1SV5B

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B03
4KBIA 1HPZB 2B5JA 4RZRA 1LW2A 2VG5B 5DQIA 1TL3B 1SH2A 3HKWA 1LW0B 1RT4B 4ED0A 5CYQB 5HP1A 2UUWA 5KFPA 2R8IA 1JLGB 4J9OA 5EWGA 2R8JA 2D41A 3MEDA 4O44A 2W7PA 1TVRB 5C24B 3UPFA 1HNIB 4EBEA 1HQEA 1ZTTA 1T03B 1N4LA 4PWDB 3BJYA 4I2QB 3DOKB 1RDRA 1S0MA 5F9LA 4K4WA 2WONB 1S6QB 3MR3A 4DL2A 2BQUA 2RKIA 3QO9B 3KLFB 1IKWB 4OL8A 4J9NA 1GX5A 4I7FB 2FVPA 3D5MA 4EO6A 3OL6A 4IG0B 3KLEB 3KLHA 4TYAA 3DYAB 5KFOA 4IDKB 3QIPA 3DRRA 3DLEA 1OS5A 1S6PA 4K4YA 1S1WA 4Y34A 1HARA 3GV8B 4Q43A 1TL1A 1S9EA 1RA6A 2IC3A 3OL9A 2OPPB 4F4WA 4NLOA 4ZPBA 4PQUA 3HVWA 3DDKA 2VA2A 4IQXA 4Q0BB 4R0EA 4NLYA 3C6TB 5L1JA 1SV5B 2ZKUA 2CJQA 2OPRB 3H98A 3M8QA 4U6PA 2B43A 5I3UA 2FJWA 2W9BB 4O4GB 4DG1A 5KT5A 4J9QA 4Q8FA 4RW8A 4YMEA 1IKVA 2OPQB 1RT7B 3DI6B 2ILZA 4XO0A 1C0TB 1FKOB 2CKWA 1NNDA 4RNHA 2VG5A 4YR2A 3V6DA 5KFTA 1TKXB 1S9FA 2AGQA 3C6UA 4R5PB 2IM0A 1LW0A 2E9TA 1RT4A 2YNFB 4NLQA 1RT6A 3BSOA 1HQUA 5EDWA 4EYHB 1ZETA 3BR9A 4URSA 3KK1A 1JLGA 3SFUA 3PZPA 5C24A 5DGAA 3FDSA 1T03A 5KT3A 3OHBA 2W9AA 5HROB 4X2BA 4I2QA 3DOKA 1TKTB 4RW7B 5DG9A 4O3SA 2ZE2A 1SUQA 2R2UA 3KLIB 4RNMA 1XR6A 5K14B 4LQ3A 4QW8A 3GIIA 4M94A 3N6NA 1IKWA 3GILA 2BE2B 1W25A 3GYNA 2I1RA 1SH0A 3DYAA 1DLOB 4ID5A 2HNYB 1N6QB 1RT1B 3QLHA 4HYKA 4RNNA 4LSNA 4XPCA 4ED3A 1JLAA 5I42B 5F8HA 3V6JA 2OPPA 1KHVA 3T5JA 5KT2A 3KLVA 2ZD1B 3RB6A 4TY8B 4B3OA 3CDWA 4ZPDA 3T1AA 4Q0BA 3M9MB 4F4YA 3C6TA 2XI2A 3MR6A 2RDJA 1JLFA 1S1TB 2YNGA 4O4GA 5D3GB 4DL5A 1R0AB 5L1LA 4ED7A 4ZVHA 5J1EA 4K4TA 3PJWA 1RT2B 2FLNA 1C0TA 1FKOA 4IR1A 1IKYB 1JXLA 3KOAA 5KFVA 3CJ0A 1BQMB 3OSNA 3KNAA 4H54A 3E01B 2B5JB 5F8NA 1T94A 3JSMB 2C22A 1MU2A 3V81A 5HP1B 4O3NA 2BQRA 2XCPA 4F4ZA 4O44B 1TKTA 3IS9B 1HQEB 3ISNC 4PUOA 4WFXA 2J6UA 1RTHB 2FVQA 4R8UA 5DQHA 4WYLA 2UVUA 1S49A 2FVCA 2JEGA 1XR5A 3DRSA 1QUVA 3H5SA 2BE2A 4ZP9A 2WK4A 4M95A 2RKIB 1S1VA 5DGBA 3BSAA 5KFFA 3PHEA 1RT1A 1GX6A 1C1CA 3M9NB 1I6JA 1LWFA 3DLEB 1S1WB 5I42A 4IOBA 3SI8A 3DMJA 1TL1B 1S9EB 2R2SA 3KMSA 4G3IA 1C1BB 4NLXA 4IRCA 2IC3B 4WYWA 4QWAA 3PW0A 5KT7A 2GIQA 4PQUB 3G6VA 2WB4A 5D3GA 4JV1A 2V4RA 2ILYA 3NAHA 5EUHA 3MFHA 3M8QB 3IGNA 4U7CA 5I3UB 1RT2A 2HMIA 4ECVA 2E9RX 4RW8B 1NHUA 1IKVB 2C28A 5FDLA 3PR5B 1BQMA 3IGVA 3E01A 3M9OB 2JLEA 3QZ8A 3V6DB 3JSMA 1JLQB 5KFNA 4WZMA 5JUMA 3C6UB 2AU0A 3KLGA 1EP4A 3JYTA 2IM1A 4ECZA 1RT6B 1HQUB 4EEYA 4WXWA 5EWFA 4Y2CA 5F8MA 3KK1B 4IH6A 4TQRA 3RB3A 3ITHA 3KJVA 4ED6A 1ZTWA 4ZP6A 3IS9A 4QWDA 3H40A 1RTHA 2YNIB 1KLMB 4RW9A 5J2MB 4RU9A 5L1KA 2ZE2B 3BQ1A 2C2EA 1SUQB 3GQCA 2RF2A 1S1UB 4MIBA 5F9NA 4URGA 2BR0A 3PVXA 1RYSA 4ZPAA 4ECWA 1DTQB 4ID5B 1RTJA 2HAIA 4ZMMA 4QWCA 3QLHB 3PW7A 5KG6A 4LSNB 1C1BA 4IFYB 1JLAB 1RT3B 2JC1A 2E9ZA 2AX1A 5HBMB 1UWBB 2HWIA 5F8IA 2ASDA 2GIRA 2FLPA 3LALA 3DLGB 4B3OB 1D0EA 4MKAA 4H4MB 1VRTB 1JLFB 4YP3A 5C25A 3CDUA 2YNGB 4O4RA 2WTFA 4FBUA 1JKHA 4TXSA 1FKPA 2WRMA 1VRUA 3NL0A 2IM2A 4KO0A 5KG5A 5J1EB 5KG2A 4MK8A 3BQ2A 2BANA 3BGRA 4ED1A 3IRXB 3PW5A 4IR9A 4ZP7A 4FS2A 1JLQA 2UVWA 3CVKA 1C0UA 4ZHRB 2YNHA 2IMWP 5KFQA 4HKQA 1CSJA 3HHKA 3Q8PB 1MU2B 1RTIB 5J2NA 3TAMB 3V81B 3N6LA 3CWJA 3MEGB 1S48A 3GIKA 4YR0A 2YNIA 1KLMA 2IAJA 4KV8B 5J2MA 2V0NA 3TQ1A 1N56A 4PUOB 4R8UB 5KFHA 2WOMA 5J2QA 2IJNA 1S1UA 2D3UA 5KFUA 2VG7A 3QIDA 4TQSA 4J9SA 5KFCA 4YQWA 4DL6A 4NLVA 3DRSB 2J6TA 3KHGA 3G86A 1DTQA 5F8GA 1S1VB 3DLKB 4J9LA 5KFJA 3T5LA 4DL7A 3N6MA 3I0RA 1C1CB 1SH3A 1LWFB 3DRPA 4IFYA 1RT3A 3I0SA 4IH7A 2OH2A 3DMJB 4KKOB 5HLFB 1TKZB 1UWBA 5HBMA 5KFXA 3EPGA 1T3NA 4K4VA 3MF5A 3H5YA 3DLGA 4ZP8A 3H59A 3H5UA 4H4MA 3NKYA 1VRTA 2W9CA 4K4UA 3I5AA 4QWEA 5KFLA 3DOLB 2VG6B 1N48A 4WZQA 2DPIA 2BRLA 2HNZA 2HMIB 4ZPCA 3IRXA 1U09A 3V4IA 5FDLB 4NLDA 4IFVA 2AWZA 5C42A 5KFMA 3LAKA 4ZHRA 3VQSA 4F50A 1S10A 2FVSA 4GC6A 3KHLA 1REVA 4O3RA 3KLGB 4WFZA 1EP4B 1RTIA 1S9GA 1JLCA 3TAMA 3JYTB 4Y2AA 3OLAA 4NLPA 2IJFA 3RAQA 2JEIA 2YKMA 2C2RA 3ITHB 3MEGA 4NLTA 3KJVB 4NYZA 4Y3CA 1JLBA 4KV8A 3RBDA 2HWHA 3NBPA 2WCXA 4EYIB 4RW9B 3MFIA 3QGHA 4K50A 1S4FA 3H5XA 4J9KA 1K1SA 2RF2B 3H4DA 3T5KA 1RA7A 2I5JA 4KSEB 2AQ4A 4MIAA 3DLKA 3CJ4A 2JEJA 4IG3B 1YVFA 4J9PA 3CO9A 1Z4UA 1RTJB 4ECTA 1S97A 4ZVGA 1D1UA 4FS1A 4KKOA 3EZUA 3QYYA 5HLFA 1TKZA 3LP2A 4I2PB 3OL8A 5JXSA 1S1XA 3PR4A 1J5OB 1DTTA 4NCGB 1S0NA 3HVTB 1C2PA 4LSLA 3G6YA 1QE1B 3DOLA 2VG6A 5C25B 5CYMA 4IKAA 1TP7A 1JKHB 1EETA 1FKPB 1VRUB 4MK9A 4TYBA 3CIZA 4KO0B 3PW2A 2IA6A 2BANB 3UR0A 3BGRB 3QGGA 5KFZA 3RAXA 4RNFA 4K4ZA 5DG8A 1QAJA 4TY9A 1HMVB 5KFWA 1IKXA 1C0UB 3LP1A 2B6AA 2YNHB 2FJVA 4MFBA 3CJ3A 1QAIA 3MTKA 1JX4A 4MH8A 2BRKA 4WE1A 4O3OA 5J2NB 1NHVA 3FQKA 4KHMA 1T05A 2ATLA 3PJXA 1RYRA 3FQLA 2FLLA 2V4QA 1K1QA 2AGOA 2IAJB 1WNEA 3M8PA 4RNOA 2WOMB 2XGQA 5J2QB 2R8KA 2VG7B 4NRTA 5KFGA 4G1QA 2R8GA 4IG3A 3GV5B 3IN5A 4URQU 2UVVA 4NLWA 4LQ9A 2D3ZA 1BQNB 5KT6A 3I0RB 4ICLA 3GIJA 3ISND 3DRPB 4I2PA 5KFEA 3I0SB 4DL3A 3Q8SB 3BSCA 1JLEA 3NGDA 4MKBA 3BSNA 4EBCA 4DL4A 2BQ3A 2FVRA 1J5OA 4NCGA 3HVTA 3MEEA 3KK2A 2D7SA 4YR3A 2J6SA 2VA3A 4IRKA 4Q8EA 1QE1A 4KHRA 2W9CB 5KG1A 3UQSA 4RW4B 