3HVTB

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
427
structure length
398
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
molecule tags Nucleotidyltransferase
source organism Human immunodeficiency virus 1
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
total genus 74
structure length 398
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB03
1TV6B 1HQEA 1R0AA 3MEGB 1SUQB 3RBDA 5JUMA 2GC8A 2OPSA 1RT6B 3CJ5A 3D28A 1TL3A 4MK7A 2JEFA 3CDUA 1T03A 5KFPA 2FJWA 2BANA 1N5YB 3QYYA 2HNDB 4RUCA 4ECWA 1HYSB 3H5UA 3OL8A 1TKTB 4TY8A 5DGBA 4IRKA 3HVWA 1TVRA 1C1CA 1RYRA 3VQSA 1MU2A 3LP1A 2ZE2B 1S6QA 1C0TA 1QUVA 4IDKB 5KFFA 3H98A 3RB0A 2UVUA 5KFAA 2VG6A 4ECTA 2ALZA 3DOLA 1S48A 3MF5A 2RKIB 4MK9A 5F9LA 1TKZB 4IR9A 2E9RX 2R2RA 3MR5A 4DL4A 3H4BA 4URSA 4QW8A 2ILZA 4R0EA 5KFNA 3QLHA 4K4XA 3NMAA 5KFGA 5I42B 4Y3CA 5KFXA 4KSEB 3G6YA 3G86A 3DYAA 5KFKA 5F8MA 1VRTB 3DI6B 5J2NB 3CIZA 1T3NA 1SH2A 3GIMA 3QIPB 1VRUB 3QGIA 1TL1B 4X2BA 2FLNA 2WHOA 3PW4A 1TL3B 4WXOA 3MR3A 4LQ3A 4RNOA 1HNVA 1KHWA 4DL6A 2XI3A 2E9ZA 3RBEA 5C42B 1TKTA 3IRXA 1HARA 1RTIA 3GQCA 1DTTA 4HYKA 1HQUA 4B3OA 4NLYA 3OSPA 5DG7A 4NLPA 3IG1A 5L9XA 5J2QB 3T5KA 1RYSA 1JLAB 1S6QB 4RW7A 3IN5A 1SV5A 1J5OB 3Q8SB 4ED0A 4DL2A 4QW9A 4DL5A 2AQ4A 1N6QB 1S0MA 3DMJB 2FVPA 1HPZA 1RTHB 2HNZB 3CWJA 4EYIB 1JKHB 3H5XA 4IG0A 4KFBA 3KK2A 1CSJA 3NKYA 3I0RA 5KFSA 4WE1B 2BRKA 4ZPCA 4R8UB 1T05A 5KFTA 3QLHB 4DG1B 2W8KA 2OPQB 5J1EA 3SFGA 5KG4A 5I42A 4KHRA 3DRPB 4K4TA 5KT2A 4O3NA 4ED8A 5KFBA 3E01A 3JSMA 1RA7A 2CKWA 1OS5A 2D3UA 2AU0A 3PJXA 4WFYA 1W25A 2JC1A 4ECUA 2ASLA 3T5LA 1TL1A 1SUQA 2GIQA 1IM4A 3Q8PB 1TQLA 1T03B 3KHRA 3NAIA 3IRXB 5KG3A 3KMSA 1RT7A 3DLEB 4FBTA 1JLFA 4Q0BA 1C1CB 3MECA 4NYZA 3OSNA 1HMVB 5KFHA 5F8GA 3T19A 4TXSA 1MU2B 5KG6A 4J9QA 3C6UA 2XWYA 4WXWA 3DLKA 2J6TA 4RU9A 3EPIA 3DRRA 3KLGB 1S49A 3GIKA 4ECRA 5C24B 1K1SA 3HHKA 2XGPA 4ECXA 4ED7A 2J6SA 2VG6B 4IG0B 5C25B 3OL9A 1JLGA 1C2PA 4WE1A 2RF2A 4ID5B 1XR5A 5KFWA 4KHMA 1C1BB 2WTFA 1RT5A 4TN2A 4J9OA 1JLBA 5KFRA 5EWGA 3BSNA 4NLGA 1IKVA 2IAJB 3DOKB 4QWDA 1LW0A 3M9MB 5L1IA 1N4LA 4NLVA 4JV0A 1JX4A 4IFVB 3CJ2A 4IOBA 2C28A 5DGAA 2FVQA 1LW2A 3I0SB 3CJ3A 2YNHB 4TYAA 3RB6A 1RA6A 4EEYA 1RTDA 5DLFA 3RAQA 2AGQA 2IM3A 1RTIB 1BQNA 4Q8EA 1TP7A 1HMVA 2UVRA 4G1QA 1EP4B 3IG1B 1N48A 4WYLA 4PWDA 1IKWB 3BSAA 4Q45A 4ECYA 4TQSA 5KFIA 3RB4A 5CYQB 4RW7B 4GC7A 4URQU 1N6QA 4IKAA 3KHLA 1BQMB 4F4YA 2WONA 4ZVFA 1S0NA 2IJFA 3NAHA 4K4WA 1JLGB 3ISND 3BSCA 3KK2B 4I7FB 4ZHRA 2ILYA 4TY8B 3NGDA 5DG8A 3GV8B 1RT4A 1JLBB 2IM1A 5KFMA 4WFXA 5T14A 3GV5B 2YNGA 2JEJA 4DG1A 1LW0B 2HWHA 3QO9B 5HBMB 4RW4A 2R2TA 5HLFA 3CJ4A 4NRUA 3JSMB 1S1WA 4IDKA 4NLQA 4RUAA 2DPIA 2HNYB 1HNIA 5F9NA 3I0SA 1S10A 3T5JA 1MMLA 2XCPA 4NLWA 4YQWA 1JLCA 2GIRA 1FKOB 5F8NA 1TKZA 4IFYA 4F4WA 3Q8RB 3MFHA 3BSOA 2ASDA 2AGOA 4FBUA 4KE5A 5FDLB 3DRSA 4RW8A 3TAMA 1XR7A 2W7PA 1JLFB 4ECQA 1KHVA 3M9NB 1UWBA 4G1QB 5EWFA 1EP4A 3UDLA 3IS9B 4O4GB 1EETA 1S9GA 4IG3B 5J2NA 2JLEA 5CYQA 3C6UB 5D3GA 4I2QB 1VRUA 2AGPA 1R0AB 3FFIA 3QZ8A 4ED2A 4Q43A 2UVWA 4IH6A 4QWAA 2ASJA 2IM2A 3LAKA 3IGNA 4ZP7A 2W9AA 4KO0A 3CDEA 2UUWA 4J9RA 3KNAA 4EBDA 2BANB 1U09A 2R8IA 2R8JA 4I7FA 4ZHRB 4ZVEA 3PW7A 1DTTB 5EDWA 4ICLA 4OL8A 4MKAA 1TVRB 4F4XA 2VG7A 4K50A 4NLXA 1C0UA 3BGRA 3DOKA 4MFBB 2C2EA 1JXLA 1DTQB 2ZD1B 3E51A 1JLQB 1SV5B 3NBPB 1J5OA 3FQKA 1TKXA 3PVXA 2I5JB 1GX6A 5F8LA 1JLEA 1T94A 3QIDA 1HNIB 5HROB 4ZPBA 1Z4UA 2VA2A 1RTHA 2HNZA 2R2UA 2O5DA 2WB4A 2C22A 2R2SA 3PJWA 3GIIA 2W9CB 1JKHA 4GC6A 5F8IA 3SI8A 3KMQA 4ZMMA 2WK4A 2YNIB 3TQ1A 4G3IA 4Q44A 4YR2A 3MFIA 2WOMA 3H5YA 3BQ0A 4ECSA 3V6JA 5KG0A 4ECZA 1S97A 1UWBB 4RW9B 4XPCA 2XCAA 3MEDA 4PWDB 3DYAB 5EWEA 1VRTA 1S1TA 4R5PA 3CVKA 3EZUA 3FFIB 4ZVHA 4WZQA 4QWEA 1K1QA 1I6JA 5KG2A 3BJYA 3LANA 2VG5A 4M94A 1LWCA 1S9EB 3HVAA 4O3OA 3KLVA 3V6KA 3RB3A 3N6MA 3QZ7A 3KOAA 4H4MB 4KO0B 4QPXA 4MH8A 2OH2A 4H4OB 3DDKA 1S6PA 2YKNA 5HP1A 3SFUA 5DQIA 4RNMA 3V6HA 1RT4B 3M8PA 5J2MA 3BQ2A 4MFBA 2FJXA 4RW4B 4U6PA 1LWEB 1JLQA 2R8GA 3DM2B 1JLAA 3DLKB 4U7CA 3GILA 2V9WA 1S1WB 4KKOA 1QAIA 1JLEB 4MK8A 3PR4A 2OPPA 4Q8FA 5HROA 1N56A 3N6LA 4KBIA 5C24A 2ATLA 1HPZB 3MR2A 1NHUA 5EUHA 3M8QA 2BR0A 2IMWP 3M9OB 1FKPB 2B6AA 1QAJA 2YNFA 3ITHB 2WOMB 3HKWA 5KFYA 1S1VA 4ID5A 5F8HA 1S9FA 2BQ3A 1C1BA 5KFDA 4RW9A 3KK3A 1T05B 5KFUA 2R8KA 3T5HA 5JXSA 1RT1A 4PUOB 4LSNA 2B43A 4NLTA 2XI2A 4WFZA 1TV6A 3FRZA 4O4GA 1EETB 1HQEB 1S9GB 3LP0B 4KV8A 4I2QA 2AX1A 3V4IB 4LSLA 2OPSB 3PHEA 5KT4A 4NZ0A 4ED6A 4ZVGA 2ZKUA 2YKMA 5L1JA 1KLMB 2HNDA 2FLLA 5KFEA 2FLPA 4H4OA 5KFOA 3BQ1A 4KAIA 4O3RA 1BQNB 1RT7B 3DLEA 4LQ9A 2QE5A 4ZP9A 3UPFA 2IA6A 1RTJA 1REVB 3KLHB 1ZTWA 1YVFA 2XC9A 3MECB 5KFJA 3H4DA 3C6TA 4NCGA 1ZETA 1C0UB 3GIJA 4O44A 4NRTA 4ED3A 1DTQA 3TVKA 4KKOB 1XR6A 2I5JA 4Y2AA 3DRRB 4RW6B 3KLGA 3HVTB 2OPRA 3KLIA 2WRMA 4TLRA 4O4RA 4DEZA 3DOLB 2HAIA 3GYNA 2BE2A 1ZTTA 3H59A 2YNIA 3H40A 1QE1A 1NHVA 4TYBA 2E9TA 3QO9A 5HBMA 5HLFB 2FVRA 4PUOA 3MEDB 1LWFA 2IM0A 4Y2CA 4O3PA 5L1LA 3I5BA 3FDSA 3UQSA 5KFZA 4K4UA 3PZPA 1IKXB 4DL7A 3QIPA 4I2PA 4IFVA 4QWBA 3V4IA 1IKYA 2I1RA 