET A;  3GB0 A;  1V9O A;  2BQ3 A;  1N36 F;  4ZP9 A;  2GCF A;  2F9J A;  4HR2 A;  1OSD A;  2XS7 A;  2ROG A;  2A3J A;  2HBY B;  4FNI A;  3C14 A;  5KFC A;  2EFQ A;  4KHP F;  4NLD A;  3CD7 A;  3D6F B;  2DIT A;  1UL3 A;  3MCS A;  1FRJ A;  2GIQ A;  2EC0 A;  2LQJ A;  1UEK A;  4FF1 A;  3NAH A;  1IKW A;  2HNY B;  1RI7 A;  3KLH B;  4IKA A;  4CLK A;  2UZA A;  4MK9 A;  2D3O R;  3TA2 A;  3HM9 A;  1FE0 A;  3CD5 A;  5KFX A;  4WFY A;  1VC5 A;  1T03 B;  3SDE A;  1PBU A;  3SCL E;  4ZVS B;  3K59 A;  1ZTT A;  3CDA A;  3IO1 A;  3PYF A;  3VAM A;  2D1C A;  1YJ7 A;  2ZZN A;  3PVX A;  1Y5L B;  1LK5 A;  2B3T B;  1OY6 A;  3VGU A;  2W2Q P;  3PFO A;  4F3M A;  1PAU B;  3ZZT A;  1KSP A;  4KTQ A;  3QAT A;  4LF7 F;  2FHJ D;  2YWE A;  4YME A;  2EK6 A;  2KJV A;  3S7R A;  1TV6 A;  2JEJ A;  4H54 A;  5CYQ B;  3T1Y F;  3K7R A;  3PRD A;  4QR0 A;  3R1H A;  2GVZ A;  4OYO A;  1H73 A;  1YJR A;  4QQB A;  3K5P A;  1E6Y B;  2XCA A;  1IBL J;  3D0I E;  1LNQ A;  5GAH I;  2HBR B;  4B3R F;  3BSC A;  1KON A;  4PAA A;  1AFI A;  3CME S;  2AX1 A;  1KVJ A;  3CCL S;  5M2P A;  3MR2 A;  5CCM A;  4ZLL A;  4TU9 A;  4ZLN A;  1UWB A;  1S9G B;  1WHX A;  1FK9 A;  1FKP B;  3WIU A;  1B99 A;  3ZNJ 1;  1MRO B;  3ADA C;  2GV1 A;  5DDO C;  3LP1 A;  2UXB J;  3BGR B;  1NUE A;  2H1Y A;  2M70 A;  3MED B;  3OTD A;  1ZM9 A;  3J7Y I;  4G1P A;  4WZM A;  4KE5 A;  1WF0 A;  1C0U A;  3K8V A;  4HLB A;  4EEY A;  2AGP A;  2B6A A;  1T11 A;  3RW7 A;  3C15 A;  4KPC A;  1IQZ A;  3G2X A;  4P2X A;  4F0H A;  2IA6 A;  4AL5 A;  1HW8 A;  3LGN A;  2OPS B;  3Q8U A;  2EBG A;  1HI1 A;  1OJ4 A;  3LP2 A;  3RR7 A;  3M6V A;  2IRX A;  3S8S A;  4H4M A;  4J9P A;  3BDP A;  2QLB B;  1V3R A;  4RNO A;  2U1A A;  4CO0 A;  4G6V B;  3M8Y A;  4OMF G;  4WFZ A;  2XY7 A;  3DLB A;  5HJX A;  2V4Q A;  3UDE A;  2IVY A;  1FCA A;  1J27 A;  4I67 A;  3PKY A;  2F4V F;  2CZ4 A;  3EIC A;  2XEX A;  1WD6 A;  1LW0 A;  3JAM U;  3CUN A;  2G9O A;  3PNI A;  1S76 D;  2DNR A;  1LFW A;  2DNQ A;  4NLT A;  1WOO A;  3HVT A;  2Z2Y B;  3CT9 A;  2BJD A;  1B0T A;  3NXZ A;  2PSZ A;  1FDN A;  4DR5 F;  5B0E A;  5HSP A;  4TY9 A;  4AE5 A;  1S1X A;  1SKW A;  2Y3Y A;  4DZD A;  5J1P A;  3RRK A;  2GQ2 A;  3EGZ A;  8ATC B;  1QY7 A;  2Z57 B;  1WC3 A;  4YY3 F;  2CG8 A;  3M2R A;  2VG6 B;  1M1K T;  5C42 A;  2XMT A;  2GGP B;  1P27 B;  4I6W A;  3QJJ A;  