4Q2LA

Atomic resolution structure of the e. coli yajr transporter yam domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
b'PPYVSSLRIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major facilitator superfamily MFS_1
publication title Atomic resolution structure of the E. coli YajR transporter YAM domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q2lA00
2HLUA 4A47A 2OKQA 1TL4A 2IFXA 1OPZA 3HHLB 3WDOA 2GO8A 3HX9A 2L3MA 2HLTA 2XMTA 2N4CA 2GA7A 5B08A 1S6UA 1P8GA 2HQIA 2W4PA 5F0WA 2EW9A 2FHMA 3MCSA 2N4DA 3TRGA 4QOTA 3HF5A 1ULRA 3MZIA 4DL0C 1AFIA 2RILA 1MWYA 1SI9A 2Q3PA 3BN7A 3LO3A 3K7RA 1LQ9A 2GV1A 4EFAC 3HHLD 2BJEA 2LDIA 2FIUA 1FVSA 1X0PA 2OFGX 1X8DA 1XBWA 2OMOA 2XMMA 1Y0HA 2ACYA 3IWLA 1FESA 1YG0A 2AW0A 5B0DA 2XMVA 3T9NA 2VH7A 4HH0A 4HH1A 1W2IA 2LQBA 2QYCA 3BDEA 3E8OA 1VQSA 3DXSX 2JDJA 4U9RA 5B0EA 5B0FA 2OFHX 3LGNA 4HL9A 1QUPA 1SQEA 3KKFA 3CJKB 2K1RB 1V3ZA 2IYIA 2VV5A 3GZ7A 5B09A 1YJTA 3F44A 4DN9A 1CC8A 1K0VA 1KVJA 1JK9B 2BYCA 3TNVA 1P6TA 2GFFA 2QLWA 3BF4A 1N5TA 5K9FA 2ZDPA 4F67A 1GXUA 4DPOA 2KYZA 2XMKA 4NPOA 3QMQA 2PGCA 3I9ZA 1FE4A 2KT2A 4Y2IA 4YDXA 5IXUA 1Y3KA 1SB6A 3BGUA 2GGPA 1WD6A 1TUVA 4Q2LA 1Q4RA 1AW0A 3KG1A 2KT3A 2AP6A 1CC7A 2OD6A 2XMUA 3FGVA 1AFJA 2QIFA 2ROEA 2AJ0A 4Y2KA 3VTIA 2N7YA 5T7LA 4ZA1A 4NL5A 1KQKA 3FMBA 2LQ9A 3BB5A 4ZOSA 2KKHA 4OJHA 4OJGA 1KVIA 1YJUA 1CPZA 4OJ1A 4A48A 2XMJA 2K7JA 1X7VA 1OQ6A 1Q53A 2PD1A 2XMWA 1URRA 1YJVA 2QLXA 3LGMA 4YEAA 5A6PA 2K7KA 3HHLA 2GCFA 2OD4A 1N5SA 2ROPA 5B0GA 3CJKA 1VQYA 5B0BA 3HHLC 2ZDOA 2IYGA 1R6YA 2OAUA 3HDSA 1IUJA 1JWWA 5B0AA 3KG0A 2HIQA 2LXFA 4A46A 1FD8A 1U7LA 5B0CA 2AJ1A 4A4JA 2ROGA 1N5VA 1MWZA 2FB0A 3HFKA 3DCAA 3KNGA 2K2PA 1TR0A 2BUNA 3IWXA 4FNIA 1YJRA 2BBEA 2OP5A 5F0UA 2G9OA 5KAKA 1GXTA 1Y3JA 1Y9OA 2GGPB 1Q8BA 1N5QA 1OQ3A 1TL5A 2RU9A 1YRXA 4HI2A 3BM7A 3QGPA 1FEEA 2W4CA 3TOQA 5T7LB 2K1RA 5A6WA 1OSDA 2BJDA 4Q2MA 4FNHA 4OJ3A 1RJJA 1Q8LA 1TZ0A 4OIXA 2CRLA 4Y2MA 4HI1A 2ASYA 2HFNA 3FRYA 1APSA 2RSQA 1S6OA 2FTRA 1FE0A 2HFOA 3BR8A 2RMLA 3UDCA 2W4DA 1FVQA
chains in the Genus database with same CATH superfamily
