3HVTB

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
427
structure length
398
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 74
structure length 398
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtB03
3NL0A 4ED2A 3DI6A 3KK1A 1U09A 2ZD1B 3KLFA 3GIJA 2IJFA 4NLPA 4LSLA 3DLEB 4H4MA 5KFTA 2AGPA 1RYRA 2J6TA 4RW4A 1N6QB 4IG0A 4ZP7A 1FKOA 4ECQA 1HQEB 4WFXA 4Q0BB 4MK7A 1RT5A 5J2NB 2AWZA 5C24A 4IRCA 3T5KA 2ASDA 3LAMA 5L9XA 1JLBB 5CYMB 3M9OB 4NLVA 4TLRA 1S9EA 2R8GA 4FS2A 2JLEA 1HNIA 1D0EA 4ZPAA 4KO0A 1IKVB 1FK9A 4WXWA 2RF2A 4IDKA 3Q8QB 2FLNA 2QV6A 1N4LA 1MU2B 4NLDA 4DL7A 4QWBA 5JUMA 5KT4A 3KHRA 2GIQA 2AGOA 1RT4B 4TQRA 1TKXA 3NKYA 4I2PA 4DG1B 5CYQA 4ZPCA 1QAIA 4NLRA 5KFVA 3GILA 5C42A 1RT6B 1JLEA 1KLMB 3ISNC 2HMIA 4NZ0A 5KFKA 3HVTB 1LWEB 4ZPDA 2YNHB 1T03B 3CDWA 4DEZA 4LSNA 4J9LA 1RTHA 4KAIA 4WXOA 5DQIA 4ZP8A 2W9BA 3DM2B 2CKWA 3DDKA 3CVKA 5KFMA 1NHUA 2C28A 2UVWA 3JSMB 1JKHA 4IFVA 4QPXA 4H4OA 4KFBB 5DQHA 1S1XA 3CJ5A 2VA2A 4J9MA 2VA3A 4NLUA 4NCGB 4KBIA 4TY8A 5EDWA 4R8UA 4DL6A 4J9NA 1N5YB 4O44B 5EWFA 3H59A 4M94A 1IKXA 2DPJA 3IRXA 3OL7A 1TL3A 3H40A 2R8JA 1RAJA 4ZVEA 3PZPA 3FRZA 4KHMA 3KK3B 4DL4A 2I5JA 2IM3A 2FVSA 2VG6A 1JLGB 3KMQA 2FJVA 3D5MA 2B6AA 1XR6A 5F8IA 5I3UB 4QWDA 1UWBB 1R0AA 3KK2B 2ILZA 1Z4UA 4XPEA 2ZKUA 2AU0A 4G1QB 5KFQA 2XI2A 3CIZA 4HKQA 1S6QA 5KG1A 1BQNB 5D3GA 1JXLA 1SV5B 2IM0A 4KKOA 2W8KA 4RW9A 3QLHA 4URGA 2HNYB 2OPQA 3DOKA 3OL8A 2WONA 2F8EX 4ECWA 5KG6A 1SH0A 1T3NA 2HAIA 1HMVA 5DGBA 3I0RB 3HKWA 4Y34A 2VG5A 3BGRB 4K4SA 5KFHA 3LP1B 2D41A 1RT1B 2AQ4A 3DLGA 1S1TA 3UQSA 5L1KA 3DMJA 1T05B 1I6JA 4DL5A 1IM4A 2W8LA 4EBCA 1BQMA 4K4WA 4WFYA 4J9KA 3HVAA 1C0TB 3C6TA 4F4YA 2O5DA 2IJNA 5DG8A 3CDEA 1K1SA 4O4GB 4Y2CA 4Q8FA 4Q45A 5FDLA 5EUHA 4ECYA 4WE1B 4LQ9A 3IG1B 5KFAA 3KLGA 5KFNA 2WTFA 2JC0A 4I7FA 3KJVA 3H5YA 3RAXA 4XPCA 3C6UB 1IKYB 1RA6A 1LW2B 1S9GB 2RKIA 4RW8A 4MFBB 4OL8A 1IKWA 5DLGA 2XCPA 3NMAA 4ZVGA 4F50A 3ITHA 4F4XA 3CJ0A 3BJYA 2BQUA 1DTQA 4Q44A 2B5JA 1QAJA 1LWCB 1ZETA 4K4VA 2OPSB 2J6UA 2BRKA 3TAMB 1TVRB 1D1UA 2IC3A 4TY9A 2W7PA 3DRSA 2ZE2B 1DLOB 3KLIB 5EWGA 5DGAA 1T94A 2OPRB 1REVB 4B3OB 4ZMMA 1RTDA 3MEEA 5KFBA 4J9OA 5KFJA 3DYAB 1TL1A 3VQSA 4EO8A 5DQGA 4ECSA 2V4RA 1SV5A 1JLQA 2WRMA 1K1QA 2VG7A 3M8QB 4IFYB 2R8IA 1HYSA 1HPZA 1OS5A 4ICLB 1LW0A 2BRLA 3DRRB 2UUTA 5KFZA 3UPFA 1EETB 4NLOA 3PR4A 3PW7A 4Q8EA 1S1UA 4RNFA 5KFWA 2IMWP 2OH2A 2WCXA 2J6SA 3H5UA 5HROB 4H54A 5KFUA 2V9WA 2YNIB 1JLCA 3PJWA 4X2BA 3LP0A 1RA7A 3GV7B 4NLXA 4MH8A 2V0NA 4O3PA 4IQXA 1RT7B 2YKNB 1SUQB 3KLEB 3V81B 3CJ3A 3LP2B 3TVKA 5KG2A 4PQUA 3BQ0A 2YNGB 1C1CB 4MKBA 3GIKA 3OSPA 5K14B 1S1WA 4IG3A 2R2UA 2RDJA 2AGQA 5KG4A 4YQWA 3SFGA 2YKMA 3Q8PB 1ZTTA 4FS1A 5KFYA 4J9RA 1JLAA 2HNDA 5F8NA 5J2MA 3V4IA 5HP1B 4R5PB 2WOMA 3N6NA 4RW6B 3KNAA 3G6XA 5L1LA 2YNFB 3EZUA 5HLFB 3OHAA 1N48A 3QYYA 3KLVA 1JLFA 3EPGA 1RYSA 3OL6A 1HQUA 3QO9B 3MF5A 5KG7A 2FJXA 5KFGA 4K50A 1EP4B 1TKTA 3DLKA 1S1VA 1XR5A 1DTTA 4QW8A 4QW9A 4TN2A 2BE2A 3QIPA 4Q43A 2AX0A 2GIRA 1S6PB 1HNVB 4ID5B 2C2RA 2OPPB 2UVVA 3KLHB 1RT2A 5J2PB 2R2SA 1J5OB 3MECB 3JYTB 3UR0A 4MK8A 3DOLA 4ECVA 3MEDB 3QGHA 1RTJA 1NHVA 4YR2A 3PW0A 4NLGA 3FQKA 4IRKA 4PUOB 2XGQA 1QE1B 3OHBA 3BREA 4RNOA 1C1BA 1RTIB 4J9PA 4ECRA 2YNIA 3V6DA 5J2QA 5KFCA 4TXSA 1TV6A 4EO6A 3OLAA 2XCAA 3GV5B 2ZD1A 2DPIA 3I0SB 5T14A 3DLEA 1N6QA 2D3UA 3FFIB 4J9QA 5KT6A 4QWEA 4XO0A 4IR9A 1RT3B 1HQEA 3DRPB 3GYNA 4Q0BA 3I5CA 5J2NA 3RB4A 3BSCA 2BANB 4ECXA 3RB0A 1JLBA 5CYMA 4O3OA 2JC1A 5F8JA 5C25B 2W9CB 5HBMB 3GIMA 4KV8B 3D28A 1TKZB 2XC9A 3PHEA 4RNMA 4WZQA 1IKVA 3MEGB 3H2LA 4EYIB 4K4TA 4JV1A 4FBTA 3E01B 1MU2A 5F9LA 3MR3A 4I2QB 4TYAA 5J1EB 1RT4A 2CJQA 2FLLA 4DG1A 2FVPA 4O3QA 4IR1A 1LWFB 1HARA 1RT6A 1KLMA 3HVTA 1LWEA 4RW7B 2YNHA 1T03A 5KFRA 1W25A 5I42B 3V6JA 1S0OA 2I1RA 2IAJB 4ZP9A 3DM2A 3NBPB 4YP3A 3V6KA 3PW2A 1VRUB 2HNZB 4NLWA 3CWJA 4R0EA 1VRTB 3JSMA 3M8PB 2FJWA 4GC6A 4KFBA 1FKPB 1GX6A 5DG9A 1S10A 4PWDB 4NCGA 1S4FA 3BR9A 3CO9A 4DL3A 1N5YA 2E9ZA 3IS9B 4O44A 5L1JA 3KOAA 1C0UB 5KFPA 5DG7A 3RB3A 4ZHRB 4WYLA 3DI6B 3KK1B 4ZP6A 3KLFB 4JV2A 3KK3A 4LSLB 1S49A 4H4MB 4MIBA 2V4QA 4IOBA 4RW4B 4IG0B 3IGVA 1JLGA 1FKOB 2B43A 2AX1A 5I3UA 1UWBA 2C2DA 1RT5B 3KK2A 5C24B 2IBKA 2E9RX 2BQRA 4G1QA 3H5XA 4F4WA 2WB4A 1BQNA 3CJ2A 2UVRA 1S9EB 1S0NA 1HNIB 2GC8A 3G6VA 4KO0B 5KFSA 4K4UA 1FK9B 1MMLA 2RF2B 2HNYA 4FBUA 4IDKB 4QWCA 2WHOA 4EEYA 3FQLA 3I0RA 1CSJA 4ED3A 5KT2A 3BGRA 3LP1A 1RT1A 4NLTA 1TKXB 4I2PB 1T05A 5CYQB 3T19A 4NLSA 3RBEA 4KHRA 5C42B 2HMIB 1JLEB 4JUZA 4F4ZA 1C0TA 3H4BA 4Y2AA 1TP7A 3NAIA 4LSNB 4O4GA 1RTHB 4O4RA 4NLQA 2W9BB 2ATLA 4NYZA 1RDRA 4WE1A 3IG1A 2R2RA 5KG0A 2C2EA 1JKHB 4IFVB 4H4OB 3C6UA 3T5HA 1IKYA 2IM2A 1S1XB 1QUVA 1LW2A 1C0UA 1S9GA 4TY8B 4MFBA 3CDUA 4O3NA 4MIAA 3H5SA 4R8UB 3QZ8A 3BSOA 1WNEA 3LALA 3PW5A 1IKXB 2JEIA 3IRXB 5F8LA 1TL3B 3I5BA 3LAKA 4IRDA 1LWCA 3BQ1A 2OPSA 5KFDA 1S48A 4WFZA 4IH5A 3TAMA 1TVRA 2D3ZA 2I5JB 3Q8SB 1XR7A 2ZE2A 3SI8A 2VG6B 1DLOA 3KLIA 3H98A 5L1IA 2B6AB 1REVA 2OPRA 4B3OA 1R0AB 4ED7A 3HVWA 3DYAA 3MTKA 1S0MA 3FSIA 3PVXA 1S6QB 