4Q2LA

Atomic resolution structure of the e. coli yajr transporter yam domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
b'PPYVSSLRIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major facilitator superfamily MFS_1
molecule tags Transport protein
source organism Escherichia coli
publication title Atomic resolution structure of the E. coli YajR transporter YAM domain
pubmed doi rcsb
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q2lA00
1FESA 2EW9A 2GV1A 5A6PA 2IYGA 3QGPA 1OQ3A 1YRXA 4OIXA 1S6UA 3DXSX 4Q2MA 3TNVA 5B0EA 3LO3A 2RU9A 2GO8A 4Q2LA 1AFJA 3BDEA 4HL9A 2AJ0A 1TUVA 5B08A 2HIQA 3BN7A 2ROPA 2AJ1A 1Y0HA 2AW0A 4Y2IA 2BYCA 4ZA1A 2G9OA 3BGUA 2ACYA 1XBWA 1IUJA 5B0GA 3LGMA 3CJKB 2PD1A 2XMTA 1LQ9A 1X7VA 2XMVA 2ROGA 2OFGX 3HFKA 5B0DA 4Y2MA 4A46A 3E8OA 2HLTA 2W4PA 2W4DA 1AFIA 1FE0A 2AP6A 1Q4RA 2RILA 2KT3A 3BM7A 1Q8BA 3F44A 3K7RA 1QUPA 5T7LB 3TRGA 4EFAC 1N5TA 1Q8LA 2JDJA 4OJ3A 1URRA 2K7JA 2FIUA 1ULRA 2QLXA 1OQ6A 3KG0A 3FRYA 5IXUA 4NL5A 1TZ0A 2ASYA 1TL4A 1Y9OA 2LQBA 2CRLA 1YJTA 4HH1A 2GFFA 2XMMA 4A47A 2OAUA 2PGCA 1FVSA 1P8GA 1YJVA 2RMLA 5A6WA 5T7LA 5B0BA 4NPOA 5B0AA 4ZOSA 5F0WA 3DCAA 4FNIA 1SB6A 5F0UA 2LQ9A 1N5VA 1Y3KA 2HLUA 1S6OA 3KKFA 1FVQA 2GCFA 2W4CA 4HH0A 4DPOA 1KVIA 3HHLA 3T9NA 1TR0A 2BUNA 1FE4A 2FB0A 3HHLD 1CC8A 3WDOA 3QMQA 4OJHA 2OD4A 2HFOA 1X0PA 1X8DA 3KG1A 1U7LA 2KT2A 1WD6A 2FTRA 3IWLA 2OP5A 3BB5A 5B0CA 1SQEA 4YEAA 1YG0A 1P6TA 3IWXA 2OMOA 1VQYA 3HX9A 1GXUA 4F67A 2OD6A 2GGPB 1N5SA 3LGNA 4YDXA 2HFNA 2Q3PA 1R6YA 2QIFA 2GGPA 2BBEA 1OPZA 4OJ1A 2IYIA 2N7YA 2ZDOA 3BF4A 2K2PA 1YJUA 2ROEA 3UDCA 2RSQA 1MWYA 3HHLC 2FHMA 2N4DA 4HI2A 1CC7A 3HDSA 2KYZA 1W2IA 2BJDA 2XMWA 3TOQA 3GZ7A 3KNGA 2VV5A 1SI9A 1APSA 1RJJA 4Y2KA 3HHLB 4FNHA 2BJEA 2XMJA 4QOTA 4HI1A 2K7KA 1OSDA 5B0FA 1N5QA 1CPZA 5B09A 1Y3JA 2K1RA 4OJGA 3FGVA 2HQIA 1V3ZA 2XMUA 3I9ZA 1Q53A 1AW0A 4A48A 5KAKA 1JK9B 2XMKA 3MCSA 2GA7A 1JWWA 2L3MA 1MWZA 3BR8A 2QYCA 2LXFA 4U9RA 4DN9A 2OFHX 4A4JA 2KKHA 1GXTA 1FEEA 2LDIA 1K0VA 5K9FA 4DL0C 1KQKA 2QLWA 2N4CA 2K1RB 2VH7A 1KVJA 3HF5A 3CJKA 1TL5A 2OKQA 1VQSA 1YJRA 3VTIA 1FD8A 2IFXA 3MZIA 3FMBA 2ZDPA
chains in the Genus database with same CATH superfamily
4ECWA 4ZVUB 2WZ1A 3GMGA 4O0NA 4F0KA 3VAFA 3IO1A 3TNVA 2GIRA 4QIFA 1IXKA 2LEBA 1P1LA 3ITHB 1WELA 4KV8B 1HNWJ 3KOAA 4QBUA 1TUVA 4NA1A 1R31A 2QL9B 1AUDA 2G4BA 4MK8A 3SSSA 4UY8T 4F3QA 3SZ2A 2AW0A 3AODA 4ZA1A 3FBCA 1GMWA 3GYNA 4O3QA 2VFRA 2MHNA 5CYQA 2ZHAA 3W3SA 1ZTWA 3VAJA 4U96A 5K20B 4JI7F 1LWFA 1X7VA 4V1Ak 1UEKA 1KP6A 1X9WA 1TFWA 5KFGA 2VG5B 1S0OA 4OI4A 3D2WA 1WJ9A 1HHQA 4PG4A 4JI6J 1DY3A 4ELTA 3QRPA 2DGVA 1S79A 2CQDA 3IMQJ 1BXNA 1XEZA 2GJFA 3D3CJ 1IR0A 4TNOA 2CNOB 2B6AA 3TRGA 4DX8H 1A9NB 5KG2A 1HI1A 2I0XA 2J9EA 2J8SA 3U1NA 2P9GA 4OZ2A 1B4SA 4DU8A 1URNA 1C0TA 3UCZP 6FDRA 4U8YA 3PXGa 2KG1A 4OHYA 1K44A 1LW2A 4RW4B 1T7PA 2YH0A 1NDKA 1BGXT 2XSFA 2ZKUA 4JBCA 2VDIA 4JP8A 5HLFB 2HBRB 3KJQB 2CQGA 3Q8SB 1XMQJ 2VA2A 2KVIA 4F3MA 3BH7B 4UOHA 5D0HA 4LR9A 2YKOA 2LQ9A 3GG0A 5I4MA 1RU1A 4JV5F 2HLUA 4YOEA 3MTKA 1WHVA 1E6YA 3GP9A 1KEKA 4CIOA 4NCAA 2BX6A 3Q89A 1KLMB 1NPKA 1TL7A 3PEHA 1Y5IB 3C8YA 3ZZRA 4U7CA 1NK7A 1WOPA 1MU2A 5GAEI 5IM0A 3PTWA 4ZLNA 3NCQA 3NGUA 4LVOP 7FD1A 2WW4A 3BPDA 3GB0A 2JVRA 5CCLA 3LP1B 3M2VB 4NLVA 5C25A 1TKDA 1FKOA 2RB7A 2U2FA 3BH6B 3DU5A 3HLUA 3PYFA 5HANA 5EGYA 3SSQA 5I3UB 5DDRC 2RUGA 4UY85 2V2ZA 3GIRA 3NKYA 1UCNA 3TA1A 5GAEU 2MGZB 2DGTA 1D8ZA 2EK1A 4P6QA 5G0RA 4E2FB 1NJZA 1IKYB 2BOPA 4BC9A 3QZ7A 2BBEA 3ZTPA 3OFEA 4ZP9A 4A8QA 4JI1F 3RW6A 3CO9A 1RBLA 1U8WA 2FYXA 4PYAA 1TVRA 3OV7A 1LWEA 3LOUA 1X9SA 1NDCA 3JTNA 3H2UB 1DHMA 4NRTA 3CJ4A 1CG2A 4X65J 4LSZB 1SIWB 3IAM9 4ZVPB 4DQQA 2H48B 1YWXA 1SI9A 2IIHA 5HATA 5DLGA 5CYJA 3KK1B 2OTLS 4FP9A 2RQKA 4IG0A 4LRAA 5B0FA 4XK8C 1S1XA 4ZLJA 2ILZA 1Y3JA 2R3VA 3UDVA 4Q45A 3CC7S 3QFHA 4UQTA 2E9ZA 4DV5J 1ZM2A 3IP0A 3MPVA 3PRVA 4IH5A 4LFBJ 2UUCJ 5HQ8A 5GAGI 4UOCA 2WOMA 1QAXA 3IA0A 2B4VA 7AT1B 1W7WA 2A1BA 1I1GA 2JX2A 5DDOC 3CCLS 4HACB 4JYAJ 1N56A 2XYPB 4ERDA 2IM0A 1LWCA 3GV5B 3W66A 2MLZA 3AA9A 4ANDA 1NNDA 1VQLS 3CCWA 1DFDA 1UKUA 3HKZD 3T5HA 2ADBA 5MLCV 3HF5A 3M9OB 6AT1B 2B9EA 4ZIVA 3EDRB 3K0JA 4CLTA 2VL1A 2CUYA 2QT7A 3GSIA 4X64F 3ONQA 2EW9A 3G4SS 2GVZB 4J9RA 2V8VA 2WRMA 3T6JA 2UVUA 3QGPA 4ED6A 4PXBA 1D9DA 1FNMA 4RW8A 2HBQB 2CQIA 1R0AA 2CQ1A 3A13A 4Q2LA 1S72S 4CZCA 2CZVC 1GAOA 2MZQA 3QSIA 1IBKJ 2YPYA 2HIQA 2YWWA 1UWAA 1HI0P 4M8LA 2R2SA 2IVYA 1RT1A 1RWNB 4Q5VA 3GJTB 2B9XA 1CULB 2PSZA 2IPOB 3TARA 3QWUA 4MK7A 1JLGA 1R8HA 2DD8S 3UCUP 2H5EA 3W9HA 5IT0A 1WNEA 1TP7A 3MEDB 2ZH9A 4FPRA 4IFYA 4NX9A 1MG7A 3J7AN 2V4JB 4Z37A 3DRSA 3UN2A 3V4MA 1AFIA 2UVWA 4F8RA 4O4GB 1U45A 2ZC4A 3NGSA 3BSNA 3M2UA 1K0TA 1KVKA 2DNKA 4X4SA 1LNQA 2B0GA 2YNFB 5I3QA 1KLNA 3MWBA 3K5NA 3BEGB 1T95A 2YX7A 1XNRJ 2GJIA 4IOBA 1E6YB 1NUEA 4KFBB 4LSLB 5IXUA 1IJFB 1U8SA 4DR5J 2OH2A 3VGTA 2B3TB 4N8NA 1NJIT 4QCLA 3I87A 4XPCA 1RTZA 4CH7A 2M3DA 4DG1A 1RAFB 2ATCB 3M30A 4FXVA 5HMWA 4DSEA 2V94A 2IJNA 4KHRA 2VD3A 5LMNJ 1Q86T 1WF2A 2M88A 1T3OA 5E41A 1LW2B 1FERA 3ZZYA 4F04B 4LREA 3I9V9 5CA5A 5F8GA 2UXBJ 1S6OA 4WTOB 