1B99A

3'-fluoro-uridine diphosphate binding to nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nucleoside diphosphate kinase investigated using nucleotide analogues, viscosity effects, and X-ray crystallography.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords PROTEIN (NUCLEOSIDE DIPHOSPHATE KINASE)
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1b99A00
4KPCA 3FCVA 3B6BA 4C6AA 1MN7A 4DUTA 3R9LA 4DI6A 1F3FA 3Q83A 5C7PA 1LEOA 4ANDA 3VGVA 1NB2A 1W7WA 3Q86A 1WKJA 3EVWA 3ZTRA 1NDPA 3VGUA 1B99A 3FBBA 4ANCA 3Q8YA 3GPAA 4W98A 1UCNA 3GP9A 3WX8A 4FKXA 1S5ZA 3NGRA 3VGSA 1LWXA 2DY9A 2BEFA 4DZ6A 3EICA 3EJMA 5BXIA 2CWKA 4UOGA 1BHNA 1S59A 4O0NA 4UOFA 3EM1A 1NUEA 3NGTA 3FBEA 4ANEA 3ENAA 5IOLA 3EVMA 1S57A 1NSPA 1NDLA 3L7UA 1NSKL 2NCKL 3G2XA 1XIQA 3NGSA 4F4AA 3MPDA 3JS9A 1NDCA 3DDIA 5CABA 1VYAA 3ZTPA 1NDKA 1B4SA 4F36A 1K44A 4CP5A 4UOHA 3VVTA 1KDNA 3B54A 2ZUAA 3NGUA 3FC9A 2HVEA 3PJ9A 5CAAA 3BBBA 3ETMA 4EK2A 3FBCA 2VU5A 1BUXA 3Q8UA 2DYAA 1NLKL 2B8PA 1BE4A 3Q89A 1F6TA 3EMTA 3DKDA 4WBFA 3ZTSA 1PAEX 1XQIA 1HLWA 3BH6B 1NCLA 2AZ1A 1WKLA 3PRVA 2AZ3A 3ELHA 2HVDA 4FKYA 2B8QA 1JXVA 2BX6A 3FCWA 1HHQA 3VVUA 3BH7B 3BBCA 2HURA 4S0MA 1MN9A 3FBFA 3EE3A 3VGTA 4ENOA 2DXFA 1EHWA 3Q8VA 3ZTOA 1NPKA 1PKUA 2DXDA 2DXEA 3ZTQA 3EVOA 4HR2A 1WKKA 1ZS6A 3BBFA 1NHKL 3FKBA 1U8WA 1HIYA 1NSQA
chains in the Genus database with same CATH superfamily
1SH3A 1WF1A 4AD6A 4NLTA 3HMJG 1RWXB 3TYTA 2ZEJA 5GVQA 2ATLA 4OHZA 5KFXA 3MURP 2NS1B 2V8HA 4DU7A 4PWUA 7FD1A 2GMJA 4ANDA 1Z4UA 4N56A 2JC0A 2DHSA 3MI7X 3DRYA 5LMUF 4DR5J 3KHRA 1KS2A 4IFVB 4NXMJ 2D41A 3VAFA 1N56A 3ZTRA 4DDFA 1NDPA 1N36F 2YTCA 3HJFA 1GNKA 4I0WA 5BYRA 2BJDA 2DHAA 2HMIB 2GGPB 5KFUA 1F2GA 2QV6A 1RA6A 3AQOA 3CJTA 1SJFA 3QWUA 4EMDA 3DRRA 4KSEB 4OZ3A 3VAHA 2JEIA 4R8UB 4DPUA 3PR4A 3QLHB 4X62F 3D54A 2E5JA 2R7TA 1IQTA 4BC9A 5DGBA 1NKBA 3M2RA 4P2SA 1BQMB 1DBDA 4A8MP 2APOA 3RU0A 4ZLLA 2BJ7A 1WOSA 2QTWA 2IYGA 2RH3A 5ETSA 4L73A 3VHQA 2BRLA 2ZH6A 4ECRA 1T03A 2EC0A 4WPAA 4IQXA 3DOKB 4PXBA 4R5PB 2R7VA 1OS5A 3MEDB 3MM5A 3QO9A 3FFIB 1LV5A 4KHPF 2V2ZA 2XHCA 4BLGA 4GKJF 1R8AA 4LRCA 3D6FB 2NYIA 2W2MP 3OSNA 1X7VA 1P6TA 4KIAA 4Y6IA 5HSPA 4DSJA 2J0XA 3OTDA 4RX6A 3OUYB 3I9ZA 3U02A 3RG6A 4ETZA 4MYTA 2XM3A 4F4XA 4G1QA 4CH0S 3PW2A 2HG4A 3L09A 3C14B 1X4GA 3CW2C 3NNCA 2HKEA 1WC0A 3G6ES 5GAGI 4F8RA 2MZ1A 2GVDA 4TYAA 1PIEA 2BQUA 1Q78A 2DKOB 2VG5A 4U9RA 2QEXS 2FVRA 5HMWA 1EARA 2G13A 1UKUA 3NRBA 2JX2A 4NRUA 5KFOA 4DV6F 1ICEB 2IYIA 3PJWA 3NS6A 3J81Y 2YNIB 3ET6A 4WU2A 4DN9A 4LF4F 4OX9J 5D0HA 2CXEA 3A8EA 4M5DA 2ALZA 3GFXA 1TL1B 1S6QB 3GCWP 3KXDA 4IOAQ 4P72A 1DQ9A 1ZAWA 2KVQE 3A3OB 3PHTA 1R6VA 2ZC4A 2RSQA 3NLCA 4DV4F 1SL2A 1GAOA 1WF0A 2DYAA 3HHKA 5KG6A 2HHVA 4QJVA 1UL3A 1RT3B 5A8RA 3KJFB 1ZM4A 2YNGA 1YJNS 4J91A 3ZZPA 4CLTA 1GXUA 2HQDA 3MOZA 1KLMB 3VZHA 2X7IA 3NBPA 4PG4A 3CE8A 3AXMA 5F8IA 1RT5B 4LVOP 3R5DA 3VAMA 2UUBF 1H73A 3CC7S 1C0UA 2XYPB 4M63A 2IRUA 1YK9A 2RVJA 4JI1J 3J81j 2AZ3A 1B64A 3C6UB 3TRGA 3ELHA 1C1CB 1TUGB 2W4CA 5GMEA 5LSRA 4DV2F 1ZTWA 1RYSA 2HBRB 4RW9A 1RAGB 4B9LA 1OYEA 4PR6A 4CDIA 2FZGB 2WW4A 9RUBA 5ETNA 2Q6BA 2QT7A 8AT1B 3OW2R 3R1LA 5AXLA 4K4UA 4FXDA 2W7AA 3G6YA 3BBCA 3I0SB 4ER8A 2XBPA 2Y1LB 4ED6A 1HWUA 2NZCA 3RUBL 3T5LA 2C2OB 1TTHB 2J6SA 2E1RA 3NAHA 3DRXA 1HQ2A 1UMJA 1RWNB 2K7JA 2U1AA 3I4HX 5HVGA 2HHXA 2HRYA 3P96A 1YJWS 2QL9B 4C8NA 2DEJA 5J1NA 5M2UA 3AD7C 5L1IA 5GADU 1PCAA 4LF4J 4C3KA 2CPDA 4OX9F 1JLCB 2KI2A 1WKKA 2B9XA 4F4WA 1U02A 1U8WA 3TVKA 2CJ9A 2PO4A 5BJRA 3UN5A 3KK2B 2V2QA 4DV0F 2BE9B 1U4BA 5A8KA 3HKZD 4ZP6A 3DRPB 3G86A 3R9LA 3OXFA 2HLUA 1SC6A 2DITA 4FVCA 1R8PA 1V3RA 4E0DA 3HHLB 3HHDA 2C3UA 3QIPA 2ZM6J 1M0SA 1SH0A 1E6VB 1FKOB 1A6LA 1LFWA 2VKZG 4CIOA 4DSLA 2B5JA 2AU0A 2XNRA 1S99A 2CPHA 2FY8A 3GPAA 4LVNP 1NEEA 1WELA 3Q2TC 1RT6B 2QG9B 3A13A 4ECYA 4C4WA 2V9KA 1YLXA 1K9MT 3M8QB 2H9ZA 4YP3A 1RQ0A 2YVSA 4USVA 5I3QA 3OJUA 3M8PB 2LU1A 1VFJA 2RQKA 4IKAA 2C2MB 2FJAB 2YX1A 1N5QA 3GLJA 5JXSA 1L3UA 1RT1B 2VFTA 2GW8A 2J8SA 2MKYA 3KLGB 2PEBA 3L9ZA 4U7UK 1IKVA 5I42B 2VJUA 1VBKA 4NLOA 2OTJS 4JV2A 3ZNUA 1ZH5A 1HW8A 4IOCQ 3M6XA 2IBKA 1S6OA 2F1FA 3EVMA 3KMSA 4DSFA 1FFWB 3HX9A 3RB3A 2QL7B 3A3PB 2CJXB 2B4OA 2W2NP 1SKUB 4RW8A 1MU2B 3QZ7A 1S9EB 3EZOA 4OHWA 3I82A 1SL0A 3IA0A 3A1YG 1CULA 3AT1B 4P7VA 4B9UA 4X2BA 2FHKA 3UR0A 2W2OP 3LWLA 3JS9A 3W7BA 1N32F 2CQ4A 3QJJA 1MU2A 2CQ0A 3M8PA 4TLRA 3GIKA 4ECTA 3M8QA 3KLEB 4CO4A 3W60A 2CFXA 3OJSA 5C2CA 1EZZB 1TK5A 3J7A1 3ZNJ1 4ECQA 4NWBA 3BN7A 4ES2A 2PE8A 1MROA 2B5JB 2FC8A 4TQRA 2IVYA 2PN6A 4RPFA 4ZJOA 2ATCB 1YI2S 1IVZA 3O2IA 1JK9B 1P27B 4QIGA 5E3CA 3MAQA 1N5YB 5CYMB 4EK2A 5LJ3Y 3H90A 4FNHA 4F50A 4FF4A 4BC7A 4E2FB 5A8KB 4A8QA 4B9TA 5KFMA 3TZZA 4OQJA 4WYLA 3AB2B 4H54A 4R0EA 3CCQS 1WJ9A 2MQOA 2VBYA 1S1TB 3N28A 1UVMA 4KT0C 2ZZTA 3KLHA 2EK1A 3DRSB 1JMTA 3CB4A 5KFQA 1VRUA 4N8NA 1VJWA 4F4ZA 3MMJA 2CZVC 2W7OA 3P45B 3HHLA 3Q24A 4DL2A 2AD9A 4LF9J 2BE2B 2QN6B 2RUSA 3I55S 2BV3A 1HNZJ 3CJ2A 1S7HA 2FHJA 1U48A 2B0GA 4CT8A 4WFAQ 4B3SF 3DXBA 2CA9A 3PRVA 1HNXJ 1HBNA 1V3ZA 3I0SA 1IXKA 1I3OB 4DSEA 3GFZA 2BX6A 4WWSA 4JV0A 2P9GA 4C8ZA 2VDIA 4CO5A 3KHLA 5F8JA 3RBXA 2DY1A 4URSA 3DLGA 1XMBA 4PZVA 2X1AA 2EG2A 2OUGA 2YNHA 4JI6F 2QX0A 2VH7A 2LEPA 4PG7A 4Q2LA 3LANA 4ZVEA 2R7SA 1TKDA 1AROP 3OXGA 1FRHA 5HI7A 4O0IA 4DV3J 1U26A 3HI9A 3QRPA 3V2UC 2H54B 3SI8A 4ZPAA 3CJ3A 1ZOTA 3KHHA 2DPIA 2MQPA 3H5XA 1KHWA 1QUPA 3RB6A 5IS2A 4DCOB 2JEJA 4Q7AA 1NJXA 5HO4A 3D1HA 5I3PA 2E9TA 3GJRB 1F3FA 2IVMA 1PG5B 3IFEA 4KGXB 2KU7A 4OHXA 4OJ1A 5F41A 2MZSA 3Q22A 1LK5A 3BSOA 2RS2A 1RBAA 2BABA 5ETMA 1GXTA 3LF0A 2HNYA 4OX7A 3TAPA 1VIXA 2CUYA 1YVFA 2J76E 4YB1P 2OIHA 2IA0A 4QIVA 1VQKS 2IC3B 2KYXA 2ZBCA 1M1GA 3HSJA 3VTIA 2B9EA 1IBLF 3CJ5A 4W98A 2GMHA 1DY3A 1Z2LA 4Q0BA 2HLTA 4FKXA 2EEYA 1FD8A 4LFAJ 3LW5C 5F0WA 3ENQA 1PGZA 2HYIB 2MHEA 3WDOA 4M1KA 4LQ3A 1S77D 3IGNA 2IY5B 2AX1A 4WTYA 4F4YA 3D3BJ 4AQYJ 2JVRA 3N79A 2BJ8A 2CQ3A 1WEZA 2GVDB 4ZPBA 5CCMA 5A76A 3MUMP 2QFIA 3P5TL 3ITHA 3LP0A 4RNMA 5IV3A 1KVJA 3HLUA 1H0HB 2GHPA 1U49A 1QAJA 2UXCF 3M2RB 2VB6A 3W9HA 1FRKA 2AJ2A 1DTTB 3T6JA 1FA0A 3SFUA 1TK8A 5EUHA 2XULA 3JAMU 1TKZA 2ROPA 4RW6A 1S6PB 4EZ9A 4G65A 1XN9A 3Q8PB 3THVA 1URRA 4DSIA 4JI8J 2HW3A 1Y9OA 2DH7A 3MM5B 3MEDA 2OH2A 2FJWA 4DR6J 3PJXA 4C11A 4C8YA 2DK2A 2UUCJ 2OTLS 4GO7X 3HP6A 3PVXA 4FP9A 4CCHA 4FF3A 2RMLA 2XMJA 1Q1KA 1RAIB 4MKBA 4JBCA 1CC7A 4Z7CA 1RSCA 3DCAA 1JQGA 8ATCB 2MZRA 3TEGA 4TU9A 2NUHA 3UFCX 3HVWA 3QLHA 1S7IA 1NAQA 2IMOA 3M32A 3J80Y 3ONQA 2F8MA 3Q8UA 4GVBB 4IYQA 4USWA 2R7RA 4U7UD 2D3ZA 2C1EB 3H8YA 5F3TA 1NK9A 3J7YI 5E41A 4JUZA 1HD1A 2Z57B 4OYWA 2QLXA 4FYWB 5D0RA 2N4CA 4DR5F 1N4LA 2L08A 4ZVQB 2KTQA 1SIWB 4AQYF 1T11A 1YJTA 2K8GA 4RZRA 4YMEA 4ERDA 1IR2A 3QPIA 2JLFA 2CYYA 2DNLA 4Y65A 1RAJA 3RRHA 1PAEX 2ZBIA 3V6DB 1VC6A 4OZNA 3TWZA 3VWSA 4NZ6A 1FRLA 4EZ6A 4HEA9 4LR8A 4QW9A 4PG6A 3LP2A 1QAIA 5D3GA 3BQ0A 1VQ7S 3CCZA 3HXMA 3OL8A 4YHHJ 1K1QA 2WB4A 1U09A 3P3DA 1KOOA 3WQPA 4ECZA 3CULA 1FJCA 2UV8A 4B9MA 1TKXB 2I0XA 3DU6A 3L7PA 2W2QP 1SJ4P 4ECWA 2X1GA 2OELA 1DQ8A 2UUCF 1YQHA 4CLPA 1RAHB 4QYRA 5J1EB 1EHWA 3BO2A 2NQPA 4DX6A 3H2UB 3GFHA 4ZDNA 3MECB 1FE0A 3SSQA 3ZTQA 3RBEA 1W2BR 2XMKA 2VG6A 1NK8A 1ZS6A 3VAGA 4CWBA 1LKZA 1TVRA 4MMOA 5GAHU 2PMZD 4LF8F 3TANA 4AT1B 4O3OA 7FDRA 1HYSA 2YWHA 2NREA 3P49B 3MMAA 4ZHRA 1AB8A 1X8DA 4LRDA 4DI6A 1Q82T 1JIHA 4AL6A 4KGMA 3M8WA 1GTHA 4OZ1A 5F3ZA 2RE1A 1TV6A 2XEXA 2JRSA 2JWNA 4WJBA 5L46A 4X4UA 2YKMB 2JEFA 1SJRA 3GTYX 4ZS6A 3DOLB 2HBZB 3P5BP 3HPOA 4IFYA 1C0TB 1L3KA 5LL6d 3MXHP 2R7OA 3GE9A 2V8DA 3ZO7A 5HQLA 4ZCIA 2WK4A 1AXQA 2RRNA 1OMSA 3QBCA 4NLRA 2DR8A 2BOAA 3AB4B 2VOPA 2C22A 1LWXA 3S8SA 3LQVA 4GC7A 2W4PA 5HVHA 3DLKA 3OT9A 4HTIA 4DZ6A 1CEZA 4UOCA 4UTGA 2QA4G 1VQ5S 2CZ4A 4NLWA 3CJSA 1BHNA 5KOXA 2LQ8A 3DYAA 1I5OB 2DEIA 3K8VA 1XBWA 4H4OA 4C8MA 3WBZA 1CS4A 1M5HA 2KYZA 3JYTB 1KSPA 3ENVA 3V6JA 3EDQB 2BVZA 3HSGA 3IXQA 3M2VB 3TVYA 4C0OC 4QCLA 1D09B 4TY8B 4ZVGA 4KFBB 1FKPA 1RXOB 1IKWB 5HAOA 3FVYA 3A8JA 4F25A 2NCKL 3GR0A 2KM8B 3G2XA 4K8RA 3UVJB 4WE1B 4WYWA 4J9NA 3V6KA 3CC4S 2ZHOA 1UWBA 4CLWA 4OI4A 1REGX 3KJVB 1G3OA 2GVZB 4FF2A 5EWEA 2V0NA 2VICA 4BDPA 2UXBF 5KFJA 2CQDA 2DGQA 3QT8A 2DGTA 4ID5A 2G4BA 4X4VA 2DBBA 2V68A 4OYZA 2M5YA 3TZWA 4B3OA 3W9JA 3KK3B 2W1BA 5FLXY 4QU7A 1UZHA 3M4XA 1GXLA 1TV6B 3HKWA 4ZK7M 4XO0A 3MAAA 4P71A 3UDEA 1WTFA 5L8RC 2CQBA 4GRSA 3TX0A 2ZHBA 3FBCA 5D15A 4WFBQ 1IJEB 4Q44A 1RLDA 3LA0A 2RRAA 1LW0B 2MSTA 4CM2A 3V6HA 2XS2A 1JLFA 3D0IE 3Q8SB 2J9DE 4P10A 2MJUA 1JNRB 2J6TA 4NA1A 1RAEB 2WB1D 1REVA 2MKJA 3N5FA 4J5OA 5LMUJ 2B56A 2KXNB 4JI0J 2YQ1A 3JSRA 1IM6A 2E44A 1PJ6A 4Y00A 4ALZA 4Z2XA 4U67Q 4NXMF 1VQ8S 1UEUA 1OPIA 4RBTA 2EXUA 5U47A 1QUVA 2MZJA 1FVQA 5B08A 1U1MA 4WF9Q 2WVDA 4M5JA 4DG1A 2V8PA 2VBXA 3CNQP 1HLWA 1Y4ZB 1QAXA 4Y28C 3TA0A 5C2GA 2FYXA 3HT3A 3MUTP 4B9VA 3NL0A 3BV8A 3OHBA 2J0WA 3EPIA 5DM6Q 3ISND 2QSFA 2EFVA 4DG1B 5B0FA 2OKQA 3BQ1A 1R6YA 3THPA 1FCAA 3D7SB 1Z1ZA 3LP2B 3R2DJ 3FEXB 1HPZB 2CPFA 2YKAA 2IRYA 3M2UB 2H3EB 2GX8A 4TQSA 4RUCA 1F9EB 1RWUA 2QJ3A 3EE3A 1WEXA 3OL7A 2BR0A 2EG1A 3GG1A 3F41A 2R7QA 3ZTOA 5E3QA 3AHPA 4PXCA 3H25A 2HFNA 1JLFB 2WBMA 3JB9k 1RT4A 4ZN1A 1OY9A 4KV8B 4ZIVA 4FBTA 1LW2A 1WHXA 4LF6F 2I6WA 3DLLQ 1J2VA 1U24A 5KFWA 1X4CA 3BEGB 3SDEB 4Y3CA 2KRRA 4Q43A 1UVIA 3OFEA 2JJ4D 1AFJA 3J7AN 1OPZA 3K2YA 4YFUA 1TL7A 1NMEB 2YWFA 2QA4S 3CMES 3KLIA 1SI9A 2XHWA 2Z2MA 4N77A 1Q8LA 5KFHA 1VR6A 1UFLA 1LWFB 1BQNB 5KG1A 4PXEA 4I6AA 1UPMB 2DISA 2H5JB 3BKFA 2VG7B 3SV4A 5DZ7A 2PA8D 1TUWA 1RTHB 3PFOA 3KJVA 4DLEA 1P9QC 2DHHA 4DV6J 5F8HA 3T3FA 1S72S 2RIJA 3H2LA 1YHQS 4KJIA 2ZE2A 1FEEA 4USTA 3T5HA 3WC0A 3UD4P 3EGZA 1JJHA 2V94A 3LUYA 2KO1A 4C3LA 3EZ5A 2A0FB 2QSWA 4LBHA 3BDPA 3FSYA 4CO3A 3OFFA 3BO3A 3LGMA 2IM1A 1T3NA 1S6PA 4ZLNA 4PQUB 2XI3A 2V6AA 2VJVA 2E29A 3IWLA 3A3NB 2POKA 3CD0A 4JP8A 4PQAA 2W8LA 1FK9A 5E3AA 3LP0B 4MTPA 1RA7A 4ZKAA 3J7ZT 5HBMA 3AXKA 2BE7D 4ANEA 1WDTA 1DJ0A 3WX4A 2XC9A 2FJEB 4K7QA 1HWLA 1JLQB 2G0CA 3IO1A 3JTNA 5K9FA 1F2HA 3GYNA 4F0MA 1HNXF 3H5SA 3LALA 4CH1A 4CQ1A 1NB7A 4DQPA 1XR5A 2W9CB 4UUWA 1KQSR 4F3MA 4IFYB 4NLXA 1QVFR 1IN0A 2LQJA 2J7WA 2DB1A 3OSPA 4NZ7A 1JLEA 2FLOA 1KR4A 4HT7A 4AYBD 2MKKA 3R1HA 1UEVA 1X4FA 3S7RA 4WTOB 2BDPA 2WZ1A 1KLNA 1RWWB 4I2PB 1U1PA 3DI6A 2B43A 4ES3A 4WZMA 1KD1T 1K0VA 5J2NB 4UOHA 2IC3A 1YJ9S 3QT6A 4ZHRB 4X62J 4A8YA 2HZCA 3GZ7A 3JTOA 1RP5A 2ZOFA 1RT7B 2MGZB 2MJNA 5DRKA 1SUQA 2N3LA 4F67A 1YBUA 3GCXP 1L3TA 2DRBA 1HYSB 1NJYA 3W63A 1U1QA 3CJRA 2AEMA 3T1YJ 5GADI 4RW4A 2ZD1A 4QPTA 4WXOA 2IA6A 2VU5A 1VK3A 4CT9A 2AT1B 3QGPA 5HLFA 