4FNHA

Crystal structure of isdi-w66y in complex with heme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase isdI
publication title Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Oxidoreductase
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fnhA00
2N4DA 1LQ9A 1FD8A 2N7YA 1K0VA 2FHMA 4QOTA 1AFJA 3DXSX 4ZA1A 3QGPA 3QMQA 2OD6A 1N5SA 3HF5A 3IWLA 2VV5A 2ROPA 3BF4A 3HDSA 5B08A 1Q53A 1Q8LA 4Y2MA 2OMOA 2LQBA 1ULRA 1OQ6A 1FVQA 1KQKA 1Y3JA 3DCAA 2GCFA 2BJEA 1IUJA 1FEEA 1GXUA 2HIQA 2RSQA 1OPZA 2IFXA 2GV1A 2OKQA 1Y0HA 1YG0A 2W4PA 5IXUA 3KNGA 1Y3KA 3FGVA 1YRXA 4NL5A 4YEAA 3FMBA 1X0PA 2HLUA 2JDJA 2QLWA 3LGNA 5T7LA 2LQ9A 2IYGA 3HX9A 1JK9B 1R6YA 4EFAC 2AP6A 1AFIA 1MWZA 3BM7A 4OIXA 1AW0A 1CPZA 3KG0A 4OJ3A 5T7LB 5KAKA 1N5QA 1Q4RA 1TR0A 1URRA 2QIFA 1FVSA 4Q2LA 2KYZA 2G9OA 1TL5A 1YJUA 2W4DA 3HFKA 2AJ1A 2BUNA 5A6PA 1N5VA 4OJHA 3HHLC 1SI9A 1OSDA 1P8GA 2W4CA 2OP5A 3TRGA 2BBEA 1MWYA 4Q2MA 2ACYA 4HH0A 5B09A 2GGPA 1SQEA 2OAUA 4HI1A 4OJGA 3TNVA 1V3ZA 3LGMA 1YJVA 1TZ0A 4A46A 2GGPB 3CJKA 5A6WA 2XMVA 1CC8A 1GXTA 2GA7A 2XMMA 5B0BA 1P6TA 5B0EA 5B0DA 3E8OA 1WD6A 4DPOA 2HFOA 2K1RA 3KKFA 2ROGA 3K7RA 1Q8BA 4DL0C 1QUPA 2GFFA 2L3MA 4ZOSA 1S6UA 1Y9OA 4HL9A 2KT2A 4YDXA 3BDEA 3TOQA 3MCSA 2K1RB 3BB5A 2AW0A 2BJDA 2XMJA 1KVJA 1CC7A 2BYCA 3BGUA 5B0GA 5K9FA 3F44A 3HHLD 2K7JA 1TL4A 2LDIA 2LXFA 2RU9A 2Q3PA 2N4CA 2QLXA 2XMUA 3FRYA 2PGCA 2FTRA 3BR8A 4HH1A 5F0WA 5F0UA 1RJJA 1YJRA 2ZDOA 2PD1A 3GZ7A 4DN9A 2HLTA 2KKHA 2AJ0A 1FE0A 3T9NA 1APSA 2RMLA 3BN7A 4U9RA 1N5TA 2OD4A 2HFNA 2FB0A 3IWXA 4OJ1A 1FESA 4A4JA 2XMKA 1S6OA 1XBWA 2EW9A 1X8DA 2XMWA 3KG1A 3I9ZA 3CJKB 3VTIA 2HQIA 2CRLA 1YJTA 3HHLA 2ZDPA 1VQSA 4FNIA 2VH7A 2KT3A 1SB6A 2XMTA 5B0AA 4FNHA 2IYIA 5B0CA 2FIUA 1U7LA 2K2PA 2OFHX 1TUVA 2QYCA 3HHLB 3MZIA 4A48A 4F67A 1VQYA 4Y2KA 1JWWA 1OQ3A 3UDCA 4NPOA 4Y2IA 1X7VA 2K7KA 2OFGX 4A47A 1FE4A 1W2IA 2ASYA 3LO3A 5B0FA 4HI2A 3WDOA 1KVIA 2ROEA 2RILA 2GO8A
chains in the Genus database with same CATH superfamily
2ZNZA 1T9TA 1FTRA 3B8HA 2XY7A 3BF4A 4I67A 3BQ1A 2X1AA 2VU5A 3BGFA 1RAHB 3SSRA 3M6XA 1RT2A 1MWZA 4WK1A 4CYUA 3CMAS 1VHIA 3EXCX 2M0GB 4ECZA 2BANA 2ZH9A 1LWCA 1I94F 1VRTA 2JOQA 1NO8A 5A6WA 5C25B 1B7YB 4PWWA 4X65F 4Y00A 3AOCA 5DG8A 2AF6A 2DCLA 2HQGA 1HQ2A 2KXHA 2W2OP 2CQ3A 1DARA 4CNYA 1R0AA 4ECSA 3PHEA 2E5HA 4WCEQ 1QTNB 3BGRA 4PWUA 2ZEJA 1F2HA 2DISA 2VBZA 5L46A 1HWLA 2Z2MA 1RT5B 2MQLA 1SCJB 1VLYA 3QBCA 5A8RA 3HHLB 4LVOP 4B3MJ 1BQNA 1VYAA 3A8JA 4RW6A 3NY0A 4PKDB 3E51A 1FXLA 1FD8A 3TX8A 3MM6A 3CCWA 2KHCA 3THTA 2OIHA 4PG7A 3TARA 2IFXA 1ZETA 1NZ8A 4P72A 2YBVA 3W2VB 4C8OA 1HBMA 2R7TA 2C3YA 3OHAA 2G0JA 4CLUA 5FDLA 5I3PA 2C2MB 4UZBA 5CCMA 4Q2LA 2F4VJ 1KR4A 2BUNA 2VFTA 3NGRA 5AJ3F 2BMBA 3D5MA 1BD6A 1YI2S 5HMWA 3V2UC 2KM8B 3WIVA 1C0UB 1GMWD 2KG0A 1G1XA 1M5KC 1RT1B 4RR5A 2A18A 1Y5LB 2ZWPA 2I1RA 2VQFJ 5K8PA 1F0XA 2HS0A 3CDWA 2ZDOA 1LV5A 2HLTA 3GFZA 1TKDA 3T9NA 3PRBA 1HQUA 3TVYA 3OVAA 4EYIB 2JLFA 5DLGA 1YJTA 5HL7Q 1YK9A 3C15B 5BYQA 4AUKA 3OFFA 2AT1B 3HKZD 2RRBA 3NLCA 2OMLA 3W5ZA 4OI3A 2UXBJ 4FKYA 4P74A 1T9UA 2FC8A 1QJHA 3MEGB 4RLEA 1YRTA 5KFKA 2RB7A 4L75A 5DQGA 3TEHB 2F8EX 3DGPA 2ZVIA 1ZOTA 4DX5A 3EZ5A 1ZM4A 3HHEA 5KFBA 3UI3A 1VHFA 5F8IA 4MJKA 5T41A 4WP8A 2UVWA 3L95X 2BJ7A 4LF8J 4FPRA 1JLEB 1AYEA 3CCVS 1D8ZA 1NHVA 3M9OB 1JX4A 1UA0A 2BJ9A 3DC2A 3HD2A 3A1YG 4UF4A 4M5JA 2MQQA 5F8JA 4DR2F 3MCMA 2CRLA 5GAHU 4XPCA 1BWVA 3A4TA 3ILOA 5LMNJ 2FDNA 3ZZOA 2CPHA 2CQBA 1B4SA 2ZOFA 1HNXJ 2IRXA 3LP0A 4DR1J 4RKUC 3S01A 4ZA1A 4JV0A 2QC3A 1XEZA 4DPYA 2UUCJ 3DLGB 3NKYA 2ZH7A 2UU9F 4OX9J 3M2RB 1UVMA 1BQMA 4PG4A 5H1SV 2ZOMA 4X62F 2QL5B 2PMZD 3FSXA 2XZWA 3C46A 3JQKA 3S1TA 5L9NA 2EFOA 1OSDA 3NL0A 2OLWA 4ZCMA 3SYZA 5J1PA 4H4MA 2CKWA 2AEMA 4QZVB 1RTJA 4WWSA 1N33J 1G2EA 3M2VB 1N34J 2CYYA 2LECA 4YP3A 3LP2B 5DLFA 1EJ7L 1VIOA 2CADA 3IR6B 4IDKA 1R8AA 4KGMA 5GAGU 4DV7F 5LMUJ 1Y11A 4DX8H 4A4JA 1JLGB 5HAOA 1Y7PA 2VPXB 2HHQA 2ZDPA 2QYGA 1U2CA 3VAIA 1UAWA 3BPDA 4DEZA 4MH8A 1U6FA 1KHVA 1HLWA 3I4HX 4TY8B 1RYSA 3T1YF 1EARA 4YDDB 3DOMA 2Z2YB 3GIMA 2XSFA 1IVZA 2AZ3A 2DO4A 2V2KA 2GAHC 4X64J 1U6BA 3DRXA 1NPRA 2GMHA 5DG7A 1JJ4A 2LCWA 3KUEA 3UNGC 1X9SA 4WFBQ 3OL7A 4C8NA 1SQEA 4RUAA 2ALYB 3QWUA 3H4BA 8ATCB 2O3DA 2GJIA 4KHRA 2QA4S 5RUBA 2J7WA 4K8RA 4C97A 2UXDJ 2BRLA 2V67A 2VJUA 4AL6A 1XR7A 2B5JB 2WZ1A 3HVTA 4QIGA 4GVBA 3IXQA 4USKA 3UN3A 2XLIA 4C8YA 4JYAJ 3TA2A 2C22A 1Q5VA 3M30B 4X4TA 1M1GA 4CLLA 2AGOA 4OV1A 4M1KA 3TUPA 2RU3A 3R3TA 2ASYA 3Q8QB 1DZ5A 3M6WA 4PZVA 5KFOA 3CC7S 3HF5A 1NXIA 2CNNB 5KT7A 1XR5A 3MD1A 4ZP9A 1F5AA 4WU3A 2VG5B 2YWEA 3QJLA 5BYRA 2AEJA 4C11B 2E1CA 2WVFA 1IBLJ 2L9WA 5D0RA 2NR0A 1IJEB 1TUWA 4O0NA 4NMLA 2HFVA 1DTQB 4DR5F 5CXTA 4PAAA 2ILZA 2P6SA 2OTLS 4ZLNA 2VIHA 4GRSA 1XR6A 4USWA 1C1BB 4Z37A 1VFJA 3SCJE 3H5YA 3HZGA 1RLDA 4LRCA 1S9FA 4N76A 1W26A 3BR9A 1M1KT 2FB0A 3K8WA 1UETA 5G0RB 3BKUA 4CO2A 2H5IB 5KFLA 4CCHA 2E5JA 3BH7B 3MM5A 3O3LA 2NXUA 4MIAA 1M5HA 3AJ1A 4MIBA 2BEFA 4M5MA 3K58A 2JC1A 2ZWOA 4O3PA 5IWAF 4QU7A 3J81j 2BKOA 2CA9A 4GO5X 2ZITA 1PJ6A 5MAOA 2FJAB 1EETA 1HBUA 4DUZJ 4U8YA 1FKPA 