1B99A

3'-fluoro-uridine diphosphate binding to nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NUCLEOSIDE DIPHOSPHATE KINASE)
publication title Catalytic mechanism of nucleoside diphosphate kinase investigated using nucleotide analogues, viscosity effects, and X-ray crystallography.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1b99A00
4UOFA 3Q89A 2VU5A 1K44A 3ELHA 3VVTA 3MPDA 1ZS6A 1EHWA 2HVEA 1NLKL 4W98A 3B6BA 3ZTSA 3VGSA 3BBBA 3ENAA 3VGTA 3NGRA 3R9LA 3DKDA 1HIYA 4WBFA 3ZTPA 3ETMA 4UOHA 3Q83A 5CAAA 1S5ZA 1LEOA 3WX8A 1WKJA 3BBFA 1NPKA 3NGUA 3DDIA 2HURA 2DXDA 3FC9A 3BH6B 1LWXA 4DUTA 1BHNA 3FCVA 3EMTA 1JXVA 1XQIA 3EICA 3NGSA 4UOGA 3FBFA 2AZ1A 2DXEA 1WKLA 1NB2A 3EJMA 3FKBA 1NCLA 1NHKL 3JS9A 4S0MA 1NSQA 3ZTQA 4ANEA 4ANCA 1NDCA 1PKUA 2CWKA 2B8PA 4CP5A 1MN7A 1NUEA 3Q86A 1HLWA 1NSPA 3VGVA 1BUXA 5C7PA 4ENOA 4HR2A 4F36A 3EE3A 3GPAA 3Q8UA 1XIQA 2B8QA 3BBCA 3FBCA 3Q8YA 2DXFA 4KPCA 3ZTOA 3EVMA 4DI6A 3Q8VA 4DZ6A 2HVDA 1U8WA 3FBBA 2AZ3A 3GP9A 3ZTRA 5BXIA 3NGTA 3PRVA 3EM1A 3FBEA 1NDLA 1B99A 1WKKA 3BH7B 1BE4A 4FKXA 3PJ9A 4O0NA 4ANDA 5IOLA 4EK2A 1B4SA 1S59A 3B54A 2NCKL 2DY9A 3FCWA 4C6AA 2BX6A 2DYAA 5CABA 3L7UA 1MN9A 1NDPA 1PAEX 1VYAA 3EVOA 1F6TA 3G2XA 4FKYA 4F4AA 2ZUAA 1NSKL 1W7WA 3EVWA 1HHQA 1NDKA 2BEFA 3VVUA 1KDNA 1S57A 1F3FA 1UCNA 3VGUA
chains in the Genus database with same CATH superfamily
4CLZA 1VC6A 3DM2A 2E29A 4HVZA 2XMKA 3T1YF 5B08A 2PMZD 5KT6A 3CCWA 1SC3B 2DNKA 4I1TA 2V4JB 2MZRA 1HKAA 3DDIA 4JI6F 5HROA 1NH8A 9ATCB 3WC0A 3J7YU 1VQPS 2E7XA 7FDRA 3NGSA 1U47A 5HSPA 1PILA 4ZMMA 3ICLA 2IDLA 3ILJA 3I4HX 2UV8A 3GJQB 2CNOB 3FMWA 2NR0A 2ZWOA 1NO8A 4MK9A 3CDWA 2XSJA 3CCJS 1D1UA 1PJ7A 2UXBF 1WTFA 1YHQS 4MKYA 1JLAA 1BE4A 1C1CB 5J2PB 2VG7A 3SFUA 2VONA 4NYZA 4OX9J 1YZ6A 2DY9A 3A3OB 5D77A 4TLQA 3TJ8A 4HH0A 3BREA 4KC5A 4NMLA 1MMDA 2B9YA 4OQJA 5DETA 2QG9B 2CQ0A 1IJEB 2F63A 3LP2B 4ZVTB 2N7YA 3WBZA 2B9WA 2QC3A 3QAUA 4M5NA 4WF9Q 4NA2A 1WORA 4G6VB 5ETSA 3SFGA 2C3OA 4IO9Q 2MQOA 5CCLA 3F56A 2J8AA 6AT1B 1EIYB 4ZPWR 3VAKA 1W25A 1NPKA 4H4KC 4A48A 3R2DJ 3BN7A 1YG0A 2DPIA 3R6GB 5F3ZA 2CJBA 3EZUA 3CJ8A 3IC1A 4KH1B 4CI0B 3H20A 4ZPBA 1SH0A 5AJ3J 4R0JA 1TKZA 2BQ3A 2FLNA 3KLHA 4CTAA 4U7UD 2YQ1A 4OYXA 2JH3A 3Q2SC 4WIQA 3D0GE 4B9VA 3UN3A 4PXDA 4F4WA 3A12A 4IQXA 1VK3A 5KG4A 3D6HB 2NXNA 3GFYA 3PTWA 1SC4B 4Q8EA 2C3PA 1FEEA 3N5BA 1O5JA 4TXSA 2RB7A 4IRCA 1FJ7A 1F3FA 5J1EA 1J5OB 1LK7A 2UVVA 1RHQB 1B0VA 4J9KA 3EZOA 2HHHJ 3NWGA 2VICA 1RACB 2H65B 2OD6A 3QZ8A 4OZ2A 4H54A 4DX6A 4GC7A 2HQCA 3D54A 4DQQA 2NSBA 4FF1A 2RT3A 1PC4A 3PYDA 4DR3F 4WTYA 3AH6A 1TL4A 3PXGa 2DGQA 1FJGJ 4ANCA 3NY0A 2ZWPA 4LF1A 4ELVA 3CJ4A 2E1PA 3OV7A 2HNYB 3LPYA 4OYWA 2G4BA 3FZBA 5DGBA 2YNIB 3WZ0A 4NMXA 1VOMA 2NXJA 2LA6A 3O3LA 2WB1D 2MQLA 1NRKA 1JK9B 3FSIA 3TEHB 1VIXA 4RNHA 1JMTA 3TAQA 2HRYA 3PW5A 5LT5A 3OL8A 3K7RA 5KT3A 1ZTTA 3G82B 3TAPA 2DNLA 3HX9A 3Q0AA 2MXYA 1U48A 3N9UC 3M1VB 4U8YA 5KFBA 4ERDA 2FGCA 3ZZ0A 2ASYA 1WDDA 4C0OC 5KG3A 2Y1LB 4DJBA 1X4FA 3JSMB 2MY8A 1PAUB 3IS9B 4PWWA 1YK9A 2ZD1A 3N79A 5HJYA 1SL2A 1VI7A 2BE2B 2DHAA 5KG0A 5K20B 1JJ4A 2OEMA 2BQUA 4USMA 1R8BA 4B9MA 3IRXA 1GMWD 1F2GA 3BO2A 3H42A 1HWIA 3PNIA 3IP0A 1N34J 3CC4S 3C3LA 1EJ7L 3R1HA 3BKFA 3MUMP 2EG1A 5HANA 3M8SA 1FKPA 2ASLA 2Z2LA 1TL1B 4HHHA 2K7KA 1YJNS 2DGUA 1D0EA 2OPQB 3CCUS 1PIEA 1T9WA 3ENVA 1UWBA 5KFCA 3AFGA 2XWXA 2XI3A 3VALA 4K4ZA 4NL5A 4Q5VA 3THTA 2VF3A 4ILRA 5F8IA 4U6PA 2CNNB 5FDLB 3R9LA 3CCTA 4IG3A 4KHRA 5CYQA 1AFJA 2VG6B 2V8DA 2IYIA 2WAQD 1GXLA 1VLOA 2HLTA 4ECWA 2O67A 5KFWA 3KLFA 4H4MA 2E9RX 3UE2A 3GIKA 1PYSB 1NK0A 3LTOA 4JI3F 2AEMA 4H4KA 5JVGQ 2KJVA 3C6UA 2NXCA 4Q44A 1U8WA 4FVMA 3LA0A 3VAGA 2GQQA 2ERRA 1UVKA 1WC1A 1IBCB 2Q6BA 4F67A 1FJCA 5CZXA 5ETPA 3ZXWA 4NYPA 3PJXA 2D3OR 5CABA 2KXHA 5KFAA 2W8KA 3RYLA 4J9SA 3CCZA 2XI2A 4O4RA 5GADU 4M5HA 3B8HA 3I56S 5LMNJ 2CQ3A 1KP6A 3GB0A 2B5JA 1XR5A 4KYZA 2V50A 2ZBCA 2IA6A 2O01C 5DQGA 2FB0A 3GCXP 2QYGA 2R8KA 4ZPAA 2DR6A 2XS5A 3KDNA 3FNNA 2OPPB 3QATA 2RILA 4CDIA 3UCGA 2GW8A 3P8BB 5LOQA 5JUMA 1XNQF 4MKAA 1YIJS 1ZA2B 2IJNA 1O0PA 2DITA 3G6YA 2C2RA 2BE7D 5B0BA 2ZBIA 4NASA 1D8YA 4WKYA 3T41A 3SZ2A 3KLGB 4LBIA 4DI6A 1UTAA 1RA6A 4ZP7A 1HPZB 2B4PA 2AP6A 3QO9B 3M8QB 1RABB 3AODA 4J9RA 3MR2A 2VFRA 1F9EB 1C1CA 3UVJB 1PCAA 4DS5A 3UDCA 1NJXA 3PKMA 3GIJA 4DR5J 3AQOA 4LF6J 1A7GE 2VA3A 3CF5Q 4P72A 3VAJA 2XYPB 2YKPA 4C3KA 1N5YA 3B78A 1NXIA 1KVIA 3JSBA 3THVA 4E8UA 1U25A 1RU1A 3V81A 4PXCA 4N41A 2CJ9A 3AJ1A 2CKWA 2KRRA 4JI0J 2V2VA 4EWTA 2AIRB 3NXZA 1JLEB 3DRSB 3BDPA 1QY7A 2GZOA 3JS9A 2PEBA 1Z2LA 4MIWA 2VODA 3GMGA 1J2VA 4DS4A 4ZKAA 2UVRA 1TL5A 4NX9A 4ZVRB 1JKHA 4NZ7A 4HI1A 1KSPA 5J2NA 2MQPA 3N01A 2DRDA 2AEFA 3OJUA 3UWTA 3POTA 5BYQA 5F41A 2VPXB 1URRA 2OMLA 2HHVA 4OLOA 1MSWD 4JP8A 1RWXB 3RB6A 1X4GA 4ETZA 1D9DA 2LQ5A 1T9XA 1N34F 1JLFA 4I7FA 5AE2A 2C3UA 2HMIB 5AXNA 1R89A 2H5EA 4QWCA 1TK5A 4A8MP 4RNOA 2PN6A 3OTEA 4EFAC 3G87A 3HFKA 1QAJA 2YWKA 2L9NA 3V6DB 1VQ8S 1FDAA 3BGOP 3IBCB 4DV2F 4JI5J 4ZJOA 1U26A 2AD9A 4TY9A 1XMOF 5EWGA 5EWEA 4I69A 4RLEA 2XLKA 1WC4A 1ICEB 1FTRA 5ADZA 2VG5B 3TW0A 4C98A 1NSPA 1IN0A 3R5BA 5IM0B 4B3OB 2M0GB 5J2MB 5L9XA 3GFZA 2NXEA 2M8HA 1S6QA 1VHFA 3NGDA 2G9OA 1E6VA 4I2QA 4K4WA 3A1YG 5HBMA 5C24B 5GAHI 1RWMB 1Z1ZA 3W5ZA 3PHEA 3KHRA 4MFBB 2YNIA 3J7A1 1TQLA 5F9NA 3PV8A 4CH7A 3LGNA 4C97A 1UVIA 2HSEB 2HHSA 1S72S 4DR1J 1GTEA 1SUQB 3K57A 1KOHA 1ROFA 2PO4A 5LMUJ 4ELTA 4USKA 2NYIA 2K3KA 2WZ1A 3G82A 2AQ4A 1XK8A 2AX0A 2V9KA 1WOPA 4YS2A 4WBFA 1U6ZA 4AL7A 3GIRA 3AY0A 3HKWA 1N5TA 2RMLA 2E7VA 1RSCA 3KWMA 4KFBB 2CFXA 4RZRA 3HK2A 4IOCQ 4OMFG 2X3GA 3RR7A 2YH0A 4B9UA 3MUVP 4LRFA 4ZHRB 2CNKB 1U49A 2W7AA 3PRBA 2GMLA 2DNQA 3RZAA 5BR8J 2HS4A 5DG7A 2CG8A 5I3UB 4K0KF 3OHBA 3DRRB 2R7OA 4DV0F 3NLCA 1VMBA 5B7WA 1Q8IA 2LXIA 4XPCA 4WP8A 3IBFB 3LGHA 4B9LA 3M9OB 1T9VA 3T1HF 2CAJA 2M8DB 1D3WA 2AU0A 2AWZA 4ID5B 3V4MA 4OV1A 4TKTA 1N88A 1ZH5A 5EGYA 1Y5IB 3TAMB 3HO1A 1FFWB 2R42A 2OPQA 2IBKA 1PYTA 4ZS6A 2XNQA 5KFVA 3JAMU 1MU2A 4M5JA 4U67Q 4KGKA 4C3MA 2BJ3A 4QU6A 2FZGB 2HURA 4CT9A 1XMBA 3MPWA 1U2CA 5G0RA 4LR8A 3EMTA 3DOLB 2VA2A 2WOMA 2DNRA 4OI6A 1GNKA 2HFVA 2RQMA 2F1FA 3EWGA 3MM6A 3TWZA 3W62A 3G86A 4C48A 2PI4A 1LV5A 2MHEA 2VBXA 3BPDA 4HYKA 3CCQS 2GAHC 2F8HA 2I2YA 2FHOB 4PRFA 1RAEB 2AHOB 3MM7B 3FEYB 4A8XA 4NLGA 3PW4A 3I9ZA 2RKIA 2E66A 1CJUB 3DU5A 1YJUA 4ZLPA 2DGOA 4ED2A 5C2GA 2OTLS 3DOKA 4G1PA 2RJZA 2VQEJ 1XNRJ 1TTHB 1UL3A 3M2VA 3BN4A 1FXDA 3OHAA 3NGUA 5C42B 4CO2A 3MM8A 1BQNB 3RG6A 2P2CB 3B4MA 2EPIA 2GVDB 4KGMA 1EKSA 3OTCA 3GZ7A 4JOUA 3Q86A 5C7PA 3J7Z5 2FHJD 1PGZA 4QIWD 3EGVA 4DV3F 3PJWA 1XJWB 2MZSA 4B3TJ 2FVCA 2A2CA 4CH1A 4C8MA 2XNRA 3U1LA 2YKQA 2F8EX 1IM6A 5I3QA 3GYXB 4O3RA 5DLFA 3VVUA 3MR3A 4R8UB 4F4XA 1DLOB 2P6TA 3AT1B 4DU8A 3TARA 1OSDA 1S97A 2FUG9 1HW9A 3OL6A 4BC9A 2RU3A 2D1CA 2Q3PA 4YHHJ 2AGQA 4J5OA 1YKWA 3BSCA 2JEGA 1IKVB 4P2SA 1UFLA 5T41A 2A3JA 2M4MA 3VAMA 5LMUF 4N8NA 2VDIA 2ATCB 1U1RA 1NB2A 2EVZA 5F3TA 3Q23A 1NSQA 4K4VA 3JQKA 3A3PB 1CULB 2FQQB 1IKWA 2WB4A 3NOCA 2J6TA 1T95A 4IQMA 4OYMA 1RYRA 2GA7A 3EGNA 5ETNA 5KOXA 3D0HE 3CIZA 2QMXA 2OAUA 3FGVA 3I9V9 2D74B 3LUYA 2WK4A 2Z57B 3C8YA 4ZK7M 5HQLA 4QCLA 5BR8F 3R5JB 3WQPA 5K8MA 4PAAA 3PYEA 3N0VA 3MDFA 2F4VJ 1KONA 2MPUA 1AZSA 5F9LA 2XLIA 1S1WA 1RQ0A 1S1UB 2Z56B 1AT1B 1U02A 5AXLA 3K59A 1Q8KA 1S1XA 2YWWA 2CWXA 1MW7A 5J2QA 4EBCA 3OR2B 4OJHA 1RGVA 5DQHA 2JFDA 4URQU 1AXQA 3SCLE 4MK7A 2XLJA 2LDIA 4PYDA 1FE0A 1RTIB 3CCVS 3MZIA 3DGPB 2DO4A 3M6WA 2UV8G 2AZ3A 4OFZA 3AJDA 3M9NB 1HNZJ 1FTCA 1TVRB 1UJ6A 3HT0A 3NMRA 1HWLA 4WIIA 4PG8A 4FPIA 4C6AA 1NAQA 3DU6A 4TLRA 2P5VA 2EFPA 4UZBA 2BE9B 4PPZA 4F4AA 3NBPA 3VV2B 4QR2A 1UCNA 4KGVB 2NYHA 1RT2B 1HBOB 1IKXA 5KG6A 4UQTA 3TA1A 4UT4A 2BACA 2FY1A 4X84A 3PM9A 2QE5A 3PFEA 4ZCKA 4RWWA 3PVXA 2UXCJ 5I4MA 4MYTA 4M5LA 4CYUB 2AGPA 2DNPA 3LQVA 3DMJB 1CC8A 2HBZB 2FJXA 2J8SA 1ZAWA 5KOWA 2PSZA 2VQEF 1E6YA 4DR4J 2Q43A 3V4IB 1VBKA 5IQQA 2OPRB 1V5VA 1UWAA 2Z0GA 4JUZA 2JDJA 2M88A 1S9FA 5L9NA 4CLKA 2J9DA 4P7VA 1RT4A 2RRBA 1WC3A 4A8QA 1R0CB 4Z2XA 1ZOTA 4JI7J 3MAAB 3N28A 4OI2A 2CQGA 3RBXA 1UJ5A 2G2YA 4C4WA 1O6XA 1VRUB 1RLCL 3IWNC 2CQIA 1SVDA 1VJQA 1M5HA 1DTTB 2KT5A 3BSAA 5JJBA 1VQSA 1B7FA 1RAFB 1ZZFA 3DYAA 2UUWA 1I51B 4KGZB 3BQ1A 1U09A 2YNFB 1UZDA 1H38A 3HFZB 4O44B 2IMOA 3QZ7A 3MEGB 4Y6IA 1HHTP 1LW2B 3NKYA 3A3NB 3EICA 3FBFA 1RT1B 2ADBA 2HNZB 4ALZA 4DV1J 1WI8A 1S1VA 4YHHF 2LEPA 2AEJA 5A8KB 2FGOA 4IFYA 1VCTA 4Q2LA 1QE1B 4DZ6A 1HD1A 4WP9A 1H2TZ 3M30B 3CMAS 1BD6A 2C2ZB 2YKOA 2OH2A 4Q8FA 2LU2A 3SYZA 4PR6A 5A8RB 2BRLA 1N48A 4YMEA 2XCAA 2HBQB 4USHA 3MR6A 1UP1A 2KKHA 2D41A 2ZH5A 2IAJA 2IHR1 2N3LA 3AD9C 4JYAJ 2R8GA 5JVHQ 2XBPA 4X64F 4RPFA 4ZJLA 2PFDA 3EXCX 4LFCF 1ZYQA 3CD0A 3OT9A 1T8EA 1RAJA 4J9LA 2DNHA 4XO0A 3BJYA 4YB5A 1FE4A 3D28A 2C42A 2VB6A 2YNGB 2MTLA 5ETVA 4LSLB 4HDHA 2QRRA 1A0OB 1SC6A 2BKOA 1U8SA 5KFTA 1Q16B 3KTQA 3PIOQ 1BQNA 1VBZA 3R7NB 2HNDA 2CDRB 4DV6J 2F9JA 4OYOA 3UFCX 8ATCB 3PG9A 4CH0S 2B4UA 3G6XA 1F3VA 2ZOMA 4WFBQ 4F0KA 4N76A 4MMOA 2B4OA 2K1RB 3UO0A 1UVNA 1NDPA 1T11A 2VC1A 2XMAA 1XWLA 2JFKA 4IDKA 2ZH3A 1X9SA 2NUHA 4ICLB 3DRYA 3UR3C 1YBTA 4O3OA 4ECYA 2HIYA 2CQHA 1F0XA 2HVEA 1U1MA 2J7WA 2EWHA 1QJHA 5KFXA 3PKYA 3TR5A 4LF9J 2V8GA 1S9EA 2R7SA 2L3MA 2QFIA 4X4UA 1TL7A 4U7CA 1IKVA 3EPGA 4OYAA 1ZAVA 4I0WA 4F4KA 2YY3A 1ZM4A 4DL4A 2DK2A 3H90A 4V1Ak 2PA8D 3HVTB 5HP1B 2AKWB 2BOPA 4KPCA 5DS7A 1HNVB 2UXCF 2HHTA 1S76D 1FFSB 2HVZA 1FRHA 5M2UA 3AD7C 3DRPB 4DL2A 4PKDB 4CLLA 4F0HA 3MMCB 4TVAB 3RJMB 2GVZB 2DR9A 2H3EB 5H9FJ 1QAXA 2W2QP 3I31A 1XBWA 2V6AA 3RGIA 1RBAA 5MLCV 1RTJB 2B6AA 4Q0BB 4B3SJ 4FVCA 1UJ4A 3IA0A 1WUUA 1XC9A 2YKMB 5RUBA 2E5GA 3M8RA 1BMQB 5KT2A 4W98A 2FZCB 2DEIA 1S1UA 3PR4A 3LH2S 3OR1A 2IRXA 2DCUB 3NAIA 1MMNA 4RO0A 1LEOA 1LW0B 2ZITA 2I5JB 2WW8A 3CJRA 4G3IA 3GJSB 1EB0A 4RWXA 4AXIA 3HVWA 2GGPA 1FDNA 1GT8A 2KO1A 2UUBF 4OI1A 2OMOA 2OPSA 2LEAA 5D3GA 3OTDA 2IC3A 4TU8A 2HHXA 1YDLA 4TQRA 2ATLA 3LAKA 1RTDB 2ZC4A 3ET6A 4QPXA 5DG9A 2J9EA 2CVEA 2DH7A 2QA4G 3ILOA 1FX2A 2E7WA 4PCQA 1DFDA 3HVAA 3G2XA 2R2RA 1VGYA 2KB2A 3TX0A 5ITHA 2DNGA 2MJNA 3WIVA 4YB7A 1J27A 1FD8A 2KFNA 2V67A 2R7QA 3TJ9A 1F5AA 2UXDF 5LM7E 4CLTA 4WTOB 4OHYA 1RT2A 2I8EA 2ADCA 1HWJA 4FYVB 3ETMA 3MEEB 2RF2B 4N5SA 2HQDA 4CO4A 1FVSA 3P6YC 2VPZB 1P9YA 4UTGA 3K2YA 4CNZA 4JI1J 4K4XA 2PMHA 1ZZNA 3D5MA 2AZ1A 4JI2F 5KFIA 1TAUA 1HQEA 4ANEA 3S7RA 1OSCA 2X51A 5K14A 1SKSA 2Z8QA 1YWXA 4A8SA 3CD6S 3D7SB 4GVLA 4QPTA 2BJ7A 5HMXA 4DSLA 2YPYA 2AJFE 3U02A 1N33F 5IV3A 1GTHA 2KI2A 1H7WA 4PUOA 3TVKA 5L1LA 1CS4B 4WK3A 2KHDA 3MR5A 2EK1A 3GSDA 1CJKA 2Q1LA 4LF8J 5AXKA 