5M2RA 3NKYA 4DPYA 5KFBA 3RBZA 1V9OA 1S12A 4F3QA 1JWWA 3GMGA 2RDIA 2W01A 1FO1A 3N6NA 4ZPTR 2HFVA 2VZ9A 4UT4A 1X9SA 4LF5J 1X4EA 2L9WA 3FNNA 2HVHA 2NPFA 1NJIT 5IQ6A 1GQEA 3ZC4A 8RUCA 3W2VB 2D3OR 4JI2F 1PJ7A 1Q0NA 2LXFA 1LQ9A 4A8XA 1KQFB 3K5OA 4L72B 2AEFA 3OL6A 4ZPWR 2O3DA 3CCVS 5D3GB 3I5CA 2VBWA 4F2SA 1CJVB 3BH6B 3OTCA 2ZJRQ 3R6LB 1HW9A 4CZCA 2DNKA 2ZNZA 3V6DA 2Z2YB 2ZVSA 2DPJA 2CPXA 1TL3B 4B3RJ 2A3JA 2XYGB 1D9AA 4PYDA 1YIJS 4LFAF 3W5YA 1N0VC 2C3YA 4CYUA 4ILMA 3BH7B 3DM2B 1B0VA 1DLOB 3HVTB 1WHVA 3MMBB 4RWXA 4F0HA 4X4OA 3P8BB 4S0MA 3D0GE 1G6BA 4OZJA 2EW9A 3S1TA 5E33A 1YJRA 4TVAB 1JLGA 4FN5A 3L3CA 2LDIA 4USUA 1GFWB 2J0QD 2ZH5A 2UVWA 2BE2A 1Y0HA 2AGOA 1B3TA 1YBAA 5D8HB 2H5EA 2GAGC 5ETRA 1LFPA 1U25A 2RKIB 2V69A 4GVBA 1S6UA 3NEKA 2OPPA 4TYBA 3WHIA 4C48A 3T1YF 2FLPA 1S1TA 2WOMB 3O44A 3OTEA 4BBYA 1PBAA 1JLGB 2NUUG 4H4MB 1N32J 2DCUB 3QT5A 4KPCA 3RR8A 4X4NA 1N34J 2IJRA 2OMOA 5DO2A 3BF4A 3TUJC 4DPWA 2BQRA 4EFAC 1KP6A 3ZZYA 5EGYA 3VALA 3RB4A 3HULA 1N5YA 4C11B 5EX0A 4UQTA 1RAOA 1U47A 2DTJA 1N48A 4GKKF 1OYDA 3M6UA 1B99A 3FBBA 4O4GB 2MQNA 4TU7A 3CO9A 4Y2IA 4Y2CA 3QFWA 3NS5A 4DUZJ 4JI5F 1FNMA 1G4CA 3TP2A 1QAYA 3QGIA 2ZH9A 3ICLA 4RW7A 1QTNB 1R89A 1BXNA 2AX0A 1CJUA 2HFZA 4EGLA 3IC1A 5K8PA 4OI1A 1KC8T 3MEGA 2CG4A 2OPSA 2SXLA 2OO4A 3E01A 4DR1F 1D1UA 3I87A 1U1KA 5DQHA 1F5AA 1H7XA 2QYGA 1BMQB 3TOQA 1EB0A 2HHPA 1NPRA 2ZNYA 4E98A 2PI4A 1DQAA 3UE2A 4P2MA 2QZ8A 4CLLA 2CJKA 4DU8A 2RHQB 1S57A 1QY7A 1IQZA 4FXWA 2J7UA 1IKVB 2F63A 1S97A 1NDLA 5HROB 4RKUC 3K89A 1YGYA 2HFSA 1TFWA 3NMAA 1VHIA 2GS8A 3UD3P 1AZSB 1KVIA 4W92B 3DDIA 2HNYB 2XB2D 1N34F 1RTDB 3FEZA 2G2YA 2EVZA 3Q8RB 5F8NA 2BBEA 4JI6J 1PC5A 1RT6A 2YQ3A 3IM8A 4HH1A 4J90A 4PABA 3V5RA 4CM0A 5J2PA 2J7KA 4NLPA 5KT2A 5KFPA 1RKIA 4OYIA 1S1XB 4GKKJ 2W24A 3QIPB 3V4MA 1FNXH 4DX8H 2UXDJ 3IRXA 3N0VA 4LREA 1VI7A 5EDWA 4X4PA 3GV7B 4WFYA 4GO5X 1R43A 2BM1A 3R6GB 2VPWB 3ETMA 4LT6A 1U2RA 1FT8A 2RQCA 3OVBA 2ABYA 1C1BB 3T9NA 1O0PA 3F56A 4LF8J 2XY7A 2R2TA 1WC3A 1B0PA 2F5GA 1RWOB 2KJVA 3MM7B 4MK9A 1FNOA 3QWPA 4USJC 2XZDB 4TY9A 4DZDA 2GCFA 3M8SA 3QRQA 3GIIA 2KDOA 4IH5A 3VCDA 4DQIA 4URQU 1IKXA 2GV1A 3DLGB 2NYHA 3IS9A 3QAEA 5IM0A 1T95A 4WBFA 5JUMA 3OTOF 1SKSA 4C2MA 1Q53A 4UF4A 2A6MA 4DS5A 2A2DA 2C2RA 2AMCB 4HYKA 1MSWD 3W3SA 3T1HJ 3S6EA 3A12A 1T9XA 5KFTA 4LSNB 3KMQA 2I1RA 1KKHA 2VG7A 3Q8QB 2KL8A 2ROEA 1PO6A 4K4YA 2XSFA 1TKTA 1T0TV 5CYQA 1GEHA 4AL5A 2LQ5A 2FZKB 4ZCKA 1RJJA 3VVUA 1SJ3P 4MT1A 3KG1A 3T9ZA 1C1CA 2J9CA 2HURA 2W4DA 2ZUGA 4NEYA 3RTVA 1GMVA 4N76A 5DLGA 4EU0A 3B8HA 4KAIA 2JNJA 5FD1A 4HI1A 2DXFA 2GJ2A 3BPSP 4ED4A 5DETA 1LW2B 4L74A 3DGVA 3EX7B 3TA1A 4DL3A 4QIFA 1RT4B 3BGUA 2DXDA 4NEZA 1HNIA 1BC6A 4IG0B 4O4RA 3L4BC 4OI6A 3M9NB 4HR2A 3MPWA 2W8KA 2ZC3A 1NHKL 1ZA1B 3R3TA 2HVZA 3H59A 3CCSS 4FS2A 5B0BA 1X4DA 3CIMA 3FQLA 4EUVA 1U0SA 4ZITA 4DUYF 4F02A 2I38A 2RAQA 2E5LJ 2M0GB 4KPYA 3E2EA 3FCVA 4X65F 4J9PA 2UXBJ 1WG4A 2CADA 3NGKA 4J37A 5CD4H 4M5DB 4DQSA 4ELTA 4KYZA 3D6MB 1RAAB 2H4YB 4MK7A 6FD1A 3SBMA 2OPRA 2OD4A 2YBVA 2F9JA 4KB7A 3MFIA 2Z8QA 3EVWA 5DS7A 4USKA 1U1OA 1Y00A 3PM9A 2R8HA 2KHDA 3ZZRA 3CT9A 3T1HF 2C28A 2YH0A 4RWWA 4CO2A 3BKUA 3NS7B 1NZ8A 1FX2A 3ADAC 4OYXA 5KG7A 1EKSA 4JB8B 5FIIA 4ID8A 4J9SA 3FCHA 2RT3A 2XMVA 2HHSA 1K8AT 1KNZA 1ZM9A 3FZBA 3GJQB 4IG3B 7AT1B 1XMQF 4WCEQ 2VV5A 4K4ZA 2J0SD 1YWXA 4K2XA 1FJEB 1LW0A 4UOFA 1FXDA 4FVMA 3QO9B 4JI7J 3M1VA 1N5TA 5L38A 1RI7A 2PMHA 3KUGA 3MM8B 2RD5C 2BJ1A 3B82A 1CLFA 1P8GA 4B3TF 3A8KA 4RW7B 3PW7A 4DV1F 4MIWA 3KOAA 2VFRA 2EFPA 1FRXA 3ZZTA 1EKRA 1U1RA 3BR9A 3MPDA 2RQ4A 1S0NA 4KY3A 4YHHF 3X1LB 1NDCA 4DUYJ 1EIYB 1APSA 4O3PA 3CDBA 4F04B 3GSIA 3D4JA 4X65J 2F8EX 1B4SA 1G7CB 3GWCA 4U8YA 2GGPA 4CP5A 2HBQB 4N8OA 1J5OA 1A9NB 3CDEA 4PWWA 3N01A 3DRPA 1LNQA 3KK1B 9ATCB 1JX4A 4ED0A 1S4FA 5E3PA 1GMWD 1VLYA 3SCLE 1R8CA 1S79A 3UNGC 4DX5A 4IFVA 2CIMA 3KK2A 3C8YA 1C4CA 1QSYA 2OSRA 2QLWA 4TKTA 5L9NA 2MHNA 3PV8A 3IAS9 1SQEA 4I56A 4DOZA 4H4OB 1JLCA 1XC9A 1X9MA 3NMRA 2LXUA 5L1KA 2IBOA 1ZETA 5HMXA 1RBOB 1HBOB 4ZIWA 3GV5B 3HFZB 4ZOSA 2DD8S 2K06A 2J6UA 2XMWA 1H72C 4USMA 5IFMA 5KT5A 4NYOA 4FF1A 4KBIA 4USHA 2KKHA 1AFIA 3MFHA 2VQFF 4LSZB 4NXNF 4CYUB 4I68A 2AKWB 2B4VA 3JSYA 1TFYA 1TL3A 2GA7A 5B0DA 1XQIA 2P9CA 5FJ4A 1NCLA 3MR5A 2NXJA 1JJ4A 3CDUA 2GO8A 3AODA 4HH0A 4NCBA 2NXEA 3TR5A 4F0KA 2Y8YA 1FD2A 4BWMA 3SYZA 2FD2A 2QMUB 1UA0A 2CQIA 3MEEB 1KLMA 3UNYA 3DLEB 4ZMMA 5JJBA 3M8RA 1AT1B 1RT3A 3PNIA 4DWIA 3VZIA 3UDCA 5T14A 1TVRB 2QC3A 4DS4A 1HKAA 2XMTA 5HP1A 2DHGA 2W25A 1N54B 3GJSB 3HVAA 2N7CA 2LEBA 1ITPA 5KG5A 4IR9A 1SKRA 1M5PC 2GNKA 3FZ2A 3MECA 1XNRF 3KUEA 3LH2S 3MCMA 4ATNA 3K58A 1D0EA 1A7GE 3DLHA 3R7NB 3L95X 2YNIA 3ET6B 3GG0A 3C66A 1MWYA 1CPZA 1WNEA 5L1JA 3AAWB 1RT7A 1EJ7L 3LO3A 2FQQB 3R5JB 2D1CA 4K2JA 4NLVA 2OI2A 4ZVPB 3CUNA 2ZDOA 2P8IA 3NCPA 4FPIA 4M5MA 3HK2A 4OZ5A 1JXEA 5J2NA 2R7UA 3Q83A 3BYPA 1LEOA 1AYEA 1HNVA 1ZPVA 2WAQD 3DI6B 2DJWA 3QQCD 3TVZA 4AFFA 5A6PA 5IWAF 3K57A 3C14A 5BR8F 3SV3A 3U1NA 1WKJA 1WSRA 2H1YA 2XY6A 4TNOA 1JLEB 5LT5A 3EGVA 2K3IA 5IV4A 3OUYA 3CD6S 1WI6A 3NCRA 4KH0B 2Q79A 2COLA 2XG8A 4WFNQ 1SC1B 2HS0A 2QRRA 2ZVIA 2OFHX 3LGNA 4OJHA 4WK1A 1F9HA 1LXNA 1RCXB 1JLQA 3P4UB 3RYLA 2KVIA 1CJTA 2KJWA 4WP9A 4R5PA 2CJQA 3W5XA 4DV4J 4ZPVR 3KUHA 3M30A 4PEOA 1M1HA 2LYVA 3GONA 3MTJA 3SEOA 5A0YA 1FEHA 2BEFA 1W2IA 2ZOMA 6AT1B 1WC4A 1SKWA 2HHQA 2DNQA 3EICA 1CSJA 3H2VE 5J2QA 4XAKA 2CQHA 2YKPA 2ZFHA 2WONB 3PYDA 2Y3YA 3EM1A 5KOWA 2P6TA 2UUBJ 4R8UA 3UWTA 3MR7A 4EI2A 1WWHA 1NSPA 4B3MJ 4JI1F 1Y3JA 1R7IA 4UZCA 3DNCA 2JEGA 4DSKA 4TLQA 3VAJA 1NK4A 1T9WA 2C3OA 2HWIA 3HD2A 3MHYA 3MD3A 3NGSA 4LRBA 3W64A 3LTOA 1HQUB 3R5BA 3EGNA 4AE5A 3KWMA 1H6KX 3GU0A 1Q4RA 1C4AA 2V8GA 1HBUA 1FVSA 3AD8C 2FVQA 1SIZA 1FJGJ 1TMJA 2YNFA 4RLEA 2AQ4A 3DDKA 1DTTA 2FHMA 4M5HA 2XWXA 2XLJA 1KHVA 1RU2A 1TL7B 5J2QB 3W61A 2HVEA 4X64J 2CNOB 2AYGA 2VA3A 2PDAA 2MQ8A 3H0PA 1QSLA 2Y1RI 1IWAA 3DLJA 2VDHA 2MPUA 4MIAA 4ZVFA 4IH7A 2GIRA 3BZQA 5K14B 3U27A 3K5LA 1UVLA 4DV0J 1RZMA 3LPYA 3O1LA 4KTQA 4HDGA 3GYXB 4NLYA 2C3MA 2HWHA 4L75A 1FJ7A 2EWHA 4B9NA 1R8HA 2OJ3A 3HO1A 4OX6A 2GAHC 2HNZB 3DKDA 4CRJA 5B7WA 1HQEA 2A1BA 5CD4A 2DNGA 3OR2B 1SQFA 4HDHA 2XWYA 3C15B 2NZ4A 4CO0A 1RACB 4USIA 1X5TA 4FYXB 3C3LA 4B3MF 2HGNA 2OPRB 4RNNA 1U6BA 2V63A 3OFGA 4WZQA 1DTQA 3CJ0A 4LFBJ 1JB0C 2EBEA 4JI4F 3DC2A 1Y11A 5CHCB 3SQGB 4ZCMA 2ASJA 4DL7A 2KM8C 4MAKA 3IN5A 1VQLS 2I9SA 1S9GA 2O5DA 3W1YC 2ZH1A 1T02A 1JLAA 3JAMY 2DGOA 2LKZA 3AA9A 5HP1B 4RO0A 2BQ3A 4LMZA 5KFGA 2UUTA 2A10A 3NXZA 2HAIA 4HHUA 1ZAVA 5ETKA 4CLUA 5KFFA 1KTVA 4OI0A 2E7XA 3DLEA 4ED7A 3CCMS 2EKYA 3HT0A 1HNIB 1PKUA 2IJNA 1IR0A 1X60A 4X64F 3EUNA 2D3O1 2B4PA 2DH8A 4PYAA 4TXSA 3NOCA 3CXCR 1S0OA 3I5BA 2HQ3A 2X1BA 4M5NA 5LJ5Y 4YR2A 1FRIA 2Z0GA 3TUIC 2E1AA 1ZM2A 2VL1A 2M8HA 4LBPA 1NSQA 1FWKA 1S10A 1IKYB 1D8YA 2IMWP 2LLZA 3MM9A 5E5NA 1UTAA 1ACMB 1RT2B 1X5PA 1TKTB 4ETXA 1NXIA 2WRMA 2IM2A 4IOBA 4K59A 3IBCB 5RUBA 3TAQA 1D9FA 3RW7A 1SPBP 4LSNA 1QTMA 2FIUA 2WW8A 2FVCA 2UXDF 4WE1A 2CQPA 4Y34A 1IR1A 3GIJA 4I6YA 4RUBA 4DF4A 2L3MA 1VC5A 4RU9A 2ZH2A 5JVGQ 1FKPB 2DNZA 1HBOA 2KRBA 1OY8A 5M2PA 4Q8FA 1IKXB 4CI0B 1VRUB 4JYAJ 5I3UA 2HQFA 2P9EA 3VV2B 3DXSX 3KLHB 4DV5F 4ILRA 5H9EK 2UVUA 1K0TA 2ZJQQ 2D7SA 3D6HB 3OR1B 4LF5F 2MGZA 2ZKUA 4O3NA 2HAFA 3G8SA 5F0UA 4YOEA 2PFDA 2NLWA 1K1SA 2V4JB 2F4VJ 2YX7A 4OFZA 2C42A 3IG1B 3UN2A 3UCZP 3AD9C 4QU6A 4J9OA 4ED3A 2JC1A 3MMCB 1GX5A 2VKRA 1XMOF 4J9VA 2HZAA 4WK3A 1S1XA 3SIPB 3PFEA 3TEHB 4OYOA 5E7OB 1MROB 4ZP8A 3HSDA 2WSFC 3ILJA 3G8QA 4EBDA 3KLEA 3K5MA 5IQQA 1MWZA 5CABA 4J9KA 4U95A 3G6VA 1NKCA 1MMDA 1VYAA 2AEJA 3MM8A 2YKNA 5CH7B 2OEMA 1RTDA 2JZ5A 3PHEA 2DRAA 2PA3A 3FQKA 3IBFB 5D4NA 4IDKB 1O6XA 3I4PA 5E2QA 3ZXWA 5DG9A 1CULB 3BSCA 3MMAB 4YN3B 3D2WA 1SH2A 1SCJB 2QLJB 1S9EA 2LDYA 2M52A 1BD6A 1ULRA 2RRBA 5KFYA 2EK6A 3KNAA 1Q5VA 2B4UA 1UZDA 4BHQA 1T9TA 4F2RA 5CYJA 3CCJS 1HNWF 4K0KJ 1VMBA 2VG6B 4OI2A 4CLFA 3H40A 1AW0A 2AYMA 3PEHA 5I42A 2QIFA 2Z58B 5DZ6A 1RKJA 4ZVSB 5K8MA 1KONA 1RT1A 2MKHA 5J1EA 1B0TA 1MWQA 3GIRA 5KT6A 4FYVB 4AXIA 2EI5A 2MEWA 2FVPA 1FESA 3R5GA 4K4SA 4FYYB 1CJUB 1KRPA 1V6HA 4YB6A 1XEZA 5B09A 4M5IA 2R9LA 4X4RA 2X1FA 3PR5B 3OVAA 1IBLJ 1NJZA 2XGQA 1EP4B 3TQ1A 1RK8A 3MTKA 5HN0A 4DR3J 5DLFA 1V5VA 4NASA 2ZBPA 1S0VA 2BRKA 4CTAB 4JV5F 1Q7LB 2DNYA 2VFUA 2PFFB 2G9OA 2FVSA 1FTRA 2MQLA 1HHQA 3FK4A 1LWCB 3FUYA 1XMQJ 4KKOB 3HFKA 5DGAA 4ZLPA 4DR7J 4ZP7A 1F0XA 2Y0SD 5HROA 1P9YA 2WHOA 3ENWA 4QW8A 5K8NA 2BA9A 4KHMA 1HL6A 1M5VC 4U7CA 1RTIB 1P1TA 4M5GA 3HFVA 1W26A 2LMIA 1XR7A 3UO0A 2KG0A 1FDNA 1VLOA 2RKIA 4B3TJ 3PYFA 3AJ1A 3M32B 4DV1J 4NI2B 3PO4A 5IT9Y 5T7LB 1FRMA 1HNWJ 4A48A 4XDCA 2KZMA 4I7FA 5FDLB 2W2PP 2RU3A 1VS3A 3TX8A 1T9YA 3OTBA 1UVKA 2AHOB 1DLOA 2GIFA 3MMBA 4C6AA 1MN7A 5LOQA 4ECVA 4DR6F 2NXCA 3DGPA 2HRTA 3VGVA 2OHDA 4DR4J 4MH8A 1T05A 1PSDA 2R4FA 1QJHA 2LECA 4IO9Q 1R0AA 4QYZJ 3C6UA 2LVWA 1X4HA 2BKPA 3SSSA 4ANCA 2GMLA 1TKZB 2B51A 1RADB 2KN4A 4RW6B 2Y8WA 2YWEA 3POTB 6FDRA 4ZLJA 2OEKA 3W2VA 4A4JA 4DQQA 4P7TA 1C1BA 5KFCA 2O1PA 4JV5J 4QOTA 3T1AA 2PC6A 2Y0BB 3QIDA 4OJGA 4DX7A 5A8RB 1R0CB 4HLBA 5F9NA 3T19A 4ES1A 2HHHJ 3MF5A 5CQGA 2GJIA 4RBVA 3KDNA 5C25B 2VQFJ 1TP7A 3AA8A 3DHWC 3N6MA 4OV1A 3OTOJ 1R0BG 3ETOA 2FJVA 2YPYA 1CG2A 3HHLD 2MKSA 1BQXA 3CVKA 5C25A 2XLIA 1YITS 2PEHA 2CQGA 3CMQA 4C97A 1XERA 2BANB 3G82B 3N9UC 4DFPA 2NXNA 3ZZZA 3O5TB 5GAHI 1RISA 3ZZOA 3NOGA 2IHR1 1R31A 3R5CA 3QNWB 3MR6A 1Q86T 4QZVB 1PJ5A 2CPIA 1WHWA 3ZZUA 1T05B 4HT5A 3CJQA 2YX4A 1NDKA 5DDOC 3US5A 2LEAA 2VONA 1BLUA 4QBUA 5ETQA 2DT9A 2H5IB 2N7YA 1KQGB 2ZUAA 1UP1A 3I0RA 1FRJA 4XDDA 5KT4A 1N36J 4LSLB 1XNRJ 4DN0A 2MQQA 1Z2ZA 3FFIA 4WU3A 5AXKA 3NP5A 3X3UA 2IFXA 4X4QA 2C2EA 1U7LA 2CPYA 1KWMA 3DOKA 1JJCB 2FGOA 3DGPB 2OPSB 2FTRA 3TW0A 2CDQA 2MB0B 1PC4A 1BUXA 2Y9HA 4J9UE 1FK9B 4YY3J 4KGKA 1BQMA 4H4KA 2BM0A 2E5LF 1Q81T 4PCQA 1I94J 2V5HG 4DCPB 4FNIA 2MY8A 1VQOS 1FKAF 4MYUA 1N52B 2DO0A 3QGGA 5D4OA 2XO7A 2YNHB 5IWAJ 1YJUA 2YH1A 3K5NA 3J7Z5 2DNNA 3M7VA 1VQYA 2DNMA 2FGCA 4U6PA 2HMIA 4LF2A 1YRUA 2QL5B 3HM9A 1P1LA 2HIQA 2RNEA 2G0IA 3KJNB 5MLCV 2XS7A 2AYEA 5C42B 3DMJA 3CJKB 3D5MA 4N41A 4ZVUB 4FZVA 5IC6B 1KBRA 2B8QA 2ILYA 4K4XA 2WOMA 3IRWP 1VIOA 3TARA 2R7WA 1UA1A 1WSVA 2C2ZB 2ZBRA 4M8LA 2OPPB 2MY7A 2HWTA 4G6VB 4ICLA 2G2ZA 2PSZA 2KFNA 1X31C 4UUXA 4HHJA 3MM6A 1RTIA 2ZH8A 4JI7F 4FDFA 4P2XA 4A8KA 2O66A 1YBTA 1YG0A 2PI5A 2A18A 2QGFB 2DHXA 2KZZA 1VRQC 2QYCA 1GK8A 3AY0A 1UJ6A 3IR6B 4H4KC 1JKHB 1LWCA 1TL4A 3IGVA 5MAOA 4B08A 2BYCA 2ZH7A 1XR6A 3BBFA 1R8BA 3RZAA 2XMMA 4LQ9A 5CZVA 3SCJE 4CTAA 3OHAA 5HK4A 3VAIA 2RB7A 3RR7A 4PUOB 