3KLFB

Crystal structure of wild-type hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
426
structure length
413
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 101
structure length 413
sequence length 426
chains with identical sequence F, J, N
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klfB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klfB03
1K1SA 5JUMA 2IBKA 1JLEB 4KAIA 3DDKA 3RB0A 1I6JA 3SFUA 2OPPA 3PW2A 1S97A 1RT1B 1S1UB 4FS2A 4ECSA 4IR9A 3IGVA 3T1AA 4PWDA 1LW0A 3G6XA 1RTJA 5KFPA 2IMWP 1FKOB 4ZVGA 4EBCA 2C2RA 2R8IA 3C6TB 3DRSB 3QGHA 2HNYB 5EWEA 2BANA 2JEIA 1SV5B 4I2PB 1LWEB 2WONB 4ZMMA 4ECYA 1U09A 3G6YA 1T03B 3FDSA 2YNIA 5EWGA 4PUOA 1RTHB 3KMQA 1JLAA 4ZPDA 1HARA 4FS1A 3E01B 2C22A 2D3UA 3HHKA 1RT2B 4K4VA 4RW6A 3Q8RB 1N48A 4O3PA 5KFXA 4NCGA 3DRRA 2FVQA 4NLRA 3CVKA 4IH6A 2C28A 1VRTA 3QIPB 5KFNA 3V4IB 2E9TA 5C24B 4K4XA 3DI6B 3DLGA 3I5BA 5KFUA 3KMSA 1JLGA 3GYNA 5J2NA 2WTFA 3MECA 4MK8A 1FKPB 3LP0B 3BSNA 4M94A 3GV5B 1HPZA 3UQSA 4ED1A 1KLMB 1S9FA 3DM2B 1T94A 4EO6A 5DG8A 3V6DA 2W7PA 1S0MA 4RW8A 1T05A 3IRXB 1HNVA 3LANA 5C42A 4K4UA 3KK1A 4LSNA 4IH5A 4WZMA 3HVWA 1XR5A 5KFRA 5EUHA 4F4YA 4K4WA 1RYSA 4JV1A 5KFEA 2WOMB 4ED6A 1R0AA 4ZPBA 4IRDA 4NLQA 4RW4B 3TAMB 5KT7A 4QW9A 1VRUB 2RKIB 5KT5A 5KFOA 4J9KA 4EYHB 2ASDA 3KK2A 3FQKA 2OPRA 4ZP6A 5KG7A 1IKXA 2VG6B 3CJ3A 4IG0A 4ZP8A 1TP7A 2W9BA 3EPIA 3HVTA 3DRPA 3CJ0A 3EPGA 3BQ0A 1RTDA 3QO9A 4OL8A 2WRMA 4O4RA 3M8PA 5D3GA 4LQ9A 5DGAA 2FLNA 3RB4A 4RW9B 4WXOA 3DOKA 3QZ7A 2YNHB 2FJXA 3IS9B 1QUVA 1JLCA 2UVVA 3GIKA 1RT3A 4IRKA 3FRZA 1UWBA 2B5JA 2AX0A 3QLHA 4DL5A 3H59A 1TKTA 3RAQA 1JLQA 3MFHA 2GIQA 3PHEA 2ATLA 2OPPB 2W9AA 5KFZA 2GIRA 4PWDB 1LW0B 5EWFA 2UVUA 1RTJB 3DYAA 1C0TA 3DLEA 4NLWA 4R0EA 5I3UA 4EEYA 4YR2A 4MKAA 4ZPAA 1JIHA 2YKNA 1MU2A 3KOAA 1S48A 2XCPA 2VG7A 2BANB 2FVRA 5KG5A 5KFBA 5DG9A 4Q44A 5T14A 5EDWA 4MIBA 3ITHA 5J2MA 5F8IA 4YR0A 2XCAA 2YNFA 1JLBA 2YNIB 4GC6A 4O44A 2R2SA 4ZVHA 4ZVEA 4PUOB 2OPQA 5KFQA 2WCXA 4MK7A 5KT3A 4J9PA 4WFYA 2WK4A 4TQRA 1JLAB 3DLKA 4ED7A 5KG3A 4RUAA 3PW0A 4RW6B 1RAJA 1XR7A 1OS5A 3CWJA 4NCGB 3DRRB 2I1RA 4RZRA 4B3OA 3OHAA 1FK9A 3M9OB 1VRTB 3PW7A 2V4QA 3PVXA 4NRTA 3DLGB 1LW2A 3H4BA 1NHUA 1JLGB 2D41A 5J2NB 3MECB 4NLGA 4G1QA 1HPZB 4K4YA 1LWCA 3G6VA 5KFDA 2V0NA 4KB7A 4Y3CA 2YKMA 4O4GA 3V6DB 3PW5A 3M8QA 4RW8B 1HNVB 5C42B 4ED8A 3KK1B 4LSNB 2OH2A 1HQEA 2HAIA 5CYQA 5I42A 1YVFA 3MR6A 1R0AB 3QIDA 2W8LA 4HKQA 1QE1A 3LALA 3CJ2A 3UDLA 5FDLA 1DTTA 2VG5A 4MFBA 5HP1A 4NLOA 3CIZA 4ZP9A 4K50A 4WFXA 5KG4A 4WFZA 3KK2B 4NLUA 2OPRB 4TYAA 4RU9A 1IKXB 1HQUA 4QPXA 3G86A 4QWDA 3QZ8A 2W9BB 4IG0B 2IA6A 3HVTB 3DRPB 1C0UA 1RTDB 3QO9B 4KHRA 4IG3A 2XWYA 3NL0A 3M8PB 5D3GB 4ECZA 4K4ZA 3DOKB 3JSMA 4Y2AA 1RT5B 3Q8QB 3BREA 4NLXA 1JLCB 4O3NA 4YQWA 1S1VA 2IAJA 1RT3B 2HMIA 4YR3A 1UWBB 2B5JB 5F8LA 3QLHB 3UPFA 1IKVA 1TKTB 1JLQB 4Q0BA 1NHVA 3N6MA 4G3IA 4WXWA 3QYYA 2BRKA 4J9QA 3LP1A 4TY9A 5F9LA 3KK3A 5DQGA 4WYLA 3IGNA 3DYAB 1C0TB 3DLEB 3BSAA 1TL3A 5I3UB 4FBUA 1SH3A 2JC0A 2YKNB 1MU2B 3I0RB 2AU0A 2BRLA 2VG7B 4KFBA 4ICLA 5F8NA 3ISNC 5J2MB 2AWZA 1JLBB 3GIMA 4O44B 2OPQB 3NMAA 5L1LA 2W8KA 1TVRB 4F4ZA 3DLKB 3MR5A 3D5MA 4F50A 2FVCA 2VA2A 2FJVA 5KFCA 3OL8A 3KHRA 4MK9A 4ED3A 4B3OB 4J9LA 1FK9B 2HNDA 2ILZA 5J1EA 1TKXA 1RT4A 2HWHA 3DMJA 3GIIA 1N4LA 4JV0A 1N5YA 3CO9A 4ZHRA 4H4OA 4MH8A 1C1CA 4G1QB 4YMEA 1LWCB 4Q43A 3MR2A 2E9RX 3KLFA 2YKMB 4O4GB 3M8QB 3V6JA 2FVPA 2D3ZA 4MIAA 1BQMA 1DTQA 2IM1A 1HQEB 4KKOA 4TN2A 5CYQB 5I42B 4LSLA 1RA6A 2BE2A 1SH2A 1RDRA 4EYIB 2ALZA 1QE1B 4Q8EA 2IM2A 5FDLB 4ED2A 1DTTB 2VG5B 4MFBB 5HP1B 2XGQA 4X2BA 2R2TA 4HYKA 3T5HA 5KT2A 1RA7A 1HQUB 2B6AA 5CYMA 4DL7A 4H54A 5KG2A 4GC7A 1C0UB 2JLEA 2V4RA 4IG3B 2ZD1A 4IFYA 5JXSA 1JLFA 5L1KA 1JKHA 2JC1A 1Z4UA 2IM3A 4ECRA 4Y2CA 3JSMB 1HMVA 3PJWA 2HNZA 4IFVA 4URGA 4QWAA 1S1VB 2IAJB 2HMIB 4NLYA 4F4XA 5KFAA 3MEDA 3V81A 1IKVB 4ECQA 4Q0BB 3EZUA 1N56A 3CJ4A 2BQUA 1S6PA 3PJXA 3T5KA 1S6QA 3LP1B 3KK3B 5DQHA 1C2PA 4MKBA 1C1BA 1IKYA 1S1XA 1TL3B 1SH0A 2IJNA 4YP3A 3PW4A 3RB3A 4TLRA 2AGQA 1XR6A 1S1TA 4ECUA 1S9EA 2F8EX 4KFBB 3GV7B 4ICLB 5C5JA 2AGOA 3NGDA 1S10A 3H5XA 5KFLA 1S9GA 3MEGA 2YNGA 2CJQA 5F9NA 1KHWA 3RBEA 2BQRA 5DG7A 2UVWA 1S1WA 1IKWA 1EETA 4IDKA 2VA3A 4RNHA 1QAJA 3OL7A 3NAIA 3T19A 4IR1A 2J6SA 4K4SA 1N6QA 4Q45A 1RYRA 2RDIA 3NBPA 1JXLA 2J6UA 2R8KA 5F8HA 4RNOA 2JEJA 2HNDB 4DL2A 2JEFA 1EP4A 1T05B 5J1EB 2UUWA 5J2PA 3KHLA 4NLPA 4H4MA 3DMJB 4TY8A 1HYSA 2UVRA 1N5YB 2ZKUA 5KFIA 4TQSA 3KLVA 4ZHRB 4H4OB 3KLEA 2C2DA 1C1CB 4LQ3A 5KT6A 2ILYA 5KG0A 3JYTA 4O3RA 3KLFB 3IN5A 2B43A 3H5YA 4FBTA 1BQMB 5L9XA 1DTQB 1TQLA 4KKOB 3BJYA 2ASJA 1D0EA 3M9NB 4IOBA 4LSLB 4M95A 4KBIA 1IM4A 4WYWA 2R2RA 3CDUA 5KFFA 2R8HA 2BE2B 2I5JA 4IQXA 1S4FA 5DLGA 5L1JA 4U6PA 4ZVFA 3DOLA 4NLSA 5F8JA 4ZPCA 4R8UA 3ICLA 3MF5A 3MTKA 2AGPA 1ZTWA 4RNMA 5KFHA 2RF2A 4DL4A 2ASLA 4ECXA 3BR9A 3H98A 1WNEA 2B6AB 3UR0A 5CYMB 4KSEB 1HNIA 3H5SA 1TV6A 4EO8A 3OSPA 2UUTA 4ID5A 3M9MB 1RT7A 2ZD1B 3LP2A 5C25A 4NYZA 4IFYB 1JLFB 4XPEA 1JKHB 1RT6A 4RUCA 2D7SA 5KFYA 4J9OA 1HMVB 2IC3A 3IG1A 2HNZB 4IFVB 