2WVFA 4IRCA 2R7RA 1TAQA 2NPIA 4RW4A 4DHVA 3PFEA 5A8KB 1KTVA 5KFVA 4I6YA 3PX6A 1H72C 1HHSA 3FSYA 4LF9J 4FPIA 2CADA 4LF2A 1O5JA 4NLQA 4AL7A 3T41A 1FNOA 3PACA 3BGFA 1H7WA 5KFRA 1T3NA 2E44A 3MHYA 2ZM6F 3OR1B 1NO8A 3I0SA 2LECA 2DXDA 2FY8A 2EK6A 2J9CA 1CJVA 4ED2A 3T5JA 1QM9A 2WBRA 3M32A 1D9FA 3OR2B 5ETKA 5KFBA 2ZH2A 1AA1B 2M4MA 1RAIB 2VG6A 3SFUA 3J7ZT 5G0RB 2HNYA 3J7Z5 2HZAA 3ZZOA 4YB7A 2GQQA 5I3UA 2BJDA 1XN9A 1NPRA 2HGNA 3OJUA 4IR1A 1S6QA 4PPZA 3RB4A 1F2HA 4NEYA 2DPJA 2ZOFA 3HHLB 4CLZA 3I56S 2K8GA 4QOTA 3JSMA 3TAMB 1LWCB 5D8HB 2AMCB 4F4YA 3C6TB 3CT9A 4M63A 3KLFB 5G4DA 4X64J 3M8RA 3DOKB 3VAMA 2ERRA 4NXMJ 2YXLA 3OTDA 2KH9A 3AJ1A 2RS8A 1C1BB 2V8GA 2YWHA 3WZ0A 2KXHA 5F9LA 2ZOMA 1RT2A 1ICEB 2J7WA 2L3MA 3L7PA 3PNIA 3A3PB 1HNZF 2HZVA 2IAJA 2CKWA 1ZS6A 2CVIA 1HQUA 2LXFA 3DLHA 1PILA 1R89A 2Y0SD 1VQ4S 3SXLA 2AZ1A 3BKTA 2JOQA 2IVFB 1UPMB 2G1DA 4M5IA 3QGIA 3R1LA 1HNWF 2ZBIA 5KFYA 3CW2C 4LSNA 5CABA 2I5JA 4M5MA 5DGBA 1J5OA 3C14A 4DR1F 3C16B 2UXBF 4TQSA 3KTQA 3HD2A 3MEDA 2QZ8A 4MKAA 2GVDA 3IBWA 2W9CB 2JLEA 1FX4A 2DGXA 2EI5A 4Y00A 4AXJA 1NBEB 4NLWA 4FF3A 3CB4A 6FD1A 1U1NA 2ZITA 4IH6A 2BABA 3BKFA 4KE5A 5D0EA 1JNZB 5BXIA 2AJ1A 4A8SA 4DR5F 4PQUA 5CXTA 1UJ4A 2PFDA 3O1LA 2FHOB 2GQCA 4OHWA 1SH2A 2E1CA 4DPXA 2BANB 3NNHA 1PBUA 2MSSA 2Z56B 2XZWA 3CWJA 2MKKA 5E7OB 2V69A 2WB1D 2AJ2A 3M8ZA 3TO8A 3OVBA 1RAEB 2OFGX 1XR6A 4C3LA 3VALA 4G65A 2F1FA 3SV4A 2DNPA 2YY3A 2ASJA 1W2BR 1FDNA 1YITS 2BKPA 2CQPA 2ZD1B 4WIIA 4YB5A 4DEZA 3K5LA 4Q44A 3I82A 2AV5A 2Z8QA 5IOLA 2HS3A 4OJ3A 5L46A 3QJJA 4DR6F 2NCKL 1DLOA 2FJWA 3M9NB 1H2UX 2HAFA 2FHJD 3BV8A 1RAGB 1VLOA 1FWLA 1FWPA 1OS5A 2UV8G 2I8EA 2ZVSA 3M4XA 4JB8B 1OJ4A 4M5JA 1FEHA 2PI4A 4WXWA 3I32A 4PG7A 1CJTB 3KG4A 5KFQA 2KFNA 1I51B 2F3JA 1P8GA 3W60A 1JXLA 1TAUA 2BM1A 1IR1A 1C0UB 3FCVA 2RS2A 4EBDA 1X31C 1GFWB 2EWHA 2H3EB 4TY8B 1GNKA 4TYBA 4Z7CA 3F73A 1MROB 1VC0A 1HFEL 1NK5A 4HH0A 2BEFA 1MMDA 4XTTA 2DISA 2HFVA 4HHJA 1YRUA 1ACMB 1LWXA 2GC8A 2X3DA 2L9DA 1F5CA 2V63A 3D6TB 2YWEA 3NS6A 1P9YA 2Y1RI 3DRRB 3UD3P 3DLKB 3HSDA 1X8DA 4BHQA 3UDLA 4ILMA 2F9DA 4URSA 2XS5A 3LWMA 3KWMA 3HJFA 4GMKA 2LQ5A 2OP5A 4CYUA 2IA0A 1HBMB 2GAHC 2XBPA 3QT5A 2R2RA 2XNQA 5DG7A 4J37A 1FNXH 1WF1A 4G1QA 1R6VA 4PWWA 3IM8A 4P74A 1C1CB 4O3RA 1Q82T 2JWNA 2DRDA 1ROFA 2AEJA 3DLGA 3H90A 4ID5A 1ZYQA 1H2VZ 3OR1A 1FTRA 1GXLA 2HURA 3R5CA 4ZCMA 1D1UA 5JMNA 4DUYF 3BJYA 5HP1B 1FKOB 1OYDA 2BJ1A 5ETQA 4X62F 2QMXA 3D4JA 3RR7A 5AXMA 4DQIA 2J7KA 3TOQA 4O4RA 2LQ8A 2CQ2A 2HPUA 3B82A 3FDSA 1FRMA 3D3BJ 4Z2XA 4GKKJ 3MTJA 3G82B 1S1UA 4Y2KA 1K73T 1SKUB 1M90T 4FNHA 1CJUA 3GYXB 4DFJA 3GIMA 4L72B 4Y2AA 4BLGA 2UXCF 3WX8A 1NKEA 2JJ4D 1IBCB 2GAGC 3TVZA 1KOHA 4H4KA 1IWGA 3MM5A 5JXSA 3LP2A 1F3FA 1WG1A 3QQCD 4CLWA 1DTTA 1RDRA 2DGSA 4TLQA 2FHJA 5AXKA 1R43A 1AB8A 3CIMA 1AW0A 3FZBA 2AGQA 2P6SA 2DHHA 4PZVA 5F8JA 1XERA 3OTCA 2C3MA 2PMZD 5GMKa 1RA6A 4LRBA 3KLGA 1XC9A 1YJ9S 4DCOB 2LQJA 2BV3A 1MWZA 2NUUG 4CLKA 1LW0B 3NMAA 4N8OA 4ED0A 2PC6A 4ZITA 1CEZA 2N7CA 4J7CA 2J6UA 2FJEB 3T9ZA 3GSDA 2EVZA 2OPPB 2W2OP 3P8BB 4ZPWR 2EG2A 1KQKA 3BO2A 2CG4A 2HHSA 3NP5A 3H20A 3LANA 5KG1A 2C22A 4K4TA 3MMBA 3Q0AA 2D69A 4C2MA 3MUTP 1VQMS 3THTA 1MW7A 1Y5LB 2WHOA 1JLGB 3JQMA 3KDNA 3KUHA 4C3MA 2HHWA 4KGMA 1BD6A 1S6UA 3LPYA 3JSRA 1U0HA 3LPEA 1KQFB 4CLFA 3PW7A 1SL1A 2X1BA 4F4ZA 2GJ2A 2E66A 3AHPA 3DLEA 1X4DA 1RTDB 5KFWA 4OX9J 4LJMA 2FJVA 2DHXA 3KHRA 2QMWA 2PO4A 4C8NA 4YB6A 3W2VA 1FRHA 2BJ7A 3CJKB 3JYTA 2MKYA 2VC1A 4CT8A 2ZZTA 1KOOA 2FC9A 3QATA 3CCVS 2UUAF 3DU6A 3SI8A 4LF6J 1WC0A 4K0KF 1NDPA 4Y2MA 5IM0B 2BKNA 3DDNA 3FUYA 2W4DA 4A8KA 1WEXA 4DUYJ 2QC3A 5H9FK 2B9WA 3EDQB 3GJSB 3UFCX 5DZ6A 3GV7B 3F0NA 3HZEA 3WC2A 5CD4A 1HW8A 2VDHA 5K5MA 2FIUA 2MGZA 2AYMA 1OQ6A 3FFIA 4MJKA 1TZ0A 2ASYA 3W2WA 4TLRA 3AT1B 2RVJA 3OL8A 4IOAQ 2NZ4A 4USIA 2CRLA 2R7UA 3OTBA 1IKVB 5KFLA 3FKBA 8ATCB 4K4WA 1SXLA 5HJXA 4Q0BB 1HNVB 4QW8A 4C98A 5IT9Y 2W7AA 2FLPA 2WONA 3VR1A 5EN1A 3O44A 3FCWA 5F0UA 4TKTA 1N5VA 1YDLA 4JI5J 3DN9A 5HK4A 3RAXA 4ELVA 1HPZB 4P2MA 2B4PA 3M2UB 4DR3F 4OLOA 2R7QA 4USWA 1L5UA 2UUAJ 4C0BA 2C2KB 3RR8A 1VBKA 4WCEQ 4E0DA 4CCHA 1G1XA 2IY5B 4CM0A 3MGJA 4KKOB 3OVSA 2KL8A 3PKMA 2JZ5A 2ASDA 2BE9B 3KFWX 3JB9k 3VVTA 1WD6A 4GKJF 5A8RA 1RHMB 2BRLA 4MAKA 4O23A 5C2GA 3HHNB 5EUHA 2DCUB 4PWDA 1YG0A 1N36J 3G6YA 4PABA 4CO0A 2YWGA 4ZK7M 2GGPB 1N5SA 2YNGB 3BGRB 1IKWA 3ZTSA 3PFOA 1RT4B 1JMTA 1FD2A 1NK9A 2UUBF 4LF5F 4X4QA 2E9TA 1TL3B 2DR7A 5E3PA 5IQ6A 2IYIA 4CDIA 1FRLA 1RLCL 1V9OA 2LVWA 3FEZA 3GFZA 5KFIA 4HYKA 1M5PC 1MWYA 3GPAA 2ZH8A 2FJBB 1UPPA 1S0MA 1CC7A 1ELOA 1HKAA 2FQQB 2H5IB 2KYZA 2ZWOA 3NWRA 2Y8YA 1RE1B 2RJZA 4UZCA 4ZHRB 3FNNA 1SPBP 4EWTA 1T9XA 3M9MB 1U6ZA 1APSA 3L9ZA 2AF6A 1YSJA 4URQU 3VQSA 1OSDA 2XY6A 3HHKA 3TUJC 5HL7Q 4OJGA 1S9EA 1KHVA 1HW9A 4EYHB 5KFFA 3EZ5A 4RW7A 1M5HA 3MM7B 2DH7A 5DO2A 2QA4G 3LW5C 5D0GA 2FVCA 1H98A 3A3OB 3R5JB 3WIUA 1FK9A 3RUBL 3C16A 5HSPA 4FYVB 3HK2A 4J9PA 2QYCA 2K3KA 1VMBA 4EZ9A 2VODA 2HVDA 4C8OA 2HBZB 4F02A 2W1BA 4IG0B 1K0VA 4YR3A 2DNNA 4F3OA 1D3WA 2QLWA 4GKKF 1A7GE 4LF4F 3BGOP 1UETA 1HMVB 5D6GA 1DARA 1S9GA 3CJKA 1Q5VA 1U2FA 3K5MA 1MLAA 5H9EJ 