3HVTB

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
427
structure length
398
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 74
structure length 398
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB03
1RYRA 3KOAA 3LP1B 3MEGB 2F8EX 2WHOA 4NCGA 3DI6A 3CJ3A 4RUCA 5HP1A 1HQUA 5J2MA 1K1QA 2ZE2B 2IM1A 4IH5A 4LSLB 4O4GB 3DMJB 2YNHA 3CO9A 2FVCA 3NGDA 1Z4UA 2W7PA 2YNGA 1S48A 4ECYA 4MK8A 1D1UA 3JYTA 3PZPA 1FKOB 1IKVA 2HNDA 3M9MB 5L1IA 1TL3A 1C2PA 3EZUA 3MF5A 4H54A 4NLRA 3HVWA 5KG3A 4QW9A 1RA6A 2QE5A 1YVFA 2W7OA 1S1VB 3GV7B 1JX4A 5F8LA 3N6NA 5KFDA 3PW4A 3DRRB 1S0NA 2I5JB 3HVTA 4YQWA 2WRMA 3LP2B 3KHGA 1MMLA 1JLFB 3C6TB 3GV5B 4WXWA 1NHUA 4Y34A 5DG7A 3DRPA 1BQNB 4J9MA 1JKHA 2CJQA 5KT2A 5KFHA 2R2UA 4WE1A 3OHBA 1TKZA 2WOMA 4PUOB 4ECWA 1LW2A 5DQHA 2J6UA 4QWCA 3NBPB 1HNIA 4ICLA 2R8IA 3DOKA 3CJ4A 2ZD1A 4IG0A 4DG1A 4U7CA 3Q8QB 1SV5A 5FDLA 2O5DA 3M8PB 4RW9B 3IGVA 5EWEA 4F50A 5I42B 3KK2B 4NLDA 1KHWA 2FVSA 4IFYA 3PW2A 4X2BA 3UQSA 1RTDB 4O3QA 4ZHRA 1N5YA 2DPJA 3I5CA 4RW7A 1C1CA 5KFVA 4I7FA 4DL3A 4YP3A 4PQUA 5J2QB 1HYSB 5KFUA 3BJYA 4RW8A 1IKWA 3GIKA 3KLEB 4KAIA 3G6XA 4EO8A 5C42B 2W9CA 3GILA 1IKYB 4PWDB 5HLFB 3V81B 1VRTA 1NHVA 4IFVA 4YR3A 4B3OA 3IRXB 3BR9A 2FJWA 3M9NB 3UR0A 5CYQA 3MEDB 4IRDA 2BE2A 2C2DA 5DGAA 4KSEB 1JLBA 4IOBA 1RT2A 5KT5A 2YNFB 3DLEB 1S6PB 5J2PA 3H98A 5C25B 4ZPBA 2YKNA 4KKOA 3CDEA 1HMVA 1S9GA 1LWFA 2BANA 2HMIB 2GC8A 3QO9A 1DTQA 3CJ0A 4NLSA 5KG2A 1N48A 3FQLA 1SUQA 4NLOA 2HNZB 1BQMA 1TL1A 4DL5A 1JLAB 2IM0A 1C0TB 1S9EB 3EPGA 3KLFB 1S1UA 2OPPA 3IS9B 4MKBA 4M95A 2XWYA 1EETA 4F4YA 5KFWA 1T03B 1IKXA 1S1WB 2R8JA 3OLAA 3MEEB 3N6LA 3KNAA 4NYZA 5JUMA 2XC9A 1C0UB 2VA3A 1MU2B 3RB3A 1S6QA 4O44A 4Q0BB 4WZQA 5DQIA 3H4BA 4LSNB 1S1XB 1RTIA 2JC0A 4EYHB 3MR3A 3HHKA 4NRTA 5EUHA 2C2RA 3NKYA 5F8MA 5CYMB 4XO0A 2C2EA 3UDLA 3IG1A 5KFCA 5DG8A 1RT3A 4EO6A 3KLGB 4ED2A 2J6SA 3QGHA 4NLPA 3DRSA 5EWGA 4H4OA 4KV8A 5KG5A 1TKXB 3V6HA 1VRUA 2B6AA 1C1BA 1J5OB 1TV6B 3H5XA 2OPRB 2W8KA 1LWEB 3DOLA 3QIDA 2VG7A 2IAJA 5KFBA 3MR6A 4KHMA 2IC3B 4NLTA 2HNYB 2RF2B 1RT1A 4H4MA 5C24B 3V6JA 3KK1B 2WB4A 3MECA 1SH0A 2R8GA 3QLHB 1FKPA 3FQKA 4MKAA 1S9FA 4I2QA 1S1TB 5EDWA 5KFQA 2AGPA 2AWZA 4G1QA 4R5PA 5F8IA 4NLUA 3KK3B 3NMAA 1HNVB 3PHEA 5KT3A 3MFHA 3BSCA 3NL0A 1HQEB 1R0AA 2IBKA 1N4LA 2JEJA 1RTJB 1WNEA 4EEYA 4O3PA 2HWIA 4IH6A 3V6DA 3KHHA 3FDSA 2XCAA 4J9QA 4XPCA 5F8HA 4K4UA 5J1EA 1I6JA 4J9PA 5KFRA 2RKIA 3JSMB 3GYNA 4K50A 4URSA 2VG6B 4RW6B 4K4VA 2V4RA 3KLHA 3CJ2A 4ED6A 4TLRA 2ATLA 4KO0B 4RNOA 4KHRA 3I0SA 3JYTB 4RUAA 1RT7A 2HNDB 2VG5B 4JV0A 1RT5A 4MH8A 2V4QA 1XR5A 2ALZA 4DL2A 1JLQA 4MIBA 4Y2AA 4ZVHA 5KFLA 2XCPA 3OSPA 2BR0A 3LP1A 4IKAA 4JV1A 4EBDA 2YKMB 4ECRA 4ZPAA 4DL6A 3LAMA 1UWBA 1XR6A 2W8LA 2ZE2A 4LSLA 4O4GA 1S10A 2D7SA 2BQUA 3DRPB 3E01B 4KBIA 4ZP8A 5KFGA 1FK9A 2RDIA 1TP7A 1FKOA 1REVB 4NLWA 3DLGB 1TKZB 2C28A 2WOMB 4ED8A 3V6KA 3OLBA 1QE1B 1NNDA 2BRLA 1CSJA 2RDJA 4J9OA 1S1VA 3KLIB 4ICLB 4QW8A 1T05B 3QZ7A 4F4XA 3MR5A 1ZETA 2ZD1B 3E51A 5KG4A 5KFNA 1LWCB 1SV5B 5FDLB 2AX0A 2I5JA 1RDRA 4URQU 5F8GA 4R8UB 1TKTB 3LP2A 1JLFA 1LW0B 3C6TA 4EBEA 3QIPB 4RNHA 1QAJA 3MR2A 1DLOA 4TY8B 3OL6A 2E9ZA 3LAKA 5KFOA 4Q8EA 1JLCB 1EP4B 5KFFA 2IMWP 5KG0A 5I3UA 2J6TA 4PUOA 1JLEB 4IR9A 2YNIB 4IQXA 4RW4B 3NBPA 2W9CB 3G6VA 2OPSB 1HPZB 4QWBA 5KFZA 4TQRA 3M9OB 4I2PB 3DYAB 2E9TA 4KFBB 3M8PA 4RW9A 4Y3CA 4B3OB 4QWAA 3Q8PB 1KHVA 3CDWA 4F4ZA 3D28A 3D5MA 3KK2A 3BREA 4O3RA 4HKQA 4OL8A 3GQCA 5F8NA 4MK7A 2BE2B 4KE5A 5D3GB 3FFIB 3DLKB 2R2SA 2UUTA 5J2QA 5HBMA 1HYSA 2ZKUA 4YR2A 2AGQA 3KLEA 5C42A 1GX6A 2V0NA 4J9RA 3ISND 3QO9B 3V81A 4PWDA 1W25A 3RBDA 5KG1A 4ECSA 2AQ4A 3IRXA 5KFEA 2W9BA 3CIZA 3SFUA 3M8QB 4IG3A 2R2TA 3MEDA 2XI3A 4QWDA 4ZVGA 2OPPB 5J2NB 3G6YA 4O3SA 1JLGA 4G3IA 1ZTTA 3I0RB 2WK4A 3CVKA 2YNFA 4NLXA 3DLEA 1S6PA 5C25A 1RT4A 4K4SA 5KFPA 5KT6A 5L9XA 2I1RA 3Q8RB 3ITHB 2HMIA 4M94A 1TVRB 3I5AA 3PW0A 2UVUA 3PJXA 2WONB 1RTIB 2HNZA 1S4FA 2CKWA 3FRZA 1JLAA 3TAMA 4TYAA 4J9SA 5KFJA 3OL8A 3MFIA 1C0TA 1S9EA 2JEFA 4Q43A 3KLFA 3PVXA 4TYBA 2UVWA 3IS9A 4IR1A 3SFGA 3DDKA 1RT3B 3ISNC 1S0MA 1N56A 3BGRB 1T03A 1KLMB 1S1WA 3PR4A 2D3ZA 3DRSB 4LQ9A 3MEEA 2W9AA 4ID5B 3VQSA 5KFMA 1MU2A 2JEIA 2XGQA 5L1JA 4Q0BA 5K14B 4MFBB 2FJVA 2ILZA 1DTTB 4WXOA 3DOLB 3MTKA 4IDKB 3C6UA 4QWEA 3DM2B 4ECZA 4ECTA 2VA2A 3LP0A 3BQ0A 4ED3A 5CYMA 1QUVA 1TQLA 3TVKA 4DL4A 2OPQB 1RTHB 2XI2A 2R8KA 2WCXA 1OS5A 2B5JA 2AGOA 5HROB 1N6QB 3T19A 3OHAA 4K4XA 3NAHA 4RZRA 2ASJA 3UPFA 4G1QB 3KJVB 2DPIA 1RT6B 5KT4A 4HYKA 1S97A 4FBUA 1J5OA 1TV6A 4LQ3A 2AX1A 2OPRA 4DEZA 1R0AB 4FS2A 2IC3A 5DG9A 3LANA 4RNMA 2HNYA 2RF2A 3V4IA 2FVQA 5C24A 2FLPA 3QLHA 4NCGB 3DI6B 4NRUA 4FS1A 3PW7A 2JC1A 5HP1B 1HQUB 1S1TA 5J2MB 4IH7A 4ZPCA 3KMSA 3KHRA 2AU0A 2YNHB 2E9RX 4WZMA 2UVVA 2YNGB 3RAXA 3RB4A 3KK3A 3CWJA 1HNVA 4ED1A 4Q45A 2IJFA 1IKVB 2ILYA 5DGBA 1HQEA 3OL7A 1TL3B 2BQ3A 2IM3A 1T94A 3OSNA 2C22A 2HAIA 4Y2CA 1JLQB 2V9WA 4ECXA 3KHLA 3MEGA 2D3UA 3HVTB 2UUWA 3H59A 3JSMA 3DMJA 1UWBB 3ICLA 2VG6A 4RW6A 1S49A 1JKHB 1K1SA 4GC7A 4KO0A 1FK9B 2EC0A 4WE1B 2GIRA 2ASLA 