1LWCA 5KFKA 5T14A 4Q44A 3LANA 3RB0A 2IM3A 3PW4A 3T19A 4KE5A 2AX0A 2HNZB 1TQLA 2XWYA 3CJ2A 3H2LA 3V4IB 5KFDA 4IFVB 1HMVA 5C42B 3FFIA 4KAIA 4RUCA 1HYSA 3QGIA 1REVB 4ZVEA 5DG7A 1S9GB 4XPEA 1JLCB 3NAIA 4IRDA 4H4OB 5KFYA 3OL7A 2QE5A 5C5JA 2YKMB 3GV7B 3D28A 3HVAA 3G6XA 5L9XA 2C2DA 1JLBB 2HNDA 2V9WA 2R2TA 1N5YB 3NBPB 2IBKA 2OPSA 1MMLA 1RT5A 4JUZA 1LWEB 5KG4A 1HNVA 4ED8A 4NLRA 4ECYA 3LP0A 1RTDA 2DPJA 2I5JB 1HPZA 4IH5A 1TL3A 4NLUA 3FSIA 3SFGA 5KG0A 1BQNA 3MECB 5CYQA 3IG1B 5DLGA 5DLFA 4J9RA 3LP2B 4TLRA 4EBDA 1FK9B 1TVRA 3GIMA 2W8KA 1HNIA 4ECUA 1S1XB 4KFBB 4PWDA 4QW9A 3I5CA 1DTTB 4JV2A 4RW4A 3KHRA 4LSLB 3Q8RB 2WONA 3OSPA 1S6QA 5CYMB 4QWBA 4ECQA 4ED2A 3QO9A 3KLFA 2XI3A 2AGPA 1EETB 4I7FA 3EPIA 4IG0A 3KLEA 3KK3B 4IDKA 4NRUA 2ALZA 3MR5A 3DM2B 5KFIA 4MK7A 3RBEA 1IKXB 3LP1B 3V6HA 2B6AB 2R2RA 3KMQA 4WFYA 4K4SA 4MFBB 4H4OA 2QV6A 2R8HA 4WE1B 1S0OA 1TV6B 4RW6B 5KFAA 5KG7A 2W8LA 3NMAA 4F4XA 1T05B 1SV5A 1N5YA 2RDIA 2JEFA 4FBTA 2OPRA 2GC8A 3OHAA 2W9BA 2ASLA 1LWEA 2F8EX 2OPQA 1RT7A 3DI6A 5J2PB 3M8PB 3OLBA 2YKNB 4G1QB 1TKXA 4K4XA 4R5PA 1LW2B 2YNFA 3MECA 4ECXA 3IG1A 5KFRA 3UDLA 4ICLB 1KHWA 3LAMA 4O3PA 3V6KA 1FK9A 2FJXA 4QPXA 1JLEB 4KFBA 1JIHA 2UUTA 5HROA 3BREA 3I5BA 4KB7A 3MEDB 4WXOA 5F8LA 3QZ7A 3T5HA 4RW7A 3MEEB 3KK2B 4TN2A 2XCAA 4GC7A 5F8JA 3KLIA 1RAJA 5K14A 2W7OA 1LWCB 4RUAA 2JC0A 4ECSA 3KK3A 3FRZA 3CJ5A 1DLOA 2HNYA 1N6QA 2XGPA 4ECRA 4Q45A 3CDEA 4JV0A 3DM2A 3KLHB 3H4BA 4EO8A 1XR7A 3QIPB 3DRRB 3ICLA 3KHHA 1S6PB 3FFIB 2O5DA 4NLSA 4NZ0A 3BQ0A 1HYSB 4DEZA 2ZD1A 1TV6A 4RW6A 2WHOA 4TY8A 3TVKA 4ZVFA 3RB4A 2XC9A 5DQGA 2ASJA 1S1TA 3Q8QB 5L1IA 5KG3A 2HNDB 2UVRA 1R0AA 4J9MA 3E51A 2OPSB 5J2PA 5EWEA 4NLGA 1RT5B 4DG1B 1IM4A 4O3QA 2EC0A 5KFSA 1IKYA 5KFBA 5KT4A 1HNVB 2YKNA 3MR2A 3LP0B 1RTDB
chains in the Genus database with same CATH superfamily
2VG5B 1SH2A 1LW0B 4FP9A 5ADZA 1YITS 1WOOA 3IMQJ 1OS5A 3U02A 1HWLA 4IUFA 2J9EA 4Q2LA 2BJ9A 2W2PP 3MOZA 2OPRB 4LSZB 4O4GB 4RW8A 2UP1A 4ZLLA 3VHQA 1Z2ZA 3O8WA 4M5IA 3C6UA 4R5PB 1RT4A 4Y65A 3QT6A 2QLJB 3R1HA 1YJWS 5HROB 5DG9A 3R7NB 3M8ZA 2XWXA 2VU5A 1KVKA 4HYKA 3SDEA 5F8HA 3Q0AA 1JNRB 3KLVA 3GB0A 5A8KB 2D1CA 2JFDA 3MR6A 1MW7A 1QM9A 5L1LA 3T1HJ 4ZK7M 1FKOA 4DLEA 3CJ0A 5B7WA 1HNWJ 1F2GA 1B99A 4I56A 2E29A 4PUOA 4WFXA 3PACA 3BGFA 3W8GA 4I64A 3DOMB 4YOEA 1XMOF 3MXHP 3C14B 5CA5A 1PYTA 5KT7A 4ELTA 4RWWA 4YY3J 2MPUA 3CC2S 1ITPA 5FDLA 1DQ8A 1VQOS 1CULB 1SI9A 3J81Y 4D3HA 1APSA 3GLJA 5J2MB 1VQ5S 1S1UB 2I9SA 1U1MA 3F73A 3BGLA 4U7UD 4QU6A 3I55S 2HWIA 3CJRA 4CO1A 1L5UA 1U1NA 2KRRA 3L9ZA 4CO4A 4FYDA 2C42A 2DYAA 4RO0A 2ZC4A 4ZCMA 4QYZJ 3QFWA 4YR0A 2MSSA 2CJBA 3ZTSA 4LF2A 2VC0A 1TL5A 2MZSA 1XMQJ 2J5AA 4JI3F 2E7WA 2IBOA 1TKZB 2LA4A 2RRAA 4E8UA 4WCEQ 2RDDA 2IFXA 2AEJA 5DDPC 1HI8A 3W5XA 3ELHA 1ZBTA 4DV5F 4DU8A 1A6LA 5BR8J 4X4OA 3BPSP 1SKUB 2K06A 2CVIA 5GAEU 2ZBCA 1S4FA 1F9FA 1OSCA 3NGSA 3ZZTA 4ZCLA 2DIUA 2DCLA 4DR3F 1R8AA 3U27A 5DG8A 1Y00A 3CEDA 4PXDA 1QAIA 1CC8A 5D4LA 2NREA 3ILOA 2DNKA 3KUGA 1WNEA 3B4MA 1T11A 4DV0F 1YJ7A 2WBRA 1WKLA 3D0HE 3HD1A 4X84A 1Q79A 3AHPA 1U1QA 4YS2A 2AW0A 1FFSB 5B0FA 5SZTA 2HLUA 2VF3A 4DSLA 1S9GB 3MI7X 5KFYA 2E5LF 3G6XA 3GV7B 3O2IA 2ZVIA 4AD6A 2FYXA 5AXLA 3AXMA 4NLRA 3BBFA 4DV4J 4ECYA 3T1HF 3FZ2A 2I5JB 1T0TV 2VKZG 1ZAXA 3FSIA 1FEEA 2HVDA 3KWMA 3IG1B 1QSSA 2AYMA 5LOQA 4UZBA 1TVRA 2OGUA 4PWDA 3FRYA 4USJC 2IRYA 1VBKA 2AYEA 4M5HA 2EFNA 4ED2A 4P75A 4HVZA 4DPOA 4MFBB 1HBMB 3M2UA 2RQMA 3A8EA 5G0RB 1VC0A 4YY3F 1BC6A 2B3TB 1TKXA 2WVDA 4PWWA 2B8PA 1YIJS 3PEHA 2E5JA 1X9SA 5AE3A 2K7JA 3M8YA 2IVYA 4ECRA 4C8MA 2CQHA 3IFEA 1TV6A 1LQ9A 5DQGA 1H3DA 1PKUA 4L72B 2OPSB 1N33F 4OI2A 5EWEA 1NCLA 3PFEA 4JI5J 3MWBA 1BXNA 4F8RA 4V19X 2HFZA 1XNQJ 3UW1A 5EWGA 1AYEA 3IA0A 1PO6A 2J76E 5HMWA 4EBEA 4A47A 3BJYA 4K4WA 1YG0A 3KLEB 2H5EA 2HS3A 3H2UB 2HFNA 3L7UA 4CWBA 4PQUA 5LT5A 2XSJB 1AUDA 5KFTA 5BR8F 3TARA 5L38A 5EDWA 1DJ0A 3JSRA 2PMHA 3DOKA 2ZE2A 2QJ3A 4RNMA 1LEOA 3SZ2A 2BE2B 1P9YA 3GYXB 2G1HA 1VMBA 4K8RA 3MM9A 1KHVA 4HR2A 3MM5B 2BOAA 3CDWA 4TNOA 4LRCA 4K4TA 2HFVA 1IKYB 1UJ5A 3FNNA 2B5JB 5F8NA 1RU2A 3AXKA 1B70B 5A6PA 2NUUG 2UXDJ 4M5DB 4O44B 2CJ9A 1V6HA 3R2DJ 2KVQE 1DZ5A 4OHZA 4M95A 5IOLA 3ZTOA 2HWTA 3NMRA 4WYWA 5B09A 6FD1A 2MGZB 1K0VA 2WB4A 4K59A 3NAHA 4N8OA 4M63A 3QZ8A 1YZ6A 2CJKA 4WZMA 4ECZA 4IH6A 3ITHA 3TNVA 2HHVA 3EICA 1AFJA 1SUQB 2XB2D 1P9QC 1DBDA 2DXFA 3UDEA 4UOGA 1H98A 1RT3B 2M5YA 1IJEB 1R8CA 5BYQA 3CJ8A 4J5OA 4OMFG 1VC6A 1FRIA 1FKPA 2WRMA 4CNZA 4ED1A 2L48A 2R7OA 3WHIA 3K5LA 3TAMB 3G9CA 4DS4A 1RHRB 5E5NA 2V0NA 6AT1B 2VBZA 3TUIC 2UV8G 4J9SA 1F9EB 3I87A 1ZPVA 3N6MA 3I0RA 1C1CB 5A8RB 4KKOB 2CQ2A 2QLBB 4ZLPA 5L8RC 3MAAB 3MUMP 2DR6A 4PG5A 4EMDA 1LKZA 3CDAA 3MMCA 2P6SA 3VQSA 2FVSA 2C2RA 4UOCA 4AQYJ 2CPYA 3LOUA 3UI3A 2EFGA 4P7TA 1AFIA 5LMUF 3P96A 1Z4UA 3DGPB 3HHLA 4NI2B 1S1XA 3MDFA 3AAWB 1XNRJ 4C8NA 3A3PB 2OTJS 4OZNA 5CYMA 3ZO7A 1EETA 4JOUA 2HHSA 2IJRA 3J81j 1NSKL 1C0UB 3ZZZA 4MYUA 4DCJB 5HQLA 4ENOA 1FD2A 1RYRA 2V4QA 1UVMA 3R7SB 1SKWA 4Y28C 2A6OA 4NMLA 5F0UA 4WP8A 5KFEA 4MKBA 2UUAJ 1Y11A 2CDQA 