3RAXA 2C2RA 5KT5A 4NLSA 4XO0A 2VG5B 4IR1A 2YNHA 1RT6A 2YKMB 3LALA 2VA3A 4ECVA 4IFYB 4J9MA 3G6VA 1HYSA 3DRSB 4RW8B 4TQRA 1S1XA 3CDWA 5J2PA 4EBEA 2C2DA 1REVA 3KLHA 5L1KA 4J9LA 3M8PB 5J2MB 5I3UA 5KG5A 4O3QA 4FS1A 4K4VA 5KFLA 4O44B 3LP1B 3FSIA 5DQGA 2V0NA 3OHAA 5D3GB 3CJ0A 4RNNA 5CYMA 3DMJA 2IJNA 2W9BA 3HVTA 5DQHA 2D3ZA 1BQMA 2F8EX 3N6NA 2WONB 1S1UA 2B5JA 2D7SA 2BE2B 2RKIA 1SH3A 4FS2A 2R8HA 4WZMA 2YNFB 3ITHA 3KLFB 5KT6A 4QWCA 1RAJA 3PW0A 4ICLB 1DLOA 3T1AA 5KG1A 2VG7B 2IC3B 3KK3B 2YNGB 3QGHA 4IRCA 1RT3B 2FVCA 4YMEA 3KJVB 4LSNB 2JC0A 3H5SA 4K4ZA 1TKXB 1IKXA 1S4FA 3DI6A 3BREA 4ED1A 4KV8B 3LAMA 2HNYA 3ICLA 3OLBA 3JYTA 1FK9A 3LP2B 3MEEA 4LSLB 5KT7A 2V4QA 2W9CA 3NL0A 2BRLA 3QGGA 4KB7A 1HNVB 1FKOA 1KLMA 4YP3A 4NLUA 1GX5A 1S1XB 2IBKA 5K14B 3I5CA 4IQXA 3C6TB 4NCGB 4MIBA 5KFQA 4K4YA 2D41A 3ISNC 2JEGA 1S1TB 4R5PB 2RDIA 3MEGA 5CYMB 2BQUA 3EPGA 2FVSA 2W9BB 1LWCB 1S9EA 4XPEA 4EO6A 1D1UA 4NLOA 2V4RA 2OPRB 3KLIB 4H4MA 1S1UB 2B5JB 4ZP6A 3MR6A 4J9PA 4M95A 4J9NA 5C25A 2EC0A 3V81B 1S6PB 2RF2B 2YKNB 5HP1B 3I0RB 4MIAA 3PR5B 1DLOB 2W7OA 4DL3A 2IC3A 1IKVB 2IAJA 4IH5A 1RT3A 3BGRB 2ZE2A 3KJVA 1LWEA 3KK1A 1LWFB 3DLGA 3DM2A 4IH7A 4WYWA 2ZD1A 3E01B 4RZRA 1C0TB 3NBPA 3G6XA 3Q8QB 1NNDA 2OPPB 4F4ZA 4I2PB 1IKYB 1FK9B 3LP2A 3MEEB 3H2LA 4RNHA 3UR0A 5DG9A 3GV7B 3OHBA 4YR0A 3V6DA 2HMIB 2JEIA 2B6AB 2FJVA 2J6UA 1S1VB 2W8LA 5DLGA 2UVVA 5J2PB 4Q0BB 1D0EA 3KHGA 3KLEB 2QV6A 2HWIA 4RNFA 4F50A 3CO9A 4PQUA 5I3UB 1IKWA 3FQLA 1RT2B 3OL6A 3PW2A 4O3SA 3LP0A 2UUTA 4HKQA 4URGA 3OLAA 4ZP8A 4ZPAA 4JV2A 3D5MA 4YR3A 4J9SA 5C42A 1N5YA 3KHHA 3V81A 3I5AA 1SH0A 3KLFA 1RTJB 1HQUB 4B3OB 4TY9A 1RT5B 4J9KA 4IRDA 3PW5A 5J2QA 2DPJA 4H54A 4ZPDA 3KK1B 1S0OA 3DLGB 4EYHB 2AWZA 3MTKA 5KFVA 1RDRA 2AX0A 4RW6A 4MKBA 5KT3A 4EO8A 2XGQA 2CJQA 3JYTB 1LW2B 4NLRA 3M8QB 3OL7A 1JLCB 5F8JA 4Y34A 5KG7A 3V6DB 2HMIA 2WCXA 1RTDB 5KFCA 4KFBB 3IGVA 4EBCA 1FKPA 5C5JA 1QE1B 4K4SA 4NLDA 5FDLA 3TAMB 4R8UA 1WNEA 4JV1A 3KLEA 5K14A 2OPQA 5J1EB 1JIHA 3BR9A 4JUZA 2BQRA 3DRPA 4PQUB 1RT1B 1RT2A 3IS9A 2RDJA 4IG3A
chains in the Genus database with same CATH superfamily
1TV6B 1M5SA 3OBIA 3M1VA 1PAUB 3VAJA 1EHWA 1Y7PA 2I8EA 3GP9A 4AT1B 4B3SJ 2KRRA 1X5OA 4LBHA 2YPYA 1X0FA 1W2BR 1YK9A 3WC0A 1T03A 1H73A 1RHUB 3QT5A 2FJWA 1UEVA 4CH0S 5AJ3J 1N5YB 3KG4A 2HNDB 3P5BP 3QYYA 4AE5A 5LMNJ 1F3FA 1V6HA 4LRCA 2MQQA 3UDCA 3VAMA 1Y00A 4IRKA 2VPWB 3Q86A 2KXNB 3AOAA 1MU2A 1S5ZA 3F41A 2ZE2B 1U7LA 5LJ5Y 3MUMP 3BDEA 1F2GA 4YHHJ 2QA4G 4IDKB 4DZDA 3H98A 3KUGA 1F9FA 3I9V9 3TX8A 4C2MA 5KTQA 1HI1A 3M8ZA 4OYIA 2VG6A 3DOLA 1S48A 5D78A 2RKIB 3O2IA 3K5OA 4CI0B 5HO4A 3CD6S 4DR6J 4JI5F 3H4BA 4CLSA 1XNQJ 2GVZA 2V50A 4USVA 2YH1A 1HFEL 4BDPA 4UY8T 4HH1A 2LQJA 4OYWA 1OMSA 4CTAB 5KFNA 4K4XA 1VQ8S 1KLNA 2DHSA 5KFGA 4KSEB 3GLJA 2GVDB 3EMTA 1WUUA 2VOPA 1SH2A 2MGZA 3GIMA 3RW7A 3P6YC 2KJWA 2IVMA 2FLNA 3BN7A 1D3WA 1TL3B 2OI2A 1XERA 3O1LA 4WK1A 4X4OA 4X4QA 3KDNA 3MI7X 4DL6A 3DLHA 4KHPF 1VC6A 1SB6A 4UW2A 4AL5A 3IRXA 1ZPVA 1QSLA 3EXCX 2JOQA 1KRPA 4LF7F 1DTTA 3M6WA 4HYKA 4JI3F 1X9WA 4B3OA 5DG7A 3IG1A 3FVYA 2CVIA 1VQSA 3M4XA 1IWGA 3TUPA 5IT9Y 2VBXA 1EJ7L 3Q8SB 1S0MA 1WF0A 4QW9A 3A8KA 4QIGA 4DL5A 2AJ1A 5A8WA 4OHZA 2Q43A 1RKIA 4YFUA 3D1QA 3CWJA 3S7RA 4DV1F 4F8RA 4C4WA 2XZTB 3PX6A 4MKYA 4IG0A 4KFBA 3KK2A 1K44A 2VODA 1GTEA 5KFSA 4LBIA 3AOCA 1TFWA 2D74B 1X9MA 3TVZA 1AROP 1JXVA 5KFTA 4YY3J 2OPQB 5J1EA 3SFGA 3MMBA 4KHRA 5KG4A 2DBBA 2C2ZB 2B7BB 2KTQA 1ZA1B 4O3NA 5KFBA 3E01A 1TR0A 3LPYA 3D0IE 2AU0A 1S57A 4MT1A 3Q0AA 3KNGA 4ECUA 1EIYB 4ZVUB 3T5LA 2XY7A 1FKAF 2HYIB 1SUQA 3Q8PB 1IM4A 1HL6A 2A0FB 1WJ9A 3P45B 3GU0A 1ZM9A 2MZSA 3PG9A 2J0WA 2KXHA 2WSFC 2GHVC 3KUHA 2XWXA 4A46A 2JNJA 5KG3A 1NAQA 4ELVA 4B9VA 1NJIT 4Q0BA 1S59A 4HTIA 2LP4A 3D68A 1UVKA 2BBEA 2DNGA 1C1CB 3MECA 3ZTRA 4E8UA 2BM1A 5IM0A 4WTOB 3CCTA 4DV7J 3RRGA 5D0EA 5KFHA 3MM7B 1DY3A 1ZYQA 1T0TV 2DNZA 2F63A 2FTRA 5KG6A 3LH2S 2XWYA 4BWJA 3DLKA 2YX1A 2J6TA 4CDIA 4RU9A 3EPIA 3DRRA 2FHKA 3GIKA 3WC2A 1TUWA 4WU3A 4ECXA 1M5OC 2BDPA 3M30B 1SC1B 4IG0B 1FDNA 1JB0C 3OTCA 4R25A 4NXMJ 1FFSB 1JLGA 2QLFB 3NCQA 3S1TA 2RU3A 3MAQA 2KDOA 4ANCA 5KFWA 2XS5A 1FHTA 3KOAA 5K8NA 1C1BB 1Q8LA 1T9UA 2GZOA 4TN2A 2WW8A 4F7VA 1XC9A 3AJ2A 2MKIA 1IKVA 2IAJB 3DOKB 2NXEA 2YWGA 2ACMA 3LO3A 3HT3A 1XMQJ 3JQJA 4P7TA 1AW0A 3BH6B 4Q2LA 4AFFA 5L1IA 5D4LA 3HSDA 1AFJA 2M8DB 4NLVA 4JV0A 3I9ZA 4OHXA 4DR3F 1JX4A 2B9YA 1XMQF 4ELTA 5DGAA 3TANA 2FVQA 2V63A 4GKJJ 1D9DA 3P3DA 3RB6A 3LTOA 4DPUA 4DCOB 1IBCB 1RTDA 2KM8B 2DEIA 2DB1A 2YWFA 3DOMB 4KGVB 3EX7B 2HQDA 3QAEA 4DR2J 3RAQA 1T7PA 2P9CA 4RO0A 3W62A 2BJ8A 2JWNA 2VQFF 1TK0A 1BQNA 1AB8A 2HS0A 1QTMA 2HHWA 1TP7A 5CD4H 4RBTA 1WOSA 2UVRA 1M1HA 3T9ZA 4P73A 4WYLA 4AL7A 2PEBA 2KKHA 5HMWA 3BSAA 4OJHA 3C15B 4PR6A 4ES1A 4TQSA 3RB4A 5CYQB 4GC7A 3DU6A 1IR2A 3VTIA 1Y9OA 1NJXA 4CCHA 4DF8A 4IKAA 2E7WA 3ENQA 3HSZA 1GT8A 5ETVA 3I56S 1WDDA 2YPZA 4X62F 1SJ4P 2FJAB 2FLOA 2K7JA 5AXLA 2M3DA 2QEXS 4JI1J 2GO9A 3BO4A 3P4UB 1LNQA 1ZAXA 4QIFA 3ISND 2VPYB 4TY8B 3KTQA 2HQ3A 4DN0A 4TNOA 4G6VB 2OEMA 5DG8A 1RT4A 2IM1A 5KFMA 2J8SA 4DS4A 2GA7A 4B9MA 