1SV5B

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse Transcriptase
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B03
2CJQA 3D5MA 4QPXA 4I2QA 3BSCA 2ASLA 1FKPB 1IKXB 1FKOB 3DOLA 3HVTB 3JSMA 4B3OB 2FVRA 1FKPA 3GV8B 4R5PA 1IKVB 1TVRB 2FVCA 2YKNB 3BGRA 1T05B 3CJ4A 2D41A 3M8QA 2AWZA 1JX4A 4IRDA 1BQMB 2IJFA 4K4YA 5J2MA 4TN2A 1N4LA 5J2PA 3FRZA 5DG9A 4F4WA 4IH7A 2BANA 4IDKA 2AX0A 4NLVA 4YMEA 3QZ7A 4X2BA 3MEGB 2HNDB 4TQSA 3EPGA 5C24A 3DYAA 2HAIA 3GIJA 2OPSB 2R8HA 4TY8A 1S6PB 4YR2A 4Y2AA 3GIKA 4K4WA 1S6QA 2B6AB 4I7FA 1HQEA 1N6QB 3GILA 2W8KA 2B6AA 3DOKB 2RDJA 2FLLA 4KO0B 1C1BB 3OHBA 5J2QB 4MIAA 4U7CA 4QWEA 5C24B 1D1UA 4O44A 3ITHB 3MEGA 3E51A 5EWFA 3GV7B 3KHGA 3RB6A 2W9BB 1GX5A 1S97A 3DDKA 2DPIA 3OL9A 3MEDB 1SUQA 1TL3B 5KT4A 4ICLB 1S0OA 4RNNA 4WYWA 2C2DA 1HNVB 4J9NA 1HMVA 3FQKA 4Q8FA 1MU2B 1VRUB 1LWCA 5C42A 1IKVA 3N6LA 1S0NA 4Q45A 3LALA 2E9RX 3BJYA 1JLCA 2WOMB 4ZVGA 3KHLA 3EPIA 4F4XA 3NAHA 5KFDA 5EWGA 4H4MA 4ZVHA 2R8JA 2XC9A 4TYAA 2ASJA 1RT1B 2D3UA 2BR0A 3KLGB 5D3GA 4ED7A 1JLBA 2V0NA 4DL3A 1RTIB 4KFBB 3IG1B 1MU2A 1VRUA 2RKIA 3DLGB 1SH3A 3NAIA 1VRTB 4H4OA 5KG1A 2V4QA 1HNIA 2JC0A 3NKYA 2OPQB 3H5SA 3KJVA 4K4VA 4KKOA 3MEEB 3RB4A 3V4IB 1RAJA 1NHVA 2C28A 1S1WA 2HMIA 5HP1B 3QIDA 2DPJA 2ZD1B 5DQGA 4IQXA 1QAJA 4ECRA 4MK8A 4G1QB 2AGOA 3DRPA 4RUAA 2J6UA 1HQEB 1J5OA 2FJXA 4URSA 1IKYB 2HNZA 2OPQA 3MF5A 4NLRA 2AGQA 4IG3B 3MFHA 4YQWA 1RT2B 3C6UB 5KG6A 5F8IA 1S1TA 1RT6A 5KFZA 1EETB 2IBKA 1JKHA 3C6TB 1RT4A 4IDKB 2BANB 5KFFA 4K4UA 4LSNA 1S9GB 3KNAA 4NRTA 1HYSB 3KLGA 4GC7A 3M8QB 2YNGA 3M9NB 2GC8A 1TVRA 4WE1A 5KT5A 4XPEA 3QGIA 1KLMA 2JEJA 3KHRA 4ECVA 3T5LA 4MFBA 1S1UA 3BSAA 4LQ9A 1WNEA 3LP2A 1LWCB 3T19A 3CJ3A 3KK3A 2R8GA 2ZE2A 1HQUB 3DRRA 2FLNA 2QE5A 4ZPBA 1N56A 3CWJA 5L1LA 4ECQA 5F8GA 1SUQB 1TL3A 1S4FA 5I3UA 5KFWA 3H59A 1TKZA 3QGHA 5C5JA 4ED6A 1EP4B 4O3PA 1JLEB 2YNHB 5KFQA 1LW0A 3G6XA 2UUWA 1S1UB 3LP0A 3KK1B 5KG5A 2IAJB 1S48A 3UR0A 5HBMA 4G3IA 1S10A 1RYRA 2YNIB 5F8JA 3H5UA 3M8PA 4M95A 3KOAA 1K1SA 2OPRB 5J2NB 3KLFA 1R0AB 2WRMA 2OPRA 3KLFB 5J2NA 1IKWA 2R2RA 1N5YB 3QYYA 5KFBA 3GIIA 4ZP6A 1TKXB 5FDLB 4H54A 3IS9B 4IH5A 1T05A 4QW8A 2ZKUA 3PJWA 4RNOA 4Y34A 2YNIA 3H4BA 3CDWA 3I5BA 2I5JB 3MR2A 3Q8RB 3G86A 3Q8QB 2AU0A 1DTQB 4G1QA 1RTHA 1TP7A 4DL4A 1KHVA 4O3SA 3I5CA 1S1XB 5KFEA 5EWEA 3T5JA 1HPZA 2RDIA 2R8IA 4K4ZA 3DMJB 1ZTWA 3BR9A 2VA2A 4WZMA 2CKWA 4EYHB 3JYTB 3TAMA 2J6SA 5CYMA 4YR0A 2E9ZA 3KJVB 5HLFA 3KHHA 5KT2A 3M9MB 5KFNA 4RZRA 4ECWA 1TV6B 4RW4B 1LW2A 1HQUA 3DRRB 3EZUA 4R0EA 3GQCA 3KK3B 3TQ1A 5T14A 4Q43A 3LP2B 2IM1A 3DI6A 4YP3A 2XCPA 1FK9A 3BQ1A 4IFYA 2B43A 3PW2A 1TL1B 4NCGA 4KHMA 2HNYA 4RNFA 5KT3A 4RW6B 1GX6A 2XWYA 3RAXA 3V6DB 3HVWA 2W9CA 3DM2B 1JLCB 2WOMA 4FS1A 3Q8PB 4LSNB 3E01B 4EO8A 4Q44A 4ED0A 3C6TA 1RT6B 3KLIB 2JEGA 3SFUA 1XR6A 2R2UA 2EC0A 4LSLA 5DG7A 4F50A 4K50A 1JLFB 4O4GA 1IKYA 4NLWA 4IOBA 2W9BA 4J9PA 3QIPB 3M9OB 3V6DA 3DRPB 2VG5A 3QLHA 4ID5B 4RW6A 2B5JA 5J2QA 4ECUA 2HNYB 4KO0A 5L1KA 2YKMA 3UQSA 2R2SA 3DOKA 1RA7A 4HKQA 5KFUA 4QWDA 1REVA 5L1JA 4IFYB 3ISND 3LAMA 4RW8A 3G6VA 1D0EA 1HARA 3MECA 4TY8B 5DQHA 3FDSA 2WTFA 4NZ0A 4IFVB 3DYAB 4RNHA 2HNDA 4M94A 1ZTTA 4NLXA 4IFVA 3PZPA 3DLGA 4Q0BB 5HLFB 1S1VA 4KFBA 4RUCA 2C22A 4MIBA 4TYBA 1C0UB 3BREA 2AQ4A 4FBUA 3H5YA 1RT1A 3LAKA 4RNMA 3MFIA 1RTHB 3BSNA 2W8LA 1JLGB 1SH2A 3DOLB 3JSMB 3QIPA 4I2QB 2V4RA 5C42B 5F9NA 3RBDA 4KBIA 4MK9A 4O3QA 3QZ8A 1HMVB 4LSLB 2GIQA 2OPPB 1OS5A 2YNFB 4ZVEA 4J9KA 3MTKA 5KT7A 2JEFA 1MMLA 2D7SA 1QE1B 3E01A 3N6MA 3OL6A 5CYQB 3ITHA 2W9CB 4DG1B 3QO9B 1UWBB 5KG4A 4NLQA 3MR6A 3DLKA 2OH2A 3DRSB 1TL1A 3PW7A 3DLKB 1S6QB 4I7FB 4XPCA 1LW0B 1DTTA 4EBCA 4R8UA 4K4TA 1JLEA 3PHEA 1TV6A 2FVPA 4KHRA 5CYQA 1NNDA 5DQIA 4DL6A 4NLGA 1T94A 4KB7A 4EYIB 2WCXA 4EEYA 4IG0B 4KSEB 5KFSA 2OPPA 1LWEA 1C0TA 5KT6A 4R5PB 4IKAA 4QWCA 2UVVA 3H98A 4JUZA 4PUOA 4YR3A 4MFBB 4B3OA 4J9OA 4IR9A 4PUOB 2BRLA 1KLMB 4F4YA 3KLEB 2VG6A 1TKXA 4KV8B 1C0UA 5FDLA 2UVRA 4WYLA 3OSPA 4IG0A 3CDUA 5KFAA 3T1AA 1Z4UA 2JLEA 1JKHB 3KLHA 4IH6A 1R0AA 1C1CA 4LQ3A 4IRCA 3H40A 5KFMA 2IM3A 4ED1A 2C2RA 1S9EB 3RB3A 5C25A 4ECSA 1DTTB 3GIMA 4ZHRA 2BE2B 4DL5A 1J5OB 1JLQB 4ECTA 5HBMB 4ED2A 3UPFA 4NYZA 1RT3A 1SH0A 1I6JA 2UVUA 3GYNA 2RF2A 3DLEB 4RW9B 2UUTA 3HKWA 2ZD1A 4NRUA 4URGA 2HMIB 1DLOA 4QW9A 5K14A 5EDWA 3MR5A 3V4IA 2W9AA 4K4SA 1TKZB 4TLRA 4NLOA 1T3NA 5I3UB 4QWBA 4ZP7A 3BSOA 4EBDA 3IRXA 1S9EA 5KFXA 4URQU 4H4OB 1VRTA 2BRKA 2YNFA 1TKTA 3FFIA 4ZVFA 3SI8A 4IR1A 1TQLA 5KFRA 4Q8EA 2FVQA 2IM2A 1JLGA 3H2LA 1YVFA 3I0RA 4ED8A 3RAQA 4KV8A 2XI2A 3OLBA 5EUHA 5KG7A 4NCGB 1RT7A 4I2PB 3NL0A 1S1VB 4WXWA 1K1QA 1TKTB 1LW2B 4RW4A 3VQSA 3C6UA 2W7PA 3PVXA 4MK7A 4IG3A 1KHWA 3BQ0A 2R2TA 5L1IA 3MECB 4TY9A 2ATLA 3MEDA 3I0SA 5F9LA 4RW8B 2IJNA 2FVSA 4MKBA 5F8MA 1BQNA 1JLAA 4FS2A 3V6HA 4WZQA 1REVB 2UVWA 4O44B 5K14B 2FJVA 4OL8A 5KG0A 3DMJA 5KFGA 1DLOB 4U6PA 5KFHA 1T03B 5J1EA 4MH8A 3UDLA 2F8EX 1S1XA 3NBPA 2VA3A 2B5JB 3MR3A 3CJ0A 2VG5B 3QLHB 4ID5A 3ICLA 4WFXA 5KG3A 4ECYA 4PWDB 1N6QA 1JLQA 3MEEA 4ZPDA 5DLFA 4ZHRB 5F8NA 3OL8A 