4DI6A 2A3JA 4PXCA 4YR3A 4HTJA 1LWCA 3R6GB 2CZ9A 2KRBA 1FJEB 2XWYA 1HMVA 4KY3A 2GZOA 2XS2A 2GJFA 4ZVEA 2MYFA 2VASA 2MJNA 2IBKA 4ED4A 4JUZA 1D8YA 2BE9B 3AFGA 2AP6A 1S12A 1U1OA 2C3UA 4HHHA 4N77A 2FC9A 3GG0A 5G4DA 4LSLB 2NS1B 2P2CB 1B0PA 3NCRA 4LF4J 2MHEA 1S72S 4H4OA 2FY8A 2K3KA 1WKJA 1NKEA 3WX8A 3G8QA 1GTHA 4FBTA 3OHAA 4NEZA 2F8EX 1RTZA 2YKNB 5L46A 1Y3JA 1CPZA 4GO7X 1TK0A 1FK9A 4QPXA 4WIQA 4NA3A 1Y10A 4RW7A 1KRPA 3O3LA 1NHKL 3TVYA 4BDPA 2GQQA 4OYXA 3QGPA 2DNZA 2E7XA 4ED5A 3DM2A 3MM6B 2IDEA 3W9JA 2QSFA 3BS9A 3RB4A 2ASJA 5KG3A 2CPZA 2NYHA 1IM4A 5KFBA 3TO8A 3LP0B 2HIQA 3TP2A 4B3RJ 5KOXA 3J7YU 1VQSA 2HZCA 4CLFA 3OTEA 3LA0A 2FVPA 3TX8A 3M9OB 2E7VA 3HLUA 4LF8F 2IC3A 2M2BA 4ZDNA 2V8DA 4LF7F 2YVSA 3F44A 1HBOA 1SKRA 4DV3F 4R0EA 5HL7Q 2XYHB 3K2YA 1MN9A 1NDCA 2KDOA 1DQAA 2B0GA 1T7PA 4G6VB 1SC3B 2D3O1 3IXQA 4EYHB 4I68A 3PO4A 3FDSA 1IN0A 4AQYF 4X62F 2BZ2A 3PX6A 3KLIB 2I38A 3GYNA 4J9VA 4RNNA 4Y2KA 2XLIA 4AL6A 3RB6A 2M9KA 2RHQB 2XI2A 1CBKA 1WSVA 3PJWA 3D0GE 2J9DE 3SQGA 2D3OR 1CJKA 1RCOB 2UU9J 4P73A 5DQHA 3W5ZA 4HI1A 3RYLA 1VOMA 4JYAJ 1S1VA 1OWXA 5KFFA 3JTNA 3IR7B 4QIWD 4Y0FA 2WSCC 3DMJA 2CG8A 3KMSA 1QAYA 4GKKJ 1TELA 2UUAF 1UA1A 4JV1A 2DHHA 2V4RA 2M0GB 4RW8B 2J8SA 2C28A 2DNQA 3E01A 3ADAC 3ZZYA 3C6UB 2RJZA 1LFWA 4W92B 3B6BA 3J80U 3IS9A 2NPFA 2EFPA 4MIBA 4ZPAA 1YQHA 2MHNA 1GQEA 3HD2A 2OAUA 5K8OA 5KG6A 1ICEB 3SDEB 4FF2A 2KZZA 1V9OA 3CDUA 4ETZA 5IWAJ 1HR0J 3W2VA 4ILMA 3Q8PB 1HHTP 1RTIB 4DOZA 4C3KA 3CWJA 2HHHJ 4PUOB 1H7XA 5KFUA 1GT8A 3W3SA 1VI7A 2OMOA 2PC6A 1SH3A 4GO5X 3OQ2A 4DPYA 1X9WA 5HLFB 4ZP8A 4JV5J 3AD8C 3HHDA 2PE8A 5KFLA 1IBLF 3IRXA 3CO0P 5FDLB 4ATNA 3QRQA 3PO5A 4O3RA 1REVA 1TFYA 1E6VA 1TK8A 1GH8A 4IYQA 4J9KA 5GAGU 1IBKF 4ZVGA 3HJFA 3VGSA 1DTTA 2YWHA 1QE1B 2HK3A 2NPIA 1TP7A 5GAEI 5B0GA 3UR0A 1L3KA 3HFKA 2BRKA 4WE1A 1U25A 4OJ3A 1SQGA 1HWUA 3AY0A 1F9HA 3CPWR 5HJYA 3OPKA 4CT9A 4USMA 1HLWA 5CQGA 3ISND 3NGDA 4ZPTR 2FVRA 1IBMF 4Q8EA 2F40A 1VHFA 4J90A 4LFCJ 3PY8A 5KFDA 2K1RA 3FEYB 3M2VA 1HYSA 4NZ7A 1NUEA 2UV8A 3VTIA 2CXEA 4OX9F 2Y1JA 1X7VA 1TKDA 1WKKA 1MG7A 3T41A 4UOHA 1TL3A 4M5KA 2CPXA 3EDRB 3TZYA 4U96A 1BWVA 2VKRA 2UU9F 2HVZA 2MKSA 2KHDA 3C66A 4JYAF 3KK3B 3UVJA 1X8DA 1URRA 1CEZA 1H2TZ 1LXJA 5U47A 5JVHQ 2VC1A 4WFYA 2PA8D 2B8QA 2RDIA 1J5EF 4QR1A 4QIFA 2W9BA 4ZVQB 1N34J 2O66A 1UL3A 2DD8S 2N3LA 1HWKA 5KFRA 4UY85 3AD9C 3LGMA 4KFBA 2DVIA 4NZ6A 1N32J 7FD1A 1UZHA 4YN3B 3FRZA 4DQSA 4JV0A 3P8BB 3BQ0A 3K58A 3ZNJ1 4TY8A 3CMES 5D0HA 2ROPA 3U7JA 2DHGA 2QGFB 3EXYA 1T9UA 1T3OA 1HR0F 2E1RA 1WORA 5IQ6A 1NJIT 2A2DA 2UUWA 1TVRB 4PWDB 2HHHF 4KGXB 4B9LA 4HT5A 3KLHA 2KKHA 4TYAA 5KFOA 3DRRA 2BABA 4LR9A 4F2RA 3M2UB 3U1LA 3DDKA 3NG8A 3DCAA 1YX2A 2J0WA 1FE0A 4J9QA 1B7FA 2CKWA 1ZPWX 1TKXB 4JI2J 4NLQA 4LF6F 4URSA 3UD5A 2DGXA 5HSPA 3HT3A 2X3DA 4DN9A 5C24A 4X2BA 3UR3C 2W9AA 4I2QA 2LCWA 4QW8A 2OSQA 2B4OA 2ZH2A 3DYAA 4ID5A 1RWVB 2MQ8A 3V6JA 1OY9A 3T5JA 3TI0A 1PILA 5KT2A 3T1AA 4Q0BA 2DRAA 2V8HA 1JLFA 2NZCA 2HS4A 1O0PA 4CLTA 1JXLA 3CNQP 1WC1A 2ZH3A 3KNAA 4FVCA 2C22A 1DY3A 5THWA 4WFNQ 4YB1P 4WYLA 1S49A 1NM2A 3AOCA 4WU2A 2OFGX 4L74A 1OO0B 1ZM9A 3BBCA 5DGBA 2NZ4A 3HXMA 3GYGA 4QWAA 1YBUA 4FVMA 4PQUB 2HBZB 4DDFA 1I5OB 2BKOA 2ZZMA 3C15B 2JLEA 3JSMA 2CADA 3KLGA 1PYSB 3THVA 1CQMA 3EVOA 4RW9A 2ZE2B 3E3XA 2XZWA 1L3SA 2LDIA 2RF2A 4EI2A 1SKSA 4ECWA 2WAQD 4OFZA 4UW2A 3RW6A 4BCAA 1Q82T 2Y1IA 7FDRA 1GMUA 3SSQA 4XTTA 4H4MB 4KO0A 5KG2A 3BQ2A 2PN6A 1WHVA 4ZP7A 1GMVA 1Y0HA 1TL7B 1BUXA 3AA8A 3HHKA 1TL4A 2YNIA 1KLMA 4HHUA 3MOJB 2QEXS 2D3UA 4J7CA 3KHGA 2OEMA 3IWNC 1DTQA 4JI0F 1F5AA 1UWBA 2UUCJ 4I6AA 1LXNA 2EFVA 5ETLA 3IO1A 2VG6B 3MM8A 2MKYA 1URNA 1HWJA 4N56A 4PZVA 1U09A 2LVWA 4WFZA 2IY5B 2DGSA 3ITHB 5HVFA 3B78A 4WKRA 2GVZB 4OX6A 2HBYB 3UWTA 2XMTA 2AQ4A 4DJBA 3IAM9 1DURA 4PABA 1D1UA 3Q23A 3POTA 4I2PB 2J0QD 3QWUA 5HAOA 2B56A 2J7UA 1H2UX 4IKAA 4B08A 1FKPB 2RD5C 5FLXY 5IM0B 3K5PA 1QAJA 4QQBA 3LP1A 2B6AA 2NXNA 4JBCA 4DUYJ 3D6MB 3VZHA 2GAGC 2XEXA 1TUWA 2XMJA 5MAOA 4DQIA 3M8PA 4KRWA 4LFAF 5F0WA 5KFGA 2XO7A 4NLWA 4DU7A 4JI2F 3I0RB 1OY6A 2YKQA 4EZ9A 4ZJOA 2MZRA 4C8YA 4U8VA 3MEEA 4PYAA 4X4RA 3TW0A 5T14A 1N88A 2IM3A 3M8WA 4USHA 3MMCB 2VBXA 3DRXA 3LPEA 2CWXA 1VQ6S 1S6UA 2CUYA 2OIHA 3ONQA 3W61A 3TJ9A 2C2DA 5LXYA 1CS4A 3N9UC 1M5VC 3RBZA 3BBBA 3QRPA 2GO8A 5CXTA 3HP6A 1N8RT 3MECB 1S57A 4PQAA 3HSGA 3HHLB 3RJMB 2UXCJ 1S1XB 3TA0A 2Z2ZA 1XQIA 4WP9A 3HSDA 3D66A 3W64A 5CYMB 2AGPA 3M4XA 1EETB 3LPYA 1TMJA 3RBEA 3V6HA 2R2RA 1VBZA 4K4SA 1C4AA 5AJ3F 4HI2A 1IWGA 3HHEA 3EUNA 2U2FA 3W65A 1RADB 4ECXA 2B7CB 1KHWA 3V6KA 3ZTRA 2VDIA 5DS7A 2W7OA 1LWCB 3CE8A 1Z2LA 1WTFA 2JHEA 3TAPA 1GXTA 2V2ZA 5CD4H 2MQQA 4F3QA 1IR2A 4AL5A 2R9LA 1FE4A 2DNOA 4OZ2A 3AQOA 3QSIA 3BO2A 2HVEA 3RBXA 2FHJD 3MEDA 2LQBA 2P5VA 1HQEA 1I51B 4CLSA 1WHXA 3ZZUA 1HARA 5HQMA 1WHYA 1FFGB 1BHNA 3GJQB 5E0OA 4FKYA 1C4CA 4NLOA 1M1KT 2UUCF 3GP9A 5I3UA 3R7BB 2L9DA 4LBIA 1EAYC 2XZDB 3DDIA 2AGQA 3IBWA 4DR5J 2HGNA 3QFHA 1XC9A 4RW7B 1EQ0A 2Z2YB 5IZHA 3GU0A 2I1RA 3R6LB 3N5FA 3C3LA 2XMAA 2Y8WA 4K2XA 2K3IA 2RUSA 4XDCA 