1FWLA 1G1XA 5ETVA 1HI0P 2JH3A 3BSNA 2CPZA 1FTCA 1SXLA 4P52A 1TU0B 1VRTA 2DR6A 3GJTB 2BACA 3GIMA 2I8EA 1VQMS 4GMKA 3U7JA 2AWZA 3L7OA 4RNFA 1EQ0A 2FJXA 4ZJLA 4CO1A 2FHJD 2ZKTA 1KTQA 2FJDB 3HHLC 2CVEA 2E1PA 4C3MA 2B9YA 3CMAS 4KGZB 4IRCA 4L6V3 3BB5A 3M6WA 3DN9A 4DFMA 3AQPA 3BDEA 2ACMA 5A8WB 4DV2J 4LR7A 1VQ9S 3NGRA 2HRUA 3H98A 2EFQA 2XI2A 4RW4B 2WVFA 2P5VA 4KH1B 4Z7YA 3D0HE 5C24B 3CO0P 5E0OA 3D1QA 1M5KC 3CSKA 3QRRA 4P74A 1T3OA 1SUQB 1UJ5A 4NMXA 5BXIA 1FHTA 5KFDA 4WKYA 3KLGA 4NXNJ 1SJ1A 2P6SA 3E51A 3FBEA 3HDSA 3MMCA 3QSYB 1TK0A 3HZGA 2YKNB 4V19X 1J27A 1UW9A 5HMZA 1OWXA 1QE1A 3VAKA 4B17A 2WSCC 2CKWA 2ZBQA 2BKOA 2HEKA 1FFGB 2F3JA 2LQBA 3FMBA 3ILOA 3OR1A 2OFGX 3PYEA 4EWTA 4F4AA 5CA5A 4JI4J 3DU5A 1E6VA 1FKOA 1U2CA 2OSQA 3KKFA 2R8IA 1ZYQA 4LBIA 3NNHA 2W7PA 2HHTA 2V2VA 3IMQJ 3ZTPA 1NK7A 2VFVA 2YQ0A 3I96A 5GAEI 2BUNA 2YPZA 5HBMB 3G9CA 3K8WA 3AJDA 3IG1A 4LF7J 1FX4A 3MR2A 5FLXU 3SZ2A 2FY1A 2RUGA 2YWKA 3G8TA 2ZM6F 4KFBA 1BWVA 1RTJB 3DDNA 4IQMA 1L3SA 1VQ4S 1XNQJ 3K17A 3MPYA 2EPIA 5T41A 5A2QU 2C2DA 4YB7A 3KYLA 4DL4A 4PQUA 4LF6J 1S48A 3PIOQ 2EFGA 1KVKA 3R27A 1YDLA 2WVEA 3MM9B 5I3UB 1RWMB 1JLBA 3HCXA 3PDNA 3OFHA 2IDLA 3C46A 5F8LA 1UAWA 2EFNA 2FPHX 4RL1A 4Z37A 1DZ5A 2JLEA 3DLKB 2UVVA 2JOQA 1WHYA 3ILLA 2Y1IA 2RQMA 2AGPA 3MUVP 1HWJA 3QGHA 4Q5VA 1RTHA 4BWJA 5LSLA 1WG1A 5CXTA 2DGVA 1QD1A 4DQRA 3CD7A 3K0JA 5LM7E 4O44B 3UI3A 3I6PA 1BQNA 1PBUA 1YRTA 3MZIA 4HACA 2WSEC 4KO0A 3KLFB 3V4IB 1HR0J 4RW9B 1OY6A 1V3SA 1JLAB 3KLIB 1M1KT 1Q8BA 1WKLA 2GC8A 3A4TA 2RF2B 1FE4A 1S9GB 1VISA 4JYAF 1H2VZ 3SDEA 1C0UB 2BW7A 2ROGA 3FMWA 2E5HA 3FCWA 5HQ8A 1VGYA 5DG7A 1UWAA 1RT5A 2NXUA 1X0FA 1WOPA 4QR2A 4CH7A 5GAEU 1M90T 3I32A 4LR9A 2HZVA 4M5KA 5THWA 2QA2A 2YWWA 2Z4PA 3MWBA 3OXLA 2YNGB 1WC6A 1H74A 2ZITA 2VOOA 2QFJA 1J5EJ 2DIVA 3C15A 4ZCLA 1S0MA 4DPTA 2OD6A 2B6AA 5ETPA 1GTEA 1NNDA 1NPPA 1S1UA 5AJ3J 3PX6A 2HNZA 2JLGA 1QSSA 1S1WA 1S6QA 1TL1A 3NWRA 3H4BA 2VQEJ 1FI4A 2AJ1A 2DR9A 4CNYA 2FJBB 4UY8T 5KG0A 2CPJA 3ISNC 4DL5A 2AV5A 4N47A 2V4QA 5I4MA 2R2UA 3PX0A 2D74B 2XMAA 3KTQA 2L9DA 2IIHA 1WEYA 3BGFA 2ZZMA 3T5KA 2XGPA 5C7PA 1GH8A 1RLCL 3RAQA 5IT0A 1W7WA 1YTYA 3TAMA 4JOUA 4UZBA 1HFEL 1NK5A 4G1QB 2MLXA 1XTZA 2DGUA 3N6LA 4DPXA 4TN2A 3UD5A 1HR0F 1PYTA 2LA6A 4B3SJ 1L3VA 4K0KF 2J8AA 2DO4A 3EGWB 3CJ4A 5D0GA 4P73A 2QLFB 3T41A 5DDQC 5DG8A 4LFCF 5HANA 1XJWB 3UW1A 4O3SA 1H3DA 2FB0A 2HNDA 2CRLA 3B4MA 4I4BA 3R7SB 3VGSA 3OQ2A 2J9DA 1T03B 3MAAB 2DY9A 2OMLA 4J9RA 4M95A 2ALYB 2L48A 1SQGA 2E66A 1ELOA 4G1PA 1LXJA 2VODA 3TO8A 3OLAA 4B3OB 2M8DB 2QMXA 1SC3B 4JI2J 1NUEA 3JSMA 1YX2A 2WVBA 5HJYA 2EC2A 2VF3A 3C19A 2OP5A 2D9OA 4L3NA 1HBUB 2MYFA 3CCUS 2LFVA 3RGIA 1WTBA 4JI3F 5DQIA 2H51B 2UZAA 3AOAA 1YKWA 4O3RA 4MK8A 3PXGa 3W8PA 4ECUA 3R8YA 3TJ8A 4WFZA 4ZJQA 2W9AA 1XIQA 3UVJA 4LFBF 5A0YB 1ZPWX 1RAFB 2DNOA 4PXDA 3BSAA 4TY8A 3FRZA 4N5SA 1BWEA 4UW2A 5B0CA 2VPXB 1T9VA 1K44A 1PYOB 1O8BA 4NCGB 2ZH3A 2UU9F 2AYBA 3SSRA 2KT2A 3U1LA 2ACYA 1CVJA 2Z56B 1IWGA 2KFZA 1KOHA 2GJFA 1AUDA 2X51A 1HNVB 3JXOA 3M30B 2XQCA 1Y5LB 3IM9A 1CJTB 4LFCJ 5H1SV 5EWFA 3CEDA 1CQMA 2R8GA 4OHYA 5JMNA 5AT1B 1E6YA 3VQTA 3PW5A 3NY0A 1BE4A 1N33F 1HBMA 1QDUB 2YKQA 3MAHA 2OGUA 4RUHA 5LSOA 5KFRA 3D28A 1IBMJ 1WF2A 3BGRB 4I2QB 4Q0BB 1S1UB 3CC2S 2B6AB 3ZTSA 1OO0B 1M5SA 4NYPA 3OV7A 4DFKA 2HGLA 4B02A 4JI5J 3D1OA 4HVZA 5HL7Q 4P9SA 2AZ1A 2MQMA 1S1VB 4KRWA 5AXMA 3TJAA 4X4SA 4C8LA 2HVIA 3LAMA 3MPUB 2LCWA 2QA1A 2Z30B 3O8WA 4OYAA 2UP1A 1NSAA 4P2FA 4PG8A 3QATA 3UDLA 4DR1J 4DLGA 4NA2A 1YZ6A 2V8VA 4M5LA 4C8KA 4PAAA 1OQ6A 2NSBA 2HHHF 1RBLA 2BJ9A 5K5MA 1T9UA 3CD5A 1KFSA 3PZPA 2UU9J 1HBMB 2CJBA 1VHFA 1BGXT 3WZ0A 1GMWA 2IDEA 4KO0B 4QWEA 3GILA 3KLFA 5L1LA 3Q8VA 2BXJA 5F8GA 1E6YB 4O3QA 2W9BA 1XMOJ 1N6QB 2KH9A 1SJQA 5D4LA 2ILZA 3DOMB 1EQMA 1EAYC 1L5UA 4MKYA 1RGVA 2AJFE 2GIQA 2AIRB 2BJ3A 4WIQA 3VQSA 2JL9A 4I64A 3ULHA 3KFWX 5D4PA 2E5IA 2DGXA 4LRFA 3E8OA 2CWXA 3A8IA 4CNZA 3Q0AA 4G3IA 2FZCB 4ZVHA 3W8GA 3W5ZA 1NB2A 1RTZA 2XZWA 3GYGA 1VBYA 3M9MB 1IBMF 3H5YA 1TAQA 1HBNB 5LXYA 3VGUA 3PW4A 1U45A 2GQ2A 2QLBB 5G4DA 4NLQA 2MLZA 4LIWA 3V81B 4WXWA 1J5OB 4YDDB 2RHSB 4C7QA 4K4TA 1NBEB 4X66F 2DCLA 1H2TZ 3UN3A 2E1MC 2VD3A 3I31A 4L76A 5ETOA 1S76D 2CDRB 1S5ZA 2DNRA 3S01A 3TZXA 4YY3F 1NM2A 2VPZB 2V34A 3DRSA 5KFAA 3AOCA 2XCAA 5CZXA 1X5SA 1TL5A 4Q2MA 1X9WA 1I94F 2CJAA 2J5AA 4OMFG 4A8OA 1HA1A 2HSEB 4OV6A 4DF8A 3RRGA 4NZ0A 4DR2J 2PGCA 3HHEA 1HI1A 3QFHA 3ZFVA 1RU1A 2M3DA 2XYHB 4ZPDA 1QE1B 3KK1A 2DRDA 3UQSA 1HHTP 3GB0A 2VA2A 3IP0A 3UDVA 3NGTA 5CYMA 5AE1A 3PO5A 3M1VB 3OBIA 4ZA1A 3BO4A 2HNDB 3GV8B 5KFKA 1DURA 5DJBA 4C8OA 2NPIA 2NSCA 1Q7YT 4OJ3A 4DR3F 2UV8G 3BN4A 4G1IA 1TQLA 2RU9A 4J9LA 2AGQA 2IM3A 5C24A 1Y5NB 3UCGA 3W62A 1TELA 5IT4A 2ADBA 3LAKA 3BREA 3MPVA 3LP1A 3ZZ0A 4J7CA 3TAMB 5C5JA 4ZPCA 3ITHB 1MLAA 2M7SA 4A8SA 3SMZA 5EX3A 5AE3A 4F36A 1RABB 2B3TB 4QWBA 4QWDA 3Q2SC 3G4SS 2C2KB 3D9BA 1JJ2R 1VJQA 4Y2AA 3NGUA 4RUAA 2K1RA 4MJKA 4QR0A 3QYYA 1RHJB 2V67A 3FC9A 4C98A 4B9SA 4QYZK 3IAM9 1IUJA 3MCNA 3AFGA 2I5JA 4IG3A 5DDPC 2E1CA 2UVRA 3KDOA 3HZEA 4X66J 4EO6A 2BJEA 3JQKA 1FFSB 3QZ8A 4AL7A 3TZYA 1W25A 3I9V9 1WORA 3MCOA 2K7KA 4XK8C 3PG9A 2V9WA 4A8FA 1RHKB 2O67A 2FDNA 1ZBTA 2CNNB 2Z2ZA 3NWGA 5ETTA 3M05A 5KG3A 1DHMA 2OPQB 1Q5YA 1F6TA 3EMTA 3CDWA 4N7TA 1OSCA 4OZ2A 4XTTA 4HI2A 2N82B 4ZVTB 4DR2F 4BS2A 1JKHA 3G96A 2VC0A 5D0EA 3TA2A 4ED8A 1FF2A 4CLSA 1FDDA 2OEJA 1Q16B 4RJVA 4DMZA 2DNHA 2L9NA 5E3RA 4RNOA 3CJ8A 3H5UA 3F73A 3MM6B 2KG1A 4ECXA 2RF2A 3G6XA 4Q8EA 4GKJJ 1CJKA 1SBRA 1YJ7A 1R27B 2RDDA 2Z2LA 3G87A 1RHMB 2C2NA 4AUKA 1H7WA 4HACB 3PIPQ 3BPDA 2M70A 5CYQB 5L9XA 3V4IA 2M88A 4O44A 3W2WB 1VQPS 3H20A 4IG0A 4MKVA 2KT5A 1VK8A 4LIRA 4YEAA 4ZP9A 1WACA 4F7VA 4KHRA 1Y5IB 2E7VA 1UVJA 3PKYA 3HD1A 4YDXA 3VGTA 3FDSA 1NO8A 3IR5B 2L41A 3MDFA 4OYPA 3OL9A 2LU2A 1K73T 4K50A 1RHUB 1DRZA 1FWPA 3IS9B 1N5SA 3TI0A 1YSJA 1JLBB 4X84A 4QWCA 4QWAA 3MCSA 1UETA 1UW4A 2HQIA 4OYBA 4LRAA 4OZLA 3RAXA 2XLKA 1I51B 3H7HB 3FKBA 1VQNS 1HIYA 5HQMA 2KXFA 2VHGA 3RW6A 1RTJA 5HVFA 3BQ2A 2G1DA 3JSBA 5HJXA 2HK3A 3T5JA 5KG4A 1IBCB 2Q6CA 4I67A 1RCOB 3N4WA 2GHVC 4JI0F 5IM0B 2CPEA 3IRXB 3Q86A 2F40A 4LSLA 2M2BA 1XNQF 3J7YU 1HI8A 2G0JA 2Q43A 1F5BA 5J2PB 2EFOA 2XTJP 3ISZA 2MXYA 1UFWA 3MM7A 1PYSB 1RWKB 2JFKA 3GP9A 3NG8A 2MZTA 5CCLA 3NBPB 1D9DA 4J9MA 4I69A 1IM4A 1FDAA 4XPEA 2ZH4A 3K7RA 3QJPA 1U1NA 2OPQA 2GZOA 3OPKA 1YJVA 2MMYA 2BANA 3EJMA 3G82A 2MDAA 2ZOGA 1EETB 3PKMA 4A46A 4UOGA 1S4EA 4O0NA 4ZVRB 2KB2A 2H4WB 1A0OB 1MNEA 3CGIA 1V5IB 4DV7F 4DL6A 2ASLA 1IBKF 4HKQA 4PWDA 5IOLA 2ZDPA 2I5JB 3BS9A 3NNAA 5JVHQ 2AP6A 1MMNA 2ERRA 5H9FJ 1QM9A 5A8WA 3L7UA 3UPFA 2K1RB 2VUGA 1AZSA 4MKAA 1VOMA 3R7BB 4CLKA 4OZ0A 4HHHA 4O23A 3RBDA 1SVDA 4Y2KA 1CBKA 3E01B 3QT7A 2NR0A 2RILA 3C2PA 1CC8A 2LA4A 2MZQA 3LOUA 3MEGB 4RW8B 3WIVA 3RB0A 3KG4A 4BCAA 2DH9A 2B7BB 2D69A 3POTA 1B7YB 1N5VA 3MD1A 2FHOB 3PEJA 3VVTA 3TJ9A 4WP8A 3KLVA 2VFSA 2R2RA 1J5EF 4K4WA 1B70B 3DLBA 2P2CB 1RWVB 2HGMA 2IVFB 1TZ0A 3TNVA 3UR3C 3J81U 1R0AB 5IZHA 1X5OA 4D3GA 2F9DA 1PILA 1U1LA 1KN6A 4EBEA 5A2QY 2VQEF 4OLPA 1N88A 2KFYA 2IJFA 4WFXA 1X4BA 1T8EA 2GFFA 1UFKA 1H38A 4NLSA 4UY85 1WDDA 2G1HA 4C9DA 2JDJA 1WC1A 3RRKA 2F65A 2DNPA 2IAJA 1RUSA 2B8PA 2FLNA 2BKNA 3I56S 2OAUA 4JV1A 4O4GA 5T7LA 2CQ1A 4C0BA 4ILLA 3SFGA 4PRFA 1ZZNA 2G2OA 4K5SA 2BW2A 3DRRB 4U8VA 4ICLB 5KAKA 5BR8J 1HD0A 3O6QA 4P75A 2Y1JA 4DV7J 2RDJA 3FSXA 3GFYA 1VC0A 1VCTA 2ADCA 4KHPJ 2I2YA 3DMJB 3CJKA 5C42A 2XCPA 1S9FA 5H9FK 2WCXA 4H4MA 3VF0B 1N0UA 5F9LA 2MKIA 1QVGR 4RBUA 3BR8A 4LF1A 4DXLA 5KFSA 4F26A 3U1MA 3CCES 2E7WA 4U96A 4LUBA 1VBXA 3FJ2A 1MN9A 3NAIA 3FBFA 2V50A 4FYDA 1ZA2B 2R8KA 2HS3A 2Q66A 3PACA 1URNA 5D77A 4ENOA 3AOBA 3R97A 2IAJB 1NHUA 2F4FA 3FEYB 5BYSA 2QMWA 4C0HA 4ED5A 2IRXA 2JSXA 3OLBA 4WKRA 2AJ0A 3SCIE 1DFDA 3BGOP 2RJZA 1QLNA 4JI3J 1U6FA 2DXEA 3DM2A 1MW7A 3HVTA 1U2FA 3EVOA 4LJMA 5ETLA 3W65A 4WIIA 4TU8A 2W9BB 2ZJPQ 1N6QA 4IH6A 3H4DA 2R8JA 1SV5B 3KJQB 3D3CJ 3SCKE 1C2PA 2VPYB 2AF6A 3I0RB 4HL9A 1CJVA 3JQJA 4ED1A 1R3NA 1U0HB 2YWGA 3B6BA 5J1PA 2JFDA 1TMMA 5EWGA 3K59A 3J80U 5HLFB 1WUUA 2ZD1B 3LGHA 1NK0A 1FJGF 3EZUA 4YS2A 4YR3A 1UVNA 4LF7F 4PPZA 1RYRA 1F5CA 3IWXA 1S1VA 4MIBA 4D3HA 2DGSA 2XO6A 3KNGA 1WG5A 3Q8YA 4KE5A 4NE9C 5LXRA 3FGVA 2YKOA 3K5PA 3PTWA 3TQEA 3PX4A 1F3VA 1T7PA 1UCNA 1JXLA 4EBCA 4KC5A 2HHUA 3WX8A 3NCQA 4Y0FA 3P6YC 3TUPA 4NLDA 2KT3A 2ZWOA 4B3RF 5EHHA 4A8WA 1NU4A 4QQBA 2ASYA 4NRTA 4PWDB 4DFJA 2PT0A 5DDRC 1KEKA 3MOJB 3EDRB 2W9CA 3D68A 1EETA 2CWKA 3MGJA 4J9QA 4W90B 2J9EA 1ZZFA 2VG5B 3RJMB 1H98A 3GSDA 5A6WA 5KFLA 5AE2A 5F8MA 2V4RA 2A6OA 3RAMA 5DQGA 2DVIA 4I2PA 3G71S 1AUSL 5D78A 5SUHA 2VBZA 4XIUA 2UUAF 5B0EA 2AW0A 1FXLA 1NSKL 2JHEA 1G2EA 2MLYA 2CNKB 4NCGA 3EPGA 2AJQA 5HMYA 4YUDA 2WBRA 3T6BA 5IT9U 1LK7A 2YY3A 3F0NA 1SB6A 3W66A 5KTQA 2PIIA 2R42A 4DL0C 3PW0A 5AXNA 2MTLA 2K3KA 1KDNA 1F60B 3B54A 3PRDA 2E9ZA 2AJ4A 3CIZA 2KXHA 1XK8A 1F1BB 4NLGA 3VR1A 4NL5A 4R0JA 5AJ3F 4I7FB 5FDLA 4DUZF 2Q3PA 3BBBA 1LWFA 1FXRA 1RHRB 1RT2A 4NI2A 2UUWA 2CNLB 1RWPB 2R3VA 3SXLA 3JSMB 2VIHA 1KFDA 4F3OA 4NCAA 2XS5A 2HIYA 3QMQA 3DHXA 3PCOB 4E8UA 3C6TA 2HBYB 4QIWD 1NKEA 3R2CJ 2HK2A 2Q1LA 1NLKL 1NHVA 1UJ4A 2CQ2A 2HQCA 1MG7A 4RNHA 2ZE2B 4KGVB 2E9RX 1S49A 3Q89A 3IR7B 3W9IA 4YQWA 4K5RA 2LQ9A 4V19J 4M94A 2H65B 2R7XA 3FSIA 4KKOA 1OSDA 1X0PA 1UEKA 3W2WA 4ZVOB 3MR3A 2PD1A 1UPPA 3QJLA 4IRKA 3D6TB 1B7FA 1TR0A 3GR1A 2ZWPA 3SQOP 3I5AA 3HSZA 4QIEA 4NPOA 4AXJA 4Q45A 4CLZA 1LOUA 3WC2A 1NK6A 5KFVA 1CJKB 2UUAJ 1EP4A 2XSJB 4OLOA 1HPZA 3M2UA 5KT7A 4FKYA 1FERA 1X4AA 2F8HA 4DV5J 1D8ZA 2N4DA 3CWJA 1ZM3A 4ECSA 4V1Ak 1DTQB 4FXVA 3MEKA 3B78A 3M8YA 4KV8A 5BYQA 1TUVA 2O01C 2U2FA 5B0AA 3UCUP 3C16B 2F4VF 5D6GA 4K4VA 2DIUA 2GQCA 4RR5A 5J2MB 1OJ4A 2CJYB 3KHGA 5KFNA 4F4KA 2JVOA 4XPCA 1S1WB 3CF5Q 1M5OC 1HQEB 1LWEB 1LWEA 1GX6A 1DAXA 2DGWA 2D3UA 3WIUA 4A47A 1OIAA 2XY5A 4YB5A 4EYHB 3PY8A 1HARA 1REVB 4QR1A 1RE1B 4Y2MA 2DR7A 1Q95G 1Q8KA 1U8SA 2BZ2A 2GO9A 1Q8IA 3THTA 4PPDA 2BOPA 1PAUB 4WP3A 3AH6A 1HWKA 5K14A 4P6QA 1HWIA 4DUTA 3CCRS 4IDKA 4ELVA 5L39A 2IPOB 4OI3A 1GMUA 2N3OA 2ASDA 2CAJA 2WVCA 3LP1B 3HF5A 2RS8A 2XSJA 5LMNJ 3NGDA 4ELUA 4LF9F 2HS4A 4DJBA 1WC5A 3BJYA 1IJFB 1JNZB 2MSSA 4OHVA 2X3GA 3LWMA 1HNZF 4GVLA 3M8ZA 1RB0A 1U6ZA 3BKTA 2YNFB 4RU2A 1XWLA 4ID5B 2HFUA 3D66A 2FUG9 2VC1A 3PYGA 2DR5A 5GAGU 3IBWA 1HMVB 1KQKA 5IC4B 1UWBB 3H42A 4KR0B 1HQUA 3DFEA 5HATA 1OQ3A 3CCTA 1N33J 2V4JA 1ROFA 5ITHA 1IKWA 4OX8A 3C6TB 1I1GA 3KK3A 5G0RB 1DARA 1S59A 3BGLA 4EO8A 2XZTB 3TUZC 1Q79A 4QPXA 5EN1A 1CS4B 1VQSA 3EXYA 3ENAA 2QE5A 4MFBB 3DYAB 4YR0A 3CCLS 2WONA 4DV3F 1I6JA 2FLLA 2GVZA 3CPWR 1Y3KA 2M9KA 3OD2A 4UQGA 1EX8A 1BY9A 4NOHA 3JQMA 2FC9A 2A2CA 2M4MA 2V2KA 2CQCA 2XNQA 4DPOA 3V81A 2XMUA 2OLWA 5GMKa 2B7CB 1NJWA 1D3WA 4IRDA 1RHQB 2YXLA 4DR7F 1K47A 2LXIA 3M2VA 3QAUA 1Y7PA 4MFBA 4IR1A 1GT8A 3JTPA 3JYTA 1C0TA 5K20B 4FS1A 4HTJA 4KQZA 2HHWA 5G0RA 3R5AA 1IKYA 3KG0A 5LMNF 2YKMA 1NH8A 4ZN3A 1HHSA 4DBQA 2R2SA 3ILIA 3PJ9A 5CAAA 2HPUA 1VBZA 2PMWA 3EYZA 3O3LA 3EXCX 4L3KA 4W4MA 3DOMA 2GQQA 5KFZA 1HMVA 3LPEA 5SZTA 4IO1A 3CCWA 4FPRA 3N5BA 2ZZNA 5IXUA 1H2UX 3IWNC 1MMLA 4DEZA 1VQ6S 2IM0A 2K2PA 1AA1B 5KFIA 3DOLA 2ZHAA 1ZTTA 3M9OB 3B4DA 3CTRA 3PRBA 2BMBA 5ADZA 4URGA 5KFEA 2WTFA 4DR4F 4DHVA 3Q23A 1F9FA 3SQGA 4FBUA 1YZ7A 3GQCA 1VDHA 1ZAXA 3EWGA 2C3PA 1N8RT 2MKCA 1WI8A 2EBGA 1SC4B 1WOOA 3F44A 1NRKA 4NMLA 3MEEA 1YRXA 2HVDA 2UXCJ 4EEYA 2LP4A 2VASA 4GC6A 2X3DA 2EKNA 3OVSA 1TAUA 3AJ2A 1JXVA 4NX9A 4NYZA 4EYIB 3OR2A 3BM7A 5GMDA 4JI8F 4DCJB 3HVRA 3CDAA 1U0HA 2CVIA 1VRTB 2E5GA 3BGRA 3D67A 2QO3A 4I2QA 5K8OA 5KG2A 4IUFA 4NA3A 1NH7A 1SV5A 1WD6A 2D9PA 4PUOA 4R25A 4I6WA 1O51A 3E3XA 3QSIA 1T94A 4OYMA 5J2MA 5DM7Q 1IBKJ 2GHWA 3FRYA 3BYRA 4PKDB 4I1TA 3C16A 2F7VA 1NPKA 1SL1A 1NZAA 1TKXA 4X4TA 4OL8A 1O5JA 2H48B 3HJVA 1RDRA 4PG5A 1Y10A 5KT3A 5H9EJ 1CQNA 2B9WA 4ITSA 4OIXA 2HQGA 2CZ9A 1FDBA 3M6VA 4CLYA 3HHNB 2KHCA 5B0GA 2HFOA 2CG8A 4NLUA 4ED2A