4DG1A 4NRUA 4ZP7A 2BQ3A 4I2QA 3GILA 2FLLA 5HBMA 2R8GA 4WZQA 3I5AA 3MEDB 4R5PA 3V81B 1RTIA 3VQSA 5DQIA 1S6PB 4ECWA 4IRCA 2O5DA 3ITHB 4ECTA 1S6QB 4DL6A 2YNFB 1K1QA 4TXSA 4JUZA 1C1BB 1IKYB 1S1XB 2E9ZA 4J9MA 2XI2A 5KFSA 1LWFA 1S1TB 1S9EB 4JV2A 3OL9A 3FFIA 4KHMA 1S9GB 3RBDA 1JX4A 3MEGB 2YNGB 4WE1A 2WB4A 3MEEA 5HLFA 4URSA 1S1WB 4U7CA 1IKWB 1D1UA 1EETB 4IDKB 1TKZA 3BGRA 3H40A 3SFGA 1LW2B 2XC9A 4O3SA 3I0SA 4KO0A 1TL1A 2OPSA 3LAMA 1N6QB 5KFGA 4F4WA 2EC0A 1QAIA 3NBPB 3GV8B 3QGIA 5HROA 2FVSA 1REVA 1BQNA 3N6NA 4KE5A 3MR3A 3KLHA 1EP4B 1T3NA 3KLIA 2FLPA 3KJVA 5J2PB 4URQU 4I7FA 4H4MB 4TY8B 1HYSB 3H4DA 3FQLA 4J9SA 3PZPA 1S49A 1S0NA 3KLEB 5F8MA 2AX1A 1MMLA 3OLAA 5K14A 2W9CA 3RB6A 3C6UA 3JYTB 2ZE2A 4RW7A 3T5LA 3OL6A 5KFTA 5J2QA 3OHBA 3GIJA 3CDEA 2QE5A 3KLGA 4IKAA 5KFJA 2I5JB 3OLBA 5KG6A 3FSIA 1ZETA 3DOLB 5KFVA 3KHGA 3PR4A 3I5CA 4R8UB 4KV8A 4PQUA 1ZTTA 5DGBA 3H2LA 2J6TA 2RF2B 1SUQA 1J5OA 1DLOA 3E51A 3V6KA 4DL3A 4Q8FA 1HNIB 3GQCA 1TV6B 1JLEA 4ID5B 1RT7B 3LP2B 5C25B 4QWEA 3Q8SB 4XO0A 2XGPA 1RT6B 4Y34A 2XI3A 1RT1A 1S1UA 2DPIA 2HWIA 3SI8A 2IC3B 3IG1B 4DG1B 1RT5A 1FKOA 4I2QB 1CSJA 5HBMB 1GX6A 3C6TA 3DRSA 4R5PB 2HNYA 2W7OA 1RTIB 4J9RA 1SV5A 4I2PA 1LWEA 2WONA 2RDJA 1T03A 2DPJA 3CDWA 2IJFA 1RTHA 4DEZA 1LWFB 3V6HA 3I0RA 3E01A 5F8GA 1RT2A 3FFIB 4NLTA 2JEGA 4WE1B 3MEEB 5HLFB 3N6LA 3QIPA 4NZ0A 1TKZB 3BGRB 3V4IA 3KHHA 5C24A 2R8JA 3DI6A 1TVRA 1TKXB 1RT4B 2QV6A 3KNAA 3I0SB 4KO0B 1TL1B 2OPSB 2C2EA 5KFWA 1FKPA 3LP0A 4J9NA 1S0OA 4TYBA 3BSOA 4EBDA 1KLMA 5HROB 3DM2A 1REVB 1BQNB 4K4TA 3LAKA 3RAXA 3KLHB 5KG1A 3KLIB 3TQ1A 3KJVB 2IM0A 5KT4A 4I7FB 3IRXA 3TVKA 4EBEA 4ED0A 3T5JA 2R2UA 2BR0A 2GC8A 3Q8PB 3NAHA 4NLVA 3HKWA 2WHOA 2WOMA 5K14B 4O3OA 2W9CB 3C6UB 4O3QA 2ZE2B 5KFMA 4QW8A 2AQ4A 2V9WA 4RW7B 4XPCA 4IH7A 3OSNA 4RW4A 3TAMA 1W25A 3MFIA 2FJWA 3D28A 1VRUA 5J2QB 4QWCA 5KFKA 2RKIA 3QGGA 3KLGB 3BSCA 4QWBA 2VG6A 4NLDA 3NKYA 5DLFA 3HVAA 2CKWA 4RNNA 3PR5B 3BQ1A 3CJ5A 4KV8B 1NNDA 5L1IA 4PQUB 3BQ2A 4ECVA 4RW9A 4RNFA 1SUQB 3ISND 1J5OB 2YNHA 1DLOB 1KHVA 1GX5A 3IS9A 3H5UA
chains in the Genus database with same CATH superfamily
2B56A 1JLEB 2RJZA 4ZPWR 3ENQA 4ECSA 3MD3A 2B51A 4ZMMA 3R1LA 3N01A 2CQDA 3UE2A 2DNLA 2GJ2A 1NZAA 3R5JB 4NCGA 3M1VA 4CLZA 4LF1A 3V4IB 2DH9A 1IXKA 2C42A 1GK8A 4ATNA 3UDCA 5KFRA 5U47A 2ROEA 2YH0A 4QYZK 5C2CA 4B9UA 7FD1A 1VRUB 1U8WA 3FEZA 3G4SS 4EYHB 2W9BA 2PFDA 5FLXY 3QO9A 4CTAB 3RB4A 4WXOA 2FJXA 1JLCA 3A4TA 4I1TA 3PKMA 2MQOA 1A7GE 3D0IE 2CZ4A 5EWFA 3DYAA 4OZ5A 4DHVA 2YKNA 3T6JA 5HJXA 5KFBA 4YR0A 4EFAC 5KFQA 2DISA 2W4PA 4DF4A 1WC4A 5B0FA 2KYZA 4JYAJ 2VF3A 2HVDA 4NLGA 2MKYA 2V0NA 1WJ9A 2ZHOA 4RW8B 4PG5A 3MM5A 2JVOA 3QIDA 4HKQA 3QT7A 1KBRA 1DRZA 5D0GA 2VG5A 2Q1LA 3H0PA 1KKHA 4ZLPA 3Q83A 4N76A 1WSVA 4DSIA 3EGZA 4FF1A 3K5PA 3GTYX 3TUJC 3OT9A 5EX3A 3IGNA 1C0TB 5I3UB 4BDPA 2ZVIA 3SQOP 3DLHA 2V2ZA 3OR2B 2V69A 4C97A 1GMVA 3QGPA 3NMAA 1UAWA 2Z4PA 2MKSA 4EU0A 3PFEA 3MMBA 2V4JB 3MR7A 3VV2B 5A2QY 1N5SA 3NGUA 3GIIA 4ZHRA 1VJWA 2BW2A 1CBKA 4B9VA 3VQTA 3I96A 4L3NA 5M2PA 2DHSA 2K7KA 4PAAA 1QDUB 2VJVA 1SKSA 3R5AA 3DOMB 5MAOA 2ZD1A 4OHXA 2IM3A 4Y2CA 3ULHA 3HJVA 2A6OA 3VVUA 3V81A 5A6PA 1HQ2A 3T5KA 2H48B 1BQXA 3PG9A 3M2RB 3I82A 3NCPA 4ZVOB 3NGDA 1NCLA 1XBWA 5DG7A 4JOUA 3WDOA 1EETA 4IDKA 3CCLS 5L8RC 2C3MA 4F4AA 3RRGA 2RDIA 5LSRA 5KFIA 2EPIA 4LFBJ 3ILOA 3W64A 3UD3P 1WWHA 2CPEA 4HH1A 5IQQA 4ZJQA 5K8PA 2E1RA 2J8SA 3KYLA 2GQCA 2V5HG 1NKCA 5KFHA 1Y9OA 2B6AB 1AUSL 1S4EA 2VFTA 2A6MA 4XPEA 3Q8YA 2AYGA 1HMVB 3D4JA 2R8GA 2N7YA 2UUCF 2VASA 3MWBA 2A0FB 2ZOGA 5GAGU 1IKYB 5IXUA 1S1TB 1FD8A 4PPZA 4URSA 2OGUA 3G9CA 1B0TA 4LR8A 4OJGA 4KHPJ 2E1MC 2UXDJ 4NZ7A 2D9PA 4Y00A 3MR3A 5E3QA 3TR5A 4QR2A 1HA1A 1TL7B 3IMQJ 4Q5VA 5J2QA 5T7LA 2HZAA 2QJ3A 3TAQA 1UVMA 2HWTA 5KG6A 3J7YU 2VBYA 1J5OA 3E51A 1B7FA 1VIXA 3IWLA 2P5VA 3IRWP 3Q8SB 2XI3A 3ZZUA 2GZOA 3SI8A 2IC3B 5E0OA 1FFGB 3ILIA 1GAOA 3PYDA 3RTVA 2B4OA 5HQLA 3KHHA 3BGRB 2G2OA 2QV6A 3R7SB 3LP0A 2UUCJ 3BKFA 2L9DA 3KLHB 1S6OA 1ZOTA 2GC8A 1Q8BA 2VFVA 3FGVA 4JI0J 5DLFA 4KV8B 2UXCF 3KFWX 3H5UA 1PIEA 3DDKA 2OPPA 4YN3B 1RT1B 1YWXA 1M5VC 5D15A 1PC5A 4A47A 8ATCB 1LNQA 1BMQB 1RTHB 4ZJLA 4IH6A 3M2UB 3TUZC 3HD2A 1UVIA 1ZPWX 4CI0B 4NXNF 2K8GA 3DKDA 4UY8T 1HPZA 2B8PA 3CJSA 3HHLA 5C42A 2CXEA 3FEXB 2H5JB 2POKA 2OPRA 3F44A 2R7VA 3BQ0A 1RTDA 4MKVA 4KPYA 1VBKA 1KRPA 3DGVA 1X4EA 1NBEB 3IS9B 2UVVA 1N8RT 2NQPA 4N77A 3H59A 2RUSA 4C6AA 3C19A 1WD6A 2ZFHA 3RG6A 1RTJB 3HXMA 2J9DE 1JIHA 4M5NA 2W2PP 5J2MA 4KC5A 4MK7A 4J9PA 2DCUB 3KJFB 2YQ3A 4XTTA 4DI6A 3R3TA 4N56A 4ETXA 4RZRA 1TL4A 1FK9A 4FF4A 4HEA9 3JQJA 1LWCA 4P52A 1S76D 1WOPA 4QR1A 2XHCA 1MWYA 5H9FJ 5ETLA 2FC9A 2KYXA 4CLYA 2CWXA 1TKDA 2DR8A 3O2IA 2DGUA 2CQIA 4RL1A 2U2FA 4YR3A 5F8LA 4NYOA 4WXWA 2HLUA 4J9QA 3LP1A 1WACA 3HJFA 3HULA 5IT9U 5J1NA 4DR3F 1KTVA 4IOCQ 5IM0B 4ES3A 5GAEU 3GIMA 4O44B 2B4UA 3FRYA 3HFVA 1T9XA 3I9ZA 4FVMA 2U1AA 1TMMA 5CCMA 2VA2A 4EMDA 2R7QA 4PG7A 9RUBA 1OYDA 4H4OA 1K8AT 4Q43A 2ASYA 2NPFA 2RDDA 2FQQB 2NLWA 2FVPA 1BQMA 4DFJA 1LEOA 4EYIB 1RDRA 2VOOA 4DV3F 4CCHA 4FXWA 2PI4A 4HYKA 3DGPB 2ZITA 3GYXB 