1SV5B

Crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1sv5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sv5B03
4K4SA 2WONA 1GX5A 1FK9A 5DQHA 3MR6A 5KG7A 1TKTA 5KFKA 1TV6A 3OHAA 4F4XA 1XR6A 1LW0A 3Q8RB 1LWFB 2ZD1A 4MKAA 3FQKA 1N56A 3DYAB 5DQIA 4Q0BA 4GC6A 4QW8A 3UPFA 1RT5B 3KK2A 3KHHA 3RAQA 2YKNB 3DLEB 2YNGA 1FKPB 3DRSB 1U09A 3KK3A 1EETB 4NLTA 1IM4A 3LAMA 2ZKUA 4NLPA 3QZ7A 3LAKA 4F4ZA 3PW5A 4WXOA 1S1UA 4WE1B 4ZPBA 2AGQA 5C42A 3KLFB 1I6JA 1RA7A 3CJ0A 5T14A 2D7SA 4DG1A 1JLCA 3V6DB 4Q45A 2BQ3A 5KFDA 1S6QB 3BQ2A 4IH7A 2OH2A 2R8JA 1C1CB 1RT2B 4R8UB 1QE1B 1KLMA 2WK4A 1HQEB 1TL1B 3JSMB 5DLGA 1JLEB 2RKIA 3M8QB 2AX1A 2ILYA 2BE2B 3D28A 3T1AA 4Y3CA 4RNNA 2UUTA 1S9GA 5EWEA 3EPIA 4ECWA 4IG0A 1C0UB 3CDWA 4RNFA 4TYAA 1C1BB 3UDLA 3V6KA 1K1SA 3DRPB 2JLEA 1MU2B 4EBCA 4M94A 3G6VA 3DOKB 4ZVHA 4IH5A 3TQ1A 3OSNA 1S0OA 2IJNA 4RW8A 2E9RX 2BR0A 1S1XB 1S4FA 4RZRA 3DLKA 4K4VA 3I0RA 5J2PB 1ZTWA 1GX6A 3OLBA 2C2EA 4G3IA 4RUCA 2JEIA 2RDJA 1HNIA 3DRRA 2UVVA 3I5AA 5F9NA 4PUOB 3MTKA 4K4ZA 2OPSB 4R0EA 2W9CA 3HVAA 2JEGA 3EZUA 1JLQB 2FJWA 3PW4A 5JXSA 3C6TB 2FVSA 1IKYA 5KG0A 4YQWA 2WHOA 2V4RA 1DTQA 4O44B 5KFGA 5DLFA 1RTIB 3MF5A 4H4MB 2FJXA 4HKQA 1RT4B 4IDKB 3PW2A 1EP4B 5KFRA 1REVA 3PZPA 5J1EB 3V4IA 1IKVB 1MMLA 1K1QA 3KLVA 3DDKA 4EBEA 3M9NB 2C22A 3QLHA 5D3GA 3BSCA 3NAIA 2WONB 4LSLA 1T05A 4ZHRA 3DMJA 4KE5A 3OL6A 3I0SA 2GC8A 4O3OA 1TV6B 3ISND 1JLFA 4JV0A 3HVWA 3KMSA 1LW0B 3V6JA 1LWCB 3CJ5A 4Y2AA 4Q8EA 2IC3B 2BANA 1JIHA 2HWIA 2ZD1B 1BQNA 3KJVB 4I2QA 4URQU 4Q0BB 3OHBA 3H5YA 1RYRA 1RT7A 3KK2B 4DL2A 5CYMB 4NLUA 4KFBA 4MKBA 2YNGB 3OL7A 3IN5A 4QWDA 3HKWA 2VG6B 4RW9A 1C0TA 3KK3B 5KT5A 1HNVB 4ED6A 3ITHB 4F50A 4NZ0A 4U7CA 1RT1B 4RNMA 2W9AA 5F8NA 5KG3A 1J5OA 2IAJA 3QGGA 4K50A 3MEGA 3BJYA 1S1UB 1TKXB 1N6QA 2R8HA 4DL5A 4NLGA 4G1QA 1IKWB 1BQMA 2AX0A 5KFZA 5KT7A 3EPGA 5C42B 3PJXA 3T5JA 1NHUA 4DG1B 2CKWA 2I5JA 4QWEA 1JLCB 1S9EA 3MR3A 1YVFA 4KAIA 4IOBA 1KLMB 3GIMA 2IBKA 1SH3A 1RTJA 3Q8SB 1HQUB 2HNDA 1KHVA 3DM2A 1TVRB 5HROA 2HAIA 5KG1A 4ED3A 1S9GB 2JEFA 2UVUA 4KB7A 4ICLA 5F8JA 4IG0B 3MEDB 5DG8A 3QGIA 4IFVA 4DL3A 5C24A 1DTTA 2FLLA 3UQSA 2V0NA 5DG9A 1N48A 4RW8B 1LWEA 4ED8A 1S97A 3DLKB 2WCXA 3I0RB 4WYWA 1NNDA 2B43A 1HNIB 4YR2A 4JUZA 4RUAA 2IM1A 1JX4A 1S1WB 3BGRA 2R2SA 3D5MA 2W9CB 4TLRA 3H98A 3MFIA 2R2TA 2OPRA 1S1TA 4J9LA 4ZVEA 2IM0A 2XI2A 4ECZA 4PQUA 2BQUA 2VG7A 1REVB 2HNYA 3H5SA 2R2RA 4MK7A 4MH8A 2W9BA 4RU9A 1N5YA 3UR0A 3QLHB 5HBMB 5D3GB 3IGNA 4ZP6A 4LSLB 2YNIA 1T05B 4ID5A 5I3UA 3DMJB 2XWYA 3N6LA 4Y34A 2VG5A 3I0SB 4M95A 4EO6A 4DL6A 4RW4A 3NBPA 3QIPA 2BRKA 1JLFB 5KT3A 1FKOA 3KLGA 4O3NA 4MFBB 2BANB 2ASLA 2IA6A 1JKHA 3TVKA 5KFOA 3PHEA 4JV2A 4I2QB 1S49A 4ECSA 4R5PA 4K4UA 5KFNA 4LSNA 4NLOA 2EC0A 4KFBB 5HLFA 3IRXA 4U6PA 1SV5A 3HHKA 1C0TB 4EEYA 4WXWA 3KLIA 4NCGA 3FDSA 1J5OB 2IAJB 3MEGB 1N6QB 4ZPAA 1BQMB 5L1JA 4J9KA 1CSJA 3IS9A 5L1IA 2YNFB 1C2PA 2D3ZA 1QAIA 4TQRA 2OPQB 2I5JB 1RAJA 4MK9A 5KFHA 2R8IA 2RF2A 4KV8A 3I5BA 4URSA 3QO9B 3LP0A 3LP2A 1T03B 3T5HA 5KG2A 3BSAA 1S1VA 1RTJB 3JYTA 1RT3A 2HNDB 4XPEA 4IRDA 3DM2B 3SFGA 4K4TA 2R8KA 4QWBA 2FLPA 1JXLA 3DOLA 3DI6A 5KG5A 5C24B 4IG3A 2YKMA 2IJFA 4TQSA 1LW2A 1Z4UA 4IRKA 1TKZA 4RW7A 1LWEB 2WTFA 2B5JA 3RBEA 4FBUA 5J2MA 2WOMA 3V81A 2QV6A 3KMQA 3H40A 2BRLA 5KG6A 4KO0A 5K14A 5C5JA 1R0AB 4RNOA 4QWAA 1JLBB 4ZP8A 1SUQA 2AQ4A 3V6HA 5KFWA 4WFYA 2JC0A 4RW6A 3BGRB 1FK9B 3LP1A 5HP1A 1JLAA 3QIDA 1TKTB 5KFMA 5FDLA 4Q44A 3NL0A 5KFFA 2B6AA 2OPRB 5EUHA 3VQSA 2DPJA 2VG7B 3PVXA 2HNYB 3FFIA 2JEJA 4KKOA 3FSIA 4NLYA 2W9BB 1T3NA 2J6SA 1T94A 3KHGA 3LANA 4F4WA 2E9TA 1TL3A 4O4RA 4QWCA 4O3SA 2OPPA 2ZE2A 1LWFA 5CYQA 3M8PA 1ZTTA 3CJ3A 3HVTA 3BQ1A 2YNIB 2DPIA 4ID5B 5I3UB 3RB4A 5L1KA 2VG5B 1QAJA 2HMIA 2YNHA 4RW4B 3QIPB 1HYSA 3G86A 5KFXA 4YR3A 2YKNA 2V4QA 4X2BA 3KLGB 1FKPA 3DRSA 3H4BA 2FVPA 3BSOA 1SH0A 3OSPA 3E51A 3OLAA 1JKHB 5KFVA 4PWDA 2IM2A 2XCPA 4J9NA 4IFYA 4R5PB 4MIAA 5J2QA 1RDRA 4ZPDA 3KLFA 4WZMA 3MECA 4IR9A 1SV5B 1HARA 3V6DA 5L1LA 5KFEA 2R8GA 2RKIB 3BR9A 1RT2A 3Q8QB 4KBIA 5EDWA 1VRUA 3IS9B 2QE5A 3KK1A 2D3UA 4IRCA 3QZ8A 4O4GA 4J9RA 5I42A 1C0UA 1RA6A 4KV8B 5KT4A 4TN2A 2XGQA 4NLRA 2W7OA 1C1BA 3KHLA 4FBTA 3LP2B 3KLEA 4JV1A 1S1VB 3DRRB 3JYTB 1RT3B 4J9QA 1IKXA 5KFYA 4DEZA 4ZVGA 3FQLA 2UVWA 3DOLB 2WRMA 3DI6B 3FRZA 4J9OA 2FLNA 1SH2A 4ECRA 4H54A 1IKYB 4ZVFA 3RB6A 1VRTA 1LW2B 4NRUA 4K4YA 1TKZB 5DG7A 1DLOA 1S10A 1DTQB 1RTHA 5F9LA 2XGPA 3BQ0A 2UVRA 4WZQA 5J2MB 2WOMB 3GIKA 3V81B 3H2LA 2C2DA 4RNHA 3V4IB 3T19A 2ASDA 5C25A 4NLVA 3RBDA 3BSNA 1SUQB 2IM3A 1EP4A 5KFTA 4DL4A 1RT6A 1S6PA 2W8LA 1S48A 4RW6B 4EYIB 2IMWP 3LP1B 4ZHRB 5HP1B 2VA2A 1XR5A 5FDLB 2J6UA 3QGHA 2B6AB 4FS2A 4NLXA 3PW7A 1WNEA 2WB4A 3TAMA 3KHRA 3ISNC 3FFIB 2W8KA 4Q8FA 4KKOB 5KG4A 1BQNB 3CDEA 1LWCA 4I2PA 3RAXA 1TL3B 2IC3A 3PR4A 3DLGA 2OPPB 1RT7B 2HNZA 2ZE2B 2ALZA 5CYQB 3M8PB 3HVTB 5DGBA 4IKAA 3KJVA 2BQRA 3QYYA 5KFIA 3IG1A 3MFHA 4RW9B 2HMIB 2YNHB 1HYSB 3ICLA 5CYMA 3CJ2A 3G6XA 2UUWA 4IH6A 5F8MA 1TP7A 2ILZA 4WYLA 4GC7A 5KFAA 2VG6A 2F8EX 1HNVA 4G1QB 3ITHA 4O3QA 1HMVA 