4ECZA 3G6YA 3IGNA 5C25B 3IS9A 5DGBA 4RW7A 1HNIB 1U09A 3QGGA 4J9MA 3KMSA 4DG1A 4MKAA 1JIHA 2JC1A 4TXSA 3PW5A 2C2EA 2XI3A 3KLHB 3IG1A 2WB4A 4WFYA 5L9XA 4DL7A 1RTIA 2AGPA 3DM2A 1BQMA 3I5AA 3N6NA 4GC6A 4NLUA 4J9LA 2YKNA 3BGRB 2J6TA 4H4MB 4ZP8A 5KFOA 4PWDA 5DGAA 2IAJA 3KK2A 3H4DA 3T5KA 4DL2A 3KK1A 3LP0B 1FK9B 3H5XA 2XCAA 4J9SA 2BQRA 1LWEB 3CIZA 2BQUA 4O3RA 1EP4A 1HNVA 4ZPCA 4NLTA 5DLGA 3OHAA 1RT5B 2D3ZA 1XR5A 4Q0BA 3CDEA 4JV0A 1RT5A 3SFGA 2XGPA 2WONB 4HYKA 3JYTA 2FLPA 3ISNC 2ZE2B 4RU9A 4ECXA 2W7OA 1RYSA 4JV1A 1DTQA 3V6JA 3KK2B 2I5JA 2E9TA 1N48A 3V6KA 3DRSA 2ALZA 3NMAA 2ILYA 4WE1B 5KFYA 3KLVA 2YNGB 4KAIA 1UWBA 2OPSA 3QO9A 1HYSA 3CVKA 4ZP9A 3D28A 5KFCA 4NLDA 2VG7A 5HROA 4K4XA 4NLPA 3T5HA 1QE1A 3Q8SB 2IMWP 3FFIB 1S1TB 5J2MB 1RT2A 3KLIA 1SV5A 4RW7B 5JXSA 2WK4A 5KFLA 5F8LA 2QV6A 5F8HA 2HWIA 1NHUA 3PJXA 3CJ5A 2I1RA 5JUMA 3LP1A 3PW0A 3PR5B 4O3NA 1FKOA 1IKXA 3HVTA 2R8KA 3NBPB 2IM0A 4DEZA 5J1EB 1T03A 2YNHA 2O5DA 3TVKA 4EO6A 3OLAA 4J9QA 4F4ZA 1RT3B 3FSIA 4J9RA 4Y3CA 3V81A 4O3OA 2BE2A 1JLAB 1BQNB 1RTDB 3DI6B 1QUVA 2WHOA 3HHKA 3LANA 3I0SB 4O4RA 1ZETA 2IA6A 4IRKA 2JEIA 4PQUB 4ZPAA 3GV5B 4PQUA 1RTJB 3CJ2A 1C1CB 2RKIB 3HVAA 1LWFB 2ASDA 5KG2A 3TAMB 5I42B 3V81B 1RT7B 4I2PA 4WXOA 2YKMB 1S0MA 2VG6B 4NLYA 5KFKA 3KLEA 4QWAA 3I0RB 5KFTA 4TQRA 2IC3B 3NGDA 3LP1B 4Y2CA 2AX1A 1S9GA 3CO9A 5KFPA 5KFIA 1RT4B 1JLFA 4O4GB 1EETA 1C0TB 3OSNA 1SV5B 2GIRA 3BQ2A 2V9WA 1IKWB 4ICLA 1N5YA 3IRXB 3PR4A 2BQ3A 2HNZB 1S9FA 4KE5A 3RB0A 2IC3A 2VG7B 5HROB 4WFZA 3FQLA 4EBEA 4R8UB 5KFVA 3M8PB 4JV2A 1C1BA 4RW9A 2RF2B 3DLEA 5HP1A 1S1WB 4ED3A 5I42A 4KKOB 1XR7A 4ZMMA 1JXLA 4FBTA 1IM4A 1RDRA 4NLSA 1LWFA 1S6PA 1RTJA 3OL7A 1S49A 3IGVA 2XGQA 1CSJA 1C2PA 1RA6A 3PW4A 3RBEA 3KMQA 2WONA 1W25A 2HWHA 1QAIA 5DG8A 5CYMB 1RTDA 4XO0A 2ILZA 5J2PB 5KFJA 1JLBB 2FJWA 5D3GB 3IN5A 1HPZB
chains in the Genus database with same CATH superfamily
1PYTA 1IR1A 2CJQA 3A1YG 1L5UA 3BSCA 3HFKA 1FKPB 4KRWA 4OZJA 4RWWA 4DPOA 2VOOA 2DEJA 4WFNQ 4C9DA 4LIRA 2M8HA 4R5PA 4YEAA 2FVCA 3SCLE 3BGRA 1T05B 3CJ4A 2KZZA 2AWZA 2AZ1A 4HL9A 4ATNA 2IJFA 4CLYA 3FGVA 4CNZA 3FRZA 5DG9A 3NGSA 3JAMU 1UVMA 1AA1B 4IH7A 2BANA 1J2VA 5D0RA 1VBZA 2FZGB 2DNZA 4OX8A 2N7YA 1KTVA 2NQPA 4WU2A 3G9CA 2B8PA 1UEVA 2R8HA 2YQ3A 1KFSA 4AFFA 3P6YC 4Y2AA 2DGUA 3GIKA 1EJ7L 4NCBA 3S6EA 4OHVA 1IJFB 2KT3A 2MKCA 3JXOA 1FFWB 2W8KA 2FLLA 4KO0B 2HFOA 3OHBA 2Y1LB 4MIAA 4M5DB 4QU7A 3JB9k 4OYMA 5DM7Q 4JI8J 3DXSX 2YX1A 4O44A 1F5AA 3OJSA 3OT9A 2PMZD 3MEDB 1SUQA 2L3MA 2WSCC 2NXEA 3A13A 4ICLB 2RUSA 2CUYA 3N5BA 4WIIA 5L8RC 2LEAA 4RNNA 3IWLA 2DBBA 1VMBA 2HQCA 2KKHA 5D4LA 2VICA 4J9NA 1HMVA 4DR5J 4Q8FA 5C42A 1S0NA 1YRXA 1RWXB 2YX7A 4QJVA 3SEOA 3LALA 5CCMA 2KG1A 1S99A 4F36A 4Z37A 4ZVGA 3EPIA 2V67A 3BJYA 2RRBA 2ZJPQ 4F4XA 5EWGA 4JI2J 3HK2A 2I8EA 2H4WB 4A8YA 4QCLA 2FY8A 2DR6A 3C3LA 1XERA 2YKQA 3JTNA 3TUIC 3UCGA 1OQ6A 3W60A 1GT8A 4CO5A 5D4NA 2W2OP 3VWSA 1DAXA 4DFPA 1MU2A 1M5KC 3DLGB 4FYWB 3NAIA 4WBFA 5AE1A 1VBXA 1BGXT 4LF8F 1IUJA 2NXNA 4ZJQA 3UVJB 1RISA 2FHJA 3JSRA 3Q83A 4LF7J 3H5SA 1H7WA 1U1KA 3BDEA 1PILA 1QM9A 3MEEB 1PAUB 2ZDOA 3P8BB 1NHVA 1WSVA 1R6YA 2NYIA 3X3UA 1I3OB 2F7VA 2IFXA 4CCHA 4K0KF 2HMIA 2ZD1B 1TUVA 3G6ES 1Q1KA 4OX9F 3ENWA 2ZM6F 2OELA 2J6UA 2SXLA 1SL1A 4OYIA 4LR7A 2MZRA 2GQ2A 3HHLC 3UW1A 3G8TA 2WW4A 2DY9A 1IKYB 3B4DA 1J5EJ 1HFEL 1TZ0A 1IBMJ 4ERDA 3FZBA 1RT2B 1IWAA 1S1TA 1RT6A 2IBKA 2RD5C 2VF3A 1SC6A 2BOAA 3W65A 3ENQA 4JI1F 2V5HG 1S9GB 3NLCA 2BKPA 4J7CA 4C3LA 3W61A 1XIQA 2BBEA 3CCSS 2DKOB 2Z58B 1TL4A 1RWNB 2DXDA 1SBRA 4ZVRB 3M9NB 1FWPA 4WE1A 4CYUA 1ZM3A 3SSQA 3V2UC 1HR0F 3KHRA 3T5LA 4QIEA 5KOWA 1VC5A 1H3DA 3W63A 1GFWB 4LQ9A 4RUHA 3TEGA 1WNEA 3LP2A 1LWCB 2PI5A 3KK3A 2R8GA 2RVJA 3DRRA 3PJ9A 5EX3A 3RUBL 2QE5A 4ZPBA 1KSPA 3GYGA 4ECQA 3DOMA 1UW9A 3HCXA 5F8GA 4C8YA 1S4FA 5EGYA 2CQHA 4OI6A 5U47A 4ELTA 2W2NP 4ED6A 2K8GA 5FD1A 1WELA 4HLBA 3G82B 4WTYA 4Y2MA 3AAWB 2BW2A 3R9LA 2R7VA 3G6XA 3HULA 1S1UB 2H65B 4BHQA 3I87A 1WTFA 2HRTA 2IAJB 2XNQA 3T6JA 3TJAA 3VR1A 2LECA 4G3IA 1RI7A 2VFRA 1RYRA 2ZM6J 2K7KA 2C2NA 3M8PA 3HHDA 3MZIA 4J9VA 3DC2A 4F0MA 1H74A 1CS4B 4PQAA 3HSZA 4DV5F 2HZVA 3PYDA 3D4JA 1R0AB 3M8WA 5IC4B 1HWUA 1ZS6A 2OPRA 3M2UB 4GVBA 1N5YB 2R2RA 1Q8IA 3F56A 4NOHA 4ZLPA 3T1YF 1L3VA 1WG1A 1X4FA 3MM9B 4CO2A 2CPDA 2MQLA 2U1AA 1IM6A 1TKXB 2E5GA 3BYPA 3IS9B 2ROPA 4PYDA 5CAAA 3LA0A 3CXCR 4J9QA 1VQNS 1FWKA 1AT1B 2UP1A 2CPYA 3I5BA 3AB2B 3G86A 3AY0A 4PXBA 1TP7A 4YY3F 1AUDA 3PRBA 3T5JA 3HPOA 2FHMA 3NNAA 1AW0A 5HN0A 2C2OB 1HPZA 1OQ3A 2R8IA 3O3LA 2CZ9A 3FEXB 4MYTA 3JYTB 2MQPA 1HQ2A 4JI0F 5JMNA 4PCQA 2MGZA 2J6SA 2E9ZA 1JJCB 3KJVB 3D7SB 3IA0A 4J37A 3TP2A 4CNYA 5KT2A 4ECWA 4DQQA 1TV6B 1RWMB 4FYXB 5L39A 2DNHA 3KK3B 3GFHA 4DPXA 2N7CA 3TQ1A 3SV4A 4YP3A 1RHQB 1HNZF 1RAGB 2B43A 1G6BA 2K1RA 1NCLA 1VI7A 2NS1B 2Y0BB 3AOCA 4NA3A 4Y2KA 4NCGA 3W2WA 4QIFA 4C97A 3EX7B 4AL6A 1FEHA 4KHMA 1MROB 4LREA 4X4VA 4LFAF 3FCWA 4P2XA 2MMYA 1PG5B 2AYBA 3HVWA 2WOMA 2HW3A 3HM9A 2VONA 1EIYB 2V69A 5A0YB 4ED0A 2W7AA 3PEHA 2OEKA 3KLIB 2BX6A 2WSEC 3B82A 3BZQA 2IBOA 4DR4J 