chains in the Genus database with same CATH topology
4KPCA 3FCVA 3B6BA 4C6AA 1MN7A 4DUTA 3R9LA 4DI6A 1F3FA 3Q83A 5C7PA 1LEOA 4ANDA 3VGVA 1NB2A 1W7WA 3Q86A 1WKJA 3EVWA 3ZTRA 1NDPA 3VGUA 1B99A 3FBBA 4ANCA 3Q8YA 3GPAA 4W98A 1UCNA 3GP9A 3WX8A 4FKXA 1S5ZA 3NGRA 3VGSA 1LWXA 2DY9A 2BEFA 4DZ6A 3EICA 3EJMA 5BXIA 2CWKA 4UOGA 1BHNA 1S59A 4O0NA 4UOFA 3EM1A 1NUEA 3NGTA 3FBEA 4ANEA 3ENAA 5IOLA 3EVMA 1S57A 1NSPA 1NDLA 3L7UA 1NSKL 2NCKL 3G2XA 1XIQA 3NGSA 4F4AA 3MPDA 3JS9A 1NDCA 3DDIA 5CABA 1VYAA 3ZTPA 1NDKA 1B4SA 4F36A 1K44A 4CP5A 4UOHA 3VVTA 1KDNA 3B54A 2ZUAA 3NGUA 3FC9A 2HVEA 3PJ9A 5CAAA 3BBBA 3ETMA 4EK2A 3FBCA 2VU5A 1BUXA 3Q8UA 2DYAA 1NLKL 2B8PA 1BE4A 3Q89A 1F6TA 3EMTA 3DKDA 4WBFA 3ZTSA 1PAEX 1XQIA 1HLWA 3BH6B 1NCLA 2AZ1A 1WKLA 3PRVA 2AZ3A 3ELHA 2HVDA 4FKYA 2B8QA 1JXVA 2BX6A 3FCWA 1HHQA 3VVUA 3BH7B 3BBCA 2HURA 4S0MA 1MN9A 3FBFA 3EE3A 3VGTA 4ENOA 2DXFA 1EHWA 3Q8VA 3ZTOA 1NPKA 1PKUA 2DXDA 2DXEA 3ZTQA 3EVOA 4HR2A 1WKKA 1ZS6A 3BBFA 1NHKL 3FKBA 1U8WA 1HIYA 1NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPC A;  3FCV A;  3B6B A;  4C6A A;  1MN7 A;  4DUT A;  3R9L A;  4DI6 A;  1F3F A;  3Q83 A;  5C7P A;  1LEO A;  4AND A;  3VGV A;  1NB2 A;  1W7W A;  3Q86 A;  1WKJ A;  3EVW A;  3ZTR A;  1NDP A;  3VGU A;  1B99 A;  3FBB A;  4ANC A;  3Q8Y A;  3GPA A;  4W98 A;  1UCN A;  3GP9 A;  3WX8 A;  4FKX A;  1S5Z A;  3NGR A;  3VGS A;  1LWX A;  2DY9 A;  2BEF A;  4DZ6 A;  3EIC A;  3EJM A;  5BXI A;  2CWK A;  4UOG A;  1BHN A;  1S59 A;  4O0N A;  4UOF A;  3EM1 A;  1NUE A;  3NGT A;  3FBE A;  4ANE A;  3ENA A;  5IOL A;  3EVM A;  1S57 A;  1NSP A;  1NDL A;  3L7U A;  1NSK L;  2NCK L;  3G2X A;  1XIQ A;  3NGS A;  4F4A A;  3MPD A;  3JS9 A;  1NDC A;  3DDI A;  5CAB A;  1VYA A;  3ZTP A;  1NDK A;  1B4S A;  4F36 A;  1K44 A;  4CP5 A;  4UOH A;  3VVT A;  1KDN A;  3B54 A;  2ZUA A;  3NGU A;  3FC9 A;  2HVE A;  3PJ9 A;  5CAA A;  3BBB A;  3ETM A;  4EK2 A;  3FBC A;  2VU5 A;  1BUX A;  3Q8U A;  2DYA A;  1NLK L;  2B8P A;  1BE4 A;  3Q89 A;  1F6T A;  3EMT A;  3DKD A;  4WBF A;  3ZTS A;  1PAE X;  1XQI A;  1HLW A;  3BH6 B;  1NCL A;  2AZ1 A;  1WKL A;  3PRV A;  2AZ3 A;  3ELH A;  2HVD A;  4FKY A;  2B8Q A;  1JXV A;  2BX6 A;  3FCW A;  1HHQ A;  3VVU A;  3BH7 B;  3BBC A;  2HUR A;  4S0M A;  1MN9 A;  3FBF A;  3EE3 A;  3VGT A;  4ENO A;  2DXF A;  1EHW A;  3Q8V A;  3ZTO A;  1NPK A;  1PKU A;  2DXD A;  2DXE A;  3ZTQ A;  3EVO A;  4HR2 A;  1WKK A;  1ZS6 A;  3BBF A;  1NHK L;  3FKB A;  1U8W A;  1HIY A;  1NSQ A; 
#chains in the Genus database with same CATH topology
 1SH3 A;  1WF1 A;  4AD6 A;  4NLT A;  3HMJ G;  1RWX B;  3TYT A;  2ZEJ A;  5GVQ A;  2ATL A;  4OHZ A;  5KFX A;  3MUR P;  2NS1 B;  2V8H A;  4DU7 A;  4PWU A;  7FD1 A;  2GMJ A;  4AND A;  1Z4U A;  4N56 A;  2JC0 A;  2DHS A;  3MI7 X;  3DRY A;  5LMU F;  4DR5 J;  3KHR A;  1KS2 A;  4IFV B;  4NXM J;  2D41 A;  3VAF A;  1N56 A;  3ZTR A;  4DDF A;  1NDP A;  1N36 F;  2YTC A;  3HJF A;  1GNK A;  4I0W A;  5BYR A;  2BJD A;  2DHA A;  2HMI B;  2GGP B;  5KFU A;  1F2G A;  2QV6 A;  1RA6 A;  3AQO A;  3CJT A;  1SJF A;  3QWU A;  4EMD A;  3DRR A;  4KSE B;  4OZ3 A;  3VAH A;  2JEI A;  4R8U B;  4DPU A;  3PR4 A;  3QLH B;  4X62 F;  3D54 A;  2E5J A;  2R7T A;  1IQT A;  4BC9 A;  5DGB A;  1NKB A;  3M2R A;  4P2S A;  1BQM B;  1DBD A;  4A8M P;  2APO A;  3RU0 A;  4ZLL A;  2BJ7 A;  1WOS A;  2QTW A;  2IYG A;  2RH3 A;  5ETS A;  4L73 A;  3VHQ A;  2BRL A;  2ZH6 A;  4ECR A;  1T03 A;  2EC0 A;  4WPA A;  4IQX A;  3DOK B;  4PXB A;  4R5P B;  2R7V A;  1OS5 A;  3MED B;  3MM5 A;  3QO9 A;  3FFI B;  1LV5 A;  4KHP F;  2V2Z A;  2XHC A;  4BLG A;  4GKJ F;  1R8A A;  4LRC A;  3D6F B;  2NYI A;  2W2M P;  3OSN A;  1X7V A;  1P6T A;  4KIA A;  4Y6I A;  5HSP A;  4DSJ A;  2J0X A;  3OTD A;  4RX6 A;  3OUY B;  3I9Z A;  3U02 A;  3RG6 A;  4ETZ A;  4MYT A;  2XM3 A;  4F4X A;  4G1Q A;  4CH0 S;  3PW2 A;  2HG4 A;  3L09 A;  3C14 B;  1X4G A;  3CW2 C;  3NNC A;  2HKE A;  1WC0 A;  3G6E S;  5GAG I;  4F8R A;  2MZ1 A;  2GVD A;  4TYA A;  1PIE A;  2BQU A;  1Q78 A;  2DKO B;  2VG5 A;  4U9R A;  2QEX S;  2FVR A;  5HMW A;  1EAR A;  2G13 A;  1UKU A;  3NRB A;  2JX2 A;  4NRU A;  5KFO A;  4DV6 F;  1ICE B;  2IYI A;  3PJW A;  3NS6 A;  3J81 Y;  2YNI B;  3ET6 A;  4WU2 A;  4DN9 A;  4LF4 F;  4OX9 J;  5D0H A;  2CXE A;  3A8E A;  4M5D A;  2ALZ A;  3GFX A;  1TL1 B;  1S6Q B;  3GCW P;  3KXD A;  4IOA Q;  4P72 A;  1DQ9 A;  1ZAW A;  2KVQ E;  3A3O B;  3PHT A;  1R6V A;  2ZC4 A;  2RSQ A;  3NLC A;  4DV4 F;  1SL2 A;  1GAO A;  1WF0 A;  2DYA A;  3HHK A;  5KG6 A;  2HHV A;  4QJV A;  1UL3 A;  1RT3 B;  5A8R A;  3KJF B;  1ZM4 A;  2YNG A;  1YJN S;  4J91 A;  3ZZP A;  4CLT A;  1GXU A;  2HQD A;  3MOZ A;  1KLM B;  3VZH A;  2X7I A;  3NBP A;  4PG4 A;  3CE8 A;  3AXM A;  5F8I A;  1RT5 B;  4LVO P;  3R5D A;  3VAM A;  2UUB F;  1H73 A;  3CC7 S;  1C0U A;  2XYP B;  4M63 A;  2IRU A;  1YK9 A;  2RVJ A;  4JI1 J;  3J81 j;  2AZ3 A;  1B64 A;  3C6U B;  3TRG A;  3ELH A;  1C1C B;  1TUG B;  2W4C A;  5GME A;  5LSR A;  4DV2 F;  1ZTW A;  1RYS A;  2HBR B;  4RW9 A;  1RAG B;  4B9L A;  1OYE A;  4PR6 A;  4CDI A;  2FZG B;  2WW4 A;  9RUB A;  5ETN A;  2Q6B A;  2QT7 A;  8AT1 B;  3OW2 R;  3R1L A;  5AXL A;  4K4U A;  4FXD A;  2W7A A;  3G6Y A;  3BBC A;  3I0S B;  4ER8 A;  2XBP A;  2Y1L B;  4ED6 A;  1HWU A;  2NZC A;  3RUB L;  3T5L A;  2C2O B;  1TTH B;  2J6S A;  2E1R A;  3NAH A;  3DRX A;  1HQ2 A;  1UMJ A;  1RWN B;  2K7J A;  2U1A A;  3I4H X;  5HVG A;  2HHX A;  2HRY A;  3P96 A;  1YJW S;  2QL9 B;  4C8N A;  2DEJ A;  5J1N A;  5M2U A;  3AD7 C;  5L1I A;  5GAD U;  1PCA A;  4LF4 J;  4C3K A;  2CPD A;  4OX9 F;  1JLC B;  2KI2 A;  1WKK A;  2B9X A;  4F4W A;  1U02 A;  1U8W A;  3TVK A;  2CJ9 A;  2PO4 A;  5BJR A;  3UN5 A;  3KK2 B;  2V2Q A;  4DV0 F;  2BE9 B;  1U4B A;  5A8K A;  3HKZ D;  4ZP6 A;  3DRP B;  3G86 A;  3R9L A;  3OXF A;  2HLU A;  1SC6 A;  2DIT A;  4FVC A;  1R8P A;  1V3R A;  4E0D A;  3HHL B;  3HHD A;  2C3U A;  3QIP A;  2ZM6 J;  1M0S A;  1SH0 A;  1E6V B;  1FKO B;  1A6L A;  1LFW A;  2VKZ G;  4CIO A;  4DSL A;  2B5J A;  2AU0 A;  2XNR A;  1S99 A;  2CPH A;  2FY8 A;  3GPA A;  4LVN P;  1NEE A;  1WEL A;  3Q2T C;  1RT6 B;  2QG9 B;  3A13 A;  4ECY A;  4C4W A;  2V9K A;  1YLX A;  1K9M T;  3M8Q B;  2H9Z A;  4YP3 A;  1RQ0 A;  2YVS A;  4USV A;  5I3Q A;  3OJU A;  3M8P B;  2LU1 A;  1VFJ A;  2RQK A;  4IKA A;  2C2M B;  2FJA B;  2YX1 A;  1N5Q A;  3GLJ A;  5JXS A;  1L3U A;  1RT1 B;  2VFT A;  2GW8 A;  2J8S A;  2MKY A;  3KLG B;  2PEB A;  3L9Z A;  4U7U K;  1IKV A;  5I42 B;  2VJU A;  1VBK A;  4NLO A;  2OTJ S;  4JV2 A;  3ZNU A;  1ZH5 A;  1HW8 A;  4IOC Q;  3M6X A;  2IBK A;  1S6O A;  2F1F A;  3EVM A;  3KMS A;  4DSF A;  1FFW B;  3HX9 A;  3RB3 A;  2QL7 B;  3A3P B;  2CJX B;  2B4O A;  2W2N P;  1SKU B;  4RW8 A;  1MU2 B;  3QZ7 A;  1S9E B;  3EZO A;  4OHW A;  3I82 A;  1SL0 A;  3IA0 A;  3A1Y G;  1CUL A;  3AT1 B;  4P7V A;  4B9U A;  4X2B A;  2FHK A;  3UR0 A;  2W2O P;  3LWL A;  3JS9 A;  3W7B A;  1N32 F;  2CQ4 A;  3QJJ A;  1MU2 A;  2CQ0 A;  3M8P A;  4TLR A;  3GIK A;  4ECT A;  3M8Q A;  3KLE B;  4CO4 A;  3W60 A;  2CFX A;  3OJS A;  5C2C A;  1EZZ B;  1TK5 A;  3J7A 1;  3ZNJ 1;  4ECQ A;  4NWB A;  3BN7 A;  4ES2 A;  2PE8 A;  1MRO A;  2B5J B;  2FC8 A;  4TQR A;  2IVY A;  2PN6 A;  4RPF A;  4ZJO A;  2ATC B;  1YI2 S;  1IVZ A;  3O2I A;  1JK9 B;  1P27 B;  4QIG A;  5E3C A;  3MAQ A;  1N5Y B;  5CYM B;  4EK2 A;  5LJ3 Y;  3H90 A;  4FNH A;  4F50 A;  4FF4 A;  4BC7 A;  4E2F B;  5A8K B;  4A8Q A;  4B9T A;  5KFM A;  3TZZ A;  4OQJ A;  4WYL A;  3AB2 B;  4H54 A;  4R0E A;  3CCQ S;  1WJ9 A;  2MQO A;  2VBY A;  1S1T B;  3N28 A;  1UVM A;  4KT0 C;  2ZZT A;  3KLH A;  2EK1 A;  3DRS B;  1JMT A;  3CB4 A;  5KFQ A;  1VRU A;  4N8N A;  1VJW A;  4F4Z A;  3MMJ A;  2CZV C;  2W7O A;  3P45 B;  3HHL A;  3Q24 A;  4DL2 A;  2AD9 A;  4LF9 J;  2BE2 B;  2QN6 B;  2RUS A;  3I55 S;  2BV3 A;  1HNZ J;  3CJ2 A;  1S7H A;  2FHJ A;  1U48 A;  2B0G A;  4CT8 A;  4WFA Q;  4B3S F;  3DXB A;  2CA9 A;  3PRV A;  1HNX J;  1HBN A;  1V3Z A;  3I0S A;  1IXK A;  1I3O B;  4DSE A;  3GFZ A;  2BX6 A;  4WWS A;  4JV0 A;  2P9G A;  4C8Z A;  2VDI A;  4CO5 A;  3KHL A;  5F8J A;  3RBX A;  2DY1 A;  4URS A;  3DLG A;  1XMB A;  4PZV A;  2X1A A;  2EG2 A;  2OUG A;  2YNH A;  4JI6 F;  2QX0 A;  2VH7 A;  2LEP A;  4PG7 A;  4Q2L A;  3LAN A;  4ZVE A;  2R7S A;  1TKD A;  1ARO P;  3OXG A;  1FRH A;  5HI7 A;  4O0I A;  4DV3 J;  1U26 A;  3HI9 A;  3QRP A;  3V2U C;  2H54 B;  3SI8 A;  4ZPA A;  3CJ3 A;  1ZOT A;  3KHH A;  2DPI A;  2MQP A;  3H5X A;  1KHW A;  1QUP A;  3RB6 A;  5IS2 A;  4DCO B;  2JEJ A;  4Q7A A;  1NJX A;  5HO4 A;  3D1H A;  5I3P A;  2E9T A;  3GJR B;  1F3F A;  2IVM A;  1PG5 B;  3IFE A;  4KGX B;  2KU7 A;  4OHX A;  4OJ1 A;  5F41 A;  2MZS A;  3Q22 A;  1LK5 A;  3BSO A;  2RS2 A;  1RBA A;  2BAB A;  5ETM A;  1GXT A;  3LF0 A;  2HNY A;  4OX7 A;  3TAP A;  1VIX A;  2CUY A;  1YVF A;  2J76 E;  4YB1 P;  2OIH A;  2IA0 A;  4QIV A;  1VQK S;  2IC3 B;  2KYX A;  2ZBC A;  1M1G A;  3HSJ A;  3VTI A;  2B9E A;  1IBL F;  3CJ5 A;  4W98 A;  2GMH A;  1DY3 A;  1Z2L A;  4Q0B A;  2HLT A;  4FKX A;  2EEY A;  1FD8 A;  4LFA J;  3LW5 C;  5F0W A;  3ENQ A;  1PGZ A;  2HYI B;  2MHE A;  3WDO A;  4M1K A;  4LQ3 A;  1S77 D;  3IGN