3KLFB

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
426
structure length
413
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 101
structure length 413
sequence length 426
chains with identical sequence F, J, N
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB03
1S6QB 1HNIB 3M9OB 4IFVB 1N56A 3T5JA 4Q44A 4MH8A 3DM2A 5J2PB 1LWFA 4O44A 1S9EA 1LW0A 1S9GB 3TAMA 4KB7A 2YNGA 5F8HA 1VRUA 2R8KA 4ECSA 1RT6B 2E9ZA 4NYZA 3H5SA 1MMLA 4ZP8A 1RYRA 2B6AB 3I5BA 5KFMA 3Q8PB 1RT2A 2WONA 4QWAA 4EO8A 2ZKUA 5KT3A 1IKVB 5KFOA 1UWBB 1JLEA 1TV6A 4KFBA 4RW6B 4RNFA 3GIIA 1S6PA 4RNMA 4ECRA 3T1AA 3MR2A 3HVTB 5FDLB 5K14A 4KAIA 3KK3A 4IG0B 4URSA 3C6TB 4MK9A 2F8EX 3EZUA 3LP1A 4G1QB 4RW9A 1S1XA 2UVUA 5HP1A 4Q0BA 5JXSA 4EYHB 3QZ7A 1ZTTA 5KT2A 1HPZB 1N5YA 5EDWA 1T3NA 3DYAA 2GIRA 2OPSA 2JEFA 2HMIB 2D7SA 5KFPA 4H4OA 1JLCB 4TN2A 4ECXA 3FRZA 2YKNA 1DLOB 3N6LA 5F9LA 3QLHA 5KFJA 2C2DA 5EWFA 1RT1B 5D3GB 3D5MA 4MIBA 3DLKB 1SH3A 2WRMA 5DG8A 2V4QA 4TY9A 2ASJA 3DMJA 3MEDA 4ID5B 4K50A 2J6SA 2WTFA 2UVRA 2HNYA 5F8JA 2B5JA 4RW7B 5DG7A 3UQSA 4WFXA 5HROB 3QO9A 4RNOA 1C1CB 5HLFB 3IG1A 3OL9A 3M8PA 3QYYA 1ZETA 4PQUA 3BQ1A 5KFWA 4IRDA 3CJ0A 3MEEB 2W9BB 4DL6A 3KK1A 3DOKA 5J2MB 5HBMA 4TY8B 3KHLA 2RKIB 4LQ3A 1RTDA 2OPQB 2R8GA 1HQUB 3DLEB 4DG1B 1XR7A 1LW2B 1HMVA 3MR5A 2HWHA 1N4LA 2XI3A 1JLFB 4NLTA 4QW8A 2HNZB 3V6KA 2AX0A 3BQ2A 3BSAA 3CJ2A 5J1EB 3RB4A 5KFCA 4ED2A 3MEGB 4KV8B 1TKZA 2IM0A 4B3OA 2OPPA 2R8HA 4J9LA 2AGPA 3GILA 5KFZA 1JLAA 1RT5A 4R8UA 2JC0A 4FS1A 4IR1A 3GQCA 3JSMA 4RNHA 5DQGA 4X2BA 4I2PA 3QGIA 4Q43A 5KT7A 4LSLA 1SH2A 3Q8QB 5F8GA 2FVSA 3CDEA 4XO0A 2YNIA 4ECTA 2QE5A 4NZ0A 2C2RA 3KLHA 1T05B 1CSJA 5KFTA 3MF5A 3UR0A 4IKAA 5CYQA 4WZQA 4JUZA 4F50A 2XCAA 1KLMA 1TKTB 1HYSA 1R0AB 1IKWA 2BRLA 2E9RX 3V6HA 1HNVB 4IG3A 2UUTA 1BQMB 3IGVA 4NLQA 5KFQA 2UUWA 3IS9A 1S9FA 1IKYB 1JKHB 4WYLA 1JXLA 4ECWA 1RTJB 1TKXA 3IN5A 3LP2B 2R2UA 1OS5A 4LSNA 3PJWA 3KK2A 5C25B 3DRRA 5KFHA 3PW0A 2HNDB 1JX4A 3LAKA 3BGRB 1RTIA 1TL1A 1RT4A 5KFGA 2IM3A 3JYTA 3H2LA 4O4GA 3V81A 1NNDA 1QUVA 5EWGA 4PWDA 3Q8RB 1QAIA 3FSIA 4EBEA 4PUOB 3CDWA 5C42B 5CYMB 3CWJA 4WFZA 3EPIA 3T5HA 4FBUA 2VG6A 3N6MA 3VQSA 3RB6A 3KLGB 5KFNA 4KO0B 3LANA 3G6VA 1D1UA 1Z4UA 1BQNB 1S1VB 2FJVA 3OL6A 3RBEA 3MECA 3RAXA 1TVRA 1S1TA 5JUMA 1VRTA 4O3NA 2C28A 4QPXA 3H40A 4ED3A 1J5OA 4O3PA 5KG3A 3KJVA 1S6QA 1JLBA 1HNIA 4IFVA 3PR4A 2RDJA 1FKOA 3IGNA 3LAMA 5KFBA 1IKXB 1S1UB 4ZP9A 1RYSA 3KHGA 2FLPA 4TQRA 1S9GA 1LWCA 2I5JA 4DEZA 4ED1A 4HYKA 2J6TA 2VG5A 4MFBB 5KFKA 4ECZA 2WOMB 1REVB 2VG7A 4RW8A 2GIQA 3ICLA 1KHWA 4ZP6A 1RT7B 1FK9B 2D3UA 5L1JA 4ED8A 2B6AA 2IBKA 4ED7A 4NLUA 5F8MA 1T03A 4MK7A 4Y3CA 3FFIB 4I2QA 3V4IB 3DLGB 2IC3A 2IM2A 4U7CA 4KBIA 3UDLA 1N48A 5KG4A 3TVKA 3DM2B 3HVTA 3BREA 2XC9A 1LWFB 4O44B 1S9EB 1LW0B 3C6UB 3TAMB 3QGGA 4NLYA 3OL8A 4NLOA 2XCPA 2YKMB 5KFSA 1S1WA 3DI6A 3I0SA 4J9MA 3I0RB 1RA6A 3DRPA 4G1QA 1JLQA 4TXSA 3BJYA 5I42A 3PW5A 3CDUA 4NLDA 4J9SA 2WONB 2IM1A 3PW7A 1QE1A 1HQEB 1TV6B 4KFBB 1KHVA 3N6NA 3NKYA 2UVWA 1S6PB 4LQ9A 1EETB 2HMIA 4K4YA 3CJ5A 1JIHA 1HARA 5K14B 3KK3B 4YMEA 3D28A 3GIJA 1C0UA 4F4ZA 4NRTA 5J2QA 4ZPCA 3LP1B 5L1LA 3V6JA 1S1XB 2W9CB 5HP1B 2J6UA 3RBDA 1C0TB 1QAJA 1DTTA 4NCGA 5KG2A 3SI8A 4ICLB 1YVFA 3RB0A 3KLFA 2BQRA 1T94A 3KHHA 5KFYA 5C24B 4H4OB 2C2EA 3DRSA 3MR3A 4XPCA 3NAHA 2AU0A 2YKNB 2ASDA 3NL0A 4ZPAA 3GV8B 1GX5A 3MTKA 2R8IA 4RUCA 3CIZA 4O3RA 4NLSA 5KFIA 3KLVA 3DMJB 3MEDB 4DG1A 3HHKA 5DGBA 4EBDA 3QIPB 2HNYB 1RAJA 4IH7A 2DPJA 2B5JB 3NAIA 1SUQB 4K4ZA 1C1BA 3QO9B 4H4MB 4ZPDA 1ZTWA 3IG1B 3V6DA 2BR0A 3M8PB 4IOBA 4ZVHA 5DG9A 5L9XA 4NLWA 1MU2A 1K1QA 3T5LA 1NHVA 1RTHA 3DOKB 3FQKA 5KT4A 4ED0A 2VA3A 2BE2B 4KKOB 2WB4A 4Y2CA 4R5PA 4O3OA 1RT3A 1JLGA 2AGOA 4ZVFA 2V9WA 1HMVB 2ZD1A 4MKAA 2YNFA 5I3UA 4YR3A 2W9AA 3PZPA 2BQUA 1XR6A 2XGQA 3PR5B 4K4TA 4NLVA 4IDKA 1N6QB 3GIMA 4NRUA 1FKPA 5DQIA 3G6YA 4O3SA 3OLBA 2R8JA 2JEGA 1TKZB 1DTQA 4B3OB 4F4XA 3I5AA 1K1SA 3OSPA 5J2NA 2ILYA 3ITHA 1TL3A 5KFRA 4I2PB 3PW2A 1SV5A 1EP4A 3NBPA 4LSLB 2IJFA 2WCXA 4OL8A 3IRXA 2IAJA 1JKHA 3OHBA 2W7PA 3H5YA 3EPGA 2YNIB 2OPRA 2FLNA 3QZ8A 5DLGA 3LP2A 3KLHB 3LP0A 5C5JA 5T14A 3KOAA 2RF2B 5C25A 2B43A 3H4BA 4K4UA 3BGRA 4FS2A 4WE1B 1NHUA 3KLEA 4I7FA 3DOLB 1S0NA 3GYNA 2YNHB 1HYSB 1IKWB 1I6JA 3FDSA 3KLIA 4IH6A 4DL5A 5KG1A 4WXWA 4PUOA 3IS9B 3BSNA 5CYMA 2BANB 5F8IA 4ED6A 3TQ1A 4NLXA 4ZP7A 2UVVA 2FVPA 3KHRA 2JLEA 2XGPA 3E01A 4LSNB 2XWYA 3DRRB 4YR0A 4RW4B 4IFYB 2V0NA 3SFUA 3M9NB 1S1VA 2ZE2B 4QWDA 4F4WA 3I5CA 4DL4A 2IA6A 4O3QA 3UPFA 1RT4B 4EBCA 4QWEA 3JYTB 4XPEA 4JV0A 1TQLA 3PJXA 1W25A 5KT6A 5J2PA 4PWDB 3RB3A 3LALA 2V4RA 1IKXA 1LWEB 3BR9A 1RA7A 3H4DA 2VG6B 4ZHRB 4QWCA 2JEJA 1RT6A 4MFBA 2BRKA 4JV2A 2WHOA 4ECYA 2WOMA 3M8QB 5KT5A 4G3IA 4IR9A 2IJNA 2ASLA 2WK4A 3MECB 1IKVA 2W8LA 1UWBA 1TVRB 4RW6A 1S1TB 3CVKA 3HVWA 4GC7A 4U6PA 2FVQA 3KJVB 3E51A 1JLBB 4GC6A 2XI2A 1FKOB 5FDLA 2IMWP 2YNGB 4KHRA 4IG0A 1VRUB 1S10A 3CO9A 3C6TA 3C6UA 3PVXA 1LWCB 2I5JB 2R2TA 4DL2A 2I1RA 2VG5B 4NLRA 2YKMA 4YR2A 4M94A 3GV7B 2VG7B 4RW8B 3I0RA 5DGAA 1RT2B 5KG7A 4KE5A 5KFFA 