4A8OA 1DY3A 3POTB 2H1YA 4LFCJ 1Q95G 1NH8A 4M5LA 2YXLA 1NSAA 3P8BB 3W65A 3V4IA 2FLLA 1S1XB 2E1PA 1T03A 5ETSA 2ZHOA 4CTAB 5C2CA 2HVIA 1Q7LB 1RHKB 1D1UA 2HBYB 5DG9A 5CD4H 2FTRA 1TK5A 2XS2A 1HR0F 2VONA 4XIUA 4LF7J 3RZAA 1FE0A 3MUMP 4WE1A 2V2ZA 1TKZA 1WHXA 1S1TA 1S5ZA 2DKOB 4IG0A 2FUG9 1NU4A 2J6TA 1DJ0A 3DI6A 3UDEA 3AODA 2J6SA 3Q22A 4ZS6A 2OFGX 1KQSR 1SJFA 3KDOA 1F1BB 1FERA 1RSCA 4QYZJ 5ETOA 4JI8F 1W2BR 2NXNA 4EI2A 2JWNA 2R7UA 5KFVA 3GIIA 4OI4A 2FHJD 3J80Y 1I1GA 4P52A 1JLFB 4C8KA 3NBPB 2DHAA 3K5NA 1AW0A 1Q16B 4J9VA 4RBVA 3HT3A 2V4RA 5DJBA 3RU0A 5EHHA 1UVLA 4RU2A 2LXIA 4HI1A 4HYKA 4BCAA 4DF8A 2C3OA 5CZVA 4J9RA 1RT5A 4P71A 1OY6A 2OJ3A 4OHXA 1NKBA 4LR9A 1REGX 3RTVA 2HVZA 5DGBA 2YNGA 3VGUA 5GVQA 1FRKA 2CPFA 4TU8A 3NRBA 4KV8B 3KYLA 1VQMS 5AE3A 5I42A 4PYDA 4NYZA 5GMDA 4ZIVA 1WG5A 4YB7A 5DDPC 2M8HA 1ZM9A 2HZVA 1WSRA 1IJFB 3KMQA 3QO9B 3GJSB 2HHHJ 4NA3A 1SKRA 4Q8EA 1NMEB 3I5BA 4O23A 2MKKA 1UMJA 3QMQA 3TP2A 2YPZA 2RVJA 3H5SA 3OJUA 3P45B 1EX8A 2W01A 1FEEA 4XTTA 4EZ6A 2JVRA 1C0UA 4NWBA 1RT1A 3EM1A 3EICA 2FJEB 1NJZA 1RAJA 1TL7A 1VIXA 1JNZB 3UR3C 2IDLA 4O3NA 2CJAA 2ZKTA 2SXLA 4OJGA 3T19A 3DXBA 1OS5A 2EK1A 1S4FA 1IM6A 2BZ2A 4MKAA 4HLBA 2BJDA 3Q0AA 4HACA 5KT5A 1I94J 4IH5A 2M9KA 3AT1B 4X65J 3ET6B 2MYFA 2YKNB 1HPZA 3AOBA 1JLQB 2HWTA 3PKMA 3EDQB 3R2CJ 2EEYA 2P8IA 1X4EA 3MOJB 4B9MA 2N4DA 3LWMA 4R0EA 3I0RB 4KO0B 3RBEA 1Q53A 3P49B 2RUSA 5J1EA 3UR0A 4ZVTB 2N82B 3G8SA 1FWLA 3IFEA 1DTTB 1MROB 3W7BA 3R1HA 2LQ9A 4F26A 4RNNA 3R5DA 2WAQD 4U95A 4Z7CA 5GAEU 2UUBF 1TL1B 4FF3A 1HHSA 3IAM9 4I69A 2QLFB 2RKIA 3KTQA 1VQ8S 2GGPB 3L4BC 4W92B 1VR6A 1NPKA 3HCXA 3CD5A 1GQEA 4YB6A 4GKKF 2LXFA 2Q3PA 4P2FA 2XCAA 2R3VA 3DMJA 5AJ3J 4OV6A 4N7TA 3BBBA 2UV8A 4LBHA 1P1TA 4OJ1A 2Q79A 3DLGA 4ES3A 2YQ0A 4FBUA 3TI0A 1UW4A 3M2RA 1OYDA 3C16A 3C6UA 2ZE2A 3IS9B 3W2WB 4C98A 2CJYB 5AT1B 2RIJA 1L5UA 3IBFB 1U1LA 4BC9A 4UUWA 2CQGA 1FK9A 3J7ZT 5B08A 5LM7E 1V5VA 3ENVA 4K5SA 1OSCA 3PW5A 3CJSA 2ZH4A 1RGVA 2WVCA 3ISND 3E3XA 3G71S 2O67A 1RTZA 4X66J 4DL7A 1NK9A 3KK1B 3D6HB 3M2VA 4BBYA 3HX9A 3J7AN 2ZM6F 1X4CA 1IBMJ 4EGLA 2W4DA 4HTIA 4C3MA 4F02A 2XNQA 2QT7A 3CGIA 1HWKA 2P6TA 3A8IA 3J7YU 2HK3A 1RWNB 3H7HB 4LQ9A 1N5YA 1FKAF 5J2NB 3C19A 3HD1A 2XMJA 1GFWB 3NCQA 1TL4A 4RWWA 2KKHA 1VQ7S 4WZQA 3UVJA 1B7FA 1LWFA 2DJWA 2FVQA 2IM2A 1XMOF 3Q24A 2CXEA 2UVVA 2GHVC 1KHWA 2G2OA 2IIHA 4DCPB 3H0PA 1R0CB 5EWEA 2V5HG 2QMXA 5JMNA 2FJXA 2W9CA 2MB0B 1FDAA 2OELA 2E1RA 2JH3A 2DVIA 1W25A 1ZAVA 2O1PA 4IH7A 4DFJA 2G13A 4WK3A 3OL9A 2WSCC 4LREA 3QIDA 3W8GA 4ZITA 2UU9J 1MWYA 3OUYB 1NDLA 4LF6F 2DEJA 1WDDA 1SV5A 3M30A 2LU2A 4X62J 3CW2C 2B4OA 1CEZA 2V34A 4ZIWA 2XMUA 4D3GA 2DGTA 2AZ1A 2HGMA 3SDEA 3OTDA 3DLJA 2RQKA 3JXOA 1H38A 4WPAA 2GQ2A 3CCSS 3TA1A 1U7LA 4JI1F 5KFDA 1VQ5S 1VISA 1DTQA 3ZZPA 4E2FB 1MMNA 1DLOB 1PG5B 3RAMA 4KPYA 2W7PA 5GADU 1ELOA 2NYIA 4MFBB 4L76A 2HFSA 1FKOA 4ENOA 1Q79A 1R8CA 1C1BA 2DH9A 3EPIA 3NGKA 1CPZA 3VWSA 1E6YB 3R7SB 3D0HE 2R4FA 1VBYA 3HFKA 2HBRB 1P8GA 4H4OA 2Y0BB 2Z2LA 2N7CA 4GC7A 4Y28C 1QVGR 2I0XA 1PYSB 3B6BA 3JSYA 4PQUA 5CYMB 1RJJA 2W1BA 4WF9Q 4DSLA 4NLOA 1JMTA 4A8FA 4FYVB 5ETNA 4PG5A 4LSLA 5HMXA 4IR9A 1F60B 4WYLA 3VAHA 3IMQJ 4LFAJ 1U1QA 2PA3A 1LWXA 3POTA 2X51A 2FVRA 4F7VA 2NXCA 3RGIA 3AXKA 3IA0A 4AFFA 3UN2A 3UPFA 3GR0A 1OPIA 4NZ6A 5IM0B 4QW8A 1RHUB 4IQMA 4YR0A 3BM7A 2BE7D 1N52B 1X4DA 3UD5A 1KS2A 2CNKB 4F50A 1I3OB 4OMFG 3TNVA 1SC6A 1YKWA 4I7FB 2IAJA 3BGLA 1WC1A 1CS4B 5K14A 4JBCA 5HI7A 1VK3A 4TYAA 2Y0SD 1U0HB 3BSAA 3HM9A 1N36F 4LUBA 4UQTA 2ADBA 2J8SA 3NS7B 3JTNA 1BUXA 1UWBA 1YITS 1CQNA 4B9LA 4JI6F 5LJ5Y 4HKQA 2KZMA 2R8JA 2LEBA 1MW7A 3HHKA 4IOAQ 4I0WA 4YUDA 1VBKA 5E33A 4ED8A 3WDOA 3OVSA 4RZRA 1AFJA 4RW4B 4RNOA 4EBEA 4CIOA 1KONA 1FT8A 2OO4A 3SI8A 1Q8LA 2HHPA 4BLGA 1YVFA 4CO5A 2XY5A 1S1VB 4RW8A 4G65A 3BSOA 2QLBB 1YBTA 1OMSA 3KG0A 9RUBA 5CQGA 4X2BA 3G82B 4KV8A 5JVHQ 5D0EA 4KGVB 5J2MB 1UP1A 1V3ZA 3ILJA 1UVNA 2ZH8A 2GIQA 1C1CA 1S97A 1MNEA 4NCGB 1T05A 4GKJF 2YKMB 5DZ6A 1Y00A 3Q8SB 2BW2A 4ZVFA 2RDJA 3KHGA 1O6XA 4TU7A 1BY9A 2A6OA 4DL3A 5KT4A 4DQQA 4F4XA 1IBKF 2IBKA 4K4UA 2MLXA 2AEFA 2D3O1 4TVAB 3QRRA 1UJ5A 3VZIA 3C66A 2AGPA 1HQEA 1NNDA 2NREA 1V9OA 3U1NA 4OZ1A 2CQPA 2QGFB 3JB9k 3IN5A 4IFVB 4JI2F 2OD6A 3I96A 3CD7A 4RBUA 2R7XA 2EWHA 4DUTA 1Y0HA 3BQ2A 5C5JA 3FBCA 1H2TZ 3LALA 2W7OA 1RWXB 2VASA 3QJPA 2EI5A 4UUXA 2J76E 5K5MA 4JI8J 3IGNA 4NLUA 4JUZA 2UZAA 2YWHA 4PUOB 2YKNA 4WFXA 4UTGA 3H90A 4RNFA 2J6UA 5D3GA 3W3SA 5KFPA 2M5YA 1WDTA 1Q8IA 4P75A 3R27A 5K9FA 2ADCA 2LDIA 5F0UA 3D3CJ 3Q8VA 2AYEA 3DNCA 5ETQA 1RDRA 3MAHA 1KC8T 1SL0A 3OR2B 1ICEB 1S6OA 1F5BA 2AJQA 1FD2A 3N6LA 1WF0A 1DTTA 1N48A 1MROA 1S9EA 3OFEA 3GIRA 4PRFA 3FQLA 4CH1A 5IZHA 5ADZA 3G4SS 3EVMA 4DCOB 3OLBA 3HXMA 4CNZA 4FP9A 4DV4F 1TV6B 2DITA 3MR6A 2HBQB 3THPA 2DRBA 2O5DA 3IRXB 1Y3JA 3M4XA 3P96A 2XSJB 2MLYA 1YG0A 3MPUB 2HVHA 2BX6A 2VODA 2YWGA 2M70A 3FMWA 3PX0A 4J9KA 3PZPA 4P7VA 2QRRA 3CJ4A 2VQEJ 3W63A 3SSSA 2YX7A 5LXYA 4Q44A 3IR5B 3NG8A 1WG1A 1XERA 2HRTA 1KFDA 4NI2B 1IKVB 3FC9A 3IS9A 1HI0P 3UWTA 3TEGA 3G6XA 4K4YA 3AD9C 1HNZF 2K7JA 3DHXA 3FRYA 2NPIA 