3HVTB

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
427
structure length
398
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 74
structure length 398
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB03
3Q8QB 3G86A 5F9NA 1TL3B 2I5JA 3H40A 2W8KA 3IRXA 1RDRA 2JEGA 3MEDB 2HNDB 2XCAA 3DOKB 4ECRA 1N48A 3GIKA 1OS5A 1SH3A 1NHUA 5DG7A 4URSA 3V6KA 1D1UA 5K14A 4QWCA 1HYSA 1ZETA 5F9LA 2WONA 4DL6A 3BQ0A 1HMVA 1TKTA 5KFOA 3DRPB 5KT2A 3PR5B 2ASJA 1RT7A 1S1UB 1IKVA 2HNYA 3QYYA 5KG0A 3TVKA 3V6DB 1REVA 1S9EA 5J2MB 4Q45A 2RKIA 5DQIA 4ECQA 2ASLA 3IG1A 4R8UB 4RW7A 3KLIA 3MECA 3CJ2A 4KHRA 4YR3A 3FSIA 1R0AB 3RAXA 1VRTB 1FKPA 1KHVA 3BSNA 4NLRA 3CJ5A 1QAJA 4URGA 1RT4A 3KK2B 5I42B 3I5CA 3UPFA 3N6LA 1RTHA 4RW9B 2WRMA 2AGQA 2YNGB 4ICLA 2JEFA 5L1IA 3RB6A 4ZPAA 1IKXA 4IRCA 4LSLA 1BQMA 2R2RA 4H54A 2IBKA 4Y2CA 2R8IA 1S9GB 3QIPA 1T03B 1GX5A 2BE2B 2BQRA 5KFFA 3C6UA 3PJWA 3G6VA 1EP4A 2BANA 3BJYA 1N56A 4MK8A 3LP2A 4NRUA 2XGQA 4IDKA 2AX1A 4DG1B 1HNVB 1T05A 3G6XA 3OL9A 3GYNA 2JEJA 3PVXA 1JLAA 1EETB 1SV5B 3M9MB 4K4UA 1HNIB 3DRRB 3DM2B 3SFGA 5KFIA 4NCGA 1RTDA 4GC6A 4ECXA 5D3GA 3QLHB 4ZHRB 1QUVA 1S1XA 2XI2A 5KFJA 5KFVA 4DL2A 3MR3A 3MTKA 4JV2A 3RB3A 5C24A 1XR5A 2WHOA 4NLVA 2W9CB 3C6TB 3TAMA 3PR4A 2WOMB 5JXSA 4ZVHA 3Q8PB 5HLFB 4RW6A 3CJ4A 2FVPA 2FJWA 3KJVA 3M8PB 4IH7A 4IH5A 4DL3A 4O3SA 1BQNA 1W25A 3Q8SB 2IA6A 4IFVA 2ZE2A 2OPQA 1RA7A 1HPZB 3T5KA 1SH2A 2YKNA 4XPEA 2VG6A 3NGDA 3NAHA 3V4IA 4RNNA 1HQUA 3MEEA 1S1TA 3DLGA 3CDUA 1I6JA 2FVRA 3OLAA 4WZQA 3GV7B 4J9MA 1C0UA 4NLPA 4Q0BA 1FK9A 2BRLA 4WXWA 1TKZB 5KFTA 3PW0A 3OHAA 1KLMB 1S1WB 2OPSB 2OPRB 4MFBA 1TVRB 1GX6A 3UQSA 5KFEA 4QWEA 2BQ3A 2FLLA 2B5JA 2E9ZA 1LW0A 2GIQA 4ZVFA 4EBEA 1VRUA 3ISND 5KG1A 2I5JB 3KLFA 3KK3B 1DLOB 1S1VA 3IRXB 4WFZA 2W9AA 4K4TA 2HAIA 2HWHA 3QIDA 4TYAA 5T14A 2WTFA 4O4RA 3BGRA 3FQLA 4B3OA 1TV6A 2WONB 4RNMA 1TL1A 3UDLA 4F4YA 5C5JA 4TY8B 3PW4A 4H4OA 3CO9A 4ED3A 4LQ9A 5FDLA 1MU2A 3V6JA 1S6PB 3QGHA 5HROB 4R5PA 1REVB 5DQGA 4KBIA 2VG5A 1J5OA 4KAIA 2W7PA 4O44B 3T19A 3D28A 5DQHA 4ZVGA 1RT2B 5KFKA 4RW7B 1Z4UA 3H2LA 2DPJA 3CVKA 2XWYA 2I1RA 4WXOA 4LSNB 3I5AA 4IQXA 5J2PB 2IJFA 5KG3A 3KOAA 1N5YA 4ED7A 4RU9A 1RT4B 3HHKA 3JSMB 2GC8A 2OPPA 4Q8EA 2F8EX 3KK1A 4YMEA 4IFYB 4ED1A 4NLGA 1IKXB 3M8QA 5KT6A 4EO8A 2YKMB 4GC7A 2J6TA 1C1CA 1JLFB 4TN2A 5KFCA 3KNAA 4RW4A 3MF5A 1MMLA 5L9XA 3QZ7A 5F8GA 4ZPCA 2ILZA 5KFPA 3DMJB 2JC0A 1EP4B 1TKXB 1RA6A 4NLXA 4U7CA 2ILYA 4QW9A 3DRSB 1RT1B 4IDKB 4IOBA 2WB4A 3CIZA 2R8HA 3NKYA 1JLEB 4KSEB 3ITHA 5J1EA 4PUOA 1JLAB 2ZKUA 3HVTA 1C0TB 1DTTA 5J2QA 5KG5A 3OL6A 2J6SA 3EPIA 5C25B 3LAMA 3NAIA 4HYKA 4ECZA 1TP7A 3GV5B 4RW8A 3QGGA 4JV1A 4WFYA 4ZPDA 3CWJA 4QW8A 5KFUA 4EEYA 1RT6B 1IKWA 4O3NA 4YR0A 4EYHB 3KHLA 3BSOA 4F4ZA 1DTQB 4IG0A 5EWGA 2IAJA 3QGIA 4RNHA 1LW2B 1JLCA 4Q8FA 2IC3A 4G1QA 1SUQA 4PQUB 1SH0A 4K4SA 3V4IB 4IG3B 2XI3A 2W9BB 3T5HA 2JLEA 4LQ3A 4MK7A 4F50A 1HQEA 3BREA 1LWCB 4Q0BB 1RAJA 4NLSA 1QE1B 1FK9B 3DLEB 4EBDA 2QV6A 2CJQA 4I7FB 1RYSA 1S0OA 3H5XA 5KT7A 1LWFA 2ALZA 2QE5A 5CYQB 3LP1A 2B5JB 3EPGA 1RTJA 2D7SA 3BR9A 1VRUB 2OH2A 4O3PA 2RF2A 2W7OA 1IKYB 2V9WA 4DL5A 2B6AB 5CYMA 4J9RA 4YR2A 3OHBA 3E01A 2HMIB 4O3QA 1S0NA 5F8NA 5KFYA 1LWEA 4Q44A 3I5BA 3DYAA 3QZ8A 5HBMB 4K4WA 4H4OB 4M95A 4J9KA 5FDLB 1MU2B 3T1AA 3HVWA 4FS1A 4KKOA 1RT5B 4NLWA 1T3NA 2FLPA 3I0RB 3MEGA 2HNZA 3FFIA 4I2QB 4O4GA 4ED0A 5HP1B 3KLEA 4TQRA 4WFXA 3LP0B 1JLBA 4ID5B 5J2NA 1XR7A 4I2PA 4QPXA 4ECWA 5C42B 4KO0B 4KV8A 4JUZA 2VG7A 4PWDB 3GV8B 3DLKA 3IS9B 3DOLA 4ECUA 3RB0A 2BR0A 5KFLA 5KG2A 5EUHA 1RTIA 4FS2A 3KLHB 5KFHA 5F8MA 1TL3A 3QO9B 4RW4B 4FBTA 3MEDA 2HNDA 3H98A 3DOKA 4U6PA 2W8LA 4K50A 4KFBB 2JC1A 4RUCA 2YNFB 3UR0A 4NZ0A 1JLGB 2V4QA 3KHRA 2CKWA 3BSAA 4ZP6A 1RT3B 1JKHB 2R2UA 3GIMA 4IRDA 4RNOA 2R2SA 4ECTA 1FKOB 1S1UA 3PJXA 4URQU 3GQCA 3V6DA 2AGOA 5KFNA 4EBCA 1S0MA 4O3OA 4R8UA 4Y2AA 2AGPA 5K14B 1R0AA 1HYSB 1D0EA 5L1LA 2WK4A 3HKWA 5KFZA 4MIAA 3NL0A 1HMVB 3KK2A 4J9SA 1TKTB 5I42A 1S6QA 4RW9A 1RT7B 2FLNA 1IKVB 2HNYB 2FVCA 1S9EB 2RKIB 1K1SA 2IAJB 4ECSA 1S9GA 2YNIA 3IG1B 1T03A 4DL7A 2UVVA 3KLIB 3MECB 4KE5A 5F8LA 5DG9A 1UWBA 5KG7A 2XC9A 2RDJA 5KFBA 2EC0A 1K1QA 3KMSA 1WNEA 1FKPB 1RTHB 4DG1A 3KLVA 4ICLB 1HNVA 4MIBA 1NHVA 2B43A 4NLTA 5KFDA 3GIJA 4ECYA 3PW2A 4NLYA 4LSLB 1T94A 1BQMB 3RAQA 3CJ3A 1SV5A 1EETA 3H5YA 3OSPA 3H59A 3QIPB 3BSCA 2AU0A 1RTJB 2AQ4A 1HNIA 3DRRA 3DM2A 1ZTWA 3C6UB 2E9TA 3E51A 5F8HA 3IN5A 4NYZA 3QLHA 4ZHRA 3CJ0A 2BANB 5DGAA 4EO6A 3NBPA 5CYMB 4IRKA 4J9PA 3LP2B 5KFMA 5F8JA 5EDWA 3C6TA 3M9NB 1T05B 4YQWA 4RZRA 5L1JA 4J9NA 4WE1A 5HLFA 4Y34A 1LWEB 3N6NA 1JX4A 4K4YA 3M8PA 3IGNA 1S97A 3IGVA 4IR1A 4NCGB 1RTDB 2UVRA 5D3GB 5KFAA 2R8KA 1S1XB 2HNZB 3JYTA 3PW5A 4O4GB 2E9RX 3PZPA 2V0NA 5C24B 4DL4A 4EYIB 4QWDA 3TAMB 2ZD1A 5J2NB 4TLRA 4KHMA 2IMWP 3I0SA 3OSNA 4O3RA 4RW6B 1JLQA 3M9OB 1TKZA 3KJVB 2AWZA 2FJVA 1BQNB 3Q8RB 2OPSA 2OPRA 4ZVEA 4IFVB 2ZE2B 2OPQB 4MH8A 1S49A 4ED6A 4WYWA 5F8IA 2YKNB 4H4MA 3MFHA 3KK3A 2VG6B 1DLOA 1YVFA 2YNHA 1S9FA 2UVUA 1HQUB 3MEEB 1S1TB 3DLGB 4MKBA 5KG4A 1RYRA 3DI6A 1N6QA 