5L1IA 3OLAA 1HPZA 1JLEB 5DQHA 1T03B 4TQSA 4I2QB 3GIKA 1HQEA 2IC3B 1JLCA 1EETA 4KSEB 1S0MA 1XR5A 4RUAA 1DLOA 4K4VA 2OH2A 4O4RA 1S48A 1RT1A 4RW9B 1S1WB 5D3GA 3DLKA 3I0SB 3DI6B 4Q0BB 5EUHA 2AX1A 3QGHA 3DRPB 4ID5A 2W9CA 1JLQB 5I42B 5KFAA 5KFVA 5KFUA 1C0TA 1N5YB 2O5DA 4RW7A 1QE1B 3DYAB 3DDKA 4IH5A 4Y34A 2OPSB 3OSNA 5HROA 4TYAA 1C1CA 4ICLA 5HLFA 2W7OA 4J9QA 4DL7A 4RNNA 5C24A 2W9BA 3MEEA 4IRKA 3QLHB 5KFLA 5J2MA 3NGDA 1C0UB 2JC1A 2RKIA 2RDIA 4TY8A 2OPQA 4K4WA 3KMQA 4J9KA 3T5KA 5J2QB 3BQ0A 1HQUA 3DLEA 1LW2A 5KFXA 4RU9A 4MKBA 4ZVGA 3QIPA 1DTTB 4NCGB 4J9PA 4ECVA 3RAQA 5KG5A 2FVRA 5KG6A 1JLFA 1SUQA 3BSOA 2AQ4A 3KLFB 2AGQA 2HNZA 4H4MA 4PQUB 2ILZA 5L1KA 5J1EA 1S4FA 3DRSB 1S49A 2CJQA 3MEGA 4KV8A 3KK1B 2CKWA 5HBMB 1RTDB 3PHEA 5F8LA 1RDRA 2BE2A 4KKOA 2EC0A 2HWIA 4FBTA 4WYWA 4ZPBA 4ZMMA 4IRCA 1TP7A 3G86A 2AWZA 3KMSA 4J9OA 1WNEA 4ECUA 4MIAA 4QW9A 1C1BB 3T19A 4HKQA 3V6DB 1N6QA 4J9NA 1S0OA 4M95A 2GC8A 1T05A 3OHAA 4MK8A 4EEYA 1MU2B 4TLRA 2OPPB 3BSCA 4DL3A 1RTHB 2C22A 1JLAB 1RT5B 3SFGA 2FJWA 4R8UB 3PW4A 3QIDA 1TKTA 4WXOA 4R5PB 1R0AA 1RT3B 3JSMB 2FJXA 4WFYA 4URGA 1JLGB 1HNVA 1IM4A 1BQMA 2FVCA 2ALZA 2ZD1B 2YNFB 5I3UB 4ZVEA 1IKYA 4H54A 1D0EA 1RTJA 4J9RA 3KNAA 3OL7A 4EO6A 4IDKB 4R0EA 5DLFA 1FKPB 5F8NA 4IQXA 2QV6A 2HNDA 4NLGA 2DPIA 1S97A 2E9TA 5CYQB 2RF2A 4TYBA 4K4SA 1DTQB 1KLMB 4WE1A 3HVAA 2BQ3A 3MFIA 5J2NB 2D41A 4Q45A 2FLLA 3DOLA 4NLPA 4YQWA 3ITHB 5KFEA 2YNHA 4KHMA 4IG3B 1TL3B 4Y2AA 4EYIB 5C42A 4WZMA 1SV5B 1EP4B 3NBPB 2R2RA 3FQLA 2BANA 3KLGA 5KG0A 1TKXB 3IRXB 2IAJB 3G6XA 4Q8EA 4URQU 4KO0A 2OPRB 3KK2B 3H98A 3M9MB 1BQNA 2R2SA 3LP0B 1RTIB 3ISNC 4Q8FA 4RW4A 1TL1B 4IFYA 5F9NA 4RZRA 2ZE2A 3NMAA 3H59A 3KLEB 5EWEA 4I7FB 4O4GB 3V81B 4QWBA 3MFHA 2VA2A 4K4XA 2HAIA 3CJ3A 3KLIB 3ISND 3H5XA 1S1UA 1U09A 3GV5B 3H5UA 3CJ4A 1LWEA 4YP3A 1C2PA 2ATLA 4ZHRA 2D3ZA 3HKWA 4ECQA 1REVA 3E01B 1SH0A 1RT7A 1FK9A 3MR6A 3M8QA 3Q8SB 5KFDA 2JEIA 2W8KA 4JV1A 1VRTB 1GX6A 3FFIA 4F4YA 3V4IA 1J5OB 3DLGA
chains in the Genus database with same CATH superfamily
4ZVUB 3DGPB 2YQ1A 3D0HE 3B6BA 4AQYF 1REGX 3RBXA 2QLXA 1PC4A 4KFBA 1ZH5A 2OEJA 3U1NA 3MR2A 1A7GE 3M4XA 1FTCA 3UNYA 2K2PA 1SBRA 4X4OA 2VQFF 1CULB 5M2UA 1QAYA 1X0PA 3NNHA 4UY85 4NX9A 1BHNA 4YUDA 1T0TV 4MIBA 3BN4A 4DPXA 3UD3P 1ZYQA 3MAHA 3QRQA 1MSWD 4DL6A 1XEZA 4F3OA 1Y10A 2ZH2A 1XR7A 1LW2B 4JI0J 1N4LA 2XI3A 4LF7J 2MKIA 2LA6A 2ZC3A 3EYZA 4DV5F 1RT5A 1NUEA 2OUGA 4TKTA 4KC5A 2Y1LB 2DNNA 5F8GA 2YX4A 3ETMA 1N33F 2UUBF 1TZ0A 1GAOA 2QZ8A 5K8OA 4WP8A 1OO0B 2R7TA 1KLMA 3OFGA 1R0AB 2RQKA 3MPYA 2UUWA 4NI2B 4YHHF 1NXIA 2BMBA 5KFHA 3CSKA 3PJWA 3DRRA 2LQ8A 3DC2A 3RTVA 2NPIA 5A8WA 3UD4P 1UVMA 3MM9A 4N77A 3KLGB 2F4VJ 2OLWA 4C2MA 3RBEA 2DB1A 4R0JA 3EDRB 3CNQP 2VD3A 4FF1A 1QY7A 2XS7A 4K2JA 4ZJQA 5LOQA 1RBAA 1S4EA 1P27B 2EW9A 2ZZMA 1KR4A 2I5JA 2J76E 1DJ0A 3VZIA 2CZ9A 3CW2C 1U8SA 4PXBA 5MLCV 2XSJB 4M5HA 1CJTA 1YK9A 4J90A 1ZM2A 1LWFB 1QSSA 3DRPA 1R6YA 2HS4A 5J1PA 4X66F 2LEBA 2HMIA 1EARA 2D3O1 2Q43A 4WIQA 1WG4A 1YKWA 1H38A 3JQMA 4ICLB 1YVFA 1T94A 4OZNA 1SXLA 1T8EA 2LMIA 3PG9A 1JXEA 5U47A 4YB1P 3N5BA 3NP5A 2UU9J 3HHKA 4DL0C 3M8PB 3HT0A 3AJ1A 4A8KA 2E1RA 2RRNA 3JQKA 2RRBA 1H7WA 4O3OA 4R5PA 3UO0A 4ZVFA 3Q2TC 1IBLJ 1AB8A 4M8LA 3G6YA 4DV5J 1K1SA 1C4AA 4B9LA 2P5VA 3ITHA 3TX0A 2MZ1A 5D15A 2WCXA 3NWGA 3OHBA 2HFVA 3H5YA 1N33J 2UUBJ 2V8DA 2A1BA 1SQFA 4Q2LA 4HACB 3QSYB 2KDOA 1CJKB 2CJAA 3SSQA 3SXLA 5CYMA 3GJSB 4KH1B 3R2DJ 2AYGA 2CPYA 4BS2A 4F4WA 5B09A 1YX2A 1BMQB 3DFEA 3UN3A 3H4DA 2VIHA 3HI9A 1RT6A 1PYTA 2WOMA 3CCVS 3OTBA 1Q82T 2N3OA 4F2SA 1Q5YA 5A2QY 1UVIA 2HFSA 2I1RA 2VG5B 2VG7B 4RW8B 2HHTA 1NJXA 4KE5A 1HPZA 5HN0A 3WHIA 2W2OP 3KTQA 3FEYB 4O4RA 1S48A 3I0SB 1VQ8S 4DCJB 2W9CA 1SIZA 5KFVA 1U25A 2RU9A 5HROA 4A8SA 4CLSA 2UV8G 2DXEA 5J2QB 1K8AT 1HQUA 4FYWB 3UWTA 5E41A 1WTFA 1Z2ZA 2C3YA 4P2SA 1VISA 2F1FA 5L9NA 3PV8A 2OSQA 3V2UC 4ANEA 4DV7F 3PYFA 4HTJA 4C7QA 4DL3A 1JLAB 2AMCB 4ZVQB 4DV0J 2G1DA 4K7QA 4Y28C 1H3DA 4EMDA 4NLGA 1DTQB 1G6BA 2AJ1A 2BM1A 1SC1B 1FDBA 1NH8A 3W1YC 2F3JA 2F7VA 1HQ2A 1X4EA 3MXHP 4ANCA 4KY3A 4Q8FA 3T6BA 2ZE2A 1GTHA 1TFYA 2UXCF 3NMAA 4C8ZA 5EWEA 3V81B 3MFHA 4C8YA 1XN9A 5GAHI 3RW6A 2BJ9A 2DH7A 5JJBA 3E01B 1FK9A 3AD9C 1VBXA 5E7OB 4CO2A 1ZPVA 3TA0A 4P2XA 1FRIA 1F5CA 2M8DB 4EGLA 2J7UA 2WONA 3OJUA 4NWBA 4N5SA 4RW6B 2JX2A 1WC5A 3BEGB 3KK3A 5IWAJ 4QYZJ 1GFWB 3JTOA 4LJMA 5D4OA 4CO4A 1ZZFA 4DFKA 3RR8A 5EDWA 2HHQA 3MAAB 4MTPA 3U02A 1RT1B 3D5MA 3GR0A 2F4FA 2JOQA 2XO7A 4M5IA 3IWNC 2XLKA 4QU7A 1ZETA 3G82A 2F8MA 3TO8A 4IRDA 4I67A 2QN6B 4ITSA 4DF4A 2KXNB 3EZ5A 3H90A 4ELVA 4DG1B 3CCSS 4RUBA 4X4UA 4CLLA 4QW8A 2V69A 3BSAA 2HFNA 1YJNS 1BC6A 3CULA 4DV6J 2AGPA 2DO0A 1D09B 1VI7A 4IR1A 4Q43A 4RPFA 2HQDA 2DRAA 4F4AA 4FDFA 5F41A 2HIYA 3DU5A 4MKYA 4DQPA 2KRRA 3SYZA 4AYBD 3BGRB 3VF0B 4LUBA 3LUYA 1N34F 1NNDA 2Q6BA 1QTNB 2OD6A 5H9FK 3W2WA 5KFNA 4OX6A 4L74A 3TWZA 3DOMA 4PCQA 1UA0A 2WVBA 2XLIA 3W2VB 1S77D 5DZ7A 3LAMA 1IKXB 4JI6F 2GIQA 4ED8A 2YWFA 2R3VA 3V4IB 2IC3A 2DCLA 2UP1A 1LW0B 5A8KB 3R5CA 4C3LA 1SIWB 1U1KA 1JLQA 1WC6A 2Y1JA 1CULA 2NCKL 2BW2A 3JTNA 