2JEJA 4JBCA 2EFPA 3QO9B 2R2TA 5HLFA 3RG6A 5D0HA 1P9QC 3DXBA 3AB4B 3U02A 2HFZA 3GE9A 1Z2ZA 3CD5A 2HNYB 3E8OA 5IOLA 1TKDA 5GAHI 1VQ9S 1HWUA 2J7UA 1Q81T 1VQLS 3UVJA 3WHIA 1R43A 2BV3A 1VLOA 3HI9A 2HHUA 1XMOJ 4LIRA 3ZZRA 3MPWA 4USJC 4KE5A 5FDLB 1N52B 1XR7A 2LA6A 1UP1A 3M32B 3HD1A 1KHVA 3GFYA 4P2SA 1KN6A 4A8FA 3UD3P 4ERDA 2O67A 3T3FA 2G2ZA 3TNVA 3NGKA 5C2GA 3IS9B 4O4GB 1S9GA 4V1Ak 5J2NA 2RT3A 3KJNB 4S0MA 2BQ3A 4I2QB 3M1VB 3BGUA 1QVFR 1WKLA 4QWAA 2EXUA 3IWXA 3ZZYA 4NE9C 1EQMA 7AT1B 1OSCA 2RNEA 4ZOSA 3VR1A 3EJMA 4H4KA 4F2SA 3I96A 2MLXA 3KNAA 4EBDA 2R8IA 1NK4A 1VQYA 1B3TA 2GQCA 2HVZA 4OX9F 2H5JB 5IC6B 3PY8A 4CRJA 4MKAA 4ZDNA 4B9LA 2CNNB 2EBEA 2J9EA 1C0UA 3BGRA 2GNKA 2A3JA 4MFBB 2E5GA 3M8RA 1R8PA 1S99A 2V8HA 1NKCA 1SV5B 3PVXA 3NNHA 1ZOTA 1RCOB 2OSQA 5F8LA 1T94A 1IWAA 1HNIB 5HROB 1CEZA 2Y1RI 3QJJA 1AT1B 1EARA 2KN4A 5GADI 5H1SV 1VIXA 2MEWA 2HIYA 5DRKA 3MURP 4I1TA 3R6LB 5F8IA 4WFBQ 3SI8A 1U1QA 3RR8A 3AODA 3TQ1A 1MNEA 2ZEJA 3L9ZA 2LEPA 3MHYA 4F4AA 4YR2A 4DR6F 3R2CJ 2F9DA 1YJ7A 2MY8A 3BQ0A 2R7TA 2KFNA 3O3LA 1S97A 3NGTA 4DQSA 4RW9B 4XPCA 1UZHA 2HQFA 1U02A 1NKEA 4LF4F 3BKUA 4PWDB 3MMCA 4OIXA 2ZH8A 3VAGA 2ALYB 3H7HB 2CQGA 5EWEA 1VRTA 4DR1F 4V19J 4WZQA 4I6YA 5CCLA 1B99A 5KG2A 4M94A 4O3OA 3V6KA 3HVAA 1UWAA 3RRHA 2XY6A 1V3ZA 1VQ5S 2CVEA 3QZ7A 4DR7F 3CD7A 3LPEA 4DUYJ 4UUWA 4MH8A 2C2MB 4PQAA 1CG2A 1Y11A 5CA5A 4WF9Q 4H4OB 2EK6A 3FZ2A 4K5SA 3DDKA 4NI2A 5LMNF 3SFUA 1E6YA 1SC4B 3B4MA 4NEZA 2VBYA 3NRBA 4Y2IA 3DKDA 2XMVA 5ADZA 1SJQA 3DHWC 2DY9A 1JLQA 1X4EA 2V9WA 2RRNA 3GILA 1DAXA 3VGSA 4Q8FA 4C8ZA 2OPPA 4X4UA 1AZSA 5ETQA 4C11A 3N6LA 4A8SA 5C24A 4NMLA 1RE1B 1N56A 3MR2A 1NHUA 1XEZA 2GHPA 5EUHA 4LBPA 4QIEA 2AD9A 5BYRA 2V2KA 5F8HA 1QAJA 3ITHB 3CJRA 2HZVA 3M8YA 4ID5A 3KFWX 1YDLA 3RBZA 1S9FA 2F5GA 1VJWA 2L9WA 5CAAA 4RW9A 3KK3A 1NJZA 2B9WA 1VHIA 4OJGA 2QZ8A 1YBAA 2B43A 3MMCB 5ETKA 4C7QA 4CM0A 1EETB 2Q1LA 4CLTA 4JV5J 3LP0B 1SC6A 2MLZA 2ROPA 2VDHA 2Q79A 4IQMA 2EFOA 2OPSB 1U25A 2P6TA 3PHEA 5KT4A 2PE8A 4ED6A 5D4OA 1VYAA 4K0KF 2QL5B 2ROEA 4HDHA 1FJCA 3M7VA 5H9EJ 1PSDA 3C16A 1RLCL 4H4OA 4FKYA 1RK8A 4KAIA 3BQ1A 3FNNA 1U1KA 4O3RA 2IA6A 4K8RA 1HBOA 1CBKA 2UUBJ 1T8EA 4TKTA 2J76E 4ATNA 3H4DA 5KFJA 3OFEA 3ZTPA 3A13A 1ZETA 3GIJA 3T6BA 4Y00A 3K7RA 3IAS9 3MM7A 4ED3A 1Q79A 1BHNA 2KYZA 4OFZA 1JMTA 1XR6A 4DR7J 4FXWA 3HVTB 3R7NB 3KLIA 1Y3KA 2O01C 1BWEA 3I6PA 4FPIA 4B3RF 3G9CA 2BE2A 2YNIA 3G87A 2LQ5A 3PM9A 2KFYA 4I6WA 2AIRB 1C4AA 1DQ9A 3K8WA 1UVMA 2Y1IA 2LU1A 4DQIA 2LKZA 3QMQA 1NPRA 1X31C 2OUGA 3KJFB 2FVRA 2NXNA 3PRVA 2IM0A 3MEDB 9ATCB 5HSPA 2H1YA 1CLFA 3EGVA 5FIIA 3PZPA 2J0SD 3CCZA 2HHPA 2CPHA 1H2UX 1Q5VA 3QATA 4QWBA 1RAGB 3V5RA 3W61A 5KT5A 4XO0A 2VG5B 1T9WA 1G3OA 3JSRA 4P10A 2CWKA 5B0EA 2XYHB 4FNIA 3SQGB 1NXIA 3TUZC 3CGIA 2RMLA 3AXKA 4J5OA 4J9MA 2ZZNA 1FE4A 5LSRA 3DRSB 4RW8B 1U8SA 2A6MA 1S1XA 1QJHA 1V3RA 2BA9A 3MM8A 4TQRA 2MXYA 4ILMA 1REVA 2VHGA 4OHYA 2L48A 5KFCA 3L09A 5J2MB 2FJEB 4BCAA 5SZTA 4DSKA 1UEUA 2KL8A 2VF3A 2VJVA 3FSIA 1FWPA 5DQGA 2V0NA 3PACA 4OI2A 2F65A 3CJ0A 3W2VB 3KG0A 3FRYA 1WI8A 4BBYA 2BYCA 5D0GA 5DQHA 4JI0J 1WG1A 2D3ZA 2ZJQQ 2KFZA 2F8EX 2W2NP 2AJQA 2LA4A 2B5JA 2C3YA 1HBUA 5I4MA 2XO6A 1RZMA 2LDIA 2RKIA 2BOPA 5C2CA 2R8HA 4FS2A 3FEXB 2YNFB 2CQ0A 1CJUB 2L9DA 3OVBA 3T1AA 3RYLA 5KG1A 3TAQA 2VG7B 2POKA 2V8VA 3M2RA 4ZPTR 3ZNJ1 1V5VA 1F1BB 2YQ0A 1FXLA 5CABA 2CQ1A 2KH9A 2FVCA 4PG4A 2CPDA 1GMUA 2ZDPA 2CNOB 1TKXB 4NA3A 4U7UK 3CDBA 3DI6A 3IAM9 1DFDA 4KV8B 3LAMA 2DNHA 2HNYA 1RB0A 1RHKB 3JYTA 2KRBA 3CEDA 1FK9A 3QQCD 3R5BA 2BKOA 1X4HA 2Y1LB 4PXBA 2V4QA 2W9CA 3NL0A 3OTEA 5AXKA 3VGVA 2CZ9A 4KB7A 4YP3A 3CC7S 4DR4F 1RHQB 3VV2B 4RBUA 2DITA 3GMGA 5A0YA 3M6XA 2AJ0A 1H38A 2IBKA 1D8YA 1OPZA 2XS7A 3ILLA 1AXQA 3BDPA 5AT1B 2VASA 3W1YC 1UFWA 3ISNC 4LFBJ 2FHOB 4LF6F 4R5PB 4D3HA 1WSVA 2M70A 3BM7A 3Q89A 4W4MA 5CYMB 3QT7A 1U0HA 3TZWA 1LWCB 4XPEA 2QC3A 4FYYB 2IBOA 4OYBA 4F67A 4H4MA 2HHSA 2B5JB 4L3NA 4ZP6A 2FYXA 5F41A 5CD4A 1NK7A 3WX4A 4J9NA 2HWTA 2LEAA 3H0PA 3LGHA 4OHVA 1FD8A 4JB8B 3V81B 2ZOMA 3N79A 5HP1B 3W9HA 5HVHA 3PR5B 3I0RB 1RAOA 5D4PA 2PEHA 1SKRA 2YH0A 2GAGC 3MM6A 3W2WA 4IH5A 3OD2A 3W3SA 3L7UA 3BGRB 2ZE2A 2WW4A 1LWEA 4WYWA 4RZRA 3DLGA 3J7AN 2HHQA 1YRUA 4A8MP 2AEFA 1NNDA 2FC8A 4I2PB 1H74A 2IRYA 2NSCA 4QR1A 3RU0A 1IKYB 2AZ3A 3UR0A 2OEKA 1IUJA 4DMZA 4N8NA 4OI1A 4GO7X 4NZ6A 2J9DE 2KJVA 1JJCB 3BF4A 3LOUA 2VFRA 1MROA 2VUGA 3CE8A 3MPUB 5I3PA 3CXCR 2J6UA 1S1VB 2HS4A 3PO5A 2GVZB 3NOCA 4ALZA 2W8LA 3UNGC 2UVVA 1R27B 1RWUA 2G0JA 2QV6A 2HWIA 3HSGA 4F50A 4JI3J 4C8MA 2W01A 3HHLC 2FJBB 1IKWA 4RWWA 3PW2A 2K1RA 3QJPA 3RRKA 2E1PA 1QUPA 4HKQA 1RI7A 5A6WA 4DL0C 2XMAA 1E6VA 2PMHA 4WFAQ 1W26A 1B0VA 2LU2A 4ZPAA 1U1NA 5CHCB 1ELOA 4EU0A 3L7PA 1PCAA 1SI9A 2NUUG 1KFDA 4NASA 2MKSA 2DCUB 2PIIA 3I5AA 1SH0A 1SQFA 4CNYA 3KLFA 5HL7Q 2MKKA 2R4FA 3ZTQA 1U2RA 4B3OB 2QMWA 4DV7F 3H90A 1RISA 3MM6B 3W2WB 4A8OA 2RH3A 1L3VA 1RTZA 4OI3A 1UW4A 3MTKA 2GX8A 2MQNA 5AE3A 4LF6J 4LF7J 1S72S 4JI4J 4RW6A 2HPUA 1HNXF 4EO8A 3VGTA 1HNZF 4UQGA 1FE0A 3CB4A 3M8QB 2XBPA 3EXYA 2L08A 5KG7A 4EBCA 2WCXA 3FCHA 4QCLA 1VBXA 1DQ8A 