4FNHA

Crystal structure of isdi-w66y in complex with heme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Heme-degrading monooxygenase isdI
publication title Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fnhA00
3MCSA 1WD6A 1X0PA 1TL5A 1CC8A 3DCAA 3GZ7A 3K7RA 2K7KA 4U9RA 1SQEA 1FE0A 1S6OA 2HFOA 2ROEA 3KG0A 5B09A 1GXUA 3FGVA 1ULRA 1APSA 2OD6A 5K9FA 5B0DA 3BB5A 2LXFA 2VV5A 4NPOA 2FB0A 2FIUA 3F44A 3T9NA 1YJVA 5T7LA 1OPZA 2RSQA 3HHLB 2KYZA 1JK9B 2LDIA 2XMMA 3CJKB 5IXUA 3BF4A 4OIXA 1Y3JA 1Y3KA 2OFHX 1R6YA 1VQSA 1FVQA 1XBWA 2GV1A 2XMJA 1OSDA 4ZA1A 3QGPA 4FNHA 5T7LB 2GCFA 3HDSA 5A6WA 1RJJA 1P8GA 2G9OA 2RILA 3BR8A 2HQIA 1U7LA 2N4DA 2XMUA 4HI2A 2KT3A 4DL0C 3I9ZA 3HHLC 2LQ9A 2OFGX 4Y2KA 4OJHA 2OMOA 4YDXA 2N7YA 1Q4RA 2BUNA 5B0FA 1YRXA 3BM7A 1AFIA 1Q8BA 3WDOA 1OQ3A 2N4CA 2OP5A 3HHLA 3TOQA 1N5QA 3E8OA 3CJKA 2RU9A 4HI1A 4YEAA 1K0VA 3FRYA 1N5SA 4HH0A 4QOTA 1FEEA 1SI9A 2BYCA 3BN7A 3LGNA 2HFNA 2BJEA 5B0CA 3FMBA 1N5TA 2CRLA 2HIQA 4OJ1A 5KAKA 3IWLA 2K1RA 3BGUA 2Q3PA 1FESA 2K2PA 2W4CA 4NL5A 2OAUA 5F0WA 3TRGA 4Q2LA 4A48A 1FD8A 2FHMA 1CPZA 1KVJA 1N5VA 1YG0A 2HLUA 2GGPB 2LQBA 5B0GA 4F67A 2W4DA 5B0AA 4DPOA 1S6UA 3LO3A 2AJ1A 4HH1A 2AJ0A 1QUPA 2AW0A 2K1RB 3UDCA 4EFAC 2BJDA 1TZ0A 3HF5A 1P6TA 2GO8A 3KNGA 3BDEA 2XMVA 1X8DA 2K7JA 2ZDPA 1JWWA 1V3ZA 2ACYA 1Y0HA 1YJTA 2PGCA 1URRA 1Y9OA 2QIFA 2XMTA 4FNIA 1AFJA 1AW0A 2XMKA 1KVIA 1MWYA 3IWXA 3QMQA 4Y2IA 2IFXA 3KG1A 1FVSA 1SB6A 1FE4A 5F0UA 2GGPA 3MZIA 2GFFA 4DN9A 4ZOSA 2RMLA 3DXSX 3HFKA 1Q53A 2OD4A 2XMWA 2VH7A 4Q2MA 3KKFA 1KQKA 2ASYA 2QLXA 3TNVA 2KKHA 5A6PA 1OQ6A 4A47A 1GXTA 1W2IA 1IUJA 3HX9A 4Y2MA 1YJRA 2IYIA 2W4PA 3VTIA 4OJGA 1TUVA 5B0BA 1YJUA 2QLWA 1TL4A 2KT2A 2AP6A 1CC7A 1Q8LA 5B08A 4A4JA 1MWZA 2FTRA 2L3MA 2ZDOA 1VQYA 2BBEA 4HL9A 2QYCA 4OJ3A 1LQ9A 2IYGA 3HHLD 2ROPA 2ROGA 4A46A 2JDJA 1X7VA 2PD1A 3LGMA 2OKQA 5B0EA 2HLTA 2EW9A 1TR0A 2GA7A
chains in the Genus database with same CATH superfamily
2YX4A 4LVOP 1MMDA 1UFWA 1Z1ZA 1ZZNA 5AXMA 2EKYA 5I42A 4JI3F 2FJDB 4ED3A 1RABB 4Y3CA 1SBRA 4IKAA 1XBWA 1AYEA 3UR3C 4URSA 5HAOA 2NXJA 4HI2A 2LLZA 5M2RA 5GVQA 4LRFA 1HQEB 3NS6A 2JJ4D 1K1QA 3FBFA 2QYGA 4IOCQ 2IVFB 2BYCA 2BJEA 2Z30B 1YIJS 2YWEA 1X4AA 1IKWA 3BZQA 2UXDF 4YB1P 5E3AA 3LANA 3W7BA 1RWWB 9ATCB 4PG8A 1MWYA 1IQTA 3IWXA 2KZZA 1DTQA 3MZIA 3DYAA 1HWLA 1RAJA 3HKZD 3WQPA 1NK0A 3CE8A 3NGUA 2V9WA 1K8AT 3PJ9A 4PCQA 3JAMY 3JYTB 1RWOB 3H98A 2DR7A 2IYGA 4CLKA 2C3PA 3BV8A 4QYZK 2WSEC 1FRIA 2Z2MA 2BKOA 4F8RA 1JLEA 3CD5A 4X62J 2CXEA 2R7QA 5AE3A 3IR6B 3GU0A 2DO0A 3CDWA 4F4KA 2KJWA 1NPRA 4C8LA 4J7CA 3TJ8A 4DV5J 2QZ8A 1YITS 2MQLA 3R5GA 5KG0A 2RH3A 2XMAA 4YUDA 4LF5J 1DTTA 4LUBA 3FSXA 3K5OA 1S6UA 4FZVA 3TQ1A 4OLPA 2P6TA 3L95X 2IRYA 4O44A 1S6PB 4YFUA 4NA1A 5KT5A 4ZJQA 3T5KA 2H65B 1IWAA 1WC3A 2RRNA 5CXTA 2OEMA 1TL7B 1IUJA 3VF0B 1ZM3A 4USIA 1NSKL 3RBZA 2WVBA 2R2RA 1HHSA 2CNKB 4M5HA 5KT4A 3OJSA 4KGVB 3TX8A 3M9OB 2VC1A 1S5ZA 2LA4A 2CA9A 1VIXA 2VJUA 3M8RA 1S9EB 2I38A 3D0IE 1DARA 2B9XA 5DM7Q 1UWBA 1LKZA 3HVTB 4R8UA 3DHWC 2FVSA 2UXBF 1ZPVA 7FDRA 4AE5A 4OI6A 2HVIA 4OZ1A 3PDNA 1VBKA 2CVIA 3H2VE 4I7FB 1TU0B 2WCXA 3WX4A 5B0CA 5KFGA 4J9MA 4MT1A 4B02A 4ECUA 1FESA 1TL1B 4B3MJ 4UUXA 1QAIA 1QUPA 3OQ2A 5F9NA 5KFXA 2ZE2A 1QVGR 2RUGA 1URNA 2B9YA 1MMNA 2RS8A 1KHVA 2HAIA 1DQ8A 3R6GB 2AYEA 1FVSA 1NUEA 1VJQA 1ZS6A 6FD1A 3KJVA 4PR6A 2MTLA 2J7UA 2ATCB 1QAJA 1XN9A 3TVZA 3V2UC 2K8GA 5A0YA 1FRKA 2IIHA 2Q43A 5KFMA 1UEVA 3W9HA 2HGMA 3GQCA 2YNGB 1YHQS 1YZ6A 3GZ7A 4NCGA 2CJAA 3K7RA 4WKRA 4U9RA 4DR5J 1VS3A 4DX7A 2GHPA 3M8SA 1C0TB 2A18A 1RU2A 3QJJA 3QGHA 4BWMA 4BC7A 4B3RJ 4JYAJ 1S4FA 2N4DA 5D0EA 2Y8YA 2DNZA 5CCMA 5D4NA 1Q4RA 4P9SA 2RQKA 5HMYA 3A3PB 2WOMB 3IRWP 1IM4A 3US5A 4WFYA 1UFLA 4LBPA 2DK2A 5KOWA 3I5CA 4C4WA 2PMWA 3QRPA 1NK7A 1RWMB 9RUBA 2J0WA 4JV5F 3Q8RB 1GT8A 3GV8B 1Q8KA 3B4MA 2HMIB 1RT4B 2XS2A 1AFJA 1U1NA 3MDFA 2E1RA 2HHTA 4ZVHA 1KFDA 1NJZA 3PG9A 5KFHA 2OD4A 2ASYA 1REGX 2WB1D 5C25A 1WOPA 2H1YA 2QN6B 1NKBA 5IQ6A 4PYAA 4TNOA 3CDAA 4ZCLA 4DCOB 4USKA 2QMXA 1YBAA 3FK4A 2YWGA 4OJ3A 4UZCA 2KO1A 4FF4A 4QU6A 4WZMA 5EGYA 2KL8A 3KNAA 2IJNA 4V19J 1YWXA 4R0JA 1OPZA 3RZAA 5GAGI 3MMJA 1FHTA 4MFBB 4ZJOA 5T7LB 3BBCA 1WTBA 2VFRA 2HWIA 3UN5A 3J7Z5 2NREA 1EB0A 2OHDA 4DQIA 3IM9A 1B99A 1D9AA 4UQTA 4TXSA 1HQEA 3H7HB 2R7TA 4F3MA 5E7OB 1U0SA 4R0EA 3NAIA 4KFBB 4OHWA 4YR3A 3L7UA 1HLWA 5KFYA 3OTOJ 2DH9A 2VPYB 2ABYA 4U8YA 3LGHA 1NM2A 3E01A 1XNRJ 1QTMA 2QT7A 3WC2A 1F6TA 2J9EA 1MWQA 2Y1IA 3AD7C 2HNDB 1TQLA 2EI5A 1D1UA 1RAEB 4KH1B 1PO6A 1J2VA 2VBWA 2W8LA 2VDHA 5HVHA 3JYTA 2LXFA 1RT1B 1IR0A 3CO0P 1R31A 2VQFJ 4K0KJ 4O3PA 1UWAA 1B7YB 5IC4B 1VOMA 1HQ2A 1UVLA 2VB6A 3W64A 1C0UB 1NZAA 1HD0A 2Q1LA 3TEHB 2IMOA 5FLXY 1FRHA 5JVHQ 3OFFA 3OUYB 5DDPC 1S9GB 2YTCA 2K7JA 1SV5A 4PQUB 2MGZB 2VIHA 4U96A 1KVIA 4AXJA 2WVCA 2QL5B 1LWXA 3MM5B 3MM8B 1S0MA 1G7CB 2MMYA 1ACMB 2VPWB 4KBIA 4WPAA 1G6BA 1S6PA 3THTA 4UOCA 2HQFA 3WX8A 1XMQF 2DH7A 3OL7A 4HL9A 2V2VA 3SSQA 1AROP 4E98A 2DBBA 3W5YA 5SZTA 4B9NA 4EBCA 2LEPA 4EGLA 4K59A 2MJUA 4WBFA 2BJ8A 3W8PA 4NEYA 2W1BA 4OZNA 3OFGA 3L09A 2YKPA 