5F3TA 4CT9A 2OTJS 3VAHA 1KC8T 3TUZC 4NZ6A 4X4TA 1RHKB 1ZPWX 3OTEA 2NUUG 4ZPAA 1P8GA 3MTKA 2ZBPA 3KLVA 4K59A 3HFZB 3DMJB 3MEDB 3M8YA 5IT0A 5ADZA 1FEHA 3LA0A 1ZTWA 5D4NA 2KT3A 2UXBJ 1AROP 4ED0A 2XNQA 4KKOB 1GQEA 2DTJA 1VIXA 1YJTA 2I2YA 1UP1A 1H0HB 2DY9A 2VPXB 1NK4A 4C8NA 3KLHB 2DISA 1EZZB 3FDSA 1U6ZA 2VF3A 3QJPA 3PACA 2K7JA 1NU4A 1GTEA 2P2CB 1V3SA 1LWEB 2RQCA 1KDNA 4ERDA 5K8PA 5HMXA 3PFEA 1XMOF 1FFWB 2XSJA 4U6PA 4DR6F 3K7RA 3ZNJ1 2YVSA 3FMWA 2CPIA 3PVXA 3SDEA 1J27A 2YWHA 3HJVA 3TA1A 3EZOA 3TAPA 2H1YA 4DR5J 3R5BA 2OH2A 1AFIA 1VQNS 4N7TA 5EUHA 2DK2A 4ICLA 1RBLA 4F36A 1C0UB 2XMUA 2RKIA 4FYXB 2AEMA 4C8MA 3FJ2A 3AD7C 3LF0A 4A8YA 5DS7A 4U7UK 6FDRA 2DGQA 1KBRA 4PQUB 4DUYF 2G0IA 3NXZA 3AB2B 3MEGA 4LFBF 1RGVA 4ZPVR 3L09A 4DJBA 5IV3A 1SKUB 5AXMA 2H4YB 4GO5X 3UVJB 3T19A 2RIJA 3OHAA 4MK8A 1OYDA 2PFDA 5J1NA 1TKTA 1OPIA 3G8SA 2FPHX 2QX0A 1IKYA 4ILRA 1IBKJ 3HVAA 1YDLA 3P96A 2OFHX 2MYFA 4N8OA 2CPFA 4HDGA 3B8HA 3H98A 4CNYA 3ISNC 3UN5A 3O8WA 1C2PA 1REVA 1SH0A 1RT7A 1X4AA 4FXWA 4OMFG 4X64F 4Z2XA 3K5PA 2HIQA 5I4MA 3H5SA 2RB7A 1XMOJ 3M2UB 1NDPA 4DR6J 1O51A 1U6FA 3HVTB 3RRHA 1Z1ZA 1S7IA 2BUNA 5K14A 2VQEF 3PNIA 4P71A 1NJYA 4L76A 4DI6A 2AJ0A 1GEHA 4F04B 4L75A 2ASJA 2V4QA 2WVEA 2VH7A 2G0CA 2HNYA 2XG8A 2HAFA 2E29A 1YQHA 4DLEA 4MYTA 5KFWA 4DU8A 3OD2A 5J2MB 4DCOB 4IOAQ 3W8GA 2YXLA 1JLFB 4NLTA 2VDHA 4B3OA 4J9LA 4EWTA 3MPUB 3EVMA 1JLAA 4BC9A 1MLAA 4I2PA 4F4KA 3QGIA 3EX7B 2QLBB 4GVLA 2YWEA 5GAGI 3EVWA 4IKAA 2DY1A 1VC0A 2KKHA 4QOTA 1IJFB 1M1GA 3N9UC 1AA1B 3MCMA 3EGVA 1TAUA 2MQQA 1Y5IB 2MXYA 1JJHA 3JYTA 3OPKA 3V81A 2W24A 4KGKA 3OR1A 3MMAA 5EN1A 3G6VA 3CD5A 4ES1A 2LLZA 3GU0A 4PYAA 1VQSA 4ZP9A 2CIMA 4NCBA 3G4SS 2VPZB 4LRCA 4UZCA 4Y3CA 2V34A 4C98A 4Z37A 4U7CA 2HEKA 5HAOA 3TAMB 2DR9A 3DXBA 4RBVA 2V4JB 1KHVA 3N6NA 3NKYA 1CG2A 1EETB 1VS3A 1NK8A 3GFHA 1VRQC 3CJ5A 1X5PA 2KG0A 4NRTA 4CH1A 1HBUB 1RWPB 2LP4A 3F73A 1UTAA 1IVZA 3G71S 2WSFC 2MDAA 4DG1A 4DSEA 1UZHA 1VQLS 1R8AA 2LYVA 2Y1IA 1K9MT 3V6DA 1YJ7A 4KIAA 4B3TF 5A8RA 1XMQF 3M6UA 1VK3A 2AGOA 3B82A 4DV1J 4WU3A 2P6TA 2FUG9 5E0OA 4TU8A 2FHJA 5GMKa 3I5AA 3UN2A 4NMXA 4OJHA 2FJDB 3H7HB 5IV4A 2ZZTA 4OLPA 2IRXA 4PEOA 4MMOA 2K1RA 1TK5A 3EMTA 3R6LB 3BGRA 4QPTA 2PGCA 4WXWA 4LF6J 5CCMA 1FRHA 1IWAA 3M30B 4UOFA 3I5CA 3PHTA 1KSPA 5J2PA 2B4UA 3ENWA 1IKXA 2ZOGA 1EIYB 1AYEA 1M5SA 2ZHAA 5B0EA 2I0XA 3O6QA 2DGUA 2EPIA 3RU0A 2QA2A 4DS4A 1NK0A 4IG0A 3C6TA 1U49A 4NLRA 2ZM6J 3BO2A 5L1IA 1DLOA 3GWCA 2M70A 2CFXA 2RS2A 4HEA9 3AB4B 3BGLA 1MW7A 5HSPA 3NGDA 1R7IA 4ZN3A 4NA2A 3BQ0A 1WACA 5HMYA 1ZBTA 4JI5F 5KG5A 3EWGA 3K17A 5LL6d 1U1LA 1WORA 5HBMB 3KJFB 3HHLB 4KKOA 4DQRA 1Y3JA 1P1TA 2ZJQQ 4DU7A 1U2CA 1RQ0A 4B3TJ 1XNQJ 2JLFA 1RTHB 2BYCA 3M8SA 4WFYA 1WHWA 1VQ7S 2LDYA 2D9OA 4PR6A 4ZVEA 1VQKS 1CC8A 4AXIA 2EFQA 1QLNA 4LR7A 1EKRA 2XY6A 1HBOB 2ZH1A 5HMWA 2XEXA 5J2NB 1SV5B 1GT8A 1M5PC 2PSZA 2LQ9A 2GAGC 3THPA 2MMYA 3ELHA 3LP0B 4O4GB 3QJJA 1NKBA 1D9DA 3EE3A 4OJGA 3CJ4A 1LWEA 1FVSA 2ATLA 1I3OB 3MR6A 4JV1A 1YHQS 2DGWA 2E7VA 2Q1LA 2A18A 1H74A 1W26A 4ECSA 2JH3A 4MYUA 2QSFA 1WC4A 2OIHA 3LP1A 1IBCB 3PYGA 1YGYA 3GSDA 1T3NA 1OY6A 2L48A 3MM7A 3MAQA 5E3PA 4I64A 2LEAA 1VQ5S 2WTFA 4PQUA 1XWLA 2FHMA 4NL5A 3M6XA 3W66A 1HMVA 1BQXA 2B51A 2W25A 4JI5J 1HKAA 3A3OB 4K0KF 1UW4A 1SC4B 3HD2A 3IR7B 2W1BA 4NA1A 2MZJA 2A6OA 4WKYA 2CDQA 3BGOP 1WKJA 4PABA 3OVSA 4OFZA 4ECTA 4NZ0A 4CLUA 1L3VA 2CYYA 4C8OA 4DR3J 3AT1B 4CO5A 2YX1A 5L8RC 3PRDA 2EFVA 4USHA 3S6EA 5C25B 3MMBA 2GMHA 5D0RA 2IM3A 2RU3A 3Q8RB 1BY9A 3CT9A 1D8YA 3KG4A 4FVMA 2NXNA 3CJRA 2H65B 1G7CB 1X4CA 1NKEA 2M7SA 4KRWA 2B56A 2F9DA 2RHQB 3W64A 4I6AA 4F0HA 3NEKA 4RWXA 2KTQA 1N48A 3HVTA 2HHSA 1S1WA 2CPZA 2W4DA 5IT9Y 1CVJA 2IIHA 3N4WA 1TV6B 4OHWA 1UVLA 3DRXA 4PG6A 3D6TB 5L1LA 4U8VA 2J6UA 4LT6A 3W9JA 1T95A 4NCGA 3MM6B 2RAQA 1L3UA 4FN5A 1FDAA 2AU0A 2MQLA 3CIZA 2HVIA 2IHR1 3QIPB 4WPAA 2VL1A 3DXSX 1FRJA 2B4VA 1K1QA 2P9CA 2VU5A 2BE2B 4IO1A 1RACB 2XM3A 2RUGA 1HL6A 3L9ZA 4HTIA 4IDKA 1KKHA 2WVFA 5CYJA 3KKFA 3PEJA 1EP4A 2IJFA 1PBAA 2QLWA 2W7PA 1FNOA 3A8JA 4TU9A 5IFMA 3OUYA 3K5MA 3O3LA 1QJHA 5LMNF 4I7FA 5GMEA 3NGRA 1UEKA 5IZHA 3KLIA 2GZOA 4IH6A 4P2FA 4OZ5A 4NLXA 4CZCA 2BJDA 2JL9A 2XY5A 4JOUA 4C11A 2DBBA 2OI2A 3WBZA 2RVJA 4NOHA 4DV4F 2YQ0A 3J7Z5 4HT5A 3M2VB 4I69A 1CS4B 2GVZA 3TANA 1X31C 1HIYA 1HWKA 1LWCB 4DL2A 2R2TA 3OLAA 4JB8B 2V4JA 4M5DB 2F40A 1EETA 1PKUA 1TR0A 2DVIA 2XSFA 4XK8C 4ID5A 5IQQA 3WIUA 1LK7A 5KFUA 4DZDA 1Q7YT 4WCEQ 3DDKA 5B0AA 4TYAA 3I96A 5DDRC 4USJC 3MM8B 3R7BB 2JVOA 3MEEA 2D3OR 3QLHB 2EI5A 4FVCA 1URRA 4LFAJ 3CC2S 1B3TA 3KXDA 2ZH8A 4J9PA 1TL7B 3D1QA 3OJSA 4DV2F 4WFAQ 2CKWA 3UR3C 4B3MF 2G2ZA 4ELTA 3R27A 4N47A 1C1BB 4IQMA 4J9NA 2VPWB 2QMWA 5ETMA 4R8UB 1V9OA 3QIDA 1HNVA 1FJGF 2YNFB 5I3UB 3GYXB 5DLFA 3WC2A 3NRBA 1WHXA 3LGMA 5A6PA 1MG7A 1TL3B 2HFUA 4E8UA 4CM2A 3LWMA 1NSQA 1BWEA 2WSEC 4KO0A 3KK2B 1NH7A 3M30A 4PKDB 1HHTP 2DNRA 5LMNJ 2ZHOA 3AAWB 2GCFA 2DNQA 3EGNA 5DM7Q 1U09A 4EFAC 1SKWA 3G87A 1L5UA 4X4RA 4DQQA 1T9WA 1J5OB 4JI3F 1S6QB 1HNIB 3M9OB 2IVYA 4MH8A 1S9EA 2MSSA 4XAKA 2AIRB 3HVRA 2DEJA 2L9WA 4YN3B 