4NLVA 3Q8SB 2VG5A 3H2LA 1LW2B 1HNIB 4WFYA 4MIAA 3PJWA 3DOKB 3GIIA 4IG0B 4DG1B 3DRRA 3RB6A 2FLNA 2WTFA 4J9NA 4NLGA 2YKMA 4WYLA 2ASDA 2XGPA 4F4WA 4IFYB 4R0EA 3I5BA 4O4RA 1BQNA 4TQSA 1DLOB 3E01A 4ZHRB 1N5YB 2IA6A 4RW7B 1C1CB 3H40A 4I7FB 3H5YA 3KLVA 4URGA 3KMQA 1REVA 3QZ8A 4PQUB 3DLGA 3RBEA 4RW8B 1IKWB 5I3UB 2UVRA 4FBTA 4YMEA 1QE1A 2R8HA 2FLLA 3T5JA 5F9LA 4EBCA 3KLIA 3TQ1A 1VRTB 1T05A 5L1KA 4IFVB 2R2RA 5KFTA 5KFYA 4ED0A 1LWCA 5I42A 4R8UA 1TKTA 3PR5B 5CYQB 2BQRA 3GIJA 1LW0A 4YR0A 3QIPA 4ZP7A 1RTDA 4TY8A 4JUZA 1JLBB 3SI8A 1RT2B 4RNNA 1JLCA 5J2PB 3NAIA 3IGNA 1EP4A 3OL9A 4Q8FA 2YKNB 5EWFA 4ZVFA 4KKOB 4RU9A 4IRCA 5HBMB 1JLEA 1HMVB 1S9GB 1LWFB 2BANB 2YNIA 1IKYA 1DTQB 4RW4A 5HLFA 3T5KA 3CJ5A 2OPSA 1HPZA 1SUQB 1BQMB 1TL1B 2JEGA 4I2PA 5C5JA 3DYAA 3HKWA 4KFBA 1D0EA 1T3NA 1IM4A 4ZP9A 1S1UB 2W9BB 4IG3B 4ECVA 4TXSA 4EYIB 1EETB 2FVRA 1JLGB 4J9KA 1IKXB 5KT7A 2QV6A 5L1LA 3CDUA 5D3GA 4NZ0A 3FFIA 3DLKA 3T1AA 4Q44A 4J9LA 1RT4B 4ZVEA 1S6QB 4O44B 2BRKA 3N6MA 4WYWA 4NLYA 3PW5A 1RAJA 3T5HA 5KG7A 3H5UA 3TAMB 4ZPDA 5F8JA 3M8QA 5KFSA 4K4ZA 3IG1B 3H5SA 5J2NA 1XR7A 4ZMMA 3I0RA 3FSIA 4H4OB 4KV8B 4ZP6A 2FVPA 1C0UA 1U09A 4ED7A 1VRUB 3EPIA 1RYSA 2B6AB 1C1BB 5KFKA 3G86A 1GX5A 5KFAA 4O3NA 4WFZA 4GC6A 3ITHA 2VG7B 1S1XA 1TVRA 2IAJB 4LSNA 1SH3A 4QPXA 5DLGA 4U6PA 4K4TA 3GV8B 2WONA 2FJXA 3C6UB 3LALA 3RB0A 1RT1B 4H4MB 5JXSA 3LP0B 4DL7A 5DLFA 1ZTWA 4MK9A 3MECB 3BQ2A 2OH2A 3BSNA 1JXLA 1FKPB 3KLGA 3QGGA 5F9NA 4JV2A 3T5LA 4I2QB 4K4WA 2B5JB 5KFIA 3BGRA 1KLMA 5T14A 1TKXA 4ID5A 4R5PB 4ECQA 3GIMA 3HVAA 4NLQA 4K4YA 1LWEA 5K14A 4MFBA 2HWHA 2IJNA 3BQ1A 1DTTA 1SH2A 4IDKA 3DM2A 4TY9A 4TN2A 3V6DB 5KFXA 1S0OA 3KK1A 3V4IB 4ECUA 4IRKA 1HARA 2OPQA 5J1EB 1RTHA 3RAQA 4XPEA 4WFXA 2RKIB 5HROA 4O3OA 1N6QA 3QYYA 3BSAA 2GIQA 4KB7A 3KLHB 3KJVA 1QAIA 1RT6A 2D41A 3QGIA 5KG6A 3IN5A 2B43A 5DQGA 3I0SB 4RNFA 1RT7B 2JLEA 3H4DA 1RT5B 1RTJA 2IM2A 1JIHA 3BSOA 1RA7A
chains in the Genus database with same CATH superfamily
1Y10A 2K7KA 3GP9A 2HFZA 4RKUC 2KU7A 4NCGA 1S7IA 2GQCA 3MR7A 3H42A 5GAGI 1UZHA 2ZHBA 4UQTA 1U2CA 1S1VB 2LP4A 1YBAA 4LMZA 4IQMA 3CNQP 2PD1A 4OZLA 3TVYA 4G6VB 3C2PA 4Y0FA 3FMWA 4DI6A 1C1CA 4YP3A 1N54B 5KFUA 1TK8A 4A48A 1FTRA 1IKYB 2ZOFA 4CYUA 3R7NB 2AEMA 1HWUA 4TLQA 3Q8UA 1JJ2R 1M0SA 2ZNZA 1LWFA 4F4AA 2GC8A 3QO9A 5IT4A 3WHIA 4ALZA 1BQMA 3OVBA 3ZZUA 3THTA 3THVA 1S1UA 4MKBA 4M95A 3ZC4A 1Q53A 3OXLA 3G8TA 1MU2B 5B7WA 4WZQA 3IR6B 1U02A 1UVJA 4YUDA 3QGHA 4H4OA 2XEXA 3UNYA 3QRPA 2NZ4A 3UDVA 3KK1B 2HG4A 4CLLA 2BKNA 1VRQC 2HRUA 2ZJPQ 1XK8A 2DEJA 2AYBA 3NL0A 3JS9A 3CJ8A 1P9YA 4KYZA 4RWWA 3MMAA 4HH0A 1XN9A 5FD1A 2ALYB 4HT5A 4K50A 4ZCIA 1TU0B 3DHWC 2QA2A 2V4QA 1R3NA 4Y2AA 2JOQA 1UWBA 1KEKA 1DAXA 1XQIA 4OZ2A 3LPYA 3IWLA 3W5ZA 3RRKA 2DVIA 5A8KA 4EBEA 1QAJA 1U25A 2J7WA 2YQ1A 4K0KF 1U1NA 4PUOA 5GAEI 7FDRA 2VF3A 4JI0F 2ZH9A 4OV6A 3M9OB 3EDQB 2HQDA 2BOAA 1BC6A 4G65A 4DQIA 3U02A 3VGUA 4HHHA 5HQ8A 2MGZA 2I2YA 3DLKB 3CD6S 1VQ8S 2AGQA 2G1DA 4UF4A 1CJVB 4USMA 2NSBA 4LF6J 1HHQA 5KFEA 3HK2A 4LF2A 3M8QB 2R2TA 3A13A 2YH0A 4NLXA 4DV7F 3UVJB 2QA4G 2V9KA 2UU9F 3DLBA 3K58A 3OL8A 2Y8WA 3D6HB 3AJ2A 2Y1RI 1BD6A 1QTMA 1KWMA 3MMBA 2CQ1A 4AQYF 3POTA 4YB5A 2M5YA 1UL3A 3LP0A 4CTAA 1N36F 1IWGA 2PMHA 5KT4A 1FX4A 4CT8A 2OPRA 4HR2A 2HNYA 1IJEB 3QRRA 2G4BA 3KMSA 4LRBA 3NS5A 2BQ3A 1VJWA 1Q7YT 4DR1J 2V2VA 1SXLA 4DV6J 3DFEA 3RBXA 1UW9A 1UJ5A 3CE8A 1RI7A 3D66A 2YH1A 4OX8A 5LJ3Y 3DU5A 1DRZA 3M8SA 2J0SD 2XMWA 4U7UD 3KMQA 2FLLA 3KLIA 2HBZB 3R5AA 3M6XA 3PR5B 4AD6A 4TY8A 5J2PB 1IBCB 1EP4A 2MJNA 3R9LA 1HI8A 1JLEA 2BANB 1DTQB 4DV2F 1NHKL 2CFXA 1X4EA 1WG1A 1VBZA 4KT0C 3G8QA 3X3UA 2XS5A 2OEJA 3PTWA 1OSDA 3PW5A 4RBTA 3FEXB 3AQOA 1VFJA 5K9FA 1KQFB 4LR7A 5HMXA 3QT7A 3FSIA 4ZP6A 2PC6A 3RRGA 1SIZA 1D8ZA 3BO2A 4LSNA 3L4BC 4U6PA 4QPXA 4DS5A 4KH0B 2ZH2A 2CRLA 3IR7B 2KH9A 3PYGA 5AT1B 2W4DA 4DR2F 1RWWB 3V6DB 3DU6A 1PGZA 4DLEA 1TFWA 4XPEA 1HBOA 1NSPA 4KTQA 2DH8A 1MMDA 4B3MJ 3KJVA 1MWYA 4FF1A 4HHJA 1ZM4A 1YG0A 3BSOA 1K47A 1URNA 4ELTA 2XMMA 1VIXA 3AAWB 4E8UA 1W2IA 3D6TB 3MM7B 2C42A 1AW0A 1JX4A 3GR1A 3UCGA 1S0NA 5D0RA 1F1BB 2M8DB 1XNRF 1WG5A 3AH6A 1JKHA 1B70B 4J9MA 5K20B 2LA6A 4C11B 1RHQB 4M5MA 2J9DA 3TJ9A 5EWEA 4IFYA 3PX4A 1ZOTA 4PYAA 2LEAA 4DL3A 2KVIA 2DGSA 2B7CB 4IYQA 2XO6A 2YWKA 3D68A 1KVKA 3FBCA 1ZZNA 4XTTA 4ZN1A 3MMCB 5KT5A 3HHLD 1B3TA 4HACB 2VB6A 3SV3A 1I5OB 1YHQS 3S6EA 5KG2A 5H9FJ 2E29A 4NZ6A 2GMJA 4ZLNA 3IS9B 1KTVA 4CH0S 3T1YF 4ERDA 2VA3A 4PAAA 3RB3A 1S1XB 1RTIA 4EYHB 3TZZA 4B3TJ 4UUXA 5EUHA 4XO0A 1RT3A 4NLPA 4I0WA 2JZ5A 5CXTA 1FESA 2DEIA 5A0YB 3PFOA 4XDCA 4H4MA 4B9SA 1NPPA 4HVZA 3PEJA 5SUHA 2H5EA 1U8WA 3DXBA 2JLFA 4IO1A 5C2GA 2MMYA 3UD3P 3FDSA 2XCAA 1P9QC 5ETOA 1RLCL 2CJ9A 3PKMA 4P7VA 1K73T 1RT7A 4OQJA 2Z2LA 4X4QA 2CPZA 3LP1A 2IY5B 2RILA 4ZPAA 2W8LA 3B4DA 4FDFA 2LXIA 4F04B 3CC4S 4IUFA 3SBMA 1VJQA 3B4MA 3CCQS 3H2VE 2MKHA 2VONA 4F4XA 5E33A 1LWCB 5A8WB 1KDNA 2AJFE 4QYZK 2E5JA 4YDXA 1RBAA 5KFFA 4ZJLA 3UO0A 4IQXA 2W9CB 4QWBA 1U2FA 3HXMA 4O3RA 4JV5J 4JOUA 3NRBA 3FFIB 1U1QA 5ETQA 1KP6A 4M5DB 3SFUA 2XNRA 4OJ3A 3AOAA 