4Q2LA

Atomic resolution structure of the e. coli yajr transporter yam domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
PPYVSSLRIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Major facilitator superfamily MFS_1
publication title Atomic resolution structure of the E. coli YajR transporter YAM domain
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q2lA00
2ROPA 1FE4A 3HFKA 1GXUA 2XMMA 2XMJA 3LGMA 1P8GA 2XMWA 4NPOA 1TL5A 4QOTA 1Y3JA 1S6UA 4OJ3A 3BR8A 3HX9A 4FNIA 2LQBA 1URRA 3IWXA 1QUPA 2JDJA 5KAKA 2LQ9A 1FE0A 1FVSA 5F0WA 2OFHX 5K9FA 2IFXA 2ZDPA 2KT2A 1Q4RA 3LGNA 1AFJA 1Q8LA 4OJ1A 2W4DA 4Y2KA 1JWWA 1OQ3A 1KVIA 1K0VA 1IUJA 2RSQA 4DPOA 2QLXA 2G9OA 1SI9A 3FRYA 1FVQA 3CJKB 1N5VA 1ULRA 2FIUA 2OD4A 1TZ0A 3QMQA 2BBEA 1X8DA 3HHLD 2FB0A 2BJDA 1YJVA 1LQ9A 5B0EA 4HI1A 2AJ1A 1MWZA 2K1RB 3WDOA 5B0DA 2HQIA 1SB6A 1N5TA 4Y2MA 5IXUA 2GFFA 4NL5A 2RU9A 4OJGA 3K7RA 2ACYA 2KT3A 2RMLA 2QIFA 1P6TA 2PD1A 3HDSA 4OJHA 2PGCA 3KG0A 4Y2IA 4A47A 1CC7A 2OMOA 4U9RA 4YEAA 5T7LB 1S6OA 1W2IA 3MZIA 3BN7A 2K7KA 2VV5A 3FMBA 1FEEA 3HHLA 2W4CA 1CPZA 2FHMA 3BB5A 1GXTA 2W4PA 5A6WA 4YDXA 3BDEA 1Q8BA 3F44A 1VQSA 4A4JA 4F67A 2HIQA 4A46A 2ROEA 2N7YA 2GGPA 1V3ZA 1TUVA 3T9NA 3KKFA 4DN9A 3GZ7A 1KQKA 2IYIA 2L3MA 1AW0A 2LXFA 3FGVA 3TRGA 2CRLA 2GCFA 2Q3PA 1KVJA 4A48A 2QYCA 1YJRA 1XBWA 1FD8A 1N5SA 2RILA 5B08A 2BUNA 2K2PA 5B0AA 1Q53A 1YJUA 2AW0A 4Q2MA 2KYZA 2OD6A 2KKHA 3UDCA 3KG1A 4HH1A 1CC8A 2HFNA 4OIXA 1X7VA 2OAUA 3HF5A 2BJEA 5B0BA 3HHLC 5B0GA 4Q2LA 3I9ZA 1SQEA 1AFIA 2ASYA 1RJJA 2ZDOA 4FNHA 5F0UA 4DL0C 3KNGA 4HH0A 2XMUA 2N4DA 2XMTA 1X0PA 1U7LA 4HL9A 3CJKA 1Y3KA 4ZOSA 3BGUA 5B0FA 2K7JA 1VQYA 3DXSX 2OP5A 3VTIA 1Y9OA 2FTRA 2OFGX 3TOQA 2K1RA 2N4CA 3E8OA 1TR0A 2HLTA 2ROGA 1YJTA 1YRXA 1N5QA 1OQ6A 2VH7A 2GO8A 5B0CA 4EFAC 1Y0HA 4ZA1A 2AJ0A 3QGPA 2GA7A 2AP6A 1APSA 1WD6A 2QLWA 2LDIA 2XMKA 2EW9A 2IYGA 3DCAA 3HHLB 1OPZA 5T7LA 3BF4A 4HI2A 1R6YA 2XMVA 1YG0A 3IWLA 3TNVA 1JK9B 2HLUA 2OKQA 3BM7A 1FESA 3MCSA 5A6PA 1OSDA 2GGPB 2GV1A 2BYCA 1TL4A 3LO3A 5B09A 2HFOA 1MWYA
chains in the Genus database with same CATH superfamily
2QA4G 4X65J 4D3GA 1HARA 3IWNC 1RAFB 1ZM3A 1URRA 1X5SA 4LSNA 2RQCA 2BM1A 1P1TA 4F25A 4PXEA 1XTZA 4KPYA 1KRPA 2YWGA 1NJWA 3KK1A 4L73A 2ZD1A 2W1BA 4QU7A 4J37A 4IG0B 1VJQA 5T7LB 2DRAA 4M95A 4IO9Q 2OPQB 1F2HA 1S1XB 1FF2A 1Q82T 4DQQA 3OVSA 4CLUA 2ZH8A 2K2PA 4J5OA 4JI8F 1J2VA 1Q5YA 2GZOA 3C6UA 2D74B 3SMZA 4Z37A 3EVOA 1JLAA 5KFWA 2W9BA 4LRAA 2K1RA 1RT4B 5LL6d 5FLXY 1BLUA 2G13A 2XSFA 3KUHA 1HHQA 4J91A 3MUVP 4DCOB 2Y1LB 2HVIA 2VG7A 2PE8A 2HQDA 3THVA 1S1UB 1U6BA 1NB2A 2YBVA 3H5XA 2D3UA 3GV8B 2KYXA 4QWBA 3W63A 5JVHQ 4DR6J 3HVAA 2WOMB 4I6AA 2AKWB 4LFBJ 1QE1B 3H42A 3RUBL 2RSQA 1W7WA 2ZUGA 1GNKA 4GO7X 1VC6A 1T03B 3W2WB 2XS5A 2Z57B 1T9XA 4WP9A 2ASJA 2W25A 4NI2B 2JH3A 3OFFA 2CNLB 4ECXA 3R5CA 2I38A 1B0PA 2NXNA 4DL2A 4WJBA 3IM8A 1N5SA 1Q7LB 3LP0B 3D0GE 3GB0A 5LJ5Y 2ZDOA 4ZP7A 4FDFA 4KQZA 3SV3A 1CJKA 4RWXA 4TU7A 2P9CA 3RB4A 4WYWA 4ZPDA 3EZUA 4JI7F 5GMDA 2BYCA 3ILOA 3VGSA 4Q0BA 4RUAA 2B9EA 3X3UA 4ICLB 2JDJA 1B99A 1RTHB 1X4CA 1ZYQA 3K5MA 5D0EA 2ZM6F 2W2NP 2W8LA 1HWJA 4HACB 1CVJA 4PR6A 2KZMA 1C1CA 4IRCA 4NLWA 4NLSA 4X62J 1FEEA 2COLA 5KT2A 3PYEA 4MK7A 1JX4A 2Q3PA 5DDQC 1BQMA 1LWEA 1UZDA 5KFPA 3CJ5A 5KG5A 4HHJA 2NZCA 2B3TB 2HS4A 6AT1B 4DV1F 3OHBA 4ED2A 2XLKA 1YGYA 1RHKB 2HEKA 2YPZA 4ILRA 3BBCA 4YR3A 1H2VZ 3AQOA 1YJWS 4LSLA 4CYUA 5BR8J 2RH3A 3BF4A 3MMAB 1LNQA 3LO3A 3MEKA 5CAAA 4AFFA 4K59A 1LW2B 4ECUA 1Z2LA 4ZHRA 2ZBCA 5HMXA 3WZ0A 1RA6A 1TL1A 3UCGA 2Q6BA 2G1DA 1SVDA 2RMLA 1UVIA 3W7BA 4EWTA 2HWTA 1W2IA 2GQ2A 1HYSA 1VQ9S 5KT4A 1NM2A 5C42B 2MKIA 4MIAA 4ECVA 5DQIA 1WDTA 2V2VA 3QT7A 3CXCR 3RBEA 4OI3A 4WIQA 2HVZA 4B3RF 4PCQA 3I6PA 2H51B 5D4LA 2V4QA 1HNIB 3K57A 4M1KA 2N4CA 3JS9A 4OYZA 2LVWA 4H54A 3NGTA 4YHHF 1YRUA 1VQ8S 2CQ4A 4UUWA 1TUGB 2DXFA 3VQSA 1KS2A 3FVYA 2Y0BB 4L75A 3FSYA 3CJQA 3NNAA 2R8KA 5JXSA 3OR2B 4TVAB 1SCJB 4DU8A 3N28A 1U6ZA 2GVZB 2OI2A 3J7YU 2X3GA 1RHUB 3GV5B 2YNHB 4B3MF 2QL9B 2RRNA 3JTPA 4I68A 2VF3A 4JI5F 3HMJG 3QLHA 2F63A 5ETVA 4DMZA 4P2MA 4ZLJA 1PYTA 1RISA 3HSGA 4JI0J 2YNFA 3BKFA 3BBBA 2LFVA 3UVJB 2XG8A 4NCBA 4CI0B 5AE3A 1DFDA 2AYGA 4OL8A 5DGBA 1Q5VA 1KQGB 1ZOTA 4X2BA 2IC3A 2OP5A 3R6LB 3M8PA 4LF6F 3PVXA 2ROGA 1LWCB 1CBKA 1RHRB 3SV4A 4NZ6A 1I1GA 1LFPA 4AQYJ 4C8LA 4K5SA 4AXJA 3MMCB 2V4RA 3CCWA 4JI6F 1U47A 4P9SA 2CPDA 4QR0A 4HKQA 2WVBA 1EETA 2HHVA 2E44A 2HFUA 1OO0B 4LF4J 3HHEA 2UVUA 2NS1B 4RBUA 2EBGA 5AXNA 1PGZA 4ID5A 4DV2J 4QU6A 3EJMA 3TWZA 2ZH6A 2AYMA 3NKYA 3OR1B 5ADZA 4A4JA 4LF1A 2DR5A 4WZQA 2EG1A 1FKAF 1AXQA 4ZN3A 1PBUA 5HQ8A 1QAJA 4KBIA 1A0OB 3M8ZA 4HL9A 2DNMA 3T1YF 1LKZA 4PWWA 3QJPA 1T3NA 3U1LA 1NK5A 3A4TA 2ZH1A 3VF0B 5A8KB 4J9RA 3CCTA 4R0EA 2F8EX 1T9VA 3DLJA 4IH5A 1IKVA 4ETZA 5KFIA 3JSMA 4ELUA 2DNYA 1VQLS 4JV0A 1FNOA 5K8MA 1JLFA 2BVZA 2VQFF 5K8OA 4R0JA 1FE0A 1M5PC 2E7XA 1NSQA 2N82B 1Q8LA 1KVIA 8AT1B 1U0SA 2ZZMA 1CLFA 2MB0B 2DR8A 2KFZA 3OSPA 1F9FA 3DLLQ 1NPKA 2HVEA 2J0XA 1N32F 5KFTA 1RT2B 4WE1B 1J5OA 1ZH5A 3GIIA 1VCTA 1HKAA 2OPPB 2CG4A 3LANA 3Q2TC 3I9V9 3FZ2A 2V34A 3Q8YA 