3FEXB 1WI8A 3VF0B 1FHTA 2AJ0A 2IC3B 4IRCA 1U2RA 1WNEA 5E3QA 2ACMA 1FJCA 3A3PB 2Z57B 4DV5F 4A8XA 2XMTA 2XC9A 5FLXU 3KK1A 1TL3B 3LANA 1T94A 5L1JA 4DZ6A 4I2PA 3KJVB 3AA9A 2CDRB 5J2QB 1ZBTA 2V9KA 3CJ3A 4DI6A 2DXFA 3SQGB 4Z7YA 3PCOB 3U1LA 4ZPDA 5H9FJ 1GXUA 3KFWX 4ZVQB 4USMA 3DYAA 3C6TA 3UE2A 4DHVA 4M5NA 2VBYA 1R6YA 3T6BA 4NLPA 2QIFA 4H4KA 3ULHA 2ZH5A 5KFGA 2FVPA 3DOKA 4TN2A 2DPJA 4MAKA 3ZXWA 1QAIA 3X3UA 3OL8A 2VFVA 3RB0A 2CWKA 4V19X 2UUBJ 2BQ3A 1PYTA 3KLIA 1WUUA 4M5DA 1U25A 3FKBA 2R7QA 2XG8A 2XWXA 1TKXB 5A2QY 1GMWA 2DNRA 3GP9A 1RAFB 4G1QA 3OTEA 1RA6A 2OPPB 2V50A 2FVSA 2B9WA 3L9ZA 4AQYJ 1RKIA 2QV6A 4GKKJ 3TR5A 2QYCA 4OLPA 2ZD1B 3TQEA 2F63A 4L73A 5HLFA 1JXEA 1SQFA 1HD1A 4L3NA 2DYAA 3IC1A 1PCAA 3AOAA 3M9NB 3L7OA 2DHGA 3BO4A 1XK8A 4OFZA 3W64A 1LWEB 2DK2A 4LMZA 1HFEL 1HI1A 3BYPA 4O44B 3U27A 2LMIA 2HRUA 1PJ5A 2YNIA 3DDKA 1U02A 4URGA 2N3LA 5KFAA 4ZP7A 3M8RA 3IP0A 2XWYA 4N8OA 2G0CA 3CCTA 1WWHA 2ZM6J 3JSMB 3RB6A 1T8EA 3HVRA 2ZH1A 4CM0A 3HULA 1O0PA 2NCKL 3ENWA 1GT8A 4OHWA 1FDNA 3ZZRA 3BS9A 1S9GA 3AHPA 3DHWC 3ILIA 1CJUB 2MKYA 2XI3A 2FGCA 1NZAA 3PYGA 3V81A 2E7VA 4ZVUB 2VZ9A 1FRXA 1KVIA 1NB2A 1VOMA 4NE9C 2VA3A 1Q0NA 3PG9A 1N5SA 3M8PB 5CZXA 3RR8A 1SPBP 3CCZA 3E01A 5HROB 4C2MA 4K4XA 1J2VA 1KTVA 3LGNA 3ZFVA 2V8VA 3D54A 1FFSB 3MPYA 3KXDA 4AXIA 5CYMA 1WTFA 3VGVA 1FJ7A 1ZPWX 4Q2MA 1RWUA 4ECQA 4B3MF 3TZXA 3GJQB 3RRKA 3GV8B 4ZP8A 4PXDA 2CPZA 3PHTA 1K1SA 4YN3B 2D7SA 1VQNS 4G6VB 3GV5B 4ELVA 1U8WA 1IKYB 3DLKB 4LRFA 4DJBA 3DFEA 1UEKA 2DR7A 3AD8C 2MKJA 3OT9A 2GMLA 3O2IA 4RW7A 3T1AA 3V6KA 2F4VF 4KJIA 1DAXA 1X4FA 1VQYA 4LT6A 4B3RF 4JI3F 4KHMA 4QBUA 1CJVB 1FWPA 4USJC 4MYTA 4QOTA 1K73T 1UWAA 2YTCA 2VQFF 1CS4A 2OKQA 5K8NA 3MM8B 4X4QA 1VJQA 3IAS9 3AJ2A 4EFAC 1R27B 4KT0C 3CD0A 3Q2SC 1RT2B 1ACMB 3FBBA 1FI4A 2NPFA 4CO0A 2CG8A 2V94A 2BANB 4B17A 3OVBA 2XULA 3W9IA 2HQFA 1RQ0A 5BXIA 1VRTB 2K1RA 1Q8BA 3MGJA 4FZVA 1X5OA 1J5OA 2GHPA 2XBPA 4NOHA 2QLXA 4Y34A 1SIZA 2UVRA 1VCTA 2H5EA 5J2PB 1QAJA 2D9OA 2MPUA 2HSEB 1R0AB 2XZDB 3M8YA 3NGUA 2H51B 3BGRB 3OXFA 3QSYB 1Y5NB 1UZDA 3W5XA 4MK7A 4E0DA 2YNHA 2PFDA 5ETMA 1UVKA 5A8RB 1TP7A 3TAPA 4ED5A 3C3LA 3E2EA 4FF1A 5KFWA 4RW6B 3RAXA 1IWAA 5DO2A 3S8SA 4FS2A 2XYHB 1LKZA 4LF8F 3ZZZA 3DRYA 3G96A 3MM6B 1CSJA 4NCGA 1Z2LA 3BQ0A 4K4TA 2U2FA 2RS8A 2MKIA 3DOLB 1MMDA 3D7SB 2ZBPA 1SKUB 2G9OA 5FDLB 3D28A 4KHPF 2W4CA 2KN4A 2CQ1A 2FLPA 1R7IA 2P2CB 4X4OA 3R1LA 2WRMA 3CUNA 4RWXA 3BPSP 5ETVA 3KWMA 1HNXF 1F9HA 4OYIA 2GW8A 3VVUA 3TOQA 3BDEA 5KG1A 1CC7A 2I38A 5CAAA 1QSSA 4EO8A 1I51B 4CH0S 2ZC3A 3DRSA 2GC8A 4WBFA 4IFVA 2PMWA 5LOQA 1S48A 3KJQB 1S49A 5A8WB 4ID8A 2HNYA 3LQVA 1HQUB 2EW9A 2MTLA 2AHOB 2DNGA 3NGDA 3R6GB 3NOGA 1VI7A 1N36J 4H54A 1GEHA 3D0IE 3SXLA 4WIIA 3HSZA 4QR0A 1BQXA 1S1UA 3HJVA 1N33F 2YKQA 1JLBA 4B3OA 3H2VE 4IUFA 4JI6J 4MMOA 3WC2A 2LEPA 1N34F 1LK7A 5D6GA 4PUOA 2M2BA 2WCXA 4DLGA 3VQTA 4ZLLA 1HMVB 2YX4A 4ZPVR 4RUHA 2Z4PA 3NS6A 2KYZA 3THVA 1WC3A 5KFJA 3BJYA 4TY9A 1FWKA 3OLAA 3OR2A 4ETXA 2CVEA 3FFIA 5D78A 4F4YA 1S0OA 2DEIA 2Y1JA 3UD3P 3IG1A 3QT5A 3J7YI 5IC4B 2KYXA 4C0HA 3MEEA 1X5PA 3NAHA 1JLAA 2C3UA 2EFQA 5D0GA 3M7VA 3F44A 3RRGA 2N4CA 1EQ0A 1YJRA 3D3BJ 2BOPA 1UFKA 1FRHA 4GKJJ 4KQZA 1LFPA 3KJFB 3N79A 3SFUA 1RHMB 3M32A 3RB3A 4WFNQ 3OTOJ 2WVDA 5KG7A 1CBKA 2RAQA 3LO3A 2NQPA 2XS5A 3G2XA 1WTBA 3D67A 3NOCA 4EBCA 3LP0B 4O4GB 4ETZA 1GH8A 3VGSA 3RYLA 2GO9A 3QT6A 3TQ1A 2MZQA 4OHZA 4OX6A 1BQMB 2IJRA 2VDHA 3JTPA 1RADB 4AD6A 1QY7A 1URRA 1L3SA 4JI0F 2AJ2A 3HMJG 2FHJA 1GXLA 1RTHB 3QIPA 2DR9A 3TUJC 1FX4A 3E8OA 2DNLA 4CLKA 2NYHA 3RBDA 3NCRA 1JQGA 5KG5A 3GQCA 3U7JA 2DRDA 1NPPA 2HQCA 1KQFB 2C1EB 4OZ2A 1MG7A 3B4MA 3ZNUA 3SQGA 4TU9A 4AT1B 3HFVA 1VRUA 3RRHA 1X4BA 1SH3A 4RL1A 4TQSA 4EUVA 5E5NA 4NLYA 5CCLA 1BMQB 5CYQB 1ZS6A 1JLCB 4WFZA 1UL3A 4QQBA 1K8AT 3S7RA 4DU7A 1VQ9S 2UUTA 2EC0A 4P9SA 4NA1A 4ECUA 2ZZNA 1K1QA 3DM2A 3DOMB 1NDCA 4OL8A 3K5LA 2QTWA 4N56A 3H20A 1Y10A 3HLUA 4CH7A 3JAMU 4FYDA 2B43A 1SH0A 3QGIA 2HHSA 3TO8A 3GONA 4R8UA 2M52A 2E5LJ 1TKXA 4F3QA 1KLMA 1RA7A 4C8LA 2ERRA 2OPPA 3CSKA 2FGOA 1S4EA 2IVYA 3OXGA 1N88A 5KOWA 3GR1A 4G3IA 2HHVA 3OFHA 1XNRJ 3LPYA 2LQJA 2CNOB 4I64A 4DWIA 3AY0A 2KL8A 2I8EA 4HH1A 4WTYA 1U8SA 4FVCA 3OFGA 4F36A 4TNOA 4ANEA 2WSEC 4LFCF 3N5FA 4J9NA 4OYMA 5LL6d 2RF2A 3QRPA 3H98A 1LWEA 2G2ZA 4U7CA 1SH2A 1FE4A 3CCMS 4W4MA 2RILA 4ANDA 2VUGA 4G1PA 4Y2AA 4QYZK 4RU9A 3EYZA 3FJ2A 4DV5J 1ULRA 4WXWA 1QVFR 2XGQA 4LF7F 1N0UA 1NKEA 3RJMB 5MLCV 1D9FA 1TL5A 2KJVA 3KK2A 2AJ1A 4CP5A 4OJHA 1RE1B 1T7PA 3SSQA 1A6LA 1L3VA 3VHQA 5E3CA 2I6WA 2F7VA 4CDIA 5F9NA 2B9YA 1CJUA 4WKYA 1VQKS 4DSEA 3RBZA 1J5EF 4HVZA 3VGTA 1YQHA 4HL9A 1HD0A 1ZA2B 1OIAA 2KRRA 2EG2A 2X1FA 4C9DA 1RBOB 1BXNA 4DSIA 1RWVB 3K59A 4QR2A 2XMKA 4USIA 3SCLE 1S59A 1VJWA 4J37A 5ETRA 2WB1D 2V6AA 4JOUA 4ZLPA 4O3QA 3MECA 3MCOA 3LP1A 3MM5B 3PACA 5I3QA 1X7VA 4CZCA 2VHGA 1V5IB 4K0KF 3JYTA 4ZVPB 1J27A 3ILLA 2B9XA 5DQHA 2JHEA 3GSDA 5D4LA 3PM9A 2GCFA 2M4MA 1QAYA 1H3DA 3KNGA 1JKHB 4XDCA 3TVKA 1H74A 2YWKA 3WQPA 1CVJA 1HBUB 4KB7A 2FY8A 1FFGB 1FVSA 1Q78A 4QIEA 3TVZA 2J7KA 1QDUB 3DLEA 5B09A 3HPOA 2MJNA 