4N41A 1HWJA 1NAQA 3IWLA 4LBPA 1RWUA 4WFNQ 2HS0A 5ITHA 4CQ1A 1R0BG 2XZDB 4DFPA 4WFBQ 1AUDA 4NA3A 1FWLA 2IFXA 3KNGA 2BE9B 1D3WA 2DH8A 4K50A 3IG1A 2RRAA 2DIVA 1IBMJ 3CC4S 3DOKA 5HBMA 4TY8B 3HHLA 3HSJA 2YKQA 3DLHA 1VHIA 2CQIA 2GNKA 3CJ2A 2MPUA 4F8RA 1U4BA 3K8WA 4B3MJ 2BXJA 4NPOA 3NGUA 4OX9F 3GQCA 4RNHA 4USMA 1SH2A 4FF4A 4M5JA 4K5SA 1F2HA 4A8XA 4X4NA 4WZQA 4JUZA 3QPIA 1BQMB 5KFQA 3IS9A 1RAOA 3GE9A 4LSNA 2HNDB 1TUGB 1Q8BA 2N4DA 3CJKA 2J5AA 4P10A 3H2LA 4O4GA 3BDEA 4EBEA 2XMVA 4DSFA 1QTMA 1E6VB 4CDIA 3QSIA 4L72B 2FB0A 4F25A 2DIUA 2JJ4D 2B7BB 4L73A 1S1TA 2CQ2A 3H40A 4O3PA 3KJVA 2KFYA 1JLBA 2Z2YB 2FLPA 2BJ7A 1S1UB 4A8WA 2HHWA 2AZ1A 2L08A 4B02A 5KFKA 1O6XA 3W63A 2IM2A 1VQYA 3BBCA 4OI6A 3TZXA 2EXUA 1CBKA 3AJ2A 3I56S 4UTGA 1X4DA 1DURA 1HQEB 2E5JA 4LIWA 3BO4A 4KHPJ 1FJCA 2GGPB 4HH0A 1FI4A 2AV5A 1DTTA 3VZHA 1U26A 2BQRA 3HCXA 3NGTA 2MLZA 1X9MA 4CIOA 2ASDA 3PKMA 2BOAA 5K8MA 4X4QA 4G1IA 3QWPA 3GSIA 2PI5A 3P5TL 4HI2A 5IT9U 3AA8A 3QO9B 3SCJE 4A8OA 5DG9A 1E6YB 4WTYA 4RL1A 4HHUA 2K8GA 1RHQB 1IR0A 2W9AA 4YDDB 2FJEB 4F7VA 5JMNA 5DQIA 3ONQA 1EAYC 3D0GE 4OYIA 4PPZA 1KQSR 2EKNA 2FC8A 2ILYA 2NUHA 3HHDA 1KS2A 3W5YA 1WOSA 5C25A 3TJAA 3FSXA 3KLEA 2DO4A 1TL4A 5AXKA 1IKWB 2A2CA 1Y9OA 3AA9A 1XMBA 2HBRB 3KHRA 5CXTA 1I1GA 1G2EA 4EZ9A 1OWXA 1RABB 4QWEA 1FRLA 2EFGA 3LPEA 2F5GA 2AJ2A 4A8QA 2JEJA 2KVQE 5C2GA 2ZVIA 3CVKA 3HVWA 1PAEX 2AYBA 2ACMA 1S10A 1Y0HA 2ZC4A 1KFSA 2K06A 1RT2B 4P72A 4TQSA 3I32A 4C8LA 4E98A 4LFCF 2G1HA 2AX1A 1KP6A 4O0NA 1QE1B 3QQCD 4Y34A 3F44A 2BKNA 4X62F 4DCPB 5KAKA 4OHVA 3SMZA 5E3QA 4J5OA 3FBEA 3QIPA 1XK8A 3L7OA 2QFJA 2OD4A 1TAQA 3CD6S 4A8MP 1ROFA 2AJFE 2G9OA 1RTDB 2BE2A 2HWIA 3EGWB 3CMAS 1MROA 4MIAA 1NM2A 3MCNA 1N36F 4ZN1A 1JLGB 2VJVA 2JWNA 5ETQA 3KUHA 2GV1A 3K57A 2MKHA 1KQFB 5CZXA 1NSKL 2XS5A 3RBZA 5CYQB 4A47A 4NLPA 4DXLA 4J37A 4PRFA 3V4MA 1FE4A 1VGYA 4OYPA 2UXDJ 1X9SA 1JNZB 1ZS6A 3QT5A 4K5RA 1N5TA 2IMOA 2DXDA 1M5OC 1A0OB 3DNCA 2FYXA 2OEKA 5ETTA 3DLGA 1U2FA 4AD6A 4IFVB 2V9KA 2QLJB 1DHMA 1UVNA 2W2QP 3ENVA 2I6WA 3D2WA 4ZLPA 3D54A 1IKVB 5KFOA 3M8RA 1S6PA 4M5DA 2HZCA 1PG5B 1U2RA 4ZVOB 3ZTQA 2WSCC 1LFWA 2UUAF 2JEFA 3CDBA 3LTOA 4DSJA 4LFCJ 3T9NA 4JI2F 3QLHA 2KJVA 2WRMA 3A1YG 3VAMA 3THTA 3GONA 2KYXA 1TL7A 3QYYA 2HG4A 1DQ9A 4USTA 2V8VA 2R8GA 1LK5A 2RD5C 3MR5A 2GIFA 3RJMB 5J1EB 3UDCA 2IM0A 1TMMA 4KPCA 4R8UA 4BWJA 1WDDA 4PQAA 3Q8QB 2ZNYA 1N8RT 5THWA 2YH1A 4AXJA 2DNHA 1N36J 3N5FA 5IC6B 1XNRF 3GJRB 1MWZA 3BGUA 1NSAA 3VVTA 1RTJB 3LP2B 2R2UA 1OS5A 3KK2A 1JX4A 1VDHA 1RT4A 5BR8F 2N82B 3CCMS 1L3TA 5LXYA 1QUVA 2ZH3A 4B3SJ 2I38A 2LU1A 3EPIA 2VG6A 2DR7A 1K73T 3OL6A 4C3MA 3MECA 3J80Y 2C28A 1J5OA 1S6QA 1HNIA 2RDJA 5K5MA 4WF9Q 2E5LF 3SQGB 1V6HA 2MSTA 1T03A 4KYZA 2JLGA 4V19X 1UJ5A 3NS6A 4XDCA 4UUXA 3DI6A 1RA6A 1LOUA 2HZAA 3PW7A 5EX3A 4KFBB 3BZQA 2LU2A 3VR1A 2HHVA 1RHMB 1Q5VA 2HYIB 4HLBA 2DRDA 3EJMA 4DX6A 1RKJA 2PE8A 2BV3A 1RISA 1QVGR 1X4HA 3GJQB 4PZVA 3NAIA 1SUQB 2B9WA 1WC1A 3FBFA 4FKXA 2X7IA 2PFFB 3IBCB 3FQKA 5KT4A 1YIJS 3NS7B 1UFWA 2E5GA 3GLJA 2ZNZA 3PR5B 3T1YF 3ZZZA 2CPXA 3OLBA 4F4XA 1A9NB 3RZAA 3P6YC 1Q8IA 3BYRA 1IR1A 2IAJA 3G2XA 2OPRA 2EEYA 2PI4A 3IXQA 3JTPA 1WOPA 1I6JA 5KG1A 3BSNA 1E6VA 8AT1B 3IM8A 2CPHA 2CPJA 3PFOA 4Q2MA 4DN9A 3DRRB 4RW4B 5LMUJ 2FJBB 4WIIA 3J7YU 2GW8A 5A8WB 1R89A 1SJQA 1ZM4A 5ETVA 3LALA 5B08A 2FDNA 2GQ2A 2J0XA 1RBOB 5ETRA 3MUTP 1BD6A 4H4KA 2U1AA 1HHQA 2ZJPQ 3PO4A 5B0BA 2I5JB 1NDLA 1LXNA 1RSCA 1HQEA 1CJTB 3RAMA 2E1PA 5SUHA 3TZZA 2MZSA 3OVBA 2J9EA 3DLJA 2GGPA 4RW9B 4N8NA 1LV5A 3K0JA 3DRPB 1HR0J 1U1PA 3PCOB 4RW7A 3C14A 4ZCMA 3MEKA 1ZAXA 2AEJA 4ZS6A 3D3CJ 3WIVA 1FCAA 3VAJA 1SB6A 2AQ4A 2OTLS 4EK2A 2MKKA 2HLTA 4KV8A 1PJ6A 4PWWA 4QIGA 4TU7A 2ZOMA 3NOGA 3AOCA 2V2QA 2XMKA 1WI8A 2FHKA 1SJFA 4R5PB 3ZNUA 1RWMB 2CWKA 1RTZA 2J0WA 2BKPA 4M5MA 3MFIA 3ITHB 1UEVA 2R4FA 1WELA 4OZLA 5C42A 1XC9A 2MGZB 2MQPA 1YJUA 1BQNA 3H59A 3W3SA 3SEOA 9RUBA 1FNXH 2VOOA 1KVIA 1GX6A 2UV8A 3K5LA 3WQPA 4O44A 2DHHA 2HZVA 2KJWA 1RT6B 2E9ZA 1ELOA 1CJVB 5E3RA 3I5BA 4ENOA 1RT2A 3QBCA 4EO8A 1TMJA 1BWVA 2POKA 5AT1B 3VGTA 3PX0A 3MMJA 3OT9A 1A6LA 4JI4F 2F8EX 1WEYA 2M5YA 1S1XA 2XHCA 3P8BB 5KT2A 1B70B 1HPZB 4DSKA 2GIRA 4H4OA 4NEYA 2LQ5A 4WU2A 4FZVA 1MWYA 2ZWPA 2Z57B 2FJAB 3TW0A 2B5JA 5HROB 2WBMA 3OL9A 3D6MB 1APSA 1RTDA 1P1LA 1HQUB 2ZOFA 1SPBP 2R9LA 4ZPWR 1FJEB 2WVDA 2CQPA 3U1MA 3PJ9A 4X2BA 4LSLA 3K89A 3CDEA 2GMJA 1NB7A 5KFTA 5CYQA 1GH8A 2VBXA 1RI7A 1CPZA 3TZYA 4DN0A 1AW0A 1BE4A 1PC5A 2PEHA 3S01A 2GMLA 3CCES 3VAFA 4PUOB 3R5AA 1IR2A 2CG8A 2ACYA 2BDPA 4KQZA 1S6UA 4USWA 3PX4A 4A4JA 2BOPA 1TVRA 4JI7J 3I55S 4IFVA 4ZCLA 4QU6A 4WK1A 4QZVB 2RSQA 5L1JA 3OXGA 1FK9B 4LF5F 2Z30B 2C3MA 4RLEA 1P9QC 1X5OA 3ILOA 4HT7A 1UETA 3R97A 1Q8KA 4B9NA 3IBWA 3F0NA 3H42A 2WONB 5A0YB 2UVWA 1H6KX 2JFKA 4JI4J 4C6AA 3KK3B 4IYQA 1RLCL 4LSZB 2JHEA 4YFUA 4MT1A 3KHHA 4DQIA 5C24B 3DRSA 2BZ2A 1FD2A 5KFIA 3GP9A 4H4MB 2W7AA 2CQHA 3M8WA 3UCZP 4NLWA 1FRXA 5D78A 2A2DA 1B0PA 3BPDA 2WB4A 1RT3A 5IT4A 2LXFA 2ZD1A 5CHCB 2F8HA 3BDPA 1NHKL 2OP5A 3EICA 4J9VA 2R7XA 2P6SA 5FLXU 3Q0AA 3J7A1 5HQMA 5DLGA 3LP2A 