3THTA 2E5IA 1WC5A 2Z2LA 1R27B 2DHXA 2H4YB 5DRKA 3T6BA 2Q6CA 3SV3A 3VGVA 3KTQA 2EC2A 2QL7B 1MMNA 2BJ3A 4DUYF 4U67Q 3JB9k 1TAQA 3ISNC 5CAAA 4PG8A 3GE9A 2P9GA 4FZVA 1FESA 1JNZB 4MMOA 2KM8B 1JJHA 3CCMS 3H25A 2R2SA 4DV2J 2IC3B 2DNLA 3QWPA 4DV1F 4B9TA 4CIOA 5D3GA 5B0BA 2VJVA 1K9MT 7AT1B 1V3ZA 3TZXA 3OVSA 3KDNA 2V2QA 4LRFA 4OIXA 2MJUA 5HO4A 5EWFA 3CUNA 4USKA 2CNLB 4CLLA 3PIPQ 4PG6A 3OVAA 1C1BA 2AX1A 4RUBA 1RWPB 3L4BC 2ASDA 2UXCF 1KBRA 2NXEA 5C25A 3RRGA 4NCAA 2DITA 3TR5A 1NJZA 4UUXA 4F67A 4A8YA 2Y9HA 4YDDB 1JLQA 3FKBA 3K17A 3SQGB 3K5MA 1CJKB 4OHWA 2JX2A 1UVJA 3Q24A 2CA9A 2HBRB 3EGNA 5IS2A 4PYDA 3CCUS 2ALYB 5HI7A 1S1VB 5IT9Y 2Q6BA 1EKRA 3I4PA 3DMJB 5HBMA 3FMWA 4LJMA 4P10A 1N48A 2HNZA 1VBXA 1K8AT 1JQGA 3LAKA 1GMWD 3K89A 4N41A 1BLUA 4LT6A 4HL9A 2CDRB 1SQEA 2IJFA 3R5BA 3RBDA 1X4HA 3MUTP 2EK6A 2HHUA 5D78A 3VAIA 3CJ4A 4DX7A 4IG3B 2AF6A 2BJ7A 1S97A 2V8GA 3QYYA 2EG1A 4NCGB 4CH1A 1F3VA 5JVGQ 2H51B 4WK1A 4ZOSA 3W2VB 4E98A 4LRBA 3I96A 3CJ3A 3CJKA 4MH8A 4P9SA 4O3OA 1PC5A 1T05A 2ATLA 3PJXA 1KVIA 2FLLA 1FHTA 1W2IA 2LQJA 2GO9A 3G2XA 3QT5A 2UVVA 1BQNB 2Q3PA 4DR5F 2HEKA 2OD4A 1Q1KA 4Q44A 1K73T 2EEYA 4M1KA 1M1HA 5ETVA 3CJ2A 1NB7A 2M70A 3J7A1 4FNIA 1NPKA 1REVB 4FKXA 4X4PA 1ZM4A 2G1DA 5HANA 2V9WA 2RT3A 1NRKA 1LWEB 1HNVA 1RABB 2E1MC 4IH5A 5DM7Q 2KFYA 4CO0A 4B9MA 4CYUB 2ZBRA 2VHGA 4J9RA 2OFHX 1DTTB 2ZUAA 3ZFVA 3KHRA 2WONA 1S6QA 5E33A 4QWBA 2YH0A 4NCBA 1FRHA 1M5PC 4WE1B 1U2FA 3M1VB 2W8LA 3HKZD 1NZAA 2NYIA 3M05A 2H9ZA 2DGVA 4OYIA 3C8YA 3UDLA 2VPWB 2ZNYA 3TYTA 4M5GA 2D9PA 3SIPB 3QZ7A 2DCUB 5AT1B 3MUVP 1RAJA 5K14A 3AOBA 2F8HA 4F4KA 2GA7A 4JI4J 2K1RB 3M2VB 1HYSB 1UJ4A 2KJVA 1UCNA 1RE1B 1UWAA 2RMLA 2RS2A 4DR2J 1S7HA 1S7IA 2FJVA 1TL3B 2DRDA 1JLGB 1KQSR 2D41A 5E3PA 1VQYA 3RR7A 2LXFA 2VFVA 3TUJC 1KONA 3HPOA 1RDRA 3CCRS 3CCTA 3EZ5A 3MMBB 3MURP 2CZVC 3D6TB 3OL6A 3CSKA 4IOAQ 3QIPA 2CNOB 1KDNA 1S1WA 1Z1ZA 3HVWA 2VA2A 3PV8A 3LF0A 5E3RA 5L1JA 4P2SA 4U6PA 2W9BB 2W2QP 4DG1A 2VDHA 3TA2A 4XO0A 1C0TB 1BE4A 2R7TA 1I94F 3GCWP 1RT6A 2MZTA 2D74B 5DGAA 5KT3A 2RHSB 1NK0A 4UUWA 4KC5A 4PXBA 2ZOFA 3S8SA 4P2XA 4OYAA 1SH0A 2DEIA 2Y0SD 1SL0A 1TAUA 2ZH6A 2AJ4A 4TY8B 3M9MB 1HI0P 2YXLA 3Q8VA 1UFKA 1Q0NA 1UZDA 3NXZA 4ZIWA 1TKTA 2J6UA 4QCLA 4LBPA 2XZTB 2ZOMA 4Y2IA 2WK4A 4USWA 3LWLA 4XIUA 1DARA 2FB0A 3I31A 3T1YJ 4IOBA 3M6XA 3PW0A 1Q95G 2FHJA 4YHHJ 1RT2A 1BQMA 4OJ1A 2DIVA 2KFNA 2IM1A 3CW2C 1MLAA 4I6WA 3X1LB 2WB1D 3B54A 1RAGB 3P3DA 1RHJB 1U1LA 2MKJA 5L1KA 4HDGA 1RYSA 1ZZFA 4ID5B 1UPPA 3IM9A 4IFYB 3Q86A 2FLPA 2JVOA 1JLFB 2Y3YA 2WTFA 2V50A 2YX1A 1KN6A 1HBNA 1XN9A 4D3GA 4IR9A 1AUSL 4C0BA 2HHTA 3TUPA 2KZMA 4Y2MA 4DF4A 3Q22A 3QT7A 5J2QA 2IVMA 3FCWA 5A0YA 1U1KA 4FXWA 4RR5A 3I0SA 2HRYA 3UCGA 2RAQA 1RWWB 3MF5A 3A3OB 3DLGA 3NKYA 2CNNB 3EM1A 4WZQA 3V4IA 4DFMA 4KHPF 4ES1A 3GSIA 3KLGB 1FXRA 3PEJA 2ZNZA 2LMIA 4KV8A 1FJGF 2HZVA 4RW9B 4DR2F 1FRMA 2RF2B 3DKDA 4ANCA 3SCLE 1EHWA 2JLGA 3M8RA 4X66F 1FT8A 4FYVB 1HNXF 3DOLA 3JTOA 4KO0B 2IA6A 2VICA 3ENQA 1VHIA 3WX4A 2LLZA 4AE5A 3BN4A 3MTKA 1NPPA 3JXOA 1NHVA 4O0IA 3CCES 1R31A 4MAKA 5J1PA 1BGXT 4G1QA 4DV6F 1F5BA 4NA1A 5B0EA 2ABYA 4RKUC 2D3ZA 4ICLA 3BN7A 2BQ3A 3BSCA 3W1YC 2HVHA 3HVTA 2VA3A 4IRKA 1KNZA 3P45B 4RW4B 4F02A 1KVJA 3MM8B 2D69A 4G1IA 2PT0A 4NOHA 2PMZD 2KTQA 4RUCA 2GJIA 1KLNA 2AJ0A 3SYZA 1Q7LB 5KG4A 3EXCX 4DV7J 5KG0A 2XULA 1FXDA 3POTB 3PM9A 4USIA 3UO0A 1CJVA 3OSPA 3B8HA 4I7FA 3NRBA 2ROGA 4C98A 3LP1B 3KMQA 2B6AB 4U9RA 3CCQS 5KFAA 5KG7A 3PIOQ 2DY9A 3QJLA 2EI5A 3MD3A 4DX5A 3OR1A 4Z7CA 2CQPA 3M8PB 2G13A 2N7CA 2KXNB 1WC4A 3E8OA 3G87A 4F3OA 4UQTA 1YKWA 5F8LA 3R9LA 3MEEB 4WP3A 1YK9A 2KJWA 5IT0A 2HG4A 2JC0A 1U6ZA 2Q1LA 4ECSA 2PA3A 1RAOA 4EWTA 2HNYA 3KHHA 2JJ4D 2O5DA 2VOOA 5H1SV 2EKNA 1KTVA 3AJDA 3PCOB 5T7LA 2A1BA 5A2QU 1AZSA 4DMZA 3JQJA 5JJBA 3K7RA 1VQ9S 5F3ZA 1TMMA 3CCSS 2VIHA 4W98A 4J9UE 1FDNA 3A4TA 1H74A 4LRAA 4LVNP 4B3MJ 2BKPA 2OPPB 1ZZNA 2KH9A 3QSYB 2QLXA 4EU0A 2KI2A 3WZ0A 2BW2A 4FF4A 1YWXA 2AIRB 1IBCB 1FKAF 3FCVA 3KK1A 1WI6A 2ZWOA 2O3DA 5D6GA 3N0VA 1JJCB 3D6FB 5FIIA 4AUKA 1HKAA 4HLBA 1W25A 1KP6A 5GADU 2LU2A 5FD1A 1RT1B 4PKDB 2VPXB 2CFXA 2W25A 1OPIA 1AT1B 4NYPA 4B3OA 2FQQB 4ZPDA 3GWCA 1YRUA 2A2CA 2DR8A 4OI6A 3R2CJ 3ZZPA 2ZHOA 2FLOA 4JB8B 1SPBP 4BWJA 4H54A 2QMUB 2XYGB 2U1AA 2BQRA 3C16A 1HQEB 4DR4F 1RTHB 4R8UA 1MNEA 1IR1A 1HQ2A 2JDJA 3H5SA 3DRSA 3QJJA 1UEUA 1PAEX 4JI8J 2B9EA 2LECA 4ZVUB 3M9NB 1VFJA 3SXLA 2W24A 4F7VA 3PHTA 2ILYA 3MFHA 5I3UB 5CHCB 1UVKA 2HMIA 5HATA 5C7PA 2AU0A 4RBUA 5F8MA 2XBPA 1J2VA 3RB3A 2QL5B 4ED6A 4I69A 3BB5A 2VONA 2H5JB 2G2ZA 3FMBA 1RHKB 5ETSA 1NEEA 3D0IE 4DV7F 2N3OA 4QWCA 2MKHA 5LSRA 2E9ZA 2JOQA 5I3QA 3ILJA 2BW7A 4FBUA 1JKHA 4P72A 1WTBA 1FWPA 2I6WA 2IMWP 1EARA 4OLPA 4HKQA 1RCXB 2DK2A 3TQ1A 1FDAA 1N56A 2HW3A 2WOMA 2DNRA 1WC6A 1XEZA 3EPGA 3MAHA 5K8PA 4C2MA 4GKJJ 4WBFA 3QAEA 2E1PA 4RPFA 4ELVA 3R3TA 4DX8H 2R4FA 4EK2A 1RHMB 2HWHA 5CZXA 1K1SA 4PR6A 1YVFA 1ELOA 3EZUA 3MGJA 3EWGA 3KJFB 1G4CA 3PR4A 1C2PA 3G6YA 2G2YA 3DU5A 2NXJA 5C25B 3M30A 4DV5J 5K5MA 5KFZA 4K4ZA 4B3TF 4I0WA 4B3MF 4HACA 2Q43A 