5C42A 4JI4F 4ID5B 3DLBA 2ZH2A 3R2DJ 2CPEA 1QE1B 1UVJA 5FD1A 1ZTTA 4KTQA 2OI2A 2E44A 2JEGA 2KXNB 2B51A 3BR8A 2Y1RI 3HHDA 1IR1A 2HKEA 2DIUA 2PN6A 1WHYA 3IWXA 5AE2A 4J9PA 4J9MA 3QPIA 1MU2A 4WE1B 1TKZB 4PR6A 2OHDA 1S1TB 2MQNA 4IG0B 3U1MA 5B0AA 2RD5C 3MM8A 3MOZA 3M2UB 2M3DA 5FJ4A 3UDCA 1B64A 1AZSA 1NEEA 3J81Y 1E6VA 3DI6B 2X3DA 3KHLA 4USHA 4UY85 2B6AB 2NXJA 1WC6A 4IKAA 4LBPA 1DQ9A 1REVA 4O3RA 2PFFB 4B3TF 4EWTA 1WEYA 4U67Q 3EVOA 5C24A 1IQTA 2W4PA 2E1AA 2JDJA 2R7SA 5A8KB 2XHWA 1KTQA 3MXHP 4F0MA 2DIVA 4JI7J 1KNZA 1H0HB 1NDKA 2QG9B 5J2PA 2FJDB 2V68A 1T95A 2MMYA 4EEYA 2KT2A 3PV8A 4QIWD 3FK4A 5IQQA 3PRVA 3NGSA 5BR8F 5F3TA 2NZCA 4DFMA 2YNGB 1RHRB 2X1BA 2HFZA 2R2UA 5I42B 1JXVA 5HBMA 4H4KC 1A7GE 2E9ZA 1FJGF 2VFRA 3K0JA 4Y2KA 3DOLA 1KQGB 3H2LA 2C2NA 3P5TL 1TMMA 2QO3A 2NXEA 2UUAF 3R7BB 2NUHA 3FSYA 4OYOA 3RW7A 1RT3B 4KGZB 4B3RJ 5HN0A 2GNKA 4JI3J 1KWMA 4DR3J 3V6JA 4OIXA 2V8HA 4K59A 4NYPA 3A8EA 3QZ7A 4CLPA 3KLFB 2Y8WA 1I6JA 1TL7B 2CZVC 4YR3A 5A8WA 4OHVA 3PVXA 3D1OA 3AQPA 3PJXA 2AGQA 2JEIA 2IRYA 2J5AA 2V8GA 3B4DA 1RI7A 3D68A 1RWWB 3CVKA 2R7OA 2QA4G 2CJBA 4M5HA 2JNJA 2BYCA 3V6DA 3HHLD 4B9UA 1UJ6A 3AB4B 4DL4A 4OZ3A 1V6HA 3CC2S 3D4JA 4X66F 4HACB 2R8IA 1T9XA 4U9RA 2DPIA 3MWBA 2LA4A 3TWZA 3CCES 2MDAA 2KG1A 1IBMF 4ALZA 4ZVOB 3MMAA 2FZCB 3PJ9A 3ZNJ1 2ZOGA 1HPZB 2BKNA 4DFPA 1HMVA 4YOEA 2LU1A 4URSA 3PKYA 4IO1A 1WC0A 3JSRA 4DN0A 1IR0A 4HTJA 1KKHA 2I9SA 3RR7A 1YZ6A 3WHIA 3T5KA 4WXOA 4J5OA 2HIQA 2OEMA 5J1EB 4CI0B 1YHQS 2G1DA 3HKWA 2L48A 4NA2A 2Q1LA 3MFIA 1UCNA 3ZZYA 3BH6B 1RCXB 1CULB 4G1IA 3PIOQ 2HIYA 3SBMA 3DRPA 5DM7Q 4R0JA 2RKIB 1H98A 1P6TA 2P9CA 4N47A 2VJVA 5KG6A 4KHPJ 2HAFA 1FXDA 5IOLA 4O3SA 1S57A 4LR7A 4I6AA 3DMJB 4DPWA 4LSZB 4K4WA 4OI0A 4O4GA 4KGXB 3LW5C 2V8DA 4A8YA 2OH2A 3CJKB 4JV1A 5EX0A 2JX2A 1R8BA 2B4UA 3C16B 3C6UB 2ZE2B 1NKCA 2EG1A 2GIFA 4OZJA 2DNNA 4FDFA 4XAKA 4P73A 4F25A 1X5SA 2YWWA 3KLGA 2GO8A 3PX6A 3IRWP 1FK9B 4ECYA 3JQMA 4ZJLA 2VV5A 1RTHA 3T9ZA 3CNQP 3FCHA 1VBZA 5ETKA 3WC0A 4M63A 4DQSA 3QATA 3VAGA 4PCQA 2AV5A 2W2NP 4KFBA 1S6QA 1R3NA 3NEKA 5A76A 1WF1A 1RP5A 2GVDA 4PXEA 4ICLA 2F8MA 2IY5B 1D0EA 1U0SA 2H54B 4YDXA 5CYQA 4WFAQ 1N5YB 1JLCA 1OY8A 3BO2A 3M1VB 4UQGA 1QLNA 5KFNA 3FCWA 1TUGB 5KFQA 2KXFA 4NXNF 1ZAWA 3UVJB 2VFUA 1LWFB 1U2FA 2Z58B 4NX9A 1PBUA 4UOCA 4DPXA 1TUVA 3BBFA 2AJ4A 3N6MA 5LJ3Y 2IJFA 4I56A 2QLJB 2K7KA 4QCLA 1SJ3P 4JI5J 4ED0A 4YHHJ 3R7NB 2JL9A 2MSTA 3TAMA 3HDSA 1ZZFA 2ASDA 2Z56B 1S10A 2ASJA 2Y9HA 3I5CA 1V3SA 2DTJA 2W9CB 2CQ0A 1RACB 1S99A 1YRXA 2RQ4A 1LK5A 5IV4A 3TA0A 4DBQA 2F3JA 1WSVA 5KFXA 2BBEA 2ACYA 3HFZB 3CB4A 4LFAF 2MZTA 3O44A 4DL2A 5CYJA 3VAFA 2OUGA 1Z2ZA 2QFJA 4NLTA 1RT7A 5IT0A 1SV5B 4JI0J 2AD9A 3JQJA 2BM0A 4USTA 4ES1A 3O5TB 3W9HA 1SIWB 4E98A 1NK7A 3G8QA 1BHNA 2WVEA 3I32A 3IM9A 3ENQA 3SDEB 5D8HB 2CDQA 2Y3YA 2ZNYA 1HNIA 4OZ0A 4A48A 4HDGA 4F67A 2MSSA 3CTRA 1KLNA 1HI8A 2M8DB 1VQOS 1YRUA 3MPWA 4HI2A 4ZLJA 1LQ9A 1X4HA 5T14A 2LDYA 3PJWA 2XZTB 3MDFA 2R2TA 2HLUA 1FKOB 4AL7A 4JV5J 1PBAA 3NWGA 3G6VA 3H59A 1S77D 4IRDA 1RBAA 1P27B 3GWCA 3EPGA 2OAUA 1C4AA 5KFMA 4NLRA 3TUIC 4QPTA 4H4OB 5JXSA 1VRQC 3J7A1 5HQMA 2FC9A 1NHKL 5KFFA 4QWDA 2VFSA 2KB2A 1RK8A 4U8VA 1BE4A 4QYRA 4KBIA 4NLGA 1G6BA 2HNDA 3TYTA 5E2QA 1TELA 5F8HA 3MI7X 4PQUB 5THWA 2WW8A 3WIUA 1SQGA 4R25A 2QA2A 2YKPA 1EKRA 1M0SA 5DDRC 1N0VC 1IKXA 4LSLB 5CA5A 1JKHA 2EFPA 2VICA 1AUDA 4KKOA 4Y2IA 3N28A 1RKJA 2NSCA 1RXOB 3D6TB 2EKNA 2H4YB 5AXNA 2WTFA 3D6FB 1Y5IB 4PEOA 3KOAA 4B02A 4ID5A 2VKRA 1PO6A 3OHBA 1OPZA 1QE1A 1PKUA 3DDIA 3UN5A 4O4RA 3IWNC 2BJ3A 2MQOA 3ITHB 4X4PA 1TK8A 1B3TA 3BDPA 1K0TA 5L9XA 1V3RA 3MUTP 2CPYA 1F3FA 3DGVA 4LRAA 1HHQA 3R8YA 7FDRA 2BOAA 2XI2A 2IAJB 3HJFA 3M2UA 2E66A 5K14B 3A8KA 1RU1A 3CIMA 4ECTA 4DV2J 2B6AA 2CG4A 2J0XA 1HBOB 3DRRA 1RWMB 1RHJB 1J5EJ 1FNXH 2GX8A 1UWBB 7AT1B 5KG0A 1U1PA 1OJ4A 3SQOP 1SL2A 2MQ8A 1AUSL 3MZIA 1FTCA 1SUQA 5A8KA 4KYZA 5KTQA 3UO0A 5IT9Y 2P5VA 5HVFA 2I2YA 3M8QA 1PSDA 1YBAA 5IT4A 4R5PA 4OYPA 3KHRA 1WHVA 3Q8UA 1X0PA 3MMBA 4K0KJ 3ELHA 4RW8B 1RAEB 3T5HA 5D77A 3MAAB 4ED3A 4RO0A 2B4PA 5HJYA 4WZMA 5F8NA 3KUGA 2G0IA 1HNVB 3CEDA 1CC8A 2EK6A 4C4WA 4CLFA 1C1CB 2CIMA 4NMXA 4K2XA 1T05B 2DHXA 3FBEA 3IGVA 2KO1A 3ZZ0A 2RU9A 3V4MA 2MY7A 4JI4J 4YMEA 4CWBA 3FZBA 1RT3A 2C2RA 3B78A 3OR1A 2VQEF 1LOUA 4FNHA 2FHOB 1HNWJ 4RX6A 4B9TA 1HQEB 3PEHA 3H42A 4PABA 3BGOP 4F0KA 3KLFA 2DD8S 4DSFA 3RW6A 2NSBA 2VPZB 2C2OB 1Q1KA 5H9FK 2YH1A 5JUMA 2C42A 1RABB 2KT5A 1NB7A 1YJWS 2GJFA 1MWQA 3A12A 2FJWA 3OQ2A 2I5JB 3PW4A 1RUSA 3T41A 4N8NA 3CJ5A 2OSQA 4B3TJ 2YY3A 4L74A 2Q6BA 1U1KA 3UQSA 1D8YA 5E3PA 2W8LA 2OTJS 1O5JA 2HWHA 2IDEA 4ED7A 5D3GB 3PRDA 1Q82T 4K2JA 3N5BA 1VQ6S 4DCJB 4USVA 3RUBL 4DV6F 1UPPA 1O51A 3LWLA 1YDLA 2RNEA 4F4ZA 1C4CA 3OSNA 5BR8J 2ZBIA 4IYQA 1R8PA 2DBBA 1S9EB 1WACA 1W2IA 5KT3A 2PI5A 3UW1A 4K4ZA 4P7TA 4X4SA 1LEOA 1CULA 5AXKA 4ZPBA 4DV3J 2F65A 4LF9F 3FRZA 2HQ3A 3MCNA 1FJGJ 2IA0A 2BJ8A 2W9BB 1CG2A 4RUBA 3MM7A 5IS2A 2UUAJ 3AJDA 4DV0J 1VMBA 1PAUB 4WTOB 4AQYF 2CQ4A 3CXCR 3QSIA 2WOMB 4ED2A 1NJYA 1FNOA 1PIEA 3M6UA 2CZ9A 2VC1A 1CLFA 3CJKA 5B0BA 5HMYA 4CRJA 5L1IA 