4K4UA 2RF2B 3H4BA 1H98A 3HPOA 3MUMP 2BEFA 1V5VA 2MQNA 1NB2A 2C2MB 4OX8A 2UVVA 4OQJA 2XGPA 2XLJA 1WDTA 1XBWA 3MURP 2AD9A 2IA6A 4O3QA 4UY8T 3PJXA 1KONA 3EVOA 2COLA 4NEZA 4JI8F 4ZHRB 1F60B 4ECYA 2HGLA 2CAJA 3P45B 2CQGA 1OSDA 2AHOB 3CCWA 3DOMB 2QL7B 1GNKA 2A6MA 2X1FA 3OQ2A 4M94A 3K59A 4FXDA 3L7UA 4HL9A 4LF5J 5KG7A 4XDDA 2LVWA 1KOOA 2HS3A 2IC3B 4EUVA 2H54B 2QYCA 2UZAA 1JLCA 2ZH5A 5GAEI 1S0MA 4LF9J 2CA9A 1B7FA 9ATCB 4Q0BB 1JLQB 2EK1A 4RNNA 2W9BA 2OPQA 4MIWA 1M1KT 1FNMA 2CNLB 2PC6A 3TARA 4ECVA 1SUQA 1G4CA 4FYDA 2AGQA 3W65A 2O01C 4F2RA 2CNNB 4GKKF 1YBTA 5LSLA 1IJEB 4OJ3A 1EX8A 3G86A 3ZZPA 3R9LA 3J81Y 2HGNA 4EZ6A 4Z7CA 2XMJA 3CDAA 3I9V9 1T05A 3BSCA 2JFDA 2HQIA 2HBQB 4DMZA 3JSMB 2XO6A 2HLUA 1FXDA 1ZM9A 1VLOA 2W2MP 4GVBB 2J0QD 4DR4F 2B0GA 2FLLA 2CPEA 3MMCB 4WZMA 3UW1A 1Q8LA 1PJ5A 1X7VA 2LXIA 5CCLA 3GMGA 3KDOA 1YJVA 4RW4A 4FYVB 4QQBA 1KN6A 2ROEA 4LRFA 1OYEA 4YP3A 3CGIA 3KG0A 5KFDA 4I56A 1H73A 2VODA 3HDSA 4F4YA 5KFFA 4QR2A 2W2NP 3Q83A 3HLUA 3MDFA 3C19A 1O8BA 4C8KA 1HD1A 5H9FJ 4QWAA 2DD8S 3LWLA 3T41A 3DGVA 5LT5A 2DHAA 3SDEB 4RW9A 1EQMA 2PMHA 1QSLA 4AQYJ 3H25A 3AFGA 5JVGQ 3OW2R 3CJ8A 2KRBA 2YKNA 3MPDA 2B3TB 1SQEA 5KFJA 2V68A 5DG8A 2JRSA 3FZBA 1N54B 2VQFJ 2Y0BB 2RH3A 3BQ1A 4YB7A 1WC3A 2IJRA 2JSXA 3HP6A 2FIUA 2E7XA 4ZLLA 3D1OA 2RKIB 3LQVA 4ZDNA 3KHLA 3MZIA 3JXOA 1WOOA 1TU0B 1VBZA 2BX6A 1YRXA 5DJBA 4GKKJ 4I0WA 3MEGB 2K3KA 1TKZA 1NKCA 4R25A 5DQGA 2MHEA 5KT7A 3FCWA 3OXFA 3MI7X 5D6GA 1Y11A 2XZTB 3A3NB 3VAIA 1TKTB 1FFGB 2UUTA 1U6BA 1IKYB 3L7PA 2MGZA 4WTOB 4E2FB 2G13A 4DR4J 4M5NA 1RK8A 1URNA 2SXLA 5EWGA 2QRRA 3G8TA 3B4DA 2V8PA 3VQSA 4YHHJ 3FKBA 3RB6A 3Q22A 1L3SA 2PMZD 2BVZA 3IGNA 3FEZA 3KHGA 1WI6A 2VFRA 1DBDA 2J6TA 4KGZB 1REVB 1RT7B 1CJVA 1N5QA 3GPAA 5G4DA 1ZA2B 3JAMY 1WG5A 3BREA 3KJQB 3H0PA 1S79A 4J9MA 1CQMA 3BJYA 2XHWA 2IM1A 1CC7A 4FXVA 3T6JA 2J9DE 3O5TB 4V19J 2F65A 5K14B 3NCPA 4OYBA 1Q16B 4ZPCA 3AY0A 1X8DA 3A12A 3TA2A 2P9GA 1TL5A 4BLGA 3RB0A 2PIIA 3CJSA 4X66J 2C2EA 4DPTA 3Q86A 4ZK7M 3GV8B 1GX5A 5T41A 5E5NA 1U8WA 3TEHB 2HNYB 3HZEA 3DCAA 4DPWA 2V63A 2VFUA 1MU2A 3DLBA 3CCJS 2V9WA 4ZCIA 4Z7YA 3LPYA 1R8PA 2MJUA 2XMMA 2H3EB 3HD1A 3ZC4A 4B3OB 2Z2LA 2CJBA 4I2PB 1WSRA 5CA5A 1T9VA 4DR1F 3O1LA 3IRXA 1M90T 3TJ8A 2LEPA 3OFFA 4WE1B 2CRLA 2DR6A 2ZKTA 4LREA 4PUOA 2X1BA 1UL3A 3TJ9A 3UPFA 4J91A 3JYTB 1RCOB 4ZKAA 2W01A 5KT6A 2PA3A 3OR1B 5B0FA 3MMAB 2VKZG 1FX2A 1S76D 2KT5A 3C15A 2W8LA 4LRAA 4DR2F 4W98A 2FVQA 4NCAA 2BBEA 4FPIA 1VMBA 3FCVA 2J8AA 2HSEB 3Q2SC 4KGVB 3BR8A 4TLQA 3ULHA 3VVUA 5A0YA 4KSEB 1OMSA 2AEFA 4LR9A 3DLKA 5ETKA 3W5ZA 1FESA 2HHXA 3DYAB 2GJ2A 5HLFA 3A13A 5C24A 1N5VA 3R3TA 2ATCB 1VHFA 1T9YA 2Z2ZA 2KG1A 2APOA 5HL7Q 3BSOA 3ENAA 4H4MA 3C16A 1C4CA 1VQPS 1FJ7A 7AT1B 3IA0A 3R1HA 3ZTOA 2PDAA 3V6DB 4P6QA 2G2OA 4TLRA 5A8RB 1PIEA 3ADAC 1IM4A 2RJZA 2ALZA 4LF4F 2E7WA 1HNZF 2Y0SD 3M6WA 4DV7J 2R7RA 2RF2A 2QA4S 4K4SA 4O0IA 1J5EF 3POTA 4DR1J 2R2RA 2X3GA 2O67A 2V2VA 4JI1F 4QYRA 3J81U 2K1RB 4DX5A 4Y00A 1Y7PA 3M32A 4B9MA 3JSYA 4K4XA 4PG4A 3QNWB 1Q0NA 1H2UX 2HK3A 1RLDA 2UUCF 2A10A 4BBYA 4ZHRA 2QL9B 3ILIA 3JSRA 2W8KA 3VGVA 3MM5A 2UXCJ 1N56A 1HWLA 2MZQA 3QAEA 5J2PB 3Q8YA 4KB7A 3B78A 2QIFA 1ZM3A 4YY3F 4ZVPB 4FF3A 4IG0B 1ZZNA 3C6TB 4MK9A 4G1QB 5HP1A 4Q0BA 3ILJA 2EWHA 3N0VA 2V94A 4TN2A 2HVZA 1DLOB 3ZZUA 3OBIA 3MWBA 2IVFB 2F63A 4GRSA 1S12A 4RNOA 4C97A 2LCWA 2YH0A 3GR1A 4AL6A 3JSBA 3MPVA 4YEAA 1LQ9A 2QGFB 3GFXA 3J7AN 3JSMA 5DDOC 1HI0P 2FVSA 3MOZA 4AFFA 4OHXA 2KB2A 3JS9A 2HBYB 4GVBA 4DPUA 3MF5A 2XCAA 2MHNA 2J8SA 4UZBA 1NSPA 5GMDA 1HYSA 3MMCA 5HQLA 1HNZJ 4CO3A 2R7UA 3UNGC 4CYUA 1NPPA 1JXLA 3T1HF 2VDIA 1KOHA 5HJXA 2ZH6A 2KN4A 2LA4A 4PWDA 2NXJA 3CDWA 1FT8A 2HRYA 1YSJA 2FJVA 3TRGA 4OZ3A 2EG1A 2FZKB 4O3NA 4QPXA 1N34J 1FVQA 4LF8F 3KYLA 4DEZA 1HD0A 1JK9B 1WG1A 2K7KA 1Y5NB 4I2QA 1VYAA 2HFZA 3S7RA 1VBKA 1X60A 3OL8A 1UW9A 2RUSA 5KFSA 4JI6J 3I0RB 1VJQA 3D66A 3L3CA 3SBMA 1HWIA 1P6TA 3IAS9 3NG8A 3D28A 4YMEA 2RNEA 3IR5B 3LP1B 4ALZA 4FNHA 3TX8A 4KGMA 2HWTA 2FHOB 4CO1A 2CQ0A 3O2IA 3MM7B 5HK4A 3JAMU 2H5EA 1Z2LA 5A2QU 4O3RA 2EFNA 2AYEA 2CZ4A 5B0DA 4B3RF 1HNWF 5HO4A 1F3VA 1NHVA 1U47A 2G2YA 3R8YA 2VFVA 1HMVB 2W4PA 1BUXA 3PIOQ 1DAXA 1N6QB 1KVKA 2R8JA 2L3MA 2E66A 2R7WA 2HRTA 4W4MA 4HHJA 1ACMB 3NBPA 2ZBRA 4F02A 2HQFA 5C5JA 5T14A 1VC6A 1JMTA 4ZP7A 3T1HJ 2HGMA 2QJ3A 4IFYB 3Q8UA 3MMBB 1TK0A 4LRDA 1HBNA 1WC0A 4DV3F 4J9UE 4P74A 4OZ2A 3QJLA 4USUA 3ZZRA 1Q79A 4G3IA 1T7PA 1UWBA 4GC7A 2E5IA 5FDLA 4LF8J 1S6OA 4D3GA 4HI1A 1IQZA 1NDCA 2ZH4A 2OHDA 1QDUB 1UFKA 2MQMA 2WVCA 4RR5A 3OTOF 1RHRB 3QFWA 4RUAA 1MMDA 3UE2A 1X4FA 1S1WB 1RB0A 1C1CA 1LNQA 4NXNF 2ZH9A 1SCJB 2CNKB 3DLEA 1WKKA 1RAAB 2Z58B 5AE3A 2EFOA 4NCGB 2FZCB 3E3XA 2HNZA 3KK1B 4I6WA 2MZRA 1U1OA 2IBOA 4OHYA 4WYWA 4CP5A 4ECUA 2YPZA 1WWHA 1UA1A 3M2RA 2GC8A 4DUYJ 4LFBJ 1WF2A 3FVYA 2FVCA 3NMRA 1FO1A 1K44A 2XULA 1NK9A 4WKRA 4DBQA 4J9RA 2CJ9A 4IDKB 4QIWD 4TYBA 4WE1A 2EFPA 5KFEA 3AHPA 2IRYA 1EP4B 3FQLA 3CF5Q 3OUYB 3N01A 4I7FB 5MAOA 3KLIB 3H5XA 1U0SA 2DXFA 1FXRA 1WHYA 2NPFA 1SJ4P 2WW8A 1RJJA 4YB6A 4MJKA 4C11B 2X1AA 4I4BA 3SSSA 1RAGB 