1SV5B

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B03
2UUWA 3C6UB 4ECXA 3G6VA 2HNDA 1HYSA 3T5LA 2B6AB 3LP0B 1TKZB 3H98A 3IN5A 3V6KA 1TP7A 1QAIA 4ICLA 4RUCA 5F9LA 4RW9B 4I2PB 5KFSA 5FDLB 4HKQA 2ATLA 2ZE2B 4NCGB 4LQ9A 4EEYA 4RNFA 1EP4A 4NYZA 3DRPA 5KFPA 3KLHA 3KHHA 1JLAA 1WNEA 3PR4A 3M8PA 1NHUA 4Q45A 3NGDA 3QO9B 1RT4B 4I2QB 4Y34A 4ED8A 1S9EA 1HNVA 3NAHA 2WOMB 5HLFB 1BQMB 2W9CA 1DLOA 1JLEB 5CYQB 1ZTWA 4LSNA 1S1VA 4ZPCA 4TYAA 4O44B 4PQUA 3NAIA 2FLNA 3DRSA 3BSNA 4F4WA 3SI8A 1DTQB 1C0UB 2OPPA 2C22A 3QGHA 4J9RA 4URSA 4R8UB 3Q8QB 3IS9B 5KFVA 1EETB 3V81B 1RAJA 5DQHA 4RUAA 2JEFA 2R2TA 3MEGA 3CDUA 3QIDA 2R2UA 2C2EA 4RW4B 5KG1A 4ECZA 4ZHRB 1S49A 2CKWA 2VG5B 1LWEB 4J9OA 4NLOA 5KG6A 4DL2A 4IKAA 4O4GB 4KV8A 4DG1A 5J2MB 4RW6A 3PVXA 1S6QB 5KG0A 4OL8A 5KG4A 4Q8FA 3D5MA 1MU2B 4PWDA 4NLSA 3MF5A 4ID5A 1JLFA 3HKWA 1FKPB 4NRTA 1JLBA 1SUQA 1TVRB 2HWHA 3OHBA 2JC0A 2V9WA 3IRXA 1S1TB 2HNDB 4URGA 5KFDA 4TQRA 1N48A 1S0OA 4ICLB 4MFBB 5KFUA 2R8IA 2YKNA 1JX4A 4ED1A 3DRPB 2FVRA 5KFKA 3KLHB 4QW8A 1JLAB 1C0TA 3M8PB 4J9SA 1QAJA 2I1RA 4DL5A 1KLMA 3H5XA 3KNAA 1S9EB 1HNVB 2W9CB 1DLOB 3I5AA 4NLTA 4IDKB 4G1QA 3TAMA 4LSNB 5DQIA 5L1JA 4PQUB 2HMIA 4I2PA 3GIMA 5FDLA 1K1SA 5EWFA 3DRSB 3OL6A 3GV7B 1T3NA 2F8EX 4WZMA 2OPPB 4GC6A 1SV5A 1JLCA 2GIRA 3V6HA 2W7PA 4IR1A 5EWGA 4WE1A 4NLGA 5KG2A 2BQRA 3MEGB 4U7CA 4DL3A 4IFVA 3DOLA 4WXOA 3HVAA 4KKOA 2BQUA 3GIIA 1RT7A 4KE5A 3UR0A 2VG7A 1S4FA 4LQ3A 4DG1B 4KV8B 5F8MA 4IRDA 4RW6B 2IAJA 1RA7A 1C0UA 2ALZA 3OL9A 4R8UA 2XGPA 5KT4A 4GC7A 2XC9A 4KFBA 2FJXA 3M8QA 3D28A 3PHEA 3V81A 4WYWA 5KFYA 5DG9A 4ED6A 3PW2A 2OPRA 2JEJA 4ID5B 4O3RA 5HP1A 4K4SA 1JLFB 5KT3A 3M9NB 4WXWA 1JLBB 1SUQB 2XI3A 3H59A 3MEEA 4TY9A 4M95A 4DL7A 3IRXB 2ASDA 4I7FA 3H2LA 5KFHA 4MIAA 2FVPA 5F8HA 4RU9A 3CDWA 3JYTA 4DL4A 1LWEA 3HVWA 2UUTA 2VG6A 5C5JA 2JEIA 4EBEA 2IMWP 4F50A 2BR0A 1LW0A 4XPEA 3PR5B 3KLIA 3MEDA 2D41A 1NNDA 2AQ4A 1TV6B 5F8LA 1LWFB 4MKBA 3Q8PB 4NLDA 4IOBA 3OSPA 5KFFA 3QZ8A 2B5JA 1KLMB 1S1TA 5KG5A 1RTJA 3GV8B 3RB6A 1HQEA 1N6QA 2DPJA 2J6SA 4FBTA 3NL0A 1NHVA 3DOKA 4G1QB 3TAMB 2V4QA 4O3SA 4NLPA 1RDRA 4MFBA 4O3PA 4NLWA 2HMIB 4EBCA 2IJNA 1GX5A 3KK3A 4ED0A 4ED2A 2ILYA 5JUMA 3PW0A 1SV5B 1JLCB 4ZP6A 2R8KA 4WZQA 1JKHA 2JC1A 1HMVA 4O4RA 3DM2B 2BQ3A 4WE1B 4Y2AA 3KLFA 5KFMA 2J6UA 1R0AA 2ZD1A 4KO0A 1IKXA 4IFVB 2WRMA 4H54A 4IH6A 3DOLB 4IDKA 3M9MB 3QYYA 4KKOB 2I5JA 1HNIA 1RT7B 1JXLA 2VG7B 3PW5A 3DDKA 4MH8A 5KT7A 3H4BA 3BQ1A 4TN2A 5KFLA 5KFIA 3OLBA 5DQGA 2R8JA 2IAJB 4ZPDA 2WONA 4NLYA 2D3UA 3RB0A 4KFBB 3M8QB 1IKVA 4IQXA 2ASJA 2WTFA 4QPXA 2OPRB 5HP1B 2FJVA 4X2BA 3I5BA 5C25A 1TL1A 2FLPA 1S6PA 1MMLA 3MEEB 1XR5A 1SH3A 4I7FB 3UQSA 3DLGA 1D0EA 1FKOA 4QWCA 2XCAA 1RYRA 3JYTB 5J2NA 5C24A 3CDEA 2FVCA 3LAMA 5DLGA 5KFWA 3PJWA 2HNYA 2W9AA 4K4YA 4ECSA 3TQ1A 4J9NA 2VG6B 3H5SA 4TQSA 1Z4UA 3OLAA 4KHMA 1LW0B 5KFTA 5F8GA 3JSMA 4Q44A 5J2PB 2WK4A 3H5YA 1RYSA 2GIQA 4ZP9A 4K4VA 3MEDB 1C1BA 2IC3A 3KLIB 3ICLA 4QWEA 4K4XA 4IG3A 2CJQA 4ECUA 2RF2B 3FQKA 5KFJA 2XGQA 2E9ZA 1BQNA 4ECVA 3QIPB 3SFGA 2B5JB 3I0RA 3N6MA 1RTJB 1HQEB 1N6QB 3RBEA 5KFBA 3OHAA 1HQUA 3BSCA 3DOKB 4IG0A 2OH2A 5KFZA 4KSEB 4HYKA 1S10A 1QE1A 2V0NA 3CWJA 3ITHA 3KK3B 4U6PA 4KB7A 2J6TA 1RT3A 2UVRA 4O3NA 1RT5A 5KFEA 1UWBB 3GIKA 3FRZA 3KK1B 1JKHB 3KLEA 3IG1A 1HMVB 1TV6A 3CJ3A 3VQSA 5KT5A 2W7OA 3NBPA 1LWFA 4H4OA 4RW8A 5EUHA 3ISNC 4FS2A 3KLFB 1R0AB 4M94A 2BE2A 4G3IA 3H40A 2ZD1B 4ZVHA 4KO0B 1IKXB 2HNZA 4Y3CA 3G6XA 3EPIA 2R8HA 4F4ZA 3GV5B 1RA6A 3CVKA 2W8KA 3MR3A 1HPZA 4Q8EA 3MECB 2I5JB 1HNIB 3HVTA 1KHWA 2R8GA 2V4RA 5DG8A 1S9GA 3H5UA 3LAKA 3LP2A 2WB4A 3MFIA 3V6DA 3KLVA 2W9BA 2YNFA 1W25A 2WONB 2XCPA 4NRUA 1TKTA 5KG7A 1S0NA 3DM2A 1IKVB 4WFZA 4WYLA 2UVWA 1S97A 4YMEA 4Q0BA 3I0SB 5C25B 3E01A 1RT2A 1TL1B 1N5YA 4DEZA 2VA3A 1S6PB 3FFIA 4ZPBA 4J9QA 4IFYA 3MR2A 4J9LA 3DLGB 1FKOB 1FK9A 1TL3A 2UVUA 2OPQA 5J2NB 5C24B 2O5DA 4KBIA 2HNYB 3DRRA 4NLRA 5KFNA 3RAQA 2AX0A 4MK7A 4LSLA 4TLRA 3DMJA 3CIZA 1C2PA 2AGPA 1S1WA 3JSMB 2AGQA 1JLGA 1C1BB 2IC3B 4TY8A 4IG3B 3V4IA 1K1QA 1ZTTA 3PW7A 3CJ0A 5KFRA 3T5KA 1BQNB 4R0EA 1TQLA 4O3OA 1S1UA 3I0RB 2IM1A 3KHGA 3T5HA 1HQUB 4IG0B 1S9FA 3UDLA 1QE1B 3CJ4A 3ITHB 3HHKA 5HBMA 3RAXA 1LWCA 1RT3B 5J2PA 2D7SA 4TXSA 1RT5B 3V6JA 1N4LA 5L1IA 4ZP8A 3DYAA 3IG1B 3KLEB 5L9XA 1LW2A 3UPFA 3QGIA 4F4YA 3NBPB 4H4OB 2RF2A 4RW8B 2R2RA 4ZPAA 3RB3A 1S1XA 4WFYA 3QIPA 2BE2B 1IKWA 4O3QA 2B43A 2FJWA 4RZRA 3KK2A 1RT6A 2HNZB 3EZUA 3NKYA 4MK8A 3C6TB 2C2RA 1HPZB 4K50A 3HVTB 2JLEA 1S9GB 4RW7A 3LP2B 1RTDA 3V6DB 1VRUA 4EO8A 2W9BB 2YNFB 1UWBA 2YKMA 2HWIA 3BR9A 1TKTB 4ECYA 5DG7A 5HROA 2JEGA 3OL7A 2QV6A 2VA2A 4NLVA 5JXSA 4YP3A 2R2SA 4QWBA 4RNHA 4NLUA 4Q0BB 3BGRB 3E01B 1RT2B 2E9TA 4H4MA 1N5YB 5KFXA 3FFIB 3LALA 4B3OA 4IFYB 3KLGA 5I42A 3QLHA 3PZPA 4ECRA 1FK9B 1TL3B 3LP1A 3MECA 2AWZA 2OPQB 5I3UA 3MR6A 1QUVA 3G6YA 5L1LA 3DRRB 4PUOA 3BJYA 2AU0A 1T94A 5F8IA 3RBDA 4LSLB 1S48A 3H4DA 5KG3A 3DMJB 4TYBA 1S1WB 2RDJA 1JLGB 1DTTA 2IM3A 1ZETA 2QE5A 4TY8B 1JLQA 3PJXA 3V4IB 1REVA 3I0SA 4KAIA 2BANA 3GIJA 4ED3A 3KOAA 3SFUA 