4FNHA

Crystal structure of isdi-w66y in complex with heme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
b'AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase isdI
publication title Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Oxidoreductase
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fnhA00
3DCAA 2XMKA 1XBWA 1YRXA 2QLWA 2N4DA 1CC8A 1TUVA 1N5QA 5A6WA 2N4CA 1GXTA 5IXUA 3HDSA 2CRLA 1Q8BA 2L3MA 2N7YA 2GO8A 4FNIA 3HHLC 2ZDOA 4Q2MA 2AJ0A 2LQ9A 5KAKA 3LGMA 3BB5A 3FMBA 1FE0A 3BR8A 5B0BA 2ROGA 2HFOA 1YJVA 2JDJA 4ZOSA 3HHLA 2GGPB 5B0GA 5B0EA 3CJKB 4DL0C 4HI2A 1N5VA 2OMOA 3HF5A 1X8DA 1Q8LA 1S6OA 1ULRA 2QYCA 3IWLA 1R6YA 3UDCA 3BN7A 5B0CA 1QUPA 1SI9A 3MCSA 3HFKA 5F0WA 1YJUA 1MWZA 4OJGA 1YJRA 1KVIA 2LDIA 3HX9A 4HI1A 3TOQA 2ROEA 4NPOA 3BDEA 4HH1A 1Q4RA 1Y3JA 2K2PA 4OIXA 5B0AA 3WDOA 1Q53A 1JK9B 2K7KA 3FRYA 5K9FA 1WD6A 5F0UA 4YEAA 2OD6A 3KG1A 4A4JA 4OJ1A 3LGNA 1TL4A 4A47A 2W4DA 2PD1A 2G9OA 2XMWA 2FB0A 5B08A 2FIUA 2GV1A 4F67A 1AFIA 2VV5A 1RJJA 2XMMA 1FE4A 1IUJA 2OFHX 1V3ZA 1YJTA 2GGPA 1LQ9A 3DXSX 3F44A 4OJHA 3CJKA 5B09A 1TZ0A 2KYZA 1MWYA 5A6PA 2OAUA 1OQ6A 2XMJA 2XMVA 4DPOA 1VQYA 3KKFA 4Y2KA 2XMUA 2PGCA 3LO3A 1OSDA 3T9NA 1X7VA 1FEEA 2ZDPA 1KVJA 1W2IA 3HHLB 2OD4A 2K1RA 5T7LB 1SQEA 1X0PA 4A46A 2OKQA 2LQBA 3IWXA 2GCFA 1S6UA 1URRA 2RSQA 2HIQA 2IYIA 4Q2LA 2RILA 2HFNA 2ASYA 4U9RA 1YG0A 2W4PA 4A48A 1CC7A 2BYCA 1APSA 2GA7A 2OFGX 2FHMA 4EFAC 2IYGA 1Y3KA 3E8OA 1KQKA 3TRGA 5B0DA 3GZ7A 2BBEA 4ZA1A 2XMTA 4Y2IA 1CPZA 1JWWA 1FESA 2KT2A 1FD8A 1N5SA 2AJ1A 1N5TA 2GFFA 2QIFA 2HLUA 2IFXA 3KNGA 4HH0A 2K7JA 4Y2MA 4QOTA 3TNVA 3K7RA 2KT3A 3I9ZA 1TL5A 2RU9A 1VQSA 3BF4A 4YDXA 2KKHA 1SB6A 1K0VA 1P6TA 2AW0A 2HQIA 2BUNA 2EW9A 3BGUA 3MZIA 4DN9A 1U7LA 2LXFA 5B0FA 2ACYA 1TR0A 2VH7A 1GXUA 2AP6A 2RMLA 3QGPA 2QLXA 4HL9A 3KG0A 1OQ3A 1Y9OA 2W4CA 5T7LA 1OPZA 2BJEA 1AFJA 3VTIA 4FNHA 3BM7A 3FGVA 2Q3PA 3HHLD 2BJDA 2FTRA 2ROPA 1FVSA 1P8GA 1Y0HA 3QMQA 1FVQA 2OP5A 4OJ3A 2K1RB 2HLTA 1AW0A 4NL5A
chains in the Genus database with same CATH superfamily
4CWBA 1HR0F 1XNQF 5A8WB 1UEUA 2HHHJ 5KFTA 3GIRA 2XWXA 2DR5A 1T9YA 3MM6A 2R7WA 2C3UA 4NOHA 3WIUA 2ZUGA 2HFOA 1YJVA 1NMEB 1YRTA 3MMJA 4DF8A 3GFZA 4PYDA 3VAGA 1VC5A 3KXDA 2ACMA 2V8PA 4WKYA 2C2MB 2HVDA 2MKJA 4DF4A 2KYXA 2V8DA 3HFVA 3T5LA 1OS5A 3R5AA 3LGHA 3DOLB 3UQSA 2F63A 2E1CA 4DX7A 1V3ZA 3HVRA 3DOMA 4D3GA 2R8KA 1SUQA 2W9BB 1GQEA 3FSIA 4B9SA 3TA2A 5BR8J 4C8NA 3NOGA 1YX2A 3MFIA 1DTQB 4DX8H 4GRSA 4UQGA 3MR6A 1Y00A 1RAGB 2APOA 3EICA 3V6JA 2H3EB 2JL9A 3C14B 2QLXA 4IFYA 2V8GA 3IBCB 1HNZF 1YK9A 3T1AA 2RQKA 1Y0HA 2GMJA 4RW9A 1YRXA 4Y65A 4LIWA 1WEZA 4EWTA 1NEEA 2O5DA 4G1IA 1ZETA 2F1FA 3NEKA 3DLKB 4PWUA 4HH1A 4RNMA 4YB5A 4H4MB 1NU4A 4O0IA 4NI2B 2X1GA 3DHXA 1HA1A 3MM9B 3HVTA 2VBZA 2R3VA 4ECUA 3HSGA 3L09A 1RHQB 4V19J 3KLEB 5F8MA 2R2TA 4KH1B 2WVDA 2DXDA 2V2VA 5D0HA 1DZ5A 1U26A 2M7SA 4RZRA 4LJMA 1RQ0A 1RAEB 4KH0B 4NCGB 5H9EJ 2XMTA 4OQJA 2RQ4A 5EUHA 2JC1A 1J2VA 4RNFA 1FJGJ 3CUNA 2MKYA 3H2LA 3DGPB 4BBYA 1K8AT 5IC4B 3CJ3A 4ZIWA 1U1RA 3RBZA 2CFXA 1U0HB 4A8YA 3S8SA 3Q8QB 2CPHA 3RZAA 1U1OA 2L48A 1HARA 3DRRA 3OR1A 1LW0A 5J2PB 3MECA 3MMCA 3K89A 1KVIA 4K7QA 4NYZA 2YKOA 1A6LA 1JK9B 3D6TB 5A8WA 4BCAA 4EBEA 4ZCIA 4CLYA 1JLQA 3T5JA 2DNGA 2GX8A 2XMJA 3R3TA 4UOCA 4J9NA 3T9NA 2V4JA 3SQOP 3AQOA 3GR0A 1GX5A 1YG0A 3GSDA 5L8RC 1HNWJ 1U2CA 2ZH5A 1OMSA 2DGUA 1LWCB 1CPZA 4DR6J 3HSJA 5KT4A 4CRJA 2HQIA 4ZHRB 1BXNA 4IG0A 5BYQA 3A3NB 4X66F 3DC2A 1WTBA 1HHSA 4EO8A 2AQ4A 2HWHA 2BJ7A 1NDCA 4OJ3A 2J7WA 3WX4A 3D3BJ 5HL7Q 5HJYA 1JMTA 2RU3A 4HTJA 5BJRA 2VFUA 2YWEA 3HHLA 4EU0A 3OV7A 1N5VA 3C14A 1JLGA 1KTVA 1PJ6A 4OHXA 3OFGA 3C6UB 4OJ1A 4YY3F 2P2CB 1U49A 3D1HA 4YR3A 3EDRB 5AXLA 1FXDA 1L3UA 1XQIA 4Z7YA 3SQGA 4OI4A 4BLGA 4ER8A 4DL7A 1RWNB 4ALZA 3K17A 5E3CA 2E1RA 3SBMA 3EZUA 1UCNA 5ITHA 3W3SA 1YJ9S 3LF0A 2UUCF 5ETKA 4C8OA 2GHWA 4MMOA 4TU7A 2B9EA 4U9RA 1RTJB 3B8HA 4H4MA 1KP6A 4J9PA 3G2XA 2KT3A 2QLJB 2ZKUA 2BE9B 4AUKA 3H90A 1PSDA 2AP6A 3JTPA 1RT6A 4LRAA 2O66A 2ROPA 2XO7A 4OV1A 2C2NA 2YWGA 3EMTA 1RUSA 4USVA 3D9BA 3KLIB 2IM3A 1EQ0A 4P75A 1E6YB 2CZ9A 2CNKB 5HBMB 4TU9A 3TAPA 4K2JA 1RT4A 4QWBA 1D8YA 4F50A 2J8SA 2NYIA 1URNA 2VOPA 1N88A 3J80U 2AGQA 1RI7A 1RWWB 4KC5A 1HLWA 4K2XA 4X84A 5HP1B 5DG9A 1HHTP 3IFEA 3HXMA 2LECA 3CULA 3IO1A 3FCHA 1M5OC 4PG7A 2Y0SD 1VI7A 1SIZA 5BYRA 4QWAA 1N56A 4F0HA 1BD6A 2ZHBA 2IVMA 3JSRA 2B4PA 3G82B 4LREA 4LVOP 1WOOA 3H20A 1XBWA 3CD6S 3DLHA 2FC8A 3CCVS 4DOZA 2AZ1A 4N7TA 3HT3A 4B3SF 2W7OA 3A8KA 3BKUA 3EPGA 4CH7A 3QJPA 3ENWA 5IS2A 5GMDA 3H2UB 4Q8EA 2XS2A 2YVSA 4DQIA 4W90B 2LEAA 2BJ1A 4ZPVR 3VGTA 1YWXA 3ZZYA 2IMOA 2UV8G 4LF1A 3BZQA 4NCAA 3T5KA 2B5JA 4YB6A 1CS4A 2ATCB 2BKPA 3UDLA 3OPKA 2AMCB 2HIQA 2CQPA 2Y1LB 2DO4A 3IWNC 3WZ0A 1XC9A 3CO9A 2BE7D 2F8MA 2V68A 4Y3CA 1E6VB 3BBCA 2MHNA 3RBEA 5AXNA 1TMMA 5F3TA 2V34A 3N79A 5LXRA 2GS8A 2XO6A 3W64A 2BUNA 5I3PA 2A0FB 4DUYF 1F5BA 4MIBA 3NCQA 1X31C 1M5KC 1Q8IA 3LP0A 2IPOB 2GIRA 3T6BA 1EHWA 5MLCV 1RTJA 4J91A 1IXKA 2OP5A 3QLHB 2HK3A 5D3GB 2PO4A 3KHHA 3TZXA 3QAUA 2KM8C 2YPZA 4Z7CA 4EEYA 1FX4A 2L3MA 