2AX0A 1QUPA 4ZOSA 2ZKUA 3K2YA 2DGQA 1HYSA 3PIPQ 4DV1J 5E7OB 2CPJA 3K57A 2EKYA 3PW0A 3MPDA 3BN7A 1QAXA 3BEGB 3I87A 3W1YC 3ISNC 1HW8A 2IYIA 1K9MT 2ZHBA 1ITPA 4ECRA 4NYOA 2V63A 3I4PA 1IKWA 5B0FA 4UY8T 4I2PB 1LW2B 2F40A 1C2PA 3PYEA 2R2RA 1FRMA 1RAIB 2EPIA 1SC3B 1DQAA 4KSEB 4KH1B 2YNFB 3H5XA 2BVZA 3J7Z5 1PAEX 1N56A 5A0YB 2HHUA 4I2QA 2WONB 3KK3A 2ZUGA 3DYAB 3C6TB 2C3MA 3M1VA 5GMKa 1RYRA 3UFCX 2BABA 2OEKA 1YIJS 4B08A 4ED1A 4NEZA 3EE3A 4OZNA 3PEJA 3DOKB 1TZ0A 4LJMA 3R9LA 3I0SB 2KTQA 2CNLB 1JNRB 2Q43A 3MURP 1NK0A 4GVLA 2L3MA 2PMHA 3CCUS 4J9SA 5EUHA 4LF5F 2LA6A 3TW0A 1X60A 3KLIB 1X4AA 2V2VA 3CMQA 3OBIA 3UDVA 4M5DB 3H25A 3BBCA 2L08A 1R89A 2DNYA 2H65B 1XIQA 4G1QB 2B8PA 2BR0A 1B0VA 4DSKA 4CLSA 3EVWA 3OV7A 3ISZA 2B7BB 1KBRA 4C8MA 1EHWA 1T9WA 3EGNA 4CQ1A 5HLFB 3QNWB 1SJ4P 2GQCA 2RDIA 2HYIB 2R8KA 2O66A 3RBXA 4KGKA 3QT7A 3VVTA 2ALZA 2DO0A 2HPUA 1B0TA 3B82A 2XYPB 2MY8A 3A3OB 3EUNA 2AYMA 5EN1A 5FLXY 3MTKA 2DNMA 2YNIB 2V2QA 2UV8G 4PXCA 2M7SA 3KKFA 3RG6A 3GIJA 2AYBA 1N6QB 4LQ3A 3BGUA 3SZ2A 4F4KA 1NM2A 2IM1A 4HEA9 4C0BA 3N4WA 4Q0BA 4DN9A 2V8PA 4DPUA 2H5JB 1TTHB 3GB0A 2IPOB 1RISA 2BDPA 1S9GB 2R7VA 3KLEB 5J1NA 1S1WA 4FNIA 1SB6A 1ZM2A 2KHDA 1GTHA 2BW7A 1TVRB 3HZEA 3H2UB 1N4LA 3V81B 2X3GA 3AFGA 2V9WA 4PG6A 4NXNJ 2BXJA 2FHMA 4DR6J 4IG3A 3MMJA 1KOOA 4M8LA 2PSZA 2X1GA 3GCXP 1FRJA 1WEXA 1IUJA 1VQLS 2F8HA 2IA6A 1TKTA 3HT0A 4F4AA 3E01B 4PPDA 1Z1ZA 3EJMA 2DT9A 4NCAA 1H2UX 2RS2A 1VK8A 3CCRS 3C2PA 2B7CB 2BE2B 2UP1A 1RAGB 4YR2A 3FBFA 1U45A 4DPOA 1VC5A 1SKSA 2XHCA 3NNAA 3EZUA 4W90B 2C28A 1KVKA 4Y65A 4O3OA 1K47A 2HURA 4DL6A 2AQ4A 4NXMJ 4RW7B 3EGVA 2AKWB 4ZPWR 3KUHA 2JRSA 2CJ9A 4PQAA 3FVYA 2HNZA 2QA1A 2FYXA 3NMRA 3AXMA 3ITHA 5U47A 2LQ5A 4ZVHA 5I3UB 3OL6A 4ZP6A 3CIZA 4KE5A 1K0VA 2GZOA 2E29A 4N5SA 2OMOA 2H48B 4X4UA 1PJ7A 2KFNA 2OPRA 4NL5A 3HSGA 2XLKA 4HT7A 1G4CA 5D4PA 4LF1A 4ZVSB 2RT3A 1VS3A 4LVNP 2HK2A 1HBOA 4RW9A 5KFUA 3QGGA 3PYFA 3QJJA 5F8MA 3GYGA 1N32F 1F3VA 2CUYA 4K4SA 4FPIA 2J9CA 4QWCA 1QM9A 4KRWA 1Q86T 2K1RB 5AXLA 4DR4F 1J5OB 4FN5A 2LVWA 4DLEA 1QUVA 4EU0A 3F41A 3D2WA 3FSIA 2RHSB 3HK2A 2FZKB 1U09A 2F4FA 2QX0A 4DX7A 2B9EA 4I6WA 3A13A 4ER8A 5HQLA 1R8HA 4DR7J 2A0FB 3MM9A 2YNHB 2IHR1 4A47A 1NAQA 1VLOA 2NUUG 2ATLA 1R31A 3MAAA 3LPEA 4NRUA 4XK8C 5I4MA 1QD1A 1HNVA 2MGZB 2LQBA 5K8OA 1L3UA 2QFIA 1NSKL 2KU7A 1EIYB 2QN6B 2HEKA 5T7LA 3VAKA 4LIWA 1WKLA 2IM3A 4CM2A 2HZCA 4J9QA 4WKRA 4OYWA 3OTOF 2RDDA 2XCPA 2DNKA 4PWDA 3OXLA 3QFWA 3D9BA 2DY1A 4Y0FA 4QWBA 3EDRB 1D09B 2LXUA 3HHNB 2W2PP 2IVMA 1ZH5A 2EC2A 1LFWA 5F0WA 4YFUA 2XB2D 8AT1B 2IJNA 1G3OA 2OPSA 5E3AA 3DRSB 4TKTA 5FIIA 4CLWA 3CJ2A 4S0MA 4OI6A 3TAQA 1SC4B 1HIYA 2FQQB 2YH0A 2HNYB 3CMES 1A9NB 1NBEB 4KR0B 3CE8A 2I5JA 2DGVA 4EYHB 5KFRA 3OTBA 2BM1A 1XMQJ 4N41A 1S1UB 2BV3A 1X0FA 1JLBB 4B3OB 3TJAA 3KLHB 1UA1A 3EZOA 4RPFA 4C3KA 1C0TA 3I9V9 4OJ3A 1PC5A 2RE1A 3CJRA 2JEFA 4I6YA 4X4NA 3ZTOA 4I68A 1NRKA 3EX7B 1NK8A 5ITHA 1U24A 3QLHB 3BYRA 1L3KA 1TAUA 3FFIB 3K7RA 4DL0C 4FXWA 2NS1B 4ZHRA 3IG1B 2VG6B 4J91A 3Q8PB 3O8WA 1FF2A 2MQMA 3MEEB 2J9DA 1JLAB 1FXRA 1WOOA 4ED6A 4U7UK 3J81U 2XEXA 2W9BA 4DDFA 2HRYA 2E5LF 1H7WA 2QL7B 2DNOA 3M32B 2QSWA 1R6VA 2MXYA 1XNRF 4A8QA 1GNKA 1XNQF 4PPZA 4DZDA 2WOMA 5EX3A 1M5PC 3W8PA 3VQSA 2AYGA 3DCAA 2BJEA 1ZM3A 5KFTA 2ZJPQ 3T1HJ 2QSFA 3DU6A 2FHKA 2DXDA 1DBDA 1A0OB 5KFEA 2APOA 2RHQB 4UZCA 2FJVA 4ZCLA 2EBGA 3TRGA 2VA2A 1RAOA 2LEAA 4DG1B 1H7XA 2VG7B 3EWGA 4YY3J 4BS2A 3KLVA 2D74B 3QIPB 4TYBA 2J8AA 1B0PA 4J7CA 1H73A 3R5JB 3CC4S 3BB5A 3O6QA 5D4NA 4M95A 2AIRB 3DU5A 1SVDA 4CT9A 1LW2A 1YJNS 1RTDB 1FRIA 2RMLA 1WI6A 4BC7A 2DGOA 1QSLA 1UZHA 1WOPA 2Z8QA 4ZPCA 1T9YA 3HO1A 1VRUB 2R2SA 2YNFA 3FDSA 3PTWA 2DXEA 1F6TA 4EBDA 5A0YA 4DV6J 2WONA 2C3PA 1PILA 2K8GA 3WZ0A 4X84A 4F3OA 4DX6A 2QZ8A 4QWAA 2DNQA 5L1KA 3WX8A 4NLWA 5H9EJ 2L41A 1FVQA 2IVFB 5KG2A 1DRZA 3I0SA 1NCLA 1HWJA 1XMBA 1X9WA 4DSJA 4IOBA 2JFKA 3FMBA 4I4BA 2QLWA 5CHCB 2CPDA 3DM2B 5KT2A 4ECXA 4LF4F 4MKVA 4Q5VA 5EWFA 4LF9J 4LFBJ 1HWIA 4WFYA 1OWXA 4FYWB 3LAMA 5C25A 4R8UB 2IBOA 3AD7C 1KLMB 2Q66A 1K44A 4NLQA 2C2KB 2JC0A 2J7UA 2X7IA 5DDOC 3LA0A 2MKSA 2H9ZA 4C7QA 1MN9A 5ETLA 3HHLA 2E7WA 2CPXA 2G2YA 3GFXA 3V5RA 2HHTA 3MEKA 4QPXA 1VGYA 1F5CA 2RF2B 3GTYX 3FEZA 3NWRA 1NSQA 2KDOA 4CLYA 3R5GA 3NP5A 3QFHA 4CLZA 2CQHA 4MT1A 4V19J 3W2VA 1IQZA 1H2VZ 2GV1A 2XYGB 3PO4A 4P10A 1N6QA 4LBIA 3A3NB 1RWKB 5A6PA 5DM6Q 2IMWP 2OP5A 3KK2B 3VV2B 3H5UA 3CULA 3LGMA 3SFGA 1OY9A 2XY6A 3CDUA 4Q43A 4K4VA 2IRUA 1TQLA 3KLEA 4NLDA 4MKBA 1SJ1A 5D0HA 1Y9OA 2VB6A 3QRQA 3PX4A 1TVRA 3MCSA 2WK4A 1AROP 3KMSA 1M90T 1RAAB 2KRBA 3TJ9A 1DQ8A 3Q8RB 3UNYA 3JAMY 1SKWA 2XGPA 4D3HA 1VQPS 4JI7F 3C15A 5M2PA 3RAQA 4LF5J 3R5BA 4FF2A 1JWWA 2ZZTA 3GLJA 4CLTA 3MECB 2DGXA 5E41A 4MIWA 3LP1B 3H8YA 2IMOA 3IWLA 3MEGA 2VL1A 3JYTB 2BE2A 4LR8A 1YZ7A 3GG1A 5IXUA 3CCQS 3OW2R 3TANA 3ZZUA 5KAKA 1IBCB 5ETTA 3QZ8A 3N01A 4HHHA 5KT6A 5HJXA 5L39A 3UCUP 3FUYA 2CZ4A 3DLEB 5C42B 4UW2A 1GXTA 2GA7A 3GFHA 2DR8A 2ZVSA 3FCVA 1JLEA 2JJ4D 2B8QA 3AQOA 2DB1A 4HDHA 1CJTB 9ATCB 3C14B 5I3UA 1KP6A 3EMTA 4DR3F 1GTEA 5K8MA 2E7XA 8RUCA 1XBWA 5EGYA 