4O0I A;  1S1U A;  4FKX A;  1E6V B;  1XER A;  2DCU B;  4K4S A;  1RUS A;  4DV0 J;  1X7V A;  1ELO A;  3T5L A;  4RZR A;  2BV3 A;  4DFP A;  2HVZ A;  4IFV A;  2V94 A;  4F36 A;  3DRP A;  2W4D A;  3K8W A;  3ZZ0 A;  1WOR A;  3D0G E;  3OPK A;  4K7Q A;  2R3V A;  4LF5 J;  4R5P A;  2J6U A;  2HZC A;  1AZS A;  3EYZ A;  1S6O A;  2FHM A;  4FBU A;  1IJE B;  5D4O A;  1PGZ A;  2Q6B A;  4DEZ A;  1N34 J;  5HVG A;  1URN A;  2OPQ B;  4OJ1 A;  2VA2 A;  2J7W A;  3G4S S;  1CQM A;  4UY8 5;  2KZM A;  3FFI B;  1AUD A;  1KNZ A;  4LUB A;  1WAC A;  3LQV A;  4NLY A;  2XMJ A;  4QWC A;  1JLF B;  4DPO A;  1HNV B;  5E33 A;  2EPI A;  3U1L A;  2WZ1 A;  2W2P P;  3F0N A;  2J9E A;  4C0H A;  4OZJ A;  2XTJ P;  4M5N A;  1YK9 A;  5KFP A;  3CSK A;  1S1T B;  4UZC A;  3W63 A;  4I6A A;  2VOP A;  4M63 A;  2MMY A;  2HLT A;  3VGS A;  2QGF B;  2H5J B;  3BRE A;  3H59 A;  1MW7 A;  5KFQ A;  1H2T Z;  4ZCK A;  3GU0 A;  4N8N A;  1JLE A;  3HD1 A;  1UVI A;  2DNZ A;  2CKW A;  2W24 A;  3QAE A;  2ZWP A;  1VLO A;  1XMQ F;  1NAQ A;  3H2V E;  3R5D A;  4C8Y A;  1YLX A;  2J76 E;  3KLI B;  5HQM A;  3CCZ A;  1FEE A;  3M8Z A;  4GKK J;  2JNJ A;  3KNA A;  3SQG A;  2WSC C;  1T02 A;  2Z0G A;  2X3D A;  4NYO A;  4DU8 A;  3D66 A;  1DLO B;  2BAN B;  5KFY A;  3UR3 C;  2FZK B;  3BGR A;  5A0Y B;  2P9C A;  1EX8 A;  2Y0B B;  4YB5 A;  3IBF B;  2YNH B;  2AYG A;  3D3B J;  4LF6 J;  5E3A A;  2XMW A;  3IGN A;  4J90 A;  3N28 A;  2B7C B;  2V8D A;  3CCR S;  1YTY A;  4NI2 A;  4YHH J;  1YVF A;  4NLU A;  1KHV A;  2YQ1 A;  2BAB A;  3ENQ A;  4DR2 F;  1HWL A;  2ZHO A;  3JYT B;  4M8L A;  4DPX A;  1Z1Z A;  5I42 B;  4DUY J;  2ZBI A;  1IUJ A;  2R9L A;  2QC3 A;  4C6A A;  3QZ8 A;  3TQE A;  2LXF A;  4H4K A;  1IVZ A;  1RTH B;  3TOQ A;  4PG7 A;  2HFU A;  3LWM A;  2BKP A;  1CS4 B;  1S6P B;  1TKT B;  3RG6 A;  5DZ7 A;  2B9E A;  3MWB A;  3MM8 A;  2RRA A;  1A0O B;  4NA3 A;  3CVK A;  3DC2 A;  1R0C B;  1U6B A;  3KK1 B;  1KTV A;  2KT5 A;  4ZJO A;  4Z37 A;  2YH1 A;  2FTR A;  2K7K A;  2D3U A;  2V2Z A;  2UUA F;  1RT6 B;  2VC1 A;  1RHU B;  1RTI B;  3VZI A;  3R97 A;  3CNQ P;  1LWE A;  3F73 A;  4KRW A;  1S9E B;  2RU9 A;  1OY9 A;  2XC9 A;  4CM0 A;  3M4X A;  4CH0 S;  1KFS A;  2CPY A;  2W9C A;  2DH9 A;  4N56 A;  3K89 A;  2VBZ A;  4X62 F;  1N33 F;  4J9V A;  3VHQ A;  2PT0 A;  1UVK A;  1RT1 A;  3Q89 A;  2EFG A;  2HHP A;  