1HLWA 2IVFB 2J0QD 3KFWX 4OX7A 3NS5A 2CQBA 3IR5B 3UN5A 2VF3A 2ZHAA 2P5VA 4EBDA 4TYBA 3ZZRA 4ZIVA 3JSYA 2W2QP 2XS2A 1SC4B 2F3JA 1CJUB 1FNMA 2ZKUA 4QCLA 3G8TA 4MIBA 2OLWA 1M5HA 4IH5A 2XMKA 1I51B 4NLSA 3PW0A 1X4EA 4RW4B 2AWZA 3QRQA 4LF2A 2DNQA 2YWKA 4P75A 5HBMB 4E8UA 2YBVA 3C66A 3FEZA 2XS5A 3DOKB 5AXNA 1KFSA 4RNNA 2BJDA 3UCUP 3QRRA 1B7FA 9RUBA 1VBZA 4RW7A 4RW9A 2V6AA 3D6MB 2HGLA 5A8KB 1B3TA 2GHVC 3VGSA 2LEAA 2DY9A 5K20B 4R8UA 1L5UA 2ZH6A 4JI5F 3T5HA 5F8GA 3TI0A 5HMYA 2DNGA 4H4MA 4EUVA 2OI2A 1T95A 3CJ3A 1R8PA 3G82B 2HFVA 2YNIB 5I3PA 1WNEA 2ZNYA 1S1XA 2GVZA 2IMWP 1FA0A 3ET6A 1WD6A 4FXDA 4YR0A 2VBWA 2MSTA 2UUCF 4WYWA 3KJQB 3JS9A 2ALYB 2E1AA 4XAKA 2Z2YB 4M5HA 1RT2A 3GILA 2PO4A 3HHLA 1LWFB 2YKNB 3VGUA 2R7TA 3QT6A 3SIPB 5EWEA 1U1NA 4FYYB 2CQPA 1LWCB 4NXMF 2QEXS 2J6TA 2HNZB 2CADA 1KFDA 4A4JA 1RAEB 2IM3A 4DCOB 3IG1B 1M5KC 1S1UA 2AJQA 4LF5F 4DV0F 3GYNA 3Q23A 4BS2A 2IRYA 2RD5C 3A8IA 3I6PA 4KYZA 2JVOA 3C6UB 4UUWA 4N56A 5BYQA 5FDLB 3QWPA 1HNVB 1NJZA 5DDRC 2XMTA 1WOOA 2HQIA 2HHHF 3MEEA 4PWUA 1YX2A 1S0VA 3W7BA 2KU7A 1T7PA 4C8NA 2VICA 4K7QA 3PFEA 2DNMA 5THWA 2XYHB 1MN9A 1ZTWA 1Q7LB 1X5OA 4DN9A 2DEIA 4YFUA 4YQWA 3M1VA 4DLGA 3R1HA 1G6BA 3VTIA 2J0WA 1GMWD 1S1TB 4I64A 5DJBA 2CAJA 3I32A 1NK7A 4CLFA 2AT1B 3NNAA 2R2UA 3A3OB 3ILOA 3I0SA 2V4JA 1TELA 2DRBA 3Q8PB 4ANDA 4CT8A 5ETOA 3DN9A 3FBCA 1TV6B 5K8OA 4F50A 4BLGA 2KFYA 2Z57B 4O23A 1WDDA 4CT9A 1UJ4A 3W9JA 3QLHB 3CT9A 2R7XA 3IMQJ 3DOMB 1IKYA 2GHWA 4M5DB 4HACA 3OT9A 1RTJA 3V6KA 5HVGA 4K4TA 1U47A 3C6TB 2C28A 4BBYA 3KLIA 3MPVA 4WFNQ 2CDRB 4YB6A 3ISND 1KC8T 4CLTA 2OMOA 4DPYA 1XR7A 1SXLA 2B0GA 1OY6A 2RF2A 2XB2D 4RL1A 2QL5B 4P71A 2DH8A 3FZ2A 3KUGA 4MKBA 4M5KA 1H7WA 3KK1A 3LWLA 4LRDA 2VDIA 2XMJA 3MUVP 2JEJA 4Q0BA 1IM6A 4KFBA 4U7UK 2AJ2A 1HMVA 3CJKA 3ITHA 1TFWA 1U49A 1GXLA 3GFXA 4DSJA 1N5VA 2BE2A 4JI3F 4G1QA 4OI1A 3I82A 1HD1A 1PG5B 4NCGB 4TNOA 1FEHA 1B4SA 5J2NA 4PXDA 1T03A 2MLZA 1FRMA 3TUPA 2RMLA 1R31A 1HNZJ 4WFBQ 1NK6A 3HF5A 3V81A 3I0RB 2DR8A 5H9EK 5J1EA 2RH3A 1PJ5A 3BPSP 3CGIA 4DR6J 2E5LJ 1NK4A 1U8WA 1UL3A 2G0IA 4DV6J 1X4HA 2ZH2A 3W8GA 1YI2S 2LCWA 1AW0A 3U1MA 1CC7A 4JYAF 1H2TZ 1AFJA 1JJCB 4Y65A 4QU7A 5HQ8A 3K57A 1S9FA 3G8SA 1PSDA 3H90A 1RCOB 3J7A1 4B3SJ 2FJBB 4KIAA 3BS9A 4IG0B 3T9ZA 1M1KT 1SC1B 4B9SA 1KKHA 3UE2A 1PILA 4FNIA 5KFJA 3DLGB 4UOHA 4DR7J 1TMMA 2DXFA 2Q1LA 3C19A 4HI1A 1UPMB 2VDHA 3M8ZA 1ZM2A 1SPBP 1RAIB 3EZ5A 4G65A 5E3PA 3GE9A 3J7AN 3UFCX 4OLPA 3R2CJ 2Q43A 1SJFA 