2D69A 3G6YA 2HQIA 3QWPA 1MU2B 3OSPA 1VQSA 2J9DE 2ASLA 3BKTA 4L3KA 3D1QA 2KZZA 4ZCIA 1W7WA 1AZSB 3LGHA 2D3OR 3PW7A 1E6VB 1TK0A 5EDWA 3QGPA 2CWXA 1S79A 2H4WB 5BYSA 1REVB 2P9GA 3W61A 1KQKA 3PFEA 2K3KA 4DMZA 5C24B 1GMUA 1GX5A 4C3LA 4NLSA 2MKHA 1B70B 2C2DA 2PEBA 2WW4A 5DDQC 4J9LA 2H3EB 3BSCA 4BDPA 3N0VA 2U1AA 3ZTPA 4NASA 1KFSA 2G1HA 3UDLA 4CO1A 1U47A 3SEOA 3G6ES 3LP2A 4OYBA 2R9LA 1YX2A 5B0GA 3VCDA 1Y4ZB 2VPWB 1HHTP 4NLXA 2E9RX 1PYOB 1JLGA 1SL1A 2VDIA 2IM0A 2MGZA 3GPAA 4ZVRB 1N8RT 2XMWA 3QQCD 4A8KA 4M5GA 2A10A 2WBRA 5B0CA 4ELTA 2OFHX 1DURA 1NHUA 1NK5A 3MHYA 5HBMB 4IH6A 2EVZA 1IXKA 4N77A 4TY8A 2HMIB 1T9VA 4KH0B 1RB0A 5D4OA 1DHMA 3N6NA 1Y3KA 1AFIA 2W24A 2ZJQQ 1JJ2R 4DR2J 2R7RA 1YJUA 1N5VA 4LIRA 2W25A 1S0MA 3Q86A 4ITSA 2R42A 5L1LA 4OYXA 3GYNA 1YJVA 4BWMA 2V0NA 2XMVA 1S72S 2OGUA 2E9TA 2ROGA 3AA8A 2B5JA 4DFKA 4URQU 1FRLA 2YWFA 4WU2A 3I31A 1UPMB 1SXLA 5CABA 3V6DB 2POKA 4ATNA 1X4GA 1N32J 3GJTB 4ZVEA 1MSWD 4DL5A 2FLOA 3KLHA 5HVGA 3VTIA 5F9LA 4KAIA 4GMKA 1RHQB 3W5YA 1JJCB 3MMAB 4DR4J 3PFOA 4U6PA 3G87A 1F9EB 2KI2A 1IN0A 3Q23A 4HT5A 4QWEA 3QLHA 2VG5A 3OPKA 4NLVA 2QJ3A 3IO1A 4C11A 3SV3A 4DV7J 2VG6A 3ZTRA 2ILYA 1X31C 2PDAA 3ETOA 4TLRA 4UOGA 3HP6A 4A46A 2AU0A 2HAIA 2KJWA 2CQIA 4JI5F 3DRPB 1WD6A 4F04B 5BJRA 4YHHF 3T1YJ 5LT5A 1WKJA 1LXNA 3K5MA 4Y3CA 2W9AA 2XS7A 1UEVA 2VPYB 2FPHX 4EMDA 3J80U 4OX7A 5G0RA 2M88A 1MLAA 3Q89A 4AE5A 5IT9U 1XC9A 3R97A 1KD1T 2JZ5A 4OZ5A 1ZYQA 1KSPA 3ZO7A 4Q45A 1SBRA 4Z2XA 2ZZMA 2XLJA 1EKSA 2QMWA 1U4BA 2N7YA 2NLWA 2FJBB 3KLGB 1Q7YT 4DG1A 1BLUA 2VG7A 4IRKA 2VBXA 2JVOA 1XQIA 3B54A 3ONQA 3CT9A 4ZPAA 1U1MA 1S1XA 3HI9A 1HARA 1RTDA 4KFBB 2ZBCA 2A2DA 1S6QB 4Y2CA 2ZH6A 4CTAA 3F56A 5EWGA 2DR5A 3M05A 2GVDB 3KNAA 4ICLB 5GMEA 4WIQA 3W9JA 3I5AA 3AB2B 4WP3A 4F8RA 2YVSA 4DF4A 3NNCA 1L3TA 2JLGA 1SJQA 2DH8A 4JV5F 1XN9A 4DU8A 1I5OB 4DR5J 5E0OA 4CO3A 1GAOA 3ZC4A 4FBTA 4C6AA 1RT6B 3MR3A 2FVCA 3CJQA 4J9UE 4IO9Q 1Q5YA 4O0IA 3F73A 1NDPA 1S0NA 4ZN1A 3I6PA 1U6ZA 2EBEA 3D0GE 4K50A 3K17A 3LF0A 3TAMB 1JLFA 2RRAA 2DNHA 2PEHA 3NBPA 4ILMA 4KPCA 2KFZA 1QTMA 1XNQJ 4TLQA 1BWEA 3BV8A 2J0QD 3GV7B 3DDNA 2BKPA 3WX4A 2WBMA 5IWAJ 1RT7B 2PT0A 5C2GA 3WBZA 1S7HA 5HO4A 3PNIA 1AA1B 4ZJOA 2XTJP 2XO7A 2GS8A 5DGAA 2ATCB 1YWXA 2B0GA 1NK6A 3JS9A 3AAWB 3HVWA 3QAUA 3QO9A 4UOHA 3SCKE 4MK8A 2K2PA 3PY8A 1HNIB 1HKAA 3FEYB 3OTCA 1JIHA 1M5OC 2MHNA 5GAHI 2XQCA 4DV2F 4L6V3 1HR0J 1VC0A 2VOPA 4CO4A 2OPQB 4RUCA 5B7WA 3GILA 3CD6S 1RWOB 4YB5A 4OI2A 3LOUA 1NJXA 1ZPVA 2Y1IA 4LF4J 1CJKB 1YBUA 3DLLQ 4OZLA 2VD3A 2WSFC 1GMVA 3TZWA 1UFWA 4FYXB 3GE9A 4B9NA 1EQMA 5CD4A 2FD2A 2EFGA 2GVZB 3ET6A 1RBLA 2HNDB 4C48A 4ILLA 1ROFA 3PO5A 1JLQA 1AB8A 1OO0B 1UW9A 1X8DA 2YKAA 2LP4A 4HHJA 6FD1A 2VH7A 4FS1A 1IKXB 5KG3A 5GAGI 2HGNA 2B3TB 5LSRA 4M94A 3I0RA 4KO0A 1N54B 4KKOB 1MN7A 3VAJA 2ZJRQ 3MD3A 2WVBA 4DQPA 1S6PB 2CAJA 4RJVA 3QGHA 4OYAA 2AJFE 2HQDA 3KG4A 4QR1A 2W8KA 4B3SF 4A8MP 1TL1A 2Y1LB 2QEXS 5CH7B 1JJHA 1Q4RA 1WORA 4NZ0A 1CJTA 3C14A 2CJXB 2DH7A 4DXLA 2GGPA 2CJKA 1HNWF 2KVQE 3ZTSA 1S12A 1NH7A 2MZJA 3ICLA 4IFYB 3GMGA 5B0EA 4TXSA 2NZ4A 2PO4A 1FFWB 2A1BA 2UXCF 4E8UA 3L7UA 3DLHA 4ELUA 3TX0A 1HA1A 3LTOA 3S6EA 2BJ1A 1BGXT 4M5KA 2LFVA 3DRRB 3MR7A 3W2WA 3MUVP 1F2GA 2KVIA 2J0WA 3C8YA 1NSPA 4IR1A 5LXRA 4LF2A 4OHYA 1Q8KA 5HP1B 1SUQB 2ROEA 1EZZB 3GFYA 3MMCB 2KFYA 1F9FA 3M8QB 4BWJA 1H72C 5KFZA 2K3IA 1M1HA 4R5PB 3GIKA 1WC5A 2RQMA 2RSQA 3L09A 2MZSA 4PG8A 2DCUB 2GAGC 2HHWA 2YQ1A 3MMBB 4Y6IA 3TJ8A 1ZA1B 1PGZA 1QSYA 4HH0A 5IFMA 3CO9A 2DRAA 2N3OA 3CF5Q 2HS4A 3MEDB 5J2NA 3M6VA 2CQ2A 4DV3F 1S6UA 3ENAA 1KOHA 2GQQA 1MMLA 3ETMA 2HMIA 3I9ZA 2CQCA 1PC4A 3SCIE 3MPVA 4DUYF 1M5VC 1X5TA 2MKCA 2VKZG 3D1HA 4DV0F 2MZ1A 6FDRA 3KG1A 1AXQA 3T3FA 1KN6A 3JSBA 3M8SA 1FDBA 4ECWA 3CDEA 1FCAA 3FQKA 3OR1B 5KFCA 1LW0B 4JP8A 3NNHA 4Q7AA 4F0HA 5F8LA 2GJ2A 3BREA 4DV1F 4ERDA 5HK4A 1LXJA 3G9CA 4DPTA 2F9DA 1EP4B 3QYYA 4JV2A 3R5CA 3SIPB 4F3MA 4YEAA 2UUWA 5HSPA 4DS5A 1U1RA 2MEWA 1YJ9S 3I82A 1FEHA 4F4WA 1NJWA 4WP9A 2JLEA 1U49A 3OUYA 3HHLC 2B4VA 4QU6A 1WG4A 3H4DA 4LSNB 3TZZA 2F9JA 4ZDNA 2XM3A 2YPYA 1UEUA 3MAQA 2CJQA 2OSRA 1Z4UA 3IBWA 2E5GA 4AL5A 4K5RA 4ZK7M 5IQ6A 1JB0C 1HBNB 2OEJA 5KFHA 4UOFA 2W7AA 3W62A 3TUZC 2JSXA 1NLKL 5AE1A 4P2SA 3ZTQA 2PIIA 4ZMMA 1IR2A 2KM8C 3H40A 1Q81T 1D9AA 1DLOA 4J9OA 5IC6B 3QAEA 3DXSX 1WJ9A 4MFBA 4QIFA 2W2MP 3G8TA 4FXVA 3MR5A 2G4BA 2GMJA 4RNHA 1S7IA 3IM8A 2R8HA 4IQXA 1YJ7A 5SUHA 2CQDA 1E6YA 3US5A 1YTYA 3MM7B 2J9EA 4WYWA 2HBZB 5KFYA 5E3RA 5DRKA 2BRKA 1JXLA 1XMOJ 2D3ZA 3P6YC 1XWLA 2GFFA 5HMZA 5F41A 2PE8A 1FA0A 3W66A 3HSJA 2R7WA 3R6LB 3BKFA 1RTIB 2V4JB 1HYSB 2ZHAA 2DHSA 1APSA 5KG4A 3GCWP 2VF3A 1FESA 1X9MA 5M2UA 4FVMA 4OX8A 2DR6A 2Z2ZA 2ZBQA 3CCLS 4LF6J 1NJIT 5IM0A 1IKWB 2HVDA 1R43A 2DHHA 1EAYC 4HR2A 1H6KX 2HG4A 4DQIA 1RLCL 2D9PA 3Q83A 3FGVA 1IWGA 2VBWA 4AXJA 3OD2A 3O1LA 1RT4B 4GO7X 2GHWA 4EK2A 3BSNA 4MKYA 1P1LA 1NUEA 4I2QB 3KK3B 4I7FA 2MJUA 2R8GA 3MR2A 4JI1J 5LSOA 2A6MA 3RB4A 1U0HA 2YX1A 4DR6F 1RT6A 1XJWB 3L3CA 4NZ7A 3KHHA 3MF5A 5DETA 1KVJA 4CYUB 3QT8A 2PGCA 2PD1A 5KOXA 1O8BA 3NMAA 3EGZA 3T5JA 1LWCB 2MHEA 5LSLA 