1QLNA 3BDEA 3GJSB 3GV5B 3IN5A 3P6YC 4H4KA 2W4DA 3US5A 5A76A 2GV1A 3MM7B 5IXUA 1J5OA 2B7BB 2OUGA 3KK2A 2J6SA 3RW7A 4DR3J 2UUBJ 2HNZB 4KAIA 2AYBA 1JWWA 2QE5A 2PSZA 2HNDA 1N5YB 4FXDA 4DV0J 3TAQA 2MTLA 2BKNA 4S0MA 2MZ1A 3OR2A 4DS5A 2LA6A 4TLRA 3KNGA 3GIMA 2EPIA 4ECUA 4Q7AA 1HNZF 3CCVS 4HTIA 2O1PA 1T8EA 4JI8F 2BV3A 2HQFA 4ES2A 3EVMA 3CJKB 3W2WB 2E5LJ 2XG8A 2BEFA 3M7VA 4LR8A 3IM8A 3NMAA 4RBVA 4F4XA 1T05B 2ASLA 3VVTA 2DTJA 1GAOA 4AXJA 3K5NA 1QVGR 3DI6A 3OLBA 2KFZA 3MEKA 1Q8IA 1M5KC 3CC4S 1E6YA 3TEHB 4X64F 5L39A 4OV6A 2QLWA 4RUAA 2X1AA 1N6QA 3I9ZA 4CH0S 1S6PB 4H4KC 3ET6A 2V8PA 3DLHA 2BJ8A 3QQCD 2DNGA 1XK8A 2WHOA 3NGTA 3D67A 4J9MA 1NDKA 2J0XA 4ZVOB 1HNVB 4KBIA 3H0PA 1T03B 3O44A 4GVBA 2ZJQQ 1S0MA 1DAXA 2BXJA 2WONB 3ETMA 1S6QB 3RGIA 1ZH5A 1RWXB 1TL1A 4KGMA 5DZ6A 3C6TB 2ZKUA 1U6BA 3IWLA 3M8QA 1N33J 4GKJF 2HHWA 3L7OA 2ILZA 2VG5A 4YR2A 2LEAA 1F2HA 1Y7PA 4MKYA 1SXLA 1LW0A 1R6YA 2B9WA 4OHYA 5K14B 4LF1A 2V68A 4OI3A 4LSNA 3Q2TC 3HO1A 2X3GA 3SCIE 4DSKA 3I32A 2EBGA 1QSLA 2H4WB 4O4GA 1NZ8A 1O8BA 2MMYA 3GMGA 1DRZA 2DXDA 2FDNA 4ZJQA 4AFFA 1U2RA 1S77D 1HWIA 4JI7J 3ZTPA 3P5BP 1KR4A 1U1RA 4N47A 2KHCA 1TTHB 4DBQA 3ZXWA 3A8JA 1S1WB 3UNYA 1X5OA 2F9JA 1EIYB 2QYGA 2VOPA 2GIQA 3PXGa 3R5DA 4ZPVR 2VBYA 4A8WA 3IGNA 2UUBF 3NS5A 3BEGB 3RG6A 2HYIB 3JAMU 3QJPA 2G0CA 2ZZNA 2QT7A 1RT6B 1PSDA 2M7SA 2KG0A 2R7RA 3KJVA 5DDQC 3GQCA 3DOMA 3C14A 2EFQA 2MZJA 3L95X 4DFPA 2NSCA 2YWWA 4KH0B 4WIIA 4C3LA 3BGRA 4ZHRB 1YBTA 4ZVTB 3MEGB 4P74A 4P2MA 5J2MA 3IRWP 1RK8A 1S1UA 3HVRA 4NLVA 3MTJA 5KFJA 1N54B 4F0HA 2CPJA 1UJ6A 5KFXA 1T3NA 2LXIA 2W9CA 1O51A 2OJ3A 2BRLA 3VWSA 5E2QA 2ZUGA 3RRHA 2EBEA 2YKMA 3ILLA 2F65A 4EFAC 2ZITA 4P2FA 4ZIVA 2PD1A 4ZITA 3KG1A 1Q16B 1RA7A 4X4NA 3BZQA 2CPHA 2VJUA 1TKZA 5D4PA 3SBMA 1S0NA 3GPAA 3CIZA 3PW2A 1HBNB 4USUA 2Z2MA 2MLXA 2J8AA 3Q89A 2WVCA 2XMKA 1UVIA 4FF3A 1EKSA 2DNPA 1N5TA 5LMUJ 5J2QB 1BWEA 2F9DA 2CZ4A 1UVLA 2RUGA 3I0SB 2YPYA 5FLXU 1NH7A 3NOCA 3FSYA 3RB0A 3PW4A 2NR0A 3T19A 3V4IB 3TVZA 3DFEA 4K0KF 2DGOA 3T6JA 5I4MA 1GTEA 1M5HA 1RT5A 1W2BR 3M2RA 4NMXA 3SFGA 5CYQA 4JI7F 4QPTA 1PAUB 4LREA 4EBDA 1FRJA 1HD1A 4OHVA 2FHKA 3VV2B 1WF1A 3QO9A 3KLFA 2RQCA 2HLTA 3AB2B 4IG0A 4NRUA 3THPA 4B9VA 2XY7A 5ETOA 2CVEA 2BM1A 4F0MA 1RT7A 5J2PB 4DHVA 4G1QB 3RRKA 2RVJA 1LW2B 3IG1A 3VZIA 3MMAA 4ICLB 2HS0A 4O3PA 2FJXA 3I5BA 1NSAA 3GFXA 1SJ3P 1NAQA 3CMAS 1XR7A 1EJ7L 3ICLA 4MTPA 4ZCIA 2RU9A 2MLZA 2ZDPA 2DHAA 2VFUA 2YWFA 3TZZA 4O3QA 4OZ0A 5KFSA 3A13A 2YQ1A 2HFUA 5DQIA 4O0NA 1SC4B 3TRGA 4CI0B 1CJVB 1QAXA 3MR3A 1Q78A 1IKWB 4J9NA 1QSYA 4I7FB 2FHOB 3GV8B 1QJHA 2GQCA 2J7KA 1B3TA 1TU0B 4NLYA 2CJQA 3H98A 1U26A 5KT5A 2OTLS 2XHWA 4USVA 2YPZA 1M5SA 3PDNA 4KIAA 4BC7A 3U1MA 2F5GA 3FBFA 3V2UC 3PZPA 1OJ4A 4ES3A 3OHBA 4WTYA 2R2UA 3ZZRA 4NYOA 1XR6A 3WBZA 4M94A 3N6NA 4DUZF 1J27A 2WW4A 2HNYB 4LF8J 2ZHBA 1NU4A 2ACYA 2MQOA 5I42B 4LF7J 1V5VA 3D4JA 1HHSA 4DV3J 1VC5A 1UEVA 4J91A 2FLNA 3KOAA 1WOPA 5ETKA 4F26A 4DN0A 4A8OA 2HRTA 2E5HA 4L3NA 4X62J 3EGVA 3TOQA 2CQIA 2RH3A 2BE2A 2ZH5A 1GX6A 2F4VF 3O5TB 3VAKA 2YBVA 3J7Z5 1R43A 1ZAVA 3JSYA 3JSBA 3EX7B 1KFSA 1RACB 3FBBA 3P49B 1HIYA 4Y2CA 2J9DA 3KK1B 4TQRA 4M5DA 4HT7A 2COLA 1RLCL 2K2PA 2KYZA 1TZ0A 2RRNA 3RUBL 1NK7A 4ZLNA 4PRFA 4B3OB 1TUGB 1VRTB 4KGZB 4YP3A 1SBRA 1G6BA 4DUTA 2UVWA 4F3MA 4M5MA 3B4DA 3DXSX 2V94A 4QIGA 3C16B 3PNIA 4R8UB 2HGMA 3T5KA 2VG7A 4WU3A 3DRSB 2L9WA 1Q86T 3EZOA 3DLKB 1B64A 1RT3A 1VGYA 4HHJA 1FCAA 3A8IA 4BBYA 3OFGA 1VJQA 2ZH8A 3OFFA 1YTYA 1QVFR 1YRXA 3R1LA 2GJ2A 2HMIB 4OYMA 4IFVA 5C42A 3TAMA 3OLAA 4DPWA 2YKPA 3PRVA 1JLBA 3FK4A 3AA9A 4OZLA 4EYIB 5IT9U 4V1Ak 4G65A 1N36J 1MWYA 2JEJA 4J9PA 4KKOA 3LP2A 4I6YA 3UDCA 1X0PA 4XK8C 3PRBA 4UTGA 3TJ8A 3T3FA 4ZVPB 3MAAA 1IBLJ 2EXUA 1WUUA 1JKHB 4A8QA 2CJYB 4W90B 3QGGA 1K44A 3RAXA 4CLYA 5D8HB 2R7VA 1VISA 1IXKA 2NQPA 2CQDA 2WOMB 4NRTA 1IBKJ 3A1YG 4A46A 1R3NA 4YUDA 3MMJA 4NI2A 2HPUA 3W62A 4DR6F 2JH3A 4DL4A 9RUBA 4UY8T 1CG2A 2FD2A 2WVFA 3FBCA 1EX8A 3I6PA 1V3SA 3CTRA 4OI1A 4X4TA 3OJSA 3VVUA 5DG7A 1SCJB 4NXNJ 3PYDA 5L9XA 3FZBA 1PJ7A 3MD1A 3G82B 1SC6A 1JXVA 2CNKB 2PI4A 3BGOP 4L6V3 2OEKA 2XQCA 1IBMJ 2H5IB 4C8OA 5AE1A 3I5CA 4IDKA 5KFIA 4B3SJ 2OMLA 2R8HA 2H65B 2LDYA 4RW6B 2F3JA 1PGZA 2GVDB 4PWUA 4HACB 4OX9J 3MCSA 3K0JA 2OSRA 2RRBA 4RWXA 4Q2MA 9ATCB 3BREA 3GFZA 3KK2B 1RGVA 3IC1A 4PAAA 3ENAA 4WFBQ 2W1BA 1O5JA 1DLOA 4GC6A 3CMQA 4RX6A 2FTRA 4DZDA 2HIYA 5K9FA 1J5EJ 2XC9A 2UVRA 2DNYA 2HNDB 4A4JA 4FNHA 4CLWA 2YKNA 1JMTA 4BLGA 4RZRA 5D77A 3OR2B 1RT4B 1T95A 3HF5A 2R8IA 4JI1J 4F25A 1RAHB 3D54A 4LFBJ 4X4UA 3HFVA 2YWKA 4OL8A 5CYJA 3MM6A 2MQNA 3LUYA 3DLEA 4C7QA 3DLLQ 1S9EA 4X65F 3VGUA 4DPTA 2DGUA 1LFPA 3C46A 2XMUA 3DI6B 1L3UA 2KU7A 1FKOB 2E9TA 3BSOA 1EQMA 1E6YB 2FHMA 3HX9A 1PC4A 2VH7A 3DLBA 1N36F 1FFWB 1N6QB 2OKQA 1EZZB 3D3BJ 1X4GA 4IO1A 2YNGA 2XS7A 5HMXA 4ZVHA 5J1EA 2ZBIA 1OQ3A 4LF6J 4CT8A 1VLOA 1MU2A 8RUCA 2FY1A 1JXEA 2XCPA 1MROA 3AJ1A 4QYZK 5DDOC 5D4OA 4GVBB 4CO2A 1KC8T 2GS8A 4FYXB 2ASYA 2Y0BB 2LQ9A 1X5PA 1TL1B 4LBHA 5AXMA 3EVWA 2BMBA 3SEOA 2HFOA 3KDOA 2IYGA 5IQQA 3M8QB 