2EC0A 1U45A 4LSLA 2HGLA 1XNQJ 4K50A 4Q7AA 1JLFB 4O4GA 3EXCX 4I64A 2M0GB 3ZTOA 2W9BA 4J9PA 1X4CA 5BJRA 2BE7D 4WP8A 2GMHA 3CJKB 3OW2R 4ID5B 3CDAA 4U9RA 3QJLA 2KFNA 1R8PA 1Y5IB 2YPZA 3THPA 3AD9C 1WKLA 1NK0A 1DQ9A 3D0HE 3IP0A 1CQNA 2R2SA 3DOKA 2GVZA 1RA7A 3TR5A 2J9DA 4RX6A 3SBMA 1CJKA 1HI1A 3EGNA 4IFYB 3U1NA 3ISND 3CSKA 4OZ3A 3LAMA 1IBCB 1SCJB 3G6VA 2QGFB 1JNRB 3MECA 3EZOA 4FP9A 4TY8B 4JI7F 4IFVB 1UPPA 1U4BA 3VGSA 2E5JA 2VPZB 3TO8A 4B9UA 4LF1A 2HGMA 2B9EA 2B3TB 3FK4A 1X5TA 4NA2A 4DV0J 2Y9HA 1SI9A 3EGZA 2C22A 3AD7C 1S12A 4MIBA 1RT1A 3LAKA 3CE8A 2ZBQA 5DRKA 2LA6A 3AJ1A 3C8YA 3IWXA 5HMZA 4RNMA 1HNXJ 4MKYA 4M1KA 3BSNA 3KKFA 2UXDJ 3DOLB 2E66A 4F04B 4PG6A 1CLFA 1RHRB 4I2QB 3MCOA 3RAMA 5C42B 2V4RA 3RBDA 4KBIA 4F7VA 2LQ8A 1OS5A 4ZVEA 4DV7J 2C42A 3ZZ0A 2GO9A 1KWMA 1CPZA 5C7PA 3HDSA 1RAFB 2D7SA 3FVYA 3P5TL 4QBUA 2B7BB 2HIYA 3BH7B 2DNKA 3N6MA 3WIVA 1O0PA 5CYQB 2E5LJ 2W9CB 2GGPA 1U0SA 1L3KA 2PFDA 4BLGA 1VQ7S 4Q2LA 4RLEA 4DR5F 4HDHA 4F2RA 4DOZA 3MR6A 2BW7A 3DLKA 2OH2A 1URNA 3DLBA 3NXZA 3TVYA 4B3TF 1WC4A 4LF5J 1S6QB 2PC6A 4XPCA 2BJEA 2KG0A 2CQ1A 1Q16B 2V8PA 2VBWA 3P3DA 4M5MA 3AFGA 4UF4A 4DV1J 1L3TA 2CPFA 3MUVP 1YJ9S 2E5LF 1AXQA 1K47A 2CJYB 3SCKE 3A8KA 2QLBB 5IWAF 4FDFA 4DSKA 2WCXA 3FC9A 1I94F 5A8KA 4IG0B 4OZ0A 4KSEB 1FJGJ 3PEJA 3W2VB 1JJ4A 2W2MP 2UV8A 2GNKA 1WF0A 2BVZA 4PPZA 3H25A 3EDRB 5CZVA 4JUZA 2NYHA 2RILA 4B3OA 1YQHA 3KG4A 3A12A 3N9UC 2GQQA 4NYOA 4PUOB 4J9OA 2BRLA 1LK5A 1SJQA 1WOPA 3MURP 2EW9A 1IR2A 3MAQA 3OSPA 2HLUA 3I6PA 5KFAA 1R89A 1R7IA 1Z4UA 3GE9A 4EU0A 2CPZA 1RWVB 2KRRA 2MKJA 3FZ2A 5IFMA 3J7YI 1R0AA 1C1CA 4M5NA 4IRCA 1T9UA 2VPYB 1FDDA 2FJDB 5KFMA 2V2ZA 2IM3A 3OV7A 2FLOA 4ZLJA 3OUYA 2C2RA 1DTTB 3OVAA 3GIMA 2L9WA 1XEZA 1LFWA 1J5OB 2DO4A 2QN6B 2WVFA 3AB4B 4K7QA 4UUXA 4RO0A 4ZVOB 4NYZA 4ED2A 1B0TA 1SH0A 1I6JA 2RU9A 1HLWA 3GYNA 2HQGA 4X62J 4RW9B 3TWZA 1GXTA 2JRSA 4LRDA 4NRUA 4ANEA 2VJUA 1DLOA 2DH8A 1URRA 2B4UA 3GCWP 1RAEB 4K5RA 5HSPA 3OTOJ 3WHIA 1P9YA 1TKZB 3MOZA 4TLRA 5I3UB 4QWBA 3C14A 3BSOA 4QIVA 4RU2A 5B0GA 3IRXA 2IDEA 1S9EA 1ICEB 3UVJA 3X1LB 4H4OB 2BRKA 3TJ8A 2PGCA 1NSAA 3M4XA 2JJ4D 3FFIA 3GPAA 2ZOGA 4GMKA 2J0SD 4IR1A 3C16B 2FVQA 3MMBB 1JLGA 3H2LA 1YVFA 3I0RA 3O2IA 2J9CA 2XI2A 3GWCA 4OYPA 3G96A 2ASYA 2KXHA 2WVBA 4PWWA 5KG7A 3M6UA 1RQ0A 3TAQA 4FKXA 1QTNB 4W92B 4JI4J 1OO0B 1DFDA 5LSOA 1S1VB 4YUDA 3NWGA 4B3SJ 4CH0S 2W7PA 1YKWA 3BQ0A 3AH6A 3I0SA 2KYXA 4QR1A 4A48A 2FVSA 4MKBA 4X65J 1JLAA 4DN9A 4C8KA 2YWWA 4WZQA 5L46A 1HWJA 5K14B 4OL8A 3DMJA 2R7WA 2FD2A 5B0EA 5KFHA 1T03B 2HHHF 2BKOA 2JNJA 3UR3C 1RLCL 3OVSA 4WFXA 2VG5B 3QLHB 3ICLA 4X4SA 1S76D 1C4CA 1NLKL 2RSQA 3MEEA 4YB7A 2OI2A 4ZPDA 5THWA 4JI8F 3FKBA 5HMYA 3OL8A 4ECZA 5F8NA 4C11B 1RU2A 2GVDB 1SKRA 1TMMA 2BM1A 1U09A 4J9MA 2CNNB 3GJRB 4DG1A 3R7BB 1JIHA 2G2YA 3IBCB 4TXSA 2A6OA 4A8FA 3KLHB 2QG9B 3AODA 4N77A 4OI3A 5L9XA 2IDLA 2HFUA 5GAEU 4CLUA 4DL7A 5A76A 1RTIA 4RUBA 2QFIA 3UNYA 3PYGA 4M5KA 2GQCA 1R8BA 1WC3A 5B0BA 1XNRF 2W2PP 2AEMA 3W5YA 4C3KA 2X7IA 3BGRB 2IRXA 3KUGA 2N82B 5BYQA 2RS2A 4H4MB 2OFHX 3Q8YA 1WC5A 1RU1A 3PX4A 1HNZJ 2RU3A 3HZGA 4F3QA 3T5KA 3H4DA 4DL2A 1IBKJ 3MM8B 4X4RA 1M1GA 1NK6A 1VQYA 3QMQA 4JOUA 3VZIA 5CQGA 1T8EA 3L7PA 5B0FA 3ZO7A 2BQRA 1LWEB 3CC7S 5JVHQ 1BQXA 2H5IB 2NUUG 4CWBA 4UZBA 3MWBA 5A8KB 2YQ0A 1M1HA 1YIJS 4B3MJ 3QT6A 3VAGA 1WF2A 2GHPA 1VQSA 4CQ1A 3CDEA 1CQMA 2HVIA 4ZN1A 2GCFA 1CG2A 3QJJA 2J8AA 4RBUA 1X4DA 4RU9A 3HP6A 3H20A 5DZ6A 1WUUA 4I1TA 1H98A 4MTPA 3M30B 4C0BA 5IWAJ 2HZAA 2HKEA 3R3TA 1JNZB 2E9TA 1VCTA 1GQEA 1TMJA 2B4OA 2JH3A 3V6KA 4KGXB 1KP6A 2YX4A 1N48A 1M5PC 2BOPA 2VBXA 4K2XA 5IV3A 3KUEA 1VBKA 3TZXA 2GJFA 3NMAA 4KAIA 2NCKL 3ZC4A 2XG8A 1YRTA 3D67A 4NLDA 3UN2A 2CWXA 4A8WA 2HBQB 4DR7F 4C8ZA 1DHMA 2IMWP 3FFIB 1OPIA 2W4CA 1X4EA 2DEIA 3LTOA 5J2MB 3MI7X 2EEYA 1RT2A 2FQQB 4FXWA 4PWUA 5CA5A 3T1HJ 2UUAF 5F8HA 1ROFA 1NHUA 2G2ZA 2AD9A 3PJXA 3CJ5A 3PW0A 4LBHA 1TUWA 2X3GA 1FKOA 4DS4A 3M6XA 2QLXA 4UY8T 3NBPB 2P9CA 3CJSA 4JYAJ 5J1EB 2DNMA 1FDBA 2CFXA 1RSCA 1RT3B 3FSIA 3BPDA 3BO3A 4OJHA 3OTCA 3P4UB 3VGUA 5A6PA 1U8SA 2ZH6A 1QUVA 2WHOA 1ZETA 2DR5A 5LM7E 4IRKA 5AE3A 3BM7A 2O66A 2AEFA 4L3NA 3F0NA 1GTEA 4FXDA 1NH7A 1RTJB 3CJ2A 3SQOP 4N56A 1RWOB 3GR1A 3HZEA 4HEA9 1MSWD 2DH7A 4FPRA 3U1LA 3CC4S 2PMWA 2CWKA 5I42B 2L08A 2MKHA 3FMBA 1RT7B 4FYYB 4X84A 5HJXA 1QVGR 1K0TA 1VBYA 2VKZG 4Y28C 3TAPA 1OMSA 2ZUAA 2GHWA 3A3NB 5KFKA 2H51B 4QWAA 1ZM2A 5KFTA 4GVLA 4TQRA 4OX7A 2IC3B 3TA0A 2AX1A 2H4YB 2FHKA 3MM7B 1YJVA 1EETA 3QBCA 1AZSA 3BQ2A 2R42A 1RTZA 1VDHA 3W62A 3R1LA 1QSYA 2CQGA 4RKUC 3QRRA 5DDPC 2RB7A 2GMLA 3D0IE 4ICLA 3R5CA 2B7CB 4I0WA 3PR4A 4RR5A 2HNZB 1TTHB 4KE5A 3G2XA 2VPWB 5AXKA 2IC3A 4HT5A 4DSLA 2E1CA 5HROB 4WFZA 3GG0A 3QATA 4EBEA 4L74A 4R8UB 3RGIA 1IBLJ 3M8PB 3IBWA 1C1BA 1SQFA 4KH0B 2WW8A 1BD6A 5G0RB 3O8WA 2Q79A 1C4AA 2F4VF 3PM9A 2QA4S 4DUYJ 2CDRB 5AXLA 4ED3A 4YS2A 4FBTA 3ZZZA 1WHVA 3OL7A 4LF9J 2DO0A 1QAYA 1V3RA 3NOCA 5ETNA 1CSJA 3CIMA 4NI2A 3RBEA 4JI3F 2RE1A 1RUSA 3US5A 2MZJA 5DJBA 5DG8A 2RHQB 5D6GA 3W5ZA 2DGSA 2E5IA 2Y1IA 1UEUA 1QVFR 2FJWA 