5KT2A 4EYIB 1YVFA 1S1UB 1IM4A 4ZVGA 1RT1A 1KHVA 3DLKA 3DI6A 2ZKUA 2AGOA 5CYMA 5C42A 5HBMB 4RNMA 3GILA 1LWCB 1RTHA 4JV2A 5EDWA 3KMSA 3DYAB 4JUZA 1OS5A 4K4TA 1LW2B 4K4WA 5EWEA 4FS1A 1IKYA 3EPGA 2FVQA 1S1XB 4EO6A 4XPCA 1IKWB 1CSJA 4ZP7A 4R5PA 3GQCA 3KK2B 1RT6B 2AX1A 1TKXA 4IR9A 2ILZA 2YNHA 4MKAA 4YR2A 5KFOA 1VRTA 3Q8RB 2BRLA 4EYHB 4RW7B 5J1EA 4K4ZA 4URQU 1J5OA 1RTDB 3OSNA 5KFAA 1VRUB 1D1UA 2BRKA 2YKMB 2YNIA 3N6LA 5HROB 5KFCA 2WHOA 3T1AA 4IRKA 3DLEA 5K14A 2D3ZA 3TVKA 4J9PA 3Q8SB 4J9MA 4FBUA 4Q43A 4NLXA 2YNGA 4WFXA 4YR0A 5L1KA 5F8NA 2OPSA 4H4MB 3LANA 5J2QA 4B3OB 3KLGB 3C6TA 5I42B 1SH2A 3QLHB 3BREA 2DPIA 3FSIA 2UVVA 1HYSB 3LP1B 2RKIA 5I3UB 3OL8A 2XWYA 2FVSA 2FLLA 4PUOB 4RNNA 4ECQA 2EC0A 3GYNA 1C1CA 3I5CA 3FDSA 4DL6A 4IH7A 5D3GA 1DTTB 3M9OB 2IBKA 1JLQB 1EP4B 1T03A 3BSOA 3RB4A 5KT6A 1REVB 4ZVEA 3CO9A 2BANB 3BGRA 1T05A 3MTKA 1RTIA 3KJVA 3KK1A 1I6JA 3E51A 3BQ2A 5DLFA 3CJ2A 1JIHA 3C6UA 4KHRA 3FQLA 1RT1B 1XR7A 3KMQA 4JV1A 2B6AA 3LP0A 1TKZA 3MR5A 3DLKB 3BSAA 2HAIA 4JV0A 1S1VB 3DI6B 2E9RX 4MK9A 5CYMB 4RW9A 5C42B 4ZMMA 4ECTA 4J9KA 1U09A 3QGGA 2ZE2A 4NCGA 4QWDA 1RTHB 3KHLA 4IH5A 2IM0A 3BQ0A 3IGVA 4NZ0A 1IKYB 3QZ7A 2XI2A 5DGBA 2C28A 1HARA 3QO9A 1RT4A 4I2QA 4R5PB 2WOMA 5HLFA 1BQMA 3T5JA 1TKXB 1JLEA 2W8LA 5CYQA 2YNHB 1SH0A 2IA6A 2GC8A 5F9NA 4ECWA 1VRTB 4O44A 3G86A 3PW4A 3NMAA 4NLQA 5J1EB 2ASLA 1J5OB 5F8JA 3T19A 1DTQA 2YNIB 4QWAA 2C2DA 4RNOA 3IS9A 4PWDB 3DLEB 1EETA 5K14B 5KFGA 4XO0A 2IM2A 3KHRA 4ED7A 3ISND 2YNGB 3N6NA 3CJ5A 2OPSB 5J2QB 1N56A 4Y2CA 4RW4A 4MIBA 4F4XA 3IGNA 4ZHRA 2VG5A 2RKIB 4YQWA 3MFHA 4IRCA 5KFQA 4O4GA 4K4UA 5J2MA 2YKNB 1S6QA 1C1CB 4QW9A 1GX6A 5DGAA 5D3GB 1MU2A 1T03B 2WCXA 1S0MA 5T14A 4YR3A 4EBDA 2IJFA 1C0TB 1T05B 2RDIA 1FKPA 1RTIB 3KJVB 1XR6A 4ZVFA 1TVRA
chains in the Genus database with same CATH superfamily
2B6AB 3V6KA 1MW7A 2NZ4A 4HI1A 4RNFA 3M8SA 1APSA 4DS5A 4QU6A 2LECA 4PQUA 3HSJA 3AJ2A 4PXBA 3M6UA 4UOCA 1RHJB 4DV7F 3V81B 1JB0C 2VFSA 4F4AA 1YLXA 2L9NA 3PFEA 4V19X 1LWEB 4PRFA 2A2DA 2ZH9A 4I69A 2F9JA 2CWKA 3D68A 1BD6A 1S1TB 1UA1A 2HFZA 5KFUA 3EGWB 1WC0A 1NK6A 3NGKA 1GXTA 3KLHB 2BJDA 4B9SA 2VDHA 2MZSA 4NLTA 1T3OA 2HMIA 3QJLA 3DOMB 1JLCA 4IR1A 4H4KA 2F5GA 3D6HB 2BA9A 2HS3A 1G7CB 4FZVA 2BQUA 4KE5A 5M2RA 1WSVA 2CZVC 2DEIA 1IWAA 4M5DA 4ID5B 3AQPA 4UZCA 3H7HB 4N77A 4LUBA 4RU9A 2CQ1A 4L72B 1X7VA 3FEXB 4CI0B 2OSRA 2V4QA 3DOKA 4NLWA 2IJNA 2HK3A 1SV5B 1HMVA 2XNQA 2N4DA 4EUVA 1MWZA 1NXIA 1IJEB 1NK7A 2IJRA 1S6OA 2PO4A 3VWSA 4OX8A 2H3EB 2ZVIA 2X1BA 3J81Y 5IQ6A 3T3FA 2ZH6A 1UVMA 1RYSA 1FDAA 4QCLA 5BR8F 2M2BA 4UF4A 1EZZB 4LRDA 5KFBA 3OHAA 3WBZA 4FP9A 4TKTA 1NCLA 1HNZJ 2X1GA 2KYZA 5EUHA 5LJ5Y 3GV5B 4OI2A 3MECB 1FVQA 3H5UA 1A0OB 3LP2A 1K8AT 3KLVA 4RWWA 1YZ6A 3DM2A 4WYLA 2OD6A 2QL7B 1UCNA 2HYIB 3T9NA 5DS7A 2KFYA 3HHDA 1UJ5A 5KFNA 3CMQA 4MKVA 2FHOB 5E3RA 4TLRA 4DV1F 4JI8J 4B9TA 1GT8A 1C2PA 3G2XA 3D0HE 1TZ0A 4S0MA 4LVNP 3GP9A 5J2PA 2KVIA 5DDPC 3HHLC 5L9XA 1WTBA 3QGIA 4H4OB 3H42A 2XS7A 1U1RA 5T7LA 4K50A 3PACA 3TZWA 4RW7A 5CXTA 1VRUA 3DXBA 1XMOJ 2JEGA 2QV6A 2GQQA 3GR1A 3HDSA 2J7WA 3ULHA 2XYGB 3R7NB 3RBDA 1TUGB 3CCMS 3QRPA 1FD8A 3GIJA 3P5BP 3L4BC 2BZ2A 3MM9B 2UXBF 1Y5IB 2XEXA 3MM5B 5HBMB 2XM3A 1MWQA 2VODA 4R5PA 2ZOGA 3TAQA 2YNHA 1X4AA 3HHEA 2H5EA 2I0XA 2YNIA 3G71S 5K14A 1G3OA 3W61A 4CIOA 1U0HA 4LRFA 2LU1A 1ELOA 3KG0A 2DXDA 4DJBA 5I3UB 2FLLA 2GAGC 4P73A 1B0PA 2B4UA 3TJAA 1C1CA 3VCDA 1B70B 2EFGA 3CO9A 3KJVA 3EVOA 1OY8A 1TKZA 3I82A 3HHNB 4HDHA 1B0TA 2ZH7A 1YJNS 2ZE2A 4P72A 2V8VA 1TUWA 3JXOA 2C28A 3Q8VA 2DHHA 5F9NA 4MJKA 3PW4A 2JZ5A 1I1GA 3TWZA 5E3AA 1H6KX 1TMMA 4CLTA 2VJUA 2LYVA 4ED7A 2DHSA 4YQWA 4QZVB 5D78A 1GX6A 4C97A 4WWSA 1A7GE 4DBQA 5T14A 5DDOC 1QAIA 3IN5A 2NXNA 2AT1B 2ATLA 5AXLA 4Y2MA 2IMOA 2VH7A 3CCSS 3X1LB 4Y34A 1HNVA 4OI1A 3TYTA 4TYAA 2VJVA 3NAIA 2FLNA 1VJWA 4F4WA 1DZ5A 3MUTP 2LLZA 3VTIA 1ZZNA 1F1BB 5KG1A 4M5JA 3HO1A 3E3XA 3SQGA 2MQOA 1FEEA 3ADAC 2G13A 4DG1A 1CULA 5J2MB 1WG4A 2F9DA 4LF8F 1MU2B 2YX4A 2FJBB 1XERA 1JLFA 3PM9A 2D3O1 1SC3B 4OZ3A 4ELTA 3VVTA 1UVIA 1N48A 3GFXA 2RSQA 1S0OA 3NGTA 4QW8A 3PXGa 2BYCA 3CJSA 1O5JA 1G2EA 4C11B 1EX8A 4JI2J 4CLWA 4WZMA 2YX1A 1UJ6A 1FFWB 1HLWA 1RKJA 3C14B 3CGIA 3UR0A 2HZVA 2VOPA 5F8MA 4OZ2A 5CCMA 5KT4A 4H4KC 4OFZA 4WYWA 5CZVA 5M2PA 3MM7B 1N32J 2IDEA 2J9CA 2VQEJ 3A8JA 1Q8KA 4YHHJ 8RUCA 2JEIA 3UNYA 4MYTA 3HFZB 2VL1A 3MMJA 3FKBA 4O3SA 1FJGJ 2OTJS 2O66A 3N01A 2R7RA 3PY8A 2HQGA 2BQ3A 2P9CA 5L38A 3BKFA 1WG5A 4ES3A 4DV2J 3LW5C 3D6MB 5KFIA 3OLBA 3AODA 4NLYA 4IUFA 4QPXA 2FJVA 1R0CB 4C8OA 1FDNA 1S6PA 3JTOA 1SC4B 4ALZA 1RAIB 2VKZG 3O6QA 1WELA 2DY1A 4K4VA 4OJGA 3JAMU 3KLIB 4K5RA 3CD0A 3EXCX 4OZ0A 2N4CA 2VD3A 3UW1A 3AJDA 1V3SA 2ROGA 1RB0A 2DNKA 4M94A 4Q8EA 2V4RA 2ZVSA 2WB4A 3NXZA 2HHHJ 3J7AN 2OO4A 1S5ZA 2E1CA 5C25B 3E01A 4K2XA 2AX0A 2CQ2A 2YKOA 5LMUJ 1S1WA 1F60B 1UPPA 1FRKA 4N7TA 1WC4A 4CLYA 3CJ0A 2Z4PA 2LQ5A 2E7XA 3CB4A 4ETZA 2D7SA 3DDIA 5L1IA 4C8KA 4WFYA 1HKAA 2RQMA 5DDRC 1RT6A 4PG6A 4I68A 1U49A 2LXUA 3V6DB 3MCOA 3R2CJ 5JXSA 4QWBA 3BGRB 2VFVA 4X4SA 3FFIB 5I42A 