5KG2A 4F8RA 1RGVA 1ZAXA 3LH2S 2HMIB 4OI1A 3NGKA 2YWFA 1S6PA 1VK8A 2UUBJ 4JI2F 3KK3B 1QAXA 1M1GA 3MEGA 2UVWA 3L7PA 1AZSB 2W2OP 2JL9A 2QA2A 2E1CA 2J6UA 5CH7B 5GVQA 1IN0A 5J2PA 2C2MB 1N5YB 4X4PA 2ZKUA 4K5RA 5KT6A 1WHWA 3IN5A 5ETSA 1D0EA 1AROP 2J8AA 1C4CA 1OJ4A 3I31A 3DOLA 4CO3A 4R8UA 3ZZOA 4AYBD 3PTWA 4P7VA 4DL4A 5DJBA 4YHHF 2Q3PA 3D3BJ 1HHQA 2D7SA 1N32F 4CH0S 1JJHA 3TI0A 2ZNYA 4R5PA 3SV3A 2JLFA 2G4BA 3ET6A 1TK5A 4DV3J 1SJRA 4C3LA 2XZWA 4HHHA 2OEJA 4F7VA 4KHMA 2KZZA 3ELHA 1UEKA 1WORA 4DV7J 2F8MA 3G8TA 1BQNA 3IFEA 2H5EA 2LA4A 4LREA 2AJ2A 1EKSA 1W26A 1B4SA 3CJQA 2KU7A 3IO1A 2NS1B 1WG1A 2JRSA 5B0BA 1CQNA 3KHGA 2ATCB 2HIYA 2COLA 3H2LA 4P2XA 3GQCA 1TV6B 3K7RA 1QY7A 2EW9A 4XDCA 2F4VJ 3TA0A 1X4GA 1GX6A 3EVOA 1FHTA 3HSDA 4J9RA 3D54A 3K58A 4DSJA 3W66A 3MXHP 5IWAJ 2QSFA 2W7AA 1BD6A 2MXYA 1YJTA 2GJIA 4UTGA 1S0OA 4OYAA 1RWKB 2IM0A 4ED0A 2R2UA 2CQCA 2WOMA 2W9CB 2ZE2B 1WI8A 4QW8A 4IH7A 4ES1A 3T1HJ 1TUGB 3QATA 2DIVA 2YWHA 2PE8A 2OSRA 2P8IA 1S1UB 2YKQA 2C2RA 2HNYB 5AXNA 3MAAA 4DV1F 1G4CA 1HHTP 4MJKA 3GJQB 4ANDA 9ATCB 4YEAA 3CIMA 2FD2A 4YS2A 2C28A 2OD4A 3Q24A 4PKDB 5C24B 3DLGA 2PDAA 3BSNA 4ZIWA 3I87A 4X4NA 3LANA 2H1YA 5HANA 1RYSA 1MROB 1RZMA 2J7UA 4DJBA 4CM0A 4C7QA 4TLQA 4ZP8A 4OL8A 3R2CJ 2VPWB 2FHJD 2YNHB 2CYYA 5BYSA 3QLHA 1KVIA 3RAQA 2ACYA 2GIQA 2XZDB 2HS0A 3SDEA 1FWLA 3QRQA 1TMJA 1H98A 4EEYA 1VIOA 4MKAA 3HX9A 2BANB 2LXFA 4HDGA 1F3FA 3R8YA 2VV5A 2F5GA 4RBUA 4XDDA 1XR7A 1OS5A 1QVFR 2PN6A 3TAPA 3HD1A 4OJ1A 3UN5A 5M2UA 3MECB 2JLGA 3V6DB 4B08A 2GNKA 1R8PA 4FP9A 1HNVB 3AB4B 2M88A 1BC6A 2CAJA 1VLOA 4UOFA 3R7BB 3MR6A 4QCLA 2HHWA 1X4FA 4ANEA 1K0VA 4MFBA 5HP1A 1OSCA 1WC5A 1HQUA 3QZ8A 2QZ8A 5GADI 2XWYA 2AT1B 2XMVA 5D3GB 4AT1B 2QMXA 4K0KJ 4NLXA 1UPMB 1S77D 4Q0BA 2X1GA 1M5HA 2WZ1A 4Q7AA 2AKWB 2DR6A 3FCVA 2WAQD 2ZH3A 3N79A 1SL2A 3OTBA 1FJGF 2ZC4A 5L1LA 4DBQA 4UUXA 1L3VA 3EVMA 1X5PA 3NLCA 4KT0C 4MK9A 4B3OB 3M6WA 1TKXA 2KDOA 3NGTA 2KJVA 3A8EA 4ELVA 2HHSA 2PSZA 2M0GB 4DR4J 1U1KA 3M8QB 2VC0A 1HQEB 2PEHA 4C8YA 1SH2A 2MKKA 1NZ8A 2YH1A 2Z58B 2V94A 3MCNA 3IR7B 4FF3A 2A3JA 4H54A 4IFYA 1Q7YT 3EUNA 5DETA 4ILMA 3FZBA 1X5OA 3KG0A 2DHGA 4KH1B 3PO5A 3W63A 1C2PA 2HURA 2E5JA 5IT9Y 1KQFB 5K5MA 3W2WB 1RWNB 3OL7A 3WIVA 2KHDA 1YBUA 1MSWD 2OMOA 5F8HA 1W7WA 2XY7A 3VAFA 2OUGA 3IAM9 3H90A 3MMCA 5H9EJ 4CO5A 1FJGJ 2N3LA 4IQXA 2R8HA 1S4FA 3ZZPA 2B7BB 1UEUA 4RKUC 3BR9A 1XQIA 3SQGA 1RT6A 4M5GA 1H2VZ 1R8AA 1VQSA 1K1QA 1RBLA 4JUZA 5A8KA 2X1BA 4DPYA 4U96A 4WE1A 2HVZA 5HLFA 3CJKB 1N34F 1I94J 3TZXA 5A6WA 3TRGA 5LSOA 3LAMA 2RS8A 4LBPA 3NBPB 3QGIA 3N6NA 1EP4B 1HI8A 1SB6A 3W65A 2E7WA 2BKPA 4D3GA 1U47A 5HVHA 4YFUA 1A9NB 2HBRB 1YITS 1KR4A 4NI2A 1CJVA 1P1TA 1KFDA 2PIIA 2IPOB 4PQUA 2ZH1A 3BO2A 2UP1A 2DRAA 4P7TA 4FYWB 1B64A 4DG1B 4ZK7M 3JQMA 2HFNA 5ETQA 3C6TA 4I67A 4JI7J 1H38A 1UJ4A 1LWEA 3B82A 2WVFA 2KFZA 3MMAB 5C7PA 4NLTA 3PRBA 1DJ0A 2RVJA 2SXLA 1N0UA 1XNRJ 2V8PA 5HL7Q 3KNAA 1TL1B 1FKPA 2QL5B 1SPBP 4OX8A 5KT4A 1H0HB 2BR0A 4KQZA 3Q8PB 2YQ1A 2Q66A 1CS4B 4O3QA 4DV2J 3X3UA 1VK3A 3NKYA 2BVZA 3K5OA 1FDAA 4ZOSA 2Z8QA 4H4KA 3NMRA 1DLOB 1GX5A 4X84A 5E2QA 5B7WA 1LW0A 2FJBB 3IBCB 3MDFA 4PRFA 4I2PB 2AJQA 3AQPA 4F0KA 3NOGA 2FHKA 1RU2A 3RW6A 2RU3A 3KJQB 2PO4A 2K3IA 4RUBA 2ZNZA 1AB8A 3HI9A 3TX0A 1L3KA 4B9TA 5AJ3J 4K4UA 2JSXA 4LSNA 3HVWA 1V5IB 4JV1A 4HT5A 1FFSB 4E0DA 3W61A 1XIQA 4J9KA 4LBIA 3KK2A 1YJNS 3CJ3A 4IG0A 2BA9A 2HFOA 3EPGA 1H7XA 3DLJA 3HHNB 5ITHA 1XMQJ 1TKTA 2YPZA 2L41A 2MGZA 2W9AA 3V4MA 1XN9A 1M5OC 3TARA 3M2VB 5L39A 5EDWA 1V9OA 5CQGA 4B3MF 1P8GA 4RUAA 3IXQA 1RAJA 2LFVA 5DZ6A 2V4QA 2VIHA 3MURP 3PW5A 2GQ2A 4RU2A 5KOXA 2NZCA 2CJ9A 2HRYA 3LALA 2XMMA 1K0TA 4WFZA 3Q22A 2BBEA 3AD9C 4DUZJ 4QYRA 4FNHA 3GFYA 3I56S 3UPFA 1IKVA 5E5NA 2RSQA 1RADB 5ADZA 2VL1A 2DXDA 3I0RB 2VQFJ 4ICLA 2EWHA 3CCUS 1RAIB 2NXUA 3MR5A 2PMHA 2Q43A 2FJVA 3D2WA 1MN7A 5SUHA 4ED3A 2HWHA 3DMJA 2OFGX 1N4LA 2R7RA 2WSEC 4G1QB 4M5LA 3KLFA 2YKMB 3TZYA 4ZPTR 1HNZF 1RWPB 4OZ3A 4B3MJ 3MTJA 4TN2A 2IDLA 3PRVA 2H54B 3WC2A 1IR2A 2GMHA 2QG9B 4WU2A 2CPYA 3CUNA 2AYBA 2XS2A 1N36F 1GNKA 2WW8A 1D9FA 2R7XA 2MY8A 5KFAA 2VBWA 3MM7A 1JJ2R 4K7QA 3PW4A 2QLFB 2C2KB 3G87A 1RYRA 5JMNA 2XG8A 2JJ4D 2XY5A 4LMZA 1VQOS 4H4MA 1BWVA 1EIYB 3CCRS 2HHHJ 1X9SA 1RWVB 4U95A 5IS2A 2R2RA 2B8QA 5L1JA 1HW9A 5F0WA 2HBZB 2HQCA 5HMZA 4L75A 1VISA 1CJUB 3H5SA 4OJ3A 4EO8A 3I9V9 5D4OA 1JLFB 2P6SA 3P96A 3I5AA 2VOPA 3VQSA 1C1BB 4J9MA 2JFDA 2IFXA 3SZ2A 3GE9A 3CMES 3R6GB 4M5HA 4AUKA 2XC9A 1H6KX 3PACA 3THTA 4OIXA 2CJBA 4C0OC 3VCDA 5H1SV 4LF8F 1SCJB 4F4KA 5LOQA 1HWJA 3C6UA 3T5LA 2IMOA 3OL6A 4QIGA 4IUFA 2VBZA 3O6QA 3HSZA 3HVRA 2HAFA 3GCXP 1L3TA 3MOZA 3EDRB 4QWEA 3UD5A 4Y34A 3T9NA 5A0YB 3O5TB 1RT5A 3BYRA 3OTOJ 3KWMA 3IR5B 4YY3J 4OZLA 3WHIA 4Q2LA 5HAOA 2VKZG 3E01A 3ISZA 5KAKA 4NL5A 5FD1A 2B0GA 1PJ6A 3N4WA 3LAKA 1HLWA 1VFJA 1X5SA 5K14B 1T8EA 3TAMA 3AA8A 4DR5F 1WC3A 4G1IA 3KLGB 4QWBA 1EQ0A 2K06A 1FXDA 3P8BB 3UN3A 2XLJA 5L1IA 2ZZNA 1AW0A 3QSYB 5F0UA 5JUMA 4TU9A 4DLGA 2H9ZA 4ZVGA 4JBCA 3QGHA 2ZH2A 3AHPA 4OYMA 1V3ZA 2B9WA 3P5BP 2OLWA 4DQSA 4JI8F 2CRLA 5HSPA 1BHNA 2VH7A 3TANA 3C15B 