3MDF A;  2ZVS A;  2DD8 S;  2E1A A;  3NKY A;  4DV3 F;  3OR1 A;  4L76 A;  5BXI A;  3M8P B;  1K1Q A;  1NJZ A;  3R5J B;  4OX9 J;  4BC9 A;  2VG7 B;  4C8Z A;  4LR8 A;  3OLB A;  1YJT A;  1SV5 A;  3KLG B;  1LEO A;  2D69 A;  3GIR A;  4UOF A;  3CJT A;  3DI6 A;  1EAR A;  1J5O A;  4OI3 A;  3JSM A;  2HZV A;  3ZTR A;  4UZB A;  2M8D B;  4IOB A;  2YX4 A;  3UN5 A;  5J2M A;  1H2V Z;  4ETZ A;  2ILY A;  3J81 Y;  1HL6 A;  3DRS B;  4ECU A;  3LAL A;  3FFI A;  5G0R A;  2MKK A;  2ILZ A;  4X4P A;  2VPZ B;  4ECQ A;  4WII A;  2JDJ A;  3H8Y A;  4Y2I A;  4F4Z A;  3M2V A;  1Y3K A;  1RK8 A;  1HR0 F;  4KGZ B;  1L3K A;  5J2N A;  2ADB A;  4DSK A;  3MPV A;  2QA4 S;  4DV4 F;  4FNH A;  1GXT A;  2E5L F;  1CJK A;  2ZE2 B;  4NXN J;  5A6W A;  2M4M A;  3MM9 B;  2E7X A;  2PC6 A;  2CPF A;  3AY0 A;  1X4C A;  1F9E B;  1VQM S;  3T1H J;  3IXQ A;  4LBI A;  2FLN A;  2N7Y A;  3J7Z T;  4F02 A;  1AW0 A;  4MYU A;  3TUZ C;  2HVH A;  2KRR A;  1HNW J;  1NO8 A;  2ZH8 A;  2FZC B;  2G0J A;  5D8H B;  5KOX A;  5SZT A;  1EIY B;  2G0C A;  4WKR A;  2QLF B;  2ABY A;  1F5B A;  6FDR A;  4ZPA A;  4YQW A;  5AJ3 J;  1X4G A;  3TVK A;  3GP9 A;  2XS2 A;  2Q43 A;  1JJC B;  3QT7 A;  2KG1 A;  1F0X A;  4Y65 A;  4PQU B;  4I2P A;  4E8U A;  2RRB A;  1TL5 A;  2DJW A;  3G9C A;  3BPD A;  4WP9 A; 
#chains in the Genus database with same CATH homology
 4CM0 A;  3G82 A;  4USW A;  4UST A;  5IV4 A;  4NI2 A;  4OYA A;  1CJV A;  1CS4 A;  3C16 B;  1CJT A;  4CLK A;  4CM2 A;  4WPA A;  2GVD B;  1FX2 A;  3MAA A;  1WC6 A;  4OYP A;  1CUL B;  1CJK A;  1FX4 A;  4CLY A;  4CLL A;  1AZS A;  4WP8 A;  2W01 A;  3UVJ A;  4CLZ A;  4OYW A;  4OYB A;  1Y10 A;  1U0H B;  3R5G A;  4P2M A;  5D0H A;  3MR7 A;  4CLU A;  4CLT A;  1WC4 A;  1CJU A;  2GVZ B;  3C15 B;  1TL7 B;  1CS4 B;  4CLS A;  4CLF A;  3C14 B;  4WP3 A;  3G82 B;  4OZ2 A;  4NI2 B;  1Y11 A;  1CJV B;  3C16 A;  2GVD A;  1CJT B;  5D15 A;  4USU A;  3MAA B;  4OYX A;  1CUL A;  1CJK B;  4OZ3 A;  1WC0 A;  3ET6 B;  1AZS B;  3C14 A;  1YBU A;  1WC3 A;  4USV A;  1WC1 A;  4CLW A;  3UVJ B;  4OYM A;  4P2F A;  5D0G A;  2BW7 A;  2WZ1 A;  1U0H A;  1WC5 A;  2QV6 A;  4CLP A;  1AB8 A;  5D0R A;  4OYI A;  3C15 A;  2GVZ A;  4OYO A;  5D0E A;  1CJU B;  5IV3 A;  1YK9 A;  1TL7 A;  1YBT A;  3ET6 A;  4P2X A;  4WP9 A;  4OYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...