1OWXA 4CH1A 3G6YA 5L1LA 2A6OA 4NXMF 5F8IA 1S48A 4E8UA 2VC1A 3W60A 1JLGB 2P6SA 4TY8B 4USUA 1JLQA 4DUYF 2GMJA 2BANA 2QL5B 2HKEA 1RT1A 4PEOA 2EK1A 4L3KA 3Q24A 2CDRB 3TOQA 3GILA 2DRAA 3HJVA 2EXUA 3GQCA 4OI0A 1UZHA 3KDOA 4LBHA 1JJHA 1PC4A 2V8HA 3M1VA 4FF4A 3FCHA 2WVEA 4H4MB 1QDUB 2N3LA 3O2IA 3S6EA 2M8HA 4B3OB 3OR2A 4C8MA 3A1YG 4PWUA 2H1YA 1Q5VA 2EW9A 3DLBA 3I5CA 2IBKA 4LF4F 3DGPA 1F9FA 1B64A 4ZVUB 3SCKE 1T05A 2BKOA 1RTIA 3KK1A 2MGZB 3POTB 2W4CA 1SJ4P 1M0SA 3QATA 2B6AA 2LKZA 3I87A 2GNKA 5CYMB 1SQGA 2IM0A 1VBKA 3MDFA 1HARA 2DXFA 2A10A 2MLZA 1OQ3A 2B9XA 4F3MA 2G2OA 2DGXA 2NYHA 2ASLA 4HLBA 4FF3A 1NJZA 5J2QB 2DRDA 2RKIB 2O1PA 2MQNA 2CG4A 4XIUA 2PIIA 3DU5A 2MZ1A 2W2PP 4QR2A 4YR3A 1LQ9A 4DR4F 3J7Z5 3H98A 1M5VC 2Z56B 5F9LA 3KLHA 1RCXB 3AXMA 5CYQB 1RXOB 1S99A 2LEPA 3A13A 2PMHA 3GPAA 3DOMA 3DLLQ 3D67A 5IV3A 1EETB 3AY0A 4ZN3A 4A8KA 3H2UB 2IDLA 1FRJA 1CC8A 3DHWC 3MM8B 4NLSA 4ID5A 1PYTA 2CUYA 4ZIVA 2MQQA 3OXGA 3PRBA 2CQPA 4OQJA 1WKLA 1JLAB 3CW2C 2HGNA 3J81j 1DLOB 4IDKB 4LSNB 2C3YA 4I2PA 3S8SA 3GV7B 1QLNA 1SV5A 1L3SA 2W7PA 4A8SA 4OZJA 2Q79A 1SQFA 4CO3A 1W7WA 2VPWB 2KHDA 2RMLA 3CCVS 1VR6A 1WUUA 3UWTA 1H2TZ 3QT5A 3VALA 5L46A 2DH7A 4EK2A 3VF0B 2K06A 2QYCA 1NU4A 4DF8A 3ZTSA 5B0DA 1HWKA 4NA3A 3K89A 3GYGA 2ILYA 2QA1A 3B82A 2Z58B 5A6PA 2K3KA 2MHNA 5B0BA 4A8MP 1A6LA 1NPPA 3CCRS 1NKCA 1FJ7A 3ZTRA 5DQGA 2CQBA 1XQIA 4MIWA 2OPRB 1PAUB 2YPZA 2ASYA 2HW3A 2W9AA 3TR5A 4K4YA 3FSYA 3V2UC 3H5SA 4HT5A 2VOOA 1HQEB 2LXFA 2NXUA 4HI2A 1VQ7S 3GIKA 2F4VF 5KT5A 1JKHB 4EZ9A 4H4OA 5IC6B 3ISNC 4FS2A 2AD9A 2CPHA 1IKXB 1RA6A 3RBXA 4DSJA 1ZPWX 4I6AA 3RRGA 2NSCA 1Y5NB 4CLUA 2GFFA 2B3TB 4DR7J 5E33A 2AGQA 3A12A 2PFFB 4K7QA 2J0WA 2QSFA 2KDOA 1YJWS 3PW7A 1OMSA 4EFAC 4R0EA 3MM9A 3MM5A 1H98A 5HBMA 1OY6A 3A8IA 3RG6A 4YDXA 3US5A 1X5PA 2DNPA 2BOPA 4GKJF 2B43A 4QR0A 2CNNB 3IAS9 2HWIA 3HSZA 1QSLA 1MROB 4PYDA 4ZIWA 1RT2B 2F40A 3TX8A 2XBPA 5I3UA 4LSLB 2RDJA 2WVDA 4UZBA 3UCGA 3ZTPA 4OJ3A 1HBNB 2AX1A 3DU6A 3SMZA 4K4ZA 1OSCA 2Y8WA 3FBBA 4OYWA 4UOGA 2HWTA 3LPYA 1H0HB 1BE4A 2R7VA 4WFXA 2DGTA 3KLGB 2DHXA 2QL9B 5IOLA 3GYNA 3UNGC 4LF6J 2BMBA 4PAAA 3GG0A 5HANA 1V3RA 2K7KA 3C16B 3BSAA 1FRLA 1FX4A 1HWIA 5F41A 4QWDA 4TU7A 2G2ZA 1IKYB 5D6GA 3PIOQ 7FDRA 1K44A 4DX7A 1XNRJ 4LFCF 2V2VA 4JI4J 3BPSP 1DARA 1GQEA 3F56A 2IM2A 4AXJA 3CJ5A 2DNHA 3R1HA 3N9UC 1DAXA 5J2MA 1H38A 4CM0A 1MU2A 4RUAA 3BO2A 1X9SA 1IVZA 1DQ8A 2MZQA 3M8WA 3N0VA 3QAEA 3EYZA 4ED8A 2DPIA 4AYBD 4C11A 2GZOA 2W01A 3BSNA 3QMQA 2C22A 4URSA 4DV4J 5DQHA 3Q23A 3CT9A 4LT6A 3QIDA 4OYIA 1N0UA 2G2YA 3C14A 2CKWA 1IN0A 5KG6A 1G1XA 4IKAA 3D5MA 5ETLA 2G1DA 2DR9A 3MOZA 2IIHA 3MM7A 2CZ4A 1YBUA 4JOUA 2JC0A 2HNDB 4URGA 3N79A 5HN0A 4FKYA 2XYPB 3M2RB 2FVRA 5CZXA 1NK8A 4M63A 2DO4A 3GYXB 2E1AA 3W62A 4NL5A 3R7BB 2O67A 2F4FA 3L95X 1HW8A 1SKUB 3UD3P 2QSWA 1VQ8S 4CDIA 1K73T 5AE1A 4Y65A 1NH8A 2C3MA 1FRXA 4DFJA 2LDYA 3GFHA 4IO9Q 2XULA 2QFIA 4UY8T 3JTPA 2OH2A 1XN9A 2B4PA 5DJBA 1WEZA 5A0YB 5C5JA 2BR0A 1F3VA 2PMWA 3KLIA 2V67A 1LWFB 3Q8PB 4IOBA 2OLWA 2XMJA 4L76A 4ED0A 2E5GA 2JVOA 4ZP6A 1NJIT 2EBGA 3AOBA 4M1KA 3AD7C 1PCAA 3RR7A 4N8OA 2KN4A 5C25A 1MMLA 4I7FB 2OIHA 1RYRA 4JI3J 3UCZP 1U1KA 3SEOA 2M8DB 4X65J 4NXNF 1Z4UA 3OLAA 2OFHX 1HBOB 5M2UA 3GR0A 3LPEA 4ZP9A 4FNIA 2QN6B 3QJJA 4ECUA 1XMQJ 3LQVA 1HIYA 1IXKA 2HBRB 1GXLA 3I6PA 3RBEA 1N6QB 4DSFA 3MD3A 2FUG9 2JJ4D 1SPBP 5KFEA 1UWBB 1RBOB 4OX7A 1SKSA 5HJYA 2R8HA 3MR3A 4QIGA 4ED4A 5HQ8A 3V6DA 2WZ1A 1F6TA 1NRKA 2XHWA 1FNXH 4YMEA 4X62J 1U8WA 3FFIA 2MYFA 1BXNA 4WF9Q 1RQ0A 2DXEA 3C2PA 1BWEA 4JI8F 1U4BA 3JSMB 3VZIA 1JLGA 1IBLJ 4TY8A 4AXIA 1T02A 4JI1J 3MAAB 2BVZA 1SJQA 4KRWA 1FNMA 3UDLA 4FPIA 5HK4A 4OI6A 4RW8B 2ZC4A 1L3UA 4DV5J 3EZUA 3K57A 3Q89A 1VQ5S 1NSQA 1SL1A 3CJTA 2ZHBA 1B7YB 3D3BJ 2OUGA 2DNYA 2DIVA 3BN4A 5CCLA 4NLVA 3WX4A 3DCAA 1MN9A 2DGOA 3KUEA 4H4MA 1R3NA 4B3OA 3NOGA 2XLKA 3T6BA 1T94A 1P9YA 3LUYA 5A8WB 2AYGA 2MGZA 3R5AA 4OHWA 4UTGA 5CYMA 4RNMA 1CSJA 1H3DA 2GVDB 5LOQA 4JI5J 3D1HA 3PO5A 5KFAA 2ZUGA 4IYQA 2RAQA 7AT1B 3FRYA 3IC1A 1T11A 2HK2A 4YOEA 2LDIA 5J2QA 2HLUA 3FSIA 3BBFA 1HYSB 3WX8A 2RKIA 3OL8A 4LR7A 2MZJA 3F41A 1PAEX 2VQFF 1HNXJ 3AOAA 1TTHB 3D6FB 4JV0A 3G8SA 3LWLA 1S1VB 1H74A 3CCES 2CQCA 4ZJQA 3MMAB 4F0HA 3BKTA 5CYQA 5B0AA 1RWVB 4LF7J 1ZPVA 1J5OB 5K9FA 4QWAA 1EETA 2NR0A 4Y0FA 3N6NA 2CJYB 2OEMA 9RUBA 2MKCA 4MIBA 2AKWB 4O23A 1P1TA 2SXLA 5DGAA 3MM8A 3CSKA 4EBDA 1C0TB 4ZVFA 2RDIA 1XR6A 3NNCA 3OXFA 4RUCA 3CD5A 5FDLB 3HSGA 3BO4A 1RWNB 4UUXA 1JLAA 2MZTA 2VF3A 1ZM9A 5BJRA 3MURP 2UU9J 1BQMB 1DLOA 4USWA 2VASA 4LSNA 4O44B 1N88A 1Q5YA 4DDFA 4DN9A 3NS5A 2ADCA 3Q83A 4YB7A 2G0IA 4NLOA 4ZVTB 4B08A 2DNOA 2R7TA 4DPXA 2CWXA 3NMRA 4WKRA 5B0CA 4ICLB 3VVUA 2BM1A 2FC8A 2FHJA 4HDGA 5B08A 4PXCA 2EG2A 1K0TA 4JI2F 4RJVA 4PQAA 4ZITA 1EARA 1BGXT 3MCSA 4DL3A 4WXOA 3KJNB 3HF5A 3OR1B 3D7SB 1C0UA 4R8UA 2OPRA 1R7IA 2AJ0A 1CLFA 4YFUA 1BWVA 1JLBB 5DETA 4YHHF 1YJRA 2DR5A 2W2OP 1TV6B 2BKNA 4USKA 5KG5A 3F73A 1HQEA 2Y0BB 4NLPA 1FJGF 3M8YA 3M30B 3M2VB 1JKHA 3ETOA 4O4RA 2GVZB 1S59A 4PKDB 3M2UB 3I4PA 2DCLA 