2CPJA 5J2NA 4DPTA 2WTFA 4B3RJ 4ED1A 2DCLA 1HNXF 1H7WA 3IRXB 3KK1A 2UXBF 1XR5A 3TVZA 4JI3J 4ED6A 1Q5VA 1FX2A 1WC1A 2DITA 3FMBA 3MM8A 2L9NA 2XMKA 4P2SA 5G0RA 1U24A 3CCMS 3CJ0A 4K2XA 4FKXA 4LFAJ 4OZ1A 1M5KC 2DO4A 1NXIA 2OSQA 4IRKA 3Q8UA 2AX0A 1M5PC 3WZ0A 4ZVTB 1RKJA 4C48A 3UVJA 1UPPA 4ZPAA 4DR5J 3DXBA 1EZZB 1S48A 3MZIA 1Q5YA 1HBMA 1DQ9A 1I51B 2P9GA 5AXMA 5KT3A 4ZVEA 2WCXA 1JLAB 4C8ZA 1VQNS 3PW0A 3M9OB 4NWBA 3SYZA 2BM1A 2DHXA 4UOCA 2ZVSA 4S0MA 4DR7F 3O44A 1DTTA 4K50A 4RU9A 1XNQJ 4PWUA 4R0JA 2I8EA 3DOKB 4EI2A 3BREA 1EKRA 4WK3A 4OZ2A 1DARA 3QYYA 3K8VA 4FBUA 5GAHI 4JI5J 4F0HA 1Q16B 3W3SA 1NK7A 3UCGA 1RJJA 4EZ9A 1FRIA 3WBZA 2HGMA 4ZCKA 1TFYA 5J1EA 5ETMA 2D3O1 4X64F 4DV0F 2VJUA 4RWWA 2X1FA 1QE1B 4M63A 4UT4A 1VOMA 2DGVA 2LEPA 4OYWA 4DL7A 4ELUA 4GC7A 4ZCMA 3EVWA 2V8DA 3TJ8A 2HNZA 2OTJS 1UMJA 4B3TF 3CCQS 3TW0A 2P9CA 4LVNP 1LK7A 1AA1B 1S9EA 3TQEA 2O66A 3POTB 3P5TL 4NCAA 1F0XA 2RUGA 4K4SA 2ZBCA 3QFWA 1KOHA 4RNOA 2JEFA 1U2FA 3BBFA 2UV8G 4PWWA 4LQ3A 2NXJA 1C1CB 2W1BA 5L9XA 4M95A 1F5BA 4KBIA 3MUMP 5K8NA 1NAQA 4M8LA 2DHAA 2Z57B 2R7TA 3MF5A 3AH6A 2WVCA 3F56A 2HFZA 3NRBA 4ZCLA 2M5YA 3T1YF 4X64J 5E3PA 4NRUA 5HBMA 3EWGA 1PGZA 1VGYA 2UU9J 1RE1B 2XI2A 2LU1A 4KRWA 5DDPC 4PG8A 5A8RB 3A12A 4GKKF 2GVZB 4DWIA 1RAGB 1U49A 1D8YA 3CJRA 4MAKA 3UN2A 2Q6BA 2FVSA 4KE5A 1T3NA 4HLBA 1FRLA 2FLPA 3BGLA 3OVSA 1S49A 3J81U 4IQMA 3OLAA 3JYTB 4CZCA 3OHBA 1ICEB 3EJMA 2K1RA 1UZDA 4DL3A 4Q8FA 2LEAA 4XO0A 1RP5A 5HK4A 1S0VA 1LXNA 3M4XA 4I2QB 2AV5A 2W7OA 4ERDA 5F41A 2E5LF 2VDIA 1FE4A 2IJFA 2CWKA 3CPWR 1LWFB 1WKKA 3HHDA 1YLXA 1TKZB 3RAXA 1N0VC 1E6VA 1FRXA 3SCLE 1HNWJ 1SJ4P 3PJ9A 4RW7B 3IM9A 3BN4A 3MM6A 2DNOA 1QSSA 3NNHA 2VD3A 5JVGQ 1FWPA 3ZNJ1 2HHTA 1S72S 1F60B 3AQOA 2R7UA 4CH7A 2VPXB 4JI6F 1CJTA 4U8VA 3OUYA 3BDEA 1SV5B 2IVFB 3W9JA 1T03B 5CAAA 2J7WA 5D4LA 3I32A 2RQCA 3CW2C 1N48A 2NZ4A 3DRRA 4EGLA 3V5RA 4ZITA 5KFNA 1V3SA 2CG4A 3HK2A 3D0GE 2Z2MA 4MK8A 1OWXA 4DXLA 1KLMB 1IBMF 1PCAA 3G82A 3SEOA 2NXNA 1NSPA 4NLQA 1BUXA 1HI1A 4X65J 3B6BA 2GQQA 4DR2F 1Y3KA 1CULB 3DRPA 3OXLA 2F3JA 4C3MA 3M8PA 2AD9A 2MMYA 1QUVA 1VQ9S 3GIKA 2XSJB 4DCOB 2ZH9A 3R5GA 3MFHA 1OSDA 1YQHA 3QAUA 3MPWA 1PKUA 1EQMA 5KFZA 4DFKA 2DD8S 1N54B 1RWMB 1Z1ZA 2HVIA 1O0PA 3PW7A 2KRBA 2FY8A 4ED7A 2DXFA 2MQQA 3MHYA 1S59A 1RWWB 3S8SA 4B3SF 3HM9A 4FPRA 1ZBTA 3TVYA 3CC2S 1JLGB 3F0NA 3UI3A 4KB7A 3ETMA 4RWXA 3NS5A 3U1MA 3NGRA 3DDIA 3QQCD 1IBCB 1Y00A 2VDHA 2FB0A 1RBAA 4QPXA 4U7UK 4Y2MA 4N47A 3NL0A 1ELOA 4L73A 2BZ2A 3QT8A 4C8LA 5HMWA 4YQWA 2VZ9A 4CYUA 1NHVA 5LMUF 2NREA 3MPYA 4WYLA 1TL3A 1SH3A 2JC0A 2ZOMA 2ZWOA 3ISNC 1KOOA 2CJAA 3PIOQ 4NASA 4N5SA 5K8MA 2QL9B 1MLAA 3B78A 3UFCX 1T02A 1T11A 2O67A 1DTQA 4A8QA 4DPOA 3O3LA 5DDRC 1LV5A 4J37A 5K9FA 5FDLB 2JH3A 3JB9k 3M32B 4JV5F 5ETOA 3OTDA 1JK9B 2Z0GA 1HD0A 2QL7B 2HS4A 4NLYA 3EMTA 1PJ7A 1F2HA 4PXDA 3D6FB 1GXTA 1CJKB 2QMWA 7AT1B 5BR8F 4QYZJ 1Q7LB 1NUEA 1Y5LB 4CT9A 4A8YA 4ENOA 3GG0A 1I1GA 4GVBB 4USMA 4WP9A 1AXQA 4DL2A 1K9MT 2JEJA 2Q6CA 3NNCA 2BE7D 2JNJA 3TZWA 3VHQA 4NXMJ 3JTNA 3BJYA 4LSLB 4WYWA 2Q79A 4NMLA 2G2YA 2FTRA 2OTLS 1D9AA 2ASLA 2A10A 3BH6B 4DX8H 5C25A 1HR0F 4M5MA 1FRKA 5IQ6A 4C11A 2LA6A 3OW2R 4USWA 2FUG9 5KFSA 2QLBB 3RBDA 2YNGB 3MEEA 2W25A 1NB7A 3H40A 4O3SA 2LXIA 1RAFB 4KGZB 3GV8B 5HROA 1FF2A 2GGPA 1HYSB 2V68A 3BH7B 3RB6A 3HKZD 4Q2MA 4IO9Q 1FVQA 1C4AA 1ZZNA 2PA8D 2Y1RI 2P6TA 4DS5A 1HNIB 5E41A 1JLEA 2C2ZB 4QJVA 1SQGA 3FNNA 2DPIA 1AYEA 3OJUA 4A48A 2PD1A 4NA1A 4DFMA 3MGJA 2KB2A 1QM9A 3V4IA 4U7UD 1TKXB 2DT9A 3HSJA 1K73T 1X4DA 5CD4A 4ELTA 1X4BA 3LOUA 4TKTA 4I7FB 4ZLJA 3T5JA 1CC8A 1MG7A 4YB6A 3R27A 3A8JA 5AE3A 3J81Y 1VRUA 3IP0A 1WC6A 2CKWA 3PR5B 4OI3A 4CTAA 1UWAA 1MWQA 3FBCA 2N4CA 3PX4A 4IR9A 3IGVA 4A8WA 1FKOB 3IWXA 3PO4A 3DRSB 2DB1A 4GMKA 4B9NA 5GMKa 1U09A 3BF4A 2DGWA 1RT2B 1OMSA 2EFQA 5KFXA 2F9DA 3CVKA 4I69A 1D3WA 1YZ7A 4X4RA 2GMLA 3K59A 4RW8A 4WFBQ 4AE5A 4LVOP 4HACB 4CLKA 5DM6Q 4OHWA 1KVKA 2IYGA 2RKIB 4LF7F 2HHVA 1NK0A 1QLNA 2VG6B 3LA0A 4LQ9A 2G9OA 4QQBA 2Y8WA 3GIRA 2BEFA 2QTWA 1WNEA 3AODA 1C0TA 5I3UA 3THVA 2HFSA 1CG2A 2XCPA 3OR2A 1UEVA 4LBHA 2YNIB 4KH0B 2R2SA 4PUOB 2PGCA 2V4JA 5IFMA 3JSYA 1T9YA 2HRTA 2MHEA 1WF2A 1R8BA 1JMTA 1X0PA 2HAIA 2EFVA 4NI2B 4QIVA 1QD1A 1R27B 2DEIA 2KVQE 3CJ2A 2HIQA 2LQBA 5FIIA 3A3NB 3QRRA 1X31C 4YDDB 3DOMA 2E5IA 2L08A 2CZVC 4PYDA 1RT3B 3PFOA 1JLQB 1U2RA 2Y1IA 1HBOB 3BSAA 3M2RA 3M30B 4GRSA 3B8HA 2HQ3A 1UCNA 2OIHA 3OXFA 1T9TA 3DLKB 4G6VB 2AJ0A 2FJEB 4Y65A 3RGIA 2D74B 3PX0A 1J27A 3PHTA 3CCZA 3QMQA 2HK2A 3VGTA 1DY3A 5KT2A 3GCWP 2B6AA 1C0UB 2BDPA 3AOCA 2AJ4A 3RBXA 1X0FA 3JSMB 3E2EA 4P2FA 1HMVA 3US5A 2OELA 2DGXA 2MZSA 2LDYA 2RIJA 4LR7A 5DQHA 1IKYA 3RB3A 3M6UA 4AL5A 2QFJA 1S1TA 4KFBB 2RQ4A 4ED5A 3LGHA 3FEYB 2OEKA 3DN9A 2HNDB 1FDDA 1TL7A 2MQLA 4TNOA 3JAMY 1TQLA 4KKOB 3M9NB 5KFFA 3RAMA 1P1LA 1UA0A 2BE2B 5B0DA 4U6PA 4OV1A 1U1QA 3C3LA 1RTZA 2FLOA 2YX4A 2IC3A 4IFVB 4X66J 4NA2A 1DFDA 4JYAF 4NYPA 2F40A 4YB1P 3EYZA 2WB4A 2O1PA 4LIRA 1IKWB 1D1UA 3BGRA 4J7CA 1WEXA 3D7SB 2M2BA 1VQ6S 4DX5A 1YRTA 3KLHA 2A1BA 3ZTPA 4M5JA 5ETKA 3UWTA 2EXUA 4FNIA 4F36A 1HFEL 