2OIHA 2BX6A 3SEOA 2KFYA 3KK3A 2B51A 1N36F 2JX2A 3UDLA 3MM5B 3R7SB 4O4GB 3W9JA 1OS5A 1X5SA 1CJVA 1FXRA 4NLYA 3W2WA 2W9BB 2VBZA 2YKNB 3P4UB 5ETRA 4RNFA 1BWEA 3QIPB 2KRBA 1TFYA 4G65A 3MXHP 3JYTA 4LF5F 1V3ZA 1JXEA 5FLXY 2QEXS 4W92B 2SXLA 4A8KA 1VQYA 5D4OA 2O66A 3TZYA 3W2VB 3T3FA 1LW2A 4X4PA 2WONB 2QLWA 1CQMA 4URGA 4FXDA 4A8FA 4QYZK 1JQGA 2L41A 4HHUA 1RTHA 4Q2MA 2QZ8A 5MAOA 5F8LA 3AXKA 2LP4A 3ZTRA 3QLHA 4WWSA 2OSQA 3G9CA 2YKAA 4YR0A 1D9AA 1SKRA 2JEFA 3BH7B 3T6BA 1RUSA 4UY8T 3SQOP 1TELA 2PFFB 5KFLA 1RWNB 3VWSA 3A8IA 1H3DA 3R1LA 4JI4F 2FC9A 1U1OA 3KXDA 1SCJB 3PW2A 2LXUA 4DQIA 2ZEJA 3KUHA 1HNWJ 5A8RA 1LWEB 3DLBA 3R5DA 2PIIA 3X1LB 5GAEU 2PMWA 4OYIA 5B09A 1X60A 3QJJA 1WOOA 3V6HA 1HNIB 3RW6A 3ZZZA 4DV7F 3RW7A 4LIRA 2POKA 2GCFA 1HBUA 2WVCA 1IQZA 2KN4A 3NCRA 1VLYA 2KVIA 4DU7A 2V2KA 7FD1A 3ZNUA 1S6UA 2UUAJ 3LAMA 3Q22A 3TUPA 2RD5C 2D69A 1KWMA 4NLWA 5IXUA 3HI9A 2ALZA 2U1AA 5F0UA 1MWQA 1SV5B 4OHZA 2BJ8A 4AQYJ 3IBWA 2J7KA 5DZ6A 2N7CA 3ZC4A 3BDEA 4YR3A 2NUUG 4DG1B 4NCAA 2MZJA 3R97A 4X4TA 4DR7J 2P9EA 2R7XA 1C0TA 3MM9B 3J81Y 1S6PA 2M7SA 3I0RA 2IY5B 1TUVA 4MH8A 4C8KA 1AYEA 1S49A 1UEKA 4ELUA 4ICLA 1GK8A 2PGCA 3KJQB 3KJFB 3Q83A 1HQUA 2ZOGA 3VTIA 2B43A 2ZJQQ 4O3QA 3UDEA 3CWJA 4ILMA 1H0HB 4WFXA 4DF4A 3DLGB 3CMQA 2FD2A 5IWAJ 3EZ5A 1XERA 4CP5A 5CYMB 3C46A 3KMQA 3EE3A 1T03A 2HK2A 2ALYB 2ZH2A 3Q8VA 1S4FA 4NLVA 4IH7A 1KLMB 4I4BA 4KAIA 5D8HB 4P71A 3SDEB 2C22A 4P52A 3MTJA 1HNVA 1KFSA 5HL7Q 5DQIA 3KK1A 4DMZA 3EGWB 1DZ5A 4DCOB 2AT1B 3HT3A 4ECVA 3FCWA 4NXMJ 1SQFA 2VBYA 3TZZA 4H4OB 1KVKA 2DO0A 2YNHB 3MMAA 1BWVA 1SJ4P 3UI3A 3JQMA 3A8JA 2CQDA 2HFUA 4RUBA 4DF8A 2CJQA 1FVQA 2AMCB 2ZH6A 4PABA 2GIQA 1GX6A 2E9TA 1A6LA 1LWFA 4LF8F 1NK5A 1DY3A 1NSAA 3NS6A 2BZ2A 3HSJA 3LP1B 4ZP9A 3HHDA 4WFYA 1QUPA 2LQJA 3VZIA 4Y2IA 2R2TA 3K5PA 5D0HA 1NKCA 1SJ3P 1ELOA 2JSXA 4TYBA 4TU9A 2DRBA 4CZCA 3ZZYA 3AXMA 3NMAA 2MZQA 3CNQP 1ZBTA 3IG1B 3G8TA 3LALA 2I6WA 3BZQA 4BC7A 5JMNA 3PZPA 2CZ9A 1L3KA 3TEGA 4BWMA 1X4HA 3D9BA 3D1HA 3VF0B 4Z7YA 1B3TA 2XY5A 4FKXA 1RAOA 5KTQA 1IKYA 4KH0B 1KC8T 2HQFA 4JV5F 2YPZA 5CHCB 1LK5A 3M2RB 2LU1A 3M8PB 2AYGA 2KM8B 4DL6A 2W4CA 4ZVSB 2VKZG 1AW0A 1M5KC 4MT1A 1NNDA 1HYSA 3F41A 3ZTPA 1U2FA 4ED3A 2OTJS 3QRRA 3OL9A 4X4SA 3H59A 4ECXA 4LF4J 2DB1A 3US5A 1DTQB 1CC7A 4WK1A 2BJ9A 1X0FA 4B9NA 4FXVA 3HHLA 4CLFA 4LRAA 1U1NA 1TUWA 1WF0A 2CPFA 1KQFB 3FBCA 4DXLA 1R8AA 3AB4B 2L9WA 4JI6J 4NLRA 4K5SA 2XEXA 2XC9A 3W61A 5H9EJ 4M5KA 1RI7A 2KHCA 1S59A 2EBGA 3B54A 3OXFA 3UW1A 2UUAF 1WC6A 3TVZA 1BGXT 2DYAA 1F1BB 3LWMA 3QBCA 4NI2B 3EVOA 4JBCA 2DH8A 5KFEA 3RBDA 2QMUB 4CO3A 3RAXA 1P27B 3HCXA 2UXBJ 1K0TA 2R4FA 3FRZA 2KYZA 3GIIA 5HVFA 2H5JB 4PG4A 5BJRA 1HIYA 3IRWP 2D3O1 3VQSA 3FQKA 4G1IA 5T7LA 4D3GA 3BBFA 2CQPA 3C6TB 3KK2B 3IGNA 1Y11A 1R8CA 4ED0A 3RRKA 4FS2A 2V68A 4USIA 2NQPA 3M2UA 1KFDA 2YVSA 3QIPA 4OZLA 3ZTQA 3IR7B 4C8LA 2GQCA 3KLEB 2YXLA 4EU0A 1EAYC 4F36A 4DFKA 3D2WA 2B8QA 4YDXA 2XO6A 1S9GA 3WDOA 1S1TB 3SMZA 4RKUC 1Y7PA 4NCGB 2Y0BB 5A76A 2KM8C 1NK9A 5IWAF 4E2FB 5F8GA 1TV6A 4YY3F 1UEUA 3LWLA 1NSKL 1DRZA 2BEFA 2G0CA 1ZM3A 3H2UB 3CSKA 2FZKB 1YBAA 3OBIA 2DGVA 4CO1A 3B6BA 2KFZA 3GONA 2C28A 5D4PA 1R0AB 1JLCB 1Y10A 2LLZA 2CVIA 3OFHA 3IWXA 2Q6CA 1M90T 1Q5YA 3A4TA 3OTBA 4FYWB 4J7CA 1WEYA 4WE1B 2DGSA 2EI5A 3ETOA 3BSOA 2DGWA 1PJ6A 3BR9A 4EUVA 5E3CA 3ULHA 2HFOA 4NZ0A 5GMKa 5E3AA 3CO9A 3HPOA 3TJAA 4C8YA 2QX0A 2MQNA 1Y00A 1W2BR 1WSVA 2YWFA 4KKOB 1CJTA 3RB3A 5DG8A 1HBNA 4GVBB 4O23A 3M6XA 1WEZA 4KO0B 1TKTB 2NPFA 4LIWA 5D4LA 5KG1A 2MZ1A 2IBOA 1FKOA 4RW8A 5IS2A 3E01A 4J9NA 4F7VA 4M8LA 3H2LA 3CJQA 4NZ6A 4K50A 1OJ4A 1X7VA 2VQFJ 1RISA 4M5DA 4QIGA 3OLBA 1EETA 1N6QA 2LQ9A 2B7BB 3UD4P 3FDSA 3DLLQ 4W90B 3UDVA 4LREA 1F60B 5E33A 1FRKA 1N5QA 2BJEA 1IBLF 3NCPA 4RW6A 2VIHA 2RHSB 3SQGA 2M70A 1VJWA 4TYAA 1SB6A 4RJVA 2BOAA 2ZH4A 4WKRA 1SIWB 3EDRB 5C25B 3QGGA 3DOMA 5EDWA 2EFVA 2XHWA 3NWRA 3MR7A 2CDQA 4DEZA 4NLQA 3EGZA 1RB0A 5EN1A 2ZHAA 2GHPA 2ZUAA 3RUBL 4H4OA 2DH9A 3M8WA 4DFPA 1K44A 3VVTA 2R2UA 3CB4A 1WG4A 2OFGX 3F73A 4M94A 4KY3A 4WFNQ 2AW0A 1CVJA 2VFSA 4DCPB 1JJCB 4O3NA 1YVFA 4CLYA 4DV4J 3P5BP 4FZVA 3S1TA 4IFVB 4MYUA 4NLPA 4NA1A 1Y4ZB 3L09A 1NEEA 2PI5A 3PO4A 4OL8A 1RHUB 2D9OA 1RHJB 4ECUA 1I94J 3UNYA 3QJLA 5F0WA 2OHDA 2CQ2A 1XMQF 1VR6A 1IM4A 5L1JA 5B0GA 4DUZF 2VDHA 4J9VA 5LJ5Y 2VV5A 2KZMA 3P3DA 1VRQC 3AD8C 2IM3A 3RAMA 2MGZB 5A8WA 2ROEA 2J5AA 2RNEA 1Y3KA 2GJ2A 5AE1A 1LNQA 3SI8A 2BANA 3NAHA 4HACA 3IM9A 3N6NA 4JI3J 1Q95G 4ZCMA 1VQNS 1VQ9S 3M8PA 3IR5B 1K0VA 4FYYB 2R7TA 3E3XA 1RT5A 1T02A 1ZM2A 2VPWB 3ZZRA 1QDUB 2VC0A 1UFKA 1UKUA 2VH7A 3RRHA 1TL3A 2ZUGA 3LP0B 4DSJA 3S8SA 1HMVA 4ZLLA 4AFFA 1U6BA 2RS2A 3CVKA 1BY9A 2V4QA 4KTQA 4B02A 1N32J 5E2QA 4KV8B 4LSNA 4DL5A 1BUXA 4WXOA 2CG4A 3C19A 2MYFA 1RT7B 3W9IA 4C11B 2VJVA 3LW5C 2X7IA 1VRTA 5EHHA 1IQTA 1Y0HA 2QN6B 1QLNA 1B0TA 4V19J 1RZMA 1XNQJ 1DJ0A 4NLDA 2OI2A 3MGJA 4RW7B 2YWGA 4B3RF 2J0XA 1OMSA 1JLQB 5ETTA 2ZH8A 3FJ2A 2EFNA 1FCAA 1X8DA 4NI2A 1AUSL 2A10A 1FWLA 1VQ7S 1KRPA 3OFEA 2ILYA 1QUVA 2RDDA 4YDDB 2FLLA 3R2CJ 1VC0A 1OIAA 3N6MA 4OHWA 2HVHA 3IXQA 4OIXA 1X4AA 1HD0A 3HMJG 3HP6A 1T05B 3OVSA 1DURA 3NCQA 1BQMA 1TKXA 5HLFA 1OPIA 3EJMA 4PWDB 3KJVB 1MROA 3FSXA 2VQFF 1KHWA 5HI7A 5KFSA 4HR2A 1KN6A 1IBMF 2V2QA 2Y1RI 5D6GA 3KLEA 3FK4A 2QSFA 4PZVA 2FHKA 4NOHA 1EP4A 4ZVFA 3RU0A 4EYHB 1X31C 2D9PA 4OZ0A 1NU4A 1YGYA 2BM0A 1CEZA 5FIIA 3W8PA 2H48B 2QL7B 2F65A 2J0WA 2E1CA 3OXGA 1KDNA 1CLFA 4DZDA 2BVZA 4OZ5A 1C1BB 1OQ3A 4OHVA 3BYPA 4IRDA 4Y0FA 4UOHA 3DI6B 2GS8A 4FNIA 3GYGA 4ED6A 4RNNA 2OD4A 4Y2KA 4PQUB 1U0HA 3NS5A 1KS2A 1Q86T 1RCXB 1PBAA 1IUJA 1CBKA 4NLTA 2QA4S 2MDAA 4F3QA 2KDOA 5SUHA 3CJKB 3ITHB 1GXTA 1C0UA 3BSNA 4ECQA 3MF5A 4DV4F 2UVWA 3C16A 5KG7A 4IG0A 1VISA 3UQSA 3DLKB 2HVIA 3MD1A 3BGRA 1KVJA 4MJKA 4DV2J 2KG1A 2DNYA 2KU7A 3F44A 1I94F 2DNOA 3K8WA 1XMOJ 4DN0A 1JJHA 1JLGA 4PG7A 3KKFA 2OP5A 4G1QA 1RHKB 4DL3A 3G6ES 1RT6B 2PT0A 3Q8PB 3S01A 3Q89A 3PR5B 1RWUA 3LANA 4O3PA 4OI0A 3AHPA 2E5LF 3SCIE 3K8VA 1RT3A 4ZITA 1HNXF 2XULA 4ZIVA 3DDKA 5K8PA 2W9CA 1REVA 2XG8A 1S5ZA 1WKJA 2WVFA 1M0SA 4HTIA 5CQGA 2ZFHA 3N6LA 4LR7A 2DIVA 2EKYA 4TY8B 2MMYA 2E1RA 1RK8A 4PG6A 3HSDA 4BCAA 2C2KB 1B70B 1PC5A 1Q8LA 5FLXU 1TKDA 4OYPA 2ZE2B 2DHHA 3I32A 1RKJA 4BHQA 1N32F 2X1BA 3FCHA 1UVLA 1YRXA 4R5PA 3C15B 4ECSA 2KT3A 1TMJA 1ZTWA 4TQSA 1YJTA 5C25A 4GO7X 3MCOA 1N54B 2OFHX 3HVRA 4C8ZA 2XGPA 4K0KJ 4DV0J 1RE1B 4HKQA 4N77A 2CXEA 4BLGA 3PY8A 4RW9B 2QSWA 2HLUA 2W25A 2V4JA 4PQAA 2WRMA 5LXRA 3T1HJ 5LL6d 2FVPA 4UQGA 1HHSA 1QAIA 2J76E 2Y3YA 2GMJA 3DM2B 1M5OC 3GR0A 2HGLA 5KFOA 3SSRA 1VQ6S 1UZHA 1U1PA 2E9ZA 2D7SA 5KG5A 4HL9A 3J80Y 2C2OB 1H7XA 3QT8A 2MB0B 5HROB 1NCLA 2O1PA 2CJKA 4X4OA 4U96A 2CWKA 4AT1B 4OX8A 2CRLA 4F0MA 3H98A 4RUHA 2ZJRQ 2K8GA 2DHGA 2WVEA 5KFPA 3LOUA 1IR0A 5J2PA 4F02A 1SQGA 3N5FA 1WJ9A 2G0IA 1WHYA 4DV5F 1KEKA 3H5SA 2XSJB 4I56A 1I1GA 1FD2A 3KG1A 1UA0A 2VG7B 1BC6A 3LP2A 3GE9A 4Y2MA 2FVSA 4BBYA 4ZVQB 2OUGA 3ONQA 2ZOFA 2HYIB 1SKUB 4RBTA 1RWWB 1HBMB 3J81U 2RRAA 3HDSA 1LXNA 3JSRA 3OFFA 3G4SS 2Y8YA 2WTFA 4L72B 1TR0A 3FCVA 1SH3A 4C8OA 3MCMA 4P73A 1NHKL 4CT8A 2FJDB 1N0UA 4QYRA 3BQ0A 3CC7S 5I3PA 2V34A 3ZTOA 3QYYA 2HVDA 4FBUA 2ILZA 3KUGA 1TKZB 1K9MT 2IDEA 1DAXA 1DQAA 3KLHB 4CTAB 1FNMA 4C11A 3VCDA 1F5BA 1FEHA 1Q1KA 1VQMS 2QO3A 2ZDOA 2ACMA 4KSEB 3K0JA 4YB6A 5B0DA 4NLUA 1J5OA 2EFOA 2ZZMA 4FXWA 4K4SA 5HK4A 4NEZA 1VQOS 4DV3J 3UPFA 1JLQA 1SL1A 1R43A 3TA2A 1KBRA 2VD3A 3JAMY 4ZP8A 2XCPA 5J1EB 3PW0A 1JXLA 3I0SB 3PYFA 1M1GA 2BMBA 4IUFA 1KQGB 1LWXA 3GV7B 1XEZA 2WSEC 2HNYA 2FHJA 2F4FA 2JLEA 3CE8A 2M52A 1HWUA 2V69A 5KFKA 2D3UA 5F8NA 3OUYB 2P9GA 2BR0A 2Q79A 2GC8A 4M95A 3L9ZA 2UUTA 4WXWA 1R31A 2JNJA 2BA9A 4J90A 2Z4PA 3DRXA 3MEKA 2R8HA 3D6MB 2E1MC 3TUJC 1G4CA 1UA1A 2VBWA 2HG4A 3MEDB 3M1VA 5E3PA 2DCLA 2XQCA 1P9QC 1XN9A 1ZS6A 2HFSA 3JSMA 1EHWA 3PW7A 4DFJA 1N5VA 3IS9A 3R6LB 3NOGA 2BE2A 2WW4A 5CAAA 1KTVA 1FRIA 3CMES 5FD1A 1OWXA 1BHNA 2ZBQA 4KGXB 2ZD1B 5HQ8A 4ZVUB 3OSNA 3MFIA 1XR7A 2W2PP 3AB2B 3Q8SB 3CJ5A 3THPA 3IN5A 5GAGI 5GAHU 2FJEB 1TL1A 2BV3A 4DR2J 3K58A 4OYZA 3IRXB 1KD1T 1WF2A 3DGVA 4X62J 2X3DA 3QGIA 3FEZA 4BDPA 4QU7A 3C14B 4OLPA 4XDDA 4RU9A 3H40A 1FKPB 4USVA 1NMEB 3KLIB 5DJBA 1HI1A 4UZCA 4KPYA 2H4WB 3SV4A 5FDLA 4LRCA 1WI6A 4AD6A 2VG6A 1S99A 1UWBB 3PFOA 1HARA 3CEDA 2HQIA 4DUYF 1X4EA 4IR1A 1O8BA 3BKUA 1EX8A 4ES3A 5D78A 3GR1A 4IG3B 5CYQB 3J7YI 3GJTB 4EZ9A 5DDQC 3O1LA 1Q78A 2E5HA 3GG1A 2B56A 1VFJA 2MQMA 3VGVA 1DHMA 3KLFB 4WU3A 3GPAA 4H4MB 2MQQA 1QVFR 3PX0A 3SBMA 4LFBJ 5E3QA 3T9ZA 4AXJA 3C6UB 4Z37A 2M5YA 4ZP6A 3MOJB 2VPYB 3W9HA 5KAKA 3ISZA 4K7QA 3EDQB 4A8OA 3HHLD 4Y2AA 3PX4A 2KT2A 1IWAA 1HA1A 2HKEA 3TZWA 3QT7A 2VL1A 5HN0A 5ETQA 3KNGA 2V8PA 2Z58B 3UD5A 3TX8A 1X9MA 4WP3A 1SL0A 2ACYA 2BXJA 2KYXA 2OPPA 2AGOA 2QTWA 2HS3A 1YRUA 2YX1A 3G6VA 3VAIA 4DR6F 4M5GA 5KFZA 4WPAA 2IVFB 4KRWA 3UN5A 3QSYB 2XSFA 4USWA 2U2FA 2LQ8A 1FDDA 3NNHA 4IO1A 3D6TB 1SJFA 3FQLA 1FX4A 3HHNB 3KLGA 4ECZA 4HT5A 3GWCA 2UUCF 2FDNA 2J0QD 1HPZA 4OZ1A 4L76A 3GILA 3QO9A 3M8QA 3ZZOA 4RW4B 3UCUP 4PWUA 4EZ6A 4RX6A 4A47A 4K8RA 3D68A 1SXLA 3UVJA 4USJC 3OFGA 5DM7Q 5LSRA 1RKIA 4EO6A 2CJXB 4ZPTR 2VZ9A 3PACA 3M32B 1FKAF 1N4LA 1U2RA 4DDFA 4MAKA 4NEYA 3ADAC 1M1KT 3DCAA 3HHEA 2FJAB 3W64A 4TN2A 3MCSA 3KMSA 3TP2A 1FRJA 3VGTA 1N5YB 1W26A 1JLEA 3DRSA 2MJUA 3P45B 1WDTA 3V81B 2OEJA 2R7RA 2VKRA 1HBMA 3U27A 4CO0A 4UOGA 4UF4A 3IWLA 4JV1A 3CO0P 3U1NA 1FK9B 4X64J 1T94A 2XHCA 1UMJA 1BLUA 1RDRA 3CDEA 5KFMA 4LFCJ 2EC0A 2ZH1A 3UR0A 3CT9A 2BW2A 2BW7A 1MLAA 4LQ9A 5EX0A 1JKHB 1R27B 2PDAA 1RP5A 4ZPDA 5J2NB 2QA2A 2NLWA 1I3OB 2MKHA 2R7VA 1WSRA 4AL6A 4N56A 3POTB 4ZIWA 3DN9A 4B08A 2HMIA 1ZAXA 4DR2F 1S57A 3MPUB 1R8HA 5U47A 4X62F 5SZTA 3BR8A 3JB9k 1RWVB 4KR0B 3QQCD 1Q5VA 3V6DA 3BM7A 3L3CA 1JLFB 3ENAA 4I7FB 1V3RA 1QVGR 1X5OA 2JC0A 3FSYA 4C3LA 4EMDA 3HD2A 4LT6A 4IKAA 5K5MA 2QIFA 3ISND 4LFAF 2ZNZA 2VG5A 2UVUA 4KHPF 3I0SA 3EXYA 5IV4A 5IM0A 4B3OA 2DXEA 2MKYA 5J2MA 2G1HA 2CPYA 5C24A 3TNVA 1L3SA 3CCES 1U0SA 3KNAA 5GMEA 2W7OA 1QTMA 4MFBA 2PA3A 3OUYA 3CIMA 2H5IB 3SSQA 1S6QB 2JEJA 1E6VB 4I2QB 5B0AA 4ANDA 5HBMB 4M63A 1SUQA 2LEBA 3V2UC 3Q8RB 2KL8A 4ZVGA 1ITPA 1FHTA 2CYYA 3PHTA 1NJIT 4LFBF 1RU2A 1YQHA 1NJYA 1SJQA 2CNLB 3MEDA 1F2HA 2HAIA 3CPWR 4J9UE 2RDJA 4DSKA 2H4YB 3I5BA 4KFBA 1VC5A 3S6EA 3UD3P 2UU9F 4JV2A 2ZKUA 5G4DA 2V2ZA 5L38A 2Y9HA 2R8IA 3M8YA 1VIOA 1S6OA 3MURP 4ZHRA 4DUTA 3FFIB 1HWKA 2W9AA 1YSJA 2QLXA 2FHMA 4P9SA 5I3UA 4WYWA 2XO7A 3DRRA 1T7PA 3RRGA 5L46A 3WIUA 1XIQA 1NKBA 2LECA 1KQSR 2ZHBA 3GP9A 2KVQE 3HZEA 1CG2A 2F3JA 1N56A 1NM2A 3GLJA 5ETMA 4I67A 1QTNB 4ID5A 1ZPVA 2ASDA 