3J80U 5D3GB 3BB5A 1F2GA 1QAXA 3K17A 3GFZA 2DGTA 4OZNA 3M8RA 1V5VA 3GONA 1E6VB 3M2RB 2LFVA 1IKXB 3SXLA 1LWXA 2DGXA 4W4MA 2FVRA 2BKNA 1FKPA 1OJ4A 1RAHB 2ROGA 4UW2A 1HIYA 5BYRA 4DPUA 4L76A 2YKNB 4ZVTB 3M8QA 1SJRA 1RCXB 2A2CA 2OJ3A 1BQMB 4K4YA 4YY3J 4F4WA 4TN2A 3BGFA 5K9FA 1K73T 1S59A 4KC5A 5E7OB 4FYDA 2ZHAA 3QZ7A 4YMEA 1SVDA 4OYAA 4DSIA 4X2BA 3MM6A 3MEGB 2HNDB 2M88A 3EPGA 2UU9J 3TUJC 2HAIA 3MPWA 4C8MA 2OPSB 3HFVA 4CZCA 2F9JA 3ZFVA 4K4WA 1SKWA 1S6QA 1N32J 5ETOA 2MKSA 1N6QB 3GILA 3E3XA 2CQDA 2RDJA 2C3UA 2HK2A 2ALYB 2QJ3A 3HVRA 4B17A 1UP1A 1D1UA 4OMFG 4JI4F 3E51A 3GV7B 3RB6A 1G4CA 2DH9A 1GX5A 4DBQA 3O5TB 3DDKA 3EVOA 5KAKA 2ZEJA 2ADBA 1TL3B 4L73A 1UFKA 4WYWA 1UMJA 3DKDA 3QAUA 2QSWA 4DCOB 4DV2J 3FQKA 5LMUF 3N6LA 3SSRA 2PN6A 1FJ7A 1Q7YT 2WOMB 2CPJA 5LMNJ 1U1NA 3G71S 2JX2A 2XMMA 2R8JA 2XC9A 1JQGA 1UL3A 3ILJA 2DCUB 4TYAA 1RT1B 2KU7A 5I3PA 3D3BJ 4DFJA 4OZ2A 2ASJA 5D3GA 4QQBA 4KFBB 1P9QC 4LFBF 2QA1A 1CC8A 4PXEA 1FJEB 1VRTB 5A2QU 1UKUA 3QFHA 1F5CA 4RBTA 2JC0A 2OPQB 1XTZA 3C2PA 4K4VA 1CBKA 4KKOA 1RAJA 5IV4A 2E7VA 3MUMP 2R7XA 2ZZTA 4C6AA 5DQGA 4LT6A 3FJ2A 3HI9A 4F4KA 1YWXA 2K3IA 4C98A 3DRPA 2KHDA 4KGZB 4NZ6A 1HQEB 1J5OA 1WEXA 2DHAA 5CZXA 2MXYA 2FY1A 2W1BA 3PTWA 2V6AA 1WDDA 4NMXA 4B9NA 2G9OA 4NLRA 2AGQA 3DFEA 1HBNA 1ZM9A 3OFGA 4YQWA 4DF4A 3C6UB 5F8IA 2ADCA 2PI4A 1FI4A 2RT3A 5B09A 4NEYA 3T9NA 1JKHA 4B3MF 4B02A 4K4UA 1B7FA 5KFFA 3QAEA 3M6VA 3W3SA 4JV5F 1GMVA 3K5PA 4NWBA 4I6AA 1HYSB 2LDYA 3PDNA 2ERRA 2YNGA 3CW2C 3SCIE 1TVRA 1YBAA 1HHQA 3BPSP 2WBMA 4LF4J 3CJTA 2FC9A 4A46A 3NCRA 2E7XA 4NZ7A 1S1UA 1RB0A 2JL9A 2VBZA 2WZ1A 2QX0A 2VODA 1UZDA 2OTJS 3AA8A 4J5OA 2FLNA 2GA7A 3GSDA 5L1LA 2QC3A 1SUQB 5HMWA 2QLJB 2HURA 5I3UA 5KFWA 3H59A 2MSTA 4UUWA 1KBRA 2L9DA 1FD8A 2EK6A 4H4KC 5IZHA 4JI5J 3K5OA 2HS3A 3PFEA 4USVA 2BUNA 2XO7A 1N52B 4DR1J 1SJ3P 4B3RF 2UUWA 3CCUS 1M0SA 5KG5A 2YWHA 1CVJA 3BGOP 3SIPB 4CT8A 4A8KA 4Z7CA 2VQEF 1KONA 2LU2A 2PMHA 3H5UA 2Z30B 3F41A 3D68A 4M95A 3RRGA 1OYDA 3QFWA 3KOAA 2DNGA 3GG1A 4O0IA 1AFJA 2ZWOA 3KLFA 2WRMA 4DPTA 4OI2A 2CJAA 1Y4ZB 4MMOA 1ZM4A 2J76E 2LVWA 5J2NA 1BUXA 3CGIA 1IKWA 3QYYA 4TU9A 1TL7A 1RK8A 3U02A 2IIHA 1PBAA 2HS0A 3WX8A 4ZP6A 3W8PA 4ZN3A 4H54A 2CNKB 4UY85 3MM7A 3CT9A 3NS6A 4Y34A 3OFFA 4ZLLA 3JSBA 2OIHA 2RMLA 3S01A 2W24A 2XWXA 3VQTA 2I5JB 1S57A 3Q8QB 4ZDNA 4O3SA 1DTQB 3I5CA 1S1XB 4KGKA 4ANDA 5EWEA 2EWHA 2JSXA 3MPDA 5IM0A 2RDIA 1EAYC 1ZTWA 1WHYA 4ZCKA 1UFLA 2GV1A 5IT0A 4AE5A 5IT9Y 5CYMA 3B6BA 3TUPA 5HLFA 2R7RA 1QY7A 4U7UK 3UFCX 3M9MB 2V2KA 1XJWB 3BKUA 1L3SA 4LFAJ 1HQUA 3EZUA 2D69A 1GMWD 4R0EA 4OI0A 1SC1B 2DIUA 3LW5C 4ZCIA 4DUZF 3LP2B 5HVGA 3DI6A 3DU5A 1X4GA 2EBGA 2RQCA 2RDDA 3MGJA 3TVZA 4C0OC 4F67A 1FVSA 4LRFA 4YDDB 1TL1B 1P1TA 1WWHA 1AUSL 3KWMA 4USWA 4BWJA 4FF2A 2HNYA 3J81j 3TUZC 3L3CA 4DR4F 1UJ5A 1GX6A 2XWYA 4U95A 3V6DB 4B3SF 3K58A 4DLGA 4Q5VA 3Q8PB 4AXJA 4FS1A 1NSPA 3PHTA 3E01B 4ELVA 2CZ4A 3C6TA 1U0HA 5CCLA 3Q0AA 1Q0NA 4K8RA 3DGVA 2LEBA 2EFVA 2JEGA 3SFUA 1XR6A 1Q81T 3B8HA 5DG7A 1NJWA 4A8OA 2OSQA 4NASA 2XZWA 1U24A 4NLWA 1XNRJ 1FERA 1WD6A 4IOBA 1D09B 3QIPB 3HD2A 5AXNA 3CCQS 2MDAA 3QGPA 3KTQA 3DRPB 3IXQA 4QZVB 3MUTP 4RW6A 2GZOA 2ZC4A 3HD1A 1CULB 3PRVA 2HNYB 5A2QY 3Q24A 1WC1A 4KO0A 4DHVA 2Z2MA 3WC2A 1NBEB 3PY8A 4WK1A 4HKQA 5KFUA 4EZ6A 1I5OB 3Q22A 3CCTA 2KN4A 1VIXA 3GB0A 5D0EA 4DR2F 3W9IA 1SIZA 4IOAQ 2HHWA 1ZPVA 2HWTA 3FDSA 4QIWD 3DYAB 1WORA 1VS3A 4RNHA 4M94A 4JI6J 3FCHA 1RWWB 1F5BA 2VIHA 3ET6A 1NPPA 2FIUA 3B54A 4Q0BB 2P9EA 3ETOA 3LGNA 3M32B 2JWNA 3QQCD 1VQ5S 4RUCA 2V4JA 3C19A 5GADI 2I0XA 2QTWA 4P71A 4PABA 3HXMA 3VAHA 4DV4F 1N0VC 3CD5A 2J7KA 1F0XA 4FBUA 1WDTA 3H5YA 1N0UA 3DHWC 2AW0A 3MCNA 5IT4A 2EG1A 1RTHB 1R8AA 1SH2A 4LMZA 5HMXA 1ZBTA 4P2FA 4DX7A 1WEYA 2LDIA 3MD1A 5SUHA 1NSKL 1HMVB 4O3QA 4CO1A 2VBYA 2OPPB 3CCMS 4B9VA 4J9KA 4HHHA 5HK4A 4W90B 1MW7A 2JEFA 3SCJE 3ONQA 4J9UE 1KKHA 1VHIA 4GVBB 3HLUA 2EK1A 1JMTA 4KT0C 5L9NA 4DXLA 4USUA 1PBUA 2Q3PA 2DY1A 3QO9B 3EMTA 1RLDA 5KG4A 1QJHA 2GVDA 3H2VE 4NLQA 5B0AA 5I3QA 4A8SA 1VQ8S 3PKMA 4OYOA 3DRSB 3PW7A 3UN3A 1RE1B 1KTQA 1GAOA 2DNOA 3DLKB 2FDNA 2J0WA 1U6ZA 1SL2A 1LW0B 2HSEB 3JAMY 2LQBA 4EBCA 4I68A 1B99A 1DQ8A 4R8UA 1JJHA 4BC9A 2UXBJ 5AJ3F 3MTJA 2BABA 3HT0A 4ETZA 5CYQA 2MKIA 4DLEA 1J5EF 4DL6A 5DQIA 1B0VA 3K2YA 4LF5F 2Y8YA 4XTTA 1PC5A 1F9EB 3MAAB 1NZ8A 1U2FA 1RBAA 5KT6A 4KPYA 2MZ1A 1N54B 2B9WA 4IKAA 2OMOA 1B0PA 2J8SA 3H98A 2XMJA 2HEKA 4YR3A 1S7HA 2J5AA 1KLMB 5IS2A 3KLEB 4C48A 1M5SA 2KHCA 5SZTA 3VALA 3OVBA 3LF0A 2XMAA 3AXKA 4K2JA 1TKXA 4YN3B 4WYLA 1N88A 4IG0A 4AD6A 1NK5A 3T1AA 2LEPA 4FF4A 5F3ZA 1H2TZ 2EG2A 3QRQA 1FXLA 1XMOF 2F1FA 1MLAA 1WKJA 1IN0A 4P75A 4USJC 4ED1A 1FA0A 1T9TA 1UCNA 1S9EB 2ZHOA 1UW4A 1HBUB 2YXLA 4NEZA 4P7VA 1WI8A 5C25A 4U8YA 2XM3A 1U1OA 1YJRA 2ZBCA 2MHEA 4DL5A 2CNLB 1JLQB 1X4AA 5HBMB 4ELUA 2QMXA 3UPFA 4PXDA 1DQAA 2L48A 1JXEA 3CMAS 2VPXB 3O6QA 3BH6B 1X0FA 2ZD1A 2KVQE 4ZPWR 2GAHC 1FT8A 4URGA 5LOQA 2MLYA 1FVQA 4QW9A 1KQFB 1M5VC 1D9AA 5EDWA 3V4IA 3BBFA 5LSLA 1RBOB 4J90A 3Q23A 1T3NA 1PC4A 3GU0A 2V8HA 4EBDA 4JI3J 4R25A 1NMEB 