1HPZA 1RT1A 3E01A 2FJVA 4NLDA 5KFQA 2XCAA 4PWDB 4ECVA 2AGPA 4O3PA 1TKXA 4IFYB 1W25A 4ZP7A 1IKWA 3GV5B 2JC1A 4ED0A 1S9EB 5J2QB 2FVQA 3T5LA 3GIJA 3RB0A 5KFBA 3MECB 3BREA 5JUMA 4K4WA 5KT6A 5EWGA 4ECYA 5HROB 1NHVA 4ICLB 4HYKA 1RTDA 1VRUB 1KHWA 4IFVB 4NRTA 4ZMMA 4O3RA 1HQUA 1DTTB 1TVRA 3KK1B 3KLHA 3LALA 4O4GB 3PJWA 5I42B 3MEDA 4I7FA 3OL9A 5EWFA 4TY8A 3CWJA 3C6UA 3NMAA 3G6YA 3SI8A 3KLEB 4NLWA 3PR5B 3OL8A 4MK8A 4NLSA 4Y2CA 3MR2A 1RYSA 3CO9A 4Q43A 1IKXB 3N6NA 4B3OA 2E9ZA 3MEEA 3CVKA 4QPXA 4DL7A 3N6MA 3I5CA 4H4OA 2HWHA 4EBDA 4WFZA 1UWBA 1JLGA 4QW9A 3T5KA 2I1RA 5J2NA 1VRTB 1S1WA 1S1TB 1DLOB 1RTHB 3SFUA 4PQUB 4K4XA 3GYNA 5KFSA 4OL8A 2RDIA 4TYBA 5KFCA 1S0MA 4ED1A 5C25B 1N5YB 3NGDA 5F8GA 1RT6B 1S6PB 4WFXA 3DYAA 1RT5A 3NBPB 1D1UA 4YR0A 5HBMA 3DLEA 1FKOB 2C2RA 5KFLA 4J9MA 1EETA 3TAMB 3M9MB 1N4LA 1TQLA 5F8IA 4NYZA 3KOAA 4FS1A 3CDUA 4LQ3A 4I2PB 4J9SA 4WE1A 2ATLA 4MFBA 3DLGB 1S0NA 2HNZB 4LSNB 3IGVA 2AGOA 1QUVA 2FVCA 1ZETA 5DGAA 5HLFB 3IG1B 3IRXB 3CJ4A 3NAHA 2GIRA 4URGA 5KFJA 3GV8B 4ECUA 4ED2A 3H5XA 3KLIB 3KNAA 1S6QA 4LQ9A 4NCGB 4YMEA 3MR5A 1C1CA 1S9FA 4R8UA 1QE1A 4IQXA 4IR1A 4F4YA 1HQEA 1TL1A 1HMVB 1HPZB 3E01B 1JLEA 3M8QA 3JSMA 4KHMA 4ZPCA 2BE2A 5L9XA 5DQGA 4ZP9A 2W7PA 4ECQA 2V9WA 3GILA 4MIBA 3NKYA 2RF2B 4TY9A 4EYHB 4ECXA 2YNFA 3LP0B 3DRPA 2J6TA 2XC9A 2OPQA 1MU2A 1D0EA 5KFUA 5F8HA 2CJQA 3DOKA 2C28A 2VA3A 4KHRA 1S1XA 3QO9A 4XO0A 4TXSA 5J2PA 5KFPA 1T03A 2XI3A 2FVRA 3H5UA 3M9OB 1RTDB 5KT2A 4IG3B 2YKMB 4XPCA 2D41A 4PUOA 3KLHB 5F8LA 3RB3A 4J9PA 3GV7B 4YP3A 2OPSA 4RW7B 4I7FB 1JLQA 4NLQA 2GIQA 4TY8B 2B5JB 3C6UB 3C6TA 4ED7A 4KO0B 5K14B 2AWZA 4O44A 3GQCA 1RTIA 4H4MA 3Q8PB 3PW0A 1RT4A 4IDKA 3GIIA 4ECTA 4B3OB 3CIZA 3MEEB 5J1EA 2O5DA 1IKVA 4KSEB 3H4DA 2ASJA 1R0AA 2AU0A 1JLAB 1XR7A 1JLBA 4H4OB 4EO8A 2R2UA 3H59A 1OS5A 1UWBB 1JLGB 5J2NB
chains in the Genus database with same CATH superfamily
2HIYA 2A10A 3CMQA 4PPDA 2ZZMA 3EXYA 3K5MA 1NJXA 4Q0BA 1FDNA 1D8ZA 4UW2A 3AAWB 4DCPB 5C42A 4CIOA 4DG1A 2PMHA 1NJYA 5DLGA 3M8QB 3UFCX 1FNMA 2RQ4A 1X9WA 3DRPB 2JJ4D 3FMWA 4OI6A 1SVDA 4RW8A 3O5TB 1VQNS 1JMTA 3M6WA 1BC6A 1X4BA 3BO4A 3EZUA 2HGMA 3C6TB 1G2EA 4DR4F 1NB2A 2FJXA 1HI8A 4RWXA 3W1YC 1R8AA 4EBEA 1Y5IB 4J5OA 2VKZG 3I0SA 4FVMA 4DPWA 3GTYX 5GMKa 2WVCA 1BQNA 1RYRA 3Q2TC 2XSJB 3QAEA 4LRFA 2G0IA 3ISZA 2RS8A 2MLXA 4G1QA 3A3NB 4DQSA 1WTBA 1IR2A 2R7TA 1GNKA 3DGPA 3VV2B 2FD2A 2FLLA 1T9XA 4UOGA 4A48A 1OPZA 2OUGA 2QMXA 3L4BC 4OYPA 4DZ6A 4GMKA 4Y0FA 1G4CA 1U1RA 4XK8C 5IFMA 2IDEA 3KWMA 3TVKA 4I2QB 4NLOA 4PG8A 4F25A 3D66A 1RCXB 1TL5A 4OI2A 1WG1A 4JI7F 1OSCA 1QAIA 4DV0F 2FTRA 4DPOA 2MHEA 1WC3A 4CYUB 2R8KA 2G2ZA 2MLYA 1YBUA 1U1QA 4DHVA 3FSXA 1TK5A 5J2MA 2EBGA 3PDNA 3H40A 5K14A 2VDIA 2Q3PA 3HFZB 2OP5A 3EVOA 3KHGA 2LFVA 3PHTA 2DJWA 3KKFA 2RAQA 2RHSB 4LVNP 3FZBA 4MIAA 4BWMA 4DSFA 2GJIA 2L9NA 4WZMA 4M5JA 1HARA 4OYBA 4ZVQB 4KBIA 2MTLA 2FHOB 2D3UA 5ETSA 4C98A 1C0UA 3P6YC 4FNIA 1UCNA 3RRGA 3DRRB 4ZVGA 2Z2MA 1U1OA 1X4GA 3DOLB 2WRMA 2OO4A 4C11A 3R3TA 3GIKA 3TVZA 4UUXA 2APOA 3G8TA 1XR5A 2J6UA 5ITHA 4B3SF 3GB0A 5IT9Y 2JWNA 1TFYA 4C0BA 3VGSA 2K1RB 3CCWA 2YNHB 4PXCA 1HYSB 2HVHA 2NXCA 4GC7A 2LDIA 2CG8A 1HNVA 1RT1A 5KFQA 1HA1A 4O3PA 5B09A 4U8VA 1R6VA 3OXGA 1XTZA 4RX6A 3OT9A 2VFSA 4B02A 3MM5A 1IBLJ 5EWFA 4I67A 3CWJA 2IA0A 3PR5B 4CO5A 1WOSA 5JJBA 3UNGC 3DU6A 1WACA 4QW9A 3T5KA 2H51B 2BDPA 4OL8A 1VBYA 1S0MA 2UU9F 4FDFA 6FD1A 2V68A 3WQPA 2ATCB 1Q1KA 1RACB 4J9SA 1H2VZ 4D3GA 3CD6S 2NSCA 1S7IA 4LJMA 1HBMB 2ZH9A 1XMQF 1JLEA 4CNYA 4PG7A 2GNKA 3HJVA 2YBVA 4LREA 2HZAA 4DR5J 5KFPA 2YKMB 2AJ4A 4J9PA 4YB5A 2EKYA 4AE5A 3H7HB 3K17A 2QL7B 1M5KC 4H4OB 1RADB 2ZBIA 3EJMA 1F2GA 1CEZA 3LH2S 5EGYA 1WORA 3BS9A 1CJUB 1LWFB 3GPAA 4X84A 4ZJQA 2P9CA 4GVBB 2AF6A 3QJJA 2HLTA 1HD1A 2JDJA 3RR7A 5E2QA 4HT7A 4EZ9A 2AGQA 1FRXA 1Y5NB 2ZC3A 2A3JA 3GMGA 4CM2A 3FBFA 3CCTA 4R8UB 1QE1B 3SBMA 2WK4A 4DV6F 3H8YA 1FJCA 2UUCJ 2PMZD 3K59A 1S1XB 3VVTA 5J2PB 2YQ1A 4PUOB 1GFWB 5I3PA 1YRTA 1RTIB 4DR6F 5AT1B 2BBEA 3DDKA 2Q66A 4KE5A 3JB9k 1JLFA 2RU3A 4M5DB 2BZ2A 4Q8EA 2JNJA 1Q5YA 1SJQA 1NDCA 2MPUA 1JJ2R 2CPDA 1MMDA 3Q2SC 2YNGB 3MMBB 3CCES 2K8GA 2GAGC 3PACA 1NHUA 2VC0A 4DL0C 1CJVA 3G6ES 5EX0A 5F8JA 3CJQA 4WF9Q 5DG9A 1QUPA 3I0RB 4C8OA 2CAJA 1B99A 1GK8A 4OX8A 2IM0A 1VJQA 2H5IB 4MH8A 3OJUA 2FJBB 5SZTA 2DGOA 2IMOA 3AB4B 1TTHB 4IOCQ 4O3NA 5CH7B 1IN0A 4K4UA 1A6LA 4D3HA 1YWXA 2RRNA 3IRXA 1N0VC 2V34A 3I9V9 4I4BA 3MEGB 3TZZA 2DRDA 1T8EA 4F3MA 1XQIA 3LP0A 2AEJA 3FMBA 1W26A 2N3LA 3DM2B 4USJC 5IV4A 4QIGA 2AZ1A 2BW7A 1TKZA 1VBZA 1U02A 1U8WA 4E0DA 2V2ZA 4L3NA 4UOCA 3GYXB 2OLWA 4C8ZA 1X31C 2RQKA 3AHPA 1FK9B 3MM9A 2YTCA 2OPRB 3VQSA 3QBCA 3G71S 1OWXA 3PVXA 2MZQA 1VQ5S 3IMQJ 5L1KA 2X7IA 2ZHBA 1S79A 3DRSA 4I56A 1SH0A 3S6EA 1V3RA 2HRUA 3KLFA 3ZZTA 4AYBD 4QU6A 1HBUA 3OBIA 2CQPA 3IS9B 2ZBQA 4JI5J 1WSRA 3CDBA 3LP2B 2DIUA 1T3OA 1Q8IA 5DZ6A 3U7JA 5T7LA 1IKYB 3RB6A 1RBOB 2KVIA 2GV1A 2Q79A 3IFEA 3H2LA 4DR3F 2W8LA 4QU7A 2RRBA 4LFBJ 2BKPA 3NCRA 5FDLB 3QGHA 4X4NA 4RPFA 3GONA 4ATNA 1WKLA 4K2JA 1LWCA 3M30A 3K5PA 2AT1B 2XLIA 3TOQA 