2ZH8A 2ALYB 4DF4A 4CO0A 3HFZB 4F4XA 4EBDA 1Q0NA 2B8PA 2F4VF 4DG1B 3KTQA 2KRBA 3DM2B 1XNQF 3HVTA 4JI6F 3UN3A 4K7QA 2HHXA 4A8KA 2K1RA 3OXFA 4Q2LA 4F67A 2E9RX 2GHVC 4I7FA 3NY0A 4Q5VA 4P75A 4W92B 2V8GA 3MTKA 1TL1A 2BR0A 4DN9A 2BABA 4IH7A 1ZM4A 5D78A 3PACA 3D28A 2KT2A 4ID8A 1U45A 4GKKF 4LF4F 4P10A 4ED2A 1MNEA 2HLTA 3IAS9 2EW9A 5SUHA 4LF1A 2QO3A 2AJFE 1UAWA 2BANB 4MKBA 1UMJA 2KHCA 3OBIA 1Q5VA 2WTFA 2CZ4A 1JKHB 1T8EA 1M5PC 4RUHA 2DGXA 3L9ZA 3NBPB 3C16A 5GADU 3O6QA 5HVGA 4J90A 4WE1B 5LOQA 3T3FA 1S6QB 3M8YA 4FYVB 2WOMA 2XHWA 3BREA 5ETOA 3MF5A 4ICLB 4GMKA 2JX2A 1Y9OA 1Q95G 3IBFB 1RT7B 3TA0A 4LRCA 3CIZA 2QLFB 3MR6A 1EAYC 4KQZA 4B9MA 1JLGA 1UFKA 3NKYA 1E6YA 3MMAB 4TYAA 4LFAJ 3FFIB 1MWZA 2E5IA 1VQYA 1UA1A 3SBMA 3V6HA 1HA1A 2JLEA 1YDLA 1JX4A 3QAEA 2R8KA 2OEKA 1O5JA 2WONB 1SL2A 2AV5A 4C98A 1UVJA 2BE7D 4HR2A 1ITPA 1TMMA 5E3CA 1LW0A 4YY3F 2KXHA 3M8ZA 2UUCF 2GVZA 4NI2B 2AX1A 4LF9J 3LUYA 2D41A 3CJ5A 2FJXA 1SJRA 4LBIA 2DCLA 5IWAJ 3UN2A 1U24A 1M1KT 4MFBA 3HD2A 3MEEB 3ZZRA 4C0OC 4DPTA 2W8KA 5HMZA 2E1CA 4UQGA 3THPA 3K5MA 1RTHB 1R0AB 3I5BA 2BACA 5L8RC 2CJYB 4KGXB 1KLMB 2IRXA 5DLFA 3TW0A 1V9OA 2M70A 3CMAS 1WEXA 2D69A 3DFEA 4NASA 2ZM6J 1S1XB 2MZTA 2H3EB 4KFBA 4P2XA 4ZS6A 1HI8A 4FPRA 3CIMA 3K8VA 4QW9A 1NSAA 4ZVRB 3NEKA 3T5LA 5KFQA 5CYJA 1KRPA 1VK8A 2VUGA 1YKWA 3EZOA 2YXLA 4WP8A 3LP1B 4CI0B 1FWPA 2B6AB 4DN0A 2ZOMA 4DL5A 4DPYA 2J8SA 3IBWA 2N7CA 3BBFA 2VF3A 1G4CA 4ID5B 3HDSA 1P8GA 1KQFB 3H25A 1RSCA 4LF6J 2CPIA 3RR7A 3ETOA 3C2PA 2ADBA 1RT1A 4CLLA 3RRHA 3OJUA 2HSEB 4WU3A 3MGJA 5KAKA 3H40A 4KT0C 3KLEB 3NRBA 1X4DA 1GH8A 1N32F 1U09A 3HHNB 4HVZA 1HBMB 1ZA2B 2NS1B 3W61A 2HGLA 1N34F 3JS9A 1S9GA 1UA0A 3Q8QB 3ZFVA 1NJYA 1CULB 4KYZA 1Y7PA 1CJUB 2Y9HA 2ZH2A 4PQUA 2MGZA 2XZDB 2RDDA 2L3MA 3ULHA 3MM5A 3DU6A 1BWVA 3MM8A 3O5TB 4I6WA 1HWIA 5HQMA 2AZ1A 4XAKA 1U1LA 2UV8G 2CPJA 1ELOA 2LXUA 2B9WA 5CD4H 3FZBA 4QQBA 2F63A 3CJKB 1FDDA 2XCPA 4HYKA 3KWMA 2A0FB 1GMWD 2XY5A 4DR2F 2CG8A 3NP5A 4OI3A 1WOSA 1YRXA 2R8IA 4JI2J 4DV2J 1IR1A 1VRTB 3VQSA 4AXIA 4DG1A 2A6OA 2W24A 3I0RA 3DM2A 2IM3A 3AT1B 4KPCA 3A8JA 1UZHA 3OTEA 1QSSA 1PYOB 1U1PA 1ZZFA 2UVUA 4K2JA 3LPEA 5EUHA 4YS2A 4PWUA 4OZ2A 3CGIA 5DZ7A 4OYAA 3H2LA 2JNJA 3MEKA 4NLTA 5EHHA 2F9DA 3CVKA 3OVBA 1P9YA 1RE1B 2GS8A 4QPTA 2FLPA 1GNKA 1DLOA 5H9FK 1NZ8A 1S4EA 4OX9J 4R5PB 5E0OA 2VQEF 1IBMF 1NCLA 4QR1A 2AD9A 3T9NA 5KFVA 4CO1A 2XM3A 3OPKA 2OFHX 1X4FA 5CZXA 2G0JA 4TY8B 1VC5A 2WHOA 2BX6A 3W2WA 2AGPA 2FJAB 3IR5B 1JKHA 2LU1A 2IM0A 3LH2S 2F40A 3LPYA 3PW4A 4GKJJ 1EP4B 2HRUA 2DHXA 4CM2A 5KFDA 4Y28C 5GAEU 3NBPA 4GC6A 4WE1A 3SCLE 2DJWA 2QC3A 4CTAB 2DKOB 3DLKB 3R7SB 2X1BA 1S6QA 1J5EJ 3K2YA 2EFQA 2F8HA 1MROB 4DU7A 2CQPA 4ICLA 2QL7B 4N5SA 3P6YC 1TAUA 1RHKB 1JNZB 3TARA 1RT7A 3EDQB 2ROGA 3JB9k 2FJBB 1SIZA 3GIIA 5FJ4A 3MCOA 3MMAA 1R6VA 2BJ7A 2CUYA 4JV1A 2ROEA 2UXCF 2B4UA 4X4PA 3J81j 4ZVUB 3ELHA 2W25A 2F7VA 1OSDA 4DSJA 2C22A 2WONA 4AUKA 1M5KC 1DRZA 2WVEA 1FF2A 4Y00A 3NGDA 5C2CA 2JC0A 1D9FA 2XB2D 3WIUA 3ZZOA 4U8VA 2XO6A 2M3DA 1RT2B 2CJXB 3BGUA 3KUEA 5JJBA 1TZ0A 3HF5A 3KLVA 3MEEA 2M4MA 5J1EB 1J27A 4DR1J 1BQXA 4C8NA 3B8HA 3I55S 4XPEA 2H5IB 4M95A 4RUAA 2HVHA 1XR6A 3NCQA 1S97A 1KLMA 4P7VA 2YH0A 3DLEA 2BQRA 2J0QD 3KOAA 5I4MA 1I1GA 3H8YA 3Q8UA 1ZPWX 3MCNA 4B9TA 1S1XA 4FXWA 4H54A 3DOKB 1TKDA 4IFYB 1HNXJ 4ZP9A 4X64J 2H4WB 2KYZA 2XMMA 1TK5A 3PHEA 2PA8D 3FDSA 3LP1A 3TJAA 1PYSB 2PC6A 4ECTA 4J9VA 4IRCA 2MXYA 1LFPA 3TZWA 4KKOB 5GAHI 4G6VB 4ID5A 1BY9A 4Y2AA 2ZH5A 2Q3PA 5ETLA 2CQDA 2EWHA 4CWBA 3GYGA 4EO6A 2HHVA 1RAAB 4CRJA 3MPUB 5GMEA 1T3NA 3KUHA 3CCLS 3CJ8A 1JWWA 3VZIA 3LP0A 3KLEA 1OMSA 1RYRA 2JEJA 2OJ3A 3DXSX 2E66A 3GIKA 3T1YJ 2ZH6A 2IYIA 1HBMA 5IC6B 1TL4A 5J2NB 1HIYA 1SKWA 2DY9A 1V3RA 2QYCA 4CO2A 4JI8J 5JMNA 5A8WB 1CULA 4FBTA 2EXUA 2RS2A 4HHJA 1CJUA 1XK8A 4HHHA 1VRUB 4X4SA 3V6JA 4ED5A 4LFBJ 3HP6A 1RWNB 2B3TB 2CJKA 3BPSP 4C8ZA 4LRBA 2OTJS 2A10A 2HHPA 1FJGJ 3KG0A 3U1MA 4URQU 2Q66A 2RQ4A 3DRYA 1CJVA 1YRUA 3CCSS 2HHWA 3QGIA 5KFOA 4DR7F 3GFXA 2CNNB 2J9DE 2FGOA 1G2EA 1UETA 3CJKA 2AEJA 5DETA 1TP7A 4QR2A 5C42A 2GQQA 2ZVIA 4Q44A 2ZHOA 1FNMA 3GJTB 2N3LA 2XZTB 3O3LA 1N5VA 1V5VA 3OLBA 5ETSA 2ALZA 2YNHB 1VRTA 3AQPA 3NGTA 3GMGA 2E7XA 4NYZA 1FA0A 3CULA 1EETB 2RMLA 3T5JA 4K50A 2LYVA 3HT3A 3FSIA 5EDWA 3OSNA 2VBZA 3AOBA 2V2ZA 3LGMA 2BXJA 3J80U 1YTYA 2X1GA 1HW8A 4UOFA 4DV6J 4ECZA 1M5HA 1XMOJ 2A3JA 1JLCA 1MMLA 3GG0A 3O2IA 2V9KA 4M5NA 3PYDA 3BQ2A 4F50A 2CZ9A 4R5PA 2KRRA 2KXFA 2DEIA 2V2KA 3RBDA 3QSYB 4B3OA 4JI7F 4DR3F 4IO9Q 2V6AA 2KM8B 2JZ5A 3DLJA 2B9EA 4QOTA 5KFAA 2DIUA 2GC8A 1N5TA 3A12A 4XIUA 4TY8A 2OAUA 3TRGA 2KM8C 1X5OA 2FHMA 1WACA 3C66A 1BQMA 3LO3A 4HH1A 1M5VC 4C0HA 3BS9A 3N6LA 4H4MB 5KG4A 1S48A 5KFCA 2U2FA 1S12A 4ZOSA 3OTBA 4O3OA 3NNCA 1NK8A 1H2TZ 2W9CA 4CTAA 1TV6B 3DLKA 4Y6IA 2QJ3A 1CC7A 2JL9A 3D6MB 3T1HF 1MROA 1H98A 2B4VA 4NYOA 3OVSA 3QFWA 2MJNA 1H7WA 2Z58B 3MM6B 1JLAB 4OYWA 4UF4A 2CWXA 3OW2R 4KGZB 4ZPWR 2IVYA 2CPZA 3RB3A 4CO4A 1RTDB 2CPHA 4CLYA 1S9FA 1K44A 2OPSB 1WDTA 5E41A 3BGFA 3UPFA 2P2CB 3MR3A 1U1QA 3H5SA 5D4OA 1FJ7A 3PO4A 1FT8A 3PJXA 3EJMA 4X2BA 