1N4LA 3PHEA 5KFGA 1C0UB 5KG6A 3KLGA 2GIRA 3BQ1A 2WCXA 5I3UA 5L1KA 4MFBB 2IM0A 4TY8A 5DG8A 4ZP8A 1LW0B 1S6PA 4IR9A 5HROA 2RDIA 3OL7A 3KLFB 5EWEA 1S1VB 2FVSA 4O44A 3CDWA 1NNDA 1RT2A 5DGBA 3H4DA 3LANA 2D3ZA 3BGRB 4B3OB 3T5JA 4LSNA 3T5LA 1TV6B 4IKAA 5J2PA 2BRKA 4NRTA 3LALA 1TL1B 5KT3A 3OLBA 4X2BA 2JEIA 2DPIA 3JSMA 1S6QB 4K4ZA 1U09A 4IFYA 4R5PB 3PW7A 2VG5B 1J5OB 2AX0A 2YKMA 3CDEA 3V6HA 3V81A 1JLFA 2YNIB 4MKAA 4R0EA 4J9LA 2C2DA 1UWBB 4QWBA 1C1BA 3DMJA 5KT4A 2FVQA 3FRZA 4Q43A 1TKXA 4F4WA 3GILA 1N5YB 1QAIA 2D41A 4ZP9A 3DRSA 1RT1A 2OPPB 4XPCA 3MR2A 3KK1B 4DEZA 3M8QB 2HWIA 1JLEA 4K4VA 1C1CB 2R2TA 2C22A 1C0TA 2XCPA 4QWAA 2UVWA 2D3UA 3RBEA 2VA2A 4XO0A 4KB7A 5C25A 4IH6A 3NBPB 1XR6A 4Y3CA 4ED2A 1TQLA 3EZUA 2R8JA 5KFSA 3DRPA 4WE1B 1RT6A 3KHHA 4WZMA 3ITHB 5J1EB 4PUOB 3KHGA 1DTQA 5J2MA 4TQSA 3HVTB 3BQ2A 1DTTB 5J2QB 4ZMMA 1LW2A 2V4RA 3D5MA 5DLFA 4MK9A 4PQUA 4RUAA 2IJNA 3JYTB 1VRTA 3TQ1A 2IM3A 3RBDA 4FBUA 4RW8B 4IG3A 1KHWA 2W9BA 1S4FA 4NLOA 2ZD1B 1LWCA 3I0SB 1QE1A 2YNGA 1IKWB 3DLEA 1S48A 1JLQB 4NLUA 4ZP7A 4I7FA 5KT5A 5EWFA 2ASDA 2R8GA 4IG0B 3SFUA 5KFWA 2C28A 1C2PA 5CYQA 1JLCB 2IC3B 4G1QB 1SUQB 2BE2A 2FJXA 1HARA 1S10A 4H4MB 2J6UA 2YNHB 4TY9A 2ATLA 1IKYA 4YP3A 2O5DA 5JUMA 2B6AA 2IM1A 3DI6B 1N6QB 4NLQA 1HQEB 3KLGB 5I3UB 4HKQA 2HMIA 4OL8A 1LWFB 5HBMA 3LP1B 1CSJA 2C2RA 3N6MA 3H5UA 4RNFA 1JIHA 1RT5A 3MFIA 3RB4A 3I0RA 2RF2B 3ISNC 2UUWA 4I2QA 5HP1A 3FQKA 2W9CA 3LP0A 4WYLA 2BQUA 3KMQA 4ID5A 4TXSA 3SI8A 2WOMA 4ECVA 3E01B 2VA3A 5C42A 5DLGA 4KO0A 4JV0A 5KFQA 3H4BA 1ZTTA 5KFRA 3DYAB 3LAKA 4PWDA 3IS9A 2XGPA 4K4XA 4G3IA 3ICLA 3MR6A 4F4XA 4KKOB 3DDKA 1HPZA 3KLHA 2UUTA 3MEGB 4TYBA 3V81B 4J9OA 3FFIB 4M94A 3NMAA 5KFXA 3QO9A 3KLEB 1JLBB 1C1BB 4I2PB 4KFBA 3FDSA 2YNFA 4ED8A 3GIIA 4KV8B 1JLGA 2IM2A 3VQSA 3G6YA 2VG7B 3DLKB 1RT3A 1JKHA 3DOLB 1KLMA 1S1WA 3HVAA 4NLDA 3OL8A 1TVRA 3MR5A 2C2EA 1JXLA 1IM4A 3H5SA 1FKOA 1RTIB 4J9QA 4ZPBA
chains in the Genus database with same CATH superfamily
4E0DA 1RDRA 1CG2A 3GCWP 3MAQA 4C8OA 1ZETA 4DV1F 2CQGA 4DL6A 3A12A 1S7HA 3QYYA 3ULHA 1RJJA 3PYGA 2ASLA 4R8UB 3MECA 4C3MA 3RAXA 5A2QY 5I42B 2AGQA 4I0WA 2HZAA 1BQMA 1SC1B 2GZOA 2R8IA 3OR1B 5KFFA 5AXMA 4B9SA 3H0PA 1VJQA 3GFYA 3UCZP 4Y2IA 1FT8A 4NRUA 2JEJA 1S7IA 1LEOA 1U8WA 4J37A 3PACA 2HFUA 2ZHBA 4KRWA 5HVHA 1YJRA 2AJ0A 1AT1B 4O0IA 1SJ4P 4WIIA 3VAJA 2VQFJ 1S1TA 1W7WA 4PCQA 3PW0A 4CLKA 2MSTA 1F9EB 5CYJA 1SC3B 3KJQB 3POTA 3TJ9A 4PWWA 4PABA 3GFZA 2DH9A 5FDLA 4FF2A 1FCAA 1VQ9S 2JZ5A 2XNQA 1T9YA 2M7SA 4FNHA 4NCBA 4B3SJ 4DPWA 4U7UK 3EVMA 1Q8BA 2ILZA 1M5VC 3D6FB 3DRSB 3TX0A 2CAJA 3HSDA 4USVA 3W9JA 3ZC4A 4UOFA 2JVOA 2OELA 5B0CA 3J81U 3NGSA 3PV8A 4F4ZA 2WW4A 3P8BB 5EWGA 2PC6A 3TZWA 1R6VA 3R7BB 4K8RA 3DN9A 1S77D 4F50A 1RTJA 2D7SA 3N5FA 3SQOP 4QCLA 3LTOA 2YQ3A 2MY8A 2E5LJ 2RU3A 3NNAA 3LPYA 5FDLB 2GMJA 3NEKA 3DHXA 1K0VA 4ED0A 1BWVA 1SC6A 4K0KJ 1CULB 3CCMS 2VG7A 2GVDB 2C3OA 1Q79A 2UXDJ 1RHRB 5KG2A 4FS2A 1RTIA 2HZCA 4RJVA 4P72A 1VRQC 4W90B 2A18A 2LCWA 2V4JA 1AROP 2FHJA 1U8SA 1FE4A 2HK2A 1ZA2B 1IXKA 4NMXA 3FBFA 2FLNA 5FLXU 3IG1B 3JAMY 2V2ZA 1UAWA 1K1QA 7FDRA 5LJ5Y 2D1CA 2UZAA 2DRBA 2W1BA 3R3TA 2O01C 2FJEB 1XNQJ 4PKDB 1RTJB 4P2MA 1NDPA 5A8RB 1N52B 5B08A 3M9NB 1VK8A 2GJ2A 4W98A 4DPUA 1KTVA 4LRBA 5D3GB 3MCOA 3M6UA 4QWDA 2WW8A 1RAIB 4BWMA 4UZBA 2NR0A 1S9FA 3ENAA 3DLGB 2PEBA 4P2SA 2ZFHA 1F1BB 2JRSA 3B54A 5B0BA 2AKWB 2BJ9A 4DR7J 2QA4S 2RDIA 5EWEA 2ZEJA 2AYBA 2RUSA 4HT7A 2J7WA 2DGSA 4OI3A 2MZ1A 1YJWS 4MAKA 2W2NP 1HBNB 4K4ZA 1U1PA 4AQYJ 2C2DA 4JI6F 2BE9B 4OV1A 1H72C 3BB5A 2Z2ZA 1YJUA 2UVWA 2VA2A 1XR6A 5B0DA 3HFKA 4X64J 3HSGA 3KHHA 5AE1A 3HJFA 3HVTB 1SC4B 2CG8A 3H2UB 2HVZA 2W9BA 2C2KB 3HP6A 3R1HA 2CADA 1LWCA 3A1YG 4PAAA 4C97A 4IG0B 2DRAA 2V69A 4LF9J 4ELTA 1NSQA 5B0AA 4TY9A 1IR1A 1PBUA 4QIFA 3T3FA 3T1YJ 1FDBA 2ZUGA 5LSRA 1RT5A 2N7CA 3MFIA 4DWIA 1HHSA 3ISNC 1KR4A 3OT9A 3OJUA 4OI0A 3A8EA 4JV0A 2CQCA 4C8KA 1OMSA 1HWJA 2FGOA 1EZZB 2MQMA 3W2VB 2LXUA 4DHVA 2RRBA 2L3MA 4E2FB 2X1BA 1HL6A 5IT0A 3A8KA 3GIKA 1PJ6A 2XB2D 2LKZA 1RT7A 2HNYA 5KG0A 3TVKA 1NKCA 5EGYA 4F3OA 2Z2YB 5KTQA 3DFEA 2OTJS 3MCMA 3MM9A 1KTQA 2YWFA 4OYWA 1QAJA 2H4YB 4ZCLA 4A8OA 2DR8A 3I4PA 3OD2A 2ROEA 4PPDA 3N5BA 1HNVB 4DN9A 1X31C 2W2OP 3M30A 3NS7B 5A8KB 2KRBA 1HNIB 1SL1A 3MTKA 5GAEI 3TA0A 3B6BA 4QYZJ 4NCAA 3T5KA 2GQQA 1XNRF 2FVRA 2RQ4A 4ZVOB 4ZK7M 4F3QA 1LW0A 4Q2LA 3KK3B 2CJYB 3VAGA 4HLBA 4WWSA 2HHWA 1SJ1A 3P4UB 2AYEA 4DFMA 4O44B 3T19A 1D09B 5DQHA 1Z4UA 4DSEA 4RU9A 3IM9A 1V6HA 5D8HB 3M8QA 2KG1A 3OBIA 2G13A 4DV7F 1NAQA 3EX7B 3IAM9 6FDRA 4DQPA 3QT7A 1C0TB 1Y10A 4JI4J 4WFBQ 1Y5IB 3MPYA 2NXEA 2OI2A 1YG0A 2V34A 3DGPA 4J5OA 4PG8A 4EEYA 2ALYB 3QGIA 2E1AA 4PQUB 4WFAQ 2QL7B 3CPWR 3LWMA 4I7FB 1KLNA 3PKMA 4O3QA 4WU3A 4C11A 1T3NA 2MZSA 2HNZA 2KKHA 3VGUA 4N41A 1KKHA 3LPEA 2KI2A 3OPKA 1Y9OA 1U24A 1Y5LB 4ECUA 2AHOB 5C7PA 3THPA 2Z8QA 4ZP6A 1KONA 2XTJP 3MD1A 2HVDA 1Q5VA 1B64A 5FJ4A 2H48B 3A3OB 4MYUA 2MGZA 5A76A 2RDJA 2GGPB 3HT0A 5BJRA 3GYXB 1RZMA 1NCLA 4PZVA 2OO4A 4WTYA 4MKVA 1TL7B 3EDQB 3HHNB 2MLZA 2Z2LA 4JOUA 1B0TA 3BO2A 4IR1A 2R8KA 