1RYRA 3Q8PB 2VHGA 2ZKUA 1PBUA 4RNFA 3GFZA 4CT8A 4X64J 2GVZB 1FRMA 4URSA 3W5XA 2OFGX 1RZMA 3DYAA 2VC0A 2NQPA 2M88A 2FGOA 2DKOB 1KWMA 1B99A 2VQEJ 5ETLA 2OEMA 2Y8YA 1DY3A 4ID5B 4XIUA 3R1LA 4LF7F 2MKJA 1T11A 4LMZA 3CCTA 2HW3A 3MEEB 3C66A 1B0VA 1GXLA 2Q6CA 3BO3A 3P49B 3D6HB 3B54A 1WF0A 3S8SA 4F26A 1B4SA 1Q78A 1RWVB 3OFHA 1U1MA 2KZZA 2R8HA 1M0SA 4B9TA 2YX7A 1F5BA 2RHSB 1K47A 4EU0A 1XERA 3PY8A 4DOZA 2AYMA 2ABYA 1F9EB 5KOXA 2GX8A 4NMLA 1HNVB 4FP9A 3M1VA 3OR2A 1KLNA 2H51B 1LKZA 3PTWA 2VC1A 4Y6IA 4ZIVA 4WFZA 3PEHA 4KO0B 4I6YA 4NYPA 2B9YA 2NYIA 3GG0A 1GMWA 2DT9A 2DGVA 3PRBA 4TQRA 2BJEA 3CEDA 4MFBB 3ICLA 1RWKB 3W62A 4CTAA 2RT3A 5F8MA 5LXRA 5D4PA 2HRUA 3DKDA 1S9EB 4C0OC 2YKMB 3VTIA 2KM8B 1Q4RA 4G1QA 1FWPA 1NK5A 4NZ7A 3B4MA 1NBEB 2BACA 3DDIA 3IBFB 3HHLD 1JQGA 3GIJA 3V6JA 2UU9F 3MUVP 2X51A 4EI2A 1C0TB 3QFHA 4E0DA 2AT1B 2D74B 3KLFA 1YBUA 4RUHA 2FY1A 2GHWA 1IBLF 5L39A 2DRBA 3HO1A 2LQBA 4ZPDA 3IG1B 3LOUA 3R5GA 4IOBA 2MB0B 1RU2A 2RS8A 3DOKB 4ZOSA 1VQOS 5I3PA 1H72C 3ETOA 2XGQA 2ZBIA 1Y4ZB 4NRUA 1R8BA 1FKPA 1FERA 4KT0C 1OQ6A 2JEGA 1XMQJ 1B0TA 3W7BA 1WKLA 1O0PA 2E1CA 3QZ8A 3NGSA 2YQ3A 1N52B 4QR1A 4F3QA 3DOLB 1D8ZA 1GXTA 4U7UD 3IS9B 2GFFA 1U02A 3TNVA 2FVPA 2ZJRQ 1MNEA 4LSNB 1F3FA 2XWYA 1OY8A 4DL4A 3FBBA 3CXCR 2DITA 3CJKB 1UVJA 2Z56B 2JZ5A 3DHXA 3W9HA 3PXGa 2CQ4A 2RE1A 4DF8A 3KWMA 2M4MA 1YI2S 3HFVA 3RRKA 4ZPTR 1S1TB 2Z4PA 3KJVB 1JLBB 2KI2A 2V5HG 3VALA 1VRUB 1Q86T 3CO9A 4BDPA 3TR5A 4F0MA 3I0RA 4LF2A 2ZITA 1JLEB 4B08A 1UCNA 3R5JB 5H9EK 3A8KA 1G3OA 5IC4B 1DZ5A 5D3GA 2KXFA 3HJFA 4UF4A 2OPSB 2C2KB 4J9QA 4PG5A 3TYTA 1W7WA 3S1TA 1DTTB 4C3KA 1AZSA 4F67A 2XNRA 3NNCA 4DV0F 1GK8A 4OI4A 1MN7A 2ZH7A 4J9OA 1J2VA 4KH0B 1HBMA 4CLWA 3OXLA 2Q79A 1N6QA 5LSRA 3TAQA 2C22A 1D0EA 4UUWA 2IDEA 2CPDA 2W4CA 3R7NB 4Q45A 2NXCA 3G8QA 1DQ8A 2NLWA 2FQQB 4IFYA 2PD1A 3ISZA 4ZJOA 3KLEB 3G9CA 3D9BA 2W2PP 3MCSA 3GV5B 4PG8A 1M5HA 1RCXB 5AJ3F 1Y3KA 1VK8A 3FFIA 1X9WA 1IXKA 1VBYA 3DM2A 5IWAF 4LBIA 5F8HA 4OYAA 1WTBA 4HH1A 2Z2MA 3NLCA 2ADCA 5KT3A 1F2GA 3HHNB 5ETPA 3GIIA 1SJ1A 5CQGA 4KAIA 3HT3A 2M8HA 2B8PA 3HX9A 1EB0A 1RWNB 4WP3A 2KZMA 3FRZA 5D0EA 2C2DA 5EWFA 5A6WA 3KG1A 3ET6A 1RKIA 3BV8A 3CC7S 4DV6F 4OV1A 3KK1A 4JP8A 2OSRA 3P4UB 2MY7A 1PSDA 2AP6A 1WSVA 4CLYA 5HANA 3BQ2A 4BC7A 3A8EA 4DQSA 3A3PB 1FDNA 3GILA 2O66A 3EXYA 1ZA1B 1MROB 3J7ZT 4K0KJ 3CE8A 2YNIA 4AE5A 2EVZA 3BH6B 2C2RA 1CSJA 3DHWC 3J7YI 2ZFHA 2D9PA 1F0XA 4WYLA 1JKHB 2LFVA 8RUCA 3LH2S 1TUVA 4B9UA 1NJWA 3SQOP 1QAIA 3CMQA 3CWJA 1H2TZ 3N6MA 1VCTA 3QRPA 3MCOA 3LANA 2DHSA 2HQ3A 2HBZB 3D0IE 5LJ5Y 5KG3A 3H2VE 1FKOA 2R7SA 3BM7A 1YLXA 1UZDA 2K3IA 5AJ3J 3ZTSA 4MK7A 3DLGB 3UDLA 3SZ2A 2MY8A 3WDOA 1WD6A 5I42A 2BKOA 1YJ9S 1S6PB 4LQ9A 2IPOB 4Q7AA 3LGNA 1ICEB 3RBDA 2VZ9A 2UXBF 3NAHA 5JVHQ 2NR0A 3EGZA 5DGBA 2DGOA 1NEEA 1PYOB 1FTRA 5DO2A 2GAHC 4ELUA 3T5LA 1FRKA 2EC2A 4QR0A 3OV7A 4MKAA 3QMQA 4V1Ak 1SL1A 2CQ3A 1UEUA 4IUFA 1FHTA 5FJ4A 4ILMA 2M0GB 4DUTA 1KTVA 3UCGA 2GVDB 1CJUA 2FLNA 4K4VA 5BYRA 1FFSB 4Y2KA 3GJTB 2M52A 5GVQA 1S0NA 5K8NA 2NZCA 5F8IA 4ED6A 2VFSA 3U27A 3RYLA 5ETSA 2B9XA 3SFUA 1RT4B 4DHVA 2QC3A 2V4RA 3DGPA 2VG6B 4RBUA 4MFBA 1K0VA 1DARA 3WX8A 2LKZA 3MECB 3TZWA 3I6PA 4OZ0A 4DR5F 2V8GA 5IXUA 2YKMA 4DV4J 3A8IA 4UQGA 4DPOA 1T03B 3GIKA 1NK6A 4GO7X 2KFNA 2NXEA 3M6VA 5HJYA 1YJWS 3DI6B 1MN9A 1C0TA 2Z0GA 4IH5A 2CDRB 4I68A 2W7OA 2ZHBA 4CRJA 4DFMA 3QT7A 2GO8A 4B9VA 2E1AA 5EX0A 3IFEA 1LW2A 4RU9A 1H2VZ 4ZVGA 2CVEA 1NMEB 2E44A 1O5JA 2RQMA 2R7OA 3RW7A 5F8LA 4ZPBA 3KMSA 4A46A 5G0RB 3H8YA 3FRYA 5K9FA 1IBKF 4WP9A 4DV2J 2KXHA 2B7CB 1R0AA 2G4BA 4CWBA 1XQIA 2C2OB 4NI2A 3FBCA 3KNAA 4R0EA 3CJQA 4IQXA 4CNZA 4KPYA 3DOLA 4YQWA 5FD1A 1FJGJ 2HHUA 2EK6A 3KLGA 4DZ6A 2IAJB 1YWXA 3CCLS 3N28A 2OPRB 3OTCA 3BKUA 1UJ6A 4ZA1A 1TTHB 2MQ8A 4C48A 2DNOA 3LW5C 3FUYA 2KVIA 2QLFB 3K5OA 1VRTB 2EKYA 1N0UA 1LWFA 2RQ4A 1S9GB 1VRUA 3TUPA 4USVA 3F56A 2B6AB 3IMQJ 4UQTA 1JLEA 2BW7A 4RNMA 4JI3J 2PN6A 3ZFVA 3MGJA 2CQDA 5ETOA 1HWUA 3HK2A 4EYHB 3QZ7A 3GIRA 1SKSA 2OPSA 1AFJA 3Q23A 5KFPA 4M5KA 2DNKA 4PYDA 4TY9A 4AL7A 4RW7B 3UQSA 3C14B 3M8PA 2RILA 2MKCA 4ZLNA 3TP2A 4LIRA 4ZVSB 1FA0A 5KFCA 4OYMA 4KV8B 3VAGA 2L41A 3BBBA 2JC0A 3NCQA 4ZLJA 2HHPA 3CCQS 3CCUS 3D68A 1FD8A 1YRUA 2QG9B 3UR0A 4HACA 4F50A 5GADU 1N0VC 4OI2A 1CJKA 4ATNA 3V6HA 4OX9J 4NLQA 1NDKA 4YS2A 1OY9A 1FEEA 2HHHF 4LRBA 3BYPA 1EKSA 5C42B 2DGXA 5T7LB 1JJ2R 1Z4UA 1BQNB 4ED3A 2PT0A 4N76A 4QYZK 4WWSA 3K5NA 4HYKA 2VG5A 2IA0A 2VG7A 4RW8A 1KHWA 4NYOA 4KBIA 1FF2A 2QYGA 3TVKA 4O44B 4RU2A 4NLYA 3CIMA 4NLOA 3I0SA 2HVHA 4WJBA 2XY7A 3CUNA 1JIHA 1XJWB 3M8ZA 5J2QA 1HI1A 1M5VC 3VAKA 1S1XB 4DUZF 3QGPA 1U24A 5KG2A 2V8HA 3SI8A 4H4OB 5GAEU 1CQNA 4KJIA 1FX4A 4DV1F 4EBDA 2DPJA 1SVDA 2B5JB 2OMLA 1PJ7A 4ZVHA 4USKA 2ZUGA 3O44A 1VC5A 4ES3A 3MHYA 1HW9A 1XR6A 1OSCA 3AQPA 3X1LB 1DTQA 4MAKA 2GO9A 7FD1A 5L38A 5CAAA 3PW2A 4LSLB 4LF6F 3HSGA 1JKHA 1GMVA 2YNHB 4DL5A 1U45A 4TNOA 2A0FB 3E01A 4A8FA 3ZO7A 3NOCA 2HHHJ 4EBCA 4JV0A 1TQLA 3UD5A 1W25A 3CB4A 3BR9A 4DX8H 1RA7A 1R8HA 2ZM6F 2IY5B 2BRKA 2WHOA 1VQ6S 3NY0A 2IJNA 2ASLA 1H7XA 1TVRB 4RW6A 1WJ9A 