3M8PB 3CMES 3UVJA 1IJEB 3P49B 4NLDA 2GS8A 2AGPA 3QRQA 2L48A 4PG6A 3WIUA 2WBRA 3HDSA 3U1MA 2M8DB 3CD7A 4JBCA 4LF8F 4CH1A 3N79A 2CDQA 5HQ8A 1EIYB 4USUA 3SV4A 3ZNJ1 2DHGA 1JLGA 4P2XA 5J2NA 4B9MA 3ELHA 1DLOB 1QVGR 4OHZA 1T9WA 5F8GA 2QFJA 1FKOB 5IXUA 3G8QA 5KFLA 5H1SV 5L38A 2GHVC 4JI6J 4X65J 5HL7Q 2GFFA 3W7BA 3EM1A 3QMQA 3E01B 2CQCA 4DZDA 3JTNA 3NKYA 3QFWA 3T6BA 4P2SA 3DOKA 4YB1P 4TXSA 1T03A 2XI3A 1X60A 4IG3B 1MMNA 3AODA 5AXMA 3N01A 4I7FB 3T1YJ 4F4KA 4ED7A 3P45B 3HXMA 2YH1A 5EN1A 2WVFA 5J1EA 1EB0A 3W8GA 1R0AA 1JLAB 1JLBA 4UTGA 3N5FA 3NNCA 1GX5A 1VQ9S 1TAQA 4ZLNA 1LW0A 3T1HJ 3UPFA 5JVHQ 3KHHA 2GVZA 2LA4A 4YFUA 3DHWC 4X4OA 4WXOA 2HZVA 4WE1B 2CJXB 2EG1A 4HT5A 1UFKA 3SV3A 5T14A 2KXFA 3V6DB 5F41A 2RKIA 5BR8J 1OY6A 1URNA 1YRXA 1VLYA 3HVRA 3M1VB 2B4UA 1ZA2B 3AD7C 1P1TA 1DAXA 4ZCIA 1JLQB 3LGNA 2C3PA 2HKEA 1DTQA 4O44B 1AFJA 4HKQA 1RT4B 3PW2A 3PY8A 1EP4B 3HK2A 4NASA 3V4IA 2JH3A 1GMWD 3WZ0A 4WP9A 2GVDA 3UNYA 1X8DA 2Y3YA 3GG0A 3OHBA 4F4AA 5HSPA 3RU0A 1ZBTA 1UZDA 1IBCB 4AL7A 3ADAC 4TLQA 4DUYJ 3VR1A 2XS2A 3L7UA 1TAUA 2NUHA 1SH3A 2DXEA 4KB7A 1RABB 4IFVA 1AXQA 4ZVRB 4DL3A 1DTTA 2BXJA 2W4CA 4ZCMA 1AYEA 3DDIA 4ED8A 1DY3A 4EK2A 2B43A 4YR2A 2AEMA 3CJSA 3I4PA 1PILA 4J9LA 1E6VB 4PQUA 3GFZA 3MCSA 1REVB 2R2RA 2MY8A 4J90A 4F67A 3BGUA 1T05B 5I3UA 3H90A 4N56A 1VK3A 1RTZA 1BWVA 1CLFA 3OTDA 4HI2A 5ETRA 1TL7B 4S0MA 2QLJB 4EEYA 4P74A 1RBAA 4KY3A 4ZPAA 2HW3A 3PIOQ 1H72C 2UUBF 2BOAA 2CJKA 2Z30B 2LQ9A 4IYQA 3SSQA 3THTA 3VAIA 2IJFA 1PJ7A 1GXLA 4ZKAA 1ZYQA 2QYCA 5G0RA 4WFYA 2JC0A 2IRYA 2HIQA 3BV8A 3D2WA 4C8MA 4C4WA 2DVIA 1ZTTA 2CJ9A 1BMQB 1SB6A 1HBNA 3RAMA 1WC5A 1OO0B 2Y1IA 3LWLA 2VPZB 1KD1T 2W2PP 3MECA 3ZFVA 3TARA 3UW1A 4LFAJ 3BR9A 2L3MA 3C15B 4OZJA 4AL5A 3QZ8A 1CJKA 1HWJA 2UV8A 2GHPA 1Q79A 2W2NP 1YZ6A 2AJ2A 1NLKL 2O1PA 2VF3A 2B3TB 3UCUP 1F60B 3MPUB 5D78A 1TMJA 2QSFA 1T9VA 4CO3A 3D1OA 2RUGA 3PFEA 1S6PA 4EYIB 4DV7J 5KTQA 2HHUA 4X4SA 1UEUA 2W8KA 2KO1A 4M5KA 1RT7B 3ICLA 3HD1A 4NCBA 5F8MA 1GMUA 1U45A 5JVGQ 3U1NA 1BD6A 2KHCA 3F0NA 5LJ3Y 1MWYA 3CB4A 2X3DA 3KLHA 1DZ5A 2HHVA 1OY8A 4C0HA 3OL9A 4FYWB 2HS0A 2NS1B 1U2FA 1VRTB 1X5PA 1RTHB 4JB8B 5KFSA 5ETQA 4EMDA 1VR6A 1YDLA 3VALA 4YR0A 2EFPA 2POKA 5CA5A 2E1MC 1XNQJ 3RG6A 4QOTA 1OQ6A 2AGOA 5K8OA 4CLZA 4USWA 3M8QA 1VC0A 5L9XA 3FC9A 1BGXT 3DRPA 2NYIA 4PAAA 2XC9A 1VQ6S 1HLWA 3QO9A 4ID8A 3M05A 1FNXH 4ZPTR 2BABA 4DSJA 4ENOA 1NK9A 3WX4A 1O5JA 3D4JA 2X3GA 3C6TA 1I5OB 2XMAA 2HQDA 2FY8A 3MEEB 2AU0A 4RBVA 2R2UA 4MYUA 5SUHA 2YH0A 3O8WA 2VH7A 3D6HB 1Q8KA 3Q8VA 1DHMA 2XSJA 2DEJA 2UUCF 2C3MA 1YZ7A 3QAUA 1B0VA 2QRRA 1TUGB 2R7UA 4IH7A 1FCAA 4KHPF 3PO5A 3CDWA 1I3OB 1ZA1B 2R3VA 4ZVHA 2VDHA 4FYVB 4K4VA 4G3IA 3Q22A 3SZ2A 5G4DA 1FO1A 5F9NA 2OPSB 2ROEA 3F44A 2EBEA 4YQWA 2VPXB 4H4MB 3CD0A 2HLUA 3GSIA 2IFXA 5KOXA 4O3OA 2XM3A 3K8WA 2IC3B 1JIHA 1F3VA 4I2QA 4LBPA 4KIAA 5LT5A 1N5SA 3POTB 5A0YA 2EFOA 2LQ5A 2GX8A 2BKOA 1VIOA 2CJYB 1YVFA 1WHYA 4CYUA 1KHVA 4LR9A 2UVUA 3DHXA 5E3QA 1N52B 2VQEJ 3SQOP 3MMJA 4A8FA 3C14A 3KDNA 1GTHA 3UR0A 2E1PA 4DSKA 2MZSA 3QWPA 2XO6A 5E33A 1FHTA 2E5GA 4OZ3A 1VC6A 1C0TB 4U67Q 1J5OB 4J9KA 4NEZA 1RAJA 2R8IA 4M5IA 4WIIA 1WTFA 3BSAA 2F9JA 3DLLQ 4QWBA 4WK1A 3DOLA 1KDNA 5CD4A 4NEYA 2B5JA 2EKNA 2C2KB 4ZP8A 5C7PA 1RI7A 4NOHA 1T9UA 4OYWA 2MKCA 3NY0A 3QIDA 3GFHA 1V9OA 2XNRA 1Y3JA 1YG0A 2ZH4A 2CRLA 2Y8YA 4HR2A 2K1RA 2DGXA 2YNHA 2V2KA 3QIPB 1HYSA 4ANCA 1NB7A 3TA1A 4JI5F 4KGMA 1WHVA 4WIQA 3KG4A 2XLKA 1FFGB 2BM0A 4DX5A 2D3O1 1YJRA 2I38A 4IRCA 4LFBF 3KHLA 2MQPA 1RHRB 2QG9B 1RT3B 2J76E 1Y5LB 4F36A 3FQLA 4N8OA 2LU1A 1CPZA 4BHQA 2C2DA 2E44A 2MZTA 4IO1A 2ZITA 1UP1A 5KFTA 1B4SA 3I96A 3PTWA 1NDLA 4AL6A 1S77D 3D1QA 3PR4A 2ZE2B 1VDHA 2OD4A 2QL5B 1GH8A 1FRLA 1HBMA 3EX7B 4PXEA 3ITHA 1I51B 3BO3A 4LF5J 3C46A 1HI1A 3RB0A 2DNMA 3OFFA 3BREA 2OGUA 1NJIT 4ICLB 1N54B 2CIMA 3OUYB 2QA2A 3VGTA 1IBKJ 4JI6F 4H4OA 1CQNA 3NOGA 4EBDA 4X65F 2ROPA 3PFOA 1X4AA 2XMUA 2PSZA 4DUZJ 2VBWA 2H1YA 4NPOA 1VQMS 2V67A 4C8NA 5F8IA 4B08A 1BLUA 3JQKA 2QYGA 3OFEA 4FN5A 4ED2A 3KNAA 2YKQA 4KGVB 3T1YF 3QGPA 4ZPVR 4R8UA 1QE1A 1RWXB 3OTOJ 4ECQA 1VHIA 2HURA 4TY9A 2YNFA 2OPQA 1UVNA 3VCDA 2XTJP 2OMOA 1S1XA 5J2PA 3OV7A 2FVRA 3T1HF 4PUOA 1VQYA 2DR7A 3TZYA 4FF1A 3K5NA 2AWZA 1RTIA 2RH3A 1FJ7A 3ONQA 4WTOB 1K1SA 1P8GA 2IYIA 4C97A 4NA2A 2ZH2A 3AD9C 3ZO7A 4M5DA 1RE1B 4I69A 5BR8F 2MSTA 1N56A 4I0WA 2YNGA 4J7CA 3MMBA 4UY8T 4AD6A 4B9UA 1KWMA 1IM4A 3QZ7A 1DURA 4MMOA 4YOEA 1OQ3A 2HQFA 5LSRA 2OTJS 2HS4A 2OEMA 2Z4PA 3UR3C 5IM0A 3BM7A 1RAFB 3K2YA 1MU2B 1S72S 4IQMA 2BR0A 2MJUA 1KS2A 3I0RA 4HH0A 3ZTSA 1KP6A 4KYZA 3C8YA 2V4RA 3B4MA 3CCUS 5K8MA 1P9YA 3HPOA 2E1RA 2CWXA 4BC9A 4DUYF 4ES1A 3HVWA 2KG0A 3DNCA 1UPMB 2O3DA 2WVDA 2XY5A 2PGCA 2MGZB 2C1EB 2AYMA 4NLUA 4QWDA 3UN2A 5BYRA 3MEGA 4TU7A 3EPGA 1FXRA 2OFGX 2DK2A 3FGVA 2DO0A 2D69A 1FXLA 2IJRA 1KLMB 1KN6A 3Q8SB 3DM2A 3J81j 2V8HA 1RWUA 3TX0A 1KSPA 1ICEB 3WDOA 1HNIB 2DHHA 1JX4A 1S1WB 4TLRA 2OPRA 1HNXJ 4NMXA 2BQUA 4CCHA 3ZZOA 1N5YA 1HQ2A 3A1YG 3CPWR 1S0VA 3D6TB 2Z2ZA 4QZVB 2MKIA 1F5BA 4KQZA 5A6PA 2PIIA 1YK9A 1A0OB 3R2DJ 