1JLGA 2YNFA 3DLEA 5KT6A 3TW0A 1S4FA 3TAMA 4OV1A 1MMNA 2IVMA 4JI1J 4ZLLA 4LQ9A 4B08A 4FYWB 3DOLB 3MTKA 1QUVA 2PO4A 4DCPB 5HVHA 2FJBB 2VQEJ 2H1YA 3GIRA 4C6AA 4C4WA 2K7JA 1B64A 3LANA 2Y3YA 1FERA 2IRXA 1SJQA 4N8NA 2MQ8A 3HFZB 2Y1LB 1ITPA 2K1RB 2R7XA 1XMQJ 1TMMA 4QJVA 1Y0HA 3K59A 3C14B 2JL9A 5HAOA 4OHWA 1QAXA 4CLKA 1TMJA 1EIYB 3DOKB 1H38A 1MWQA 1R6YA 4JI7J 4DHVA 1ZA1B 3W5YA 4C98A 4DFPA 2F8MA 3IA0A 3C15A 2BXJA 3HO1A 4QYRA 1VCTA 3SI8A 1RAIB 3PIOQ 4HI2A 4KKOB 3K0JA 1IKYA 1WOSA 2Z2ZA 2BDPA 2W9BB 1F3VA 3P3DA 2P2CB 4NPOA 3A8IA 5HO4A 3PXGa 3QBCA 2CZVC 2WVBA 5E3QA 2FDNA 1GK8A 3H8YA 1FJEB 1IQZA 3H5SA 3OUYA 3KG0A 1WJ9A 3ITHA 2UVWA 4Q2MA 1S76D 1RT1B 2DITA 3FCWA 5AE1A 2OH2A 5DZ6A 9ATCB 5T7LB 2LKZA 2IJNA 4BWJA 3VAHA 3DM2A 4TN2A 3KK1A 2KKHA 3OTOF 3CCUS 3M8WA 2D41A 3QSYB 4ZJOA 3HP6A 4AYBD 4Y2MA 3MEGB 1NO8A 1K1QA 1HBNB 4A46A 2RH3A 1FKOB 4AL6A 5DDOC 2QE5A 3T9NA 5EHHA 1FRIA 3I56S 4P2XA 1T9YA 3PX6A 3Q83A 1BQNB 5F41A 4ZIVA 1KVJA 2R8IA 3OJSA 1X4DA 2LQBA 1NK4A 5J2QB 2A2DA 2CG4A 4DPOA 2F4VJ 1NPRA 2YBVA 3BYPA 3MPWA 1F5AA 4X4PA 2HMIB 4FF2A 1N5QA 1N48A 4C3MA 4UW2A 2QMWA 2L08A 2FB0A 1EJ7L 1XNQF 3OLAA 3UVJA 3W60A 3QNWB 3BN4A 3D3BJ 2UUBF 2E1AA 4DDFA 2DR7A 3G8SA 3J7Z5 4I69A 2QIFA 1BY9A 1YZ6A 4ED2A 3ONQA 4JI2J 3R5GA 4KV8A 2NS1B 1H3DA 2MLXA 1MW7A 3I32A 2CJAA 3W2WB 6FDRA 3NOGA 3QLHB 1U24A 1S9FA 4WIIA 1SPBP 2W2MP 2MYFA 1NBEB 3IAS9 4H4KC 2GHVC 1N4LA 4NYOA 2BJ7A 4DPTA 5DM7Q 3QATA 5L38A 2AZ1A 2QFJA 2VG6B 4I4BA 2V4RA 2GMLA 4JV0A 4MH8A 3MHYA 2ALZA 3T6JA 5BXIA 3HF5A 4O4GA 4LF8J 3MAHA 4QZVB 4QW8A 4KGKA 1M1HA 4X4SA 2ROGA 3GSDA 3QSIA 1CJKB 2YNIB 3KTQA 2VPZB 5KFZA 2M3DA 3BREA 2BE2B 1AB8A 3N4WA 1NM2A 1SJFA 3R5DA 4C3LA 5DO2A 4BC7A 3RBDA 3SCKE 2AKWB 4PABA 4B9LA 4UOHA 1HNXJ 1ZTTA 1KRPA 5C25A 2V69A 5HVFA 2VV5A 1UVMA 1O8BA 3U27A 3PNIA 1S9EA 2FY1A 4WPAA 5HK4A 4Q43A 1F5CA 3O6QA 1N56A 3PR4A 4LF4F 2DRBA 1TELA 2GS8A 4WXOA 1YJ7A 1GXUA 5CYMA 3TVKA 2XYHB 3RAMA 2Q3PA 3RG6A 4DEZA 2W2OP 3OD2A 4V1Ak 5DG9A 3W65A 2FLPA 3MAQA 4P2FA 5LJ5Y 5IT9Y 3PW7A 2X7IA 3IM8A 2AU0A 2POKA 2ZZTA 4JI8J 3KK3A 2NXJA 3OL7A 1HQEA 4LJMA 1N33J 3ADAC 2WVFA 1YWXA 3RBZA 2D3UA 3Q24A 2CWXA 4KHPJ 3MM5B 4P52A 5BR8J 2HYIB 2HRYA 2KZMA 1BHNA 5GVQA 3EGVA 3Q86A 4C11A 2AMCB 1UVNA 1XTZA 3OV7A 1TL7A 5I3UB 4HDHA 3K5OA 5KFYA 1LK5A 1R8CA 3CCWA 1V3ZA 1VR6A 2E7WA 1TKTA 4O0IA 3ZZOA 1JLBB 1QSYA 1E6YA 5IM0B 4ZS6A 2B8PA 2VBXA 4HDGA 3M8YA 4DUYF 1SUQB 1GNKA 4I2PA 1AZSA 3DYAA 3HKWA 4WK1A 3OR2A 3PY8A 3OBIA 2BJ1A 1TK5A 1IVZA 2CG8A 2MZ1A 3UN5A 2AJ1A 1NDLA 2AHOB 1PJ5A 1UAWA 2UXDJ 2VHGA 2FVPA 4OIXA 2B6AB 2UXBJ 2VG7B 1S1XA 1FRLA 2A18A 2C2OB 3C6UB 1XMOJ 4PQAA 5DLFA 2KG1A 5FLXU 2KYZA 3K17A 1FNOA 2RHSB 1R8BA 4LFCF 2V94A 3HT3A 4IDKA 2KXFA 3B8HA 2Q1LA 2RDDA 1WC6A 2EI5A 2KRRA 2IRUA 1JK9B 3TUIC 1RWVB 2EPIA 3CJKA 2WHOA 1P8GA 2FTRA 2XY5A 2BJ8A 1TL3A 3CJSA 4NLRA 1XWLA 2LU2A 2D9OA 4HLBA 3M2UA 3N6NA 3O5TB 4L76A 3EWGA 4A8YA 4Y34A 5H9EK 4M5LA 3TA0A 4B9TA 4I68A 2R2UA 2E5HA 3PHTA 1GEHA 3VAMA 4KJIA 5DQHA 2W4CA 3CJ4A 2HIQA 4RW9B 3L3CA 3UDCA 3K7RA 4O3QA 4ZHRA 1M5KC 3MOZA 1LEOA 2W9CA 4PWDB 5HLFB 1HWIA 3M9NB 4DXLA 3MEDB 1BLUA 5DGAA 3TO8A 3T41A 3M2RA 1HMVA 5KFXA 1Q78A 1TL1A 4DL5A 3HHLB 5K8NA 4FXVA 3MEEB 5A2QY 4DFKA 4B9MA 2VFUA 4ZVPB 3QWPA 2DNGA 4P71A 3HHLC 2LCWA 1JB0C 1WDTA 1ZS6A 2YKQA 2J0XA 3LQVA 3SCLE 1C1BA 2OSQA 3DOLA 4B3SF 1AUSL 3MR6A 4GKJF 4NLTA 3MECA 2R8GA 2F63A 1XJWB 2C2MB 3LPEA 4RJVA 3RJMB 2JEJA 3PYDA 3QFWA 4X66J 1WEXA 2HGMA 5I3QA 2GW8A 5IFMA 1CEZA 1X4BA 3VVUA 3S8SA 3LTOA 4I6AA 2FHKA 3C14A 5DJBA 1SKSA 3QZ7A 2ZJQQ 5HI7A 2XSFA 2RQKA 3QIPB 4Q8EA 2QA1A 1MNEA 3KG4A 1DZ5A 3KUHA 2CJXB 3BN7A 3KK2A 2RVJA 4HKQA 3GYXB 4KE5A 1S0VA 1EZZB 3KLEA 4C0OC 2PFFB 4C97A 2DIUA 2J76E 4KPYA 2IDLA 2W9BA 1NJZA 3OVAA 1RLDA 4NEYA 4Q2LA 2P8IA 1TUWA 3I5AA 3W62A 4JBCA 4J9SA 5HANA 3KLFA 2X51A 3CGIA 5AXLA 1XC9A 4ID5B 2R4FA 2JEIA 1RJJA 4Q0BA 4OYMA 2Z8QA 3NS6A 1U4BA 4LR9A 2Q6BA 1T9UA 2VC1A 2C2NA 2ZM6F 2V67A 1T9WA 4NL5A 3T19A 2XULA 3ZNJ1 4DU7A 2BM1A 4RNMA 3TOQA 3ZTPA 4DV1F 4A47A 2EEYA 4ZPCA 2LMIA 3A4TA 3D4JA 3HHDA 1W26A 2J7KA 2NLWA 4CP5A 2VQFF 1R8AA 3MEGA 3HVTB 2JH3A 3JSMA 2GVZB 2HVDA 1GMWD 5DZ7A 1M5OC 1FXDA 4NLVA 3ETOA 2HZCA 2WTFA 1Y3JA 1BQNA 1WOPA 2RB7A 3D1QA 1KC8T 1VQOS 4RW7B 3H5YA 3QZ8A 2QO3A 4CO0A 4MYUA 1VK3A 4PEOA 1VRTB 2F3JA 4PR6A 2EK1A 1E6VA 4ZP7A 4RNNA 4JYAF 1CC7A 3OVSA 4NOHA 3UR3C 4F25A 2AT1B 4ZVEA 3U1LA 4ER8A 3T5HA 1PYOB 3HCXA 2N7CA 2OKQA 3ZZPA 1M5VC 4ZMMA 5I3PA 4CQ1A 5AE3A 2NXCA 1RYSA 5KFKA 3PCOB 5DLGA 2MZSA 5D78A 4NCBA 3J80Y 3OR1A 1Z1ZA 5GMEA 3BSNA 3NWGA 3T5LA 5KFIA 1A9NB 3D67A 2DNKA 2Y9HA 4ECQA 2ROEA 1K0TA 2OGUA 3RZAA 5HMYA 2Z56B 1U1LA 3W2WA 1ULRA 1S0OA 3BGUA 4NXNF 3DLHA 1NJWA 4Y65A 3GJQB 3KLHB 3HULA 1S6OA 3QGIA 1RHJB 3BH7B 1UMJA 3BBCA 4X4RA 2F8EX 1HQUA 3O44A 2RT3A 1DHMA 1ZPWX 3CO9A 2FVCA 2W7PA 4LRAA 3ILLA 1IKVA 1G2EA 3GYGA 2KM8B 2WW4A 3HVWA 5U47A 2ZEJA 1YVFA 4DN9A 2JDJA 2W7OA 3LOUA 1Q8BA 2GHPA 3ZZZA 2GQ2A 4X62F 1IBKJ 2KM8C 3IRWP 3H2UB 1FD8A 3M8PB 5B08A 2V8HA 3U1MA 3BGOP 2MXYA 4OZJA 3HFKA 1HYSB 3I9ZA 5C42B 3CCVS 2JRSA 5HJXA 3N28A 4OYBA 2BE2A 4KSEB 