2QL9B 5F41A 5IQQA 5KFXA 1KQSR 1DZ5A 1LQ9A 1KOHA 2YNFA 1UWAA 1H38A 2VASA 2GIFA 1NDKA 2NXJA 1TQLA 4Q8EA 1TAUA 1D9DA 1P6TA 4KV8A 2DNLA 3OLBA 4KJIA 5CD4H 5HI7A 1VGYA 4DQSA 1E6YB 4I2PB 5B08A 1UVNA 3NL0A 1Q8LA 2HG4A 2ABYA 1HWKA 1LK7A 2B56A 3MXHP 4WXWA 1RHKB 5L38A 1HNWJ 1MN9A 4M5JA 1LW2B 1MG7A 3SZ2A 3PVXA 4MK7A 2DTJA 1KHWA 2R2TA 4ZJLA 4WIQA 5F9LA 3BO2A 4RW8B 2IJNA 3IM8A 5F8MA 1HKAA 3LPEA 1REVB 4HT7A 4C7QA 2HBRB 1MMNA 1YJNS 4OIXA 2ZNZA 2PD1A 2YWKA 4LBIA 5J1EA 3DU6A 2F8EX 3FEZA 2AZ3A 4F0KA 4F3OA 2JOQA 4ECYA 1ULRA 5H9FJ 1N6QA 1T7PA 1MN7A 2Z2ZA 3WDOA 4WP3A 1U2RA 5CABA 3R5DA 3G6YA 3QSYB 2X1FA 1NK7A 4RW7A 3QGGA 3J7YU 2HLTA 2MYFA 3Q8VA 4ZK7M 1VQMS 3PW5A 4KQZA 2XI3A 4G65A 3IG1A 3MOJB 2P5VA 1KN6A 2YVSA 4DCPB 4WWSA 4Y0FA 3AOAA 2KI2A 4LF2A 5GAGI 3HJFA 3M8ZA 2XMVA 4ZLNA 2AYEA 4J9LA 2YKNA 3BGUA 2N4CA 1TELA 2G0IA 4M8LA 5B0CA 2CQIA 1U6FA 2AJ1A 4WKYA 2J7UA 1XK8A 2G2OA 3SQGA 2IAJA 4UTGA 4GO7X 3LP0B 4JI2F 3DLHA 3VTIA 3ZTRA 1N5QA 1SB6A 3DRXA 1U1MA 3CIZA 4O3RA 4ZPCA 3WX4A 1DRZA 1JXVA 3OHAA 4TNOA 3VF0B 4AXIA 1FRMA 4P6QA 4JV0A 3W1YC 3EYZA 5HATA 3JYTA 2OSRA 2JLGA 2FLPA 4F26A 4M63A 3ZXWA 4DX6A 4Z2XA 3PO4A 1DTQA 4H4KA 1FNMA 2OD6A 3HFZB 3V6JA 1OYEA 3ILLA 3DRSA 1VK8A 3G4SS 2YNGB 2APOA 3D1OA 4I6WA 1VC0A 2F8MA 1Y00A 1N34F 3BKTA 1F60B 2VG7A 2JZ5A 4PG7A 1ZAXA 5HANA 2CJKA 5LJ3Y 5JVGQ 2UXCJ 2FHOB 1WTBA 4A47A 2DNYA 1S1TB 4CM2A 1QDUB 2C3PA 1Q8BA 2JDJA 2RQMA 1F3VA 4RW7B 4JV5J 1ACMB 4NE9C 3J7Z5 3LP1A 2HK3A 2M2BA 3BF4A 3SV3A 3BYRA 3DDNA 3PR5B 3HVTA 1HI8A 3BO4A 4X4TA 1YI2S 1A9NB 1D8ZA 3C46A 1YSJA 1YJUA 4XK8C 1CJTA 3T1HF 2O5DA 5ETMA 1I51B 2BEFA 4Y3CA 2FPHX 1U48A 1Q7LB 1JLAB 4ZKAA 3IRWP 1CJUB 3HHKA 3LANA 2XY6A 2Q6CA 4P2MA 3DOMB 4S0MA 7AT1B 4PQUB 1LOUA 1NZAA 3CPWR 4C8OA 4XDCA 1TAQA 4OYZA 2NREA 4NA1A 2AP6A 1N5SA 2B8QA 3R7SB 2BJ3A 2MQQA 1R8CA 1Z2LA 2VG6B 1CJTB 1S0MA 1VQLS 1QSSA 4C3MA 3KLEA 3RW7A 3IC1A 5D0GA 5LXYA 2KJVA 2KXFA 3NGDA 1U25A 1NRKA 4Y2CA 3ZTQA 4X64F 2LQJA 2ZJRQ 5KFIA 1SJ4P 4PXCA 3TA1A 2Y0SD 1C0TB 3OSNA 2GIRA 3THVA 4PEOA 1X60A 3AT1B 4UZCA 4ZCLA 2XQCA 1NPKA 4I6YA 1HR0J 1N5YA 1BHNA 1K44A 2CJXB 2G1HA 3DCAA 3G8SA 3T41A 3TQEA 2QA2A 5I4MA 3RB0A 2Y1RI 2XY5A 3UD3P 1Y3KA 2WAQD 2LXUA 2MY8A 5E3PA 1Y10A 3M2VB 5T7LB 5KFVA 4RW9A 5HP1A 1YGYA 3I55S 3GYXB 1V3SA 3WC0A 1M90T 1WG5A 6FDRA 2XYHB 1EQ0A 5G4DA 5D8HB 1ZYQA 2LU1A 3D66A 1WC6A 3NS7B 2R9LA 2OEJA 1JXLA 2XSFA 1FD2A 4QYRA 3S1TA 1H6KX 1M5HA 3OPKA 2AT1B 3W64A 4ES3A 1X7VA 2AJ0A 4IYQA 2E1MC 2PDAA 3NGUA 2XGQA 2HHUA 2KT2A 4CLPA 4BC7A 1MMDA 2HWHA 3DHXA 1K9MT 5FLXY 3Q8UA 5CYMB 1RTDA 1R0CB 4XO0A 2H5EA 4OZ5A 3T3FA 5J2PB 2H5JB 4HVZA 1JLBB 2EKYA 2IRUA 2ZNYA 2H3EB 1NPRA 1WG4A 2CIMA 2EFPA 3ENVA 2PEHA 3VGTA 5H1SV 3UD4P 5H9FK 3H8YA 2ASLA 2LCWA 2VOPA 1FKOB 3JSMA 2YQ1A 4B3OB 1JB0C 1TK5A 1E6VA 4UOHA 3OFEA 3GV8B 1IKVB 1U1RA 1CJVB 4CLWA 2D41A 2HHTA 2Y8WA 2A1BA 3ILOA 1N4LA 4ZOSA 1B4SA 1OIAA 2VDHA 2M8DB 1FF2A 4BDPA 2D3O1 4XAKA 1J27A 4TQSA 3D6HB 2ZBPA 3AQOA 3DYAA 2C2KB 2DHSA 4MT1A 2NR0A 4TY8A 1FX4A 4M5LA 5HQLA 4E0DA 3P49B 3MMAB 2M9KA 2B6AB 4JI0J 4P10A 4CLKA 3E2EA 3C15B 4DV3J 5AT1B 3DOKB 2GVZB 1VJWA 2XBPA 1C1BB 3QSIA 3ZZYA 1CULA 2GO8A 3R6GB 4U7CA 4OJ1A 2ZH9A 5K8OA 2HFSA 4FF3A 5EWFA 3MEGA 3KHGA 2B51A 2YWEA 1F2HA 2UUCF 3OL9A 1NHKL 1Q5VA 4JI6F 5KOXA 2DVIA 4Z7YA 5E3QA 3CCVS 4L72B 5D78A 3J81Y 3F73A 1NK4A 2CAJA 1VRUB 4DV4J 2KM8C 1UA1A 4MJKA 3TX8A 4Q45A 2CRLA 2HVEA 2U2FA 3DGPB 1PYOB 1H2UX 1NDPA 1GEHA 5ETTA 3SQGB 3KHLA 4LIWA 4ZVHA 1QD1A 2M3DA 2D9OA 1NAQA 2DR7A 2CVIA 1F6TA 2K3KA 2RQ4A 3PIOQ 4ED7A 3BS9A 1PJ7A 2V0NA 2Z57B 4OZLA 1RTIB 5H9EJ 3CMES 4LJMA 2VU5A 3LQVA 1YJ7A 1EARA 2YPYA 2RIJA 2V50A 2KDOA 4N7TA 3WZ0A 3MAHA 2A2DA 1R31A 3OTDA 4H4OA 2P2CB 2XZTB 3OXLA 4OLPA 1HNIA 2DT9A 3NKYA 1FCAA 4WFAQ 3KJVA 4USMA 5DDOC 2AIRB 2VH7A 3UWTA 1KVJA 1RBLA 2C28A 3D3CJ 3N79A 4LRCA 4IQXA 5IM0B 2Q6BA 1YJTA 2FB0A 2V68A 4ECRA 2AGOA 2MB0B 3CJKA 2KZMA 4DPYA 3N0VA 3MMAA 4B3TJ 4LF7F 2LKZA 2OPQA 2ZOMA 3MF5A 5CXTA 2DR8A 3MFHA 1VQ6S 3NNHA 4LUBA 2FGOA 5KG6A 4UOCA 1FE4A 5KFZA 1H2VZ 4IDKB 2BANB 4LSNA 3KNAA 2HAFA 1YHQS 4GKKF 4CTAB 1HA1A 5ETRA 2VFTA 4GC7A 3KLGA 5GMEA 3M8QB 3OFHA 2GC8A 4XPEA 1EKSA 3QGIA 2JEJA 3NGRA 1RAOA 4ILRA 3THTA 4ECVA 3TI0A 2OP5A 3VAIA 2O01C 4USHA 4PR6A 3CJ3A 4ZIWA 4R0JA 1SL0A 3WQPA 1X9WA 1DARA 4OV6A 1BWEA 3CWJA 2HPUA 4DI6A 1TL3A 2N3OA 2LQ5A 2ZFHA 3EGVA 4LF8J 1Y9OA 3R5BA 1LXNA 1Z1ZA 5C5JA 1B64A 3B4MA 4LRAA 4X66J 3ZNUA 5ITHA 1EP4B 4O3PA 1T9XA 1KLNA 1JLEB 3CTRA 2IJRA 3M8YA 1S72S 2MQOA 2BJ1A 1S6UA 1S5ZA 2YKPA 3LP0A 3PKYA 3HHNB 3T6BA 2BM0A 1S48A 2GX8A 5HBMA 3KJQB 4TKTA 2ZH8A 1S10A 1YITS 2YNIB 5F8JA 2R7OA 4JI5F 4ED4A 2ZH2A 2KM8B 4X66F 2V2QA 2OPRB 3M2UA 2MEWA 4X65F 2X3DA 2OUGA 4C8NA 3GIIA 5FDLB 1IR0A 4LR9A 4QW8A 2QIFA 1T05A 3H4BA 2ZKUA 3PJWA 1RYSA 2J9DE 3CDWA 2IYGA 1WEZA 3HSJA 3MR2A 2AU0A 4G1QA 1RTHA 2BACA 4ALZA 1KHVA 4DL4A 3HF5A 2GHVC 3BN4A 2CPHA 5BYSA 1W2BR 3M1VA 4K4ZA 3RYLA 3DMJB 3EXYA 1GK8A 2RH3A 3BR9A 3MR7A 2VA2A 2CKWA 4EYHB 3EJMA 4WZMA 1WOOA 2HFNA 4YB6A 2UU9F 4OYXA 4DS5A 4QIGA 3TZYA 2K7JA 3K89A 4YR0A 5HO4A 1PGZA 2V8GA 1U6BA 3KHHA 