2LDYA 1MU2B 4PCQA 3DGPB 3GYXB 2VOPA 1JX4A 1PGZA 5DETA 1RBOB 2ACYA 2AU0A 2A6MA 3HLUA 3HHKA 2D74B 1RKJA 3PRDA 5HLFB 4I2QA 3GSIA 3V2UC 1FCAA 1FRLA 1DBDA 1VC6A 3WZ0A 1ZZNA 4MKYA 2ASJA 4EWTA 4KJIA 3IP0A 3D54A 1RHKB 1LFWA 1N36J 2B7BB 3M8YA 4F4WA 1NB7A 4FPIA 1KLNA 3QIPA 1VQPS 1NK9A 1LK7A 4V19J 4TU8A 3U1NA 2MHEA 2E5HA 4Q8EA 3EJMA 4GKKJ 3NCPA 1TFYA 4MH8A 1UFWA 3AT1B 1G4CA 1RWOB 5J2MB 1H98A 2PEBA 1M90T 2V8GA 2HVDA 5EWFA 1NO8A 1GXTA 4OYWA 3DFEA 2BM0A 5FJ4A 1HYSB 3H25A 2B6AB 4X62F 2LU2A 3P8BB 4ZK7M 3CXCR 2MQLA 4B3OA 4MIWA 3D5MA 3MM7A 2HAIA 1FWLA 3RUBL 4JV0A 2B3TB 2C42A 2X3GA 3SQGA 1J5OB 1MN7A 1ZAVA 1U09A 2ERRA 4Q44A 2OFGX 2V8HA 3ZTPA 2GJFA 3ZC4A 4AUKA 4HH1A 5CH7B 2P6SA 2DB1A 2KDOA 3QRPA 5J2QB 3QAUA 4R0JA 2KYZA 4RU9A 3Q0AA 1RB0A 3BR9A 1YSJA 3DMJA 4IR1A 2FJEB 2RKIA 1X4FA 2VODA 1HBNA 1Q53A 4NLOA 4IRDA 2J6SA 2ZJRQ 2IM1A 1WTFA 4N7TA 3PHTA 1HI1A 2FJVA 1RT4B 1L3SA 2DNKA 4LFBF 1FDAA 3EPIA 4FF1A 3D67A 5I3UB 2IM2A 2CXEA 3EXYA 5G0RA 4YY3J 1Y00A 3V6DB 2HFUA 1WHYA 2K1RA 2EG2A 1BHNA 3G6ES 3M2UA 3D6TB 1RTIA 3CNQP 5HQLA 4ZPCA 2EBEA 3NKYA 2XWXA 3BDPA 1JXVA 3CCES 1MLAA 8ATCB 3W3SA 5F8IA 4WFXA 2NXJA 1KLMB 4EBEA 5CABA 4U96A 1WUUA 3OSPA 4LF4F 5HMXA 1ZS6A 3Q86A 3O44A 1F9FA 4RNOA 1BD6A 2JC0A 4LJMA 4GC6A 3PFOA 1MSWD 4Q45A 3MR6A 4M8LA 2G13A 4HLBA 2RHQB 2DH9A 2FVPA 3FBEA 4WFAQ 1GMUA 4P10A 5HO4A 2OD4A 3T1HF 2HRYA 2OSQA 1X9MA 3PTWA 5GMEA 4PPZA 2L9NA 5GADI 1RWKB 5L1LA 4ZCKA 1ZOTA 4DOZA 1HIYA 4ZVOB 4AXIA 1QVGR 1D3WA 5C25A 1YLXA 2HEKA 3LF0A 4JV2A 4JI8J 2KJVA 4PG6A 5I42B 3Q8VA 1TK0A 1S48A 2J8AA 4NA1A 2V2VA 1KP6A 2GQQA 2HLUA 1Y11A 1ZA1B 2OKQA 4O3NA 1VQ4S 1S6UA 3V4IB 3D3BJ 3OL7A 2FVQA 4UZCA 2XULA 1S5ZA 2V34A 1NH7A 2JZ5A 1H38A 1XWLA 3UD5A 2KRBA 2GVDB 4NEZA 1U0HA 1VBYA 3HP6A 2EFGA 5E3AA 4W90B 5K14B 4C4WA 4DPWA 1RHRB 2M8DB 1ROFA 1TK5A 2E9RX 1JLEA 2V63A 3TQ1A 3NNHA 3N5BA 4IOBA 1SJRA 3PACA 1NZ8A 2HK3A 4NLXA 1NM2A 4RW6B 3OR2B 1S0OA 3GIRA 2IC3A 4MIAA 2K7KA 2M3DA 3M8QA 4B9MA 1V5IB 2JRSA 5CD4A 1NRKA 2WSCC 4DDFA 2KFZA 3KNGA 3FBBA 1YVFA 1Q0NA 3CJ2A 1QAIA 1KWMA 3CD0A 4USUA 2NXEA 2HFZA 2HW3A 4I0WA 1FDNA 5J2PB 4JI4J 3P49B 1R7IA 1EX8A 1UVNA 1VK3A 1RT3B 3N5FA 5CYQB 3R2DJ 3EGZA 2R8IA 2YKPA 4UY85 1LNQA 2N3OA 5B0DA 1MMDA 1MROA 5HSPA 3T9NA 1CJKB 2AF6A 1DARA 5EHHA 3BSCA 1NPRA 4OHWA 5D3GA 