1LFPA 4OJ1A 3G9CA 2HVEA 4EK2A 3AXKA 2CQ0A 2FC9A 3MCSA 2DCLA 3NOCA 1WHWA 2CJBA 1OYEA 3CSKA 4B9VA 4PCQA 3IG1A 2KFZA 2M52A 5EWGA 5KG5A 2YKOA 5LMUF 1RKIA 2C3UA 3RR8A 3LW5C 1N32J 1EQ0A 2D9PA 4WP3A 1NU4A 1VK8A 3ZTQA 1FKPA 2CDQA 3G4SS 3OTDA 1MN9A 4P73A 4J91A 4ZCMA 1JXVA 2ACYA 3NEKA 2EKYA 1FRMA 4F0KA 3QGPA 2OTLS 2E44A 2ZHAA 3UCZP 3CJ2A 4USUA 4ZKAA 2V2ZA 4BHQA 1APSA 3DN9A 4LFBJ 4MIBA 3OSPA 2JVOA 2VJVA 4N56A 5LMNF 1HBMB 2PI5A 2ZE2A 2D7SA 3PYEA 3MM5A 4CLTA 2V34A 2DBBA 2AYMA 1CSJA 1T05B 3TA1A 2CAJA 1DQ9A 2KXHA 1SJ3P 1LW0B 2QGFB 3MM6B 3OL6A 3HJFA 5I3UA 3BBBA 1WHXA 1NDCA 1Q79A 2CDRB 1QD1A 4B3OB 4JI6J 2HSEB 2NYHA 1SL0A 1Q0NA 4XAKA 3FNNA 8ATCB 2ZKUA 1SKRA 4OMFG 2UV8G 2YX7A 3PRDA 2HHPA 2P9GA 2YTCA 4WU2A 3TQEA 3UN2A 3I0RB 1UFKA 3ILOA 1HR0J 1YJTA 1H98A 2W2QP 2UVUA 1OYDA 3DOMA 1R6VA 1UW4A 4OJGA 4IR1A 1S0MA 1T03A 3DRSB 4PPDA 3G82B 3DLLQ 2ZJRQ 1VQPS 3C6UA 2WVDA 1RHRB 3A8KA 4CLZA 1F60B 4HL9A 1A7GE 5M2UA 1Q8KA 4FZVA 3TA2A 1SJRA 2B7BB 2G0JA 2WB1D 1RHMB 2VD3A 3DKDA 1KD1T 4OX9J 1FCAA 3DI6B 4D3HA 1H73A 3TEGA 3ZFVA 1Q16B 4QIGA 3EM1A 2E7VA 1UEKA 2MKCA 3G96A 1VLOA 5C7PA 1S7HA 1CJUB 1S49A 2DISA 4WE1B 1V3RA 4DX6A 2VG5A 2MZRA 2AD9A 3GCWP 3AD8C 1WC4A 3CT9A 5D4PA 2M8HA 2RNEA 4NLGA 2YKMA 4R0EA 3I5BA 1FNXH 1Y5NB 4JI4F 1DLOB 3X1LB 1NH7A 3TNVA 4URGA 2DGQA 4PQUB 1WC5A 5KFTA 3NGRA 1NJYA 2A3JA 1TTHB 1JLCA 1U8SA 3CXCR 2X1GA 3WIUA 4FYYB 4RW4A 5HLFA 3CJ5A 2AF6A 4JI3F 4ECVA 2C2KB 3TRGA 5L1LA 1KQKA 1RT4B 1S6QB 1GTEA 1RAJA 3I4PA 4NASA 1LQ9A 2KVQE 3EGNA 1T7PA 4K4ZA 1XR7A 2XBPA 3KXDA 4ED7A 4ZLPA 4WFZA 2OAUA 3I96A 2ZH6A 2WONA 2AIRB 4DN0A 1ZZFA 1JXLA 5BYRA 2EKNA 3MM9A 2JHEA 5T14A 3VGTA 4NLQA 2Q43A 4CLFA 4USIA 1S72S 4Z7YA 1WWHA 1RTHA 3RAQA 4LRCA 3J7ZT 4TU7A 1VQ4S 5LOQA 4BDPA 1FDDA 4Y2KA 2B43A 5DQGA 3I0SB 2UXCJ 1JIHA 4RUHA 3M6VA 1NK9A 4C8NA 2YNGA 4ECYA 4B3RJ 3M9MB 2N82B 5KFDA 2IHR1 2J9CA 3EUNA 1WEYA 3FCVA 2YPZA 5E0OA 5HMWA 1HNIA 2GAHC 1GXLA 4KGXB 2Y0SD 1X60A 3BO4A 3PW2A 4ZLJA 3UQSA 3K57A 5KFVA 2HHHF 3BJYA 4RW8A 1IKWA 1PC4A 4YR3A 3IRXB 3M05A 2RSQA 1RT2A 1F9FA 1H0HB 1X4AA 2CVEA 1WKJA 2ZVSA 5CYJA 2XSJA 4USVA 5B0CA 3LO3A 3T1HF 2RQ4A 5KFWA 3N6LA 4K2JA 1SC4B 1YLXA 2EC2A 1R31A 2AZ3A 1D9AA 4ANEA 2C2RA 4Z37A 3G6ES 2C2EA 3UDLA 5DG8A 2KT2A 4LF5J 1TFYA 4GKKF 5B0EA 5B0AA 4LF7J 1NZ8A 1VIOA 5MAOA 5KFBA 4KHMA 2IC3B 2LFVA 2AYEA 5C24B 1SH0A 4DZ6A 3E2EA 3KUEA 2KDOA 2JJ4D 4MAKA 2AGPA 3EVOA 2AWZA 2ROPA 1IUJA 3K5MA 1HNVB 2ZC3A 2FC8A 1Y11A 1RBOB 1WNEA 3KHHA 4N8OA 2VDIA 2UUCF 4FNIA 3C3LA 2CNNB 5D4NA 2ZUAA 3PM9A 1RAEB 4ZVHA 2BR0A 2NZCA 2JX2A 4DZDA 1REVB 4NLWA 1NRKA 4N7TA 2BRLA 2UZAA 1SQGA 2DO0A 2GX8A 2V4JA 2GVDA 5IZHA 2YX1A 2VFVA 2DNYA 2HEKA 3P96A 1HPZB 1LOUA 2NR0A 3U1NA 4QWAA 2HHVA 1B7FA 4N5SA 3MPVA 4YDDB 2IVFB 2CZ4A 2UUTA 2XWXA 2L9WA 2LXUA 1UJ6A 2RE1A 5J2NB 4G3IA 1FEHA 3EICA 1RBLA 3PW0A 5IWAJ 1SL2A 2HNZA 4F3MA 1CLFA 4PXBA 3NGTA 1H72C 1D9FA 1S1WA 2ZZNA 2E1MC 1NKEA 1H6KX 1YQHA 4QWEA 1YTYA 1WD6A 3GONA 2YKPA 2MQNA 4DV0F 1WEZA 2WCXA 3BGLA 4ES1A 3RW7A 3NAHA 3EDRB 1RT6B 2E66A 1M90T 1QSSA 2QEXS 4FS2A 3QPIA 3S01A 2FVQA 3QAUA 4AL5A 2K2PA 5F0WA 4NRUA 5HP1B 3MM8B 1SC3B 3CDBA 3I87A 5IT0A 3VALA 4QYZJ 4DPYA 4ECXA 3EJMA 3MURP 1CJTB 5IS2A 4DR7J 4X4TA 1J27A 2O01C 1DY3A 3PJWA 3EZ5A 5DS7A 1XBWA 3VHQA 3EE3A 3CCES 2JFDA 2NREA 2U2FA 1Y00A 3FMBA 5F9LA 2XLKA 1KNZA 4X84A 2CPDA 4J5OA 2CQGA 1FJGJ 4YR0A 4R25A 4RBVA 1S77D 3OTCA 2OPSA 4RR5A 4KFBA 1VQ6S 2VASA 1WHYA 2FVRA 3GG0A 1UJ4A 4NI2B 4J9KA 1IBMJ 2FIUA 4NLYA 3W66A 1QLNA 3H5UA 5F3TA 5F8JA 1AFJA 3BGFA 2F65A 2NPFA 4DMZA 1SH3A 3PRBA 1HNZF 1OWXA 2K06A 3QGGA 1RK8A 3C19A 2IMOA 3BGRA 1KLMA 4EMDA 4MFBA 3ET6B 1HIYA 4KGZB 3K5NA 1C4AA 2C2ZB 2E1CA 4WFXA 1IBLF 2YQ0A 3R5BA 3H4DA 4MT1A 2H51B 4PYDA 1G4CA 2V2KA 4DV4J 1FHTA 2VC0A 1IXKA 1UA1A 2DGTA 2QSFA 1HW8A 4H54A 2QT7A 5KG3A 2COLA 1HBUA 2PMZD 3R8YA 4ED5A 5F8LA 1W2BR 1M5PC 1GT8A 3AY0A 1WTFA 3LP2B 2OHDA 1VYAA 1YX2A 5KT2A 1KFSA 3Q2SC 1LW2A 3H90A 3NBPB 4U7CA 3M1VA 5I42B 3CCTA 2HIYA 4PG4A 2PEBA 4DU8A 2VUGA 1SVDA 3NXZA 3ZZYA 1N5TA 5K8OA 3GIKA 3CCRS 3C16A 3KG1A 1N34J 1WG4A 4B3OA 3BEGB 3BR9A 1IR0A 2OEKA 4X4UA 3A3NB 3GTYX 1KN6A 2J8SA 2LEBA 4WJBA 3TX0A 1S9GA 2E5LF 4RBUA 3SDEB 1AT1B 2XWYA 3TYTA 1IKXA 4OFZA 1FFGB 3KDOA 2GIFA 1HD0A 3L09A 4F36A 3HHKA 2DGWA 3DRSA 3W2VA 4QR1A 3HSZA 5JVHQ 2W8KA 3EYZA 1WOOA 2DR9A 2RF2B 1FDBA 4LR8A 4MKAA 3QT5A 3JSRA 3L9ZA 5EDWA 5KFQA 3AXMA 5F8IA 3A8JA 5KT3A 2HKEA 3PIPQ 2ZWOA 4IH6A 2ZUGA 5F8HA 2HPUA 4LRDA 2RKIA 2J9DE 4HTIA 5CABA 1N0UA 4OZNA 2R7RA 4W92B 5LXYA 4KO0B 3V2UC 2BACA 2HW3A 3D9BA 5LSLA 3R3TA 1M1KT 4ZP8A 2QLBB 1TP7A 2ZITA 3IMQJ 1F6TA 3V6KA 1NNDA 1VQ5S 2I5JA 4MTPA 4OX6A 3C6TA 4WK3A 1DLOA 1FDNA 2FJDB 3T9ZA 3R27A 2IMWP 2GCFA 4DPWA 2J6TA 4M63A 1RWXB 4DUZF 2R7TA 4CLYA 4F4ZA 3D28A 1GXTA 1B4SA 1RWPB 2DO4A 2XQCA 3R6GB 3BYRA 3V81A 3OFEA 1X4CA 2OFHX 2J6SA 1UPMB 2WK4A 2R3VA 1RT4A 5KFPA 4WFBQ 4X64F 2BW7A 1C0TA 3BBFA 2GO8A 3DDKA 3PEHA 1XIQA 4DV5F 2L9DA 4OYZA 3P4UB 5L1JA 2CPYA 5K14B 2ILZA 1BMQB 1R0BG 4NXMF 2OPQB 1JXEA 5HROB 1Q4RA 4LUBA 4LIWA 2ZBPA 3J7A1 3IM9A 4K0KJ 3O2IA 2CWKA 2P6TA 1YRTA 4JI0J 