5KG2A 1S1TB 4KO0A 5DG9A 1W2BR 3I4HX 4Q8FA 4DR1J 3Q89A 3RBDA 3C8YA 3L7UA 4MFBB 1S0MA 3ZZPA 2VDHA 2XM3A 3DHWC 3L09A 2XLJA 1Y0HA 5M2UA 2GVDA 2NPIA 1PYOB 1FE4A 3J81j 1NXIA 5H1SV 1AYEA 1Q81T 3EPGA 2DY9A 3UO0A 2AGPA 1RP5A 3BEGB 2VL1A 1NZAA 3LUYA 3GFXA 2CJAA 3QBCA 4EZ9A 3SSQA 1RYSA 3JAMU 1R7IA 1RACB 1X5PA 1NKBA 3DOMB 4TQSA 4LMZA 3CDWA 1UWBB 2IJFA 1WJ9A 4YDXA 3MR5A 4DSIA 3Q83A 4L3NA 5C25A 1KQKA 4OHZA 1VQOS 4LRDA 4RR5A 5BYRA 3M8QB 3BBFA 2P8IA 4DEZA 4ENOA 1VK8A 4HH1A 2IM1A 1F60B 1G4CA 5DO2A 1QTMA 3LALA 3L9ZA 2XMUA 1XIQA 3MM7A 3TUPA 3VTIA 2NYHA 5DM6Q 1N5QA 4A8YA 5B0CA 4RW8B 1C1BA 2OIHA 4JI1F 2CJ9A 4X4OA 3N0VA 3QPIA 1SKWA 2ADCA 4DPXA 1VBYA 4R5PB 1SJ3P 5E33A 4DDFA 2AD9A 4F0KA 3EXYA 4CT8A 4KTQA 5I42A 2VKRA 4OYIA 4F8RA 3DLGA 4OYOA 1JNZB 2BE2B 4FZVA 1GTHA 4OHYA 3UD3P 2SXLA 2HK2A 1FX2A 4PXCA 1NKEA 4JV1A 2VASA 3QRRA 4P75A 2YKMB 2DJWA 5CZVA 3DLBA 5CQGA 2DNRA 3M32A 2G4BA 3QGHA 2EFQA 1X60A 3R5BA 1OWXA 3NXZA 1V3SA 4CLPA 4C9DA 3PW0A 3QJLA 3S8SA 1RHMB 1BQMB 5HVHA 3TOQA 5HBMB 4F2SA 3VGVA 3OHAA 2QFJA 2D41A 2LDYA 2KTQA 3PM9A 3Q2SC 3H5YA 4DPUA 2L08A 3K58A 4MK8A 4LIWA 3H0PA 3FEYB 1FK9A 3PJWA 4KAIA 4NLVA 1VQMS 1WKLA 2I8EA 5K5MA 5HI7A 2P2CB 2IHR1 4M5GA 3G87A 2HWIA 2Y1JA 2H1YA 3NG8A 5F8MA 2VONA 1WTBA 2VJVA 5HVGA 1LEOA 1HMVA 1NJIT 1RAIB 4W4MA 3CCES 3BDPA 2CA9A 3BO3A 3D1HA 4I69A 3QJJA 3UN2A 1KEKA 1TQLA 3MFHA 4FKXA 3MWBA 2XO7A 2EFPA 4CO4A 4UUXA 1K44A 2MJNA 4C0OC 4MYUA 2BR0A 4J7CA 4C0BA 3CJ8A 4IQMA 2HGMA 4ELVA 1RWKB 3NGSA 2DIUA 2I0XA 2CAJA 2MLXA 1NUEA 2QT7A 1Y9OA 1OSCA 4B3TJ 1YJTA 1FXLA 3V6DB 2RHQB 1RWNB 2OHDA 4XO0A 3HHLB 4V19X 1PYSB 4A8WA 3OXGA 2RHSB 2PFDA 3D5MA 4NE9C 1IKYA 3MCNA 2IRXA 2B4UA 4PUOB 3HHDA 3HHKA 2YKPA 2XMAA 4DS4A 1S10A 2AWZA 1TK5A 1RAEB 5THWA 4OX6A 3OTEA 2M5YA 3POTB 4ZVPB 1KHWA 1S9EA 1R43A 1LWFA 1WC1A 3KLGB 1KLMA 4LF5J 1HD1A 5IXUA 3EVMA 4WK1A 2KT3A 3MOZA 1HWUA 3NRBA 4Y2AA 3IRXB 4TU9A 4RNHA 1HPZB 3PXGa 3MAAB 4PPZA 1YDLA 3V4IB 1HNZF 1TVRB 2F8MA 2LXFA 2V4JB 2HNZB 3DOKB 3GR0A 4LFCJ 4CO1A 3Q8VA 3I0SB 3SEOA 3SSRA 2VA2A 1E6YB 1FRLA 3TZYA 3P8BB 3DXSX 2FQQB 2KVIA 1H3DA 4CNZA 4EFAC 5E7OB 2FZKB 1XMOF 2V8VA 1APSA 3DCAA 3KDNA 3MOJB 1RTJA 4OLPA 3VALA 3DRSA 2OKQA 4OI0A 3C3LA 1R0BG 2XSJA 3FC9A 5F8HA 4B3OA 5K8NA 2HNDA 2UUBF 2XHWA 1SQFA 1IKXA 4NA2A 3A8KA 3BSNA 3HD1A 1SH0A 3O44A 2YNIA 2CQPA 2DH7A 1RT7B 3H4BA 1HI0P 3AA9A 3W5XA 4DV5J 3C16A 1YJVA 2V8PA 2QFIA 1B7FA 4I56A 4FP9A 1VC0A 4X66F 4KR0B 1ZA2B 2QL7B 2PSZA 4U6PA 1UVNA 3I56S 2AV5A 4AL5A 2GQCA 1N6QB 5A0YA 2JOQA 2WHOA 2XULA 4CNYA 2BQ3A 1WHXA 2MLZA 1BMQB 1U0HA 4NASA 2J7KA 1KDNA 5GAGI 4UZBA 5HLFA 2FLNA 4Q2MA 3GCWP 4X84A 4E2FB 2N3LA 4QIVA 1TAUA 1NZ8A 1CJVA 1Q8IA 1H98A 1S57A 5H9FJ 1SV5B 3THPA 2YY3A 2E66A 3H5UA 1TTHB 3GFHA 1NDCA 3MUMP 3OUYB 4ZN1A 3KK3B 3R7NB 3G6VA 4A8SA 1ZZNA 1QLNA 3E01A 3VHQA 5B09A 4J9MA 2H4WB 5T14A 4RW6A 2I6WA 1X0FA 4JB8B 4L74A 1CEZA 4DQSA 2OTJS 3DDIA 4Q45A 4EO6A 5KFBA 1LK5A 4ZCMA 3OV7A 2FB0A 2MKHA 2AJ1A 3OT9A 4P52A 2CQ0A 5AT1B 2CJBA 2CJKA 3MZIA 1NK9A 3DFEA 1VQ6S 2GHVC 5KFFA 4J9NA 5KFAA 1H0HB 1U49A 3M4XA 1KFDA 2LEPA 3H20A 4WKRA 5MLCV 2QA4S 4TXSA 3DI6B 2J7WA 2XYHB 2MPUA 3M6WA 1WF1A 2J9CA 1BGXT 1RT6B 4OZ0A 2DBBA 3DRPA 3MEEA 2C2RA 1S99A 2ASYA 2J5AA 2G2OA 1ITPA 4I6YA 4CO3A 1YQHA 3TQ1A 4N47A 1EJ7L 1Q16B 4PXDA 2VFVA 3P4UB 2H5JB 2BKPA 3M6UA 2D69A 2FHOB 2Y1RI 2FZGB 3TARA 1SPBP 1N4LA 1M5HA 3GYGA 1F9HA 1RA7A 3DRRB 4WPAA 1RAGB 2ROPA 2FJVA 1FKPB 4XK8C 2EWHA 1WSVA 1RCXB 3FRZA 2C22A 4MYTA 4OZ1A 4K4UA 2YNGA 1EAYC 2X1AA 2OMLA 3DMJA 1D9DA 1SI9A 3FRYA 2BM0A 4LT6A 2DNKA 4FF3A 1HBOA 4EGLA 1ZM4A 2RQKA 2GW8A 5IQ6A 2WW8A 6FDRA 1FRIA 1WOPA 1S6PB 2KRBA 2XZWA 4V1Ak 1T8EA 1D9FA 1CPZA 3MECA 4Q43A 2W2QP 3T6JA 4M8LA 1ZTTA 2CVIA 2LQ5A 5C2CA 5GADI 3FUYA 2JC1A 3FCWA 3MD1A 2Z2MA 4EYIB 1UPMB 2MJUA 2XI3A 1Q79A 4ZVRB 2VDIA 1I5OB 2FLOA 3I0RB 4RLEA 1B0TA 5KFGA 3ZTQA 1N33F 4ERDA 1NRKA 3LGHA 2CIMA 4ZCLA 4WFXA 5KT6A 1X31C 1RAHB 4G1IA 2K3KA 4USIA 2AP6A 4OX9F 3V81B 2IYGA 3QSIA 3HJFA 2JEFA 3TR5A 2XYGB 3N6NA 2DGUA 4RUBA 1Y10A 3FBBA 3ADAC 5K14A 4CH1A 4IR1A 2FGCA 2UUTA 1H38A 4N5SA 4C8NA 4CM0A 4KH1B 1WNEA 2QGFB 4KHPF 4I2PB 4DOZA 1I94J 3CCRS 1FEHA 4MT1A 2DD8S 2IAJA 2UV8A 4NL5A 2RU9A 3KG4A 4NLGA 2ZOMA 2ZJPQ 2PC6A 4PRFA 2RAQA 2G0CA 3KUEA 4OV6A 2BJ9A 4JUZA 1S9GB 1VQSA 3ITHB 2EFNA 1K47A 1FJGJ 1C4CA 2F5GA 4YMEA 1U6FA 2A10A 3GYXB 5ETLA 1Y5NB 2IM3A 5J1PA 2KDOA 4Y0FA 4YN3B 4F4XA 4S0MA 4ELTA 1TL7B 1PCAA 3HP6A 1NHUA 1PO6A 3UI3A 4XAKA 3A3OB 2GGPB 3ZNJ1 1R89A 2XWYA 1FDAA 2QC3A 3MHYA 2RS8A 4NLTA 4ED4A 2B4OA 2DGOA 3E2EA 4TLQA 3M2UB 3TJAA 1JLEA 2JHEA 3WIUA 5LM7E 2GJFA 1GX5A 3UW1A 2HHQA 3TW0A 3NP5A 3CCJS 2XNRA 1RT5B 2B5JB 3MR7A 2ZVIA 4UF4A 4QWDA 2VPYB 4DL6A 3IN5A 4J9UE 2OMOA 4TY8B 3EM1A 4O4RA 4DJBA 2QL5B 3Q8UA 5EWGA 2FZCB 3UN3A 4YFUA 2F40A 4M5HA 4FPRA 4TU8A 5B0AA 2YWKA 1MU2B 5IFMA 1GMWA 1HNXF 2EKNA 2WSEC 1SQEA 1D1UA 3F41A 2Y8WA 3VR1A 5J2MB 3BGUA 4DR7F 3LH2S 2PMWA 5KT5A 2WONA 2EEYA 2IJNA 2XYPB 3HKWA 2P5VA 3HK2A 4ILMA 2M2BA 4KFBA 3RR8A 5KFQA 3K5PA 2JJ4D 3FK4A 3BSOA 2GJ2A 5D3GA 1O6XA 4ZPWR 2R9LA 3IA0A 3CJTA 3EDRB 4QIGA 2HURA 3CJ0A 1ZBTA 4KRWA 3PHTA 1UPPA 3DGPB 