3WX8A 4JV1A 4E0DA 1KTQA 4PQUA 3N79A 3PR4A 3OSNA 4F3MA 3EDQB 3KHRA 2MKHA 4MFBB 3PV8A 3OVAA 4X4UA 2K7JA 3TQEA 1OS5A 2GAHC 1VRUA 2B4VA 3JSRA 4WPAA 3KYLA 1H0HB 4NASA 1N5SA 2QMXA 4LF7F 5GAHU 1HQEB 3GCXP 4DUYJ 3TZXA 1T9YA 1S1VA 3QO9A 2VHGA 4RBUA 3IRXB 3M6XA 4Y00A 3ZZUA 1XC9A 4RUAA 2G2OA 2HGNA 2IBKA 3TWZA 4X4TA 2XQCA 1CEZA 2MKCA 1E6VA 3IS9B 4XDDA 3NCQA 2V8VA 4A8SA 4NLVA 4CH7A 1EP4B 6FD1A 3RR7A 4N76A 2HZAA 3KLFB 1DLOB 2U2FA 2HWTA 4LF8J 4JI6J 3QPIA 1Y5IB 1XR6A 3NGKA 3G6YA 1Q78A 4EGLA 1GH8A 3JQMA 4NLUA 4EO8A 4BDPA 2CJ9A 2DT9A 1G3OA 4WK3A 2ROEA 3K17A 5I4MA 4P6QA 3KLEB 4WP8A 1HI8A 7AT1B 4ILMA 4P52A 3KHLA 1FERA 3I56S 3KG0A 5CYJA 3HD1A 4J9QA 1CQMA 2FB0A 1JLBA 5DZ7A 2RRNA 4B3MJ 4J9PA 1HR0F 3GJTB 4ZVGA 5BYSA 1BQMB 2HBYB 3HI9A 4RX6A 5A6WA 2WOMB 4WWSA 4UUXA 4X64F 1TL1A 5H1SV 2M70A 1FKOB 2G4BA 1S9GA 1I94F 2XY5A 3FK4A 2JJ4D 2UVUA 3OR1A 4FS1A 5KFWA 3MR5A 2IM0A 3RB6A 3W9HA 2RQ4A 1Y5LB 3P5BP 3W5ZA 4CLSA 3C14B 4OZJA 2GMLA 1U26A 3CW2C 2KM8B 1SQEA 2FZKB 3QFHA 1JK9B 4RUBA 3NY0A 1N5TA 2M9KA 2VIHA 4EO6A 4LMZA 4QZVB 1HBOA 1TTHB 1FJEB 4ELVA 4KHRA 4ECUA 4RUCA 4NEYA 1KN6A 3DU5A 3MMBA 4J9SA 2YX4A 2FJAB 4OI2A 2NUHA 1RAGB 3JTPA 1C4CA 5GAGI 3KJVA 2RNEA 3CO0P 3MMCB 2ZH9A 4DL3A 2ZZTA 1C0TA 4WYLA 1REVA 1YITS 1XR5A 3JAMY 1EQ0A 4OYOA 2JLFA 3HD2A 4DV1J 1BMQB 3PHEA 3BQ1A 5KFGA 3TZZA 3JQJA 4PUOB 1HKAA 4QJVA 3AQOA 2V2QA 5E7OB 1NHVA 4LREA 4FDFA 3RJMB 4WP3A 1Z1ZA 4PG4A 3HHLD 5IM0A 3GCWP 5JJBA 5KFHA 2JH3A 4ILRA 5CQGA 3SV4A 4TY8A 1N33F 5A8RA 5L1IA 2ZUGA 2DGWA 4I56A 4NWBA 3PXGa 2PGCA 3FJ2A 1N34F 3M8PB 2UVWA 1WI8A 3E01B 3KDNA 2PT0A 4MAKA 3ILLA 1S6PA 4G1PA 3D1OA 3BPDA 4KT0C 4FS2A 1NK8A 2CQ3A 2UXBJ 5KFFA 2KFNA 1I3OB 4RPFA 1WHXA 3KJNB 1MG7A 4NCBA 2MXYA 4FYXB 2I2YA 1SKRA 4O3SA 1WI6A 2CQIA 1S57A 1QAYA 4QIEA 2ILZA 3MM9B 2MPUA 1OSCA 3OTOJ 1KD1T 2HNDA 2BQ3A 1F1BB 4USTA 2PFFB 3OXFA 4Y2CA 1S9EA 3QT8A 2VQEF 4I2PB 1CLFA 3SCLE 3G9CA 1UETA 2DIUA 4ZLLA 5I3QA 4CTAB 1YKWA 2IA0A 1WSRA 3A13A 4DS5A 1AUDA 1EB0A 3G8QA 5F9LA 3GFZA 3W2WA 1NZAA 4GMKA 4WTYA 4J9KA 2HMIB 2E1MC 2N82B 3DRYA 2Z30B 4Q43A 3KOAA 2R3VA 1U1QA 5IV4A 1U4BA 4NXNF 1S1WB 1RXOB 4DU7A 1VQ8S 3PNIA 3DI6B 3R5JB 2EKNA 1U7LA 1C1CB 3DLEA 4DV4J 4JI5J 1YJRA 1N5YA 3NCRA 3RG6A 4LFAF 3EM1A 4DCJB 5E5NA 1FRHA 4FNHA 1U1MA 4FZVA 4PEOA 2FUG9 1OJ4A 5LSLA 