3M8QA 3N6LA 5D3GB 4IFYA 2R2TA 4MKAA 4ICLA 3NGDA 4KKOB 3MFIA 3DRRA 4RW9B 3QLHB 2HWIA 1EETA 3IGNA 2OPQB 3DOKB 3FDSA 2WONB 3SFUA 3PW4A 3GV8B 5HROA 3PJXA 2EC0A 1HMVB 5KFIA 3ISND 4IH6A 2VG5B 5JXSA 1TQLA 5C5JA 4KB7A 4TQSA 5DLFA 3LANA 3DLGB 4GC7A 1S1TB 3QZ7A 2ALZA 1RT7A 2YKNA 1SUQA 3DMJB 3KLEA 3V81A 3LP2A 3QGGA 3BSNA 1BQMB 2YNGA 1C1CA 3T5LA 3E51A 2XWYA 5K14A 2UVUA 3C6TB 4EBDA 3KMSA 4NRTA 4O3SA 2FVRA 5KFEA 2E9TA 5FDLB 3NAHA 3KLGB 3HHKA 1JIHA 3QGIA 5HP1A 4IKAA 4I7FB 4R5PA 3KJVB 4RW6A 2BR0A 2BQ3A 2YNFA 1GX5A 2RDIA 4URSA 4WYWA 4ZPBA 4HYKA 4RNHA 2RKIB 4ED1A 4RW8B 5HLFA 1IKWB 5KT3A 3V6HA 3G6YA 4NRUA 3ITHB 4URQU 3QO9A 4M95A 5F9NA 5KT7A 4KSEB 1DTQB 4K4XA 1EP4A 2B5JB 4EBEA 4ZVHA 4RNNA 5KFFA 2XGPA 1S97A 5EWEA 2IC3B 1S6PA 2ILYA 2WK4A 5F8MA 1HNVA 3DRSB 4ID5A 2D7SA 2OPPA 4Y3CA 3KLHA 5J2PA 4IH7A 3N6MA 4RZRA 5KFOA 1J5OA 5F8GA 3MECA 3JYTA 2HWHA 1RTDB 4ED0A 1NNDA 3MEEB 3MEDA 1TL1B 3H4DA 2IA6A 1JLQB 4DL2A 3CJ4A 2VG7B 4ECUA 4K4ZA 4PUOA 1QE1A 3MFHA 1HYSB 1HPZB 3OLBA 2JEFA 3OSNA 1RTIA 1LW0B 4TYBA 4U7CA 3V6DB 3KHHA 4ED8A 4QWAA 3M9NB 3OL9A 1KHWA 1S1UB 1JX4A 1S9FA 3TQ1A 2C22A 3T1AA 5KFLA 4NLYA 1JLCB 3I0SA 5F8HA 4MK9A 4JV0A 4EYHB 3LP0B 4YR3A 4ED6A 4O3RA 3FFIA 2R8HA 4YMEA 5KG5A 4K4YA 3KHLA 3IN5A 1RT3A 3DRPA 4PQUB 1KHVA 3KHGA 2FLPA 2BANA 2FVQA 4ECTA 1S1WB 4IG3B 2R8KA 5C25A 2YKMB 5HBMA 3Q8RB 2W9AA 2W9CA 4KV8A 1TKZA 2ASLA 4ZVFA 3MEGA 2IM1A 1JLAB 2HNDB 1SH3A 5J2MB 3V4IB 2FVCA 3EPIA 2WOMB 3QIDA 3E01A 4WZMA 3ICLA 3PR5B 4KE5A 4I2QA 4U6PA 4LQ3A 1ZTWA 2QE5A 5J1EA 1SH2A 3T5JA 3RB6A 1JLFB 1HQUB 4G3IA 1LWFA 1TKTB 3DLKB 1S1VB 5KG3A 1DTTB 4RUCA 2W7OA 5KT5A 2BE2B 3QIPB 4RW7A 3RAQA 5I42A 2UUWA 4RUAA 1RT2B 2ASJA 1C2PA 2IAJA 5KFXA 2JEGA 3BQ2A 3NBPA 4YR0A 4ECZA 1VRUA 2HNZA 3DOLB 4RU9A 1RTJB 1VRTA 3M8PA 2XI3A 3UDLA 1FKPA 3MR5A 4PWDA 1YVFA 3I5AA 1C1BB 3IS9A 3G86A 3MR6A 3M9MB 3GQCA 2JEJA 3MR2A 3GIIA 3BSAA 4J9SA 4ZHRA 5J2QB 1N56A 3RBDA 1TV6B
chains in the Genus database with same CATH superfamily
1U09A 3W9HA 1MWQA 4X4RA 1WC1A 4UOCA 3TEGA 3H0PA 2Y0BB 5DDPC 2ASDA 5L9XA 4C8LA 3T9ZA 4ZVRB 1WKJA 1EAYC 1VQMS 2AGOA 4DOZA 3F44A 2NPIA 4ZPCA 2YWGA 2FHJA 2XEXA 1LWEB 2IBOA 2YNHB 3CDWA 1RTHA 3IWNC 3ZNJ1 3HO1A 1DFDA 1VQ7S 1R8PA 2VA3A 1A7GE 3MMAB 5CAAA 2EBGA 4KHMA 2M8HA 2QA4S 2XS5A 4ALZA 1A6LA 4GMKA 4A8OA 3R1LA 2EXUA 3HHLA 4Y34A 2B9WA 4DV4J 1RJJA 3JAMY 3DMJA 2GMLA 1BQMA 2M88A 2FD2A 2DNQA 4F4YA 2D3OR 4MMOA 3BM7A 4HHJA 3ZTPA 4WK1A 2G0IA 4NE9C 2WTFA 3MM8B 2IRXA 4DPXA 3H25A 3NGUA 1DTQA 1VR6A 1PJ6A 2W2PP 2J76E 2H9ZA 2WBRA 5D4OA 3B4DA 5EWGA 3BB5A 4FN5A 4MJKA 1UL3A 1TL1A 4EO8A 4F3MA 3SZ2A 4X4VA 3F41A 3ZZYA 4IQXA 1SUQB 1DBDA 3BQ0A 5BR8F 4DX8H 2YH0A 1UFLA 1TUWA 3TUZC 4MYTA 1YQHA 4ES1A 1DTTA 3FEYB 3UCZP 2BE2A 4Q43A 3QNWB 3WX4A 4MK8A 2NYHA 3HDSA 1ELOA 2Q79A 1HBMB 3J7A1 1KOOA 2ZNZA 2DGSA 1TELA 1PIEA 2V68A 3GYNA 1Q4RA 4ECXA 4DR2F 4IUFA 3RB0A 4DPWA 2JWNA 1TKZB 4CLSA 1UMJA 3CMES 4TYAA 1EHWA 4CZCA 1F3FA 3WZ0A 1F9HA 3G8SA 4FDFA 1KWMA 4B3TJ 4UQTA 1NJXA 2F40A 1ZA1B 1HHQA 2AEJA 2YKOA 3QSIA 4OYAA 4CTAA 2RVJA 1WORA 1HNZJ 4OI0A 1I5OB 3MPYA 4H4KA 1FKOB 2FZGB 1YJVA 3DLLQ 3HULA 3HHNB 1D3WA 2LQ9A 1WSRA 5CCLA 5E3PA 4ZOSA 3TZXA 1TTHB 5DDOC 5E3RA 4KHRA 1B64A 3VAHA 1XBWA 1C0TA 4RR5A 4OJGA 1FXLA 5E3AA 3LH2S 1NDCA 1LV5A 1JKHB 1IJEB 3QZ8A 4LFCF 3Q2SC 4QU7A 1LWCA 3ONQA 4WBFA 4I56A 2ZDOA 2EC2A 1M5KC 1REVA 2M2BA 3VTIA 3N6LA 5DZ6A 2AJ2A 4AT1B 2CAJA 3THPA 2B9XA 2GMHA 1YIJS 1CLFA 2OPQB 2IRUA 3J7AN 1DQ8A 3F56A 5JXSA 1GEHA 2C3YA 4LRDA 1T11A 3LWMA 2JX2A 2BR0A 2BQ3A 2F9DA 2RDIA 6AT1B 2RKIB 1VC6A 3V6HA 4NRUA 1VOMA 1EP4A 4PCQA 1I51B 2DNOA 4WP8A 3R8YA 4KJIA 1OMSA 4ECUA 4K4ZA 2HVZA 4PUOA 1ZM9A 2LDIA 2Y9HA 3D2WA 3CF5Q 2I6WA 1IR2A 3HFZB 1HNWF 4PYAA 3IN5A 3VWSA 2DRDA 3R6GB 4U7UK 1NEEA 4CH7A 3US5A 3TO8A 4ZVFA 1NKEA 5J2MB 1FRKA 4U6PA 4B9MA 2HSEB 1PGZA 5IXUA 1CULB 2NREA 3QIPB 3DRYA 2FC9A 2ASJA 4M8LA 1RKIA 2HAFA 2HNZA 4OJHA 4A47A 4LF9J 3MR5A 2RRAA 4PWDA 1YVFA 1MG7A 2CDRB 2VPWB 4IOCQ 4C0BA 4ED2A 2J6TA 1PC5A 1RT5A 3KG0A 1OPIA 4FS2A 3AOCA 1KC8T 2BMBA 5CZVA 4L3KA 1L3SA 3PFOA 2L9WA 5E41A 1H73A 3N01A 2DR6A 2RQMA 1UVMA 1RAEB 4B3RF 3MMCB 3CJ5A 1WEZA 4NLUA 3T9NA 3MMJA 3N5BA 4O44B 3OL7A 2HBQB 3PM9A 2G9OA 3FRZA 4DUYF 4DL4A 3KMQA 2QLFB 2RHQB 4FP9A 3VV2B 3IBCB 4NA1A 5IT4A 2ERRA 2UUAJ 2VV5A 2ZH2A 4X4PA 4DMZA 3T41A 3PKMA 2VG5A 5I3QA 4K4SA 2AHOB 1F5AA 1T05B 1QD1A 4R25A 1D8ZA 4M5NA 2DNLA 3KJVA 1BMQB 3CJ0A 3TAMB 3KLIB 1TL4A 1Y9OA 1MROA 4IFYB 2R8IA 3DGPA 3UPFA 3HZEA 1EETB 2R9LA 4RNFA 1J5EJ 1S76D 2V0NA 3BKFA 1RHUB 4CQ1A 3G4SS 1S7IA 1S1WA 1Y7PA 2AYGA 3FCWA 1N34J 4R5PB 4JI8J 4FKXA 3P5BP 2Y0SD 2GHVC 1S7HA 1TMJA 4WTYA 1AZSB 1Z2ZA 2UVVA 3CMAS 3U02A 2LQBA 1AROP 1D9AA 1NHVA 1VDHA 3FQKA 2MKJA 1UP1A 1X8DA 2XMJA 2FLOA 4YHHJ 4F25A 1WC0A 2AJFE 2CQGA 2LMIA 4LBHA 2GNKA 3NG8A 1RAGB 5IC6B 4DV3F 1SKSA 1HQEA 3VZHA 4DV1F 3CJQA 3EDQB 1AW0A 1OSDA 2CYYA 1HLWA 4FBTA 3E01B 5LT5A 2VJUA 5M2PA 2QL7B 3GFHA 2FLLA 2K3IA 4ERDA 4RBVA 3MM7A 1D9DA 3U1LA 3FJ2A 4IO9Q 4R0EA 1TU0B 2FJWA 3LA0A 1S4FA 1N5YA 1JXVA 3D0IE 2MHEA 2C1EB 4LSLB 1YJ9S 2LA6A 5IT9U 2F4FA 5K9FA 