1SVDA 2ZHAA 3CNQP 1M5PC 2UXBJ 4J91A 3SCLE 3TA0A 4BWMA 3KLEA 2HEKA 5K14A 3NMRA 1CJTA 3BR9A 2DNNA 1Q95G 3FCVA 4YDXA 2D3O1 2BQRA 4KPYA 4LT6A 2UUCF 4LVOP 2CUYA 1G4CA 4G1IA 1HQEA 3PFEA 3VZHA 1R0AA 4AQYJ 1SUQB 2KU7A 3NG8A 2J7WA 2OHDA 4UT4A 1OJ4A 2GC8A 3CDAA 2HRYA 3HM9A 1RT6B 2GHWA 3CJ5A 4MK7A 3CDUA 2PT0A 5IT9U 4L76A 2ZUGA 3JTPA 4ECWA 1HYSB 1WG5A 5LXYA 3J81Y 3OL8A 1SXLA 2HG4A 2HBYB 2EWHA 3PEHA 2UV8A 4UUXA 2F4FA 2IMOA 3I32A 5DGBA 1TVRA 1C1CA 5D77A 3M2VA 1S12A 3ZZ0A 1AYEA 1OWXA 1P9YA 1U24A 3LP1A 3GJRB 4L73A 4EI2A 4CLPA 3FEYB 1S6QA 1C0TA 2E5JA 3RZAA 3PKMA 5B0CA 1TMMA 3HHLA 4DU8A 2EW9A 2UVUA 5KFAA 3THTA 1URRA 4OZ3A 4UZBA 1VQPS 2MQMA 2XMTA 1X5PA 5F9LA 2DNOA 3OVSA 4IR9A 1AUSL 3HJVA 2XQCA 1HBMB 3MR5A 1X4FA 1HNWJ 4URSA 1APSA 5FLXY 3OJSA 1DBDA 4OHWA 2ILZA 3JB9k 3Q8YA 3A8JA 2FIUA 1IBMF 3QFWA 1NDCA 1KC8T 5I42B 4Y3CA 3I87A 3G86A 5F8MA 4X4RA 1U6FA 4DX6A 4K0KJ 5HATA 1VJQA 4KYZA 3EICA 5LXRA 1N33F 2W24A 2DNPA 4WXOA 4Q5VA 1KD1T 2ZOGA 3D6HB 1F6TA 1N0UA 3M6UA 3TOQA 2KXFA 2ZHBA 1BMQB 2E9ZA 3H2VE 4GVBB 3LQVA 4DX5A 2M0GB 1HARA 2CJBA 2HKEA 3LGMA 4PG7A 4PXDA 2CQHA 3L3CA 2X1BA 3PRBA 3R1LA 4M5LA 5KOWA 5F3ZA 5J2QB 2EBGA 1VISA 4WKRA 3HK2A 1XIQA 1S6QB 1NHKL 3PKYA 1J5OB 4ED0A 1VR6A 2AYBA 1W7WA 4DL2A 2AQ4A 3X1LB 3UWTA 2OAUA 2XLIA 2FVPA 1WC3A 1RTHB 2HNZB 2FPHX 2B9EA 3W5ZA 4B3SF 3ULHA 1GEHA 5LOQA 4EYIB 2V69A 1HBUB 3H5XA 1NH7A 3R5AA 2MKHA 1CSJA 3CCWA 4DUTA 3R5JB 5CH7B 1CJKB 3ET6B 1IM6A 1T05A 2V8GA 4R8UB 1KQSR 2W8KA 4PPDA 3PIOQ 4NOHA 2VICA 4K4TA 2V2QA 2W2PP 2V8DA 3KG1A 1R8BA 1NK0A 4K2JA 2IVFB 3PJXA 1YJRA 3Q23A 4B3TJ 3CPWR 2CG4A 1YJWS 2G2OA 2ZBPA 1TQLA 3NP5A 3N5FA 5M2PA 3LWMA 1JJHA 1F5CA 1ZS6A 2PFDA 1XK8A 1P1TA 3NAIA 4JI1F 2Y9HA 1RT7A 4FBTA 5GAGU 1FXRA 5A0YB 1Q82T 3IBCB 3KYLA 4OX7A 5F0WA 1RSCA 1VHFA 2CJKA 4Y65A 4OZNA 2E7XA 1HMVB 4UOFA 1K47A 2CQIA 3C66A 5DS7A 3U1LA 5C7PA 3OSNA 3T19A 1RHMB 2O3DA 3CD0A 5GMDA 1XMBA 1M1GA 4KTQA 1KTQA 1M0SA 1Q8BA 1GH8A 3QAUA 3KLGB 3E3XA 3EDQB 3UFCX 4ECRA 2XGPA 3HHNB 2DHXA 2HQIA 4A8YA 2V5HG 4FPRA 2VG6B 3CJTA 3IBWA 3K58A 2BE9B 1WEZA 2J6SA 2E1RA 2DH8A 2EK1A 5T7LB 1WI6A 4LREA 5E3PA 5AE2A 4ID5B 1RWMB 2BEFA 1K0VA 2F3JA 4KHMA 4J9OA 1JLBA 1JQGA 5KFRA 2JLGA 2VFSA 1RP5A 2DVIA 3GFXA 4NLGA 3PFOA 5CCMA 1KNZA 3DDNA 3SBMA 4X65J 5ETTA 4N7TA 4WJBA 4X4TA 2DHHA 3B4DA 1N4LA 1WC5A 2C28A 4IOBA 1RGVA 2CPEA 4Z2XA 2XMWA 2LFVA 1YG0A 2DRDA 1ZH5A 2RU9A 1UL3A 2IA0A 5K9FA 3VWSA 3TJ8A 2EG1A 2X7IA 3A1YG 3D1HA 3FBCA 1RTIB 3UN2A 1Q8KA 4HACB 5HJYA 5HMZA 2N4CA 1XNRF 3NNAA 4KPCA 2C2OB 3KDOA 3NWRA 1BGXT 4F04B 4G1QA 2EI5A 4JP8A 4EK2A 1EP4B 3IG1B 3VALA 5EGYA 1Z2LA 1IKWB 5GAEI 2RJZA 4JI2F 5K8PA 3OTOF 3N9UC 2VBZA 3CJKA 3G6ES 5KFIA 2VL1A 1QSSA 2RS2A 2K3IA 1TAUA 1FFGB 1BQMB 2VFTA 1LV5A 4ZVFA 1BD6A 1ZA2B 1KEKA 4O0IA 2VQFJ 4U7UD 3G82B 2VH7A 4WCEQ 2HZAA 3BSCA 3GWCA 2B56A 4I7FB 4ZHRA 1H72C 2ILYA 1TL5A 3F0NA 3R97A 4DDFA 1KOOA 3MCOA 1VQOS 1TL7A 3LUYA 2H54B 1JLBB 1WF2A 2LYVA 1VLYA 3BGFA 1HR0F 2HGMA 4DG1A 2NYHA 3IP0A 1U47A 3VHQA 3W8GA 2RRBA 3MZIA 2AP6A 2ZOFA 3U1MA 3J81j 3S8SA 4RUAA 2DPIA 1K8AT 2VIHA 5F9NA 2M4MA 1CC7A 5ETMA 3TEHB 3OPKA 4NLWA 4YQWA 1UMJA 2GIRA 3C3LA 1Q7LB 2DISA 5LT5A 1Q78A 4IFYA 4F4WA 4DFJA 4QR0A 2AGOA 1HI8A 2AEJA 2W7PA 3DRSA 4RW8A 3NGSA 2UUCJ 4PEOA 2XZDB 4ECQA 1EP4A 2MQOA 2X1GA 1FERA 2XMUA 3S01A 5SUHA 3FMBA 3R3TA 3CJKB 1EETA 4IG3B 5IS2A 4CNZA 3OV7A 3C6UB 4HH0A 1VRUA 2QGFB 2IRXA 3FFIA 2V68A 2VKRA 3HKZD 3PNIA 1WSRA 6AT1B 4Q43A 2IM2A 3C46A 4GO5X 1HNZJ 3V4MA 3LAKA 3IGNA 3QSIA 2KT3A 1VIOA 2VBWA 3CDEA 3GJQB 4FYVB 3UN3A 4OYPA 2BANB 1U09A 2HAFA 2MJUA 1M90T 4I7FA 4ZHRB 1OYEA 2R8JA 1S77D 2H65B 1DTTB 5EDWA 2GFFA 4OL8A 2GGPB 1TVRB 4F4XA 2VG7A 3GJTB 3J7Z5 2H48B 4K50A 1IVZA 2C2EA 1FWLA 1RQ0A 2DR9A 1QLNA 1DTQB 2ZD1B 2FUG9 1FX4A 3MPDA 3QPIA 4P2XA 4ZVPB 3LA0A 3SQOP 1TKXA 3NGRA 1GX6A 1PAEX 4CM2A 1JLEA 2RIJA 4X4SA 1YITS 3UCGA 4ZPBA 4ZLJA 3FMWA 2C22A 1RJJA 2D69A 2F9JA 2V8PA 3GIIA 1YJ9S 3BEGB 4ZMMA 3AT1B 1B70B 2CFXA 3KXDA 1LFPA 1FJGJ 1SPBP 2GAHC 2RE1A 3PYDA 4WP8A 1GQEA 3P49B 3ENVA 3H5YA 1DQAA 2ZJRQ 2ERRA 2DH9A 4QYZK 2DRAA 2G2YA 2MKJA 3G71S 1U1RA 1G6BA 1R0CB 3CCJS 2XCAA 4A8QA 4MMOA 1KVIA 3A12A 3I55S 1ZPWX 4WFNQ 2KYXA 3ONQA 1VBZA 3DYAB 4USMA 4R5PA 3EZUA 4ZVHA 5CXTA 4QWEA 1K1QA 2X51A 3LANA 2VG5A 1LWCA 3Q24A 3N6MA 2R7OA 2P9GA 4H4MB 4OZJA 7FD1A 4KO0B 1EKRA 3B6BA 4QPXA 2G1HA 1FRIA 2QTWA 1TUVA 2GS8A 1U48A 4YB5A 1IR1A 4JOUA 3W8PA 5DQIA 1WTBA 5GAEU 4DSLA 2CQ2A 3CMQA 3M8PA 1F9HA 1WHXA 2HRTA 4OJ3A 4ZVTB 3V6HA 4EMDA 1RACB 1LWEB 5K5MA 1WF1A 1L3SA 1JLAA 1WC0A 5KOXA 1S1WB 1JLEB 4MK8A 3PR4A 1U1PA 2WVEA 2CPZA 2GJFA 3KWMA 3J80U 1HPZB 5A6PA 4FYWB 4ZN3A 3W9JA 2OTLS 3A3OB 3K5LA 3M9OB 2YNFA 2OO4A 1S1VA 1ROFA 1VQ6S 3MM5B 1C1BA 3M2RB 2HK3A 1WEYA 3CMES 4IYQA 1RT1A 1CULB 4DV0J 2XZWA 3B8HA 4C3MA 2XI2A 2BMBA 1TV6A 1PKUA 2NXUA 4O4GA 1S9GB 4WFZA 2NREA 4QIWD 1BLUA 4KV8A 3T1HF 4I2QA 2AX1A 4P72A 4I64A 4ZVGA 4YB1P 2WBMA 1IBLF 2HFNA 4ES3A 5A8KA 5L1JA 3WX8A 3RR7A 4MYTA 1J27A 2HNDA 2K2PA 5E3AA 4GKKF 5KFEA 5KFOA 1BQNB 1KTVA 4X64J 4ZP9A 2HHTA 5FJ4A 2ZJPQ 1RTJA 4HLBA 5LSOA 3UD4P 1YVFA 5A8RA 5THWA 1MMNA 3BBCA 