1N6QB 1RGVA 3EDRB 3FK4A 3TUIC 1ITPA 3J7AN 3IS9A 3D67A 2B8PA 3TVYA 3W9IA 2QJ3A 4LF4F 2PI5A 3LP2A 4KTQA 2AYBA 1RTJB 4RKUC 2YPYA 2FLPA 5FLXU 1HHSA 4IRKA 3BDPA 5F0WA 2AYGA 5L9NA 4FXVA 1N36J 5FDLA 4USKA 4IUFA 2GO9A 3CO0P 5HJXA 2JEJA 4LFAF 1T94A 3BO2A 3RYLA 3M8PA 2MZ1A 2V4QA 2NQPA 4RW4B 1CJTB 4FKXA 2KM8C 4LIRA 1UFLA 2OAUA 2HHPA 2WW8A 1SBRA 1VYAA 1RT2A 4B9SA 3HF5A 4QYZK 4ZVOB 1UEVA 3HSJA 1VRQC 5FD1A 1X5OA 3FNNA 1LW2B 1DLOA 3HHLC 2LU2A 3X1LB 3MGJA 1UFWA 1U6ZA 3OXLA 1SUQB 4RW6B 4P73A 3OTCA 2B6AB 1X5SA 5CHCB 3PX4A 3UE2A 2WB4A 1R6YA 4JYAJ 1B7YB 3RW7A 5KFIA 4DQPA 3MFHA 4N47A 3G6XA 4IH6A 2ILZA 3PV8A 3GFXA 1PAEX 3E01A 3SCKE 1N34J 1ACMB 1U25A 4IFYB 2VBZA 2YWGA 3C66A 4WP8A 3R5DA 4WCEQ 1HW9A 1IQTA 2KH9A 4O0NA 2XSFA 2VC1A 1LFWA 4I7FA 4JI8J 1H2UX 3AD8C 1FI4A 1XNQF 2EK1A 4B9LA 2IDLA 2WSCC 4JI1J 3W5ZA 1FNOA 1AROP 4LVOP 3GYNA 4J9UE 4TYBA 1ELOA 2YX4A 3BBCA 2KVQE 3HM9A 2YWKA 3SCLE 4O23A 3T6JA 5E3AA 2ZZTA 3TZXA 4EUVA 3CDUA 3MAHA 2EFNA 4WE1A 2VPWB 4BLGA 1ZETA 2Z58B 4FPIA 1MWQA 3CGIA 1NH7A 2YKOA 4TVAB 3QATA 1RHMB 1YLXA 1JQGA 2E1CA 3M8SA 2J6TA 3VAHA 1QSSA 4OX7A 1S7HA 3KXDA 2I2YA 1ROFA 5KT2A 4FF3A 3GV7B 4PPZA 1JLQA 4CH0S 4Y2IA 3OR1B 5B0GA 5B0CA 4O44A 2GCFA 2V4JB 1RT4A 1RLCL 1D9FA 2CZ4A 1OPIA 1RHQB 1BXNA 4FPRA 1PC4A 1H6KX 1Q4RA 3MI7X 1XR6A 3J7YU 4GRSA 4MAKA 1XMOJ 3Q86A 1NK5A 1OIAA 1FKPB 4V19J 2RU9A 1EETB 2YXLA 5HVFA 3LAKA 3M7VA 1U6BA 1SJ3P 4V1Ak 2BV3A 2HHQA 3NGRA 1TL1B 3JSMB 4I1TA 4Y3CA 3R6GB 4OHXA 3UDLA 3MCMA 1R27B 4EBCA 3FKBA 1R89A 2KRBA 3I5AA 4PYDA 2FVSA 2N7CA 1E6VA 3GYGA 1X0PA 2HBYB 1REVA 5FLXY 5L39A 2DCLA 3BSCA 2WONB 1T05A 4JV0A 1S99A 1LEOA 1SJFA 1TL7A 3EZOA 3IN5A 2VV5A 1WC0A 4I6AA 4DU7A 5EHHA 3ET6B 1U8SA 3IAS9 2VQEF 5B08A 3DFEA 4PYAA 4LFCJ 2Z2LA 2HAIA 5DG8A 1KVIA 2L9WA 1ZH5A 1WC6A 1S6UA 4C9DA 1NNDA 1DFDA 3K5OA 4RUAA 3SSSA 4HHJA 4MT1A 2W9CB 2HHTA 2LEBA 4ZVEA 2CQHA 8AT1B 1V5VA 3MD3A 2R7VA 1ZAVA 5HBMB 5D0EA 4X4UA 1N0UA 3EXCX 1OY9A 2DRAA 2H65B 2ADCA 4AT1B 3PHEA 4OYIA 4ZCKA 3QJPA 4A8QA 4RBUA 4DXLA 3B82A 3C15A 4LMZA 2A1BA 2XY6A 3NRBA 3I5BA 2UXBJ 1XWLA 3ZZUA 3IP0A 1D3WA 4B3TJ 2N4DA 3H0PA 5A2QU 1R43A 3MUVP 1UPPA 3MXHP 2WTFA 1WD6A 2V50A 3DGVA 1TKTB 4USMA 3NL0A 5KFFA 2Y1RI 4U9RA 2HNYB 3FSIA 3LANA 4O4RA 4Z7YA 4I6WA 3UDVA 2YNIB 1Y11A 3BEGB 2CQGA 3KUEA 2JSXA 1SL1A 3LOUA 1YIJS 5LXYA 2MKKA 2B9YA 1SV5B 5E3RA 4HH1A 4CP5A 4LF2A 2XGQA 4KV8B 4TN2A 3ZZ0A 4JV1A 1WDDA 3JYTB 3MUTP 4CLPA 1FVQA 4HTJA 1VRTA 2HFOA 1RTHA 2PN6A 2N82B 4K2XA 3RBDA 3BSNA 4DPXA 1C4AA 3FSYA 3LP1B 4ZHRB 3MM6B 4LF5F 1NMEB 3PW7A 1WNEA 3AOCA 2V8VA 3CDEA 5L46A 3K5LA 4C2MA 4IKAA 2ZOMA 2B8QA 2Q1LA 4OIXA 1FDDA 1U1PA 3M8YA 2NYHA 3BH6B 2Y8WA 1IBKF 2NSBA 2VFVA 2RT3A 5D4PA 2QMWA 3L7PA 1SKWA 4DUZF 5HROB 4L72B 5D0RA 3M32B 1MSWD 5D0GA 2RS2A 1HQUA 3JAMU 2Y1LB 5I42B 3HULA 3D54A 2YX1A 2B4VA 1U1KA 4ZN3A 1IKXB 3MEEA 2I1RA 3Q8UA 4C8KA 3NXZA 4C6AA 5A6WA 1UAWA 3J7YI 2C42A 2E7VA 3OTOF 3NGDA 3ZNUA 9RUBA 3AJ1A 2EC2A 3QT8A 5DS7A 1RU1A 1HI0P 4DMZA 4NXNJ 1WC4A 3DLGB 3IGVA 4LSNB 3PX6A 3NGKA 5HLFB 4F26A 4QJVA 3BGFA 5AJ3J 1F3FA 1PBAA 1QDUB 1U0SA 2HHXA 2DXFA 4ANDA 2MZRA 2DO4A 1H74A 5B0FA 3TWZA 4DX8H 2CQIA 4UOHA 4XPCA 2OPSA 4ITSA 3C6UB 3AH6A 1X4CA 4H4MA 3Q8PB 2HG4A 1FDAA 2QT7A 5DQHA 1F5CA 5KFKA 2DR5A 2Z8QA 4F4XA 2QLWA 4LSZB 3BBBA 2R9LA 1N5QA 2DIVA 2EW9A 2KM8B 4OHWA 3LAMA 2V9KA 5KOWA 4DQQA 3UDCA 2AP6A 2D7SA 5A8KB 2IVFB 4JV5J 3JSYA 1NK0A 4CM0A 2GAHC 4RNNA 4DR2J 3KNGA 3R5GA 3GJTB 3R1LA 2E1AA 1LXJA 4M94A 2HVDA 4IH5A 2E9RX 3KG1A 3EGZA 4NXMJ 3A8EA 1H7WA 3JQMA 1FTCA 1MG7A 1SC6A 2M3DA 2HBQB 2M8HA 3GG1A 3PZPA 2LVWA 5A2QY 3RRHA 2VONA 4Q7AA 4HVZA 3SXLA 5CD4H 2Z57B 4CLKA 4G1IA 4LRCA 3CXCR 2VOOA 3KJVB 1HIYA 2DHSA 2NPFA 2OEKA 5CYMB 2H48B 3OL7A 1U1MA 4RW9A 1C0TA 4U7CA 1J5OA 2DNNA 1IKWB 5GMDA 1FERA 3PJXA 3NCQA 1S9EA 3MR3A 2N4CA 4KAIA 2ACMA 3FCHA 3BKUA 1HNXF 3ENAA 5H9FK 2QA1A 1S9GB 3UQSA 3DLKB 3SIPB 1AA1B 2IM1A 5M2RA 1XK8A 2VL1A 3ILJA 3E8OA 4KPCA 2J9DE 1FRMA 3BN7A 4HDHA 1HHQA 2IRUA 5D4NA 4DQIA 3HSGA 3KJQB 3ZTOA 3J7ZT 3QIPA 4KH1B 1M5HA 1WJ9A 2ASLA 4I6YA 4ECSA 1WF2A 1FJGJ 2MJNA 1H98A 2XMMA 2XQCA 4X64J 1CSJA 1N36F 5IS2A 3PCOB 4CRJA 2HZCA 1RT3A 4K8RA 2GJFA 3SFGA 3U02A 1FKAF 1EKRA 4HTIA 1T95A 1JXLA 4UY85 2EI5A 3HI9A 2KT2A 3LQVA 2V8PA 4FBUA 3NNHA 2IIHA 3C3LA 4K0KF 4RL1A 1ZAWA 3Q0AA 3HZEA 4OJGA 3I56S 4QWCA 2ZE2A 3FZ2A 5A76A 1IM6A 3LF0A 3W64A 3KLGB 2LDYA 1YBAA 4USVA 1H3DA 3OLAA 1X4HA 2KHDA 4M5LA 1M90T 1K8AT 1X0FA 1TELA 3VTIA 5GVQA 1ZM4A 4ZITA 1IQZA 4ANEA 2QE5A 2OI2A 5H9FJ 4EI2A 3A3PB 4FBTA 1VQ8S 3CT9A 4FYXB 3KUHA 1QD1A 4P9SA 5DG7A 2WOMB 1N32J 1RLDA 4K7QA 2HVIA 1M0SA 1N34F 1W2IA 4CT9A 1S12A 5DDPC 2DISA 5AXLA 2DCUB 1FFWB 3KHRA 1ZPVA 1BQNB 3W2WB 4IO9Q 4ILLA 1B7FA 2OPPB 3WC0A 4QIFA 1UMJA 1YKWA 2CJBA 3WBZA 1W2BR 4G1QB 3LGMA 1TKXA 1RBLA 1W25A 2M2BA 4ED0A 4JI1F 2NXNA 3EVWA 1OYEA 1EJ7L 4DSEA 2ZOFA 1PBUA 5HMYA 2R42A 2MZJA 4O4GB 1FRJA 3MEDA 2FIUA 3G6YA 2QLXA 1WF1A 3RBZA 2JVRA 1EX8A 4DR1J 3SFUA 2G1DA 3UWTA 3TUJC 2W7AA 1REGX 4Q5VA 4J9MA 4FS1A 2W24A 4XDDA 1EZZB 1YTYA 3ZZZA 4ECUA 2F1FA 2H4WB 5C2CA 2XEXA 2K2PA 4KHMA 