4U7CA 2SXLA 2R7QA 2V9KA 2G4BA 2DEJA 3I4HX 1SJFA 2CQ4A 4NXNF 4ZP6A 3IAS9 2C2EA 5HJXA 1IM6A 2MKKA 5LXRA 2IIHA 2FPHX 5ETQA 4LSNB 3EYZA 2X1GA 3CIMA 4QIVA 1JB0C 1KQFB 3OTDA 2KT3A 5M2PA 4YDXA 1P6TA 3PW5A 3CVKA 2YNHA 1U0SA 5KFQA 4B3SF 3N6LA 1S59A 4ZVRB 3LWMA 4X4VA 3I56S 2FZKB 2RQ4A 1B7YB 2HHXA 3GZ7A 4J9LA 4CP5A 1G3OA 3UN3A 2GW8A 4Z2XA 1Y5LB 2HGLA 3PJ9A 2ZVSA 2AZ1A 3H59A 2KO1A 2QIFA 5KFMA 3S6EA 3G96A 5HN0A 1RTIA 5KOWA 3KJVB 1FO1A 3NBPA 3NCPA 3OFHA 3QGHA 1RHUB 4K50A 2I2YA 3H4DA 3CO9A 5BJRA 2DNNA 3MZIA 2QL9B 4JI0J 4QZVB 5HLFA 5F41A 4DSEA 4JI1F 3UN5A 4I67A 1G2EA 4LFBF 1CQNA 3FEXB 2ZM6F 4MK9A 2CQ3A 3BGRB 3HHLD 1Q8KA 2W4PA 2CG4A 3PKMA 2BACA 3AD7C 2CYYA 2HSEB 3TA1A 2UZAA 3FQLA 3R5AA 3VAJA 1UP1A 3ENWA 2QYCA 2HURA 4DR1F 3HHNB 2ATCB 4EBCA 4CM0A 2W2MP 1QE1A 2W9CB 4GVLA 2WZ1A 1PG5B 3Q2SC 1WACA 3KUEA 3BR8A 3FFIA 2AJQA 2NSBA 1WG1A 1U2CA 2YKMB 5LMNF 4JI6F 2DR9A 2FGCA 2R2TA 3CD5A 4LFAJ 4ED8A 1HPZA 2Y1LB 1X60A 2C3YA 4NLUA 3X3UA 5DLGA 3WIVA 1HNIA 5D0GA 4QW9A 2QTWA 2ZOGA 3KG4A 2V67A 2JFKA 2XI3A 1Y5NB 3DU6A 1F0XA 2N82B 3JS9A 1VLYA 1N0UA 3S1TA 1UFLA 2EG2A 2XY6A 2BA9A 4CQ1A 1TV6B 3CCLS 1WC0A 2H1YA 1SV5A 2V34A 1F3FA 2OPQA 1YI2S 1BQXA 1NH8A 2VQFF 2RSQA 1GFWB 1EB0A 3FJ2A 3BV8A 4NA2A 4FDFA 2EWHA 1Y9OA 3T5HA 2K8GA 4DQQA 1Q8BA 4K5RA 3KK3A 3CJ5A 1N5SA 5E3QA 2XGPA 1DHMA 2QO3A 4EO8A 2ZWPA 1HHQA 2ZD1A 4WWSA 5AJ3J 4ID8A 2RS8A 1S1TA 1F1BB 4LMZA 3MPVA 1RT5B 3CJTA 2F63A 2QMWA 4TVAB 2PGCA 3M2RB 1P1LA 3SMZA 3VAFA 1YSJA 4TU9A 1WSRA 5CYQB 3BKUA 1R0CB 4FN5A 2GIFA 3DOKB 1Q5YA 3HFZB 3EDQB 3QO9B 3KLFB 1GX5A 3D5MA 4EO6A 4IG0B 1P1TA 2V8VA 1HW9A 2BE7D 3MM9B 4F4WA 3DRYA 2FJWA 4TKTA 1KKHA 1RT7B 3MPUB 3A8KA 1WEYA 1HNWF 3MMAB 2QMXA 2MQMA 2AJ2A 3FVYA 2FJDB 4O3SA 2IRUA 3V4MA 1R8PA 3BDPA 2R7XA 4XPCA 3ZZOA 4EZ6A 4V19J 1WDDA 1VQMS 1VQ7S 4ZN1A 3OTOJ 3BPDA 3QBCA 3EGZA 3CT9A 3OSNA 3BO4A 1KWMA 4C9DA 4J37A 3ISZA 3MPYA 5D15A 1WJ9A 2FVCA 4NX9A 4ZP9A 2LKZA 3PHEA 2NUHA 1S4EA 1P27B 3SI8A 1VJWA 3NOGA 3KYLA 1D3WA 2YKAA 1ZYQA 2YWGA 3DGVA 1I3OB 4FYYB 2G0IA 4N7TA 5JUMA 4UOFA 5RUBA 2QG9B 5HQ8A 3WIUA 2IPOB 3K57A 1FF2A 4RU9A 1XMQF 1YBAA 1WF2A 5B08A 3Q83A 3PX4A 3W7BA 4ZMMA 3HSJA 2QA2A 2CPFA 4DV1J 4KH1B 1VQ4S 4OYPA 1D0EA 1PIEA 1R7IA 1OQ6A 3CD0A 3ZTQA 3C15A 2GMJA 4FS2A 4ANDA 2G0JA 4E2FB 2LU1A 3GIKA 1MSWD 5DZ7A 2QZ8A 3EMTA 2DBBA 2E5GA 3QIDA 4DL6A 2O01C 1NXIA 2IA0A 3SSSA 4RLEA 1WF0A 2K7KA 2FJBB 2E66A 3KJNB 4PPZA 4OYBA 4R25A 2DO4A 1WG5A 4H4MA 4K4UA 1NJYA 4OZ5A 1D9DA 5M2UA 4FYWB 4W4MA 1UA0A 4USTA 4OLOA 4NLDA 4NXMJ 2DH7A 1S10A 3LTOA 1TL7A 4KGVB 4OYOA 1JLCA 4NYZA 2BBEA 3R27A 1WD6A 4CNYA 1WWHA 4UF4A 3DN9A 2XYPB 4OZ1A 4ECTA 3LGNA 2BDPA 2D9OA 3KJQB 3OL8A 1CVJA 4B9SA 2FGOA 4HH1A 2VG6A 2EK1A 3W60A 1FDDA 1UAWA 2CPDA 2V5HG 4C8ZA 3K5OA 1HMVB 3SSRA 3AT1B 3N79A 2A18A 1UKUA 3D9BA 3V5RA 2Y1RI 3FQKA 2MY8A 1L3VA 4FXVA 3L09A 2LEBA 4RNOA 2GVZA 2VZ9A 2VG7B 3OTCA 1IR0A 4DV4F 1MN7A 1HBUA 3Q8UA 3TZWA 4I2PA 4DL3A 2VFTA 1JLEA 2WW8A 1YJTA 3AOAA 4ELUA 2J0SD 4ZA1A 5IM0A 3DHWC 4LF5J 3H2LA 4IFVB 1NK6A 4OV1A 5C42B 4OYZA 2E1AA 2EW9A 3QGIA 2MKCA 3CULA 4IRDA 4H4OB 2AYGA 3OTOF 5IT4A 3J7YI 1JLBB 1MMLA 2DY1A 3G4SS 1RTDA 4U95A 2B4UA 2X1FA 3D1QA 4WTOB 3LP2B 1FK9B 4C6AA 2W8KA 2IRXA 1YDLA 1JJ4A 4ZN3A 3Q8RB 2WVEA 4ECQA 3T9NA 5CCLA 2ALZA 2W4CA 3MR5A 5BYRA 3DM2B 4MK7A 1S0OA 1G7CB 3FBEA 2CJXB 1S6OA 1UEKA 2JSXA 1QUPA 1X31C 3ULHA 4FF1A 2BVZA 4JI5F 3MECA 1BY9A 2LQ5A 4KYZA 1XNQF 5K8NA 1X4BA 4KB7A 4WXOA 1A0OB 2XS5A 5F8JA 4XDDA 3DLJA 3A3NB 3NNAA 2CQCA 1FVSA 1S79A 1KS2A 2E44A 2V4JA 4NLSA 2GX8A 3AB4B 4NZ0A 5T41A 3K59A 4YB6A 5IFMA 2R7UA 1GNKA 1HBOB 1WOSA 2GHPA 2N4CA 3E51A 1RISA 5IC6B 3JQKA 3GSDA 2AV5A 3UD4P 3FCHA 3UCZP 1WEXA 3F41A 5F9LA 3D2WA 4I1TA 2MQPA 2RKIA 2NLWA 4YFUA 3K8WA 4DFKA 4CZCA 4IDKB 1PJ5A 4X4QA 4HH0A 4CDIA 1U48A 1CC7A 1UPMB 2R3VA 2B43A 1IKVA 2DGWA 1NDLA 2L08A 3J81U 4NXMF 5EHHA 3BR9A 4PCQA 1CJUA 3FUYA 2UXDF 4GRSA 3MCNA 1WG4A 5C2GA 1ZA2B 2KL8A 1DLOB 3QLHA 3HHLC 4M5LA 4FPIA 2N7YA 4DL5A 4ZCKA 4A8XA 4IR1A 4IO9Q 1I94J 3E01B 1X4CA 2VODA 3V81A 1AW0A 3CD7A 1NSQA 1L3TA 2Z57B 1RSCA 5A2QY 2EVZA 3IS9B 2VB6A 2JEGA 4WPAA 3EJMA 1HW8A 3NNHA 1LWFA 3DLEB 3HDSA 1S9EB 4G3IA 4IRCA 3GFHA 4TLQA 2BJEA 3G6VA 1QTNB 2B9XA 4NPOA 2ZH4A 2B51A 3D6HB 4LF5F 5GAGI 5KFNA 1S5ZA 4A8SA 3BQ1A 3G71S 2NCKL 3KUHA 2BR0A 3DXBA 1RTJA 1UW9A 3L3CA 1WC3A 3D68A 2L41A 2GMHA 4ER8A 2YNGB 2XO6A 2DR5A 1VRUA 2W2OP 5J1EB 5KG5A 1YLXA 4MK8A 2BANA 3IRXB 4DFJA 4U7UK 1MU2B 5J2NA 1N5VA 1XTZA 1MROB 1KQKA 5GVQA 1E6VB 1FNMA 5A8WA 1H0HB 3OXFA 3D1OA 3IR6B 1ZM2A 3KFWX 4TQSA 3QPIA 3FC9A 2DHSA 3H8YA 5SUHA 1FJCA 1NK8A 2GAHC 5DETA 2NXUA 1XNRF 2APOA 4FPRA 2DPIA 3M6VA 3Q8YA 2MDAA 4QU7A 1D8ZA 1Q5VA 1N52B 1H7WA 4WFAQ 1QY7A 2V2KA 3OTBA 3OV7A 5HVHA 1FWKA 1HFEL 2KT5A 4KSEB 4LVOP 4LIWA 3UCUP 3U1NA 1X9MA 3AQPA 3N4WA 5EX0A 1PYOB 3F0NA 1RU1A 4TYBA 4KHPJ 2KM8C 1VR6A 4KGKA 4GMKA 2YNHB 2KXFA 1JX4A 3FSXA 1FJGJ 5GAHU 2R8KA 2CJAA 1VK3A 2PI5A 2FIUA 1VQKS 1RI7A 4IG3A 3KG0A 4URQU 1G1XA 5HMZA 3Q8SB 2OHDA 4X66J 4NCGA 4C8LA 2D7SA 1HNXJ 1FRXA 1WELA 4Y6IA 4KE5A 2AT1B 2RIJA 2XSFA 3UVJB 