1HWUA 4TYAA 4F7VA 3DRSA 4YN3B 2FY8A 2MQQA 2DO0A 1HWJA 5LXRA 4DR5F 3MR7A 4ZJQA 2Q3PA 2W9CA 4PG5A 3DDNA 4X84A 5AXMA 2PSZA 3HSGA 1UVKA 2GJ2A 2W8LA 3M8SA 3AXKA 4G3IA 1RYSA 5ETTA 3GYGA 1PBAA 3PJ9A 3AB2B 1S49A 3BF4A 5HP1A 5K8PA 3HM9A 4LF5J 5JVGQ 3GB0A 4J9NA 3AQPA 4CRJA 3OTDA 1UZDA 1QTNB 1CSJA 1NPKA 5GADU 1N88A 5KFEA 5KFOA 3KWMA 3IC1A 3PKYA 5B0AA 1FKPB 4C2MA 4F04B 3T5LA 2DNOA 1S97A 3KMSA 3VWSA 4NYPA 4C8MA 2XTJP 1RU1A 3NL0A 4C8LA 1C4AA 2W4CA 3TX0A 1TKXB 5HL7Q 2UUBF 1WC5A 4USVA 4EEYA 4DSFA 3MMJA 3E3XA 4L72B 1W26A 2IFXA 3THTA 1QSLA 2L3MA 2Y9HA 3ET6B 4TXSA 1CBKA 4M1KA 4O44A 1NPPA 4UOGA 1UVLA 3AD9C 5KG5A 4CH0S 2QZ8A 2GX8A 2HHQA 5IC4B 2LEBA 2RQKA 2N3LA 3TNVA 1P9YA 4LRAA 2D9PA 2YY3A 2E5JA 2HBRB 1IXKA 3BEGB 4IRKA 4U7UD 3ZTOA 4FVMA 4L3NA 3LP2A 4CLPA 1S1UB 4AQYF 2AX1A 1RISA 1OQ6A 3AHPA 3OFGA 2WVEA 5EX0A 1FNXH 4HHUA 2PMZD 3CC7S 2HHSA 4CO5A 2LEPA 2QO3A 3LOUA 2D3OR 4WFZA 4OHZA 2YKOA 4OYIA 1HHSA 3FCHA 2UP1A 3MMAB 2VFSA 5H9FJ 3HHEA 3WIUA 3BQ0A 2BJ8A 4OYPA 1VQMS 2AEMA 4DFKA 2BJ9A 1IJFB 2DHSA 1SC6A 2EPIA 3M1VB 4TU9A 1ULRA 2HS3A 4PG7A 4QWEA 4PAAA 3M2VA 1RHUB 1SV5B 2VH7A 2CYYA 2C1EB 4QWAA 2VG7B 1C1BB 3I0SB 4ED1A 4JI3J 1QD1A 2NSBA 4NRTA 5L38A 5ETNA 5GVQA 3RAQA 4I68A 3P96A 2XNQA 4RR5A 2VQFJ 1X7VA 5GAEI 1ZH5A 2HPUA 4A8QA 4J9VA 1RTJB 4USWA 1N32F 1FWKA 4XIUA 1N6QA 2WBRA 4JI1F 2F4FA 1OY8A 3IAS9 2Q6CA 3HCXA 3NMRA 4N47A 2E66A 4Z2XA 1OYDA 2XCAA 3POTA 2VC1A 4P2FA 2DGTA 3OBIA 5BR8J 3WX4A 2GC8A 1ZA2B 3JYTB 2LP4A 4R25A 3SSRA 2KXFA 4JV5J 2Z0GA 4JYAJ 1VMBA 3NP5A 4OX9F 4NZ6A 4JI2F 1T3NA 4DL0C 1VDHA 5D4LA 4NRUA 3UVJB 4FPRA 1VQ5S 2EBGA 2IPOB 2XMVA 4ED4A 3IO1A 4AE5A 3M8WA 2XMAA 3CJKB 1V3ZA 2KB2A 3GV8B 3QJJA 1EKSA 2RDIA 3UDVA 5T14A 1EQMA 3TZWA 1AROP 2R2RA 2BE2B 2QSFA 1X31C 1OWXA 1BGXT 1SIWB 5KT4A 1GMVA 2RHSB 1URRA 2NLWA 2CPEA 4AL7A 1T03B 2BOPA 2GCFA 2YNHA 2KHDA 4B9UA 2V8DA 3QWUA 2JX2A 4DFPA 1KQGB 2G0CA 4DF4A 1NK0A 3V81B 5LJ5Y 3MFHA 3RBEA 2IBOA 3BREA 2ZNZA 1KVKA 1K0TA 1B64A 2B5JB 3IRWP 3VZIA 5KFXA 2UUAF 3Q8YA 5A8WB 2AYMA 4J9RA 2VPXB 5AXKA 4K4XA 2V67A 2XGPA 5ETKA 2ZE2A 1LWEB 4ZVQB 1UPPA 1FWPA 5DG9A 1JLGA 2CG8A 1IN0A 4P2MA 1X9WA 2K3IA 2DGSA 2H5EA 5GAGU 3TYTA 4X62J 4M95A 3THVA 4PYAA 4MKAA 5M2UA 1YJWS 4MK8A 5E3CA 1R8HA 5B0BA 4IO1A 4K0KF 1QSSA 1OMSA 5EUHA 1N48A 4QBUA 2M5YA 3HVWA 