4B3TF 4L76A 1B99A 5C5JA 2MZRA 5CQGA 1TQLA 1SH3A 2DNOA 2G13A 5L9NA 3HP6A 2KH9A 2XBPA 1UVLA 2LDIA 3F73A 4F4XA 1N6QA 4QIEA 1QTMA 4F04B 1V5IB 4B9MA 1N33J 5GAHI 3HVAA 1RAAB 3F44A 3GPAA 4ED6A 2YNHB 1IR2A 2QGFB 1D1UA 2XI3A 3L7PA 5HBMA 1K1QA 4LFCF 4J9MA 2CJ9A 3DU5A 4LF8F 2R7TA 2W24A 5DG8A 2AEFA 5EDWA 2KRRA 3GZ7A 5ETPA 3RB4A 3WHIA 2BW7A 2G1HA 4C9DA 4O3OA 2NZ4A 1GNKA 1JJHA 3IRXB 3D3CJ 2FVSA 1JJ2R 4JI6F 2CG8A 5HP1A 1RCOB 1WI8A 2HS3A 2EWHA 5HN0A 2Z2LA 1QVFR 4TYAA 2LYVA 1U1PA 4H4OB 1LW2B 2JDJA 5B0GA 1DLOB 2BX6A 4ZVSB 2AKWB 2CNOB 1S10A 2CQGA 3KG4A 1U1LA 3K5PA 1W25A 2KJWA 2OELA 4KGKA 4IKAA 4NEZA 4ELTA 3MAQA 3IBFB 1VJWA 3DRYA 3SSRA 2F4VJ 1YZ7A 3CNQP 3JQKA 3PJWA 4MFBA 2ZJPQ 4I68A 1WC4A 3QYYA 4UUXA 2H51B 3JSBA 3BREA 4C3KA 3GYNA 1GMUA 3KJVB 4QYRA 3V2UC 4EI2A 1VHFA 2KT2A 3JS9A 4CLSA 4RW7A 1HFEL 1QUVA 3BEGB 4CT9A 1LWEB 3AY0A 1Q81T 3G4SS 2ILZA 1TV6B 3D6MB 3WBZA 2VHGA 3SZ2A 1BWVA 3HSZA 1H2VZ 2VU5A 2N4DA 1GXTA 5HAOA 4JI2F 2CRLA 2LU2A 2O3DA 3MURP 3UVJB 3OQ2A 2FLPA 4DR3F 2PEHA 3D4JA 2ZITA 4JB8B 2PA8D 1O0PA 4ELVA 3TZWA 1FEHA 1JLAB 2R2SA 1S99A 3POTB 3TI0A 4C7QA 2ZNZA 4I6AA 2ROEA 1BLUA 2QSFA 4K4YA 1H0HB 1HNIB 2HRTA 2G9OA 2JLFA 4X4QA 5KFHA 1HBOA 3PG9A 4QCLA 2YKNB 5A6PA 4G1QB 1SQEA 2QFIA 1I6JA 2BKNA 2JVRA 4KB7A 3KK3A 3GJRB 1EZZB 3M8PA 3NGKA 8ATCB 4PCQA 4QW8A 2KFYA 2QMWA 4BS2A 1PC4A 5GAEI 4DN9A 4WPAA 4J9KA 3KG0A 2EG1A 5E5NA 4IG3B 4Q44A 5D4LA 4KO0B 1C1CB 1GTHA 4LBIA 2EKNA 3P4UB 4IUFA 5B0BA 5F8NA 4Y6IA 2ZH2A 3BH6B 1I3OB 2VPYB 2PT0A 1Q8LA 2V94A 1NSAA 4DFMA 3Q2TC 2R7UA 1FRIA 2JWNA 3HCXA 3BSCA 4X2BA 4LUBA 1Q53A 3NGRA 5DETA 1FI4A 1WC0A 2OEKA 4UQTA 4ZCLA 4QR0A 1DAXA 2PFFB 4QIVA 1KR4A 3LP1B 4EUVA 1S9EB 4RUAA 3K58A 2VC1A 4OX6A 2O01C 1WNEA 4J9SA 4OI3A 4DL2A 4K4WA 1H7WA 1PAUB 2AV5A 3E8OA 1F9HA 1RTIB 2HK2A 3QRPA 2OPSA 5IM0A 1NBEB 5B0FA 4FKXA 3KJVA 1YHQS 2X51A 4I4BA 3EGVA 3BGLA 2FJXA 1H2UX 2DPIA 4P2MA 1LKZA 2GHPA 3ADAC 5FIIA 4PRFA 1HYSB 5M2RA 2C3MA 2AHOB 4B3MF 4NZ0A 2DNMA 1WC3A 4P2FA 2VKZG 1LK5A 1U4BA 2ASDA 1UA1A 3D67A 2FVQA 4OIXA 2C22A 4OZJA 1KLMA 2DGVA 3UVJA 4PWDA 5J2NA 5FLXY 3NBPB 4M63A 4ZP7A 3IBWA 1VQ7S 5FD1A 2K1RA 3PDNA 3OXGA 3IAS9 3PX0A 2BYCA 3KLVA 5K8MA 1RWUA 3LWMA 3ZO7A 3BJYA 1WC5A 5DG7A 3GIJA 2FGCA 3N4WA 4NMLA 3CJ0A 2E9ZA 4G1QA 1HI1A 2CVIA 1ACMB 1RBLA 3HHLD 4ZDNA 1FVQA 3I0SB 3EGWB 2OIHA 1BQMB 5A6WA 3M6WA 1HBNA 3TUZC 4WWSA 1VBXA 3QO9B 3O2IA 2J0QD 2MHEA 3QZ7A 4X4RA 3LOUA 1NSPA 2UV8A 4DV0F 4C0OC 3DM2A 2VPZB 1WG1A 4NPOA 4JOUA 2HW3A 4DSIA 1TFYA 5HQLA 1C1CA 2PN6A 2E1PA 1OY6A 1VK3A 2JSXA 2QL5B 4NXMF 1CLFA 1Q7YT 1TZ0A 1YBAA 1TFWA 3SXLA 1NKEA 3DFEA 2A6OA 2EFGA 1UKUA 1IKWA 3ISND 1MWQA 1NJZA 3ZFVA 3PX4A 2QIFA 3MMBA 5L1LA 1P9YA 2KKHA 2RHSB 3KDOA 3O8WA 3CE8A 1LXJA 3Q22A 1KHVA 4G6VB 1TTHB 1Q5VA 1RDRA 3RB3A 5J2QB 5KFUA 5K14A 1S4FA 3W9HA 3HHLC 4DL5A 1WKJA 2D74B 1WG4A 1KHWA 2RUGA 4DU8A 4ICLB 3LPYA 2VODA 1HI8A 2HZAA 1FRKA 1U8WA 2WHOA 3FCVA 3N01A 2DNPA 4LT6A 1U1NA 4WCEQ 4NYPA 3ET6B 1WD6A 2IY5B 2DRBA 1TUWA 1HYSA 5CZVA 1PJ7A 2KI2A 2KT5A 2Q6CA 3HPOA 4C3MA 3B6BA 4KRWA 4Y2KA 4LQ9A 2R42A 1FEEA 1VLYA 1R8HA 4CCHA 4CO0A 1AZSB 4KGVB 3E01A 3MUMP 4QZVB 3KUHA 5FLXU 2QL7B 4NRUA 4ZLJA 2ZHAA 2CZ4A 4NYOA 3OBIA 3ISNC 1VRQC 4ED4A 1IWGA 4JP8A 3B82A 4WJBA 4YY3J 1RTZA 5KOXA 1IR0A 1S1WA 4NLRA 1UVIA 1RT7B 4GO7X 5GAGI 3S7RA 2FJAB 2FHJA 4MTPA 2UUCJ 3RBDA 2DXEA 8RUCA 2BXJA 5IQQA 3D5MA 4IFVB 3J7YU 4ZN3A 2VG6A 2ZM6F 4PZVA 2ZH1A 5I3UA 2M8HA 4X4PA 3BKFA 4UTGA 5HI7A 3PO4A 3NNHA 2C2OB 4CO5A 3BBBA 5DLGA 2B7BB 2HPUA 1TU0B 2XLKA 3FUYA 1VQ6S 5KFOA 2QYGA 4KTQA 1YITS 1SL0A 2JJ4D 4LF6J 2G0IA 3QO9A 4EZ9A 3CDWA 4DV1J 1UEVA 3GU0A 1DTTA 5HMYA 2J9DE 3PRVA 1RHUB 3MR5A 1CBKA 1JJ4A 1APSA 2CPYA 1RWVB 3G8QA 4WFBQ 4LBPA 3HHEA 4C98A 3PW5A 4E98A 2ZBIA 4DU7A 2N7CA 3M32B 1CVJA 4Y00A 1RHMB 2MKCA 2HMIA 3GFHA 5L1IA 4CT8A 2HVHA 4W92B 3CD7A 4CP5A 4ED7A 1WSVA 3KJQB 4DL0C 3GCWP 4ERDA 4PG8A 5F8JA 1VISA 1H38A 1R43A 3BKTA 2E44A 3VZHA 3HX9A 3TOQA 4DUTA 2ZNYA 4NE9C 1JLFA 2MLZA 4USHA 3W65A 4KV8B 1ZA2B 4OZLA 5CA5A 3GMGA 4ICLA 3BO4A 5DDQC 4JI0F 4B3SJ 3MCMA 3ET6A 2V6AA 1D0EA 4OYXA 2XB2D 4G1PA 4LQ3A 2ZE2B 2ZH3A 3W61A 1FD8A 5IFMA 2LXUA 5KG1A 3SCKE 4NEYA 1W7WA 2M4MA 2L9NA 5HROB 2YWFA 2UUAJ 4PEOA 4CDIA 3U1LA 3ITHA 2OPPB 4CM0A 2J6SA 5A8KA 3PW4A 4ZPCA 4UF4A 3DRXA 3IG1A 4ZN1A 3OW2R 2HZCA 8AT1B 4WFAQ 1SQFA 1K73T 1CEZA 1N36F 3SIPB 3M8QB 4FPRA 1RT7A 4I1TA 2PEBA 4GKJF 3L9ZA 2HIYA 1T03A 2RRAA 1YKWA 1HQEA 2MSSA 4I2QB 1RU1A 4YN3B 4B3TJ 4DPWA 5CAAA 2QV6A 4MH8A 1NK8A 3FK4A 5A76A 4KKOB 3NS5A 4OZ3A 1Q7LB 3JYTB 1KLNA 3QIDA 3CMES 1FFWB 2DR7A 5K8NA 3FFIA 4NA2A 4ZVFA 3EGZA 2HHVA 2A3JA 1Y5NB 1HQUB 1EETB 1Y9OA 3UN2A 1U6ZA 5C2GA 3K5OA 2V5HG 3IM9A 2JVOA 4WE1A 1TK0A 3CDAA 4ZLPA 2DPJA 1AW0A 3DOKB 3M1VB 3TARA 4LFCJ 3AA8A 3ILIA 2GC8A 4Y0FA 4LF8J 4MKVA 3BN4A 2IJNA 1H98A 1SI9A 5D8HB 3H25A 3ZZ0A 5IT0A 1LXNA 1U45A 4JI6J 3ELHA 1X9MA 1TK5A 2C3PA 3R97A 4F67A 2I38A 3MDFA 1FE4A 1GMVA 2NSBA 2OPRB 3ZXWA 1C1BB 4DX6A 4Y28C 3PXGa 3MTJA 3JTOA 3GILA 1VQYA 2C28A 2YWHA 2CQDA 3QAEA 2ZVSA 2OD4A 2B6AA 2QLFB 2XI2A 3BYPA 2IJRA 4ZLLA 4B3OB 4Y2IA 3AD8C 4IRDA 1NK0A 1SPBP 1SL2A 1PJ5A 