2HNZB 3N79A 4EYIB 2IMWP 2G2YA 3M9OB 1I5OB 1RAAB 1S49A 4ED6A 2LEAA 3PHEA 2QGFB 2MKJA 5L1KA 2Q3PA 1Y3JA 4DU8A 2XLJA 2J9EA 5HROA 2FVSA 5DM6Q 1I94F 1V5IB 3RZAA 2MKCA 5IV4A 2E7XA 2G0JA 2YWHA 4CTAA 2IYIA 3W65A 2MGZB 4GKJJ 2PD1A 1CJVB 4AFFA 1TKXA 3EYZA 1KD1T 3HJVA 4QWAA 3RR7A 4IH6A 4ED2A 4K2XA 2R7WA 5J2MA 4JI2F 1VQPS 1GTEA 2PN6A 1VI7A 2EFQA 3TQ1A 1MW7A 3DLEA 5KT5A 1I3OB 2BOPA 2K1RB 5E5NA 3ELHA 3EVWA 3C19A 1OYDA 2F9JA 2C3UA 2RF2B 4ID8A 2XSJA 1SBRA 3DYAB 4CTAB 2IVYA 2ZDPA 4ZS6A 2F7VA 1OJ4A 4FYWB 3SCLE 4YUDA 4KFBA 1VQOS 3D67A 4OZ1A 4FF4A 2VDIA 2NXJA 3OR2B 1P6TA 2DGWA 3TEGA 2WVDA 1S9EA 2OJ3A 5J2MB 4Q45A 3B82A 3GTYX 1QM9A 2DB1A 4E8UA 1FKPA 1RTHA 2JEFA 3MURP 1V5VA 2R2RA 1Y5NB 2EC2A 3PJWA 4A8XA 4B3RJ 4C7QA 2AX1A 4DLGA 2SXLA 3OL9A 1S6OA 4WIQA 4K4UA 2C1EB 3DRRB 2XI2A 4QQBA 4DV6F 3R2CJ 4JBCA 1T02A 5HLFB 3ET6A 3BZQA 3Q8SB 2ZM6F 4ETXA 1SH2A 3BR8A 4B9VA 1F3FA 2XHCA 4P73A 1YRTA 2OPSB 1HR0F 4ANCA 4EBEA 1NSAA 3ISND 3KLFA 4GO5X 1S1VA 4NXMF 2LFVA 5F3ZA 3DU5A 3BGRA 1SQFA 4YS2A 2X51A 2G9OA 3W9HA 2KZZA 4K5RA 3AA8A 1JMTA 4X66J 1J5OA 4ZVGA 3OTOF 3J7Z5 3CCWA 3PYFA 4WXOA 1UA1A 4ZPTR 2OPPA 3GSIA 4ED1A 1EAYC 4LFAF 2OGUA 2AJFE 3IWXA 4LF7F 2XMWA 5L9XA 3QZ7A 1UPMB 1X4AA 3UD4P 3IR5B 3BKUA 3H90A 1URRA 3HZEA 2WB4A 4R25A 3W5ZA 3QT8A 1ULRA 3RU0A 1PJ5A 3GV5B 4RW8A 3QGPA 3DOMA 1VQ8S 1DTQB 2CDQA 1X5TA 4ZLLA 2CNKB 1RADB 4RBTA 2JFKA 2Y9HA 4DR1J 3EPGA 4I6WA 5LMNF 1VHIA 4A8YA 4C8YA 5F8NA 1H7WA 3A4TA 2ZH7A 1JNRB 4M95A 4J9KA 3HFZB 2CA9A 2HGNA 2M3DA 4I2QB 1TFYA 2M8HA 1ZAVA 4KV8A 2ZUAA 3BYRA 5L38A 3GV8B 3DLKA 1NK4A 1IBLJ 5KOWA 5F8MA 4AL5A 2W8LA 1GAOA 4C0OC 2OP5A 1LKZA 1Q53A 1WC4A 2QIFA 3BSAA 5AXNA 3MUVP 1TK5A 4ECTA 5HQLA 2ROPA 5EX3A 3OTBA 2X1GA 4HR2A 1U1MA 4P75A 2WK4A 3WX8A 2F65A 4NX9A 2VPXB 2ZH2A 1KP6A 4B02A 2RKIB 4DDFA 1YBTA 2UVVA 4DL7A 4NA2A 3B4DA 1GH8A 1B0PA 4DG1A 4ICLB 3BPDA 4GVBA 3PW2A 4DQIA 4LSLB 3RAQA 3C46A 2DIVA 4JYAF 9ATCB 2ZDOA 1PYOB 2QA4G 2J7UA 1QTMA 1UMJA 4FPRA 1NK5A 3FZ2A 1JLQA 1JB0C 4C2MA 3UR3C 1V9OA 4NL5A 1HI8A 2YKNB 5K8PA 5KG4A 1DHMA 2LQJA 5E3CA 2EXUA 4ZP8A 1S6PA 4V19J 3IBFB 4DR2F 5H9EJ 4X2BA 1VQYA 3M2VA 4X62J 1ACMB 4NOHA 4X65J 2G2OA 4YB6A 3W61A 4R0EA 2FLOA 3DMJA 3M2UB 2Y1LB 2HVHA 2OFGX 4LIWA 4QR0A 5H9EK 1KOHA 3TA1A 3GG0A 4F67A 2V8PA 2GIFA 1M5SA 2HPUA 3UD3P 3IR7B 1TQLA 3VCDA 5KFSA 3DRPA 1VR6A 2YX7A 4X4TA 2VQEJ 4RLEA 1PCAA 4CYUA 1KHWA 2NXCA 4NLUA 1JLQB 2AMCB 2BA9A 1DFDA 4NZ7A 3HMJG 2V6AA 3W64A 3UNGC 3FCWA 1M5KC 4JI8J 2C2RA 4OHZA 1MG7A 2RB7A 4ZCIA 1RBLA 5HP1A 4WYLA 2BM0A 3MTJA 1ZTTA 3UNYA 3LAKA 3ICLA 3OQ2A 3QO9A 1YZ7A 2YNFA 2DY1A 4ED8A 3ZNUA 2GS8A 1RU1A 2EVZA 3G82B 2HHPA 2G2ZA 5M2UA 2VZ9A 2I5JA 5BR8F 4CO4A 3DOKB 1OS5A 2XMMA 2R7VA 2CVIA 4HTIA 1S0VA 3DRPB 1CJUA 1Q7LB 1RU2A 3OW2R 2DNLA 2RS8A 3TQEA 4AE5A 5FD1A 2JL9A 2MHNA 2H3EB 3N6LA 4ERDA 2GA7A 1CC7A 3C6UA 5HATA 5B0EA 2B3TB 4MK8A 4M63A 1ITPA 1IBMF 1RACB 2RS2A 3HSZA 4B3MF 2HHHJ 3MPDA 4ZLJA 1QUVA 2GHVC 1ROFA 5LMUJ 2H65B 2W2QP 3EZ5A 1N0UA 1I6JA 1MSWD 5H9FJ 1UVKA 2ZH4A 3GLJA 4UY8T 2OPRB 3UQSA 3J7YI 4BDPA 4ALZA 2I5JB 3FQLA 3P45B 1X9SA 3JTOA 3D28A 2VJVA 1RXOB 1FFGB 1U48A 1HKAA 3FUYA 2F8EX 3GP9A 4NI2B 1JLFB 1BHNA 3PIOQ 2JLFA 5GAGI 2MQNA 3CIZA 1JLEB 2VKRA 2ZKUA 3Q0AA 2BZ2A 2RIJA 3PYEA 4C4WA 3DXSX 2W01A 3HKZD 4ZPDA 4DBQA 4ILLA 3QPIA 2DISA 2QL5B 2CPDA 4G1QA 1SUQA 1SH0A 2PDAA 2FHJD 2FIUA 3GJRB 1F3VA 4L6V3 4IG3B 3HM9A 3BREA 4EBDA 2VBZA 1RWKB 3LP1A 2KM8C 5ETVA 3BM7A 2HMIB 3J7AN 2DGTA 3MOZA 2G1HA 2EKYA 2H5JB 4P6QA 2FLPA 3I0RB 4UOHA 1S6UA 4N56A 1JLBA 4CNZA 5IWAJ 1DRZA 3MMCA 4I4BA 3IS9B 3NMRA 3BYPA 2DXEA 4M5DA 3CD5A 1MROA 4LF2A 4GKKF 4K50A 2N3OA 4RUCA 1FO1A 1ZS6A 4ES2A 1D9DA 3M1VA 1LNQA 4RNOA 4LRAA 5L8RC 1S1UA 1KDNA 3V6DA 3OFHA 1M1GA 3LUYA 4I68A 2CDRB 1HYSB 4DCJB 1D0EA 4RW9A 2YX4A 2K3IA 4LBIA 1FRXA 3NCQA 1LOUA 2XLKA 4LF5J 3OXFA 3MHYA 4IOCQ 3W8GA 1CJKA 5EN1A 2DNNA 3CCVS 2CXEA 4C8LA 3D54A 1FRIA 1M5OC 2J0QD 2AV5A 2BKOA 1BE4A 3L95X 1L3UA 2HGMA 1FTRA 4DX7A 1G4CA 1BQNB 1B70B 5JVHQ 1WTBA 2OPQB 1QY7A 1DLOA 2IPOB 1N4LA 4G1IA 1HNZJ 3G9CA 2E44A 3M32A 2DO4A 4F25A 2M5YA 1E6YA 5J2PA 1FFSB 3PRDA 1SB6A 4NE9C 4KHPJ 2YKMA 2DNMA 2HQCA 1L3TA 3ZZTA 4ZP9A 5D4NA 4FP9A 1C1CB 2YWEA 1N34F 4OHXA 5CH7B 1J5EJ 3CCQS 3CD0A 3D4JA 4KB7A 3FVYA 2OSQA 2XMTA 1U49A 4EK2A 4C8MA 2KB2A 2NSBA 1AFIA 5E33A 4DUTA 1S48A 1EARA 5AE3A 1SKWA 2K7JA 3C14A 4U67Q 1IKYA 4YP3A 5JUMA 4LF1A 2HBQB 2C3YA 2AF6A 2FHKA 1F5BA 1N32J 1WF2A 2Q6BA 3NY0A 3JXOA 1XK8A 2FJAB 1E6YB 3SI8A 1VDHA 4TU9A 3E01B 3J81Y 5DLGA 1LQ9A 2A2CA 2JSXA 1KVKA 4RL1A 1U6FA 4KPYA 3QFHA 3CEDA 4KYZA 1KLMA 2R7XA 4N7TA 4ZPBA 3Q8QB 2DEJA 3OXGA 3D68A 2LYVA 4MYTA 4WTOB 3PG9A 5DM7Q 3BKTA 4B08A 4L3KA 2HHTA 4J91A 4RW7A 3Q2TC 3FJ2A 1KHVA 3PNIA 4LUBA 3RB6A 3KTQA 3I4HX 1Q81T 3CJTA 1VISA 2DXFA 3R6LB 2BANA 1CBKA 1S5ZA 3ZO7A 3MM8B 1T05A 1YJ7A 1A6LA 3UCGA 2ZJQQ 3O44A 3QLHB 1X5PA 4LBPA 1U6BA 5C24A 2WHOA 1SVDA 5D0RA 1WC1A 4DR5J 3CJ4A 3M6WA 4CCHA 2FJWA 4NXNJ 3M8PB 3TUIC 1RUSA 2IA6A 2DNKA 1NO8A 5FLXY 2VG6A 4AL7A 1T9TA 1BUXA 1TMJA 1KLMB 5KFEA 1VHFA 3VV2B 2F4VJ 2CZ4A 2P6TA 3M8YA 1FI4A 4PYDA 2HAIA 2V8GA 2BJ8A 