5I3UA 4YB1P 5B0EA 3A3OB 2QG9B 2WB4A 4ZCLA 3CJ2A 3IRWP 4EMDA 3CIMA 3SDEA 2GC8A 2KRRA 3ET6B 4DV0F 3I0RA 4UZCA 4I2PB 2V2QA 4WK3A 3PYDA 2QX0A 5DDRC 4Y2AA 4FYXB 1UZDA 4YY3F 1U0HB 3CDUA 3P6YC 2BJ8A 2Y8YA 1L3TA 1BQXA 1TL3B 4DDFA 2YBVA 3BQ1A 1TVRA 3NXZA 1XR7A 2B6AB 2WB1D 2Q3PA 3FSIA 1CS4B 1IBKF 1S6QB 3M8QA 3ZZPA 3VGTA 1F5CA 1U1NA 1REGX 4MT1A 1HMVB 3R97A 3T1HJ 1TQLA 1Y3KA 2A0FB 4A8SA 4G6VB 1S1TB 3KLEA 2YKNA 3V81A 4ZIVA 3QGGA 2NZ4A 1Y5IB 9ATCB 1HR0F 5GMDA 2DXEA 3QPIA 1IN0A 2I38A 5ETPA 2UXDF 2K1RA 2E1CA 4URSA 3J81Y 2Z30B 2NUUG 3MZIA 1FDAA 2OTJS 3ZZZA 3AA9A 5K20B 2M0GB 1V6HA 3MEDA 1WC6A 2F8HA 2IA6A 3MCMA 3OSNA 3QT5A 1KHWA 3KG4A 1S1UB 2C22A 4F02A 2CQ0A 1LWXA 3AD8C 5LSLA 4K4YA 8RUCA 4MTPA 2FJAB 3LQVA 5HBMA 5DJBA 4A8MP 2MZTA 1JLAB 3HFKA 3QIDA 4S0MA 4LRBA 2MLXA 2KVQE 2KKHA 4ZLJA 1TKTB 5B0CA 1S1VB 4RUCA 1S77D 2C2ZB 2B56A 1TUVA 2FDNA 3OQ2A 4YR0A 3OD2A 1Q78A 3MTJA 1QDUB 2GVZA 2JFKA 4JV5F 4F8RA 2LEBA 1XEZA 5KOWA 3M8YA 4DQQA 3CDBA 2HIQA 1VLOA 3DI6A 2QLXA 3MM9A 1YZ6A 3W65A 2QA2A 3UCGA 5HVHA 4X65J 4O23A 4F0HA 3HSDA 1SQGA 3AFGA 2Z4PA 4ZPDA 3ZZ0A 4DZDA 3ENWA 3OTEA 2WVFA 4N56A 1P6TA 4DQPA 2UVWA 3TOQA 2KHDA 1HKAA 3PRVA 2HVHA 4QIFA 3Q23A 5IQQA 3H59A 4M94A 3FKBA 2R8JA 5F0WA 1GNKA 2VL1A 2A3JA 4HKQA 1ZOTA 5KG1A 2AW0A 5D3GA 1YBUA 4JOUA 3GZ7A 3DOKA 2WONA 3MI7X 4X64F 2HAIA 3HHDA 3PKYA 2C2MB 3POTA 3N79A 3RJMB 1RCXB 5GADU 4O4GB 2X3DA 1S99A 3KLGA 2ZH8A 4C4WA 1LW2B 2XCPA 4I4BA 5B0DA 5K8MA 4F4XA 3ITHA 2IRYA 1F60B 2R3VA 3BJYA 3RZAA 1URNA 2ZE2B 4DR7J 1DLOB 4ZMMA 3HJVA 5DQGA 1SJ3P 2YWFA 4QR2A 3CJKB 5KFZA 3HJFA 2LLZA 1OPZA 4DV7F 2AIRB 5HMYA 4DS5A 4NWBA 4PQUA 2JVRA 2CZVC 3CW2C 2N82B 3P4UB 4IG3A 2R2UA 4FS1A 2Z2YB 3W63A 4CO1A 2O66A 1FD2A 2OIHA 2EKYA 5HLFB 3U1MA 4ZDNA 5T7LB 5I4MA 3IBFB 4ZIWA 1J5OB 3BYPA 4BDPA 3PRDA 3QT8A 3MDFA 1UTAA 2BZ2A 2YNIA 3OLAA 1RLCL 3L09A 2D3UA 2ZOMA 3HHLD 4C9DA 3HHLC 5F8JA 2OKQA 3GIMA 1SC6A 1VC5A 1OWXA 1T8EA 4OHZA 4DG1A 4YB6A 1GFWB 3M1VA 2WVCA 4I6AA 2P8IA 4NI2A 1YLXA 1FE4A 5D4PA 2MQPA 3BR9A 3CD5A 3RB3A 4C97A 3KK3A 3R27A 4UW2A 1FJEB 1T9VA 5IWAJ 3KK2A 5L38A 1VQOS 3H2VE 1S0NA 4K4UA 4O0IA 5HSPA 4DV2F 4ED3A 1B7YB 4KH1B 1RK8A 1RB0A 1RTHB 3Q8YA 2C2EA 1MW7A 2OFGX 3GLJA 4OZ3A 2IM2A 1E6VA 4UOHA 3RGIA 2BJEA 5HI7A 2EFOA 4ANDA 4HH0A 1J2VA 3M6WA 1X5TA 3MM5A 4TVAB 1X5OA 4ZVPB 2RB7A 1NZAA 3MFIA 3M4XA 4DPTA 4RX6A 2VC0A 3HHLB 2ZUGA 3GV8B 3DMJB 1FI4A 4OX6A 1BQMB 4C8KA 4RJVA 3NNCA 3CCWA 5IV4A 3MXHP 2FVRA 2LECA 1CQNA 2CQ1A 1JIHA 4LVNP 2BA9A 3KUHA 2MQ8A 4KSEB 1DTQB 1KFDA 4K4XA 3RR7A 1KBRA 5MAOA 2ZH4A 4KGMA 3J7YI 2H3EB 5F8GA 1TL1B 3M32A 1FRXA 1RWNB 1X4AA 4U7CA 3OL9A 4P9SA 2YY3A 5D4NA 2DGOA 3K5OA 3WIUA 2OJ3A 3HM9A 3KUGA 4UQGA 4UUWA 1S4EA 3EVMA 4K59A 3T6BA 2KZZA 2IM1A 4Y28C 3Q83A 7FD1A 2VBZA 2RH3A 2DTJA 2XULA 3ZC4A 1HHSA 1DTTB 2BE2B 3PIPQ 1C2PA 2FJBB 1PYSB 1VRTA 3QQCD 4BC7A 2AF6A 2DITA 2X1FA 4OX8A 1VQ8S 4J9SA 2E9RX 2XO7A 2DGXA 1KLNA 2RUGA 2H48B 4WFXA 2AWZA 5GAHI 4WP9A 1NK8A 2R8GA 5JVGQ 4DS4A 2Q6BA 1IUJA 5AE1A 3KHRA 1YZ7A 3W9JA 2H1YA 1F9FA 2GJFA 3QAEA 3GG0A 2XY5A 3T3FA 1P27B 1T3OA 1U45A 4CTAB 2BE7D 2CUYA 3B54A 1MNEA 2GHWA 3QJPA 1RBOB 3JQKA 3GPAA 4QWDA 3M6VA 4MAKA 3M2RA 2QJ3A 1C4AA 1WI8A 2PSZA 3OL8A 2MGZA 4RO0A 5KFHA 3DLGA 2CZ9A 4DCJB 2LYVA 2CJXB 2V5HG 4WFAQ 3KJNB 4WFYA 1C0TB 2LQ8A 2WAQD 4CH1A 4IYQA 4A8FA 2HGLA 2JFDA 4Q45A 3HX9A 2M9KA 2YQ1A 3FSYA 2UUCJ 1RAHB 3G87A 1RAAB 2VDHA 2KJWA 3CCUS 1LWCB 3CJSA 4C7QA 5BXIA 3SYZA 1REVB 3BBCA 3FBEA 2DIVA 1B0VA 2GMJA 2BRLA 4OYXA 5KFWA 4NZ6A 2HHUA 5A8WA 5FJ4A 3LP0A 1RA7A 2CJKA 4RKUC 2GAGC 2LXFA 2L9DA 3FBBA 1DQAA 4CT8A 2HNDA 3BF4A 3K8WA 1K73T 3FMWA 4J9VA 1EP4B 2H5EA 1XR5A 5HANA 4HDGA 3OR2A 4C8OA 2E1AA 1PILA 1SJRA 4F4AA 1V3ZA 5HL7Q 4PUOB 1JK9B 4GKJJ 2HGNA 2EVZA 2O67A 5J2QA 1E6YA 4USHA 2ZD1A 4B3MF 3BKTA 3I87A 3WDOA 4DX5A 4NA2A 4I68A 3I5CA 3BKUA 3I9ZA 2LQJA 2NZCA 2XMKA 4JB8B 1RHKB 1F2GA 2R7VA 3MGJA 5D0RA 3LGNA 4ZJOA 3SEOA 2MQQA 2ADBA 2E5JA 2HNZB 1K8AT 3P8BB 3KDOA 3GSDA 3FNNA 4QU6A 1RBAA 4PWDB 1EZZB 3BO2A 5E3CA 4DJBA 2B43A 2Z56B 1N32F 4PWWA 1RT5B 2K3KA 3H5XA 4NCBA 1Y10A 1BQNA 2UVRA 5F3TA 2UXBJ 1FEHA 4ZJLA 4OZ2A 2KI2A 2ZWPA 3M2VA 5KT2A 2APOA 2IYIA 5AE3A 1H38A 3BPSP 1Y3JA 1VQKS 3MPVA 1R0CB 4ZVSB 2V8PA 2ATLA 1ZM2A 4U7UD 3C6UA 4WWSA 3H5SA 2PFDA 3D67A 4LF6F 2BJ1A 3UFCX 2HQ3A 1S48A 1I94J 4L6V3 2B4PA 1MN9A 3EGVA 2DGQA 2L48A 1GK8A 2HBZB 2R2TA 1YJUA 3DRRA 2GHPA 2E7WA 4OYMA 3SFUA 4E2FB 3PTWA 2VG5B 5C5JA 2E5LF 1FNMA 2XWYA 1VQ9S 4EUVA 1CG2A 5KFEA 1NO8A 2EFVA 3KJVB 2EKNA 2CJAA 3X1LB 5KT3A 2KFZA 3B6BA 3AQOA 1SKUB 4XDCA 4ZCKA 4HT7A 1TAQA 2WK4A 5IT0A 3W5ZA 5J2PA 2DISA 1M5VC 1MROB 3CJ4A 3DGPB 2J7WA 4QWAA 1U0SA 4F3OA 4A8XA 1JMTA 2CPDA 4DU8A 2DXFA 5GMEA 2HFVA 1ZAXA 1S1WB 2EK1A 2XHCA 2V34A 3QWPA 1SH3A 1N54B 2E29A 4OV6A 3RR8A 4BS2A 1DQ9A 1SH2A 3PY8A 1GTHA 3UDVA 1HBNA 2JEGA 2YXLA 2ROGA 3GQCA 2VDIA 4K0KJ 1M5PC 4FF2A 3BSAA 4ZHRA 2DEIA 3GIJA 1QTMA 1TK5A 1HQEB 3IAS9 4NLVA 3BH6B 4DR3J 4DZ6A 5IZHA 3I31A 4QWBA 2CNOB 1RHQB 1WI6A 5CYJA 3BDPA 3C19A 1PCAA 1YKWA 3ILJA 5L9NA 4V19J 5KFKA 2J0XA 4P10A 3MM7B 4PXDA 1FDDA 2Q1LA 2YVSA 2C28A 2FIUA 