3BQ0A 1I94F 1MMLA 1TR0A 2NLWA 2C2KB 3ZZRA 1S1TB 1L5UA 1FNXH 3FGVA 2QLBB 3NS7B 2CWKA 3GYGA 1RGVA 3M6UA 3KLFA 4YHHF 1CJVB 2C2DA 4MKAA 3N6MA 1TK8A 5C24B 3EJMA 1U09A 2EC2A 4GVBB 3PTWA 1UZHA 3OFFA 4PG4A 2JZ5A 3MMAB 2Z2YB 4LR8A 2RIJA 2OEJA 3DKDA 2GZOA 2OPPA 2HS0A 4M5NA 2DKOB 3V81A 3RB6A 2YY3A 2CJBA 3K59A 1VRTB 3BQ2A 4RW6B 3R5CA 1N48A 5C42B 1OQ6A 4JI2J 2EFVA 3IAM9 2HBYB 3KHLA 3M8QA 3W5YA 4DR3J 3OTOF 4AQYF 3JXOA 2FD2A 4DI6A 2RF2A 1EKSA 5D0RA 3TQ1A 4X64F 1NHVA 3M6VA 1CJTB 2U1AA 7FD1A 4I2QA 2AGOA 1WC6A 5DDOC 1NZ8A 1O6XA 3JYTA 4OHYA 4B9NA 2AEMA 2IIHA 5A8RB 3OTEA 1XMQF 4Z2XA 3VGSA 2J0WA 4I2PB 3AJ2A 4QIWD 2HBRB 2IVFB 3M1VA 4A8WA 4ETXA 3LGNA 3OHAA 4HT5A 1L3VA 2AJ2A 1T11A 1R0BG 1S6QA 1RHKB 4QU6A 1KFDA 1NDKA 3JQMA 5K5MA 4X62F 1MU2B 2MKSA 1SJFA 3ILJA 2DCUB 3V4IB 1FHTA 4JBCA 5KFYA 2RKIA 3QNWB 2DCLA 2AX1A 1VJQA 1UZDA 4R0JA 2OPRA 1DARA 1V9OA 1C1BA 2HBZB 4J90A 4Q0BA 3H98A 2GIQA 3QGPA 2UXCF 2W4CA 4DLGA 3B78A 4M5HA 3AB4B 4B3RF 3I31A 3ENQA 5JMNA 1FRMA 4ZVUB 3J7A1 3GYXB 4B17A 2F9DA 4C11B 2DNRA 5CXTA 1UEKA 4IDKA 4EYHB 6AT1B 1SKWA 3BN7A 3GQCA 1ZM2A 1FNMA 2XCAA 1YJ7A 4ID8A 3MEDA 4WIQA 2BW2A 1R31A 5JJBA 1CJVA 2G0CA 3G6ES 4LRCA 4KHRA 4WK1A 4ZVQB 4ANCA 4GVBA 4OJHA 2FVRA 5AE3A 3J81Y 4B3MJ 2WSEC 3MMAA 3HJVA 5HK4A 3R5JB 3I96A 2OFGX 2VZ9A 1S7IA 3BGFA 4KSEB 1PYSB 2GMHA 2Y8YA 5F0WA 4KR0B 2HNDA 3H8YA 2Z56B 3J7Z5 3M30B 4IH7A 3DYAA 1VMBA 3OVAA 3R5DA 4CIOA 2W9CB 4ED3A 3TVKA 3R2DJ 1XMBA 5EN1A 1IBCB 3A8IA 1RISA 4DR6F 2AJFE 2FJEB 5IXUA 2DRDA 4JI4F 4DPXA 3UDVA 3M8YA 1CJTA 3TVYA 2WVEA 3LAMA 5HVGA 3AJ1A 1VBKA 1W26A 2HQ3A 2MKHA 3RB0A 4J9UE 4RNHA 3Q8RB 1KOHA 5A0YB 1U6FA 3U7JA 2FZGB 1QD1A 1BGXT 5EHHA 5KFAA 1ZOTA 4H4KA 2KDOA 4ZITA 1N0UA 4WFZA 2XHCA 3PYGA 2VONA 2X7IA 3AD9C 1IJEB 1G3OA 4OZ0A 1U1QA 3KOAA 4QJVA 2MQQA 3N6NA 3HLUA 2FDNA 3LH2S 3W8PA 2ILYA 4Y2CA 2FHJD 3O6QA 1N0VC 5K20B 1Q5YA 2N3LA 3AOCA 3X3UA 2VH7A 2CJQA 5ETMA 2I5JB 4PXEA 2VF3A 2X3GA 3NS6A 3MXHP 2QA2A 4NXMJ 5F41A 2D9PA 5IT9Y 5DGBA 1WELA 5KG5A 1SH0A 4IR1A 2CAJA 4ED5A 4ECVA 2YNIA 1SCJB 1QSYA 2CZVC 3BGRB 4AYBD 2CQCA 3LP2A 4HI2A 1UWBA 4ES3A 3MCSA 1R7IA 4HI1A 1RSCA 4U7CA 3Q8UA 2VKRA 3VAKA 4XAKA 4ZVRB 3KYLA 4RO0A 1JLCB 1ITPA 2KM8B 2R9LA 3FQLA 2EFPA 2LQBA 2CWXA 4ED0A 1JLBB 2M8DB 2VG5A 2IM2A 1CG2A 3UR0A 2M0GB 3CCMS 2DY1A 1WTFA 4LR7A 3H5XA 2V9WA 5DZ7A 2RMLA 3G6VA 2BVZA 3BV8A 3GWCA 3W9IA 2J0SD 5CYQA 3EXCX 2Z2MA 2EG2A 3DDIA 3T6JA 4KFBB 5IWAF 5KFXA 3TANA 1FE0A 2NZCA 2IC3B 4FVCA 3D28A 3M30A 1D9AA 1KBRA 1P1LA 2V2ZA 1KQFB 1QUPA 3MEEB 2XZDB 2WW4A 3HFKA 1JQGA 3U02A 1XR6A 2JH3A 3W62A 1S0VA 1WSRA 2CPFA 1RWOB 4ZCKA 1TELA 3I4PA 1FKPA 2E5HA 2H54B 5IV3A 2W2NP 1WUUA 5M2PA 2P6SA 1FRLA 4ZVPB 4JV5F 4NLGA 2VA3A 4L75A 2ZM6J 2E9TA 4K0KJ 1K1SA 4DR7F 1SJRA 5KG6A 3G71S 4USKA 2C2ZB 2CJAA 3I5AA 1RT5B 2OO4A 3DI6A 3N5BA 1KS2A 1X4HA 4DR1F 3HKZD 5EWFA 4O44A 4XDDA 2D69A 3L4BC 3QGIA 3MM7B 4L3NA 3C2PA 2BQRA 2QTWA 3PEHA 2D3O1 1FT8A 2ZD1A 4FYYB 2ZZNA 2OH2A 2WONA 4IRKA 4UY85 4OI6A 3EVOA 5C7PA 4DQRA 1FRJA 1EKRA 2MLXA 4JI7J 4XPEA 5IT9U 1FDBA 1M5SA 2J6TA 2G4BA 4Q8FA 2GQQA 1GK8A 3LAKA 1TL1A 2CPJA 5B0AA 1PILA 4KYZA 1F5CA 2BANB 5ETTA 4X4UA 3BGRA 3R6GB 2JEFA 3D66A 5EX3A 5KT3A 4U7UK 3CD0A 4M5LA 1R27B 2E9RX 3ONQA 4ECYA 1HBUB 3HO1A 3UCGA 1YTYA 3QJLA 1S9GB 2I0XA 1EJ7L 1H7XA 1HKAA 1Y5IB 2MXYA 5KG2A 1VIOA 1H2TZ 4R5PB 4B9VA 1G4CA 4ILMA 3QGHA 4WTOB 1JLBA 5HATA 1R8PA 3PIOQ 3AXKA 4OZNA 4PKDB 4HTIA 1FJ7A 4OLOA 4JI0J 3TR5A 3JSMB 2VJVA 2LVWA 4WU2A 4QYZK 2LQ9A 4CTAB 5GAHU 5MAOA 4K4SA 3P8BB 1VFJA 3MM8A 4YB1P 4UZBA 1IM6A 4CNZA 4A8MP 2D1CA 4F4ZA 1S1UB 3PYEA 4U6PA 3G6YA 2EC0A 3AODA 6FDRA 1PIEA 2EK6A 3AOBA 5J1EA 3EWGA 1VQKS 4YEAA 1NJWA 1RTDB 4KFBA 2RDDA 4DCJB 2VL1A 2M70A 2J5AA 1AA1B 2LXIA 2ALZA 3R1LA 5AXKA 3MM6B 4F2RA 5F8LA 2XGPA 1UWAA 2P5VA 1N36J 4I64A 2V63A 3CCSS 3OTDA 5KT2A 4GKJJ 3FJ2A 1IJFB 5KT6A 2E5GA 2ZOFA 1C0TA 1DHMA 2CIMA 3DOMB 5AE2A 2ZBPA 3US5A 1SUQB 3VWSA 5DQIA 3EUNA 1RYSA 2BZ2A 2Z0GA 3MOJB 4CLLA 1RLDA 4O0NA 2KFZA 2MMYA 1UJ6A 3ULHA 3U27A 3IGNA 4KPCA 4PQUB 2H1YA 2Q6BA 2LEBA 4DSEA 1TL3A 4HDHA 2MYFA 3C16A 5CYMA 2FB0A 2CDRB 4RW9B 2NUHA 3C6TB 2LA6A 3M9NB 3KK2A 2KXNB 2XS5A 2GNKA 4DSFA 1TAUA 2DB1A 5HANA 5ETSA 3TZYA 1OSDA 4OYIA 2V50A 2DITA 5HVFA 2HZVA 2MJUA 5L38A 3CT9A 3UNGC 1GEHA 3M2RB 1SJ4P 2VFRA 3H5UA 2LEPA 3K7RA 2AGPA 3W63A 3KLHA 3D0IE 1R0AB 4C8YA 3C8YA 3NP5A 4DQSA 4B08A 3MUVP 4UT4A 2VUGA 1B0TA 2F40A 2CG4A 2QL9B 3KUEA 4UW2A 3MEKA 5AJ3J 2J9CA 3TUPA 2XS7A 4Q2MA 1S9GA 4Y34A 3EXYA 1XN9A 4IQXA 1C4CA 1ZM3A 2WCXA 3G87A 2W01A 2QYCA 3R7SB 1WHWA 4J9VA 5ETOA 4QIGA 1I94J 3LWLA 1DQAA 3PR4A 5HMXA 3G86A 1OJ4A 4U8YA 5H9FK 2HFSA 3OXFA 1YJTA 5GAEU 2EBEA 2K8GA 4DN0A 4YHHJ 5ETQA 1M5VC 2KHCA 2WBMA 4DS5A 3UWTA 2VPXB 3DRRB 3OR1B 1FKAF 2VDHA 4K4TA 2BRKA 3QRQA 3MECB 3VGVA 2A2CA 4KHMA 3K57A 4Q45A 2CVEA 2D41A 3FBEA 2RE1A 2M88A 2EFNA 2XGQA 1XIQA 2YNGA 3G96A 4CLFA 1JLQB 1FJEB 3SYZA 2HVEA 2V4JB 3D68A 2QLWA 3DLJA 3F41A 2A2DA 2NPFA 3TW0A 3DDKA 1VQ8S 1RHRB 4R8UA 4YFUA 1S1XA 3OTOJ 2RQMA 3KMQA 4AQYJ 4OZ1A 2HGLA 2MGZB 3HD2A 4CH1A 3Q24A 2FLNA 2CQ3A 4X64J 2ZC4A 3K8WA 4IG0B 4I69A 4OJGA 4Q43A 4QW9A 