1S79A 2FY8A 1S12A 1FDAA 1WC1A 1PJ6A 2HRTA 3CWJA 5KTQA 2BJDA 2ILYA 2GV1A 3OFFA 2ZBRA 3CJRA 1JLQB 3AD9C 4A8MP 2PMWA 1U1RA 4LVNP 3GPAA 4PG7A 1I94F 4O0NA 4RW6A 3V5RA 6FD1A 1NK7A 1I51B 4DV7J 1VI7A 2KRBA 2NUUG 3GIIA 4Z2XA 4IG0B 2UU9J 1Y3KA 3AD7C 4OYXA 2EFQA 2XGPA 2CQ3A 1WF2A 2XHCA 1X5OA 4RU2A 3DLGA 2CQIA 3A8EA 4AQYJ 4L74A 3JAMU 2PIIA 4QQBA 5CYQB 3HD2A 2RU9A 1N36J 4U9RA 4ILRA 4IRCA 3EGWB 2LEPA 1K9MT 4GRSA 1GMVA 4ZP9A 3C46A 4UY85 3RGIA 1TKDA 1J5EF 5E3AA 4YB7A 3PKYA 2RQMA 1RWOB 1NSAA 2B9WA 3EVWA 1XEZA 2AYGA 4JI5F 1TVRA 3PDNA 2DGVA 2FJXA 3GFXA 1ROFA 4MK9A 1Q8IA 3I4HX 4OI0A 4I2QB 2EG2A 4R5PB 3WX8A 5E2QA 2VBZA 4FPRA 5IC6B 4PG8A 4TY9A 1K44A 5D77A 1HARA 2MKYA 2A1BA 1KLNA 1MROA 2LU1A 2CQ2A 4OZ0A 4A8SA 1PAEX 1RT5B 2OELA 2DHAA 2WVEA 4DV2J 3KOAA 2L9NA 4CM2A 5J2MA 1ZAVA 3FGVA 2HQGA 2KZZA 5HQMA 1RA6A 3LGMA 4W4MA 2RIJA 4W98A 4ENOA 3DRRB 1JLFB 4L6V3 3BDEA 4FNHA 5ETRA 4DWIA 3KJNB 1VMBA 5IQQA 2ACMA 1N5YA 3I5CA 4I7FA 2OD6A 2VIHA 4DX5A 2QTWA 3G6XA 2C3YA 2HLTA 1WC3A 3GILA 4DR2J 2BKPA 5HQLA 3TJ8A 3NLCA 2OI2A 1RWNB 3FK4A 1K0VA 4C7QA 3E3XA 4P2SA 1S6PB 3H98A 4ZPBA 2WVCA 5LSRA 4FYXB 4QIEA 4CRJA 3FBBA 3FQLA 1JLAB 2IM0A 1V3SA 4U67Q 2MJUA 1EETA 2G0IA 1YK9A 5JUMA 3DRXA 4O44A 1CC8A 3VGSA 5I4MA 1V9OA 5LT5A 4X4OA 2O66A 3PJ9A 3KLGB 2LQJA 1TKXB 1LFWA 1NK8A 1VRUA 1XNRJ 2FLOA 2J8AA 1WORA 1QUPA 2IAJA 2EG1A 1KR4A 2HHSA 3IBFB 2PSZA 2HGLA 2HHUA 5H1SV 4F3QA 2GQQA 5K8PA 2B4UA 4O3PA 2HWIA 5A8RA 5H9EJ 1JJ4A 4C8OA 1SC6A 4DUTA 1N52B 1VISA 2VKZG 4GVBA 5HVGA 3A1YG 1VS3A 1EX8A 4LSLA 1IN0A 2VDHA 2RQCA 2RDIA 3T1YJ 2RJZA 2XZTB 1NSKL 2DY1A 3FC9A 1QE1B 4J9OA 1GMWA 3HHNB 2YWFA 5FDLB 2QX0A 3BB5A 4DR3F 4M5KA 5G0RA 3MAAA 2CYYA 3LAKA 2H48B 4E0DA 5CH7B 2G2YA 1FVQA 1UFWA 1UVKA 2KJVA 4QIFA 3Q8PB 1VQSA 3TZXA 3DGPB 1PIEA 1U1OA 4DSEA 4EU0A 4PKDB 4ZPWR 3C66A 4WWSA 4NI2A 3LGNA 5D15A 4P72A 3RYLA 2I1RA 4M94A 3PJXA 2IDEA 2ASYA 3BM7A 1JWWA 3P5BP 3M30B 3MTJA 2Z57B 2X1AA 3UI3A 4ED4A 1DTTB 1R27B 3GFZA 4ECZA 5IOLA 4ELVA 4CO3A 4ECTA 2VA2A 3WC0A 2W2PP 3TWZA 1RAGB 2HFUA 2XI2A 2AGOA 2MHEA 4QU7A 1J5OA 1TV6A 3ET6A 2DYAA 2AW0A 1VQNS 5K5MA 1KQGB 4NCGB 4DCJB 4LBPA 1S1TA 1WKLA 3RAXA 4ED1A 4YOEA 3FVYA 5M2RA 3NMRA 5BJRA 1QDUB 2BJEA 5RUBA 2ASLA 4LIRA 4X65F 2I0XA 2W7AA 3HD1A 3UWTA 3E01A 1C1CB 2FD2A 1NAQA 4A8WA 1NK6A 4S0MA 2EFNA 4HHUA 4R0JA 2M0GB 5I42A 4R8UA 3GFHA 4JUZA 5ETPA 4DR4F 3NG8A 4W90B 4Q8FA 4ZVFA 2B8QA 1LWFB 1MN7A 1BQMB 3F44A 1S1UB 1JMTA 1FEEA 4F2SA 4FF4A 5D3GA 4MMOA 2L41A 4Q44A 4IOCQ 3SDEA 2NCKL 3M32A 1JNZB 4H4OB 4DBQA 5JMNA 1WC0A 2QYCA 3EPIA 2A2CA 4JB8B 2H3EB 3T6BA 5F9NA 4JV2A 1PYSB 3HVAA 2GZOA 3BQ1A 4L72B 3MMAB 3V4IB 5CHCB 4IRKA 3L7UA 2EVZA 1A6LA 2IIHA 1N6QA 3HMJG 2GGPA 3L7PA 4BBYA 4M5JA 3D0IE 2B56A 1FO1A 3O3LA 2A6MA 1I1GA 1YRUA 3WIVA 3BZQA 2IM1A 3DHXA 3DMJB 2YNHA 1JQGA 3JTPA 2MHNA 1S48A 4ZCLA 2U1AA 2NPIA 2G2OA 1SL1A 3AOBA 5A8KB 5MLCV 3GV5B 3PACA 5ETSA 3J81Y 4PUOB 2XLIA 4DG1A 3ENQA 2O5DA 4ATNA 5GMDA 3W9JA 1M1GA 2MGZB 2DPJA 3TUZC 1PG5B 3CEDA 2H65B 1NHVA 4IFVA 2FJWA 3UR0A 3OTOJ 1NDPA 2UUAF 2YKNA 2DNQA 1K8AT 3P45B 4K2XA 3FEYB 1TUVA 1NH8A 4FPIA 1X9SA 3ZZRA 3UD4P 4DQPA 4NYZA 3MMBB 4AFFA 4CT9A 1UVLA 1EHWA 4DSJA 3NKYA 3SEOA 4CTAB 5D0GA 3OPKA 2OPRB 1LWEB 4DR6F 4ZPTR 4LF9F 2HNYB 5B09A 1FFSB 5D0EA 4AT1B 1BWVA 2HWTA 1TR0A 1WF1A 1QY7A 2DHGA 3BSCA 3QQCD 1SCJB 1RTJB 3ZO7A 3D0HE 2IPOB 5A6PA 5J1EA 4URSA 3A12A 5HSPA 4B9UA 4RNOA 1WI8A 2F9DA 1JLQA 3H7HB 3H0PA 4CH1A 3JSBA 4EBDA 1O5JA 1OPZA 1XNQJ 2LQ8A 2PGCA 5AXMA 1B99A 1XERA 1S1VA 3KLIB 1VHFA 2UUBJ 5KG4A 3LWMA 4YY3F 1UPPA 4TY8B 4F0MA 1EP4B 5KOWA 4WP8A 1JLEB 3MWBA 2D1CA 1FRXA 4TQRA 4UTGA 5K8MA 4C0BA 3QJPA 3SCIE 4FXDA 5IV4A 3NNAA 4YR2A 1ZPVA 1GX6A 4MIWA 1W25A 4NWBA 4ECSA 2AQ4A 3J81j 4DF4A 2XI3A 1CULB 2OPPB 4RUBA 3SMZA 4UOGA 1GQEA 2FZKB 5L9XA 2R42A 2DNMA 2XMKA 4TYBA 3WX4A 2JNJA 1BWEA 1MU2A 4RX6A 1HHSA 2M70A 3FZ2A 1VQLS 4DL4A 2LQ5A 2HBYB 5G4DA 2QG9B 1HBOB 3K8VA 5E7OB 3CCZA 1OQ6A 3KJVB 3GZ7A 1RSCA 3TJAA 1RWKB 4D3GA 2MQMA 4Q45A 2A6OA 1FRHA 2EXUA 1MG7A 2FGCA 1O51A 2VFTA 5AJ3F 1JKHB 2EC0A 4M1KA 1RTZA 5KAKA 3DRRA 1HI0P 1MSWD 4IFYB 4O4RA 2IA6A 3TZWA 4LF4J 1QVFR 3RBEA 3AB4B 3ZTSA 2FZGB 2K3KA 2I8EA 4WFNQ 1GH8A 4USWA 4DR5F 4DV3F 3SIPB 1PKUA 3DDNA 4YHHF 3BF4A 1AXQA 4N47A 1OSCA 2V6AA 2BBEA 2OIHA 4IG3B 4TXSA 3FSYA 1YIJS 1R89A 3DLKA 1HA1A 1SB6A 1CJVA 2W01A 1HW9A 2CJYB 7AT1B 5E5NA 3M8QA 1ZAXA 5J1PA 1X0PA 4LF1A 4LFAF 1VC5A 4L3KA 4K4TA 3MD3A 3CCSS 1FXLA 3LALA 4WF9Q 4H4MB 1ZTWA 2W1BA 4RWXA 3KLGA 2AJ4A 1TKXA 1U6FA 2HWHA 2HQIA 6AT1B 4DX7A 4Q5VA 3DDIA 1IWAA 4KH1B 1RT7B 4MJKA 1YBUA 1OIAA 3B54A 4DUYJ 3LP1B 2FHOB 4MKVA 3D7SB 2ZBIA 3MUMP 2VH7A 2WZ1A 5EX0A 1HKAA 3M2VB 4QW9A 1LKZA 3GFYA 2MQQA 1X31C 1QVGR 2C1EB 3QJJA 2ZH7A 1OMSA 2DGOA 3M6WA 3OHBA 2WSCC 5EGYA 3KYLA 3WBZA 3FKBA 3LH2S 4ECWA 1UKUA 3Q8YA 5FDLA 4RPFA 2QJ3A 4BCAA 1RTDB 2LDIA 2H54B 3WDOA 3NNHA 4LFCJ 4ZVTB 2YXLA 4BLGA 1B0TA 3ZXWA 3WZ0A 4IOBA 2YNFB 3DLEB 5J2PA 2DR8A 3DGVA 2BANA 2M9KA 1DTQA 3W8GA 5J1NA 2RUGA 2XO7A 1F5BA 3SSSA 5DDPC 1IJFB 2CVIA 4F67A 1SJ4P 4MKYA 2PA3A 3L7OA 1PBUA 2GNKA 4EO6A 3EGZA 1RAOA 2PE8A 