1E6VA 4OYMA 4JI2F 7FDRA 2R7RA 5KFNA 5K20B 4O0IA 5JUMA 1DTQB 4M94A 1LWFB 3OQ2A 1EHWA 2VHGA 4CTAA 1TKTA 4P74A 5F3ZA 2C2EA 3W8PA 2XGPA 2LKZA 2YKOA 1S1VA 4DFJA 4L72B 4C8MA 3H2UB 4ECRA 2KKHA 3UNYA 3NLCA 4JI4J 2L9DA 4USHA 4A8OA 2AF6A 1N34J 4BC9A 3G2XA 4NLUA 2L41A 3TEGA 2UUCF 1RI7A 3ENQA 4CLWA 2HMIA 3I5CA 5CYQA 4JP8A 5D0HA 1R0CB 1S12A 1OY8A 4USKA 5CXTA 4C8KA 4DX5A 3MM6B 4DUYJ 3UR3C 2VICA 2R2TA 2NXCA 2UU9J 1T3OA 1FJCA 3EE3A 1SIZA 3AT1B 2LEBA 3THTA 2E7WA 5J2NB 2CWKA 1B3TA 5C24A 2HWHA 3B6BA 3C6TB 1UA0A 1S1WA 2KU7A 5JJBA 3HZEA 5K8PA 4YY3J 1LV5A 1TFYA 4HR2A 5KG6A 4U95A 4LFAF 1YJ9S 4F02A 5EN1A 2MKSA 2CRLA 3TAMA 3UDVA 2RILA 1J5EJ 1B64A 2B9YA 3QGIA 4CLLA 4MIBA 2G0IA 3UFCX 2AYEA 3QWUA 2ZE2B 1U26A 4C11B 3GE9A 4H4OB 2QLWA 5FJ4A 1XNQF 4HT5A 4DR2F 1XR6A 4DS5A 1R27B 4RW4A 4FXDA 1R3NA 2A0FB 3RW6A 3R3TA 3OJUA 2VIHA 1IR1A 4LF2A 4H4MA 1OQ3A 3MEGA 3ZTSA 1C0TA 4MKYA 2XHCA 4ZVFA 3M8YA 4USJC 2OEJA 1ZAVA 4OJHA 3KJVB 5BXIA 4LR8A 5ETOA 1FRXA 1JLQB 1HBMB 3UDEA 4HLBA 1V5VA 1UEKA 1X4EA 4JI8J 3PX4A 1IBKF 1VR6A 4NX9A 3H7HB 2D9OA 5IT0A 5A8WB 5B0GA 3SCJE 4C8OA 1IWGA 4OHVA 4QW8A 4P73A 1AZSA 3DNCA 4Y6IA 3JSRA 2QLJB 3JAMY 1UP1A 4CH0S 2ASDA 3LP1A 2CQ3A 2RF2B 3RB0A 4ILLA 4FYDA 2K06A 3JTNA 2ZC3A 4USUA 3HZGA 1LXJA 1NJXA 5HP1A 3O5TB 3PNIA 1HQEA 1OY9A 1PSDA 1RDRA 3UQSA 4OYWA 4ZJQA 2VD3A 2I9SA 1YLXA 4DV3F 1HBUA 1RHJB 1HQUB 3MPVA 3BN4A 3G82B 4FKYA 4TNOA 2KG1A 2H48B 4BDPA 4OFZA 1NBEB 4NXMF 1VRUB 4ZITA 4DSJA 3MR6A 3IS9A 3A3PB 5E0OA 3HHLC 3H8YA 2D9PA 4LIRA 5F8NA 3MGJA 2RRBA 4GVBB 3JSBA 2X7IA 3BV8A 3QGPA 4QQBA 1H73A 3R9LA 1IBMF 4JI7J 4N56A 3HM9A 1TKXA 3Q8PB 1XMBA 5JMNA 5LSOA 2U1AA 3OJSA 2YKNA 1YTYA 1U1KA 3BS9A 3ULHA 1G2EA 1GMVA 1M90T 1UFLA 2DHGA 3MFIA 1F9EB 2KN4A 4DPOA 2ZM6J 2R2SA 3CD7A 4DF4A 1A9NB 3L7PA 1LQ9A 1T02A 1URNA 2HQIA 1TKZA 5EX3A 4K4XA 4WFBQ 3G4SS 1WC6A 4IDKB 1JQGA 3M1VA 2E1CA 2BXJA 2CQIA 4I6WA 5GAHI 2B4VA 4M5JA 2IRUA 1U4BA 4QYZK 4XIUA 2VFUA 2XC9A 1UAWA 1JXVA 2KJVA 4DV1J 5B0BA 2JEJA 3MPDA 1MG7A 1NSAA 1OPIA 1YSJA 1N0VC 2KFNA 4IG0A 4EBDA 3CPWR 3V2UC 5T7LA 3M6VA 1FKOB 2OPQA 3EZOA 4ZDNA 2WK4A 5BYQA 3R5JB 1U1LA 1S1XA 4B17A 2XBPA 3F56A 1WACA 3MM9B 1Z2ZA 4YB7A 1T7PA 4DR3F 2GQQA 2JSXA 3M30B 2YVSA 5A2QU 3M9OB 1AFJA 1Y11A 5IT4A 2HQCA 2DPJA 1X8DA 5H9FK 2CPXA 4KY3A 4PWDB 1KHVA 3J7AN 2IVYA 4PG5A 1RT4A 1VFJA 1GH8A 3R8YA 1WG5A 4OI2A 4RW7B 3HULA 1KONA 2VODA 2N7CA 5IC4B 3CEDA 2G2YA 3BGLA 1K9MT 4ED5A 2CFXA 2FDNA 3GJSB 1SKSA 1S1UA 1MW7A 5SUHA 1SBRA 4USMA 3MM8B 2FGOA 5SZTA 4YS2A 4ITSA 2M52A 2WOMA 1QE1A 4B3RJ 1IWAA 3I9ZA 5T41A 4DG1B 3FDSA 2W24A 2C28A 2L9WA 4I67A 2G0JA 1T03A 3W2WA 3BGOP 4FYWB 5KFEA 1ZAWA 2R3VA 1WEXA 4YHHJ 1PJ7A 2JEIA 4NI2A 3QT5A 1W26A 2W9AA 1XK8A 1DRZA 4RO0A 2QE5A 1SH3A 3ICLA 2AYBA 4E98A 2OPSB 2WSCC 3D1QA 1IUJA 3LP0A 4ECSA 2H9ZA 4B3MJ 2HVHA 3MTJA 3ISNC 1N88A 1NPRA 1SL0A 1N5TA 3O2IA 3BPDA 4I2QB 1FFWB 4JI5J 3MMJA 4FYYB 1S97A 1CC7A 5J2PB 1KN6A 3CO9A 3CCQS 2VV5A 3ZTRA 1VISA 3KLHB 1N48A 3CCSS 4M5IA 4GC6A 3KKFA 3FGVA 1YJRA 1REVB 2MKJA 4ICLA 5D77A 3M2RA 2PEBA 5AE2A 2OD6A 2AJ2A 1RTHA 3KLEB 3QSYB 1F5CA 3BQ0A 5F0UA 4NYZA 4PG4A 4LF6J 2BDPA 4HACA 4USWA 1NDKA 4JV2A 1YKWA 3IFEA 2LU2A 5CHCB 4F4YA 4YDDB 4MJKA 4C3LA 4KV8B 4OV1A 4WCEQ 2RB7A 2VC1A 5CYMB 3Q0AA 4JI6J 3ISND 2QA1A 1XERA 4RX6A 2HRUA 4CO0A 5DZ7A 4G1PA 4CLFA 4F4ZA 5IZHA 1P9YA 2EFGA 3Q24A 4DQPA 1Q0NA 1FX4A 1SL2A 4I1TA 1RQ0A 2B7CB 3MAHA 6FD1A 5KT7A 3MMAA 5EGYA 1Y5LB 2DITA 4QR1A 2IYIA 2I1RA 4F4KA 3SIPB 4KSEB 1LW2A 2RQ4A 2KXHA 2GAGC 3QO9B 3T1YJ 1RJJA 1VQKS 4EEYA 1I3OB 3CDEA 1ZZFA 2V8GA 4R25A 3N6MA 3EGNA 2E9TA 1HWKA 2XMKA 2DHXA 2YQ3A 1D0EA 5D0RA 5C42A 1EQMA 2VQFJ 2HRTA 1FDBA 1NNDA 4UY85 3ENVA 4M5LA 2GJIA 3OFGA 3E51A 3PKMA 3RB6A 3PFEA 3TUIC 4LSZB 5IWAF 3RB3A 2GAHC 1VBKA 1KQSR 4Q44A 2AGOA 3CC4S 3FEZA 1RWOB 2UVWA 4ES2A 4OJGA 1HNIA 3OVBA 4MAKA 1GXLA 1N32J 2HG4A 2XNQA 4PYAA 3NBPB 1VGYA 1KC8T 2AZ1A 4N8OA 5KG7A 1IQZA 4A8QA 2LCWA 5E3QA 2BRKA 5J2QB 4LF9F 3VAIA 3OR2A 2LXIA 4QWCA 3D68A 4TYBA 2F9DA 2Z58B 2GVZA 3J80Y 4J9PA 2YNHA 3CO0P 3EGZA 2LYVA 2MHNA 1YJ7A 2VPZB 2AX1A 1RTIB 2CYYA 3JTOA 2A3JA 3MCMA 4UT4A 3RTVA 2VA3A 4CP5A 2HFOA 2BA9A 1L3SA 2J6TA 4DV0F 2Q6CA 3IXQA 3LPEA 4TQRA 2W01A 3BH6B 3UVJA 2KH9A 2KI2A 1U1MA 2DYAA 2HQ3A 3EDQB 1RAAB 3PX0A 3QNWB 3CMES 1BQXA 2VJUA 2MZSA 2PN6A 4M5DB 4U7CA 1T05B 3QRPA 4DSLA 4Y2IA 1LWCA 3NAHA 1J27A 1FXDA 4ETXA 3MMCA 1NH8A 4N76A 4J9KA 4C7QA 4I4BA 2KYZA 1O8BA 3TZZA 4EUVA 2XZTB 4F26A 2MTLA 3HT3A 2Y1IA 1OYDA 4IQXA 2AIRB 2MDAA 5J1EB 3FQKA 3CULA 2WVCA 1Q86T 4DLEA 4JI1J 1DQAA 2B6AB 3MXHP 4G3IA 1AT1B 1FESA 3JYTB 5A6PA 3OR1A 1LFWA 4LBIA 1JLCB 4CLKA 3IAS9 2IFXA 3G6XA 4OI4A 4C98A 2J9DE 1RTDB 1UVKA 2V94A 5E2QA 2M3DA 3O1LA 4Y28C 4NCGB 1UVJA 4B9TA 5DS7A 1LK7A 3HPOA 2NXEA 1ZPWX 1IBLF 5A8KA 4X4PA 3KYLA 1FJEB 2C2OB 1V3RA 1FD2A 2P6TA 4OX7A 3ZZOA 3MMBB 4NZ7A 1NMEB 1M5OC 3GILA 3AA8A 3G6YA 3U1MA 3H5SA 1S59A 3W2VB 3PACA 1YK9A 4R8UB 2DB1A 2Y8YA 2JEGA 2GHWA 4H4KA 2RDDA 4KB7A 3SXLA 2R8IA 1K8AT 2BANB 3PR5B 3LP2B 1RT2A 1NDLA 4ED1A 4WE1A 1N8RT 2D3OR 1JJHA 3HVTB 1QD1A 2OPPA 3BGFA 2ZUAA 5LMNF 3H59A 2J0WA 2O1PA 2H4YB 1S1TA 3QIPB 1RU1A 5I3UB 1NK8A 