3TAMA 2YQ3A 2DNMA 2UUBJ 4NA3A 1MN9A 2R8JA 1X5TA 4UY85 3C14A 2JL9A 2D3ZA 4I6AA 5GADI 2CPIA 4DFMA 4F4YA 3H5YA 1TK8A 2G13A 2VU5A 4FNHA 4PXEA 3KLIA 4U8VA 3HLUA 3W5YA 2EFQA 4M1KA 5M2RA 4ZLJA 4K2XA 1GXUA 2K7JA 1MU2B 3DOLA 2XM3A 3O44A 5A0YB 3OTOJ 2MKIA 1RADB 4OX9F 4XIUA 3AOBA 1WNEA 5G0RB 2H51B 2C3MA 2CQ1A 2NPIA 2UXDJ 2WOMB 2N3OA 3ZZTA 1VBXA 4DX5A 2JJ4D 2CPDA 3HZGA 1RXOB 2BUNA 4ZN3A 4GC6A 2RS8A 1PBUA 3NGTA 1M5SA 2MZTA 4YB1P 2HFNA 3NGKA 3MM6B 2RHQB 4EI2A 3MM7A 3DXBA 3UNGC 4L74A 5CXTA 3M9MB 4JI2J 2QFJA 2HRTA 4EEYA 1CJUA 3FZ2A 2LVWA 3QFHA 1RBOB 5HQMA 3V5RA 1ZM9A 4A8WA 1HFEL 1N33J 3D66A 4IRKA 4HEA9 5AJ3F 2H54B 3KDOA 4F04B 2Z30B 1WHXA 2RKIB 1NLKL 1FNOA 3QWUA 3VGSA 5C42A 4LQ3A 2E5IA 1EZZB 4D3HA 3DOKB 2GVDA 5EX3A 2DXDA 2DY1A 2G1DA 3QJPA 1N36J 1U24A 3M2VB 5ETKA 3TYTA 2ZKTA 2J0SD 1CQNA 2EG2A 2QLBB 2GX8A 3MM8B 1NUEA 3IMQJ 1WG5A 3QNWB 3OJSA 1JLBB 3Q8UA 2RSQA 3MD3A 3B82A 3FBBA 3MPVA 3BO4A 3X3UA 2DKOB 1HI8A 2HHHF 4K59A 1FO1A 4RW4A 4LF5J 1RLDA 1S77D 1VDHA 3LGMA 3EYZA 2IMWP 1Q0NA 1AB8A 2NS1B 3H5XA 2RH3A 4R8UA 1H98A 2XTJP 1DLOA 2V63A 2EKNA 4ZVPB 1YJ7A 2P6SA 3M32A 2HQ3A 4N47A 1FJGF 3ELHA 5M2PA 5IT4A 1X5PA 1YI2S 2WSFC 4E98A 4B17A 3FEXB 1CPZA 4ZPCA 1V5IB 1B0PA 4JI4J 2HWTA 1WOSA 3H4DA 2KJWA 1CULA 3IFEA 5HVGA 2HQGA 2IVYA 1JWWA 1NK6A 1NJWA 2YBVA 4NRUA 4WYLA 2NZCA 3G71S 4ZCLA 4P74A 2QL5B 3EVMA 3K5MA 4X4RA 1FK9A 2V5HG 1M1HA 2HWIA 3GFHA 4DV7J 2JWNA 2CQ4A 2YWEA 2DJWA 2W4PA 5LSOA 1IKWB 1UPMB 1O51A 2DBBA 2IJRA 2ZVIA 3IR6B 1QSYA 1PAEX 4K5RA 1TP7A 4ZA1A 4CWBA 3TANA 1YITS 2Z2YB 4OX6A 3HHKA 1FXLA 5GVQA 3OR2A 1AZSB 4DQRA 1S1WB 4DPUA 3HFVA 3SIPB 4RL1A 3H8YA 5LJ3Y 4QR0A 1VS3A 5KT5A 2MHNA 4DLGA 2RVJA 4Y00A 1S1XB 5D0GA 4PYAA 1RTIA 3UN2A 1NHUA 4KB7A 5J2QB 4Y65A 3UCZP 1U1QA 1G6BA 3DGPA 1L3VA 2H9ZA 4S0MA 3AA8A 2DVIA 5ETLA 5IFMA 3LPEA 3DLHA 3JTPA 5LSLA 4ID8A 3TQ1A 1LOUA 3TQEA 1TVRA 3OD2A 2FC8A 2LQBA 4YR2A 5J1PA 2DT9A 1X4CA 5KFJA 3J80U 1DBDA 4C2MA 3CJTA 3OTOF 1YTYA 1Z4UA 3QSIA 2FIUA 2M3DA 2QLFB 1SPBP 2YX4A 3CW2C 3ZNJ1 1PG5B 1S48A 1HBOA 3NP5A 1K8AT 5DZ7A 4LRBA 4CRJA 1P1TA 1HHQA 1HL6A 3CDAA 1WHVA 3D1OA 3K89A 4YUDA 3W7BA 3HSZA 3A8KA 3MPDA 4FPRA 3NBPB 4FS1A 1H6KX 3WC2A 2OEKA 2IM2A 2C1EB 2J6SA 4CYUA 2UZAA 3DMJA 2RE1A 1IKXB 2ZC3A 5F8HA 2FYXA 4KE5A 2GJFA 3WX4A 4IR9A 1Y9OA 4CQ1A 2PC6A 2B9EA 3V4IA 2JEIA 3MMJA 2OPRA 3PDNA 2YWHA 1UW9A 4L3KA 1YZ7A 3BKTA 5CCMA 2I9SA 2EFGA 3FFIA 3DHWC 3QPIA 4EBDA 1AROP 5IQ6A 1RAAB 5LMNF 2FVQA 1E6YB 1T9TA 2XMJA 4EBEA 4FYXB 4P7TA 2DNZA 1B99A 1TUGB 1JNZB 2QMWA 3OPKA 5A2QY 2IRUA 2PEHA 3MAAA 3TZXA 1S12A 4DPOA 3CCRS 4GKJJ 5A6PA 3RTVA 1P6TA 3P5TL 3R7BB 2MKKA 1NKEA 3HULA 2L9DA 1VRUA 4OV6A 4EGLA 5EWFA 1RT4B 2JHEA 3OL7A 3GSIA 3GV8B 5FJ4A 1DTTA 2HBYB 5BYSA 1RWKB 2KG0A 3VGUA 3MTKA 4F3OA 2VFVA 2GMHA 4DN9A 2LKZA 2RRNA 3JTOA 4DPXA 2YNFA 4X2BA 4GO5X 3T9NA 5IC4B 4O44A 3MEGA 5H9FK 5L1KA 4JV5J 3VR1A 1WTBA 1RT1A 2HNZA 3HSGA 1OY8A 4AL5A 3DYAB 3A8EA 4QZVB 4IOAQ 4F4ZA 2GO8A 5KT4A 2R9LA 3R5CA 5A8KA 4W4MA 2RU9A 2XWYA 5A0YA 1QE1A 5IT0A 1NPRA 1QSLA 3QFWA 2BJDA 4ENOA 1J5EJ 1SIZA 4DR5F 2JVRA 4LF6F 1S1VB 2GQ2A 3M30A 4IFYB 2W1BA 4WJBA 4CNYA 4EK2A 2LA4A 4LUBA 1FERA 4JI0F 1NK4A 3NG8A 3LF0A 4B9TA 2WHOA 4OYBA 2XMUA 1GEHA 1FFGB 5B0CA 2W7PA 2GO9A 2ZJPQ 3HM9A 2IAJB 3DC2A 2XB2D 3T1AA 2YNGA 4HH1A 4DSFA 4LSLA 2FLOA 3U7JA 4QIFA 1FT8A 3VQTA 2BRKA 1I6JA 2N4CA 4DX7A 1GX5A 3LO3A 4ATNA 3MI7X 4WFZA 4L6V3 3O6QA 1U1KA 2MQ8A 2ZVSA 1FRLA 2QJ3A 1WEXA 1G3OA 1MWYA 3OVAA 1YJWS 5GMDA 3RAQA 1U45A 4NLSA 2HNDB 1NPPA 1NJZA 1NBEB 2B4VA 3KFWX 3W8GA 3HKZD 2QGFB 3HJVA 1JLBA 4QBUA 2K1RA 4QOTA 4X4NA 3CUNA 2OLWA 3OSPA 3OVBA 5ETOA 4QIVA 1AUDA 2V0NA 2YTCA 4OZNA 3ZFVA 2QLJB 4JI5F 2IM1A 1R6VA 1EKRA 1FRMA 4UOFA 1VQKS 4AUKA 2V8VA 2WVDA 4IDKB 1JB0C 3TO8A 2ZBRA 3GYNA 4UW2A 2I1RA 4ZVEA 2BM1A 3RR8A 4Q45A 1URNA 2X1GA 2J7UA 1RJJA 3MFHA 2WSCC 3O8WA 5BYRA 4YY3J 5KG2A 2DHSA 4GKKJ 5DDPC 3P96A 1S9EB 2HRUA 3HVTA 3RB0A 5HP1A 1TL7B 2EK6A 1VHIA 4U7UK 4DR1F 2CIMA 2HGMA 1S7HA 2HFZA 2LYVA 3MMBB 2GNKA 3BB5A 3DRPA 5HMWA 5KFDA 4X4QA 3MMCA 3PIPQ 2ZZNA 1G1XA 2A0FB 2W01A 2Y1JA 2GVZA 2RQ4A 4CO5A 4FF4A 1RTJA 5AXMA 4MIBA 4Q0BA 5IC6B 1RTZA 3FUYA 4PPDA 4OJGA 2YKMA 3NEKA 1WELA 3CD7A 1YJ9S 2HHPA 2N82B 1S0MA 5IT9Y 3EVWA 4NCBA 2B8PA 2DD8S 3MCNA 5KFFA 2B6AB 2W24A 1FA0A 2MSTA 2H1YA 4R0EA 1LW0A 1S0NA 3D67A 3L7PA 3KHHA 4GKJF 4KJIA 3JTNA 1RYSA 2XMWA 2I5JA 1MNEA 3QRQA 1Q82T 1HW8A 2HHQA 5CD4H 3TUZC 4ED5A 4MK8A 3OR1B 1H73A 3SCJE 3CJ3A 2ROPA 1JIHA 4PEOA 4X65J 2FY8A 2I0XA 2LFVA 3JQJA 4RNMA 3KG4A 1RTDA 1Q4RA 2COLA 2GV1A 2QA1A 2GGPB 2XZDB 2OPSB 4K2JA 2HAFA 2KH9A 5BXIA 5D3GB 2IC3B 1JNRB 2XMMA 4O0NA 3K5OA 4NXNJ 3ET6B 3H4BA 1AFIA 2XGQA 2QL9B 1J5EF 2B9XA 3KHGA 1IBLJ 3ZZPA 1RHRB 4K4UA 2JVOA 2J6UA 4ZOSA 2ZH7A 3MEEA 2RF2A 2DHXA 4V19X 5F8JA 2APOA 3PCOB 1IWGA 4F26A 4B9SA 1WC0A 3BH6B 1NHVA 1HR0J 3GJRB 2XZTB 3TOQA 5D15A 1T9UA 1KKHA 1N52B 3I87A 1GQEA 4CM0A 1IR1A 1DQ9A 1HQEB 1CS4A 1NH7A 2R7UA 4GMKA 3VAHA 2AJQA 3OW2R 5K14B 1Q79A 3PRVA 2CPJA 4X66J 4LBPA 2DISA 3GIMA 1S7IA 1XNRF 2RQKA 4ED8A 1U1LA 3CJ2A 4PUOB 3MM5A 1N5SA 9RUBA 4O4GA 4ZN1A 4P10A 1CJKB 4F3MA 4KT0C 1HQ2A 1XMQJ 5CA5A 4IH6A 3KK3B 4DUZJ 1I5OB 2HEKA 2VFUA 1S10A 2W9BA 5KFRA 2YKNA 4LRDA 1Q7LB 2VUGA 1SI9A 2K06A 4YQWA 3EUNA 4UUXA 4EO8A 1CJVB 2VASA 3BGUA 2RIJA 4B3TF 3W2WB 3W2VA 4CM2A 2CJYB 1MWZA 2F9DA 2WONA 4ECRA 3M4XA 3JYTB 4J37A 4HT7A 1UEVA 3SCKE 1EQMA 4NLOA 1H72C 2AX1A 1FWPA 3BPSP 1P1LA 3RB4A 4ZDNA 2C3YA 4GKKF 2G2ZA 3NNCA 5K8NA 1RTHB 3OQ2A 3QLHB 1Q7YT 1B4SA 2IFXA 2GHVC 4ED1A 2A6MA 1MMLA 4DOZA 4LSZB 1H74A 4DCJB 1Q8BA 4ES1A 4F8RA 1B64A 2IPOB 3J7AN 2RUSA 1LWEA 2MKJA 4WU2A 3MECB 2F5GA 4FKYA 1LFWA 2ZBPA 3IGVA 4MIAA 5JXSA 3BGLA 2CPHA 1PO6A 1SBRA 1JJ2R 4QW9A 2YX7A 1HNIA 4ETXA 5D4NA 3T6JA 3KYLA 1V6HA 2E5JA 3R3TA 3MAHA 2FJBB 3TVYA 4B3RJ 1WD6A 3PYGA 2Y0SD 5DDRC 3G8QA 3NRBA 2JOQA 3ENWA 3GQCA 4YP3A 1T3NA 4YFUA 2CADA 3DDNA 1HBUB 3I82A 1SV5A 3GU0A 3QGPA 2XZWA 2F4VF 2CZ4A 4CLWA 1DARA 2FPHX 3BEGB 4MTPA 4DG1A 2ASJA 3EM1A 3M6UA 2W8LA 3O5TB 2CPZA 4ILLA 3VAFA 2OELA 4X65F 3IO1A 4F2SA 2EC2A 3MM9A 1LKZA 4AE5A 3L7UA 3M7VA 2KXNB 2VOPA 3R5GA 1IBMJ 5L8RC 1FF2A 1ZETA 2HGNA 3D4JA 2JRSA 2B0GA 5H9EK 2MY7A 1C0TB 4WCEQ 4NXNF 1S6PB 3I0RB 4NPOA 3CCLS 3DLGA 1RAIB 1HNZF 3I96A 4HTJA 2WVBA 1HQUB 5CYMA 3J7ZT 2V8HA 1KR4A 2B7CB 3RBEA 1KLMA 4ZVOB 4LJMA 2IRYA 4JI8J 3SDEA 1KNZA 4C7QA 1X0PA 1S4EA 2RDIA 1M5PC 4OJ3A 4N8OA 5HAOA 3CCSS 3NS7B 3EX7B 3MMBA 4FDFA 1HR0F 2AJ0A 1T03B 3W5XA 2YNHA 4OI4A 1L3TA 1UAWA 4O0IA 1QD1A 2X1AA 1REGX 2C2DA 3KK1B 1R8PA 3OLAA 2HS0A 2XYGB 3FMBA 3K5LA 2BYCA 1NDKA 1KOOA 4C0BA 4X66F 3G96A 3MMAB 2MLZA 1LFPA 4ZCIA 3BGFA 2KZZA 2E44A 1SJRA 4DR4F 4I68A 2K3IA 3ZTSA 2R2SA 4P75A 3LP1A 1GMWA 3BYRA 4QYZJ 1Q53A 4L75A 2PD1A 3T5KA 2DTJA 1LWFB 3QIDA 3ZZUA 1XTZA 2W2OP 2DPJA 3TRGA 3CTRA 2MEWA 3IG1A 5E41A 1D09B 1K1QA 4Y2CA 4DSEA 1IVZA 3PEJA 4LF2A 4JI7F 1X4BA 2CPXA 2E5LJ 2M9KA 5J1NA 1RWPB 1HNXJ 3W60A 4F25A 1G7CB 4TNOA 4XPEA 3T5HA 2IA0A 3M2RA 5B0EA 2L08A 3HJFA 1U7LA 4M5IA 1T9YA 1W2IA 1EARA 1WF1A 5C2CA 3W63A 2HZAA 4J9PA 1IKYB 3TA0A 3R8YA 4OZ3A 4RR5A 4E0DA 3KOAA 2BABA 1W7WA 3KJNB 4NYOA 4KIAA 4USUA 4IH5A 1G2EA 2J9DE 4ECTA 4DV1F 2CQCA 4P2XA 3DLEB 3VZHA 2V4RA 2FJVA 2EBEA 3CGIA 5KFHA 1FRXA 3KUEA 5B0FA 5KFUA 2OKQA 3NGRA 4BS2A 2R7WA 3QT6A 4QQBA 2EXUA 1LWCB 2NREA 1DTQA 4JV0A 1HYSB 2R3VA 1ULRA 1UFWA 5HVHA 2IVMA 4QR1A 2Z2MA 1MG7A 1SQEA 3ILLA 2F8MA 1SJ1A 1NB7A 1UETA 1WHWA 2DGXA 1Y5NB 3DFEA 3HHLB 2Y1IA 1C4CA 3CDUA 4DQPA 3AA9A 1UVMA 4JYAF 3MAQA 3FBEA 3D1QA 1WKKA 2AJ4A 4QWAA 1R6YA 5E0OA 4DQSA 1IXKA 3DLJA 4WZQA 1KQKA 4I6WA 1S0OA 2XYHB 1GMVA 3A13A 2GHWA 1FJEB 3Q24A 3CULA 3HF5A 4DHVA 1SC1B 3FVYA 2AYBA 2WBRA 3Q8QB 4DBQA 4FN5A 3MUTP 5T14A 2IM0A 3L7OA 4QWDA 4DV6F 2HPUA 2XMTA 5GAEI 5K8OA 4DV5J 3C6TA 1R0BG 3KK2A 4CLPA 3D3BJ 2RUGA 3PX6A 4Q43A 5DRKA 3D6FB 2XY6A 5E3RA 3CC2S 5KFNA 1KHVA 1FI4A 2C2NA 2BJ1A 5T7LB 4P2MA 2G2OA 4I2PB 2YH1A 3L95X 3L4BC 1MN7A 3K17A 2J9CA 3M2UB 2I38A 1S1TA 1X9WA 3CDBA 2OJ3A 1N0VC 4OHXA 1VBYA 4NCGA 5HATA 2DIUA 4FP9A 1R7IA 4M5MA 3T19A 3QMQA 1S9GB 5A6WA 4WZMA 1OY9A 2LMIA 2XMVA 2LXFA 4XAKA 1GH8A 3ZO7A 4LF9F 4Q7AA 2HHUA 2XY7A 4JI8F 4FF2A 4B3MJ 3M05A 5KFQA 2ZDPA 5IZHA 4LF7J 3ENQA 1TV6B 3MECA 2DEJA 1S0VA 4KBIA 1R0AA 1P8GA 1JLCA 2DRAA 3H2VE 4K4TA 1IJFB 4IYQA 4KHMA 1T0TV 4RUAA 1YRTA 4RBVA 2ZZTA 4Y34A 3ILIA 1JXVA 4DLEA 1U4BA 4WE1A 4ZLNA 3M8ZA 2DGTA 3GV5B 1K47A 2QYCA 2Z2ZA 3HHLC 5DDOC 3QGHA 2CA9A 4YEAA 4B3SF 1D8ZA 1D9FA 4DPWA 4CLSA 1OO0B 1V3SA 2XS7A 4CLUA 3AJ2A 3KHLA 4YOEA 4C8NA 2CQBA 3DHXA 4KKOA 1EQ0A 1NZAA 4GVBA 1SKWA 1A9NB 4KQZA 3P49B 3AAWB 4KO0A 1TKTA 3DNCA 3KLVA 4DWIA 1L3UA 4NRTA 2FLPA 1OY6A 2HZVA 1CJTB 1OPZA 3FRYA 3W3SA 1HBNB 5A2QU 4U95A 2V9WA 1YJVA 3CCMS 4J91A 3IAS9 3PRDA 5CYJA 1YBUA 4P2FA 1RA7A 3TI0A 2GAGC 2W2NP 1FKOB 2LCWA 4RW8B 3E01B 4PG5A 4CIOA 3TUIC 3H25A 3DXSX 3CJ0A 1LQ9A 2IJFA 2JC1A 4ER8A 4M5DB 1EETB 3CD5A 1N6QB 1TAQA 2A18A 3B4DA 3H7HB 4DSIA 1NDCA 1OYEA 3GTYX 1R3NA 2GJIA 3BBCA 3E51A 1K1SA 3I6PA 3BQ2A 3NL0A 1KTQA 4RW6B 3PEHA 5I42B 4K4YA 4HI2A 3SQGB 5DLGA 3NNAA 3HD1A 3D3CJ 1RAHB 3RBZA 3CJSA 2W4DA 2AYEA 2X1FA 2XS2A 1F6TA 5D0EA 4JI1F 4LVNP 4NWBA 3DOMB 2A1BA 4RBUA 5KFGA 5F8MA 3AOCA 4RUCA 4IFVA 3U1MA 4C0HA 5H1SV 4Z7CA 4C9DA 3I4PA 4R25A 1UPPA 3MOZA 2HWHA 2O5DA 3AQPA 1RBLA 5L39A 1GMUA 4QIEA 4A46A 2K2PA 2E1AA 5HMZA 2KXFA 2AYMA 1KLNA 2ZH9A 3V6JA 3FKBA 5DM6Q 2CJAA 5E5NA 1PKUA 1ZPWX 2IYGA 4QW8A 2IIHA 3G8SA 3HXMA 3Q8YA 3AOAA 1TFWA 4X4VA 1JLAB 4DUYJ 2MGZA 4WFAQ 4DX8H 1QM9A 4BWJA 4UUWA 4J9QA 3H5UA 3PJ9A 3QT5A 2V94A 2MLXA 1PYOB 4LMZA 2NCKL 4ZJQA 3W65A 3T5LA 5LXYA 3QRPA 1VK8A 1VYAA 5A8WB 3ISNC 4QWEA 5HMYA 2BKNA 7AT1B 4XTTA 1X4DA 2BANB 2F40A 3M6VA 4HACB 5DO2A 2AJ2A 1IBKJ 2P8IA 2ZM6J 4UOCA 5EUHA 3LP0A 2W2MP 4YN3B 3BV8A 4USTA 1JX4A 3W66A 3DLEA 1RT5B 4LBHA 2GFFA 8RUCA 2WBMA 4KV8A 4QJVA 4B3MF 2VFTA 3E8OA 1V9OA 2UP1A 2MKCA 4LF7F 1T3OA 1FESA 2N4DA 1NK8A 4ES2A 3PO5A 1LWCA 1PSDA 4GRSA 1TL3B 4OX7A 1RT7A 5THWA 4ED7A 1HMVB 3Q2TC 5AE3A 5DGAA 4AYBD 3BO3A 1HNWF 4LSNB 4I64A 1S79A 1NDLA 4NLXA 1H2VZ 4P6QA 4DR6J 1N8RT 4RW7A 2WCXA 1BQXA 2VOOA 4PXBA 1VRTB 2C2EA 3MPYA 5HJXA 2ABYA 2DR8A 3T1YJ 2GIFA 2UUCJ 2G0JA 1F5CA 5C5JA 1UVJA 3IM8A 2QT7A 2ZNYA 3MWBA 1AA1B 2F7VA 2EEYA 1FWKA 2MSSA 1FDBA 1TK0A 4MKVA 2FTRA 2MKSA 3SXLA 1YLXA 2HW3A 3BBBA 1T05A 5E7OB 1M5VC 4AQYF 4LR9A 5IT9U 1L5UA 5AT1B 3WX8A 4EYIB 1YX2A 3GG0A 3V6KA 1HI0P 4PWDA 3KJVA 2EW9A 4DL7A 2HZCA 4DL0C 1Y5LB 5CD4A 4Y3CA 4F50A 1RCOB 1BXNA 3OXLA 4LVOP 1C4AA 1DQ8A 4OZJA 3KG0A 2AJ1A 1WACA 1BQMB 1HLWA 3W1YC 4DR7F 1TKXB 5D0RA 5HLFB 4I2PA 2OO4A 4NE9C 2BDPA 2HHWA 3K5NA 3QAEA 2DXFA 3R27A 4OI3A 4XDCA 1MROB 1RHMB 2QV6A 3BF4A 2L48A 5CH7B 2JLFA 4FF3A 4IOBA 2KTQA 1F9FA 4ZVHA 1WG1A 3I55S 6FD1A 4DPYA 2CPEA 1EP4B 5HO4A 3D0IE 1Q81T 1APSA 1VQ4S 1RWOB 1WC5A 4A4JA 3R5AA 2M2BA 1C1BA 2YQ0A 3GFXA 1LXJA 1TMMA 4J9OA 1OYDA 3DI6A 1ZA1B 2FVRA 1OQ6A 1H2UX 1F9HA 3DKDA 3JXOA 4L3NA 2AV5A 4U9RA 4FBTA 4PQUA 1PJ5A 4ITSA 1TU0B 4HDGA 1GFWB 3GCWP 2LDYA 3CJKA 3ITHA 2DR5A 2O3DA 3IAM9 3CXCR 3FC9A 3F0NA 4FYDA 2NSCA 1WKLA 4ZPVR 2AF6A 4NXMF 2FJWA 2OGUA 2P9CA 6FDRA 1U0HB 3EPIA 4HHJA 2JLGA 2A6OA 4ED4A 3DLKA 4Y28C 4L73A 1C0UB 2RAQA 3H0PA 5K9FA 2OSRA 1GAOA 1VQ5S 3SV3A 1FNXH 4JB8B 2JZ5A 3C16B 4LFAJ 4IG0B 2VHGA 2A2DA 4KHPJ 4A8YA 4DPTA 3WHIA 1RT6A 3BGRB 3T5JA 1NK7A 3C66A 1B7YB 2NXUA 4XK8C 3I5CA 1JLGB 3MHYA 1YJRA 2Q66A 2DNNA 3C2PA 1WWHA 2BBEA 2DR7A 4G1QB 4J9MA 4DR3J 4QWBA 2C2MB 3BS9A 2ZHOA 5L1IA 3QWPA 2CZVC 4N7TA 1QAYA 2PE8A 2ROGA 4I6YA 4HLBA 2MLYA 1RT3B 1Y3JA 4TY8A 2W9CB 1XQIA 3E2EA 2RQCA 1REVB 8AT1B 1ACMB 1CSJA 3N4WA 1IBKF 3I5AA 2ZM6F 2CUYA 3SSSA 2GIRA 1K73T 1RAGB 2ZE2A 1NZ8A 3VHQA 4URSA 1QSSA 2Y8WA 2BKPA 1SH2A 2UU9J 5GAGU 4F2RA 3JSYA 1C2PA 2HBRB 4O3SA 5CZVA 2HK3A 1XR6A 4MKBA 3C15A 4TU7A 2B3TB 5IOLA 5KT7A 3O2IA 1UW4A 4RU2A 1Z2ZA 2HIQA 5I42A 4OJ1A 4CCHA 2NZ4A 1IR2A 1U6FA 4LF4F 2B5JB 4RW9A 1VQLS 2BQRA 5KFYA 4R5PB 1TZ0A 3J81j 2VJUA