3JSYA 3JTNA 4CP5A 4AXIA 4O44A 4RPFA 3C15A 3TVKA 2B4OA 1LWXA 3D0HE 1RWVB 4AL6A 1UFLA 3KLGA 4RW6B 3CC4S 3R9LA 1IR0A 4OZ0A 5L38A 3EE3A 5L39A 1OY8A 4TLRA 4DEZA 1PYSB 3CO0P 3DOLB 1RWPB 2HAIA 2H9ZA 2RQMA 2LLZA 2O1PA 4LF8J 1ZTTA 4B3RJ 1VC0A 2CQCA 2HIQA 2E44A 2FGCA 2ZWOA 3MM5A 4OI4A 4TYBA 3WZ0A 1SJ1A 4A4JA 4QPTA 2J0QD 2DNRA 5HBMA 4OX8A 5ITHA 1LWFA 2EEYA 3MAHA 3PHTA 4RL1A 4O3PA 8RUCA 4TU9A 3FDSA 2XNQA 3UQSA 2WVCA 2UXDF 2XS2A 3Q2TC 1S6OA 1IKXB 1JK9B 2AHOB 2I1RA 3TW0A 2AJFE 3U1NA 1KQKA 2ZH1A 4DR5J 3RAXA 5DDPC 3PX4A 4D3GA 4IR1A 2Z8QA 2YKMB 3D54A 2GMLA 3MUTP 1YBUA 2VA3A 3DLBA 1I5OB 4DBQA 1TMJA 2PO4A 1HYSA 3UD5A 3CDWA 3PEJA 2C2DA 4FZVA 3OTBA 1DARA 3KLHA 2RQKA 3POTB 1KQFB 5L1KA 2MPUA 1ACMB 5KFLA 4O44B 2H4YB 5JMNA 2YY3A 4YHHF 1RWXB 2Z58B 4LF9J 3TO8A 5D3GB 3P96A 4RNNA 4WK3A 1BQXA 2RAQA 3DMJA 3ZZPA 2QIFA 2CPIA 3MM9B 2XULA 1BQMA 2FB0A 3OFGA 1S1UA 1QY7A 4KIAA 1ZZNA 4LR8A 4OYAA 3ITHA 2XLJA 4QWCA 3MD1A 4HEA9 4ICLB 2YKOA 2O66A 2IC3B 3KK3B 3O44A 3ZZZA 1NDLA 3G8SA 3QGHA 1RT3B 5LSLA 1OSDA 4X66J 2W4PA 2YWHA 3AQPA 2ZFHA 3BREA 4ED1A 2Z0GA 3UN5A 1YZ7A 5HN0A 4A8WA 1X5TA 1H98A 3QWPA 1O0PA 3LP2B 3MEEA 4DX8H 4ZITA 3CCVS 2LXUA 1DHMA 2BRLA 3H25A 4ZPWR 2Q3PA 2DJWA 2WAQD 3B54A 2DPJA 2HHHJ 5IQQA 1FRMA 1GX5A 1T9VA 1S4EA 3K5PA 3C2PA 2UXBF 1YSJA 4JI8J 3WDOA 4MIBA 1IN0A 2YKPA 4BLGA 4EGLA 5KFQA 1F5AA 1N5QA 4RJVA 4USUA 3EWGA 2BM0A 2JEGA 1JWWA 2RDIA 3MPYA 3MEGA 2HGLA 2RB7A 2RHQB 4K2XA 4HI1A 4B17A 4FF1A 4NMXA 5ETLA 4F0MA 2V4RA 4JI4F 2PI4A 2OPRB 1U2CA 5AE1A 4LRFA 4U8YA 4DQPA 3SSSA 4J9PA 3NNCA 2G4BA 3LW5C 5C25A 3EGWB 1NB7A 1S6PB 2YKNB 2F8HA 2QA1A 5B0BA 5L8RC 2EPIA 3W9IA 2XMJA 2Z4PA 1CJKA 3MOJB 2IC3A 2YWKA 1CQMA 3M2VB 2LEBA 1IKVB 2IAJA 5B0GA 3CCLS 3SXLA 4LFAF 1HD1A 1T9TA 1XJWB 3T9NA 4IH7A 3DM2A 4E98A 2ZHOA 2RILA 4CZCA 4FYXB 1UA1A 1FA0A 3C19A 4QYRA 3TWZA 1S79A 3Q8QB 3BPSP 5DG9A 3LP2A 3MEEB 4RNHA 3H2LA 3GV7B 3NS6A 2P5VA 4C3LA 1JJ2R 2B9XA 2K3KA 4FVMA 3SQGA 1FNOA 3V6DA 2HMIB 1NSAA 2B6AB 2JVRA 2NSBA 2FJVA 2VC1A 4P9SA 1YIJS 4JI8F 3GG1A 4HT7A 3MM8B 3SEOA 5IV3A 3CMAS 1D8ZA 5MLCV 1EB0A 4RNFA 4CLZA 2KG1A 1X5SA 3OQ2A 4PQUA 3FQLA 3NS5A 5F0UA 3DGPA 4KGMA 3LP0A 1R8AA 2UUTA 3EVOA 3PW5A 3QFHA 4URGA 3QNWB 3CC2S 2HURA 2CAJA 3W7BA 1UA0A 5DDQC 2BKNA 2HHVA 3K57A 4X64F 4N56A 1Y5LB 3UNYA 1N33J 4X4VA 1FX2A 2F1FA 4NXMF 4GVBA 1RBLA 4NPOA 1N5YA 2XTJP 1WOOA 5IFMA 1N5SA 1U1OA 5B0AA 5HI7A 2HSEB 4LFAJ 1HQUB 1IBKF 1OYDA 4TY9A 1RT5B 3MAAB 4L3KA 1Q7YT 3R5GA 1REGX 2DH7A 1YLXA 2HFSA 4AQYF 4DSFA 4H54A 4CT8A 3KK1B 1KONA 1TL4A 4LRBA 1U8WA 4X84A 1S0OA 5KFVA 2ROGA 3H20A 2JEFA 2ZWPA 3PJ9A 5CZVA 4MKBA 2X3DA 4CO1A 3ZXWA 2CJQA 2L9NA 2XGQA 1HNXJ 2VONA 3HFVA 3FSYA 4NLRA 4KC5A 3VZIA 3IRWP 1A6LA 3OXFA 1FKPA 2HHHF 1ULRA 2COLA 1F60B 1JXEA 3BV8A 1UTAA 2DGQA 4R8UA 3S6EA 1R8CA 4M5NA 4JV1A 3SCJE 1T9XA 2DGUA 3AA9A 2I0XA 4M63A 5IQ6A 2ZM6F 1UKUA 3DRPA 4PQUB 1N5VA 1VMBA 3IS9A 2M5YA 4QZVB 1KQGB 1FXDA 1HD0A 1QM9A 2C42A 1I3OB 2ZDOA 1UAWA 3D9BA 4ITSA 3UE2A 1FCAA 3FGVA 3MCSA 2UUAF 3AB2B 2HVIA 5JUMA 2FHMA 5G0RA 4DFPA 2BACA 4OI6A 1TL3A 5IWAF 2OFGX 2QA2A 1UJ5A 2W1BA 5KFPA 1RHRB 3MR7A 3NXZA 3EDRB 4WU2A 1MW7A 3H5UA 4EZ9A 1TKTB 4QU6A 3QGPA 1B0TA 1L3UA 1RYRA 4HT5A 2HLUA 2BKPA 2RS8A 3CTRA 1UVIA 4X4NA 2QMUB 1NKBA 3D6FB 2OSRA 4TVAB 4ZPVR 4USWA 1VC5A 1RWWB 1G2EA 3NCRA 2FD2A 2M52A 4N41A 1HWLA 1Q1KA 3W5YA 3P8BB 4QOTA 2A2CA 2W4DA 3CF5Q 1WC1A 4DLEA 3RB0A 4ECTA 4ZCMA 2ALZA 3R2DJ 4MK9A 2V2ZA 1TUGB 4I68A 3GTYX 2E9RX 1F0XA 2R2RA 1NLKL 1R3NA 3QBCA 4DV6F 4W92B 5A2QY 1GMVA 2MDAA 2WB1D 4KGZB 4R0EA 3EZOA 3QLHA 4U95A 1IBMJ 3NMAA 5LJ3Y 5KFXA 1SIZA 4CO3A 3IM9A 2V9KA 3TZXA 1SL2A 2VV5A 2K1RB 5KFKA 1VRTB 3DI6B 1PJ5A 2ZVSA 2ZZTA 3CIZA 3IO1A 4DR2F 3QIPB 1QDUB 1VRUB 2ZH6A 1TL1B 2XMKA 1E6VB 2QRRA 2WHOA 1NZAA 3MR3A 3PW4A 3R7SB 3T1HJ 2DR8A 4LQ3A 1TFYA 2JLFA 1HNVA 1KHWA 4C8YA 2W2OP 5T41A 1VGYA 3T1YJ 3IWLA 1TKTA 3HVRA 1RTIA 2OFHX 2FJDB 2R7SA 1URNA 1FVSA 1WTFA 4C0BA 3OSPA 1MLAA 3OXLA 4NLPA 4P6QA 3J81U 5I3QA 4P75A 4UTGA 1RYSA 4LFBF 1DRZA 3EYZA 2BJ3A 5GMEA 2CQ4A 3DMJB 3HZEA 1OY6A 3MM9A 4MKVA 3CCRS 2FC9A 1M5HA 2R9LA 1JKHB 3JQKA 2DGTA 3G82A 1HLWA 4HHHA 1OPIA 4C6AA 2H5EA 3PYEA 3I0RA 4WE1B 2BRKA 2C2NA 4ZPCA 1HIYA 3FJ2A 3QLHB 4DG1B 5E7OB 1CJTB 2E5LF 2WVFA 3A8EA 2Z2LA 5KT2A 4ED8A 3JSMA 2CKWA 1OS5A 2PMWA 3FBEA 3PIPQ 2GQQA 2C3UA 1W2IA 1D9AA 1W25A 4L74A 4WFYA 5DZ6A 5ETPA 1IJFB 1TL1A 2ASLA 2GIQA 2KO1A 4K59A 3TI0A 4DSJA 2DNYA 1NB2A 5ETOA 1H7XA 2LECA 1GXTA 3DOMA 1BC6A 4OV1A 1Y3JA 5HJXA 3NCPA 3LGNA 3ELHA 3IRXB 3HSJA 4OYZA 3KMSA 3DLEB 4QQBA 1MWYA 2E5LJ 1KP6A 1NK6A 4YY3F 3TJ9A 2VQEF 3ZC4A 5BYSA 3HJFA 3HMJG 1LFWA 3PXGa 1SJ3P 2FZGB 2DNQA 2WBRA 3M8SA 3C6UA 1R7IA 4MIWA 4WXWA 1H7WA 2OKQA 2J5AA 3GSIA 4LIWA 4ZJOA 3WQPA 1S49A 1N0VC 2MHNA 3ENAA 1V9OA 5M2UA 3CCES 4XTTA 1FRKA 3TJAA 4ED7A 4HI2A 1NCLA 4Y2MA 5C25B 3R5CA 4CLYA 1CS4A 4KRWA 4LFCF 4WE1A 1QAYA 2RF2A 2DGSA 1XR5A 4ZS6A 4DPWA 4DV1J 1IQTA 2ZNZA 2Y1JA 3VAIA 1LXJA 2JJ4D 2VC0A 5D4NA 5EWGA 2LXFA 4X4PA 4QWDA 4EZ6A 1RADB 3IWNC 3M9MB 5HQ8A 2ZH3A 1X8DA 1WEXA 2R3VA 2X1AA 3SYZA 4IFVB 2AYGA 2CPJA 4I69A 4OMFG 1BXNA 3UDEA 4Q2MA 1LW2A 3I0SB 