2UXBF 1P9YA 2HS3A 2YKOA 3CO0P 2F5GA 3GYXB 4DOZA 1URNA 4RW4A 2CPIA 4KY3A 4CT8A 3NAIA 2RRNA 2E1MC 2FZGB 2MLZA 4MYUA 2A2CA 1S1VA 6AT1B 2XNRA 3VAMA 5JJBA 1BQNB 2QL9B 2AP6A 4BHQA 3GG0A 3G82A 3T5LA 4NXMF 1WEZA 5J2MA 4F2RA 2BQRA 3LAKA 4MK9A 5IV3A 2DNZA 3FNNA 2YKMA 3N9UC 3BN4A 4WJBA 5DZ7A 3KDNA 4ILRA 4YB1P 2LYVA 3PW2A 2EFNA 3GSIA 1VBXA 1U48A 4W98A 1HBMB 1SC1B 5GAEI 1ZTWA 1U26A 4QW9A 4K7QA 5LMNF 4P6QA 1D9DA 3GZ7A 3TZYA 2B56A 5F3ZA 4Q0BB 2QE5A 4DR1F 2A3JA 4OI1A 7FD1A 2RQCA 2UUCF 3DN9A 2K06A 3BZQA 1UVIA 2AX1A 2F1FA 4OX9F 2FIUA 2RUGA 3DKDA 1S1WB 5C7PA 1M5SA 3MFHA 1FNMA 1TFYA 2OPQA 1WELA 1WOSA 3P3DA 1DFDA 4FXDA 2P9EA 2V69A 3R5AA 2RH3A 1WF2A 1T3NA 2VC0A 2Z30B 4IG3B 4OQJA 4I1TA 4HHUA 3P5BP 1CJKA 1G7CB 1TKTB 5KFIA 2EXUA 1TR0A 4ANCA 4EZ9A 4YQWA 2HFUA 4KIAA 1D3WA 1TMJA 2GVZA 1OYEA 4DR7F 3K8VA 4ZN3A 5LMUF 2V4QA 1KDNA 2DGSA 4DS4A 3ADAC 4RNMA 5F8GA 5DQIA 1FJEB 3F0NA 3VALA 1XTZA 4M5IA 1WC4A 3DGPB 2ZUAA 2VOOA 3IBCB 1S6PA 3UD4P 3PXGa 4PXBA 4C8ZA 5K20B 3CDBA 2KT3A 2Y8YA 2RJZA 2AMCB 4X64F 2HNZB 2MZRA 2W2QP 1TV6A 4V1Ak 1YSJA 3M8WA 1UJ4A 4A8WA 3CJ0A 1BC6A 3IRXA 2XSJA 1OQ6A 2XMAA 4IFYA 2DNPA 5HANA 4ES2A 4X4RA 3PR5B 1R0BG 3I55S 3CDAA 3CCJS 3Q8YA 2OPRB 3GJRB 5A2QU 3LUYA 1IBKJ 1T0TV 1FDDA 2UXDF 4P2MA 4OLOA 2YQ3A 2ZC4A 4NI2A 1HWUA 1IKVA 4RW9B 2XMMA 4ZCKA 1XMQF 4JYAF 2KH9A 3D66A 3W60A 1UKUA 1ZZNA 4JI2J 2CVIA 2AWZA 5HP1A 2IC3A 1RU2A 4J90A 4NRTA 3HVAA 3MMCA 1N5TA 1T02A 4U7UD 4H4MB 1RTJB 1EB0A 2C2ZB 1TL3A 3KJVA 1NK4A 5J2QA 3EXYA 3CJ8A 4IDKB 3OJSA 3MM9B 3U02A 1IBLF 1TFWA 3L7PA 1RCOB 1KRPA 1WHWA 4PYAA 3KJNB 2CFXA 3MEDA 3T6JA 2LLZA 3FZ2A 4DQRA 2WB4A 1T3OA 3BO3A 4B9VA 1SJRA 1HW9A 5T7LB 5D15A 3K5OA 1AT1B 1YGYA 5GADI 1TAQA 1SI9A 3HSDA 1T11A 2D1CA 1FO1A 1B99A 4YS2A 3IR7B 2BACA 4B3SJ 1KEKA 2ZH3A 5B0DA 4PWDB 2HFOA 4RBTA 4DV4J 2L9NA 2D3UA 1LW0A 4FF4A 3AH6A 3PYDA 3CPWR 3T1HF 1VDHA 4UT4A 2OPSB 4ZKAA 1GK8A 5AXMA 1EP4A 4JB8B 4L72B 4EO6A 4XDDA 2HW3A 2ZD1A 2UXCJ 2D41A 2BA9A 2HVEA 4YY3F 4IOCQ 4NPOA 2EFVA 3HVTB 2ZBRA 4DUZF 4F2SA 3M8ZA 4GC6A 4GVBB 5G4DA 4LSNA 2ABYA 5H9EK 3G86A 2ROPA 5ETPA 1VC6A 1RWPB 5KFSA 1HNZJ 2L9DA 2PC6A 3NS5A 2QMUB 1LNQA 4O44A 3SV4A 3CJTA 3JTOA 2IYGA 1GX6A 3I56S 1IM4A 5L8RC 2FLNA 5L38A 1C0TB 4P2XA 3V6HA 1HBNA 3NXZA 2C2EA 4FKXA 4A8SA 3JSMA 4ZPTR 3X1LB 4MTPA 2J0SD 2DGWA 2DGUA 5DS7A 2Q6CA 3NCPA 1VQ4S 3D6MB 4ZHRB 2HHXA 2HFNA 3GU0A 4FYYB 4ECVA 3PR4A 2E5IA 2HZAA 2COLA 2PI4A 4LFBF 4DUYJ 2HGLA 5HQ8A 1OQ3A 1TU0B 3EGWB 2UVUA 2MQPA 5HATA 4NCBA 4NEYA 4B9SA 3M9MB 4AYBD 3M8PA 3SMZA 2WHOA 1ZAXA 2JFDA 1HL6A 5HROA 4Y2MA 3VZHA 1UTAA 4QJVA 2DY9A 4X4VA 5JVGQ 2GIRA 4ED4A 1JK9B 3ZZTA 1P9QC 1N5QA 5HVHA 3P4UB 1RTIA 2V4JA 4LRDA 1CQMA 5M2RA 2Z0GA 3PDNA 1S0VA 2HWIA 3UCZP 1IKYA 1WKKA 1UFLA 4LRBA 3LH2S 3Q2TC 3DLKA 2BE9B 2XO6A 1EETB 3VR1A 3CWJA 1FKPB 2AW0A 1RZMA 2ZFHA 4USUA 2O01C 4TQRA 4OYZA 1FX2A 2LKZA 2HHHF 2OD4A 3V4IB 4XPEA 3MTJA 5SZTA 1S76D 4C0OC 1T03B 3K5PA 3K89A 4ZVGA 4Q8FA 1U1OA 2FY1A 4XO0A 2JEJA 3UCGA 3NGTA 4ZJQA 4U96A 1RT4A 2PA8D 1CJVA 1U1NA 2LQ8A 4QIVA 1YLXA 4KC5A 2BQUA
chains in the Genus database with same CATH topology
2ZNZA 1LQ9A 3HXMA 4CNZA 4FP9A 4DV4F 1FTRA 1TV6B 2DITA 3B8HA 2XY7A 1X4HA 3MR6A 5T14A 3BF4A 2LDYA 3PJWA 4I67A 3THPA 3BQ1A 2DRBA 2O5DA 5D4OA 3IRXB 2X1AA 1DHMA 1Y3JA 3M4XA 3P96A 2XSJB 3N6NA 1YG0A 3MDFA 2R2TA 1Y3KA 3BGFA 2HVHA 2HLUA 3SSRA 3M6XA 1FKOB 2VODA 4AL7A 2YWGA 1RT2A 2M70A 3FMWA 3PX0A 1AFIA 2W24A 1MWZA 2ZJQQ 4J9KA 4WK1A 3NWGA 3G6VA 1JJ2R 3PZPA 3CMAS 3H59A 4P7VA 2R7RA 1YJUA 2QRRA 1S77D 4IRDA 1N5VA 3CJ4A 4LIRA 2W25A 3EXCX 1S0MA 1P27B 2M0GB 3GWCA 4ITSA 2OAUA 1C4AA 2YX7A 3SSSA 5KFMA 3EPGA 2BANA 5LXYA 4Q44A 3IR5B 2ZH9A 4NLRA 5L1LA 3NG8A 1LWCA 1WG1A 3TUIC 4QPTA 1I94F 3GYNA 1YJVA 4H4OB 1VRTA 1XERA 4BWMA 2JOQA 5JXSA 1NO8A 1KFDA 2V0NA 5A6WA 2XMVA 5C25B 1S72S 3J7A1 1IKVB 4X65F 2E9TA 2FC9A 3IS9A 3T5JA 2ROGA 3AA8A 1HI0P 5KFFA 4Y00A 4QWDA 2B5JA 4DFKA 4URQU 3UWTA 1FRLA 2VFSA 5DG8A 2KB2A 3G6XA 1RK8A 4K4YA 2AF6A 2DCLA 2YWFA 4QYRA 4KBIA 4WU2A 2K7JA 1HNZF 3DHXA 2KXHA 3FRYA 3I31A 2NPIA 4NLGA 1G6BA 1SXLA 2CQ3A 3FEXB 1DARA 1WI8A 2HNDA 3V6DB 3TYTA 4CNYA 5E2QA 3VF0B 4ECSA 1R0AA 1FHTA 2AJ0A 5F8HA 2IC3B 3PHEA 3MI7X 4PQUB 2E5HA 2POKA 4WCEQ 5THWA 3BGRA 2WW8A 4ATNA 4IRCA 1X4GA 4PWUA 1U2RA 1WNEA 1MSWD 4ZVEA 5E3QA 4DL5A 2FLOA 3KLHA 4R25A 1FJCA 2QA2A 2DISA 2YKPA 2VBZA 4KAIA 3VTIA 5F9LA 4GMKA 1HWLA 2Z2MA 4DV5F 1RT5B 4A8XA 1M0SA 2MQLA 1VLYA 2XMTA 1N0VC 5DDRC 1IKXA 3MMAB 4LSLB 5A8RA 5CA5A 2XC9A 1JKHA 3KK1A 3HHLB 2EFPA 4LVOP 1TL3B 3LANA 1BQNA 1T94A 3PFOA 5L1JA 4I2PA 3KJVB 3AA9A 1AUDA 4KKOA 4U6PA 4Y2IA 4RW6A 3N28A 5J2QB 4PKDB 1RKJA 1ZBTA 3E51A 2NSCA 2V9KA 3CJ3A 2KI2A 1FXLA 1IN0A 1FD8A 3SQGB 3Q23A 3TX8A 5AXNA 3MM6A 2WTFA 3CCWA 1Y5IB 4HT5A 3KOAA 2KHCA 4QWEA 3U1LA 3QLHA 2VG5A 4B02A 3THTA 4ID5A 2VKRA 4ZPDA 3OPKA 2OIHA 5H9FJ 4NLVA 1PO6A 4PG7A 3OHBA 1GXUA 3KFWX 3TARA 3IO1A 1OPZA 4C11A 2IFXA 1QE1A 1ZETA 3SV3A 3W2VB 4C8OA 4O4RA 3IWNC 3DYAA 1HBMA 3C6TA 3UE2A 2R7TA 4DHVA 2C3YA 3OHAA 2VBYA 1R6YA 2VG6A 2MQOA 5FDLA 5I3PA 3ITHB 3T6BA 5CCMA 4NLPA 2QIFA 4Q2LA 4X4PA 4H4KA 3ULHA 2ZH5A 