1G6BA 4NCAA 2KXNB 3M2UA 2LKZA 2C2OB 3R7NB 4PQAA 4OI0A 1MU2A 3P4UB 4KHRA 3TUZC 2ZH1A 3M9OB 1RTDB 1XMOF 1Y9OA 2B9EA 4J91A 5K14B 2C2MB 3QNWB 4KC5A 4ECTA 2GMJA 1H73A 4KSEB 3HO1A 1QVFR 4H4KA 1UWBB 5HATA 4HHUA 1NRKA 3CIMA 1D09B 4PEOA 5CABA 2NZCA 3OHAA 4DLGA 2MGZA 2HRYA 4DI6A 2OSQA 2CPYA 1RB0A 2PA3A 1X7VA 4P2FA 4QIVA 4Q45A 2YQ0A 5AXNA 2OH2A 1PJ5A 3ETMA 1KLMA 1M1HA 1RWMB 2AX1A 4CLSA 1O8BA 4ECWA 1FXDA 1C0UB 4RNFA 3V6KA 1L3SA 2JLEA 3G6VA 3JS9A 2RDJA 1HNIA 3L09A 2UXCJ 1Q8LA 1LKZA 2JEGA 3HHLD 3NGUA 4M1KA 2DGWA 2WHOA 1HR0J 5H9EK 5KFGA 3MF5A 3TA0A 1K1QA 4OHYA 4FKYA 3M9NB 2LP4A 1NSAA 1OSDA 1U26A 2HWTA 4CLLA 4LFCF 1K0VA 4DFPA 2CDRB 2V2QA 4URQU 3H20A 4DL2A 4E98A 1HNVB 4F50A 4P71A 1RT1B 1SIZA 1N6QA 2UUAJ 3NWGA 4CTAA 3S1TA 1SXLA 1U2RA 3MTJA 4CT8A 3MDFA 4XAKA 1RTJA 3L9ZA 3MM5B 4CLTA 4G65A 2XYHB 5HANA 4M5HA 4OHVA 5DM7Q 2R2SA 4OYAA 3H98A 5DO2A 4OI3A 1S1TA 2E5JA 2XI2A 1XJWB 2RQCA 2AJQA 1UETA 4LSLB 2VASA 4ZJOA 4RW4A 3NBPA 4LR7A 2OKQA 3PEJA 3OTEA 4B3TF 5KFOA 4WWSA 3FVYA 5KFNA 4LF1A 4Y2KA 4U6PA 4NCGA 1X9MA 2PEHA 3PNIA 1BQMB 5L1JA 5U47A 1UEKA 3CC2S 2DEIA 1X9SA 1NK4A 1KR4A 3BPSP 2RUSA 4TQSA 1LW2A 2U2FA 2K3IA 1F6TA 4ZVTB 4RUBA 3KMQA 2BRLA 5KG6A 4KO0A 2MEWA 5LSLA 1SUQA 2AQ4A 1X5TA 5H9EJ 3G9CA 4RW6A 3TYTA 3DC2A 5F0UA 4C3KA 2B6AA 1M1GA 1NPPA 4DPYA 4J37A 3A4TA 4O3SA 2YKNA 1TK8A 5KFVA 2VU5A 4IFYA 4R5PB 2K3KA 4AXJA 1YBTA 3O1LA 5KFEA 2BM1A 2J9CA 1NM2A 4J9RA 4FYDA 1RWPB 2BJEA 1N8RT 2UVWA 1NUEA 4RU2A 3FRZA 3B4DA 2GQCA 2DNZA 2YKPA 4NX9A 2QZ8A 1S48A 2MKJA 4E8UA 4OLOA 5M2UA 2OJ3A 1F1BB 5GAEU 2O66A 4LR8A 3QT6A 1FD2A 4O3QA 4QBUA 3PO4A 3P3DA 2CNLB 1RCOB 1Y10A 5HJYA 6FDRA 4B3MJ 2CPJA 1APSA 1NJWA 3KK1B 2J0QD 1CVJA 1QTNB 2ZOGA 4LF7J 3MEKA 1NPRA 2CFXA 2DHXA 2WSFC 3C16B 5C25B 3C2PA 2ZH7A 3R9LA 2DR6A 2VIHA 1PCAA 2QA4G 2LA6A 3SCJE 1EETA 1TUWA 4NYZA 1RUSA 1OMSA 4MFBA 5L8RC 3IRXB 2UZAA 3LPEA 2HS3A 2FYXA 1TL1A 3JSMA 2ZWPA 4JI4J 2GO8A 3GILA 2BJ9A 2E5LF 3LP0B 2BJ3A 4DX7A 2C28A 3HJFA 2G9OA 3RBXA 5A8WB 3GLJA 2C2NA 1IJFB 2V8GA 2Y0BB 1UVLA 2E66A 3H4DA 2FGOA 3RJMB 1XR7A 5K9FA 2KYZA 2WONA 4JV5F 1UA1A 2WBMA 4LUBA 2L08A 4DR2F 2E7WA 4P6QA 1TR0A 5K5MA 1U7LA 1BUXA 3AJDA 3DRSB 2ZNYA 1U48A 4NLPA 2NUUG 4NXMF 3PW5A 2FHJA 4R0JA 1K44A 3KLFB 2VJVA 1ZM9A 4FF4A 4TU9A 3E3XA 1O51A 1NKCA 1NO8A 3I31A 2UUTA 4QR2A 3IWNC 4RBTA 2JFKA 3OSNA 2IJNA 2L9DA 3HFKA 4RZRA 3KJNB 5DDRC 4RUCA 4N8NA 5T7LB 5ETTA 4BS2A 2W9CA 4PXDA 3FEZA 3BN4A 3NMRA 4ZPWR 4UQGA 4Z37A 5KFRA 1M5VC 1IKVB 2G13A 5KAKA 4UZBA 1U1NA 2I6WA 1QSLA 1Z2LA 2DNGA 1LWCB 1IWGA 3BYPA 2J9EA 3IBFB 3EGNA 2FZCB 2LQJA 3UVJB 3H25A 2DNLA 4V19X 3MZIA 4A4JA 4QWEA 2J9DA 1E6YB 2DY1A 2B4PA 2HQIA 4UZCA 3QGIA 2VKRA 1Q78A 1XMQJ 2F7VA 1WKKA 4JUZA 1L3VA 3UD3P 3Q23A 3UD5A 1J5EJ 1FRKA 3MFIA 2QSWA 2R7SA 1RU2A 3I82A 1UJ6A 2HNYA 2HK3A 4X64F 1KBRA 3SYZA 2A6OA 2YNIA 2FC8A 2G4BA 4FZVA 4EO6A 2QN6B 3QSIA 4LBHA 1PYSB 2BJ7A 3R5BA 3CJ8A 3FEYB 5HO4A 5HAOA 2BJ1A 3VZIA 1SV5A 1O6XA 3KLIA 1FF2A 2CNKB 4OI4A 2AJ1A 2B56A 5IQQA 1C2PA 4F8RA 4MK9A 1JK9B 4KV8A 2KJVA 2R7QA 1T03B 3T5HA 1ZM3A 4N5SA 1H0HB 3JYTA 4JI2J 3PRVA 5C24B 3MM8B 2R7XA 5E0OA 2JRSA 4DN0A 1CQMA 1R0AB 1JLBB 3WC2A 1XBWA 2FPHX 3LP1A 3MM6A 2ASYA 1JJHA 2BVZA 2VG7B 3BGOP 2AD9A 1GMVA 4OZLA 2NXJA 3FJ2A 1QAJA 2G0CA 2CQDA 5GAEI 1U0HA 1RDRA 4ZPDA 3R6LB 4IR9A 2X1AA 1LXNA 2R8GA 3A13A 2RKIB 1N32F 2CQ3A 1DARA 2XULA 4JI3J 4WTYA 2BE9B 5I42A 1RA6A 2W7OA 1C1BA 1S1VB 1IKXA 4DEZA 1FE0A 2H4YB 3DI6B 3HP6A 2B4OA 4YEAA 1JNRB 1DTQB 4M5NA 1FJEB 1GXTA 3V81B 3V4IB 1B0TA 2ASDA 3Q24A 5HP1B 2XO7A 4KRWA 3KDOA 4ER8A 4K59A 1V3SA 3FFIB 3DLGA 1SQFA 2KJWA 3IA0A 2U1AA 1YSJA 4I68A 3W61A 5IC6B 5KFAA 2VG6A 1NEEA 3N28A 4OJHA 2XCAA 2ZVSA 4PWDB 4ZS6A 3EDQB 3GIJA 1Q53A 1R7IA 4EZ6A 4DR1F 4A8WA 2KZMA 4IFVB 2XHCA 1DTTB 3MOJB 1TVRA 3J7Z5 3V4MA 3W3SA 2GA7A 1SC1B 2IVYA 4NYPA 1LQ9A 3C6UA 3SI8A 3NGTA 3QWUA 4Q43A 1V5IB 1PSDA 1DJ0A 4PQUB 1R0BG 3MMCA 1S4EA 1AUDA 1VBKA 4GO5X 2DH8A 5HVHA 4DPUA 2RSQA 3BZQA 2D1CA 1XNRJ 2VHGA 2C2RA 2CPZA 5HN0A 3CTRA 3CE8A 5THWA 1S0NA 3VVUA 2FVCA 5A8KA 1QJHA 3HHDA 4IQXA 4OYOA 4DS5A 3PG9A 1HMVB 2ZBCA 1VK8A 1PO6A 2HHWA 1ZZFA 2QMUB 2KT3A 2CJQA 2I0XA 4FVCA 3TJ8A 4KJIA 2HFZA 4DUTA 4Y65A 3MCNA 2D41A 3MAAB 2C3YA 1WI8A 5LJ5Y 2YWHA 3ZTPA 2ALYB 5FIIA 4HACA 1T02A 4B3OB 5G0RB 2XY7A 2ASJA 4YDDB 4HEA9 1LK7A 3D3CJ 4DX6A 2GMHA 4MYTA 5E7OB 3FQKA 1HBNB 2QX0A 3DLEB 2F8MA 1WC1A 2F5GA 5HMZA 2AIRB 1JWWA 3UCGA 1XIQA 1VC5A 2UXCF 4W90B 4FXDA 2O67A 1NSKL 3ENWA 5M2PA 3G82B 2UP1A 1NU4A 1C1CB 1HR0F 1UW9A 2ILYA 4DV4J 1S9GA 3RW6A 2QO3A 2HHHJ 5DETA 3DLKA 3TQEA 1BQXA 1Y7PA 1KNZA 1P1LA 2VICA 1QAYA 2CNOB 1PJ6A 3SMZA 4IDKB 3LUYA 4HI1A 3KLVA 4BWJA 2WVBA 4Y6IA 1YJUA 4HLBA 2EK6A 2ZC4A 9ATCB 2KTQA 2DXDA 2ZD1B 5HQLA 2DT9A 4F0MA 3H5YA 1W7WA 2KFYA 1VQOS 5F8NA 4DL5A 4NMLA 5KFZA 3T5JA 1JLCB 1FX4A 2MSSA 2VBXA 2PEBA 2HQGA 3ULHA 3JQJA 2JEFA 1VHFA 1RAAB 1R0CB 2XWXA 4XDCA 1FFSB 2WCXA 3PM9A 1MN9A 5AE3A 1NH8A 1U4BA 3KUGA 2LMIA 2MQLA 1YRUA 3P5TL 5GADU 2BE7D 4L6V3 4XIUA 2ZH5A 4M95A 4NA3A 2CQ4A 5KT3A 4OZ2A 3KLGA 4A8KA 4M8LA 1U47A 1NKBA 4QIEA 3AT1B 3H2VE 2W1BA 