4C8YA 5IQQA 1NU4A 1NCLA 4YQWA 4MFBA 4FBTA 1RWXB 1QY7A 3M05A 2MSSA 4LF7F 1RT1B 5LOQA 2HHUA 3CW2C 4O3PA 5F9NA 2I5JB 3CJSA 1X4HA 3TRGA 4HDGA 1UVMA 2GHPA 3FFIB 3FEXB 2DCLA 3PG9A 1JJ2R 1WTFA 2CVEA 3NNHA 2X1BA 4DX6A 4ZLPA 4Q7AA 3OTBA 3JQMA 4WK3A 3UWTA 3DKDA 1JLBB 3UCUP 4YR2A 3WQPA 3DOMA 2Z4PA 3DLKB 3GJQB 2E5LF 1UWBA 3JQKA 4X4SA 1GQEA 5J1NA 2DNNA 4OHXA 3RU0A 1BHNA 2DXDA 3KLIB 1T9TA 2CPYA 5F0WA 1U02A 3M8QA 1I51B 3ONQA 4N77A 4B08A 5IM0B 2C3PA 3W3SA 3CJKB 2WRMA 3T1HF 3O6QA 4QBUA 1U24A 1YBAA 4FVMA 4N41A 2DNHA 4KKOB 2UV8G 4RW8A 4F36A 3DM2B 3SFUA 3I96A 1PJ6A 4NLPA 2WZ1A 4QCLA 1EKRA 3KFWX 4Q5VA 1HNZJ 2YH0A 4RZRA 3D6TB 4R5PA 1SIWB 2JRSA 3JXOA 2R7OA 1GK8A 1WI6A 2KM8C 1TELA 2RUGA 1X7VA 1CQMA 1MROB 4AL7A 1WUUA 3NS6A 5ETNA 1S9FA 1EARA 3OPKA 2BE2A 1LXNA 4UW2A 3EGWB 1RBOB 1VQYA 1WEZA 3M2RB 2LA6A 3HSJA 4U96A 2FLLA 4B3SF 1XMOJ 2CZ4A 3K5NA 3L3CA 2KJWA 2M7SA 1FDNA 5HROB 2IVFB 4ZVGA 3TNVA 4F3MA 2VBZA 2A6OA 2LEAA 5AE1A 3AD9C 2UUBJ 4DV6F 1Q78A 2YKMA 4WTOB 4K5RA 2CNNB 1O5JA 3WBZA 4NPOA 2EFOA 2VG6B 1NHKL 4NLRA 1NO8A 3NCQA 2Q43A 1BE4A 2IRYA 2B8QA 4Z2XA 4KPCA 3RRKA 3MAQA 1DQ8A 4X66J 1KLNA 5ETPA 5HMZA 3IBFB 1L3KA 3KLVA 4LR7A 2HBQB 5HBMA 1MLAA 4ZVEA 4TY9A 3W5ZA 1VC5A 1CULB 2JLFA 2BOAA 3K2YA 2VG5B 1SC4B 4LF5F 1QJHA 1CG2A 5HN0A 4K0KF 4BLGA 1TUWA 1KQFB 2ZHBA 3FKBA 5DZ6A 4C0HA 4ED8A 2A2DA 3D9BA 2ZFHA 2FTRA 3CSKA 2ILYA 3I31A 2XCPA 1OQ6A 4WXOA 2KRRA 2AJ0A 2EW9A 1DARA 3GIRA 4C48A 3MTKA 4L76A 5D78A 2UP1A 4PABA 2GV1A 1U25A 2E1PA 4ZJLA 2FJBB 5HMWA 3KWMA 3NNCA 5HL7Q 3R7SB 1NKCA 4MH8A 3VVTA 1HR0F 3RRGA 4P6QA 2ZEJA 4WFZA 3OBIA 2DRBA 2QLXA 4U7UK 1WC4A 3OL8A 2PIIA 2QRRA 1N5YB 3IM9A 1PILA 4IFVB 1VRTB 4MK9A 5L1IA 3NWRA 3Q86A 1RK8A 3V6DA 4TYAA 1GAOA 3HHLA 2RT3A 4DSEA 5B7WA 2W9CB 2OEMA 3NGKA 4FVCA 4XDCA 3K5LA 3UE2A 1BWVA 4PUOA 3OXFA 4RNNA 2UXCF 3GCXP 4F2RA 4U8YA 1Q53A 4O0NA 5HO4A 4MKAA 1N36F 3POTA 2DO4A 1X4BA 4PG8A 3D6MB 2FUG9 2Y3YA 8RUCA 3KLGA 1MN7A 4PWUA 2CDQA 2CDRB 2IA6A 3IRXA 3A13A 2V2KA 2IVMA 1HPZA 3MAAA 3CE8A 1FTRA 3I4PA 1D09B 3V4MA 3L7OA 3V4IA 4PZVA 1TVRA 2DK2A 2V4JA 2HNZA 3DOKA 2DNLA 3U1NA 2P6SA 3D0IE 2O67A 2AX0A 3I0SA 4KYZA 4RU2A 1E6YA 1NLKL 1HFEL 1W25A 2KHCA 2E5HA 3TVYA 3K59A 1S76D 3HD2A 4DV7F 2J0QD 1QAIA 4AXIA 1FWPA 3KHRA 3IG1B 4QW9A 5F3TA 1UFKA 2JNJA 2VPWB 2QJ3A 3ENAA 2OELA 3DGVA 2J0SD 1QVFR 2HHHF 5E5NA 1PAEX 1FRKA 3SQGB 5DJBA 3IAM9 1RT7A 2D3ZA 3NGUA 3ENWA 1N33J 2DXEA 2R2UA 2F8HA 4DZDA 4IFYB 3WC0A 3NMAA 1MMLA 4I64A 4OX9J 2ZH2A 3B78A 5KFDA 4DWIA 3PHEA 5LMUF 1N6QA 3OSNA 1KWMA 1QDUB 2DY1A 4JI3F 1L5UA 2HLUA 2APOA 1UCNA 3CD0A 2P9GA 5KAKA 1UEUA 4KHPJ 2KT2A 1WHVA 3ZZRA 7FD1A 1TK8A 1GTEA 1SH2A 3D3CJ 4UOHA 3FBEA 3T5LA 3DHXA 4ED6A 3UD4P 1SV5A 1CS4B 4ECZA 3VAHA 3OUYA 1QTNB 4U9RA 5D15A 3KK3A 2DH9A 4Z7CA 3KK2B 3CDAA 1SC6A 1GMWD 3ZTOA 4K4YA 1X5OA 4LBHA 1LW0B 2CPIA 1JMTA 2K3IA 5A2QY 4WFYA 4JBCA 2E1RA 5BYSA 4DR5J 3KTQA 1S4FA 3EX7B 4B9VA 5H9EJ 5D0GA 2VH7A 3PEJA 3OL7A 5I3PA 3OTOF 4QZVB 3DC2A 2YKAA 5C5JA 3NY0A 4GVLA 5L1JA 3ETMA 2ZNZA 3DI6A 2RDIA 2R4FA 1HNWF 2B8PA 4FF4A 1RT6A 2QA2A 2V8DA 4LVNP 3SQOP 3AOAA 1YITS 3KHHA 3N6LA 3CJ4A 5KFYA 2HQGA 4FF2A 3N79A 3K7RA 2FC8A 4DBQA 3FMWA 3GV7B 1HQ2A 2ZWOA 3K8VA 3GG0A 3MR3A 3AQPA 4AL6A 1VYAA 1UL3A 4DXLA 3DRRA 2BJ1A 1BQNB 4NYPA 4PG7A 1VI7A 1FKPA 4OI6A 1JKHB 4F4WA 1HNXJ 2E7VA 2BJEA 3U7JA 4K8RA 4DR7J 3KNGA 3DLEB 3SDEB 1HLWA 4HEA9 5KT3A 1REGX 5LSRA 4ZA1A 5IT9U 1S6PA 2EPIA 3BH7B 4X4VA 2RKIB 1R6YA 2RE1A 3CCZA 3UNGC 1CQNA 2Y9HA 4MMOA 3ILIA 5D6GA 3HX9A 2CJQA 1Q8KA 3CDBA 2HQFA 2GMLA 1UEVA 3I0RA 1MN9A 3H98A 2ZBPA 4JI2J 4IR9A 3GFZA 2NR0A 4RW9B 4CCHA 5MAOA 2ZBQA 1S7IA 3V81A 4K2JA 3AHPA 4KE5A 4CQ1A 1VQ4S 3DYAB 3IR7B 5ITHA 4HVZA 2UVVA 2FJWA 2CQDA 3RJMB 3SFGA 4P71A 2VBXA 2UUWA 2YWHA 4I2PA 2UUCJ 5EWEA 1F1BB 4PKDB 2QMWA 3OFHA 1WC0A 3ZC4A 3V6JA 4PQUB 1FNMA 5DLGA 1S9GA 4LQ9A 2GNKA 2DRDA 2ZWPA 3ITHA 5C2GA 3MM5B 3RGIA 5K9FA 3FJ2A 4RU9A 3A8EA 2BE7D 3N01A 5LSLA 2Z8QA 4YP3A 2V2ZA 4ED0A 1DJ0A 4L3KA 4K4WA 1TL7A 4C97A 3HDSA 2FHKA 1EZZB 1KOHA 2W2MP 1SKRA 3IC1A 4RJVA 2UXBF 4C8ZA 1VLYA 4LFAJ 2IJRA 4J9OA 4RNMA 4ZS6A 2GGPA 3P5TL 4DV4F 2UXDF 3MR2A 3TA2A 3BREA 2OPRB 4CH7A 1RE1B 4NRTA 3M2UA 2V6AA 3UN5A 4B02A 4DL0C 4ZJOA 3P3DA 4GRSA 4OZLA 1RT5A 2B5JA 2F9JA 4ER8A 1HNVB 1SUQB 2JC0A 1HBNB 1XNQJ 1TV6B 2E9RX 4DR2J 1WOSA 4TY8A 3TAPA 1TL3B 1B4SA 3AH6A 2FLPA 1R8BA 1IXKA 5IC6B 2FY8A 2FHJD 1SC1B 2BJ8A 1Y3JA 2F4VF 2XZDB 3MDFA 4ECTA 1Q4RA 4YB5A 1IQTA 1MU2A 3M7VA 4UOCA 3KLFB 3K8WA 1KR4A 4NMXA 1HHSA 4JYAF 5J2MA 1C4AA 1ZM9A 2LXUA 4ZPTR 2BRLA 2Z2YB 3CCMS 5CCMA 1VJWA 2W4CA 3I5AA 5HJYA 2V0NA 2RJZA 3K5OA 4LREA 4J9LA 2FJEB 3G8SA 3N4WA 1U09A 3C15B 2L3MA 1NK7A 5DQGA 1DTTB 3EZ5A 4W98A 1IBKJ 1FD8A 2WTFA 4ZPVR 1YJUA 5KFSA 4U7UD 4F3OA 3PZPA 2UUAF 3TZXA 4GMKA 1Y4ZB 3K17A 4DU7A 3DGPA 3Q8SB 3J7ZT 1ZA1B 1RT3B 1ZS6A 2ZKUA 1PG5B 4Y65A 1KD1T 2C2ZB 3PEHA 1OMSA 2IA0A 3PTWA 4OQJA 1WSRA 1R8CA 2FYXA 1T9WA 1DTQA 3L95X 3N5FA 5A8RB 5AJ3F 3D67A 1X5TA 2F1FA 4DQRA 1RGVA 1JIHA 3CF5Q 1S6UA 3BR8A 2LQBA 2DISA 3IRWP 5E3CA 2LMIA 1K0VA 5KFXA 4NXNF 3N5BA 3F73A 4E0DA 3NGRA 1UW4A 1X4FA 2D1CA 4DV3J 2EBEA 4RUHA 3R5GA 1NEEA 3ET6B 