3F44A 4LVOP 1IKXA 4IFVB 4H54A 4U67Q 4DV2F 4A8XA 3TJ8A 1ZOTA 4ZPDA 3L09A 2D3UA 2QLWA 4Z7YA 2MQPA 1VRQC 2NLWA 5HP1B 2Y1LB 3LGMA 4ENOA 3FJ2A 4NEYA 2CQ4A 2XCAA 3R2DJ 4BS2A 3D6TB 2FLOA 1N36J 3IXQA 2IMWP 1YJUA 3FQKA 1NDCA 5GADU 2V63A 1B4SA 1BLUA 4KGKA 4W92B 4GVBB 2MKJA 2WSCC 4B9LA 1QD1A 2CA9A 4DV3J 4RLEA 4KY3A 1HNWJ 3JB9k 4BBYA 1FF2A 5ETTA 3EPIA 5MAOA 2I5JB 5C2CA 2V9KA 4KC5A 2CIMA 1U0SA 2HHHF 2WONB 2A1BA 1S0NA 1AFJA 1MROA 2UVWA 4DX5A 2XLIA 3GIRA 3I0SB 1RT2A 1VYAA 1ZM2A 3C19A 4WBFA 2Y1JA 1VC0A 1H2UX 4MK7A 4LSLA 5LMUF 3JQMA 2IC3B 1PYSB 1RAHB 1YRXA 3T5KA 4YY3J 2R7UA 4WCEQ 2PC6A 2CZ9A 3ZNJ1 2V2QA 4BC7A 4UQTA 4LBPA 3RB3A 2KJWA 1HBNA 1ZM4A 2BE2B 4O3QA 2HNZB 1IR2A 5A8KB 1Q8LA 5DZ6A 3HVTB 3PHTA 4AL6A 2ZH3A 1JNRB 3KLGA 2XY7A 4M5HA 2R3VA 4RPFA 4LMZA 1PJ7A 1QUVA 3CIMA 2AU0A 5CH7B 4CO2A 3AJ1A 3H4DA 2ZJPQ 1RAEB 4TYBA 4ZVOB 4UW2A 1BQXA 2XSJB 2DBBA 1IM4A 4G1IA 2KFNA 3C16A 2XHCA 3GONA 1WACA 4ZVQB 2RS8A 2UUBJ 1IKYA 2FVQA 3ZZTA 3Q8RB 3T1HJ 2EFQA 2MXYA 1IR1A 4NWBA 3EE3A 4IRKA 3CF5Q 3GWCA 4WU2A 4USTA 4CO5A 3IBFB 3UR3C 3HM9A 1JXEA 1VFJA 1RHKB 1YRUA 3M9OB 3TQEA 3NRBA 4AD6A 1VISA 3BSOA 3RB4A 2YWGA 2K3IA 4ZKAA 3MTKA 3BQ2A 2LA6A 1RU2A 4JV1A 4ECTA 5IV4A 1RTHB 2QMWA 1CPZA 1F5CA 1ICEB 3IBWA 3T5JA 1TFYA 4JB8B 4PG7A 3ZZPA 3OPKA 2RB7A 2H4WB 3R27A 3M4XA 1P1LA 4ZPWR 2BW7A 3ZXWA 3OV7A 3U02A 1U6BA 5IXUA 1RZMA 4BC9A 1S0MA 5JVGQ 2Y9HA 3VAMA 1S4EA 3G6VA 2HNDA 2DB1A 5EX0A 1Q8BA 3M2RA 4Q7AA 3KHHA 5BYRA 4WIQA 5AJ3J 3BM7A 1VIOA 1T95A 1FWKA 4RWXA 1D3WA 3PX4A 4QIVA 1TK8A 1RLDA 2ZZTA 4RW4B 4NE9C 4G65A 2UXDJ 2CPZA 4Q8FA 4PWDA 1E6VB 5DM7Q 5IT4A 2BEFA 1IBMJ 1VGYA 3BBBA 5HVHA 5KFDA 5A0YA 1FD2A 1MNEA 2V8PA 2YWEA 2C42A 1NKEA 3VHQA 3DRPB 3CMAS 2C3OA 3M8PB 5A8RB 4KYZA 1LK5A 4GVLA 1RWUA 1RWOB 1K1SA 3QRQA 2XMWA 3CCQS 2GIRA 2YKQA 4NLGA 3MEGB 2UV8G 3K0JA 2AEMA 1WDDA 2ZFHA 1CJKB 3N5BA 4HL9A 1HQ2A 4ES2A 2IFXA 2V50A 3BYPA 4GC7A 3B4DA 2EFPA 3NP5A 4L3NA 4WXWA 3EM1A 2ASDA 4I7FA 3CDWA 1CBKA 4EBEA 1RAFB 3PX6A 3DDNA 1NHKL 1HBOA 3HD2A 4FYWB 2FHMA 1UW4A 4F3OA 3TO8A 1O51A 2RILA 2IRUA 2DPJA 2B8PA 1N6QA 4EBCA 1GX5A 4F36A 1OYEA 3EUNA 2N3OA 3DM2B 4ER8A 2LMIA 2RHSB 2MQMA 2J6UA 2CJXB 2EFOA 3JAMY 3FBFA 3DRYA 4DUZJ 1GMVA 1PKUA 1NH7A 2IBOA 1EQMA 4RUHA 1QSYA 3MAHA 1AT1B 4ECSA 5J1NA 1HWJA 1PJ5A 3JSMA 5J2PB 3IAM9 2E5LJ 1YX2A 5THWA 3MEKA 2EVZA 3MAAA 2XGQA 3HJFA 3N6MA 4ZCKA 5JVHQ 1Q79A 4LF1A 4L6V3 4HYKA 3M7VA 3T1YF 2VUGA 4RW8A 3KLFB 3TA1A 1RAOA 3G6XA 2W8KA 2Q43A 2KVQE 1M5PC 4XDCA 3J7YI 3SCIE 1DQ9A 4NRUA 1NO8A 4OYXA 3CPWR 3H25A 3CUNA 2XWXA 3ILIA 2VPYB 1TL1B 2J9DA 2Z8QA 5F3ZA 2IVMA 2F1FA 3CULA 1TMJA 1EKSA 2YBVA 3NNAA 2N82B 4DR7F 1C1BB 1IBKJ 5A8WA 1ZYQA 3KG1A 2HHVA 1Q7YT 4F02A 3T5HA 3IWNC 3M6XA 1QVFR 1QTMA 3V6JA 1C4CA 5K8OA 3W66A 3EJMA 1VBYA 3KJFB 2C2RA 2EI5A 4PCQA 1RACB 1BHNA 1GFWB 1X4EA 3UO0A 2GJFA 2R7OA 4OI3A 1V5VA 2AMCB 3DRRB 2NXCA 5KG3A 1WF0A 4B9UA 4A8QA 5HMYA 4W90B 3D4JA 1NJWA 4LBIA 1VQMS 2UXCJ 2I6WA 1PG5B 1N5TA 1X9MA 2DNQA 1OS5A 2FHKA 2RRAA 3MMAA 1ZBTA 1IKWB 3KK2B 3QAUA 1J5OA 1RTDB 3OSNA 5LM7E 3OVBA 2YKMB 5ETVA 4FBUA 1R6YA 5F8NA 2VC0A 2FZKB 2FVSA 4FYYB 4F67A 1BY9A 1CJTB 2MQLA 4LF6F 1I6JA 4F0KA 1GTHA 1FI4A 1U09A 4A4JA 2V69A 4E2FB 2KHCA 3LO3A 1BQMA 1URRA 4DFMA 1XNRF 4O44A 1KVKA 3NMAA 2HAFA 3HI9A 5LJ3Y 3VAHA 2JRSA 2Z2MA 3EWGA 3NWRA 4WK3A 1SJ3P 2XZDB 2JWNA 3CC2S 2WB1D 3PNIA 2ZUAA 5HMWA 2GCFA 3VGUA 3OTOJ 2HVEA 3AB4B 2MY8A 3V4MA 4ICLA 4WU3A 5KFSA 1NLKL 2XMUA 1F3FA 2DNGA 1Q78A 4DFPA 1KQSR 5I3PA 3PR4A 1U1MA 5DRKA 3NGSA 1Q82T 1ZTWA 4U95A 4ZPCA 3UD4P 3RZAA 4DSKA 1Q53A 3IS9B 3SSSA 4DV4F 1JJ2R 3U7JA 2G4BA 2JEFA 2R2TA 3R97A 3BH7B 1S76D 3FEZA 4ECZA 1L3KA 2DK2A 1KKHA 3OR1A 4DL2A 5KG4A 1KN6A 3VAJA 2HHUA 3PFOA 3BF4A 4ZLPA 1JLBA 1TVRB 2H51B 2PEBA 2B51A 3FBCA 4CO0A 1M5KC 2PDAA 2V8GA 4B9VA 2KH9A 3P45B 2I2YA 5IZHA 4RBTA 4ED1A 2HRUA 1QAJA 1UAWA 3I5AA 4J9UE 5DQIA 3H0PA 3DRSB 1YG0A 1EB0A 2GVZA 4DPYA 2E5JA 3EVWA 4IFVA 4C8LA 1DHMA 3HVAA 4X4PA 2HHPA 5L9NA 4LQ3A 4DV0F 4KV8B 2VV5A 4CH7A 1Y7PA 5DG9A 3PW2A 4O3RA 5HP1A 4UT4A 4AE5A 4B3RJ 2L48A 3H2LA 5F8HA 4NASA 2HS0A 1F2HA 5D4NA 4FYDA 2LQ8A 1C4AA 2MKYA 1HI0P 2H54B 1NNDA 1A9NB 2ZNZA 3GB0A 4WP8A 1SXLA 4GVBA 3SZ2A 1YWXA 2E1MC 8AT1B 5F0UA 4PG5A 4TU8A 3V5RA 2CPYA 4ZPVR 1Q86T 3HSDA 3WHIA 2I5JA 2WONA 3FZ2A 1VQOS 4P7VA 5KOWA 4EMDA 5DLGA 2HQCA 3LAMA 4JI3F 3PJWA 1RABB 3GTYX 3W8GA 4X65F 4AQYF 3EICA 2IC3A 1XMQF 2MKKA 4X64J 2AHOB 1TR0A 3I9ZA 4FYVB 4DZDA 1MN7A 3CWJA 4KH1B 1Y00A 3OFGA 2OP5A 5I3QA 4Z2XA 3GSIA 2MZRA 3TW0A 2BE2A 2KG1A 4GC6A 2HNZA 4XK8C 4M8LA 2EBEA 5A8KA 3HVTA 1UZDA 2FJAB 3KXDA 3OVSA 2XCPA 4GRSA 4C7QA 2CDQA 4X62F 3W1YC 3DLGB 4NLRA 2W2MP 3EGVA 4CLLA 1NKBA 4TLQA 2XMAA 1IBLF 5CQGA 2XSJA 3KHGA 1F9EB 2YTCA 4P2FA 1VC5A 3NWGA 2L41A 3RAXA 4GO7X 1MMNA 1FNOA 2R2RA 1VC6A 1Q4RA 4I4BA 4USJC 2ZZMA 3QIPA 2D1CA 4CLSA 2FJWA 2PD1A 3OR2B 3SCLE 3W9IA 1X5OA 1NJXA 3CE8A 3LALA 3AA8A 2AWZA 4ZPTR 1ZAXA 5CAAA 1AROP 2IYGA 2VBYA 5H9EK 2KB2A 2AYBA 4ZVSB 4QR1A 1KHVA 3ENAA 4O0NA 4N47A 1RTHA 3KFWX 5D4OA 4M5MA 4LRBA 1UMJA 4ILLA 2WSEC 1YGYA 2YWKA 3D1OA 5ITHA 4Z37A 