3D67A 5KFJA 1VR6A 2W7OA 1X0FA 2OIHA 2BE2A 2Y9HA 3CCQS 3MR6A 4ED7A 1ZBTA 1WHYA 2BOAA 2HVZA 3MM9B 4R5PB 2C2MB 4IQXA 4OZLA 5KFHA 4C4WA 4OIXA 1FRIA 1OQ3A 1YRXA 2NXCA 3MECB 3MAHA 4EGLA 3B4DA 1AYEA 1IN0A 2KVQE 3LTOA 4DPWA 3DM2B 5EWGA 4DV3J 4NCGB 2HQGA 1UVLA 3PW2A 5ETMA 3G8QA 1S0NA 4DBQA 1WF0A 3EZUA 1FHTA 2GIFA 2ACYA 4FYDA 4USJC 2E9RX 1XBWA 1XQIA 4MFBA 2HS0A 4OYXA 4ILRA 4DS4A 3CD5A 3R2DJ 1TKTB 5F8IA 2HG4A 1F3VA 1WKJA 2BM0A 2XMTA 5J2QA 3DYAB 1ZM9A 4CTAA 5B0DA 3OJSA 1FJCA 3HI9A 1YQHA 5IWAF 4HR2A 1NB7A 2R8JA 3U1MA 1RACB 1ZA1B 1YTYA 5E2QA 3OSNA 5D4OA 2GZOA 2BJ8A 2QLBB 5M2RA 3IG1B 4NLTA 3KHGA 1LEOA 4WF9Q 3Q8YA 2DGWA 1SQGA 4GVBB 3B6BA 1U2RA 7FDRA 3QAUA 4FVMA 4N5SA 5A2QY 2B43A 1RTIB 4OX9F 2YTCA 3I96A 4JI8F 4C8KA 4KPYA 5K14B 2J9DA 1PYTA 3EX7B 3E01A 1RTHB 3EVOA 3MPUB 2J7UA 3C15A 1JXVA 1XTZA 4WTYA 3CMES 1CSJA 5IV4A 4O4GA 2MZRA 3DCAA 3AQOA 1N0UA 3PHEA 4A8WA 4A8FA 3IS9B 3OSPA 2QEXS 3KKFA 4QR1A 3PW0A 3HHLA 3SEOA 3CCUS 2J76E 1TL3A 2MQLA 3U27A 2V4QA 4I69A 3MAAA 1U1RA 3KLEA 1OYEA 3HHLD 2A0FB 4LR8A 4DV7J 3HJVA 1X0PA 1RHQB 1Q78A 2DXFA 2LLZA 2LXUA 1SUQA 2YKAA 3KG1A 4WU2A 4WYWA 4DR2F 4WK1A 1N6QB 3NAHA 4NA2A 2K3IA 4K4SA 1O0PA 1UZHA 4YDDB 1OO0B 2DIUA 1KONA 2HK3A 3IWXA 2DR5A 1IQTA 4X65F 1Q79A 2HFSA 2CQ0A 2MZSA 1VYAA 2CNLB 3LQVA 2IJRA 3DLKA 2JFKA 4HDGA 3DGPA 4WE1B 4NLSA 3UNGC 3MXHP 5IT4A 5C7PA 4ZVGA 2Z2MA 2VG6B 2B9YA 5CYMA 3DLLQ 2ZH4A 4JV0A 3R7NB 1Q0NA 5DG9A 1B7YB 1PJ7A 3M8WA 3CJ3A 3R7BB 5I3PA 3EGZA 2Z0GA 2RF2A 3W62A 4I2PA 1EKSA 4Y2CA 3FK4A 2GMJA 4IDKA 3VAIA 4B9VA 4ED3A 4X2BA 2IC3B 4TY9A 4ZP8A 2DH9A 4KKOA 2K06A 1JLEA 2D3O1 5ETSA 1S6PA 4WFAQ 2DVIA 3DOMA 3A8JA 1RABB 5CZVA 1FKAF 4KHPJ 1RAJA 4PUOB 2DGQA 1X4AA 2HGMA 2HNDA 2NXJA 4CO5A 1VRTB 3T1YF 3PO4A 3DDKA 3KMQA 1N0VC 1RUSA 2HVHA 4A4JA 3TVKA 2PFFB 5ETLA 2LDIA 4DN0A 2Z30B 1HWUA 4QPTA 2KN4A 4OLPA 2HEKA 1TV6B 1WHWA 2Y1LB 3NXZA 3OTEA 1RT1B 5KT6A 4WFZA 4PQAA 5LSLA 1ITPA 1GX6A 3DI6B 3H5SA 1S1VA 4USKA 2VG7B 2J8AA 4WP3A 1DTTB 4ITSA 1B0VA 4YP3A 4LFCJ 3FFIB 5T14A 4ZPVR 4WPAA 3W7BA 5HMXA 3OVAA 1X60A 3GCWP 4KHMA 5LT5A 3DYAA 4IFVB 5CYQB 5L1JA 1JLBB 3IR6B 3K2YA 4DDFA 5KT4A 2G2YA 3R6LB 4HL9A 2W9CA 1NJYA 1RB0A 2FGOA 3CJ0A 2ROPA 3TA2A 1HBNA 2MKIA 2L08A 1U48A 4DX6A 1NJXA 1T0TV 1QSSA 3CIZA 4GVLA 2F8HA 3RG6A 5GAHU 5J2MA 1AROP 4V19J 1BQMB 4ER8A 1VRQC 2LU1A 1N52B 3LAKA 4I1TA 3ZNJ1 3G6XA 4B08A 1S12A 3E2EA 2W4PA 2YKNB 3UPFA 2ZC3A 2PDAA 5J1PA 4CLSA 1M5KC 4DQPA 1T05B 2H5JB 4PXCA 2VICA 2UXCJ 5IT9U 3KG0A 2RD5C 3P4UB 4R25A 4NL5A 4MTPA 2CIMA 2Z57B 3MD1A 4M5DB 5H1SV 2IRYA 2LCWA 4PG8A 3H5XA 1SC3B 2KHCA 2VKZG 2CJYB 4F25A 3DGVA 2XMMA 3R3TA 1ZPWX 3UN5A 1YJVA 2E7VA 5B0BA 5J1EA 4JI2F 4WZQA 5B0AA 2JEIA 2DY9A 3BGLA 4ZOSA 3GJQB 3NS7B 3Q8RB 5AE2A 4DQRA 2QMUB 1WC1A 3CVKA 4K8RA 1HBOA 2QA1A 3LGHA 3GQCA 4ED1A 1SL2A 1NKCA 1QVFR 1BLUA 2FHKA 3MURP 4DL6A 2FJXA 1X5OA 1TR0A 2PE8A 2R8GA 1F5BA 8AT1B 1PJ5A 5JJBA 2MSTA 4CM2A 3QMQA 5GADU 3FSXA 1G3OA 4C3KA 1J5EJ 1LKZA 1W26A 2APOA 5A2QU 1WSRA 2VPZB 1NDLA 4BWJA 3PDNA 3VWSA 2LMIA 1S59A 4OZNA 2FUG9 5EX3A 3PRDA 5D15A 1TL7B 1J5OB 2MLYA 4XDCA 2QIFA 4QWEA 2AYGA 5KFUA 1U26A 1LK7A 1S48A 3AOCA 3GONA 5BYQA 2AJFE 3NRBA 2JRSA 1N32J 2LYVA 3NGKA 5CH7B 3MMCA 3SCLE 2F63A 2QN6B 4OHZA 4DCJB 4XAKA 1HBMA 4DSFA 1RT6B 2HNYB 2WVCA 2HWTA 3KNGA 2YKPA 2AT1B 1B7FA 4GRSA 3ZTQA 1FA0A 2OPRA 4KB7A 3MUVP 3H40A 1REGX 5E0OA 2BW7A 3MECA 3SMZA 1PYSB 4DL7A 1PGZA 4K4XA 2EEYA 2FZCB 4DR7J 5E3QA 2YX4A 3ITHA 4QYZK 2UZAA 2E1AA 1GX5A 3H2LA 3L7UA 1CQNA 5AXNA 2MXYA 1ZZNA 3BO4A 3M05A 1F1BB 4OI6A 3C14B 1RT7B 4WZMA 3M1VA 2P6TA 4YN3B 5H9EK 1N36F 3OLAA 1G6BA 4H4MA 1UJ6A 4YUDA 5FLXU 3Q2TC 3W8PA 4B9LA 2HWIA 3NY0A 3PYEA 4DPUA 1YKWA 4DPYA 4ZHRA 3J81Y 2FLLA 4LT6A 4RPFA 5GAGU 5K8NA 2OFHX 3AD7C 4JV1A 1BQNB 1LXJA 4AE5A 3PG9A 2YNIA 3MFHA 3KK2B 1FF2A 1RT2B 4B3SJ 2CG8A 2W8LA 2J6SA 2KTQA 2VH7A 2ZOGA 3D66A 4KC5A 4QWAA 4W92B 1FKPB 1T03A 1BC6A 2HK2A 1EB0A 4D3HA 1HHTP 4B3OB 1S1TA 2DNOA 4B3MJ 2WVEA 4PG6A 3BSAA 4DUTA 2AYEA 2OELA 2ZBPA 5E5NA 3MR3A 4I2PB 1U1KA 4JI1J 2BJ3A 1U0SA 3POTB 5C42A 2GNKA 2DY1A 2IYGA 3I6PA 2HAIA 4NZ0A 4WK3A 3PVXA 4F36A 4P7VA 4OQJA 2J0WA 3W63A 2ZBRA 3FVYA 3OHBA 2ZD1A 4CLPA 3NMRA 2AJ0A 4B3RJ 2VQFJ 4PXDA 2BYCA 4C11B 2HRYA 5KT7A 1Q81T 1XNRF 3EPGA 1HPZA 2EFVA 5B0GA 3E51A 3IBCB 4HHHA 1UEVA 4PEOA 5LSRA 3PKYA 2F7VA 4CH1A 4G1QB 1EQ0A 1MN7A 2J9DE 4R5PA 4CP5A 4Y6IA 4F26A 4LFCF 3UNYA 2WOMB 3OFFA 1WDTA 3R5AA 1EZZB 4DFKA 2L41A 1K9MT 3AQPA 3N6MA 2XLKA 1KFSA 3UE2A 2MY8A 1HARA 2XGPA 3J7A1 3K59A 3PR5B 2W8KA 1TL4A 1YZ6A 1FXRA 2IVMA 2RKIB 3R27A 2VBZA 4I4BA 4FS2A 4MYTA 3N01A 3RBDA 2VFSA 2ASLA 2CDQA 3WX4A 3G8TA 2HHHF 3CCZA 2YWKA 4OI1A 4A47A 2PI5A 2UU9F 4OYOA 1WEZA 3SCJE 3U7JA 5AJ3J 2Y1JA 4IOCQ 2X7IA 1UWBA 5KG6A 3VQTA 4H4OB 3TUPA 1C4CA 3AJ2A 2CJQA 3WIVA 3IGNA 2ZEJA 4NXNF 2XQCA 4NRUA 2AU0A 2GCFA 5M2UA 4I0WA 2MQOA 2L9NA 3T3FA 2XNRA 2CQCA 3W61A 3FEYB 4EU0A 4YHHJ 3PJWA 3K5PA 1ZOTA 4LVNP 1CC8A 1S7HA 3K89A 1M1KT 4EK2A 5LMUJ 2HFOA 3QT8A 1XR7A 3UN3A 2QA4S 2VKRA 1NSAA 3OFGA 3MM8B 1JKHB 3MFIA 1PO6A 4X4NA 1MN9A 3G71S 1S7IA 3BPSP 3HX9A 3J81j 3CCMS 3LGNA 1Y11A 3P49B 1RADB 1R8CA 3P5BP 2KYXA 4JUZA 1R0BG 