4NLWA 4B02A 4ECTA 5EX0A 2VBWA 2JFDA 3CC4S 4NX9A 1RWKB 1TVRB 4RBUA 1M1KT 2KYZA 4P72A 3I87A 4F2SA 3CCJS 5LMUF 3T1YF 3HHLB 4LRDA 4PQUA 3VAHA 3DRPA 1XMQJ 3CCLS 4USIA 1JLGB 1VIXA 3UE2A 2GVDB 2ZWPA 1LK7A 5G4DA 3PIPQ 4HH0A 3C6TA 4L74A 2IMWP 1ELOA 5B7WA 3NWGA 3R1HA 1NSQA 3MEGA 3SQGB 5FJ4A 2KZZA 1SC3B 3UCUP 2FHOB 3JB9k 2VD3A 2XZTB 1WJ9A 3TAQA 1SL1A 4E0DA 4X62J 1SKRA 1AB8A 3M2RA 3VZIA 1MNEA 5CCLA 2KXHA 4ZOSA 5F3ZA 1R0AA 4C3LA 3HF5A 1X8DA 1VQ5S 2WB1D 1NPKA 1JXVA 3MI7X 1VQOS 1RT6B 1FWKA 2DGOA 3FRYA 2UXCJ 4W4MA 3MF5A 1VS3A 4XK8C 4TY8A 4B3RJ 2OSQA 3SCIE 1YI2S 2OUGA 3KTQA 1HPZA 1L3SA 2H4YB 3MHYA 3THTA 4LRFA 2WK4A 5DDRC 1HW9A 1SC4B 2Q79A 1RT4B 1FDAA 3M8RA 1T3NA 3VV2B 1IN0A 1QY7A 3ZZOA 5CD4H 2HS4A 3N9UC 4GO5X 3GFXA 3NGDA 2DHSA 3W60A 3M4XA 3J80Y 2YQ0A 3D0GE 3VQSA 4A8SA 4RUHA 1ZZNA 3IGVA 1IKVA 5GMEA 1ROFA 3MPUB 2ALYB 3RRKA 4CLPA 4ZJQA 2N7YA 2COLA 3HI9A 3HD1A 5DM7Q 1S76D 3I0RA 2DNYA 2B43A 4DPUA 2WRMA 1FF2A 1KVKA 2HNYB 4F4WA 4LR9A 4OI2A 3TJAA 4H4KC 3MR2A 1I5OB 4JI4J 2MGZA 3PR5B 1Q16B 2BJ3A 2ZHOA 4QR2A 5KFDA 5KT7A 1VC6A 3NL0A 3SFUA 3UR3C 4NZ6A 4G3IA 2CKWA 2B51A 4C6AA 4QYZJ 1X4FA 1LV5A 1SC1B 4KAIA 1TVRA 4Z37A 5A2QY 1PC5A 2B5JB 1CS4B 1FD2A 2GVDA 2RH3A 4NLSA 1UW9A 2YQ3A 1H6KX 3UD5A 4OYBA 3ZTRA 1R0CB 4NMXA 2PSZA 1SC6A 1AUSL 4C0BA 3OVSA 3DHWC 2FZCB 4OX7A 4PABA 3MM5A 5J2MA 4CNYA 3LP0B 2XMAA 4FF3A 2QEXS 5HQ8A 3HHNB 5B08A 2VASA 4DBQA 3OXLA 1VQNS 1GXLA 2RT3A 3GG1A 3R5BA 1S1VB 3BQ1A 1RWXB 1EAYC 3PJXA 4ED8A 5IC6B 3IWXA 3KMSA 3P5BP 4PR6A 5GAGU 4O3NA 1ZAWA 4QBUA 2R8HA 1Y3KA 4JI8F 5CHCB 4LF6F 4D3HA 5L1KA 4QOTA 1N6QB 4ID5A 5HMWA 2X3DA 2HHPA 4DV1F 3UO0A 4J9RA 1P6TA 2GHVC 2M52A 3E2EA 4NWBA 4DL6A 3CWJA 3NGTA 2W8KA 1VBZA 1DFDA 2MZJA 4ES2A 3RR7A 3ZTSA 4X4NA 1U1KA 3PACA 2ZOMA 3DU6A 2L9WA 1AROP 2KVIA 1F9FA 3I5BA 1QVGR 1VRUA 2HHXA 5DGAA 2F3JA 2PI5A 3OJSA 2GGPB 1M5HA 3UD4P 3CJQA 5D4NA 4KE5A 1KSPA 3GIIA 2FVPA 4K5SA 3K5MA 5ETRA 3P6YC 4M5DB 1HMVA 2JEIA 2JLEA 2CQ1A 3RAXA 1YGYA 2Y1IA 1RTHA 3FSXA 3SEOA 5IWAJ 1QSLA 1Q0NA 1KKHA 1F1BB 2C3YA 2DH7A 2GCFA 4FP9A 2V8VA 3IXQA 3D2WA 3I4HX 4P6QA 4EYIB 5GADI 4ELUA 3TWZA 2HNYA 3CCWA 2D9OA 1YJWS 5D77A 1HD0A 4NLXA 1FFGB 3AHPA 4NZ7A 1N5TA 1UL3A 2G1DA 1TL5A 4LFBF 4KHPF 3BF4A 3R6LB 4MFBB 4RLEA 4WF9Q 2NXUA 4YR2A 4JV5J 3OL9A 3I32A 2DY9A 5H9FJ 2DHAA 2N4CA 1CULA 3TJ9A 4IOCQ 4YB7A 1HBMA 5A2QU 4DR7J 1O51A 4DSJA 4RW7B 2YNFB 1U24A 2UUAF 4ED2A 2E5JA 3M2UB 3S6EA 4DR1J 2D7SA 2H65B 1T3OA 4WK3A 2E29A 2KTQA 1HWKA 5DDPC 1VQPS 3RW6A 7FDRA 4QWDA 4BHQA 3DNCA 3FQKA 3D0HE 4OLPA 1T94A 4A46A 1RE1B 2N3OA 2R8IA 2WOMA 4NLQA 4F3OA 1FESA 3PW0A 4YMEA 3NGSA 2Y1RI 3NAIA 1OYEA 2OI2A 1HBOB 1SV5A 1S1VA 1FTRA 1OQ3A 4AL7A 2DRAA 3CF5Q 1SJ1A 2DISA 2BQ3A 1BQXA 2XC9A 1REVB 1XNRF 1CJUA 1KRPA 3ILOA 2QA4G 3W1YC 4DJBA 7AT1B 4P9SA 3KK3B 3CO0P 1RBAA 3M8PB 1L3TA 4NLPA 2XSJA 2RRNA 2DIVA 3IM8A 2R8GA 2M2BA 3BO2A 2K3IA 4OHWA 1JB0C 1F3VA 2CQHA 3P49B 5KG3A 2GGPA 5AT1B 3D54A 2HVIA 4B9TA 4ZK7M 3GIMA 2HAFA 3IRWP 3BDPA 1WDTA 5LL6d 3PFOA 1NK9A 4P71A 4WXOA 4J7CA 4M5DA 4R25A 1JX4A 4USMA 1KDNA 3MAAA 2W7PA 3CCQS 3NCPA 2CPEA 2XG8A 2W8LA 1QTNB 9ATCB 4ANDA 1ZM9A 2G2OA 4ZP8A 2YKMA 3DLBA 2JRSA 1B7YB 1UA0A 1H73A 2J9DA 2UUTA 5DRKA 2ABYA 2YXLA 4HVZA 2AJ0A 4IOAQ 4QPXA 1PKUA 3RAQA 2OGUA 3PFEA 3PEJA 1MSWD 1Q79A 1X0FA 3RRGA 2OPSB 5IM0B 1UTAA 4FBTA 1KD1T 2BOAA 5G0RB 1SQGA 2IM0A 1IQTA 1JNRB 5I4MA 5JVHQ 1NNDA 1XTZA 5LSLA 5KFMA 1LQ9A 3OSPA 3W9JA 4DV3J 4LF7F 5DLFA 4LSNA 2YNFA 4X4SA 1DURA 2WZ1A 4WFYA 4HT7A 4LIRA 3M2UA 2VQFF 3O5TB 4FF2A 3AFGA 2V4QA 2IRXA 4IOBA 4M8LA 3F56A 5HSPA 2ZJQQ 3AQPA 3C15A 4URSA 1KLMB 2PMWA 1N4LA 2CJYB 1GXUA 4RW4B 4PWDB 5J2NB 2DHHA 1RK8A 2FJBB 4M94A 1QE1A 2RDIA 3HFZB 4P7TA 1F60B 4DPTA 1RT2A 1EIYB 4C2MA 4N8NA 2K1RB 1NJIT 2ZH6A 3TA0A 2E7XA 4OX8A 4FVMA 1EARA 2B56A 4YP3A 4DWIA 1IKXB 5EWEA 3TX0A 1QSSA 4K4XA 3ZTOA 1RXOB 5KFKA 3SV3A 5LMNF 4A8XA 1V3RA 4JUZA 1TKTB 3HZGA 1G1XA 3C3LA 5KFJA 1REVA 3N28A 2Z8QA 2B9XA 3J7AN 2E5LF 2J7UA 1SH2A 2F65A 1JKHA 4LF9J 4F0KA 4QPTA 2ZOGA 2RJZA 5D78A 1HBNB 5E0OA 4FF4A 4GKKF 2CPDA 3D1OA 4FPIA 1G2EA 2JNJA 4OV6A 2V0NA 1S6PA 3DM2B 4DEZA 3M7VA 1S77D 4EMDA 1VC0A 3TA1A 3J81j 5DQHA 2XHWA 4YDXA 1IBKJ 2JLGA 5KFBA 2KG1A 2DNLA 2NXCA 3HHDA 4OYWA 1X60A 1UFWA 3EPIA 2RAQA 3IP0A 3I56S 2W2QP 1FRXA 2I9SA 1VQLS 2XNQA 2DGTA 1P1TA 1IKWB 3BO3A 2C2RA 3PY8A 1RBOB 2ZH4A 4A8QA 4P52A 2XWYA 3CDBA 4AL6A 4TNOA 3MMBB 3HK2A 2YWWA 3GSIA 2GAHC 1TUGB 3EVMA 4DMZA 2V2KA 1S7HA 2QMXA 3WX8A 3KK1A 1V6HA 3D7SB 2PD1A 5K14B 5ETVA 3GTYX 4DZDA 2GV1A 4CLKA 4RWWA 2WW8A 2DGWA 5DM6Q 4ZVHA 4URGA 2IAJA 3GLJA 2E7WA 2P9CA 2RS2A 1EP4B 2YKAA 2CQBA 4ECWA 2O1PA 4O23A 4LF4F 5G0RA 4FYWB 3EE3A 3TRGA 2CNNB 1A0OB 3BSNA 1WHYA 1WDDA 2K3KA 1K0TA 2H5EA 1K0VA 1MMNA 1NJYA 2WAQD 4HLBA 5L9XA 2POKA 3GP9A 3MR3A 2IRUA 3KNAA 2AYBA 5RUBA 1N32F 4RWXA 5D15A 5HO4A 2VFSA 4WFNQ 4WXWA 5LMUJ 3DCAA 3T1YJ 3MWBA 2ZEJA 2DGXA 4RUCA 2HFZA 4W98A 3VAJA 3E01B 4CYUB 5D0GA 2HNZA 3LQVA 2B7CB 2XNRA 4HACA 2MZSA 4DG1B 2MJNA 1LEOA 4RW4A 1ULRA 3SSSA 1TMJA 2IRYA 2CNLB 1BHNA 1VOMA 2J0XA 2NCKL 4I7FA 1S1WB 1ZM4A 2WB4A 3A13A 2H9ZA 5IOLA 2J8AA 3TJ8A 5CZXA 1IKXA 