4M8LA 2A0FB 2ZH4A 4C8MA 4KC5A 4DF8A 5BYSA 1PAUB 4NLUA 3PHEA 3NCQA 2G13A 4EEYA 2UV8A 3V6DA 1I6JA 5KFRA 2XTJP 2X1BA 4K4VA 2HNDB 2OEMA 3DXSX 2DCUB 8AT1B 4DL6A 1U7LA 4K8RA 1S10A 1U0HB 1DURA 3MMJA 2HBRB 3MM7A 1TKZB 2CQ4A 2IA0A 3NGUA 2ZD1B 3C15B 2OD4A 2AX0A 2N7YA 1ZH5A 4GO5X 2CQCA 4NX9A 3GJTB 3SQGB 4DSIA 1UFLA 4ZA1A 4B3SJ 1RAHB 3I55S 4GKJJ 3CD7A 4OL8A 1LWXA 2HFOA 4C8LA 1NMEB 3W9IA 2KHCA 4J7CA 5KG1A 1T9TA 3OUYB 4O3SA 3RTVA 3MMCA 2D3O1 3CVKA 3US5A 4HACA 4K4SA 3NGSA 3ITHB 2GFFA 2CKWA 2QL5B 1U6ZA 3IS9A 2HZAA 3J7YU 2D3ZA 1PCAA 3Q89A 4UY8T 3IO1A 4FN5A 3DM2B 1X5SA 3BKUA 1DJ0A 1YI2S 2DNNA 2B9YA 1L3SA 1SI9A 3HDSA 2G9OA 4FP9A 4UOFA 2R7SA 4Q7AA 2KFYA 5A0YA 1WSVA 3AJDA 4C8ZA 3V4IA 2ABYA 2XZWA 2YVSA 3KHRA 3MUVP 1HI1A 2LLZA 1YSJA 3HSGA 2FHJD 2MKKA 2V9WA 5CA5A 3J7AN 3TVZA 1U6BA 3DMJA 2E1RA 1K1SA 1C4CA 2GIRA 1Y4ZB 3TZYA 2RS8A 2SXLA 4UT4A 4J90A 5DDRC 1RB0A 2ERRA 4WYLA 4EGLA 1RXOB 4QBUA 5CZXA 3N0VA 1R8PA 4WP9A 4ZVQB 3HM9A 4ED0A 1LWCA 5A8WA 2ZM6J 1H2TZ 2BQRA 2PA8D 3OL9A 1HNWF 1PC5A 5HBMB 2JEGA 1D0EA 2EWHA 4HEA9 4DV1J 5KT7A 3FFIA 3RU0A 2DH7A 2BRKA 3FJ2A 1CQMA 4M5DA 2VQFJ 2JFKA 4KV8B 4TVAB 5SZTA 1QJHA 1FJ7A 2BJ3A 5LL6d 2R7UA 4YFUA 3GIMA 3CB4A 1LWEA 2E7XA 2KXNB 3R1HA 2YWEA 3QYYA 2KYXA 1HWJA 4JYAJ 2LQ9A 1RTJA 4ZN3A 1F2HA 1BGXT 4QCLA 4QU6A 4RUCA 4O4GB 3NGDA 3DLJA 4ZDNA 2K1RA 3MF5A 4PXDA 1WUUA 1ZAWA 1Y7PA 4OZ5A 4DL0C 3PW4A 2WBMA 3M7VA 4IOAQ 1NJXA 2D3OR 3D6MB 5DG7A 4WIQA 2FQQB 2DXEA 1DFDA 1RACB 2J6UA 2VPXB 3THPA 3DOKA 3A3OB 3Q8QB 1CPZA 3AODA 3JB9k 3I6PA 1F9HA 4PZVA 2FGOA 3PO5A 1U1PA 4GO7X 4ES2A 1WDDA 2ZOGA 4KRWA 2V8VA 4OLOA 4NXNJ 3Q8VA 2E1PA 4BS2A 5C25B 2Y1JA 3ZTRA 4KKOA 4LRFA 3GMGA 2HVHA 2YWWA 4WCEQ 4CIOA 1S9EB 1AYEA 1CULA 2OPPA 3GG1A 5FJ4A 1PBAA 4QIVA 5DQIA 1LV5A 4DSKA 2DJWA 4HH1A 5CYMB 2DXFA 2OSRA 3G71S 2BEFA 2EBGA 2QZ8A 3BS9A 4TNOA 4X62J 3Q2TC 3H5XA 2CQBA 3ILIA 1RT1A 2WB4A 2OMLA 1FWKA 1F2GA 3TAQA 5T7LA 3KK3B 1HQEB 4LF6F 5CCMA 1G1XA 2H9ZA 4TU8A 2NUHA 4OLPA 1NKBA 4CWBA 2ATLA 4TLRA 3CJTA 4C0HA 2GA7A 3VAGA 2XCPA 2ATCB 1HBNA 2EW9A 2PEHA 2HZVA 1FKOA 1Q5VA 2RRAA 1TL7B 2WOMB 4OZ3A 3C8YA 3SSRA 3E51A 1RUSA 1SV5B 5L39A 2B9XA 1TKTB 1F3FA 5KFOA 1N0VC 4G1IA 1E6YB 2XMUA 5LMUJ 2KT3A 3KJFB 2XYGB 4ILLA 4P7TA 3UD5A 3AT1B 4I2PB 1AZSB 3DYAB 3OR2B 2WSFC 4WKRA 3GQCA 4NA1A 4NE9C 2XY6A 4DR1F 5J2QA 1OQ3A 1TL4A 4DV6F 3ISND 4A4JA 1YJUA 2NXUA 1WTBA 1ZM2A 5HJYA 4IG3A 2OUGA 2KL8A 2VPWB 1YJWS 2NSCA 2HMIA 1GTHA 5IT9U 5CCLA 1R8HA 4XIUA 5KFJA 4KQZA 2YQ3A 1V5VA 1VDHA 1UEVA 1VQ9S 3GJRB 4C2MA 5LMNJ 4K5SA 2FJVA 3OW2R 4IDKB 2KG0A 4DLGA 3BQ0A 2YWHA 3MGJA 2HS3A 4FF3A 2PDAA 4RZRA 4AXJA 1SC1B 2E5IA 3QAEA 4H4KA 4KGVB 2EBEA 1YKWA 3QMQA 3CJKB 3QLHA 2MY8A 2HURA 5DGBA 1TL3B 1CS4B 2CNOB 3M2UB 2YX4A 2HGNA 4F7VA 4USHA 2F40A 2VG6A 5E3RA 3TR5A 1U47A 3FEZA 5ITHA 4E2FB 1H7WA 3M2VA 1KSPA 3GCXP 4FVCA 4A8FA 3N79A 1YITS 1FVSA 2VOPA 2ADBA 4ZHRB 5E3PA 3KLVA 2F5GA 4YMEA 1B7YB 3TQ1A 2H5JB 1NUEA 4AXIA 3GIJA 4B3MF 2XLJA 1RTDA 4PG6A 5D4OA 1G7CB 3QT8A 3R5JB 3M2RB 2DHXA 4RU9A 1CJKA 1HMVB 2YNIA 2Y8YA 2FPHX 2RU3A 1TL1B 1B0PA 3W9HA 4YN3B 3TARA 2QV6A 3VAJA 5L8RC 4L75A 2QLWA 1Q86T 1JJCB 4MYTA 1C1BB 4NMXA 1HD1A 4DL7A 1KQSR 3MECB 2IVYA 4QR2A 4DPUA 4A8XA 4DOZA 4JI4J 2DNRA 2J9EA 3CW2C 2R7VA 1Q1KA 2XYPB 1FWLA 2N3LA 3T3FA 3R97A 1RA7A 5ETKA 4CDIA 3GJSB 2WAQD 3GLJA 4JI3J 1Z4UA 4MK8A 1D1UA 5FLXY 2HNDA 2Z4PA 8RUCA 4B3TF 3EZUA 1UEUA 4WTYA 3GV7B 4YQWA 1NHUA 1U0HA 2Z58B 1TKZA 1F0XA 2ZD1A 2V8PA 2BW2A 1M5SA 5A2QU 3KK2B 5ETTA 3FSXA 3ENWA 5ETMA 2VOOA 3KLEB 3SQGA 3SQOP 3N9UC 3W3SA 5DRKA 4C8YA 3QFHA 5LSOA 3OQ2A 2MLZA 1JLBA 5IM0A 5DM6Q 3CJ0A 2DT9A 3HPOA 4NLOA 1SUQA 2FJAB 3KLFB 3P8BB 1QSLA 3RUBL 1RHKB 3K5PA 4J9UE 4Q0BB 2P6SA 1YJNS 2GMHA 1KVIA 2HFVA 4OYOA 5F8MA 4CNYA 5GAHU 2CADA 3AA9A 3WQPA 2B6AA 3KDNA 1SIWB 2VG7A 1SQFA 3FCHA 3TAPA 4JV5F 3PYFA 2CZ9A 2LVWA 3AB2B 1U48A 3GR0A 4G1PA 1IM6A 2F9JA 4U95A 2IYGA 2HHHJ 4OHVA 4B9NA 3CULA 4J9PA 3JSMB 3LA0A 4KIAA 1IR1A 2ZHOA 3JYTB 1S6UA 3HJVA 1P1LA 3AQPA 2G2ZA 2VODA 1NSQA 1XR5A 1OO0B 4JI1F 4C3KA 4ECRA 1FFWB 3T1HJ 2BQUA 2VFRA 3OLBA 3VQTA 4ICLB 4AUKA 4XDDA 5KFNA 4URQU 2XS2A 1T9XA 1RDRA 2VQEF 1LXJA 1E6VB 3MR2A 4GKKJ 5KG0A 3NS7B 4JP8A 3G6VA 2QLJB 4RW9A 2N4CA 3HT0A 5LM7E 1P27B 2MZJA 1XMQF 2FJEB 2R2SA 5HBMA 4Y00A 4PWDA 2IFXA 4F2RA 5F0UA 3MEDA 2UUCJ 1KKHA 4DS4A 3CCLS 2K3IA 2ZDOA 2Z0GA 2W4PA 1X8DA 2JEFA 1OY6A 3HHLA 4JI7F 1U26A 3OR1B 3SFGA 2ZZMA 3MEEA 4OX7A 5B0DA 2N3OA 2B4PA 2NQPA 1YJVA 3BV8A 4K4XA 2O1PA 4ILMA 3UPFA 4G1QB 2DPIA 1YGYA 4DX8H 4YB6A 4NEZA 1Y5IB 2UP1A 1R0AB 4DCOB 2DK2A 3M6UA 4X4VA 7FD1A 5C2CA 1HQUB 2CPJA 2UVVA 2Q79A 1YRXA 2IJFA 1IKVB 3BH6B 3VVTA 1KBRA 3V4MA 2BM0A 1X5PA 3H59A 1VQMS 3MDFA 3BPDA 3CMQA 2MDAA 1U45A 3H2LA 3M8ZA 1I3OB 2QA4S 1X4GA 3VR1A 1RHUB 1A0OB 2M4MA 5A6WA 5CD4H 1TAQA 3NGKA 3BR8A 5THWA 2KHDA 2BABA 3QIPA 4DV0J 3IGNA 3HHEA 3J80U 1Z2LA 5EN1A 4J37A 1BE4A 3OTBA 2IJRA 1Q7LB 5JJBA 3NP5A 4EYIB 3MEKA 2MY7A 4RO0A 2GJFA 2DR6A 3T1AA 3MCOA 2C3MA 4EZ9A 3IG1B 2CQDA 2NXNA 3J7YI 1D3WA 1GX5A 4GC6A 5CZVA 2R7WA 1M5HA 3BQ2A 1FKPB 2LECA 1Q5YA 1FI4A 4ID5A 1XMBA 4U8YA 2F4VF 