4EUVA 2KXNB 3NOGA 4ECQA 1JJCB 3RJMB 5DGAA 2IBKA 4C8LA 4MYUA 2N7YA 2OMLA 3KJFB 1NM2A 4BC7A 1CJVB 3HSJA 1MWQA 4GKJJ 2EBEA 2BDPA 4ED5A 3MM8A 5FIIA 4NCBA 1VFJA 4M5GA 2IJFA 2RNEA 2VPXB 5CCMA 3MCMA 3H0PA 1WHXA 2LA6A 2POKA 3M2VA 1VDHA 1QDUB 2F4FA 4DUZF 4TYAA 4O3PA 1BQNA 2XGQA 1BHNA 3I0RA 2P2CB 1XMOJ 1UEUA 1VQ6S 1N34J 4PR6A 4WP8A 5J2NB 5D3GA 2N3LA 3M8QA 3MF5A 5DS7A 3ENVA 2V8HA 5HQLA 2WB4A 1CJUB 3V4IA 1EARA 1JK9B 1Q95G 3MEGA 4NLYA 2IRUA 2LKZA 2Z58B 2QSWA 1F5AA 4RNMA 3BKUA 2I38A 2X51A 3TX8A 1FRJA 3LP2B 2HFZA 4LRDA 3SSRA 5I42A 4LF7F 1C0TB 1HWKA 4M5LA 4Y3CA 3VCDA 3P6YC 4USHA 1OSCA 1PCAA 1JLEB 4KAIA 5E3CA 3SQGA 3W64A 4M5KA 1RA7A 2YNFA 5CAAA 3G96A 2AQ4A 4NXNJ 1HWLA 2E5LF 3MZIA 4URGA 1CQMA 5L1KA 2DB1A 3NCRA 4RW8B 1R0AB 1RWWB 5ADZA 1RTJB 5D78A 2RHSB 4Y34A 2HHHJ 2IMWP 3H8YA 1T8EA 1GEHA 3UW1A 4RBVA 5HJYA 3CCTA 2HFUA 5C42B 4F4WA 1TKZB 1Q8KA 1ZZFA 4MH8A 4ZVSB 2JEGA 4LF7J 4K59A 3QSYB 1FDAA 3NWGA 4QJVA 4EO8A 2V8PA 2G9OA 4XIUA 2U1AA 2X3GA 4KBIA 5KFMA 1W25A 2RE1A 2IBOA 4QYRA 4DR4F 2XLJA 4IQMA 1KSPA 4KV8A 4NASA 1LQ9A 2HRUA 1NK4A 3PEJA 1VRUA 3CCRS 4JI6F 4EBCA 4LIRA 2XSJB 2LEPA 3OXLA 1N6QA 4ELUA 3R5BA 1KC8T 3K7RA 3EPIA 1KDNA 1NSKL 5T7LB 4C11A 5L1LA 5KFZA 2MQ8A 1U6BA 2NLWA 3T5KA 4DL4A 3ZFVA 1S77D 2B7BB 3MAQA 2JH3A 3CCJS 4LF4J 4NYZA 1MROA 4NYPA 4ZVOB 4QW9A 1L3SA 3QRRA 5EX0A 1JKHA 4PKDB 3OL6A 3MD3A 1IBLJ 3FBEA 4B3TF 2ZZNA 3CDBA 1RXOB 3R97A 3ET6B 1IVZA 1CBKA 2MLXA 2YKMB 2PEBA 4NPOA 2RU3A 3CJRA 2DTJA 2E1RA 4AYBD 2O01C 2XO7A 1HNIA 1H0HB 2B51A 2DRBA 1FVQA 2CPIA 4UOFA 4DLEA 1WSVA 1C4AA 1F9EB 4GVBA 1PAEX 3IN5A 2BUNA 1EKRA 4H4OA 3IG1A 5F9NA 2FB0A 4PQUB 3KDOA 3R8YA 3RBZA 5KG0A 1WC4A 2XYHB 1WC6A 3MCOA 4U6PA 3OHAA 3KNAA 1JIHA 1OY8A 4I7FB 4G3IA 1N33F 5K14A 3BB5A 1BY9A 4DL5A 4F7VA 2E5JA 1N5YB 1RWXB 1SQEA 3M2RA 2ZH7A 4TN2A 4OV6A 4J9KA 3PY8A 4B9TA 4KGZB 4F67A 2OD6A 4OYZA 1MU2B 2QE5A 3CDUA 3D7SB 3BR9A 5KFKA 1K1SA 2WBMA 2AEFA 2JVOA 1TUWA 1YBAA 4OJ1A 1IKYA 3EVMA 4RW6A 4QWBA 4G1PA 3UWTA 1UMJA 4ENOA 2V4RA 2R7SA 3M8YA 2CQ4A 2OEKA 2N4DA 2B4OA 2CPHA 4YY3J 3DRPA 1IJEB 4OYIA 4DFMA 1UWBB 1NRKA 1U02A 5JUMA 1H7XA 1W2IA 2GHPA 2XMWA 4RU9A 1YI2S 2I1RA 4DV2F 1N5YA 3C46A 4DMZA 3GZ7A 4L73A 3BYRA 1F60B 4S0MA 5M2PA 3MMJA 4O3NA 2ZH5A 3SYZA 4OZ3A 4KH1B 4RWXA 3ETOA 2XMJA 4CO3A 3DDIA 2OEMA 1RT5B 2A2DA 2DO0A 2CFXA 2YVSA 1HBUA 1X5TA 2E7WA 2EBGA 2K1RA 3LAMA 2CPYA 4J9UE 2E5LJ 2XMUA 3LP0A 1HQEB 2VBWA 2W2PP 3I4HX 3I9ZA 4L74A 4ZVTB 4X4TA 4JI5F 4L6V3 3D0HE 1RAHB 5KOWA 4DV2J 1JWWA 4X4UA 1WEYA 2DIVA 3BDPA 1T94A 2FVQA 3CGIA 3KLIA 1JJ2R 4CH0S 2UVRA 1YHQS 1HQ2A 3DHXA 4B3RF 3JSMB 2D3UA 1KVJA 3G8SA 1U24A 4DV0J 2OKQA 3K57A 4USVA 5K8OA 1OIAA 1HNXJ 2XY5A 1WKKA 4H4MB 1TELA 2D7SA 4P73A 3KK3B 2RDJA 1DQ8A 3LUYA 4O3OA 5DDQC 1UVKA 3J7YU 1YLXA 3Q23A 1RHJB 2E1MC 1S10A 4WYLA 5LMNF 4JI2J 3TQEA 3X3UA 4NXMF 1CS4B 1SC4B 2DEIA 3UO0A 3V6JA 2DKOB 2F8MA 3QPIA 2E29A 2DXEA 5RUBA 2FC8A 1FKPA 1VBXA 2BJ9A 3VGSA 2XCAA 4WWSA 3WDOA 4TU7A 1SKSA 1Q1KA 1S1VB 4ID8A 4WIQA 3TQ1A 1TKZA 1KR4A 1M1GA 1OPIA 2DNGA 2AWZA 2M7SA 1BWVA 2D74B 1DBDA 1ZM3A 2PD1A 4RO0A 5CQGA 5E33A 3CDEA 2QO3A 5KFNA 3DOLA 5I42B 1REVA 2F5GA 3ET6A 4FKYA 2OHDA 2F40A 1LV5A 3UR0A 2AP6A 2AHOB 1QE1A 2MKSA 3C6UB 1N5TA 3QLHA 4LRCA 3NBPB 2V34A 4ZP6A 2C3UA 2F4VF 3QFWA 5JVGQ 2NR0A 2XB2D 4DSLA 3R2CJ 3RB3A 3TA0A 2CNKB 2A10A 4FN5A 3BBBA 3E3XA 4HH1A 3FMWA 3VAKA 4RU2A 2OAUA 2PGCA 1M0SA 2C2NA 3AXKA 2IC3A 1RTIA 4HTIA 4DG1B 4KTQA 4QYZJ 1NSQA 1YX2A 2KFZA 3MMCB 1UFLA 2IM3A 1S6PB 1LFWA 1RCOB 4LBHA 4ETZA 5IV3A 3TZYA 1SKWA 2ZBCA 2CA9A 2ZUGA 1C2PA 2COLA 1TKXB 3DOKA 2VZ9A 4K4UA 2ZBQA 1OMSA 3TEHB 3TW0A 1DLOB 2WSCC 1PJ6A 3SDEB 3T1AA 3DGPB 3BSCA 3D0IE 3H42A 3EGVA 1HNVA 1UFKA 2QV6A 3NEKA 4WE1A 5KFXA 4ZVQB 1NZAA 2KT2A 1GT8A 2CYYA 4NMLA 2VASA 3N0VA 1JLFA 1L3UA 3C2PA 4MKVA 4NLRA 3NGTA 2PIIA 3EWGA 3OUYA 3GIJA 3SCIE 1XIQA 3T5LA 3DLBA 3FZ2A 4Q8EA 4FS1A 1Z2ZA 2CJBA 4ECSA 1FDDA 4OI3A 3CDAA 1RISA 3FRZA 3UQSA 4LFBF 3UVJA 4ES3A 2GHVC 5E3AA 3KUEA 4YR2A 3DNCA 1SUQB 3KYLA 3EGNA 4OYBA 4NWBA 1DAXA 1FT8A 3PW5A 3M32B 3OXGA 1U09A 3A4TA 4MIWA 3CO0P 2GVDB 1EAYC 2XYGB 2DNRA 2GO9A 3I0SB 4QR0A 5LSOA 5DM6Q 4K0KJ 5ETOA 4FYWB 4X4VA 3MPDA 5GAHI 4CI0B 3HZGA 5KFEA 4F50A 2DR9A 2XWYA 3OUYB 2VQFF 4B9NA 1L3VA 4KO0A 3NLCA 3VVUA 3A1YG 3PJ9A 2V9KA 4MT1A 5F8LA 4PG5A 2BA9A 2OEJA 5K8MA 2I2YA 3L7OA 1HI8A 1N5QA 5DRKA 1BE4A 2DNHA 3ISND 3PYDA 4DCPB 4HACA 1FX2A 3FGVA 1DURA 4MKYA 2MMYA 5IC6B 2HQ3A 3FJ2A 4YFUA 3KJVB 3KLGB 1VI7A 4R0JA 3T1HJ 2Y8WA 4UUWA 4AFFA 5ETTA 2HW3A 1RI7A 3HO1A 1H3DA 2GA7A 4B3SF 3O6QA 1QAIA 2NS1B 5J2PB 2FJDB 4P2SA 1C1BA 1P1TA 2KG0A 3IXQA 5IC4B 4X62J 4A8YA 1NHVA 2M5YA 4ED4A 4ZKAA 2MZ1A 3J80U 2C3YA 4J9SA 1QAJA 4U7UD 2CNNB 1VHIA 1F6TA 3H4BA 5KG4A 2FY1A 2VBYA 2AD9A 3G9CA 1PSDA 4JV5J 5J2NA 3HULA 2ABYA 4HEA9 5D3GB 3CC4S 1BQMA 2XI2A 1OY9A 1QY7A 4ZVHA 1TUGB 4NLUA 5A6PA 1GMUA 2WVDA 3Q24A 2JL9A 3DOLB 4KIAA 2R8IA 3OLBA 3EYZA 5B0EA 1F0XA 1UW9A 1X4FA 1XMOF 4G6VB 3FBBA 5F8MA 1UVNA 4I2QA 5H9FJ 1S1WB 1MNEA 3CSKA 2B56A 3Q8VA 1KN6A 4B3OA 1RSCA 1QAYA 2WSFC 3WBZA 4CO2A 1NH8A 3Q8QB 3RB6A 1HWIA 5BR8J 4KHPF 3AOAA 3D5MA 2XMVA 1TK0A 3MMBB 3OQ2A 1KBRA 1MMLA 