4H4OA 3VQTA 2HLUA 4R8UA 1N5YB 1WC3A 1U1OA 1K0TA 1F3VA 4ER8A 5I3UB 1R0AA 2WBMA 1VC0A 1G3OA 3HFVA 3D4JA 4Z7CA 1N8RT 3SDEB 2QLJB 1CJUA 3I0RB 3UQSA 5H9FK 2N4DA 1QAXA 1G1XA 2C3MA 1N36J 3HVAA 3FUYA 2IJNA 5B0BA 2C2OB 4OHVA 3GYGA 3RAXA 1UVIA 3TW0A 4OL8A 2Z8QA 3W5YA 3QBCA 3NMAA 5EX0A 3GJTB 4P2FA 1W2IA 2B5JA 2U2FA 1ZETA 3TQEA 2CADA 2GO9A 4B9UA 2V8GA 1TVRB 2E7XA 5DDQC 5EGYA 2YQ3A 3VQSA 3OFEA 4HT5A 3PYFA 3M8QB 2FZKB 3IA0A 1ZM4A 3L7PA 2IFXA 3HSJA 3KLEB 2YKNB 3V81B 3CJ3A 4OZLA 1MWYA 2VFRA 3C2PA 2BW7A 1XMOJ 2HVDA 4QYRA 5KFYA 3Q8UA 4ANCA 1VHIA 3ZXWA 3MD3A 4P74A 2WOMA 2K1RB 2MXYA 3PYEA 4N8OA 4USVA 1RYSA 2JHEA 1KQFB 5KFGA 1PYOB 3DLKA 1RADB 4QW9A 4QW8A 2AX0A 4DSFA 2MKHA 1IBMF 3FBCA 1TL7A 3NMRA 3MEDB 2DGVA 2HBYB 3I4PA 4RNOA 1T7PA 2PMHA 4KGZB 4TXSA 2XYGB 2OUGA 4L74A 2KYZA 3U7JA 4OI1A 2ZBQA 3OFFA 4OI3A 5HBMB 2V4JA 1WSVA 1NLKL 3D1OA 3AD9C 2BABA 3F73A 3BYRA 4EWTA 1W25A 2I1RA 5BJRA 3PW2A 2GVZB 3JSMA 1YGYA 2UU9F 4K2JA 2ZOFA 3FRYA 3DI6B 4WIIA 3MM9B 1TK8A 2QFJA 1G4CA 3GE9A 1WF0A 3L3CA 4G1QA 4FYDA 4WKRA 2XHWA 2Y1LB 4QWCA 3M2UA 2VB6A 1R6VA 2FTRA 2J0WA 4NLTA 1XMQJ 2KG0A 2BJ7A 5JVHQ 1RDRA 4LIRA 2K7JA 1KFSA 2QYCA 3O8WA 4JI5F 5IC4B 4WFZA 4B9SA 2YH1A 4DSJA 1S0MA 1QVFR 5D3GB 4DR6J 2VU5A 2ZH5A 4ILLA 5IM0B 3W62A 4XTTA 3DOKB 2WONB 1AA1B 3KWMA 4ELUA 2KU7A 5D78A 5KFIA 3ISND 4TQSA 3POTB 4LF7J 3TANA 4KB7A 2KT5A 2MZSA 1RWVB 2MQNA 4O3SA 3NAHA 2R4FA 2XO6A 3KLGB 4IKAA 4RW6A 1GMWA 4M63A 3ITHB 2L08A 4URQU 3CD6S 2RS2A 2LCWA 5HJXA 1BLUA 2PMWA 4RZRA 5KFOA 3MECA 3K5PA 4NEYA 2HWHA 3V2UC 4RL1A 4RBTA 3H4DA 2OSQA 1ZM3A 1KQGB 4TYBA 4ED8A 1WC5A 4B17A 2KL8A 3TQ1A 4OI4A 3QFHA 4EYHB 1H2VZ 1U4BA 3OJSA 4N41A 3KHLA 5I3PA 4PQUB 5LMNJ 2G2OA 2FVQA 4IG3B 1BXNA 4DF8A 1R89A 4WZMA 3CJRA 5AXNA 3S8SA 3K59A 1KNZA 2ZBCA 4PG7A 5KT5A 2MQLA 2UUWA 2IAJA 1I1GA 4ECZA 1VRUA 2A1BA 4DHVA 1N33J 3MR6A 3M9MB 1T9XA 3MAHA 2QL9B 2V69A 3RBDA 4NLQA 1FT8A 3KLFA 3BO4A 2DCUB 5AXKA 3VAGA 2J9CA 4TLRA 1D0EA 1H6KX 4JI6J 2CG8A 4YB7A 5JUMA 5KT4A 4DN9A 4DG1B 2CRLA 3SQGA 2VQFJ 3M1VB 3WX8A 4F3QA 5HJYA 1U6ZA 1KRPA 4NI2B 2J5AA 4ZP8A 4NXMJ 1VQ6S 3CVKA 1T0TV 3TI0A 3PACA 4DSLA 1I3OB 2BX6A 3FGVA 4W98A 1MMNA 1PC4A 5EWFA 1B0PA 3HZGA 4DF4A 3KK3B 1PO6A 2GIFA 3D5MA 3KK2B 1YX2A 4B9VA 4X62J 5A8RA 3G82A 3JXOA 3QLHA 2K2PA 5E5NA 4OI6A 1FF2A 2EFNA 2QGFB 3HKWA 2VUGA 1UCNA 3ETMA 4V19X 2MQMA 3FBFA 4WJBA 4CIOA 2CVEA 4J9KA 1JXEA 2VPXB 5EN1A 4DPUA 3HCXA 1RSCA 5KFNA 3A4TA 4UOGA 2P6SA 1E6VB 2PC6A 1TFWA 3MOJB 1QAJA 1T9WA 4UY85 4DV6F 3MM5B 5KFJA 1K1QA 2A18A 1OS5A 4OX7A 4GKKF 1Q8KA 4NLOA 3OTOF 3TJAA 2J6SA 4HR2A 4TLQA 5KG2A 8ATCB 2UXCF 2MQOA 3ZO7A 3V4IA 4DL0C 1RE1B 1FJ7A 3LOUA 3OHAA 4CLZA 1WTBA 1HQUA 5A6WA 1VMBA 1M1HA 4F2RA 2FGOA 3R1HA 4I6WA 2B7BB 2FHKA 3LPEA 4DXLA 4PG8A 1RT2A 2O3DA 3M8WA 3CUNA 1T9UA 2G2ZA 3M32B 3PW0A 2YPZA 3TAQA 2RQCA 2DEJA 2W4DA 3CC7S 2RIJA 4GO5X 4XO0A 3M8ZA 5J1NA 3RB4A 1GQEA 2XM3A 1VIXA 1WKKA 2E5HA 3J80U 3SCKE 1OQ6A 3ENAA 3D3BJ 1Q82T 2FVPA 5E33A 4OMFG 4A46A 4C8ZA 3CD0A 1R3NA 5CCMA 4P2MA 3UNGC 5IOLA 1YI2S 3VALA 4JI7J 1VRTB 1IBLJ 3K58A 4KFBA 1S10A 2MKSA 1URRA 3E8OA 1RGVA 4FXWA 1IJFB 2NUHA 3CCLS 4KTQA 4JV2A 1R8HA 1Y5LB 3RRHA 1U1LA 3D66A 4JYAJ 3D1HA 2HS0A 1DAXA 1HW9A 2EBEA 2UUBF 1ZBTA 4JI0F 2CZ4A 2P9CA 2IYGA 4CLYA 1J27A 3R2CJ 3OT9A 1RAOA 2J7KA 3NS6A 4JBCA 4DUZJ 4ZVQB 3H2UB 2XSJA 3MM6A 1S9GA 3P45B 4MFBA 4IRDA 1WC4A 2VZ9A 3Q8SB 2QC3A 2X1BA 1M0SA 2LEAA 1KVIA 3ZTSA 4OZNA 3M2RB 2COLA 2HHHJ 3AY0A 2MGZB 5J1PA 4LJMA 3NOCA 3DLGB 4GC7A 4LF5J 3QZ7A 2ALZA 3BSNA 4V1Ak 1H2TZ 1X0PA 3PO5A 4NRTA 4RUBA 3W60A 3CC4S 4DR1J 2IJRA 2YX7A 3ADAC 3KKFA 4DR3F 4EBEA 4ZVHA 2BOAA 5CH7B 2ILYA 3JSBA 2Z2MA 3Q2TC 1JWWA 2UP1A 3GFZA 2DNKA 2CDQA 3KHHA 3R7SB 5A8WB 1NK4A 3OFGA 2DVIA 3LP0B 4ED6A 3FFIA 4L73A 3QATA 1OJ4A 4OX9F 4HACA 4KHPJ 2HNDB 2JRSA 2EK6A 3EPIA 2HHPA 4I2QA 3MWBA 4G65A 3ZTRA 5H9FJ 2HQFA 3ILOA 4K5SA 1GT8A 2W7OA 3R2DJ 4B3SF 3OR2B 1RQ0A 1GXUA 2MSSA 4USKA 2GA7A 1RHRB 2D9PA 2QLWA 4X4SA 1NM2A 1F0XA 2QLBB 1JNRB 4WKYA 5J2QB 1E6YB 2ZD1B 1EB0A 4QYZK 4IRCA 4LF4J 1U02A 2Q66A 1FFGB 3WC0A 4PWUA 3TVZA 4M5HA 5H9EK 2VD3A 4NLDA 2HFZA 3BH7B 4ZKAA 3QT7A 4NLRA 2HMIA 4NZ0A 2QN6B 3CTRA 2OD6A 2R7XA 3GYXB 1PG5B 3MUVP 4LFBF 2CKWA 3EXCX 1NPPA 1R8AA 4QPXA 1S1XA 3L9ZA 3NS5A 1FO1A 3GSIA 4FXDA 4CO3A 2J7UA 1HNXF 7AT1B 1BQNB 5AJ3F 4URGA 4OYZA 4NL5A 3TZYA 2H65B 3M2VB 1BWVA 4DR5J 1P8GA 2W8LA 3AJ2A 1K1SA 2MY7A 3JQMA 3C14A 4D3HA 4I7FA 3C6UB 1NCLA 2GCFA 4F7VA 1RA6A 4KY3A 4RW8A 2N7CA 1WUUA 4ZVGA 1ULRA 4CNYA 2DRAA 3AQPA 1IBCB 1RTDA 3MEEA 3A8KA 2XNQA 2V4RA 4DCPB 3DRRB 4FKYA 5RUBA 3W7BA 2XMTA 2DNZA 4NLXA 5LL6d 1D8YA 1ACMB 4JI2J 3AT1B 1M1GA 2MEWA 3MAQA 1PJ5A 1JLFA 1Y5NB 3M05A 2EI5A 3IP0A 9RUBA 3JSRA 3K5NA 5J2PB 3NNHA 1RTJA 1LKZA 1XQIA 3FCHA 1RWUA 2XCAA 1IR1A 4KH0B 4L76A 2MKKA 3G8QA 4NOHA 2M5YA 2MZRA 3FCVA 3J7YU 4YDDB 1T02A 3D28A 2DY1A 1IKVA 3EE3A 2AYBA 3OXGA 2D9OA 3BZQA 2GJ2A 4P7TA 4O3QA 3GIRA 3D6HB 1KONA 2NSBA 1HBNB 3DM2A 3EX7B 3W2VA 4F26A 2GFFA 2OO4A 4NCGA 4W92B 4ZHRB 1CC7A 1XK8A 4WYLA 4P6QA 1X9SA 4KT0C 5B0AA 2HBRB 3PXGa 4A8YA 4DU7A 4A8WA 1HL6A 2OEJA 1MMLA 2ZUAA 