1RWMB 2MXYA 4AYBD 4LF4F 5LM7E 3HVAA 2CRLA 2JWNA 3NBPB 2AZ3A 5KAKA 4DV6J 2GGPA 1BQNA 4C97A 1U02A 4Q5VA 2ZH9A 4DZ6A 3WC2A 2PEHA 3K8VA 1X4DA 4KFBB 1REGX 2RILA 3AODA 2LXUA 1U8SA 1F60B 1LK7A 1Y4ZB 2EFOA 1KQGB 3H90A 2XM3A 1LWEA 1T9WA 4N76A 2KYXA 5C2CA 2QC3A 4A8KA 1TK5A 5AE2A 5CZVA 2YNFA 4B3RF 4CYUA 1Y3KA 3VAGA 3VF0B 1JIHA 1S99A 2UUTA 3GFYA 2XCAA 4GC7A 2R7WA 2YX4A 3GR0A 3KLHB 2M8HA 3DRRB 1XERA 1OIAA 2HZAA 3FFIB 4DEZA 4WK3A 3M1VA 1M5OC 5ETTA 2MB0B 2DISA 5L1IA 1R0AA 5B0DA 4BHQA 1HPZB 3HZEA 5HP1A 5KFPA 2CQ1A 2PIIA 2V69A 5IC4B 5C24B 2W7PA 1HNIB 4I2QB 3BH7B 2HK2A 4JP8A 3S7RA 4DL2A 3GG1A 2VQEJ 5JMNA 4KTQA 3DYAB 3GONA 1AB8A 4Y34A 5CABA 4Q43A 1NK9A 2A0FB 1BMQB 2YQ0A 2BJ1A 4ZPBA 4Q0BB 1SV5B 5IV4A 2OPQB 2V6AA 1FX2A 3V6DA 3UDVA 3ZZ0A 2IM0A 2P8IA 3D1HA 1HQUA 3M32A 2J7WA 1JLGA 3VGTA 1T9VA 1FEHA 2PEBA 1YJUA 3TX0A 4A48A 1VCTA 1R0BG 4LQ3A 3MMBA 3MHYA 3CD6S 5ETMA 2KXHA 4CLZA 2QA4G 2ZD1B 3QT8A 4QR0A 3HJVA 2VPZB 4GKKF 2CPEA 5LJ3Y 2RDJA 1S1TB 5HMYA 1SL1A 1C0TA 2Q66A 4O23A 5KFVA 3JSMB 3HCXA 3AH6A 4XAKA 3CJSA 4O3NA 2WSFC 1N5QA 2C3PA 1OSDA 2ZEJA 2DNHA 2FZGB 4DLGA 1TR0A 4RUHA 2CIMA 5H9FK 2XNQA 1I6JA 1IJFB 4NLXA 4BC9A 1RUSA 2DNMA 3W9HA 1BD6A 5IWAF 1S76D 3MPDA 1NHUA 3VAHA 2AHOB 3RAMA 4QWDA 4DR4J 2YNIB 1KLMB 2XTJP 2ZH1A 1DTQB 2HAIA 1MMDA 4DCPB 3I82A 5E41A 2LEPA 3CJQA 1VQ8S 2JC1A 2IVFB 1UWBB 4MKAA 4JV5F 2XY5A 5AXNA 4O4RA 1NK5A 4TXSA 5LJ5Y 1LV5A 1NMEB 2Z56B 4DQPA 1X4AA 2ZJPQ 5I3PA 3HULA 1KD1T 1H72C 2HQIA 2IHR1 2HHPA 2VPYB 3RR8A 1PJ6A 1ZM3A 2IDLA 2V63A 3DRPA 4IFYA 2NXCA 4U8YA 2OH2A 3GJRB 1GMWA 1U47A 3IBFB 3H5UA 5K8MA 3I5AA 1Q7YT 3M6WA 1I1GA 2Z0GA 1YZ7A 3P4UB 2AWZA 2O67A 1HI1A 2MEWA 3IP0A 2YQ3A 5ITHA 2XHCA 3JAMY 1OYDA 2VBWA 2P6TA 3PYFA 4CTAA 4DSIA 1MWQA 1R8BA 2ZC3A 2GCFA 1T9TA 2A10A 3PX0A 2Y8YA 2WSEC 4MT1A 1A7GE 2MKIA 2B4VA 2X7IA 1U0HA 4LFCF 1W26A 4PG4A 1DFDA 2VQEF 3W8PA 3M6UA 5KFWA 5LSLA 1IKXA 1F5CA 3JTPA 4BWMA 1CS4B 2GFFA 4OHXA 4L3KA 1SIZA 5KT6A 1FD8A 3GIJA 3G8SA 4QJVA 1SC1B 3TUZC 1T02A 2PFFB 5KG1A 4OX8A 3LANA 1SB6A 4C48A 2R7SA 2AX0A 2PDAA 4B3TJ 8ATCB 4A8MP 2QLFB 4MKVA 1JLCB 5EN1A 1UTAA 1UFWA 4P71A 1N34F 4UZCA 2ACMA 1U8WA 5H9FJ 1R8HA 3SV4A 4C4WA 3OUYA 1PBUA 3NP5A 2DO0A 3PG9A 5DLFA 1VRQC 4G1PA 2C1EB 3AJ2A 1V5IB 4JV2A 4KPYA 4RW4A 1N32F 5FJ4A 3EPIA 3OVBA 5J1NA 2YTCA 3CC7S 3MCOA 1FDBA 1HBUB 2LQ8A 1OPZA 4TU8A 3T9ZA 2P9EA 1JLEB 4CLKA 3MEDB 1XBWA 4TN2A 1HNZJ 2M3DA 3CXCR 2BYCA 4WJBA 4K5SA 4ZS6A 2OELA 3OT9A 2VD3A 3Q8QB 4KQZA 3BGUA 2EC0A 3W5YA 1FA0A 3MR2A 2GIRA 1RTDB 1Q8LA 4LF9J 1T9YA 1JK9B 1KOOA 1RBLA 4X64J 3EE3A 1D9FA 2BQUA 1NLKL 4N5SA 4CCHA 4K4YA 4F0KA 1M1GA 1U6FA 3OL9A 2H3EB 5E7OB 4QOTA 4QIEA 3VALA 2W01A 2F4FA 2MQLA 4NL5A 4QR2A 4RNHA 1S9FA 1RLDA 4MIWA 1ZETA 1NB2A 1Q4RA 3SFUA 4L75A 2RB7A 3NS7B 3NEKA 3PFOA 1HL6A 4HDHA 2ZDOA 4KPCA 3LQVA 2V4JB 3HK2A 1JLAA 1IUJA 2OPPA 2DGTA 3I9V9 3LGHA 1AROP 2BX6A 2A6MA 5D3GB 2BM0A 1KEKA 1K47A 1VYAA 1VQLS 1OMSA 4LR7A 3OJUA 3M8SA 4DF8A 2HKEA 4F4ZA 2X1BA 2WVBA 3NS6A 2OP5A 1WI8A 3GJTB 4C11A 1CJTA 1XR5A 1ZS6A 2RKIB 1GEHA 2ZZTA 1RT1A 1RAAB 4ZVSB 1C1BB 2GHVC 1SJ4P 1IQTA 3R5CA 5EUHA 3L7PA 4ECVA 3W66A 1IKVB 1RWUA 2OEJA 4OI4A 3IGVA 1OY8A 3HSZA 1JLQB 1EP4A 3JYTA 2OO4A 2MY7A 1W7WA 2UXBJ 2CWKA 3DHXA 1CJUB 6FDRA 1RTHA 1X4EA 1SVDA 2HAFA 1QTMA 1H38A 2DKOB 2VFSA 3QLHB 1M90T 3KXDA 5HBMB 1YHQS 1XIQA 4LRDA 5HK4A 3WQPA 4ZLJA 1CSJA 2JL9A 3V81B 1QD1A 2IAJA 2VL1A 1GK8A 5KFCA 3UFCX 3FGVA 1N0VC 3PYGA 1LWFB 5CH7B 4OX7A 3G8TA 3IWXA 4M5NA 4Y2AA 2DR7A 2JEIA 4NLPA 2ADCA 1VDHA 2DH9A 2N4DA 4P6QA 3LH2S 3R5GA 1RAFB 2CQ0A 4C3MA 3CCZA 4MIAA 3HM9A 1RTJB 2BJDA 4FS1A 1LNQA 2POKA 4LF9F 2M4MA 5KTQA 4L73A 2DT9A 1RAIB 2LP4A 1RHQB 2I0XA 1VRUB 1GXUA 5K20B 2BANB 4ILLA 4RNFA 1VQPS 4TY9A 4NE9C 5L9NA 4YB5A 4BS2A 5J2NB 4LIRA 3ENVA 1SIWB 2KG1A 2AGOA 5A8WB 5BYSA 2XGQA 3GIRA 1D9AA 1MWZA 4LQ9A 3NGUA 3GCXP 2RQKA 4KJIA 1RQ0A 1FTRA 3BSNA 2KT2A 2ZHAA 1KSPA 4RL1A 5AXKA 3UQSA 1CLFA 1Q53A 5GAHI 3QAUA 5ETPA 4DSFA 1U49A 3CB4A 1NBEB 5B0AA 3NAIA 1ZA1B 5DDRC 5H9EK 3NLCA 2Q79A 2F7VA 1ULRA 3ZNUA 4YEAA 3TANA 3QRRA 3MM7A 1ACMB 4C0HA 4KR0B 1FJ7A 1VIXA 1Q81T 2OLWA 3NCQA 2YY3A 4K0KJ 1PCAA 3BYPA 3OBIA 4P7VA 2HQDA 1N5YA 2OPRA 2GC8A 4K2JA 1FX4A 1Y5IB 2FZCB 4R5PA 4DSJA 1WDTA 4OJHA 2GQ2A 1YJVA 3H2VE 4LUBA 3LAMA 4ETXA 2M52A 2UXBF 5HROA 4DL0C 2ZJRQ 4X4SA 3IBCB 5BXIA 4WKYA 3H4BA 3QIPB 5ETRA 1YJRA 3HI9A 3W2WA 4ZJLA 5A8KA 1QDUB 5DJBA 2YX7A 4NLGA 4DG1B 4Y00A 2ZFHA 1D09B 2GGPB 2C2NA 1U45A 1UW4A 2Z4PA 2GHWA 4J9OA 4F2SA 3UPFA 3H5XA 1ZTTA 1N4LA 3S01A 2OD6A 4CLUA 4M8LA 3N5BA 1SL2A 1S6PA 1RA6A 4DPUA 2M88A 3UN2A 5A6WA 2X51A 3DNCA 3J7ZT 3NWRA 4YMEA 4IOCQ 1YJ9S 4NWBA 2YNFB 2XMVA 2E1CA 1NK4A 1CULA 1VIOA 5EGYA 1T03A 2JRSA 2JZ5A 1TKTB 1IWAA 4CRJA 3BKTA 1AA1B 2YKOA 3MCMA 2VFRA 3CGIA 3CDBA 4PPDA 5GMKa 4ED3A 2FJAB 5GMEA 3NGKA 4DV2F 1B4SA 2G2OA 4F4YA 3C6TA 2AD9A 1R0AB 2GMLA 1RT2B 2RU3A 1BQMB 1T94A 1X5TA 5HP1B 1DQ9A 4MYTA 2IMOA 5F3TA 4DCOB 3DC2A 2UVUA 2PFDA 4PG7A 4DUZJ 3J80Y 3BSAA 1YJNS 1V3RA 4RBTA 3W63A 2F1FA 3RZAA 5H9EJ 3UNGC 4RU2A 3KKFA 1FWLA 2Z8QA 1NPRA 1H2VZ 5EX3A 3PR5B 