4JI5F 3DKDA 3CD6S 4U8YA 4K2JA 1QTNB 2BX6A 1Y3KA 4ATNA 3QLHB 3AAWB 4JYAJ 3LP1B 3MPWA 3ZZ0A 1RP5A 2WVCA 1SL2A 1HNXF 5KT6A 2B7CB 1WI6A 4X4RA 3KMQA 3DLKB 3AD8C 4QOTA 2MDAA 2XI2A 3ZC4A 1WWHA 1VCTA 2W8LA 3JSYA 1VRTB 3QSIA 3G86A 4LF7F 2CPEA 1QSSA 2Z2ZA 2HRTA 2C2DA 1QAXA 5D15A 3DLEB 5KFGA 3TX0A 2BJ1A 9ATCB 1WOOA 1YSJA 2U2FA 4RW4A 4DPOA 3AFGA 2GMLA 2KT2A 1LEOA 2P5VA 2Z30B 1E6VA 2ZDPA 4LIWA 4A47A 4ECXA 1FO1A 2FQQB 4I56A 2EEYA 4I2PB 4Q5VA 3K5MA 4NCGB 3DRPA 2NZCA 1WNEA 3M8PA 1NHUA 3CJQA 5A8RA 1SBRA 3BN7A 2Q3PA 4X4VA 2UU9F 4FVMA 2DNMA 2HFNA 4AL5A 2OAUA 2MQ8A 1P9QC 3FGVA 1NDPA 3MEGA 2J7UA 5D0EA 2BACA 4C9DA 1SJFA 1CJKA 1ULRA 2O01C 1Q95G 3GCWP 5U47A 2HVHA 3A8KA 3G8TA 2E44A 3D54A 4LR9A 3VGSA 2HWHA 4BLGA 3GCXP 1M1GA 4W98A 1YBTA 3HCXA 1NMEB 2YKNA 3HP6A 3IWLA 4CWBA 3NCQA 3FZBA 4C8NA 4DL5A 1S9EB 2XZTB 3A3NB 2RQCA 5L1JA 1UEUA 3E8OA 3THPA 2B9EA 2OPPB 2KU7A 3AB2B 3AD9C 3LF0A 2QLXA 1M5SA 1PBAA 3C66A 5D77A 5EWGA 3PRDA 2JHEA 2EG1A 2HPUA 2ZZNA 2EFNA 3L9ZA 2B4VA 2CJKA 4D3HA 4IRDA 4C8YA 3PHEA 5KFYA 5KT3A 4IOAQ 2VHGA 1W2BR 2DIUA 4DL7A 4MIAA 2FVPA 1N8RT 4N56A 4P2SA 3CJRA 1YKWA 1FJEB 3THTA 3I32A 2Y8YA 2YQ0A 1FE0A 2D41A 1QAYA 3I4HX 5KFFA 5ETKA 1SI9A 3GV8B 4X4TA 3NL0A 3TAMB 5IM0B 1RDRA 4MFBA 3GJQB 4USIA 4UOFA 2JFDA 2R8KA 1TL7B 3KLFA 4ZVPB 1FFSB 4LRCA 1LOUA 3DOLB 2E5HA 3TZXA 1UFKA 2VG7B 3ZZZA 3ELHA 3H4BA 3SXLA 3HXMA 4IQXA 4HH0A 2PSZA 1TL1A 2ZITA 1VQ4S 3JYTB 3RU0A 1Z2ZA 3GJRB 1C1BA 3ICLA 5H9EJ 2MKIA 2JNJA 4TNOA 5LSLA 1VS3A 2E5IA 2ZKTA 1S10A 1R8HA 2ZOMA 4DV3F 1D9AA 2J6TA 2FD2A 1O6XA 5HVFA 1HNWF 1UW9A 3NNHA 1R0AB 4JV5J 2YKPA 5AE3A 1WKJA 4DR1J 3BS9A 4R0JA 3DN9A 1ROFA 1RHQB 1U24A 1D09B 5BXIA 2VA3A 2BJ3A 2PT0A 4ZPBA 1RAAB 2QLBB 1FKOB 3UN5A 1I94F 3DRRA 4M5KA 2ZHAA 2VBZA 3PYEA 3PCOB 4IG3B 4YY3F 2IM1A 1SL0A 1Y0HA 4WP9A 4B3TJ 3P4UB 3CCUS 3NG8A 3OW2R 1IKWA 3KK2A 2ZNYA 4KQZA 2XMMA 1RTDA 3I31A 2YKMA 1L3VA 2J0SD 4J5OA 4Q0BB 3K17A 2R7QA 1U7LA 3TA2A 2E9TA 4XAKA 2WBRA 3MR6A 3P8BB 2OPQB 1CJTA 5E3QA 1YTYA 4B02A 2FGCA 4KAIA 4F4KA 4LIRA 1S1UB 2EKYA 2UUBF 4JV2A 5EDWA 3ZFVA 4K4WA 3H90A 3CNQP 4C8ZA 3SSRA 2NSBA 4C98A 2ILZA 3T1HF 2AJ4A 4F04B 3P3DA 5HROB 3BPDA 3IR5B 4NLXA 3Q8YA 2GA7A 4FN5A 3TVYA 1K47A 2MY7A 1PC5A 4DF4A 5JMNA 3OFEA 5DO2A 3E51A 3K8VA 3G87A 2KXFA 4HVZA 4KT0C 3ZTQA 5C42B 1S7HA 1XC9A 1SJ1A 4KTQA 5HQLA 2ROPA 3Q8UA 3R5GA 3IS9A 1R6VA 4F0MA 3KHRA 2AP6A 2YQ1A 3D66A 1D8YA 4USVA 4C3MA 1RLCL 3WC2A 5KFQA 2YKAA 4QW9A 5D3GB 1FA0A 2UUCF 2Q1LA 1TVRA 2QO3A 4OZLA 5H9FK 3LP0B 5SUHA 2B7BB 4BCAA 3TANA 1DY3A 2DGQA 3VAKA 4DUYJ 2KRRA 1Y3JA 3NGDA 1KONA 5AJ3F 2WOMB 5HLFB 3BYRA 1HWUA 2AV5A 3OT9A 3DRSA 4J37A 1RAJA 1GMWD 1Y11A 3TP2A 1RHRB 4CZCA 2ZJRQ 2VG5B 2UXDF 4O4GB 4KV8A 2XSFA 4OL8A 2KT5A 3G82B 1R0BG 2G1HA 3ZZRA 2L9DA 4WTYA 4MYUA 4TQRA 2X1AA 3M6WA 1QM9A 4C4WA 4LF4J 4DV6J 1WSRA 5ETNA 2RIJA 2NPIA 3NY0A 5ETQA 5EWFA 3T9ZA 4QPTA 1VQNS 2A18A 5KG2A 4U7CA 2OMLA 4N76A 1N33J 2GQ2A 2MSSA 4CRJA 1YK9A 2Z2YB 1YRTA 4DOZA 2XY5A 4KGXB 1YJTA 2WSFC 3L7OA 3IRXB 3I55S 2UUTA 3DC2A 3TUPA 1OPZA 3J80Y 3CDAA 4I6WA 3WZ0A 4YEAA 4TU9A 2MB0B 2R7XA 1VQKS 2HHWA 3EMTA 3EDRB 5HQMA 2ZEJA 1REGX 2C2MB 5CABA 3QGPA 3M9MB 2FDNA 4DUZF 1U48A 4TN2A 4U7UK 2IAJB 5EGYA 1KSPA 4KFBB 2XG8A 3MCNA 4CLPA 3UQSA 3DLGA 2DITA 3OQ2A 4PPDA 4X4OA 2FJDB 3HK2A 5F8GA 3U1MA 2FZGB 3DNCA 4NA2A 1NPKA 2AF6A 2E9ZA 2NUUG 2A6MA 3EX7B 2UZAA 4KB7A 1EKRA 1RWXB 4KJIA 4ZOSA 3RTVA 1HW9A 1NSPA 2HQFA 3RRHA 3TJ9A 3CXCR 1JWWA 2RNEA 4DU7A 2KL8A 4X4NA 2XS5A 4YDDB 5J2NB 4CH0S 2ALYB 3CIZA 2X7IA 4K0KJ 1IBKF 4YN3B 2NXJA 4JP8A 3T6JA 4O3OA 1O0PA 1UETA 3UN2A 3PKMA 4B17A 1VQPS 1KQKA 2BJ7A 2RF2A 3MI7X 4CO4A 4PG8A 3NKYA 2Z2LA 1HPZB 1S9GB 1DFDA 4U7UD 1JK9B 3AQOA 1TKTB 4F8RA 5IWAF 2V8DA 5L39A 1X4BA 2V2KA 4ID8A 3QLHA 3LP1A 1WEYA 2HQIA 1RWMB 3BJYA 3DMJB 3SIPB 4L73A 2EC2A 5C2GA 4ED3A 2VFRA 3SFUA 1YVFA 1NUEA 5H9FJ 2BXJA 2XQCA 2M7SA 3DLKA 2UXCF 2DJWA 1EAYC 8ATCB 2YX7A 3TI0A 3FEYB 3DYAB 1LW2B 4FS1A 1CJVB 4DHVA 1QUPA 4DR3J 5KFOA 1VRTA 1RBAA 3N6LA 5BYQA 3T1AA 3DLEA 3TVKA 5HMZA 4FVCA 3BREA 3D0GE 2J8SA 4PUOB 3R7SB 2CRLA 2G0CA 1OYDA 1DTTB 3JQKA 2RQKA 2VZ9A 4NYPA 1X5TA 2E9RX 3G6ES 1CJUB 4NCGA 4IH5A 4NZ0A 5D4LA 1RWPB 1TKXB 2FY1A 1DURA 1KP6A 2H48B 1RADB 2CQ0A 2QJ3A 5J1EB 4NCAA 2KZZA 5B7WA 4GKJJ 2VFUA 3W2WB 4CM2A 1RISA 1KVIA 2ZWPA 2CJBA 4EGLA 4MTPA 3JTNA 2PFDA 2LVWA 3FMWA 3D9BA 4DR6J 3OTOF 1GNKA 2J0XA 2OELA 4QQBA 1KTQA 2HHXA 1KFSA 3LH2S 4Q45A 4X4QA 5FIIA 3P96A 1S9EA 1AZSB 2V2ZA 2KZMA 1S79A 1DTQB 1C0UB 2OPPA 4J9RA 4R8UB 1RWKB 4F25A 3HHLD 3U27A 1XMBA 1T9TA 1NM2A 4IO1A 4X84A 4CLFA 4A46A 5F0WA 2HHTA 3C46A 4P74A 3CCLS 3H2VE 2BE9B 1NK9A 2HBQB 3TAMA 5IM0A 1KOHA 1U2FA 1XTZA 3ILJA 2U1AA 3LTOA 1TL7A 5A76A 4WFNQ 4RUBA 1WHWA 4N8NA 1Q81T 3DOLA 2P9EA 1X8DA 2VG7A 5E7OB 2MHEA 1RA7A 3A8EA 2HRYA 2MSTA 1NJYA 4DQPA 4M5LA 4B3RF 3JYTA 4LSZB 3MXHP 4OLPA 1QY7A 1FTRA 2E1PA 5H1SV 1J5EF 4X66J 4LFAJ 5F8LA 4DQSA 1HD1A 1RHMB 3RB6A 3ILLA 4O3PA 4CNYA 2QMXA 2IRYA 2HFUA 1X60A 4OYMA 2H4YB 5KFMA 1R0AA 5ETRA 4F3QA 1B0VA 3VAFA 1RT7B 3BQ1A 4MMOA 2R8JA 2VB6A 3HZGA 2FTRA 1OY9A 3I5BA 