4ECUA 4XK8C 3BSAA 2GIQA 4NZ7A 3NY0A 4RNFA 2DIVA 4BC9A 1RYRA 2HBQB 2JSXA 4ZPVR 2ZE2B 3PZPA 4LVOP 5L1IA 2CIMA 2OMOA 2ZOMA 5HN0A 2PT0A 2HHQA 1RCOB 4QOTA 4JI2F 3HVTA 1MMLA 2GVZA 2GJIA 2CJQA 5KFHA 2ZNYA 2Q6CA 2JVRA 2WOMA 3D0GE 1D8YA 1PILA 2QL9B 3BKFA 2V50A 1SV5A 3IGVA 1R0CB 1HNZJ 2MEWA 3K8WA 1FTCA 4X2BA 4ES3A 4RW7A 5E3CA 4EO8A 2R9LA 1VRTA 4I1TA 3ENAA 4CLSA 1IBLJ 4CLUA 3DOMB 1BQXA 4PXCA 4OI6A 4CLPA 1KOHA 3LUYA 2Z30B 4LF8F 1FJCA 4F4YA 1T03B 4L3NA 4P75A 1Z2ZA 1DQAA 4CO2A 5ETNA 4E98A 1VGYA 2OJ3A 2L3MA 2XMVA 3DRYA 4M5GA 4UZBA 3RW6A 3QIDA 2V5HG 2PN6A 3HLUA 3SSQA 1TZ0A 2J5AA 1ICEB 5CD4A 5ETLA 3NMAA 2M7SA 1T0TV 2IBKA 1AFIA 2B4VA 1HNXF 2XZDB 1RWMB 4OYIA 3KLHA 4ED6A 3VV2B 2M2BA 2VG5B 2JWNA 1CS4A 3GE9A 3JXOA 4DL2A 1QTNB 2HK3A 2E5LJ 1O0PA 3PRVA 1D9DA 4IKAA 4JV1A 2YKMB 2YWGA 3Q23A 2QYGA 3DRPB 5DETA 4Z7CA 1EB0A 2RMLA 5IXUA 3QRQA 2RDJA 1H2VZ 2OP5A 1EARA 1FRKA 1WSRA 4OHZA 1JLCB 1GFWB 4Y28C 4IR9A 4RW4B 5GADU 3M8PA 4Y3CA 3MPDA 4JI8F 9RUBA 2BYCA 3IWNC 1NB7A 1N5SA 1HYSA 1N33F 5C42A 2M88A 2ZBQA 2DR5A 2ZVIA 3AJ1A 3VF0B 2DGXA 4QWDA 4KHPF 2VJUA 4YB1P 1WF0A 1VBYA 3R7SB 5BR8F 4ANCA 2WONB 4TYAA 3VAIA 4WTOB 1VBKA 2FZCB 3MM9B 3ISNC 3S1TA 5IQ6A 1ZBTA 1AUDA 3R5CA 1S57A 2XMTA 2EK6A 1RTHB 1NLKL 2FHMA 1Q81T 1OS5A 4LBHA 3GU0A 2EFVA 1NCLA 4LQ3A 2BV3A 3SCJE 1AROP 3KWMA 4GMKA 4DUZJ 2D74B 1NJIT 2MQLA 3OFGA 1EQMA 2QC3A 2YNGB 1FX2A 2C22A 2UXDF 2B9EA 1YDLA 2UXBF 2MQOA 4GC7A 4N41A 1FK9B 2E5GA 2XM3A 1XMOF 1AA1B 1HNIB 1R7IA 3OT9A 4MIAA 2CQHA 1OPIA 4J9NA 4X64J 2YY3A 3UFCX 2MZQA 1HBMA 4DV5J 3H25A 4UUWA 4RW8B 1IKWB 4FBTA 2J0WA 3GWCA 1T05A 2R2RA 3UW1A 4ZVOB 3BKTA 1FKAF 1LW0A 4NXMJ 2P9CA 3MM6A 2C3OA 1RT2B 3NAIA 5FIIA 5EWFA 2QFIA 1X4HA 4PG5A 3ULHA 2XSJB 2OFGX 5C5JA 2V8DA 1IM4A 2X3DA 3RRHA 1UZDA 3OXFA 1ELOA 1HHTP 3KJQB 3BPSP 3N6MA 2HVZA 2VBYA 3OJUA 4NA3A 1PYTA 4Y2IA 2DH9A 3I0RA 1I94J 2O3DA 1RE1B 3G86A 5E41A 2BZ2A 2DD8S 1NXIA 4FYVB 1EAYC 1FXRA 4PPZA 2BA9A 3CCJS 5H9FK 2FUG9 1EKSA 4HI1A 3R6LB 2CXEA 5AE2A 4K4YA 4ZOSA 3HSJA 3G82A 1SH2A 2ZWPA 4CO5A 2HVIA 4USKA 1MLAA 2AV5A 1SKUB 1SQEA 4O3OA 3VGVA 2XMAA 1NEEA 5KG6A 3IN5A 4EUVA 5B0BA 2DB1A 1SJ1A 2GHWA 2DY9A 3DI6A 3IR5B 2JLGA 2I38A 1CVJA 2K8GA 3JYTA 4F3OA 3GB0A 3UDEA 2XMJA 2QRRA 1J5EJ 2N4DA 2V4JB 2CPIA 2GVDB 4CO4A 3KHGA 1S4EA 1UCNA 1CJUA 3O8WA 4ZJQA 4L73A 4WE1A 3O1LA 3M8RA 4PWWA 1X7VA 4DSLA 4QWCA 4ICLA 1VC0A 4JI5J 2VU5A 3R1LA 3KNGA 4NLDA 3U7JA 2KJWA 1YZ7A 4PQUA 3D6FB 2KFNA 3JTOA 4QPTA 4IRDA 2ADCA 2RRBA 4X66F 2C2DA 2CPFA 1TUGB 2W24A 3FZBA 2CPEA 5BYQA 1KONA 4NLSA 1Y9OA 2HNZB 1GMUA 4QR0A 1FRJA 1HLWA 2HLUA 1S1WB 2HQFA 1S6QA 3TP2A 3OXGA 3EXYA 5KFCA 2MPUA 3SXLA 4WBFA 1PO6A 4PXEA 2MKSA 3IFEA 2AJ0A 4F4KA 3CDAA 1EKRA 1NDKA 4FXWA 1ZM3A 2MSTA 3ZZ0A 4DQRA 1T95A 1S59A 4G1QA 1X0FA 3MFHA 1R0AA 4P10A 3N5FA 2DTJA 4J9QA 4XPCA 4K4UA 3I82A 2GJ2A 4U96A 2I6WA 1DBDA 3LGHA 4WFAQ 4EZ6A 3I0SA 3G2XA 2XNQA 1QM9A 2VL1A 3JSYA 4DFJA 1H7XA 3LAMA 2CNLB 2FHJA 4X4NA 2LA4A 3IBCB 2APOA 1ZETA 1N5VA 3MR5A 2Q66A 1Q82T 3FBEA 1N8RT 2E9ZA 1U0SA 4FVMA 3KUGA 2OPSB 4OI4A 2HS4A 3AHPA 4KFBB 2VZ9A 4N77A 4MK7A 4OI2A 3PV8A 3MD1A 3I31A 3G87A 3NWRA 2I9SA 2V0NA 3IRXA 3QJLA 3PG9A 1VHIA 2E9TA 1LK7A 3G6YA 4ZVGA 3UCUP 3TUPA 2ZKTA 4DSFA 2VPYB 2B3TB 4FYDA 3FRZA 3R7BB 3SV4A 5GAHI 4ZVSB 3BGRB 1KLMB 2HFSA 2W9AA 3VQSA 1SBRA 1ZM9A 4MFBB 2BOPA 2PFDA 1UP1A 1L5UA 3HKZD 2CJKA 1RP5A 4ED3A 4IO9Q 2V68A 2ZH3A 4FKXA 2V8GA 4DR3J 1FNMA 2ASJA 1VC6A 1S97A 2V2QA 1RAAB 3P6YC 2VBWA 2IC3A 3MZIA 2BMBA 5CQGA 2OO4A 5C24A 4BWMA 1UVIA 3CMES 1RKJA 2R7OA 3W63A 1HNVA 2VFSA 2MSSA 1FE4A 2IM3A 2BVZA 1HBUB 4Y2CA 4GVLA 3WC2A 4J9VA 3ICLA 3D3CJ 1Y5LB 2XHWA 2WW8A 5GAGU 1LW2B 1U1KA 1X9MA 4WFYA 3M1VB 4PWUA 3ELHA 2CUYA 1X9WA 2X1FA 1REVA 3AOCA 2RRNA 1H74A 3C16B 2B51A 3CC7S 2AJ2A 3NNCA 3JQJA 1UETA 4ID8A 3MOJB 4P6QA 1S9GB 1KOOA 3T5KA 1HPZA 1NKCA 1T11A 2CPXA 1IKXB 2B0GA 4K5RA 3LF0A 4WYWA 2RHQB 1U1MA 2RAQA 1KFDA 5KFSA 5J2NA 1IBKF 1MWZA 3TUJC 3W2VB 4M5HA 1NB2A 1U09A 2IBOA 3W64A 5KFAA 3UN3A 4N76A 3PFEA 3JQKA 4OI3A 3GV8B 3F41A 4X65J 3TEHB 3W8PA 5JXSA 5F3ZA 1Q95G 4ZCKA 2P5VA 4K4WA 2B5JB 4CO1A 4KY3A 2G1HA 4LT6A 1NPKA 1ACMB 4I6YA 3GSIA 3ENVA 4EFAC 2QL7B 2RKIB 4NMLA 4CNZA 2HAFA 4KB7A 1RT6A 1BXNA 5M2PA 4DR4J 2JLEA 3VTIA 3CC2S 4C9DA 4C8KA 4ETXA 5HP1A 4IH5A 3DC2A 3MM8A 5DDQC 3D1OA 2I5JB 3QT6A 2WRMA 3EXCX 1CJTA 2RD5C 3C6TB 3DRPA 4CI0B 4K7QA 2QMXA 4FKYA 4P2MA 4NCAA 1N32F 1WKKA 2WBRA 2FVSA 2MKJA 4F02A 1LNQA 5GAEU 3ZZTA 3V81B 4C48A 4LSZB 2GAGC 2QLFB 3FRYA 1T02A 5AXNA 3MUTP 3CD0A 1G3OA 3N01A 3CDEA 4LFBF 1U49A 4OJHA 1C0TB 3EPGA 3IXQA 1X4FA 4F0HA 2R8JA 3KNAA 2XC9A 3D2WA 1C0UB 3MCMA 3H4BA 2JC0A 3MR3A 4A8OA 2QLXA 2F1FA 4WU3A 3P49B 4ANDA 3ILJA 1WI6A 4I67A 3V6HA 3JQMA 1GAOA 4JI6F 3IWXA 3V6JA 2H4YB 2RUSA 4LBIA 4B02A 3D1HA 1S99A 1T3OA 5IV3A 2DXDA 2KB2A 4RLEA 1FWPA 3FBFA 3VAFA 4OYAA 1RAFB 3GYNA 1HR0F 4RW6B 2BUNA 2EFPA 3H20A 5LXRA 3IAM9 2UUAJ 1NK0A 3S7RA 2BE7D 2F7VA 3NCPA 4KBIA 5KFGA 1FK9A 1LXNA 2QN6B 3DLGB 4UQGA 2DHHA 3EZOA 4ED8A 3HZGA 2L48A 1KS2A 3LP2A 1G6BA 2IRYA 3EX7B 1L3VA 4OX9F 2YPYA 3NBPA 4CYUB 4DR6J 4ZK7M 2DNPA 4LF9J 