5KFRA 1CJTB 3LA0A 3ZO7A 2HHXA 1JXLA 4A8MP 3MM6A 2M88A 4NXMJ 2YWEA 2QYGA 3SCIE 4RNOA 2BACA 2DGWA 5ETKA 3M2VB 2KL8A 2PO4A 2EKYA 1AFIA 1DY3A 4DN0A 5B0FA 5J2NA 2Z2ZA 4DX8H 3LTOA 3C6TA 4NA3A 4DQIA 2C2MB 1IBMJ 3CJ2A 3S01A 4K7QA 2XQCA 5GAGU 3NOGA 2FJXA 3EGVA 3KMQA 4O4GB 4IH6A 3WX8A 1ZAXA 3AAWB 3GIJA 3NCRA 4OYBA 2HS3A 2JVOA 2JLGA 3PO5A 4BWMA 2FJAB 2VOPA 1P27B 1RUSA 1ROFA 4WFNQ 4K4TA 3RAQA 2CNOB 3WDOA 1RAJA 2ACYA 2ZE2A 3VV2B 3PW5A 5KFHA 3HHNB 3CTRA 4C11A 2H5EA 4H4OA 4KJIA 2QEXS 3R1LA 2ALZA 1IJEB 2HZAA 2OEKA 4CWBA 2R7UA 4GO5X 1FNXH 2O66A 1Q95G 3R2CJ 4OZ3A 2HGLA 2C2KB 1XBWA 5DDPC 2K8GA 3QRQA 2AHOB 1K1SA 2HBRB 1H2UX 2DKOB 4UOGA 2J76E 2HIYA 1VIXA 3SI8A 1S77D 1NSKL 3B54A 4UZCA 5DLFA 3KJVA 3HSDA 3NEKA 4DL4A 1D8YA 4CIOA 1YBTA 1JLQA 1FWKA 2NLWA 1S4EA 3PFOA 1C0UB 1HBMA 3LGMA 4DR3J 2NREA 2M9KA 4IUFA 5KFZA 2E5JA 3PKYA 3D7SB 5F8LA 5FIIA 2R8HA 4UOFA 1M5SA 5A8WA 3OLBA 4O44B 1RLCL 3U27A 2BMBA 3TAQA 2QIFA 3TVZA 2LQ8A 1WELA 2W7OA 1HD0A 4DCJB 3GMGA 5D4NA 2RF2A 1IR2A 1RSCA 2HZCA 3VAGA 4TLRA 3J7A1 4ZKAA 2DO0A 1FRJA 1YJNS 1B0VA 2DIVA 2BUNA 4CLSA 3R2DJ 1XR5A 4RKUC 2MZJA 2OSRA 2PI5A 5L1LA 3W64A 3W8GA 1C2PA 5GADU 1Q7YT 1VQPS 3J80U 1YG0A 1HQUA 5F41A 2WCXA 3G82A 3JSYA 3ZZTA 1IKWB 4DSKA 1VRUA 1DLOB 2LQJA 1O51A 3KJFB 5G0RB 1XEZA 1WG1A 4IOBA 2C3YA 5IOLA 1JLGB 3OL6A 3A3NB 4GVBA 4RWWA 3G8TA 2B51A 4J9VA 4TN2A 2KFYA 2LU1A 2DH8A 1EQ0A 2FJDB 4N8NA 1U1PA 1A7GE 3OD2A 2QTWA 2M70A 3O3LA 4F67A 3R1HA 2HIQA 4KIAA 5E41A 3VGUA 3BSCA 1GX6A 1BUXA 2EFVA 4K50A 3PDNA 2V5HG 4LJMA 1KBRA 3H25A 1FO1A 1CJUB 3D3BJ 4NEZA 2LA4A 3DOLB 2AT1B 4IRKA 3TX8A 4ZVUB 2M8DB 4JOUA 4WYLA 3H90A 1XNRF 4X4RA 4PEOA 3W62A 4K2XA 4XPCA 3K89A 1YZ6A 1Z1ZA 2QMXA 4K4ZA 4DFPA 3CD6S 2RU3A 1VBZA 5D4OA 1V6HA 4O3RA 2MKYA 4IDKA 1EP4B 4ZLLA 4DCPB 1IBCB 3G8QA 1VOMA 1RKJA 5LXYA 4QIFA 3BGRB 4FNIA 4DSFA 3WIVA 3C14B 3OL9A 4LR9A 3LQVA 3GIMA 2W4DA 4Y2KA 4X64F 1LOUA 2MGZB 4K4VA 1VK3A 2PMZD 1HA1A 3EUNA 4DFMA 3NWGA 4AE5A 1KP6A 2FD2A 3T9ZA 2ATLA 2NSCA 1Y5IB 2AGQA 1OJ4A 4YEAA 1G3OA 2EK6A 3DDNA 1VIOA 1UJ5A 3V6KA 4CM2A 3F44A 2RVJA 2XS2A 1FKOA 3ZZ0A 1JJCB 4HHUA 2ZBIA 2C3OA 4QWAA 1SJFA 3MM9A 5DETA 3M30A 4ANCA 3PJ9A 3D0HE 3UR0A 5HANA 3M8WA 2DGQA 4HH0A 2ZKTA 1G1XA 4N7TA 3AJDA 4URQU 2BW2A 1M1GA 4PWDA 3UCZP 2LECA 3J7YI 1FA0A 5DGAA 5HATA 4Q8EA 4RW7A 2C1EB 3US5A 1S6QB 5CYJA 3VVUA 3MEDB 1FRHA 4IG3B 3RBZA 4X4UA 2RIJA 4LF8F 2NPFA 3ZNUA 3G86A 4DUTA 1TL5A 3PIOQ 1WORA 3MM8A 5IWAJ 1UJ6A 1M1KT 3T19A 4BS2A 3KMSA 4DG1A 1RZMA 1JXEA 1YWXA 5B0EA 2V9WA 4CZCA 4EBEA 2YX1A 3VWSA 2AZ3A 5H9EK 1RU2A 3M9NB 1EKSA 4RL1A 3FMBA 3D54A 4OYXA 1RWMB 3CNQP 4LF9J 3GG1A 4MIWA 1F6TA 1H2TZ 5KFLA 2OPSA 3S7RA 1GEHA 4OIXA 4IYQA 2E29A 3U02A 4CRJA 3J81U 5KTQA 2BJ3A 3UPFA 2DNQA 3MI7X 2NSBA 4G1QB 4I2QA 2MQMA 2BKOA 3T5HA 3GTYX 4A8FA 3IBCB 1FXRA 2F4FA 5FDLB 4H4KC 3CDUA 5J2PA 4W92B 4JV5F 1GFWB 2MQLA 3KLHA 2EG2A 4DV0J 1GXUA 1XWLA 2XMJA 2AEFA 3QT6A 5DM7Q 4UQGA 4ATNA 1REVA 3OXLA 3WHIA 1AUSL 4OYPA 4ZCIA 2YKQA 3KLEA 2HNYB 4LRFA 2AEJA 3OTCA 1NJZA 3CGIA 1JB0C 4I7FB 5L1KA 1KSPA 4K4SA 2OUGA 1OIAA 3BYPA 4RPFA 3QZ7A 1UW9A 3HXMA 1R8HA 2YH1A 5EDWA 5A6WA 2ALYB 4XDDA 1TUVA 4KV8A 3V5RA 2NYIA 5CYMA 4LSNB 4DR4F 4ECQA 4YR0A 1S48A 2YXLA 1KVKA 1UZHA 3KK1B 2DEIA 2ZD1B 1S0VA 3TA1A 4ECWA 1HWLA 4NCAA 5FD1A 2XI2A 4KGKA 2KHDA 2IBOA 5AXMA 1KNZA 2MKCA 1RKIA 1DAXA 3CUNA 2XB2D 3R6GB 2ZDPA 2VBYA 3C6UB 1VDHA 3QO9A 4A8XA 1L3UA 2OD4A 1K0TA 1JLAB 2W9BB 2K1RB 1SB6A 2I2YA 1HI8A 2E1AA 3W66A 2EXUA 1IBLJ 1V9OA 4A47A 3FSIA 1KTVA 1OS5A 2DT9A 2OLWA 5KFMA 1HIYA 1F0XA 2VG7B 1IM4A 2DCUB 4ED3A 4KH0B 2VOOA 3ILLA 2BZ2A 2Z2LA 2VQEF 2AW0A 2R8GA 1SXLA 3GLJA 4Q2LA 4FS2A 1QVGR 2IPOB 2C2NA 3PRDA 3LW5C 5GMEA 3D2WA 3E3XA 4ES1A 3RBXA 4DUZF 2HLTA 3H2VE 1NPPA 3PY8A 1IN0A 2R7QA 4EO8A 4GKJF 3W60A 3NBPA 3BO4A 4E8UA 5ETMA 2MQQA 2EI5A 1FDDA 2JZ5A 3BSAA 4P2FA 5LMNJ 2AJQA 1NK0A 4BWJA 1B70B 1ZM2A 3B82A 2HGNA 5F8JA 3ZZYA 1T9YA 2VFSA 5J2QA 2JX2A 2HAIA 3ETOA 2BX6A 4P10A 4QYRA 1NSPA 2CNKB 4DPYA 1OYEA 1CJKB 1MWZA 1TK0A 4WF9Q 4LF7J 2DPIA 2QO3A 2BV3A 5GMKa 3TVKA 4ZIWA 3QGGA 2HHPA 3SZ2A 2CQBA 5L9XA 1M1HA 1RTIA 3SBMA 1WDDA 5IT9Y 2MY7A 3PYGA 2AQ4A 2HFSA 4UQTA 1XMQF 4ZP8A 2LLZA 4Q0BB 3AB2B 1UFWA 2ZH4A 2M4MA 2MQOA 1P9QC 5DDRC 1RWUA 1CC8A 2C2DA 4GKKF 2B9WA 3IR6B 3GWCA 3CWJA 4OI1A 1U1OA 2X51A 2V8HA 4HTJA 2O01C 3GYNA 4ZP6A 5HSPA 3RRHA 2K7JA 4IH7A 1S72S 2HZVA 1C1CB 3RYLA 2QMUB 2YTCA 3PV8A 4M5DA 1T05A 2GIRA 2KG0A 2H5IB 2MLYA 2E5LJ 4ZVSB 5KG3A 2W7PA 2CJYB 2KB2A 3FCVA 1F3VA 3P45B 2CZVC 4P2SA 4J9QA 1LWEB 2XMWA 4X65F 2M0GB 4OJ1A 3QWPA 1RBAA 4IRDA 2ZJRQ 3T1HJ 3DU6A 3DRXA 2V9KA 1IVZA 5J1EA 4NOHA 5HAOA 4LSLB 3VAFA 4CYUB 2VC0A 3HFZB 2KXNB 3BN7A 2B6AA 2DTJA 2PMHA 3AOCA 3DXBA 2W4PA 3R27A 1RLDA 2ZH5A 2E5GA 4OZNA 3JYTA 4URSA 2BKNA 2MQPA 4WU2A 1JLCA 2J9DA 1IJFB 1SQGA 2ZVSA 2HK3A 4ZHRB 3MPYA 3W5YA 3OFEA 1HL6A 1TL1B 1PAUB 2WB1D 3LAMA 1KOOA 3GFYA 2CJXB 1RTDA 4B3SJ 2FC9A 1TAQA 5GAHU 4NCGA 2J7UA 3KDOA 2V63A 1WD6A 1HYSB 3MCOA 5KG4A 2U2FA 3KJQB 3PO4A 4DV6J 1Y7PA 2DR6A 2XMMA 3MMBA 2VUGA 2XS7A 3CCVS 3HO1A 2KT5A 1PC4A 1RAOA 4DR6F 2VZ9A 2ERRA 4LFBF 3GP9A 3I82A 1N5VA 1I6JA 2IMWP 3HHLD 2MSTA 