1AT1B 1HL6A 2MQNA 1UZDA 4X4OA 2ZH6A 4KT0C 4EZ6A 4OYMA 4ID5B 1IM6A 4ECRA 4H54A 2ZKTA 2VJUA 1KD1T 3B78A 1M5OC 1Q8LA 3P3DA 2NSCA 3E01B 1BQXA 1SJ4P 2K7JA 1FJ7A 3G6ES 3WQPA 1P27B 1G2EA 3FEXB 4NA3A 3THPA 4LFAF 2RQMA 3FQLA 4NLPA 4Q0BA 1S0VA 1KTQA 4KGKA 3MM6B 1HYSA 2AGPA 2RMLA 3IBFB 3NCPA 2Q1LA 3LH2S 1WOOA 4KFBA 4LSLA 2P9EA 1NPPA 2PEHA 4FNIA 3KLFA 3QIDA 2NXEA 2DO4A 2YX1A 3TAPA 1NK8A 2M9KA 4MMOA 1IBMF 1JLCB 2DHSA 1RT5A 2RKIA 3JAMY 2G1HA 2RIJA 1IR2A 1REVB 1UAWA 4FVCA 4OJHA 3ZZPA 1CLFA 2OPSB 2FTRA 3H98A 2UVVA 1FDBA 1FCAA 2F65A 1JLQA 2WW8A 3N5BA 1QVGR 3NBPA 4TVAB 1RQ0A 1FO1A 1LWFB 2H9ZA 3AXMA 4KPCA 4W4MA 4U95A 1AXQA 4IRDA 2RQCA 3UR3C 4JI4J 4ATNA 1DTQA 2HFNA 2KM8B 1GTHA 1T03B 3MAAB 4OMFG 4BWMA 2GGPA 3AH6A 3BGRA 2QX0A 1F9HA 3N5FA 5J1NA 1A6LA 3NGDA 1B99A 2JFDA 3L3CA 3JQJA 4HDHA 3I5CA 3UVJB 3X1LB 2Q43A 4RW9B 1ZM4A 4N47A 5L9XA 5FJ4A 1G7CB 2HS4A 2W24A 3CNQP 1VQ8S 3V6HA 1L3TA 3GIIA 4L76A 4IO9Q 2W2QP 2R9LA 3Q86A 1SC6A 4OI2A 1YJNS 4I6AA 1LFPA 3GR1A 4RWWA 2RQ4A 1IKXA 2KRBA 4RNFA 1TFYA 4M5HA 1QLNA 2YNGA 4K7QA 3G2XA 5D4NA 3KLIB 4ZJOA 3AB2B 3MR5A 3Q22A 2BR0A 4YQWA 1SJ3P 4C8YA 2OGUA 3CXCR 2V9WA 3ENAA 5L39A 1U1LA 2HQDA 3NGRA 4ES1A 1D8YA 4JI0J 4LBPA 2HHXA 1Q53A 3FC9A 3MEEB 3W9JA 2R7XA 3KUGA 4U8VA 1T9TA 2HSEB 2KDOA 3J80Y 2HHPA 3ILOA 3TAMA 2HVIA 2BQ3A 4C8ZA 2E1PA 3NS5A 3BZQA 4EI2A 3MM5B 3CUNA 2RRAA 4U9RA 4AQYJ 2MHEA 3MR2A 1QUVA 3SFGA 4DX7A 1FWKA 2AZ3A 1J27A 1IBMJ 2FDNA 1LXNA 4OYAA 1TL5A 1JB0C 1RKJA 1VQSA 5A8WB 2DGUA 3CC2S 5BYSA 1XMBA 3ADAC 2OLWA 4A8OA 2UUTA 2NZCA 1JJ4A 4KGVB 2YQ0A 3FMBA 3HVWA 5EHHA 1FESA 3PRBA 3MM7A 1RYSA 1VQ9S 2WTFA 4IO1A 4ZPDA 2IA6A 3A8EA 4USMA 3MM9A 2P8IA 1AZSB 1HR0J 2MEWA 3LO3A 3OBIA 4ANCA 2RRNA 2KJWA 2ZFHA 3FBFA 4ECVA 4DR4J 5B08A 3BN7A 3DLJA 3QT6A 4DV3F 3KJNB 3QYYA 1SJFA 3DM2A 1YRTA 4ED8A 2A6OA 2IRXA 3HSGA 1MSWD 4QIWD 4FYYB 2XMAA 3LWLA 1QSLA 5LXYA 4MK9A 1IUJA 2PA3A 2SXLA 5HVGA 2CPXA 1U25A 3AFGA 1HIYA 3LGMA 4WBFA 3SIPB 4CYUB 4DOZA 3MUMP 1VCTA 2O3DA 3ELHA 3I5AA 3Q8PB 3PJXA 4OV1A 9RUBA 3JYTB 2BE7D 3THVA 2YNHB 2ZUAA 1KS2A 2DNYA 2HLTA 3OPKA 2V6AA 4A46A 1SJQA 2MDAA 3IM9A 1FE0A 3OT9A 4I7FA 1Q4RA 2A3JA 1KQGB 2IM1A 5SUHA 3R7SB 1FFGB 2XLIA 2MQPA 4N77A 3M2RB 3KLHB 3D1QA 3PV8A 1M5VC 1KLMA 3RBEA 1HQUB 2HMIA 5F3TA 3EICA 2QSFA 4DSIA 1TKXA 2JLFA 1U1MA 5T41A 3ZC4A 1T05A 2ZZMA 2BKOA 4X84A 3TEGA 1V3RA 4KQZA 1VQNS 3S7RA 4WFBQ 1OY6A 2OPSA 3HP6A 2CPZA 2XSJA 5L1IA 2VG7A 3FQKA 3O8WA 1VRUB 2MZTA 4R0EA 4QPXA 3VV2B 4ANEA 4KYZA 3GJRB 3HCXA 4ZCIA 5HLFA 2UUCF 2W01A 4P9SA 4RNOA 1R8PA 2CJKA 3W5XA 2BRKA 1PBAA 4B9SA 1KVIA 1GH8A 4LF8F 1RWOB 2Z2ZA 3BBFA 3EXCX 3OD2A 4M5NA 4ZVEA 1VQ7S 3IAS9 2CWXA 3HD1A 2DYAA 2A2CA 2HZCA 4IH7A 5F8HA 3JXOA 1C1CA 3PR4A 1T9VA 3M8PA 1RZMA 1VLYA 1X5SA 2JC1A 4KGXB 4NZ6A 3TR5A 2VPYB 3LF0A 4K5SA 1N8RT 4ZPBA 4ZIWA 5IWAJ 4L3NA 4LF5J 3B54A 2BMBA 3G6VA 4RZRA 2YKNA 3C19A 2Q3PA 2GIQA 2G13A 1RAOA 1RT6A 1ZAWA 5F3ZA 5LJ3Y 3K58A 2XS2A 2J0XA 2V0NA 2O5DA 4PWDB 3UDCA 1Q16B 4J5OA 2A6MA 3QBCA 1FFWB 1RTJA 1Y00A 4JYAF 5B7WA 3AD8C 3ZO7A 4FF4A 4TQRA 4ZDNA 3MI7X 2ZH3A 3HVTB 4ETXA 5EWFA 2R42A 3G87A 1RJJA 3G86A 2JEFA 5C24B 4C6AA 5DG8A 4R8UA 3KLVA 5J2PA 1R3NA 1VJWA 1I6JA 2DH8A 1IWAA 4IFVA 2UXDJ 4JI0F 4C8MA 2ZHBA 3Q2SC 3W5ZA 2RHQB 5B09A 3QGGA 4YHHF 2FGCA 3ENWA 4GO7X 3CD7A 3VAHA 4JV2A 1RT3B 4MKBA 1NHKL 4ZPTR 1HNXF 4DWIA 3C3LA 4DZDA 2GVZA 3MDFA 1V6HA 3BBCA 4YB1P 1U6FA 4GC6A 2NPFA 4U67Q 2AYBA 1LK5A 3V5RA 4DR7F 4P10A 1UTAA 2LP4A 2B7CB 3ZTOA 3PW4A 4ZPAA 3T19A 1FFSB 3M1VB 4KO0B 3TANA 3M8QB 3W5YA 5HI7A 3B8HA 2V8DA 2K1RB 1O51A 2CPDA 1KKHA 5ETRA 1NHUA 2M0GB 5LM7E 4JI3J 5FDLA 1RTDA 3C15B 3A8KA 4OHXA 2PA8D 4DF8A 4KSEB 3S1TA 4QWDA 1TK5A 3H4DA 5DQHA 4P71A 2B5JB 2VIHA 1S1XB 2KB2A 2CZ9A 5A0YB 1S4EA 2V5HG 4QQBA 3KLEB 5KG5A 1EP4B 1Y0HA 1VQ5S 4XPEA 4FZVA 3UDEA 2EFGA 2ATLA 4N76A 3M6UA 3VF0B 3R1HA 4C0HA 2VJVA 1HBNB 1JLAA 2DNZA 3F56A 2VOPA 2W2MP 2QL7B 5E3RA 5IQQA 2JNJA 5HAOA 2Y0BB 4CRJA 1K47A 1Q7YT 2C2RA 4LQ9A 9ATCB 2DNLA 2ROGA 3LA0A 3KK3A 2HNZA 3BO3A 2XTJP 2OUGA 4Y28C 5J2MB 3CPWR 1YBTA 2XZDB 1RLDA 3TZXA 1ZETA 2R7VA 2KT3A 4F4AA 1Q8BA 4PCQA 3FSIA 1QUPA 2VHGA 2FVRA 2FLNA 3D0GE 2MQQA 2JDJA 2WK4A 1H38A 2PMHA 2QL5B 3DFEA 1URRA 2HHUA 2EG1A 1KHWA 2YKQA 4USUA 3PIOQ 2QLFB 2HYIB 3KHLA 1GMVA 4ICLB 2I6WA 4J90A 4I64A 1PG5B 1HWJA 2C2ZB 2G0IA 2RF2B 2DT9A 3CJ2A 3QO9B 4NLOA 5AXLA 3U02A 3T1HF 1UVIA 2GHWA 5A6WA 2WSEC 1SH3A 2R2TA 1QE1B 3C6UA 4NEZA 4A8MP 1VQKS 1KNZA 2ZJQQ 1NU4A 1BUXA 3IC1A 3M6WA 2EC0A 4RKUC 2BZ2A 3DOMB 3RGIA 4RUAA 1U47A 4O44A 3QLHB 3NL0A 1X4EA 4B3TJ 4LMZA 3BQ2A 1TMJA 1FE4A 4F0HA 4ZCKA 1S99A 2XI3A 5CHCB 5C5JA 4N7TA 1VC5A 1WC5A 3D9BA 5KFCA 1LWEB 1IKWB 1N48A 2J5AA 5B0CA 3PX4A 2CVEA 4QIVA 1N88A 2VPWB 1GXUA 3DLGB 2H54B 3VGVA 4ECTA 1HLWA 2HMIB 1RYRA 4BDPA 3TZZA 2BW2A 4ZJQA 3D68A 1Z4UA 1EHWA 4V19X 2ZDOA 2R8HA 3PZPA 2ROEA 2YNIB 4P7TA 3KK2A 3RZAA 1VIXA 1NCLA 4C7QA 1CVJA 1CS4A 2OSRA 4ZPCA 3B4MA 4OYPA 3ZZTA 3R9LA 2KZMA 1WACA 4B02A 2PT0A 4OZ1A 3K8VA 5L38A 2BJEA 1J5EF 1S4FA 3P5TL 1UVJA 1UVMA 2K7KA 3D6FB 3S6EA 1NAQA 2JSXA 4CWBA 3N4WA 3V81A 2A18A 2PN6A 4Q7AA 1NH7A 3W65A 4LF1A 1U1QA 2XS7A 1B64A 2KXFA 3HKWA 4N56A 1R27B 