chains in the Genus database with same CATH topology
4UOFA 3Q89A 2VU5A 1K44A 3ELHA 3VVTA 3MPDA 1ZS6A 1EHWA 2HVEA 1NLKL 4W98A 3B6BA 3ZTSA 3VGSA 3BBBA 3ENAA 3VGTA 3NGRA 3R9LA 3DKDA 1HIYA 4WBFA 3ZTPA 3ETMA 4UOHA 3Q83A 5CAAA 1S5ZA 1LEOA 3WX8A 1WKJA 3BBFA 1NPKA 3NGUA 3DDIA 2HURA 2DXDA 3FC9A 3BH6B 1LWXA 4DUTA 1BHNA 3FCVA 3EMTA 1JXVA 1XQIA 3EICA 3NGSA 4UOGA 3FBFA 2AZ1A 2DXEA 1WKLA 1NB2A 3EJMA 3FKBA 1NCLA 1NHKL 3JS9A 4S0MA 1NSQA 3ZTQA 4ANEA 4ANCA 1NDCA 1PKUA 2CWKA 2B8PA 4CP5A 1MN7A 1NUEA 3Q86A 1HLWA 1NSPA 3VGVA 1BUXA 5C7PA 4ENOA 4HR2A 4F36A 3EE3A 3GPAA 3Q8UA 1XIQA 2B8QA 3BBCA 3FBCA 3Q8YA 2DXFA 4KPCA 3ZTOA 3EVMA 4DI6A 3Q8VA 4DZ6A 2HVDA 1U8WA 3FBBA 2AZ3A 3GP9A 3ZTRA 5BXIA 3NGTA 3PRVA 3EM1A 3FBEA 1NDLA 1B99A 1WKKA 3BH7B 1BE4A 4FKXA 3PJ9A 4O0NA 4ANDA 5IOLA 4EK2A 1B4SA 1S59A 3B54A 2NCKL 2DY9A 3FCWA 4C6AA 2BX6A 2DYAA 5CABA 3L7UA 1MN9A 1NDPA 1PAEX 1VYAA 3EVOA 1F6TA 3G2XA 4FKYA 4F4AA 2ZUAA 1NSKL 1W7WA 3EVWA 1HHQA 1NDKA 2BEFA 3VVUA 1KDNA 1S57A 1F3FA 1UCNA 3VGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOF A;  3Q89 A;  2VU5 A;  1K44 A;  3ELH A;  3VVT A;  3MPD A;  1ZS6 A;  1EHW A;  2HVE A;  1NLK L;  4W98 A;  3B6B A;  3ZTS A;  3VGS A;  3BBB A;  3ENA A;  3VGT A;  3NGR A;  3R9L A;  3DKD A;  1HIY A;  4WBF A;  3ZTP A;  3ETM A;  4UOH A;  3Q83 A;  5CAA A;  1S5Z A;  1LEO A;  3WX8 A;  1WKJ A;  3BBF A;  1NPK A;  3NGU A;  3DDI A;  2HUR A;  2DXD A;  3FC9 A;  3BH6 B;  1LWX A;  4DUT A;  1BHN A;  3FCV A;  3EMT A;  1JXV A;  1XQI A;  3EIC A;  3NGS A;  4UOG A;  3FBF A;  2AZ1 A;  2DXE A;  1WKL A;  1NB2 A;  3EJM A;  3FKB A;  1NCL A;  1NHK L;  3JS9 A;  4S0M A;  1NSQ A;  3ZTQ A;  4ANE A;  4ANC A;  1NDC A;  1PKU A;  2CWK A;  2B8P A;  4CP5 A;  1MN7 A;  1NUE A;  3Q86 A;  1HLW A;  1NSP A;  3VGV A;  1BUX A;  5C7P A;  4ENO A;  4HR2 A;  4F36 A;  3EE3 A;  3GPA A;  3Q8U A;  1XIQ A;  2B8Q A;  3BBC A;  3FBC A;  3Q8Y A;  2DXF A;  4KPC A;  3ZTO A;  3EVM A;  4DI6 A;  3Q8V A;  4DZ6 A;  2HVD A;  1U8W A;  3FBB A;  2AZ3 A;  3GP9 A;  3ZTR A;  5BXI A;  3NGT A;  3PRV A;  3EM1 A;  3FBE A;  1NDL A;  1B99 A;  1WKK A;  3BH7 B;  1BE4 A;  4FKX A;  3PJ9 A;  4O0N A;  4AND A;  5IOL A;  4EK2 A;  1B4S A;  1S59 A;  3B54 A;  2NCK L;  2DY9 A;  3FCW A;  4C6A A;  2BX6 A;  2DYA A;  5CAB A;  3L7U A;  1MN9 A;  1NDP A;  1PAE X;  1VYA A;  3EVO A;  1F6T A;  3G2X A;  4FKY A;  4F4A A;  2ZUA A;  1NSK L;  1W7W A;  3EVW A;  1HHQ A;  1NDK A;  2BEF A;  3VVU A;  1KDN A;  1S57 A;  1F3F A;  1UCN A;  3VGU A; 
#chains in the Genus database with same CATH topology
 4CLZ A;  1VC6 A;  3DM2 A;  2E29 A;  4HVZ A;  2XMK A;  3T1Y F;  5B08 A;  2PMZ D;  5KT6 A;  3CCW A;  1SC3 B;  2DNK A;  4I1T A;  2V4J B;  2MZR A;  1HKA A;  3DDI A;  4JI6 F;  5HRO A;  1NH8 A;  9ATC B;  3WC0 A;  3J7Y U;  1VQP S;  2E7X A;  7FDR A;  3NGS A;  1U47 A;  5HSP A;  1PIL A;  4ZMM A;  3ICL A;  2IDL A;  3ILJ A;  3I4H X;  2UV8 A;  3GJQ B;  2CNO B;  3FMW A;  2NR0 A;  2ZWO A;  1NO8 A;  4MK9 A;  3CDW A;  2XSJ A;  3CCJ S;  1D1U A;  1PJ7 A;  2UXB F;  1WTF A;  1YHQ S;  4MKY A;  1JLA A;  1BE4 A;  1C1C B;  5J2P B;  2VG7 A;  3SFU A;  2VON A;  4NYZ A;  4OX9 J;  1YZ6 A;  2DY9 A;  3A3O B;  5D77 A;  4TLQ A;  3TJ8 A;  4HH0 A;  3BRE A;  4KC5 A;  4NML A;  1MMD A;  2B9Y A;  4OQJ A;  5DET A;  2QG9 B;  2CQ0 A;  1IJE B;  2F63 A;  3LP2 B;  4ZVT B;  2N7Y A;  3WBZ A;  2B9W A;  2QC3 A;  3QAU A;  4M5N A;  4WF9 Q;  4NA2 A;  1WOR A;  4G6V B;  5ETS A;  3SFG A;  2C3O A;  4IO9 Q;  2MQO A;  5CCL A;  3F56 A;  2J8A A;  6AT1 B;  1EIY B;  4ZPW R;  3VAK A;  1W25 A;  1NPK A;  4H4K C;  4A48 A;  3R2D J;  3BN7 A;  1YG0 A;  2DPI A;  3R6G B;  5F3Z A;  2CJB A;  3EZU A;  3CJ8 A;  3IC1 A;  4KH1 B;  4CI0 B;  3H20 A;  4ZPB A;  1SH0 A;  5AJ3 J;  4R0J A;  1TKZ A;  2BQ3 A;  2FLN A;  3KLH A;  4CTA A;  4U7U D;  2YQ1 A;  4OYX A;  2JH3 A;  3Q2S C;  4WIQ A;  3D0G E;  4B9V A;  3UN3 A;  4PXD A;  4F4W A;  3A12 A;  4IQX A;  1VK3 A;  5KG4 A;  3D6H B;  2NXN A;  3GFY A;  3PTW A;  1SC4 B;  4Q8E A;  2C3P A;  1FEE A;  3N5B A;  1O5J A;  4TXS A;  2RB7 A;  4IRC A;  1FJ7 A;  1F3F A;  5J1E A;  1J5O B;  1LK7 A;  2UVV A;  1RHQ B;  1B0V A;  4J9K A;  3EZO A;  2HHH J;  3NWG A;  2VIC A;  1RAC B;  2H65 B;  2OD6 A;  3QZ8 A;  4OZ2 A;  4H54 A;  4DX6 A;  4GC7 A;  2HQC A;  3D54 A;  4DQQ A;  2NSB A;  4FF1 A;  2RT3 A;  1PC4 A;  3PYD A;  4DR3 F;  4WTY A;  3AH6 A;  1TL4 A;  3PXG a;  2DGQ A;  1FJG J;  4ANC A;  3NY0 A;  2ZWP A;  4LF1 A;  4ELV A;  3CJ4 A;  2E1P A;  3OV7 A;  2HNY B;  3LPY A;  4OYW A;  2G4B A;  3FZB A;  5DGB A;  2YNI B;  3WZ0 A;  4NMX A;  1VOM A;  2NXJ A;  2LA6 A;  3O3L A;  2WB1 D;  2MQL A;  1NRK A;  1JK9 B;  3FSI A;  3TEH B;  1VIX A;  4RNH A;  1JMT A;  3TAQ A;  2HRY A;  3PW5 A;  5LT5 A;  3OL8 A;  3K7R A;  5KT3 A;  1ZTT A;  3G82 B;  3TAP A;  2DNL A;  3HX9 A;  3Q0A A;  2MXY A;  1U48 A;  3N9U C;  3M1V B;  4U8Y A;  5KFB A;  4ERD A;  2FGC A;  3ZZ0 A;  2ASY A;  1WDD A;  4C0O C;  5KG3 A;  2Y1L B;  4DJB A;  1X4F A;  3JSM B;  2MY8 A;  1PAU B;  3IS9 B;  4PWW A;  1YK9 A;  2ZD1 A;  3N79 A;  5HJY A;  1SL2 A;  1VI7 A;  2BE2 B;  2DHA A;  5KG0 A;  5K20 B;  1JJ4 A;  2OEM A;  2BQU A;  4USM A;  1R8B A;  4B9M A;  3IRX A;  1GMW D;  1F2G A;  3BO2 A;  3H42 A;  1HWI A;  3PNI A;  3IP0 A;  1N34 J;  3CC4 S;  3C3L A;  1EJ7 L;  3R1H A;  3BKF A;  3MUM P;  2EG1 A;  5HAN A;  3M8S A;  1FKP A;  2ASL A;  2Z2L A;  1TL1 B;  4HHH A;  2K7K A;  1YJN S;  2DGU A;  1D0E A;  2OPQ B;  3CCU S;  1PIE A;  1T9W A;  3ENV A;  1UWB A;  5KFC A;  3AFG A;  2XWX A;  2XI3 A;  3VAL A;  4K4Z A;  4NL5 A;  4Q5V A;  3THT A;  2VF3 A;  4ILR A;  5F8I A;  4U6P A;  2CNN B;  5FDL B;  3R9L A;  3CCT A;  4IG3 A;  4KHR A;  5CYQ A;  1AFJ A;  2VG6 B;  2V8D A;  2IYI A;  2WAQ D;  1GXL A;  1VLO A;  2HLT A;  4ECW A;  2O67 A;  5KFW A;  3KLF A;  4H4M A;  2E9R X;  3UE2 A;  3GIK A;  1PYS B;  1NK0 A;  3LTO A;  4JI3 F;  2AEM A;  4H4K A;  5JVG Q;  2KJV A;  3C6U A;  2NXC A;  4Q44 A;  1U8W A;  4FVM A;  3LA0 A;  3VAG A;  2GQQ A;  2ERR A;  1UVK A;  1WC1 A;  1IBC B;  2Q6B A;  4F67 A;  1FJC A;  5CZX A;  5ETP A;  3ZXW A;  4NYP A;  3PJX A;  2D3O R;  5CAB A;  2KXH A;  5KFA A;  2W8K A;  3RYL A;  4J9S A;  3CCZ A;  2XI2 A;  4O4R A;  5GAD U;  4M5H A;  3B8H A;  3I56 S;  5LMN J;  2CQ3 A;  1KP6 A;  3GB0 A;  2B5J A;  1XR5 A;  4KYZ A;  2V50 A;  2ZBC A;  2IA6 A;  2O01 C;  5DQG A;  2FB0 A;  3GCX P;  2QYG A;  2R8K A;  4ZPA A;  2DR6 A;  2XS5 A;  3KDN A;  3FNN A;  2OPP B;  3QAT A;  2RIL A;  4CDI A;  3UCG A;  2GW8 A;  3P8B B;  5LOQ A;  5JUM A;  1XNQ F;  4MKA A;  1YIJ S;  1ZA2 B;  2IJN A;  1O0P A;  2DIT A;  3G6Y A;  2C2R A;  2BE7 D;  5B0B A;  2ZBI A;  4NAS A;  1D8Y A;  4WKY A;  3T41 A;  3SZ2 A;  3KLG B;  4LBI A;  4DI6 A;  1UTA A;  1RA6 A;  4ZP7 A;  1HPZ B;  2B4P A;  2AP6 A;  3QO9 B;  3M8Q B;  1RAB B;  3AOD A;  4J9R A;  3MR2 A;  2VFR A;  1F9E B;  1C1C A;  3UVJ B;  1PCA A;  4DS5 A;  3UDC A;  1NJX A;  3PKM A;  3GIJ A;  4DR5 J;  3AQO A;  4LF6 J;  1A7G E;  2VA3 A;  3CF5 Q;  4P72 A;  3VAJ A;  2XYP B;  2YKP A;  4C3K A;  1N5Y A;  3B78 A;  1NXI A;  1KVI A;  3JSB A;  3THV A;  4E8U A;  1U25 A;  1RU1 A;  3V81 A;  4PXC A;  4N41 A;  2CJ9 A;  3AJ1 A;  2CKW A;  2KRR A;  4JI0 J;  2V2V A;  4EWT A;  2AIR B;  3NXZ A;  1JLE B;  3DRS B;  3BDP A;  1QY7 A;  2GZO A;  3JS9 A;  2PEB A;  1Z2L A;  4MIW A;  2VOD A;  3GMG A;  1J2V A;  4DS4 A;  4ZKA A;  2UVR A;  1TL5 A;  4NX9 A;  4ZVR B;  1JKH A;  4NZ7 A;  4HI1 A;  1KSP A;  5J2N A;  2MQP A;  3N01 A;  2DRD A;  2AEF A;  3OJU A;  3UWT A;  3POT A;  5BYQ A;  5F41 A;  2VPX B;  1URR A;  2OML A;  2HHV A;  4OLO A;  1MSW D;  4JP8 A;  1RWX B;  3RB6 A;  1X4G A;  4ETZ A;  1D9D A;  2LQ5 A;  1T9X A;  1N34 F;  1JLF A;  4I7F A;  5AE2 A;  2C3U A;  2HMI B;  5AXN A;  1R89 A;  2H5E A;  4QWC A;  1TK5 A;  4A8M P;  4RNO A;  2PN6 A;  3OTE A;  4EFA C;  3G87 A;  3HFK A;  1QAJ A;  2YWK A;  2L9N A;  3V6D B;  1VQ8 S;  1FDA A;  3BGO P;  3IBC B;  4DV2 F;  4JI5 J;  4ZJO A;  1U26 A;  2AD9 A;  4TY9 A;  1XMO F;  5EWG A;  5EWE A;  4I69 A;  4RLE A;  2XLK A;  1WC4 A;  1ICE B;  1FTR A;  5ADZ A;  2VG5 B;  3TW0 A;  4C98 A;  1NSP A;  1IN0 A;  3R5B A;  5IM0 B;  4B3O B;  2M0G B;  5J2M B;  5L9X A;  3GFZ A;  2NXE A;  2M8H A;  1S6Q A;  1VHF A;  3NGD A;  2G9O A;  1E6V A;  4I2Q A;  4K4W A;  3A1Y G;  5HBM A;  5C24 B;  5GAH I;  1RWM B;  1Z1Z A;  3W5Z A;  3PHE A;  3KHR A;  4MFB B;  2YNI A;  3J7A 1;  1TQL A;  5F9N A;  3PV8 A;  4CH7 A;  3LGN A;  4C97 A;  1UVI A;  2HSE B;  2HHS A;  1S72 S;  4DR1 J;  1GTE A;  1SUQ B;  3K57 A;  1KOH A;  1ROF A;  2PO4 A;  5LMU J;  4ELT A;  4USK A;  2NYI A;  2K3K A;  2WZ1 A;  3G82 A;  2AQ4 A;  1XK8 A;  2AX0 A;  2V9K A;  1WOP A;  4YS2 A;  4WBF A;  1U6Z A;  4AL7 A;  3GIR A;  3AY0 A;  3HKW A;  1N5T A;  2RML A;  2E7V A;  1RSC A;  3KWM A;  4KFB B;  2CFX A;  4RZR A;  3HK2 A;  4IOC Q;  4OMF G;  2X3G A;  3RR7 A;  2YH0 A;  4B9U A;  3MUV P;  4LRF A;  4ZHR B;  2CNK B;  1U49 A;  2W7A A;  3PRB A;  2GML A;  2DNQ A;  3RZA A;  5BR8 J;  2HS4 A;  5DG7 A;  2CG8 A;  5I3U B;  4K0K F;  3OHB A;  3DRR B;  2R7O A;  4DV0 F;  3NLC A;  1VMB A;  5B7W A;  1Q8I A;  2LXI A;  4XPC A;  4WP8 A;  3IBF B;  3LGH A;  4B9L A;  3M9O B;  1T9V A;  3T1H F;  2CAJ A;  2M8D B;  1D3W A;  2AU0 A;  2AWZ A;  