1NDKA 4CLLA 3ILOA 1FNXH 3EM1A 2PSZA 4OZ2A 4NCBA 5D6GA 2DNKA 1IQZA 1HI0P 3T41A 3K0JA 3VAFA 2IY5B 5MAOA 2HQGA 3IR6B 5DO2A 2CDRB 3SCIE 2NYIA 4DZ6A 3PX0A 1N48A 1HWIA 3R6GB 2QSFA 3GR1A 4Q45A 2KHDA 2R7VA 4RW7B 2F40A 3GR0A 4OJ1A 2DR7A 2Q66A 1XTZA 1N6QA 4M5DB 2U2FA 3FC9A 1A0OB 1NUEA 4AD6A 2H5IB 2JX2A 3DXSX 3IFEA 5BR8J 1UFKA 2WONA 2AYMA 4DV2F 1YGYA 4ZVOB 4F4YA 4DFMA 1XNRJ 2V67A 2ZBRA 2IJFA 2YWEA 4PYAA 1JLGB 4OZ5A 1UETA 2MY7A 2BW7A 3ZFVA 1CJUA 8ATCB 1SKWA 4DLGA 3IBFB 1ZM2A 3GV5B 4WFXA 3N5BA 2K8GA 4ZKAA 1HW8A 2HWHA 5HBMB 1WDTA 4RW4A 3N01A 3CJ4A 4NRUA 3PV8A 4PRFA 2R7UA 4DX7A 1S1WA 2MZ1A 3H8YA 4NLQA 3O5TB 1RWKB 4ZCIA 1HNIA 3I0SA 3N4WA 3QWUA 3IC1A 1MMLA 2XCPA 1JLCA 1FKOB 1TKZA 2G9OA 3D1OA 4BC7A 4TU8A 3Q8RB 2Y3YA 1YI2S 4FBUA 1PYTA 2XLKA 3W64A 1M1KT 1B7FA 1JLFB 3M6VA 1WC4A 4B3MJ 1UWBA 1C4CA 2I38A 4KGKA 4N5SA 1U45A 3UDLA 2IDLA 3D6MB 3ILJA 2VKZG 2GMJA 5ETNA 1U4BA 2MKYA 4LUBA 4B9NA 2UXCJ 2JLEA 5CYQA 5D3GA 2CZ4A 2Q6BA 1U0HB 2UVWA 4QU7A 1GXLA 4XK8C 3BO2A 2Z56B 3A8IA 2ASJA 1RLDA 5A8KB 1U6ZA 2F8MA 4PYDA 1PILA 4DHVA 4J9RA 3D67A 2MB0B 4KHPJ 3PW7A 4H4KC 3K8VA 4ZCKA 4B9SA 4ICLA 2OJ3A 3IR7B 1X9SA 2L41A 5H9FJ 1IBKJ 2RQ4A 4FF3A 2UV8G 2ZC3A 4KJIA 4NZ7A 5BYQA 1JXLA 1LXNA 2BX6A 2J9CA 3E51A 1JLQB 1J5OA 3NBPB 2OEJA 2HLTA 2W25A 3BKFA 3D6TB 3DGVA 5F3TA 4FNHA 1PG5B 3BYPA 3C14A 3QIDA 1FRLA 1AZSB 1TELA 4C11B 5B09A 1WKJA 1RTHA 2HNZA 2MLYA 2O5DA 1VOMA 3GCXP 3UVJB 2R2SA 1F3VA 3PJWA 3OT9A 3EVWA 4GC6A 4Z7YA 4OI0A 2WK4A 4KR0B 4N8OA 4NYPA 2B3TB 4Q44A 2YX7A 3A4TA 1WACA 4I0WA 2WOMA 4PPZA 4JYAJ 4ECSA 4HHJA 3M32A 3V6JA 1NK8A 3A3PB 2N82B 4Y6IA 3SV3A 1UWBB 2OD6A 1FD2A 3U7JA 2XO7A 4ZVSB 2ADCA 1Y5NB 4RUBA 4J37A 1MN9A 5E3RA 1H2VZ 1NPPA 3DHXA 4GKJF 4IOAQ 3VGUA 3AQOA 3DRYA 4MAKA 3RB3A 1FRJA 2B4UA 1FDAA 1YZ6A 2NUHA 4L75A 1N88A 3VCDA 3OVAA 3KLVA 3TQEA 2IYGA 3OFHA 4ETZA 4WWSA 4B9UA 3MGJA 2OH2A 2BZ2A 2HFUA 3MUVP 3CUNA 1S6PA 2YKNA 1BWVA 3HPOA 1WOPA 4RNMA 1OO0B 2E1MC 2CQBA 2GJ2A 2VJUA 2QJ3A 3BQ2A 3J7ZT 5J1PA 4RX6A 4NA2A 4MFBA 3VAKA 4DV3F 3F56A 2ATCB 2ABYA 4MYUA 2UXCF 4J90A 3DM2B 4U7CA 2PD1A 2QG9B 4M8LA 1QAIA 4KKOA 2EFNA 1J5EF 5HROA 3X3UA 1RAIB 1X4CA 5DJBA 4N76A 1KOHA 3M8QA 1UJ6A 4RBVA 3SZ2A 2IMWP 3MCMA 2ACYA 2V94A 3OXGA 2B6AA 1RCXB 5KFYA 2WOMB 1H2TZ 2M9KA 1EQ0A 1UVLA 5KFDA 5DM6Q 1EKSA 2KB2A 4K5RA 2R8KA 2OTJS 1N8RT 1S0VA 2ZH7A 2M2BA 1RWNB 4PUOB 2CQDA 3MMBB 4LSNA 3RBXA 4CLFA 4NLTA 4E2FB 4OX9J 3IA0A 1CJVB 1HQEB 2J7KA 2YQ1A 4PG6A 4PZVA 5RUBA 2ZBQA 2N7YA 3V4IB 4LSLA 3AD7C 4UOHA 4IO9Q 1CPZA 4NZ0A 2E7VA 3R8YA 1SJRA 1DZ5A 3W66A 3BPDA 3G96A 1FT8A 4HL9A 4QIVA 2HQCA 1B7YB 1O8BA 5HANA 1VI7A 2DGXA 1Q86T 5J1NA 2FLPA 4YDDB 3PCOB 1T9YA 3DLEA 3C8YA 2DR5A 2QE5A 3UPFA 2DEJA 2I2YA 1REVB 2CNKB 1ZTWA 4F02A 2XC9A 3MECB 2V34A 3SDEB 4NCGA 2LDYA 3T6JA 5EHHA 1U0SA 2L3MA 2C1EB 3W65A 3J80Y 2NZ4A 2R7XA 2YX4A 1AA1B 4NRTA 3UCZP 1DTQA 2ADBA 2UP1A 4KKOB 2Z30B 3D2WA 4YB6A 4Y2AA 2I5JA 3W2VA 3DRRB 1OQ6A 2YXLA 1T95A 5B08A 2OPRA 2UXDJ 3CCSS 3TR5A 5A2QU 4DQRA 3R27A 1GAOA 3UCUP 3MCNA 3K89A 3BB5A 1CS4B 3UO0A 3Q8UA 2B7CB 2D3OR 1NHVA 1F2HA 1TL7B 2M7SA 2IDEA 2VDIA 2H51B 4M5HA 3THVA 2PA8D 5KFUA 4PUOA 3ETOA 5K20B 3I5BA 4WIIA 4K4UA 4JI7F 3R7BB 1XN9A 2ZZMA 4C8NA 1I94F 5H9FK 1YJVA 4IFVA 3NWGA 3V4IA 2D9OA 4UOGA 3CCQS 2C2RA 3D0GE 2RQCA 5G0RB 1P6TA 4ELUA 3LALA 4I4BA 2HW3A 4OV6A 2VFUA 4GKKJ 4IFYB 1NU4A 2QSWA 3HF5A 1EX8A 2GMHA 2NZCA 3G6VA 5U47A 3D3CJ 1NZ8A 3HFZB 3Q83A 4J9LA 2GJIA 3M8PB 3GFZA 4A8KA 5I3UA 4DCJB 4O3QA 4FS1A 3DGPB 4K4VA 4RUHA 3J7YU 2EFVA 2MZQA 5GMKa 4A47A 3OHAA 2K7KA 4I67A 2W2QP 3QRQA 5CYMA 2IJNA 2ASYA 1KVKA 2W9BA 3HVTA 2ZH4A 1VBYA 2DXFA 3N6NA 2WONB 3A3NB 4NEYA 2A6OA 2BE2B 1YWXA 1ZAVA 1SH3A 2CADA 2NPIA 1NM2A 2BE7D 2R7QA 2X3GA 4WIQA 3IMQJ 3PDNA 3MXHP 2CQ3A 1RAJA 2RUGA 2HBRB 3FZBA 4N77A 5ETSA 1DLOA 2JFKA 3BR8A 2QLXA 2VU5A 3L4BC 4G1PA 4RLEA 1XBWA 4CTAA 4IRCA 1NH8A 1VRQC 2NLWA 3TEGA 2JC0A 5KT3A 3HXMA 2UZAA 1N36J 3H5SA 2EC2A 3AFGA 1ITPA 1S4FA 4DS5A 1AFIA 3U27A 2XYGB 2LCWA 3ICLA 3OLBA 1R6YA 2MZRA 2UUAJ 1NBEB 2OIHA 1U2FA 2QT7A 5GAGI 3QGGA 1HNVB 1FKOA 1KLMA 1X4AA 3GFHA 1PGZA 4FF4A 2DKOB 4B02A 6FD1A 1S1XB 2HHXA 2BUNA 3OTDA 2DIVA 4GRSA 5A8RB 3THPA 3HDSA 3P5TL 3C6TB 5K8OA 4DV5F 4IQXA 1L5UA 2ZBCA 4I6AA 3ZTOA 2D41A 4K4YA 4NCAA 4OZ1A 1S1TB 4P7VA 3DC2A 4A8XA 5B0DA 2BQUA 4DV5J 3EPGA 2FVSA 4OLPA 2W9BB 1S9EA 1NSPA 1D1UA 5EN1A 4ZA1A 4ANDA 3MR6A 3DNCA 1RU2A 2CXEA 4M95A 1P27B 3D4JA 5CZXA 3TA2A 2OMLA 2XSFA 1HA1A 1VS3A 2VOOA 4MIAA 2W7OA 4DL3A 1KSPA 4HTJA 1DLOB 4QBUA 5HQLA 1VQNS 2IRUA 4G65A 2K06A 2FY1A 1PJ6A 1RAFB 1HBNB 1T3OA 5B0FA 4CLWA 4I56A 3EUNA 3FKBA 2WTFA 1LWFB 2AV5A 4NWBA 2KVIA 3E01B 4ZJQA 3ISZA 4QYZJ 3NBPA 4F4ZA 1K0TA 1FK9B 1RAHB 4ZLLA 3MTJA 4LR7A 2PC6A 4F0HA 4C8OA 4YR0A 1X4BA 1KR4A 4KH1B 2IJRA 2C2KB 2XHWA 2GQ2A 2JVOA 5LMUJ 1FEHA 1N5TA 2BW2A 1FWKA 5DLGA 5J2PB 4Q0BB 1D0EA 4PCQA 3KHGA 3KLEB 1NPKA 2Z2MA 4ZJLA 1D9FA 4ED5A 1X60A 4O3SA 2DTJA 1RT2B 3HP6A 4GMKA 2P2CB 2W7AA 3D3BJ 1HW9A 3NGUA 1NK9A 1PBUA 5EX0A 3TUJC 9RUBA 1RABB 3GCWP 4XDDA 1PC5A 3PTWA 2P9EA 3D5MA 4CO0A 4J9SA 4USKA 4J9VA 1QSYA 3V81A 3CJSA 4C9DA 3NY0A 4DPOA 1NSQA 