4ATNA 1MWYA 3QPIA 4M5IA 2V2QA 2OPQA 2VG6B 3E3XA 1U6BA 5I3UB 1RWMB 1TKTA 2RD5C 1N5YA 3DLGA 1GFWB 4XTTA 4F02A 4CLTA 3MAHA 4ZPAA 1SB6A 2HQGA 1RT3A 4FXWA 4F7VA 1NAQA 1MG7A 3ISZA 5KFLA 1SIWB 1T9TA 4PUOA 4P7VA 2V8HA 3PYFA 1DTTB 1TKXA 1NZAA 2HLTA 2B4VA 2AT1B 1FERA 2PFDA 2Y1JA 4TN2A 5BYSA 4C8LA 1XR5A 5E3PA 4EO6A 2DIUA 2UVRA 5E41A 4AXJA 5D6GA 3M2VB 3GV8B 4N76A 4JYAF 3OTCA 2MEWA 2HMIB 1Y3JA 1MROA 4MK7A 1MN9A 3GR1A 5F0UA 1QDUB 1GX6A 4TKTA 1HNXF 3CCES 3ZTPA 4H54A 3RJMB 2YKPA 3HVWA 4AFFA 2XMVA 2AWZA 4DS4A 4ECSA 1W2IA 4J5OA 3T3FA 2A1BA 3GJQB 2MZQA 2ASYA 2JFKA 3H5SA 4DR5J 2WVCA 1C0UA 2FHMA 3DRSA 5B0DA 3FRZA 2XY6A 2ADBA 1JLFB 1KTQA 1UAWA 5T41A 4YDDB 3MZIA 2AF6A 4KBIA 1C2PA 1EP4A 2MTLA 3EZ5A 1TKZA 3AOAA 4DV5F 4F4YA 4JI5F 1NPRA 4O4GB 2OLWA 3QMQA 3QWUA 2LLZA 3HMJG 4WZMA 2UUWA 4E2FB 1TUVA 2YX1A 1S57A 4DR2J 3MPYA 2AYMA 4YQWA 5L1JA 3R5GA 3HZEA 3QRRA 4DFPA 1S6OA 4DSLA 2NQPA 1HD1A 1R8CA 2BJ8A 4LBHA 1RCXB 3PHTA 1BWEA 2XZWA 1UETA 3OUYA 3ITHB 1PO6A 3KLGB 1B4SA 4CYUA 4CLUA 4J37A 4WKRA 1UVNA 5A8KB 4DG1A 1QAJA 2HBQB 4U7UD 3IG1B 4F3MA 2FPHX 1RZMA 3JAMY 2G0JA 2OJ3A 4U95A 1NB2A 1Z4UA 4OFZA 1RACB 2GFFA 2IFXA 4DL4A 4F4AA 1I51B 3OT9A 4NXNF 1S59A 1T03B 4ZJLA 3H42A 4LVNP 1HQEB 2UZAA 4KY3A 4TVAB 4NA1A 1J27A 4K0KF 2FTRA 3OVBA 2ZVIA 2A10A 3DOLA 2DK2A 2FGOA 1RWPB 3VR1A 3HKWA 1JIHA 3B4MA 2PMHA 4V19X 5KAKA 3BR8A 3Q8PB 1ZTWA 2W9BA 4JI8J 4OYAA 3FFIB 1UVMA 3IR7B 1WC1A 3M8WA 3TP2A 1R89A 4Y2AA 3ETOA 4C48A 1DTQA 4X65F 1VQ4S 1Q4RA 4ITSA 5K9FA 2OD6A 4OX9F 4ANEA 2KG0A 2W4DA 4WE1B 3CVKA 1LWFB 2FIUA 4OYPA 2ADCA 4PAAA 4NLYA 1Z2LA 3V4MA 3KWMA 4IYQA 4JI7F 2RHQB 3M2VA 3GCXP 4HDGA 1X7VA 4I6YA 1T9WA 1FNOA 1FCAA 1QAYA 1O8BA 3R8YA 1KN6A 4TQRA 1C4AA 3EVWA 4LF2A 2M3DA 1WWHA 2UXDF 3T1HF 4UOFA 1HHQA 2MZ1A 5T14A 4QWCA 3DLKA 1HL6A 5J1PA 1AFJA 2PC6A 4FS1A 4NI2A 2UU9J 4QQBA 2Y8WA 1NM2A 4HHHA 2B6AB 3MM9A 2CA9A 2GIFA 3N5FA 3BB5A 1IKYB 5CYJA 3OHBA 3KLEA 2GJ2A 2MY8A 4ZMMA 2HQFA 1R6YA 2ZH9A 3CJSA 1JJCB 3EGNA 3Q8SB 4LFBJ 1CJKB 4KHPJ 4L72B 1OWXA 4NCGA 4O4GA 2CPXA 2NXEA 2E7VA 4IR9A 4M5GA 1VQ9S 4A8OA 3NMRA 4FXVA 4MIWA 3KLFB 3OJUA 3DGPA 3ZZTA 4RR5A 3H59A 3LUYA 2GMLA 5KFFA 2IYIA 1FA0A 1U0HA 1QM9A 1NKBA 3QFHA 1KEKA 3KLGA 2FY1A 2HLUA 3V81B 1S79A 2R7OA 3JAMU 1RAHB 5J2PA 3FVYA 3CSKA 2P9GA 1XWLA 4CO4A 2G2YA 3G8SA 2XCPA 3F0NA 3DDNA 2JEJA 4YOEA 2ZDOA 4IRCA 3FEXB 3FMBA 1DQ8A 3FZBA 2VOOA 1RB0A 2UXBF 4FKYA 2RF2B 4KGMA 3WIVA 4DCPB 2Y0BB 1XMOJ 4WYLA 3ZTQA 1K47A 2HWTA 3W7BA 2UVVA 1LWCA 5AXMA 5K8OA 3QWPA 2BMBA 2UUBJ 3HSDA 3MD1A 4ZHRA 2XMMA 2KZMA 2VIHA 4DV7F 4BWJA 5EWGA 2QA4S 2GJFA 1D09B 1XNRJ 1T7PA 3UNYA 4WTYA 3NG8A 4LRBA 1EB0A 1S6UA 1FXLA 2JOQA 2MZTA 4DL3A 2EK1A 1TL7B 2V67A 1Y11A 1LWFA 4UUWA 1UJ4A 3TNVA 1VK8A 2X1FA 1LWXA 2LXFA 1UP1A 2ACYA 2EEYA 2RDJA 1S6QB 3C6UA 2AYEA 4DXLA 2VBYA 2VQEF 3HHKA 2XMKA 4U8VA 2WSFC 4EK2A 1AYEA 1WORA 3TO8A 3GV7B 1T9VA 3J7ZT 2RKIB 3R9LA 3CMQA 2FHKA 3GV5B 2GQCA 4L73A 4Q0BB 1YJUA 2EXUA 3QFWA 3ZZPA 2QFJA 2CQIA 1IBMF 2HEKA 4MK9A 5AJ3F 4Q5VA 1X4GA 2RS8A 4O4RA 3FBFA 1CSJA 4ZPWR 1PYOB 3GG0A 1IKYA 3FEYB 4DQQA 4RUBA 4DFJA 2GAGC 4CLWA 3Q0AA 1BMQB 2HURA 4WU3A 2WSCC 2XQCA 1CJKA 4IDKB 2LA4A 2V69A 2KO1A 2I6WA 2ZBQA 3KLIA 2IYGA 4OYZA 2BBEA 4PXCA 1E6YA 3MEDB 3U1MA 3MPDA 5KG0A 4B9UA 1IWAA 2HAIA 1F2GA 2LMIA 2HQDA 2B9YA 1YVFA 3UD3P 3JQJA 4LF7J 1JNZB 3L95X 4USWA 4I67A 4NLDA 2VQFJ 3A12A 3CCRS 2Z4PA 4ZKAA 3FDSA 2NREA 3AB2B 2XYGB 4TQSA 2ZH7A 1WHXA 2HNDB 4HHJA 2BR0A 3DYAB 1NRKA 1U2RA 2Q1LA 1S49A 2YQ1A 4XDCA 2VFVA 3TZZA 4FYVB 5JUMA 1PBUA 2XULA 4KQZA 3CDUA 3HT0A 3R7NB 2H48B 1IVZA 3MPWA 3G82A 4JV0A 5KFSA 3VALA 4IQMA 2CQ4A 3C19A 3QSYB 5E3AA 1CC7A 1FDDA 4MIAA 2HHTA 1W2BR 5LMNJ 2AYGA 1VGYA 5LT5A 2AIRB 2YBVA 2LFVA 5E7OB 1S48A 2DNQA 2F8HA 4MJKA 3KDNA 3NLCA 3M05A 4CH0S 2E5LJ 3QT6A 1RAIB 2NXJA 1FKOB 2QG9B 1NHUA 1PCAA 4KT0C 1NH8A 4TLRA 1TL7A 4GKKJ 1Q8BA 1UPPA 2D3UA 2BOPA 1HI0P 4ZPBA 5HQMA 4ED1A 5HMZA 3ETMA 3CD5A 3R2CJ 3TAMB 2J9EA 1T9XA 2RQCA 1FWLA 1E6VA 4N56A 3BDEA 2RVJA 2A18A 3WC0A 1QLNA 5KTQA 1ZAVA 4LSLB 3A4TA 2RRBA 2YNIB 4MKYA 3BH7B 2CPIA 4DV6F 2OAUA 3AJDA 5BXIA 3LP2B 3CTRA 4YUDA 3QLHA 2N82B 1RA7A 2ZFHA 5D3GA 2NR0A 1X9WA 1UWBB 2QMUB 3CJ2A 2XYHB 3W5ZA 5CABA 1S9FA 1BE4A 4DFKA 3VVTA 4ZPTR 3NNCA 3PO5A 4ZA1A 4WIIA 1G7CB 2JC0A 5D0EA 1VR6A 2DVIA 3FSYA 4DV4F 1FX2A 2XLIA 1KFSA 2BDPA 1B3TA 1FRHA 3DGVA 3PRBA 4PQAA 4PPDA 1Y4ZB 1HWIA 2U2FA 4R0EA 2YTCA 2GW8A 5KFPA 3OD2A 1A7GE 2B3TB 4NCBA 3OFHA 4JV2A 4KGZB 2YNHA 2VG5B 4LF4J 1RAJA 4ZLNA 5KFCA 2DNNA 4USTA 4RU2A 3AT1B 2NUUG 4JI1F 4BC9A 4OZ5A 3TUIC 2BJ9A 3FNNA 4F36A 1YJRA 3LW5C 1WI6A 2YH1A 1LOUA 2KXFA 3SCLE 1F6TA 1N32J 5CYQB 3THVA 3DMJB 3IRXA 4UY8T 4X4TA 4ECZA 3K5LA 1PYTA 1MW7A 1FJCA 3BSOA 4NLUA 3RGIA 2DHXA 4I56A 1VYAA 2BM1A 4H4OA 2WVFA 1LW2A 3MD3A 1UFLA 1GAOA 2FY8A 1HR0J 1XNQJ 1DLOA 2D3ZA 2L41A 4J9OA 2RU9A 1FKPB 1J5EF 2W1BA 4LFAF 3VVUA 2OTJS 3VTIA 4FBUA 3KJNB 4AXIA 2YWKA 1J5OB 4ZS6A 2HHWA 1X5PA 2NPIA 2GO8A 2CXEA 4E8UA 3RW7A 4C97A 4DUZF 1F2HA 2DGSA 2DO0A 5U47A 4EBDA 1A9NB 4OL8A 2IHR1 3DI6B 1FKOA 2DYAA 2XY5A 3EX7B 4O44B 5KFNA 1UW4A 2Z30B 3AXMA 3JTNA 1LWEA 3OL8A 1R8AA 1TV6A 