2GV1A 4M5GA 1X4CA 1TV6A 4ED3A 4B9LA 3V6JA 4ILRA 4RW7B 2M4MA 4LF6J 1LXNA 4M5NA 5KT6A 3NG8A 3ENVA 3PYDA 4TN2A 5KFCA 4YEAA 3KNAA 4ZPCA 4P10A 1R31A 4NLXA 3W63A 2MLYA 1WUUA 4HACA 4M5LA 1YJ9S 2UUCJ 3TRGA 4KSEB 5J1EA 4DU7A 4ECZA 1T8EA 4NPOA 3QGGA 2XMAA 1NPRA 1RT6B 1OWXA 4EYHB 1FEHA 5HI7A 2BKNA 1FWPA 2XI3A 2JLEA 4LQ3A 3GU0A 1HQEA 4NLSA 4QIVA 5E3RA 1S0OA 3P49B 4FDFA 2L9DA 3G8SA 1H3DA 1KS2A 2V9WA 1HNXJ 2C3MA 4JI7F 1HLWA 3T1AA 4KKOA 4NLWA 3FFIA 1EKSA 1Y4ZB 1NK7A 4DV1J 1SJQA 1N54B 3C16B 4OHWA 3H98A 4M5MA 4JI0F 4A8SA 1KQGB 4LIRA 4HACB 2J8AA 1K47A 4YY3J 5C2CA 2LQ9A 2VU5A 1L3VA 2DR6A 2X3DA 3PX4A 1HW9A 3ILLA 4KJIA 2VL1A 1WF0A 3HKWA 3CMQA 3NGUA 1IKVB 2GMHA 2BJ7A 1ZM4A 2E5IA 2DHGA 3KLIB 5KAKA 4WK3A 4A8WA 4L72B 8ATCB 2ZBIA 3AQPA 1LK5A 2VPYB 5HANA 4ECYA 2C3PA 1HW8A 4L3NA 2JVRA 4DUZF 1WD6A 3QIPB 3BSCA 2VONA 1R7IA 2Z57B 4HHHA 1FJEB 1FA0A 3ZZUA 5HMZA 5KFMA 5F8JA 2F8HA 4N76A 2FY8A 2QTWA 3RBZA 3RUBL 3OFEA 2EEYA 2EFNA 3TI0A 4NCGB 1KQSR 3DXBA 4USWA 3L9ZA 3HK2A 2DH8A 3KJVB 2ZE2B 4C0BA 2YNHA 4X4VA 3SEOA 3GJSB 2JLGA 1KVIA 4MFBB 3PY8A 4G1PA 2KG0A 1TAQA 4IR9A 4F02A 3CDWA 5DGBA 4KR0B 1FRMA 2N7YA 1OY8A 4HL9A 2DYAA 2H51B 1U4BA 2KXFA 3QJJA 4DF4A 1HWUA 2HKEA 1ZAXA 4XPCA 3KK1B 9RUBA 2QG9B 3CIMA 4XO0A 5C25A 2WSCC 2R9LA 4YB1P 4WCEQ 2YWGA 4CH0S 2H5IB 4Z37A 3KHGA 1DTTB 3CJQA 4DV2F 1PJ7A 3K5NA 3RBDA 4EI2A 3OXLA 2ZZMA 4DPXA 4ZP7A 3AD8C 4QJVA 1WKKA 1C2PA 2N4CA 4F0MA 2IC3B 2FJXA 2RJZA 2YNHB 4X4RA 1AUDA 2FC8A 2VDHA 2BJDA 4HKQA 5HBMA 4OLOA 1FRLA 3U27A 1NSPA 2MKHA 5B0FA 4ECVA 1N8RT 2HK3A 5C42A 1ZZFA 2VA3A 1VLOA 3P6YC 3ZFVA 1HNWF 1T9VA 4M94A 5KFXA 3KLEB 1IM6A 5HMWA 2WVEA 3DOLB 2IRXA 3BBCA 1FKOA 5F9NA 3QRQA 4X84A 1GXUA 4C48A 1H98A 3AOCA 2YKPA 3G96A 3CUNA 3HI9A 4XK8C 3HHLC 2DXDA 3O1LA 3NOCA 4YDDB 1WEYA 4CWBA 1YKWA 4ZLNA 1U1RA 3K89A 2OSRA 1R0AB 1WORA 3FCVA 2HS3A 2O1PA 2CJXB 4ZPAA 4IRCA 2RQMA 1R89A 2DNPA 4Y6IA 1EP4A 1IQTA 1P9QC 3FRYA 4IDKA 1IN0A 3D3BJ 1SV5B 2PEHA 4QU7A 4ZHRB 3WZ0A 4OJ3A 4B3SF 3C66A 1DQAA 5E0OA 4O3SA 3I9V9 4A4JA 4IFVA 1X9MA 1CJTA 1VC6A 4XPEA 1C0UA 4FNIA 3PRBA 1RHMB 5F0WA 2P8IA 5CAAA 4JI6J 2ASYA 3Q89A 2G0CA 3UDLA 1PSDA 2NUUG 4RPFA 4NA1A 2VG5A 3EGNA 1TMMA 4WKYA 4LSNB 3D66A 2RILA 4L75A 2HAFA 1RWVB 2Z4PA 3HX9A 3PM9A 2GC8A 2CWKA 3E2EA 2JOQA 3QFWA 2IDLA 4DR6F 4JI5F 2R7QA 1H2VZ 1EP4B 4J90A 1RAHB 4IDKB 1WG4A 3ITHA 4IYQA 4UTGA 4CLSA 1HQ2A 2ZBCA 4K0KF 2CQPA 4I6AA 4WFYA 1RKIA 1IKWA 3T6JA 1WC5A 2FGCA 4RUHA 1E6VA 3KG4A 3W3SA 3H8YA 2K7KA 2HZVA 3EXYA 1PC5A 4OX7A 2W7OA 2HVEA 5MAOA 2ZNYA 4U95A 3THVA 1ZYQA 4FS1A 5HO4A 3MUTP 3M05A 1UTAA 1X5SA 2IMOA 3TAQA 2HLTA 1XNQF 2MJUA 1WEXA 2AZ1A 3LQVA 2XYPB 2Y3YA 1TL3A 3MPVA 1JXEA 5HMYA 2HNDA 2B9YA 1JLGB 2R2SA 1WC0A 3GQCA 4LFCF 4F8RA 1CVJA 4F3MA 2ZH9A 1S76D 4F4KA 1TKTB 2P6SA 3BBFA 1S9GA 2C2MB 1T03A 3F73A 1RCXB 2VBWA 1AFJA 5T41A 1M5HA 2L08A 3OSPA 3H59A 5LOQA 2MZQA 1XNRJ 1AB8A 2IFXA 2R7OA 4Y34A 2OKQA 4USJC 4FYXB 4K4YA 3OVAA 3K58A 5AXLA 2FJDB 4CO1A 3TAMB 4K2JA 5F8IA 3MFHA 4P7TA 4FVMA 1HWKA 2IM0A 4V19X 3MDFA 4DV7J 1TELA 2GAHC 4B3OB 4IKAA 3VTIA 4DV5F 3DLLQ 4CH7A 1UVMA 4PYAA 4IFYA 2C2OB 1YITS 1Q8KA 3I87A 5A2QU 1C1BA 2UP1A 4A47A 4ZJLA 4DX8H 2RMLA 1XMQJ 2D3UA 4CLLA 4DR3F 2ERRA 3EZUA 4CLTA 4M1KA 3BQ2A 2VFUA 5L39A 1HWIA 4OHYA 2DY9A 1EB0A 3GB0A 5CA5A 4DMZA 5G0RA 2K8GA 4AXIA 4KTQA 3CDAA 2QL9B 2NYHA 3D0HE 2IBOA 1TUVA 2W9CA 3LP0A 3KMQA 4DZ6A 4ELUA 1U1QA 3C15A 1JJCB 2BVZA 2HSEB 3RRKA 4E98A 1TTHB 3R7SB 1C1BB 4I2PB 3OL8A 2D3O1 2DR7A 4UQTA 3QJLA 4PQAA 3TNVA 3IRXA 3H20A 4QIWD 3D3CJ 4I67A 2WONA 1AXQA 4ZVQB 3MWBA 3FEYB 4CM2A 4B9TA 3UDEA 2ZWOA 1FX2A 2RE1A 5D0HA 2XGQA 4UZCA 1JJ4A 3QBCA 4YDXA 2CQ3A 2HBRB 1RTDA 3DDIA 2CWXA 5KFJA 5KFVA 1WTFA 3RB3A 2W9CB 1TKDA 3PR4A 4ZVHA 3Q8PB 2AEJA 4DSLA 4DZDA 3P96A 1XERA 1W2IA 1H2UX 1I94J 1EQMA 3AJDA 1FK9A 1NH7A 1TKZB 5HL7Q 4QWEA 2E9ZA 2BQ3A 4QU6A 5GADI 3IRXB 1T7PA 1QSLA 3ADAC 2XULA 3UVJA 2BEFA 2WONB 1U2FA 1M1HA 3T1HJ 3QGHA 1IBCB 3AJ2A 3H2LA 2DPJA 1C4AA 4FXDA 2CVEA 2DT9A 4JI2J 2F63A 2VFSA 3A3NB 2OMLA 1WDDA 3JS9A 1RA6A 5DDOC 3HHLD 3EDRB 2V2VA 2EW9A 5J2QA 3OL6A 2J6SA 1U0HA 3EPIA 5M2RA 2FHOB 3HSJA 5KOXA 1NKEA 4HHJA 4YR0A 4RUBA 3KHLA 2BABA 2X1FA 1H7XA 4RNHA 1LW2B 1JLCA 3VF0B 5LT5A 3OFFA 1FK9B 5CCLA 2QV6A 1NZAA 1FEEA 3H5XA 2EK6A 2NUHA 1LWFA 4WPAA 1HD1A 5A6WA 4ILMA 1KQKA 4B3TJ 1AW0A 1HBMA 2QJ3A 4Q44A 2PA8D 3HVWA 1CEZA 3W2WB 2E7WA 3MPUB 4N5SA 4QPXA 4ECWA 3P3DA 1Q82T 1KNZA 3CJSA 5K8NA 2PI4A 3QT6A 3KLHB 3MXHP 1GQEA 3AH6A 4ED4A 2VHGA 4KT0C 7FD1A 4KGZB 3VZHA 2R2UA 5HVFA 4F2RA 3ISZA 4LMZA 4HEA9 1S0MA 3W60A 4R8UA 3QJPA 4C3KA 4ZLPA 3H42A 1HMVB 5I42A 4F2SA 1K1SA 2MQLA 1DURA 3OR1A 4KE5A 4DV6J 2EC0A 1WACA 4A8QA 4MIBA 3TX8A 2ZM6J 3UN2A 4NYZA 5DDRC 1HR0J 2R7UA 4GKJF 2F9DA 2V5HG 4NXMJ 2OUGA 3F0NA 3I82A 1UJ6A 2AD9A 2VUGA 3M2RB 3OSNA 3M8RA 3RR8A 3Q8RB 1AUSL 2QLWA 2OEMA 3A8JA 1KFDA 2V50A 1J2VA 1HI1A 3OTOJ 3HHDA 1HQUB 3MEEB 2KT5A 1RYRA 5E2QA 4LR9A 3BQ1A 1NU4A 4LFAJ 1NMEB 3SQGB 1U45A 4LF7J 5EX0A 3KDOA 3H4DA 3TJAA 1TL1B 3QATA 5DS7A 2B56A 5IM0B 2ACMA 4CIOA 4TNOA 4QWBA 1SQGA 5KT4A 1N5YB 3JSBA 2MHEA 3DRSA 4ANDA 3MR2A 