4IG3A 2G1DA 3NRBA 5DGAA 2ZD1B 4FF4A 3OV7A 3MR2A 3NGUA 3H2LA 3QQCD 4C97A 3OVBA 2GQCA 4UOFA 3AOCA 4OV6A 1WC6A 1S6QA 3ZTQA 4YB1P 5HAOA 3M32A 2N4CA 2DIVA 4BCAA 1HQUA 1TP7A 4DPXA 1WDTA 3BH6B 3GG0A 2AJFE 6FDRA 4ZHRA 4Z7YA 2GS8A 2OSRA 5KG2A 1T8EA 3MUTP 3CDBA 2M88A 2GO9A 1DTQB 4O4GA 3QIPB 1EIYB 4DPUA 2KTQA 2C2ZB 2MZRA 4LFBJ 3MOZA 2D1CA 2Y8WA 2RQCA 3TAQA 1RTDA 2Y1IA 2PIIA 2SXLA 1WEYA 4EU0A 2AJ4A 3AA8A 1F60B 2A10A 3C16A 1M1GA 4WKRA 1I5OB 4UY8T 3QAEA 5FLXY 1VLYA 3MM7B 3M30A 4DN0A 4OYBA 2XNRA 3MF5A 1H3DA 2APOA 4PXBA 5KG4A 1IBLF 4LF4J 2YX7A 3N28A 2CRLA 3PW4A 4D3GA 3WC2A 3ENWA 5DDQC 2GO8A 4FBUA 5F0WA 4EZ9A 3DMJB 4BHQA 2YX1A 2C2MB 5J1PA 5IT4A 3CCWA 4XK8C 2GHPA 3G2XA 1TAQA 4F3OA 3T1HJ 1NB2A 2DYAA 1O5JA 1SUQA 2GIFA 2EEYA 1PCAA 3IN5A 3PYGA 3MTJA 4F4YA 2CFXA 3QMQA 4Y28C 2GGPA 4Q2LA 3MUMP 2QFJA 4USMA 5KT5A 1NAQA 4RW8A 2OJ3A 4DR4F 3DOLB 2VU5A 4X66J 4WCEQ 1LK5A 3NS7B 3BO3A 1DTTA 3M2UB 2J7UA 5L1KA 2BQRA 1R6YA 2OH2A 2HHPA 1F5BA 4NMXA 1CJVA 5E41A 2VUGA 4HHJA 4CO2A 1PIEA 2C3YA 4MYTA 4N8OA 2F4VF 2XYPB 1URNA 3UO0A 4F4XA 3ENQA 5K8NA 2L9DA 1X5SA 4PKDB 5L1JA 1K9MT 4B9NA 2HFNA 1VQKS 2W8KA 4DR2F 3TJ9A 2RILA 1RT7A 1QLNA 2HVEA 3PR5B 1FESA 1Z4UA 1D09B 3U7JA 2JDJA 2DNNA 4DWIA 1Z2ZA 2CZ9A 2V4RA 3ZZTA 3AAWB 1T9VA 3D7SB 3Q89A 2FZCB 3I9ZA 1IKXB 1DQ8A 3OL8A 2N7YA 5C25B 4OZ5A 2KG1A 4RNHA 2IVMA 4KGMA 5E2QA 5L9NA 2MJUA 4KGKA 1XJWB 5B0GA 3R6LB 1RT5A 3HDSA 3P5TL 2GZOA 4QW8A 2HIQA 2BANA 3SSQA 4URQU 2RRAA 3B4DA 1OPIA 3BGFA 4ZMMA 3M05A 1FI4A 2M0GB 5AE2A 1VBXA 2DHXA 2YKMA 1UZHA 3JSMA 3M9NB 2MY7A 1FRXA 4F2SA 1SJ1A 4WF9Q 5CD4H 2HHUA 2ADCA 3CB4A 4G6VB 2RS2A 4LF7J 1CJTA 2IC3B 3M8QB 2MGZB 5EGYA 2U1AA 4NYZA 5LOQA 3LP0A 2ZBQA 3FNNA 3CD6S 4ANEA 5ETRA 1ITPA 2I5JB 2DISA 4DMZA 1GEHA 2HAFA 1LW2A 1AA1B 1SBRA 4CYUA 2JEGA 1QM9A 1XMBA 3MWBA 3TAMA 3H4BA 3TUJC 1EARA 1RTZA 1RWNB 1RAJA 1WEZA 1FFWB 3J81j 2A2CA 5AXLA 3ZNUA 4C3MA 1C2PA 5T7LB 1CULA 1MROB 3CUNA 2VBZA 5FLXU 1HI0P 3VCDA 1S6OA 4O3RA 3BBCA 5CYMA 1LOUA 2RVJA 1YZ7A 3EMTA 1FDBA 3HX9A 4P2SA 1NU4A 4NMLA 2WVFA 2VJUA 3MZIA 4RNMA 3QZ7A 2QL7B 4GC7A 2YQ3A 4JP8A 1YTYA 4ZVRB 1VRUB 3H42A 3PW5A 1HNIA 3LTOA 3QGIA 4C0HA 1FJGF 1JXEA 4WTOB 3QO9B 2H9ZA 5GAEU 1U2CA 4DI6A 2ZH8A 4X64J 4OJHA 2AKWB 2DO4A 1B99A 2NQPA 4J9MA 1S4EA 4JUZA 2YNFA 4MK9A 1WSVA 2K8GA 