1WF2A 1IUJA 1EQMA 2ZD1B 1Q95G 3TAMA 2WONB 3CXCR 2WBRA 3LTOA 1RADB 4XPCA 1HNZJ 2HFNA 2QE5A 3B54A 3BPSP 9RUBA 4QWEA 4JYAJ 1TL1B 3T5HA 3VHQA 2BKOA 2R2RA 3KNGA 4Y2MA 4LSLA 3H4DA 4XIUA 2BABA 1KONA 5KFEA 1DRZA 2BV3A 4RJVA 3CW2C 1HNVB 1JLAA 1S5ZA 1BUXA 3POTA 1HNXJ 2CQ0A 3CPWR 1HNIA 3NKYA 3FMWA 2FLLA 4KIAA 1ZH5A 2ZC3A 2VJUA 4NLOA 2H5JB 3QSIA 1RKIA 2HQCA 2YKNA 1SKSA 1HIYA 4DDFA 3TEGA 4N41A 2PI4A 3P3DA 3PW7A 1QAXA 1NSKL 5KG4A 1OO0B 3D6HB 1RAOA 4K4UA 1MWZA 5KFIA 4DCOB 5CD4A 4DV5J 4JI5J 3V5RA 2J76E 4NLTA 3EDQB 4USUA 2VV5A 2Z58B 2Y3YA 3DXSX 3NGUA 3VAMA 3KUGA 4IG3A 4OYOA 2Q43A 1IQZA 3MM8B 1BQNB 2WTFA 1URRA 2RSQA 1ZPWX 1NO8A 2DTJA 4KO0A 4DR4F 3UCZP 2ZZMA 1KQKA 4YR0A 2IDLA 3AA9A 3DMJA 5J1EB 3Q23A 2MB0B 4KJIA 1FWPA 4TLQA 2B8QA 3S01A 1X4CA 3UI3A 4O3SA 2VICA 4FNHA 2W25A 4JI3F 1P8GA 5KFGA 2ZUAA 1N5QA 1RKJA 3KHRA 3LP1A 4FNIA 1VCTA 1S9EA 3K0JA 1UVKA 4K50A 2FC9A 2FUG9 3GONA 1RLCL 4A8KA 2ZWOA 3W8GA 4ZVEA 2OMOA 3W66A 2B4UA 1T95A 5DJBA 4NXNJ 1C0TB 2NXNA 1FXRA 1OYDA 5GADU 2B0GA 2QSWA 3BPDA 2QZ8A 1J5OA 4HEA9 1RTIA 3H2VE 2IA6A 1N8RT 4LF5F 3MR7A 1NB7A 3CDEA 2DBBA 4ECQA 5LJ3Y 4RW8B 4N47A 4X66J 2I8EA 4DX5A 2YX7A 1TL3B 5HVHA 2NSCA 1JWWA 4X65J 1NK7A 3X1LB 3C16B 5CYMB 4OX9J 1AXQA 4BWMA 4PG6A 2MQOA 4L6V3 3KK2B 4FZVA 2FJDB 4PXDA 2BJDA 3I9V9 3AD7C 2F9JA 3LANA 3MGJA 4FS2A 2PMZD 3NBPA 4F4KA 2VB6A 1R3NA 1HNVA 1PBAA 2OSRA 1YSJA 3KLHB 2AD9A 3OL6A 5K8PA 4ZVTB 1H3DA 2EI5A 3PCOB 4C8MA 2UXDJ 3T1HJ 3CB4A 3AAWB 3E51A 4M1KA 5KFQA 5KG7A 2RUSA 3UN3A 3A1YG 1S0NA 3ZC4A 1K9MT 5I3QA 3H5YA 2W7AA 2XMUA 3I0SA 2R8JA 1BQMA 2W2OP 1F5AA 3VGUA 1PAEX 1PGZA 5E3QA 4RBVA 5D4OA 2DJWA 4WYWA 2PIIA 3G8TA 1Y7PA 1BQNA 1D8ZA 2L9DA 2OTLS 2MKIA 5ETLA 3PV8A 4DPOA 3GIKA 2DGQA 4IH6A 1CC8A 3SI8A 2BE2B 3RAMA 1OY8A 4PPZA 3PKYA 4EGLA 4JV1A 2AX0A 2HRUA 2KJVA 1U25A 3QIPB 4HHUA 1KNZA 2QN6B 2YNGB 1U47A 2E5IA 4U96A 2CJXB 2YPYA 3U1NA 3VCDA 3FEZA 4CO1A 2W9AA 2GJIA 1U02A 2XTJP 3DLLQ 1U2FA 3T19A 4M5JA 2R7XA 3MPVA 5IQ6A 1UVJA 3H4BA 3VQTA 4R8UB 4ZPDA 3Q8YA 1S1XB 5J2QA 3D1QA 3NNAA 2KL8A 2M9KA 2UXBJ 4ECXA 3OR2B 3SCJE 4QU7A 2IA0A 4MYTA 2P6TA 2CADA 1Q78A 1YRUA 3QJJA 2E1AA 1FDNA 4DV3F 2JEGA 2EW9A 3PX6A 1CQMA 1NH7A 1NCLA 1LNQA 2ZBCA 1NK4A 2EKYA 4RW8A 4DV7J 4NA3A 3UW1A 3GB0A 4WZQA 2IVYA 5DZ6A 1D3WA 2HVZA 2QC3A 3DRPB 4OI1A 1DJ0A 3HDSA 1VDHA 4K59A 5F8IA 2W2PP 1YBUA 2X1AA 1IBLF 4P2SA 2BA9A 1AZSA 3QATA 1XJWB 1T9UA 3GFYA 3MEGB 2AU0A 3A8EA 2I2YA 2R7RA 2BRLA 5LXYA 2K7KA 2C1EB 1SVDA 1TL4A 3NXZA 2FJVA 1NPPA 1SBRA 2KU7A 4OI0A 2VQEJ 4FYDA 4RL1A 2KFNA 1T02A 2DR6A 1NHKL 1XEZA 1HW8A 4O3QA 4DUYJ 2C2EA 1WG5A 4NRTA 1WF1A 2HWIA 1AUDA 2FVCA 2DNKA 4FXDA 4IFVA 1MN7A 4LF9F 2R7SA 3QT5A 2AJ1A 1IBMJ 1B7FA 3I9ZA 5KFWA 1DY3A 4TY8B 5D4PA 1WOPA 2KHDA 1WACA 4IH5A 5ETNA 3TQEA 3DLEB 3PYDA 3ZNJ1 2FQQB 3BM7A 3QBCA 3GJSB 1HPZB 2MY7A 1EX8A 3K5NA 2QX0A 1IBKF 1B70B 3L7OA 2XLJA 3G9CA 2EPIA 3O1LA 3VAIA 1NJXA 2HRYA 4GC6A 3V6KA 4LSZB 1NK5A 4KGXB 3H7HB 2XYPB 2BE2A 4A47A 3A3OB 4S0MA 2IM1A 1MLAA 1IKVB 4DV2F 3M32A 3QIPA 4C4WA 4RX6A 3IR6B 3CJRA 2XM3A 3I0RB 2MPUA 4N5SA 4AL5A 1F0XA 5JXSA 3LALA 3TX8A 2EBGA 4B9LA 1N52B 4AD6A 3V6HA 4CQ1A 1ZZFA 4P73A 1GMWA 4ENOA 1YZ6A 2FLOA 3T9ZA 1HWUA 3QQCD 3OR2A 4IO9Q 4NL5A 4KV8A 5THWA 3KFWX 4DLEA 1WHVA 4RPFA 1N34F 3QGGA 5B0EA 1CQNA 2DNHA 4DZ6A 1O5JA 4F25A 1RAFB 2YH0A 1N54B 4MKBA 4DSKA 2BEFA 2ZE2A 3CC7S 1GTEA 5KT5A 4QIFA 1AFIA 5SZTA 1RJJA 1NLKL 5LSRA 4V1Ak 5HROA 4CM2A 1JXEA 1Q1KA 3ZZZA 3KKFA 1X0PA 2YX4A 2HHHF 1OIAA 1XK8A 3FC9A 4WP8A 3VAFA 5HLFB 1Y5LB 3RU0A 4A48A 4EFAC 2L08A 2ASLA 4GC7A 3MM5B 5M2UA 3HULA 5J2MB 4QR1A 1RABB 4ZCMA 3NAHA 3R27A 4WFXA 2F8EX 4P10A 2OEMA 3SDEB 2BM0A 3CC2S 2C42A 1OPZA 3MUTP 2KVQE 3GJTB 2VA2A 4DV6J 3PKMA 5L39A 4Q7AA 2AZ3A 2CPZA 5FDLB 5IV4A 2HHUA 2LQ5A 2KN4A 3NY0A 4C8KA 1UFKA 2HGMA 5BR8F 2F7VA 4ID5B 1X4AA 3DLEA 4KKOA 3RRHA 2HG4A 4DV4J 3FCWA 4L3KA 1QAIA 4BC7A 3MCOA 3CCUS 1S97A 1HQUA 2I1RA 4RKUC 1Z1ZA 4ZP9A 1EETA 5B09A 1WEYA 5HJXA 1VRUB 2PA3A 5C25B 1WKKA 2OHDA 3DOKA 4K5RA 3PW2A 4JI1J 3OL7A 2GA7A 3PZPA 1X5SA 1ZA1B 1FTCA 1U0SA 1IR1A 4BDPA 3CCZA 3TYTA 2EVZA 2FYXA 1HMVB 1XR7A 5IT4A 1U7LA 3H40A 4K4VA 1NKCA 1M1GA 1RTHB 4DR5F 4KPYA 3BGOP 2RB7A 1Y10A 3K8VA 4EBCA 2C3OA 1S12A 1VHIA 4A8FA 2Q66A 4O3PA 3I82A 2QO3A 1KQGB 3NMAA 1HWLA 3FZ2A 1H72C 1WKLA 2MKKA 4X4VA 2ZZTA 3UDCA 4MK8A 3BS9A 1YJNS 1J5EJ 1PG5B 5GMKa 4F8RA 2HGNA 4B3OA 4WP9A 3WQPA 4HR2A 1FJGF 4LFAJ 3OLBA 2AJ4A 4DR2F 3HM9A 4U67Q 2VDIA 5LJ5Y 1M0SA 2H4WB 2MQPA 1CULB 3KHGA 1S1TA 3SSQA 3CIZA 1X4DA 1HBMB 1FK9B 4DUZJ 2OKQA 4ES1A 4Q2LA 4C0HA 2W4PA 5LSOA 5C24A 4CO2A 4PXBA 1JLEB 2ZBRA 2LU1A 2DXFA 2ZKTA 3B4DA 1KC8T 2GO9A 3R7BB 2VPWB 5E33A 1T8EA 4ZJOA 3ENVA 1WF0A 5HLFA 2R2UA 1IM4A 4J9QA 3CJ4A 2VFTA 3IA0A 1VRTA 4RW6A 4ETZA 3C46A 1M1HA 1SJ3P 5C42A 2B9WA 1F9EB 2X1BA 2WOMB 2CDQA 2DHGA 2R4FA 3CCTA 3PJ9A 3SDEA 1U48A 1HNWF 4M5MA 2FJWA 3L3CA 2IDEA 3PHEA 1SV5B 2F5GA 5LOQA 4MAKA 4ECRA 1U1MA 4DQPA 5FDLA 3P96A 1T05B 2E66A 3CJ5A 4DHVA 1RT1B 4URQU 3RTVA 1CJUB 3ICLA 2J7KA 3OTBA 5LM7E 3PVXA 2MLYA 1ZPVA 5F9NA 2PGCA 2ZDPA 1KVJA 1VQMS 4P2XA 1FFSB 3A3PB 4N77A 2XSJB 5KFVA 3IMQJ 2Y9HA 3MTKA 