5DM6Q 3T41A 5EWEA 4HHUA 1RT2A 5H9EJ 4USTA 4DL7A 2F1FA 4C8YA 2YH1A 3NGKA 3ZZZA 2B56A 4JOUA 4ZLJA 4DS5A 2W4PA 4EO8A 4DQSA 1TMJA 5J1EA 1VQ7S 2PT0A 4J9SA 2Z56B 3GCWP 5C24B 4DX8H 2EFOA 3DGPB 3KLHA 1VMBA 2YQ3A 4B9SA 3B54A 4TVAB 5CZVA 2HFOA 4O3RA 2Y1JA 1S49A 3CCWA 1YJVA 1P9QC 1KN6A 3DOKA 3NWGA 4DR6J 2ZNYA 1SH0A 4NYPA 4IFYA 2Q79A 2AGQA 2ERRA 4HI1A 1UEUA 3L7PA 4OHZA 1P27B 4ZVGA 3JXOA 1YQHA 3M32B 1HYSA 2I9SA 3TUZC 4KKOA 2IRUA 3KLFB 2BJDA 1GXLA 3RRKA 3RW6A 4O4GB 3I87A 1FWKA 2X1FA 2HFUA 3KK2B 2CPXA 4ETXA 5GAGU 2E9TA 2QSFA 4PXEA 2MLXA 2BQUA 4X62F 1QM9A 4A8SA 4JI0J 3SIPB 1FX4A 2W2PP 4B17A 4IH6A 5KFJA 2JLFA 4DV5F 4ZJLA 3RW7A 5J2NA 1EIYB 1FDNA 4I69A 2ZJPQ 2YWFA 4G1QB 3R5CA 2IMWP 4LF5F 5A8WA 4PPZA 3JQKA 3R1HA 1RZMA 1VRUA 2LEBA 2PIIA 2LQJA 3N28A 1RJJA 4UZBA 2HS0A 4L3NA 3TA1A 3A8KA 1MN7A 4YP3A 2OMOA 4KR0B 1RWVB 3VGUA 2V8PA 2MB0B 4W4MA 3NOCA 5E33A 1N5SA 4IH5A 4FS2A 1SI9A 4IUFA 2XYPB 2E7VA 4IDKB 4L6V3 1YJWS 1HNWJ 2L9DA 2NPFA 3C8YA 1RP5A 2KJVA 1IKVB 3BO3A 4P2SA 2NCKL 4WP3A 4BDPA 3SCKE 1YJTA 3ENQA 3TAPA 5KFFA 2Y1LB 5F8MA 2XNQA 2GFFA 1GTEA 1ZAWA 1S59A 2YNHA 4Q0BB 1TUWA 5BR8J 1EETA 1NH7A 3S8SA 1S76D 1U6FA 3EXYA 2FGCA 1W7WA 1WOOA 2W7PA 1NHUA 3EGNA 2OPRB 3LWLA 2MQPA 2LP4A 2DPJA 1S57A 3JSRA 4PQAA 1LW2B 4ZVFA 4ILLA 1LFWA 2CWKA 4OIXA 2ZEJA 1RGVA 2FHJD 4O3QA 4TU7A 1Q1KA 4TLQA 1KTQA 4J9RA 4LF7J 4C8MA 2LVWA 3Q2TC 4OZ0A 3R3TA 3I82A 1JMTA 4OI1A 4OJ1A 4LQ9A 4M5GA 4MK7A 2B4PA 3SI8A 3CJSA 4UTGA 2UUWA 4QJVA 3R9LA 1WJ9A 4FN5A 1V3ZA 2JEFA 1M5OC 4ZCIA 3SV4A 2IPOB 2HHHJ 4DR5F 2VH7A 4L74A 4KTQA 3IG1B 4I56A 4IG0A 3ETMA 4ZIWA 1H74A 1KEKA 4CLSA 1SKUB 2XG8A 3MPVA 4H4MA 2ATLA 2C3OA 4B3RF 5KG3A 4JYAF 1TV6A 2XULA 4JUZA 1L3KA 3MD3A 1X31C 4X4OA 3E3XA 2HZCA 5D0GA 4ECWA 4F4ZA 3G2XA 1UVNA 2HBZB 4RJVA 4RKUC 1S0NA 3JAMU 1SJQA 3ZZ0A 4PUOB 2UVRA 3W65A 1F9FA 2RB7A 1F2GA 4J9QA 4FYWB 1WORA 1JLAA 5KG5A 4HT5A 4ZCKA 5DQIA 1HR0J 2H51B 3LGNA 2CRLA 2R7VA 1RTDA 2V67A 1FFWB 3W5ZA 2OPSA 2HLUA 2ZHAA 2XHCA 2V8DA 5GADI 5F8JA 1CVJA 2BA9A 4ECQA 4R25A 1EKSA 4N8NA 3W8GA 4RNFA 5K20B 3VV2B 2UZAA 2BE9B 3V4IA 1REVB 4DPXA 2DRAA 4UUWA 4C7QA 3ILJA 1VQNS 4FDFA 4NX9A 1KP6A 5RUBA 2VBYA 1Q7LB 3UWTA 4M5KA 4ED4A 5C24A 3U1LA 2ZITA 3CJ4A 3BSOA 4UT4A 3DGPA 3HVAA 2VICA 3BGLA 1WF1A 1UKUA 3Q0AA 2O5DA 1F5AA 1FX2A 2OMLA 1A0OB 2CPEA 1BUXA 1K1SA 3E8OA 3OTOF 4WXWA 3G6YA 4ES3A 1IJEB 3DOLB 4XTTA 2YQ1A 1XNRF 2VKRA 2LQBA 3ZNUA 2XC9A 2W4DA 4Q8EA 2IBOA 3PFOA 1BMQB 4ERDA 5T14A 1HNZJ 3PX0A 3M32A 1NK5A 3D9BA 4Y2IA 5KG1A 1WNEA 3R97A 3W60A 2XI3A 1TVRA 3KLFA 2C2RA 1WHWA 4O4GA 3EPIA 4OX8A 1MU2B 1TUVA 3T5HA 3ZZYA 2ZJQQ 2M8DB 5IV3A 5FDLB 1BGXT 4XDCA 2DH8A 2AHOB 2ZJRQ 2VQFF 3KK2A 4K0KF 1FRMA 1KS2A 1Q81T 4DV7J 3IFEA 2JFDA 3HHLD 3GJQB 5AE2A 2Y0BB 4GRSA 5IOLA 2VFVA 1RHUB 4EYIB 4O0NA 1VQOS 4F0KA 4YR0A 4ZP6A 3IWNC 1CS4B 4ZN3A 5KG2A 5K9FA 3RAQA 2R2TA 4ZHRB 4TY9A 2DT9A 4G1QA 1FERA 4Y65A 3W63A 4KY3A 2M8HA 1S1TB 1WUUA 4QIEA 2BDPA 2MQOA 3J80Y 1HBUB 3U7JA 4ZPVR 4ZN1A 5ETQA 4ANEA 4ZDNA 1Y5NB 3R27A 2QFIA 5DRKA 4C3MA 1Y00A 8AT1B 4QWAA 3DOMB 4IDKA 2QV6A 3CT9A 1Q5YA 1RLCL 1KONA 2CQ0A 3CMES 1IKVA 5A6PA 1WF2A 2MKYA 1RHMB 3ILIA 4ZITA 3IR7B 3EGVA 3A3NB 5ETNA 2A6MA 3H0PA 2VZ9A 4GVBB 3DRRB 4CYUB 5E3QA 1NDPA 4NLPA 3SSSA 2ZC4A 3Q24A 2W2MP 2MHEA 4D3HA 1KR4A 1U2CA 3CD6S 2MZJA 2HGNA 5LMNJ 1ZM9A 2VV5A 3D66A 2OPRA 4X4TA 4C3KA 2XSJB 2C42A 3TAQA 4AL7A 5J2QA 4A8QA 2XSFA 3QGPA 3D6HB 1CEZA 3TANA 5KFSA 2DR8A 2DITA 4DUYJ 4ECXA 3TWZA 3R2DJ 2AJ2A 2LQ5A 1ZYQA 4QWEA 3FBBA 2XO7A 2OELA 4FF1A 4NLRA 2M88A 1IVZA 1FNOA 2YNIB 1FXLA 2C2NA 4LF2A 3BKFA 1T9TA 2L9NA 2JVRA 2HZVA 4CH1A 3Q8PB 2GMHA 1MLAA 1HARA 4BWJA 2FJEB 3AA8A 2AYMA 2AT1B 5ETMA 2QLWA 3RGIA 1LK7A 2ZDOA 1B3TA 1HMVB 2DGSA 3IG1A 1WD6A 4BCAA 1ROFA 3EZ5A 1SQEA 3MM9B 2ZH9A 5ETRA 1RXOB 4IYQA 1LNQA 3GB0A 3QATA 3CJ0A 2E44A 2NSCA 3SQGA 5I3UB 1VBYA 4FF2A 1RAHB 3CJ2A 2H9ZA 4OJHA 4ZVSB 4WFNQ 5HLFA 1VC0A 4OZ3A 3M1VB 1KNZA 1GK8A 1PKUA 1N54B 1GEHA 2C3MA 1KOHA 4LFAF 4RX6A 2WAQD 3PV8A 2DHHA 1Z2ZA 1TKTB 2QIFA 2XMKA 1KQGB 3M9MB 2GMJA 4IR1A 2PI4A 1BQNA 3HX9A 3K8WA 5FLXU 2OPPB 5CABA 1RTJB 2CDRB 3X3UA 4K4TA 2FLLA 1VFJA 2HURA 1VIOA 1NDCA 4P71A 2NXUA 2PO4A 4USMA 4LF9F 3PRDA 2EVZA 1QAXA 1S77D 2BJ1A 2VU5A 5IWAF 1REVA 4ELVA 4RW4A 3BYRA 1VK3A 1UZDA 3VWSA 4V19X 1GXUA 4DQRA 2ZWOA 1Z2LA 4TU8A 5THWA 1PIEA 1F1BB 2I6WA 3DC2A 2O1PA 2RRBA 4NZ0A 1X4CA 4ED0A 3GCXP 1CJKA 1RAOA 3IC1A 3DRSB 5F8NA 2FJWA 3V5RA 1TAQA 3NNHA 1XC9A 5D15A 5M2PA 1FDBA 1UVKA 4X4UA 2AJQA 2ZM6F 1X5TA 3PFEA 3I4PA 3DOLA 1U1MA 3KK3B 1HWUA 2Y1RI 4WFZA 4RBUA 2VPXB 3TEGA 4MIAA 3ONQA 4WYWA 1YJRA 1YBTA 3H59A 4M1KA 1R27B 3DN9A 2J8AA 2ADCA 1T9YA 2FVQA 1T11A 3V4MA 2UVVA 1RA7A 2RDIA 2K3IA 4LF6F 1WWHA 1MU2A 2POKA 5FDLA 3JSBA 1YGYA 2ZWPA 1N33J 1C1CB 2O66A 2QRRA 4E2FB 4FVCA 2P5VA 4FXVA 4TN2A 4RUBA 2PE8A 4ZA1A 3BBBA 1I5OB 2D3OR 1CS4A 3EVOA 2BUNA 2FC9A 2X3DA 3HZGA 5HBMB 2QMWA 1LXNA 3CC4S 4DSIA 2UU9J 6FDRA 3VAKA 2BW7A 4ILRA 1UP1A 1S1TA 2YVSA 3I4HX 1KDNA 5HMXA 3GV7B 4QIFA 2GAGC 1EHWA 3MMCB 1JB0C 4K4VA 4NLOA 2MKHA 3ZZPA 4M5LA 1L3VA 5HJYA 2ZH1A 4I2QB 3DGVA 1S0VA 1T9UA 3DOMA 3CCTA 3M6VA 