2NSBA 2ZM6J 1VK8A 1HMVA 1BMQB 1YK9A 4FYXB 2VFVA 3D1HA 3VAGA 2QGFB 3RB0A 2NXUA 4RLEA 3MEGB 4DN9A 3AAWB 1F9FA 2EKYA 3VGUA 2NREA 4B9MA 3A8IA 1GXTA 4DR6J 5EWEA 2H65B 4LFAJ 4M5DA 4DL0C 2C2DA 4YR0A 4DV1J 2DBBA 1FXDA 5BYRA 3TUIC 3PIPQ 4F4KA 4F0MA 3CJQA 1JLAB 1V3SA 4NCGA 3OTOF 1FD8A 3PHTA 1FTCA 3L4BC 3CJ8A 4B9UA 2EPIA 1JX4A 3OTOJ 1RGVA 3ZTRA 2D9PA 2NXNA 3DLEB 2HNZB 3HMJG 2V2VA 2N82B 1N4LA 2IHR1 5IFMA 2MTLA 4HT7A 2BE2B 3AY0A 5KFDA 2W9AA 2PMWA 2RDIA 3RRHA 5THWA 3BGUA 1NB2A 2XWXA 3BQ0A 1YVFA 4W90B 1A0OB 2JC0A 3AJDA 2YWFA 4BBYA 3LALA 5ETPA 3H5YA 1RHUB 1QTNB 3ILJA 3CE8A 2IAJB 3V6DA 3JAMU 3DKDA 4U7UK 2D1CA 2MB0B 2CWKA 3E8OA 2ALYB 4X4PA 2W2NP 1YJWS 2VBXA 4CT9A 2NQPA 1X4HA 1RWUA 2LFVA 3GFYA 3MR7A 3F44A 5IS2A 4DU7A 4P75A 1AZSA 3TX0A 2VU5A 3WC0A 2KJVA 5FDLB 5CD4H 1XMQF 2W9BB 3DMJA 1I94F 1YIJS 2D9OA 3M30B 3TJ9A 4OX7A 1RBOB 2G0JA 4QWCA 4DZ6A 1XWLA 1VOMA 2MKCA 2ZWPA 3RW7A 5MAOA 2Q66A 3IS9A 5LJ5Y 1UP1A 4PPDA 2DJWA 5LOQA 2J0SD 5KFAA 3WHIA 3CTRA 3KHHA 5T7LA 1M5SA 1N54B 3R5DA 4BS2A 4ILLA 5GVQA 4OL8A 1RHKB 3KXDA 4K5RA 5LL6d 2RT3A 5A76A 5L9NA 4F4XA 4DL2A 2M8DB 5GMDA 3RAQA 5EDWA 1JJHA 4DPOA 1YGYA 3GR0A 2KM8C 1SL0A 2Q6BA 1HNIB 3EGWB 4DX5A 2AX0A 2ILYA 3QO9A 5C2CA 3N28A 1BWEA 2AJ4A 2KU7A 1WKLA 2HHTA 4OI0A 1RCXB 1HYSB 4HKQA 2BVZA 3EM1A 1FXLA 4DV4J 4RUBA 3AB4B 3G82A 5HROA 3BN4A 5D77A 1KRPA 1TVRB 4FKXA 4GC7A 1V5VA 4AD6A 2OMOA 1VQYA 3QWPA 3GWCA 3HSZA 4J9NA 5J2QB 2XG8A 5DM7Q 2C42A 1QTMA 2C3OA 2OI2A 2NYHA 4QIGA 4YDXA 4AUKA 4J9VA 2NUHA 1Z1ZA 3DI6A 3PYGA 2B8PA 2HVEA 3SCKE 4YMEA 3QRQA 4R8UB 2ALZA 1VQOS 2K2PA 2M70A 3NNAA 1FI4A 3GE9A 5HBMB 2GMLA 1JLBA 3HDSA 3I55S 3VZHA 1SH0A 5JVHQ 4WKYA 1FJGF 5HP1A 1P9QC 3Q83A 3OR2A 5FLXY 2VV5A 2R7TA 1IKVA 4OFZA 2QYGA 1L3KA 1S1WA 2DR6A 2FZKB 2KHDA 3IFEA 4ZLLA 4WFNQ 4WKRA 1K8AT 2X1FA 3EJMA 1NK0A 2JEJA 1CPZA 3D6HB 5AT1B 2VB6A 3ZZZA 2ZNYA 5ITHA 4O3SA 4DR1J 2AEMA 1RU2A 4USTA 4DV0F 1SKRA 5KT3A 4IDKB 4A48A 1XK8A 3TVYA 4C0OC 1KWMA 4ZN3A 5L8RC 3MCSA 4EYIB 2FVSA 2HRTA 1YJ7A 1ZH5A 1T9YA 2EFNA 2HBYB 3ILIA 3J81U 5F8NA 2C3PA 2AKWB 3BR8A 2E5IA 2H4YB 3O5TB 3RTVA 1VIOA 4LIWA 2YNHA 3NOCA 3N9UC 2H1YA 4DXLA 4FBUA 1VRTA 1Q5YA 3H2VE 3JSBA 1PC4A 3JSYA 2O66A 2BQRA 2F4VJ 4I56A 3HT0A 3CMQA 4I2QB 4OX8A 4PUOA 1N32F 2V67A 1OWXA 3QAEA 4WP9A 2C2EA 2JHEA 1FRXA 4KJIA 3RBXA 1U0HB 2B8QA 2GV1A 3D54A 1QSYA 4D3GA 4ECYA 1X9MA 5K8PA 4Y0FA 2CJ9A 1CULA 3UI3A 2UU9J 4JI3F 1DQAA 4Q2MA 3M6VA 3US5A 4FF2A 2GO8A 2HQFA 5DQGA 2L48A 4KRWA 3IR5B 4HVZA 2B6AB 3BYPA 3DRSB 2EKNA 4MFBB 2MZJA 4H4KC 3FCHA 4IFYB 2QA2A 3ISZA 3T1YJ 3H5UA 2IDEA 4M1KA 2V2KA 2V68A 1TL1B 4I6WA 4RBUA 3W2VB 3O2IA 2P5VA 2RRBA 4DV6J 3I4PA 3HFKA 2WVBA 4JOUA 1WUUA 3GFHA 5A0YA 1CJTA 2H51B 4CO4A 3HVRA 5DDPC 2DR8A 4ZMMA 3IRXA 4EFAC 1SV5B 4JI7J 2B5JA 3CJSA 2RUSA 3SV3A 2HHQA 3Q8UA 2R8KA 4X4RA 4ZLPA 2KI2A 4E98A 3IR7B 4TXSA 1GTEA 3GCXP 4O44B 1VBZA 2ZNZA 3D28A 3MPYA 2J0QD 2UP1A 2CJXB 4WJBA 4W98A 3LP1A 5DZ7A 5C25B 3TAQA 4LQ3A 1S1UB 2BXJA 3W1YC 4ZN1A 1NMEB 5ETNA 4QIEA 1B0PA 1J2VA 3RU0A 1QD1A 3SDEA 8RUCA 5F0WA 3CCSS 2EFOA 4ECUA 1NSPA 1JNRB 2OPQB 1EX8A 2XZTB 3ILLA 4B3MF 4ZCLA 1T02A 3TWZA 4IKAA 4DUZJ 5SZTA 2CJAA 2C1EB 3P45B 2VQEJ 3MEKA 4CNYA 2H4WB 2D3OR 2VFUA 1TTHB 1KFDA 3JS9A 2QTWA 1PC5A 2OD4A 2Z4PA 5KFPA 1H2TZ 3IWLA 3HT3A 5HVHA 4Z7YA 1S49A 5ETVA 3MOJB 1TKTA 4OZJA 2XO6A 1LOUA 3KK1A 2CQ3A 4A8XA 3DRYA 1S97A 3OL7A 1JLQB 1GQEA 2LA4A 4IYQA 5D4LA 1TU0B 1I94J 2M2BA 4QU7A 4K4VA 4IG3B 5KFSA 3EVWA 3BF4A 1ZAXA 4OHVA 3EMTA 3JTOA 3U1LA 3OW2R 3RYLA 4GO5X 2R4FA 3H7HB 1DQ9A 3HHLC 4HI2A 4X66J 4C97A 2UV8A 3TI0A 2Y1IA 3M8PB 2QG9B 3OFHA 5DJBA 3L95X 2V50A 4DSKA 4RW9A 4UQGA 3W8GA 1PKUA 1V5IB 1R0CB 1VISA 2OSQA 3QGHA 1U1PA 2YQ1A 3IRWP 4XO0A 3PCOB 2MJNA 1S9EB 1S9GB 2XULA 2B4UA 1U4BA 2IMOA 1X5PA 4KR0B 5AJ3F 4ZVRB 2HNDB 1HBUB 4LBIA 4P72A 4RNHA 5A8WA 5KAKA 3V6KA 5KT5A 2IM2A 3TZWA 2DHAA 5KG7A 3SQOP 1F2GA 4RW7B 3QZ8A 1XNQF 1RT7A 4YY3F 3BREA 3GIKA 2KKHA 1UW4A 3ULHA 3ZXWA 4CO1A 2Z2YB 3W2WB 1NK6A 4WFXA 2M8HA 1WORA 2FLOA 1HR0F 3F41A 2GQ2A 4HT5A 3W9IA 3D1OA 5HO4A 2CPEA 3PM9A 4DV5F 2XEXA 1K1QA 2ZVIA 1N34F 1KQSR 5LXRA 2R7WA 4UTGA 2ZDPA 5K9FA 3MCNA 1T9UA 2GX8A 4J9LA 1B3TA 3ENQA 2UXDF 2MY7A 1WDDA 5HMZA 4UF4A 3O3LA 1WI8A 4OYWA 2XC9A 3V6DB 3N6NA 1Y4ZB 2EXUA 5CYMB 4DQSA 2C28A 1AFJA 4ZVFA 3RRKA 1VJQA 2Y3YA 5HMYA 1S6QB 1UA0A 2DK2A 4Y2IA 2DHGA 4ECXA 2E7XA 3T6BA 2OPRB 1GK8A 3NAIA 4DJBA 3I31A 4FXDA 1E6VA 1EP4A 2EC2A 1B70B 4FXWA 4NI2B 5AE3A 3D6MB 2JLGA 2BQUA 2V2QA 2V4JA 2BACA 3R6GB 1D0EA 1CJKA 4OZ0A 1EETB 1O6XA 3PX0A 2VOOA 2LDYA 4ALZA 2OPQA 1RT4A 4FDFA 3BQ1A 3DXBA 2W7PA 3BM7A 3QJPA 4DV1F 2IDLA 3TYTA 2CQHA 2P9CA 4KH0B 2ZJPQ 2ZE2B 1JQGA 2YBVA 2YPZA 2RAQA 5FD1A 1PAUB 2Z2LA 1NJWA 1I3OB 4ZJLA 4JI8J 2FZGB 3A3NB 4M94A 1RTHA 2XCPA 5KT2A 2CZ4A 4DFPA 1WTBA 3CJTA 3QNWB 2MYFA 2G0CA 2I5JB 3EE3A 4TY8A 3NNCA 4QZVB 1S57A 1FVSA 4X66F 3IGVA 1SV5A 2Q79A 3EUNA 4L75A 5KFOA 4DL3A 4NLXA 3V2UC 5KTQA 4ZS6A 1Y3KA 4AT1B 2ZE2A 4YS2A 2HWHA 2W4CA 1RT3A 2FVPA 2VONA 3I5BA 4JI4F 3QJLA 5BJRA 3CF5Q 4DF4A 3AD9C 2HGLA 1TL1A 1YZ7A 3MPWA 3M6XA 1X4BA 1IM4A 1YBUA 3ISNC 2YKMA 4NYOA 3S8SA 1WOSA 4CTAB 2EFPA 5DETA 1S9FA 2DPIA 