2D69A 4X4OA 2DRBA 3FQLA 1CSJA 3CE8A 2AJ1A 2KXFA 4A8QA 4WU2A 2CXEA 1VQ5S 1RACB 5GAEI 3UCUP 5GAHU 3IG1A 2R2RA 4H4OB 1QUVA 4R8UB 3FVYA 2MKIA 1X4EA 3LAKA 3CCJS 1KSPA 3H98A 4B3OA 1Y00A 1R0AB 3W8GA 1KKHA 1KQSR 4JI4J 4TU8A 2CNLB 1F2HA 4F0KA 4X4QA 1R31A 4NXNF 5A0YA 1CJUB 2GQQA 2YX1A 2YNGA 2RNEA 3GWCA 2BV3A 3KMSA 5LM7E 4QBUA 4BWJA 4OYIA 4QQBA 3NCPA 4CLPA 2VJVA 1TZ0A 3HHKA 5HMXA 2YNFA 2ZM6J 3QJLA 3QO9A 2ZH7A 3IM9A 2B5JB 2AMCB 5F8MA 4ETZA 3KLHA 4Q2LA 2MLYA 4BHQA 1R6YA 4D3GA 5HQLA 2DHHA 1O8BA 1S12A 4DR4J 1XNQJ 1NPRA 1B4SA 4FPRA 4USMA 4ZK7M 3MOZA 4YMEA 1RT3A 2N3OA 2DCLA 4IO1A 1YJWS 4USTA 1VQ4S 2BM1A 4FYVB 2WOMB 3THTA 4LQ3A 2QE5A 5J1EA 2M8DB 3ZTOA 4PG5A 1LWFA 3DLKB 2C3PA 4RW7A 4I69A 2ZJPQ 4ID8A 2CIMA 4NYOA 1B99A 1TL7B 3OBIA 1X4GA 2HRUA 1NH8A 3G86A 2VQEJ 2KYXA 5SZTA 1V3SA 5K5MA 3KK1A 5KFTA 4IG0A 2YWWA 2MJUA 4ZPWR 2PI4A 3LAMA 3M9OB 4R0JA 1VHFA 2JLEA 1FK9A 1WHWA 2V4JB 4AQYF 1N4LA 4KGVB 4DV5J 2FY8A 3EUNA 3VGUA 1YRXA 2CQDA 1LEOA 3GU0A 2HZVA 4LFAJ 3CJ8A 4LSNA 5DQIA 2W9BA 3DDKA 2YX4A 3D0GE 3GR1A 3JSMB 2IMOA 3NGRA 4TY8A 2W4CA 5L46A 3IRXA 2N3LA 2CJBA 1ZZNA 5G0RA 2BACA 2V8DA 1VQSA 4G1QB 2QMUB 3D0HE 2J8SA 1SJ1A 2F8EX 2N4CA 3M2UB 5D0GA 3KDNA 2E5GA 2D41A 3WBZA 1U48A 1VQNS 1FJGF 4NZ7A 4K4WA 2HURA 3GJQB 4BC9A 4I1TA 4LQ9A 2OSRA 1WG1A 1Q5YA 1YJNS 3TUJC 2VH7A 2BQUA 4E8UA 1U25A 5DGAA 5L8RC 3I56S 1YK9A 1Q8IA 1HPZA 3LWLA 1X4BA 4CO5A 2V9WA 1NMEB 4O3PA 1U6FA 1G2EA 4OI2A 2RRNA 2DKOB 1U8WA 4EU0A 3PG9A 5A8KA 1SC3B 2OP5A 1XN9A 3R5GA 4RW6B 1FDNA 5JJBA 1GAOA 2E7VA 2B8PA 2R7UA 2IIHA 4A8KA 3NCQA 3EPGA 3OL6A 1RWXB 2GIRA 4MIWA 3MECB 1X5PA 1X7VA 2RD5C 3PNIA 2VBXA 1H7XA 2IVMA 1FHTA 2HPUA 3BREA 3JAMU 1BGXT 2VF3A 1Q1KA 1QUPA 2NXNA 1U7LA 5T14A 2OTLS 5D6GA 1CBKA 3TUIC 3CCRS 2NSCA 2JZ5A 3H7HB 4ZVOB 1B7FA 3HD2A 1D09B 1VJQA 4PXEA 3J7ZT 2HS4A 3S1TA 4NPOA 1CVJA 3TA1A 4LF8J 4IR1A 4G1PA 2W25A 2HFOA 2HVEA 2B4OA 2LDYA 2R7OA 4NX9A 3K57A 4NA3A 1OQ3A 2IAJB 2F4VJ 1VRUB 1G6BA 2DXDA 4NLWA 3T1YJ 4GC6A 2WVBA 3RW6A 1O51A 4A4JA 3KOAA 1UFKA 5DG7A 1VS3A 1QY7A 3PEHA 3KLFB 4NMLA 1S49A 5AT1B 2DH9A 1IWGA 4J90A 1D9FA 4PR6A 1XNRF 4QIEA 1UPMB 4JI3F 3K5MA 4HEA9 4NLSA 3MHYA 3SQGB 5KAKA 2JNJA 2EG2A 1VIOA 3BN7A 1QAYA 3BSOA 1WNEA 2E1PA 4WFBQ 1VFJA 3UDEA 4KPYA 3GCXP 1U8SA 5A8RB 3G82B 8AT1B 3QLHB 1R8CA 2BBEA 3IGNA 3N9UC 1KS2A 3FDSA 2Z2ZA 4U9RA 5HROA 3QRQA 1DARA 3C8YA 4QYZJ 3LP2A 2P9EA 4N76A 3K89A 4OZ1A 2CPIA 2AZ3A 1H7WA 5H9EJ 2J9DA 5DM6Q 4ZCMA 1HI1A 3OR1A 4FF3A 1S6PA 1HNVA 1KVJA 2OPPA 1SJQA 2BJ3A 3HP6A 4NEZA 2BEFA 2XY6A 5BR8J 3MAAA 4MK9A 2NYIA 5GADI 4U96A 5KG5A 4KGXB 3A1YG 4ZVUB 3Q8RB 4KV8A 1YJTA 3IR5B 3V4IB 5T41A 3C16A 3ICLA 4GVBA 3RB6A 1HQUB 3Q24A 3P3DA 1Q8LA 5I42A 4GO7X 4ZITA 1FTRA 3CCMS 1RT2B 1FRIA 1JNZB 3M8PA 4N77A 3G6ES 3DU5A 5DLGA 2XLIA 3MCNA 1RCOB 2MJNA 4DR2J 2DGWA 2AJ0A 1P1LA 2LU2A 1NB2A 4ECQA 4JI1F 1CJKA 4KO0A 1GH8A 3MEKA 1CJTA 4Z7YA 5G4DA 1V3RA 1TKXA 5C42A 4C11A 4WXOA 2W2OP 1NHUA 2VIHA 4KFBB 2HHWA 2F3JA 5EDWA 4PXBA 4DL6A 2ZZTA 2DPJA 1NDKA 3W2WA 5F8IA 4F4KA 2KFYA 3Q86A 4LRAA 1SV5B 1X5SA 4RW9A 1T3NA 3I6PA 2VBYA 1IM4A 2H5IB 3SV3A 4LREA 3CDEA 2Z0GA 3MD1A 4LFCJ 3HKZD 3H5YA 2XSJB 5A2QY 4IQMA 3MM6B 1S9GB 2EPIA 4MFBB 4X66F 3AB2B 4F50A 4OHWA 3J81j 3M8SA 1TAUA 3DRSA 3ULHA 1EIYB 1NJIT 5LMUF 4J9OA 4I67A 1XIQA 1P9YA 2UUTA 4Q8EA 2XB2D 2W7AA 4KR0B 1U2CA 1U6BA 1FFWB 1GMVA 4YQWA 3OVAA 4JP8A 2ZDPA 1AFIA 4Y2IA 1RU2A 3BV8A 3ETOA 3GTYX 3UN5A 1RBLA 3UR3C 2C2RA 2HS3A 4B9NA 1MN7A 4LRCA 1Q7LB 1OY6A 3DOLA 4YR2A 2HG4A 1KTVA 2NXCA 4IRKA 1R0BG 1C1BA 1HNWJ 3O5TB 1QTNB 6FD1A 3FFIB 1RISA 3VGVA 3Q22A 5HMZA 1LFWA 3UN3A 4HACB 3GFYA 1Q5VA 2Z2LA 2RJZA 1MU2A 4I2QB 2MHNA 2EG1A 2RSQA 1U1RA 2X7IA 1HARA 4UUXA 2NCKL 2VODA 4EFAC 1FXRA 1AFJA 2NXUA 1GX6A 4DL3A 5ETRA 1S6OA 4K5RA 2GQCA 3GONA 1SBRA 3EICA 3IAM9 2ACYA 3A3NB 4A48A 4DR4F 1WF2A 4AYBD 2HMIB 1Z2LA 2XZWA 4DV4F 1UA0A 4B3RJ 3UW1A 1HQ2A 4K7QA 3JTPA 1S1XB 3N0VA 3DLBA 4USWA 4DUYJ 3BS9A 3G8TA 2U1AA 4BLGA 2RRBA 3QSYB 4DFMA 1Q16B 3MPWA 4PEOA 3SMZA 3TZWA 3FEXB 3MTKA 2CNNB 2KXHA 3PVXA 3D9BA 1L5UA 2YWKA 2HQGA 1VBXA 1NSQA 3PW4A 2OD4A 3PJXA 4P2SA 3PRBA 4ZJQA 2PO4A 3LANA 3SCJE 1CEZA 1CPZA 2JOQA 4I64A 2ZFHA 1WG4A 4W4MA 2QSWA 3C14B 4I7FB 4ED1A 4RW8B 3G6YA 3BGFA 4RNNA 4IH7A 3CMQA 4UF4A 1RTDB 1NNDA 3MEEB 4MKYA 3HK2A 4Z37A 3KXDA 3A8JA 5IM0A 3L4BC 1QE1A 3QWUA 1RXOB 1JX4A 2FY1A 3I0SA 3CCTA 4P72A 5CQGA 3DRPA 1KHVA 2BANA 1DY3A 4DUTA 2YQ0A 2W9CA 1AUSL 1JJCB 4XDDA 2ROEA 3QT6A 1ZTWA 2OFHX 2VPYB 2XYHB 1HBUA 1JLFB 1JQGA 3FK4A 1SKRA 3P96A 2KO1A 1WEYA 1BY9A 3OV7A 4PRFA 3AXMA 3HSZA 3BQ2A 4RU9A 1RTJB 2XI3A 3UDLA 4B3TF 3VVUA 3I5AA 3MR2A 4DV3J 1S59A 1Q95G 3M6UA 4DV1J 2QL5B 2MYFA 2P9GA 4OIXA 2GGPA 2FHJD 1M1KT 1HNZF 4GVLA 3BGUA 2W2QP 3J81U 1FWKA 3AB4B 2DGUA 1IKVB 2WW4A 1U49A 2POKA 1HWKA 4KQZA 2JLFA 4DN0A 2DJWA 1P1TA 3ILLA 3DM2B 5LSRA 1YTYA 3W2VB 2CPEA 5D4LA 3HF5A 1R8BA 2MLZA 2A2CA 1QLNA 4J9MA 1N5SA 4NCGB 3DLHA 4LVOP 3VGSA 3H40A 4ATNA 2HRYA 2IM3A 1N88A 2FJVA 4XPEA 1DHMA 1GXLA 2EFGA 5KFQA 3MUMP 2XI2A 2ZBIA 4DV0J 2IM0A 1F1BB 3SSQA 4B9TA 2BKNA 3B8HA 4CLWA 4DPOA 3C6TA 1FD8A 4YY3J 1MLAA 