4WXWA 1IBLF 2W2OP 2OFHX 2FGCA 3CJKA 2RF2A 3QO9B 5KG2A 1Q81T 2HNDB 4K4TA 3TO8A 1HWIA 3C19A 1Z4UA 2HBZB 4RW7A 2QFIA 4LF6J 2DKOB 3A12A 2WOMA 3MD1A 4OJ1A 2BMBA 4DPTA 4QWAA 3L95X 2A2CA 1WEXA 2RB7A 3EE3A 3PJ9A 5KFMA 5EUHA 3ENVA 4ZVUB 1L3TA 2YWWA 4F4WA 3W2WA 2L41A 2OPPA 2GMLA 3OVAA 2DPIA 1YJTA 3BQ1A 3RB4A 2X1FA 2R4FA 4QQBA 3PYDA 3G86A 2Y0SD 1LNQA 4MIWA 4YR3A 5I3QA 5AXKA 1Q82T 4DR5F 1JJCB 2IM2A 2XCPA 1DQAA 4WFAQ 2CQBA 3OXFA 2XMKA 5EDWA 1WG5A 3VGUA 4O4GA 4UQTA 5ETOA 2BJ8A 3EMTA 4CLFA 4H54A 4NRUA 4HHHA 3BQ0A 2UVRA 3CNQP 2IM3A 1WWHA 4DL4A 4QIWD 4B9TA 1BY9A 4OV6A 4DBQA 4DFMA 4ILRA 4B3MF 4L76A 2P8IA 2KT5A 2UXDJ 5A0YB 4GKKJ 4LF7F 2FJVA 4P7VA 4ECVA 1N5TA 4G6VB 3A8KA 4OV1A 2DNKA 5ETLA 3GV5B 2Q43A 3GU0A 5KFBA 2AEFA 4ZIWA 3TAPA 4M5GA 5EWGA 3GIRA 3MWBA 1RTDA 4L73A 4DN9A 4O3RA 2DNPA 5CZXA 4YHHJ 3MURP 3F41A 3ENQA 2YY3A 4NLSA 3K0JA 4U8YA 1UWBA 2UUBJ 4TKTA 1KEKA 4MJKA 3C14B 2G1HA 2H3EB 4LBIA 4JI4F 5IC4B 3M6XA 1R8HA 2ABYA 5C2GA 4AUKA 5HMXA 2ATLA 2RDDA 2GIRA 2GGPB 3GFYA 1U49A 3MR5A 4ELUA 1RKJA 3T9ZA 1FWPA 2KG1A 3EYZA 4PWUA 1IR1A 3OD2A 2VA3A 3H5UA 2AMCB 1NCLA 4QCLA 5F8LA 4YP3A 2EFGA 2B5JB 1ZOTA 4A8YA 1T11A 3GQCA 1IBMJ 2HRTA 1UW4A 2O5DA 4FF2A 3QSYB 4QW8A 3LWMA 3GJSB 2B7BB 1RWWB 3P96A 5LMUJ 2QC3A 2PFDA 1BE4A 1VJWA 3S8SA 2CPIA 2G2OA 1S6QB 5E3CA 4KR0B 5B0BA 1HQEB 4XTTA 4A8SA 2IYGA 2KYXA 1P9QC 3TQ1A 3GR1A 1ZTWA 1SL2A 2JEIA 3DRRA 1GAOA 3JSRA 1J27A 3OW2R 3HVAA 3I87A 1DBDA 4NZ6A 3TNVA 4CLYA 3PEHA 5GADI 1RJJA 3F73A 1RWOB 5E3PA 4RJVA 4LSLA 3OL6A 2G2YA 1B3TA 4RO0A 1R8CA 2HWIA 3CCQS 4MKBA 4C0OC 3ITHB 3J81U 4K50A 1R8PA 2OEJA 2HYIB 4PZVA 1F2HA 1BQMA 2AX0A 1T0TV 2RIJA 1J5EF 1QLNA 2AV5A 2IVMA 4OFZA 1S97A 1RSCA 3W2VB 4Y28C 1X4EA 1MLAA 2SXLA 1FX2A 3E2EA 5DDQC 1KTVA 2F65A 1UVIA 2W2MP 2HK2A 5D3GB 4ZP6A 3IGNA 2XG8A 4F04B 2JX2A 2GQ2A 4JI2F 1S49A 4R5PA 3BF4A 1WEYA 3UN3A 2XYPB 4U96A 1SKUB 3HSZA 2YNFB 2D3ZA 1F5AA 2OPQB 2FJEB 1XN9A 4TU8A 2EVZA 5F3TA 2EEYA 3T9NA 2YKMA 2VODA 5HMWA 1NK8A 2V2VA 4KHPJ 2COLA 4B9NA 1D9DA 3NS7B 1QTMA 3HSDA 3HLUA 3FCWA 2ZZNA 3AA9A 4DS4A 2RRAA 2ZHAA 2J7UA 2C3UA 4JOUA 1CJUA 4CDIA 4JI3F 1LWFA 2MKHA 1ZZNA 2VG5B 4GVBA 2FVPA 1SQGA 4J9NA 2HQCA 2HGNA 3O44A 4F3OA 2PA8D 2VFRA 3MMAB 5IM0B 4NE9C 3NCPA 3IRWP 3KK1A 1UTAA 3PX0A 1FRIA 3QJLA 4DV5J 1VQPS 4J9QA 1T7PA 2MQQA 3IAM9 3TJ9A 2FLNA 5B0AA 1SH2A 1EQ0A 3C16A 5C25A 1RP5A 4F0HA 1GMWA 3QRRA 2ZDPA 2AW0A 4KKOB 2M88A 2OMLA 2K7KA 2W4DA 3A8JA 1TL3B 2P2CB 5CYQB 3T41A 3HVTB 4WPAA 4CWBA 2HMIB 3FBEA 1SI9A 3PXGa 1VLOA 2UUWA 2V8DA 5DJBA 2DNQA 2F8EX 3TRGA 3CCZA 4ZP7A 3T5LA 1R3NA 2HEKA 3J7A1 3UDEA 4K4WA 1XEZA 2QA4S 4ZMMA 5A8WA 4N7TA 4DOZA 4HDGA 1B70B 3GSDA 1XNRF 3KLEB 1HL6A 2KDOA 5K20B 2YX7A 4B17A 4DL7A 1VIXA 3I5CA 2HWHA 2M70A 4DV1J 3LO3A 4WFZA 5MLCV 4KT0C 1SJ1A 3B8HA 1QY7A 1RAHB 1FA0A 3B78A 1FEHA 3G87A 5KFCA 4ED1A 1N5YB 1UWAA 3W60A 1RT6B 2PE8A 3RUBL 2K06A 4AXIA 2B7CB 4DCJB 3EGVA 5HI7A 2J0WA 2N3OA 5F3ZA 2QLFB 4RLEA 1NBEB 1KKHA 2MXYA 3DRXA 3GV8B 1AT1B 2F4VJ 1DQ8A 3UI3A 1T9YA 2KRRA 2EFVA 2HVEA 4DU8A 4F4YA 2W7PA 1ZAXA 5DQGA 2IRXA 3B6BA 3QT7A 2ZJQQ 2DR9A 2M4MA 3DOMB 3U1LA 2DY9A 3J81Y 3D1HA 4YDXA 2LEAA 3AOAA 3RB3A 1N5VA 2JVOA 4NLQA 4C48A 8RUCA 3GIIA 1IKVA 3RR8A 4K4SA 5IZHA 3FBCA 3S7RA 1FK9A 1QSYA 4A8OA 2H5EA 2CVEA 1EAYC 1TUVA 3H42A 1JXVA 2E7XA 2AHOB 2AJ0A 4DV4F 2MQNA 3I9ZA 3M8RA 2HHHF 3M2RB 3MUMP 4OZ1A 3GP9A 1GTEA 3ZZPA 1E6YA 2ZFHA 1RT2B 3K89A 3R7SB 3T1AA 2CNNB 4TYAA 2V6AA 1SC4B 3BB5A 1CC7A 3GCXP 3ZC4A 5IT4A 1VQ7S 3I6PA 1CULB 2P9EA 2ACYA 3MTKA 3S01A 4R0EA 3Q89A 3V5RA 1IKYA 5KG0A 1RHUB 2DNRA 2CYYA 4L75A 4ELVA 4B9VA 2BEFA 3TANA 3KK2B 2Q6BA 3KK3B 5KT5A 4ED6A 3GJQB 4NLGA 2W25A 3I55S 5IQ6A 1WELA 3GIMA 1TL4A 2VBYA 1NDPA 2ZH8A 5C24A 3MM8A 2DR8A 4DV7F 1RHJB 4P72A 3HT0A 1YQHA 3DCAA 3NGSA 3D6FB 4OX6A 2VG7A 3H5SA 3CCRS 4I64A 3IXQA 3QLHB 3DMJB 4Y34A 1FKOA 1M5SA 4P10A 4F7VA 2ZEJA 2BANB 1NPKA 3HX9A 2D9PA 4KGZB 2AYEA 4LF6F 2XLJA 4LRDA 3J80U 2PC6A 4OZ0A 5ETPA 2PT0A 2I5JB 3W5YA 4URSA 1S1VA 3BYRA 4IOAQ 3OTBA 3DI6A 4IG3A 3UD4P 1LWEB 3LA0A 3V81A 3VGVA 2CJAA 5C5JA 4EFAC 4RNOA 1WOPA 5KFWA 3BGRB 3BR8A 5HP1A 1JLAA 4N76A 2HFVA 2KI2A 3CCVS 3FEXB 3FBBA 2AZ3A 3FFIA 2KL8A 2YVSA 4BC7A 5D77A 5B7WA 4C8YA 4ID5B 4X4RA 5A8RB 4X2BA 4O0IA 3H4BA 5LSOA 1JKHB 3MPYA 4PWDA 2DH7A 2LCWA 3W5XA 3V6DA 5ETNA 4USTA 1NSPA 4OJ3A 1PC5A 1WF0A 3VQTA 1VQKS 1ZS6A 3H2UB 4QYZJ 1K73T 1QAXA 3PKMA 1VOMA 3M1VA 3X3UA 2YWEA 2V5HG 2AKWB 2NCKL 4ZVFA 1T9TA 1S10A 2XGPA 5K8NA 4RNHA 2UXDF 4GKKF 1HNWJ 1JNZB 1EP4A 3SDEB 2VQFJ 3NEKA 2DITA 4JP8A 3ISNC 4R25A 4P75A 3BKTA 2ALZA 2GZOA 1RAOA 4YHHF 2DNHA 1Q5VA 1HMVA 1EARA 3R5JB 4EGLA 4N41A 2QTWA 3W9HA 3CJRA 2JC1A 5DZ7A 1ZM2A 5JUMA 3SCIE 1NHVA 4HYKA 4NZ7A 3MAAA 3LALA 3KTQA 3PJWA 1Z1ZA 3CCSS 3NMAA 2MHNA 4MK8A 1PGZA 1N33J 3CO9A 4B3OA 1P27B 1X4DA 2YPZA 4LF4J 3CF5Q 2ZBPA 3I32A 4X4VA 1IWAA 2RDIA 2H54B 2RD5C 1HBOB 4YN3B 2W2QP 4DF8A 3DLEA 4LRAA 1R8BA 3TAMB 1FESA 3KOAA 1KQKA 4LQ3A 2RILA 3TJAA 4A8XA 2HNZB 3AQOA 3UO0A 2E5IA 4OLPA 3IG1B 4WP3A 4URGA 1HWLA 1D8YA 3G82A 4CNZA 4YMEA 1C1CA 4IR1A 2NLWA 1JB0C 2EXUA 1IBMF 5LM7E 