3SCKE 3V6DB 1UMJA 3EGWB 1XWLA 4DX6A 1HQUB 4WXWA 2XLJA 3M32B 3H40A 1KFDA 3H42A 1FNXH 5F9NA 3SQOP 2F4VJ 1NO8A 2DRBA 5A0YB 4QYRA 1RWKB 1RP5A 5IV3A 3LALA 3DLGB 2DXEA 2B9YA 1UVNA 4F4AA 1FXLA 3NL0A 1RKJA 5MLCV 1O6XA 3TEGA 8AT1B 4AT1B 3N28A 3RTVA 1S48A 2ROEA 1TFWA 4KV8B 3A12A 2MLYA 1OYEA 4ILRA 1VS3A 4YQWA 3PYEA 4P52A 3G86A 3T5LA 4OJGA 3D3CJ 4EGLA 1P8GA 4QWEA 2LYVA 2BUNA 3DOLB 2R42A 1NDPA 4ZHRA 4F50A 3KHLA 1S9GA 3JQMA 3LO3A 2BOPA 3MEGA 4NLTA 3BF4A 4DPXA 3WDOA 2XMWA 3CCJS 5GMDA 2C3OA 4C8KA 4DWIA 2I5JA 2YWEA 2FC8A 1H6KX 3R8YA 1LK5A 2KVIA 3J7AN 5JXSA 1WHWA 2HQCA 1HD0A 2CQBA 3HVTB 1U1PA 3R97A 1LOUA 4L76A 3BM7A 5ETNA 4B9UA 2V2VA 4DXLA 1HA1A 5DO2A 4MFBA 2WBMA 1HBMA 2AEFA 1RWNB 4KHMA 3NY0A 5G0RA 2M8DB 1K1QA 1ZAWA 1RXOB 3TWZA 3HZGA 3MAQA 1NSPA 3DRPB 2XNRA 3ETOA 2KN4A 4K7QA 4KHRA 1RKIA 5E3CA 2HVIA 1TUVA 5M2RA 4EUVA 2FUG9 2F8MA 2H54B 2QA4S 3PTWA 3NGRA 4DQRA 4CTAB 2OPSA 3OR1B 2L3MA 2DPJA 3R5JB 1KTQA 4DR7J 3GTYX 4DR6J 1S0VA 1U0HB 3H20A 3KLEA 4JI4F 2AKWB 1IKXB 3FEZA 1PBAA 2HHQA 3NNCA 3CF5Q 4CLPA 2IYIA 2C2KB 2XSJA 2ERRA 5T7LB 4K4XA 2VUGA 3VAMA 2OI2A 1AZSB 5GADI 5DM6Q 5E3AA 1X4FA 1RWOB 2DH8A 2ZBPA 4E0DA 2AEMA 2ZBQA 1SQFA 5D4NA 1VBYA 3MR7A 3BO3A 4CO3A 4WF9Q 3MM5A 1ROFA 3E2EA 1XJWB 1RZMA 1FTCA 2JLFA 5J2PA 1SJ1A 4R0JA 1IKYA 2QA1A 3C2PA 2B5JA 1LW2A 2QSWA 3HKWA 1WEZA 3OUYB 2XLKA 2EKYA 4ED0A 1AXQA 3OXLA 2HFSA 2R8JA 4O44A 1IQZA 3QMQA 2HQGA 1H73A 4N8NA 4OQJA 2VV5A 1RBAA 1FERA 4ZPWR 1U4BA 3IR5B 2MGZA 4AL7A 4IQXA 4Q8FA 3O1LA 1IVZA 4MJKA 1NNDA 3UD3P 3P5TL 4I4BA 1SJQA 3HT0A 2DB1A 2LFVA 2QX0A 1SUQA 2AMCB 3GIIA 1YGYA 4IQMA 4OZ3A 3VQTA 4AXIA 1IKWA 3W9IA 4TU7A 3GILA 4RJVA 4Z7YA 3T1YF 4B9NA 4X65J 3O6QA 4ALZA 4ED7A 4YHHF 2C2ZB 2KB2A 1FRKA 2FJEB 3D7SB 4B02A 3GR1A 2FVQA 2JVRA 1FRLA 2AJFE 1QUVA 2MSTA 1C1CA 5A8RA 5I42A 1XMBA 2HBQB 2PO4A 3QNWB 1F6TA 2E9RX 1M0SA 2W7AA 4EEYA 1FNOA 5LL6d 2YH1A 1ZTWA 3TQEA 1RBOB 4F04B 1SJRA 1NKBA 4URGA 2AJ1A 3PVXA 3DGPA 2Z58B 4DR7F 3PW7A 4CM2A 1JLAB 3QATA 5F8IA 4F36A 4HEA9 2JNJA 1X0FA 2IM2A 2PMWA 2HQ3A 5D0EA 1C0UA 3OW2R 1NKCA 3OD2A 4UQGA 3WC0A 2B4PA 3SCJE 3UE2A 1UETA 4ZKAA 4OZJA 3VR1A 5KFHA 2IJNA 3PKYA 4C11B 1CJTB 1FI4A 2J6TA 1VK8A 4NASA 5F8GA 4DL7A 3MPWA 3ZC4A 4IH7A 3N01A 3OXGA 2MZQA 4K4VA 3H5YA 4OYWA 1VRTA 1B0TA 5B0CA 1RAEB 2CPIA 2HRUA 1RJJA 3M30B 1KOHA 4ZPCA 3H7HB 2CQGA 2QRRA 1U24A 3PRDA 4PXEA 1EP4B 3JYTB 4ANEA 4ERDA 1GXLA 3RAQA 3ILIA 4Y3CA 2C2MB 2WCXA 2ZKTA 3MFIA 2CAJA 4PEOA 2XMMA 4A8FA 3DLKA 1X5SA 2QFIA 1A9NB 2H48B 2G9OA 1J5OB 4LSLA 2C3MA 3RU0A 1LWXA 4OI0A 3VCDA 4ITSA 4Z37A 1YRTA 2L9NA 1RB0A 1T9XA 2IAJB 4CH7A 5LSOA 3NWGA 3BKFA 4NEYA 2I8EA 1FVQA 2ADBA 2R8GA 2Z30B 2DJWA 3F56A 1XMOJ 4QBUA 1VQNS 2QFJA 2DGQA 5KFKA 2P9CA 1NJXA 2ZM6J 1TQLA 4C0OC 2QN6B 1B0VA 1ZOTA 2GNKA 4XPEA 3OL7A 5C5JA 3C19A 3D28A 4KT0C 3BYRA 4M5JA 3LP0A 1U7LA 4CO5A 4DR1J 2ZH7A 3TJAA 2C2OB 4UT4A 3HMJG 3OFEA 3ET6B 1JJ2R 2QV6A 1R6VA 5LMNJ 3LW5C 3BH6B 4YB7A 4JI6J 2J9CA 2JEFA 3G82A 5CD4A 4JI3J 3DDNA 5CCMA 1R89A 5HVGA 3KLIA 3G6ES 2RE1A 1NJWA 3B82A 4Q45A 3CDEA 2W2NP 4B17A 4RW6A 5D0RA 3TVKA 2GVDA 4ZVFA 3CCWA 2RNEA 5KT4A 2VQFJ 1K0TA
chains in the Genus database with same CATH topology
3AQOA 1HPZB 2VG5B 5DQIA 1SH2A 3HZEA 3BO2A 1LW0B 5HP1A 5KFPA 2CQ1A 2FHJD 4FP9A 5ADZA 1YITS 3MEDA 2LQBA 2P5VA 2PIIA 3TRGA 5C24B 2W7PA 1HNIB 1HQEA 4CI0B 4I2QB 1QAXA 1WHXA 3S7RA 3MR3A 4DL2A 1Q78A 1IKWB 4J9NA 1QSYA 3GG1A 4I7FB 3ZZUA 4KTQA 3DYAB 1OS5A 4Y34A 1HARA 2FHOB 4Q43A 1WHYA 3GV8B 1QJHA 1NK9A 5E0OA 3U02A 1HWLA 4IUFA 2J9EA 1C4CA 4NLOA 4Q2LA 1M1KT 2GQCA 2J7KA 4ZPBA 2UUCF 4Q0BB 4NLYA 3MOZA 1SV5B 2CJQA 2OPRB 3H98A 5I3UA 1U26A 2L9DA 4O4GB 5KT5A 2OTLS 4RW8A 2UP1A 2OPQB 2XHWA 3V6DA 1M5SA 1Z2ZA 3O8WA 3C6UA 4R5PB 2IM0A 3D1HA 3PDNA 1RT4A 4KIAA 4Y65A 3IBWA 3U1MA 4BC7A 1HQUA 3M32A 2J7WA 1JLGA 3V2UC 3PZPA 2HGNA 1FEHA 1YJUA 4ES3A 3R1HA 3OHBA 4WTYA 1YJWS 5HROB 1XC9A 4A48A 5DG9A 4RW7B 5IZHA 2R2UA 3ZZRA 4NYOA 1XR6A 4LQ3A 3MMBA 3MHYA 3WBZA 3CD6S 4M94A 3N6NA 4DUZF 2KXHA 2I1RA 2XWXA 2HNYB 2ZHBA 4HYKA 1NU4A 2QA4G 2ACYA 2MQOA 5I42B 3SDEA 5F8HA 3N5FA 3Q0AA 1JNRB 3KLVA 3GB0A 3C3LA 1HHSA 2ZD1B 4QR0A 5A8KB 2VPZB 4GKKF 4K2XA 2CPEA 2D1CA 2K3IA 2JFDA 4XDCA 3THTA 5LJ3Y 3MR6A 2RDJA 1VC5A 2E5IA 1S1TB 1UEVA 2Z2LA 1MW7A 1R27B 1QM9A 5HMYA 5L1LA 2DHXA 1SL1A 5DRKA 3T6BA 4ZK7M 1C0TA 1FKOA 2Q6CA 4DLEA 2FLNA 2Q66A 3KOAA 4O23A 3CJ0A 5KFVA 5B7WA 3SV3A 3JSMB 3AH6A 3KTQA 4F26A 4XAKA 1MMNA 4DN0A 1F2GA 4DUYF 4U67Q 4A8OA 3JB9k 4O3NA 4I56A 2WSFC 1N5QA 2C3PA 2E29A 2E5HA 4L3NA 1OSDA 1TAQA 3ISNC 4PUOA 4WFXA 4PG8A 3GE9A 3TOQA 2P9GA 4FZVA 2CQIA 2DNHA 2RH3A 3PACA 2BE2A 1FESA 1JNZB 3BGFA 4DLGA 1TR0A 4I64A 2ZH5A 4MMOA 4RUHA 2KM8B 2CIMA 1JJHA 3CCMS 3H25A 1GX6A 2XNQA 2F4VF 4YOEA 1I6JA 3O5TB 1XMOF 3MXHP 1IJFB 2R2SA 4NLXA 2IC3B 3VAKA 4BC9A 2DNLA 3J7Z5 3QWPA 4DV1F 5CA5A 2DNMA 5KT7A 4ELTA 1R43A 4B9TA 4CIOA 5D3GA 5B0BA 1ZAVA 3JSYA 1BD6A 1K9MT 4RWWA 5IWAF 2MPUA 1S76D 3CC2S 1V3ZA 3JSBA 1NHUA 5FDLA 3EX7B 3VAHA 1KFSA 3OVSA 1DQ8A 4OIXA 5HO4A 2MJUA 1VQOS 3P49B 5EWFA 4Y2CA 3CUNA 3RAMA 2J9DA 3KK1B 4TQRA 4M5DA