3JTNA 4CLWA 2KDOA 4OYXA 1KTVA 4AQYJ 1VCTA 5GAHU 1BE4A 3UD5A 5K8MA 1H7XA 3PYFA 2KB2A 3PNIA 1XWLA 1L3TA 1RCXB 4JI2F 4DV2F 3KHRA 3UD4P 2L9WA 4P2FA 1OY9A 2KG0A 4GVBA 2J0SD 2EPIA 1OO0B 4ZLNA 2FD2A 5A6WA 3DMJB 4DEZA 2HHUA 1OY6A 2N7YA 3HPOA 3MURP 4ZPTR 1PGZA 3OVAA 1YJ9S 5DDQC 1S1VA 3M4XA 1HWJA 2C1EB 4DUZJ 2FUG9 1EQ0A 2YX1A 4ECYA 1JJ4A 2H54B 5GMKa 5BYQA 3DLGB 3C6TB 5CQGA 3HM9A 4F4AA 3NXZA 2HQGA 2HBQB 1OS5A 4JV2A 1FRJA 3BKTA 5L46A 3I56S 4DF8A 2F9JA 4C11B 4PG6A 3Q8VA 3OR2B 2MLZA 3G71S 4RNOA 3DI6A 3PW7A 2HW3A 2E5JA 2RVJA 5HO4A 3BN4A 5G0RB 3V81B 3KMQA 2FTRA 4NXMJ 1C4AA 5DZ6A 1IXKA 3RB6A 2X1AA 4B3SJ 1WG4A 2V8HA 2CJBA 2HNYB 4NMXA 1HMVA 1FWLA 4JI1J 3S6EA 3CPWR 5B0DA 2Y8WA 4GKJF 4DFJA 3RUBL 4CH7A 1AUDA 2LDIA 2GIFA 2KYXA 4P7TA 4C2MA 3MM9A 4WWSA 3BQ0A 1SKSA 1RAIB 2DGOA 4Q8FA 3UDVA 1J5EF 2ZHBA 4OLOA 5I3UA 2B7CB 2KH9A 2DRBA 5MLCV 1RT3B 2NYHA 3C15B 1RYSA 2MPUA 4P73A 3TO8A 4AT1B 1PCAA 4KHPJ 2KFZA 2MSTA 2KTQA 3OL9A 4DPWA 3M1VA 2CQ4A 2NR0A 2EFNA 2DIVA 1R8PA 1T94A 1SIWB 2DNGA 1TTHB 3QT5A 3CTRA 5A2QU 2ZBQA 1JJ2R 2EC2A 8ATCB 4F0MA 1NBEB 5B08A 3BJYA 1U8WA 5BYRA 1N6QB 2DEJA 2OPPA 2VFTA 1RTJA 4ZVTB 2VOOA 3VAFA 4IQMA 2MQQA 3OTCA 2KZMA 2B5JB 1VLOA 4PXBA 1NRKA 4B9LA 4ZVEA 1O6XA 3A3OB 5D3GB 2RUSA 1HBOB 4O4RA 4ZPBA 2KT3A 3C6UA 1BWEA 1TELA 2I5JB 3MMBA 2CVEA 4ECVA 2OP5A 2I8EA 3ZZTA 4DR1F 1X9MA 3WC0A 4LR7A 2DYAA 3U27A 1IBCB 2G0IA 5KT6A 1WEZA 3DRSA 1QVFR 2MY7A 1WELA 3QQCD 3TI0A 2DY1A 4NLVA 1UJ5A 1FXDA 4ATNA 3T19A 1OPIA 2YNFB 1F5BA 2M9KA 3HLUA 5F8GA 1VQ9S 2HFZA 3VQTA 4MYTA 3JTOA 2KT5A 4A47A 3CO9A 1Y4ZB 3HFVA 1QJHA 2YWHA 4UOGA 2RAQA 1HNXF 5LL6d 1XQIA 3CC2S 1PJ6A 3KK3A 5L1JA 2PMHA 2LFVA 4K4UA 2PD1A 1WHVA 3IGVA 4UW2A 3TZZA 1U02A 1X9WA 1YVFA 3DCAA 5IFMA 5CD4A 1Y5IB 3IP0A 5LMUJ 2MKCA 3NS7B 2V34A 2DXFA 1U25A 4RBVA 2P9GA 1C1CA 1WC1A 1NSQA 2N4CA 3R8YA 1NHKL 4K8RA 4H4KA 2VG6B 3T1YF 3TUIC 2ZKTA 5F3TA 2K2PA 3BO4A 3GSDA 5HBMA 4CNYA 4EFAC 1JXLA 3M2VA 4JI8F 1URRA 2R7UA 3CF5Q 4U95A 4LFBF 3HVRA 3ZTSA 2C28A 1FJGF 3NS5A 4L73A 1HNVB 3FMWA 3ENWA 3RTVA 2KHDA 3TAMB 4RUCA 4LR9A 3MMCA 3UCUP 3CEDA 2NUUG 2IC3B 5D8HB 4NOHA 1LQ9A 4A46A 2R7XA 1P1TA 4P52A 3AD9C 5ETVA 4HACB 4I2QA 5KFKA 3ITHB 5AJ3J 2XS7A 2BJ3A 3P4UB 3OR1B 3R7BB 2E7WA 1DZ5A 1V6HA 5KOXA 3I5AA 3FJ2A 1VQ5S 1GQEA 2G9OA 2BKNA 4DHVA 3PY8A 1RWPB 2X51A 3N6MA 1KFSA 1S7HA 4RL1A 1YJNS 2QMUB 1AZSB 3KHLA 4X84A 3DMJA 1NNDA 1XIQA 3UE2A 2W4CA 1FD8A 4URGA 3PX6A 4DFMA 2G2YA 3C14B 3O8WA 3GR1A 3G8TA 4Z7CA 3G96A 4LSNB 1Q79A 3EUNA 2D74B 5HL7Q 3AXKA 3S7RA 1KQKA 1WSVA 4K4SA 4DV6F 1TK8A 2DNYA 2RRAA 4WCEQ 3VTIA 1K47A 4HT7A 1XMOF 1LXJA 2ZUAA 1YLXA 2ZZMA 2J9CA 3OR2A 1GMUA 3HVWA 5E2QA 3MECB 3ZTOA 2ZBPA 4GVLA 5G0RA 3V81A 1R89A 2AF6A 3NCRA 2B51A 2A2CA 1ULRA 5LXYA 4EI2A 3ZC4A 3F56A 5CYMB 1IKYB 2XWXA 2HNYA 3BSCA 5HJXA 2RT3A 1VBXA 2KI2A 3QSIA 4LFCJ 3QJLA 4FYDA 4ZPAA 3D68A 2MQNA 2VODA 2KVQE 4OYZA 4WKYA 2HIQA 3CXCR 4YHHJ 2EFVA 1RK8A 1RWKB 2D9OA 2W9AA 2I1RA 2RE1A 1RT3A 2W7AA 2YWWA 1BD6A 1TL7A 1PYTA 2V0NA 1FDAA 4QIWD 4MIBA 3W1YC 4OYOA 4RW7B 4QWBA 4FYXB 3VALA 3NMAA 4L72B 2RF2B 4LSZB 4MKAA 2G4BA 2XCAA 5L38A 5CHCB 3MCSA 1GTHA 1S9EA 4LT6A 3QGGA 4RR5A 3QAUA 3GPAA 2F3JA 2COLA 5I42B 1FJEB 1T9XA 2XMJA 1CBKA 1L3SA 2F8MA 3HHDA 3BR8A 3PYGA 1AUSL 2YKOA 2JWNA 3UR0A 1Q8BA 2B5JA 4XK8C 5J2PB 1N5QA 1FFGB 3KJFB 4RWXA 1U49A 2UUAJ 5D3GA 2HFNA 4KJIA 2GVDB 1K73T 2I5JA 2IM2A 1H3DA 1CPZA 5B0GA 2ZFHA 2VG7B 3IS9B 3V6KA 5HMWA 5HQLA 3KNGA 3ISNC 4AD6A 4X4VA 5KT7A 2IA6A 2E5LJ 4RNHA 2KKHA 2B43A 3S1TA 4CQ1A 2YNFA 3DYAB 4G3IA 3PW0A 2CPFA 3ENVA 3TJ9A 1YJ7A 1VRQC 2YNGA 1P1LA 2P9CA 3LAKA 4DR6F 3HHEA 5K8OA 3CCVS 4N7TA 1MW7A 5J1PA 2BM1A 4RW9B 4DL4A 1JXVA 2E5HA 2KFNA 1C0TA 3G8QA 2V50A 3PW2A 7FD1A 3BF4A 2D3UA 1UJ4A 5EWGA 1FO1A 3W2VB 1E6VB 4YDXA 3HK2A 3FC9A 2GQ2A 2W2NP 3EYZA 3RYLA 2E1PA 4ZPCA 4K4ZA 2KFYA 3R7NB 1DJ0A 1NPKA 3HI9A 3HKWA 2R8HA 1NB2A 4X66J 2HMIA 2P6SA 4CNZA 1RT4A 1LK5A 4F02A 3UDCA 1QUVA 4JI0F 3FCHA 3FQKA 1MG7A 3ZTRA 3B4DA 4X4NA 4CT8A 4WFBQ 5M2UA 2DNHA 5HATA 4O44B 3CJTA 3OD2A 4N8OA 1ZOTA 3HMJG 3SZ2A 2C2MB 2V2QA 2DNRA 3CD0A 2MKJA 1X0FA 2ACMA 4G1PA 2HAFA 4G1IA 2DRDA 2JEIA 1HNVA 3N01A 1CC8A 3TAMA 3UD3P 1ZM2A 3H20A 3M9NB 2IC3A 3L7OA 5DGBA 5EWFA 1EARA 1HNWF 5T7LA 1Q86T 3PCOB 3FQLA 3ITHA 2DD8S 3NG8A 2ZBIA 2AIRB 3RB0A 2GIQA 4LSLB 2XGPA 3QYYA 3BN7A 5IQQA 3ZNJ1 1HL6A 5BR8F 4QW8A 1JLFB 2P8IA 2JEGA 3U02A 3RRGA 4C8KA 1GMWA 2PGCA 3GFZA 2ZE2B 2QGFB 4OI4A 3VR1A 1FTCA 2LU2A 2VONA 2BM0A 3CUNA 2R7RA 2CIMA 1LOUA 3F0NA 4LSNA 4CH0S 3JSYA 2HNDA 3D3CJ 2PMZD 3CD7A 2OKQA 2IJFA 2Y0SD 3RBXA 2HBYB 2UP1A 1H0HB 4LF7F 1N36J 2HG4A 3P96A 4LIRA 3HSJA 2AZ3A 2VKZG 4NCGB 4DZDA 5KT3A 4NA3A 1W2BR 2HWTA 2DNLA 4EBEA 5A2QY 1U1OA 3H5XA 3GIJA 4OZJA 2LCWA 1SC6A 2ZVSA 3S01A 1DHMA 2HKEA 1R8BA 1C0UA 3BSAA 1WDDA 2FLOA 2M5YA 3P45B 4F36A 1ZETA 5CYMA 1NO8A 4CM0A 1IKYA 3NMRA 2B4OA 2HHHF 1NH8A 3OUYA 2HK2A 2O3DA 3SDEB 5L1KA 3TUJC 1NU4A 4ZVOB 5D0HA 2V5HG 1VR6A 4CIOA 2IHR1 1F5CA 3HD1A 4YMEA 3R2CJ 5F9LA 3QZ7A 2MYFA 2XMWA 3KKFA 3QBCA 4F04B 2LDYA 5L1IA 1O51A 1K9MT 1RACB 5C25B 3GR0A 4RW7A 4DUTA 1WEYA 2W7OA 1RHQB 4K2XA 3R1LA 