4P75A 2DNMA 3E51A 1IUJA 5KOWA 2N4CA 2HQCA 3MAAA 2HFOA 1RT1A 2O5DA 5AXNA 1ZOTA 4CH7A 2QT7A 4DL7A 3KMQA 2RDIA 4ZVTB 4K4WA 3SV3A 4MKBA 4DUZJ 3RAQA 1S57A 5KG6A 1XNQF 3DRSB 2RMLA 1SQGA 4X62J 2GHVC 4BWMA 2DEIA 1T3OA 2CUYA 4ZMMA 2OKQA 4QW9A 2QL5B 4KR0B 2OPPB 1AUSL 1QAXA 3QWUA 1RT3B 2FJXA 2LDIA 1LFPA 2ZD1B 4D3HA 2GVDA 2YKAA 4TVAB 3US5A 5D0HA 2DPIA 5LSOA 2ZBQA 4IG3B 4Y2AA 1RE1B 4QCLA 1PAUB 3FEXB 3G6ES 3L4BC 4C0HA 1TL1B 1YZ7A 3W2VA 2HPUA 3T9ZA 4OI1A 3ZZTA 5IQ6A 2P8IA 3Q8SB 2G0JA 2M3DA 3DLLQ 3V4IA 5AXLA 1HI8A 1LW0A 4M5LA 2VPYB 5A8KA 2XYGB 4P9SA 1T02A 4ZP8A 2VBYA 3WZ0A 5KFMA 2OJ3A 4ECRA 4JV5F 1M1HA 1OPZA 3T1AA 1Y00A 5CD4A 1RUSA 1MMNA 1GMUA 3EZUA 3SCKE 2PA8D 2JDJA 1JLCB 3TQEA 2XB2D 5M2PA 3DMJA 3MEDA 3U1LA 1Q7LB 2DNLA 3N79A 2EBGA 2UUAJ 5M2RA 2W9BB 4LQ3A 1F9FA 4JI2J 2OPQB 4OV6A 2DHGA 1YZ6A 3L95X 5G0RA 4OX7A 2QSWA 3FZ2A 4HR2A 4DR3F 5KFZA 2DH9A 2ASYA 5DDQC 2VUGA 2BABA 1NRKA 2MQOA 2QFIA 3KLHA 1T05B 3RG6A 1VOMA 4G1PA 2H4WB 4UOCA 3IM9A 4CLKA 4L3NA 2E9RX 2R7QA 1HLWA 3IGVA 3LAKA 2KM8C 1XNRJ 1SKRA 4L3KA 5IS2A 1KVJA 4UT4A 5E3CA 5JUMA 1VRTA 5BR8J 2HKEA 4ILLA 4ER8A 2QEXS 1Q53A 1S9GA 1BGXT 5ETNA 2AKWB 2B6AA 1RAHB 2BM0A 4ED7A 3FC9A 3HULA 2PEBA 4LF1A 1G1XA 5KG4A 5GAHU 4PG7A 3Q24A 4IO9Q 2E5HA 1M5KC 2NREA 2E5LJ 4TXSA 4ES2A 4AUKA 3HHLC 4C4WA 1TKDA 4JV5J 2PMWA 5FIIA 1C0UA 2GJIA 4F4ZA 4FF2A 2ZVSA 1U7LA 1QAJA 3PM9A 1Q81T 4I1TA 3GCWP 2HQGA 1VQ9S 2YKNB 4CLZA 2R8IA 4RUCA 1T9TA 1NO8A 3VCDA 1FWKA 5BXIA 4K4ZA 3UVJA 2ERRA 2OMOA 3I31A 2DNYA 4DLGA 4J7CA 4C9DA 2Q66A 3AODA 3PZPA 4NLVA 3MR7A 2FZGB 4DR7F 2XMTA 4O3SA 3SCIE 2MZTA 2WBRA 3EM1A 1TKZB 2J7KA 3UDEA 1RWWB 5KFRA 2CQBA 2C2ZB 4XTTA 3TI0A 4L6V3 2MLYA 3T1YJ 3KOAA 1NHUA 4K2XA 5SZTA 7FDRA 5D8HB 5T7LA 2YWGA 1ZAWA 1YJRA 3QAUA 4P7VA 3RB3A 3PRVA 5IOLA 1D9AA 4U9RA 5KT5A 3R5DA 3CD0A 3M2UA 3RR7A 4FKYA 1UVKA 3PYEA 3HXMA 4P2MA 5DGAA 2DYAA 3W9IA 2IDLA 1RWOB 2ZZNA 4LFAF 5HQ8A 1RAEB 1N5YB 1L3KA 3SCLE 4KGXB 3AD8C 4IRKA 2XQCA 3GTYX 2ZDPA 5J2MA 2B8QA 5CZVA 2R7VA 5KFXA 1U1RA 2BJ3A 3Q89A 1JLFA 4YOEA 2ILZA 2CNOB 3I9ZA 5HI7A 3ZTRA 2O3DA 4IRCA 1PYSB 2Y1RI 5C7PA 1XIQA 4Q5VA 4DFJA 1R6VA 1DQAA 2VONA 1MU2B 1UJ4A 3MD3A 5HVFA 1KEKA 4URGA 3CD7A 3SIPB 3NCRA 1KQKA 4QIVA 3IP0A 4EO6A 2F9JA 4DR7J 1S97A 2AZ3A 6FD1A 4ETXA 1U1NA 1DRZA 2BQ3A 4USIA 4DSLA 2D41A 5K20B 2YNHA 2C2NA 1TELA 4YB5A 3IRXB 4CO0A 2HVDA 2R2SA 1F5AA 3BH7B 3EDQB 2HAIA 3CPWR 1LEOA 1KTQA 4KTQA 2KFZA 2NS1B 2JEIA 2CZVC 2FY8A 3E2EA 3TAMA 2R8KA 4NYZA 3C15B 4S0MA 2MEWA 1IWGA 4CLTA 2J7WA 1LXJA 2UVUA 1HBUA 3AQOA 2DR8A 1R27B 1R31A 1TFWA 3J81j 4LVNP 2XS2A 2D7SA 1IBMF 3J80U 2JVRA 3DLKB 1SH3A 5DRKA 3H2UB 5DG7A 5HLFB 1V3ZA 2N7YA 3FCHA 2HWHA 4B9SA 2LECA 3C16B 4ED2A 1HNXF 1SJ3P 1W2IA 2OPPA 1GXUA 5HMZA 1KNZA 4FS1A 5HVHA 3GCXP 2YWWA 3A4TA 4IG3A 3IRWP 2NXUA 1UFLA 4ECWA 2PO4A 1R3NA 3PW0A 4O23A 1TL1A 2DGTA 3POTB 3FSIA 2B4PA 2QA4G 2XYPB 4FNIA 4QIFA 4QIEA 3M32B 3IO1A 1X4BA 1RYSA 2HVEA 4UOGA 4ED1A 3HSDA 1X5TA 2IBKA 3MM5B 2AF6A 3EUNA 5B0GA 4KHPF 3M7VA 2XCPA 4DSIA 4G65A 3PW5A 1VQ4S 4NLDA 2KH9A 2WAQD 3TVZA 5L46A 2A3JA 1B64A 4K4YA 1SL0A 5BYSA 1FKAF 2NSBA 2U2FA 5HP1B 2FD2A 3TEGA 4ANDA 5CABA 2V67A 2GA7A 4RKUC 5KFYA 4XPCA 1X0FA 3NL0A 1RHUB 3HSZA 4PXCA 1MWQA 1RAJA 3D67A 2BR0A 2MTLA 2ALYB 3HM9A 1RTHA 4Y2CA 2P9EA 5RUBA 2O1PA 1LWXA 4FPRA 1TUWA 4K4TA 1VLYA 1HNXJ 1HBOA 1OQ3A 5I3QA 3RGIA 5J2NA 1SJRA 1SV5A 3RUBL 3E8OA 1S0VA 2H48B 3LP0A 4N56A 4FS2A 3BPSP 3AXMA 2CQ1A 3DDNA 1HYSB 3TQ1A 3CO0P 4CYUB 2JLEA 4RJVA 3PDNA 3R6GB 4GKJF 3K58A 5GAGU 2CG4A 3M9NB 1T9XA 4PWDB 4HDHA 4ID8A 3P3DA 3M8QB 4IR9A 2C3PA 2VASA 5D77A 4OZJA 3NGKA 2XI2A 2YNGB 3AXKA 2B4OA 2HURA 4JI8J 3R2CJ 4YR2A 1V3RA 3GV7B 2BJ8A 4NE9C 1OIAA 1F1BB 4I2QB 2FGCA 1XR5A 3H20A 3MD1A 2C3UA 3I4HX 2ZWOA 2HK2A 4BCAA 5B7WA 4X4SA 1JWWA 2YTCA 4OYWA 4UW2A 5EGYA 1ITPA 5KFLA 2JC1A 1F6TA 4YDXA 4J9KA 1KD1T 2VFTA 2BE7D 4JBCA 2J0SD 4W92B 1S49A 4P52A 3VWSA 1YRTA 4M1KA 2EC0A 2FTRA 1TP7A 1UKUA 4OYXA 1BXNA 3VGSA 1X4GA 2XTJP 1SI9A 3KUGA 3ZZ0A 1S99A 3C46A 2UXDF 1P9YA 1S59A 1QSYA 2KHCA 1KFDA 4H4KC 3NBPB 4DS5A 3GG1A 5KG0A 1TKXB 2GQCA 4CH0S 4URQU 1T9UA 3M9MB 5BJRA 1RTIB 3VHQA 3TVYA 4X4PA 4RZRA 2VA2A 3CJ3A 4M63A 3H5UA 3HKWA 1HHSA 1WEXA 4GKJJ 2VBZA 1HBNB 2XWXA 2V2KA 4HHHA 2GJFA 3PIPQ 2MKYA 2FC9A 1U0HB 4ZVRB 3R7SB 1UWBB 1TV6A 3CJTA 1WHVA 5FDLB 2VB6A 3THVA 5HVGA 2R42A 3MM6A 1N5YA 2GQQA 1JXVA 3JB9k 2IVMA 4ECXA 5F9LA 2H5JB 2YKPA 2UVRA 2RDDA 5F8JA 3JQJA 1C1CB 1WEZA 3KJNB 4PAAA 3CJ0A 1PO6A 1NJZA 1NCLA 4Y2IA 1N32F 3DLEB 1IQTA 4X65F 2HNZB 4LR8A 2C3OA 4NXMF 2V2ZA 4XO0A 4DPYA 1TK8A 5E3AA 3UCUP 2QE5A 2ZEJA 3M2RB 5IM0B 3W60A 1SL2A 3ILLA 3VV2B 3CTRA 2GS8A 4B3SF 2BRLA 3TUJC 2VICA 2VJUA 1ZAVA 3MTJA 1S9FA 2L9DA 3FK4A 2Y8WA 1EJ7L 5KFGA 3T3FA 4OI0A 1PGZA 4CLPA 4FBUA 3NNAA 3C3LA 2I8EA 2L9NA 2CJYB 1D1UA 4OYOA 1S1VB 3QT8A 3M2VA 3RAXA 1DFDA 2QA1A 1HA1A 1CS4A 3PR4A 1NJIT 1LWCA 1N88A 1FE0A 2CXEA 4ECZA 3RRGA 4OYZA 2OO4A 4NLUA 3VGUA 2Q3PA 3C6UB 4G6VB 1BLUA 1NZ8A 3ZZOA 4J9SA 1Y5LB 3GFYA 3MM8A 2H9ZA 2DNZA 1HARA 4PXEA 2DR5A 3VQTA 1N5SA 2Z8QA 4JYAF 3TOQA 2YBVA 3WX4A 5CH7B 3BS9A 4K8RA 1S5ZA 1C1BA 3HKZD 