1U7LA 1G4CA 1Y7PA 5HQMA 4LRFA 3CMAS 4RJVA 1SVDA 5HN0A 5HBMA 4MIAA 1FJEB 3HVTA 2HIYA 1SIZA 1P6TA 3N79A 4HLBA 4F2SA 2X1AA 1FJGJ 2QFIA 4P2FA 4DR3J 2L9WA 2QFJA 4K4ZA 1JLCA 4QR2A 1PYOB 3PO5A 1DRZA 4P2XA 4IRKA 1OPZA 4K2XA 4RUHA 2MJUA 3MMAB 1XJWB 5GADI 3JQKA 1D09B 1DTQB 1Y5NB 1UJ5A 3ICLA 4NE9C 4IR9A 3CULA 2DNMA 2F9JA 5HROB 4RUCA 4RW6B 4DS5A 5AE1A 1TK8A 4O0IA 3GTYX 4WFYA 1JLFB 2C2OB 2AGOA 2DNQA 2WCXA 3CEDA 2WAQD 5F41A 1XR5A 1NXIA 4J9MA 4HI1A 4RL1A 5A8KA 4CLUA 4QU6A 1X4CA 1Q7LB 1RKIA 1RWVB 2GS8A 1SJRA 4HTJA 3V4IB 4UZBA 1IBKF 1HD1A 4UUXA 4AL6A 3HHEA 2AIRB 2HQIA 3S01A 1V3ZA 1ZPVA 3ZZUA 3DRXA 3GYGA 3BSOA 4DV6F 2J6TA 5C24A 4E8UA 3EXYA 3I0RB 1DZ5A 3ZNUA 4J9QA 1M1HA 3P96A 3HHDA 1D9AA 3UD4P 2OPPA 1ZAVA 4MIBA 2YQ3A 3BS9A 4DR2J 1WC3A 2VG5A 1FEEA 2ACMA 2R2UA 5KG3A 3H59A 4KY3A 2AX1A 3V81B 2VFTA 2VA3A 1S76D 1NZ8A 4WU3A 1E6VB 1GMWD 2MQMA 4ZP7A 2MKHA 2IFXA 1U1OA 2QLJB 2N3OA 4NLGA 1CJKB 3GFXA 2I9SA 5KOXA 2ADCA 4EEYA 3DXSX 1AUSL 2QJ3A 2D41A 3NG8A 4DV7F 1O8BA 2RU9A 5LMUF 4K4YA 1IQZA 1SC1B 3BDEA 2MKJA 4DI6A 4NLDA 2Q6CA 2ZH1A 1VQPS 4K50A 3CJ5A 1JXEA 3SBMA 2FD2A 4OZ5A 3HM9A 3RRGA 4LF9F 5KFTA 4AL5A 4TU8A 1TMMA 2GW8A 3CCES 1RWMB 2GMHA 1SJ1A 1UFWA 2AJQA 5D0RA 5IZHA 1ZTTA 1PIEA 4CLYA 2CAJA 1C0UA 2XM3A 5D4PA 4DSJA 1RHRB 3R5GA 4NI2A 1R7IA 4PAAA 3UD5A 4EO6A 4M95A 4DLGA 2RILA 1H6KX 1TV6A 4I67A 1RK8A 2EFQA 2QRRA 1H74A 4UT4A 4PRFA 3GILA 2ZJRQ 2HQCA 1VHFA 1ULRA 2D3ZA 1RWPB 2QLXA 2WONB 1FRKA 1WTFA 1VK3A 3FRYA 4PWUA 4EBEA 2YH1A 1RP5A 1Y9OA 2LQBA 3GLJA 5DLFA 1QJHA 1EJ7L 3DRRA 4C48A 1YJTA 2OJ3A 3SQGB 4AXIA 1VS3A 2GFFA 4LUBA 4B17A 4EMDA 3HXMA 4DV4F 1WG5A 2HHVA 2M52A 1S1TB 2KT5A 3CDWA 1HNZJ 2G2OA 2FPHX 1SCJB 2RH3A 2R7OA 2XHCA 3C66A 2CPFA 3MM6A 3TJ8A 3UCGA 3HPOA 1SB6A 4DPTA 4LF8J 2E5GA 4NMXA 5DQIA 2CXEA 4ICLA 2MPUA 3DMJB 4FF1A 2BANA 3LP0B 3MMAA 2DCLA 3OXFA 5CZXA 4Q43A 3DC2A 4NOHA 3T9NA 2W9BA 3DHWC 4WXOA 3JTPA 2LXIA 2RDDA 4UW2A 4TU9A 4IUFA 3K5OA 3CD0A 1TQLA 2FJAB 5HVFA 1R8AA 3HFZB 4AQYF 2O67A 4N41A 2KRRA 2ZHOA 3HVAA 4BCAA 1NKBA 1XNQJ 4C9DA 1T11A 4RX6A 4L3KA 4OX6A 2KO1A 3M8SA 4HHUA 3QT7A 4YEAA 4J9OA 3N6LA 3DRPB 4CLLA 1UL3A 1EIYB 1WWHA 3MOZA 3K17A 5GMEA 1U49A 2OTJS 1R6YA 4LF6F 2KZZA 1NEEA 3EZOA 5BR8F 1X4GA 2O1PA 1Y10A 1R8BA 2OO4A 2CQBA 1YJUA 1U2CA 3AA8A 3AOBA 4G1IA 1Z2LA 2RSQA 3TP2A 3VHQA 4F2RA 2FHMA 2X1GA 4Q8FA 2DRAA 5A8RB 3H25A 2HKEA 4P52A 2XY7A 1HBOB 1WI6A 2NYIA 1WG4A 4ECZA 1RBAA 1EQMA 1HA1A 2CDRB 2DITA 3RAMA 3VZIA 1RWKB 4IG3A 4CNZA 1HQEA 1S5ZA 1FK9B 4RR5A 4PYDA 4LSNB 4NZ7A 2LU2A 1UA1A 3GG1A 2VC0A 4RBTA 2W25A 5U47A 3M7VA 2UUBJ 1N33J 4CQ1A 2DGOA 2VF3A 1SQFA 2XHWA 3QIPA 1B0TA 3POTA 4ES2A 1H73A 1RAAB 2VUGA 1VC6A 1DJ0A 3ETMA 1HD0A 3TJAA 1LW0A 2XMKA 4PXEA 3K8WA 2CPJA 3MEEA 1T9WA 4J91A 1Q8IA 2KFYA 1MMNA 1NLKL 1VGYA 3HFVA 4K2JA 1EETA 1SBRA 3GV8B 3ZZ0A 1ZA2B 3GU0A 3C6TA 3A12A 3TUZC 1IBLF 3KJVA 3OL9A 2F8EX 2G2ZA 1VBYA 3J7YI 2DEJA 1IKXB 2E5HA 2N4CA 4I68A 3KMSA 3IWNC 3IRXB 2VQEF 4XDDA 3CD6S 3KLHA 4LR7A 4Y65A 3QIPB 2LEAA 1YJRA 2UUWA 3L09A 3VTIA 5J1EB 4RNNA 4FBTA 1I5OB 4UOGA
chains in the Genus database with same CATH topology
4ECWA 3GMGA 3VAFA 3IO1A 3TNVA 2GIRA 4QIFA 1IXKA 2LEBA 1P1LA 3ITHB 1WELA 4KV8B 3KOAA 4QBUA 1TUVA 4NA1A 1R31A 1AUDA 2G4BA 4MK8A 3SSSA 4UY8T 4F3QA 3SZ2A 2AW0A 4ZA1A 3GYNA 4O3QA 2VFRA 2MHNA 5CYQA 2ZHAA 1ZTWA 3VAJA 4JI7F 1LWFA 1X7VA 1X9WA 1TFWA 5KFGA 2VG5B 1S0OA 4OI4A 3D2WA 4PG4A 4ELTA 2DGVA 1S79A 2CQDA 1XEZA 4TNOA 1IR0A 3TRGA 4DX8H 2B6AA 1A9NB 5KG2A 1HI1A 2I0XA 2J9EA 3U1NA 2P9GA 1URNA 1C0TA 3UCZP 6FDRA 3PXGa 2KG1A 4OHYA 1LW2A 4RW4B 1T7PA 2YH0A 5HLFB 1BGXT 2XSFA 2ZKUA 4JBCA 3Q8SB 2CQGA 2VA2A 2KVIA 4F3MA 2YKOA 2LQ9A 3GG0A 5I4MA 4JV5F 2HLUA 4YOEA 3MTKA 1WHVA 1E6YA 1KEKA 4CIOA 4NCAA 1KLMB 3PEHA 3ZZRA 1Y5IB 3C8YA 4U7CA 1NK7A 1MU2A 5GAEI 5IM0A 3NCQA 4LVOP 7FD1A 3UD3P 3GB0A 2JVRA 5CCLA 3LP1B 3M2VB 4NLVA 5C25A 1TKDA 1FKOA 2RB7A 2U2FA 3DU5A 3HLUA 4UY85 5EGYA 5I3UB 3SSQA 5DDRC 2RUGA 3NKYA 3TA1A 5GAEU 2MGZB 2DGTA 1D8ZA 2EK1A 4P6QA 5G0RA 1NJZA 2BOPA 1IKYB 4BC9A 3QZ7A 2BBEA 3RW6A 3OFEA 4ZP9A 4A8QA 4JI1F 3CO9A 1TVRA 3OV7A 1LWEA 3LOUA 1X9SA 3JTNA 4NRTA 3H2UB 1DHMA 1WTBA 3CJ4A 1CG2A 4DQQA 4QCLA 1SIWB 3IAM9 1YWXA 1SI9A 5DLGA 5CYJA 3KK1B 2OTLS 4FP9A 2RQKA 4IG0A 5B0FA 4XK8C 1S1XA 2ILZA 1Y3JA 4Q45A 2E9ZA 3CC7S 4UQTA 1ZM2A 3MPVA 4IH5A 5HQ8A 5GAGI 4UOCA 2WOMA 1QAXA 3IA0A 2B4VA 3CCLS 2A1BA 1I1GA 2JX2A 5DDOC 1N56A 4ERDA 2IM0A 1LWCA 3GV5B 3AA9A 1NNDA 1VQLS 3CCWA 1DFDA 1UKUA 3HKZD 3T5HA 2ADBA 5MLCV 3HF5A 3M9OB 3K0JA 2VL1A 4X64F 2QT7A 3ONQA 2EW9A 3G4SS 4J9RA 2V8VA 2WRMA 3T6JA 2UVUA 3QGPA 4ED6A 4PXBA 1D9DA 1FNMA 4RW8A 1R0AA 2CQIA 2CQ1A 1S72S 4Q2LA 4CZCA 2CZVC 1GAOA 2MZQA 2HIQA 1HI0P 4M8LA 2R2SA 2IVYA 1RT1A 4Q5VA 2B9XA 2PSZA 3TARA 3QWUA 4MK7A 1JLGA 1R8HA 2DD8S 3UCUP 2H5EA 5IT0A 1WNEA 1TP7A 3MEDB 2ZH9A 4FPRA 4IFYA 4NX9A 2V4JB 4Z37A 3DRSA 3V4MA 1AFIA 2UVWA 4F8RA 4O4GB 1U45A 2ZC4A 3BSNA 3M2UA 1K0TA 2DNKA 4X4SA 2YNFB 2B0GA 5I3QA 1KLNA 3MWBA 3K5NA 3BEGB 1T95A 2YX7A 2GJIA 4IOBA 1E6YB 4KFBB 4LSLB 5IXUA 1IJFB 1U8SA 2OH2A 1NJIT 2B3TB 4N8NA 3I87A 4XPCA 4DSEA 4CH7A 2M3DA 4DG1A 3M30A 4FXVA 5HMWA 2V94A 2IJNA 4KHRA 