A;  2IY5 B;  2AX1 A;  4WTY A;  4F4Y A;  3D3B J;  4AQY J;  2JVR A;  3N79 A;  2BJ8 A;  2CQ3 A;  1WEZ A;  2GVD B;  4ZPB A;  5CCM A;  5A76 A;  3MUM P;  2QFI A;  3P5T L;  3ITH A;  3LP0 A;  4RNM A;  5IV3 A;  1KVJ A;  3HLU A;  1H0H B;  2GHP A;  1U49 A;  1QAJ A;  2UXC F;  3M2R B;  2VB6 A;  3W9H A;  1FRK A;  2AJ2 A;  1DTT B;  3T6J A;  1FA0 A;  3SFU A;  1TK8 A;  5EUH A;  2XUL A;  3JAM U;  1TKZ A;  2ROP A;  4RW6 A;  1S6P B;  4EZ9 A;  4G65 A;  1XN9 A;  3Q8P B;  3THV A;  1URR A;  4DSI A;  4JI8 J;  2HW3 A;  1Y9O A;  2DH7 A;  3MM5 B;  3MED A;  2OH2 A;  2FJW A;  4DR6 J;  3PJX A;  4C11 A;  4C8Y A;  2DK2 A;  2UUC J;  2OTL S;  4GO7 X;  3HP6 A;  3PVX A;  4FP9 A;  4CCH A;  4FF3 A;  2RML A;  2XMJ A;  1Q1K A;  1RAI B;  4MKB A;  4JBC A;  1CC7 A;  4Z7C A;  1RSC A;  3DCA A;  1JQG A;  8ATC B;  2MZR A;  3TEG A;  4TU9 A;  2NUH A;  3UFC X;  3HVW A;  3QLH A;  1S7I A;  1NAQ A;  2IMO A;  3M32 A;  3J80 Y;  3ONQ A;  2F8M A;  3Q8U A;  4GVB B;  4IYQ A;  4USW A;  2R7R A;  4U7U D;  2D3Z A;  2C1E B;  3H8Y A;  5F3T A;  1NK9 A;  3J7Y I;  5E41 A;  4JUZ A;  1HD1 A;  2Z57 B;  4OYW A;  2QLX A;  4FYW B;  5D0R A;  2N4C A;  4DR5 F;  1N4L A;  2L08 A;  4ZVQ B;  2KTQ A;  1SIW B;  4AQY F;  1T11 A;  1YJT A;  2K8G A;  4RZR A;  4YME A;  4ERD A;  1IR2 A;  3QPI A;  2JLF A;  2CYY A;  2DNL A;  4Y65 A;  1RAJ A;  3RRH A;  1PAE X;  2ZBI A;  3V6D B;  1VC6 A;  4OZN A;  3TWZ A;  3VWS A;  4NZ6 A;  1FRL A;  4EZ6 A;  4HEA 9;  4LR8 A;  4QW9 A;  4PG6 A;  3LP2 A;  1QAI A;  5D3G A;  3BQ0 A;  1VQ7 S;  3CCZ A;  3HXM A;  3OL8 A;  4YHH J;  1K1Q A;  2WB4 A;  1U09 A;  3P3D A;  1KOO A;  3WQP A;  4ECZ A;  3CUL A;  1FJC A;  2UV8 A;  4B9M A;  1TKX B;  2I0X A;  3DU6 A;  3L7P A;  2W2Q P;  1SJ4 P;  4ECW A;  2X1G A;  2OEL A;  1DQ8 A;  2UUC F;  1YQH A;  4CLP A;  1RAH B;  4QYR A;  5J1E B;  1EHW A;  3BO2 A;  2NQP A;  4DX6 A;  3H2U B;  3GFH A;  4ZDN A;  3MEC B;  1FE0 A;  3SSQ A;  3ZTQ A;  3RBE A;  1W2B R;  2XMK A;  2VG6 A;  1NK8 A;  1ZS6 A;  3VAG A;  4CWB A;  1LKZ A;  1TVR A;  4MMO A;  5GAH U;  2PMZ D;  4LF8 F;  3TAN A;  4AT1 B;  4O3O A;  7FDR A;  1HYS A;  2YWH A;  2NRE A;  3P49 B;  3MMA A;  4ZHR A;  1AB8 A;  1X8D A;  4LRD A;  4DI6 A;  1Q82 T;  1JIH A;  4AL6 A;  4KGM A;  3M8W A;  1GTH A;  4OZ1 A;  5F3Z A;  2RE1 A;  1TV6 A;  2XEX A;  2JRS A;  2JWN A;  4WJB A;  5L46 A;  4X4U A;  2YKM B;  2JEF A;  1SJR A;  3GTY X;  4ZS6 A;  3DOL B;  2HBZ B;  3P5B P;  3HPO A;  4IFY A;  1C0T B;  1L3K A;  5LL6 d;  3MXH P;  2R7O A;  3GE9 A;  2V8D A;  3ZO7 A;  5HQL A;  4ZCI A;  2WK4 A;  1AXQ A;  2RRN A;  1OMS A;  3QBC A;  4NLR A;  2DR8 A;  2BOA A;  3AB4 B;  2VOP A;  2C22 A;  1LWX A;  3S8S A;  3LQV A;  4GC7 A;  2W4P A;  5HVH A;  3DLK A;  3OT9 A;  4HTI A;  4DZ6 A;  1CEZ A;  4UOC A;  4UTG A;  2QA4 G;  1VQ5 S;  2CZ4 A;  4NLW A;  3CJS A;  1BHN A;  5KOX A;  2LQ8 A;  3DYA A;  1I5O B;  2DEI A;  3K8V A;  1XBW A;  4H4O A;  4C8M A;  3WBZ A;  1CS4 A;  1M5H A;  2KYZ A;  3JYT B;  1KSP A;  3ENV A;  3V6J A;  3EDQ B;  2BVZ A;  3HSG A;  3IXQ A;  3M2V B;  3TVY A;  4C0O C;  4QCL A;  1D09 B;  4TY8 B;  4ZVG A;  4KFB B;  1FKP A;  1RXO B;  1IKW B;  5HAO A;  3FVY A;  3A8J A;  4F25 A;  2NCK L;  3GR0 A;  2KM8 B;  3G2X A;  4K8R A;  3UVJ B;  4WE1 B;  4WYW A;  4J9N A;  3V6K A;  3CC4 S;  2ZHO A;  1UWB A;  4CLW A;  4OI4 A;  1REG X;  3KJV B;  1G3O A;  2GVZ B;  4FF2 A;  5EWE A;  2V0N A;  2VIC A;  4BDP A;  2UXB F;  5KFJ A;  2CQD A;  2DGQ A;  3QT8 A;  2DGT A;  4ID5 A;  2G4B A;  4X4V A;  2DBB A;  2V68 A;  4OYZ A;  2M5Y A;  3TZW A;  4B3O A;  3W9J A;  3KK3 B;  2W1B A;  5FLX Y;  4QU7 A;  1UZH A;  3M4X A;  1GXL A;  1TV6 B;  3HKW A;  4ZK7 M;  4XO0 A;  3MAA A;  4P71 A;  3UDE A;  1WTF A;  5L8R C;  2CQB A;  4GRS A;  3TX0 A;  2ZHB A;  3FBC A;  5D15 A;  4WFB Q;  1IJE B;  4Q44 A;  1RLD A;  3LA0 A;  2RRA A;  1LW0 B;  2MST A;  4CM2 A;  3V6H A;  2XS2 A;  1JLF A;  3D0I E;  3Q8S B;  2J9D E;  4P10 A;  2MJU A;  1JNR B;  2J6T A;  4NA1 A;  1RAE B;  2WB1 D;  1REV A;  2MKJ A;  3N5F A;  4J5O A;  5LMU J;  2B56 A;  2KXN B;  4JI0 J;  2YQ1 A;  3JSR A;  1IM6 A;  2E44 A;  1PJ6 A;  4Y00 A;  4ALZ A;  4Z2X A;  4U67 Q;  4NXM F;  1VQ8 S;  1UEU A;  1OPI A;  4RBT A;  2EXU A;  5U47 A;  1QUV A;  2MZJ A;  1FVQ A;  5B08 A;  1U1M A;  4WF9 Q;  2WVD A;  4M5J A;  4DG1 A;  2V8P A;  2VBX A;  3CNQ P;  1HLW A;  1Y4Z B;  1QAX A;  4Y28 C;  3TA0 A;  5C2G A;  2FYX A;  3HT3 A;  3MUT P;  4B9V A;  3NL0 A;  3BV8 A;  3OHB A;  2J0W A;  3EPI A;  5DM6 Q;  3ISN D;  2QSF A;  2EFV A;  4DG1 B;  5B0F A;  2OKQ A;  3BQ1 A;  1R6Y A;  3THP A;  1FCA A;  3D7S B;  1Z1Z A;  3LP2 B;  3R2D J;  3FEX B;  1HPZ B;  2CPF A;  2YKA A;  2IRY A;  3M2U B;  2H3E B;  2GX8 A;  4TQS A;  4RUC A;  1F9E B;  1RWU A;  2QJ3 A;  3EE3 A;  1WEX A;  3OL7 A;  2BR0 A;  2EG1 A;  3GG1 A;  3F41 A;  2R7Q A;  3ZTO A;  5E3Q A;  3AHP A;  4PXC A;  3H25 A;  2HFN A;  1JLF B;  2WBM A;  3JB9 k;  1RT4 A;  4ZN1 A;  1OY9 A;  4KV8 B;  4ZIV A;  4FBT A;  1LW2 A;  1WHX A;  4LF6 F;  2I6W A;  3DLL Q;  1J2V A;  1U24 A;  5KFW A;  1X4C A;  3BEG B;  3SDE B;  4Y3C A;  2KRR A;  4Q43 A;  1UVI A;  3OFE A;  2JJ4 D;  1AFJ A;  3J7A N;  1OPZ A;  3K2Y A;  4YFU A;  1TL7 A;  1NME B;  2YWF A;  2QA4 S;  3CME S;  3KLI A;  1SI9 A;  2XHW A;  2Z2M A;  4N77 A;  1Q8L A;  5KFH A;  1VR6 A;  1UFL A;  1LWF B;  1BQN B;  5KG1 A;  4PXE A;  4I6A A;  1UPM B;  2DIS A;  2H5J B;  3BKF A;  2VG7 B;  3SV4 A;  5DZ7 A;  2PA8 D;  1TUW A;  1RTH B;  3PFO A;  3KJV A;  4DLE A;  1P9Q C;  2DHH A;  4DV6 J;  5F8H A;  3T3F A;  1S72 S;  2RIJ A;  3H2L A;  1YHQ S;  4KJI A;  2ZE2 A;  1FEE A;  4UST A;  3T5H A;  3WC0 A;  3UD4 P;  3EGZ A;  1JJH A;  2V94 A;  3LUY A;  2KO1 A;  4C3L A;  3EZ5 A;  2A0F B;  2QSW A;  4LBH A;  3BDP A;  3FSY A;  4CO3 A;  3OFF A;  3BO3 A;  3LGM A;  2IM1 A;  1T3N A;  1S6P A;  4ZLN A;  4PQU B;  2XI3 A;  2V6A A;  2VJV A;  2E29 A;  3IWL A;  3A3N B;  2POK A;  3CD0 A;  4JP8 A;  4PQA A;  2W8L A;  1FK9 A;  5E3A A;  3LP0 B;  4MTP A;  1RA7 A;  4ZKA A;  3J7Z T;  5HBM A;  3AXK A;  2BE7 D;  4ANE A;  1WDT A;  1DJ0 A;  3WX4 A;  2XC9 A;  2FJE B;  4K7Q A;  1HWL A;  1JLQ B;  2G0C A;  3IO1 A;  3JTN A;  5K9F A;  1F2H A;  3GYN A;  4F0M A;  1HNX F;  3H5S A;  3LAL A;  4CH1 A;  4CQ1 A;  1NB7 A;  4DQP A;  1XR5 A;  2W9C B;  4UUW A;  1KQS R;  4F3M A;  4IFY B;  4NLX A;  1QVF R;  1IN0 A;  2LQJ A;  2J7W A;  2DB1 A;  3OSP A;  4NZ7 A;  1JLE A;  2FLO A;  1KR4 A;  4HT7 A;  4AYB D;  2MKK A;  3R1H A;  1UEV A;  1X4F A;  3S7R A;  4WTO B;  2BDP A;  2WZ1 A;  1KLN A;  1RWW B;  4I2P B;  1U1P A;  3DI6 A;  2B43 A;  4ES3 A;  4WZM A;  1KD1 T;  1K0V A;  5J2N B;  4UOH A;  2IC3 A;  1YJ9 S;  3QT6 A;  4ZHR B;  4X62 J;  4A8Y A;  2HZC A;  3GZ7 A;  3JTO A;  1RP5 A;  2ZOF A;  1RT7 B;  2MGZ B;  2MJN A;  5DRK A;  1SUQ A;  2N3L A;  4F67 A;  1YBU A;  3GCX P;  1L3T A;  2DRB A;  1HYS B;  1NJY A;  3W63 A;  1U1Q A;  3CJR A;  2AEM A;  3T1Y J;  5GAD I;  4RW4 A;  2ZD1 A;  4QPT A;  4WXO A;  2IA6 A;  2VU5 A;  1VK3 A;  4CT9 A;  2AT1 B;  3QGP A;  5HLF A;  5M2R A;  3NKY A;  4DPY A;  5KFB A;  3RBZ A;  1V9O A;  1S12 A;  4F3Q A;  1JWW A;  3GMG A;  2RDI A;  2W01 A;  1FO1 A;  3N6N A;  4ZPT R;  2HFV A;  2VZ9 A;  4UT4 A;  1X9S A;  4LF5 J;  1X4E A;  2L9W A;  3FNN A;  2HVH A;  2NPF A;  1NJI T;  5IQ6 A;  1GQE A;  3ZC4 A;  8RUC A;  3W2V B;  2D3O R;  4JI2 F;  1PJ7 A;  1Q0N A;  2LXF A;  1LQ9 A;  4A8X A;  1KQF B;  3K5O A;  4L72 B;  2AEF A;  3OL6 A;  4ZPW R;  2O3D A;  3CCV S;  5D3G B;  3I5C A;  2VBW A;  4F2S A;  1CJV B;  3BH6 B;  3OTC A;  2ZJR Q;  3R6L B;  1HW9 A;  4CZC A;  2DNK A;  2ZNZ A;  3V6D A;  2Z2Y B;  2ZVS A;  2DPJ A;  2CPX A;  1TL3 B;  4B3R J;  2A3J A;  2XYG B;  1D9A A;  4PYD A;  1YIJ S;  4LFA F;  3W5Y A;  1N0V C;  2C3Y A;  4CYU A;  4ILM A;  3BH7 B;  3DM2 B;  1B0V A;  1DLO B;  3HVT B;  1WHV A;  3MMB B;  4RWX A;  4F0H A;  4X4O A;  3P8B B;  4S0M A;  3D0G E;  1G6B A;  4OZJ A;  2EW9 A;  3S1T A;  5E33 A;  1YJR A;  4TVA B;  1JLG A;  4FN5 A;  3L3C A;  2LDI A;  4USU A;  1GFW B;  2J0Q D;  2ZH5 A;  2UVW A;  2BE2 A;  1Y0H A;  2AGO A;  1B3T A;  1YBA A;  5D8H B;  2H5E A;  2GAG C;  5ETR A;  1LFP A;  1U25 A;  2RKI B;  2V69 A;  4GVB A;  1S6U A;  3NEK A;  2OPP A;  4TYB A;  3WHI A;  4C48 A;  3T1Y F;  2FLP A;  1S1T A;  2WOM B;  3O44 A;  3OTE A;  4BBY A;  1PBA A;  1JLG B;  2NUU G;  4H4M B;  1N32 J;  2DCU B;  3QT5 A;  4KPC A;  3RR8 A;  4X4N A;  1N34 J;  2IJR A;  2OMO A;  5DO2 A;  3BF4 A;  3TUJ C;  4DPW A;  2BQR A;  4EFA C;  1KP6 A;  3ZZY A;  5EGY A;  3VAL A;  3RB4 A;  3HUL A;  1N5Y A;  4C11 B;  5EX0 A;  4UQT A;  1RAO A;  1U47 A;  2DTJ A;  1N48 A;  4GKK F;  1OYD A;  3M6U A;  1B99 A;  3FBB A;  4O4G B;  2MQN A;  4TU7 A;  3CO9 A;  4Y2I A;  4Y2C A;  3QFW A;  3NS5 A;  4DUZ J;  4JI5 F;  1FNM A;  1G4C A;  3TP2 A;  1QAY A;  3QGI A;  2ZH9 A;  3ICL A;  4RW7 A;  1QTN B;  1R89 A;  1BXN A;  2AX0 A;  1CJU A;  2HFZ A;  4EGL A;  3IC1 A;  5K8P A;  4OI1 A;  1KC8 T;  3MEG A;  2CG4 A;  2OPS A;  2SXL A;  2OO4 A;  3E01 A;  4DR1 F;  1D1U A;  3I87 A;  1U1K A;  5DQH A;  1F5A A;  1H7X A;  2QYG A;  1BMQ B;  3TOQ A;  1EB0 A;  2HHP A;  1NPR A;  2ZNY A;  4E98 A;  2PI4 A;  1DQA A;  3UE2 A;  4P2M A;  2QZ8 A;  4CLL A;  2CJK A;  4DU8 A;  2RHQ B;  1S57 A;  1QY7 A;  1IQZ A;  4FXW A;  2J7U A;  1IKV B;  2F63 A;  1S97 A;  1NDL A;  5HRO B;  4RKU C;  3K89 A;  1YGY A;  2HFS A;  1TFW A;  3NMA A;  1VHI A;  2GS8 A;  3UD3 P;  1AZS B;  1KVI A;  4W92 B;  3DDI A;  2HNY B;  2XB2 D;  1N34 F;  1RTD B;  3FEZ A;  2G2Y A;  2EVZ A;  3Q8R B;  5F8N A;  2BBE A;  4JI6 J;  1PC5 A;  1RT6 A;  2YQ3 A;  3IM8 A;  4HH1 A;  4J90 A;  4PAB A;  3V5R A;  4CM0 A;  5J2P A;  2J7K A;  4NLP A;  5KT2 A;  5KFP A;  1RKI A;  4OYI A;  1S1X B;  4GKK J;  2W24 A;  3QIP B;  3V4M A;  1FNX H;  4DX8 H;  2UXD J;  3IRX A;  3N0V A;  4LRE A;  1VI7 A;  5EDW A;  4X4P A;  3GV7 B;  4WFY A;  4GO5 X;  1R43 A;  2BM1 A;  3R6G B;  2VPW B;  3ETM A;  4LT6 A;  1U2R A;  1FT8 A;  2RQC A;  3OVB A;  2ABY A;  1C1B B;  3T9N A;  1O0P A;  3F56 A;  4LF8 J;  2XY7 A;  2R2T A;  1WC3 A;  1B0P A;  2F5G A;  1RWO B;  2KJV A;  3MM7 B;  4MK9 A;  1FNO A;  3QWP A;  4USJ C;  2XZD B;  4TY9 A;  4DZD A;  2GCF A;  3M8S A;  3QRQ A;  3GII A;  2KDO A;  4IH5 A;  3VCD A;  4DQI A;  4URQ U;  1IKX A;  2GV1 A;  3DLG B;  2NYH A;  3IS9 A;  3QAE A;  5IM0 A;  1T95 A;  4WBF A;  5JUM A;  3OTO F;  1SKS A;  4C2M A;  1Q53 A;  4UF4 A;  2A6M A;  4DS5 A;  2A2D A;  2C2R A;  2AMC B;  4HYK A;  1MSW D;  3W3S A;  3T1H J;  3S6E A;  3A12 A;  1T9X A;  5KFT A;  4LSN B;  3KMQ A;  2I1R A;  1KKH A;  