1WOSA 5A8RA 1NXIA 2NYHA 3CEDA 3JSYA 5C25A 4I2PA 2QA1A 2DEIA 1Q86T 2QT7A 4FN5A 4TYBA 2Q3PA 4MYUA 3NWRA 4DV0J 3AH6A 2A6MA 2HHSA 4HYKA 1ICEB 1V3SA 4GVLA 3ILLA 2P9EA 4I6WA 4WBFA 4DR4J 4CLZA 1TP7A 3NOCA 3M9MB 3MAAB 2D3OR 1R6VA 3CJKB 1MU2A 5B0CA 1TAQA 2EFQA 5DS7A 2UU9F 3V4IA 2P8IA 2V9KA 4K8RA 1RU2A 5IZHA 5F9LA 2YKMB 4A4JA 4PYAA 2ERRA 1G6BA 5KFRA 3TUJC 4JI3J 1HQ2A 1R8BA 3P5TL 4RU9A 1L3KA 2VG7B 4USJC 4ZIVA 3LA0A 1LFPA 4OMFG 2M5YA 3LO3A 2CUYA 5JVGQ 1YLXA 2ZH8A 1KWMA 3M9OB 1RA6A 3T41A 2CJKA 2ASJA 3EYZA 1S0MA 2KB2A 3HJFA 3IN5A 4C11A 2LP4A 2HHQA 5H1SV 1D9FA 1NDLA 3D6FB 3MOZA 1FK9A 3W2VB 2DT9A 4LSNB 4TY9A 4LF5J 4FF1A 1H74A 2YKQA 1TKDA 3UN5A 2W2MP 1P9QC 3O3LA 2MQNA 3J81U 1JLEA 2DNZA 3UFCX 2QJ3A 1REGX 2G2ZA 2FZKB 3RYLA 1VBYA 3C15B 3IWLA 3PM9A 3TVZA 2GVZB 3C66A 3DN9A 1QE1B 1VLOA 3I6PA 1RT2B 5L46A 3H0PA 3VF0B 2BACA 1M90T 3Q83A 3J7YI 2IBKA 2W9CA 1ZAXA 1MMDA 1XMOF 4TXSA 1S4EA 2GQ2A 3CIMA 4XO0A 5F8GA 4AE5A 1T05A 3IC1A 2UUBF 4PG5A 4WP3A 1RT1A 5DQGA 2ZJRQ 1VQSA 2LQ8A 3M8ZA 2AW0A 3BGUA 1JKHB 4HL9A 4M5KA 3FKBA 5A0YA 3THPA 1OPIA 1F3FA 3IR5B 4DPYA 1DBDA 3S1TA 1DQ9A 5H9EK 2RNEA 3OFEA 3FBBA 1S6PB 2HYIB 4TU8A 2ROGA 2UVUA 3W2WB 2O67A 2HKEA 2QRRA 1RHJB 3V6DB 3ZNUA 4RNNA 1YIJS 2DH8A 2OMLA 3SV4A 2ATLA 1BC6A 3RR8A 3GE9A 2JHEA 3MCNA 2LQJA 1X5OA 2OFHX 2I5JA 1BY9A 3CJKA 4RNOA 2R7VA 1Z2ZA 5T7LB 1HWJA 2LCWA 1GH8A 2B8PA 1B0PA 5E3RA 2MQMA 2DH9A 3EZOA 2V4RA 5AE1A 1NDPA 3ENAA 2SXLA 3KK1B 2VG7A 4OHVA 2DEJA 1JXLA 4UOHA 4MT1A 4F26A 5GVQA 3M6XA 1UMJA 2IAJB 2BJEA 2XY7A 3KJFB 1B64A 1FVSA 1N33F 2XEXA 3G6XA 2BQUA 4ZVOB 1KOOA 3QT7A 4G65A 1JLCA 4UOGA 3ZZUA 5ADZA 4X4OA 3TEHB 4OYMA 3W2VA 2IBOA 3LPEA 3I5CA 4FYXB 5CCMA 3K2YA 2R7QA 3WC2A 3L7UA 5I42B 4ILLA 4M95A 2WVBA 1RP5A 2AJQA 2MQLA 4HKQA 3IS9B 2HNZB 3PRDA 3Q89A 2DD8S 4HACB 4OHZA 2GVZA 2EFOA 5KOWA 1OSCA 4J9LA 2HSEB 1IBLJ 1XERA 1GMWD 2F4FA 1I1GA 1X4EA 1B0VA 1N5SA 2IC3A 4I7FB 2K7JA 1YBTA 2CYYA 3P45B 2AEJA 2VBXA 3MEEA 3N0VA 1FO1A 3BYRA 5EGYA 2KRBA 2F4VF 3RUBL 2OPQB 4CZCA 2UVWA 4ZVGA 4N8OA 4O3RA 4FDFA 2MSTA 1N5YB 1S0OA 3DLGB 3RG6A 5F8HA 3CMAS 1QJHA 3LGMA 2XSFA 2UP1A 3I55S 4EZ6A 1NK6A 1OY9A 4IO1A 2K06A 4PWWA 2J6UA 1RT3B 3DXBA 4CO3A 1ZBTA 2MQ8A 5CH7B 5KFZA 1M5PC 3N6LA 1ZYQA 2K2PA 4PUOB 3CJTA 2MDAA 1RT5A 1UPMB 2Z57B 1RYRA 3QT8A 3Q86A 1TKXB 2XMWA 3OSNA 2DR8A 2H5IB 3RBXA 4I0WA 1U8SA 3Q8VA 3UPFA 3PNIA 3W2WA 2E1MC 3MM7A 1K44A 1V5VA 2NS1B 4IFYB 1X9SA 4F3QA 4ILRA 4NLVA 3V6DA 1YDLA 3BBFA 2RILA 1LFWA 1P27B 3SFGA 1Q82T 3Q2SC 1MROB 4ZP6A 5J1NA 2VC0A 4CI0B 1S72S 3BSAA 4DV2J 5T7LA 5DO2A 4GMKA 1SXLA 2BANA 2LDYA 3SMZA 2PDAA 1AT1B 1ZS6A 1D9DA 1NUEA 1C0UB 3DRSB 3W5XA 3HVTB 3O44A 1WEXA 4LMZA 5SUHA 4OZ2A 1HBUA 4AT1B 2LKZA 2HFVA 2JX2A 1TKZB 2HFUA 3WDOA 2DR9A 2IJFA 1UJ5A 4YS2A 3KG1A 3BR9A 1KQSR 4UZCA 1X5TA 2CQ2A 4RBTA 4P74A 4F0MA 1GT8A 3OLAA 3FBCA 5E2QA 3EM1A 4R5PA 3MFHA 2B4OA 2PE8A 3QZ8A 4NASA 1N34J 6FD1A 3M8SA 3JSMA 1SJQA 1X4BA 5I42A 4CTAA 2Z2ZA 4C8ZA 1Q8KA 1T0TV 3OUYB 3CGIA 3IS9A 5C2CA 1S1UA 3A8JA 3NRBA 1ZTTA 1YQHA 3CJ8A 4K4ZA 1RTDA 3NCRA 1LW0B 3MMCB 1SKUB 3UDEA
chains in the Genus database with same CATH topology
1ZH5A 3TARA 2ZC3A 3AA8A 5H9FJ 2DHAA 1HR0F 4NLOA 5A8WB 1XNQF 2N4CA 1UEUA 5KFTA 1RKIA 4IOCQ 2XWXA 2GC8A 2YKNA 4YB7A 4Y0FA 1SKSA 2DR5A 3BN4A 1HBMA 3MM6A 2R7WA 2C3UA 4NOHA 4DDFA 2ZUGA 2HFOA 1YJVA 1O51A 1YRTA 4N41A 2IJNA 1H98A 4RW7B 2PI4A 4DSJA 3P3DA 3PW7A 3MMJA 4DF8A 1QAXA 3GFZA 2YNFB 1U24A 5KG4A 3VAGA 1VC5A 2UUAF 1SI9A 5D8HB 4ED2A 2E5JA 3H25A 1OO0B 3M2UB 3S6EA 3ZZ0A 2D7SA 5IT0A 4K4UA 1MWZA 1LXNA 5KFIA 1U45A 1T3OA 4WKYA 4WK3A 2E29A 2MKJA 4DF4A 2KTQA 2KYXA 2V8DA 3T5LA 1OS5A 1HWKA 3R5AA 1X9MA 1TK5A 3V5RA 2J76E 5DDPC 2C3PA 3DOLB 3UQSA 4NLTA 1VQPS 4F67A 2VV5A 2I38A 2E1CA 3MDFA 3RW6A 1FE4A 1V3ZA 7FDRA 3HVRA 3DOMA 2NSBA 2OPRB 4D3GA 4QWDA 3DXSX 4BHQA 3DNCA 3VAMA 3FQKA 1C1BB 3D0HE 4Y28C 3PXGa 3MTJA 3JTOA 2R8KA 4OLPA 3GILA 1VQYA 4IG3A 2YWHA 1SUQA 2Q43A 2W9BB 1GQEA 2CQDA 3FSIA 3QAEA 1T94A 1IQZA 2ZVSA 2OD4A 3MM8B 4B9SA 1BQNB 4A46A 2WTFA 2B6AA 1URRA 2RSQA 1ZPWX 2N3OA 1NO8A 2DTJA 2XI2A 4KO0A 3TA2A 4DR4F 2R8IA 4C8NA 3UCZP 2ZZMA 1KQKA 3MFIA 2WOMA 1DTQB 4NLQA 4B3OB 4Y2IA 4DX8H 4YR0A 4F3OA 1FESA 3AA9A 3DMJA 3PW0A 5J1EB 4IRDA 4UQGA 4YMEA 3MR6A 1NK0A 1Y00A 1SL2A 2Y1RI 3BQ0A 3NAIA 3Q23A 1I94F 2APOA 2MB0B 4KJIA 4TLQA 1MMLA 3S01A 1HBOB 1X4CA 3V6JA 1SV5A 1TR0A 2JL9A 3UI3A 1S1VA 1FTRA 2NLWA 2QLXA 4IFYA 3ZZRA 4O3SA 2V8GA 1OQ3A 1HNZF 4AL7A 2DRAA 3CF5Q 1S1TB 1L5UA 4FNHA 1FNXH 3FGVA 3T1AA 1SJ1A 2W25A 2RQKA 4JI3F 1P8GA 1Y0HA 2DISA 2BQ3A 1RGVA 2GMJA 4RW9A 5KFGA 1BQXA 2XC9A 1YRXA 1REVB 1XNRF 4Y65A 1N5QA 3M6UA 4LIWA 3KLFA 1RKJA 3KHRA 3LP1A 4FNIA 4YHHF 2C2DA 4MKAA 1KRPA 1S9EA 3N6MA 1TK8A 3K0JA 2QA4G 1UVKA 1WEZA 4EWTA 4DJBA 5C24B 2FC9A 4K50A 1NEEA 2FUG9 3KK3B 4A8KA 1U09A 4ZVEA 2OMOA 3M8PB 1L3TA 3OFFA 4NLPA 2O5DA 2B4UA 1T95A 4G1IA 5DJBA 1ZETA 2XSJA 1C0TB 4PG4A 1FXRA 2JZ5A 3MMAB 2RRNA 2F1FA 2RIJA 3DLKB 5GADU 2B0GA 4PWUA 4HH1A 2OPPA 2QSWA 4RNMA 2HS0A 2QZ8A 4YB5A 2DIVA 4H4MB 1NU4A 1J5OA 3V81A 2R8GA 4O0IA 4HEA9 3RB6A 2M2BA 3BO2A 2YY3A 1RTIA 2CJBA 2K3IA 2X1GA 4OHWA 3DHXA 