2QO3A 1B70B 4Y2CA 5EUHA 3IG1B 4L72B 5BYSA 2CPHA 2V67A 3BPDA 4TY9A 5AE2A 1IBKJ 4B3OB 4QZVB 3ZTQA 2JL9A 1HYSA 2HGMA 2KZMA 4H54A 5A0YB 2DIUA 1JLCA 4LMZA 1AYEA 1KOHA 1HR0J 1NH7A 2YNGB 3ENQA 2UXDJ 4CO2A 2ZVSA 2FHMA 3MUTP 2YNFB 4ZCIA 1X4CA 3EZ5A 1RWKB 1N5TA 3QO9B 5KG7A 4K50A 4CLTA 2X3GA 2KVIA 3KLHB 1FJCA 4I0WA 2R7TA 4PAAA 4QJVA 2KTQA 3O44A 3DKDA 1NZ8A 4Q5VA 3V6DA 2ASYA 2OAUA 4LF9F 1AUDA 2XYPB 2DPIA 3JS9A 5HVFA 1RT3B 3O6QA 3AHPA 1NKBA 3PV8A 5B0FA 4RNMA 4Q2MA 5K8OA 1HW8A 5THWA 5J1EB 1LWFB 1PJ7A 2GQ2A 3GG1A 3HVTA 4RW7B 1BE4A 4JV5J 1S0OA 1APSA 3D68A 1M90T 3S7RA 3EWGA 4CP5A 5A6PA 1C0UB 4ANEA 2HHSA 3KK1B 2HHVA 4MIBA 4IOBA 4EK2A 3QRRA 4IG0B 5LXYA 1JLGA 5K8PA 2C2DA 2W01A 4ZS6A 2A6MA 4Z2XA 2DR9A 2N7YA 1FK9B 2HK3A 2UUAF 2W2NP 3BGRA 2ZH9A 2WW8A 2YWEA 4LSNB 3HLUA 2LXIA 2W9BB 4NMXA 5KG0A 2MKCA 1KTQA 5DRKA 1RAIB 4TY8B 4O3NA 1XMBA 2C42A 4C0OC 2JEIA 3IRXB 5CA5A 3VAIA 1NDLA 3LF0A 5G0RB 1WF1A 2M70A 4ED7A 3DYAA 1RWMB 2GS8A 4X64J 2DR8A 2GVDA 1NB7A 3WQPA 1UZHA 4N7TA 1J5EF 4CLFA 3Q0AA 2KM8C 5B08A 2DHSA 4M1KA 3THVA 4LBIA 3R5JB 4CLUA 2OHDA 1GX5A 4ZPBA 5CHCB 5DO2A 4XIUA 1N34F 1QSLA 4OJ1A 3K8VA 1TKDA 2HZCA 5U47A 4JI8F 2WVEA 4ZLPA 3ZZUA 1HWLA 2HFNA 4DL2A 3CJTA 4DV7J 3V5RA 1HPZB 2DH8A 4DLGA 1EKSA 4CLKA 4C6AA 4YHHF 3H90A 2R8HA 5A8KB 1NXIA 3SXLA 2XMUA 1YRUA 3UVJA 5SUHA 2G0CA 2B7CB 1NSKL 3W64A 3EGNA 1L3VA 3AH6A 4ELVA 3EZOA 2H5JB 1KR4A 3EVWA 3CNQP 1XTZA 1S0VA 4NLPA 4AXIA 1LXJA 1NJWA 3DGVA 5K8NA 4WTOB 3TYTA 4CRJA 2FJDB 4N8NA 1U1MA 1SI9A 1HNIA 1BC6A 1FRMA 4CO4A 3R9LA 3ISZA 2GIQA 4TQRA 2KM8B 1JLEA 3NGSA 3VHQA 2F65A 4KAIA 2W24A 3B4MA 2P5VA 3H42A 2HQIA 1S6UA 4ZVTB 2VFTA 1SC1B 4FXVA 2KB2A 2LU1A 3E2EA 3K5LA 3HT3A 3DRXA 1SL0A 4DV2J 2RQ4A 4KKOA 4P75A 3CCQS 4P7VA 2BXJA 4HLBA 3EGWB 3QRPA 2OLWA 4WPAA 1NRKA 2Q43A 3T1HF 2O5DA 1FX2A 4Q8FA 3TRGA 4Y0FA 5KFAA 2RU9A 2EFPA 1IKWA 1RWOB 5FD1A 4Q44A 1NKCA 2IC3A 2AYEA 2BE9B 3AD7C 2ZEJA 4B08A 4ECSA 3MR7A 2V9KA 5D77A 5GAEU 2VFVA 1LW0A 4KYZA 4CCHA 2M4MA 3KUEA 2IMWP 5HROB 3PJWA 1UVKA 1VQYA 3LP2B 2KDOA 1LOUA 3SFGA 5IT9Y 3EM1A 1NBEB 1NDPA 1HBOA 3G6XA 3EZUA 3CCVS 2OELA 3OR1B 5CD4H 3RU0A 2PD1A 1RWPB 1S6PB 1HNVB 2OPPB 3UR0A 3OPKA 3OFHA 2XGQA 2XS2A 4LIWA 3R6LB 4K8RA 4EO6A 1TV6A 3GV5B 3SV4A 3MAAB 1N6QA 3R5CA 3FEZA 3ZZOA 3BSCA 4W90B 4O3OA 2VPZB 4KV8B 4EYIB 2BOPA 2K8GA 3C16B 2H4YB 2RT3A 5F9LA 2DT9A 4X4UA 4GVBB 1YG0A 4X65F 1VISA 1T03A 1VQPS 5KFRA 2ATCB 5I42B 1FERA 4K2XA 1FXDA 2LVWA 1LFPA 2XLKA 4U8VA 3M8PB 3OVBA 5DG9A 5JMNA 3A3PB 1Q7YT 1O6XA 2V4QA 2E66A 1IXKA 2AX1A 2XNRA 1K47A 2LXUA 1EJ7L 2Z58B 3AJDA 2IBKA 4USJC 2BQRA 3RG6A 4RWXA 4PQAA 5B0GA 1CJKB 3G6VA 2J8AA 4KO0B 3RTVA 1CJTB 2C3UA 3DOMA 1U1KA 1HD1A 2OMOA 2PIIA 1TKXB 2DNMA 2C2NA 5C42B 4C11B 4UY8T 3H4BA 4OZ0A 4KPCA 5A76A 1H3DA 2OI2A 3JTNA 3ELHA 4AL6A 4J7CA 4MIAA 3ILIA 2D74B 3W2WB 2CQBA 2PMZD 4BBYA 1TL5A 2MTLA 5HVGA 4DR7F 4HDHA 3C15A 4RW9B 1RLDA 4CI0B 1PSDA 3W8PA 3OTCA 4IH6A 5GMKa 1V5IB 1RT7A 3NCRA 3EGZA 2UVUA 1FWLA 2YPYA 4DQRA 1S79A 5HP1A 4DX7A 1T9TA 3MPDA 2GJIA 1BD6A 1FA0A 5KFFA 3UO0A 3DRSB 4M5DA 2FPHX 3DHXA 2XY7A 1RTZA 1LK5A 1X4FA 2VKZG 3OTDA 4XK8C 5CZXA 1XWLA 4YB5A 3LO3A 4YR3A 5H1SV 2GO8A 1GTEA 4EGLA 3G2XA 5C25A 2ASLA 4HI2A 4KE5A 3IO1A 2P2CB 4FPIA 4J91A 1VGYA 4ED4A 2HLTA 2Y1IA 2QMXA 3DOLB 1EARA 4B3MJ 1C1BB 3CGIA 1ICEB 1N56A 4H4MA 1NK5A 2ABYA 4ZP7A 1ZYQA 4QOTA 4X84A 1WD6A 1O0PA 2KRBA 2WSFC 3T5KA 1QSYA 5IWAF 2ADCA 2RF2A 4IDKA 3CDAA 2QV6A 1MU2B 4UZBA 3PYGA 2KJVA 3CCZA 3NY0A 1TK0A 3TVYA 4BCAA 1SPBP 3D1QA 5KFMA 3HT0A 3I55S 2V8VA 2W4PA 3CCSS 4KBIA 4J9NA 5ETVA 2PEBA 5DETA 4HHHA 3W1YC 3OXLA 1N32J 2NLWA 1T95A 1Y11A 5KOXA 2UV8A 3UN2A 2VG6A 5BYQA 2QEXS 2ZKUA 2QA1A 2VFSA 2BKPA 4AUKA 1UWAA 3TA0A 4ECWA 2KHCA 3N28A 2J9EA 1H98A 4EBCA 1IQZA 2LQ5A 4PABA 1MSWD 2OEKA 2Y1JA 5FDLA 2NQPA 3TP2A 4LF6J 1YBTA 2I0XA 4M5JA 2RS8A 1SL2A 3GFXA 1D1UA 1SXLA 3HPOA 1LQ9A 3A12A 2KXNB 5ETLA 2HEKA 1ITPA 1WACA 2F8MA 1R7IA 5GAGI 1FVQA 2E5LJ 3FSXA 5ETSA 3PR4A 4M5GA 3PW7A 2OH2A 4DSEA 2WCXA 2DK2A 4X2BA 4YOEA 3AODA 4MH8A 5EX3A 1HIYA 3O2IA 3EXYA 2V8HA 2XTJP 1TMMA 1FVSA 1YITS 1SC4B 2V2ZA 1Q81T 1WJ9A 2MY8A 2FGCA 4L75A 2DNGA 1SQEA 2ACMA 1DRZA 5BYRA 3DCAA 3VAFA 2P6TA 1QE1B 3J7Z5 1SIZA 4J9PA 4DI6A 4FF1A 3I0SB 2DH7A 3DLEA 2HK2A 3MPUB 3SCLE 3DRPB 5D0EA 2BANB 4HHUA 5CYMA 2W9CB 2ZZMA 2PEHA 4WZQA 2L41A 4LF2A 1HBUB 5IS2A 3R7NB 1UEVA 3P49B 1WWHA 4ZP9A 4YP3A 3V6KA 4DWIA 2G4BA 1PYTA 3KTQA 4AXJA 1Y0HA 2E9ZA 1NK6A 2UZAA 1B3TA 2R7RA 2FHOB 2ZKTA 4AD6A 3IGVA 1UWBA 2GGPB 4RWWA 4FNHA 5DS7A 1RI7A 3K2YA 3BDEA 3CULA 4AL7A 1A0OB 3OVSA 4J37A 5M2RA 3LP1A 1RT1A 2HW3A 3T19A 3K17A 2ZJRQ 4F4ZA 4P73A 2NR0A 4O4RA 1AT1B 1WELA 4WE1A 4C48A 4ETXA 3RBXA 2CJYB 3PJ9A 4C3LA 3W66A 3PW5A 5F8LA 2UUCF 1VLYA 3I5BA 3AAWB 5L1IA 3CPWR 4Y65A 2CA9A 2DNPA 6FDRA 4QR1A 2A2DA 4MKAA 1M5OC 1QM9A 4ICLA 1UJ6A 5D15A 4NYPA 2AZ1A 2B51A 1JJ4A 2HHXA 1CJVA 3L7OA 2DO4A 1C1CA 3T5LA 1EQ0A 1WHXA 5HATA 4CYUA 5K14A 3C6TB 2I8EA 1U2RA 2Y3YA 3L95X 3UE2A 2AD9A 1YDLA 2DYAA 4LBPA 4F04B 4HYKA 2B3TB 1HI0P 2QSFA 2XGPA 5DZ7A 4Y2KA 5EWEA 1U2FA 4Y3CA 4ID5A 3KNGA 5LOQA 3CB4A 3NWRA 4WU3A 