2LKZA 2ZBPA 4QZVB 1NSKL 5D0EA 1ZM9A 2C3OA 3I5CA 1MW7A 4KV8A 1ACMB 2VB6A 1RLDA 2J6TA 2RF2B 4LR9A 4ALZA 1EHWA 3TNVA 4DR6F 1RT1A 2HWIA 4BWMA 2J9EA 1RTIB 2EKNA 2N4DA 3PEHA 1RTHA 3V6HA 2HSEB 1I5OB 3G6ES 1VQMS 2CZ9A 4DUYF 3M2UA 2EG2A 2OPSB 3VTIA 4EBDA 1REVB 3KLIB 3DFEA 4RUHA 4E8UA 3LGNA 4KGMA 2MQNA 1W25A 4AXJA 4P10A 4QR0A 4CLWA 4KY3A 4RNNA 5CXTA 5CABA 4UW2A 3BN7A 2RNEA 3OBIA 1SUQB 3IS9A 5ETPA 3SFUA 4HTIA 2KT2A 1RTJA 3M8YA 4EBCA 1Z2ZA 4FVCA 5EWEA 6FDRA 3VR1A 4C0BA 3G6YA 5EWGA 4DV6J 4B9LA 4E2FB 4LFBF 4FS1A 3ZO7A 1XC9A 3PIPQ 1HBNB 4DR6J 4WIIA 1NMEB 4MMOA 5D77A 3DM2B 1WELA 3CCVS 4DR1J 1WEYA 2KM8C 4BC7A 2PI5A 3W5ZA 4L3KA 3IC1A 4QU7A 4DUYJ 2LCWA 2N82B 3L9ZA 1QSLA 4RBVA 4C8MA 2BXJA 2RS2A 5E3RA 5AT1B 2LLZA 3C14B 2R7WA 4KHPF 2QLJB 1B3TA 1F1BB 2UXDF 3KDNA 2BYCA 5IM0A 2E66A 4O44A 3LQVA 2NUHA 4RW6B 2BJ3A 3D6TB 4LF2A 2MDAA 1SKUB 1BLUA 1IJEB 4LF5J 4EWTA 4OFZA 3TUPA 1B99A 1SC3B 3HO1A 1YVFA 2MEWA 3VGSA 1TK0A 1JXVA 3NXZA 3H20A 4ZP9A 4WFXA 2DTJA 4P73A 2XYHB 3DGPA 1S79A 1TZ0A 3M05A 1T7PA 3ZZ0A 4OMFG 3BGUA 4GKJJ 1JJCB 1RT5B 2HMIA 2HBYB 1SL1A 3JSRA 1UWBB 1VBXA 2LMIA 2VKRA 4WJBA 1L5UA 5F9LA 3KK3A 4N7TA 2XEXA 4C2MA 3DLEB 5LSLA 2IIHA 1JLBB 3AY0A 1AZSA 3A3OB 2HQDA 5I3QA 4ZPVR 2E5HA 1PSDA 4JI0F 3LWMA 4RBTA 1N5YA 1RAAB 3R2DJ 1G3OA 3MR2A 4BS2A 5I42B 2YTCA 2O01C 1Y11A 1T9UA 4X2BA 4PXEA 2J0QD 2JC1A 3QJPA 2CQ4A 1R43A 3QFHA 4F4XA 2IAJB 1U7LA 3AXMA 4FXDA 3W9HA 3CJ4A 4LRDA 5LL6d 4OI6A 4YP3A 2RRAA 2AGQA 1RLCL 7FDRA 1S10A 1OYEA 2OEMA 4GVLA 2CJQA 2HRUA 1MNEA 5B08A 4B02A 1H2UX 3W9IA 3KTQA 5KOWA 3PXGa 3TOQA 5GAHU 2AEFA 4TQSA 5KG0A 1SIWB 2B43A 1N33J 2RH3A 3CD0A 3RBZA 2ZDOA 2MQMA 3GFZA 4ED4A 2FYXA 1KP6A 5E7OB 4LIWA 3P3DA 1IBLJ 1TV6A 1VC0A 2EI5A 4ETZA 8RUCA 3G8SA 3G96A 5KFYA 4J9OA 3IA0A 4MTPA 2FLLA 2IBOA 4ECWA 1S6QB 5LXRA 1S7HA 3CC4S 3OL9A 1M5SA 2LQ5A 5CCLA 2QEXS 1HBUB 2GW8A 1RXOB 2V67A 4K59A 3O1LA 4NEYA 2KTQA 3Q2SC 1TFWA 3CCJS 1Y5IB 1SJFA 4OX6A 3VAIA 3J80U 2W9CA 3OFHA 2ZE2A 3R5BA 1N5TA 4R25A 3PR4A 3C16B 4UUWA 1UW4A 4O23A 4DSLA 2VICA 2HW3A 1FTRA 1RT7B 1S1UA 4DV5J 1UJ6A 4QOTA 4P6QA 5A8WB 2HNYA 3D1HA 1RHJB 4OX9F 1Y0HA 2DGSA 2NPIA 2KL8A 2XMTA 4WP8A 4ZVRB 2BOAA 5C24A 3IBFB 1JWWA 4ZVQB 5KFWA 2OMLA 4J9NA 2ZH6A 1TK8A 4K8RA 3SCKE 1MROA 5CHCB 4XPCA 2HHXA 2KXFA 3BSCA 5I3PA 2UUBF 3FUYA 2YNHA 3SFGA 2IBKA 3BB5A 3OJSA 3R9LA 4KGKA 1M0SA 2WBRA 5KFPA 2IMWP 2V6AA 2BANA 1KWMA 2D69A 1V3RA 4W90B 3IAS9 2MZ1A 2CPIA 3W1YC 1E6YB 2YXLA 3TX8A 1U1OA 1XEZA 2DHHA 4LF9J 3NCQA 3MECA 1X4AA 3CTRA 4M94A 3KDOA 3LW5C 5LMNJ 3V6DA 1Y7PA 1HNVA 1UA1A 4OX9J 3RUBL 4F4YA 5B0CA 4O0IA 4RW4B 2GO9A 3QJJA 1TP7A 2M3DA 4DPUA 1QSYA 3HPOA 4O4RA 5D3GA 3DDNA 2FLNA 1AFJA 3QZ7A 1BWEA 2FC8A 1Y3JA 3FRZA 4DL5A 1LXJA 3PHEA 1XERA 2J5AA 3I55S 1RHUB 4DV7F 3VGUA 2M9KA 3HFZB 2WSCC 1GMWA 5DDQC 4DPWA 2WBMA 3BZQA 2W24A 3UNGC 3ITHA 4ZJOA 1KFSA 2XO7A 1WG5A 2B9EA 2VQEF 4B3OA 1OY8A 1VRTB 2EEYA 4UZBA 4LF4J 3JQKA 4KGXB 3PDNA 3D66A 3G6VA 4FN5A 4WU3A 3M8QA 2OH2A 1HQEA 2F4VF 4ZDNA 2BJEA 3AOBA 1FX4A 1IKXB 1VQ8S 4LF6F 1ZM4A 4Z7CA 1S12A 4XAKA 2BJDA 3KG1A 5D4NA 3Q8QB 4O3NA 5IWAF 3GG1A 2F1FA 2B5JB 4WTYA 2HHUA 2WVEA 3CJ8A 2VG7B 2ZUAA 1L3UA 3W2WA 1BXNA 1SC4B 2W8KA 4F4ZA 2DKOB 3OXGA 4F50A 3LF0A 3T1HF 4F3OA 2GS8A 4CLSA 2MLZA 2KJWA 3MM9B 3LTOA 4O4GB 2B9YA 2YQ0A 4DX6A 2KZMA 1YJWS 5CYQB 2Y3YA 1GXUA 1UFLA 1ZH5A 4KYZA 2QRRA 4DU7A 2VQEJ 1JNZB 2GFFA 1NDKA 5M2RA 1IR0A 4DDFA 2O3DA 3B54A 4IG3B 1UW9A 3K8WA 2F4FA 5IZHA 3B4MA 3C66A 5L9NA 1S1VB 1EB0A 2OHDA 2MJNA 4HTJA 2J0WA 2CQ0A 3WIUA 2WVDA 1R8HA 4LF6J 3CJKA 3RBEA 2WB1D 2W4DA 4Q45A 2ZH8A 3QRPA 3NBPA 1EP4A 3PKYA 1MMDA 2UVRA 2KO1A 4N8OA 3NY0A 2DRBA 5I4MA 4ZVFA 1OO0B 5F8JA 3N0VA 2C1EB 1YBAA 2F7VA 3ZTRA 2YWKA 3H98A 1KC8T 5CYMB 3OSPA 4DN0A 1APSA 2XBPA 1VHIA 3VVTA 3M9MB 2HK3A 2FHMA 1RU1A 4DG1A 4WZQA 1SQEA 4QIEA 1FTCA 5CZVA 1S1XB 3PYEA 1L3SA 3PYGA 3MMAA 1REGX 3FC9A 3CB4A 3HFKA 4WWSA 1S1WB 1JJ4A 4C4WA 1TL1A 2MHNA 4CO4A 4JI4J 4W98A 1NJYA 3QBCA 4TY8B 3HT3A 3FQLA 1RHMB 1SI9A 1CS4A 5BXIA 2AZ1A 3NEKA 2GO8A 4K0KF 5KFTA 4HHJA 3CDEA 1ZETA 1HW8A 1NPPA 2J0SD 3BS9A 4K5SA 1DLOA 5CA5A 2WSFC 3E8OA 3LP2B 4F67A 3GMGA 5IOLA 4JI1F 4A8KA 3EGNA 4I2PA 2VHGA 4WFNQ 2ZEJA 2LQ8A 3W8GA 4X4SA 3CCWA 3BO4A 4DR4F 4HDHA 3FFIB 4BHQA 4CDIA 2B3TB 3O8WA 4NA3A 3N9UC 3S1TA 3I0SB 1TTHB 2XB2D 3VF0B 5DZ7A 1G6BA 4W92B 2CQBA 1IWAA 2JHEA 3KKFA 3J80Y 1IM6A 5KFKA 3FMWA 1WKJA 4L72B 3CJ5A 4FXVA 4KGVB 2R7OA 3BKTA 2XO6A 1PYOB 3TZZA 3CCSS 3AB2B 3RB0A 5D4PA 3DHXA 3W2VB 3M2VA 3HHLD 2JEIA 2WONB 2IRXA 4ECYA 1OPZA 3KMQA 1FI4A 1PAUB 4K4VA 1RWXB 1S7IA 1U0SA 4O3PA 5IT0A 1NB2A 2GHPA 3QIPB 2PMZD 4RO0A 4AL6A 1FVSA 4K4XA 3DI6B 4JI1J 1GH8A 1G1XA 1VDHA 1SXLA 3ADAC 1VR6A 3UO0A 3HHLC 4IH5A 5HQMA 1T3OA 4X62J 1FEEA 4BWJA 2CNKB 3KUHA 1UKUA 4CNZA 3EPIA 4PZVA 3M6XA 1T9VA 2VODA 3AJ2A 4FYVB 4C0HA 2XSFA 1YSJA 1ZZFA 3FCHA 1YRUA 1I94F 1F2GA 3W60A 4PWDB 1DQAA 2UVUA 1LWXA 4R0EA 2I38A 1T95A 3CULA 4HR2A 5KG3A 2IVYA 4LFCJ 1YX2A 2CADA 3HZEA 4CWBA 2W4CA 4X4UA 1DQ8A 4G1QA 4K4YA 3AXKA 2YKMA 3U7JA 2QSWA 3QNWB 1R0AB 4EZ6A 2BX6A 3CGIA 4TYAA 4JI7F 1V5VA 4QWDA 4I6AA 5EX0A 3HVTB 1SBRA 3D9BA 