2JVRA 2WB1D 2CKWA 5BXIA 4PRFA 4KGZB 4RBVA 1FRIA 1NBEB 3H2UB 1FTCA 4LVNP 3BYPA 4C6AA 3CPWR 1MMLA 4ERDA 3UCGA 2ZH4A 2CPFA 1FXLA 4DZ6A 1AYEA 4IQMA 3DRPB 2XO7A 1YIJS 4J9UE 4P73A 4KKOB 1KEKA 5HMWA 1AUSL 2B9XA 4F4AA 2ALZA 2YH0A 4YHHF 3OTBA 4E98A 4X65F 3MXHP 1Y3KA 1JLBB 3DOKA 1Q4RA 4K5RA 4DR3F 3D0IE 4EZ6A 2VFVA 3IA0A 3MM6B 2W25A 5A8KA 1TL1B 3DYAB 3MECA 2NXNA 3MURP 3ZZ0A 1D9FA 4DSKA 2OPPA 4F0KA 2HGMA 1EAYC 1D0EA 4KBIA 2VD3A 1T11A 2LU1A 3BM7A 5CA5A 3G82A 4WKYA 2KM8C 2YNIA 1U24A 3CJ0A 1N33J 1F2GA 1ZZFA 3FRYA 2XCPA 2FVSA 4J9LA 2EG1A 4LF9F 3UDCA 3MAHA 1SKUB 2GA7A 1HBOB 2V9WA 3AOAA 3VALA 4QOTA 2C2OB 2I0XA 1QVFR 2O1PA 3NAIA 3D68A 3R5GA 3KJVB 4O3OA 4HL9A 4KHMA 3MCNA 3IG1A 3R7NB 4YDXA 1SQFA 3SQOP 1IKWB 4DL4A 3JQKA 1REVB 1SL2A 2OD6A 3I4HX 4LT6A 1VHIA 2KKHA 2Z56B 5HVFA 4ANCA 1WC0A 3L7OA 1CS4A 2MHNA 2QLXA 1Q8IA 4L6V3 5FDLA 1X4AA 3PZPA 2VQEJ 5MLCV 4OZNA 3A1YG 4Q7AA 4CP5A 1NDLA 4B17A 2VOOA 1PYTA 3UI3A 1X0FA 2WW4A 2R4FA 2YWFA 1L3VA 3U27A 3CVKA 5C42B 1T9UA 3SSSA 1YGYA 4UTGA 2OELA 2PI4A 3KLHB 3US5A 1DY3A 4A47A 2FPHX 2RE1A 4ICLB 2IJFA 4JI7F 2HBQB 4NLPA 2JNJA 3R97A 2CJBA 1YBUA 1L3UA 2XMMA 3RB3A 1S6PB 2JOQA 3OL6A 4CLUA 4LRBA 3JXOA 2KT5A 4DBQA 3S8SA 2FC8A 1KBRA 4LFAJ 2QIFA 3G87A 3UN3A 3DOMA 3HKZD 3GMGA 4M5DA 4XO0A 2HNDB 1YJVA 3D66A 3N0VA 1VQOS 3SV3A 2A18A 2CWXA 5E0OA 3TVKA 2Z2LA 1G1XA 4DR5J 2ZVSA 1PAEX 4NLDA 3HXMA 1S7IA 3FCWA 4DSEA 1Y3JA 5KFDA 1YBAA 3O6QA 1DFDA 1S72S 2EFPA 3B4MA 1S76D 3NGRA 2RSQA 2DVIA 2XEXA 4NLQA 1AXQA 4U8YA 3W2WB 2CPXA 4XPEA 2IJNA 2WZ1A 1Q79A 1SI9A 3RYLA 3FFIA 2QGFB 3GLJA 4OLOA 1Q16B 4WIIA 3CCJS 4QIWD 2AW0A 3QSYB 1U0SA 2VA3A 3SXLA 2H65B 2DR6A 3FBFA 3KNAA 4KV8B 1P6TA 5K9FA 2IA6A 5D78A 2ZH3A 3DLEB 4FXVA 4NCGA 1N0VC 1N5YB 4H4KC 3NNCA 4DUZF 1JIHA 2DCUB 3R7SB 1U1LA 3NMAA 4H54A 4K4UA 1K44A 2FLNA 1UEUA 4YB5A 2A2DA 4I7FB 2BW7A 3MEKA 1UFLA 2K2PA 5LL6d 4K2JA 2W9CB 1N5QA 3N6MA 2LA6A 4CO4A 1RJJA 2VBXA 4YR2A 3VAGA 2VFRA 3HT0A 1IR0A 5F3ZA 3S1TA 4DQSA 1RWXB 3I87A 3VF0B 2CQ0A 4AQYJ 4F4ZA 1GFWB 2B9WA 1QUVA 2M52A 4IH7A 1YBTA 2CQGA 2E7XA 3VQTA 2H51B 4IG0A 4OZ1A 2WK4A 2CJYB 3H5YA 2OPQB 4O0NA 3AD8C 1RTHB 2NUUG 3LGNA 5KOXA 3D6HB 2FGCA 4IKAA 1BXNA 3VVUA 4NI2A 4CLYA 4CLLA 4KC5A 1Z2LA 1SH0A 3DLGA 3RRGA 1YZ6A 5LSRA 5HROB 2C3OA 4DX5A 2MZ1A 2HHVA 4O3QA 1V6HA 4KO0B 