2RF2A 2WBMA 3MWBA 4U67Q 1HR0F 3QLHB 1PILA 5AXLA 2OSRA 3P5TL 3MR2A 1Y3JA 5ETTA 4F7VA 1PG5B 2BZ2A 2G1HA 4NLYA 1AXQA 3KLGB 3DDKA 5IS2A 4Q45A 1FKAF 1Q8IA 1UVMA 4PXDA 3EWGA 5DG9A 4MH8A 2QX0A 2W2OP 1R8AA 2ZBRA 3CB4A 1QSYA 1WKKA 5J2PA 3PXGa 3CCRS 3EVMA 5FD1A 2QA1A 3ZZUA 1R3NA 3THVA 2GVDA 2HRTA 1U47A 5D77A 3ADAC 3FVYA 2VG7A 4C8OA 2ZUGA 3IS9A 4NE9C 4YN3B 2ILZA 1MN9A 5IV4A 4F4WA 1R8CA 3GYXB 4QYZJ 2EK1A 2N3OA 1Q8LA 2WW4A 1IM6A 4OHYA 3E01B 4DSKA 2ZZNA 4C3LA 4DX6A 3DXBA 4EU0A 2BANA 1H72C 3TVKA 3KHHA 5K14B 2UUBJ 2FZKB 4NLGA 4I64A 1SQGA 3SXLA 2L48A 2FIUA 1IBLJ 4AYBD 5ETKA 5F3ZA 4ZCMA 4D3GA 4RW9A 2IM1A 1T02A 2KG1A 1RHJB 5D6GA 3PKMA 1PC4A 2MZRA 1NLKL 2GQCA 4C6AA 4QWCA 2A1BA 1HNZF 3GWCA 3BGRB 5MAOA 3UCZP 2M2BA 4DV4J 3K5PA 3HJFA 1FXRA 3DLHA 1SCJB 3W2VA 1E6VA 1OY8A 2ASDA 2NQPA 3WHIA 5FIIA 2DHGA 2YQ0A 1D3WA 1XTZA 2GAHC 2Z2ZA 5DO2A 4DV7F 1R8HA 4DV0J 1WSRA 1DBDA 4FNIA 4K4WA 2EBEA 4NLXA 4XO0A 1X4GA 1TFWA 1SV5B 5I3PA 4DWIA 1VJWA 3FFIA 1A6LA 4OX7A 2RKIB 3W9IA 1F60B 3OXLA 4OI2A 3T6BA 3JQMA 3MD1A 3Q23A 4WU2A 1UEKA 3ISND 1X0PA 3DRPB 1V3SA 1IBKJ 5HANA 2MQMA 5KG6A 4DDFA 4HTJA 1UW9A 1FKPB 1NKCA 2VOPA 4NI2A 1JIHA 3BKUA 5J1NA 5JVGQ 2PEHA 2DISA 4F25A 2DR9A 3D1HA 3IN5A 5J2MB 2FHKA 3R5DA 4FKXA 4LSLA 1RTHA 1R0AA 2OEJA 1SL1A 1VISA 2DPIA 1YG0A 3CDBA 2AW0A 2K1RB 2HPUA 2DGTA 3HJVA 2Y3YA 1JLFA 4FS1A 4DFKA 2ZOGA 1Q78A 2CQ2A 4Q2MA 5D0RA 3ZTPA 5LMNF 1U48A 1R0CB 4A4JA 3W9JA 3BDPA 1JNRB 1OYDA 2V8VA 4OI0A 2W9BB 2Z0GA 3Q86A 4DUYF 1FRXA 3MCMA 2N82B 1TL3B 3QO9B 1RHRB 2B6AA 1PC5A 1PBAA 4KGMA 4ED1A 3LA0A 5B7WA 3KG4A 1T9VA 5HVFA 1VQSA 2BQ3A 2F5GA 2V4RA 2RILA 2HBRB 4S0MA 2OFGX 1AT1B 2G0CA 3TOQA 4JI5J 3R5JB 1NJXA 1SUQB 4HH0A 1SC4B 1NAQA 5F8LA 2BKPA 3C16B 3D54A 1WHXA 4CDIA 2MEWA 2XEXA 2AJ1A 3QT8A 4ES1A 1P6TA 4CO5A 3N9UC 1M0SA 2HEKA 4LF8J 5DG8A 4J9OA 4A8OA 2NXNA 3SDEA 3A1YG 2AEMA 4M5MA 5C7PA 3KFWX 4DPUA 5T41A 4JB8B 2HNZB 1LEOA 1ZH5A 3BGOP 1JLGB 3JTPA 1E6YB 3CMQA 4UY8T 2Z57B 4BS2A 2NUHA 1RB0A 2DHAA 4NA2A 1FK9B 3EGZA 1O8BA 5HI7A 5AXNA 3SCJE 1RT6B 3H2UB 2FVPA 5U47A 4LQ3A 5EX0A 1LW0B 3K5LA 3QLHA 2GVZB 5DQHA 3AAWB 2JOQA 1N0VC 4YEAA 2D1CA 2O01C 2Z2YB 4FPIA 2RHSB 3BSNA 4USWA 1NKEA 1W26A 3KLGA 4WP9A 4IO1A 2EC0A 3RU0A 1VQPS 1FJCA 4DR4J 3G6ES 2E1MC 1RISA 2DGVA 5L9XA 3D0GE 4ZPDA 3R5BA 1F9EB 3KLIB 5E3RA 1FCAA 2B0GA 2DNNA 1LV5A 2UVWA 4HDHA 1F0XA 5F41A 2EBGA 2VBXA 1UPMB 3N0VA 2OO4A 2HQIA 1T9WA 4RBTA 4RNNA 1YRTA 2UUTA 1FE0A 3IRXB 3UVJB 1AA1B 3Q8YA 2GMLA 5KTQA 2WSCC 5ITHA 5K14A 4M8LA 1QE1B 3K57A 2DTJA 2HVDA 3ZO7A 5A8RB 5KFBA 4EZ9A 1EP4A 4OL8A 2MKIA 1FNXH 3GFYA 3PYEA 4IQXA 3MUTP 4I67A 1RBAA 2WBRA 2FY8A 3I6PA 3BGRA 2BMBA 4ZP7A 3FUYA 2OH2A 3QPIA 4PPDA 2HZAA 3MPDA 4X4RA 4NRUA 1TKZB 2F4FA 1OSCA 4CO3A 3GV5B 1RT5B 4DV3J 1DAXA 3HFKA 1N33F 3BYPA 2XI2A 1VGYA 3BR9A 2JH3A 4OYBA 2CQCA 3QWUA 4PKDB 1D9DA 2IAJB 2GHWA 3M2UB 3BPDA 4KHMA 2HQDA 4TLRA 4RO0A 1W25A 4QBUA 1WC0A 5B0EA 3VHQA 2RKIA 3QJPA 2C2OB 4ENOA 2ZH4A 4U7UK 4TQRA 2AKWB 3BB5A 3C3LA 2UU9F 3HHLB 5L1LA 3DRPA 1VQ6S 5HQ8A 4U7UD 3A13A 1N5YB 1FKPA 3HHLC 1RCOB 4EMDA 2NXEA 4KRWA 1DY3A 4MMOA 2A2DA 3FMBA 2PEBA 4MK8A 4WTYA 3M8WA 2FHOB 3EGWB 4JP8A 3VAGA 1ICEB 2AJ0A 4N77A 2ZH7A 2VASA 4HTIA 4AQYF 5J2MA 3I31A 2JLGA 3I0RB 5F8IA 1RI7A 1NJWA 4CLUA 3L4BC 5A76A 1UTAA 1AW0A 4KSEB 3F73A 4LMZA 2ZH3A 1CJTB 3AJ1A 4ALZA 4YB7A 1W2IA 2J5AA 4B9UA 3D1QA 2CQGA 2K06A 5H9EK 4X65J 2AP6A 3A4TA 3TQEA 4ER8A 3HSDA 4RPFA 4KO0B 5G4DA 2GJ2A 4KHRA 1DLOB 5JUMA 4ZLLA 1TKXB 3MR5A 1T0TV 4DMZA 3SYZA 4DUZF 2W9BA 1U1RA 2DNMA 2AQ4A 2CDQA 1R6YA 2NLWA 5IM0B 1TL3A 3QO9A 2YY3A 5DDRC 1CQMA 4J9UE 1NPPA 3TX0A 4DV1J 1GFWB 2EK6A 1VBZA 1HFEL 2EG1A 5IZHA 2NPIA 3NNAA 3RBEA 1X4EA 3W2WB 2XZWA 2W2QP 3D4JA 1U1KA 3U1NA 2YKMB 1S10A 5HROB 1HHQA 2CQ1A 2YKAA 3LOUA 2QA4S 1HD1A 4NXMF 1SUQA 3B78A 2FHJA 4B3SF 5KG7A 2P9EA 2PDAA 4YQWA 4DX5A 5LSRA 3MXHP 3MOZA 3TZYA 4JI1F 5IT9U 1T95A 2CQHA 1JLBB 8RUCA 3L3CA 3OTDA 4JI4J 4BLGA 4I6YA 1T03B 2HNZA 1WF0A 1IJFB 5DG7A 1KBRA 4FF3A 3IA0A 4ZLPA 1B0TA 4ELTA 2HQ3A 3GJRB 4KHPF 1FK9A 4ECSA 2WZ1A 4I68A 2HYIB 3AY0A 4B3TJ 4F3QA 5B0FA 4ANCA 4PWDB 3D67A 1RT6A 1C2PA 2XYGB 4DZ6A 4QWDA 3UDLA 5LM7E 2E1AA 4RW8B 3D3BJ 3PEJA 3MTJA 3R5AA 5K8PA 2XLKA 3P49B 2MKSA 4ZK7M 1NK6A 2L41A 2JC1A 1M1HA 1VQ4S 3TVYA 2OI2A 3KLIA 3DLEB 2ROPA 4B3MF 4TKTA 3UI3A 1JQGA 1BHNA 4NXNJ 2WW8A 1PBUA 4KE5A 3F44A 3BO2A 4LR8A 3GTYX 4FVMA 4O0IA 4IOAQ 1H2VZ 3IRXA 4F3OA 3UVJA 4GO5X 1WG1A 3TR5A 1UCNA 4WXOA 4E8UA 3CCJS 4KC5A 2RU9A 1SC1B 4YDDB 1S79A 1QE1A 4DJBA 1HNIB 4DU8A 3D7SB 5A8RA 2DB1A 1WKJA 2DXEA 3MEGB 1YZ7A 4F26A 1B64A 4PG4A 1JJCB 1SL0A 1CSJA 3LALA 2IA0A 3QWPA 4HKQA 1D09B 1HHTP 4EUVA 1KC8T 2HHQA 3LP0B 2V68A 2IVMA 1XEZA 4LRDA 3KUGA 2OPQB 4OYPA 1TKZA 5LMUF 3C46A 2HFVA 2MZ1A 1RT5A 1DURA 4OV1A 2FPHX 2V4QA 3FEYB 4J5OA 3CSKA 1XERA 3MM6A 3VVTA 1TL5A 2IAJA 3WZ0A 3M2UA 5DGAA 2CAJA 3AHPA 4F4YA 2RQMA 3VVUA 5E3PA 1KSPA 5LXRA 2VD3A 1I94J 3PJWA 3HSGA 1GX5A 4NLDA 3DNCA 1S1WB 3FZ2A 1CJVB 5BYSA 1GX6A 2V4JB 4QYRA 3PIPQ 3LW5C 1AB8A 2LMIA 2AGOA 4DL0C 3NGRA 4Y2KA 4CLTA 3CCUS 1RAGB 1FRLA 3HHLA 2R7OA 4OZ5A 2V94A 1G3OA 2C2DA 3GIRA 