4K4ZA 5L46A 2ZBIA 2BMBA 2GCFA 3IR6B 2DNKA 1D9DA 2KT3A 2BRKA 4TY9A 5E3AA 1XNRF 2V34A 1VYAA 1KQSR 1MU2B 1QTNB 2QA4S 2OPQB 2LXUA 4DV2F 2C3YA 4DL0C 5KFCA 1PG5B 1FD2A 1RT4A 2NYHA 1GMWD 4ZKAA 3G71S 2DNYA 2IM2A 3K5MA 3LGMA 1U0HB 2RRNA 1CJUA 5HMYA 3AD8C 2JLEA 2KH9A 4YOEA 1JLFA 1S57A 5AXLA 3L3CA 5KTQA 1EJ7L 2RHSB 2XTJP 3PJWA 2FZCB 1HHSA 2CJYB 2AMCB 3D0HE 2W2NP 1C1BA 2BJ8A 4MYTA 3SSSA 4ZA1A 3M8ZA 4DUTA 2JDJA 4WF9Q 5AJ3F 4N41A 2XLKA 4V19J 1QAJA 1FO1A 2VPZB 3JTOA 2K7JA 3D3CJ 5HJYA 1K44A 2D1CA 1HIYA 2H5IB 3D1QA 3FK4A 1RACB 3KJNB 4O3RA 1Q8KA 3I4HX 4CLFA 2ASJA 1XMQF 4IOBA 1IM4A 4LRAA 2CPXA 1XJWB 4ZPCA 3E3XA 3HP6A 1X5TA 4ECXA 3D67A 2A18A 3H8YA 1NO8A 1JKHB 5A0YA 4DQIA 2QO3A 1WF0A 3MEDB 2EVZA 1U1NA 1U6BA 4TXSA 4YB5A 2FZGB 2LQJA 3LPEA 1LQ9A 4LRCA 1S9GB 1AFIA 4FYYB 1VQ4S 3QWPA 3WX4A 3BV8A 2CNNB 1ZAWA 2R7SA 1N6QB 3L7UA 4CIOA 1QAIA 1R6VA 2JX2A 5LXYA 3UCZP 3CD6S 4DUZF 3KLEB 4USJC 5K14A 4P71A 2QFIA 2Z2YB 4CLPA 3KLGA 2YX7A 2I5JB 3MCOA 1BGXT 3FSYA 2AHOB 1RSCA 1IBKF 4J9UE 2VQFF 1PC4A 4ID5B 2XZTB 2YKAA 2Y1JA 2GA7A 1RKIA 3V2UC 3PX6A 3IG1B 1HWIA 3OFGA 4C98A 1D8ZA 1TL5A 2LQ9A 2HHPA 4DEZA 3K5LA 2JEGA 3QT5A 3GJRB 1DZ5A 3C15A 2MKHA 1TVRA 2BW7A 3MAQA 4KO0B 4J5OA 2KG0A 4I64A 1EAYC 1U02A 2GIFA 3KJVB 3IRXA 1RI7A 3HKWA 4O3OA 2G0JA 6AT1B 2GVDB 1Y4ZB 5G4DA 1NPKA 1K47A 3X1LB 2HVHA 4U67Q 1R89A 3BQ1A 5JVHQ 4ECVA 4RNFA 4DZDA 3UDEA 3UDLA 5KG4A 1K1SA 4KAIA 2NR0A 3VAGA 1I6JA 4BLGA 1ZPVA 1F9FA 3ENAA 2FZKB 3OR1B 2XMUA 2DH7A 3FDSA 2YWWA 1SC1B 2ZH7A 1IBKJ 1JLAA 2HHHF 2GV1A 3CNQP 5E3CA 5KFUA 3EZ5A 5IT4A 1U6FA 3HLUA 3MCMA 2W7PA 1S0MA 1YBTA 1NK6A 1XK8A 1H2TZ 4DPXA 5KT7A 1RQ0A 3R7NB 4RJVA 2YX1A 4M5DB 1KSPA 5D8HB 1X9WA 5DGAA 4RW9B 3DOKA 4FYXB 4PQAA 2BACA 3VWSA 2Y0SD 2VFUA 4NLWA 4HL9A 1PILA 5T14A 2H4YB 2YNFA 2FHJA 3I4PA 4NCGB 3M1VB 3GONA 3ZZTA 1KVJA 3FJ2A 2DGOA 3EX7B 1OPIA 3TJ9A 4OZJA 5KFDA 3ENWA 4ER8A 4DN9A 5CZXA 1YKWA 3J7Z5 2YVSA 1QE1A 4F3QA 2NYIA 3OTOF 3L4BC 5HATA 1A0OB 4J91A 2GAHC 2PEBA 2W9BB 4YY3F 1VJQA 1R31A 2DBBA 3QO9B 2DK2A 1GMUA 2NXCA 4J90A 4LRBA 1JLCB 1URRA 3MUVP 3UR3C 1HWKA 5DQGA 4N8NA 3DYAB 1A6LA 2YKNB 3ZNUA 1CLFA 2E7VA 3POTA 1NH7A 3T6BA 2XQCA 3L7OA 1Q8LA 2CVEA 2ILZA 2R4FA 3QAEA 1C1CA 3V6JA 1UVLA 1X7VA 3MM5B 3TYTA 2RE1A 2YWGA 2OP5A 2X51A 4C8NA 2VG5B 1RA7A 2HFUA 1Q79A 3L95X 3G8QA 3R1HA 3J7AN 2J9DA 4QWAA 1ZM3A 3ZTQA 4WK1A 1N56A 3DRYA 2UXCJ 2IJNA 3BBBA 4B3RF 2HLTA 2NUUG 2XYPB 4ECUA 3SSQA 3FCWA 2F8EX 5A8RA 2ZJQQ 2ADBA 5IV4A 2GVZA 4X4OA 2NXEA 4JI3F 3MMBB 3NAIA 2DVIA 3AA9A 4IR1A 3TEGA 2PFFB 1R3NA 3QT6A 5HVFA 2IDEA 1Q1KA 1VQ7S 2I6WA 4ZHRB 2C2DA 1HI0P 3JYTA 3JS9A 1GT8A 1VI7A 4LFAF 4FBTA 2LECA 2QN6B 3CDUA 3CT9A 3A8IA 4UOHA 4NXNJ 4MIWA 4F26A 4NLSA 2PA3A 4DQQA 2LDIA 5B09A 3MTKA 2AGPA 4RNMA 2GMJA 3K2YA 3MPUB 4LT6A 2ZD1B 2UV8A 3JSBA 2BQ3A 4I2QA 1R8CA 2CA9A 3V81B 4CQ1A 1SQFA 1TAUA 2O5DA 3IWNC 1P9QC 1RUSA 1LWFA 2QLXA 4JV2A 2CUYA 3BO3A 1EETB 1KTQA 4IDKB 1TKZA 2EFPA 2VBXA 1XMOF 1FCAA 4PPDA 4OLOA 1XNQF 2X3GA 5C2GA 2ZHAA 3VAJA 3H4DA 2JWNA 4BBYA 2CQ3A 2AZ3A 3C2PA 4RW7A 2ZOFA 1NRKA 2ZUGA 2CPFA 1ROFA 2XY6A 4IKAA 3OLBA 2IRUA 5KFVA 3D68A 1ZTTA 2QC3A 3QJLA 3OFFA 4JI5F 4D3HA 1WHVA 3CO0P 2AF6A 2B4PA 1WOOA 4USIA 2BJ1A 3KUEA 1SV5A 2DRDA 2RDJA 3NWGA 1RHRB 1T03A 4GO5X 3NNAA 5DO2A 2YBVA 2QX0A 3CDWA 1NK5A 1EARA 3MEKA 1QAYA 4OI0A 2IVMA 1QJHA 1ZS6A 1NK4A 4XIUA 3W5YA 3M8WA 1SKRA 2C2EA 4DR3J 1KLMA 2ZWPA 2QT7A 2H4WB 3TQ1A 2V2VA 2G2ZA 2DJWA 2WVBA 3NAHA 1VHFA 2AQ4A 3RJMB 3MFIA 2FJWA 5J2QB 4WBFA 5T7LB 4Y28C 2XYGB 4X4QA 1XMOJ 1CULA 2ROGA 4WCEQ 4H4KC 2B9XA 1J5OB 4DV4F 2XSJA 1Q82T 3RRHA 1S97A 1CQMA 3T1AA 3G6XA 2R8IA 2PT0A 3CC7S 4DLEA 2DGQA 3GSIA 3A8KA 3EXYA 5ETTA 2C22A 1Z2LA 3Q8RB 2AP6A 2FVQA 4ZVPB 2EKYA 1UVJA 1FE0A 2M8HA 4PEOA 3R5DA 4JI2J 1JLGA 3T41A 2MQPA 3LP0B 3D6HB 3UQSA 2RQKA 3GJSB 5HVGA 1P9YA 3DC2A 5LJ5Y 3M7VA 4IRDA 1KS2A 3DLLQ 5KFOA 3JXOA 4ZP6A 1SVDA 2WRMA 2UU9F 2HG4A 3DNCA 3S01A 2ACMA 2OPPB 2HQFA 1VQ5S 1HD1A 1U6ZA 1RK8A 4YHHJ 4MIBA 4GC6A 4YUDA 1RISA 4ZVHA 2I9SA 2LU2A 1N32J 3CWJA 4DV4J 2I1RA 1FXLA 1LW2A 3BYPA 2RRBA 1HPZB 2AYEA 2OFHX 1B0VA 3N5FA 4O0NA 3F73A 1YZ6A 1RCOB 4ILRA 2J76E 3Q23A 3HHLB 2C2OB 5C42B 1R7IA 3CXCR 1UL3A 2KKHA 5FDLA 3GP9A 4FKYA 1D09B 4OYIA 3CIZA 4C9DA 3RZAA 2OPRB 2A2DA 3M32A 1WOSA 3ENVA 1RTDB 4OZNA 3VAHA 2YPYA 3EGWB 5LM7E 3BPSP 4USVA 2W01A 3UCUP 4M5KA 1CJKA 2DXEA 3NS6A 3D1OA 1U2CA 3MOJB 5J2MB 1OQ6A 2RILA 1HNWF 2DNPA 3ZC4A 3T9ZA 1FK9B 4UZCA 4GVBA 1Q0NA 3FSXA 4HI2A 1VS3A 4YMEA 1LWCB 2D3ZA 2QGFB 4LSLA 2H65B 2AW0A 5B0EA 3CMQA 1O6XA 2V4RA 1JB0C 3BR8A 1NK9A 2F65A 1PYTA 1NM2A 2Y8YA 1XTZA 3Q0AA 5AE2A 2XWXA 3PJXA 3SXLA 1CVJA 3LP1B 3DHWC 3CCES 2DEJA 2R42A 2P9EA 2AGOA 2WW4A 2YNGA 3CF5Q 2BQRA 2MSTA 4DSFA 5DDOC 3T19A 2J6SA 2M4MA 4X65F 4P9SA 3K0JA 4DV1J 4NLPA 1HYSA 4H4OB 2AIRB 1BQMB 2KXHA 1HKAA 3DU6A 4CRJA 3H42A 1U8SA 3CD7A 3AJ1A 2CFXA 4USUA 3IBWA 1HNIA 2ZBRA 4F25A 3J7A1 3OTEA 3W62A 2V8VA 4G65A 3EZOA 3P6YC 4OJHA 1S6PB 3ITHB 2L3MA 1FA0A 2E9ZA 4KR0B 1QUPA 1JX4A 3MEGB 2MJUA 4PXBA 4I0WA 5KFGA 1Q8IA 2EC0A 2DNRA 2ZC3A 3GR0A 3EICA 3GFXA 5J2PB 4OHYA 4I7FA 2XNQA 2YKPA 1MWZA 1RCXB 1MMLA 