3G2XA 3Q23A 2CJ9A 3K59A 3S6EA 5D78A 3DC2A 1NDKA 1TAUA 5GMKa 2HW3A 5DLFA 5LMNJ 2R3VA 1WHYA 1VRTA 3R7NB 2ZKTA 3GR0A 4LF4F 2QFIA 2X7IA 2MQQA 2XQCA 3RRGA 1HARA 3SSQA 2DK2A 2D3OR 3CJKB 2HBZB 3ZTSA 1F0XA 5HJYA 2U2FA 4OJGA 1BXNA 2LXFA 2KH9A 3RRHA 4OX8A 1CULA 2E5HA 2GVDA 2APOA 3G87A 5G4DA 2XS2A 1HPZA 2UUTA 1TZ0A 1QLNA 1MNEA 5I4MA 3G6YA 1WOSA 4Q2MA 2AW0A 3R5GA 4USKA 2GJIA 3G86A 3VQTA 2OFHX 1N48A 3CNQP 2FZGB 1FESA 2I2YA 3BQ0A 1Q8LA 1RP5A 5KFOA 5GAHU 1OIAA 1RISA 4NWBA 4ECQA 1PO6A 2AYMA 3IG1A 2YVSA 4JYAJ 2A10A 1VRTB 3BSNA 1RT4A 1WDTA 1QVGR 2NSCA 2C2ZB 2CQHA 3TARA 2CNNB 2M8DB 2GVZB 3KJNB 2BQRA 4DFKA 1PAUB 1N56A 2ZZNA 5A8RA 2CPHA 2EI5A 1UETA 2BJEA 4OZ3A 3KUHA 5D3GA 4P74A 1FDNA 4CQ1A 1OSCA 1JWWA 1R8HA 3Q8YA 1BGXT 3C6TB 5FIIA 2LQ5A 2ZH8A 2B9XA 1KBRA 4IH7A 1NB2A 2K2PA 1RA7A 4DR2J 1HPZB 2XMUA 2Q6CA 2MB0B 3NAHA 3CDUA 3DLGA 2FHMA 3PX0A 5ETPA 2ROGA 4F7VA 3JB9k 1FJCA 4OIXA 4KC5A 4TY8B 4LQ9A 1MU2A 1HBNA 3B8HA 3CD6S 2VIHA 3I5AA 3TZYA 1RT4B 1UJ4A 3JSMB 4G6VB 4NLGA 1UEKA 5CQGA 5F8GA 2ILYA 1RT1B 2QYCA 4M5JA 3IWNC 3HVTA 1RBAA 1YJVA 3CCLS 1RCOB 5DJBA 1TP7A 3IM8A 2PSZA 3QAUA 3MOJB 4QW8A 2CPIA 4O3NA 3CMAS 1RI7A 1T0TV 4IG0A 1MWQA 2L48A 3D2WA 3T5HA 1UWAA 2XZTB 4MK7A 1NJWA 2ATCB 5CYQB 2OH2A 4O3PA 2Z2MA 4DL5A 2B6AB 5HAOA 2D74B 3WIVA 4LR7A 1MU2B 3H2VE 1ZAWA 5BR8J 3EVOA 3W2VA 2KO1A 1F2GA 2BR0A 2H4WB 3KKFA 1VQLS 1UKUA 1NLKL 1A0OB 3I31A 1RT3B 4PR6A 1BY9A 2DHHA 3FGVA 3QRPA 1A7GE 5K14B 3QSYB 4AXJA 3GFHA 2KTQA 3VVUA 1U47A 2YNIA 3TZXA 5KG7A 2KN4A 2RNEA 2GQCA 3CDBA 3AT1B 1HNVA 1NXIA 3GIJA 1HBUB 4HH0A 3CJ3A 3GZ7A 5A8KA 2AU0A 1HNIA 5CHCB 4ZN3A 5DGAA 1SJFA 4LJMA 2JHEA 2LDIA 5F0UA 4CI0B 1S1XB 3PJ9A 4F36A 3TP2A 1WC6A 2IHR1 2HYIB 5CCMA 3MM7B 2VD3A 3IBCB 4KHMA 3K5MA 4O3RA 4RW6B 5IT9U 2O3DA 2FJVA 4DV3F 5D0GA 4C98A 3ZZYA 1RGVA 3KK3A 3VAHA 2UVUA 2KJVA 3SDEB 2XMJA 4MTPA 2EFPA 4O44A 1UFLA 3DCAA 2HVIA 3LALA 1WKJA 2MDAA 2V2QA 3K5LA 2OD4A 3RBXA 4FKYA 1OQ6A 3J80Y 4R5PB 1RBOB 4QR2A 4KGVB 2JJ4D 2YNIB 4FYYB 4KY3A 3FRZA 4Q43A 4F4WA 2FTRA 4LR8A 1RAFB 5U47A 4JI8F 2NZCA 2R2TA 2C22A 1C0TA 3TUZC 3HO1A 1IJFB 4CO3A 4JV5F 2F4FA 1QDUB 2PMWA 2J8SA 4OYPA 4PUOB 2V4RA 3D5MA 1RWMB 4PQUA 1URNA 2X3GA 5I3PA 3FMWA 2HQ3A 2YNGA 4I7FA 2J9CA 2KJWA 4DV0F 1FNXH 1IUJA 2CQBA 4HTJA 2ZOFA 2WB1D 1CSJA 5IS2A 2HQDA 2B8QA 2RH3A 3MMBB 3H4BA 5KFRA 2E5JA 4F4XA 2MZJA 3MEGB 1FRJA 2HHUA 1UVLA 1QJHA 2DNOA 2ZHAA 2YWWA 5GVQA 2IM2A 2C2EA 3W5XA 3O6QA 4DV4F 2MLXA 2HHHF 3MEDB 3R5BA 2XCAA 2PFDA 1NH8A 2VFRA 5LXYA 1SH3A 1K73T 1RWOB 1VYAA 5KT2A 2W4PA 4DCPB 1ZPVA 3UDVA 2PA3A 2GGPA 3UPFA 1QVFR 4AT1B 2YNGB 2CPEA 4MT1A 3L7UA 1SJ3P 2FJBB 2GMLA 2Y0SD 2B9EA 4CM0A 3G6VA 3BJYA 1RHUB 4ED5A 1TL7A 3G6XA 4NEYA 2J0SD 3PVXA 1FHTA 5JVGQ 2UXBF 3K5OA 2XY7A 4JV2A 1TU0B 4I69A 2PFFB 3JTNA 1D8YA 3W66A 2AJQA 2LEBA 2YXLA 2KFZA 4ANEA 1R6YA 2FZCB 1RB0A 4A48A 1Q4RA 3NGDA 4RNNA 4TVAB 2AJ4A 4Q0BA 1LFWA 2BRLA 4WP9A 1X5OA 1YK9A 4N47A 1NUEA 2FLLA 2AT1B 1UEUA 1DQ8A 1NSKL 3I55S 4F4YA 1WHVA 1XMOF 4IO9Q 3GMGA 1N34J 4WP8A 4CLUA 3J7ZT 3BGFA 1RT2B 1DAXA 1CJVA 1YTYA 2UXCF 1VBYA 4IUFA 3HHKA 3UE2A 3UCUP 2HG4A 1B7YB 4ZVPB 1SXLA 2MMYA 4KPCA 4RW4A 1QD1A 2C42A 5GAEU 2HRUA 2BV3A 3PFOA 4DPOA 3NKYA 1RAEB 2ZVIA 4PXEA 3AJ1A 5K9FA 6AT1B 2ZBQA 2CPFA 4CLYA 3SCKE 5J1NA 2MKIA 2K1RA 1WSRA 2I8EA 2FDNA 1CS4B 4Q0BB 1RAJA 5L46A 3P5BP 3AA9A 3NGRA 3LWLA 3V5RA 2RF2A 2QSWA 3GJTB 2W24A 4K7QA 1MWYA 1LWEA 4K4WA 3DYAA 1AZSA 3QQCD 1UPPA 3MM5B 2J9DE 2YBVA 2CQ2A 4USUA 3LOUA 4LVOP 3FBEA 4ID5B 4KO0B 2R7RA 1S72S 4JUZA 4PWDB 2Z0GA 3MD3A 3QNWB 2W7AA 4RW4B 2KZMA 1VC5A 2CQ0A 4NZ0A 3W5YA 2QMXA 3OR2A 4C9DA 4Z7CA 1TL5A 4J9UE 4O3OA 4HI1A 2W4CA 2DJWA 2HHQA 3BH6B 3CXCR 4DQRA 3R97A 2CZVC 1M0SA 1T3OA 2PO4A 4X4SA 2RUGA 3KMSA 3MCNA 4QBUA 2M2BA 2M0GB 1HNZF 1NHVA 5L9NA 1X4BA 2AQ4A 3DRRA 4TLQA 3E51A 3ILJA 5F8HA 1S99A 3NBPA 3LP2B 3Q83A 2B8PA 5HLFA 1MMDA 1LWEB 1AZSB 1Y0HA 3BGLA 1V3SA 2UVRA 2GW8A 3PW5A 3SIPB 2A0FB 1ZM3A 2IYGA 1NDLA 4R0JA 2CJBA 1YI2S 4CRJA 2OPSA 4FYVB 1CPZA 1R43A 2XZWA 4MH8A 2V8DA 1FX4A 5CABA 3CJ8A 2EFVA 4H4MA 1VQNS 2QRRA 2CNOB 5THWA 2BOAA 2MKYA 3OL7A 5IFMA 3VAMA 2FQQB 2BRKA 2DPIA 2AJ2A 1PILA 3WC2A 1K9MT 3V81A 3UN3A 2V63A 3ZZOA 4BCAA 2YH0A 2V8VA 3W62A 3GILA 1RWNB 3FSXA 1WHXA 2GO9A 4DR4J 4CH1A 4DEZA 4U7UD 2HWIA 4K4VA 4PEOA 3IO1A 1HBOB 1L3SA 1X0PA 3NBPB 3RJMB 2HHVA 2E29A 3ZTOA 1R8PA 1S4EA 4Y65A 1X0FA 3M7VA 1DTQA 2QMUB 1JQGA 4ZMMA 4HH1A 5C2GA 1RTZA 4XDCA 4M5HA 4JI7J 1HHTP 5ITHA 3W1YC 1FERA 4RBUA 1JJ2R 4RWWA 4H4MB 1ZPWX 5M2PA 4OL8A 4OQJA 3H5UA 4RNFA 1YSJA 2UUWA 4I2QA 5B7WA 2WOMA 4IRDA 3SCIE 3X3UA 1LK7A 3V81B 4J9OA 2MKSA 1VBXA 2QLFB 1JJHA 1TVRA 4B9MA 4UUWA 2GX8A 1G1XA 1FJ7A 4QWCA 2U1AA 3SV3A 2ASJA 4DUZJ 1U1OA 2CQ4A 2RKIA 4ZIVA 3ZTQA 4NEZA 1G7CB 3T9ZA 1O6XA 2VB6A 5HJXA 3ZZPA 3KK2B 4Y2MA 2WRMA 4ICLA 5L1IA 1KVJA 4LSLA 1Q5YA 1GTHA 5BYSA 1GXTA 1FFWB 2QX0A 3M4XA 2HS4A 1KN6A 3GYNA 2P9GA 4LF8F 1EETB 3SFGA 3DM2B 2CJKA 2WOMB 3IXQA 1NKBA 1F5AA 4OLPA 2YKNA 4JI3F 5ETRA 3O3LA 4NLPA 2V68A 3OHAA 1TVRB 4GRSA 3T9NA 1VRUA 3CCJS 1Y3KA 1WEZA 1VOMA 4DQSA 3CC4S 2HBYB 5DQGA 3B78A 2DNGA 3VALA 2I1RA 