2VG7 A;  3Q8Q B;  2KL8 A;  2ROE A;  1PO6 A;  4K4Y A;  2XSF A;  1TKT A;  1T0T V;  5CYQ A;  1GEH A;  4AL5 A;  2LQ5 A;  2FZK B;  4ZCK A;  1RJJ A;  3VVU A;  1SJ3 P;  4MT1 A;  3KG1 A;  3T9Z A;  1C1C A;  2J9C A;  2HUR A;  2W4D A;  2ZUG A;  4NEY A;  3RTV A;  1GMV A;  4N76 A;  5DLG A;  4EU0 A;  3B8H A;  4KAI A;  2JNJ A;  5FD1 A;  4HI1 A;  2DXF A;  2GJ2 A;  3BPS P;  4ED4 A;  5DET A;  1LW2 B;  4L74 A;  3DGV A;  3EX7 B;  3TA1 A;  4DL3 A;  4QIF A;  1RT4 B;  3BGU A;  2DXD A;  4NEZ A;  1HNI A;  1BC6 A;  4IG0 B;  4O4R A;  3L4B C;  4OI6 A;  3M9N B;  4HR2 A;  3MPW A;  2W8K A;  2ZC3 A;  1NHK L;  1ZA1 B;  3R3T A;  2HVZ A;  3H59 A;  3CCS S;  4FS2 A;  5B0B A;  1X4D A;  3CIM A;  3FQL A;  4EUV A;  1U0S A;  4ZIT A;  4DUY F;  4F02 A;  2I38 A;  2RAQ A;  2E5L J;  2M0G B;  4KPY A;  3E2E A;  3FCV A;  4X65 F;  4J9P A;  2UXB J;  1WG4 A;  2CAD A;  3NGK A;  4J37 A;  5CD4 H;  4M5D B;  4DQS A;  4ELT A;  4KYZ A;  3D6M B;  1RAA B;  2H4Y B;  4MK7 A;  6FD1 A;  3SBM A;  2OPR A;  2OD4 A;  2YBV A;  2F9J A;  4KB7 A;  3MFI A;  2Z8Q A;  3EVW A;  5DS7 A;  4USK A;  1U1O A;  1Y00 A;  3PM9 A;  2R8H A;  2KHD A;  3ZZR A;  3CT9 A;  3T1H F;  2C28 A;  2YH0 A;  4RWW A;  4CO2 A;  3BKU A;  3NS7 B;  1NZ8 A;  1FX2 A;  3ADA C;  4OYX A;  5KG7 A;  1EKS A;  4JB8 B;  5FII A;  4ID8 A;  4J9S A;  3FCH A;  2RT3 A;  2XMV A;  2HHS A;  1K8A T;  1KNZ A;  1ZM9 A;  3FZB A;  3GJQ B;  4IG3 B;  7AT1 B;  1XMQ F;  4WCE Q;  2VV5 A;  4K4Z A;  2J0S D;  1YWX A;  4K2X A;  1FJE B;  1LW0 A;  4UOF A;  1FXD A;  4FVM A;  3QO9 B;  4JI7 J;  3M1V A;  1N5T A;  5L38 A;  1RI7 A;  2PMH A;  3KUG A;  3MM8 B;  2RD5 C;  2BJ1 A;  3B82 A;  1CLF A;  1P8G A;  4B3T F;  3A8K A;  4RW7 B;  3PW7 A;  4DV1 F;  4MIW A;  3KOA A;  2VFR A;  2EFP A;  1FRX A;  3ZZT A;  1EKR A;  1U1R A;  3BR9 A;  3MPD A;  2RQ4 A;  1S0N A;  4KY3 A;  4YHH F;  3X1L B;  1NDC A;  4DUY J;  1EIY B;  1APS A;  4O3P A;  3CDB A;  4F04 B;  3GSI A;  3D4J A;  4X65 J;  2F8E X;  1B4S A;  1G7C B;  3GWC A;  4U8Y A;  2GGP A;  4CP5 A;  2HBQ B;  4N8O A;  1J5O A;  1A9N B;  3CDE A;  4PWW A;  3N01 A;  3DRP A;  1LNQ A;  3KK1 B;  9ATC B;  1JX4 A;  4ED0 A;  1S4F A;  5E3P A;  1GMW D;  1VLY A;  3SCL E;  1R8C A;  1S79 A;  3UNG C;  4DX5 A;  4IFV A;  2CIM A;  3KK2 A;  3C8Y A;  1C4C A;  1QSY A;  2OSR A;  2QLW A;  4TKT A;  5L9N A;  2MHN A;  3PV8 A;  3IAS 9;  1SQE A;  4I56 A;  4DOZ A;  4H4O B;  1JLC A;  1XC9 A;  1X9M A;  3NMR A;  2LXU A;  5L1K A;  2IBO A;  1ZET A;  5HMX A;  1RBO B;  1HBO B;  4ZIW A;  3GV5 B;  3HFZ B;  4ZOS A;  2DD8 S;  2K06 A;  2J6U A;  2XMW A;  1H72 C;  4USM A;  5IFM A;  5KT5 A;  4NYO A;  4FF1 A;  4KBI A;  4USH A;  2KKH A;  1AFI A;  3MFH A;  2VQF F;  4LSZ B;  4NXN F;  4CYU B;  4I68 A;  2AKW B;  2B4V A;  3JSY A;  1TFY A;  1TL3 A;  2GA7 A;  5B0D A;  1XQI A;  2P9C A;  5FJ4 A;  1NCL A;  3MR5 A;  2NXJ A;  1JJ4 A;  3CDU A;  2GO8 A;  3AOD A;  4HH0 A;  4NCB A;  2NXE A;  3TR5 A;  4F0K A;  2Y8Y A;  1FD2 A;  4BWM A;  3SYZ A;  2FD2 A;  2QMU B;  1UA0 A;  2CQI A;  3MEE B;  1KLM A;  3UNY A;  3DLE B;  4ZMM A;  5JJB A;  3M8R A;  1AT1 B;  1RT3 A;  3PNI A;  4DWI A;  3VZI A;  3UDC A;  5T14 A;  1TVR B;  2QC3 A;  4DS4 A;  1HKA A;  2XMT A;  5HP1 A;  2DHG A;  2W25 A;  1N54 B;  3GJS B;  3HVA A;  2N7C A;  2LEB A;  1ITP A;  5KG5 A;  4IR9 A;  1SKR A;  1M5P C;  2GNK A;  3FZ2 A;  3MEC A;  1XNR F;  3KUE A;  3LH2 S;  3MCM A;  4ATN A;  3K58 A;  1D0E A;  1A7G E;  3DLH A;  3R7N B;  3L95 X;  2YNI A;  3ET6 B;  3GG0 A;  3C66 A;  1MWY A;  1CPZ A;  1WNE A;  5L1J A;  3AAW B;  1RT7 A;  1EJ7 L;  3LO3 A;  2FQQ B;  3R5J B;  2D1C A;  4K2J A;  4NLV A;  2OI2 A;  4ZVP B;  3CUN A;  2ZDO A;  2P8I A;  3NCP A;  4FPI A;  4M5M A;  3HK2 A;  4OZ5 A;  1JXE A;  5J2N A;  2R7U A;  3Q83 A;  3BYP A;  1LEO A;  1AYE A;  1HNV A;  1ZPV A;  2WAQ D;  3DI6 B;  2DJW A;  3QQC D;  3TVZ A;  4AFF A;  5A6P A;  5IWA F;  3K57 A;  3C14 A;  5BR8 F;  3SV3 A;  3U1N A;  1WKJ A;  1WSR A;  2H1Y A;  2XY6 A;  4TNO A;  1JLE B;  5LT5 A;  3EGV A;  2K3I A;  5IV4 A;  3OUY A;  3CD6 S;  1WI6 A;  3NCR A;  4KH0 B;  2Q79 A;  2COL A;  2XG8 A;  4WFN Q;  1SC1 B;  2HS0 A;  2QRR A;  2ZVI A;  2OFH X;  3LGN A;  4OJH A;  4WK1 A;  1F9H A;  1LXN A;  1RCX B;  1JLQ A;  3P4U B;  3RYL A;  2KVI A;  1CJT A;  2KJW A;  4WP9 A;  4R5P A;  2CJQ A;  3W5X A;  4DV4 J;  4ZPV R;  3KUH A;  3M30 A;  4PEO A;  1M1H A;  2LYV A;  3GON A;  3MTJ A;  3SEO A;  5A0Y A;  1FEH A;  2BEF A;  1W2I A;  2ZOM A;  6AT1 B;  1WC4 A;  1SKW A;  2HHQ A;  2DNQ A;  3EIC A;  1CSJ A;  3H2V E;  5J2Q A;  4XAK A;  2CQH A;  2YKP A;  2ZFH A;  2WON B;  3PYD A;  2Y3Y A;  3EM1 A;  5KOW A;  2P6T A;  2UUB J;  4R8U A;  3UWT A;  3MR7 A;  4EI2 A;  1WWH A;  1NSP A;  4B3M J;  4JI1 F;  1Y3J A;  1R7I A;  4UZC A;  3DNC A;  2JEG A;  4DSK A;  4TLQ A;  3VAJ A;  1NK4 A;  1T9W A;  2C3O A;  2HWI A;  3HD2 A;  3MHY A;  3MD3 A;  3NGS A;  4LRB A;  3W64 A;  3LTO A;  1HQU B;  3R5B A;  3EGN A;  4AE5 A;  3KWM A;  1H6K X;  3GU0 A;  1Q4R A;  1C4A A;  2V8G A;  1HBU A;  1FVS A;  3AD8 C;  2FVQ A;  1SIZ A;  1FJG J;  1TMJ A;  2YNF A;  4RLE A;  2AQ4 A;  3DDK A;  1DTT A;  2FHM A;  4M5H A;  2XWX A;  2XLJ A;  1KHV A;  1RU2 A;  1TL7 B;  5J2Q B;  3W61 A;  2HVE A;  4X64 J;  2CNO B;  2AYG A;  2VA3 A;  2PDA A;  2MQ8 A;  3H0P A;  1QSL A;  2Y1R I;  1IWA A;  3DLJ A;  2VDH A;  2MPU A;  4MIA A;  4ZVF A;  4IH7 A;  2GIR A;  3BZQ A;  5K14 B;  3U27 A;  3K5L A;  1UVL A;  4DV0 J;  1RZM A;  3LPY A;  3O1L A;  4KTQ A;  4HDG A;  3GYX B;  4NLY A;  2C3M A;  2HWH A;  4L75 A;  1FJ7 A;  2EWH A;  4B9N A;  1R8H A;  2OJ3 A;  3HO1 A;  4OX6 A;  2GAH C;  2HNZ B;  3DKD A;  4CRJ A;  5B7W A;  1HQE A;  2A1B A;  5CD4 A;  2DNG A;  3OR2 B;  1SQF A;  4HDH A;  2XWY A;  3C15 B;  2NZ4 A;  4CO0 A;  1RAC B;  4USI A;  1X5T A;  4FYX B;  3C3L A;  4B3M F;  2HGN A;  2OPR B;  4RNN A;  1U6B A;  2V63 A;  3OFG A;  4WZQ A;  1DTQ A;  3CJ0 A;  4LFB J;  1JB0 C;  2EBE A;  4JI4 F;  3DC2 A;  1Y11 A;  5CHC B;  3SQG B;  4ZCM A;  2ASJ A;  4DL7 A;  2KM8 C;  4MAK A;  3IN5 A;  1VQL S;  2I9S A;  1S9G A;  2O5D A;  3W1Y C;  2ZH1 A;  1T02 A;  1JLA A;  3JAM Y;  2DGO A;  2LKZ A;  3AA9 A;  5HP1 B;  4RO0 A;  2BQ3 A;  4LMZ A;  5KFG A;  2UUT A;  2A10 A;  3NXZ A;  2HAI A;  4HHU A;  1ZAV A;  5ETK A;  4CLU A;  5KFF A;  1KTV A;  4OI0 A;  2E7X A;  3DLE A;  4ED7 A;  3CCM S;  2EKY A;  3HT0 A;  1HNI B;  1PKU A;  2IJN A;  1IR0 A;  1X60 A;  4X64 F;  3EUN A;  2D3O 1;  2B4P A;  2DH8 A;  4PYA A;  4TXS A;  3NOC A;  3CXC R;  1S0O A;  3I5B A;  2HQ3 A;  2X1B A;  4M5N A;  5LJ5 Y;  4YR2 A;  1FRI A;  2Z0G A;  3TUI C;  2E1A A;  1ZM2 A;  2VL1 A;  2M8H A;  4LBP A;  1NSQ A;  1FWK A;  1S10 A;  1IKY B;  1D8Y A;  2IMW P;  2LLZ A;  3MM9 A;  5E5N A;  1UTA A;  1ACM B;  1RT2 B;  1X5P A;  1TKT B;  4ETX A;  1NXI A;  2WRM A;  2IM2 A;  4IOB A;  4K59 A;  3IBC B;  5RUB A;  3TAQ A;  1D9F A;  3RW7 A;  1SPB P;  4LSN A;  1QTM A;  2FIU A;  2WW8 A;  2FVC A;  2UXD F;  4WE1 A;  2CQP A;  4Y34 A;  1IR1 A;  3GIJ A;  4I6Y A;  4RUB A;  4DF4 A;  2L3M A;  1VC5 A;  4RU9 A;  2ZH2 A;  5JVG Q;  1FKP B;  2DNZ A;  1HBO A;  2KRB A;  1OY8 A;  5M2P A;  4Q8F A;  1IKX B;  4CI0 B;  1VRU B;  4JYA J;  5I3U A;  2HQF A;  2P9E A;  3VV2 B;  3DXS X;  3KLH B;  4DV5 F;  4ILR A;  5H9E K;  2UVU A;  1K0T A;  2ZJQ Q;  2D7S A;  3D6H B;  3OR1 B;  4LF5 F;  2MGZ A;  2ZKU A;  4O3N A;  2HAF A;  3G8S A;  5F0U A;  4YOE A;  2PFD A;  2NLW A;  1K1S A;  2V4J B;  2F4V J;  2YX7 A;  4OFZ A;  2C42 A;  3IG1 B;  3UN2 A;  3UCZ P;  3AD9 C;  4QU6 A;  4J9O A;  4ED3 A;  2JC1 A;  3MMC B;  1GX5 A;  2VKR A;  1XMO F;  4J9V A;  2HZA A;  4WK3 A;  1S1X A;  3SIP B;  3PFE A;  3TEH B;  4OYO A;  5E7O B;  1MRO B;  4ZP8 A;  3HSD A;  2WSF C;  3ILJ A;  3G8Q A;  4EBD A;  3KLE A;  3K5M A;  5IQQ A;  1MWZ A;  5CAB A;  4J9K A;  4U95 A;  3G6V A;  1NKC A;  1MMD A;  1VYA A;  2AEJ A;  3MM8 A;  2YKN A;  5CH7 B;  2OEM A;  1RTD A;  2JZ5 A;  3PHE A;  2DRA A;  2PA3 A;  3FQK A;  3IBF B;  5D4N A;  4IDK B;  1O6X A;  3I4P A;  5E2Q A;  3ZXW A;  5DG9 A;  1CUL B;  3BSC A;  3MMA B;  4YN3 B;  3D2W A;  1SH2 A;  1SCJ B;  2QLJ B;  1S9E A;  2LDY A;  2M52 A;  1BD6 A;  1ULR A;  2RRB A;  5KFY A;  2EK6 A;  3KNA A;  1Q5V A;  2B4U A;  1UZD A;  4BHQ A;  1T9T A;  4F2R A;  5CYJ A;  3CCJ S;  1HNW F;  4K0K J;  1VMB A;  2VG6 B;  4OI2 A;  4CLF A;  3H40 A;  1AW0 A;  2AYM A;  3PEH A;  5I42 A;  2QIF A;  2Z58 B;  5DZ6 A;  1RKJ A;  4ZVS B;  5K8M A;  1KON A;  1RT1 A;  2MKH A;  5J1E A;  1B0T A;  1MWQ A;  3GIR A;  5KT6 A;  4FYV B;  4AXI A;  2EI5 A;  2MEW A;  2FVP A;  1FES A;  3R5G A;  4K4S A;  4FYY B;  1CJU B;  1KRP A;  1V6H A;  4YB6 A;  1XEZ A;  5B09 A;  4M5I A;  2R9L A;  4X4R A;  2X1F A;  3PR5 B;  3OVA A;  1IBL J;  1NJZ A;  2XGQ A;  1EP4 B;  3TQ1 A;  1RK8 A;  3MTK A;  5HN0 A;  4DR3 J;  5DLF A;  1V5V A;  4NAS A;  2ZBP A;  1S0V A;  2BRK A;  4CTA B;  4JV5 F;  1Q7L B;  2DNY A;  2VFU A;  2PFF B;  2G9O A;  2FVS A;  1FTR A;  2MQL A;  1HHQ A;  3FK4 A;  1LWC B;  3FUY A;  1XMQ J;  4KKO B;  3HFK A;  5DGA A;  4ZLP A;  4DR7 J;  4ZP7 A;  1F0X A;  2Y0S D;  5HRO A;  1P9Y A;  2WHO A;  3ENW A;  4QW8 A;  5K8N A;  2BA9 A;  4KHM A;  1HL6 A;  1M5V C;  4U7C A;  1RTI B;  1P1T A;  4M5G A;  3HFV A;  1W26 A;  2LMI A;  1XR7 A;  3UO0 A;  2KG0 A;  1FDN A;  1VLO A;  2RKI A;  4B3T J;  3PYF A;  3AJ1 A;  3M32 B;  4DV1 J;  4NI2 B;  3PO4 A;  5IT9 Y;  5T7L B;  1FRM A;  1HNW J;  4A48 A;  4XDC A;  2KZM A;  4I7F A;  5FDL B;  2W2P P;  2RU3 A;  1VS3 A;  3TX8 A;  1T9Y A;  3OTB A;  1UVK A;  2AHO B;  1DLO A;  2GIF A;  3MMB A;  4C6A A;  1MN7 A;  5LOQ A;  4ECV A;  4DR6 F;  2NXC A;  3DGP A;  2HRT A;  3VGV A;  2OHD A;  4DR4 J;  4MH8 A;  1T05 A;  1PSD A;  2R4F A;  1QJH A;  2LEC A;  4IO9 Q;  1R0A A;  4QYZ J;  3C6U A;  2LVW A;  1X4H A;  2BKP A;  3SSS A;  4ANC A;  2GML A;  1TKZ B;  2B51 A;  1RAD B;  2KN4 A;  4RW6 B;  2Y8W A;  2YWE A;  3POT B;  6FDR A;  4ZLJ A;  2OEK A;  3W2V A;  4A4J A;  4DQQ A;  4P7T A;  1C1B A;  5KFC A;  2O1P A;  4JV5 J;  4QOT A;  3T1A A;  2PC6 A;  2Y0B B;  3QID A;  4OJG A;  4DX7 A;  5A8R B;  1R0C B;  4HLB A;  5F9N A;  3T19 A;  4ES1 A;  2HHH J;  3MF5 A;  5CQG A;  2GJI A;  4RBV A;  3KDN A;  5C25 B;  2VQF J;  1TP7 A;  3AA8 A;  3DHW C;  3N6M A;  4OV1 A;  3OTO J;  1R0B G;  3ETO A;  2FJV A;  2YPY A;  1CG2 A;  3HHL D;  2MKS A;  1BQX A;  3CVK A;  5C25 A;  2XLI A;  1YIT S;  2PEH A;  2CQG A;  3CMQ A;  4C97 A;  1XER A;  2BAN B;  3G82 B;  3N9U C;  4DFP A;  2NXN A;  3ZZZ A;  3O5T B;  5GAH I;  1RIS A;  3ZZO A;  3NOG A;  2IHR 1;  1R31 A;  3R5C A;  3QNW B;  3MR6 A;  