2F65A 1T95A 4I4BA 1KQKA 5KFNA 4RZRA 1LW2A 3DRRB 2YY3A 3GLJA 5A8WB 2KTQA 1XMBA 3TA2A 5T14A 4Q43A 2HHHJ 2IM1A 2RAQA 3PFOA 3BQ1A 4IFYA 3TJ9A 3PW2A 1HHTP 2ZH5A 1E6YA 2IYIA 3CD6S 4LBPA 1FRXA 3HMJG 3DRYA 4OFZA 3RR7A 4RW6B 4KGVB 1NKCA 3UD5A 5M2PA 2X51A 1JLCB 3MMBA 5K8MA 3EVMA 5IT9U 3TARA 4Q44A 4DV2F 1MWZA 4E2FB 3TANA 5E5NA 4CT9A 2DXEA 1ZPWX 4B9SA 1RZMA 3S8SA 2R2UA 1EB0A 1SJ1A 2HHPA 2KL8A 2PA3A 2G13A 2XHWA 2I9SA 2Z8QA 2XMKA 4F50A 1FNOA 2MTLA 4MAKA 4AYBD 3A8JA 5EN1A 4C2MA 1RCOB 1WF1A 3K5NA 3ZNJ1 4DR3J 3M9OB 4ETXA 3V6DA 1ZAVA 2VG5A 3QLHA 2QRRA 1WI6A 3ZZOA 2B5JA 5J2QA 5LT5A 4DZ6A 4ECUA 2ATCB 1Q79A 5L1KA 4LSZB 2VD3A 5KT4A 4QWDA 1X5PA 2C2MB 3MM5B 2W25A 4RW8A 5AE2A 1UEKA 1D0EA 2QFJA 1HNXF 3NG8A 2WTFA 2HHSA 4F0HA 2V8VA 1A7GE 3OUYB 4DV3F 4A8QA 4B9LA 2HNDA 1ZTTA 4IFVA 2EFQA 3DLGA 2CNOB 3HSDA 2D3OR 5HLFB 3MPUB 1JJ2R 1S1VA 3N4WA 4DDFA 1W26A 4ES2A 4KFBA 2MGZB 5RUBA 3K5LA 1O8BA 2IVFB 2QEXS 5ETPA 1C0UB 3A3OB 4PPDA 1D9FA 1HBOA 3G8QA 2HQ3A 2EBEA 1X8DA 2JHEA 2RS8A 3MM8A 2C3MA 4ID8A 1JLGB 1FDNA 6AT1B 4WPAA 1T9WA 1K0VA 3FBEA 5K5MA 4CRJA 1EKRA 5F9NA 3PCOB 1VFJA 2B4VA 2GIQA 3NNCA 1S6OA 2OMLA 3MTKA 3NMRA 1MMLA 2XSJB 4DSJA 1S4EA 2YKAA 3HJVA 1NEEA 4UQTA 4AUKA 4DR7J 5A0YA 2M52A 4NYPA 2VDIA 3OL6A 5HQ8A 3KDOA 1XNQF 1VLYA 1NU4A 4DG1B 1F1BB 4N8NA 4O0NA 3POTB 1D8YA 1UWBB 2P6TA 5F3TA 4YFUA 4JI7J 1I94J 2POKA 3CO0P 2G1DA 1TL1A 1MNEA 2ACMA 4ES1A 4DR6J 2COLA 1Y5LB 2K1RB 1A0OB 1V9OA 2VC0A 4I7FB 4QPTA 5C2CA 3KFWX 4F2SA 5GAGU 1S0VA 2VZ9A 3VAFA 1YG0A 2AV5A 5E3CA 5T7LA 3FRYA 1YRUA 5DM6Q 2DJWA 3PHEA 3JTPA 4TU8A 1TV6A 1WHWA 1RAIB 2XMWA 3GCXP 4KHRA 4OI4A 4NXNF 1NNDA 4KB7A 3AQPA 2VFUA 4P72A 3HHLD 3KG0A 3RU0A 4ZCMA 2HIQA 4DV6F 5KFSA 3EZ5A 1VR6A 1BMQB 2EPIA 1KVIA 3RRKA 4QWCA 1KVKA 1N33F 4PUOA 2W01A 4MFBB 3FBCA 2Y3YA 1GXUA 3GZ7A 5J1NA 3A3PB 4EI2A 3CD0A 4IR9A 5AXMA 1HD0A 3R1HA 4NXNJ 3V4MA 2HZCA 4GO5X 4F4YA 2VG6A 4FNHA 4KV8B 1C0UA 2UVRA 3MM9A 3CCLS 4DV6J 1FFGB 4B9MA 1AYEA 1ZA2B 3NWRA 2BMBA 4IOCQ 1YTYA 1K8AT 1JKHB 3W8GA 2DRAA 1LV5A 3H40A 3DLLQ 3K8WA 4QR0A 2CQ0A 2NXUA 5GAEI 1RP5A 4FNIA 4I69A 1QTMA 4ECSA 1X31C 2BE2B 3BR8A 4QYZJ 1CJKB 2F4FA 1RT3A 2MJNA 3TOQA 3D2WA 1UZHA 3I96A 2RF2A 1RWKB 3HKWA 2Z0GA 3R5GA 1VJQA 3M2VA 3O44A 1VQKS 1YJWS 3TZWA 3R8YA 2HYIB 1TL5A 2DISA 2W9AA 4K4SA 4AQYF 1UA0A 1ITPA 1Q53A 1RJJA 2C2ZB 4JB8B 2EVZA 1G7CB 4ZVUB 2IVMA 4LF9F 2IMOA 4JYAF 1VRTA 5MLCV 4ZVFA 1FRKA 3SI8A 5KFRA 4P9SA 1KOOA 1VOMA 3D54A 2IM2A 3P5BP 4HDGA 1VHFA 4ED8A 2MQ8A 5H9EK 2WVCA 4CO4A 5EUHA 1WSRA 4EK2A 4DFKA 3IFEA 4NCGB 1UETA 3SYZA 3IBFB 1ZAWA 3CD7A 1RT7A 4KH1B 3GTYX 3LH2S 4BWMA 5BXIA 2ZZNA 2V4JB 1SKSA 2R7SA 2H1YA 2VQFJ 1GNKA 1K1QA 1RHMB 1SC4B 1UVLA 1TKTB 2HS4A 4RW4A 2AEJA 3VQSA 4OYBA 3ULHA 3HT3A 1NKEA 4IG3A 1FXRA 2IY5B 2LQ9A 3CCZA 3MECB 4TY9A 3T9ZA 3MEDA 4CP5A 4KY3A 5L1IA 3PV8A 1BQNA 3K57A 4HHUA 2FJVA 2VHGA 5KFGA 1NKBA 3FCVA 3NRBA 4MH8A 3UDLA 1S1XA 3CDBA 1Y5NB 2B5JB 3AJ2A 3TNVA 7FDRA 5BR8J 3CJ0A 4ID5A 1BE4A 2DITA 3MR3A 2VQFF 2XLKA 5B0DA 2NPFA 3RG6A 4YHHJ 3JS9A 3D1HA 4N41A 5IQ6A 3IGNA 2I2YA 5C25B 3KNGA 3IS9A 1SQEA 1HNIB 5D4OA 1Y3JA 4BBYA 4N76A 2GGPB 2OHDA 1HL6A 2HRUA 2JC1A 3LUYA 4MKAA 2B0GA 2B4PA 3MM6B 4WP9A 3UE2A 3OJUA 2HVDA 4Y65A 4RJVA 4DX5A 1OY8A 1BQMA 3I4HX 3I5AA 4NL5A 5IXUA 4DFMA 1S7IA 1U26A 3IWNC 4F02A 1CJVA 3ZTSA 1P1LA 1FTRA 2UZAA 5KFOA 2D1CA 1YBUA 5C2GA 5DGAA 1TR0A 4RL1A 1RHUB 3KK1A 2FYXA 4P74A 1FK9B 2OGUA 3H5XA 1HD1A 2XCAA 1GTHA 2OEMA 4OV1A 3MAAA 2R4FA 2RJZA 4HACA 4RBVA 2IPOB 1HBMA 1T0TV 3GP9A 3MEKA 4NLTA 5J1PA 3QT8A 4NCAA 2HHXA 1RT5B 4C0HA 2CDQA 2C2DA 1N32F 1XR5A 5DDRC 2AKWB 4Q0BA 2KT5A 4HYKA 4LFBJ 2BXJA 4BCAA 2ZOFA 1XBWA 3K59A 2WBRA 1UFWA 4USIA 2W7OA 3U27A 3V5RA 2ZH1A 4K0KJ 5GAHU 5HAOA 5T41A 2ALZA 4CO3A 1NJYA 2XNRA 3ZZRA 4WE1B 3KLVA 2MPUA 4ZP9A 3QO9A 3CVKA 2VC1A 3UCZP 2FJEB 3VV2B 3EGWB 3VHQA 2KFZA 3D1QA 4G1PA 4D3HA 3W7BA 4F3MA 3T5HA 1IBMF 2CPEA 5F0WA 1QE1A 6FD1A 5GMKa 1RACB 1IWGA 1WOSA 2XMUA 4HTJA 2ZH4A 1TKDA 4HH0A 1HI0P 2HQDA 2UUBF 5KFLA 5EHHA 3R97A 2WK4A 5F8LA 1B7YB 1OSCA 4QYZK 3CEDA 1YDLA 4NXMJ 4E98A 2I1RA 4OYWA 4O3NA 4LVOP 1VQ9S 4LFCF 1HWLA 4XDDA 4F4ZA 1T03A 1O5JA 1PSDA 3TVKA 3OLAA 2QSFA 3G82A 3KXDA 3J7AN 2DHHA 4J9RA 3CNQP 3V81A 4L3KA 4O3OA 3UDEA 5HQMA 3PX0A 1X4BA 3DI6B 2J0XA 4O4RA 3I0SB 2Z2YB 3FSYA 3IO1A 5ADZA 1XC9A 2JEIA 4NXMF 2QA4G 4ZPAA 3I4PA 2CQBA 4X4QA 2M5YA 2EXUA 3GV5B 4DSEA 1C1CB 2RKIB 5ETVA 1A6LA 1LWFB 2GFFA 3JQJA 3RBZA 8RUCA 4LFCJ 1FXDA 2P8IA 3V81B 3D6TB 4AT1B 1VLOA 3ISZA 2VL1A 2YWGA 2ZZMA 4JI1J 4NLYA 1QSLA 3P45B 2CPIA 1RGVA 3MCSA 3RW6A 4GKKJ 4UOFA 1LFPA 3I0RB 3NGKA 2KRBA 1I1GA 2JLFA 3DN9A 4DR6F 3AOBA 3CO9A 1S9GA 2ZJQQ 5KFPA 4CIOA 3RTVA 3DXBA 1ZA1B 3EE3A 4DV5J 1M5OC 2BA9A 4PYAA 3W2VA 1SV5B 3FBFA 3VAMA 2V9WA 1IKWB 1BXNA 3K8VA 3IRXB 3NCPA 4MKVA 1R6VA 2K06A 2F5GA 3L7OA 3R7NB 4ZA1A 3TYTA 2NXCA 2ZKTA 4ZVSB 1RKIA 4OJ3A 2XLIA 2UUAJ 3BN7A 2VG7B 1UVKA 1DJ0A 3IR7B 2MSSA 3FQLA 2OTLS 2B9YA 2AMCB 3B78A 2PO4A 4JV2A 2RF2B 4DZDA 1CEZA 4DU7A 1DY3A 1R43A 2MQMA 2QYGA 4WK3A 4DUTA 5I42A 4ZMMA 1UTAA 4NLSA 5A8RA 3FMWA 1S6PA 4MIWA 4CLTA 3TX0A 