1UA1A 3G6ES 3B8HA 3FCHA 3W2VA 3QFWA 4R8UA 2L9NA 3KG0A 3MUTP 4KHMA 2BANA 3LP2A 3BB5A 1GXTA 3PRVA 4QPTA 2ZNYA 1V3ZA 3HVTA 5HQLA 4AD6A 1ICEB 3VAKA 4KHRA 3G9CA 2GO9A 4OZ5A 4O3QA 4K0KJ 2GIFA 3QIPA 2MZQA 3KG1A 5D4PA 5I3UA 4USTA 3TJ9A 4WP3A 2ILZA 4ANEA 3CC7S 4QIWD 3KOAA 3W9HA 1QAYA 5I3QA 3D6HB 2XY6A 1RT1A 3QLHB 3MF5A 2HYIB 2DHAA 3A12A 2RRAA 2DGTA 4FXVA 1ACMB 4AYBD 5L39A 2I5JA 2YNFB 3CMAS 4ALZA 3AD8C 1FHTA 4HTIA 1HR0J 1U8WA 3FFIA 3HKZD 3FNNA 4NLOA 1OY6A 3PYFA 1X9WA 3HI9A 3ZZZA 1KFSA 2IC3B 2E9ZA 3M8PB 4Y2MA 3QIDA 4QYZJ 4DL7A 4U67Q 3M9MB 4HHHA 1JLBA 3W9IA 4F50A 3DLKA 3QAUA 4FS1A 4X62F 1YVFA 5M2RA 2QLFB 2Z0GA 2UXCJ 1KVJA 1PC5A 2C42A 3KLIA 1N36J 2GIQA 2QSWA 2XY5A 5IM0A 1EETB 3JQJA 3EYZA 4PPDA 4PG6A 3CJKA 3CCUS 2CQHA 3RZAA 3IMQJ 4ZIVA 2RDJA 5KFOA 4ID5B 1FI4A 2ABYA 4KKOA 4F0MA 5F9LA 3DM2A 5BR8F 4U8VA 5IS2A 4CT9A 4DZ6A 2PDAA 3Q8QB 1TU0B 1N54B 1HWIA 1H72C 4NZ0A 4NLYA 1HW9A 4O23A 5CCLA 3V6HA 5CD4H 5CA5A 3NS7B 3Q8RB 1BY9A 1MROA 4L6V3 1SJ1A 4HDHA 4DV7J 1P6TA 2NCKL 2CQCA 1K73T 1RYRA 2X1FA 1F5AA 5CABA 1RTZA 1WC5A 3UD5A 2ZH9A 5HROA 1IKVB 3CIZA 3JSMB 4OLOA 1X9SA 2CPZA 2ZC4A 1JLFB 3GONA 2CQ1A 2HHHJ 2VBWA 2FPHX 2VG6A 2HBZB 3NOCA 1U45A 3DRYA 2CG8A 5C7PA 4FNHA 5RUBA 3LWMA 2E1MC 4HT7A 1ZTWA 4IOCQ 3R5AA 2FVRA 1XN9A 1FRMA 1J5OB 5LMUJ 4FYXB 2FY1A 4YOEA 4JI3J 2EVZA 1F2GA 1CULA 4KO0B 3IWXA 3VZHA 2VG5A 2RUSA 1QAXA 3O8WA 3VGTA 4EYHB 1T94A 4FN5A 5HK4A 4F04B 2XTJP 3RW7A 2YX7A 3H2LA 2LP4A 2NXJA 2XCAA 1NB7A 2DVIA 3EVWA 2V68A 2O5DA 2Q66A 2PFFB 1N52B 4XPEA 2GVDB 2BQRA 3D66A 1VS3A 2JWNA 1H7WA 4CLYA 3I5BA 5LT5A 2J6SA 4JI0F 3M8SA 4CLTA 2B56A 1BC6A 3P49B 4B9LA 1LWXA 2R7SA 4P2XA 1Y00A 1BD6A 1U2CA 3EICA 4EBCA 1QSYA 1N5YA 2NXUA 1TR0A 4IFVA 1VRTA 3OTOJ 1IM6A 2IDLA 4G6VB 4KGXB 2W9CA 5C25B 3DDKA 4AQYF 3IBWA 3VQTA 2AMCB 2R7TA 4PQAA 2G1HA 3JB9k 1PIEA 1HNWJ 1MWQA 5HMYA 1RCOB 1VHIA 2CKWA 3MM7B 3PJXA 2B43A 3IR5B 4HI1A 2G2ZA 3TQEA 5B0DA 4LF4F 1C1BB 4Z7YA 3BQ1A 3Q22A 1RWVB 4DV2F 4DL3A 4RUCA 1JNRB 2VFTA 1QSLA 4A48A 5I42B 3ZFVA 1RXOB 4X4TA 3DLGB 5A76A 1KTQA 1TFWA 3D6FB 3HJVA 1FT8A 3EWGA 4C2MA 2ASLA 1O0PA 5CZXA 1UJ4A 3FSXA 1RADB 3TUZC 3OLAA 3R5DA 3GSDA 3AB4B 4IOAQ 2AJFE 4WP8A 1S0NA 3IG1A 1OSDA 2QZ8A 3M32B 4DR5F 2IM2A 2WSFC 5HQMA 4FF1A 2VKZG 2WB4A 1WKJA 1WI8A 3PIPQ 3L4BC 3SQGA 2ZH3A 4C3MA 2NUUG 5CD4A 4UTGA 2V50A 4NLQA 2PD1A 4CLZA 4IFYA 1VMBA 2IBKA 1YRTA 2RS2A 4D3HA 1G6BA 2FVSA 4DI6A 4DL5A 4MKBA 1FK9B 2N7YA 2OH2A 2C3MA 1UWAA 2XGQA 4DR1F 3TJ8A 2B7BB 3CIMA 3LOUA 1HMVB 1U1RA 2B9XA 3DU5A 2HFZA 3C46A 5M2PA 1CS4A 1KKHA 2R7VA 1NJYA 2NZ4A 1FERA 3BM7A 2VFRA 1WKKA 5IV4A 3KK2A 1D8ZA 3AODA 4FPIA 1LW0A 1AROP 2A18A 3TO8A 1QSSA 1RHQB 2R7XA 4PAAA 2IY5B 4BCAA 5L8RC 4WXWA 2DNZA 3P6YC 1S7HA 2FIUA 1TZ0A 2BBEA 2Z30B 5FLXU 4WBFA 2IM0A 2XLIA 2AEMA 2EC0A 3MURP 4OMFG 3ZTPA 5EHHA 2DHSA 2UXBJ 3QFHA 3EXCX 2XWXA 3NCPA 1IKYB 5LXRA 1YIJS 2R42A 4DV4J 2UXDJ 5L9NA 1JJ4A 4YB6A 2L48A 3BO2A 1R6VA 1S0OA 2RNEA 3ILJA 4KT0C 4B9SA 2NUHA 1S9EB 4ZVHA 1VHFA 4NEYA 5DG8A 1KLMB 3QZ8A 4P72A 3AD7C 1T0TV 3T1AA 4C3KA 3PX6A 2FVQA 2IMOA 3KHGA 3GU0A 4RBVA 4OYAA 1TKDA 2BJ7A 3QQCD 3HFKA 2ZJQQ 1VQNS 2CWXA 2F4VJ 4Y3CA 4WFAQ 1BQNA 4M5KA 2ZH7A 1S5ZA 3CJ3A 3W1YC 4DPWA 2X1GA 1NK6A 4WZMA 3CC2S 2CADA 1JKHA 2V69A 3C66A 4JYAJ 5ETRA 3DLEA 3SDEA 2D7SA 3J81Y 1ELOA 2CUYA 1M0SA 4X4NA 2QV6A 1RTJB 2ZOFA 2MZTA 2MQ8A 3MPWA 2BABA 3DRSB 2RKIA 2XSJB 4B3OB 2ZITA 2HNDB 2OJ3A 1UKUA 1IKXB 1SJQA 2Q79A 3VAMA 5B08A 2YNIB 9ATCB 2UUAJ 4ZMMA 4BBYA 2POKA 2W2PP 4DFKA 2HHTA 3C16B 2N4DA 1FJ7A 3OTDA 2OFGX 3ELHA 3W9JA 4ID8A 1PJ5A 3RR7A 4RW9A 5A0YB 3Q23A 4ZVTB 5AJ3J 2ADBA 4MKVA 1U0HB 4Y2CA 2ZOGA 2WVEA 5F8GA 3VZIA 3BYRA 2MXYA 3DYAA 5HLFB 1FVSA 2EC2A 1L3TA 4V19J 2J6UA 3SCKE 1ZPVA 1JWWA 1CJVB 5KFJA 4NXNJ 2DGSA 1ULRA 4ZK7M 3CB4A 3KXDA 2HW3A 5KFVA 1Q1KA 2HVDA 3IGVA 1XR7A 1R8AA 4NRUA 1WC3A 1SKUB 3E01B 2HHSA 4WTYA 4PQUA 4ZVQB 2JFDA 3TYTA 4RW6B 4ZCKA 3MM5A 3AOBA 4OX8A 3D1OA 2OAUA 4X4QA 3M8RA 1WEYA 2AJ4A 1BWEA 2XMTA 3QAEA 4ZOSA 4W90B 4Y34A 1K1QA 5L38A 1H74A 2YPYA 2IDEA 1DHMA 4B3TF 2GA7A 2QX0A 4ES3A 1YBUA 3VAJA 3T6BA 3G71S 5AXKA 2GMHA 3P5BP 5E3AA 3BQ2A 5DRKA 1U2FA 4ECYA 4LUBA 2KM8B 4WWSA 2OPRA 2KVQE 3DRPB 3MEEB 1NDPA 3SSSA 1TP7A 3QMQA 1R8PA 4KC5A 2WVDA 3M6XA 2GMJA 2FVPA 5GVQA 4WU3A 4DHVA 1MNEA 2M8HA 2EK1A 3VCDA 1HNVA 1SUQA 3ZZUA 1HBNA 2DNGA 1DZ5A 1TV6A 3BZQA 4WKYA 2F3JA 2FHJA 1TL3A 5EUHA 2ROEA 8ATCB 4DN9A 3GZ7A 1AW0A 2WBMA 2MZRA 2XEXA 2WVFA 2CXEA 4FBUA 4LFCF 3A8JA 2YNGB 3RG6A 1N56A 3DMJB 5ETQA 2GS8A 1HBOB 3KLFA 2P9EA 4HYKA 4IKAA 3T5KA 3K0JA 3PR4A 2HAFA 3HFVA 4EI2A 2MHEA 3MECB 3TUJC 1MMNA 4I0WA 3ISZA 4KGZB 5KOXA 2HBYB 3BKUA 3C15A 4ANDA 1DTTA 4OJ3A 4AT1B 2DR9A 2F65A 4EZ6A 3R97A 3T3FA 3TI0A 1G7CB 1WHWA 4DV5F 2XY7A 4B9NA 4LVOP 5KG0A 1RT3A 2PGCA 1UETA 4RNFA 3FBFA 4NLXA 2W8KA 1U2RA 5K14B 3T9NA 1HW8A 5A8RA 3G96A 2QLBB 2JLEA 4EMDA 4NWBA 2W7AA 3I87A 2HHWA 5KFUA 3W65A 1R0AA 1M5VC 7AT1B 1RABB 4YB1P 1D9AA 2IAJB 1GT8A 1SC3B 4ZPBA 2F7VA 3PW7A 2OGUA 3AJ1A 3ET6A 1MSWD 2MMYA 4C6AA 3EPIA 1CJTA 1FFSB 2ZZTA 5I4MA 2QSFA 3P96A 2RQMA 4G65A 4OZ2A 1VBXA 4RBTA 2CPEA 1X9MA 2WW4A 3WX4A 2OFHX 4NLDA 2J8SA 3M2VA 2DNOA 