3A8EA 4JI3J 4N41A 4MJKA 1J5OB 2NZ4A 1N5YA 4IG3B 2BW2A 1PSDA 5C42B 1U0HB 3RAXA 2XY7A 2MSSA 2PA3A 1BXNA 1I3OB 2J6UA 2NSBA 2FZCB 4W98A 4KV8B 1RWXB 4ETZA 5AJ3F 5KFZA 2BE2B 2H48B 1S1UB 2G2ZA 5H9FJ 1ZTWA 5B0BA 2AYBA 2YPZA 4WFXA 2OSQA 1U4BA 2QFJA 2YX7A 3OT9A 2UXDJ 3UDEA 3HULA 1CJTA 4I2PB 2X3GA 1A7GE 4ZP8A 1RLDA 3GP9A 4NEZA 1VC6A 4MAKA 1IWGA 3K58A 5H1SV 4N47A 2B8QA 2GZOA 2Q6BA 4OHXA 2VPZB 1YSJA 2BOPA 3MFIA 1D8ZA 4EZ6A 4KO0A 3G6XA 1TUGB 2YKNB 2ILYA 3IAM9 4WJBA 1WC5A 3PIOQ 2M7SA 1TKXA 2GCFA 2RQCA 1JLCB 1ZBTA 2YKQA 2XMUA 1N52B 4XPCA 1X9SA 1M90T 2ASLA 4J9LA 3EDRB 1NDKA 4MKYA 4B3OB 4A8FA 5IM0A 4M5JA 1FEHA 3KXDA 3D1OA 3NAHA 2XS5A 1IR2A 3NGSA 2JRSA 3J7YI 1BC6A 4IOBA 5KT2A 1X5PA 1H6KX 3TP2A 3D2WA 3H5UA 1R7IA 1BQMB 1SH3A 2YKMA 2QA2A 2F8EX 5HROA 3I32A 3VGSA 2D3ZA 5K5MA 2R42A 4UY85 2RD5C 3HZEA 1U2RA 1HQUB 3Q89A 1TFYA 3CJ3A 4RWWA 4LVNP 3ISZA 2LA6A 2W9CB 4LFCF 4RW6B 3X1LB 2KN4A 4ITSA 1C1BB 4NLQA 4KAIA 4BC9A 1JLBA 2CNOB 6AT1B 3JQJA 1T03A 2FB0A 2KVIA 4YHHF 2I2YA 3KK1B 5D4PA 3MR7A 3Q22A 3NCPA 1KQSR 4F0HA 2SXLA 5D4LA 2CQIA 1XR7A 3GJSB 4LIWA 5BXIA 3T6JA 3QT7A 4KPYA 5B0AA 4PWDA 3Q83A 4U7CA 3Q2SC 3QIPB 4KGKA 2UXBJ 2Q6CA 2NXCA 3MHYA 4PG5A 2DNPA 4Q0BA 2EG2A 4OHVA 1X4HA 1VQ8S 4TU9A 2BEFA 1RKJA 2XTJP 3PRVA 4DLEA 2HS3A 2IDLA 3K89A 4RW8A 3H42A 2VA2A 4USJC 3ZTQA 4I1TA 1WI6A 3GYNA 3FEZA 1N48A 4RZRA 3DLBA 1LW2A 2HWHA 3KLHB 2ZNZA 1VQKS 3M6WA 3BEGB 2O67A 4ED6A 5CCLA 2UUAF 2X7IA 2PFFB 1QTNB 4M5DB 3PR5B 3I9V9 4NWBA 4F2SA 2HVZA 1TK0A 1VLYA 4MTPA 2DNKA 3M05A 3AA9A 2CADA 3N79A 3DU5A 4Z37A 2KU7A 2GNKA 2E5LF 5I3QA 1SXLA 1T7PA 4LBHA 3PM9A 1HYSB 2XNRA 1Y11A 1HNIA 2B7BB 2GIRA 3MEGA 1HKAA 1YK9A 2FZGB 1JLQB 3ICLA 1SJ1A 4WF9Q 4JV5J 3IXQA 4P72A 2BBEA 3AXMA 4QZVB 4UOHA 1RADB 2OPQA 2DR6A 4OZLA 2QLJB 3G82B 3A8IA 2AEFA 4A8YA 1YX2A 1Q82T 2QEXS 1O0PA 3C19A 4PUOA 2VFUA 4CCHA 4X66F 2V63A 4DS4A 2AX0A 4NLWA 3W3SA 3FEXB 3UQSA 1X60A 3T1AA 4F2RA 3CCES 3MFHA 4LJMA 2LQ9A 2JHEA 3OV7A 4K4YA 3G4SS 3LQVA 1S1WA 5LSLA 2V4JA 2XWYA 3UFCX 2CJQA 4DCJB 1RAFB 2GGPB 1KKHA 2HS4A 3AJDA 1QSLA 2AJ4A 2R9LA 1J5OA 4DI6A 4IG3A 1U6BA 1U0HA 3OHBA 1SB6A 3PO5A 3GONA 1RWUA 4PRFA 4PABA 3LTOA 2GX8A 2WB4A 4NRTA 4KV8A 1FFSB 1OYEA 5KFUA 2BE2A 3RB4A 1S1UA 1D0EA 1ZA1B 2CJ9A 2IJRA 1WHYA 2CNLB 2J6SA 4M94A 4J9KA 4I2PA 4Y34A 2PN6A 3NL0A 2DHSA 2E5GA 4M63A 4ECRA 2K3KA 5IT9Y 3OFEA 1S0OA 1PAUB 5C2GA 4NZ6A 2YKNA 3VGTA 5DJBA 1HWKA 2RU3A 2MY8A 4QIVA 2AMCB 3EPGA 3QRQA 4Q7AA 1PJ5A 3GE9A 4JBCA 1RBOB 3SQOP 1KD1T 2WVDA 2JSXA 3K5NA 4Z7YA 2QSWA 1LWEB 4L75A 2ZBCA 1N88A 3K17A 2EFGA 5L9NA 1L3UA 2XMVA 4FP9A 4HDGA 3CCQS 3CCMS 4ZKAA 5CYQB 1NDLA 5KFWA 4YB5A 3HCXA 3PR4A 2AYGA 4P74A 1N36F 4DL2A 3CW2C 4Y2MA 3Q8SB 2V69A 3MOJB 1S7IA 2FDNA 3G8SA 4IG0B 5EX3A 3PW5A 2HK3A 2IDEA 1F3VA 1HQUA 3J7AN 3MM7B 5AXKA 4ZHRA 1B7FA 2VA3A 1XMBA 1UJ6A 3VZHA 1XMQJ 1N56A 4RW6A 1C1BA 1T05B 3GG1A 2NZCA 1NSPA 3KDOA 4OMFG 1HBUA 3HSZA 2CQ3A 1K0VA 3FRYA 3KK1A 1EX8A 4L3KA 2EEYA 3VAHA 3PVXA 2YPYA 1RKIA 3D6TB 3BDEA 2F4VJ 1WG5A 2E9ZA 2RIJA 2DO4A 5KFEA 3N4WA 1XNQJ 2CQBA 4MYUA 4JI6J 3QIPA 2JFKA 4LREA 1U6ZA 4CZCA 3DRRA 4CYUA 2EKNA 2FJVA 2QE5A 4OYIA 1OIAA 3V4IB 2C3YA 1KOOA 3I0SB 4DCPB 5IT4A 3PX4A 5F8HA 5CA5A 2H5EA 3G6VA 1WKLA 5EN1A 3FBCA 2XSJA 3DKDA 3VCDA 4NPOA 3CDEA 5JXSA 3P8BB 2DGUA 4W90B 1RTIB 4DSLA 4GKKJ 4LF4J 3MI7X 2E29A 4WK1A 2VG5B 3OHAA 2Z4PA 1XJWB 4M5DA 2ZOFA 2BV3A 1UVIA 2C3UA 5DQGA 4OX9F 3RR8A 1F3FA 4EK2A 1DFDA 2YNIA 4K5RA 3B82A 3AB2B 4MK9A 4YB6A 1FKOB 4WYLA 3G87A 1V5IB 3AODA 3FSYA 4N76A 3P3DA 1SC3B 2ZZTA 2UUBF 3H4BA 1RTZA 1X4BA 2HHSA 2QLXA 2VHGA 2FVRA 3CJQA 1TVRB 2LQ8A 1IBLF 1N8RT 3CC7S 4OX6A 3W66A 3D6FB 3CWJA 1JLQA 2H4YB 3O1LA 3LAMA 1NB7A 2HVEA 2QLBB 1ZAVA 3TA2A 4LRAA 4DV4F 1PAEX 3FGVA 4CLZA 2BRKA 1MSWD 2R7WA 2W01A 3M6XA 3H90A 3G82A 1QD1A 2MZQA 5DS7A 3IBCB 2QTWA 4DV0F 2FC8A 3BM7A 1FI4A 4DL3A 2AU0A 4QU7A 3W5XA 1KVKA 2DXDA 2D3O1 1EZZB 3E2EA 3W62A 3PRBA 4NL5A 4OFZA 4YY3J 2GO9A 3M8QB 1TKTA 5DDOC 2UUCJ 4J9PA 1M1GA 3SV3A 4RU2A 1Y0HA 3EVWA 4I6AA 1FE4A 4WZQA 2GGPA 4G65A 3N5BA 2OTLS 4WIQA 1IBKF 3HXMA 3IO1A 4K4XA 3J81U 1UPPA 4ED8A 3AOCA 3WIVA 1KHWA 3D5MA 1CLFA 4ZMMA 4PYDA 2AWZA 1HI0P 4DBQA 1S6OA 5B09A 1I51B 3NLCA 5HSPA 3RG6A 1Y3KA 1G1XA 2DNQA 2LKZA 3DHXA 1SKRA 4DSEA 5J2QB 3FBEA 3WDOA 1WC4A 4RNMA 1HBNB 3CNQP 3KHGA 3GIMA 3AJ2A 4ELUA 1FEEA 1RA6A 4J91A 1N4LA 3QNWB 5BJRA 2HRYA 1SVDA 2XGQA 4Y2CA 5CH7B 4X64F 1Q16B 1X8DA 4O23A 3LP2B 3F41A 5CAAA 3NOGA 1LWEA 3UNGC 4NCBA 1B4SA 2WRMA 2ZC3A 4ZIVA 3MUVP 1YJUA 5CYQA 3ZXWA 1YI2S 2XY6A 1HPZB 1NHVA 1N32J 3CCZA 2YBVA 2CYYA 1B0PA 4WIIA 3M6UA 2ZD1B 3VAJA 4EWTA 1N34J 4JI5F 4KIAA 3M8PB 4EEYA 5KFPA 3PZPA 3HT0A 5IXUA 4IRDA 4OV6A 3BH7B 1H2UX 5E5NA 3MM7A 4IFVB 4O3NA 3SSRA 5AT1B 3SQGB 5A8KB 1U7LA 3LWMA 4OYMA 4DQPA 2DVIA 1VQMS 4LF8F 3OLAA 2M0GB 1N0UA 1T05A 2J76E 4I4BA 2PSZA 5HLFB 1FD2A 3MPYA 4H4OB 3FNNA 4NMLA 3OL8A 4PWWA 3TZXA 3SFGA 5GMDA 3FRZA 1VYAA 5ADZA 4DR2J 2IBKA 1LWCB 1KLNA 2ACYA 1R0BG 2YWKA 3QRRA 4ZVPB 4DFPA 3V6DB 3DRXA 2R4FA 3M2RB 3MUMP 5HP1B 3PTWA 2EFPA 4V1Ak 2CFXA 3PEHA 4PG7A 1VDHA 1UL3A 1BQNB 2J7KA 2R2SA 3P5BP 3QZ8A 4FYYB 