1HYSB 3OLBA 2JEFA 2NXEA 4WFNQ 5HAOA 4GKJF 3QMQA 5KFLA 1JLCB 4PKDB 3KHGA 2FLPA 4IOAQ 1IQTA 3FC9A 2IDLA 3NNAA 2XZDB 1F9EB 3M30A 1NU4A 2F63A 1EQMA 4DFKA 1NK9A 2QT7A 4DFJA 1IBMJ 1RZMA 4DQSA 5HQ8A 2JVOA 3U27A 5HK4A 3VR1A 1FKPA 4LSZB 3V6DB 4C8NA 5F0UA 3IC1A 2IJFA 2VASA 4AE5A 2AGPA 3TX0A 2J9DE 2F7VA 2IA0A 4QIVA 1X0FA 5C24A 3MMBA 2KH9A 4YN3B 3BGLA 3SQOP 1S9EA 3GP9A 2WZ1A 3NP5A 1CQMA 4CM2A 3PX6A 2UXBF 3C66A 4EZ9A 3NKYA 5CYQA 3W5XA 1QAIA 2ZHAA 3HVTB 2E1MC 4C3MA 2H54B 4Q7AA 2UU9J 4DX6A 2CPFA 1UETA 2CWKA 3W3SA 3A8EA 1RAJA 4ZVEA 2I5JA 2KN4A 1JLGB 1XR6A 2ZBRA 2ILZA 4MKVA 1I94F 4C98A 3I32A 3W9IA 3GMGA 1SJ4P 4H4KC 1NK7A 2W8KA 5KG6A 3BGRB 3W61A 1T9YA 3CD7A 4Y6IA 4AL5A 1UPPA 1MWZA 3LPYA 4JI5J 3UNYA 3HMJG 4XPCA 2B9YA 3K0JA 3PIOQ 3NGTA 4K4VA 1NSAA 2IHR1 3BBFA 4OYBA 5KFBA 3DYAB 4L3NA 1SV5A 1JLQA 3CXCR 3HD1A 3OW2R 3DXSX 2GVDB 4DFPA 2UV8G 2G1HA 3LW5C 3PCOB 3OSPA 4LUBA 3CSKA 2YKMA 5B7WA 1ZTTA 2C2KB 4CH0S 4ZPTR 5F8NA 3TA2A 3TAPA 5L1LA 3TJ9A 4QPTA 2GV1A 1HI8A 1RP5A 3O3LA 4TN2A 3NS7B 2DNHA 4CT9A 3L7UA 4E98A 4ECVA 3QGHA 4PG4A 1LNQA 4DSKA 1UJ5A 2YKQA 3Q8VA 3OHBA 1EKRA 1SIWB 3PDNA 2VICA 1YRTA 2OEMA 1X4HA 3IM8A 3HI9A 4K0KF 4O0NA 3PEJA 5KT6A 1KN6A 4Q0BA 5J2NA 1N0UA 1JLBA 4OYWA 2VOOA 2JC1A 1H74A 3DDNA 3HXMA 3UVJB 1RT4A 3TARA 3DNCA 4ES2A 1RT6A 1KLMA 4QCLA 4ZA1A 4ENOA 1F6TA 3FMBA 3GB0A 3PFEA 2QIFA 3NWGA 5AXMA 1S72S 2CQPA 4ZP6A 2XS7A 3IR7B 1JJHA 2I2YA 2BUNA 3UDCA 3OUYA 2DD8S 2DO0A 2CQHA 2EWHA 3DXBA 1HNIB 2HNYA 3EVOA 1SL1A 2VBWA 1UEUA 1WDDA 1A9NB 1VJWA 3JSYA 1L3KA 4JUZA 1JLEB 2V2VA 4OHYA 3BEGB 3NAIA 2FB0A 2RU3A 1NPKA 3CT9A 1N36F 1ZH5A 1IKYA 2MZJA 3D6TB 3LALA 5C7PA 1YSJA 2OPSA 4IH5A 1SB6A 3KYLA 3FZ2A 2OPRA 2V50A 3JB9k 1S57A 3R5AA 1VBZA 4YFUA 3I9V9 4KKOB 5IFMA 2HWIA 4LR8A 1M5SA 3HSGA 2EC0A 4RU2A 3LGHA 5HQMA 2PE8A 5D8HB 1QJHA 1M5HA 1XMOF 2XQCA 3QGIA 1IKWB 2XMWA 3WC2A 4DV6J 5F3ZA 2HZAA 1W2BR 1V5VA 2IC3B 4M5IA 1FNXH 2PI5A 2HHQA 3N6MA 1CC8A 4GKKJ 2MKYA 3JYTA 4ED0A 3OTOJ 4CM0A 3MFHA 3TZZA 2CPXA 1RTIA 1LW0B 4UOFA 3DDIA 3R5BA 1X60A 1S9FA 4RBUA 5ETKA 2R7WA 2UXCJ 2AEFA 4P71A 4ECTA 2R8KA 2V63A 3MEGA 1HBOB 4OQJA 4OYOA 3IR6B 3KG1A 5KTQA 3TUPA 5KG3A 4FF4A 2HYIB 4PXCA 2VOPA 3NBPA 3IMQJ 4ED5A 2YKPA 4PPZA 3JQJA 3AOAA 3IS9A 5IV3A 2JEJA 3UD4P 1TV6B 3C46A 4RW4A 1N6QB 4ITSA 5CXTA 1VK8A 4MK7A 1VYAA 3RRGA 3F0NA 3D6MB 4ZPAA 4TNOA 1YBAA 1VCTA 3Q8QB 2XSFA 2LKZA 3RYLA 1YHQS 5KFVA 1T03B 4DEZA 1XMQF 3ZZRA 4J9LA 2KT3A 1HD0A 7FDRA 1UKUA 1WG5A 4IFVA 3SCIE 1PBAA 3MCSA 3WHIA 1IKXA 5D0HA 4U95A 4FYWB 4DPYA 1HWJA 1N52B 2FVSA 3GJSB 1LK7A 2K06A 5IQ6A 2CPZA 1VBKA 1IVZA 2AU0A 3TWZA 2BVZA 1JXLA 1MMDA 2EEYA 2UUBJ 3RUBL 3N5FA 4LT6A 3EYZA 4JI0J 3QJJA 4DR6F 3DOMB 5B09A 1VK3A 5L1KA 3EMTA 1Z1ZA 1PAEX 4LF7F 1HFEL 4KGKA 5GVQA 1KEKA 4ECYA 2VHGA 3AJ1A 3DHWC 3OJUA 2PA8D 1HHTP 2J6UA 2G2YA 2KG1A 3ENVA 4HTIA 1T94A 3B78A 2M3DA 2HVIA 2QZ8A 1V9OA 3GCWP 5AXLA 2VG7A 1PKUA 3C15B 1NUEA 1H2UX 1L3UA 5C2CA 4DBQA 3PX0A 3NEKA 3H5UA 4WF9Q 2JSXA 3ZZTA 1RT7B 1Q79A 2RDJA 1S5ZA 5KG4A 3TNVA 3R7BB 5LMNF 2BYCA 3I4HX 1KD1T 3Q89A 1VRQC 5HP1B 4LRFA 2CG4A 3QYYA 2HHTA 1FRLA 3KLVA 1B0TA 3MF5A 2FJXA 2HQDA 2K7KA 4TU7A 5ETTA 1ZPVA 4M5DB 3HHEA 4I6YA 2Z57B 3PO4A 4NLGA 2AP6A 1TR0A 5ETNA 3SSSA 2ZC4A 5LXRA 4C3KA 1N33F 1RUSA 3UD5A 2SXLA 4OX9J 4NASA 2PN6A 1RHJB 5C25B 2W1BA 3H2LA 3PX4A 4B3SJ 2EFQA 2QMWA 2LEPA 4JI6F 2BJ9A 1LWEA 4Y2MA 2YNHA 2CPJA 2VQFF 2DBBA 2W2MP 2B4VA 3CWJA 3R5DA 4NXMF 4QIWD 1OIAA 2F9JA 3MMAA 1FTCA 3MURP 2GAHC 4ILRA 4DQIA 4H4MB 1VBYA 2VONA 4RLEA 2E44A 4PZVA 1UW9A 2C3OA 2HWTA 4YEAA 2RF2B 4X62F 4IDKB 4E0DA 2WHOA 4EEYA 5ETMA 1R27B 2CWXA 4J5OA 4LFBJ 3IBWA 1TP7A 1VI7A 4PG6A 3MM8A 5FLXY 1ZZFA 2ZH3A 1C0UA 3SIPB 3VZIA 3BN4A 3BR8A 1NJYA 2D3ZA 1HNXJ 3LTOA 4XAKA 2VG6B 5AJ3J 1FNOA 3BBBA 1WHVA 3SBMA 3NGDA 4DCOB 2M7SA 5DLFA 4DLEA 1GMWD 1SUQA 2MSTA 1RU1A 4PPDA 5HN0A 5FDLB 1AXQA 2VFUA 4YUDA 4M95A 3R3TA 1KVKA 4OLOA 3A8IA 2X51A 1K9MT 2F5GA 4ZN3A 1GMUA 2BKOA 2WVDA 5M2UA 1HBMA 1OY9A 5FIIA 2YTCA 4JV0A 2RHSB 1FKAF 3DLJA 2WSEC 1DZ5A 1FRJA 1WTFA 2E1RA 4G1IA 1TKZA 3M8RA 2CPYA 4F2SA 2FVCA 5CABA 4ES3A 4LR9A 4FVCA 1TFYA 4G3IA 1HWIA 2RE1A 1ZAVA 2XMMA 1KDNA 3D3CJ 4WP3A 2AT1B 4MYUA 2NPFA 4GRSA 4JI7F 3UD3P 3GIIA 1IBLF 1TUGB 3DLEB 1RYRA 1FKOA 4OZJA 4TU9A 5ETOA 3DFEA 5CYMB 4FNIA 1N5VA 2L3MA 2XBPA 1UEKA 4JYAF 2XG8A 2JJ4D 5MLCV 4BWMA 4DL7A 2HKEA 2DNNA 2CVIA 2L9NA 1DJ0A 3GILA 3ISNC 3VAJA 2H4WB 4KC5A 2DHXA 1JKHA 1KQKA 2VA2A 1QSSA 2ZNYA 4DUZF 1KP6A 5E7OB 3WIVA 4OHXA 2CQCA 2FQQB 4C0HA 1UWBB 4OZ5A 1Z4UA 2O01C 4TKTA 3AOBA 5LSOA 3CIZA 2PT0A 3IWXA 4YS2A 2DB1A 1AB8A 1FEEA 2ZVIA 2ZJQQ 2OPQA 4M5LA 1UJ4A 4OYPA 2HHHF 3LP1B 1RT1B 1I6JA 3OXFA 1XJWB 1UAWA 2NS1B 3RBZA 2I9SA 5HMWA 1R43A 4LF5F 2IVYA 5FLXU 4WE1B 2D3O1 2ZBPA 1OYEA 2RKIA 3S6EA 3CC2S 4DR1F 2LA4A 3J80Y 1UVLA 1NHKL 2KFNA 1UVNA 4M5KA 1FWPA 4FZVA 3UI3A 4C2MA 4HH1A 1FE0A 4OFZA 3VVTA 3CCES 4NXNJ 4ICLB 2XWXA 4CWBA 2Y8WA 2YNIB 4F0MA 1CJVB 1C1CB 3GIKA 2ZWOA 4MKBA 4CYUB 5K14B 2AGQA 3Q8PB 4HVZA 3IXQA 5J2MA 3VF0B 3N6NA 3KNAA 4B9LA 2V2KA 4RUHA 4KHPF 1N48A 3ZFVA 4QIGA 1CULA 3KJFB 3C3LA 1W7WA 3QIPA 