3M2UA 4ENOA 4YMEA 3L3CA 2LA4A 3MF5A 1BD6A 4NYPA 1DQ9A 5KFPA 1OO0B 1X4EA 1RKJA 3OV7A 2BACA 2XBPA 4LSZB 4ZKAA 1GMWD 2DR5A 2DNZA 4BBYA 1NRKA 2BMBA 2JH3A 2R4FA 4UUXA 2HFOA 5F41A 2V8HA 1UP1A 1RWWB 4K4SA 1QE1B 1UW4A 2NPIA 4YY3F 2WVBA 2POKA 2FC9A 1YRXA 1ELOA 1T11A 1XMBA 3HPOA 1HNWJ 1VRUB 2DNRA 2OAUA 1MWZA 1RE1B 5ETQA 2R7SA 4OJHA 1UVIA 1X4DA 5KFYA 1R8AA 4CLPA 4DJBA 2I6WA 2IVFB 5AJ3F 2PIIA 1T9WA 3MM6B 1AYEA 5LM7E 3RB0A 3G82A 5A8WB 4FZVA 4M8LA 3DOKA 2ZH3A 2JC1A 1PGZA 1OSDA 4ZJOA 3K2YA 1JKHB 2CIMA 4P2XA 2E1PA 2R7TA 1X4FA 2MY7A 3L4BC 2FVCA 5DG9A 3MECB 5F8LA 3OTDA 5KFBA 5IQQA 2KFNA 3N0VA 3HLUA 4OX9J 5KFDA 1O51A 1BQMB 3OTCA 1FD2A 5HK4A 3IN5A 4Q5VA 5HQMA 4OI1A 3CJ0A 4ER8A 1IJEB 2LECA 5K8MA 1YGYA 3DHWC 3ZXWA 4USMA 3CMES 2ZH6A 1EHWA 2YKOA 3W9IA 2N82B 3I0SA 2VV5A 1ZM9A 4OJ1A 3MUMP 1YBUA 2OPRA 1EKRA 1RWPB 2LMIA 1S1TB 1EX8A 5KG6A 3ZTPA 1XWLA 3LGHA 3K0JA 3FNNA 4DR6J 4JI5J 2H54B 4LFBF 2AEFA 1OPIA 3LANA 2D3ZA 3POTB 4MMOA 3NGTA 4RR5A 2CPYA 5D0EA 2E66A 1U09A 4NI2A 3CDEA 1JLFA 4MKAA 2B0GA 4QPTA 1JK9B 4F04B 3KDNA 2HHSA 2F3JA 4U8YA 1JLEA 4Y0FA 3BN7A 2E1CA 4G65A 4DX6A 3RBEA 3TR5A 2RD5C 1SIZA 1OQ3A 2ZC4A 3TUJC 3TOQA 3EGWB 2B4VA 2IJNA 4IG3A 1WSVA 1S4FA 4I56A 3I0SB 3IRWP 1U26A 2DHXA 3N01A 1YJNS 3R5JB 3R2DJ 2RHSB 2O5DA 3ENQA 1XN9A 4A8MP 3W8PA 2HMIA 4DX5A 1TUWA 4CLFA 2UU9F 3I0RA 1FRKA 2ZBRA 1RAOA 2J5AA 1F9HA 3BO4A 2IRUA 1NJXA 3LA0A 3IS9A 2XGPA 2COLA 3K8WA 4FYDA 4LFCJ 1HWLA 1VCTA 2H5EA 2FB0A 5ETOA 3FDSA 3VQSA 2VOPA 2VG7B 1S1WA 4NLDA 1IM4A 1LFPA 1RTIB 5IV3A 1Q16B 2V4JB 1HYSA 3CCRS 3RAMA 1K8AT 2G0IA 3CCUS 1FE0A 1N33F 1KSPA 4OI4A 1HA1A 3BEGB 4KHRA 3H7HB 3FSIA 2RRNA 4DN0A 3I5CA 1PIEA 3EXCX 4H54A 4P2FA 3VGTA 1X4HA 2N3LA 1YQHA 4DSKA 1IBKF 4PG6A 3M9MB 1RWXB 4ZCKA 5JMNA 1SI9A 2ZOGA 2MZRA 3MMAA 1K44A 2RRAA 2EPIA 1UZHA 2W4DA 2A6OA 4IH5A 1BQNA 1SL2A 1KOOA 2OPQA 3AXMA 3OLAA 2A2DA 4B9UA 4WXWA 3WQPA 4DV5J 2F40A 2DTJA 1S1WB 4Y2KA 1GX6A 4OZLA 2GIQA 3D7SB 4BC9A 1WKLA 2W9AA 4OZ0A 3PO4A 4O4RA 2Y8WA 7AT1B 4H4OA 4DPTA 4DR3J 2K06A 2IJFA 3V4MA 2GFFA 3AAWB 4OYZA 2MTLA 1C1CA 3MGJA 5HVGA 5BYQA 2DO0A 1QAXA 2ZOMA 4USHA 2HRYA 2Q79A 3DKDA 1YIJS 2ZH5A 2E1MC 2ABYA 5DETA 1X4GA 3MMAB 4DFJA 4PXDA 5KFUA 2P5VA 1NHKL 4F26A 4LREA 3J7YU 2BXJA 3DGVA 4F4AA 1VBZA 1FKAF 2LU2A 2W9BB 1LWCB 4A8FA 4QZVB 3OJSA 3ETMA 3QWUA 4ZVSB 5CYMA 3IWLA 1MN9A 2Z58B 2ZH1A 3E01A 2WVCA 3QZ8A 4H4OB 1D8ZA 3UWTA 1RT5B 4XTTA 3JQJA 4YHHJ 1U1NA 5GAGU 1XR7A 4OYOA 3ONQA 3AB4B 2AEMA 2MQ8A 2CQIA 1P1LA 1Q95G 2LQ8A 3J7A1 4U6PA 2ZC3A 2KYXA 3U1MA 2V4QA 2E5GA 3GIMA 1HFEL 3WX4A 1FJGF 3TO8A 5KFNA 3UD5A 4QYZK 1FXLA 3R6GB 4YN3B 2Y1RI 5L1LA 1BWEA 4MIAA 1RT7B 2HNYB 2VF3A 4CT8A 3DLHA 3D6TB 3S8SA 4F0HA 5T7LA 1FWKA 3MM9B 4LRFA 4M5KA 4O23A 4ZJQA 3MM8A 3PCOB 2W25A 3GE9A 3QLHA 5CYMB 2DKOB 1D9FA 4J9NA 1U1LA 3HT3A 3CCES 3M8PA 3M30B 5IT4A 3QMQA 4KH0B 3JSYA 1KWMA 3JYTA 4M5IA 4DSIA 4BC7A 2HQFA 4I1TA 1XMQF 4UT4A 5D4PA 3TJ8A 4FVCA 1U02A 3KLGA 3N4WA 1NPKA 2QZ8A 1L3KA 5DG8A 3QAEA 1LW0B 4ETZA 1NNDA 3L7PA 2JEIA 3WC0A 2R42A 1EIYB 1XTZA 2HS0A 3J81j 4XDDA 5T7LB 3G6ES 2ZNZA 1RHKB 3CULA 2BJ1A 2DHSA 3M8QB 4DLEA 4DUYF 3CB4A 2FD2A 2FY1A 4ZDNA 1RT6A 2QFJA 2L41A 3M6VA 3PDNA 3JYTB 4WJBA 2IM3A 3DGPB 1VQ7S 2CJAA 2JDJA 2H1YA 1WG5A 2I38A 2CQ1A 2W2PP 3DDNA 2BE2A 4WBFA 3VAKA 2IM1A 3BDEA 3KLGB 2KXHA 3K17A 3D1QA 1GT8A 5LL6d 1N5TA 2BQUA 3BKFA 4N77A 1HIYA 4X4NA 4C11B 3TVYA 3C16A 1SPBP 1GXLA 3FZBA 1FVSA 3NMAA 5DRKA 4I64A 3SSRA 3D1HA 1JXLA 1KC8T 1WG1A 1F5CA 2KU7A 2W8KA 2J0WA 2JEGA 4DSJA 1N36F 1RAGB 1IKVA 3TWZA 3PXGa 3KUGA 1RLDA 3S7RA 1Z2ZA 3KLIA 4RO0A 3I6PA 3CD7A 3KJFB 1ZM2A 3HDSA 3QIPA 5A0YA 2BE2B 2XS5A 4YB7A 1PC4A 4OYIA 2ADBA 1TL4A 2B4PA 4Y00A 3UN5A 3JQKA 4ZPWR 3T1HF 1F9FA 3HVRA 4NCGA 4RKUC 3DLJA 4JI1F 4CO0A 3EM1A 1QSYA 5JXSA 2XZDB 3AOAA 3KJVA 2HEKA 1W25A 2ZE2A 2GHPA 3BF4A 5JJBA 1F2HA 2XO7A 3ILOA 3AFGA 4MFBA 3QT5A 2VOOA 3A13A 4ZVFA 1X9WA 4TYAA 1Y11A 2JX2A 4RNMA 3L7OA 5HROB 1F60B 4DI6A 5KFKA 2XWYA 3WDOA 5KG3A 1B3TA 4ED7A 2OLWA 3E8OA 3FSYA 3KK1A 2BX6A 4PWUA 4X4PA 5IT9Y 4OI2A 1P9YA 2Y8YA 3KG1A 1CLFA 5A0YB 4L73A 2UUAF 4B3TF 1TKXB 2IRYA 3ILIA 1ZA1B 2R8HA 4LF4J 4EZ9A 1DTTA 3CE8A 3BPSP 2YWKA 3WBZA 2DGXA 2Z56B 2KM8B 3C3LA 4DXLA 2DGQA 2IC3A 1VQ6S 1FDAA 5LXRA 2KHDA 2UUBF 4P71A 4CZCA 3DLEB 3IFEA 4IO1A 1UFWA 3SZ2A 2NYIA 3M6XA 1WC3A 4PXCA 4YR2A 3OHBA 3I5BA 1VQ5S 3TVZA 2XEXA 3KLEA 2JFDA 3Q22A 2XSJB 3DOLA 2XMVA 2KT2A 5EUHA 1VC0A 4KFBB 2KL8A 4ZVUB 3PO5A 3MAAA 4FXWA 1QUPA 4EBCA 4C0HA 1R0AA 1SKUB 1YBAA 2IVMA 1FDDA 4N8NA 3IC1A 1S9EB 1PAEX 4ECSA 1VQKS 2P9EA 2XC9A 1UWBA 2AYGA 1FKPB 3ZTRA 1RTHB 1XJWB 3FMBA 2MEWA 4NLYA 1SV5A 3Q86A 2OMOA 1PKUA 4ZHRA 5LJ3Y 1L5UA 2DITA 3D9BA 6FD1A 2EG1A 2HIQA 3CT9A 4DQQA 1JX4A 4PRFA 2MPUA 3IGNA 4V1Ak 5KFAA 2E9RX 2YY3A 3HD1A 1VGYA 1FD8A 3R5AA 3ET6B 5HMXA 3HXMA 4FXVA 3GSDA 2YQ0A 2CG4A 1YVFA 2HLUA 2YH1A 3DI6A 2GIRA 2LDYA 3NCPA 2BE7D 4S0MA 2Y0BB 2NCKL 3MAAB 5SZTA 3KLFB 1S1VB 1C4CA 2VQFF 3BGRB 4LSNA 3OLBA 4NASA 1Q86T 5BYRA 1G3OA 5DZ6A 3GPAA 1J5OB 3V6HA 1N0VC 1RQ0A 1W26A 1UWBB 4TU7A 2F5GA 2OPPB 3LO3A 4FN5A 2VICA 2VH7A 4NMLA 2MZTA 2XCPA 