1SJFA 2OGUA 4KB7A 3JSMB 4FXDA 4PXCA 5LT5A 5HK4A 4NLSA 2RHQB 2J6TA 4ZVQB 4RW4B 5KFLA 1EQMA 2DCUB 3I0SA 2ASJA 4EYHB 4A8XA 1U2FA 4DR4F 4E0DA 5DLGA 1EKRA 4NCAA 1M5SA 1RTIA 2VQEJ 2MHNA 1NXIA 1QAYA 1CJKB 1IBMJ 4O3SA 2FLNA 3MEDB 2VG5A 2KXNB 3M30B 3DLGA 3ET6B 5F0WA 3C6TA 4U6PA 2G1DA 2GJIA 3OL6A 3SMZA 4X4QA 5K8NA 3H4DA 3SCIE 4C11A 4P2MA 1S72S 3ILLA 3KG1A 3N5FA 1FKOA 3MAAB 3POTB 4WK3A 3RJMB 2QG9B 1GXTA 1KWMA 3CJRA 2C2ZB 3WBZA 3HHKA 4IR9A 2MKKA 1RDRA 1ZAXA 3AH6A 2CZVC 1RBLA 2RJZA 3I96A 2C2EA 2XLJA 4M5IA 3GILA 1QY7A 4CLPA 3MPWA 2RDJA 4RLEA 1SQFA 2HQCA 2VFSA 1NMEB 1F9HA 1LWFB 4QPXA 2MZSA 1IKXB 1ZTTA 1SJ3P 3AFGA 4CLFA 4J37A 2ZKUA 3R6LB 4DSFA 4Y0FA 3J7A1 4AFFA 3C15A 4DV3F 2UXCJ 4MKVA 1EJ7L 1Y5LB 4P6QA 3UCGA 4BBYA 1F2HA 1WC6A 2LXIA 3ENAA 2HFSA 4CP5A 4YOEA 1VI7A 4AL5A 5F0UA 2VL1A 3M8QA 4PAAA 2J0XA 4USHA 2R7SA 1U8SA 4K5SA 3E51A 3FCWA 5KFNA 3T9ZA 1WI8A 1OJ4A 1N6QA 2FVCA 2XYHB 4OQJA 2WVFA 1RUSA 2JDJA 4PZVA 3SFUA 4ED7A 1BLUA 3KYLA 1B70B 4TQSA 2APOA 2K7KA 2XBPA 1GAOA 1SH2A 4C0BA 2WSFC 3UW1A 3IMQJ 3H5YA 1HBOA 1FVQA 2BOAA 2M52A 2JVOA 1T3OA 3ILOA 3KDNA 3GFHA 1DQAA 4USVA 1AFIA 4C97A 1OQ3A 3QFHA 2HIYA 1IKWB 4PEOA 3EE3A 3EM1A 2BJ9A 3GSIA 2J9DA 2DNOA 1Y10A 2NYIA 1S1VB 4A48A 4X65F 1DTQB 1HBNA 4DPOA 3J7ZT 4WTOB 1DQ9A 3VGVA 3HO1A 2VC0A 2R8JA 1RQ0A 4GO7X 1A9NB 5KFRA 2XQCA 4NLUA 4DOZA 4AL6A 1U26A 4YR2A 4TYBA 2DR5A 1CQNA 1IN0A 4OJGA 3EMTA 2PI5A 3DI6B 2WK4A 3LP2A 5IT0A 2CPDA 1VQLS 4DV1F 1QDUB 1JLEB 2GA7A 1C4CA 4C9DA 3RAMA 1HPZA 2R2UA 4QR0A 3DDIA 4DL6A 2OUGA 4HEA9 1JK9B 2QL9B 2GV1A 2DGWA 2ZD1A 4A8MP 3M7VA 3QT6A 3NWRA 1DTTB 3EZUA 4USUA 3M8PA 2VDIA 4C48A 7AT1B 2VG6A 2CKWA 4DXLA 1NK4A 4IFVA 3VAMA 1GMVA 2BRLA 3FKBA 5A8KA 3BH6B 2Z2LA 2J7WA 4ILMA 3EICA 3DLLQ 4DR7J 4JI4F 2ZDPA 2RNEA 1H73A 1NEEA 2PFDA 4H4OA 3LF0A 1OWXA 3QMQA 3UO0A 3DDNA 1OQ6A 2FQQB 1X5SA 1LWCA 4RU9A 1YBUA 4QIGA 1S99A 3AB4B 3G86A 5LSOA 3V6DA 3MAHA 4WFAQ 4HACA 3M2RA 5HP1A 5LJ5Y 3QIDA 3O44A 3OR1A 4B3TF 3PKYA 2OIHA 4B9VA 5GAEI 5KFIA 1UWBB 2LECA 3J7YU 4R8UB 2U1AA 4CT9A 3OXGA 4J9NA 1APSA 2GW8A 3EX7B 1Q7YT 2RSQA 5ETPA 3JSMA 4FNHA 1HW9A 1SJ4P 1SPBP 2C2KB 3KJNB 3I9ZA 5HN0A 3CDUA 1CG2A 2UV8A 1AZSA 3C6UB 1B0VA 1UW4A 3MMBB 1L5UA 2L08A 2H5JB 2GJFA 3OSPA 1I6JA 2DGQA 3C14A 2LEAA 3G9CA 1KVJA 4A8WA 2CPYA 3KJVB 4IRKA 1JJHA 3MAQA 3FCVA 3MEDA 3KJQB 3EXCX 4JI7J 2XMTA 4DLGA 3M30A 3ET6A 4DR3J 2I0XA 5A0YB 3K59A 4QCLA 2VJVA 5LJ3Y 2G13A 1Q53A 2MDAA 5KFTA 4NXNF 2G2OA 5AE1A 4HLBA 3IM8A 3AOAA 2QA4G 2FYXA 2CG4A 2D7SA 3K0JA 4B08A 3BQ1A 3MAAA 3POTA 3MECA 4MIWA 1QLNA 1X7VA 1VHIA 1WTFA 1PJ7A 4JV0A 4Q43A 1H38A 3OFHA 1XR5A 3PHTA 1NJIT 2OD6A 3TYTA 3GLJA 1RU1A 4ES2A 1D8YA 1IQZA 3IGNA 4I0WA 2MLYA 3VAIA 3T1HJ 3J81Y 5L39A 1LWFA 3UNYA 4GC7A 3AQOA 3D0HE 4KH0B 2D9PA 4ANDA 1IKXA 2OLWA 4DQQA 1R43A 2R3VA 3N6NA 2R8GA 3IWLA 1K0TA 3SEOA 4BHQA 4FKYA 2F65A 4NZ7A 4Z2XA 3B6BA 2IY5B 2GO8A 2FY1A 4H4KC 1VHFA 1FTRA 2IFXA 3M2VB 3AD8C 2BVZA 3TNVA 2Z8QA 1I94F 4XDDA 5C5JA 3TUPA 2MQ8A 1JXEA 1HI1A 2XLIA 4L76A 4FBUA 1NK9A 3KMSA 1TR0A 4N56A 1Z4UA
chains in the Genus database with same CATH topology
1VC6A 4MAKA 2YX4A 3MECB 4LVOP 1MMDA 3K58A 5H1SV 1UFWA 2MJNA 1Z1ZA 1H7WA 5G0RA 3V81A 1R89A 2AF6A 4N47A 2Q6BA 4OHXA 1ZZNA 3MM6B 5AXMA 2EKYA 2VPZB 2B51A 2A2CA 3NCRA 5I42A 1JLAB 1ULRA 4JI3F 1YSJA 5LXYA 2BOPA 3MFIA 1D8ZA 4EZ6A 2FJDB 3ZC4A 3F56A 4KO0A 3G6XA 4ED3A 4Y3CA 1SBRA 2YKNB 5CYMB 4IKAA 2ILYA 1IKYB 1XBWA 2XWXA 3IAM9 2HNYA 4WJBA 3BSCA 4ZPWR 3OW2R 2IVYA 3UR3C 3PIOQ 2M7SA 1TKXA 2GCFA 2RQCA 4URSA 2CPZA 3RB3A 2RT3A 1JLCB 4CO4A 1ZBTA 2YKQA 2XMUA 4HI2A 1N52B 2KI2A 4XPCA 1X9SA 1VBXA 1M90T 2CPHA 2LLZA 1RTDB 2ASLA 4J9LA 3QJLA 1S9FA 4ZPAA 2OPSB 5GVQA 5M2RA 4FYDA 1HQEB 2MQNA 3NS6A 2VODA 4MKYA 2JJ4D 5E41A 1K1QA 4A8FA 4B3OB 3BGFA 5IM0A 4IOCQ 4WKYA 2IVFB 3UPFA 1FEHA 2BYCA 2BJEA 3MR3A 3D1OA 3H5SA 5D4OA 2HIQA 3NAHA 1U1QA 2XS5A 1FJ7A 3CXCR 1YIJS 2JRSA 2EFVA 3PO4A 1FT8A 2YWEA 3PJXA 1X4AA 3J7YI 1IKWA 4IOBA 1BC6A 4X2BA 5KT2A 3BZQA 1X5PA 1H6KX 2UXDF 1RK8A 2D9OA 3TP2A 2W9AA 5DM6Q 2I1RA 3D2WA 3H5UA 1R7IA 4YB1P 1BQMB 1RT3A 1SH3A 2W7AA 2RE1A 3LANA 5E3AA 3W7BA 5EWEA 2YKMA 1BD6A 1RT2A 2AYBA 5H9EJ 2QA2A 4PG8A 1MWYA 1IQTA 3IWXA 2F8EX 4DL7A 5HROA 2F1FA 2V0NA 4C8YA 1DTQA 1FDAA 4QIWD 4MIBA 3I32A 3MZIA 3DYAA 3NGKA 3ZZZA 2YH1A 2B56A 2D3ZA 1HWLA 1RAJA 5K5MA 4JOUA 3HKZD 1NK0A 3CE8A 4RW7B 4QWBA 4UY85 2V9WA 2RD5C 4DS5A 3VALA 3HZEA 1U2RA 2W4PA 3NMAA 1HQUB 4L72B 1K8AT 2RF2B 4EO8A 1TFYA 4DQSA 3CJ3A 4RWWA 5J1EA 4LVNP 3ISZA 4MKAA 4PCQA 2LA6A 3JAMY 2W9CB 1VQ7S 2PT0A 2G4BA 3JYTB 3H98A 4J9SA 2IYGA 2DR7A 5C24B 4DX8H 2EFOA 2XCAA 3KLHA 1VMBA 5L38A 2YQ3A 5CHCB 4LFCF 4RW6B 3X1LB 3MCSA 2KN4A 4ITSA 1C1BB 2C3PA 4NLQA 4KAIA 4B9SA 1GTHA 2WSEC 1S9EA 4BC9A 1FRIA 4LT6A 1JLBA 5CZVA 3QGGA 2HFOA 3QAUA 4O3RA 2Y1JA 1S49A 2Z2MA 3CCWA 4F8RA 1T03A 2FB0A 1YJVA 2F3JA 1JLEA 2KVIA 2COLA 3CD5A 5I42B 1FJEB 4YHHF 2I2YA 2R7QA 2XMJA 5AE3A 3KK1B 1L3SA 1P9QC 2F8MA 5D4PA 3IR6B 3HHDA 1KN6A 3DOKA 3BR8A 3NWGA 2DO0A 2ZNYA 1SH0A 3CDWA 4F4KA 4NYPA 2KJWA 2YKOA 4IFYA 4C8LA 2JWNA 2Q79A 3UR0A 2QZ8A 2AGQA 1Q8BA 2B5JA 1YITS 2MQLA 