3TA1A 4USHA 1RTJB 3AJDA 4DR3J 2UUBF 4ID8A 1E6YB 4ENOA 4J9KA 4TLQA 1PO6A 3H2UB 2DRBA 2AEMA 3DLGB 2P8IA 2OMOA 3OUYA 1FDDA 5IC4B 1JJ4A 1HHSA 1FO1A 2LQ8A 5K8MA 1Y4ZB 2AX0A 1VK8A 3PYFA 4P74A 3FK4A 4QR2A 1L3KA 2AZ1A 5E33A 3DFEA 4HHUA 1LW2B 3KJQB 4LVNP 2B0GA 4F3OA 4FXDA 2SXLA 3OL7A 1MN7A 4Y34A 2OP5A 3I31A 1RTDB 3N0VA 4KFBB 2G1DA 1HWJA 3JQMA 4M5GA 2BXJA 1QE1B 5C5JA 4F4KA 4K4SA 3QJLA 2PA3A 3TAMB 4UOCA 4Y2KA 1WNEA 1O5JA 3KKFA 2OPQA 5J1EB 1JIHA 1ZM3A 2Z2ZA 4CO5A 3E2EA 2Y8YA 1RT2A 2EG2A 2B8PA 3W63A 1B0PA 4IG3A 5DETA 2RDJA 4JI2J 1BE4A 1N34F 4WPAA 2DHGA 2KT2A 3MEGB 4C97A 3RBDA 2FY8A 2KZMA 1Q16B 2XG8A 2OPSA 4OYOA 3D28A 3CT9A 3LF0A 2YQ3A 1LKZA 2J9DA 2BANA 1CQNA 2B51A 1VQKS 4RUCA 2V4JB 4K7QA 5E2QA 2OGUA 4TY8A 2XHCA 1Y0HA 4PAAA 3HVWA 4DOZA 1HBOB 1FVQA 1F9EB 4KH0B 2I9SA 4OX6A 5E5NA 3VQSA 5IM0B 4UQTA 5HAOA 1MG7A 4DSIA 3GPAA 5ETRA 4ES2A 2XNRA 2UU9J 2JSXA 3B82A 3K17A 2OLWA 2AT1B 5B7WA 4X65F 1ZBTA 5CQGA 5L46A 2VA2A 1QUVA 2W4CA 1M5KC 2F4VF 5KFFA 3HHEA 4USTA 2PMZD 2BVZA 1WG4A 3CW2C 1SCJB 3GZ7A 3TZYA 1LK7A 1H3DA 3MF5A 4R0JA 3BBFA 3CSKA 1TKZB 1R8HA 2B4VA 2XYPB 4Z7CA 4DL4A 2DY1A 2DR6A 4QW8A 1GTHA 2JHEA 2A18A 3N28A 4CO4A 1VQ4S 2RUSA 1ZZFA 3Q2SC 4EFAC 1PJ7A 1NRKA 1X4GA 5JJBA 4XIUA 2I6WA 3G6YA 5IT0A 2PI5A 4IO1A 3DYAA 1J5EJ 4JI7J 5J2NB 2AKWB 1T3NA 2IYIA 4FYDA 2R42A 3MEKA 3FEZA 3QGIA 4C8KA 4X2BA 1RBAA 4RU2A 1SL0A 4USIA 1NSKL 2E1AA 3BS9A 3JXOA 4RNOA 1FNMA 4M1KA 4ETXA 3I82A 2XI3A 1YJTA 5C42B 1PIEA 4XAKA 3RBEA 3AJ1A 3IXQA 4PWUA 4LF5F 4CH7A 3TYTA 1H6KX 2KVQE 3SSQA 5L9NA 3GQCA 5HVGA 1FESA 1HQUA 4NLYA 3W60A 3ZO7A 4CLKA 4J7CA 3GONA 4PXEA 4NXNJ 1PBAA 5L9XA 2F4VJ 1EAYC 1RWOB 3T5KA 4FF2A 3PYGA 1JLAB 1R89A 2AJ4A 2HFOA 2MQ8A 4RW7A 1FFWB 1SV5A 2MZTA 3MMJA 3IN5A 2YVSA 2OELA 1N6QB 2A10A 1P8GA 2RHSB 3C14B 4M5DA 5D8HB 1HPZA 1A7GE 1FJ7A 2ZH5A 4P2MA 1FI4A 4F36A 3MMAB 4EWTA 2VPZB 4JYAF 3TRGA 3NKYA 3CJ8A 3QT8A 4KGXB 1H0HB 2XMMA 1SC3B 3DN9A 3HT0A 3L95X 2DNLA 4GVLA 3US5A 5I42A 4BS2A 3DRPB 5D0RA 2JRSA 2D3UA 1RA7A 4JV5F 5E0OA 2G0IA 3O6QA 2JC1A 1YX2A 3W5XA 1P1LA 4ZVRB 5BJRA 3D7SB 3TP2A 5DDOC 4WP3A 1Z1ZA 2IHR1 2ZVIA 1KWMA 1U1LA 1T03B 3AXMA 4CYUB 3KHRA 1FDBA 1YQHA 3QT6A 1NJYA 1B4SA 3BBBA 3JTOA 4LRAA 3VAHA 1JLFA 3HFKA 3ILIA 4NYZA 1RAAB 1TK8A 4FKXA 2M88A 3VVUA 4FN5A 5F8GA 4TXSA 1MU2B 3Q8VA 2HVHA 4DQQA 4J9QA 4ZIWA 1FEEA 4ZK7M 2Y0BB 2IVYA 1SQEA 4KY3A 2QFJA 1HQ2A 2AGPA 1ICEB 2HVDA 2DT9A 3BZQA 4Y0FA 5C24B 1K1SA 3AA8A 2FHJD 3HHKA 4NA1A 4TU7A 2DGOA 2CNLB 1L3TA 3MMAA 2D1CA 3HLUA 1C2PA 2XY5A 2LMIA 3VQTA 1RT5A 3MAAA 4DV3J 4NXNF 4RR5A 3FCWA 3BSNA 1HBNA 1UZDA 2N3LA 2QYCA 1LW0A 4NYOA 4DU7A 4CO2A 3FBBA 2E5IA 5AXMA 2CYYA 2PFFB 1Q8IA 3AHPA 1R6VA 1VFJA 3CJ2A 4YB7A 2MGZB 2CIMA 3G2XA 1X0PA 3CJ3A 2MHEA 2YNHB 4TYAA 5LMUF 3R1HA 1RA6A 4DF4A 2AW0A 2CJ9A 2EKNA 4M5IA 4DCPB 2AJ2A 4W98A 5IZHA 5FD1A 1WWHA 2BJ9A 2KI2A 1WHVA 5CYJA 5DLFA 3TAPA 3C16B 2AGQA 2IM3A 2Y0SD 3GB0A 3CJQA 3GYXB 3FUYA 1I51B 1Q4RA 4DN9A 4Q8EA 1YJNS 4O0NA 1YTYA 4CIOA 1HMVA 2DXDA 1K73T 2YKQA 4PWDA 2MKCA 1OQ3A 5HMYA 2ZC4A 4ECYA 3O8WA 2KZZA 1FRXA 2P6SA 2RD5C 3IR5B 2LXIA 4URQU 1HWKA 3MD3A 4PKDB 3KHLA 3RAMA 2DGVA 1BY9A 4WBFA 1KKHA 3G4SS 1S0NA 4O23A 4PXCA 5E3CA 2HBZB 2RDDA 3DLJA 3NAHA 2ZUAA 4L6V3 5T7LA 3WBZA 3KK2B 2MYFA 2HK2A 5AXNA 5HQMA 3NGDA 2J0XA 4DSEA 4ZIVA 2UU9F 3GV8B 2J8AA 3HHLD 5EX3A 5T14A 3PRDA 2GGPA 4Y28C 3JAMU 1X7VA 2YNGA 1I1GA 4M5MA 5IXUA 1LW0B 3HZGA 3TZZA 4B08A 2ZH9A 4IOCQ 3OW2R 4B3TF 4DV0F 3JSMB 1D09B 2ZITA 1F5BA 3RTVA 4IDKA 4F25A 5BR8F 3F73A 4DV2J 1NK5A 1Q5YA 2CPXA 3SIPB 1CVJA 2DNMA 1WELA 2VD3A 1S10A 3OJUA 3T5JA 1IBLJ 5F8NA 2HZCA 2E29A 4LF2A 4P52A 1HHQA 2ASDA 3MFHA 3OL9A 1RU1A 1YBTA 3BSOA 3OR2B 3TAMA 4FVCA 3J7YI 2NR0A 3M9NB 1QTNB 4WKYA 4G1QB 3AY0A 5EWFA 4B3MF 3HULA 4ZLNA 2WSCC 2Q6CA 2XSJB 4NX9A 1CJVA 2HS3A 1KVJA 2AYEA 2PDAA 1O6XA 4HR2A 1R0AB 3QZ8A 4ED2A 4E0DA 4IH6A 1V5IB 1Y5IB 4BC9A 3CULA 4ED4A 1KFSA 4ANEA 1QD1A 2JFDA 3OR1B 4ZP7A 4KO0A 2W9AA 2UUWA 3T1YF 2N7CA 1HHTP 4N47A 1DURA 2OD4A 1NO8A 4ZVEA 2V4JA 2RRAA 4JI0F 1XQIA 1NEEA 2WVDA 2U1AA 3EVMA 1HR0J 4U67Q 2FDNA 3SDEA 4NLXA 2YKAA 1KBRA 3DOKA 3SCKE 3DDIA 4LFCJ 1FTRA 2QO3A 3B78A 4C48A 2C3OA 3FQKA 2CJYB 2FQQB 2I5JB 2KHCA 3NLCA 2CDQA 2H4WB 2DCLA 3ZZTA 2NCKL 5IT4A 1R0BG 4EEYA 1Z4UA 1RHJB 1RBOB 2R2UA 2W2MP 2WB4A 2ZNYA 2HGNA 5GVQA 3UDVA 4DPYA 2W9CB 2CZVC 1JKHA 5DZ7A 3ENWA 3GG0A 5D15A 4PABA 3KMQA 3UW1A 2ZKTA 2YNIB 4G3IA 4RKUC 1FJGF 4C3KA 2DXEA 3OR2A 3MFIA 3GSDA 2N3OA 1SL1A 5KG0A 4YN3B 2VQEJ 4ECZA 1R31A 5KAKA 2BJ1A 4QJVA 1AUDA 3AD8C 4DV6J 3MEDA 2VB6A 3M8WA 2LVWA 1SKSA 1YRXA 1S1TA 2JDJA 2RSQA 3CVKA 3FFIB 2KM8C 3HX9A 1QVGR 1I6JA 3WIVA 3BJYA 4OLOA 1S9EB 3AD9C 1MMDA 4OYXA 2B4PA 3BKTA 4J9UE 4ZVQB 1FTCA 3IM8A 4FXVA 2CA9A 5AJ3F 1NJWA 4PG5A 3GJSB 2XB2D 4YS2A 2F7VA 5HP1A 1RXOB 3NEKA 4LJMA 3JSBA 3MDFA 4F0KA 1BUXA 2R7RA 3K5NA 1RT4B 5J2MA 2BJDA 1OY9A 2FGOA 1U6BA 2FJXA 1WHYA 2NS1B 4RW4B 4UZCA 1FRHA 4U6PA 2R8GA 1N34J 1N36F 3DLKB 2JZ5A 2V2VA 4DFKA 1VDHA 5IWAJ 4ZLPA 3VVTA 5DDRC 4KBIA 4U9RA 2ATLA 2HVEA 2NQPA 2BR0A 3NOGA 2HRUA 4LRDA 4JI5J 1FKPB 1MROB 3HKWA 2KG0A 4YOEA 1SBRA 1XWLA 1UPPA 2QLWA 