2YTCA 1H0HB 4EUVA 4FPIA 1T9XA 4MKYA 3CTRA 2BYCA 3O2IA 4WU2A 1D9AA 4U8VA 4RUAA 4RW8B 4Z2XA 5MLCV 2VJUA 3DOMB 3TUPA 2ADCA 3SFUA 5KFWA 2B51A 2C28A 4LRCA 2F8MA 2QO3A 2A3JA 3LGMA 2J6UA 4CDIA 3GCXP 3DI6B 3IA0A 3ZZRA 2GO8A 4X4OA 2VKZG 1TUGB 4UOCA 3KNGA 3FQKA 1GEHA 1U2CA 2G1DA 3UDCA 1X8DA 4JB8B 2O67A 3EUNA 4KV8B 1JLGA 3DLKB 2E5LF 3CW2C 1NM2A 1R8BA 5DO2A 2PI5A 1NHUA 1D1UA 2CQDA 1TKTA 3PR5B 2UXDF 2VASA 4U96A 1REVA 5DQIA 5E3PA 1Q78A 2XMKA 4AD6A 3TANA 3CJ5A 4KGKA 5ETSA 1U7LA 3BV8A 2IBKA 1N88A 1ZBTA 1OY9A 2NS1B 3WHIA 3MR7A 4DG1B 1BMQB 4GVBB 2N4DA 4DV3J 3TYTA 4RX6A 3TAMA 2FVPA 2ZJRQ 4PXBA 3HFVA 3THTA 1QSSA 3AD7C 3ZNJ1 1N5VA 1S57A 4J7CA 4J9MA 1RLCL 2XSFA 1SQEA 2LEPA 4FF1A 1WHWA 4OZ5A 5T14A 2NPFA 3DRXA 4B3OA 2XM3A 5K5MA 1S6PB 1FF2A 1REVB 4KBIA 2W7PA 4C8NA 3HHEA 4JV5J 4IQXA 1KRPA 3M2VB 5E41A 1SKSA 2ZVSA 4DR7F 3EE3A 3R5CA 4ZN1A 2HFNA 1MMLA 1SJRA 2KDOA 3DMJB 3D0GE 3QWPA 2JC0A 4U7CA 2CNLB 4UOGA 3AQOA 4DS4A 1NK0A 5AXKA 2RAQA 3HCXA 4AQYF 4DV0J 3OVSA 5CD4H 3M8ZA 1KFSA 1GMVA 3MCSA 1YRUA 1B7FA 3HF5A 3CC2S 4K5SA 4H4KA 3N9UC 4CYUB 4D3HA 1K0TA 2ZJPQ 4WFNQ 2QT7A 1NJYA 1MN7A 2B7CB 4X64F 3Q8VA 2MYFA 4ES1A 3RTVA 2VODA 2OD6A 1UEVA 4ELVA 2CUYA 1VS3A 5D15A 2QLXA 2LU1A 4EZ6A 4DV4J 4LF9F 2GHWA 4QR1A 3UI3A 3PRVA 4O4GA 5HP1B 4I2PA 1UFKA 2KYZA 2CZ9A 3T1YF 2Q1LA 4OYAA 3QO9B 4FBTA 1S12A 2QN6B 2YNFB 3ETOA 2RQKA 1F6TA 1VQSA 2DCUB 2LA6A 3PJXA 4RBVA 2VBXA 1UA0A 2PMHA 3PTWA 5H9FK 1S59A 4DF8A 1CJUB 2UXBJ 2YPYA 3G4SS 2I0XA 1WNEA 2HHXA 1RHQB 2B43A 4OYBA 4B9NA 1PYSB 2NZ4A 1DBDA 1NBEB 4P9SA 1O5JA 3TZZA 3C6UB 1EJ7L 3TW0A 1X60A 4IRKA 4QIGA 5EDWA 1IR2A 1WI6A 4DSFA 1S97A 4DL0C 2A1BA 5LSLA 4O4GB 4DL4A 4TLRA 1DARA 1Q1KA 1XMOJ 1TKZA 2AWZA 4ZVEA 1QTNB 4TU8A 2L9WA 2UXCJ 4CT9A 3MEKA 2XLIA 5B09A 1FXDA 2MSSA 3VAFA 1VK3A 1UJ5A 3CJRA 2BKPA 4USTA 2XNRA 2ZITA 4N8OA 2EKNA 4QYRA 5AE2A 1G6BA 1YX2A 1H74A 3GG1A 5F3TA 2AX0A 1VQMS 3HHLA 3A8IA 2D41A 4A8KA 4CP5A 2YQ1A 2EBEA 4DOZA 2V9KA 1NJZA 1IWGA 2VFVA 2OTLS 4CO5A 2R8JA 4WZMA 2QSFA 1NK6A 2HQGA 1LW2A 4YFUA 1IQZA 2DD8S 4NLOA 1B99A 2JWNA 4ZVTB 1RWUA 4G1QB 1SUQB 2QLJB 4JI4F 3T41A 2ATLA 1HD0A 4NLQA 1VIOA 1QAYA 3H25A 1Q8IA 3LP1B 3W2WA 1NPPA 3NNCA 1SL0A 4L76A 3MI7X 4TXSA 1YDLA 3PX6A 5KFQA 1NEEA 4EMDA 4G3IA 3JAMU 3MR6A 3KLHA 2CFXA 3U1NA 1NZ8A 1JLBB 3HHLB 3SMZA 3MMCB 3BBBA 1S79A 4EWTA 4M5DB 2QE5A 4J9QA 4C8ZA 3H40A 1MROB 5DG7A 1T95A 1V3RA 5F9LA 3BO3A 3M1VB 1HMVA 1S1UB 3V6DB 2B9WA 3CCZA 3CJ2A 2UV8A 4B17A 4NLRA 4RW9B 1IKXA 4HT5A 3JSRA 3F44A 5E3QA 1GX5A 1VBKA 1CJKB 1VQ4S 1OY6A 8RUCA 3NCRA 1N5SA 3OTEA 3M2RA 1IVZA 1DZ5A 3UW1A 2VPWB 3TA2A 4TKTA 1FNOA 1EQ0A 3HD2A 1HQUA 3MEEA 4WZQA 2DR9A 2RSQA 4UY85 2XG8A 1HI0P 2B5JA 1U1KA 3SQGA 1O0PA 4K4TA 1DLOB 1GNKA 2WTFA 4CLZA 5K8OA 1NDCA 4ZA1A 2E7VA 1TL1A 3EGZA 5C5JA 4W92B 4ZITA 3PW4A 5IM0A 3M32B 4BS2A 4ATNA 5J2PB 1N5YA 2EBGA 3GR1A 2YPZA 4HVZA 1IKXB 2BW7A 3VZIA 2DRDA 3EZOA 2YKMB 2J6TA 5HQ8A 2HGLA 1P27B 2X1AA 1WOOA 2DH7A 5IXUA 3DU6A 3QSIA 3PHTA 3W7BA 2WZ1A 4WF9Q 4HYKA 1TFWA 3CWJA 5IQ6A 5DZ7A 1R3NA 2IAJA 5GADU 3Q24A 1RK8A 3WIUA 3IBWA 3DLBA 4YOEA 3CJKA 3X1LB 2W2MP 2B5JB 1VMBA 3BR9A 3C14B 3G8QA 5D4OA 1IKYB 3OVBA 1PBAA 4GMKA 1S0NA 1IWAA 2ZBPA 2GAGC 2MJNA 1PYTA 3J80U 2D69A 3R27A 1Q7YT 3VHQA 2J76E 4P7VA 5CZVA 1HHQA 1YJTA 3GFXA 3KHRA 2CKWA 2IDEA 3MZIA 2NREA 2AGOA 1TK8A 2HURA 3EWGA 2AJ1A 3KUEA 2Y1JA 4J9SA 1ZH5A 1KEKA 4LF8J 3D6MB 1XBWA 2IAJB 4CO2A 2GVZA 1SKRA 1Y00A 3NLCA 4KH1B 4O0NA 1ZTWA 1P8GA 4JI3J 2BANB 3C6TA 1NK9A 4USIA 1T05B 4YQWA 2BBEA 4OHVA 4RZRA 3N6NA 1U0SA 3CC7S 2V0NA 5C24B 3FEZA 2ZD1A 4B3RF 4DR4F 3RW6A 2IJRA 3GJQB 3BDPA 2VG6B 4MKBA 1M1KT 1N6QA 2B4OA 3T6BA 5I3UA 4LT6A 3V2UC 4TY8A 3Q2SC 3TEHB 3O8WA 3PIPQ 1BQXA 2KVQE 3T5JA 3T5LA 1TV6B 2WSEC 1ICEB 3JSMA 3BH7B 1M90T 4AYBD 3PW7A 4DS5A 3R8YA 5DDQC 4WP3A 2VC1A 4HDHA 2DBBA 2DGVA 1RT1A 4C3LA 3KXDA 4X66F 1BLUA 3SBMA 2KRRA 4QIEA 5J1EB 2XYGB 4MK9A 3AHPA 4FBUA 4OYMA 5ADZA 2XY6A 2ZD1B 3K8VA 4OV6A 2MXYA 1CQNA 1RABB 2ASDA 4YB5A 2Z30B 5CYQA 1S10A 3PFEA 5AJ3J 2B6AA 3U7JA 1N6QB 2HRTA 1HQEB 4PG4A 5I3UB 2QLBB 4XIUA 2KVIA 4ZVRB 1OYEA 2K3KA 3RB4A 4H4KC 3Q8UA 3US5A 4QOTA 2EG2A 4K4XA 4LRDA 4DR1F 4KKOB 2FUG9 3FFIB 2LXIA 1NB7A 5ETMA 3EMTA 2UV8G 4IQMA 1RT3A 3H5SA 3VWSA 1DJ0A 4ECRA 3IP0A 2XWXA 4URSA 3V6KA 5K14A 4X4QA 3BS9A 2WAQD 1IBLF 4OX6A 2MQPA 4EFAC 2EK1A 4OFZA 1HBUA 2LVWA 4Y2CA 4AUKA 1YZ6A 1FWLA 5K20B 2AP6A 2I9SA 4GVLA 3NXZA 4RU2A 3KWMA 1S1XA 1BC6A 4DL2A 3MR3A 4NLVA 3MM7A 4OZNA 4RW6A 2VPZB 4DL3A 2Q43A 4LFBJ 1RSCA 4OZ2A 3L09A 3V4IA 3FK4A 3R5DA 5ETLA 3SDEA 1TR0A 5KFTA 3C8YA 4EGLA 5D77A 2J7KA 4ZIWA 3SV4A 1IBMJ 5SUHA 1ZOTA 4MIWA 4R5PA 4I6YA 4B3MJ 1B0VA 1LWXA 2J0XA 3GIRA 2BW2A 3FCHA 2XYHB 4Q8EA 4EO8A 2DGUA 3CCSS 3K7RA 1FVQA 2IY5B 4X62F 2G4BA 2PT0A 4ZCMA 3I32A 4X65F 2DEIA 4PUOA 1WOPA 5GMEA 4PG5A 3CO0P 3JTPA 5C25B 3LAMA 4JV1A 5EHHA 1B4SA 4DPYA 4NYOA 3BSOA 2BM1A 2UU9J 3A3PB 4Y28C 4Q8FA 3V4IB 3NS5A 1H38A 2HFSA 2DVIA 5KT7A 2VQEF 2BDPA 4X4UA 2VC0A 1SIWB 3EICA 3K57A 4J9RA 3HULA 3MMBA 1VJWA 2DGOA 5HBMB 3G71S 5H1SV 5DDPC 3UO0A 2RQCA 3P5TL 3MEGA 2MQOA 3VGSA 1OPZA 2H9ZA 3TAPA 