2XS5A 3TA2A 4A8XA 2QE5A 1FNMA 4USHA 4DS4A 3FSIA 3DOLB 2GX8A 2RB7A 4R8UB 5DGBA 2QLWA 3HDSA 2VC1A 4L74A 1F3VA 1IJFB 4PG4A 4OYOA 3PY8A 4USKA 1FKOA 1VBYA 1V6HA 4R5PB 3DRSA 4CM2A 2EBGA 5H9FK 1W2BR 1VCTA 3ET6B 2RU9A 2DPJA 2MZQA 2DO0A 5GMDA 1NJWA 2GJFA 5IC4B 2EFGA 1RT2A 4JB8B 4LRFA 4NZ0A 2MY7A 1BQNB 2BKOA 1TU0B 3TVKA 1H74A 4HACA 1X60A 3D28A 2RKIA 3HCXA 2VG6A 1KONA 1NNDA 5IV3A 3ISND 1DURA 1KHVA 3OD2A 2BJ9A 1R0CB 3VAKA 3I6PA 4UOGA 2KN4A 2ZJRQ 2YNIA 2F8HA 4PUOA 1ULRA 1J2VA 4NXMF 1NDPA 2ZH5A 1W2IA 1YJ9S 2BKNA 2EBEA 4DOZA 4ANCA 4DQRA 1P6TA 3SV4A 4EO6A 1X4HA 1T05A 3S6EA 4WZMA 2WOMB 1O51A 4ZPBA 2PMWA 4ZS6A 4OYPA 4P2MA 5DRKA 2KG1A 2G13A 2K3KA 4F2RA 3PV8A 1RT3A 1JLQA 1IQTA 1HBOA 3RYLA 2GIRA 1DAXA 1FJ7A 3M8SA 4YR2A 3H2VE 3FBFA 3M30A 3EE3A 3MAAB 3OVBA 1FRJA 1G2EA 2CIMA 5GADU 2WK4A 3U1LA 3DLKA 2MLYA 4YDXA 4HT7A 3DLGB 2D41A 1FJEB 1OQ3A 4Y3CA 3RW7A 4ILLA 3HMJG 2G0CA 2FJDB 5FJ4A 3JTPA 4GO7X 1N34J 1BY9A 2CVIA 4C3KA 2QA4G 3GPAA 4MKYA 1YDLA 3MD1A 3KUGA 3VZIA 2H3EB 1JNRB 1FDNA 1C0UA 3R5CA 4ZLLA 4ECZA 1DHMA 3JSMA 3QLHB 3LUYA 1F9HA 3SDEB 2V9KA 4KFBA 2AEJA 2AWZA 4OHZA 3ZZZA 1URNA 2DNNA 3OV7A 5E33A 2RD5C 1UP1A 2MQ8A 2FVCA 3OPKA 3OL8A 2M7SA 4NX9A 2HNDA 2DR7A 2C3UA 2Z56B 1RB0A 3CO9A 2EK1A 3SMZA 3NG8A 1NJXA 4KKOA 1UFKA 2BE2A 2BABA 1SKWA 1HWLA 4CO1A 4MFBB 5HP1B 1B7YB 1VMBA 3HF5A 4CT8A 1HQUB 3D6MB 2YKOA 3MPVA 2HQIA 5JXSA 4B9MA 1Z4UA 4IFVA 4L76A 4Q0BB 1NEEA 2IYIA 1AUDA 1Y5NB 2XMWA 1KEKA 4A8SA 5KFLA 3Q86A 5F9NA 1IKWA 2OJ3A 4C8KA 1S6UA 4LJMA 4RNHA 1FJCA 3VGVA 5AXKA 1JXLA 2R8KA 5CYJA 3HZGA 3GLJA 2ILYA 5EHHA 2KFNA 4XK8C 5DLGA 1ZTWA 4HVZA 2RF2A 1ITPA 2MKIA 2W2MP 4C8OA 2UUTA 4IFYB 2HZCA 4KPCA 4PG6A 3GILA 1RWUA 4QIFA 2F9JA 3GR1A 2BM0A 1RTIA 5DQIA 1NLKL 1RABB 3ETOA 3PNIA 2HFVA 4CO0A 1YJUA 2ROPA 4U7CA 4NZ6A 1CC7A 5RUBA 1WEZA 2OPSA 1FWKA 1REVA 4RPFA 4Y2IA 3KLIA 4URQU 3EXCX 2G1HA 4J9SA 5F8MA 3MMCB 2LYVA 1U25A 5D0HA 1WDTA 3BPDA 2HBQB 1I3OB 4FF2A 4ZN1A 5D0RA 1SUQA 3AD7C 3GWCA 1VQPS 3SQGB 1RBOB 4X4VA 4ZN3A 1NK8A 1RT6B 3C46A 1DBDA 1PJ5A 2DNHA 5LJ3Y 1GFWB 2VFRA 1HL6A 2VFSA 5DS7A 2M52A 2GHWA 5A8KB 3M6VA 2ZKTA 2XMJA 1HBNA 4WE1B 5HLFB 5BJRA 1VC6A 1RT4B 1KN6A 3DU5A 3G2XA 4F2SA 4TYBA 4WPAA 3DM2A 5KG1A 4CLUA 1MN9A 1FDBA 2X1AA 2WHOA 2E29A 2JVRA 4M1KA 2HZVA 2AEMA 1PBAA 1U1RA 1U1MA 4OYBA 1CJVB 3HVAA 2FGCA 2RQMA 1WF1A 4PQUB 1NH8A 3BQ2A 1HNZJ 5F8GA 2ZDPA 2VONA 3C14A 1RHKB 3C6TB 4HH0A 1N36J 1SIZA 3J7ZT 1LWEB 2V8HA 1F9EB 4OYZA 1UVKA 1PAEX 1MMNA 4RW6A 4V19X 2P2CB 2IY5B 4OYXA 2APOA 2XMAA 3I5BA 2HQGA 2CG8A 2ADCA 1FKPB 5BYRA 3GV5B 2EG1A 3CEDA 1S9FA 5DG8A 3GB0A 4QPTA 1IWGA 1UFWA 3H7HB 4RR5A 2OI2A 5KFEA 2KVIA 4PYAA 4NMXA 3N5BA 4QW9A 2L48A 5KT5A 1U1LA 4X66F 2ASDA 5KG7A 3QPIA 2EK6A 5SZTA 3DCAA 4DSEA 3RR8A 5H9EK 3MI7X 3UDVA 1UWBA 2XHWA 2RT3A 1LW0B 4P74A 3DLEA 1U45A 2FVRA 5KG5A 4Q44A 1JLBA 1B70B 4WFYA 3OHAA 3AOAA 4NRTA 5GMEA 3H4BA 4J9VA 1H3DA 2CDQA 2HGNA 3EM1A 4LSNB 5I42A 2MZRA 2F63A 2W8LA 3AFGA 4V1Ak 4OI2A 3KK2B 4LF8J 3G86A 4IG0B 2E7XA 2DR9A 1FRHA 3KXDA 3R6LB 4Y2AA 2IAJA 1WHXA 2DNZA 3F41A 1TKTB 3PRDA 4IYQA 2MGZB 4A4JA 2FJAB 2KHCA 1RAOA 1LKZA 3DLBA 2AU0A 5F8NA 2CQHA 1VQYA 1WSRA 1TVRB 1YJRA 2V50A 2JOQA 3OVAA 3KHRA 4USTA 4WTOB 2OO4A 2FY1A 1CEZA 4MH8A 2RHQB 3U02A 4MIAA 2EFNA 4I56A 1KDNA 4OQJA 2FDNA 2ALZA 5ETVA 1LOUA 3GYGA 5GAGI 3VZHA 3BGFA 4B17A 3ZTSA 3W5XA 2DY1A 4DV6F 5L1KA 1R0BG 1OY9A 1IKVB 1S6QA 3AAWB 4QIWD 3EGVA 3H2UB 4TLRA 1XR6A 3GV7B 4ICLB 1LFWA 4DR1F 1HBUA 1SJQA 2VA3A 2CQGA 3HSGA 2KFYA 1BE4A 3KHLA 3J7YI 3DMJB 1KNZA 4HI1A 3KLFB 4JI8J 3H5YA 1UJ5A 5T41A 2PC6A 3GFHA 3SCJE 3T3FA 1WTBA 3C16A 2C3PA 1HNXJ 1WI6A 1WDDA 1JQGA 4KIAA 2UXBJ 3UR0A 4KSEB 1TR0A 1RT7A 3NWRA 5A8WA 1S5ZA 3MM7B 4ECTA 3AT1B 2YNFB 4CO2A 1YGYA 2FIUA 2G0IA 4LF5F 3VALA 3CJTA 4F3MA 2ZM6F 1FKAF 1H72C 2MZTA 2LP4A 3KNGA 4BCAA 4F4WA 4H4MB 1ZAVA 1F5AA 1OY6A 5JJBA 4P75A 1TELA 1CPZA 1FFWB 2G1DA 4GKJF 1SC6A 2KT5A 4DSKA 3TJAA 5HO4A 1GQEA 4ITSA 1FEHA 2AJ1A 3S7RA 2XGPA 5B0GA 4DR7J 3NP5A 1YK9A 1CSJA 4ZVSB 4A8FA 2B7CB 2GAGC 5IC6B 1NKEA 3TP2A 4KTQA 1E6YA 6FD1A 3N6LA 3UD4P 2CNOB 2R8JA 4Z37A 2HS3A 4DCPB 3BSOA 3W8PA 4FDFA 1YJ7A 4FZVA 2E1AA 3C6UB 2DYAA 4RW4A 2ZM6J 4K2JA 3QGGA 1SL0A 1VBZA 1UVNA 3SIPB 3MPDA 3ILJA 4DV0J 2BOPA 2CJKA 2MB0B 4AFFA 3FBEA 2NSBA 3A1YG 2QA1A 4FS2A 2HEKA 2N3OA 4NCBA 4W4MA 4NE9C 1M1KT 2HVEA 2KXNB 1HARA 3E01B 2D3UA 1B0PA 3RR7A 1N33F 4E98A 1ZYQA 3HHEA 1VRTA 4B3TJ 3KMSA 3GYNA 3TA1A 8AT1B 4IOAQ 5F3ZA 1GXLA 4L6V3 1IBLF 5B0AA 3PM9A 5EUHA 4K4WA 3FZ2A 5AE1A 5ETNA 4F02A 3TAMB 3P45B 1P27B 3B4DA 3R97A 3FQKA 1WKLA 1IKXA 1YHQS 1X9MA 5GAEI 1F6TA 3OFEA 3W7BA 4YB7A 2B5JA 4FPIA 3K89A 3FBBA 2NSCA 5F3TA 1WTFA 4I6WA 4DCJB 2VG7A 1X4CA 1YIJS 3TWZA 2XCAA 5F8IA 1GTHA 1OIAA 3T1YJ 3ZXWA 1Q81T 4ID8A 1FERA 1T0TV 4OHVA 3MM9A 3PVXA 2J9CA 5J2NB 4PXCA 4O4GA 1NU4A 2C2NA 4QBUA 1AT1B 4ED8A 3KK1B 2CDRB 4Y0FA 4GKKJ 5CYQA 4ZLNA 4DV5F 4M5IA 1F5CA 3MM8B 1YRXA 5G0RB 3SBMA 2X7IA 4DMZA 2IJRA 2X3DA 4KHRA 1RAHB 4IG3A 1VC5A 1EX8A 4UY85 2ZHBA 1S1VA 1FNOA 3IM8A 3N6MA 2ERRA 2ZZTA 3UVJB 1IQZA 1SJ3P 2BRLA 1HBMB 4AQYF 5K8OA 1G7CB 2J0XA 3D5MA 4PCQA 4DZ6A 2IA0A 