2ZM6J 1T11A 5M2RA 4F2RA 3VF0B 1T05B 1GMWD 2ZBIA 2DIUA 3T5HA 1SJFA 5JXSA 2QX0A 2XM3A 2EKYA 3HD2A 1N32F 2HFVA 3D66A 3FRZA 2DK2A 4Q7AA 1G1XA 3MPVA 1VCTA 1WC6A 2DD8S 4FP9A 3SV4A 1QAXA 2VFVA 3L7OA 3I4PA 2ZKUA 1JNRB 3RJMB 2YKMA 1V3SA 3G8TA 1KLMB 2N4DA 2FZCB 2CG8A 3CIMA 1VBKA 2GO8A 2DGWA 2JH3A 1CC8A 1RT7B 4LQ9A 2GIFA 1SIWB 3GYGA 3KLHB 3POTA 4MJKA 1PC4A 2CJAA 3WIUA 3C6TA 1Q53A 2QA4S 1C0UB 4OYMA 4DXLA 1TTHB 2MZJA 3OTOJ 2FHJA 4MTPA 2R7WA 2IIHA 1KS2A 3AH6A 3OUYB 3ZNUA 1UCNA 1NMEB 4AXJA 4C8LA 2GW8A 2GV1A 2YBVA 3ETMA 1WKKA 1LEOA 1UJ4A 1X4DA 2WRMA 1GNKA 3EGNA 4O4RA 1TK5A 5FLXU 2CRLA 3GYNA 3RUBL 4HVZA 1OIAA 2QYGA 3H59A 3ZZOA 3H40A 1QE1A 5G4DA 1S7IA 1HKAA 1KDNA 4EUVA 4WP9A 4DJBA 2APOA 2X1FA 1MSWD 3HO1A 2E9TA 3QO9A 5HLFB 4LF5J 4Y2CA 1GFWB 4DR1J 2GVDA 3M05A 5BXIA 5L1LA 2YWWA 3H42A 5KFZA 4CWBA 3PO4A 4DL7A 3QIPA 4I2PA 1TAQA 2AMCB 4XDCA 1IKYA 1SQGA 4WTYA 4DUZF 2H3EB 4NLSA 2QLBB 7FDRA 4NL5A 4CH1A 2D9PA 2YNHA 1J2VA 1RT6A 1NDPA 4UF4A 5GAHU 4ECVA 1I94J 3EGZA 2JL9A 3I4HX 4DPXA 1T02A 1UPMB 4M5JA 4EBEA 5J2PA 3MWBA 5E3QA 4DV4F 2FLLA 2BOAA 4JI6F 1UVJA 1PYOB 1IXKA 3BGLA 5KG5A 2HBQB 4LF1A 1XNQF 3LP1B 1FJEB 3QRPA 1TZ0A 2A2DA 2CJXB 2PN6A 4W90B 4YEAA 2A1BA 5H9EK 4LR9A 2DHAA 2WVBA 5A8WB 2Z2YB 1S76D 2NXCA 4B9TA 3BGOP 2MQPA 2ZH2A 3MOZA 1S7HA 2D7SA 3UI3A 4K4WA 3BO3A 2LQBA 4ZCLA 4C0HA 4WZMA 3KLFB 3HHDA 4Z37A 5KT6A 1HBMA 3CCMS 3PW0A 4DR4J 4LSZB 2QL7B 4UY85 1Y10A 1VK3A 2YNGB 4OQJA 5E41A 3FSXA 3SMZA 2MSTA 3G8QA 2DYAA 3KJVB 2BABA 4LSNB 4KT0C 4YMEA 1DJ0A 4K4ZA 2KT5A 1IKXA 2QMXA 1UVNA 3AOBA 5LM7E 3DU5A 5DM7Q 2IFXA 3GIRA 2MMYA 3M2UA 2CQPA 4P2FA 4YUDA 4LSLB 2DO0A 5KT7A 4ER8A 3OFFA 1LQ9A 2AF6A 1G7CB 1YHQS 4DI6A 3DRXA 2XEXA 1GXUA 5GADU 1UW9A 4AUKA 2BJEA 3BYRA 3KUEA 4NLUA 2M8HA 3JAMY 5K14B 2VPXB 3I5CA 1RAEB 2G13A 1N54B 4NCGB 2G0CA 2XSJA 4LF9F 3DCAA 4P71A 4LF4J 1Q0NA 1A9NB 3EZ5A 3ADAC 1ZAWA 3AAWB 4CLUA 4EO6A 1U49A 3RW6A 1RUSA 2E66A 2NXJA 2PGCA 4NLOA 2C3PA 3KLIB 1O51A 3M30A 1S1UB 3V2UC 4DPTA 1K9MT 2Y8WA 3OR1A 2EVZA 3F44A 4ZN1A 2EC0A 3K2YA 4NI2B 2RF2B 4OZLA 1M5VC 2MJNA 4JI6J 1B64A 2YTCA 1FF2A 6FDRA 3RGIA 1RT3A 3KJVA 1EZZB 3KK1A 1S6UA 5IV4A 2GCFA 2Z57B 4AYBD 2ZD1A 4X66F 5JVHQ 1C0TB 2QN6B 4CQ1A 2BJ7A 4U8VA 2OPPB 3HHLB 2E5HA 3M2UB 3G6XA 4A48A 5JVGQ 3TVYA 4DUYF 4DR5F 2MSSA 4DUZJ 2NPFA 1HNWF 1WHWA 1U26A 4U96A 2VZ9A 1WD6A 5LL6d 4F3MA 3OHBA 1TU0B 4DWIA 2JEIA 2QFIA 4CYUA 2IPOB 2CPFA 3ZZUA 4PG8A 3K59A 2CWXA 3K5MA 5HMXA 1U1MA 3DLLQ 4CT9A 4ILRA 1SKUB 3LWLA 4L72B 4ILLA 3CO9A 5I3UB 1YKWA 5HVFA 2FZKB 3TUIC 3OL6A 4FDFA 1LK5A 3BN4A 1RKJA 1MWQA 4HDGA 3OLAA 4ZP8A 1GK8A 1JNZB 4KQZA 4V19X 4JV2A 3ZTSA 2C3MA 3FBFA 4BHQA 3HCXA 3TARA 1XMOF 4YR3A 5C42A 1VQMS 3KHHA 2RVJA 3NS7B 3CCUS 3SSRA 5A76A 2EFQA 2QLJB 1MWZA 4IUFA 2LQ9A 4IRDA 2MQLA 5J2QA 2V6AA 4ZPDA 4F26A 2B8QA 3TX0A 4EYHB 1N32J 2AWZA 3R5DA 2CPYA 1ZM4A 3UR3C 1RDRA 1VQ7S 4C98A 4F3QA 2WSEC 1LOUA 1WORA 2DO4A 1UEKA 2WZ1A 5HK4A 3JYTB 1YJUA 3QSYB 1JLCB 2EFGA 2QL9B 4RWXA 5F8JA 3V6DB 2HMIA 1GMWA 3IGVA 3Q22A 1IJEB 3J7A1 4M5KA 3BH7B 4NLDA 4LF8F 5FDLA 4X62J 3ET6A 4PWWA 4HACA 2E1CA 4DV4J 4JUZA 8AT1B 3JS9A 1YRTA 1RT1B 1CULA 2MTLA 4C0OC 3QRRA 4LMZA
chains in the Genus database with same CATH topology
1TV6B 1M5SA 3OBIA 3M1VA 3VAJA 1Y7PA 2I8EA 2KRRA 1X5OA 1X0FA 1W2BR 2JEFA 3WC0A 4CH0S 1T03A 2FJWA 1UEVA 1N5YB 3KG4A 2HNDB 3QYYA 4AE5A 1V6HA 2MQQA 3UDCA 3VAMA 1Y00A 4IRKA 2VPWB 2KXNB 1MU2A 3F41A 3MUMP 2ZE2B 1U7LA 5LJ5Y 3BDEA 1F2GA 2QA4G 4IDKB 3H98A 5KTQA 1F9FA 3I9V9 3TX8A 4C2MA 1HI1A 2VG6A 3DOLA 1S48A 5D78A 2RKIB 3O2IA 3K5OA 4CI0B 5HO4A 3CD6S 4JI5F 3H4BA 2YH1A 1HFEL 4BDPA 4UY8T 4HH1A 2LQJA 4CTAB 5KFNA 1VQ8S 4K4XA 1KLNA 2DHSA 5KFGA 4KSEB 2VOPA 1SH2A 2MGZA 3GIMA 3RW7A 3P6YC 2KJWA 2IVMA 2FLNA 3BN7A 1D3WA 1TL3B 3O1LA 1XERA 4WK1A 4X4OA 4X4QA 3MI7X 4DL6A 3DLHA 4KHPF 1VC6A 1SB6A 4UW2A 4AL5A 3IRXA 1ZPVA 1QSLA 3EXCX 2JOQA 1DTTA 3M6WA 4HYKA 4JI3F 1X9WA 4B3OA 5DG7A 3IG1A 3FVYA 2CVIA 1VQSA 3M4XA 5IT9Y 2VBXA 3Q8SB 1S0MA 1WF0A 4QW9A 4QIGA 4DL5A 2AJ1A 5A8WA 4OHZA 2Q43A 1RKIA 4YFUA 3D1QA 3CWJA 3S7RA 4DV1F 4F8RA 4C4WA 3PX6A 4MKYA 4IG0A 4KFBA 3KK2A 2VODA 1GTEA 5KFSA 1TFWA 2D74B 1X9MA 3TVZA 1AROP 5KFTA 2OPQB 5J1EA 3SFGA 3MMBA 4KHRA 5KG4A 2DBBA 2KTQA 2B7BB 4O3NA 5KFBA 3E01A 1TR0A 3LPYA 3D0IE 2AU0A 3Q0AA 3KNGA 4ECUA 3T5LA 2XY7A 1FKAF 2HYIB 1SUQA 3Q8PB 1IM4A 1HL6A 1ZM9A 2MZSA 2J0WA 2KXHA 2WSFC 2GHVC 4A46A 2XWXA 5KG3A 1NAQA 4ELVA 4B9VA 1NJIT 4Q0BA 4HTIA 1UVKA 2BBEA 2DNGA 1C1CB 3MECA 4E8UA 3RRGA 2BM1A 5IM0A 3CCTA 5KFHA 3MM7B 1ZYQA 2DNZA 2FTRA 5KG6A 3LH2S 2XWYA 4BWJA 3DLKA 2YX1A 2J6TA 4RU9A 3EPIA 3DRRA 2FHKA 3GIKA 3WC2A 4WU3A 4ECXA 1M5OC 2BDPA 3M30B 4IG0B 1FDNA 1JB0C 3OTCA 4R25A 3OL9A 1JLGA 3NCQA 3S1TA 2RU3A 2XS5A 2KDOA 1FHTA 5KFWA 5K8NA 1C1BB 1Q8LA 4TN2A 2WW8A 1XC9A 3AJ2A 2MKIA 1IKVA 2IAJB 3DOKB 2YWGA 3LO3A 3HT3A 1AW0A 4P7TA 4Q2LA 4AFFA 5L1IA 5D4LA 1AFJA 2M8DB 4NLVA 4JV0A 3I9ZA 4OHXA 4DR3F 1JX4A 2B9YA 1XMQF 4ELTA 5DGAA 3TANA 2FVQA 1D9DA 3P3DA 3RB6A 2KM8B 4EEYA 1RTDA 2YWFA 2DB1A 3KTQA 3EX7B 3RAQA 3QAEA 1T7PA 2P9CA 2JWNA 1TK0A 2VQFF 1BQNA 2HS0A 1QTMA 2HHWA 1TP7A 5CD4H 4RBTA