2DNRA 4F26A 4B3SF 2VICA 1FKOA 2AEFA 3IP0A 3DRXA 4ZVRB 4TQSA 4KHMA 3H5YA 3R6LB 1SJRA 1N34J 2POKA 4K4XA 4IG3A 4K5SA 3P5TL 4X64F 3B8HA 3K5NA 1MLAA 5DDQC 2BABA 4P2MA 4C6AA 4OX6A 3FRZA 2GV1A 2ZD1B 1F5AA 2KRBA 1U1PA 5AXKA 2R8GA 3LAKA 1VK8A 3PO4A 4WFZA 3W9HA 4OMFG 4Q0BA 5LXYA 3A3OB 2OPQA 5B0EA 3CCWA 3QSYB 1WC5A 3SQOP 1N54B 5HMXA 2N7CA 5KFRA 2F8MA 1S1UA 1UWAA 1S9FA 1V9OA 3UDCA 1EJ7L 1RT3B 2I38A 2Y1IA 1KEKA 1YJ9S 2NS1B 3HFKA 1Y5LB 2H9ZA 3TZYA 2B4OA 2R42A 5HROA 4OI4A 4ES1A 3FC9A 5KFXA 3SV4A 2IPOB 2CNKB 2I9SA 4B9NA 2GMHA 1RSCA 1NEEA 3KUHA 3MPVA 3RYLA 4G1PA 3GG1A 1VDHA 2M3DA 4ZVGA 3J7ZT 5C42A 3BO3A 1VQ9S 4NXNJ 1UFLA 1WJ9A 1XWLA 3KMSA 2XS2A 1HR0J 4EZ6A 3DLHA 2A3JA 2M0GB 2MLYA 1WF2A 5E2QA 1SIWB 3TUZC 1M5HA 2DH9A 4MKAA 1L5UA 3QPIA 4WTOB 3R5DA 1ZH5A 2G0JA 2QA2A 3PYGA 1OPIA 4UUWA 2V68A 4DU8A 2FPHX 1ZA2B 3GLJA 4JYAF 1I51B 2ZOFA 2MLXA 1YQHA 4JI0J 2WVBA 4IH7A 5D3GA 2GJIA 1IBCB 1REVB 5ETMA 1IQTA 1JIHA 2ZH5A 3LP0A 3MR5A 1R31A 3DI6B 1N52B 1D8ZA 1Q8IA 3TUJC 1RWWB 1TUVA 3BQ0A 4Z7CA 3K7RA 2WOMA 5HLFA 3RJMB 3L7PA 4XTTA 4FKXA 2KG0A 1FKAF 2GGPB 1NK0A 3LA0A 2KJVA 5L8RC 4PWDB 4Y2CA 4F4XA 2VG5A 3MFHA 1FX2A 1ZM3A 4O4GA 4K4UA 2DR7A 1JJCB 1GEHA 4DPWA 2C2OB 3G82A 1OO0B 1KBRA 1FVSA 4K59A 2ZM6J 1VK3A 1S12A 3SSQA 3RW6A 1EP4A 3N4WA 2AZ1A 3D1QA 4ED5A 3FCVA 1JLEB 2DNZA 2DKOB 1NAQA 1D9FA 3I96A 4LRAA 5E3CA 3LGHA 2PGCA 5I4MA 1DBDA 1X4HA 4F2SA 3PVXA 1S6QB 5KG0A 3MF5A 1M1HA 1LV5A 3PRVA 1TAQA 4FPRA 3IRXA 1Y10A 4DUTA 1UFWA 2HLTA 3H8YA 2VQFJ 1HNZF 3AH6A 1YHQS 2I1RA 1RKIA 3H5XA 3RRKA 1RK8A 2XMKA 5IFMA 3ZZYA 5G0RB 4GO5X 1VBZA 1YITS 5D4PA 1U1LA 1VHIA 3CTRA 3GFYA 1DQAA 3QWPA 4EU0A 3DGVA 4J90A 4MAKA 4A8OA 3KJQB 4RW6B 2IAJA 3OFFA 4LFBJ 2XGPA 4KFBA 1LKZA 4K4SA 2C2ZB 1SUQB 2RT3A 2YY3A 4DL4A 3AHPA 1VQYA 1KVJA 4F50A 1UKUA 3ISZA 1R8BA 2AQ4A 2P6TA 2QEXS 3QRRA 1R43A 2AJ2A 1G4CA 1KLMB 2J6SA 4DSEA 2NCKL 1VOMA 2XYHB 3MTJA 1XMOF 2JC1A 1XIQA 2PA8D 2X3GA 4WE1B 4Y2AA 3HT0A 1AYEA 3C8YA 4WK1A 1WC3A 3HD1A 2W2NP 3EVMA 5HAOA 1TFWA 5LL6d 5J2NA 4KH0B 2VG6B 4HR2A 1LW0B 4Q44A 4NMLA 4QWEA 5KFJA 4X4UA 1WDTA 5KFZA 1WC1A 1X0PA 3CD7A 4KHPJ 1T9YA 3D2WA 3VQSA 2XMTA 3ET6B 1IWGA 4J7CA 4OYAA 5EX3A 4JV5F 4NYOA 1HPZA 1CVJA 5DG8A 1S9GA 1HD0A 4DR1F 2UV8A 1TKTA 4HT7A 1Q1KA 2KTQA 2ZBPA 4HHUA 3UI3A 1RGVA 1BUXA 2O5DA 4KBIA 1U1OA 4HHJA 5K8NA 3DMJA 2HGMA 3LWMA 2MJNA 1FRIA 3FUYA 3T41A 1FE4A 3R5BA 2HEKA 1QE1B 3CJ4A 3HHKA 5CD4A 4B3TF 3DYAA 2A2CA 2LU2A 1LW2A 3UPFA 4FF2A 1CJVA 2VFTA 2DVIA 4CT9A 1SIZA 5FLXU 2RH3A 2JLEA 4CYUB 3OUYB 3BR9A 4ECYA 1NB2A 2F8HA 4G6VB 1FK9B 1TL3B 1URNA 4PUOA 3LGNA 3EXYA 4JI6J 2CJ9A 2CNLB 1DTTA 2QMUB 4YUDA 2CPFA 2R7SA 3QWUA 2KO1A 1CJUA 3PX0A 1EIYB 2E7VA 2J5AA 5EWEA 2ZDOA 3M8RA 2Q6CA 1TKXA 4IR9A 4DX6A 5J1EA 1D1UA 4EI2A 3TUIC 4ELVA 2KKHA 4QYZK 3L7UA 4J9MA 4Q43A 3HMJG 3W2WA 5L1KA 1PIEA 3C6TA 1SH2A 2UVVA 5GAGI 1NSAA 2K2PA 2YXLA 4C2MA 2XWYA 1TK0A 3J7A1 3FDSA 3BGFA 2BKPA 3K2YA 1XEZA 3CJ2A 1WHXA 2P8IA 3JQJA 4OX9J 2RU9A 2ERRA 1YJ7A 4MK9A 4ZMMA 2C1EB 5LMNJ 4FF1A 4NPOA 3UVJB 1AZSA 1U45A 2CADA 2AJFE 1DTQA 1U47A 4HACB 4J9VA 3QT6A 4RKUC 4KGVB 1P8GA 3ISND 1H7WA 1N32F 2VQEF 4CLKA 5KAKA 2DGVA 4FNHA 1WC6A 2MJUA 2PMZD 4NZ6A 3GJTB 5D0RA 1I5OB 4YB6A 1YJVA 1HWLA 1KOOA 4C3KA 4LQ9A 2PN6A 2KYXA 3JSRA 2RU3A 4I0WA 3OFHA 1RT4B 4I2QB 3J80U 1IR0A 3HFVA 4U9RA 2CQGA 4OYBA 5GMKa 2W7AA 3ENVA 4QIFA 5B09A 3SI8A 2K7JA 2LA4A 3Q8QB 5HATA 3CDUA 3P49B 2C2EA 5IT9Y 3MGJA 1S49A 1MMDA 2HG4A 4CTAA 4J9OA 3U1NA 1VJQA 2W24A 3G9CA 1R27B 4B9MA 3F0NA 3TEHB 3CO0P 3OHBA 2L9WA 2MKHA 1SKRA 3CCJS 3OTCA 1O8BA 1PILA 3PV8A 2R8IA 4DV6F 1CQMA 5D0HA 1ACMB 3KNAA 4P2XA 1QJHA 3QQCD 1TL5A 2APOA 3GIMA 2DD8S 3QBCA 2QA4G 3TA0A 4DLEA 2KI2A 1N33F 2ZHOA 2VIHA 2AJ1A 3PKYA 2P9GA 1RT7A 3OJSA 2IA0A 3W5ZA 4NMXA 2V4JB 3V81A 4ZCIA 2JEJA 2IY5B 4ZK7M 2CPXA 2M70A 1LWEA 3EZOA 2VONA 2H5JB 3GJSB 1S1TA 3VR1A 1B3TA 2NXEA 4OHXA 5AE2A 1F2GA 4WZQA 5T41A 3BH6B 1U1NA 2ZD1A 4RBVA 3FMBA 4HH1A 4KKOB 3HZEA 5KT7A 5KFLA 1UVJA 2RE1A 2N7YA 2W1BA 2J9EA 3R9LA 4HTIA 2WTFA 4X2BA 1S72S 4FDFA 3O8WA 1SH3A 4CNZA 4QWCA 2HBYB 1WTFA 4M5IA 4J9NA 2CQDA 1F0XA 3C15B 2WK4A 4ANEA 3MHYA 4OZNA 2FB0A 4ILRA 1FFGB 3QIPB 1IM6A 1RTJB 4KSEB 1FXDA 5JJBA 1OQ6A 4U6PA 4MKYA 1RT3A 3CC7S 5SZTA 3MMCB 1T9WA 2K1RB 1IJFB 5K20B 1X5SA 2OI2A 2ZBCA 5ADZA 3GE9A 1JNZB 4UY85 4OHZA 3OD2A 1VI7A 1IKVB 4QYZJ 3GU0A 4DEZA 4J9QA 4J9LA 2UVUA 5C24B 3QJPA 2GHVC 3UE2A 2HQ3A 2KXNB 4K0KF 2JLGA 2QX0A 3I0RB 1UEKA 4OYPA 2UUAJ 5LSRA 1S6UA 2OFGX 2EKNA 3KLEB 3IG1B 3TRGA 4NEZA 3OBIA 4RZRA 2FIUA 1KR4A 5A2QU 5AXNA 1FDBA 5GAGU 2W9BB 3ENWA 4PPZA 2WBMA 4BWMA 4YS2A 4IFYB 3MECA 3DXSX 1V5IB 2E1RA 2IM3A 1ZETA 2QE5A 2QG9B 3V4IB 1REVA 2JSXA 2QLFB 2GAHC 1NK4A 4NX9A 2XO7A 3DI6A 2KM8B 2ZH1A 4K4TA 3UD5A 1QVGR 4EO6A 2YWWA 1J27A 2XO6A 4DR3F 2MMYA 2GGPA 3DLJA 4P10A 3T1YJ 2BRKA 4DFKA 4J9PA 3G8QA 3KNGA 3EGNA 1K0VA 3MM6B 1SCJB 3RW7A 4QBUA 2CQIA 4V1Ak 4LF9J 1G6BA 1UTAA 4V19J 4ZVEA 2GHWA 2CPJA 1U8SA 3VGVA 1AB8A 1XR7A 1SC6A 5K8MA 3D3CJ 1GK8A 1ZS6A 3KHLA 1RUSA 4LF5J 1JLEA 1VHFA 3IA0A 2IA6A 3R5CA 4RNOA 2HFSA 3PEJA 2YNGB 2M9KA 