3SSRA 2CNKB 2DR7A 4ID5B 2R2SA 2MB0B 1QVGR 2MZ1A 4CLLA 1RAFB 3G96A 2RQKA 4ECRA 5KFCA 3E3XA 1X9MA 4QWEA 1BHNA 2HFSA 2DNYA 1Y4ZB 4WCEQ 2XC9A 3RAMA 4LF4F 4JV1A 3M30B 3MR3A 3D54A 1IWAA 4N5SA 3V6JA 3B82A 3MMCA 1FKPB 4USIA 1SKWA 4O44A 2ROPA 4CDIA 3O1LA 4N47A 2OGUA 2YKAA 1X9WA 3K7RA 1OYDA 5C24B 3MMBB 1FDBA 4AQYJ 1S9EB 3G71S 5KFSA 2CQIA 3NRBA 4FBUA 2KT2A 1UVJA 1ZA2B 1T05A 5CYQB 1P9QC 4FYYB 4ZLLA 1H0HB 3D6FB 2R7SA 1HA1A 2RAQA 2DGTA 4DR5F 4NYZA 3NGKA 3S01A 4B02A 2ZH1A 3JTOA 3EDRB 2CQ3A 1F5BA 5KFDA 3TAMA 2I5JB 2FC8A 3KLIA 5CD4A 3V4MA 3HVWA 1ZPWX 2R7QA 4YDXA 4IFYA 1RABB 1EETA 4UTGA 1FJGJ 2BJDA 4X4NA 2DY9A 4ZPVR 4U67Q 4WIQA 2QYGA 4HTJA 4R5PA 4JI2F 4WYWA 3BO3A 2DHAA 3LUYA 1UA1A 4P2XA 2X1AA 2BDPA 3TX8A 1S97A 1FESA 2PGCA 3U1NA 1AZSA 2D7SA 2HRTA 4CO0A 1W26A 1JLQB 3H20A 1VQLS 4QR0A 2QFIA 3H8YA 3T1AA 5F8HA 4NLYA 4O3RA 2LFVA 2JLGA 1Q86T 4RPFA 1BWEA 2AV5A 2M52A 1G7CB 2YKMB 2W9AA 4ELTA 4LR7A 4OJ3A 2O1PA 4USUA 3E01A 3PR5B 1U1PA 2NXJA 5GAGU 4KRWA 1U24A 1NJZA 3RAQA 1EX8A 4AFFA 5KFXA 3VAMA 1U1QA 2D1CA 1WOSA 4X4TA 1SJFA 4C8YA 3NL0A 4LSLA 1ROFA 4Q0BB 5J2NB 4M5MA 4Y00A 1JLBB 2J0SD 1JB0C 2RUSA 4WXWA 3M6XA 3ET6A 4EZ6A 2FLNA 1RT4B 1DURA 3GJRB 3P5TL 4I2PA 1XC9A 1RT6B 1KLMB 1O5JA 2VKRA 1FFSB 4KIAA 4CNZA 2V6AA 2QTWA 1YJRA 1U0HA 5DQHA 1TL3A 1X31C 1FX4A 3CO0P 3PZPA 2RMLA 1U26A 1LXNA 2QRRA 1XNRJ 2B6AA 3OUYB 3N4WA 4OLPA 5E2QA 2B4UA 2ZITA 3VCDA 1CS4A 1S6QA 2JH3A 3NLCA 3TR5A 2J0QD 4JI3J 2BW2A 2HNYB 1SH0A 3QFWA 1HMVA 1JJ2R 5DGBA 1SCJB 1WHYA 4JI4F 2XMVA 2AQ4A 1S1TA 4DL5A 4F67A 5DG8A 2WSCC 1Q53A 2AJ4A 2ZHOA 2IPOB 2JC0A 2HQCA 1Q0NA 1RKJA 1IKYB 2XZTB 2E5IA 3NOGA 2HFUA 2OPSB 2GZOA 2BRKA 2ZM6F 3QAUA 2W7PA 2JDJA 1NK0A 2X1GA 1NSPA 2OPRB 4HL9A 2WRMA 5E0OA 3KJQB 3GR0A 2CFXA 4ILMA 2PFFB 2GW8A 2OMLA 4U8YA 2IY5B 1S1UA 5KFUA 2XLJA 2F1FA 2MDAA 2ZH6A 3GV7B 1XNQF 4F4WA 3TVKA 1RHMB 1WOOA 3HVRA 5C2GA 5F41A 3CEDA 4J9RA 2GX8A 1JLAA 2IVFB 4F36A 4NCAA 5ADZA 3IWLA 3D7SB 3RRKA 5LJ5Y 1WKLA 1TKTA 1S1VA 1K0VA 1IR0A 2CJ9A 2RILA 3JYTB 3LGMA 5EHHA 1FCAA 2V94A 4C8MA 2FJEB 5DM7Q 1C4CA 1RTIB 2FZCB 3AXKA 3TJ8A 1H72C 2VQEF 4J9QA 2MMYA 4IR9A 5A2QU 4P52A 1BUXA 3PHEA 3MEGB 4K4TA 3MCOA 1YWXA 3RW7A 2CJQA 1RWWB 3TEHB 4DV5F 4LF1A 1FRHA 5L39A 5ITHA 3NBPB 2PA3A 3PHTA 4LFAF 3T6JA 3CO9A 3IS9B 5L1JA 4DSIA 2H51B 5KFPA 1PAUB 1UW4A 1GXTA 1OO0B 1WDTA 4ZN1A 4FVMA 4RW4B 3AA8A 2VC1A 2PDAA 4JI1J 2AKWB 3X3UA 1ZAWA 2CQ2A 3M7VA 2HIYA 1OSCA 1HWUA 3DC2A 2AYMA 4ZLNA 3RBEA 1N0VC 3G9CA 2DR5A 3BGOP 2DHGA 2Q6CA 4O4GA 2ZHBA 2G1DA 2ZOGA 2CQ4A 4IFVB 3T5HA 2A6OA 2G0JA 1LW2A 3ZNUA 1IKXB 3I96A 3KFWX 2ZE2A 3SI8A 1DLOA 1SQFA 1X4DA 2G13A 3IFEA 3CJKA 2B8QA 3A13A 4HI1A 3VAKA 5ETQA 2EW9A 2MPUA 3E51A 2Y1RI 3QGPA 4J9UE 4EBDA 2ALYB 2QA4G 2E9TA 4X66J 2RDDA 1WOPA 5E3QA 3DU6A 2AJQA 4RNHA 5HLFA 5T7LA 5F9NA 5KT7A 1SVDA 5LMUJ 1U47A 1YJ7A 1XERA 1K44A 2A10A 2DNRA 1J5OA 2IDEA 1IM6A 2VG7B 3I82A 2YWHA 1UFWA 5HO4A 3M9NB 1ZS6A 5LJ3Y 4UT4A 1WEXA 2AEMA 1OY8A 4PYDA 2ZC3A 2B9EA 3UWTA 2ZZNA 2LP4A 3EJMA 1NAQA 4EI2A 2FUG9 2XMAA 3T5JA 3FZBA 1Q8BA 4RUAA 4OV1A 4LF8F 2B0GA 1PBUA 2R42A 1N5QA 2MZQA 2BM0A 3DN9A 2F4VF 3T1YF 3OTBA 2FYXA
chains in the Genus database with same CATH topology
3GIJA 4C8NA 1U09A 5F0UA 2MJNA 3IC1A 2IJFA 4X4RA 2DGWA 4UOCA 2VASA 4AE5A 2AGPA 2AJ0A 1QTMA 1P1LA 2LU2A 1TK5A 2J9DE 4ECQA 1HQEB 2F7VA 2IA0A 4QIVA 1X0FA 5C24A 3MMBA 3IAS9 5DDPC 2ASDA 5L9XA 2KH9A 3BGLA 4NLVA 1S9EA 4JI1F 5IZHA 4KO0A 3I31A 3NP5A 4C8LA 1GH8A 3MEKA 1CQMA 3T9ZA 5G4DA 1VQMS 4QWBA 3PX6A 2AGOA 2UXBF 3C66A 1V3RA 4DOZA 4EZ9A 1TKXA 3NKYA 5CYQA 3F44A 2NPIA 4ZPCA 2YWGA 1QAIA 1WI6A 2FHJA 5CYJA 3BDPA 2ZHAA 5C42A 2XEXA 5L9NA 4V19J 4C11A 5KFKA 3HVTB 1LWEB 2IBOA 2E1MC 4C3MA 2YNHB 2J0XA 3CDWA 4PXDA 3MM7B 1FDDA 1RTHA 2Q1LA 4Q7AA 3IWNC 4WXOA 3HO1A 1DFDA 2YVSA 1VQ7S 1NHUA 2C28A 1R8PA 2FIUA 4H4OA 2CPFA 4KFBB 3VQTA 2HHWA 2VA3A 1A7GE 2F3JA 5EDWA 2HLUA 4PXBA 4R8UA 1UETA 4DL6A 1N5YB 3MMAB 1U1OA 2DPJA 3W3SA 1K0TA 3A8EA 1RAJA 4ZVEA 3W2WA 2EBGA 4KHMA 2I5JA 2KN4A 2M8HA 1JLGB 1XR6A 5F8IA 2QA4S 5I3UB 1R0AA 2ILZA 2WBMA 1VC0A 4F4KA 2XS5A 2KFYA 1I94F 4ALZA 4C98A 1G3OA 3I32A 3GMGA 1SJ4P 1SV5B 1X5SA 4H4KC 1NK7A 3SDEB 1N8RT 2W8KA 4RW9A 1A6LA 4GMKA 4A8OA 3R1LA 3HHLA 5KG6A 1T3NA 3I6PA 3I0RB 4Y34A 3BGRB 2B9WA 2VBYA 1RJJA 3JAMY 3UQSA 3DMJA 2N4DA 2GMLA 1IM4A 1QAXA 1BQMA 1G1XA 3CD7A 2M88A 4Y6IA 4AL5A 2FD2A 2C3MA 2DNQA 3HVAA 3SV3A 4F4YA 2IJNA 1MWZA 3CDEA 2D3OR 2Z0GA 4MMOA 5B0BA 3LPYA 3BM7A 4OHVA 4HHJA 3MD1A 4WK1A 2WTFA 3MM8B 3HKZD 3H5YA 2IRXA 3HMJG 3RAXA 1UVIA 4XPCA 2XSJB 2B9YA 5A2QY 3H25A 4IQMA 3MM6B 3TW0A 1S9GB 2EPIA 4OL8A 4MFBB 2Z8QA 4X66F 3AB2B 3K0JA 3NMAA 3PIOQ 4F50A 4OHWA 5EX0A 1W2IA 1DTQA 2B5JA 2U2FA 1ZETA 4K4VA 3M8SA 2GO9A 4B9UA 2V8GA 1TVRB 1TAUA 2E7XA 3DRSA 2J76E 2H9ZA 5DDQC 2WBRA 5D4OA 3B4DA 5EGYA 5EWGA 3ULHA 3BB5A 2IHR1 4FN5A 4MJKA 5KFBA 2YQ3A 1UL3A 5LMUF 4J9OA 3DYAB 1TL1A 3OFEA 4HT5A 3VQSA 4I67A 4EO8A 4F3MA 4L3NA 1SV5A 1JLQA 3CXCR 3M8QB 3SZ2A 3OW2R 2UUTA 3DXSX 3IA0A 1ZM4A 4X4VA 4Q8EA 3L7PA 2IFXA 2XB2D 4DFPA 2UV8G 2W7AA 3F41A 3ZZYA 3LW5C 4KR0B 4IQXA 3KLEB 2YKNB 1SUQB </