4ID5 B;  3V4M A;  4OV1 A;  4TKT A;  1N88 A;  1ZH5 A;  5EGY A;  1Y5I B;  3TAM B;  3HO1 A;  1FFW B;  2R42 A;  2OPQ A;  2IBK A;  1PYT A;  4ZS6 A;  2XNQ A;  5KFV A;  3JAM U;  1MU2 A;  4M5J A;  4U67 Q;  4KGK A;  4C3M A;  2BJ3 A;  4QU6 A;  2FZG B;  2HUR A;  4CT9 A;  1XMB A;  3MPW A;  1U2C A;  5G0R A;  4LR8 A;  3EMT A;  3DOL B;  2VA2 A;  2WOM A;  2DNR A;  4OI6 A;  1GNK A;  2HFV A;  2RQM A;  2F1F A;  3EWG A;  3MM6 A;  3TWZ A;  3W62 A;  3G86 A;  4C48 A;  2PI4 A;  1LV5 A;  2MHE A;  2VBX A;  3BPD A;  4HYK A;  3CCQ S;  2GAH C;  2F8H A;  2I2Y A;  2FHO B;  4PRF A;  1RAE B;  2AHO B;  3MM7 B;  3FEY B;  4A8X A;  4NLG A;  3PW4 A;  3I9Z A;  2RKI A;  2E66 A;  1CJU B;  3DU5 A;  1YJU A;  4ZLP A;  2DGO A;  4ED2 A;  5C2G A;  2OTL S;  3DOK A;  4G1P A;  2RJZ A;  2VQE J;  1XNR J;  1TTH B;  1UL3 A;  3M2V A;  3BN4 A;  1FXD A;  3OHA A;  3NGU A;  5C42 B;  4CO2 A;  3MM8 A;  1BQN B;  3RG6 A;  2P2C B;  3B4M A;  2EPI A;  2GVD B;  4KGM A;  1EKS A;  3OTC A;  3GZ7 A;  4JOU A;  3Q86 A;  5C7P A;  3J7Z 5;  2FHJ D;  1PGZ A;  4QIW D;  3EGV A;  4DV3 F;  3PJW A;  1XJW B;  2MZS A;  4B3T J;  2FVC A;  2A2C A;  4CH1 A;  4C8M A;  2XNR A;  3U1L A;  2YKQ A;  2F8E X;  1IM6 A;  5I3Q A;  3GYX B;  4O3R A;  5DLF A;  3VVU A;  3MR3 A;  4R8U B;  4F4X A;  1DLO B;  2P6T A;  3AT1 B;  4DU8 A;  3TAR A;  1OSD A;  1S97 A;  2FUG 9;  1HW9 A;  3OL6 A;  4BC9 A;  2RU3 A;  2D1C A;  2Q3P A;  4YHH J;  2AGQ A;  4J5O A;  1YKW A;  3BSC A;  2JEG A;  1IKV B;  4P2S A;  1UFL A;  5T41 A;  2A3J A;  2M4M A;  3VAM A;  5LMU F;  4N8N A;  2VDI A;  2ATC B;  1U1R A;  1NB2 A;  2EVZ A;  5F3T A;  3Q23 A;  1NSQ A;  4K4V A;  3JQK A;  3A3P B;  1CUL B;  2FQQ B;  1IKW A;  2WB4 A;  3NOC A;  2J6T A;  1T95 A;  4IQM A;  4OYM A;  1RYR A;  2GA7 A;  3EGN A;  5ETN A;  5KOX A;  3D0H E;  3CIZ A;  2QMX A;  2OAU A;  3FGV A;  3I9V 9;  2D74 B;  3LUY A;  2WK4 A;  2Z57 B;  3C8Y A;  4ZK7 M;  5HQL A;  4QCL A;  5BR8 F;  3R5J B;  3WQP A;  5K8M A;  4PAA A;  3PYE A;  3N0V A;  3MDF A;  2F4V J;  1KON A;  2MPU A;  1AZS A;  5F9L A;  2XLI A;  1S1W A;  1RQ0 A;  1S1U B;  2Z56 B;  1AT1 B;  1U02 A;  5AXL A;  3K59 A;  1Q8K A;  1S1X A;  2YWW A;  2CWX A;  1MW7 A;  5J2Q A;  4EBC A;  3OR2 B;  4OJH A;  1RGV A;  5DQH A;  2JFD A;  4URQ U;  1AXQ A;  3SCL E;  4MK7 A;  2XLJ A;  2LDI A;  4PYD A;  1FE0 A;  1RTI B;  3CCV S;  3MZI A;  3DGP B;  2DO4 A;  3M6W A;  2UV8 G;  2AZ3 A;  4OFZ A;  3AJD A;  3M9N B;  1HNZ J;  1FTC A;  1TVR B;  1UJ6 A;  3HT0 A;  3NMR A;  1HWL A;  4WII A;  4PG8 A;  4FPI A;  4C6A A;  1NAQ A;  3DU6 A;  4TLR A;  2P5V A;  2EFP A;  4UZB A;  2BE9 B;  4PPZ A;  4F4A A;  3NBP A;  3VV2 B;  4QR2 A;  1UCN A;  4KGV B;  2NYH A;  1RT2 B;  1HBO B;  1IKX A;  5KG6 A;  4UQT A;  3TA1 A;  4UT4 A;  2BAC A;  2FY1 A;  4X84 A;  3PM9 A;  2QE5 A;  3PFE A;  4ZCK A;  4RWW A;  3PVX A;  2UXC J;  5I4M A;  4MYT A;  4M5L A;  4CYU B;  2AGP A;  2DNP A;  3LQV A;  3DMJ B;  1CC8 A;  2HBZ B;  2FJX A;  2J8S A;  1ZAW A;  5KOW A;  2PSZ A;  2VQE F;  1E6Y A;  4DR4 J;  2Q43 A;  3V4I B;  1VBK A;  5IQQ A;  2OPR B;  1V5V A;  1UWA A;  2Z0G A;  4JUZ A;  2JDJ A;  2M88 A;  1S9F A;  5L9N A;  4CLK A;  2J9D A;  4P7V A;  1RT4 A;  2RRB A;  1WC3 A;  4A8Q A;  1R0C B;  4Z2X A;  1ZOT A;  4JI7 J;  3MAA B;  3N28 A;  4OI2 A;  2CQG A;  3RBX A;  1UJ5 A;  2G2Y A;  4C4W A;  1O6X A;  1VRU B;  1RLC L;  3IWN C;  2CQI A;  1SVD A;  1VJQ A;  1M5H A;  1DTT B;  2KT5 A;  3BSA A;  5JJB A;  1VQS A;  1B7F A;  1RAF B;  1ZZF A;  3DYA A;  2UUW A;  1I51 B;  4KGZ B;  3BQ1 A;  1U09 A;  2YNF B;  1UZD A;  1H38 A;  3HFZ B;  4O44 B;  2IMO A;  3QZ7 A;  3MEG B;  4Y6I A;  1HHT P;  1LW2 B;  3NKY A;  3A3N B;  3EIC A;  3FBF A;  1RT1 B;  2ADB A;  2HNZ B;  4ALZ A;  4DV1 J;  1WI8 A;  1S1V A;  4YHH F;  2LEP A;  2AEJ A;  5A8K B;  2FGO A;  4IFY A;  1VCT A;  4Q2L A;  1QE1 B;  4DZ6 A;  1HD1 A;  4WP9 A;  1H2T Z;  3M30 B;  3CMA S;  1BD6 A;  2C2Z B;  2YKO A;  2OH2 A;  4Q8F A;  2LU2 A;  3SYZ A;  4PR6 A;  5A8R B;  2BRL A;  1N48 A;  4YME A;  2XCA A;  2HBQ B;  4USH A;  3MR6 A;  1UP1 A;  2KKH A;  2D41 A;  2ZH5 A;  2IAJ A;  2IHR 1;  2N3L A;  3AD9 C;  4JYA J;  2R8G A;  5JVH Q;  2XBP A;  4X64 F;  4RPF A;  4ZJL A;  2PFD A;  3EXC X;  4LFC F;  1ZYQ A;  3CD0 A;  3OT9 A;  1T8E A;  1RAJ A;  4J9L A;  2DNH A;  4XO0 A;  3BJY A;  4YB5 A;  1FE4 A;  3D28 A;  2C42 A;  2VB6 A;  2YNG B;  2MTL A;  5ETV A;  4LSL B;  4HDH A;  2QRR A;  1A0O B;  1SC6 A;  2BKO A;  1U8S A;  5KFT A;  1Q16 B;  3KTQ A;  3PIO Q;  1BQN A;  1VBZ A;  3R7N B;  2HND A;  2CDR B;  4DV6 J;  2F9J A;  4OYO A;  3UFC X;  8ATC B;  3PG9 A;  4CH0 S;  2B4U A;  3G6X A;  1F3V A;  2ZOM A;  4WFB Q;  4F0K A;  4N76 A;  4MMO A;  2B4O A;  2K1R B;  3UO0 A;  1UVN A;  1NDP A;  1T11 A;  2VC1 A;  2XMA A;  1XWL A;  2JFK A;  4IDK A;  2ZH3 A;  1X9S A;  2NUH A;  4ICL B;  3DRY A;  3UR3 C;  1YBT A;  4O3O A;  4ECY A;  2HIY A;  2CQH A;  1F0X A;  2HVE A;  1U1M A;  2J7W A;  2EWH A;  1QJH A;  5KFX A;  3PKY A;  3TR5 A;  4LF9 J;  2V8G A;  1S9E A;  2R7S A;  2L3M A;  2QFI A;  4X4U A;  1TL7 A;  4U7C A;  1IKV A;  3EPG A;  4OYA A;  1ZAV A;  4I0W A;  4F4K A;  2YY3 A;  1ZM4 A;  4DL4 A;  2DK2 A;  3H90 A;  4V1A k;  2PA8 D;  3HVT B;  5HP1 B;  2AKW B;  2BOP A;  4KPC A;  5DS7 A;  1HNV B;  2UXC F;  2HHT A;  1S76 D;  1FFS B;  2HVZ A;  1FRH A;  5M2U A;  3AD7 C;  3DRP B;  4DL2 A;  4PKD B;  4CLL A;  4F0H A;  3MMC B;  4TVA B;  3RJM B;  2GVZ B;  2DR9 A;  2H3E B;  5H9F J;  1QAX A;  2W2Q P;  3I31 A;  1XBW A;  2V6A A;  3RGI A;  1RBA A;  5MLC V;  1RTJ B;  2B6A A;  4Q0B B;  4B3S J;  4FVC A;  1UJ4 A;  3IA0 A;  1WUU A;  1XC9 A;  2YKM B;  5RUB A;  2E5G A;  3M8R A;  1BMQ B;  5KT2 A;  4W98 A;  2FZC B;  2DEI A;  1S1U A;  3PR4 A;  3LH2 S;  3OR1 A;  2IRX A;  2DCU B;  3NAI A;  1MMN A;  4RO0 A;  1LEO A;  1LW0 B;  2ZIT A;  2I5J B;  2WW8 A;  3CJR A;  4G3I A;  3GJS B;  1EB0 A;  4RWX A;  4AXI A;  3HVW A;  2GGP A;  1FDN A;  1GT8 A;  2KO1 A;  2UUB F;  4OI1 A;  2OMO A;  2OPS A;  2LEA A;  5D3G A;  3OTD A;  2IC3 A;  4TU8 A;  2HHX A;  1YDL A;  4TQR A;  2ATL A;  3LAK A;  1RTD B;  2ZC4 A;  3ET6 A;  4QPX A;  5DG9 A;  2J9E A;  2CVE A;  2DH7 A;  2QA4 G;  3ILO A;  1FX2 A;  2E7W A;  4PCQ A;  1DFD A;  3HVA A;  3G2X A;  2R2R A;  1VGY A;  2KB2 A;  3TX0 A;  5ITH A;  2DNG A;  2MJN A;  3WIV A;  4YB7 A;  1J27 A;  1FD8 A;  2KFN A;  2V67 A;  2R7Q A;  3TJ9 A;  1F5A A;  2UXD F;  5LM7 E;  4CLT A;  4WTO B;  4OHY A;  1RT2 A;  2I8E A;  2ADC A;  1HWJ A;  4FYV B;  3ETM A;  3MEE B;  2RF2 B;  4N5S A;  2HQD A;  4CO4 A;  1FVS A;  3P6Y C;  2VPZ B;  1P9Y A;  4UTG A;  3K2Y A;  4CNZ A;  4JI1 J;  4K4X A;  2PMH A;  1ZZN A;  3D5M A;  2AZ1 A;  4JI2 F;  5KFI A;  1TAU A;  1HQE A;  4ANE A;  3S7R A;  1OSC A;  2X51 A;  5K14 A;  1SKS A;  2Z8Q A;  1YWX A;  4A8S A;  3CD6 S;  3D7S B;  4GVL A;  4QPT A;  2BJ7 A;  5HMX A;  4DSL A;  2YPY A;  2AJF E;  3U02 A;  1N33 F;  5IV3 A;  1GTH A;  2KI2 A;  1H7W A;  4PUO A;  3TVK A;  5L1L A;  1CS4 B;  4WK3 A;  2KHD A;  3MR5 A;  2EK1 A;  3GSD A;  1CJK A;  2Q1L A;  4LF8 J;  5AXK A;  2OIH A;  2BX6 A;  3SEO A;  2KFY A;  3KK3 A;  2B51 A;  1N36 F;  2JX2 A;  3UDL A;  3MM5 B;  3R7S B;  4O4G B;  3W9J A;  1OS5 A;  1X5S A;  1CJV A;  1FXR A;  4NLY A;  3W2W A;  2W9B B;  2VBZ A;  2YKN B;  3P4U B;  5ETR A;  4RNF A;  1BWE A;  3QIP B;  2KRB A;  1TFY A;  4G65 A;  3MXH P;  3JYT A;  4LF5 F;  1V3Z A;  1JXE A;  5FLX Y;  2QEX S;  4W92 B;  2SXL A;  4A8K A;  1VQY A;  5D4O A;  2O66 A;  3TZY A;  3W2V B;  3T3F A;  1LW2 A;  4X4P A;  2WON B;  2QLW A;  1CQM A;  4URG A;  4FXD A;  4A8F A;  4QYZ K;  1JQG A;  2L41 A;  4HHU A;  1RTH A;  4Q2M A;  2QZ8 A;  5MAO A;  5F8L A;  3AXK A;  2LP4 A;  3ZTR A;  3QLH A;  4WWS A;  2OSQ A;  3G9C A;  2YKA A;  4YR0 A;  1D9A A;  1SKR A;  2JEF A;  3BH7 B;  3T6B A;  1RUS A;  4UY8 T;  3SQO P;  1TEL A;  2PFF B;  5KFL A;  1RWN B;  3VWS A;  3A8I A;  1H3D A;  3R1L A;  4JI4 F;  2FC9 A;  1U1O A;  3KXD A;  1SCJ B;  3PW2 A;  2LXU A;  4DQI A;  2ZEJ A;  3KUH A;  1HNW J;  5A8R A;  1LWE B;  3DLB A;  3R5D A;  2PII A;  3X1L B;  5GAE U;  2PMW A;  4OYI A;  5B09 A;  1X60 A;  3QJJ A;  1WOO A;  3V6H A;  1HNI B;  3RW6 A;  3ZZZ A;  4DV7 F;  3RW7 A;  4LIR A;  2POK A;  2GCF A;  1HBU A;  2WVC A;  1IQZ A;  2KN4 A;  3NCR A;  1VLY A;  2KVI A;  4DU7 A;  2V2K A;  7FD1 A;  3ZNU A;  1S6U A;  2UUA J;  3LAM A;  3Q22 A;  3TUP A;  2RD5 C;  2D69 A;  1KWM A;  4NLW A;  5IXU A;  3HI9 A;  2ALZ A;  2U1A A;  5F0U A;  1MWQ A;  1SV5 B;  4OHZ A;  2BJ8 A;  4AQY J;  3IBW A;  2J7K A;  5DZ6 A;  2N7C A;  3ZC4 A;  3BDE A;  4YR3 A;  2NUU G;  4DG1 B;  4NCA A;  2MZJ A;  3R97 A;  4X4T A;  4DR7 J;  2P9E A;  2R7X A;  1C0T A;  3MM9 B;  3J81 Y;  1S6P A;  2M7S A;  3I0R A;  2IY5 B;  1TUV A;  4MH8 A;  4C8K A;  1AYE A;  1S49 A;  1UEK A;  4ELU A;  4ICL A;  1GK8 A;  2PGC A;  3KJQ B;  3KJF B;  3Q83 A;  1HQU A;  2ZOG A;  3VTI A;  2B43 A;  2ZJQ Q;  4O3Q A;  3UDE A;  3CWJ A;  4ILM A;  1H0H B;  4WFX A;  4DF4 A;  3DLG B;  3CMQ A;  2FD2 A;  5IWA J;  3EZ5 A;  1XER A;  4CP5 A;  5CYM B;  3C46 A;  3KMQ A;  3EE3 A;  1T03 A;  2HK2 A;  2ALY B;  2ZH2 A;  3Q8V A;  1S4F A;  4NLV A;  4IH7 A;  1KLM B;  4I4B A;  4KAI A;  5D8H B;  4P71 A;  3SDE B;  2C22 A;  4P52 A;  3MTJ A;  1HNV A;  1KFS A;  5HL7 Q;  5DQI A;  3KK1 A;  4DMZ A;  3EGW B;  1DZ5 A;  4DCO B;  2AT1 B;  3HT3 A;  4ECV A;  3FCW A;  4NXM J;  1SQF A;  2VBY A;  3TZZ A;  4H4O B;  1KVK A;  2DO0 A;  2YNH B;  3MMA A;  1BWV A;  1SJ4 P;  3UI3 A;  3JQM A;  3A8J A;  2CQD A;  2HFU A;  4RUB A;  4DF8 A;  2CJQ A;  1FVQ A;  2AMC B;  2ZH6 A;  4PAB A;  2GIQ A;  1GX6 A;  2E9T A;  1A6L A;  1LWF A;  4LF8 F;  1NK5 A;  1DY3 A;  1NSA A;  3NS6 A;  2BZ2 A;  3HSJ A;  3LP1 B;  4ZP9 A;  3HHD A;  4WFY A;  1QUP A;  2LQJ A;  3VZI A;  4Y2I A;  2R2T A;  3K5P A;  5D0H A;  1NKC A;  1SJ3 P;  1ELO A;  2JSX A;  4TYB A;  4TU9 A;  2DRB A;  4CZC A;  3ZZY A;  3AXM A;  3NMA A;  2MZQ A;  3CNQ P;  1ZBT A;  3IG1 B;  3G8T A;  3LAL A;  2I6W A;  3BZQ A;  4BC7 A;  5JMN A;  3PZP A;  2CZ9 A;  1L3K A;  3TEG A;  4BWM A;  1X4H A;  3D9B A;  3D1H A;  3VF0 B;  4Z7Y A;  1B3T A;  2XY5 A;  4FKX A;  1RAO A;  5KTQ A;  1IKY A;  4KH0 B;  1KC8 T;  2HQF A;  4JV5 F;  2YPZ A;  5CHC B;  1LK5 A;  3M2R B;  2LU1 A;  3M8P B;  2AYG A;  2KM8 B;  4DL6 A;  2W4C A;  4ZVS B;  2VKZ G;  1AW0 A;  1M5K C;  4MT1 A;  1NND A;  1HYS A;  3F41 A;  3ZTP A;  1U2F A;  4ED3 A;  2OTJ S;  3QRR A;  3OL9 A;  4X4S A;  3H59 A;  4ECX A;  4LF4 J;  2DB1 A;  3US5 A;  1DTQ B;  1CC7 A;  4WK1 A;  2BJ9 A;  1X0F A;  4B9N A;  4FXV A;  3HHL A;  4CLF A;  4LRA