4TQRA 5J2NA 4OX9F 5C42B 3RG6A 4OZJA 1YLXA 1N33J 1WI8A 2LLZA 3E3XA 5KFHA 3MEDA 2EFOA 3SXLA 3K5PA 5RUBA 8AT1B 3NWRA 1FKOB 4URQU 1I1GA 3NWGA 1U6ZA 2OIHA 4Y2AA 2IIHA 2AGPA 2FYXA 1IBKJ 1Y7PA 3I56S 1S6QA 1J27A 5A6PA 4ZOSA 1N5QA 1UZDA 2M88A 4ZPVR 4XAKA 5E3AA 2QYGA 3SYZA 1NK8A 1ZZNA 1I51B 3H5YA 4WK1A 3RYLA 1UVJA 2E9TA 4EO6A 4GKKJ 4OMFG 2QEXS 4HI2A 1Z1ZA 4P52A 1XIQA 4BHQA 4MJKA 3PEHA 1TK0A 5J2NB 2B7BB 2VBYA 3D0IE 4IFVB 1CJTB 2RT3A 4WYWA 2V94A 3R9LA 3S1TA 4OI6A 2ACYA 2CPJA 1C0UB 2D9OA 5KFGA 2DHAA 5LMUF 5IOLA 3HZGA 3DNCA 2ZWPA 1RT2A 3FBBA 3NOGA 3LF0A 3RW7A 2KFYA 3R1LA 2DIUA 1DY3A 1S6QB 5IZHA 4EU0A 2VG5B 4Q7AA 3EGVA 2DNYA 5GMDA 4U9RA 2HQIA 1NJIT 5CZXA 2F1FA 2GCFA 3C2PA 1WF1A 3F41A 2ZZTA 2GQ2A 4K59A 4AL6A 2YKAA 1WJ9A 3LGNA 1W2BR 3PEJA 4IOAQ 3FKBA 1GMUA 3ITHB 4LVNP 4TQSA 3LH2S 3ZZZA 3IAS9 1KQFB 3QRRA 1R0CB 3O5TB 1CS4A 1R8CA 1IKWB 4KIAA 2FZKB 3D6HB 3VAIA 4FKXA 1E6VB 3ENWA 4ITSA 1U25A 3UFCX 4DFPA 3I96A 5E7OB 2XO6A 3MM5A 3BGOP 3BGUA 4ID5A 4KO0A 4PWDA 2PE8A 1FJGJ 2L9NA 3DDKA 4ES3A 2M52A 5B0GA 4FF3A 4F0KA 2MKKA 5I3QA 2NXNA 5ETNA 2QC3A 1U2RA 1VLYA 1TL3B 3RGIA 3CGIA 2HNDB 2PMZD 3VR1A 1H2TZ 2NXUA 5IWAF 3DRYA 4KQZA 2CYYA 2RVJA 2O66A 4RWXA 3FEXB 4YR3A 2WSFC 4J9VA 2HFZA 1PG5B 2ZHOA 4URGA 4NA3A 2A6MA 3BN4A 2EWHA 1S9GB 1T03B 2RHQB 2D9PA 1WELA 5AT1B 3LP2A 1JLAA 5KFIA 4ECXA 4GC6A 3CCTA 1XR5A 4LF5F 2HIYA 5D6GA 1FNMA 1VIXA 4BLGA 2QA1A 4D3GA 5ETKA 1X7VA 2DNHA 1UW9A 3ZZ0A 2KT3A 4OYXA 3GV7B 1RHJB 3MPWA 1GFWB 2CPXA 1YHQS 3NS6A 4HHUA 2QMWA 5KG1A 5HN0A 4GO7X 2WBRA 4WFZA 1FRHA 2HWHA 3QIDA 4UF4A 1Z2LA 3VVTA 3CO9A 2J9DA 2CPZA 4KAIA 4DUYJ 4WKRA 3CVKA 2P2CB 3KOAA 4UQGA 5LSOA 2E1RA 4IFYB 3S01A 4GC7A 1HBOA 2OEJA 1FTCA 3CSKA 4QW9A 4L74A 4IOBA 2EFGA 4KHPF 1JLAB 1JNZB 4JP8A 1G2EA 5KG5A 4YHHF 3NAIA 2YX1A 3NGKA 1CC8A 1APSA 2AZ3A 1XC9A 3I9ZA 5BXIA 1J5EF 2M70A 2CRLA 4CNYA 2CJQA 1RYSA 2V2KA 2ALZA 2Q66A 3AOBA 3GONA 5G0RB 3OFGA 3FC9A 1IR0A 3SSSA 2KXNB 3CF5Q 2Y1IA 3AODA 3LP0B 4WFXA 3MAHA 2NLWA 4DCOB 1N36J 2OHDA 1A9NB 3C15B 5KFLA 3EJMA 1N32F 4CLWA 4PG7A 1YWXA 1UCNA 2P9CA 5IC6B 2AIRB 2BJ3A 1LXJA 2WVFA 4KGMA 5KFZA 3OUYA 3NL0A 3JQMA 3KK2A 1JXVA 1REGX 3KYLA 5HSPA 1AA1B 4JI1J 2QA2A 1M5PC 1H6KX 2WBMA 2NQPA 1LV5A 3AB2B 3KLVA 1SCJB 4NLTA 1O8BA 3FBCA 1T94A 1T9UA 1EETA 2M9KA 3DM2A 5CD4A 4J9PA 3IR6B 3MMJA 4JI0J 5L1JA 4WE1A 3VGVA 3IMQJ 4UW2A 3U1LA 1UVNA 3IGVA 1P1TA 1RTDB 4Z7YA 4BWJA 3KFWX 3PZPA 1R27B 1V3ZA 3NP5A 5IC4B 1Q0NA 1D3WA 3N28A 2DCLA 1MMNA 5CXTA 2WCXA 1XEZA 4DR5F 3AXKA 4NXNF 2C2NA 3AD9C 2LP4A 2UUAJ 3F56A 1CQMA 3UVJB 2VFTA 4NRTA 5KT3A 3OUYB 3GYGA 2DNQA 2F4VF 5ETTA 3GWCA 4KGXB 4J9LA 3LW5C 2FVQA 1QAIA 1FXRA 1GMWA 3NRBA 2UUBJ 4Y3CA 4LF6F 3SCJE 2GNKA 1H73A 4C6AA 4WE1B 2OEKA 5J1PA 1R0BG 1VFJA 3PKYA 5J2QB 2XS7A 1U0HB 2XHWA 4A46A 4PPZA 1QE1A 2XY5A 5EWFA 3G8TA 3D1OA 3M8WA 2R8GA 2UUCF 5GAHI 2YKQA 3AY0A 1JLCB 4HDGA 5D4LA 3U02A 2HFVA 3KG0A 3B4MA 3M8SA 2RU9A 2RDDA 4NZ6A 1WWHA 2BUNA 2IA0A 2V67A 1LWFB 4LBHA 2HWTA 3N6MA 1JIHA 2LQBA 4W4MA 1HBMB 1MLAA 3MM6A 2PGCA 2GJFA 2JNJA 2FPHX 4TYBA 2KHCA 4DV2J 5A8WA 3NNHA 1HNXF 1UL3A 2B4UA 3GIIA 1XQIA 1JKHA 3HVAA 3MR5A 1GK8A 3UR0A
chains in the Genus database with same CATH topology
3Q8QB 5DO2A 2HHHF 4E0DA 1RDRA 1CG2A 3MEDB 3OXGA 3R5BA 2XCAA 3MAQA 1NH8A 2VFRA 5LXYA 2PI5A 1SH3A 1NHUA 2LYVA 4MYTA 4C8OA 1D1UA 1K73T 1ZETA 4DV1F 2CQGA 2CQDA 4DL6A 5DM7Q 4B08A 1TKTA 5KT2A 3PR5B 2W4PA 2UXDF 2HHTA 2VASA 1S7HA 3QYYA 3ULHA 1REVA 1RJJA 5DQIA 2ASLA 5E3PA 4R8UB 1ZPVA 4RW7A 3MECA 1Q78A 2XMKA 4C3MA 3Q2TC 3RAXA 2PA3A 2GGPA 3TANA 3FJ2A 1KHVA 3PNIA 3CJ5A 5A2QY 4KGKA 5I42B 3UPFA 1QVFR 4LUBA 2AGQA 2YNGB 2CPEA 1U7LA 3RB6A 4I0WA 3KTQA 1BQMA 2IBKA 2R8IA 1N88A 3I4HX 1ZBTA 1Q81T 1SJ3P 3OR1B 5KFFA 2NS1B 5AXMA 2FJBB 4B9SA 2GMLA 2Y0SD 3GFYA 3UCZP 3G6VA 2BANA 3BJYA 4Y2IA 4ED5A 1BC6A 1FT8A 4NRUA 4DG1B 3MM8B 1T05A 3G6XA 2N4DA 2JEJA 2J0SD 3PVXA 1A6LA 1FHTA 3UCGA 5JVGQ 4J37A 2ZJQQ 3TYTA 2UXBF 3K5OA 3O44A 3PACA 2XY7A 3QLHB 1X5PA 4JV2A 2ZHBA 1U6BA 4RX6A 5C24A 2WHOA 4I69A 2PFFB 3TAMA 4KRWA 3JTNA 3CJ4A 3M6WA 4CCHA 1YJRA 2FVPA 2FJWA 2AJ0A 3M8PB 3TUIC 1D8YA 2ZJRQ 4O0IA 4PXBA 2IA6A 2AJQA 2DNKA 2LEBA 3THTA 1SJ4P 1QSSA 2KFZA 1NO8A 5FLXY 1R6YA 3NGDA 2VG6A 4A48A 1Q4RA 4WIIA 3VAJA 4RNNA 1S1TA 1N5VA 4AL7A 2AJ4A 4J9MA 4Q0BA 1LFWA 2BRLA 2XSFA 4PCQA 1SQEA 2LEPA 4FF1A 3PW0A 1X5OA 1KLMB 5KFEA 1WHWA 1VHFA 2MSTA 4N47A 2FLLA 1UEUA 1DQ8A 2CZ4A 2P6TA 4OZ5A 2HAIA 5CYJA 5T14A 2V8GA 3DRXA 2NPFA 2GV1A 3POTA 3I55S 4B3OA 1X4CA 3GFZA 1TV6A 2DH9A 4F4YA 1WHVA 1XMOF 4IO9Q 4ED3A 4B9LA 5FDLA 4FF2A 1FCAA 5K5MA 3V6JA 1S6PB 1VQ9S 2JZ5A 3GMGA 1FF2A 1REVB 4KBIA 2XNQA 3J7ZT 4C8NA 2W7PA 3BGFA 2M7SA 1RT2B 1DAXA 4ILRA 4RW7B 3HHEA 1YTYA 2M4MA 4FNHA 2UXCF 4IQXA 1VBYA 1KRPA 4NCBA 4IUFA 3M2VB 5E41A 1LXNA 3HHKA 1SKSA 4U7UK 3UE2A 2ZVSA 3UCUP 4DR7F 1Q8BA 5KT6A 3NG8A 2HG4A 3ENVA 4TN2A 5KFCA 1SXLA 2MMYA 4YEAA 3KNAA 3R5CA 4RW4A 2HFNA 1MMLA 1SJRA 4ZPCA 2KDOA 2ILZA 3DMJB 3D0GE 3QWPA 1R31A 2JC0A 2C42A 5GAEU 4NLXA 1M5VC 4U7CA 2HRUA 3DRSB 2BV3A 3AQOA 3PFOA 1YJ9S 4DPOA 3NKYA 3TRGA 4DS4A 4KSEB 1NK0A 5J1EA 5AXKA 3ZC4A