2VD3A 1Q86T 1WF2A 2M88A 1T3OA 5E41A 1LW2B 1FERA 3ZZYA 3I9V9 5CA5A 5F8GA 1S6OA 4IRCA 2R7RA 1TAQA 2NPIA 4RW4A 4DHVA 3PFEA 5A8KB 1KTVA 5KFVA 4I6YA 3PX6A 1HHSA 3FSYA 1O5JA 4NLQA 4AL7A 5KFRA 1FNOA 3PACA 3BGFA 1H7WA 1T3NA 2E44A 3MHYA 2ZM6F 3OR1B 1NO8A 3I0SA 2LECA 2EK6A 2J9CA 3T5JA 4ED2A 1QM9A 2WBRA 3M32A 1D9FA 3OR2B 5KFBA 2ZH2A 2M4MA 2VG6A 3SFUA 5G0RB 2HNYA 3J7Z5 3ZZOA 4YB7A 2GQQA 5I3UA 2BJDA 1XN9A 2HGNA 3OJUA 4IR1A 1S6QA 4PPZA 3RB4A 2DPJA 2ZOFA 3HHLB 3I56S 2K8GA 4QOTA 3JSMA 3TAMB 1LWCB 5D8HB 4F4YA 3C6TB 3CT9A 4M63A 3KLFB 5G4DA 3M8RA 3DOKB 3VAMA 2ERRA 3OTDA 2KH9A 3AJ1A 2RS8A 1C1BB 2V8GA 2YWHA 3WZ0A 2KXHA 5F9LA 2ZOMA 1RT2A 2J7WA 2L3MA 3L7PA 3PNIA 1HNZF 2IAJA 2CKWA 2LXFA 2CVIA 1HQUA 3DLHA 1PILA 1R89A 2Y0SD 1VQ4S 3SXLA 2JOQA 2IVFB 2G1DA 3R1LA 3QGIA 1HNWF 2ZBIA 5KFYA 4LSNA 2I5JA 5DGBA 1J5OA 4DR1F 2UXBF 4TQSA 3KTQA 3MEDA 4MKAA 2QZ8A 3IBWA 2W9CB 2JLEA 4Y00A 2DGXA 2EI5A 4AXJA 4NLWA 4FF3A 3CB4A 6FD1A 1U1NA 2ZITA 4IH6A 2BABA 4A8SA 4KE5A 1JNZB 4PQUA 2AJ1A 4DR5F 5CXTA 1UJ4A 3O1LA 2FHOB 2GQCA 4OHWA 1SH2A 2E1CA 2BANB 3NNHA 2MSSA 2XZWA 3CWJA 2MKKA 5E7OB 2WB1D 3TO8A 3OVBA 2OFGX 4C3LA 1XR6A 3VALA 1M1KT 2ASJA 2F1FA 3SV4A 2DNPA 2YY3A 1W2BR 1FDNA 1YITS 2CQPA 2ZD1B 4WIIA 4YB5A 4DEZA 3K5LA 4Q44A 3I82A 2AV5A 2Z8QA 2HS3A 4OJ3A 3QJJA 4DR6F 1DLOA 2FJWA 3M9NB 1H2UX 2FHJD 2UV8G 5C5JA 1OS5A 2I8EA 2ZVSA 3M4XA 1FEHA 2PI4A 4WXWA 3I32A 4PG7A 3KG4A 5KFQA 2KFNA 2F3JA 1P8GA 1TAUA 1JXLA 2BM1A 1C0UB 2RS2A 4EBDA 2EWHA 4TY8B 3F73A 4TYBA 1GNKA 1VC0A 1MROB 1HFEL 1NK5A 4HH0A 1MMDA 2DISA 4HHJA 1YRUA 2GC8A 2L9DA 1F5CA 2YWEA 3NS6A 2Y1RI 3DRRB 3DLKB 4BHQA 1X8DA 3UDLA 4ILMA 2F9DA 4URSA 2XS5A 3LWMA 3KWMA 3HJFA 4GMKA 2LQ5A 2OP5A 2R2RA 2IA0A 1HBMB 5DG7A 2XBPA 1FNXH 2XNQA 4J37A 1WF1A 4G1QA 1C1CB 4O3RA 1Q82T 2JWNA 1ROFA 3DLGA 1ZYQA 4B9TA 4ID5A 1H2VZ 3OR1A 1FTRA 1GXLA 3R5CA 4ZCMA 1D1UA 4DUYF 3BJYA 5HP1B 1FKOB 3RR7A 4X62F 2QMXA 4DQIA 5AXMA 2J7KA 3TOQA 4O4RA 3B82A 2CQ2A 2HPUA 3FDSA 1FRMA 4Z2XA 3MTJA 1S1UA 4Y2KA 1M90T 4FNHA 3GYXB 4DFJA 3GIMA 4L72B 4Y2AA 2UXCF 1NKEA 2JJ4D 3TVZA 1KOHA 4H4KA 3MM5A 5JXSA 1K73T 3LP2A 1WG1A 1DTTA 1RDRA 2DGSA 4TLQA 2FHJA 5AXKA 1R43A 3CIMA 1AW0A 3FZBA 2AGQA 2P6SA 5F8JA 1XERA 3OTCA 2C3MA 2PMZD 5GMKa 1RA6A 3KLGA 1XC9A 1YJ9S 2LQJA 2BV3A 1MWZA 2NUUG 1LW0B 3NMAA 4N8OA 4ED0A 2PC6A 1CEZA 2N7CA 2J6UA 2FJEB 3T9ZA 3GSDA 2EVZA 2OPPB 4ZPWR 1KQKA 3BO2A 2EG2A 2CG4A 2HHSA 3NP5A 3H20A 3LANA 5KG1A 2C22A 4K4TA 3MMBA 3Q0AA 4C2MA 3MUTP 1VQMS 3THTA 1MW7A 1Y5LB 2WHOA 1JLGB 4C3MA 4KGMA 1BD6A 1S6UA 3LPYA 3JSRA 1KQFB 3PW7A 1SL1A 2X1BA 4F4ZA 2GJ2A 2E66A 3AHPA 3DLEA 1X4DA 1RTDB 5KFWA 4LJMA 2FJVA 2DHXA 3KHRA 2QMWA 2PO4A 4C8NA 4YB6A 3W2VA 1FRHA 3CJKB 3JYTA 2VC1A 4CT8A 3CCVS 1KOOA 2FC9A 2UUAF 4F02A 4K0KF 3DU6A 3SI8A 4Y2MA 5IM0B 3DDNA 4A8KA 2W4DA 1WEXA 2B9WA 3UFCX 3GV7B 3HZEA 1HW8A 5K5MA 2FIUA 2MGZA 2AYMA 1OQ6A 3FFIA 4MJKA 1TZ0A 2ASYA 3W2WA 4TLRA 2NZ4A 2RVJA 3OL8A 4IOAQ 2R7UA 4USIA 2CRLA 3OTBA 1IKVB 5KFLA 1SXLA 4Q0BB 1HNVB 4QW8A 4C98A 5IT9Y 2W7AA 2FLPA 2WONA 3VR1A 5EN1A 3O44A 5F0UA 4TKTA 1N5VA 3DN9A 3RAXA 4ELVA 1HPZB 2B4PA 3M2UB 4DR3F 4OLOA 2R7QA 1L5UA 3RR8A 4C0BA 4WCEQ 4E0DA 4CCHA 1G1XA 3MGJA 4KKOB 3OVSA 3PKMA 2JZ5A 2ASDA 3JB9k 3KFWX 1WD6A 4GKJF 5A8RA 2BRLA 4MAKA 4O23A 3HHNB 5EUHA 2DCUB 4PWDA 1YG0A 3G6YA 4CO0A 2YWGA 4ZK7M 3BGRB 2GGPB 1N5SA 2YNGB 1IKWA 3PFOA 1RT4B 1JMTA 1FD2A 1NK9A 2UUBF 4LF5F 4X4QA 2E9TA 1TL3B 2DR7A 5E3PA 5IQ6A 2IYIA 1FRLA 2LVWA 1V9OA 3FEZA 3GFZA 5KFIA 4HYKA 1M5PC 1MWYA 2ZH8A 1S0MA 2FJBB 4QYZJ 1CC7A 1ELOA 2KYZA 4ZHRB 2RJZA 3FNNA 4EWTA 3M9MB 1U6ZA 1APSA 2AF6A 1YSJA 4URQU 3VQSA 1OSDA 2XY6A 3HHKA 3TUJC 5HL7Q 4OJGA 1S9EA 1KHVA 1HW9A 4EYHB 5KFFA 3EZ5A 4RW7A 1M5HA 3MM7B 2DH7A 5DO2A 2QA4G 3LW5C 2FVCA 1H98A 1FK9A 3HK2A 4J9PA 2QYCA 2K3KA 1VMBA 4EZ9A 2VODA 4C8OA 4IG0B 1K0VA 4YR3A 2DNNA 4F3OA 1D3WA 2QLWA 4GKKF 1A7GE 4LF4F 1UETA 1HMVB 5D6GA 1DARA 1S9GA 3CJKA 1U2FA 3K5MA 5H9EJ 4ILLA 1X0FA 2W7OA 5KFJA 2OIHA 2BE2A 3CCQS 3MR6A 4ED7A 1ZBTA 1WHYA 2HVZA 3MM9B 4R5PB 4IQXA 4OZLA 5KFHA 4C4WA 4OIXA 1FRIA 1OQ3A 1YRXA 3MECB 4EGLA 3MAHA 3B4DA 1IN0A 3DM2B 5EWGA 4NCGB 1UVLA 3PW2A 3G8QA 1S0NA 4DBQA 1WF0A 3EZUA 1FHTA 2ACYA 4FYDA 4USJC 2E9RX 1XBWA 4MFBA 2HS0A 4DS4A 4ILRA 3CD5A 1TKTB 5F8IA 2HG4A 2BM0A 2XMTA 5J2QA 3DYAB 1ZM9A 4CTAA 5B0DA 3OJSA 1FJCA 3HI9A 1YQHA 5IWAF 1NB7A 2R8JA 3U1MA 1YTYA 5E2QA 3OSNA 5D4OA 5M2RA 3KHGA 3IG1B 4NLTA 4WF9Q 2DGWA 1U2RA 7FDRA 3QAUA 4FVMA 4N5SA 5A2QY 2B43A 1RTIB 4OX9F 2YTCA 3I96A 4JI8F 4C8KA 4KPYA 5K14B 2J9DA 3EX7B 3E01A 1RTHB 2J7UA 1XTZA 4WTYA 3CMES 1CSJA 4O4GA 2MZRA 3DCAA 3AQOA 1N0UA 3PHEA 4A8WA 4A8FA 3IS9B 3OSPA 2QEXS 3KKFA 4QR1A 3PW0A 3HHLA 3SEOA 3CCUS 2J76E 1TL3A 2MQLA 3U27A 2V4QA 4I69A 1U1RA 3KLEA 3HHLD 1X0PA 2LXUA 1Q78A 2YKAA 2LLZA 3KG1A 1SUQA 4WYWA 4WU2A 4DR2F 4FS1A 1N6QB 4WK1A 3NAHA 4NA2A 2K3IA 4K4SA 1O0PA 1IQTA 4YDDB 1OO0B 2DIUA 1KONA 3IWXA 2DR5A 4X65F 1Q79A 2CQ0A 2MZSA 3LQVA 3DLKA 2JFKA 4HDGA 3DGPA 4WE1B 4NLSA 3UNGC 3MXHP 5IT4A 4ZVGA 2Z2MA 2VG6B 2B9YA 5CYMA 3DLLQ 2ZH4A 4JV0A 5DG9A 5I3PA 3EGZA 3CJ3A 2Z0GA 2RF2A 4I2PA 4X2BA 4Y2CA 2GMJA 4IDKA 3VAIA 4B9VA 4ED3A 2IC3B 4TY9A