A;  1U1N A;  1TUW A;  1WF0 A;  2CPF A;  1KQF B;  3FBC A;  4DXL A;  1R8A A;  3AB4 B;  2L9W A;  4JI6 J;  4NLR A;  4K5S A;  2XEX A;  2XC9 A;  3W61 A;  5H9E J;  4M5K A;  1RI7 A;  2KHC A;  1S59 A;  2EBG A;  3B54 A;  3OXF A;  3UW1 A;  2UUA F;  1WC6 A;  3TVZ A;  1BGX T;  2DYA A;  1F1B B;  3LWM A;  3QBC A;  4NI2 B;  3EVO A;  4JBC A;  2DH8 A;  5KFE A;  3RBD A;  2QMU B;  4CO3 A;  3RAX A;  1P27 B;  3HCX A;  2UXB J;  1K0T A;  2R4F A;  3FRZ A;  2KYZ A;  3GII A;  5HVF A;  2H5J B;  4PG4 A;  5BJR A;  1HIY A;  3IRW P;  2D3O 1;  3VQS A;  3FQK A;  4G1I A;  5T7L A;  4D3G A;  3BBF A;  2CQP A;  3C6T B;  3KK2 B;  3IGN A;  1Y11 A;  1R8C A;  4ED0 A;  3RRK A;  4FS2 A;  2V68 A;  4USI A;  2NQP A;  3M2U A;  1KFD A;  2YVS A;  3QIP A;  4OZL A;  3ZTQ A;  3IR7 B;  4C8L A;  2GQC A;  3KLE B;  2YXL A;  4EU0 A;  1EAY C;  4F36 A;  4DFK A;  3D2W A;  2B8Q A;  4YDX A;  2XO6 A;  1S9G A;  3WDO A;  1S1T B;  3SMZ A;  4RKU C;  1Y7P A;  4NCG B;  2Y0B B;  5A76 A;  2KM8 C;  1NK9 A;  5IWA F;  4E2F B;  5F8G A;  1TV6 A;  4YY3 F;  1UEU A;  3LWL A;  1NSK L;  1DRZ A;  2BEF A;  2G0C A;  1ZM3 A;  3H2U B;  3CSK A;  2FZK B;  1YBA A;  3OBI A;  2DGV A;  4CO1 A;  3B6B A;  2KFZ A;  3GON A;  2C28 A;  5D4P A;  1R0A B;  1JLC B;  1Y10 A;  2LLZ A;  2CVI A;  3OFH A;  3IWX A;  2Q6C A;  1M90 T;  1Q5Y A;  3A4T A;  3OTB A;  4FYW B;  4J7C A;  1WEY A;  4WE1 B;  2DGS A;  2EI5 A;  3ETO A;  3BSO A;  2DGW A;  1PJ6 A;  3BR9 A;  4EUV A;  5E3C A;  3ULH A;  2HFO A;  4NZ0 A;  5GMK a;  5E3A A;  3CO9 A;  3HPO A;  3TJA A;  4C8Y A;  2QX0 A;  2MQN A;  1Y00 A;  1W2B R;  1WSV A;  2YWF A;  4KKO B;  1CJT A;  3RB3 A;  5DG8 A;  1HBN A;  4GVB B;  4O23 A;  3M6X A;  1WEZ A;  4KO0 B;  1TKT B;  2NPF A;  4LIW A;  5D4L A;  5KG1 A;  2MZ1 A;  2IBO A;  1FKO A;  4RW8 A;  5IS2 A;  3E01 A;  4J9N A;  4F7V A;  4M8L A;  3H2L A;  3CJQ A;  4NZ6 A;  4K50 A;  1OJ4 A;  1X7V A;  2VQF J;  1RIS A;  4M5D A;  4QIG A;  3OLB A;  1EET A;  1N6Q A;  2LQ9 A;  2B7B B;  3UD4 P;  3FDS A;  3DLL Q;  4W90 B;  3UDV A;  4LRE A;  1F60 B;  5E33 A;  1FRK A;  1N5Q A;  2BJE A;  1IBL F;  3NCP A;  4RW6 A;  2VIH A;  2RHS B;  3SQG A;  2M70 A;  1VJW A;  4TYA A;  1SB6 A;  4RJV A;  2BOA A;  2ZH4 A;  4WKR A;  1SIW B;  3EDR B;  5C25 B;  3QGG A;  3DOM A;  5EDW A;  2EFV A;  2XHW A;  3NWR A;  3MR7 A;  2CDQ A;  4DEZ A;  4NLQ A;  3EGZ A;  1RB0 A;  5EN1 A;  2ZHA A;  2GHP A;  2ZUA A;  3RUB L;  4H4O A;  2DH9 A;  3M8W A;  4DFP A;  1K44 A;  3VVT A;  2R2U A;  3CB4 A;  1WG4 A;  2OFG X;  3F73 A;  4M94 A;  4KY3 A;  4WFN Q;  2AW0 A;  1CVJ A;  2VFS A;  4DCP B;  1JJC B;  4O3N A;  1YVF A;  4CLY A;  4DV4 J;  3P5B P;  4FZV A;  3S1T A;  4IFV B;  4MYU A;  4NLP A;  4NA1 A;  1Y4Z B;  3L09 A;  1NEE A;  2PI5 A;  3PO4 A;  4OL8 A;  1RHU B;  2D9O A;  1RHJ B;  4ECU A;  1I94 J;  3UNY A;  3QJL A;  5F0W A;  2OHD A;  2CQ2 A;  1XMQ F;  1VR6 A;  1IM4 A;  5L1J A;  5B0G A;  4DUZ F;  2VDH A;  4J9V A;  5LJ5 Y;  2VV5 A;  2KZM A;  3P3D A;  1VRQ C;  3AD8 C;  2IM3 A;  3RAM A;  2MGZ B;  5A8W A;  2ROE A;  2J5A A;  2RNE A;  1Y3K A;  2GJ2 A;  5AE1 A;  1LNQ A;  3SI8 A;  2BAN A;  3NAH A;  4HAC A;  3IM9 A;  3N6N A;  4JI3 J;  1Q95 G;  4ZCM A;  1VQN S;  1VQ9 S;  3M8P A;  3IR5 B;  1K0V A;  4FYY B;  2R7T A;  3E3X A;  1RT5 A;  1T02 A;  1ZM2 A;  2VPW B;  3ZZR A;  1QDU B;  2VC0 A;  1UFK A;  1UKU A;  2VH7 A;  3RRH A;  1TL3 A;  2ZUG A;  3LP0 B;  4DSJ A;  3S8S A;  1HMV A;  4ZLL A;  4AFF A;  1U6B A;  2RS2 A;  3CVK A;  1BY9 A;  2V4Q A;  4KTQ A;  4B02 A;  1N32 J;  5E2Q A;  4KV8 B;  4LSN A;  4DL5 A;  1BUX A;  4WXO A;  2CG4 A;  3C19 A;  2MYF A;  1RT7 B;  3W9I A;  4C11 B;  2VJV A;  3LW5 C;  2X7I A;  1VRT A;  5EHH A;  1IQT A;  1Y0H A;  2QN6 B;  1QLN A;  1B0T A;  4V19 J;  1RZM A;  1XNQ J;  1DJ0 A;  4NLD A;  2OI2 A;  3MGJ A;  4RW7 B;  2YWG A;  4B3R F;  2J0X A;  1OMS A;  1JLQ B;  5ETT A;  2ZH8 A;  3FJ2 A;  2EFN A;  1FCA A;  1X8D A;  4NI2 A;  1AUS L;  2A10 A;  1FWL A;  1VQ7 S;  1KRP A;  3OFE A;  2ILY A;  1QUV A;  2RDD A;  4YDD B;  2FLL A;  3R2C J;  1VC0 A;  1OIA A;  3N6M A;  4OHW A;  2HVH A;  3IXQ A;  4OIX A;  1X4A A;  1HD0 A;  3HMJ G;  3HP6 A;  1T05 B;  3OVS A;  1DUR A;  3NCQ A;  1BQM A;  1TKX A;  5HLF A;  1OPI A;  3EJM A;  4PWD B;  3KJV B;  1MRO A;  3FSX A;  2VQF F;  1KHW A;  5HI7 A;  5KFS A;  4HR2 A;  1KN6 A;  1IBM F;  2V2Q A;  2Y1R I;  5D6G A;  3KLE A;  3FK4 A;  2QSF A;  4PZV A;  2FHK A;  4NOH A;  1EP4 A;  4ZVF A;  3RU0 A;  4EYH B;  1X31 C;  2D9P A;  4OZ0 A;  1NU4 A;  1YGY A;  2BM0 A;  1CEZ A;  5FII A;  3W8P A;  2H48 B;  2QL7 B;  2F65 A;  2J0W A;  2E1C A;  3OXG A;  1KDN A;  1CLF A;  4DZD A;  2BVZ A;  4OZ5 A;  1C1B B;  1OQ3 A;  4OHV A;  3BYP A;  4IRD A;  4Y0F A;  4UOH A;  3DI6 B;  2GS8 A;  4FNI A;  3GYG A;  4ED6 A;  4RNN A;  2OD4 A;  4Y2K A;  4PQU B;  1U0H A;  3NS5 A;  1KS2 A;  1Q86 T;  1RCX B;  1PBA A;  1IUJ A;  1CBK A;  4NLT A;  2QA4 S;  2MDA A;  4F3Q A;  2KDO A;  5SUH A;  3CJK B;  3ITH B;  1GXT A;  1C0U A;  3BSN A;  4ECQ A;  3MF5 A;  4DV4 F;  2UVW A;  3C16 A;  5KG7 A;  4IG0 A;  1VIS A;  3UQS A;  3DLK B;  2HVI A;  3MD1 A;  3BGR A;  1KVJ A;  4MJK A;  4DV2 J;  2KG1 A;  2DNY A;  2KU7 A;  3F44 A;  1I94 F;  2DNO A;  3K8W A;  1XMO J;  4DN0 A;  1JJH A;  1JLG A;  4PG7 A;  3KKF A;  2OP5 A;  4G1Q A;  1RHK B;  4DL3 A;  3G6E S;  1RT6 B;  2PT0 A;  3Q8P B;  3S01 A;  3Q89 A;  3PR5 B;  1RWU A;  3LAN A;  4O3P A;  4OI0 A;  3AHP A;  2E5L F;  3SCI E;  3K8V A;  1RT3 A;  4ZIT A;  1HNX F;  2XUL A;  4ZIV A;  3DDK A;  5K8P A;  2W9C A;  1REV A;  2XG8 A;  1S5Z A;  1WKJ A;  2WVF A;  1M0S A;  4HTI A;  5CQG A;  2ZFH A;  3N6L A;  4LR7 A;  2DIV A;  2EKY A;  4TY8 B;  2MMY A;  2E1R A;  1RK8 A;  4PG6 A;  3HSD A;  4BCA A;  2C2K B;  1B70 B;  1PC5 A;  1Q8L A;  5FLX U;  1TKD A;  4OYP A;  2ZE2 B;  2DHH A;  3I32 A;  1RKJ A;  4BHQ A;  1N32 F;  2X1B A;  3FCH A;  1UVL A;  1YRX A;  4R5P A;  3C15 B;  4ECS A;  2KT3 A;  1TMJ A;  1ZTW A;  4TQS A;  1YJT A;  5C25 A;  4GO7 X;  3MCO A;  1N54 B;  2OFH X;  3HVR A;  4C8Z A;  2XGP A;  4K0K J;  4DV0 J;  1RE1 B;  4HKQ A;  4N77 A;  2CXE A;  4BLG A;  3PY8 A;  4RW9 B;  2QSW A;  2HLU A;  2W25 A;  2V4J A;  4PQA A;  2WRM A;  5LXR A;  3T1H J;  5LL6 d;  2FVP A;  4UQG A;  1HHS A;  1QAI A;  2J76 E;  2Y3Y A;  2GMJ A;  3DM2 B;  1M5O C;  3GR0 A;  2HGL A;  5KFO A;  3SSR A;  1VQ6 S;  1UZH A;  1U1P A;  2E9Z A;  2D7S A;  5KG5 A;  4HL9 A;  3J80 Y;  2C2O B;  1H7X A;  3QT8 A;  2MB0 B;  5HRO B;  1NCL A;  2O1P A;  2CJK A;  4X4O A;  4U96 A;  2CWK A;  4AT1 B;  4OX8 A;  2CRL A;  4F0M A;  3H98 A;  4RUH A;  2ZJR Q;  2K8G A;  2DHG A;  2WVE A;  5KFP A;  3LOU A;  1IR0 A;  5J2P A;  4F02 A;  1SQG A;  3N5F A;  1WJ9 A;  2G0I A;  1WHY A;  4DV5 F;  1KEK A;  3H5S A;  2XSJ B;  4I56 A;  1I1G A;  1FD2 A;  3KG1 A;  1UA0 A;  2VG7 B;  1BC6 A;  3LP2 A;  3GE9 A;  4Y2M A;  2FVS A;  4BBY A;  4ZVQ B;  2OUG A;  3ONQ A;  2ZOF A;  2HYI B;  1SKU B;  4RBT A;  1RWW B;  1HBM B;  3J81 U;  2RRA A;  3HDS A;  1LXN A;  3JSR A;  3OFF A;  3G4S S;  2Y8Y A;  2WTF A;  4L72 B;  1TR0 A;  3FCV A;  1SH3 A;  4C8O A;  3MCM A;  4P73 A;  1NHK L;  4CT8 A;  2FJD B;  1N0U A;  4QYR A;  3BQ0 A;  3CC7 S;  5I3P A;  2V34 A;  3ZTO A;  3QYY A;  2HVD A;  4FBU A;  2ILZ A;  3KUG A;  1TKZ B;  1K9M T;  2IDE A;  1DAX A;  1DQA A;  3KLH B;  4CTA B;  1FNM A;  4C11 A;  3VCD A;  1F5B A;  1FEH A;  1Q1K A;  1VQM S;  2QO3 A;  2ZDO A;  2ACM A;  4KSE B;  3K0J A;  4YB6 A;  5B0D A;  4NLU A;  1J5O A;  2EFO A;  2ZZM A;  4FXW A;  4K4S A;  5HK4 A;  4NEZ A;  1VQO S;  4DV3 J;  3UPF A;  1JLQ A;  1SL1 A;  1R43 A;  3TA2 A;  1KBR A;  2VD3 A;  3JAM Y;  4ZP8 A;  2XCP A;  5J1E B;  3PW0 A;  1JXL A;  3I0S B;  3PYF A;  1M1G A;  2BMB A;  4IUF A;  1KQG B;  1LWX A;  3GV7 B;  1XEZ A;  2WSE C;  2HNY A;  2FHJ A;  2F4F A;  2JLE A;  3CE8 A;  2M52 A;  1HWU A;  2V69 A;  5KFK A;  2D3U A;  5F8N A;  3OUY B;  2P9G A;  2BR0 A;  2Q79 A;  2GC8 A;  4M95 A;  3L9Z A;  2UUT A;  4WXW A;  1R31 A;  2JNJ A;  2BA9 A;  4J90 A;  2Z4P A;  3DRX A;  3MEK A;  2R8H A;  3D6M B;  2E1M C;  3TUJ C;  1G4C A;  1UA1 A;  2VBW A;  2HG4 A;  3MED B;  3M1V A;  5E3P A;  2DCL A;  2XQC A;  1P9Q C;  1XN9 A;  1ZS6 A;  2HFS A;  3JSM A;  1EHW A;  3PW7 A;  4DFJ A;  1N5V A;  3IS9 A;  3R6L B;  3NOG A;  2BE2 A;  2WW4 A;  5CAA A;  1KTV A;  1FRI A;  3CME S;  5FD1 A;  1OWX A;  1BHN A;  2ZBQ A;  4KGX B;  2ZD1 B;  5HQ8 A;  4ZVU B;  3OSN A;  3MFI A;  1XR7 A;  2W2P P;  3AB2 B;  3Q8S B;  3CJ5 A;  3THP A;  3IN5 A;  5GAG I;  5GAH U;  2FJE B;  1TL1 A;  2BV3 A;  4DR2 J;  3K58 A;  4OYZ A;  3IRX B;  1KD1 T;  1WF2 A;  3DGV A;  4X62 J;  2X3D A;  3QGI A;  3FEZ A;  4BDP A;  4QU7 A;  3C14 B;  4OLP A;  4XDD A;  4RU9 A;  3H40 A;  1FKP B;  4USV A;  1NME B;  3KLI B;  5DJB A;  1HI1 A;  4UZC A;  4KPY A;  2H4W B;  3SV4 A;  5FDL A;  4LRC A;  1WI6 A;  4AD6 A;  2VG6 A;  1S99 A;  1UWB B;  3PFO A;  1HAR A;  3CED A;  2HQI A;  4DUY F;  1X4E A;  4IR1 A;  1O8B A;  3BKU A;  1EX8 A;  4ES3 A;  5D78 A;  3GR1 A;  4IG3 B;  5CYQ B;  3J7Y I;  3GJT B;  4EZ9 A;  5DDQ C;  3O1L A;  1Q78 A;  2E5H A;  3GG1 A;  2B56 A;  1VFJ A;  2MQM A;  3VGV A;  1DHM A;  3KLF B;  4WU3 A;  3GPA A;  4H4M B;  2MQQ A;  1QVF R;  3PX0 A;  3SBM A;  4LFB J;  5E3Q A;  3T9Z A;  4AXJ A;  3C6U B;  4Z37 A;  2M5Y A;  4ZP6 A;  3MOJ B;  2VPY B;  3W9H A;  5KAK A;  3ISZ A;  4K7Q A;  3EDQ B;  4A8O A;  3HHL D;  4Y2A A;  3PX4 A;  2KT2 A;  1IWA A;  1HA1 A;  2HKE A;  3TZW A;  3QT7 A;  2VL1 A;  5HN0 A;  5ETQ A;  3KNG A;  2V8P A;  2Z58 B;  3UD5 A;  3TX8 A;  1X9M A;  4WP3 A;  1SL0 A;  2ACY A;  2BXJ A;  2KYX A;  2OPP A;  2AGO A;  2QTW A;  2HS3 A;  1YRU A;  2YX1 A;  3G6V A;  3VAI A;  4DR6 F;  4M5G A;  5KFZ A;  4WPA A;  2IVF B;  4KRW A;  3UN5 A;  3QSY B;  2XSF A;  4USW A;  2U2F A;  2LQ8 A;  1FDD A;  3NNH A;  4IO1 A;  3D6T B;  1SJF A;  3FQL A;  1FX4 A;  3HHN B;  3KLG A;  4ECZ A;  4HT5 A;  3GWC A;  2UUC F;  2FDN A;  2J0Q D;  1HPZ A;  4OZ1 A;  4L76 A;  3GIL A;  3QO9 A;  3M8Q A;  3ZZO A;  4RW4 B;  3UCU P;  4PWU A;  4EZ6 A;  4RX6 A;  4A47 A;  4K8R A;  3D68 A;  1SXL A;  3UVJ A;  4USJ C;  3OFG A;  5DM7 Q;  5LSR A;  1RKI A;  4EO6 A;  2CJX B;  4ZPT R;  2VZ9 A;  3PAC A;  3M32 B;  1FKA F;  1N4L A;  1U2R A;  4DDF A;  4MAK A;  4NEY A;  3ADA C;  1M1K T;  3DCA A;  3HHE A;  2FJA B;  3W64 A;  4TN2 A;  3MCS A;  3KMS A;  3TP2 A;  1FRJ A;  3VGT A;  1N5Y B;  1W26 A;  1JLE A;  3DRS A;  2MJU A;  3P45 B;  1WDT A;  3V81 B;  2OEJ A;  2R7R A;  2VKR A;  1HBM A;  3U27 A;  4CO0 A;  4UOG A;  4UF4 A;  3IWL A;  4JV1 A;  3CO0 P;  3U1N A;  1FK9 B;  4X64 