2HFVA 3NL0A 1FVQA 2DNPA 2D3O1 5EX0A 3FBCA 1UMJA 4CO5A 2BJDA 3C2PA 1VRQC 3LPYA 4NMLA 2VB6A 5KG1A 3S6EA 2FVCA 3GJRB 2MYFA 1X4GA 4O4GA 3TZWA 1F3FA 2GCFA 5E3PA 1WHYA 3OVAA 3GR1A 1JLEB 5KFKA 3UDCA 1XNRJ 2IIHA 4ZLNA 2QN6B 3GQCA 2CQGA 4OZJA 1HI1A 4BC7A 1M5KC 2NQPA 1SL1A 2YQ1A 4F0HA 3CCLS 4LRCA 4O3OA 1DQ9A 3QYYA 2Z56B 1L3VA 1F5BA 4DLGA 2DGXA 4B9MA 1YZ7A 2H65B 3PRBA 2OTLS 3MCSA 2CPJA 1MWYA 1VQ7S 1QM9A 5U47A 1FTCA 2LQ9A 3NAIA 3DN9A 1YX2A 4X64J 4J9SA 4QPXA 2HRYA 5CH7B 4TKTA 3IO1A 2WONB 3TEHB 2GFFA 3B4DA 4P7TA 2B4PA 5G4DA 3GPAA 4KFBB 3KHLA 3AFGA 1FWLA 5DDOC 2QG9B 2RD5C 2VU5A 2ZBRA 3R7BB 2KO1A 5D3GB 2DR7A 4LRBA 3WC2A 4YUDA 1C0UA 3PW2A 3T5JA 1UTAA 2GX8A 2QYCA 3CD5A 3AXKA 4A8KA 3BR9A 3GIKA 2H54B 5F8IA 2O3DA 1DURA 1X0PA 1WWHA 3AJ2A 2AU0A 3FQLA 1EB0A 1E6VB 2ATCB 3SYZA 4O44A 4CDIA 1EX8A 3E8OA 3QATA 3HLUA 3GSIA 1FCAA 1P1LA 3KUGA 2LDIA 1XJWB 3IWLA 1FFGB 4XTTA 1NH7A 2YX4A 4USVA 4CTAB 4LQ3A 4LF8J 2HS0A 1TL4A 1TKTB 3CMQA 1GMUA 1IR0A 2JL9A 1S1VB 1S49A 1VQ5S 9RUBA 1AUDA 4ZPAA 3FZBA 4M5MA 2B0GA 5ETSA 1U48A 2DEJA 1I94F 3GJTB 1X4AA 2HMIB 5CYQB 4AUKA 5D8HB 3UDLA 1RWPB 2W2OP 2N3OA 5EWFA 2CZ9A 4QJVA 4C4WA 4PYDA 3LAKA 1NAQA 2V2QA 2K7KA 3AY0A 3LWLA 2BOPA 4DPTA 5L46A 2XO6A 2R7WA 1H7XA 1WOOA 2OSQA 2Q1LA 1FJGF 2KZZA 1IKWA 2MY8A 1DLOA 3H40A 3NMRA 2VPXB 3CJRA 5G0RA 3F0NA 4EK2A 2MZ1A 4GC7A 1JLGA 5C24B 2BE9B 4OHWA 1XC9A 1S1WB 4J90A 5DQHA 1BXNA 3N9UC 2PA3A 2J9EA 1OPZA 4JV5J 2CQ2A 4O3NA 5GAEU 3W61A 2R2RA 2GC8A 1PKUA 3BPSP 5BJRA 3TAMB 4F3QA 1YI2S 2PEHA 2C3UA 2X3DA 1QUPA 3TP2A 1CJUA 4ZVOB 3DOLA 3LGNA 3BJYA 4BHQA 4KGVB 3EMTA 5ETTA 3QT8A 1H6KX 5LJ3Y 5GAEI 2HKEA 1SJRA 3J7Z5 5DG7A 1XQIA 3T41A 3HSZA 1EP4A 3I32A 3TX0A 4IO1A 2R8JA 2WAQD 2UZAA 4A46A 4CO2A 4RW4B 1T9UA 4M63A 5E3RA 2BQUA 4DR4J 1RB0A 2ZZNA 3BGRA 4H4MB 3C14A 3NGDA 1NK4A 3MEGB 2HFNA 1VLOA 3HF5A 1C0TB 4ZPCA 1D3WA 3A8IA 2MGZA 2WBRA 1V5IB 1U7LA 4MTPA 3IP0A 4QR2A 3MD3A 3LF0A 1U1NA 2GO8A 4QIEA 1TMMA 4ED7A 5JVGQ 3BKTA 1RWWB 2YWFA 4HI2A 2MQNA 3I55S 3A1YG 1CSJA 4DF8A 3D28A 1ZETA 3AXMA 1RBLA 2JFKA 1P8GA 2UVRA 4FYVB 1AA1B 2A2CA 3H4DA 4M5NA 2G9OA 3KNAA 1UVLA 2MKKA 1AZSB 4PXBA 1TMJA 1WF0A 3HCXA 3RAXA 1NHVA 4QWEA 1PBAA 4DX7A 3LP1B 4EU0A 3B4MA 2FHMA 2ZHOA 4O3SA 1S6QA 3MEDA 1T95A 1WF2A 5KFCA 4IG3A 2H3EB 2YWWA 3D4JA 4URGA 5KOWA 1SJ4P 2VQEJ 1R31A 1T11A 5HP1B 2J8AA 4LBPA 1HQEB 5AXLA 4JI4F 4F4AA 3DLHA 1N34F 1YHQS 2KXFA 3TANA 4DUZJ 2A6MA 1QUVA 2DGVA 1WG4A 1YRXA 1HBUB 1EIYB 4GKJJ 3CVKA 1HHTP 4B9UA 2Y0SD 1JK9B 3X1LB 3HVRA 1B7YB 3KJNB 3NS5A 4DUYF 2HSEB 4ZP9A 4QOTA 3HVWA 1U1QA 1U8SA 3MPUB 2BEFA 3IS9B 3IGNA 2HPUA 2V67A 2PT0A 5IV3A 4FXWA 2UU9F 2CPFA 2ACMA 3RAMA 3SCLE 2OO4A 2CPHA 1Z4UA 2A1BA 1DBDA 2PI4A 4Y00A 3S1TA 2BW7A 1A6LA 1AB8A 4G1QA 1S6OA 1S79A 5FDLA 5HVFA 1TKXB 4UY8T 2MEWA 5HJXA 3BDEA 1Q8BA 3PW4A 1XMQJ 4YY3F 2ZHAA 2YKNB 1N0UA 3OW2R 2E5IA 4P7VA 2PA8D 4GKKJ 1MMDA 3TA0A 1J5EF 2YQ0A 4F7VA 2HNYA 3PCOB 4NA1A 2JVRA 1Y3KA 4NYOA 4I7FA 1TKZB 4WIIA 1X4DA 3ZXWA 1R0AB 3PYDA 2DHHA 3M1VB 2XMVA 3C19A 3HT0A 4KGMA 3CT9A
chains in the Genus database with same CATH topology
2QA4G 5D3GA 2YNFB 4D3GA 3CMAS 1HARA 3CD0A 3IWNC 4ZPWR 4ALZA 2P9GA 1FHTA 2R9LA 4HTIA 3IA0A 1ZM3A 1URRA 5KAKA 1X5SA 3FFIA 4LSNA 1UEUA 4QIGA 2KT2A 1WHVA 3ZZRA 2BM1A 2RQCA 1P1TA 7FD1A 3HKZD 3FNNA 4NLOA 4F25A 1TK8A 4PXEA 1XTZA 1GTEA 1X9WA 1SH2A 3HI9A 3CJ0A 3ZZZA 4KPYA 1ZBTA 1KRPA 2YWGA 4KRWA 3T5LA 1KFSA 3DHXA 2IC3B 1NJWA 4ED6A 3UD4P 2E9ZA 1SV5A 3M8PB 3KK1A 4Y2MA 2ZD1A 1E6VA 4QU7A 4JI2F 3QIDA 7FDRA 4J37A 4ECZA 4QYZJ 4IG0B 4DL7A 4U67Q 3VAHA 3M9MB 2R7RA 5T7LB 5KFNA 1JLBA 4U9RA 3OUYA 3KK3A 4F50A 2DRAA 4O0IA 4M95A 2DH9A 3DLKA 3QAUA 5JUMA 1DTQB 4X62F 1LWFB 1YVFA 3OQ2A 4FS1A 4M94A 5M2RA 4IO9Q 2OPQB 3KK2B 3CDAA 1SC6A 4CTAA 2Z0GA 1S1XB 1TKTA 4K4YA 5F3ZA 1FF2A 2C2EA 1X5OA 1KVJA 1Q82T 1LW0B 2XGPA 1PC5A 4DQQA 2C42A 2LKZA 2YKOA 3OVSA 1S1VA 4DFJA 3KLIA 4L72B 4C8MA 2ZH8A 2CPIA 2K2PA 4J5OA 4JI8F 3H2UB 4ECRA 2KKHA 1J2VA 2GIQA 2QSWA 1JMTA 2K3IA 3NLCA 2L9DA 4USHA 4A8OA 5A2QY 2AF6A 3C6UA 5IM0A 1EETB 4WFYA 2D74B 2XY5A 4JBCA 4PPDA 3SMZA 2E1RA 4BC9A 5BYSA 3EYZA 4NLUA 2L41A 4PG6A 3CJKA 3KTQA 4Z37A 2UUCF 1JLAA 1RI7A 5KFWA 3CCUS 2CQHA 3ENQA 2W9BA 1S4FA 3EX7B 2HMIA 3I5CA 3RZAA 4B9VA 5CYQA 5H9EJ 2K1RA 1RT4B 5LL6d 5FLXY 2RDJA 2VH7A 1BLUA 5KFOA 4ID5B 2ABYA 3PEJA 4KKOA 5CXTA 4C8KA 2G13A 3OL7A 5I3PA 5F9LA 2XSFA 3OTOF 4QZVB 3DM2A 5BR8F 3DC2A 3MUVP 5IS2A 2YKAA 5C5JA 3MM6B 4CT9A 2HVIA 2VG7A 3UR3C 3Q8QB 2PE8A 2PDAA 5L1JA 3THVA 1N54B 1S1UB 1U6BA 1HWIA 2ZNZA 4NZ0A 4NLYA 2R2TA 3H5XA 2D3UA 3DI6A 3GV8B 1HW9A 2KYXA 4QWBA 2RDIA 2R4FA 5JVHQ 4O23A 1T3OA 1FJCA 3HVAA 5CCLA 3V6HA 2WOMB 1HNWF 4I6AA 5CD4H 4FF4A 1RT6A 1SIZA 1QE1B 2QA2A 5CA5A 2V8DA 2RSQA 4LVNP 3Q8RB 1BY9A 1MROA 2LEBA 3THTA 2E7WA 4L6V3 2ZUGA 5J2NB 1YITS 1GNKA 3KHHA 3N6LA 4GO7X 5C24A 1VC6A 1SJ1A 2HWHA 4HDHA 3CJ4A 3W2WB 5KFYA 1T03B 2XS5A 3C6TB 4FF2A 3N79A 1UA0A 3K7RA 2FC8A 4DBQA 3FMWA 1P6TA 3GV7B 2ASJA 1S1WA 2KU7A 5JJBA 2CQCA 1K73T 3HZEA 2W25A 2JH3A 1RYRA 3OFFA 2X1FA 1F5AA 5HROA 2ZH9A 5K8PA 1IKVB 3K8VA 1LV5A 3GG0A 3MR3A 3CIZA 1TFYA 3JSMB 3AQPA 5KG6A 4AL6A 4OLOA 4ECXA 