3O6QA 2F8HA 4MIBA 2VOPA 5KFUA 1D0EA 1V3ZA 5HQMA 2HQ3A 3L7OA 5J1NA 3CMAS 1PAUB 4TY8B 2F63A 1XERA 1L5UA 2J5AA 1UJ5A 4X66J 2OTLS 3P5BP 4IDKA 2PMWA 3IWXA 1CS4B 3D0HE 5LMUF 4H4KC 3MR6A 1PYOB 4ES3A 3TUPA 2CUYA 2ZD1A 4DSIA 5DRKA 2A6MA 1SCJB 4DSLA 3DYAB 5AE1A 1RT5B 3CW2C 2ZM6J 3MAQA 4CH7A 2PI4A 4ZPBA 2EPIA 4HL9A 3SSRA 2BUNA 1JLCA 5KFDA 4CZCA 1AFIA 2LQBA 1NK6A 3GJRB 2HSEB 2BE2B 3EVMA 2ZH3A 2WW4A 1B64A 3J80Y 2C2EA 3N9UC 3RRKA 5J1PA 4K4ZA 3CEDA 4U7UD 2JL9A 4X4TA 3ZZRA 2MY7A 1EKSA 1SIWB 1TV6B 2XHWA 3OFHA 3V6JA 3VAFA 4RWWA 4DR7J 4FNHA 1RT7A 2X51A 4RNMA 4AFFA 3BJYA 1S1UB 5KT7A 1YJ7A 1KTQA 3IWLA 3W66A 4RR5A 1RWVB 2BA9A 4GO7X 5MAOA 1HQUB 2HNDA 4ZN1A 4YB7A 4ED3A 3WX8A 4IG0B 4G1PA 1S5ZA 3UCZP 1WHWA 1N48A 1F0XA 1U6FA 3GR0A 2IHR1 2RJZA 2XMJA 4F0KA 1FWLA 1SKSA 4ECZA 5HK4A 1A9NB 1G7CB 4ZOSA 2IA6A 4MTPA 5EX3A 4KFBB 4ERDA 1RAGB 1Q86T 1WEZA 2XBPA 3OR2B 1AZSB 3FDSA 2JLFA 2IAJB 2ZBRA 4TQRA 2MLZA 1Q7LB 5KFHA 1HNZJ 4QYRA 1UKUA 3BGLA 3EICA 4Z2XA 2NR0A 2V63A 4JI0J 3RBEA 5CAAA 3AOBA 4DF4A 1RKIA 3MM7B 2UV8G 4NI2B 1LOUA 5LMNJ 2DPJA 1TU0B 2JFDA 2W9BB 1T3NA 4KPYA 4PXBA 2ZUGA 4W92B 4DV5F 3NS6A 1LK5A 1FD8A 3OSPA 3LW5C 3T3FA 2J7KA 4C3LA 2LYVA 2G0JA 2ZNZA 3Q8QB 1KFDA 4OQJA 3ZTQA 1KVKA 1C4CA 3DXSX 3CULA 2OHDA 3MOZA 2CWKA 1YX2A 5D0HA 3R2CJ 5ETKA 3W63A 5JMNA 4ES2A 5KFYA 4WU3A 4K4YA 3KFWX 4X4QA 2VFUA 4F2SA 4USHA 4PKDB 5GMEA 4LRBA 2IMWP 2P6TA 3NG8A 4GKJJ 4NLXA 1RISA 4ZLJA 2NREA 5BYQA 2KU7A 2MQMA 2CPXA 1F9FA 3RAXA 5K8PA 2XYGB 2IC3A 5DGBA 2BQRA 3QYYA 4DV2J 4RW9B 2GGPA 2ZWOA 5RUBA 2CPFA 3POTA 5BXIA 3R5AA 1S9EB 5J2QB 2DGSA 4DV1F 1RAIB 2FZGB 4ECYA 1VRUB 5IWAJ 4NRTA 4C8LA 3A3OB 2KKHA 1S6OA 1KQFB 3DN9A 1Y0HA 2WSEC 3IR6B 1UZHA 3RZAA 3HHLB 2GIFA 2P9GA 3CCLS 4ZVSB 2F4VF 2MB0B 4PCQA 4ETZA 2J0SD 3DLHA 5E41A 4P52A 2J8AA 5T41A 3M9MB 1NXIA 4I2PB 1RHKB 3IBWA 3NAHA 3FRYA 1VQ4S 1S6QA 4LQ9A 2X1GA 1HQEA 2FUG9 1HPZB 3R8YA 2M9KA 3PKYA 5F8HA 4F02A 1AUSL 4XO0A 3M2VB 4B3RJ 2J7WA 1EQMA 2FHKA 1WG4A 4WK3A 1KOOA 3OJSA 1TMMA 1A7GE 3CIZA 2VD3A 1AW0A 3NS5A 4JV2A 1NZ8A 4LF9J 2Z56B 4U7UK 2OD6A 3Q8RB 4MKAA 2YKAA 5DQIA 1Y4ZB 2VUGA 1XC9A 3CSKA 3GZ7A 4Q2LA 2PDAA 4F4ZA 2ZKTA 2DYAA 1KLNA 2ZDOA 1RA7A 3SQGB 2JHEA 2CVIA 3TX8A 2BQ3A 3BQ2A 2R8JA 1VQLS 3MPWA 5ADZA 3IM8A 3D28A 4DCOB 5EWEA 5D15A 3VAGA 2CQ0A 3IC1A 1S0OA 2XMVA 2FQQB 3W2VA 1MROB 4FXWA 4WKYA 3OLBA 2JOQA 1UVJA 2KXHA 4P7TA 3GCWP 5JXSA 4BCAA 2YWFA 2EG2A 2W4PA 1NZAA 2HFUA 5E5NA 3CCMS 1MMLA 1RWKB 5D3GA 3THPA 2DD8S 2GC8A 2FJDB 3CJ5A 5BYSA 4Q0BB 4OYZA 4YB6A 1U24A 4WBFA 3SEOA 2W9AA 1GT8A 2R8HA 1TKXB 5C42B 4DG1B 2CKWA 2BW2A 3THVA 4IOBA 5KG1A 1LFPA 4ICLA 3MEDB 2MYFA 2P6SA 3G96A 4OYMA 2M5YA 4PG4A 4RW8B 1PG5B 4WYWA 3OUYA 4DV3J 3NP5A 4ZK7M 4OX9J 4JYAF 1TZ0A 3D5MA 3P8BB 3D0GE 3VHQA 3IR5B 4ED5A 3PYFA 1URRA 3BPDA 2WVEA 1PIEA 1Q7YT 4ILMA 1S59A 2Y1JA 3DLJA 2VG5A 3I0SB 1K0TA 3N4WA 2BRKA 2OELA 5LXRA 3ILIA 1M1KT 3AA8A 1V6HA 3VAKA 3AQPA 4JI8F 3MMAA 3M2UB 1UA0A 4ZJLA 2GW8A 2VFTA 4RUHA 2C2ZB 3VAMA 1HFEL 3MHYA 3G4SS 3R97A 4CQ1A 3DGPB 4M5MA 1RAEB 3VZHA 3TR5A 3V6HA 1FVSA 2V69A 1CC8A 4Q44A 3EGWB 4BBYA 2O01C 4CO1A 3CDAA 2GQQA 2QGFB 2F4FA 4KKOA 1YHQS 2E9TA 1TL3A 1L3KA 1R31A 5CYQA 3HVTA 4CO0A 2IY5B 2HMIA 2RMLA 3TZWA 4PRFA 3N0VA 3QT5A 4FYYB 1RK8A 2DBBA 2XMTA 4ZCLA 5L1LA 5B0EA 5IV3A 2V94A 3R5CA 2HVZA 3D9BA 1HNWF 1KFSA 4M63A 5B0DA 1F9EB 5CQGA 4A47A 2VQFF 4NLRA 3KLEA 4X4PA 3JTPA 3JXOA 3PYEA 4KGKA 4WZQA 2XS5A 5J2MB 3IBCB 2N7YA 1RT6A 6AT1B 4A8MP 4KH0B 4FS2A 3EWGA 2Y9HA 5HVGA 1HWKA 3OFGA 4LT6A 3LPYA 2GJ2A 4Z7CA 1YJ9S 3ETOA 2M52A 2A0FB 7FDRA 2RNEA 4WYLA 1DQ9A 5DM6Q 1N33F 3CJTA 2MMYA 3K57A 4X62J 3IR7B 3NOCA 4CTAB 4YS2A 2OIHA 2FVQA 3DOMA 5KT6A 2NPIA 2FZKB 3CC4S 2LECA 1U1LA 3M6VA 3DLBA 3MCOA 1HW8A 4NLWA 4AQYJ 2DTJA 3MR2A 3N6NA 2E9ZA 3CVKA 3AXMA 3N6MA 3QQCD 2RHQB 4C11B 1S1WA 1S1TB 4ZVPB 4K4XA 3DU5A 3EZ5A 4UOFA 1D1UA 3NBPB 1FE4A 2JLGA 3W8PA 2I8EA 4J9VA 4W4MA 4K0KJ 3M2RA 1UVMA 2KFZA 3TAQA 2F9DA 1LWXA 1D9AA 3CCJS 4NCGB 1S9FA 4X66F 2KZZA 2QL9B 2HFNA 3D3BJ 2V9WA 5GAHU 4ECXA 4U95A 5LL6d 3G8SA 2VPYB 2H9ZA 2HGLA 1CULA 3G2XA 2D3OR 1SC3B 4UT4A 2ERRA 3NNAA 1VGYA 4KO0B 3UN5A 2ZM6F 3PW0A 3BH7B 4EO8A 3H59A 1OS5A 1TK0A 4OZ5A 1S76D 4GC6A 1I94J 3KK2A 2YKNB 1WKJA 2PFFB 1U09A 3KK3A 4N77A 4YY3J 2D74B 4NLTA 2UXBF 1CJTA 3W9JA 1B0PA 1JXEA 1H38A 1I6JA 4UF4A 1KONA 1WUUA 4DDFA 2RE1A 1ULRA 2MDAA 1JLEB 2A18A 1J2VA 3EPIA 1NDKA 2XS7A 3KG0A 4L74A 3V2UC 4F3QA 1GX6A 4ZA1A 2R7WA 1RXOB 4EU0A 4DR7F 2CZVC 2FJWA 3PW4A 1IVZA 3DXBA 5DLFA 3NLCA 1TKDA 2C22A 3QLHA 2CQ1A 3NAIA 1WI6A 3DMJA 3ISND 2BANA 3HHEA 4QPTA 4ZLLA 1VCTA 4DR4J 2KB2A 3HKWA 5KG3A 4PG5A 2DNYA 3N5BA 2DGQA 4QR1A 2I5JA 2DB1A 2EFQA 1H7XA 4FP9A 3LGHA 4ED4A 1RQ0A 2IBKA 4DFKA 2K7JA 3VWSA 5IOLA 3TI0A 5D4OA 1LWEA 3BGRA 1KOHA 4GVLA 4L3KA 3RTVA 3US5A 4MK7A 4Q2MA 4ID5A 2XWYA 4DL6A 5A8RA 3WHIA 1JLFB 1HNZF 1JJ4A 4MFBB 1GQEA 3OQ2A 1VFJA 1JKHA 2FB0A 1Q8BA 1SJRA 3QPIA 4JI0F 5IT0A 1RZMA 3AJ2A 1YI2S 3TA2A 4BDPA 1YGYA 2HPUA 1KRPA 2CADA 2W01A 1HD0A 4PWWA 2VZ9A 1CJVB 5LMNF 3Q83A 2CQ2A 4NL5A 4XPEA 3I4HX 1MW7A 4DFJA 3M6UA 3ZXWA 3OR1A 3ILLA 2E5HA 