3PO5A 1S49A 1HW8A 3IGVA 2VB6A 4DR1F 2X1BA 1P8GA 5GADU 3PW4A 1NJXA 3KMQA 3L9ZA 2WONA 3IM9A 3M7VA 1W25A 3PG9A 3R5JB 1N5TA 2HQIA 1QAIA 5IOLA 2QZ8A 5K8PA 3ZZUA 4KGMA 1T02A 3FBBA 4OJGA 5E2QA 1NK8A 2I6WA 1HPZB 3R27A 4WTOB 2OLWA 3D5MA 5DZ7A 4I2QA 4QPXA 5B7WA 2A6MA 1RWPB 3HVTB 3DOLA 2DGWA 2PSZA 3QT5A 4CH7A 2MHNA 3M2RA 4PG5A 2FHJD 2WSFC 5DS7A 1TVRB 2N4DA 2BJ7A 1FX2A 1FRLA 2AHOB 2CVEA 1JX4A 4IRDA 4CH1A 3LPYA 4FVCA 5J2MA 1BY9A 5J2PA 1TL7B 2DIVA 2V8DA 3KJNB 3Q89A 1ZZNA 1XMOJ 2AX0A 4IDKA 3NS5A 2A18A 4NLVA 2KXNB 4AQYJ 2DNQA 3WIUA 4WF9Q 1FE0A 2BZ2A 3Q2SC 4FKYA 1G3OA 4DPWA 4FF1A 2AJQA 5C24A 3GIJA 2RUGA 2A3JA 4DF8A 4ED5A 1S6PB 3OTBA 4OQJA 4YR2A 4DQRA 1XMQF 4I7FA 1HQEA 1HWIA 3U7JA 3D6MB 3OQ2A 4YHHF 2IVYA 2B6AA 5GVQA 2DGQA 4PKDB 5LMUJ 2DR9A 4ZPTR 1KS2A 5J2QB 4KIAA 1FRJA 1NO8A 4QWEA 1SJFA 2D74B 5C24B 5E0OA 1SIWB 3ITHB 4DJBA 3N01A 2W9BB 1S97A 2DPIA 1FTCA 2R7UA 1W2IA 4ZPVR 2P6SA 1S0OA 2ZH7A 1NB7A 1CC7A 3PXGa 1HBMB 1HNVB 1R3NA 1MU2B 5LXRA 1LWCA 1IKVA 1Q86T 2VKRA 2NZ4A 2EC2A 3KG1A 2ZBIA 2PT0A 4U67Q 2UUCJ 1JLCA 2CQ3A 2E9RX 2NZCA 3NAHA 3OBIA 5KFDA 4H4MA 2Z4PA 4Y2IA 4X4NA 1ELOA 4ZVQB 5FIIA 1VQPS 1HBOB 2D3UA 3ETMA 4LR8A 2ZBRA 3KLGB 3ADAC 2BR0A 1JLBA 1FESA 4DL3A 3BGLA 3DLJA 3CJRA 1VQ4S 3ELHA 2HRYA 4GRSA 3IG1B 2G0JA 1VRUA 2RKIA 3JQKA 3ET6B 3M32A 1SH3A 3MD3A 5CH7B 1KRPA 3RRHA 3FUYA 2LMIA 3M05A 5KG1A 3AHPA 2DYAA 2V4QA 4OX9J 1KDNA 4ANCA 1F9HA 3CB4A 5K8NA 3RB4A 2DNPA 3OR1B 3V4IB 2HHVA 2EFGA 3MDFA 1S1WA 1Y7PA 5HP1B 1FFSB 3GJQB 3MCMA 3QIDA 4ZITA 1BLUA 1QAJA 5M2UA 2XULA 2DPJA 4MK8A 4G1QB 2XYPB 3LGHA 1PCAA 4RUAA 3C15A 1ZOTA 2XZDB 1TFYA 2FJXA 5CHCB 4URSA 2HNZA 3CF5Q 2IRYA 3NGTA 3HHLA 3W5XA 2R7TA 4IG3B 2MKYA 2A10A 3NOGA 1PIEA 4KPCA 2HFZA 3R2DJ 4CM0A 2ZH3A 4M5IA 3A4TA 1EETB 3R6LB 3C6TB 1U0HB 1RT4A 2C1EB 2CPXA 1NUEA 2QYCA 1Q5YA 3FSXA 4KTQA 1RABB 4FXVA 1VYAA 4NRTA 4TLQA 2KFYA 1AB8A 2WB1D 4FN5A 1FNXH 2CZVC 1MROA 5KT5A 1PO6A 1KLMA 2KVIA 2XEXA 4HI1A 2PA8D 1HW9A 3VVUA 4MFBA 9RUBA 3MPVA 3BSAA 4B3RJ 2HVHA 2E1AA 4ZIVA 3S7RA 2XS7A 3T19A 3EICA 1X0PA 1OSDA 2CQ4A 3MMCA 4ZVPB 4PG8A 4ITSA 2ZE2A 1HQUB 2DNRA 3EUNA 4KR0B 5MAOA 1NSQA 1KEKA 3PNIA 4M5GA 2XS2A 1N56A 1VISA 2V94A 2KB2A 3KJFB 4DQPA 1TKZA 3QGHA 2ZVIA 4NI2B 5D15A 4DUZJ 3CCRS 4WFBQ 3Q86A 2GAGC 2UUBJ 2YNHB 3QT7A 5KFQA 1YLXA 2D9PA 1LW0A 3GFYA 3KK1B 3FNNA 4A4JA 1X9SA 4EZ9A 3UR0A 2ZHBA 5G0RA 1UJ4A 4QU6A 3GSIA 4GKJF 3OD2A 1N8RT 2HGNA 4HI2A 2RNEA 3PYFA 3ZZPA 4F25A 4CTAA 3QJPA 3J7A1 1FRHA 1K1SA 2BJ9A 2GW8A 5J2NB 4ZS6A 4I67A 2OD4A 3G87A 3KLFB 4WU3A 2XSJA 3LGMA 3UO0A 5KFBA 1HBNB 3N5FA 1IBLF 5ETKA 3HHLB 4IH5A 4RNOA 8AT1B 2YNIA 2ZDPA 3Q2TC 2XS5A 3Q8RB 1HHSA 4HHJA 4LF4F 1WACA 4I56A 5EX0A 4OHZA 4OI1A 5KFEA 2FC8A 4DR2J 1TUGB 4DU8A 4YOEA 4N5SA 2NUHA 1GXLA 1IJEB 2VFSA 3NCQA 3TAMA 3NEKA 3EWGA 5HVFA 5DDQC 3BDPA 1PJ5A 5JJBA 2JVRA 3TEHB 1RWUA 3OTOF 2FUG9 3IAM9 3OXFA 3LWLA 2WVDA 4RW4B 1GMWA 3HX9A 4HACB 4CDIA 3GQCA 2DXFA 3MMCB 4X4OA 5A8RB 2UV8G 4AL5A 1H73A 2XCPA 1FK9A 3EDQB 1S77D 1RADB 4HH1A 2Q66A 1FDAA 3GFXA 1U7LA 3P96A 3D6FB 2KYZA 3CULA 4U8VA 3BKFA 4P7TA 4RNFA 5KT3A 3RAXA 2MZTA 3DM2B 2QLWA 1XWLA 1MWYA 3VCDA 2W9CA 4KHPJ 4A8MP 2DB1A 4LSNB 2L9NA 1DURA 1TU0B 2Q1LA 4LRBA 2M7SA 4USTA 4EO8A 4DR3F 2J0QD 2DGOA 2EKNA 1RT6B 2H9ZA 2OKQA 2K2PA 4OLOA 4PAAA 3K0JA 2EFOA 1AFIA 4PZVA 2O1PA 1PAEX 5A6WA 4UT4A 3EVWA 1V3ZA 4CLSA 2Q43A 1IKYA 1KFDA 3JSYA 3UNGC 3W9HA 5HL7Q 4FYVB 1UVIA 4Y6IA 2RHSB 3I9ZA 2E44A 5LL6d 4ZJOA 3PRDA 4KHPF 1NB2A 4DMZA 1N34J 2YKMA 4Q2MA 2QO3A 4OHXA 3UQSA 5K20B 2I38A 1Q8KA 3KDNA 5L1JA 1REVA 4W98A 2DK2A 2MZSA 3AA9A 1VK3A 1UAWA 1HARA 5BR8F 4LQ3A 2BYCA 5DQHA 3A8IA 2DHGA 4NZ0A 2CADA 2ZWPA 3ZZTA 4CLZA 1NJZA 4NLXA 2AJ4A 3PZPA 3CC2S 3BEGB 3GJSB 1XMQJ 2Z2LA 1GMUA 4A8XA 2M70A 3CCES 3CCWA 5LMNF 1X9MA 1T3OA 3TRGA 4CLFA 2W4DA 3SSSA 1YZ7A 2XMTA 3M6WA 4TYBA 1O6XA 3BREA 4B08A 5HJYA 1KR4A 3VAJA 4DV7F 2AQ4A 2GJIA 3VAKA 2QMUB 1ZZFA 3MFIA 3UDVA 2W8LA 1F9FA 3JSMB 1H0HB 3AXMA 3QIPA 2ROEA 3C16A 3U1MA 4EGLA 2CJBA 7FD1A 4DV0F 4PG4A 4MK9A 3D9BA 3QZ8A 1N36J 4LSLB 2R7QA 5E3RA 2L41A 2YNFB 1EZZB 1KD1T 1NDLA 5KT7A 3QNWB 4FPIA 2AYGA 1BC6A 1QE1B 5LJ5Y 3E01A 2MKKA 5ETQA 2JFKA 4K5SA 2BJDA 3ITHA 1U02A 3EM1A 1EX8A 3L7UA 3PACA 5D77A 1TK8A 2VV5A 4M5DA 2QL5B 2EI5A 2FTRA 3OTEA 2XLJA 4BS2A 4P52A 1QLNA 1GH8A 3H0PA 1XQIA 2LXFA 2E1RA 5D4PA 3O1LA 3CJ8A 4IO1A 4YB1P 3PIPQ 4X64J 1APSA 4IQMA 3W2WB 1RAAB 1LNQA 2YKOA 4O23A 1DTTA 3K7RA 1W7WA 2FZCB 1JLEA 2HQFA 3BBCA 5A8WA 4RWXA 4QR2A 4V1Ak 4K4TA 2FVPA 4LVNP 3PX6A 1F3FA 2E1PA 4USKA 4ER8A 3UDCA 4NLGA 1V5IB 1T94A 2QL7B 1PJ6A 4EYIB 2DRDA 4EEYA 3VGVA 3I32A 3IAS9 1U8WA 1YX2A 3QPIA 3OR2A 3UI3A 2OPPA 1LWEA 2P9GA 1AZSB 1C0TA 1LXJA 2EFNA 2KJWA 2MLXA 3M1VB 2RRAA 4P73A 4R5PB 2UVVA 1R0BG 3H7HB 2C3YA 5FLXU 2NPIA 4YB5A 2V9KA 1Q95G 3LWMA 2HFVA 1Q4RA 2V2VA 2G4BA 4OHWA 3M8SA 1FJGF 1R8HA 3ENAA 4V19J 3LO3A 5FDLA 1FHTA 1RXOB 3OR2B 4JP8A 3K5MA 3CDUA 4TVAB 1T11A 5E3AA 4V19X 2JLEA 3KLHA 4IH6A 2CQ2A 2CQCA 3GJTB 1CS4A 4DX8H 3HHEA 1SKUB 2MZQA 4J91A 3RB3A 3DDIA 4P2SA 4C11A 1CJUA 4ZHRA 2LYVA 4ECTA 2BDPA 1IXKA 2MQNA 2VQEJ 