3W3SA 2CAJA 2DO0A 5HJXA 1N56A 4Q2MA 4PXDA 3R5JB 2DT9A 3WQPA 4C0HA 2YKNB 1CC7A 1S6QA 2QIFA 3BB5A 3CEDA 1FERA 3K5PA 4DR6F 3FQLA 3N5FA 2UUWA 1S7IA 3QT7A 1S77D 4P9SA 4FXWA 3QFHA 4P7TA 2M5YA 3ONQA 2ZH2A 1JQGA 4KR0B 4NYZA 3EDQB 1PYOB 2BW2A 2J0QD 4DCJB 1XJWB 1UVLA 2IVYA 4DR5J 5GAHI 1VQ6S 5G0RA 4LF2A 5B0GA 4RO0A 5KFVA 1AW0A 1NDKA 3ZNUA 1WI8A 2YH0A 2ZH8A 4RW6A 2RRBA 5HVGA 4W4MA 1SC1B 2NUHA 3HKWA 3W9JA 1FKPB 1SUQA 2V9WA 2QYGA 5F3TA 1TL4A 3M32B 4MFBB 1S0VA 1JX4A 3NLCA 6AT1B 1KLMA 3BGUA 5DM6Q 4FYXB 2W9CB 2OEKA 3M05A 2C3UA 3PDNA 3R8YA 4YB1P 4PR6A 4WE1A 1RU1A 4KPCA 2B8QA 2GQCA 3WDOA 3GMGA 1XNQJ 4DLGA 3OL9A 5IT0A 2RVJA 5DZ7A 2B56A 4BWJA 2DGUA 5E0OA 1HI1A 2XI3A 4M95A 1FTCA 3HVWA 2VG6A 2HFOA 1HHTP 1LW0A 4DCOB 4X66F 2FJEB 4LFAF 3P6YC 2CQ3A 1OIAA 4MKBA 4NLDA 4HEA9 2V5HG 3Q86A 4ZA1A 2EFVA 4JBCA 5FD1A 3BBCA 5JUMA 1RBLA 4F2RA 3ET6A 1FRHA 4J91A 2WRMA 3R1LA 3NGUA 3WIUA 3DDKA 3H20A 1WHYA 3UDVA 3RB0A 2QZ8A 3M8QB 4RR5A 2D3OR 2M52A 3W63A 2I8EA 4QYRA 3CDEA 1SQEA 2FVCA 2YVSA 5KFWA 4B3MJ 6FD1A 4DQQA 1TK5A 1N34F 3MEDB 3KYLA 2XNRA 2RHQB 2CJQA 2RRNA 2KXHA 1FRMA 3UCUP 4ECVA 2B5JB 1B99A 2FC9A 2WW8A 1QE1A 3PYFA 2UVRA 3J81U 1ZAVA 4OJHA 2W7OA 3CJ3A 1X4CA 4EWTA 1RE1B 4F4ZA 1HNIB 2FYXA 4CYUA 3OUYA 3S1TA 3W5XA 2CVIA 3PTWA 1S97A 2HIYA 5AT1B 2OTLS 2ACYA 5K8PA 4A8FA 1B7FA 2HURA 1FK9A 1TL3A 1Z1ZA 2HNYB 4C0BA 4DV0J 4OYOA 1KWMA 2HS4A 4GKKJ 1BQNB 4DR2J 4ELUA 5ETOA 4I64A 3ITHB 4JI4F 2PI5A 4DXLA 1PO6A 4ZP8A 4WKYA 1GXUA 5FJ4A 2MTLA 4DS4A 3B4MA 2JOQA 4EO8A 3OL7A 2VA2A 4YP3A 4NLUA 3OTBA 4HHHA 1EHWA 1Z2LA 2D69A 3BV8A 3W65A 1CQNA 2X3DA 1FXLA 2L3MA 1UJ4A 3K5OA 2DR8A 3IO1A 2AGOA 2DCUB 4AQYJ 1LWCB 4P75A 2DHGA 1HR0F 3EPGA 1WOSA 3X3UA 3UVJA 3K58A 4QIWD 2ADBA 1KC8T 2BRLA 5C7PA 1H7XA 1MG7A 1UVKA 2CQHA 3IFEA 2ATCB 4HACA 4ZLJA 1L3TA 1VQSA 2B9YA 1PGZA 2LCWA 3LANA 2RQ4A 2QTWA 2DRBA 1OSDA 3QNWB 2FY8A 4RNNA 4JI0F 4F7VA 4Y2IA 4JI7J 2ABYA 4ILMA 2LQ9A 3BGRA 2XMVA 2X1FA 4DPTA 3QFWA 4J9KA 1FCAA 4ANDA 3QGGA 2BM0A 2Y3YA 5GAHU 4MT1A 4XDDA 4ANCA 3GZ7A 4OHYA 1RT4A 4I2QA 3HKZD 4ECWA 2C2NA 2LP4A 2DISA 5GADI 2BV3A 1TKDA 1D9DA 4DSIA 2C3PA 3IGNA 3B78A 4DZ6A 4IRCA 1TU0B 2KFZA 5HO4A 3BGLA 4CLZA 1T03B 4DCPB 3IR6B 1LFPA 4P71A 1KDNA 3C6UB 2ZM6F 4U8VA 2BE7D 4RW9B 4HKQA 2AJQA 4O0IA 1U02A 4WJBA 3J7YU 3MPYA 2QLJB 3POTA 3NAHA 5CHCB 1Q0NA 3E2EA 2ZH4A 4DV7J 1Q16B 2WAQD 4CCHA 3B54A 1AXQA 4ZHRB 3R3TA 1GH8A 3IWXA 2Q66A 3RAMA 3ENQA 3RGIA 1ITPA 2V4JA 2DTJA 1ZZFA 5KOXA 2A0FB 3S01A 4NRTA 4ZJLA 2BJ8A 2L08A 4OIXA 3HULA 4K8RA 4IQMA 5KFKA 1HBMB 2X51A 3HPOA 1KD1T 4J9SA 4P52A 3JSBA 2YQ3A 5B0FA 5ETSA 1TAUA 2J9DE 4NZ7A 1KRPA 3IRWP 3V6HA 1DJ0A 2IVFB 1E6YB 2ACMA 4KKOA 3GIIA 1S4FA 1YBAA 4LFBF 4BHQA 2XC9A 2FJXA 1NSKL 2P2CB 4JI1F 3M9NB 1XK8A 2K8GA 3H59A 4ZCLA 1CEZA 1V3ZA 1HBUB 1M90T 3C15A 4XPEA 2J8AA 1N0VC 2JL9A 2XY6A 1KS2A 3OSPA 4WIIA 4DV5F 3SV3A 1RTJA 4NI2B 1M1KT 1NHVA 4G1QB 2W25A 1YZ7A 4ZJOA 4E98A 1N5VA 5RUBA 4NCBA 3MMCA 3KDNA 2K1RA 2DNLA 3I9V9 2M4MA 1I3OB 2W4PA 4RL1A 4IDKA 1R8CA 3PW5A 4MH8A 4LR8A 1WKKA 4I6YA 1FXRA 1IKVA 2YPYA 3VAIA 3MEEB 2V34A 1D0EA 5C24A 6FDRA 2VDIA 2HSEB 2D9PA 3KG4A 5BR8J 5EN1A 2RF2B 3SDEB 3W2VB 3I0RA 3G96A 2V0NA 3MMBB 1HL6A 3KK3B 1KFDA 4KHPF 3KLEA 3IG1A 2D74B 3VGTA 3TNVA 4ZVHA 3H40A 4KO0B 4Y3CA 4C48A 2DH8A 4QJVA 3UFCX 1WG1A 3TAPA 3GFZA 2ZBRA 2W9BA 2UP1A 1RHUB 3MD1A 4CP5A 3NGRA 4IFYA 1X4GA 3MR2A 1MSWD 3RAQA 4DV1J 2ZWOA 1IUJA 3U1LA 3V4IA 1K1QA 1NPRA 4E0DA 3G4SS 4Y00A 4OYZA 1TQLA 1LK7A 1HQUB 3W64A 4IG0B 2G9OA 3NCRA 1RT5B 2GO9A 3NBPB 1FHTA 2BJEA 1RTZA 1KNZA 4MK8A 2M88A 2XTJP 4DPUA 2YNFB 2FHJD 5DG7A 1X4FA 1P27B 4Q2LA 1N5YB 3Q22A 1ZAWA 2ROEA 3EZ5A 3PZPA 3MM6A 3HVRA 4JI6F 2BUNA 4FXDA 3TZZA 4DN0A 5BYSA 2YWHA 3PJXA 3HHLB 2QGFB 4EYIB 2NYIA 3IM9A 1LXNA 2UXBJ 1CS4B 3BZQA 3MUVP 1M5OC 1U2CA 1S1XB 3HLUA 1S57A 1NK5A 4YR2A 4URQU 4A8YA 2DHAA 1WF1A 1AFIA 2D3ZA 3NS6A 2YNGA 2E29A 4OLOA 5K5MA 3AA9A 5GVQA 3UN3A 1UVNA 2V6AA 4ECQA 1U25A 4DL6A 3CJKB 5IT9U 4R25A 3TVZA 3FVYA 2EWHA 3FNNA 4KPYA 2KT3A 3KKFA 1YIJS 3SBMA 4U96A 4OX9F 1I94J 2HAIA 2QT7A 3UDEA 3NEKA 5HL7Q 5LMNF 2B0GA 1LFWA 2OEJA 3PJ9A 5DGBA 3CC4S 4WP3A 2HZCA 4KGMA 1VLYA 2FGOA 2LQBA 2DGWA 4ZCMA 5F8JA 3PYDA 3R6GB 1NZ8A 4M5GA 1BMQB 4AUKA 3WC0A 2GO8A 2OPSB 2LEAA 4GMKA 2HGLA 2BDPA 3MOJB 3PG9A 4DX8H 1F9HA 2AZ3A 5IS2A 1UA0A 1FKPA 1UL3A 1LNQA 3OXLA 3AOCA 3A3PB 1T7PA 2HHSA 1KTVA 1TP7A 3M32A 4C0OC 4ZLLA 2JVRA 2MKSA 1KLNA 2CJAA 3QO9B 2W9CA 1U26A 3Q2SC 3DHXA 2EK6A 4CQ1A 3QGHA 3AT1B 5CA5A 2RUSA 4OZ5A 2WVFA 3MZIA 2Y1RI 1N36F 2R4FA 1H72C 3BDPA 2XLJA 3HT3A 4LF8J 2W4DA 3KTQA 2CXEA 1J2VA 4AT1B 3IR7B 4IOCQ 1WD6A 2OJ3A 1X31C 2VPXB 5HSPA 4PQUB 5KTQA 2JH3A 3MAQA 1FJCA 3WIVA 2YH1A 4ITSA 2R9LA 3IBCB 3VV2B 2BQRA 2H65B 3K5LA 3FK4A 1X0FA 1H73A 2HFVA 2ALZA 1P6TA 1PJ6A 3M8QA 3D28A 4ED6A 5CD4H 2VU5A 3HX9A 2DGSA 1NB7A 2JDJA 2OD4A 4NOHA 5E5NA 3MEDA 3PR5B 2JLFA 2UUCJ 3KWMA 3QZ8A 2B5JA 2HZAA 2BOAA 2HMIB 2AIRB 4USHA 3W7BA 3PW0A 1JLCB 1AUSL 4M5NA 3ZO7A 5IQQA 3B6BA 3LOUA 4ZS6A 5EHHA 2HVZA 4Y28C 2O3DA 1HNIA 1JXLA 5ETPA 1U1QA 4M5DB 2ASJA 1XBWA 3OTEA 1XR5A 1RAGB 