J;  1T94 A;  2XHC A;  1UMJ A;  1BLU A;  1RDR A;  3CDE A;  5KFM A;  4LFC J;  2EC0 A;  2ZH1 A;  3UR0 A;  3CT9 A;  2BW2 A;  2BW7 A;  1MLA A;  4LQ9 A;  5EX0 A;  1JKH B;  1R27 B;  2PDA A;  1RP5 A;  4ZPD A;  5J2N B;  2QA2 A;  2NLW A;  1I3O B;  2MKH A;  2R7V A;  1WSR A;  4AL6 A;  4N56 A;  3POT B;  4ZIW A;  3DN9 A;  4B08 A;  2HMI A;  1ZAX A;  4DR2 F;  1S57 A;  3MPU B;  1R8H A;  5U47 A;  4X62 F;  5SZT A;  3BR8 A;  3JB9 k;  1RWV B;  4KR0 B;  3QQC D;  1Q5V A;  3V6D A;  3BM7 A;  3L3C A;  1JLF B;  3ENA A;  4I7F B;  1V3R A;  1QVG R;  1X5O A;  2JC0 A;  3FSY A;  4C3L A;  4EMD A;  3HD2 A;  4LT6 A;  4IKA A;  5K5M A;  2QIF A;  3ISN D;  4LFA F;  2ZNZ A;  2VG5 A;  2UVU A;  4KHP F;  3I0S A;  3EXY A;  5IV4 A;  5IM0 A;  4B3O A;  2DXE A;  2MKY A;  5J2M A;  2G1H A;  2CPY A;  5C24 A;  3TNV A;  1L3S A;  3CCE S;  1U0S A;  3KNA A;  5GME A;  2W7O A;  1QTM A;  4MFB A;  2PA3 A;  3OUY A;  3CIM A;  2H5I B;  3SSQ A;  1S6Q B;  2JEJ A;  1E6V B;  4I2Q B;  5B0A A;  4AND A;  5HBM B;  4M63 A;  1SUQ A;  2LEB A;  3V2U C;  3Q8R B;  2KL8 A;  4ZVG A;  1ITP A;  1FHT A;  2CYY A;  3PHT A;  1NJI T;  4LFB F;  1RU2 A;  1YQH A;  1NJY A;  1SJQ A;  2CNL B;  3MED A;  1F2H A;  2HAI A;  3CPW R;  4J9U E;  2RDJ A;  4DSK A;  2H4Y B;  3I5B A;  4KFB A;  1VC5 A;  3S6E A;  3UD3 P;  2UU9 F;  4JV2 A;  2ZKU A;  5G4D A;  2V2Z A;  5L38 A;  2Y9H A;  2R8I A;  3M8Y A;  1VIO A;  1S6O A;  3MUR P;  4ZHR A;  4DUT A;  3FFI B;  1HWK A;  2W9A A;  1YSJ A;  2QLX A;  2FHM A;  4P9S A;  5I3U A;  4WYW A;  2XO7 A;  3DRR A;  1T7P A;  3RRG A;  5L46 A;  3WIU A;  1XIQ A;  1NKB A;  2LEC A;  1KQS R;  2ZHB A;  3GP9 A;  2KVQ E;  3HZE A;  1CG2 A;  2F3J A;  1N56 A;  1NM2 A;  3GLJ A;  5ETM A;  4I67 A;  1QTN B;  4ID5 A;  1ZPV A;  2ASD A;  3TAM A;  2YQ3 A;  2DNM A;  2UUB J;  4NA3 A;  1MN9 A;  2R8J A;  1X5T A;  4UY8 5;  3C14 A;  2JL9 A;  2D3Z A;  4I6A A;  5GAD I;  2CPI A;  4DFM A;  4F4Y A;  3H5Y A;  1TK8 A;  2G13 A;  2VU5 A;  4FNH A;  4PXE A;  3KLI A;  4U8V A;  3HLU A;  3W5Y A;  2EFQ A;  4M1K A;  5M2R A;  4ZLJ A;  4K2X A;  1GXU A;  2K7J A;  1MU2 B;  3DOL A;  2XM3 A;  3O44 A;  5A0Y B;  3OTO J;  2MKI A;  1RAD B;  4OX9 F;  4XIU A;  3AOB A;  1WNE A;  5G0R B;  2H51 B;  2C3M A;  2CQ1 A;  2NPI A;  2UXD J;  2WOM B;  2N3O A;  3ZZT A;  1VBX A;  4DX5 A;  2JJ4 D;  2CPD A;  3HZG A;  1RXO B;  2BUN A;  4ZN3 A;  4GC6 A;  2RS8 A;  1PBU A;  3NGT A;  1M5S A;  2MZT A;  4YB1 P;  2HFN A;  3NGK A;  3MM6 B;  2RHQ B;  4EI2 A;  3MM7 A;  3DXB A;  3UNG C;  4L74 A;  5CXT A;  3M9M B;  4JI2 J;  2QFJ A;  2HRT A;  4EEY A;  1CJU A;  3FZ2 A;  2LVW A;  3QFH A;  1RBO B;  5HQM A;  3V5R A;  1ZM9 A;  4A8W A;  1HFE L;  1N33 J;  3D66 A;  4IRK A;  4HEA 9;  5AJ3 F;  2H54 B;  3KDO A;  4F04 B;  2Z30 B;  1WHX A;  2RKI B;  1NLK L;  1FNO A;  3QWU A;  3VGS A;  5C42 A;  4LQ3 A;  2E5I A;  1EZZ B;  4D3H A;  3DOK B;  2GVD A;  5EX3 A;  2DXD A;  2DY1 A;  2G1D A;  3QJP A;  1N36 J;  1U24 A;  3M2V B;  5ETK A;  3TYT A;  2ZKT A;  2J0S D;  1CQN A;  2EG2 A;  2QLB B;  2GX8 A;  3MM8 B;  1NUE A;  3IMQ J;  1WG5 A;  3QNW B;  3OJS A;  1JLB B;  3Q8U A;  2RSQ A;  3MD3 A;  3B82 A;  3FBB A;  3MPV A;  3BO4 A;  3X3U A;  2DKO B;  1HI8 A;  2HHH F;  4K59 A;  1FO1 A;  4RW4 A;  4LF5 J;  1RLD A;  1S77 D;  1VDH A;  3LGM A;  3EYZ A;  2IMW P;  1Q0N A;  1AB8 A;  2NS1 B;  3H5X A;  2RH3 A;  4R8U A;  1H98 A;  2XTJ P;  1DLO A;  2V63 A;  2EKN A;  4ZVP B;  1YJ7 A;  2P6S A;  3M32 A;  2HQ3 A;  4N47 A;  1FJG F;  3ELH A;  5M2P A;  5IT4 A;  1X5P A;  1YI2 S;  2WSF C;  4E98 A;  4B17 A;  3FEX B;  1CPZ A;  4ZPC A;  1V5I B;  1B0P A;  4JI4 J;  2HWT A;  1WOS A;  3H4D A;  2KJW A;  1CUL A;  3IFE A;  5HVG A;  2HQG A;  2IVY A;  1JWW A;  1NK6 A;  1NJW A;  2YBV A;  4NRU A;  4WYL A;  2NZC A;  3G71 S;  4ZCL A;  4P74 A;  2QL5 B;  3EVM A;  3K5M A;  4X4R A;  1FK9 A;  2V5H G;  1M1H A;  2HWI A;  3GFH A;  4DV7 J;  2JWN A;  2CQ4 A;  2YWE A;  2DJW A;  2W4P A;  5LSO A;  1IKW B;  1UPM B;  1O51 A;  2DBB A;  2IJR A;  2ZVI A;  3IR6 B;  1QSY A;  1PAE X;  4K5R A;  1TP7 A;  4ZA1 A;  4CWB A;  3TAN A;  1YIT S;  2Z2Y B;  4OX6 A;  3HHK A;  1FXL A;  5GVQ A;  3OR2 A;  1AZS B;  4DQR A;  1S1W B;  4DPU A;  3HFV A;  3SIP B;  4RL1 A;  3H8Y A;  5LJ3 Y;  4QR0 A;  1VS3 A;  5KT5 A;  2MHN A;  4DLG A;  2RVJ A;  4Y00 A;  1S1X B;  5D0G A;  4PYA A;  1RTI A;  3UN2 A;  1NHU A;  4KB7 A;  5J2Q B;  4Y65 A;  3UCZ P;  1U1Q A;  1G6B A;  3DGP A;  1L3V A;  2H9Z A;  4S0M A;  3AA8 A;  2DVI A;  5ETL A;  5IFM A;  3LPE A;  3DLH A;  3JTP A;  5LSL A;  4ID8 A;  3TQ1 A;  1LOU A;  3TQE A;  1TVR A;  3OD2 A;  2FC8 A;  2LQB A;  4YR2 A;  5J1P A;  2DT9 A;  1X4C A;  5KFJ A;  3J80 U;  1DBD A;  4C2M A;  3CJT A;  3OTO F;  1YTY A;  1Z4U A;  3QSI A;  2FIU A;  2M3D A;  2QLF B;  1SPB P;  2YX4 A;  3CW2 C;  3ZNJ 1;  1PG5 B;  1S48 A;  1HBO A;  3NP5 A;  1K8A T;  5DZ7 A;  4LRB A;  4CRJ A;  1P1T A;  1HHQ A;  1HL6 A;  3CDA A;  1WHV A;  3D1O A;  3K89 A;  4YUD A;  3W7B A;  3HSZ A;  3A8K A;  3MPD A;  4FPR A;  3NBP B;  4FS1 A;  1H6K X;  3WC2 A;  2OEK A;  2IM2 A;  2C1E B;  2J6S A;  4CYU A;  2UZA A;  3DMJ A;  2RE1 A;  1IKX B;  2ZC3 A;  5F8H A;  2FYX A;  4KE5 A;  2GJF A;  3WX4 A;  4IR9 A;  1Y9O A;  4CQ1 A;  2PC6 A;  2B9E A;  3V4I A;  2JEI A;  3MMJ A;  2OPR A;  3PDN A;  2YWH A;  1UW9 A;  4L3K A;  1YZ7 A;  3BKT A;  5CCM A;  2I9S A;  2EFG A;  3FFI A;  3DHW C;  3QPI A;  4EBD A;  1ARO P;  5IQ6 A;  1RAA B;  5LMN F;  2FVQ A;  1E6Y B;  1T9T A;  2XMJ A;  4EBE A;  4FYX B;  4P7T A;  2DNZ A;  1B99 A;  1TUG B;  1JNZ B;  2QMW A;  3OPK A;  5A2Q Y;  2IRU A;  2PEH A;  3MAA A;  3TZX A;  1S12 A;  4DPO A;  3CCR S;  4GKJ J;  5A6P A;  3RTV A;  1P6T A;  3P5T L;  3R7B B;  2MKK A;  1NKE A;  3HUL A;  2L9D A;  1VRU A;  4OV6 A;  4EGL A;  5EWF A;  1RT4 B;  2JHE A;  3OL7 A;  3GSI A;  3GV8 B;  5FJ4 A;  1DTT A;  2HBY B;  5BYS A;  1RWK B;  2KG0 A;  3VGU A;  3MTK A;  4F3O A;  2VFV A;  2GMH A;  4DN9 A;  2LKZ A;  2RRN A;  3JTO A;  4DPX A;  2YNF A;  4X2B A;  4GO5 X;  3T9N A;  5IC4 B;  4O44 A;  3MEG A;  5H9F K;  5L1K A;  4JV5 J;  3VR1 A;  1WTB A;  1RT1 A;  2HNZ A;  3HSG A;  1OY8 A;  4AL5 A;  3DYA B;  3A8E A;  4QZV B;  4IOA Q;  4F4Z A;  2GO8 A;  5KT4 A;  2R9L A;  3R5C A;  5A8K A;  4W4M A;  2RU9 A;  2XWY A;  5A0Y A;  1QE1 A;  5IT0 A;  1NPR A;  1QSL A;  3QFW A;  2BJD A;  4ENO A;  1J5E J;  1SIZ A;  4DR5 F;  2JVR A;  4LF6 F;  1S1V B;  2GQ2 A;  3M30 A;  4IFY B;  2W1B A;  4WJB A;  4CNY A;  4EK2 A;  2LA4 A;  4LUB A;  1FER A;  4JI0 F;  1NK4 A;  3NG8 A;  3LF0 A;  4B9T A;  2WHO A;  4OYB A;  2XMU A;  1GEH A;  1FFG B;  5B0C A;  2W7P A;  2GO9 A;  2ZJP Q;  3HM9 A;  2IAJ B;  3DC2 A;  2XB2 D;  3T1A A;  2YNG A;  4HH1 A;  4DSF A;  4LSL A;  2FLO A;  3U7J A;  4QIF A;  1FT8 A;  3VQT A;  2BRK A;  1I6J A;  2N4C A;  4DX7 A;  1GX5 A;  3LO3 A;  4ATN A;  3MI7 X;  4WFZ A;  4L6V 3;  3O6Q A;  1U1K A;  2MQ8 A;  2ZVS A;  1FRL A;  2QJ3 A;  1WEX A;  1G3O A;  1MWY A;  3OVA A;  1YJW S;  5GMD A;  3RAQ A;  1U45 A;  4NLS A;  2HND B;  1NPP A;  1NJZ A;  1NBE B;  2B4V A;  3KFW X;  3W8G A;  3HKZ D;  2QGF B;  3HJV A;  1JLB A;  4QBU A;  2K1R A;  4QOT A;  4X4N A;  3CUN A;  2OLW A;  3OSP A;  3OVB A;  5ETO A;  4QIV A;  1AUD A;  2V0N A;  2YTC A;  4OZN A;  3ZFV A;  2QLJ B;  4JI5 F;  2IM1 A;  1R6V A;  1EKR A;  1FRM A;  4UOF A;  1VQK S;  4AUK A;  2V8V A;  2WVD A;  4IDK B;  1JB0 C;  3TO8 A;  2ZBR A;  3GYN A;  4UW2 A;  2I1R A;  4ZVE A;  2BM1 A;  3RR8 A;  4Q45 A;  1URN A;  2X1G A;  2J7U A;  1RJJ A;  3MFH A;  2WSC C;  3O8W A;  5BYR A;  4YY3 J;  5KG2 A;  2DHS A;  4GKK J;  5DDP C;  3P96 A;  1S9E B;  2HRU A;  3HVT A;  3RB0 A;  5HP1 A;  1TL7 B;  2EK6 A;  1VHI A;  4U7U K;  4DR1 F;  2CIM A;  2HGM A;  1S7H A;  2HFZ A;  2LYV A;  3MMB B;  2GNK A;  3BB5 A;  3DRP A;  5HMW A;  5KFD A;  4X4Q A;  3MMC A;  3PIP Q;  2ZZN A;  1G1X A;  2A0F B;  2W01 A;  2Y1J A;  2GVZ A;  2RQ4 A;  4CO5 A;  4FF4 A;  1RTJ A;  5AXM A;  4MIB A;  4Q0B A;  5IC6 B;  1RTZ A;  3FUY A;  4PPD A;  4OJG A;  2YKM A;  3NEK A;  1WEL A;  3CD7 A;  1YJ9 S;  2HHP A;  2N82 B;  1S0M A;  5IT9 Y;  3EVW A;  4NCB A;  2B8P A;  2DD8 S;  3MCN A;  5KFF A;  2B6A B;  2W24 A;  1FA0 A;  2MST A;  2H1Y A;  4R0E A;  1LW0 A;  1S0N A;  3D67 A;  3L7P A;  3KHH A;  4GKJ F;  4KJI A;  3JTN A;  1RYS A;  2XMW A;  2I5J A;  1MNE A;  3QRQ A;  1Q82 T;  1HW8 A;  2HHQ A;  5CD4 H;  3TUZ C;  4ED5 A;  4MK8 A;  3OR1 B;  1H73 A;  3SCJ E;  3CJ3 A;  2ROP A;  1JIH A;  4PEO A;  4X65 J;  2FY8 A;  2I0X A;  2LFV A;  3JQJ A;  4RNM A;  3KG4 A;  1RTD A;  1Q4R A;  2COL A;  2GV1 A;  2QA1 A;  2GGP B;  2XZD B;  2OPS B;  4K2J A;  2HAF A;  2KH9 A;  5BXI A;  5D3G B;  2IC3 B;  1JNR B;  2XMM A;  4O0N A;  3K5O A;  4NXN J;  3ET6 B;  3H4B A;  1AFI A;  2XGQ A;  2QL9 B;  1J5E F;  2B9X A;  3KHG A;  1IBL J;  3ZZP A;  1RHR B;  4K4U A;  2JVO A;  2J6U A;  4ZOS A;  2ZH7 A;  3MEE A;  2RF2 A;  2DHX A;  4V19 X;  5F8J A;  2APO A;  3PCO B;  1IWG A;  4F26 A;  4B9S A;  1WC0 A;  3BH6 B;  1NHV A;  1HR0 J;  3GJR B;  2XZT B;  3TOQ A;  5D15 A;  1T9U A;  1KKH A;  1N52 B;  3I87 A;  1GQE A;  4CM0 A;  1IR1 A;  1DQ9 A;  1HQE B;  1CS4 A;  1NH7 A;  2R7U A;  4GMK A;  3VAH A;  2AJQ A;  3OW2 R;  5K14 B;  1Q79 A;  3PRV A;  2CPJ A;  4X66 J;  4LBP A;  2DIS A;  3GIM A;  1S7I A;  1XNR F;  2RQK A;  4ED8 A;  1U1L A;  3CJ2 A;  4PUO B;  3MM5 A;  1N5S A;  9RUB A;  4O4G A;  4ZN1 A;  4P10 A;  1CJK B;  4F3M A;  4KT0 C;  1HQ2 A;  1XMQ J;  5CA5 A;  4IH6 A;  3KK3 B;  4DUZ J;  1I5O B;  2HEK A;  2VFU A;  1S10 A;  2W9B A;  5KFR A;  2YKN A;  4LRD A;  1Q7L B;  2VUG A;  1SI9 A;  2K06 A;  4YQW A;  3EUN A;  4UUX A;  4EO8 A;  1CJV B;  2VAS A;  3BGU A;  2RIJ A;  4B3T F;  3W2W B;  3W2V A;  4CM2 A;  2CJY B;  1MWZ A;  2F9D A;  2WON A;  4ECR A;  3M4X A;  3JYT B;  4J37 A;  4HT7 A;  1UEV A;  3SCK E;  1EQM A;  4NLO A;  1H72 C;  2AX1 A;  1FWP A;  3BPS P;  1P1L A;  3RB4 A;  4ZDN A;  2C3Y A;  4GKK F;  2G2Z A;  3NNC A;  5K8N A;  1RTH B;  3OQ2 A;  3QLH B;  1Q7Y T;  1B4S A;  2IFX A;  2GHV C;  4ED1 A;  2A6M A;  1MML A;  4DOZ A;  4LSZ B;  1H74 A;  4DCJ B;  1Q8B A;  4ES1 A;  4F8R A;  1B64 A;  2IPO B;  3J7A N;  2RUS A;  1LWE A;  2MKJ A;  4WU2 A;  3MEC B;  2F5G A;  4FKY A;  1LFW A;  2ZBP A;  3IGV A;  4MIA A;  5JXS A;  3BGL A;  2CPH A;  1PO6 A;  1SBR A;  1JJ2 R;  4QW9 A;  2YX7 A;  1HNI A;  4ETX A;  5D4N A;  3T6J A;  3KYL A;  1V6H A;  2E5J A;  3R3T A;  3MAH A;  2FJB B;  3TVY A;  4B3R J;  1WD6 A;  3PYG A;  2Y0S D;  5DDR C;  3G8Q A;  3NRB A;  2JOQ A;  3ENW A;  3GQC A;  4YP3 A;  1T3N A;  4YFU A;  2CAD A;  3DDN A;  