1Q86 T;  4QZV B;  1PJ5 A;  2CPI A;  1WHW A;  3ZZU A;  1T05 B;  4HT5 A;  3CJQ A;  2YX4 A;  1NDK A;  5DDO C;  3US5 A;  2LEA A;  2VON A;  1BLU A;  4QBU A;  5ETQ A;  2DT9 A;  2H5I B;  2N7Y A;  1KQG B;  2ZUA A;  1UP1 A;  3I0R A;  1FRJ A;  4XDD A;  5KT4 A;  1N36 J;  4LSL B;  1XNR J;  4DN0 A;  2MQQ A;  1Z2Z A;  3FFI A;  4WU3 A;  5AXK A;  3NP5 A;  3X3U A;  2IFX A;  4X4Q A;  2C2E A;  1U7L A;  2CPY A;  1KWM A;  3DOK A;  1JJC B;  2FGO A;  3DGP B;  2OPS B;  2FTR A;  3TW0 A;  2CDQ A;  2MB0 B;  1PC4 A;  1BUX A;  2Y9H A;  4J9U E;  1FK9 B;  4YY3 J;  4KGK A;  1BQM A;  4H4K A;  2BM0 A;  2E5L F;  1Q81 T;  4PCQ A;  1I94 J;  2V5H G;  4DCP B;  4FNI A;  2MY8 A;  1VQO S;  1FKA F;  4MYU A;  1N52 B;  2DO0 A;  3QGG A;  5D4O A;  2XO7 A;  2YNH B;  5IWA J;  1YJU A;  2YH1 A;  3K5N A;  3J7Z 5;  2DNN A;  3M7V A;  1VQY A;  2DNM A;  2FGC A;  4U6P A;  2HMI A;  4LF2 A;  1YRU A;  2QL5 B;  3HM9 A;  1P1L A;  2HIQ A;  2RNE A;  2G0I A;  3KJN B;  5MLC V;  2XS7 A;  2AYE A;  5C42 B;  3DMJ A;  3CJK B;  3D5M A;  4N41 A;  4ZVU B;  4FZV A;  5IC6 B;  1KBR A;  2B8Q A;  2ILY A;  4K4X A;  2WOM A;  3IRW P;  1VIO A;  3TAR A;  2R7W A;  1UA1 A;  1WSV A;  2C2Z B;  2ZBR A;  4M8L A;  2OPP B;  2MY7 A;  2HWT A;  4G6V B;  4ICL A;  2G2Z A;  2PSZ A;  2KFN A;  1X31 C;  4UUX A;  4HHJ A;  3MM6 A;  1RTI A;  2ZH8 A;  4JI7 F;  4FDF A;  4P2X A;  4A8K A;  2O66 A;  1YBT A;  1YG0 A;  2PI5 A;  2A18 A;  2QGF B;  2DHX A;  2KZZ A;  1VRQ C;  2QYC A;  1GK8 A;  3AY0 A;  1UJ6 A;  3IR6 B;  4H4K C;  1JKH B;  1LWC A;  1TL4 A;  3IGV A;  5MAO A;  4B08 A;  2BYC A;  2ZH7 A;  1XR6 A;  3BBF A;  1R8B A;  3RZA A;  2XMM A;  4LQ9 A;  5CZV A;  3SCJ E;  4CTA A;  3OHA A;  5HK4 A;  3VAI A;  2RB7 A;  3RR7 A;  4PUO B;  1FWL A;  1G1X A;  5ETV A;  1HI0 P;  2JH3 A;  3BSN A;  2CPZ A;  1FTC A;  1SXL A;  4P52 A;  1TU0 B;  1VRT A;  2DR6 A;  3GJT B;  2BAC A;  3GIM A;  2I8E A;  1VQM S;  4GMK A;  3U7J A;  2AWZ A;  3L7O A;  4RNF A;  1EQ0 A;  2FJX A;  4ZJL A;  4CO1 A;  2FHJ D;  2ZKT A;  1KTQ A;  2FJD B;  3HHL C;  2CVE A;  2E1P A;  4C3M A;  2B9Y A;  3CMA S;  4KGZ B;  4IRC A;  4L6V 3;  3BB5 A;  3M6W A;  3DN9 A;  4DFM A;  3AQP A;  3BDE A;  2ACM A;  5A8W B;  4DV2 J;  4LR7 A;  1VQ9 S;  3NGR A;  2HRU A;  3H98 A;  2EFQ A;  2XI2 A;  4RW4 B;  2WVF A;  2P5V A;  4KH1 B;  4Z7Y A;  3D0H E;  5C24 B;  3CO0 P;  5E0O A;  3D1Q A;  1M5K C;  3CSK A;  3QRR A;  4P74 A;  1T3O A;  1SUQ B;  1UJ5 A;  4NMX A;  5BXI A;  1FHT A;  5KFD A;  4WKY A;  3KLG A;  4NXN J;  1SJ1 A;  2P6S A;  3E51 A;  3FBE A;  3HDS A;  3MMC A;  3QSY B;  1TK0 A;  3HZG A;  2YKN B;  4V19 X;  1J27 A;  1UW9 A;  5HMZ A;  1OWX A;  1QE1 A;  3VAK A;  4B17 A;  2WSC C;  2CKW A;  2ZBQ A;  2BKO A;  2HEK A;  1FFG B;  2F3J A;  2LQB A;  3FMB A;  3ILO A;  3OR1 A;  2OFG X;  3PYE A;  4EWT A;  4F4A A;  5CA5 A;  4JI4 J;  3DU5 A;  1E6V A;  1FKO A;  1U2C A;  2OSQ A;  3KKF A;  2R8I A;  1ZYQ A;  4LBI A;  3NNH A;  2W7P A;  2HHT A;  2V2V A;  3IMQ J;  3ZTP A;  1NK7 A;  2VFV A;  2YQ0 A;  3I96 A;  5GAE I;  2BUN A;  2YPZ A;  5HBM B;  3G9C A;  3K8W A;  3AJD A;  3IG1 A;  4LF7 J;  1FX4 A;  3MR2 A;  5FLX U;  3SZ2 A;  2FY1 A;  2RUG A;  2YWK A;  3G8T A;  2ZM6 F;  4KFB A;  1BWV A;  1RTJ B;  3DDN A;  4IQM A;  1L3S A;  1VQ4 S;  1XNQ J;  3K17 A;  3MPY A;  2EPI A;  5T41 A;  5A2Q U;  2C2D A;  4YB7 A;  3KYL A;  4DL4 A;  4PQU A;  4LF6 J;  1S48 A;  3PIO Q;  2EFG A;  1KVK A;  3R27 A;  1YDL A;  2WVE A;  3MM9 B;  5I3U B;  1RWM B;  1JLB A;  3HCX A;  3PDN A;  3OFH A;  2IDL A;  3C46 A;  5F8L A;  1UAW A;  2EFN A;  2FPH X;  4RL1 A;  4Z37 A;  1DZ5 A;  2JLE A;  3DLK B;  2UVV A;  2JOQ A;  1WHY A;  3ILL A;  2Y1I A;  2RQM A;  2AGP A;  3MUV P;  1HWJ A;  3QGH A;  4Q5V A;  1RTH A;  4BWJ A;  5LSL A;  1WG1 A;  5CXT A;  2DGV A;  1QD1 A;  4DQR A;  3CD7 A;  3K0J A;  5LM7 E;  4O44 B;  3UI3 A;  3I6P A;  1BQN A;  1PBU A;  1YRT A;  3MZI A;  4HAC A;  2WSE C;  4KO0 A;  3KLF B;  3V4I B;  1HR0 J;  4RW9 B;  1OY6 A;  1V3S A;  1JLA B;  3KLI B;  1M1K T;  1Q8B A;  1WKL A;  2GC8 A;  3A4T A;  2RF2 B;  1FE4 A;  1S9G B;  1VIS A;  4JYA F;  1H2V Z;  3SDE A;  1C0U B;  2BW7 A;  2ROG A;  3FMW A;  2E5H A;  3FCW A;  5HQ8 A;  1VGY A;  5DG7 A;  1UWA A;  1RT5 A;  2NXU A;  1X0F A;  1WOP A;  4QR2 A;  4CH7 A;  5GAE U;  1M90 T;  3I32 A;  4LR9 A;  2HZV A;  4M5K A;  5THW A;  2QA2 A;  2YWW A;  2Z4P A;  3MWB A;  3OXL A;  2YNG B;  1WC6 A;  1H74 A;  2ZIT A;  2VOO A;  2QFJ A;  1J5E J;  2DIV A;  3C15 A;  4ZCL A;  1S0M A;  4DPT A;  2OD6 A;  2B6A A;  5ETP A;  1GTE A;  1NND A;  1NPP A;  1S1U A;  5AJ3 J;  3PX6 A;  2HNZ A;  2JLG A;  1QSS A;  1S1W A;  1S6Q A;  1TL1 A;  3NWR A;  3H4B A;  2VQE J;  1FI4 A;  2AJ1 A;  2DR9 A;  4CNY A;  2FJB B;  4UY8 T;  5KG0 A;  2CPJ A;  3ISN C;  4DL5 A;  2AV5 A;  4N47 A;  2V4Q A;  5I4M A;  2R2U A;  3PX0 A;  2D74 B;  2XMA A;  3KTQ A;  2L9D A;  2IIH A;  1WEY A;  3BGF A;  2ZZM A;  3T5K A;  2XGP A;  5C7P A;  1GH8 A;  1RLC L;  3RAQ A;  5IT0 A;  1W7W A;  1YTY A;  3TAM A;  4JOU A;  4UZB A;  1HFE L;  1NK5 A;  4G1Q B;  2MLX A;  1XTZ A;  2DGU A;  3N6L A;  4DPX A;  4TN2 A;  3UD5 A;  1HR0 F;  1PYT A;  2LA6 A;  4B3S J;  1L3V A;  4K0K F;  2J8A A;  2DO4 A;  3EGW B;  3CJ4 A;  5D0G A;  4P73 A;  2QLF B;  3T41 A;  5DDQ C;  5DG8 A;  4LFC F;  5HAN A;  1XJW B;  3UW1 A;  4O3S A;  1H3D A;  2FB0 A;  2HND A;  2CRL A;  3B4M A;  4I4B A;  3R7S B;  3VGS A;  3OQ2 A;  2J9D A;  1T03 B;  3MAA B;  2DY9 A;  2OML A;  4J9R A;  4M95 A;  2ALY B;  2L48 A;  1SQG A;  2E66 A;  1ELO A;  4G1P A;  1LXJ A;  2VOD A;  3TO8 A;  3OLA A;  4B3O B;  2M8D B;  2QMX A;  1SC3 B;  4JI2 J;  1NUE A;  3JSM A;  1YX2 A;  2WVB A;  5HJY A;  2EC2 A;  2VF3 A;  3C19 A;  2OP5 A;  2D9O A;  4L3N A;  1HBU B;  2MYF A;  3CCU S;  2LFV A;  3RGI A;  1WTB A;  4JI3 F;  5DQI A;  2H51 B;  2UZA A;  3AOA A;  1YKW A;  4O3R A;  4MK8 A;  3PXG a;  3W8P A;  4ECU A;  3R8Y A;  3TJ8 A;  4WFZ A;  4ZJQ A;  2W9A A;  1XIQ A;  3UVJ A;  4LFB F;  5A0Y B;  1ZPW X;  1RAF B;  2DNO A;  4PXD A;  3BSA A;  4TY8 A;  3FRZ A;  4N5S A;  1BWE A;  4UW2 A;  5B0C A;  2VPX B;  1T9V A;  1K44 A;  1PYO B;  1O8B A;  4NCG B;  2ZH3 A;  2UU9 F;  2AYB A;  3SSR A;  2KT2 A;  3U1L A;  2ACY A;  1CVJ A;  2Z56 B;  1IWG A;  2KFZ A;  1KOH A;  2GJF A;  1AUD A;  2X51 A;  1HNV B;  3JXO A;  3M30 B;  2XQC A;  1Y5L B;  3IM9 A;  1CJT B;  4LFC J;  5H1S V;  5EWF A;  3CED A;  1CQM A;  2R8G A;  4OHY A;  5JMN A;  5AT1 B;  1E6Y A;  3VQT A;  3PW5 A;  3NY0 A;  1BE4 A;  1N33 F;  1HBM A;  1QDU B;  2YKQ A;  3MAH A;  2OGU A;  4RUH A;  5LSO A;  5KFR A;  3D28 A;  1IBM J;  1WF2 A;  3BGR B;  4I2Q B;  4Q0B B;  1S1U B;  3CC2 S;  2B6A B;  3ZTS A;  1OO0 B;  1M5S A;  4NYP A;  3OV7 A;  4DFK A;  2HGL A;  4B02 A;  4JI5 J;  3D1O A;  4HVZ A;  5HL7 Q;  4P9S A;  2AZ1 A;  2MQM A;  1S1V B;  4KRW A;  5AXM A;  3TJA A;  4X4S A;  4C8L A;  2HVI A;  3LAM A;  3MPU B;  2LCW A;  2QA1 A;  2Z30 B;  3O8W A;  4OYA A;  2UP1 A;  1NSA A;  4P2F A;  4PG8 A;  3QAT A;  3UDL A;  4DR1 J;  4DLG A;  4NA2 A;  1YZ6 A;  2V8V A;  4M5L A;  4C8K A;  4PAA A;  1OQ6 A;  2NSB A;  2HHH F;  1RBL A;  2BJ9 A;  5K5M A;  1T9U A;  3CD5 A;  1KFS A;  3PZP A;  2UU9 J;  1HBM B;  2CJB A;  1VHF A;  1BGX T;  3WZ0 A;  1GMW A;  2IDE A;  4KO0 B;  4QWE A;  3GIL A;  3KLF A;  5L1L A;  3Q8V A;  2BXJ A;  5F8G A;  1E6Y B;  4O3Q A;  2W9B A;  1XMO J;  1N6Q B;  2KH9 A;  1SJQ A;  5D4L A;  2ILZ A;  3DOM B;  1EQM A;  1EAY C;  1L5U A;  4MKY A;  1RGV A;  2AJF E;  2GIQ A;  2AIR B;  2BJ3 A;  4WIQ A;  3VQS A;  2JL9 A;  4I64 A;  3ULH A;  3KFW X;  5D4P A;  2E5I A;  2DGX A;  4LRF A;  3E8O A;  2CWX A;  3A8I A;  4CNZ A;  3Q0A A;  4G3I A;  2FZC B;  4ZVH A;  3W8G A;  3W5Z A;  1NB2 A;  1RTZ A;  2XZW A;  3GYG A;  1VBY A;  3M9M B;  1IBM F;  3H5Y A;  1TAQ A;  1HBN B;  5LXY A;  3VGU A;  3PW4 A;  1U45 A;  2GQ2 A;  2QLB B;  5G4D A;  4NLQ A;  2MLZ A;  4LIW A;  3V81 B;  4WXW A;  1J5O B;  4YDD B;  2RHS B;  4C7Q A;  4K4T A;  1NBE B;  4X66 F;  2DCL A;  1H2T Z;  3UN3 A;  2E1M C;  2VD3 A;  3I31 A;  4L76 A;  5ETO A;  1S76 D;  2CDR B;  1S5Z A;  2DNR A;  3S01 A;  3TZX A;  4YY3 F;  1NM2 A;  2VPZ B;  2V34 A;  3DRS A;  5KFA A;  3AOC A;  2XCA A;  5CZX A;  1X5S A;  1TL5 A;  4Q2M A;  1X9W A;  1I94 F;  2CJA A;  2J5A A;  4OMF G;  4A8O A;  1HA1 A;  2HSE B;  4OV6 A;  4DF8 A;  3RRG A;  4NZ0 A;  4DR2 J;  2PGC A;  3HHE A;  1HI1 A;  3QFH A;  3ZFV A;  1RU1 A;  2M3D A;  2XYH B;  4ZPD A;  1QE1 B;  3KK1 A;  2DRD A;  3UQS A;  1HHT P;  3GB0 A;  2VA2 A;  3IP0 A;  3UDV A;  3NGT A;  5CYM A;  5AE1 A;  3PO5 A;  3M1V B;  3OBI A;  4ZA1 A;  3BO4 A;  2HND B;  3GV8 B;  5KFK A;  1DUR A;  5DJB A;  4C8O A;  2NPI A;  2NSC A;  1Q7Y T;  4OJ3 A;  4DR3 F;  2UV8 G;  3BN4 A;  4G1I A;  1TQL A;  2RU9 A;  4J9L A;  2AGQ A;  2IM3 A;  5C24 A;  1Y5N B;  3UCG A;  3W62 A;  1TEL A;  5IT4 A;  2ADB A;  3LAK A;  3BRE A;  3MPV A;  3LP1 A;  3ZZ0 A;  4J7C A;  3TAM B;  5C5J A;  4ZPC A;  3ITH B;  1MLA A;  2M7S A;  4A8S A;  3SMZ A;  5EX3 A;  5AE3 A;  4F36 A;  1RAB B;  2B3T B;  4QWB A;  4QWD A;  3Q2S C;  3G4S S;  2C2K B;  3D9B A;  1JJ2 R;  1VJQ A;  4Y2A A;  3NGU A;  4RUA A;  2K1R A;  4MJK A;  4QR0 A;  3QYY A;  1RHJ B;  2V67 A;  3FC9 A;  4C98 A;  4B9S A;  4QYZ K;  3IAM 9;  1IUJ A;  3MCN A;  3AFG A;  2I5J A;  4IG3 A;  5DDP C;  2E1C A;  2UVR A;  3KDO A;  3HZE A;  4X66 J;  4EO6 A;  2BJE A;  3JQK A;  1FFS B;  3QZ8 A;  4AL7 A;  3TZY A;  1W25 A;  3I9V 9;  1WOR A;  3MCO A;  2K7K A;  4XK8 C;  3PG9 A;  2V9W A;  4A8F A;  1RHK B;  2O67 A;  2FDN A;  1ZBT A;  2CNN B;  2Z2Z A;  3NWG A;  5ETT A;  3M05 A;  5KG3 A;  1DHM A;  2OPQ B;  1Q5Y A;  1F6T A;  3EMT A;  3CDW A;  4N7T A;  1OSC A;  4OZ2 A;  4XTT A;  4HI2 A;  2N82 B;  4ZVT B;  4DR2 F;  4BS2 A;  1JKH A;  3G96 A;  2VC0 A;  5D0E A;  3TA2 A;  4ED8 A;  1FF2 A;  4CLS A;  1FDD A;  2OEJ A;  1Q16 B;  4RJV A;  4DMZ A;  2DNH A;  2L9N A;  5E3R A;  4RNO A;  3CJ8 A;  3H5U A;  3F73 A;  3MM6 B;  2KG1 A;  4ECX A;  2RF2 A;  3G6X A;  4Q8E A;  4GKJ J;  1CJK A;  1SBR A;  1YJ7 A;  1R27 B;  2RDD A;  2Z2L A;  3G87 A;  1RHM B;  2C2N A;  4AUK A;  1H7W A;  4HAC B;  3PIP Q;  3BPD A;  2M70 A;  5CYQ B;  5L9X A;  3V4I A;  2M88 A;  4O44 A;  3W2W B;  1VQP S;  3H20 A;  4IG0 A;  4MKV A;  2KT5 A;  1VK8 A;  4LIR A;  4YEA A;  4ZP9 A;  1WAC A;  4F7V A;  4KHR A;  1Y5I B;  2E7V A;  1UVJ A;  3PKY A;  3HD1 A;  4YDX A;  3VGT A;  3FDS A;  1NO8 A;  3IR5 B;  2L41 A;  3MDF A;  4OYP A;  3OL9 A;  2LU2 A;  1K73 T;  4K50 A;  1RHU B;  1DRZ A;  1FWP A;  3IS9 B;  1N5S A;  3TI0 A;  1YSJ A;  1JLB B;  4X84 A;  4QWC A;  4QWA