4LFAF 1X9SA 3R5CA 1YJ9S 2CPZA 2I38A 2ZC4A 1B0PA 1UL3A 1JLFB 4F02A 5EN1A 3DRRA 2MKSA 2CRLA 3TAMA 2CQ1A 1BQNB 4NYPA 4PG7A 4DL2A 4WJBA 2VBWA 1N5SA 1VI7A 2FPHX 2RILA 1FKPA 4OI6A 2VG6A 1JKHB 4F4WA 1U45A 3DRYA 1Q7LB 2B9YA 3LP0B 1B64A 3D0GE 3GB0A 3QGIA 5LJ5Y 2BJEA 3U7JA 2ZDOA 4FNHA 4ZP7A 3KNGA 4MIBA 4KQZA 3LWMA 3DLEB 3SDEB 4HEA9 3UFCX 2AYEA 2E1MC 5KT3A 3SV3A 3QWUA 4HT7A 4RWXA 1ZTWA 4TU7A 4IOCQ 2P9CA 2ZE2B 3R5AA 3RB4A 5LSRA 2FVRA 4WYWA 1XN9A 1U26A 4ZA1A 4C11B 1FRMA 3GE9A 4H4OB 2QLWA 4ZPDA 5FJ4A 1J5OB 1S6PA 2EPIA 1XNQF 3EZUA 4HT5A 4X4VA 2RKIB 1R6YA 4DR2F 2FY1A 4YOEA 4JI7F 1XR6A 2RE1A 3CCZA 2EVZA 3UNGC 2BYCA 1F2GA 1CQNA 4DS5A 4MMOA 4Q0BA 4KO0B 4RUAA 3X3UA 4ICLB 1R27B 4RW4A 5D6GA 4FXDA 3HX9A 2CJQA 3IWXA 3VZHA 2JDJA 1R3NA 2VG5A 3RW6A 3R3TA 3OJUA 1RTHB 1X4CA 1ZYQA 3CDBA 1QAXA 3O8WA 3K5MA 4H4MA 2GMLA 1OQ3A 4EYHB 1T94A 4FN5A 1UEVA 3MEGA 3I0RA 3RW7A 2YX7A 3H2LA 1C0TA 3H98A 2ZM6F 4MKYA 4ZVFA 2W8LA 1HWJA 4USJC 4IR9A 1CVJA 2XCAA 1NB7A 3GFZA 2DVIA 4PR6A 2NR0A 2KZMA 1C1CA 2O5DA 1ZAVA 4OJHA 4IRCA 3KJVB 2Q66A 2PFFB 4RW9B 4CCHA 5MAOA 4NLWA 1FRXA 1N52B 4NLSA 4XPEA 1FEEA 3V81A 1JLQB 2BQRA 1VS3A 2JWNA 2COLA 5KT2A 1HBMB 3AHPA 4KE5A 1H7WA 4CQ1A 1VQ4S 4MK7A 1JX4A 3DYAB 2Q3PA 3IR7B 5DDQC 1BQMA 1LWEA 3I5BA 5ITHA 4HLBA 5LT5A 5KFPA 4HVZA 1X4EA 3CJ5A 2UVVA 5KG5A 4JI0F 2J6SA 4HHJA 3PX4A 3M8SA 1IBKF 2FJWA 4NX9A 2B56A 1BC6A 3P49B 2CQDA 4B9LA 2D9OA 3SFGA 5IT0A 2R7SA 2B3TB 2VBXA 5A8WB 2UUWA 2HS4A 2YWHA 4I2PA 5B0GA 3SCJE 1Y00A 4C8OA 4DV1F 4OHVA 4QW8A 5EWEA 1BD6A 3OHBA 4ED2A 2XLKA 4PKDB 1YGYA 4EBCA 1QSYA 1N5YA 4ILRA 2QMWA 3DNCA 2NXUA 3OFHA 4YR3A 1TR0A 1H2VZ 3AQOA 4IFVA 4Y6IA 1VRTA 3JSRA 1YJWS 4LSLA 3JAMY 1UP1A 3ZC4A 4CH0S 2RH3A 3BF4A 2ASDA 3LP1A 2CQ3A 4G6VB 2RF2B 3V6JA 3RB0A 4ILLA 4PQUB 3MMAB 1FNMA 5DLGA 2W9CA 4FYDA 5C25B 3DDKA 1S9GA 3JTNA 3LO3A 3MEKA 4LQ9A 2GNKA 4AQYF 3IBWA 3VQTA 2R7TA 3ITHA 4AFFA 2ZC3A 4K59A 4PQAA 3HZGA 3JB9k 1LW2B 3MM5B 1LXJA 1NJXA 5K9FA 3FJ2A 4ECUA 4RU9A 3A8EA 5HP1A 1Z2LA 4ZHRA 3O5TB 5HMYA 2ZBCA 5HMXA 3PNIA 1HQEA 3N01A 3WZ0A 2CKWA 3MM7B 5LSLA 2Z8QA 1RA6A 4YP3A 3PJXA 1TL1A 2B43A 3IR5B 3UCGA 2Q6BA 4ED0A 1PSDA 4HI1A 1RDRA 2G1DA 3UQSA 5B0DA 1DJ0A 4LF4F 1C1BB 2RMLA 2VD3A 4K4WA 4C97A 2I9SA 3HDSA 2FHKA 3BQ1A 1KOHA 3Q22A 4DV3F 1UVIA 1HBUA 3W7BA 1SKRA 4EWTA 3IC1A 2HWTA 1W2IA 2GQ2A 1HYSA 2UXBF 4C8ZA 4DV2F 1HQUB 4DL3A 3MPVA 4RUCA 1VQ9S 1VLYA 5KT4A 4J9OA 1JNRB 3BN4A 2VFTA 4RNMA 5C42B 4ZS6A 2GGPA 1QSLA 4TNOA 2KG1A 3P5TL 4BDPA 4OFZA 4A48A 4NXMF 1VRUB 4DV4F 2MKIA 4MIAA 2UXDF 4ECVA 3MR2A 3TA2A 5DQIA 5I42B 3BREA 3ZFVA 4DSJA 2OPRB 3MR6A 4X4TA 3IS9A 4CH7A 4NRTA 3DLGB 3CXCR 3M2UA 3RBEA 4OI3A 5E0OA 1KTQA 3HHLC 4B02A 1TFWA 3H8YA 4DL0C 2D9PA 2HVZA 4LIRA 1FT8A 4PCQA 3I6PA 3MGJA 2RRBA 4B3RF 5F8NA 3P3DA 5D4LA 2V4QA 3JSBA 4C2MA 2ASLA 1O0PA 1HNIB 3K57A 5CZXA 4M1KA 1RT5A 2B5JA 2F9JA 4OZLA 2N4CA 1HNVB 1SUQB 2JC0A 1UJ4A 3FSXA 1HBNB 3QGPA 4QQBA 2LVWA 4H54A 1TV6B 3TUZC 2E9RX 4YHHF 1YRUA 1VQ8S 3OLAA 3R5DA 2CQ4A 3GSDA 1IBMF 4UUWA 3AB4B 4IOAQ 4TY8A 3TAPA 4N56A 1TL3B 3HM9A 3AH6A 2AJFE 2FLPA 3VQSA 1TKXA 1S0NA 1KS2A 1L3VA 1R8BA 3IG1A 1OSDA 3Q8PB 3FVYA 1IXKA 2QZ8A 1XMBA 2FHJD 3FSYA 3M32B 5LSOA 3NNAA 2U1AA 3OJSA 4DR5F 2YKNA 2R8KA 2IM2A 2WSFC 1Y3JA 1YTYA 5JXSA 2F4VF 4FF1A 2VKZG 3OR2B 2WB4A 1U1KA 3BS9A 3MDFA 3ULHA 1G2EA 4ECTA 1WI8A 1Q4RA 4YB5A 1IQTA 1M90T 1UFLA 3N28A 2DHGA 3MFIA 1U6ZA 1MU2A 4UOCA 3PIPQ 2KN4A 4DPOA 3SQGA 3J7YU 2R2SA 2ZH3A 2X3GA 3CD7A 3K8WA 3KLFB 4C3MA 2NUUG 3GV5B 4DF4A 1A9NB 1KR4A 3L7PA 1LQ9A 2YNHB 1HHSA 4B3MF 4JYAF 5J2MA 1C4AA 1ZM9A 1T02A 1URNA 2HQIA 1TKZA 5EX3A 2RRNA 4NLQA 4K4XA 2LXUA 3JTPA 2PD1A 4I68A 4WFBQ 3G4SS 4IFYA 1VMBA 4ZPTR 1YRTA 2IBKA 4JI5F 3HMJG 2BRLA 4IDKB 3QLHA 2RS2A 4D3HA 1G6BA 3CCMS 5CCMA 1VJWA 2W4CA 2FVSA 4DL5A 3I5AA 3M1VA 2V0NA 2RJZA 4MKBA 4DMZA 3K5OA 1FK9B 2E1CA 4J9LA 2BXJA 2FJEB 2N7YA 3G8SA 3N4WA 1RISA 2CQIA 2OH2A 1U09A 4I6WA 5GAHI 2L3MA 2C3MA 1NK7A 5DQGA 2B4VA 1DTTB 2IRUA 3EZ5A 2YNFA 1U4BA 1FD8A 2WTFA 4ZPVR 4XIUA 2VFUA 1YJUA 5KFSA 2XG8A 2XGQA 2XC9A 4F3OA 4NCBA 1UAWA 4CI0B 2KJVA 3PZPA 2UUAF 5B0BA 5AE3A 4DR1F 1DFDA 2AYGA 4OL8A 2JEJA 5DGBA 4GMKA 2B7BB 1KQGB 3CIMA 1Y4ZB 3LOUA 1HMVB 1OPIA 1YSJA 1ZOTA 4X2BA 2IC3A 2OP5A 2B9XA 1U1RA 3DGPA 3DU5A 3M8PA 4LF6F 2HFZA 3Q8SB 3J7ZT 3PVXA 2ROGA 1RT3B 3C46A 1N0VC 5M2PA 2KFNA 1LWCB 2ZKUA 4IG0A 3SV4A 2R7VA 4EBDA 1NJYA 4Y65A 3CPWR 1KD1T 2NZ4A 3V2UC 4NZ6A 1FERA 5T7LA 1I1GA 3M6VA 3PEHA 2IA0A 4OQJA 1LFPA 1R8CA 3BM7A 2VFRA 1DTQA 1FKOB 4C8LA 3L95X 2OPQA 3N5FA 5A8RB 3KK2A 4K5SA 5AJ3F 4ZDNA 2WK4A 5BYQA 4AXJA 1D8ZA 3MMCB 1U1LA 2V4RA 1S1XA 1X5TA 2F1FA 4B17A 2XBPA 3F56A 4DQRA 1RGVA 3CCWA 1JIHA 1WACA 1S6UA 1Z2ZA 3MM9B 3BR8A 4YB7A 4JI6F 2LQBA 3CF5Q 4DR3F 1LW0A 1AROP 2DISA 2GQQA 2JSXA 1U47A 2A18A 3TO8A 2CPDA 2YVSA 3M30B 3IRWP 1QSSA 2R7XA 5E3CA 3M9OB 4QR0A 1AFJA 4BCAA 4HKQA 5L8RC 2LMIA 1K0VA 5KFXA 4WXWA 2DNZA 3P6YC 1S7HA 2FIUA 5IT4A 1EETA 1TZ0A 2DPJA 2BBEA 1X8DA 3N5BA 3F73A 4NXNF 4E0DA 2HHVA 2E44A 2CPXA 1OO0B 1UW4A 1X4FA 2IM0A 2XLIA 2EC0A 2D1CA 4PWDB 1KHVA 3MURP 3HHEA 2IVYA 4PG5A 1RT4A 1VFJA 2NS1B 4OMFG 4RBUA 2EBEA 2UVUA 2EBGA 4RUHA