3D5MA 1FT8A 5F8NA 2X3GA 1OY8A 1N88A 5L9NA 1L3TA 3AFGA 1DQ8A 1TL5A 3QO9B 4DJBA 5T41A 1CG2A 1HWLA 2HQCA 4HTJA 2BKOA 3Q8RB 1TVRB 2CA9A 2AJQA 3RB4A 3MFIA 5HMZA 1HWKA 2ZH1A 3W61A 5KFMA 3N5BA 2HHXA 3KKFA 2R8KA 2H4WB 1NZAA 3OHAA 4ELUA 1MROB 2AEJA 4YY3J 4HYKA 1W7WA 2ZBCA 2RF2A 2JC1A 5J2MB 2W25A 5ETVA 4WZMA 4U8VA 1WELA 3D54A 1T94A 3OSNA 3SZ2A 3W1YC 2HAIA 3TX8A 2Y0BB 4PRFA 5A76A 1URRA 3BDPA 2UUWA 2HS0A 4U7UK 1UWBB 4F8RA 3SYZA 4KO0A 2NXEA 3OTEA 3CJQA 3Q8SB 4HT7A 2YKAA 5D4LA 4KGMA 2WSEC 1V6HA 3RB6A 2FLNA 2OTJS 3B78A 2ASDA 4DPXA 4F4WA 1T8EA 4TQSA 5D6GA 1N5YB 3H40A 4I7FB 1CBKA 1RABB 3JTNA 3P5TL 5AXKA 3HVRA 3QWUA 4AE5A 2R8HA 5GADI 3MXHP 1HFEL 4EBCA 2F4FA 5L1KA 3CF5Q 2Z2MA 4TKTA 3Q22A 2DGUA 4DQQA 1JNRB 2HHTA 4CZCA 2UXCF 1FA0A 1UTAA 3OFHA 1ZYQA 4B3RF 3CD5A 1EETB 1P6TA 3CDUA 4NZ0A 3LWLA 1NK5A 4O44B 3HSDA 4EI2A 2DNHA 4ZPDA 2MZTA 4WKYA 2RS2A 3JAMY 1FD2A 1VRUB 4CH7A 3K2YA 5AJ3J 3ETMA 1SKWA 2LYVA 4O3NA 3POTB 2IAJB 5CAAA 3CO0P 2P9EA 3LP0B 4P9SA 1IQTA 3DCAA 4ZVRB 2BX6A 1PJ7A 2A10A 5K14A 3ZTOA 3VCDA 1U2RA 5A8RB 1YJ9S 2OPQA 3F56A 1B0VA 4DR5J 4DV3J 5HROA 2IYIA 1ZA2B 4OHYA 3VZHA 4A8QA 4YHHJ 4GVBB 2MKIA 3A3PB 2W2NP 3MI7X 1RWUA 3CJ3A 4LSLB 4ZITA 2MLYA 3CCMS 5GMKa 2ZH5A 1C2PA 3B6BA 2DHSA 4M5IA 4LF5F 5G0RB 3MAAB 4WXWA 4LF7F 2KO1A 2CQPA 3EVMA 3VZIA 2EFOA 4LFAJ 1VLYA 1L3UA 4Y6IA 4IG0A 4F50A 1H2UX 1KHWA 3EMTA 1YJRA 3K5LA 1V5IB 1JJHA 2DRDA 5EX3A 4USJC 4KAIA 1VOMA 2HK2A 4AL7A 5CYQA 3IP0A 2G0CA 2VICA 2OLWA 4A8KA 4LREA 4EWTA 1RADB 2CNKB 2NYIA 2DKOB 5ADZA 4V19X 3CMAS 5KOXA 2AEFA 2KT5A 2H5IB 2ZFHA 4CCHA 4I56A 4LSNB 4NA2A 3F73A 4NRTA 2XS7A 2J7UA 3KFWX 2D69A 1J5OB 1TV6B 4OYWA 4OZ1A 1R43A 1PSDA 3IC1A 2B4OA 3FQKA 3PO4A 4I2QA 1S1TB 3CPWR 4R5PA 2AP6A 2ZDPA 1X5TA 5D0HA 1DARA 1Q8LA 4I6WA 2EFGA 2R7QA 3W7BA 2CPHA 2XY7A 5IWAF 4KHRA 4RUAA 1BUXA 1YBTA 1RT5A 3UE2A 5KFLA 4B17A 3MPYA 3CTRA 1XR6A 3E01B 2HFNA 2GO9A 2C28A 3AA8A 3HZEA 4KR0B 3R2DJ 1VQYA 3RR7A 1HL6A 2V63A 5F8GA 4R8UB 1TK0A 1JLFA 2QMUB 2ZC4A 3IBWA 4RNHA 4CM0A 3NCRA 1RU1A 1CQNA 3L95X 3TANA 2LXFA 2XB2D 2KTQA 1KHVA 3CDWA 1RQ0A 2J0QD 4KPCA 5D3GB 2BJ9A 3K89A 1FF2A 2O67A 4J9RA 1VQ7S 3MCNA 3CIZA 3M32B 4DR7F 2DNLA 2MB0B 1S6PA 1OY9A 2Z2YB 4RL1A 3R2CJ 3FUYA 1RTIB 1JLAA 2MTLA 5B0GA 3PVXA 1OJ4A 1RT3B 5HL7Q 3HX9A 2XGQA 2Y1IA 4UZCA 3VAKA 2BE9B 1F9EB 4USTA 4OHXA 3CUNA 1TQLA 1FJGF 1WACA 1T9VA 2DRAA 2B5JA 1N6QB 2GGPB 1O6XA 4M5NA 4UOCA 4FBUA 2AX1A 1REGX 1J2VA 5L46A 3B82A 5B0FA 4ITSA 1IBMF 4FS1A 4IH7A 4O23A 4YS2A 2YNHB 2E9RX 4ZIWA 1KTQA 5HATA 4I64A 3BO3A 2LDYA 4NYPA 2F8HA 3KHLA 1WHVA 2KI2A 3F0NA 2ZH8A 3I9V9 4OYPA 2QSWA 4DG1B 3MPUB 1L3KA 1RCXB 2VKRA 1RZMA 2UVRA 3CIMA 3TI0A 1QE1A 1IR2A 3E8OA 3W5XA 3T5JA 1RU2A 4IFVB 4YEAA 1UA0A 4P74A 4CLWA 2HHWA 1UWAA 1TAUA 2YKNB 3PX0A 3ZNUA 2MQPA 4DV4F 1RGVA 2XG8A 1T3NA 1D09B 3HI9A 2KN4A 4QIWD 1HQ2A 1JLGB 3DGPA 4DQSA 3DNCA 3ISZA 4J9LA 3UNGC 5IC4B 3VWSA 4TU9A 5KG7A 3TAMB 1QAYA 4ETZA 2DNOA 1VBXA 4DFMA 4ZVUB 3HFVA 1C0UA 2FYXA 2DNZA 1RISA 3Q0AA 3RB0A 3M4XA 5D8HB 3M30A 1FE0A 4OI1A 1P1TA 1DTTA 1N34F 4V19J 1S5ZA 4K59A 5J1EB 5JVGQ 3J81U 2PI4A 2HQ3A 1QAIA 2C3PA 4F26A 1HNWJ 1VQKS 2IM2A
chains in the Genus database with same CATH topology
2K7KA 1RYRA 2HFZA 4RKUC 4X4RA 3BZQA 2F8EX 2KU7A 4NCGA 2JSXA 4ZPVR 1HQUA 2IM1A 2ZE2B 3O44A 2RT3A 1DHMA 3DMJB 2YNHA 1ZPWX 2GQCA 2FVCA 2MHNA 3CO9A 3DHXA 3JTPA 1S48A 2W7PA 4ZCLA 3PZPA 4LVOP 5GAGI 1IKVA 1G2EA 5L1IA 2KM8B 2ZHBA 4UQTA 3HVWA 2CIMA 5U47A 2OMOA 1YVFA 4DN9A 2JDJA 1S1VB 2W7OA 2ZOMA 5HN0A 2PT0A 2U1AA 2HHQA 2NPIA 3LOUA 1Q8BA 2GHPA 1YBAA 4QOTA 4JI2F 3ZZZA 3HVTA 2GQ2A 1SL1A 5A8KB 1MMLA 5MLCV 4LMZA 3GV5B 3PACA 4X62F 2GJIA 2CJQA 4IQMA 5KFHA 2ZNYA 2KM8C 2Q6CA 2JVRA 2WOMA 2PD1A 3J81Y 3D0GE 4PUOB 1D8YA 1PILA 4OZLA 3TVYA 3IRWP 4G6VB 2XLIA 3C2PA 3H2UB 4Y0FA 4DG1A 1SV5A 3ENQA 1FD8A 2O5DA 3M8PB 3IGVA 4ATNA 5B08A 3FMWA 2V8HA 3U1MA 3K8WA 1FTCA 2MGZB 4X2BA 4ES3A 2MXYA 4OZJA 2DPJA 4RW7A 1C1CA 5E3CA 3TUZC 3HFKA 4YP3A 1N54B 1HYSB 5KFUA 1TK8A 3I9ZA 5C42B 1FTRA 4A48A 4EO8A 3CCVS 1IKYB 3CEDA 2ZOFA 2R9LA 2JRSA 1VRTA 1NHVA 4IFVA 4I1TA 3N28A 2FJWA 3UR0A 2BE2A 1HWUA 4TLQA 4KSEB 1LFPA 4OJ1A 3G9CA 1JJ2R 2UUAF 2YKNA 1M0SA 2CQ0A 2DNQA 1K8AT 2FC9A 3MCSA 2ZNZA 1LWFA 2GC8A 3QO9A 5IT4A 4K2XA 4ALZA 3FEYB 1BQXA 1BQMA 4PXCA 4OI6A 3OVBA 1TUVA 3ZZUA 1NH8A 1KOHA 3THTA 3THVA 3LUYA 1S1UA 4MKBA 4M95A 1X9SA 2DCLA 3ZZRA 4LF8F 1FJCA 4F4YA 3UD4P 4DQPA 1T03B 3ZC4A 1WHWA 1Q53A 2CJBA 4L3NA 3OXLA 4NYZA 3G8TA 1MU2B 3MMBB 1Z2ZA 1DQAA 4AFFA 4CT9A 5B7WA 4WZQA 4CO2A 3IR6B 4E98A 1UVLA 1VGYA 2OJ3A 4DSJA 2L3MA 2XMVA 3CSKA 3NKYA 3DRYA 4B9VA 4PCQA 3SEOA 4CTAB 3IG1A 4YUDA 1UVJA 2KFZA 2M52A 3QGHA 5EWGA 4H4OA 5KG5A 2YKOA 3OPKA 5LMUF 2XEXA 3RW6A 1RKIA 2OPRB 1LWEB 2C3UA 3QIDA 3RR8A 3LW5C 4ZPTR 4DR6F 4LF9F 2NZ4A 2HNYB 5B09A 2V5HG 3KK1B 2D9PA 2PN6A 1NU4A 3HLUA 1VK8A 3SSQA 2HG4A 1TZ0A 2J5AA 1FKPA 2CDQA 3G4SS 3OTDA 2HWTA 1TR0A 2HRUA 4ZCMA 1WF1A 1XK8A 2ZJPQ 1QY7A 2DHGA 3HHNB 3NMAA 2ACYA 2AYBA 3BSCA 2EKYA 2M7SA 3NL0A 1FRMA 2IBKA 1RTJB 1AFIA 3D0HE 2B4VA 3MMAA 4RWWA 4HH0A 1XN9A 3QGPA 1HNXF 2OTLS 5FD1A 5J1EA 2E44A