A;  3MCS A;  1UET A;  1UW4 A;  2HQI A;  4OYB A;  4LRA A;  4OZL A;  3RAX A;  2XLK A;  1I51 B;  3H7H B;  3FKB A;  1VQN S;  1HIY A;  5HQM A;  2KXF A;  2VHG A;  3RW6 A;  1RTJ A;  5HVF A;  3BQ2 A;  2G1D A;  3JSB A;  5HJX A;  2HK3 A;  3T5J A;  5KG4 A;  1IBC B;  2Q6C A;  4I67 A;  1RCO B;  3N4W A;  2GHV C;  4JI0 F;  5IM0 B;  2CPE A;  3IRX B;  3Q86 A;  2F40 A;  4LSL A;  2M2B A;  1XNQ F;  3J7Y U;  1HI8 A;  2G0J A;  2Q43 A;  1F5B A;  5J2P B;  2EFO A;  2XTJ P;  3ISZ A;  2MXY A;  1UFW A;  3MM7 A;  1PYS B;  1RWK B;  2JFK A;  3GP9 A;  3NG8 A;  2MZT A;  5CCL A;  3NBP B;  1D9D A;  4J9M A;  4I69 A;  1IM4 A;  1FDA A;  4XPE A;  2ZH4 A;  3K7R A;  3QJP A;  1U1N A;  2OPQ A;  2GZO A;  3OPK A;  1YJV A;  2MMY A;  2BAN A;  3EJM A;  3G82 A;  2MDA A;  2ZOG A;  1EET B;  3PKM A;  4A46 A;  4UOG A;  1S4E A;  4O0N A;  4ZVR B;  2KB2 A;  2H4W B;  1A0O B;  1MNE A;  3CGI A;  1V5I B;  4DV7 F;  4DL6 A;  2ASL A;  1IBK F;  4HKQ A;  4PWD A;  5IOL A;  2ZDP A;  2I5J B;  3BS9 A;  3NNA A;  5JVH Q;  2AP6 A;  1MMN A;  2ERR A;  5H9F J;  1QM9 A;  5A8W A;  3L7U A;  3UPF A;  2K1R B;  2VUG A;  1AZS A;  4MKA A;  1VOM A;  3R7B B;  4CLK A;  4OZ0 A;  4HHH A;  4O23 A;  3RBD A;  1SVD A;  4Y2K A;  1CBK A;  3E01 B;  3QT7 A;  2NR0 A;  2RIL A;  3C2P A;  1CC8 A;  2LA4 A;  2MZQ A;  3LOU A;  3MEG B;  4RW8 B;  3WIV A;  3RB0 A;  3KG4 A;  4BCA A;  2DH9 A;  2B7B B;  2D69 A;  3POT A;  1B7Y B;  1N5V A;  3MD1 A;  2FHO B;  3PEJ A;  3VVT A;  3TJ9 A;  4WP8 A;  3KLV A;  2VFS A;  2R2R A;  1J5E F;  4K4W A;  1B70 B;  3DLB A;  2P2C B;  1RWV B;  2HGM A;  2IVF B;  1TZ0 A;  3TNV A;  3UR3 C;  3J81 U;  1R0A B;  5IZH A;  1X5O A;  4D3G A;  2F9D A;  1PIL A;  1U1L A;  1KN6 A;  4EBE A;  5A2Q Y;  2VQE F;  4OLP A;  1N88 A;  2KFY A;  2IJF A;  4WFX A;  1X4B A;  1T8E A;  2GFF A;  1UFK A;  1H38 A;  4NLS A;  4UY8 5;  1WDD A;  2G1H A;  4C9D A;  2JDJ A;  1WC1 A;  3RRK A;  2F65 A;  2DNP A;  2IAJ A;  1RUS A;  2B8P A;  2FLN A;  2BKN A;  3I56 S;  2OAU A;  4JV1 A;  4O4G A;  5T7L A;  2CQ1 A;  4C0B A;  4ILL A;  3SFG A;  4PRF A;  1ZZN A;  2G2O A;  4K5S A;  2BW2 A;  3DRR B;  4U8V A;  4ICL B;  5KAK A;  5BR8 J;  1HD0 A;  3O6Q A;  4P75 A;  2Y1J A;  4DV7 J;  2RDJ A;  3FSX A;  3GFY A;  1VC0 A;  1VCT A;  2ADC A;  4KHP J;  2I2Y A;  3DMJ B;  3CJK A;  5C42 A;  2XCP A;  1S9F A;  5H9F K;  2WCX A;  4H4M A;  3VF0 B;  1N0U A;  5F9L A;  2MKI A;  1QVG R;  4RBU A;  3BR8 A;  4LF1 A;  4DXL A;  5KFS A;  4F26 A;  3U1M A;  3CCE S;  2E7W A;  4U96 A;  4LUB A;  1VBX A;  3FJ2 A;  1MN9 A;  3NAI A;  3FBF A;  2V50 A;  4FYD A;  1ZA2 B;  2R8K A;  2HS3 A;  2Q66 A;  3PAC A;  1URN A;  5D77 A;  4ENO A;  3AOB A;  3R97 A;  2IAJ B;  1NHU A;  2F4F A;  3FEY B;  5BYS A;  2QMW A;  4C0H A;  4ED5 A;  2IRX A;  2JSX A;  3OLB A;  4WKR A;  2AJ0 A;  3SCI E;  1DFD A;  3BGO P;  2RJZ A;  1QLN A;  4JI3 J;  1U6F A;  2DXE A;  3DM2 A;  1MW7 A;  3HVT A;  1U2F A;  3EVO A;  4LJM A;  5ETL A;  3W65 A;  4WII A;  4TU8 A;  2W9B B;  2ZJP Q;  1N6Q A;  4IH6 A;  3H4D A;  2R8J A;  1SV5 B;  3KJQ B;  3D3C J;  3SCK E;  1C2P A;  2VPY B;  2AF6 A;  3I0R B;  4HL9 A;  1CJV A;  3JQJ A;  4ED1 A;  1R3N A;  1U0H B;  2YWG A;  3B6B A;  5J1P A;  2JFD A;  1TMM A;  5EWG A;  3K59 A;  3J80 U;  5HLF B;  1WUU A;  2ZD1 B;  3LGH A;  1NK0 A;  1FJG F;  3EZU A;  4YS2 A;  4YR3 A;  1UVN A;  4LF7 F;  4PPZ A;  1RYR A;  1F5C A;  3IWX A;  1S1V A;  4MIB A;  4D3H A;  2DGS A;  2XO6 A;  3KNG A;  1WG5 A;  3Q8Y A;  4KE5 A;  4NE9 C;  5LXR A;  3FGV A;  2YKO A;  3K5P A;  3PTW A;  3TQE A;  3PX4 A;  1F3V A;  1T7P A;  1UCN A;  1JXL A;  4EBC A;  4KC5 A;  2HHU A;  3WX8 A;  3NCQ A;  4Y0F A;  3P6Y C;  3TUP A;  4NLD A;  2KT3 A;  2ZWO A;  4B3R F;  5EHH A;  4A8W A;  1NU4 A;  4QQB A;  2ASY A;  4NRT A;  4PWD B;  4DFJ A;  2PT0 A;  5DDR C;  1KEK A;  3MOJ B;  3EDR B;  2W9C A;  3D68 A;  1EET A;  2CWK A;  3MGJ A;  4J9Q A;  4W90 B;  2J9E A;  1ZZF A;  2VG5 B;  3RJM B;  1H98 A;  3GSD A;  5A6W A;  5KFL A;  5AE2 A;  5F8M A;  2V4R A;  2A6O A;  3RAM A;  5DQG A;  2DVI A;  4I2P A;  3G71 S;  1AUS L;  5D78 A;  5SUH A;  2VBZ A;  4XIU A;  2UUA F;  5B0E A;  2AW0 A;  1FXL A;  1NSK L;  2JHE A;  1G2E A;  2MLY A;  2CNK B;  4NCG A;  3EPG A;  2AJQ A;  5HMY A;  4YUD A;  2WBR A;  3T6B A;  5IT9 U;  1LK7 A;  2YY3 A;  3F0N A;  1SB6 A;  3W66 A;  5KTQ A;  2PII A;  2R42 A;  4DL0 C;  3PW0 A;  5AXN A;  2MTL A;  2K3K A;  1KDN A;  1F60 B;  3B54 A;  3PRD A;  2E9Z A;  2AJ4 A;  3CIZ A;  2KXH A;  1XK8 A;  1F1B B;  4NLG A;  3VR1 A;  4NL5 A;  4R0J A;  5AJ3 F;  4I7F B;  5FDL A;  4DUZ F;  2Q3P A;  3BBB A;  1LWF A;  1FXR A;  1RHR B;  1RT2 A;  4NI2 A;  2UUW A;  2CNL B;  1RWP B;  2R3V A;  3SXL A;  3JSM B;  2VIH A;  1KFD A;  4F3O A;  4NCA A;  2XS5 A;  2HIY A;  3QMQ A;  3DHX A;  3PCO B;  4E8U A;  3C6T A;  2HBY B;  4QIW D;  1NKE A;  3R2C J;  2HK2 A;  2Q1L A;  1NLK L;  1NHV A;  1UJ4 A;  2CQ2 A;  2HQC A;  1MG7 A;  4RNH A;  2ZE2 B;  4KGV B;  2E9R X;  1S49 A;  3Q89 A;  3IR7 B;  3W9I A;  4YQW A;  4K5R A;  2LQ9 A;  4V19 J;  4M94 A;  2H65 B;  2R7X A;  3FSI A;  4KKO A;  1OSD A;  1X0P A;  1UEK A;  3W2W A;  4ZVO B;  3MR3 A;  2PD1 A;  1UPP A;  3QJL A;  4IRK A;  3D6T B;  1B7F A;  1TR0 A;  3GR1 A;  2ZWP A;  3SQO P;  3I5A A;  3HSZ A;  4QIE A;  4NPO A;  4AXJ A;  4Q45 A;  4CLZ A;  1LOU A;  3WC2 A;  1NK6 A;  5KFV A;  1CJK B;  2UUA J;  1EP4 A;  2XSJ B;  4OLO A;  1HPZ A;  3M2U A;  5KT7 A;  4FKY A;  1FER A;  1X4A A;  2F8H A;  4DV5 J;  1D8Z A;  2N4D A;  3CWJ A;  1ZM3 A;  4ECS A;  4V1A k;  1DTQ B;  4FXV A;  3MEK A;  3B78 A;  3M8Y A;  4KV8 A;  5BYQ A;  1TUV A;  2O01 C;  2U2F A;  5B0A A;  3UCU P;  3C16 B;  2F4V F;  5D6G A;  4K4V A;  2DIU A;  2GQC A;  4RR5 A;  5J2M B;  1OJ4 A;  2CJY B;  3KHG A;  5KFN A;  4F4K A;  2JVO A;  4XPC A;  1S1W B;  3CF5 Q;  1M5O C;  1HQE B;  1LWE B;  1LWE A;  1GX6 A;  1DAX A;  2DGW A;  2D3U A;  3WIU A;  4A47 A;  1OIA A;  2XY5 A;  4YB5 A;  4EYH B;  3PY8 A;  1HAR A;  1REV B;  4QR1 A;  1RE1 B;  4Y2M A;  2DR7 A;  1Q95 G;  1Q8K A;  1U8S A;  2BZ2 A;  2GO9 A;  1Q8I A;  3THT A;  4PPD A;  2BOP A;  1PAU B;  4WP3 A;  3AH6 A;  1HWK A;  5K14 A;  4P6Q A;  1HWI A;  4DUT A;  3CCR S;  4IDK A;  4ELV A;  5L39 A;  2IPO B;  4OI3 A;  1GMU A;  2N3O A;  2ASD A;  2CAJ A;  2WVC A;  3LP1 B;  3HF5 A;  2RS8 A;  2XSJ A;  5LMN J;  3NGD A;  4ELU A;  4LF9 F;  2HS4 A;  4DJB A;  1WC5 A;  3BJY A;  1IJF B;  1JNZ B;  2MSS A;  4OHV A;  2X3G A;  3LWM A;  1HNZ F;  4GVL A;  3M8Z A;  1RB0 A;  1U6Z A;  3BKT A;  2YNF B;  4RU2 A;  1XWL A;  4ID5 B;  2HFU A;  3D66 A;  2FUG 9;  2VC1 A;  3PYG A;  2DR5 A;  5GAG U;  3IBW A;  1HMV B;  1KQK A;  5IC4 B;  1UWB B;  3H42 A;  4KR0 B;  1HQU A;  3DFE A;  5HAT A;  1OQ3 A;  3CCT A;  1N33 J;  2V4J A;  1ROF A;  5ITH A;  1IKW A;  4OX8 A;  3C6T B;  1I1G A;  3KK3 A;  5G0R B;  1DAR A;  1S59 A;  3BGL A;  4EO8 A;  2XZT B;  3TUZ C;  1Q79 A;  4QPX A;  5EN1 A;  1CS4 B;  1VQS A;  3EXY A;  3ENA A;  2QE5 A;  4MFB B;  3DYA B;  4YR0 A;  3CCL S;  2WON A;  4DV3 F;  1I6J A;  2FLL A;  2GVZ A;  3CPW R;  1Y3K A;  2M9K A;  3OD2 A;  4UQG A;  1EX8 A;  1BY9 A;  4NOH A;  3JQM A;  2FC9 A;  2A2C A;  2M4M A;  2V2K A;  2CQC A;  2XNQ A;  4DPO A;  3V81 A;  2XMU A;  2OLW A;  5GMK a;  2B7C B;  1NJW A;  1D3W A;  4IRD A;  1RHQ B;  2YXL A;  4DR7 F;  1K47 A;  2LXI A;  3M2V A;  3QAU A;  1Y7P A;  4MFB A;  4IR1 A;  1GT8 A;  3JTP A;  3JYT A;  1C0T A;  5K20 B;  4FS1 A;  4HTJ A;  4KQZ A;  2HHW A;  5G0R A;  3R5A A;  1IKY A;  3KG0 A;  5LMN F;  2YKM A;  1NH8 A;  4ZN3 A;  1HHS A;  4DBQ A;  2R2S A;  3ILI A;  3PJ9 A;  5CAA A;  2HPU A;  1VBZ A;  2PMW A;  3EYZ A;  3O3L A;  3EXC X;  4L3K A;  4W4M A;  3DOM A;  2GQQ A;  5KFZ A;  1HMV A;  3LPE A;  5SZT A;  4IO1 A;  3CCW A;  4FPR A;  3N5B A;  2ZZN A;  5IXU A;  1H2U X;  3IWN C;  1MML A;  4DEZ A;  1VQ6 S;  2IM0 A;  2K2P A;  1AA1 B;  5KFI A;  3DOL A;  2ZHA A;  1ZTT A;  3M9O B;  3B4D A;  3CTR A;  3PRB A;  2BMB A;  5ADZ A;  4URG A;  5KFE A;  2WTF A;  4DR4 F;  4DHV A;  3Q23 A;  1F9F A;  3SQG A;  4FBU A;  1YZ7 A;  3GQC A;  1VDH A;  1ZAX A;  3EWG A;  2C3P A;  1N8R T;  2MKC A;  1WI8 A;  2EBG A;  1SC4 B;  1WOO A;  3F44 A;  1NRK A;  4NML A;  3MEE A;  1YRX A;  2HVD A;  2UXC J;  4EEY A;  2LP4 A;  2VAS A;  4GC6 A;  2X3D A;  2EKN A;  3OVS A;  1TAU A;  3AJ2 A;  1JXV A;  4NX9 A;  4NYZ A;  4EYI B;  3OR2 A;  3BM7 A;  5GMD A;  4JI8 F;  4DCJ B;  3HVR A;  3CDA A;  1U0H A;  2CVI A;  1VRT B;  2E5G A;  3BGR A;  3D67 A;  2QO3 A;  4I2Q A;  5K8O A;  5KG2 A;  4IUF A;  4NA3 A;  1NH7 A;  1SV5 A;  1WD6 A;  2D9P A;  4PUO A;  4R25 A;  4I6W A;  1O51 A;  3E3X A;  3QSI A;  1T94 A;  4OYM A;  5J2M A;  5DM7 Q;  1IBK J;  2GHW A;  3FRY A;  3BYR A;  4PKD B;  4I1T A;  3C16 A;  2F7V A;  1NPK A;  1SL1 A;  1NZA A;  1TKX A;  4X4T A;  4OL8 A;  1O5J A;  2H48 B;  3HJV A;  1RDR A;  4PG5 A;  1Y10 A;  5KT3 A;  5H9E J;  1CQN A;  2B9W A;  4ITS A;  4OIX A;  2HQG A;  2CZ9 A;  1FDB A;  3M6V A;  4CLY A;  3HHN B;  2KHC A;  5B0G A;  2HFO A;  2CG8 A;  4NLU A;  4ED2 A; 
#chains in the Genus database with same CATH homology
 4KPC A;  3FCV A;  3B6B A;  4C6A A;  1MN7 A;  4DUT A;  3R9L A;  4DI6 A;  1F3F A;  3Q83 A;  5C7P A;  1LEO A;  4AND A;  3VGV A;  1NB2 A;  1W7W A;  3Q86 A;  1WKJ A;  3EVW A;  3ZTR A;  1NDP A;  3VGU A;  1B99 A;  3FBB A;  4ANC A;  3Q8Y A;  3GPA A;  4W98 A;  1UCN A;  3GP9 A;  3WX8 A;  4FKX A;  1S5Z A;  3NGR A;  3VGS A;  1LWX A;  2DY9 A;  2BEF A;  4DZ6 A;  3EIC A;  3EJM A;  5BXI A;  2CWK A;  4UOG A;  1BHN A;  1S59 A;  4O0N A;  4UOF A;  3EM1 A;  1NUE A;  3NGT A;  3FBE A;  4ANE A;  3ENA A;  5IOL A;  3EVM A;  1S57 A;  1NSP A;  1NDL A;  3L7U A;  1NSK L;  2NCK L;  3G2X A;  1XIQ A;  3NGS A;  4F4A A;  3MPD A;  3JS9 A;  1NDC A;  3DDI A;  5CAB A;  1VYA A;  3ZTP A;  1NDK A;  1B4S A;  4F36 A;  1K44 A;  4CP5 A;  4UOH A;  3VVT A;  1KDN A;  3B54 A;  2ZUA A;  3NGU A;  3FC9 A;  2HVE A;  3PJ9 A;  5CAA A;  3BBB A;  3ETM A;  4EK2 A;  3FBC A;  2VU5 A;  1BUX A;  3Q8U A;  2DYA A;  1NLK L;  2B8P A;  1BE4 A;  3Q89 A;  1F6T A;  3EMT A;  3DKD A;  4WBF A;  3ZTS A;  1PAE X;  1XQI A;  1HLW A;  3BH6 B;  1NCL A;  2AZ1 A;  1WKL A;  3PRV A;  2AZ3 A;  3ELH A;  2HVD A;  4FKY A;  2B8Q A;  1JXV A;  2BX6 A;  3FCW A;  1HHQ A;  3VVU A;  3BH7 B;  3BBC A;  2HUR A;  4S0M A;  1MN9 A;  3FBF A;  3EE3 A;  3VGT A;  4ENO A;  2DXF A;  1EHW A;  3Q8V A;  3ZTO A;  1NPK A;  1PKU A;  2DXD A;  2DXE A;  3ZTQ A;  3EVO A;  4HR2 A;  1WKK A;  1ZS6 A;  3BBF A;  1NHK L;  3FKB A;  1U8W A;  1HIY A;  1NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...