1HBU B;  3I82 A;  1SV5 A;  3GU0 A;  3QGP A;  2XZW A;  2F4V F;  2CZ4 A;  4CLW A;  1DAR A;  2FPH X;  3BEG B;  4MTP A;  4DG1 A;  2ASJ A;  3EM1 A;  3M6U A;  2W8L A;  3O5T B;  2CPZ A;  4ILL A;  3VAF A;  2OEL A;  4X65 F;  3IO1 A;  4F2S A;  2EC2 A;  3MM9 A;  1LKZ A;  4AE5 A;  3L7U A;  3M7V A;  2KXN B;  2VOP A;  3R5G A;  1IBM J;  5L8R C;  1FF2 A;  1ZET A;  2HGN A;  3D4J A;  2JRS A;  2B0G A;  5H9E K;  2MY7 A;  1C0T B;  4WCE Q;  4NXN F;  1S6P B;  3I0R B;  4NPO A;  3CCL S;  3DLG A;  1RAI B;  1HNZ F;  3I96 A;  4HTJ A;  2WVB A;  1HQU B;  5CYM A;  3J7Z T;  2V8H A;  1KR4 A;  2B7C B;  3RBE A;  1KLM A;  4ZVO B;  4LJM A;  2IRY A;  4JI8 J;  3SDE A;  1KNZ A;  4C7Q A;  1X0P A;  1S4E A;  2RDI A;  1M5P C;  4OJ3 A;  4N8O A;  5HAO A;  3CCS S;  3NS7 B;  3EX7 B;  3MMB A;  4FDF A;  1HR0 F;  2AJ0 A;  1T03 B;  3W5X A;  2YNH A;  4OI4 A;  1L3T A;  1UAW A;  4O0I A;  1QD1 A;  2X1A A;  1REG X;  2C2D A;  3KK1 B;  1R8P A;  3OLA A;  2HS0 A;  2XYG B;  3FMB A;  3K5L A;  2BYC A;  1NDK A;  1KOO A;  4C0B A;  4X66 F;  3G96 A;  3MMA B;  2MLZ A;  1LFP A;  4ZCI A;  3BGF A;  2KZZ A;  2E44 A;  1SJR A;  4DR4 F;  4I68 A;  2K3I A;  3ZTS A;  2R2S A;  4P75 A;  3LP1 A;  1GMW A;  3BYR A;  4QYZ J;  1Q53 A;  4L75 A;  2PD1 A;  3T5K A;  2DTJ A;  1LWF B;  3QID A;  3ZZU A;  1XTZ A;  2W2O P;  2DPJ A;  3TRG A;  3CTR A;  2MEW A;  3IG1 A;  5E41 A;  1D09 B;  1K1Q A;  4Y2C A;  4DSE A;  1IVZ A;  3PEJ A;  4LF2 A;  4JI7 F;  1X4B A;  2CPX A;  2E5L J;  2M9K A;  5J1N A;  1RWP B;  1HNX J;  3W60 A;  4F25 A;  1G7C B;  4TNO A;  4XPE A;  3T5H A;  2IA0 A;  3M2R A;  5B0E A;  2L08 A;  3HJF A;  1U7L A;  4M5I A;  1T9Y A;  1W2I A;  1EAR A;  1WF1 A;  5C2C A;  3W63 A;  2HZA A;  4J9P A;  1IKY B;  3TA0 A;  3R8Y A;  4OZ3 A;  4RR5 A;  4E0D A;  3KOA A;  2BAB A;  1W7W A;  3KJN B;  4NYO A;  4KIA A;  4USU A;  4IH5 A;  1G2E A;  2J9D E;  4ECT A;  4DV1 F;  2CQC A;  4P2X A;  3DLE B;  3VZH A;  2V4R A;  2FJV A;  2EBE A;  3CGI A;  5KFH A;  1FRX A;  3KUE A;  5B0F A;  5KFU A;  2OKQ A;  3NGR A;  4BS2 A;  2R7W A;  3QT6 A;  4QQB A;  2EXU A;  1LWC B;  2NRE A;  1DTQ A;  4JV0 A;  1HYS B;  2R3V A;  1ULR A;  1UFW A;  5HVH A;  2IVM A;  4QR1 A;  2Z2M A;  1MG7 A;  1SQE A;  3ILL A;  2F8M A;  1SJ1 A;  1NB7 A;  1UET A;  1WHW A;  2DGX A;  1Y5N B;  3DFE A;  3HHL B;  2Y1I A;  1C4C A;  3CDU A;  4DQP A;  3AA9 A;  1UVM A;  4JYA F;  3MAQ A;  3FBE A;  3D1Q A;  1WKK A;  2AJ4 A;  4QWA A;  1R6Y A;  5E0O A;  4DQS A;  1IXK A;  3DLJ A;  4WZQ A;  1KQK A;  4I6W A;  1S0O A;  2XYH B;  1GMV A;  3A13 A;  2GHW A;  1FJE B;  3Q24 A;  3CUL A;  3HF5 A;  4DHV A;  1SC1 B;  3FVY A;  2AYB A;  2WBR A;  3Q8Q B;  4DBQ A;  4FN5 A;  3MUT P;  5T14 A;  2IM0 A;  3L7O A;  4QWD A;  4DV6 F;  2HPU A;  2XMT A;  5GAE I;  5K8O A;  4DV5 J;  3C6T A;  1R0B G;  3KK2 A;  4CLP A;  3D3B J;  2RUG A;  3PX6 A;  4Q43 A;  5DRK A;  3D6F B;  2XY6 A;  5E3R A;  3CC2 S;  5KFN A;  1KHV A;  1FI4 A;  2C2N A;  2BJ1 A;  5T7L B;  4P2M A;  2G2O A;  4I2P B;  2YH1 A;  3L95 X;  3L4B C;  1MN7 A;  3K17 A;  2J9C A;  3M2U B;  2I38 A;  1S1T A;  1X9W A;  3CDB A;  2OJ3 A;  1N0V C;  4OHX A;  1VBY A;  4NCG A;  5HAT A;  2DIU A;  4FP9 A;  1R7I A;  4M5M A;  3T19 A;  3QMQ A;  1S9G B;  5A6W A;  4WZM A;  1OY9 A;  2LMI A;  2XMV A;  2LXF A;  4XAK A;  1GH8 A;  3ZO7 A;  4LF9 F;  4Q7A A;  2HHU A;  2XY7 A;  4JI8 F;  4FF2 A;  4B3M J;  3M05 A;  5KFQ A;  2ZDP A;  5IZH A;  4LF7 J;  3ENQ A;  1TV6 B;  3MEC A;  2DEJ A;  1S0V A;  4KBI A;  1R0A A;  1P8G A;  1JLC A;  2DRA A;  3H2V E;  4K4T A;  1IJF B;  4IYQ A;  4KHM A;  1T0T V;  4RUA A;  1YRT A;  4RBV A;  2ZZT A;  4Y34 A;  3ILI A;  1JXV A;  4DLE A;  1U4B A;  4WE1 A;  4ZLN A;  3M8Z A;  2DGT A;  3GV5 B;  1K47 A;  2QYC A;  2Z2Z A;  3HHL C;  5DDO C;  3QGH A;  2CA9 A;  4YEA A;  4B3S F;  1D8Z A;  1D9F A;  4DPW A;  4CLS A;  1OO0 B;  1V3S A;  2XS7 A;  4CLU A;  3AJ2 A;  3KHL A;  4YOE A;  4C8N A;  2CQB A;  3DHX A;  4KKO A;  1EQ0 A;  1NZA A;  4GVB A;  1SKW A;  1A9N B;  4KQZ A;  3P49 B;  3AAW B;  4KO0 A;  1TKT A;  3DNC A;  3KLV A;  4DWI A;  1L3U A;  4NRT A;  2FLP A;  1OY6 A;  2HZV A;  1CJT B;  1OPZ A;  3FRY A;  3W3S A;  1HBN B;  5A2Q U;  4U95 A;  2V9W A;  1YJV A;  3CCM S;  4J91 A;  3IAS 9;  3PRD A;  5CYJ A;  1YBU A;  4P2F A;  1RA7 A;  3TI0 A;  2GAG C;  2W2N P;  1FKO B;  2LCW A;  4RW8 B;  3E01 B;  4PG5 A;  4CIO A;  3TUI C;  3H25 A;  3DXS X;  3CJ0 A;  1LQ9 A;  2IJF A;  2JC1 A;  4ER8 A;  4M5D B;  1EET B;  3CD5 A;  1N6Q B;  1TAQ A;  2A18 A;  3B4D A;  3H7H B;  4DSI A;  1NDC A;  1OYE A;  3GTY X;  1R3N A;  2GJI A;  3BBC A;  3E51 A;  1K1S A;  3I6P A;  3BQ2 A;  3NL0 A;  1KTQ A;  4RW6 B;  3PEH A;  5I42 B;  4K4Y A;  4HI2 A;  3SQG B;  5DLG A;  3NNA A;  3HD1 A;  3D3C J;  1RAH B;  3RBZ A;  3CJS A;  2W4D A;  2AYE A;  2X1F A;  2XS2 A;  1F6T A;  5D0E A;  4JI1 F;  4LVN P;  4NWB A;  3DOM B;  2A1B A;  4RBU A;  5KFG A;  5F8M A;  3AOC A;  4RUC A;  4IFV A;  3U1M A;  4C0H A;  5H1S V;  4Z7C A;  4C9D A;  3I4P A;  4R25 A;  1UPP A;  3MOZ A;  2HWH A;  2O5D A;  3AQP A;  1RBL A;  5L39 A;  1GMU A;  4QIE A;  4A46 A;  2K2P A;  2E1A A;  5HMZ A;  2KXF A;  2AYM A;  1KLN A;  2ZH9 A;  3V6J A;  3FKB A;  5DM6 Q;  2CJA A;  5E5N A;  1PKU A;  1ZPW X;  2IYG A;  4QW8 A;  2IIH A;  3G8S A;  3HXM A;  3Q8Y A;  3AOA A;  1TFW A;  4X4V A;  1JLA B;  4DUY J;  2MGZ A;  4WFA Q;  4DX8 H;  1QM9 A;  4BWJ A;  4UUW A;  4J9Q A;  3H5U A;  3PJ9 A;  3QT5 A;  2V94 A;  2MLX A;  1PYO B;  4LMZ A;  2NCK L;  4ZJQ A;  3W65 A;  3T5L A;  5LXY A;  3QRP A;  1VK8 A;  1VYA A;  5A8W B;  3ISN C;  4QWE A;  5HMY A;  2BKN A;  7AT1 B;  4XTT A;  1X4D A;  2BAN B;  2F40 A;  3M6V A;  4HAC B;  5DO2 A;  2AJ2 A;  1IBK J;  2P8I A;  2ZM6 J;  4UOC A;  5EUH A;  3LP0 A;  2W2M P;  4YN3 B;  3BV8 A;  4UST A;  1JX4 A;  3W66 A;  3DLE A;  1RT5 B;  4LBH A;  2GFF A;  8RUC A;  2WBM A;  4KV8 A;  4QJV A;  4B3M F;  2VFT A;  3E8O A;  1V9O A;  2UP1 A;  2MKC A;  4LF7 F;  1T3O A;  1FES A;  2N4D A;  1NK8 A;  4ES2 A;  3PO5 A;  1LWC A;  1PSD A;  4GRS A;  1TL3 B;  4OX7 A;  1RT7 A;  5THW A;  4ED7 A;  1HMV B;  3Q2T C;  5AE3 A;  5DGA A;  4AYB D;  3BO3 A;  1HNW F;  4LSN B;  4I64 A;  1S79 A;  1NDL A;  4NLX A;  1H2V Z;  4P6Q A;  4DR6 J;  1N8R T;  4RW7 A;  2WCX A;  1BQX A;  2VOO A;  4PXB A;  1VRT B;  2C2E A;  3MPY A;  5HJX A;  2ABY A;  2DR8 A;  3T1Y J;  2GIF A;  2UUC J;  2G0J A;  1F5C A;  5C5J A;  1UVJ A;  3IM8 A;  2QT7 A;  2ZNY A;  3MWB A;  1AA1 B;  2F7V A;  2EEY A;  1FWK A;  2MSS A;  1FDB A;  1TK0 A;  4MKV A;  2FTR A;  2MKS A;  3SXL A;  1YLX A;  2HW3 A;  3BBB A;  1T05 A;  5E7O B;  1M5V C;  4AQY F;  4LR9 A;  5IT9 U;  1L5U A;  5AT1 B;  3WX8 A;  4EYI B;  1YX2 A;  3GG0 A;  3V6K A;  1HI0 P;  4PWD A;  3KJV A;  2EW9 A;  4DL7 A;  2HZC A;  4DL0 C;  1Y5L B;  5CD4 A;  4Y3C A;  4F50 A;  1RCO B;  1BXN A;  3OXL A;  4LVO P;  1C4A A;  1DQ8 A;  4OZJ A;  3KG0 A;  2AJ1 A;  1WAC A;  1BQM B;  1HLW A;  3W1Y C;  4DR7 F;  1TKX B;  5D0R A;  5HLF B;  4I2P A;  2OO4 A;  4NE9 C;  2BDP A;  2HHW A;  3K5N A;  3QAE A;  2DXF A;  3R27 A;  4OI3 A;  4XDC A;  1MRO B;  1RHM B;  2QV6 A;  3BF4 A;  2L48 A;  5CH7 B;  2JLF A;  4FF3 A;  4IOB A;  2KTQ A;  1F9F A;  4ZVH A;  1WG1 A;  3I55 S;  6FD1 A;  4DPY A;  2CPE A;  1EP4 B;  5HO4 A;  3D0I E;  1Q81 T;  1APS A;  1VQ4 S;  1RWO B;  1WC5 A;  4A4J A;  3R5A A;  2M2B A;  1C1B A;  2YQ0 A;  3GFX A;  1LXJ A;  1TMM A;  4J9O A;  1OYD A;  3DI6 A;  1ZA1 B;  2FVR A;  1OQ6 A;  1H2U X;  1F9H A;  3DKD A;  3JXO A;  4L3N A;  2AV5 A;  4U9R A;  4FBT A;  4PQU A;  1PJ5 A;  4ITS A;  1TU0 B;  4HDG A;  1GFW B;  3GCW P;  2LDY A;  3CJK A;  3ITH A;  2DR5 A;  2O3D A;  3IAM 9;  3CXC R;  3FC9 A;  3F0N A;  4FYD A;  2NSC A;  1WKL A;  4ZPV R;  2AF6 A;  4NXM F;  2FJW A;  2OGU A;  2P9C A;  6FDR A;  1U0H B;  3EPI A;  4HHJ A;  2JLG A;  2A6O A;  4ED4 A;  3DLK A;  4Y28 C;  4L73 A;  1C0U B;  2RAQ A;  3H0P A;  5K9F A;  2OSR A;  1GAO A;  1VQ5 S;  3SV3 A;  1FNX H;  4JB8 B;  2JZ5 A;  3C16 B;  4LFA J;  4IG0 B;  2VHG A;  2A2D A;  4KHP J;  4A8Y A;  4DPT A;  3WHI A;  1RT6 A;  3BGR B;  3T5J A;  1NK7 A;  3C66 A;  1B7Y B;  2NXU A;  4XK8 C;  3I5C A;  1JLG B;  3MHY A;  1YJR A;  2Q66 A;  2DNN A;  3C2P A;  1WWH A;  2BBE A;  2DR7 A;  4G1Q B;  4J9M A;  4DR3 J;  4QWB A;  2C2M B;  3BS9 A;  2ZHO A;  5L1I A;  3QWP A;  2CZV C;  4N7T A;  1QAY A;  2PE8 A;  2ROG A;  4I6Y A;  4HLB A;  2MLY A;  1RT3 B;  1Y3J A;  4TY8 A;  2W9C B;  1XQI A;  3E2E A;  2RQC A;  1REV B;  8AT1 B;  1ACM B;  1CSJ A;  3N4W A;  1IBK F;  3I5A A;  2ZM6 F;  2CUY A;  3SSS A;  2GIR A;  1K73 T;  1RAG B;  2ZE2 A;  1NZ8 A;  3VHQ A;  4URS A;  1QSS A;  2Y8W A;  2BKP A;  1SH2 A;  2UU9 J;  5GAG U;  4F2R A;  3JSY A;  1C2P A;  2HBR B;  4O3S A;  5CZV A;  2HK3 A;  1XR6 A;  4MKB A;  3C15 A;  4TU7 A;  2B3T B;  5IOL A;  5KT7 A;  3O2I A;  1UW4 A;  4RU2 A;  1Z2Z A;  2HIQ A;  5I42 A;  4OJ1 A;  4CCH A;  2NZ4 A;  1IR2 A;  1U6F A;  4LF4 F;  2B5J B;  4RW9 A;  1VQL S;  2BQR A;  5KFY A;  4R5P B;  1TZ0 A;  3J81 j;  2VJU A; 
#chains in the Genus database with same CATH homology
 4UOF A;  3Q89 A;  2VU5 A;  1K44 A;  3ELH A;  3VVT A;  3MPD A;  1ZS6 A;  1EHW A;  2HVE A;  1NLK L;  4W98 A;  3B6B A;  3ZTS A;  3VGS A;  3BBB A;  3ENA A;  3VGT A;  3NGR A;  3R9L A;  3DKD A;  1HIY A;  4WBF A;  3ZTP A;  3ETM A;  4UOH A;  3Q83 A;  5CAA A;  1S5Z A;  1LEO A;  3WX8 A;  1WKJ A;  3BBF A;  1NPK A;  3NGU A;  3DDI A;  2HUR A;  2DXD A;  3FC9 A;  3BH6 B;  1LWX A;  4DUT A;  1BHN A;  3FCV A;  3EMT A;  1JXV A;  1XQI A;  3EIC A;  3NGS A;  4UOG A;  3FBF A;  2AZ1 A;  2DXE A;  1WKL A;  1NB2 A;  3EJM A;  3FKB A;  1NCL A;  1NHK L;  3JS9 A;  4S0M A;  1NSQ A;  3ZTQ A;  4ANE A;  4ANC A;  1NDC A;  1PKU A;  2CWK A;  2B8P A;  4CP5 A;  1MN7 A;  1NUE A;  3Q86 A;  1HLW A;  1NSP A;  3VGV A;  1BUX A;  5C7P A;  4ENO A;  4HR2 A;  4F36 A;  3EE3 A;  3GPA A;  3Q8U A;  1XIQ A;  2B8Q A;  3BBC A;  3FBC A;  3Q8Y A;  2DXF A;  4KPC A;  3ZTO A;  3EVM A;  4DI6 A;  3Q8V A;  4DZ6 A;  2HVD A;  1U8W A;  3FBB A;  2AZ3 A;  3GP9 A;  3ZTR A;  5BXI A;  3NGT A;  3PRV A;  3EM1 A;  3FBE A;  1NDL A;  1B99 A;  1WKK A;  3BH7 B;  1BE4 A;  4FKX A;  3PJ9 A;  4O0N A;  4AND A;  5IOL A;  4EK2 A;  1B4S A;  1S59 A;  3B54 A;  2NCK L;  2DY9 A;  3FCW A;  4C6A A;  2BX6 A;  2DYA A;  5CAB A;  3L7U A;  1MN9 A;  1NDP A;  1PAE X;  1VYA A;  3EVO A;  1F6T A;  3G2X A;  4FKY A;  4F4A A;  2ZUA A;  1NSK L;  1W7W A;  3EVW A;  1HHQ A;  1NDK A;  2BEF A;  3VVU A;  1KDN A;  1S57 A;  1F3F A;  1UCN A;  3VGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...