1TK8A 3BDPA 1KR4A 2BUNA 1K0TA 2VFTA 5L9XA 1V3RA 5KFGA 2ILYA 2FVPA 3MUTP 3DOKA 2CPYA 2PDAA 4TN2A 5AJ3F 2DPJA 3ETOA 3D5MA 4MAKA 4TLRA 1BD6A 3HP6A 1YI2S 7FDRA 4A46A 5HMWA 2AU0A 2HAIA 2KJWA 2CQIA 3V2UC 2KM8B 1QAIA 4JI5F 3DRPB 3X3UA 3OL8A 2VFVA 3RB0A 1WD6A 2XI2A 2IAJB 1C0UB 2KG0A 1G1XA 5BJRA 4YHHF 4V19X 3HJFA 1M5KC 1RT1B 5LT5A 3M2UA 2BQ3A 2E66A 5K14B 1LXNA 2A18A 1Y5LB 3KLIA 3K5MA 2I1RA 4Y3CA 5K8PA 2W9AA 3CIMA 4ECTA 4M5DA 1U25A 2XS7A 1F0XA 2HS0A 2B6AA 2ZDOA 3CDWA 1LV5A 1UEVA 2HLTA 3GFZA 2CG4A 2R7QA 2J0XA 1TKDA 2VPYB 3T9NA 1HBOB 2FPHX 2XG8A 2XWXA 3DRRA 3PRBA 1HQUA 1TKXB 5A2QY 2DNRA 3TVYA 3OVAA 4G1QA 4OX7A 5G0RA 3OTEA 2M88A 4EYIB 1FNXH 2JLFA 1RA6A 2OPPB 4AE5A 2GX8A 2FVSA 5DLGA 1UWBB 2B9WA 1XC9A 1YJTA 5HL7Q 1KD1T 2JZ5A 5KG0A 1U1PA 1RKIA 2QV6A 1SL2A 3MZIA 3TR5A 2QYCA 4OZ5A 5BYQA 1ZYQA 1KSPA 1FTCA 4OLPA 1SUQA 5A8KA 4Q45A 2ZD1B 4AUKA 3OFFA 3HKZD 5KTQA 1SBRA 4Z2XA 2ZZMA 5HLFA 2P5VA 2XLJA 5IT9Y 2RRBA 2I2YA 1JXEA 3M8QA 1PSDA 3NLCA 2QMWA 1U4BA 2N7YA 2OMLA 1YBAA 2NLWA 4OI3A 2FJBB 5IT4A 3KLGB 1HD1A 4R5PA 1Q7YT 4DG1A 1BLUA 2VG7A 4L3NA 4IRKA 2VBXA 2JVOA 3IC1A 2FC8A 3KHRA 3ONQA 1QJHA 3MEGB 1WHVA 4RLEA 3M9NB 3L7OA 2DHGA 3BO4A 1XK8A 3CT9A 4OFZA 1YRTA 1X0PA 5KFKA 1LWEB 2DK2A 4LMZA 1HFEL 1HI1A 2RB7A 3MMBA 4O44B 4RW8B 3U27A 2LMIA 4ZPAA 5DQGA 3T5HA 2HRUA 5D77A 1U1MA 4ED3A 2B4PA 2F8EX 1S1XA 3DGPA 3HI9A 4WZMA 5F8NA 1HARA 2YNIA 1RTDA 3DDKA 4URGA 1ZOTA 2N3LA 5KFAA 4ZP7A 1HNVB 4KFBB 2ZBCA 3M8RA 3EZ5A 2A2DA 1S6QB 1ZM4A 3HHEA 3CEDA 4Y2CA 5KFBA 3UI3A 2ZH6A 4CTAA 3F56A 2XWYA 4N8OA 1VHFA 5F8IA 4MJKA 2G0CA 3CCTA 1CC8A 1WWHA 5EWGA 5T41A 2DR5A 3M05A 3JSMB 2EK6A 3RB6A 1T8EA 2UVWA 4C4WA 1C1CB 2CIMA 3HVRA 3L95X 2ZH1A 4K2XA 1T05B 2DHXA 3IGVA 2KO1A 3ZZ0A 3KNAA 4ICLB 4FPRA 1O0PA 1JLEB 3I5AA 2RU9A 3AB2B 3V4MA 4F8RA 2MY7A 3ENWA 2YVSA 1GT8A 4OHWA 1D8ZA 1FDNA 3ZZRA 3CCVS 3BS9A 1NHVA 4DF4A 3NNCA 1S9GA 3M9OB 1L3TA 3AHPA 3DHWC 4YMEA 2JLGA 1SJQA 2DH8A 1UA0A 1JX4A 4JV5F 1XN9A 3DC2A 3A1YG 3FZBA 2MQQA 5F8JA 4DR2F 2XI3A 2FGCA 1NZAA 2CRLA 5GAHU 1RT3A 2C2RA 3B78A 3OR1A 5E0OA 2VQEF 4XPCA 4CO3A 1LOUA 1GAOA 3ZC4A 4FNHA 4FBTA 1RT6B 3MR3A 2FHOB 2FVCA 3V81A 2FDNA 4RX6A 3ZZOA 2CPHA 2CQBA 4B9TA 2VZ9A 1HQEB 1FRXA 1KVIA 2ZOFA 1VOMA 3PEHA 2IRXA 3LP0A 2VA3A 4IO9Q 4O0IA 4RKUC 3S01A 3KLFA 4ZA1A 2DD8S 3F73A 4JV0A 1N5SA 1S0NA 1XEZA 4DSFA 3M8PB 3DLGB 3I6PA 1U6ZA 2EBEA 3D0GE 3RW6A 2NSBA 2VPZB 4K50A 1Q1KA 5CZXA 3NKYA 2ZH7A 2UU9F 3RR8A 3M2RB 2YH1A 1UVMA 5JUMA 3LF0A 3TAMB 1BQMA 2C42A 3CCZA 3E01A 2KT5A 5HROB 1NB7A 1JLFA 4PG4A 2RRAA 2DNHA 4C2MA 4K4XA 5H1SV 1YJWS 1J2VA 2PEHA 3NBPA 4ILMA 2FJWA 3OQ2A 1KTVA 2ZOMA 2I5JB 3LGNA 3PW4A 2KFZA 1QTMA 3ZFVA 4X62F 2V8VA 3D54A 3MPYA 3CJ5A 4N8NA 2PMZD 2OSQA 3FSXA 2YY3A 2XZWA 4AXIA 3C46A 4TLQA 1BWEA 5CYMA 3S1TA 1WTFA 5L9NA 2EFOA 1OSDA 2Q6BA 1U1KA 1FJ7A 1ZPWX 4Q2MA 3UQSA 1RWUA 3NL0A 2OLWA 4ECQA 4B3MF 3RRKA 4ZCMA 1D8YA 3GV8B 5E3PA 4ZP8A 3SYZA 4PXDA 2J0QD 2CPZA 5J1PA 4H4MA 3GV7B 2CKWA 3DDNA 2W8LA 4QZVB 2OTJS 1K1SA 1RTJA 1O5JA 2HWHA 2D7SA 1VQNS 4G6VB 4ED7A 3GV5B 4ELVA 1IKYB 5D3GB 3PRDA 3WX4A 2WBMA 3M2VB 1Q82T 1G2EA 2CYYA 2LECA 4YP3A 3DLKB 1RT7B 2PT0A 3LP2B 5DLFA 1VIOA 3IR6B 3N5BA 3DFEA 4IDKA 1S7HA 3WBZA 4DJBA 1R8AA 4KGMA 1VQ6S 5GAGU 2DR7A 5HO4A 3PNIA 4DV6F 1O51A 3LWLA 2MKJA 4DV7F 2GMLA 3O2IA 4DX8H 2XO7A 4A4JA 5DGAA 4RW7A 1JLGB 2RNEA 1YWXA 4F4ZA 2B0GA 3T1AA 1C4CA 3V6KA 1NK6A 2F4VF 1Y7PA 2VPXB 2HHQA 2ZDPA 3OSNA 3AAWB 3HVWA 3QAUA 3QO9A 3SCKE 3VAIA 1UAWA 4KJIA 2ZBIA 2K2PA 1DAXA 4MK8A 1X4FA 4IYQA 1VQYA 1R8PA 2DBBA 4LT6A 4DEZA 3PY8A 1S9EB 4B3RF 1HNIB 1WACA 1U6FA 3FEYB 4MH8A 1W2IA 3OTCA 1KHVA 5KT3A 4JI3F 2PI5A 4KHMA 3I4HX 4QBUA 4TY8B 1RYSA 3UW1A 4USJC 4K4ZA 1JIHA 4MYTA 4P7TA 4X4SA 4QOTA 3T1YF 1K73T 1M5OC 5AXKA 4ZPBA 4YDDB 2YTCA 4LF9F 3FRZA 2VQFF 2MHNA 5GAHI 2HQ3A 2IA0A 3DOMA 4DV2F 2W9BB 4L6V3 3GIMA 2XSFA 2OKQA 5K8NA 2DO4A 2V2KA 1CG2A 3MM8B 4X4QA 1U6BA 3DRXA 1VC0A 3IAS9 3MM7A 5IS2A 3AJ2A 2GMHA 2VOPA 5DG7A 4CO4A 1VMBA 4EFAC 1JJ4A 1R27B 2LCWA 4KT0C 2OPQB 3CD0A 3Q2SC 1RT2B 4AQYF 3UNGC 2CQ4A 3CXCR 1X9SA 4WFBQ 4RUCA 5B7WA 3OL7A 2WOMB 4ED2A 4C8NA 1SQEA 3GILA 3CD6S 4RUAA 3QWUA 4YB5A 4OI2A 2NPFA 3LOUA 1NJYA 4CO0A 3H4BA 1NJXA 1FNOA 2O3DA 3M6UA 2GJIA 2VC1A 2V94A 1ZPVA 2BANB 4KHRA 4B17A 3OVBA 3CJKA 1CLFA 5B0BA 5HMYA 2QA4S 2XULA 2Y1IA 1RQ0A 1VRTB 2J7WA 2K1RA 5L1IA 4C97A 1Q8BA 2AX0A 1QUPA 3DLLQ 4ZOSA 3MGJA 4OZLA 2ZKUA 2BRLA 2VD3A 2WSFC 3K2YA 2DGQA 4AL6A 1UFWA 4FZVA 1X5OA 1XR7A 2B5JB 3PIPQ 2GHPA 3GE9A 1J5OA 2XBPA 4NOHA 4B9NA 5E7OB 2QLXA 2CPJA 2FD2A 4Y34A 3K57A 3HVTA 1SIZA 4QIGA 2UVRA 2EKYA 2EFGA 3PW0A 2H5EA 5J2PB 1QAJA 3BN7A 3IXQA 4EBEA 2D9OA 2XLIA 1QAXA 2HNDB 2MPUA 3BEGB 3I87A 1R0AB 4C8YA 4ILLA 1ROFA 3PO5A 1JLQA 1OO0B 3TA2A 2C22A 1X8DA 2YKAA 3OXFA 3BGRB 1Y5NB 3ISNC 4HHJA 6FD1A 3M30B 4X4TA 4MK7A 4E0DA 2VH7A 1HW8A 2IYIA 2YNHA 2AGOA 4FS1A 1K9MT 4OV1A 2ZHBA 4M1KA 1IKXB 4ECRA 5KG3A 1UVKA 4NYOA 5A8RB 5GAGI 3R3TA 2HGNA 2RU3A 1TP7A 2B3TB 3I4PA 3TAPA 1IKWA 5B0FA 3I0RA 2ASYA 4KO0A 5LSRA 4M94A 3Q8QB 4UY8T 4I2PB 4ED5A 1LW2B 2F40A 3C3LA 1N54B 3E2EA 4FF1A 4KKOB 5KFWA 1DZ5A 4RW6B 3VAJA