3K59A 1VRTB 1HA1A 3H2VE 3BQ2A 4RW6B 1JB0C 3MM9B 3HVTA 2CQHA 3P49B 5KG3A 3R5CA 2GGPA 3D54A 2IA6A 1N48A 2VBZA 5C42B 1N8RT 1OQ6A 4ECUA 3L09A 4LF5F 2EFVA 2HVIA 1NB7A 4B9TA 3IAM9 4V19J 3CDEA 2DBBA 3KLEB 5F8MA 2R2TA 4ECQA 5LJ3Y 4ZK7M 3KHLA 3M8QA 3GIMA 4RW8B 4N47A 3IRWP 3BDPA 1DZ5A 2I8EA 5LL6d 3PFOA 1NK9A 2YX7A 4WXOA 3OTOF 1U26A 2M7SA 4RZRA 4LJMA 1RQ0A 4NCGB 4M5DA 4R25A 5H9EJ 1JX4A 4AQYF 1TL3B 2XMTA 4OQJA 2RQ4A 2NSCA 1JWWA 2FD2A 5EUHA 2W7PA 3CCQS 2JC1A 1J2VA 2CPEA 2XG8A 3NCPA 2RF2A 4RNFA 2W8LA 1NK7A 3TQ1A 4X64F 3X1LB 1NHVA 5CYMB 3M6VA 1AXQA 4BWMA 2U1AA 4PG6A 2MQOA 4L6V3 7FD1A 4I2QA 3CUNA 3H2LA 3KK2B 4FZVA 2AGOA 2FJDB 1ZM9A 4PXDA 4ZP8A 2YKMA 2BJDA 5DDOC 4BBYA 1K8AT 3DLBA 2JRSA 3I9V9 1UA0A 2J9DA 3CJ3A 2F9JA 3LANA 2UUTA 3JYTA 3MGJA 4FS2A 2PMZD 1U1RA 2CFXA 4OHYA 5DRKA 4B9NA 3NBPA 2ABYA 4HVZA 2AJ0A 4IOAQ 4A8YA 4F4KA 4QPXA 2VB6A 3RAQA 3S8SA 3PFEA 3PEJA 1R3NA 3OTEA 5A8RB 3Q8QB 2CPHA 1HNVA 1XMQF 1MSWD 2OSRA 1Q79A 3RZAA 1U1OA 2L48A 4Z2XA 1HARA 1YSJA 3DRRA 3OR1A 1X0FA 3KLHB 2AD9A 3RRGA 2OPSB 5IM0B 3OL6A 5K8PA 2J0WA 1H3DA 2EI5A 4FBTA 1LW0A 4C8MA 5J2PB 3MECA 1KD1T 4I2PB 3MMCA 3AJ2A 1KVIA 3CB4A 4QIWD 3AAWB 4NYZA 2YKOA 1A6LA 5G0RB 3E51A 3M1VA 2IVFB 1JK9B 4A8WA 4ETXA 5A8WA 2IM0A 3LGNA 4M1KA 3OHAA 1IQTA 5KFQA 5KG7A 1JNRB 4HT5A 4BCAA 4EBEA 4ZCIA 5I4MA 1L3VA 5JVHQ 3A1YG 1JLQA 1S0NA 3ZC4A 1NNDA 1XTZA 5LSLA 1K9MT 5KFMA 1LQ9A 3OSPA 5I3QA 3T5JA 1S6QA 3H5YA 2DNGA 2GX8A 5DLFA 4LF7F 2XMJA 3R3TA 2YNFA 4LSNA 4UOCA 4X4SA 4QU6A 4J9NA 2W7AA 1DURA 1KFDA 4WFYA 2XMUA 4HT7A 3T9NA 5K5MA 4X62F 4LIRA 2V4JA 3I0SA 3M2UA 2R8JA 3AQOA 1MU2B 2MKSA 2VQFF 3GR0A 1SJFA 1GX5A 1BQMA 3O5TB 1YG0A 3GSDA 4FF2A 5L8RC 2DCUB 2V4QA 3V4IB 1FHTA 2ZH5A 1F5AA 2DGUA 4JBCA 5KFYA 2RKIA 1LWCB 2IRXA 4IOBA 1CPZA 4M8LA 1PGZA 2DCLA 3F56A 2AX1A 2ZJQQ 3AQPA 5E3QA 5KT4A 4RBVA 5D4OA 4URSA 2DJWA 4R0JA 2OPRA 1DARA 1KLMB 1V9OA 1C1BA 4WYWA 2HQIA 2PIIA 4ZHRB 3G8TA 1N4LA 4IG0A 5BYQA 4Q0BA 3H98A 2GIQA 1GXUA 4RW4B 3QGPA 2UXCF 4PWDB 5J2NB 2W4CA 1Y7PA 1BQNA 1RK8A 2FJBB 3DC2A 1QE1A 2RDIA 4X66F 1WTBA 1D8ZA 4M94A 1HHSA 4EO8A 2L9DA 4P7TA 4DLGA 2HWHA 3B78A 2AQ4A 2OTLS 1F60B 2MKIA 1RT2A 3AB4B 4C2MA 4B3RF 4N8NA 3PV8A 4OJ3A 2J7WA 2K1RB 4DPOA 1NJIT 2ZH6A 3GIKA 2DGQA 4IH6A 3I31A 3TA0A 2E7XA 3ENQA 3WX4A 5HL7Q 1CC8A 4OX8A 3SI8A 2BE2B 1FRMA 4FVMA 3RAMA 4JV1A 3J7A1 2B56A 3GYXB 1JMTA 4PPZA 4B17A 2F9DA 4EGLA 4YP3A 2RU3A 3PKYA 4DWIA 2AX0A 2HRUA 4HTJA 5BJRA 2KJVA 1U25A 3QIPB 4C11B 2VFUA 2DNRA 5CXTA 2YWEA 1IKXB 3HHLA 5EWEA 4EU0A 3OV7A 4IDKA 1KNZA 1N5VA 4EYHB 1QSSA 1SKWA 4K4XA 3BN7A 3GQCA 1ZM2A 5KFKA 3SV3A 1FNMA 1JLGA 1KTVA 2YNGB 1U47A 5LMNF 2E5IA 4OHXA 4A8XA 2XCAA 1V3RA 4ID8A 3OFGA 4JUZA 1TKTB 3HZGA 3U1NA 3VCDA 3FEZA 4CO1A 3MEDA 3C6UB 1G1XA 3C3LA 2W9AA 5KFJA 1REVA 2BW2A 2GJIA 1R31A 3N28A 2Z8QA 2B9XA 4OJ1A 5JJBA 4YY3F 3DLLQ 1U2FA 1U49A 3D1HA 2E5LF 4YR3A 2J7UA 1SH2A 2G0CA 5AXLA 1FXDA 1L3UA 1JKHA 3T19A 3SQGA 3G6ES 4OI4A 2R7XA 4KHRA 4QPTA 2ZOGA 3MPVA 4DL7A 5IQ6A 4WK1A 4ALZA 1UVJA 2RJZA 4OJHA 5D78A 1HBNB 5E3CA 3H4BA 2E1RA 5E0OA 2FVRA 3VQTA 5AE3A 4R8UB 4ZPDA 1S1XB 3J81Y 5J2QA 3D1QA 4FF4A 3EZUA 4GKKF 5ITHA 3NNAA 3W3SA 1YJ9S 3LF0A 2UUCF 2M9KA 2WSEC 3MMAA 2GHWA 4C8OA 2CPDA 3D1OA 4MMOA 4TU7A 4ECXA 4U9RA 1RTJB 3OR2B 1G2EA 3SCJE 3B8HA 3I96A 4H4MA 2OFGX 2VZ9A 2V0NA 4QU7A 4J9PA 1S6PA 2IA0A 4MYTA 3BGFA 3DM2B 4DEZA 4KSEB 2P6TA 1S77D 2GMHA 1VC0A 1Q78A 5F0WA 1YRUA 3TA1A 3QJJA 2E1AA 1FDNA 4DV3F 2KT3A 2ZKUA 2XHWA 4YDXA 5DQHA 4KR0B 2HNDA 2JEGA 3H8YA 2JLGA 5KFBA 2EW9A 3J7Z5 2KG1A 3M30B 4IH7A 3PX6A 3DYAA 4AUKA 1CQMA 2DNLA 1PSDA 1VMBA 2AP6A 3JTPA 1NH7A 3OVAA 1RT6A 3HHDA 3R5DA 2O66A 4CIOA 2W9CB 2ZBCA 1UFWA 4ED3A 3TVKA 3EPIA 2EKYA 4RW8A 1NK4A 1XMBA 4NA3A 3UW1A 3I56S 5EN1A 2ROPA 1FRXA 3GB0A 2I9SA 2XO7A 1VQLS 4OV1A 4WZQA 2XNQA 1RISA 2IVYA 2YWGA 1D3WA 1P1TA 2DGTA 2HVZA 4DR6F 2AJFE 1IKWB 3DRPB 3BO3A 2FJEB 2C2RA 4OI1A 5IXUA 3PY8A 4JI4F 1DJ0A 3HDSA 2ZH4A 4A8QA 3KLIB 4K59A 2IM3A 2XWYA 5F8IA 3CDBA 4AL6A 1E6YB 3TVYA 2X1AA 4TNOA 3LAMA 4P2SA 3MMBB 2BA9A 1IBLF 3AJ1A 2HQ3A 2MKHA 3RB0A 3HK2A 5HBMB 4TU9A 4RNHA 3TAPA 1RT4A 3Q8RB 3GFYA 4QWBA 3MEGB 4DMZA 2AU0A 1D8YA 2V2KA 4F50A 1KOHA 3A8EA 2I2YA 1S7HA 2NYIA 2QMXA 2R7RA 5A0YB 1URNA 2BRLA 2VOPA 5LXYA 1U6FA 2K7KA 3U7JA 1N88A 3KK1A 1V6HA 1TL4A 2PD1A 2FJVA 5K14B 1BGXT 5EHHA 2GV1A 5KFAA 1SBRA 2KU7A 4OI0A 1ZOTA 2AGQA 1RI7A 4RWWA 2WW8A 2DGWA 5DM6Q 4ZVHA 4FYDA 4URGA 2IAJA 4H4KA 2KDOA 2E7WA 2KFNA 1N0UA 2P9CA 4KC5A 2RS2A 1T02A 4WFZA 1XEZA 1EP4B 1HW8A 2YKAA 4K2XA 4X84A 4O3QA 5HP1B 2C2EA 2CQBA 4ECWA 5DG9A 1WG5A 1HHTP 2O1PA 2VONA 3IFEA 4NRTA 1IJEB 1WF1A 1G3OA 4O23A 4OZ0A 1U1QA 5G0RA 4LF4F 2HWIA 1AUDA 2FVCA 2DNKA 3HXMA 2LECA 3CULA 3KOAA 4FXDA 3TRGA 4IFVA 4QJVA 3IO1A 2MQQA 4LF9F 2R7SA 3N6NA 3HLUA 3FCHA 2FDNA 3LH2S 1M5OC 4PG7A 2AJ1A 3BSNA 2Y0SD 1WHYA 1VI7A 1B7FA 2K3KA 3I9ZA 5KFWA 2ILYA 1K0TA 4Y2CA 2FHJD 3O6QA 2H5EA 1N0VC 1K0VA 4TY8B 5D4PA 2N3LA 1MMNA 1SIZA 1NJYA 2KHDA 2WAQD 4HLBA 5BYRA 1WACA 2POKA 5L9XA 3X3UA 4IH5A 4QWAA 2VH7A 3MR3A 2CJQA 1N56A 2IRUA 1BD6A 2I5JB 3DLEB 4PXEA 3KNAA 2AYBA 2X3GA 3NS6A 3BM7A 2ZHBA 3MXHP 2IVMA