3I82A 1RHJB 2FHJD 2N7CA 5D4LA 1PCAA 2ROPA 1NK7A 4ZITA 3F41A 2VA3A 1KQGB 1N32J 1R8CA 3UDVA 2KL8A 4YR3A 2YNFA 5I3UA 4X65J 3FMBA 4HVZA 2Y9HA 2FLOA 2KU7A 2OGUA 1HW8A 2V50A 2IYIA 3OSPA 1TL3A 1UPMB 3IWXA 4NXMJ 2EBEA 2VOPA 5HATA 3D1HA 4OL8A 3CCZA 5D0GA 1GMWD 5LMUF 2B43A 2CADA 1S72S 3U7JA 5F0UA 3M1VB 2BANB 4RO0A 3OR2B 3C2PA 2LQJA 1YBAA 4YR0A 5DM6Q 2DNPA 3V5RA 2YY3A 2IRUA 4QWCA 4JV2A 1R43A 3BB5A 2WK4A 3BGFA 1AT1B 3LGHA 2WW4A 3UFCX 2IMWP 4QBUA 4KHRA 1UPPA 3W8PA 1OJ4A 2DJWA 1HR0F 3BBFA 4CTAB 3MOJB 3OFEA 3AH6A 4DR2J 3IC1A 1Q95G 2XYHB 3ZXWA 3OTDA 3RB4A 1UWAA 3QGHA 4LVOP 1UAWA 4UOHA 5B0CA 3D3BJ 1I5OB 4TY8A 5FLXY 3Q8VA 3T5KA 3I87A 3FSYA 5EHHA 3KLFB 1NZAA 2CVIA 4JYAJ 2AJQA 2CJQA 3BF4A 8ATCB 3C8YA 3CMES 1JJ4A 2IYGA 4FBTA 1WNEA 2KO1A 4HKQA 2KYZA 1S0OA 4M95A 4EEYA 5CD4H 3SFGA 1RT5B 2FJWA 3PW4A 4WXOA 4LBHA 1BQMA 3BN7A 2NSCA 1FKPB 5F8NA 2HNDA 1PILA 5F0WA 2E9TA 1RP5A 1VIOA 1KLMB 4X84A 6AT1B 3HZGA 4KHMA 1QUPA 4EYIB 4LF4J 2C1EB 5F9NA 1RXOB 3D6FB 4CLFA 1S7HA 4WBFA 2CJKA 3TUIC 1J5EJ 2I9SA 2D69A 2N3LA 3ISND 1S1UA 3MM9B 4JI1J 3ZZYA 2KT2A 3M8QA 1CEZA 4OLOA 1VFJA 2VKRA 3T5JA 4Q44A 1D9FA 2YNGA 3HHEA 1VR6A 3GYGA 2UUCJ 2GHPA 2ROGA 5AE2A 1MMLA 4ZIWA 4CCHA 4RWWA 1RAFB 1QD1A 1FXLA 1RADB 3GZ7A 1X5SA 3AOBA 5JXSA 1ZTTA 4CM0A 3DU6A 5LJ3Y 2QTWA 2YKOA 4YY3J 2HMIB 3IR6B 3N6LA 1FDDA 2NYHA 5D3GB 3GB0A 2WZ1A 4ED4A 2J6SA 4C0BA 4WK3A 4WFXA 3QO9A 1E6YA 1IN0A 1CLFA 3KUEA 4Y0FA 1AZSB 1NLKL 2BA9A 2H5IB 3V6KA 2AX0A 4FYYB 3OVAA 2X1GA 3PKYA 2DGSA 1VJWA 1HBMB 3NWRA 2VBWA 1I94F 2D1CA 3KFWX 3EXCX 1R0CB 1IKWA 4F3MA 4DDFA 4BHQA 3DRYA 1VQMS 1TKXA 5AE1A 3IN5A 3WC0A 1RTIA 4JI7F 2DHXA 4AT1B 3D4JA 2M2BA 2XMWA 5CYMB 4AL5A 3T5HA 4X4VA 2ZDOA 4RBTA 2DNGA 5DDPC 1EQ0A 2WB1D 4W90B 5KFBA 1WUUA 3BKFA 2WOMB 5KTQA 4ZP6A 2YPYA 2D3UA 1U0HA 5DZ6A 3FFIB 4ZCKA 3AJDA 5A76A 3DM2B 2XC9A 2CQCA 2CJXB 3QGGA 1JB0C 3CCRS 3CDUA 1QE1A 2J9CA 2M9KA 5F3ZA 2JNJA 3PYDA 3HMJG 3W61A 4IOCQ 1U48A 2W9CB 5LM7E 3ZTPA 2XMAA 3MR3A 2Y3YA 2MJNA 5H9EJ 4NLSA 3G96A 4IH7A 3DN9A 3ET6B 3SV4A 5E33A 3QT6A 5L9XA 3UI3A 4RX6A 2J9DA 4F0KA 1JLGA 1F9HA 3MPWA 3QATA 2KHDA 2BQUA 1HNWJ 4B3RJ 2YWKA 1QVFR 3PO5A 3GIMA 5IM0A 1RU1A 4DWIA 4Y65A 4GMKA 2DCUB 4U96A 3M05A 4ETZA 3EPGA 2YNIB 4PPDA 1I94J 5BYQA 3P5BP 2MLXA 2XBPA 3GYNA 4Y2MA 3X3UA 1YITS 2AW0A 1SC6A 1NPRA 2EG2A 3SSRA 2MKSA 1SC3B 2V0NA 1S1VA 2ZE2B 4QWDA 1AXQA 1W2BR 4XPEA 1B7YB 1V5IB 3IAM9 3NS5A 1YTYA 4OZ1A 3AOAA 4ZJLA 2QO3A 1YG0A 4P73A 5E2QA 2XZWA 2OAUA 1IKVA 2QMUB 3LO3A 4U95A 4GC6A 2B9EA 1FKOB 4DV3J 2ZBCA 4LF9F 3C6UA 4B17A 1JJCB 4M5GA 1I51B 1K0TA 1WF1A 1JNRB 5DQHA 3QRRA 2CWXA 3BKTA 1Q1KA 1EHWA 4OI3A 1QM9A 4CI0B 2NZ4A 2C42A 5I42B 5KFAA 3OSNA 3K8VA 1NPKA 3OTOJ 3HFKA 4OHZA 2BJ1A 3K2YA 3FGVA 4QJVA 1RWXB 4JI0F 2FVRA 3I4PA 4DX7A 3PX6A 2OELA 3G82B 5L1KA 3HF5A 4NXNJ 5J1EA 1S4FA 5GADI 3PHEA 3KDNA 1RDRA 5C2CA 4U67Q 2AWZA 1ULRA 1UMJA 3D7SB 5H1SV 1XTZA 4A48A 3FNNA 1HFEL 2V6AA 4MKVA 1KRPA 1U1QA 4H54A 1RTJA 2X3DA 3OL7A 5DETA 2QV6A 2E1MC 4PXDA 2ADBA 2VV5A 3ENQA 1IM6A 4ED5A 2BANA 2QMXA 1RAIB 4Q8EA 3G6XA 1CJUB 2F4VF 2LXUA 4PWUA 4QWBA 2ZUAA 4NASA 4OJ1A 3W2WB 2D3ZA 4ECQA 2AJ4A 4U8YA 3SQGA 4P7TA 4OIXA
chains in the Genus database with same CATH topology
1S6QB 1HNIB 3M9OB 1N56A 2IVYA 1HWLA 2MZQA 3QAEA 4MH8A 5J2PB 1HI8A 1S9EA 1LW0A 4KB7A 2MSSA 5A8KA 2VPYB 4XAKA 3B78A 1T02A 3HVRA 4ZP8A 2L9WA 2QIFA 2VBYA 3D0HE 3WZ0A 1ZM3A 5KFMA 4AQYF 2QLXA 1PC4A 4KFBA 4YY3F 2OJ3A 4ECRA 1ZH5A 4JV5F 1OPZA 3T1AA 1Y00A 3U1NA 3MR2A 4N41A 1A7GE 3M4XA 1MMNA 4FF3A 1FTCA 4IG0B 1HWJA 1ZZNA 3C6TB 1NAQA 3IWLA 4MK9A 1RWUA 4WFNQ 2HS0A 3EZUA 4G1QB 3SCKE 5HP1A 4Q0BA 2K2PA 1SBRA 4CQ1A 5ITHA 4X4OA 2PA8D 4DFPA 2VQFF 2JDJA 5M2UA 2EWHA 1QAYA 3N0VA 4WFBQ 1AUDA 2V94A 4NA3A 1JLCB 1X0PA 4TN2A 2HVZA 3NNHA 4UY85 1DLOB 3ZZUA 4NX9A 4YUDA 2IFXA 3KNGA 3OBIA 3BN4A 3MWBA 4MIBA 2XB2D 5M2PA 1D3WA 3DMJA 3MEDA 2DH8A 2IVFB 4K50A 3UD3P 3U1LA 1Q7LB 2DNLA 3N79A 1ZYQA 2EBGA 4RNOA 3IG1A 3MAHA 2RRAA 4C97A 2LCWA 2DIVA 2YH0A 3CC4S 3GR1A 5M2RA 4AL6A 1MSWD 2W9BB 4DL6A 3DOKA 1XEZA 4F3OA 3JSBA 5HBMA 4TY8B 4LQ3A 1F9FA 2OPQB 3HHLA 2ZH2A 2DHGA 1XR7A 1LW2B 2YKQA 3L95X 3MPVA 4YEAA 3DLHA 1LQ9A 1N4LA 2CQIA 2XI3A 5G0RA 2MKIA 2LA6A 2ZC3A 3GFXA 4OX7A 2QSWA 2GNKA 3EYZA 3CJ2A 2MPUA 3FZ2A 4F8RA 4DR3F 3K8WA 1U4BA 4DV5F 5KFZA 1RT5A 2BXJA 2DH9A 4NPOA 4TKTA 4OX9F 3GQCA 3JSMA 2ASYA 4RNHA 4KC5A 5DDOC 5DDQC 1HI0P 1SH2A 2DNNA 4FF4A 5F8GA 2VUGA 2FVSA 2BABA 1NRKA 3MOZA 4K5SA 4AFFA 2MQOA 2YX4A 4A8XA 4OHXA 1N33F 2KB2A 2UUBF 3KLHA 1T05B 1TZ0A 1GAOA 1VOMA 4G1PA 2QZ8A 4UOCA 5K8OA 3MF5A 4X4NA 4WZQA 1OO0B 4JUZA 2XCAA 2MHNA 2R7TA 4L3NA 1KLMA 3OFGA 1HYSA 3QPIA 1R0AB 2RQKA 2E9RX 3MPYA 2R7QA 3IGVA 1BQMB 5KFQA 2UUWA 3IS9A 3MMCA 4YHHF 4CO3A 2R7UA 3UNGC 1JXLA 3GE9A 5KFHA 4LSNA 3CSKA 3PJWA 3T1HF 3DRRA 2HNDB 3LAKA 1Q8BA 2N4DA 2KM8C 3DC2A 3CJKA 3RTVA 2NPIA 2J5AA 3H2LA 1KOHA 4O4GA 5A8WA 2ZH6A 3UD4P 1UVMA 2KN4A 2LA4A 4PWDA 3BDEA 1SKRA 4EBEA 2XMVA 3CDWA 4DSFA 3MM9A 4N77A 1QTMA 1FT8A 1E6VB 4L72B 3KLGB 2FB0A 2HRYA 5IS2A 2OLWA 4F25A 2DIUA 1KVJA 1YSJA 5E3CA 4C2MA 2FJVA 2JJ4D 3TRGA 3RBEA 2B7BB