4NXNF 4JI7J 2V4JA 4DV0J 3SDEA 2B51A 2VJUA 4CO2A 5CYJA 4WFNQ 5AJ3F 2J6SA 2RVJA 2ZUAA 3RGIA 3CJ3A 5KFXA 2ADBA 1FKPA 4CLUA 3BSOA 2CPHA 3IM9A 3E51A 3KJFB 3HCXA 1IXKA 2WZ1A 2Z2YB 1U2CA 4P2MA 4A46A 3O3LA 2GHWA 3AXKA 5KT4A 3D0IE 2J0XA 4GKJF 3M8ZA 3JTOA 3EUNA 3HKZD 3JSBA 2FLOA 2Z0GA 1MNEA 3HMJG 2DHAA 1TKZB 2E29A 3LTOA 4DV2F 3MR7A 3T19A 2WB1D 5FJ4A 1P6TA 1HBOA 3CUNA 1VISA 3PIPQ 2VA2A 3MM9B 3PYGA 4DWIA 2NZ4A 2ZJRQ 2FHMA 3TAMA 3ZTRA 1K47A 2M7SA 5KG4A 1K9MT 2CG4A 2HNZA 5IWAF 1HWUA 5I4MA 5D8HB 3IG1A 1MWZA 1TP7A 2NXEA 4NWBA 5GAHI 4NYOA 5AE2A 1KQGB 1PYTA 3ET6A 2HFSA 5CCLA 4B3SJ 1BWEA 3QRPA 3KYLA 2LXUA 1HBUB 2QEXS 1KHWA 1L3UA 3U27A 1FWKA 2IPOB 7AT1B 4TY8A 1I1GA 3OL8A 1S57A 4QPXA 2CZ9A 1CS4A 2KN4A 5GAGU 1YJNS 1H2TZ 4MKVA 1NSQA 1GXUA 1KQSR 1VQSA 4ETXA 4WFXA 3W65A 3DYAA 1RT5A 3PRBA 5HBMA 4PR6A 2I9SA 2HHSA 4B3RF 2LEPA 2DGTA 4DJBA 3M30B 3GE9A 1QUVA 2VB6A 2CA9A 5DGAA 1CBKA 5KFJA 3KLIB 3HFVA 2UU9J 3WIVA 5CXTA 4NA1A 3CC7S 2BX6A 4OZNA 4ZPCA 3B54A 2BE2A 2P5VA 5ETMA 5ETVA 3D6MB 4LF9F 1FT8A 1SPBP 2PD1A 2AJFE 4OI1A 2GIQA 1DRZA 1RWNB 2XZDB 1WOOA 3FUYA 1JLGB 5J2NB 1HKAA 1M5PC 5KG7A 1TKTA 1TV6A 3TEGA 1FJGF 2FC9A 2BACA 1WHXA 3RAQA 4ZDNA 1Z2ZA 2JZ5A 2ZKUA 1U0HB 2DH9A 1Q16B 3OPKA 1S1UA 4WKRA 4PABA 3TW0A 2NXUA 3CJ0A 1SQEA 1TFWA 3A8IA 3DDNA 1Y00A 2ZHOA 4QR0A 2BOPA 2MKYA 4UUWA 3BBFA 3AFGA 7FD1A 4IG0A 1C1BB 3GWCA 3DOKB 3D68A 1XMBA 2LXFA 1S4FA 2B9XA 2B9WA 3M8WA 2UVVA 2FJAB 3IO1A 5LOQA 1CG2A 2Q6CA 2ROGA 5J1EB 2QIFA 1N88A 4DV6J 4OMFG 3R1HA 1PKUA 2XZTB 4ZHRA 2EWHA 1O0PA 3KMSA 1LW0B 4Y2AA 2C3OA 4ZLPA 1OYDA 2F3JA 3MPVA 2GVZB 3K7RA 3CD5A 4KFBA 4DR6J 2VG6B 3FCVA 4NZ0A 3OR2A 1AZSA 2IAJA 3QGGA 1NHKL 1VS3A 4DV3F 4OX9F 1F9HA 3DKDA 2XB2D 4K5SA 3K8VA 5HROA 1TVRB 1UL3A 2LXIA 1WDTA 5DDOC 3M32A 3Q8YA 2V0NA 1SKRA 1FTRA 1MN7A 3W62A 4CLWA 1M5OC 2E5LJ 4WFBQ 3MM7A 4NI2A 2R2TA 3MMCB 3VF0B 2W9BA 4RU9A 3DRYA 4K5RA 2WAQD 3N6LA 1LV5A 2PO4A 3QFHA 2HBRB 2GVDB 3HD2A 4LIWA 5BJRA 4LSNA 2EC0A 1Q0NA 5HLFA 2MKSA 3HHKA 1NAQA 3M4XA 2BKNA 1VBXA 3D7SB 1G3OA 4WJBA 5L1IA 2KFNA 3AB2B 2ZVIA 4C7QA 2R7RA 2BJDA 3K58A 4IRDA 4DLEA 5KG5A 3ZZYA 1UJ4A 4HACB 4Y00A 2FY1A 1FRHA 2QV6A 1FDBA 1KVJA 1AB8A 3MPDA 4YUDA 2D9OA 2CXEA 1SL0A 2YQ3A 1EHWA 2QLBB 1WSVA 5D6GA 3HHNB 4NLYA 4CO4A 1QM9A 5I3UB 2CPEA 4E2FB 3PRDA 1SJ4P 3HT3A 2MQ8A 2FHJD 3TEHB 1IR0A 5J2QA 1NJZA 1VRUA 3AY0A 2HAFA 4KGXB 3R27A 3O2IA 3VAJA 2ZH6A 3R7BB 1HHTP 1YJVA 4F2RA 4J9OA 3OVBA 4ECRA 3HHLA 5GAGI 5F9LA 4NLVA 1VI7A 5D4LA 4X62F 1FEEA 4Q8FA 2RQMA 5CZVA 4I2PA 2DNOA 2FDNA 3KJVA 1Y3KA 4ALZA 5CYMA 3CJ2A 4DR3J 3TP2A 4AQYF 2J8SA 1HPZA 1VMBA 1NKEA 1KC8T 1IKWA 2BYCA 2ZJPQ 2XNQA 1YITS 3MECB 4MKYA 2DGUA 1YJWS 3M2VA 2F40A 2LLZA 2R7OA 1CJKB 1IUJA 2DGVA 2XZWA 4W98A 1NK7A 2A2DA 4CI0B 4Y2CA 1RYSA 1Q95G 2B0GA 3HZGA 3F56A 8ATCB 3JAMY 4C3MA 2X1BA 2MQOA 4TNOA 4WU2A 3BKFA 4ELTA 1S6PB 1OJ4A 3L3CA 3BDEA 4LF8J 2UUAF 3OVSA 4DQRA 1N4LA 1TQLA 1GEHA 4EWTA 1ZPWX 2DRBA 3SQGA 2LQ8A 3CJ4A 3H5XA 4USIA 1G1XA 5CCMA 4OYXA 1UVKA 4ZP9A 1BHNA 3CJKB 2RF2B 4EYHB 2OSRA 1MROA 4Y2MA 2H5JB 3KLHB 3ILOA 1X4FA 4RW7B 1I94F 4ZIVA 2M0GB 4YY3F 2XMWA 5IT9U 2IBOA 3NWRA
chains in the Genus database with same CATH topology
2WONA 4C97A 3MR6A 4NA2A 2ZH2A 2A10A 4PPDA 4JV5F 1UA1A 2ZZMA 2WBMA 4LUBA 3EXYA 4ES3A 4M5DA 3K5MA 2ZD1A 4I69A 5DRKA 5BR8F 4DSIA 2L08A 2MSTA 4DR2F 1NJXA 1N56A 3DYAB 4DSLA 4Q0BA 2E7WA 5AE1A 4P6QA 1FDNA 1RT5B 1TR0A 5K5MA 1U7LA 4I0WA 1D8ZA 2YNGA 3MMBA 3DRSB 4UY8T 2ZNYA 4B9UA 3MAQA 4CH7A 1U48A 1IM4A 2PI4A 4NLPA 2NUUG 1DURA 3QZ7A 4UW2A 4NXMF 4MMOA 4YOEA 1OQ3A 3PW5A 3AAWB 5LSRA 4ZPBA 2OTJS 2HS4A 2FHJA 4R0JA 2EPIA 4HL9A 5C42A 3KLFB 4CIOA 4DG1A 3SSRA 2BUNA 1JLCA 2Z4PA 5KFDA 2PMHA 4CZCA 1AFIA 2LQBA 1ZM9A 1NK6A 4FF4A 1NJYA 4TU9A 3E3XA 3UR3C 1O51A 1NKCA 5DLGA 1NO8A 3M8QB 3I31A 2BE2B 3UFCX 1FNMA 2UUTA 5IM0A 4QR2A 3BM7A 2ZH3A 3IWNC 2RQ4A 3K2YA 1X9WA 4RBTA 3DRPB 1MU2B 2JJ4D 3FMWA 4OI6A 2JFKA 3OSNA 2IJNA 4RW8A 2L9DA 4IQMA 3HFKA 3O5TB 2MJUA 4RZRA 2BR0A 1S72S 1JMTA 1KS2A 3I0RA 3M6WA 3J80Y 1VQNS 2C2EA 5DDRC 1BC6A 4RUCA 4HH0A 3N9UC 4N8NA 5T7LB 3RRKA 5J1PA 4K4ZA 1X4BA 3CEDA 4BS2A 2W9CA 3BO4A 3EZUA 4PXDA 2HGMA 3FEZA 3C6TB 3BN4A 3NMRA 3C8YA 1G2EA 4ZPWR 2V4RA 3B4MA 3CCUS 2JL9A 4X4TA 3ZZRA 4DR4F 2FJXA 4UQGA 5K8MA 3HPOA 1HI8A 4Z37A 2MY7A 4RWXA 5KFRA 1M5VC 1IKVB 2G13A 2E1RA 1R8AA 5KAKA 4EBEA 1Y5IB 1U1NA 4BC9A 1QSLA 4J5OA 2VKZG 1SIWB 3I0SA 4FVMA 1TV6B 1Z2LA 4DUYF 4ES1A 5GMKa 2XHWA 2DNGA 3HVWA 3OFHA 2KG0A 1LWCB 3DNCA 3V6JA 3VAFA 2O3DA 2J9EA 4RWWA 1BQNA 3EGNA 2XY5A 2PGCA 2LQJA 4FNHA 2MGZB 1RYRA 3H25A 1RT7A 3Q2TC 2AYMA 2XSJB 4NLUA 2X51A 4QWDA 3QAEA 2DNLA 4RNMA 4AFFA 4V19X 2KYZA 5BYRA 3MEGA 3BJYA 1S1UB 3ISZA 2RS8A 3MZIA 4G1QA 4A4JA 5KT7A 4TU7A 3EPGA 4QWEA 1FXRA 2J9DA 2OFGX 2DK2A 3FGVA 2DO0A 1KTQA 3IWLA 4DQSA 1E6YB 1WTBA 1FXLA 1KLMB 2BA9A 1KN6A 2B4PA 4GO7X 5MAOA 3Q8SB 1HQUB 2HNDA 2HQIA 3DM2A 4YB7A 4ED3A 2R7TA 4IG0B 1GNKA 3QGIA 2V8HA 2VKRA 1RWUA 3DGPA 4G1PA 1Q78A 2FD2A 2FLLA 3UCZP 1WHWA 2F7VA 1N48A 1F0XA 1KSPA 4A48A 1OPZA 3WDOA 1HNIB 4JUZA 1L3VA 1U6FA 2QMXA 3UD3P 3GR0A 3Q23A