3N28A 2E5LJ 4HHUA 4JV0A 5MLCV 2E1PA 1Q4RA 1JXEA 4JP8A 1NJZA 2IM1A 4IO1A 1KQKA 2XLIA 2M8DB 4ED2A 1DTTB 4OV6A 2Y1LB 2XGQA 2R2TA 3SCIE 3T5HA 3P4UB 5CYMA 3GU0A 3GZ7A 3RRKA 2ABYA 4WKYA 2VUGA 1FESA 1VQKS 4URGA 2BQUA 5EN1A 4WIQA 2BV3A 2Y0BB 4PABA 2HGLA 4LF9F 1S1XA 5K20B 3TUIC 5LMNF 2QYCA 2AJFE 2M70A 4P72A 3K57A 1PBUA 1KHWA 1S1WA 1KD1T 4CH1A 2E5GA 4JI6J 5EGYA 4U9RA 4G1PA 5HI7A 4CLLA 4WP3A 5J1EB 2VU5A 3LO3A 4TY8A 2Z30B 4OLPA 3TO8A 4F0MA 4AQYJ 4LUBA 2I0XA 4NOHA 1ZA2B 2B4VA 1SJ1A 1IBMJ 3LP2A 4NYZA 2KI2A 4ZP7A 2HNZB 4DR2J 1R6YA 1U26A 2CPZA 4LF4F 1O5JA 2QYGA 2CPDA 2K2PA 4Z7YA 2Z2ZA 1S99A 3ZTOA 1S9EB 4LSZB 3FFIA 3J81j 2LVWA 3BEGB 1LW2B 2DH8A 2JFKA 3I0SA 5BYQA 3P49B 3JAMU 2ZJPQ 3ILLA 2DNMA 3PZPA 1FNXH 1M1HA 1S0NA 2AX1A 2QMUB 2FGOA 2OKQA 3C8YA 4B3SJ 3GIJA 4UQTA 3M8RA 4ZIVA 1XMBA 2ALYB 2DY9A 3WQPA 5L38A 3V6KA 1Q95G 4OZ0A 1T9WA 3W2VA 5D6GA 5HBMB 5THWA 3KG4A 2WONA 1Y10A 2DGTA 2D3OR 2CPHA 4Y6IA 1Q86T 4DFPA 1VQLS 5LMUJ 3QIPA 1X8DA 3DI6A 1YG0A 4EK2A 1RWOB 4CP5A 3TEHB 4FYDA 4EBEA 2R9LA 2HPUA 3FVYA 1WHYA 4I68A 3BBCA 1O8BA 3CD5A 2MSSA 2K1RB 1NPRA 2JZ5A 3K17A 4NLDA 5FLXU 5HN0A 2E44A 3GSDA 4MT1A 1Q78A 2BE9B 4QWCA 4U8YA 3PW2A 4Y2KA 3BM7A 4PWDA 3A3PB 4NPOA 2MKJA 2NCKL 2QIFA 2FPHX 3NCRA 1U4BA 4JV5J 4ZPDA 3BDPA 3HHKA 4UQGA 4NLRA 2XM3A 3CDAA 3L09A 3UW1A 2E9TA 2XULA 1WUUA 5J1PA 3BKUA 1T94A 4DU8A 1E6VB 1NJIT 1GTEA 5BR8J 1KLNA 2MZJA 1R0AA 1N5QA 1TUWA 1TUVA 3PCOB 1NSQA 1ZM2A 3MM6B 4AXIA 2HHQA 3HVTA 2J7KA 2D9OA 1PYSB 3NGSA 1WG4A 2ATLA 1U48A 4QU6A 4UF4A 1CJTB 4NEZA 4DX7A 1MU2A 3KOAA 3OUYB 5DG9A 2CQ1A 3ONQA 1H73A 4JI4F 4ZVUB 1VLYA 2KRRA 2MYFA 1HR0J 2OPQA 3Q89A 5ETRA 4TQRA 4AD6A 4WKRA 2DR5A 5A2QU 3DRRB 2XS7A 1U1PA 1NHUA 1FT8A 1FXRA 4I6YA 1QTMA 4A46A 2V63A 1YI2S 3G82B 2MTLA 4OI4A 4B9SA 3LWLA 3QWUA 4MYUA 4NLOA 1KQGB 1QVGR 4OX7A 3MMJA 3DXSX 4NLUA 2H51B 5HQ8A 1XWLA 1U0HA 2IA6A 3DRPB 3M8PB 3Q8VA 2YWEA 4G3IA 4Z2XA 2V2QA 2MLXA 3HT0A 4BC9A 4TVAB 5LT5A 2CQPA 2FHOB 2UZAA 4I4BA 3Q2TC 4J9LA 3A13A 3ZZYA 2BJ7A 3CMAS 2EC2A 4TU8A 4CLTA 2RAQA 2E9RX 2DNQA 3WC0A 2ZH4A 1IVZA 1RA6A 2LEBA 1PO6A 1IUJA 2R3VA 4Q8EA 1RHQB 3PYFA 2BUNA 2V2KA 1YJVA 1FRMA 2OAUA 1VRQC 5HMXA 1JKHA 5DM7Q 4ECRA 1RAEB 1J5EF 3RU0A 3MEDA 4CYUB 4ECQA 2Z2LA 3EZUA 2OD6A 4MKBA 1TL3B 1SH0A 2ZBQA 4DQPA 4DF8A 5C5JA 3H5XA 2UUAF 1S9GA 4EUVA 4X62F 1UETA 3U1NA 2V8GA 3BGOP 1N6QA 1UTAA 1N88A 1T05B 2UUWA 2DNGA 1M90T 3CDBA 3KLVA 3ZFVA 1NHKL 3KLEA 3THPA 1DTQB 3PEJA 1WC0A 2VPYB 2I5JA 3QSIA 1N52B 1GEHA 3ICLA 1NSAA 4ID5A 1HWUA 3K5NA 4RUCA 3OTCA 2GHVC 3IG1A 4LFCF 5D78A 3MAHA 4LF7J 2MPUA 4IRCA 3FKBA 4DL6A 4X4TA 4RLEA 4ES2A 3LPYA 3MUTP 1YTYA 4KO0A 3CE8A 1IR1A 1J5EJ 3SSRA 3EDQB 1UZHA 3KJVA 3ZZRA 2GVDA 2N7CA 2UUAJ 4RX6A 4WFAQ 1NDCA 5KFJA 2YY3A 4ZCIA 4TU7A 3NOCA 2L9WA 2EFOA 3MCSA 5C25B 4AL7A 4C11B 4F04B 1NKBA 4A8MP 3UNYA 2ZZMA 2HYIB 2IHR1 2MKCA 3OR1A 3GJTB 3H25A 3I0RA 5A76A 1ZA1B 2CQ2A 2IRYA 2CNLB 3MEEB 2AYMA 4PR6A 3OQ2A 3DRXA 4A8OA 1TAQA 5HROB 4K4TA 3VAMA 3CSKA 2A2CA 2GGPB 4NLVA 1N5VA 2DIUA 3NS7B 3AJDA 2W2QP 2V9WA 4KJIA 5KFMA 1Q53A 3U27A 5CD4H 3OSNA 2RMLA 2CJXB 2KM8B 2XNRA 3CCTA 1LFPA 2Y9HA 4CNYA 1LK5A 3WX8A 4M5DA 1NDLA 4RW9A 2I2YA 2HKEA
chains in the Genus database with same CATH topology
5JUMA 2IBKA 2B56A 1JLEB 2RJZA 3BB5A 4TU9A 4ZPWR 3OJSA 4DLGA 4KGKA 2H9ZA 3ENQA 1M0SA 3I6PA 3VAKA 4ECSA 2WBRA 3MD3A 2KN4A 5KFPA 4ZVGA 2IMWP 4JBCA 2B51A 3QGHA 2ZH2A 3AHPA 2BANA 1V3ZA 2B9WA 4ZMMA 2ZJRQ 2YNIA 2F8HA 3R1LA 4PUOA 1V3RA 4W90B 3N01A 2CQDA 3UE2A 3IAS9 2MZ1A 2OLWA 1ULRA 2CPIA 2DNLA 2GJ2A 1J2VA 1E6YB 1NZAA 4DQSA 4JI8F 4NCGA 2CRLA 3M1VA 3TX8A 4NXMF 2ZH5A 1W2IA 1U1OA 2VH7A 3TANA 3V4IB 1XEZA 1YJ9S 2DH9A 2EBEA 4DOZA 1IXKA 2CPJA 3NCQA 5J2NA 2WTFA 3MECA 1X4AA 2C42A 4DQRA 1P6TA 3CTRA 4M94A 4ED1A 3SV4A 2DCLA 3LW5C 4EO6A 1HNXF 3V6DA 4ATNA 1X4HA 1H7WA 1T05A 1Y7PA 3IRXB 1HNVA 3S6EA 3KK1A 2UXBF 3UDCA 4WZMA 1UA1A 1XR5A 5KFRA 3TVZA 4F4YA 2WOMB 5B0CA 1O51A 5U47A 4ZPBA 4O0IA 2ROEA 4ED6A 2YH0A 4B9UA 4RW4B 2DITA 4ZS6A 7FD1A 1VRUB 3FEZA 5DRKA 3G4SS 4EYHB 3FMBA 2GO9A 3MM8A 2L9NA 2KG1A 2XMKA 4P2SA 2W9BA 3QJJA 2G13A 1TP7A 2K3KA 2M3DA 1U24A 5G0RA 3CJ0A 3CCMS 5FLXY 3QO9A 1QSYA 4K2XA 3HPOA 4O4RA 4CTAB 5D3GA 4F2RA 3PV8A 3DDNA 2FLNA 3RB4A 4OZ1A 1AFJA 4WXOA 1M5KC 3QZ7A 2DO4A 2FJXA 1BWEA 1JLCA 2OSQA 1RT3A 4IRKA 2FC8A 1Y3JA 3FRZA 4I1TA 2AX0A 4DL5A 1M5PC 3PKMA 3WZ0A 1JLQA 1LXJA 3PHEA 1XERA 1RKJA 1IQTA 2J5AA 3I55S 4DV7F 1HBOA 2MQOA 1A7GE 3RYLA 2GIRA 3D0IE 1DAXA 2M9KA 2CZ4A 5EWFA 1FJ7A 3DYAA 4OZ5A 2WSCC 3M8SA 4DHVA 5DDQC 3H2VE 4ZPAA 4YR2A 2YKNA 3DXBA 3M30A 3T6JA 1S48A 3MZIA 5KFBA 2WBMA 3BZQA 2W24A 3UNGC 1HBMA 1FRJA 3ITHA 3OVBA 1DQ9A 4YR0A 2P9GA 1G2EA 5AXMA 2CIMA 5KT3A 4ZVEA 1KFSA 4EFAC 2WCXA 5KFQA 2XO7A 5GADU 2WK4A 1JLAB 3U1LA 3DLKA 4C8ZA 1VQNS 2DISA 3PW0A 1WG5A 2W4PA 2VQEF 4DF4A 3M9OB 4B3OA 5B0FA 1VRTB 2KYZA 4YDXA 4HT7A 3DLGB 3PDNA 2D41A 1FJEB 4NWBA 3SYZA 4NLGA 3G6VA 1OQ3A 2V0NA 4Y3CA 2BM1A 3RW7A 4FN5A 4WU3A 3M8QA 4RW8B 2G0CA 2ZHOA 2FJDB 3HMJG 4ILLA 5FJ4A 3JTPA 4GO7X 2DHXA 2OH2A 1HQEA 1BY9A 4PG5A 2CVIA 2ZVSA 4UOCA 3MM5A 2JVOA 3QIDA 4HKQA 4C3KA 4DR7F 2QA4G