1U6ZA 5GAEI 4DMZA 3TQ1A 2HNYA 3VZHA 1FWPA 4I67A 4Y6IA 3W5YA 2ZJQQ 1BQNA 3SFGA 2AYMA 3BSCA 3DOKB 3CMES 2CVEA 2QC3A 3OTDA 4OZ1A 3ITHA 3ZZOA 4O3NA 1HMVB 1LWFA 5IC4B 3PEHA 2C2KB 3NS7B 3O44A 1KHWA 4A8WA 2OSQA 3MFIA 2OGUA 1DRZA 4PXEA 5KG7A 5D0GA 2DEJA 2JX2A 2AEJA 2OMOA 2VBWA 2RUGA 3RUBL 5FLXY 1X9WA 1Y9OA 1ZTTA 2CG8A 2LXIA 1GMWA 3BEGB 4DL0C 1GMUA 4OV1A 2HHQA 2IHR1 3I56S 3BR8A 1LWCA 2UUAF 5J1PA 2AGPA 1WHVA 2XB2D 4ZPAA 4ZDNA 2F7VA 4UOHA 2CFXA 4OV6A 2KM8C 3LP2B 3IMQJ 2HBZB 4LJMA 1UWBA 3BKUA 1RCOB 4WFBQ 4L75A 4NXMJ 3RBZA 3L3CA 1GAOA 5LXRA 2YWFA 3BDEA 3O3LA 5KT2A 2W2QP 4BDPA 2RD5C 2OHDA 3FCWA 4JUZA 1R89A 1X4DA 1MWYA 1LWXA 4OJ1A 4ZP7A 2AYEA 5T7LB 1Q7LB 1OJ4A 3MUMP 2RJZA 4EYHB 4RW7B 1VRUB 2BBEA 2Z0GA 2WHOA 1JXVA 1HI8A 3NCPA 5AXMA 1IBMF 4YR0A 1SKWA 4RX6A 4UQGA 2GHPA 7FD1A 2EC0A 3OVAA 2GJ2A 4LF9F 1EP4B 1T03A 2VBXA 2NREA 2AW0A 5DLFA 1PSDA 3C6UA 1HHSA 2IYIA 4RW9A 2Q6BA 4N5SA 3IM8A 4LF5F 5LSOA 1N5QA 3M6VA 4R5PB 4AFFA 2YNHB 3D0IE 4WPAA 2GC8A 4PG4A 4USMA 5MLCV 2YNIB 1HHQA 2GX8A 3THVA 5K14B 1U0HB 2GVDA 3BGOP 4ZHRA 3M8ZA 3Q0AA 1C1CB 3W8PA 5IWAJ 1CG2A 3MR7A 2D9OA 2WCXA 1H2VZ 1NBEB 3KJVB 1PBUA 1HYSA 3CJ8A 3T5LA 4DR4J 1TKZB 2LFVA 1NDLA 3Q2TC 1U2RA 4ERDA 2R7WA 2ZE2B 4PZVA 4EEYA 4WFAQ 1HBMA 5KFPA 4AL7A 4OHVA 2HVDA 1HFEL 1T8EA 1JJ4A 1S1VA 2F63A 4DSLA 4DR5F 5LT5A 4TVAB 4DWIA 2F3JA 1E6YA 1GTEA 4QIEA 4YB5A 2R2UA 3PIPQ 2PI4A 2JFKA 1U6FA 2EPIA 2E5LF 3K59A 2E66A 3SCJE 2NQPA 1HBUA 1FEHA 3OJUA 4RBUA 1C0TA 4RU2A 1VIXA 4KIAA 1HNVB 2IRXA 3O1LA 4NI2A 4G1QA 1VLOA 4N41A 5FDLA 3OL6A 1T3NA 1R8AA 2LEBA 2F8EX 3NOCA 4LREA 1UPMB 4DQRA 2ZBQA 3ZZUA 2DNNA 1T9VA 5E41A 1RI7A 3SQGB 4DG1B 1CULB 2MPUA 5GAEU 1XNQF 2J76E 2PA3A 2FZCB 1JLFB 2B9WA 3MEEA 4TY9A 2QA4S 3N28A 5KFHA 3KUGA 1RJJA 2HVIA 1LXJA 5GMEA 2GW8A 2ZC3A 4PWWA 1VMBA 3SDEA 3W2VA 2CPDA 4FBTA 1IQZA 3DFEA 3MMBA 3KK3A 4ED2A 3CCTA 4P6QA 1NZAA 2HQDA 4KO0A 4IH6A 3QYYA 1T0TV 4D3GA 2WW4A 3ILOA 3C3LA 1W2IA 2J7KA 2FLPA 3VAGA 4B3MF 1WOPA 2XZWA 1N5SA 5KFTA 2GIQA 2DR6A 5G4DA 1YDLA 2GIFA 2QRRA 1HQUA 4IG0A 4DQIA 1RT5A 2F4VJ 1TV6A 1WEXA 3NBPA 3CCZA 3MCMA 4G3IA 3JS9A 2LQJA 3CVKA 3M30A 3M2VA 1W26A 2YNFA 1V6HA 1W25A 3ZTOA 1VQLS 5D8HB 1UEVA 3M2UA 2OKQA 2VKRA 1N5YA 4ZN1A 1K9MT 1S6PB 2RS2A 1FT8A 3A4TA 2DYAA 4HTJA 5A2QY 5GMDA 4ZLNA 1JMTA 3HHLA 4GKKF 4DR2F 1KQGB 1AUDA 1CS4A 1T9XA 4TXSA 1J5EJ 3FSXA 1N4LA 2QFJA 2GS8A 4F4YA 3RR8A 1S1XA 3MWBA 2CYYA 3C6TB 3TEGA 1SVDA 4CT8A 2NPFA 2PEHA 4ETXA 2MEWA 1EQ0A 2R2SA 4RNHA 3EGZA 3GSDA 3E01B 4ECRA 4NA1A 2CPIA 1WORA 1SB6A 1S1WB 3CJKA 3TARA 4CO1A 3I0SA 3KOAA 4B3SJ 1FDDA 3CDBA 3S7RA 1AA1B 3K8WA 3ETMA 2ZKUA 3O5TB 4I1TA 4KGZB 5A6WA 3VQTA 4XPCA 5HI7A 4L74A 1RT6B 4QU7A 3FBEA 1YI2S 2RDDA 5E3PA 4A48A 2Y0SD 5KFCA 2VPZB 3Q8SB 1T9UA 2OPSA 5I42B 1R8PA 1VBXA 5CYJA 1Y4ZB 2F65A 1JLQB 1KQFB 2HIQA 4JI7F 2BANB 2PE8A 4KHRA 1RT1B 1F5BA 2V94A 3MPDA 3IGVA 3QZ7A 3SYZA 3QO9A 2ZBIA 1HA1A 2BJ9A 3AXKA 1SH0A 2COLA 4LFCJ 2CNOB 2Z57B 4CTAB 4NLQA 3M1VB 3T19A 2E7WA 4PABA 4XO0A 2H5IB 4FXVA 1BC6A 4C3LA 1ZA1B 4DI6A 4PYAA 3QT8A 4Y2KA 1UP1A 2DY9A 1FESA 1FWLA 1TELA 3MPUB 3DGPB 2IJFA 1T05B 1RTIB 3KK1B
chains in the Genus database with same CATH topology
2UUWA 2QO3A 3OXFA 1S77D 4OZLA 4FXWA 2B6AB 3LP0B 3V6KA 1MW7A 2B7BB 5SUHA 4BCAA 4RUCA 4P7TA 3CD5A 2M5YA 5FDLB 2NZ4A 3ONQA 3TANA 2ZH2A 2DGQA 4HI1A 3BO4A 4UUXA 4RNFA 3VAKA 4KR0B 4NYZA 2KRRA 3M8SA 2BW2A 1JLAA 1APSA 2MZTA 1Y3JA 3NGDA 1KONA 5AJ3F 1ZM9A 5BJRA 3MURP 2WOMB 5HLFB 1BQMB 4DS5A 1DLOA 2LECA 2J0QD 4QU6A 1UVLA 1HWUA 2AV5A 2VASA 4LSNA 4O44B 4PQUA 2IVYA 3DRSA 5GAHI 1VQ6S 5G0RA 4J37A 3AJ2A 4PXBA 1N88A 5B0GA 3M6UA 5KFVA 4UOCA 4DV7F 4DDFA 4DN9A 3V81B 1JB0C 1RAJA 3NS5A 1AW0A 2VFSA 3TP2A 2ADCA 4YB7A 4CZCA 1WI8A 2ZJRQ 2L9NA 2VG5B 2YH0A 3PFEA 4V19X 1LWEB 4PRFA 4NLOA 2A2DA 2UXDF 2ZH9A 4I69A 4O4GB 4KV8A 2ZH8A 4RW6A 2XSFA 4B08A 2DNOA 2R7TA 4OL8A 2RRBA 2KT5A 2NUHA 2F9JA 1BD6A 3HKWA 1FKPB 3ZZRA 1SUQA 2V9WA 3NMRA 4WKRA 2L9DA 4WTYA 1S1TB 5B0CA 4MYUA 5F3TA 4TQRA 1UA1A 1TL4A 2HFZA 3M32B 2X1AA 4ICLB 4MFBB 3M6WA 5KFUA 1S0VA 3EGWB 1QM9A 1NK6A 1JX4A 2BM1A 2FC8A 4C4WA 2FHJA 3NGKA 3NLCA 4HDGA 1GXTA 3KLHB 2BJDA 5B08A 4PXCA 4B9SA 1KLMA 3BGUA 5DM6Q 2EG2A 2W9CB 2RIJA 2MZSA 2NPIA 4NLTA 1K0TA 3M05A 2C3UA 1T3OA 2HMIA 3PDNA 4JI2F 3QJLA 5EWFA 3T9ZA 4QPTA 1VQNS 4YB1P 1JLCA 2A18A 4PQAA 4IR1A 4H4KA 4PR6A 4WE1A 1BGXT 5KG2A 2BA9A 3MCSA 4U7CA 2OMLA 4N76A 2HS3A 4DL3A 1G7CB 2GQ2A 2MSSA 4FZVA 4WXOA 2BQUA 3HF5A 4KE5A 2GQCA 5M2RA 2CZVC 3OR1B 3WDOA 1YRTA 3GMGA 4DOZA 2XY5A 1C0UA 4DLGA 3OL9A 4R8UA 5IT0A 2RVJA 4M5DA 2B56A 2OPRA 4ID5B 3AQPA 4BWJA 1R7IA 2AJ0A 4N77A 1YJTA 2DGUA 4YFUA 2WSFC 1CLFA 5E0OA 3L7OA 1JLBB 1HI1A 2XI3A 5DETA 4M95A 3IRXB 4LUBA 1FTCA 3I55S 4RU9A 2CQ1A 4L72B 1X7VA 3HVWA 3FEXB 2UUTA 3DC2A 1OPZA 4YHHF 2VG6A 2HFOA 1HHTP 1YJRA 4CI0B 1LW0A 3J80Y 2DR5A 2OSRA 4X66F 2FJEB 3CDAA 4LFAF 3P6YC 1TV6B 4I6WA 2CQ3A 3WZ0A 1OIAA 4MKBA 4YEAA 4NLDA 4TU9A 4HEA9 2V5HG 5KG5A 2MB0B 2R7XA 3F73A 1HQEA 4ZA1A 1VQKS 2EFVA 3DOKA 2V4QA 2HHWA 4JBCA 4NLPA 1FJGF 4NLWA 2IJNA 3M30B 3M2VB 5FD1A 5JUMA 1SV5B