4XK8C 5J2PB 1N5QA 5KG0A 3Q22A 2ERRA 3NCPA 4HI1A 4RWXA 2RH3A 1KQSR 1U49A 4YUDA 2SXLA 5D4LA 2CQIA 1XR7A 1UEUA 3L7PA 2HFNA 5D3GA 1DTTA 4LIWA 4OHZA 1P27B 4LUBA 4KJIA 4ZVGA 3T6JA 1YQHA 3FSXA 3K5OA 4KPYA 3M32B 1HYSA 2I9SA 1K73T 2I5JA 2IM2A 1H3DA 1CPZA 5B0GA 3TUZC 5B0AA 4PWDA 1S6UA 4KKOA 2IRUA 2ZFHA 4FZVA 4OLPA 3Q2SC 3QIPB 4KGKA 4U7CA 2VG7B 3KLFB 3TQ1A 2BJDA 1GXLA 2P6TA 3IS9B 3RRKA 3V6KA 3RW6A 5HMWA 3KNGA 3L95X 4O4GB 3I87A 2IRYA 4O44A 1S6PB 4YFUA 3ISNC 2Q6CA 2X1FA 4NA1A 3MHYA 5KT5A 4PG5A 2DNPA 4Q0BA 2EG2A 4OHVA 4X4VA 1X4HA 3T5KA 1VQ8S 4TU9A 3KK2B 2CPXA 2RRNA 5CXTA 1RKJA 5KT7A 4ETXA 5GAGU 2E9TA 2IA6A 4RNHA 2KKHA 2QSFA 4DLEA 2B43A 2HS3A 4RW8A 1IUJA 4PXEA 3S1TA 2YNFA 4CQ1A 3DYAB 2BQUA 3VF0B 1ZM3A 4USIA 2VA2A 4G3IA 4X62F 4USJC 3PW0A 2R2RA 1QM9A 2CPFA 4I1TA 4A8SA 3ENVA 1WI6A 1HHSA 2YNGA 1P1LA 5KT4A 2P9CA 3GYNA 3FEZA 3LAKA 1N48A 3OJSA 4DR6F 3TX8A 4B17A 4IH6A 5KFJA 3M9OB 2JLFA 3HHEA 5K8OA 4RZRA 3CCVS 2VC1A 3DLBA 4DV5F 1MW7A 5J1PA 3RW7A 5J2NA 1LW2A 2LA4A 2BM1A 2HWHA 4RW9B 3KLHB 1VIXA 4DL4A 1FDNA 4I69A 2ZNZA 2ZJPQ 2E5HA 1VQKS 2KFNA 3M6WA 1C0TA 3BEGB 2YWFA 4G1QB 2O67A 3R5CA 5CCLA 4ED6A 3G8QA 3M8RA 2IMWP 2UUAF 4LF5F 1S9EB 2I38A 2PFFB 5A8WA 4M5DB 3PR5B 3D0IE 3I9V9 4NWBA 2HVZA 4PPZA 1DARA 1TK0A 4F2SA 1VLYA 3R1HA 2B9XA 4MTPA 7FD1A 1VRUA 3BF4A 2LEBA 3PW2A 5DM7Q 2DNKA 2PIIA 2D3UA 1UWBA 1UJ4A 1LKZA 2LQJA 3M05A 3HVTB 4R8UA 3AA9A 3DHWC 3N79A 3N28A 2FVSA 5EWGA 3DU5A 1RJJA 1FO1A 2UXBF 3W2VB 1ZPVA 2HS0A 4L3NA 3TA1A 4Z37A 1E6VB 7FDRA 4AE5A 4YP3A 2KU7A 2OMOA 4OI6A 4KR0B 4YDXA 2HVIA 3HK2A 2GNKA 2GQ2A 4OZ1A 3PDNA 2MB0B 3EYZA 2CVIA 3RYLA 3H2VE 4I7FB 4ZPCA 5E33A 1N5SA 4K4ZA 2KFYA 4IH5A 4FS2A 1SI9A 2WCXA 4IUFA 3WX4A 1DJ0A 5B0CA 2E5LF 5I3QA 1SXLA 5KFGA 4J9MA 1T7PA 3HI9A 3HKWA 4IDKB 4L6V3 2R8HA 1YJWS 4B02A 3PM9A 4ECUA 1FESA 2HMIA 2L9DA 2P6SA 1TL1B 4CNZA 4UUXA 1RT4A 1LK5A 1QAIA 2NPFA 4F02A 1QUPA 3OQ2A 3UDCA 3C8YA 1QUVA 1RP5A 2KJVA 4JI0F 5F9NA 1IKVB 1HYSB 5KFXA 3FCHA 3BO3A 4P2SA 2XNRA 2ZE2A 1QVGR 3FQKA 2RUGA 4BDPA 3SCKE 2B9YA 1URNA 1MMNA 1YJTA 2RS8A 1KHVA 3B4DA 3ENQA 5KFFA 1HNIA 3TAPA 4X4NA 2HAIA 4CT8A 4WFBQ 5M2UA 5F8MA 1DQ8A 2B7BB 2AYEA 2DNHA 1FVSA 4O44B 2GIRA 3MEGA 2XNQA 6FD1A 2GFFA 3KJVA 4PR6A 1GTEA 1ZAWA 2J7UA 1QAJA 4N8OA 1XN9A 1JLQB 2YNHA 1ZOTA 3ICLA 4Q0BB 1SJ1A 3HMJG 3SZ2A 3TVZA 2DNRA 3CD0A 4WF9Q 2MKJA 3V2UC 1EETA 1NH7A 3IXQA 3S8SA 1S76D 2K8GA 5A0YA 1X0FA 1FRKA 2Q43A 2BBEA 4G1PA 1U6FA 3EXYA 4G1IA 4QZVB 2FGCA 2JEIA 1HNVA 1UEVA 5KFMA 2HGMA 2OPQA 4OZLA 3N01A 2W7PA 1NHUA 3EGNA 2OPRB 2YNGB 3LWLA 3GQCA 1YHQS 1CC8A 3TAMA 2MQPA 3GZ7A 4NCGA 3UD3P 4A8YA 2CJAA 3K7RA 2QEXS 1ZM2A 3H20A 1O0PA 1Q82T 4U9RA 4WKRA 3M9NB 1VS3A 2DPJA 2IC3A 3L7OA 3JSRA 4PQAA 5DGBA 1LW2B 4ZVFA 4PUOA 4ILLA 1LFWA 5EWFA 2GHPA 2VFUA 4CCHA 1HNWF 5T7LA 4X66F 3M8SA 1C0TB 1Q86T 4DS4A 2AX0A 2A18A 3FQLA 3ITHA 4NLWA 2DD8S 4OIXA 1RGVA 3NG8A 3QGHA 2FHJD 4BWMA 4BC7A 3QJJA 4O3QA 2ZBIA 3RB0A 3W3SA 3FEXB 4TU7A 3UQSA 3T1AA 4F2RA 3CCES 3MFHA 2GIQA 1Q1KA 1S4FA 2N4DA 4LJMA 4LSLB 2XGPA 2DNZA 2LQ9A 5CCMA 2JHEA 5D4NA 1Q4RA 4TLQA 3OV7A 2RQKA 5HMYA 4K4YA 3G4SS 3LQVA 1KTQA 1S1WA 2WOMB 3IRWP 1IM4A 4J9RA 3US5A 4C8MA 2LVWA 4WFYA 5LSLA 3Q2TC 3QYYA 4OZ0A 3R3TA 1UFLA 1JMTA 2V4JA 3I82A 4OI1A 3BN7A 2DK2A 2XWYA 3I5CA 5KOWA 4OJ1A 5IQQA 4LQ9A 4C4WA 3UFCX 2CJQA 1HL6A 4MK7A 5BR8F 1NK7A 2B4PA 2J0WA 2GGPB 4JV5F 3SI8A 4QW8A 1JLFB 1GT8A 3Q8RB 3GV8B 2UUWA 4QJVA 2JEGA 3B4MA 3U02A 2HMIB 3RRGA 2HS4A 1QSLA 2AJ4A 4FN5A 2R9LA 4C8KA 1RT4B 2XS2A 1J5OA 1V3ZA 2JEFA 2PGCA 1AFJA 4IG3A 3MDFA 1U1NA 1U6BA 3GFZA 2E1RA 1M5OC 2HHTA 2ZE2B 4ZCIA 3OHBA 1SB6A 3SV4A 4OI4A 3PO5A 3VR1A 1FTCA 1RWUA 4ZVHA 1KFDA 1NJZA 5KFHA 2LU2A 2VONA 4PRFA 4DR5F 2BM0A 2OD4A 2VH7A 3CUNA 2ASYA 2WB1D 5C25A 4KTQA 3IG1B 4I56A 4IG0A 2R7RA 1NKBA 5IQ6A 2CIMA 1LOUA 2GX8A 4LSNA 1KEKA 2WB4A 2XG8A 4CH0S 3JSYA 3MPVA 4H4MA 4TNOA 2HNDA 4NRTA 3CDAA 4KV8A 2ATLA 4ZCLA 2C3OA 2QMXA 1YBAA 2PMZD 5KFUA 5KG3A 2BE2A 4B3RF 3CD7A 4OJ3A 2YWGA 3RB4A 4JYAF 1S1UA 1D0EA 2OKQA 2KO1A 2IJFA 2Y0SD 4FF4A 2CJ9A 4QU6A 1TV6A 1WHYA 2UP1A 4WZMA 2XULA 5EGYA 1H0HB 4JUZA 1L3KA 2J6SA 4LF7F 3MD3A 4X4OA 4M94A 3KNAA 2HG4A 3P96A 4LIRA 2IJNA 4J9KA 3E3XA 4I2PA 2VKZG 4Y34A 2PN6A 4NCGB 2HZCA 4ECWA 4V19J 4F4ZA 1UVNA 3NL0A 2DHSA 1YWXA 5KT3A 4R0JA 4RKUC 1OPZA 3RZAA 2E5GA 4M63A 4NA3A 4ECRA 1S0NA 1W2BR 2HWTA 2K3KA 1SJQA 2DNLA 3ZZ0A 4PUOB 2UVRA 4EBEA 4K0KF 5GAGI 5A2QY 5IT9Y 1F2GA 1F9FA 2RB7A 3MMJA 3OFEA 4J9QA 4MFBB 5T7LB 1U1OA 1S0OA 3GIJA 3H5XA 4OZJA 1WTBA 2LCWA 2VFRA 1SC6A 2HWIA 2ZVSA 3S01A 1DHMA 1JLAA 1R8BA 5KG5A 4HT5A 4ZCKA 1C0UA 3BSAA 2FLOA 2M5YA 4NZ6A 5DQIA 2YKNA 1ZETA 5CYMA 1NO8A 5DJBA 1IKYA 1HWKA 2RU3A 3J7Z5 2NREA 3NMRA 2B4OA 2MY8A 4QIVA 2HHHF 3EPGA 4Q7AA 3LGNA 4DQIA 1NH8A 2CRLA 3OUYA 2R7VA 3GE9A 1D9AA 4JBCA 1RTDA 2O3DA 1KD1T 4UQTA 3SDEB 5L1KA 2OPSA 4TXSA 1NU4A 2HLUA 3TUJC 2JSXA 3K5NA 1HQEA 2ZHAA 2QSWA 1LWEB 2V5HG 2ZBCA 1N88A 2V8DA 2EFGA 5L9NA 2R7TA 4CIOA 5GADI 1L3UA 2IHR1 2XMVA 4FP9A 5F8JA 1F5CA 4HDGA 4F3MA 3CCQS 5E7OB 3CCMS 1CVJA 4ZKAA 2BA9A 5CYQB 4ECQA 5KFWA 4R0EA 3NAIA 4KFBB 4YB5A 4OHWA 4YMEA 4R25A