2UVUA 4LF6F 4HR2A 2F3JA 3DLEB 2UUTA 1X5OA 4GKJJ 3QRPA 4NX9A 2HMIB 1NJIT 3IR6B 5K14A 3MR5A 1U1QA 1IQTA 4OHYA 1QUPA 1T9YA 4NLOA 3GIRA 3PYEA 4YDXA 2YTCA 1EQMA 4ZP7A 3VVTA 2LA4A 2RQKA 4FZVA 2IA0A 2QT7A 2DRBA 4URQU 1KNZA 2J7WA 2HBZB 2DGVA 2FGCA 4X4UA 1TKTA 5DO2A 3T1YJ 3W66A 3J80Y 4LF6J 1DBDA 2VFVA 1FO1A 1YZ6A 4UOGA 2GJ2A 1NM2A 2OO4A 2G0CA 3RAQA 1YK9A 1V6HA 3FEYB 4G1IA 1FEEA 1R27B 2XB2D 4F4AA 1YBTA 2YWFA 3MPYA 4C4WA 5IC6B 2XY7A 4FVMA 4Y00A 1WJ9A 1T9VA 1S79A 4F8RA 1UPMB 2CG4A 4IUFA 5GMDA 1B3TA 2F4VJ 3HO1A 3C6UA 3MHYA 1REGX 3ILIA 4EUVA 1SQGA 2F63A 2ATLA 1WC0A 3QWUA 2ZITA 2AJ2A 2MJUA 3HKZD 3MMJA 4FS2A 3V6HA 2BJ8A 1KC8T 4U7UD 1AROP 2UVWA 1Y0HA 5FJ4A 4O44B 4NPOA 5KG0A 3TZZA 4U6PA 3H42A 1G1XA 1DLOB 2ACYA 5HVHA 2KH9A 2JVOA 2VA3A 3NBPA 2CXEA 1U1LA 5KG3A 4MYUA 4PWDB 4QOTA 5F0UA 1JLQA 3OR1A 2VUGA 2FZKB 4RPFA 4ZHRB 5DLFA 1SPBP 2R3VA 4DQIA 2CQPA 2Z56B 1KQGB 2O67A 2V63A 2LXIA 5KTQA 5DGBA 3POTA 4E8UA 3KMSA 2AYMA 4L6V3 1U49A 1FKAF 1VIOA 2FJBB 2C2EA 4K59A 3LOUA 2XYGB 4CI0B 2WB4A 4WFYA 8ATCB 4DWIA 4DL0C 1IBKF 2UXDF 4N8OA 3DM2A 2BV3A 1JK9B 3I56S 2AGPA 1ZH5A 3N6NA 4DSFA 4GC6A 1IQZA 2ZUGA 2F9DA 2E29A 3N28A 4NLUA 4ENOA 4C8LA 1X4HA 2B9XA 2X1GA 2J6TA 2QLFB 4ZP8A 1VC6A 4PWDA 3IMQJ 4G6VB 3KK2A 2XTJP 4UQGA 2CJ9A 3M30A 2PIIA 5ETSA 1NK9A 4J9SA 1MWQA 4KYZA 2XO6A 1WHXA 2BQUA 1X5SA 1EP4A 1HNVA 2A0FB 5DLGA 4DCJB 1HNWF 4X4PA 1H7XA 2D3ZA 1JWWA 3F44A 1RT5A 2FJAB 3JTOA 2WONB 4NMLA 3SFGA 3J7ZT 2XGPA 1VQOS 3ISNC 1OWXA 2F8HA 1FRIA 2OAUA 2ZE2B 2DD8S 1RKJA 1XN9A 4U96A 4ECXA 1NH8A 2W2QP 2C3OA 3KUHA 3MM5A 3L95X 4DV1F 4JV1A 1L3UA 1FWLA 3KK2B 2I5JA 1LKZA 1N5VA 3DNCA 2HBYB 2YBVA 2CA9A 5DETA 3SMZA 3ZTPA 2ILYA 5KFYA 1N36F 2DHXA 2GS8A 3VZHA 1UWBA 2OPSA 1NXIA 1HYSA 5KFCA 4WCEQ 3D28A 4ILLA 5HROA 2PE8A 4K4XA 2AJFE 1PKUA 4NLPA 1OPZA 1FJCA 3Q8SB 3L09A 3RJMB 3UCUP 1O51A 4WJBA 3KLIA 1SV5A 5ETLA 5JXSA 3D0GE 2QV6A 1B70B 2HWIA 1TFWA 3C14B 1UVJA 5JUMA 4EFAC 1SC3B 1Z2ZA 2YH1A 1U2CA 2PEBA 1PYSB 4JBCA 2R8KA 1IKXA 2IM0A 3UN5A 4DEZA 2UXBF 2PFFB 2YNHA 4EO6A 2UXCF 3RZAA 1U1PA 2DNNA 1IVZA 3RR8A 3RBXA 2X1AA 4HTIA 2WVEA 3SDEB 2BE2A 1BQNB 1RTDB 2IHR1 3E8OA 4TU7A 2IA6A 1OY6A 2N3LA 4OZ1A 2E5HA 2J9EA 5E33A 4EMDA 4PQUA 2RRNA 3HVAA 2H54B 4L75A 2ASDA 4X62F 3HSGA 5KG2A 3J81U 3TAMB 2F40A 3OXGA 5D0HA 4PRFA 9ATCB 4I2PA 3I31A 4WXOA 1Q82T 3IR5B 1N33J 1M1KT 2YKMB 4CYUB 3BBBA 2QMWA 2W4PA 1U47A 2DCLA 1OY9A 3NY0A 2LLZA 5LSRA 1G2EA 1EHWA 4CLLA 3DGPA 2KO1A 3W9JA 2VJVA 3C66A 3LP1B 3BV8A 3I82A 1TK0A 2AF6A 5M2RA 4ILMA 4N47A 3R2CJ 1RT4B 2M4MA 1JLFA 4O4GB 1VRQC 2Y1JA 1LEOA 3GR0A 5AJ3J 1WKKA 3I9V9 2CG8A 3QWPA 3WBZA 3H90A 4DN0A 2HVZA 2NSBA 3CMQA 2BQ3A 3NP5A 1S9FA 2YH0A 4DUYF 1Y11A 2NLWA 5E41A 2ZVSA 2MY7A 2XHCA 2MLZA 3JQMA 2V34A 3AJDA 3DLEA 4IO9Q 1SXLA 2LP4A 1S1WB 4WKRA 3H2UB 1P27B 1NDCA 2JFDA 2NSCA 5GAHI 3CUNA 4AL7A 1UJ6A 1H72C 2GMJA 4KKOB 1XR7A 5CYJA 4OX6A 2ZC3A 1IM4A 1RDRA 1BWVA 3CJQA 3CCJS 1LWFA 1HBUA 1RTJA 3L4BC 4B9TA 4CO0A 1C2PA 1RA6A 3TW0A 1Q78A 3R5AA 3A8EA 2E7WA 4EWTA 2O3DA 2OFGX 4D3GA 5CD4A 1RHJB 2ILZA 4M5HA 2BE9B 3SDEA 5KFJA 1D3WA 3GMGA 2HHQA 3AD8C 4XIUA 2H48B 3IN5A 2CYYA 3KYLA
chains in the Genus database with same CATH topology
2CJQA 3A1YG 1L5UA 3BSCA 3HFKA 1FKPB 4KRWA 4OZJA 4RWWA 4DPOA 2VOOA 4WFNQ 4C9DA 4LIRA 2M8HA 4R5PA 4YEAA 2FVCA 3SCLE 3BGRA 1T05B 3CJ4A 2KZZA 2AWZA 4HL9A 4ATNA 2IJFA 3FGVA 4CNZA 3FRZA 5DG9A 1UVMA 4IH7A 2BANA 1J2VA 1VBZA 2DNZA 4OX8A 2N7YA 1KTVA 2NQPA 4WU2A 3G9CA 1UEVA 2R8HA 2YQ3A 1KFSA 4AFFA 3P6YC 4Y2AA 2DGUA 3GIKA 4NCBA 3S6EA 4OHVA 1IJFB 2KT3A 2MKCA 2W8KA 2FLLA 4KO0B 2HFOA 3OHBA 4MIAA 4M5DB 4QU7A 3JB9k 5DM7Q 3DXSX 2YX1A 4O44A 1F5AA 3OJSA 2PMZD 3MEDB 1SUQA 2L3MA 2WSCC 4WIIA 3N5BA 4ICLB 5L8RC 5KT4A 4RNNA 2C2DA 1XMQF 2LEAA 3IWLA 2DBBA 1VMBA 5D4LA 2KKHA 4J9NA 1HMVA 4Q8FA 5C42A 1S0NA 1YRXA 2YX7A 4QJVA 3SEOA 5CCMA 3LALA 2KG1A 1S99A 4Z37A 3EPIA 4ZVGA 3BJYA 2ZJPQ 4F4XA 2RRBA 3HK2A 5EWGA 2I8EA 4A8YA 4QCLA 3C3LA 1XERA 2YKQA 3JTNA 3TUIC 3UCGA 1OQ6A 1GT8A 4CO5A 5D4NA 4DFPA 3VWSA 1DAXA 1MU2A 1M5KC 3DLGB 3NAIA 1VBXA 5AE1A 1BGXT 4LF8F 1IUJA 1RISA 2FHJA 3JSRA 3H5SA 1H7WA 1U1KA 3BDEA 1PILA 1QM9A 3MEEB 2ZDOA 3BO3A 4C8LA 1NHVA 2NYIA 1R6YA 3X3UA 4CCHA 2F7VA 2IFXA 4K0KF 2HMIA 2ZD1B 1TUVA 3G6ES 1Q1KA 4OX9F 3ENWA 2ZM6F 2J6UA 2SXLA 1SL1A 2MZRA 2GQ2A 3HHLC 3UW1A 3G8TA 3B4DA 1IKYB 1HFEL 1TZ0A 4ERDA 3FZBA 1RT2B 1S1TA 1RT6A 2IBKA 2RD5C 1SC6A 4JI1F 3ENQA 2V5HG 1S9GB 3NLCA 4C3LA 2BBEA 3CCSS 1TL4A 1SBRA 3M9NB 4WE1A 1HR0F 1ZM3A 3SSQA 3V2UC 3KHRA 3T5LA 4QIEA 5KOWA 1VC5A 1H3DA 4LQ9A 4RUHA 1WNEA 3LP2A 1LWCB 2PI5A 3KK3A 2R8GA 2RVJA 3DRRA 5EX3A 2QE5A 4ZPBA 1KSPA 4ECQA 3DOMA 5F8GA 4C8YA 1S4FA 5EGYA 2CQHA 4OI6A 5U47A 4ELTA 4ED6A 2K8GA 5FD1A 1WELA 4HLBA 4WTYA 4Y2MA 3AAWB 2BW2A 2R7VA 3G6XA 1S1UB 4BHQA 3I87A 1WTFA 2LECA 2IAJB 2XNQA 3T6JA 3VR1A 4G3IA 1RI7A 2VFRA 1RYRA 2K7KA 3M8PA 3HHDA 3MZIA 3DC2A 4PQAA 4DV5F 1R0AB 1HWUA 2OPRA 3M2UB 4ZLPA 1N5YB 2R2RA 1Q8IA 3F56A 4NOHA 3T1YF 1L3VA 1WG1A 1X4FA 3MM9B 4CO2A 2CPDA 2MQLA 2U1AA 2E5GA 1TKXB 2RQCA 3CXCR 3IS9B 2ROPA 4J9QA 1VQNS 2UP1A 2CPYA 3I5BA