4I6AA 2V68A 2OAUA 1FKAF 2CWKA 2R42A 5DM7Q 1MU2A 3A3NB 3DGPA 2J0XA 5DS7A 2CNLB 2ABYA 1HPZB 3JTNA 3PCOB 3GFYA 5F8LA 2JEIA 5HLFA 2H4YB 3RW6A 3FSIA 4AFFA 3VV2B 4FF2A 3TX8A 4UF4A 2QYGA 5CCLA 4FF3A 4RJVA 2W4PA 2EXUA 3CJ8A 2QJ3A 1BQXA 3LP2B 1HBUA 5KFAA 2NS1B 4IYQA 1N32J 2UVVA 1VQSA 2XM3A 2IMOA 2CQ4A 2QC3A 5KFMA 3T5JA 1KSPA 1LW0A 2JLGA 2B7CB 4OZ3A 4EBCA 5J2MA 5K5MA 2BJ7A 4ELUA 1IWGA 1WC4A 3KMQA 5DDPC 2QL9B 2AP6A 1ICEB 3EGVA 1HYSA 3D0HE 3NS6A 4ZA1A 2HIYA 4ZLNA 2DGUA 5GAHI 5A0YB 2FHJA 3I96A 2VG6A 2OPRA 2WONB 2X3DA 1S7HA 4OX9J 4M5LA 4JI2J 1J5OA 2KYXA 2BACA 4ECZA 2IRXA 3KK3B 2QG9B 2XYGB 6AT1B 4I6WA 4ECYA 4QYZJ 2WTFA 5KFRA 4K4SA 5H9EJ 4ECXA 3PJWA 4PWWA 4KSEB 2H5IB 4LF6J 3KLGA 4Z37A 2CUYA 1HW8A 4X4SA 5IT9Y 2HWHA 1VIOA 3OFFA 1TUGB 1BY9A 1BQNA 2XBPA 4HT7A 4KPCA 4ED5A 1RT4A 2WB4A 3PYFA 1UW4A 1VI7A 3CJQA 1H74A 3GWCA 5I3UA 2LQ5A 3KLVA 2VB6A 4DXLA 2MQMA 4C11A 2XSFA 2UV8G 4J37A 2AIRB 1FX4A 4M5MA 4ZOSA 3GTYX 2MDAA 3D28A 3POTB 2QA4S 4GVBA 1NH8A 4QW9A 3DM2A 4I1TA 2VG5A 1FO1A 5CXTA 3OJUA 1I6JA 1MNEA 3TEHB 2V94A 1D8YA 4YS2A 3SCKE 2DNRA 3DLBA 2BV3A 3EZUA 5JMNA 2AYBA 2BRLA 4CCHA 4S0MA 4HDHA 2R7OA 3PO4A 3S7RA 5B08A 2HVIA 4DL6A 2XZWA 1HHTP 3LO3A 2CVEA 2MZTA 1R89A 4I67A 1VRTB 2L08A 4AYBD 3AB4B 4BC9A 3AJ1A 2B8QA 2KG0A 1L3KA 3FQLA 2OIHA 2V8PA 1RKIA 2DNHA 2OGUA 5JXSA 5I42A 5ETMA 3W60A 5F9NA 3K8VA 2XHWA 2XHCA 3GV5B 1IBKJ 2VL1A 1Y4ZB 3V4IA 2C2KB 2QMWA 1H6KX 1ZYQA 1HA1A 2GVDA 2PE8A 2Z8QA 4PXEA 3T19A 1VRQC 3K2YA 3OD2A 2BKNA 5EX3A 3SFGA 3CCRS 3LPEA 4KH1B 4Q2MA 2ZE2B 5KG7A 5L39A 2ASLA 1APSA 4OZ2A 1S99A 4R5PB 5EN1A 2PFDA 2ILYA 3GPAA 1AB8A 1JLGB 5ETSA 2ZZNA 1VQ7S 3DGVA 2MKJA 3L9ZA 4WE1B 4X4VA 2I38A 2FHMA 4HHHA 2E1PA 4ECWA 1KHWA 4U7CA 3OR2A 5D0GA 2VKZG 1X0PA 2EC2A 2MJNA 2J6UA 4DV5J 4A8XA 4M5IA 4ZVSB 1XMOF 4ED6A 3FSXA 4EYIB 2P9CA 3K59A 4OJGA 4JI8F 1M5VC 1UW9A 5J2PA 2NYIA 3I55S 3MTKA 4DR1J 3NXZA 1K1QA 1VQYA 1JLFB 2W9AA 1TK8A 1RT3A 1S6QB 3MAAA 5IQQA 5C24B 2K3KA 3J7Z5 1F9HA 3LW5C 2CQ2A 1F9EB 1HQUB 1WF2A 3BYRA 3EZOA 4P9SA 2IDLA 1RBLA 4DFJA 3TAPA 5KFSA 4OJ3A 2XSJA 2MKIA 5D6GA 4ETXA 2DNZA 3MEGA 3PW2A 2RIJA 3NBPA 4IUFA 3HVTB 2LYVA 1RTDB 4DR4J 2IDEA 4J9OA 4ZPTR 4NLRA 3KHGA 4HEA9 1W2IA 5IT9U 2F4VJ 2JFDA 1OIAA 3BO2A 2ZBRA 3IRXA 3D2WA 5ETVA 1JMTA 4CQ1A 3PRVA 3TARA 4V1Ak 1K47A 3Q2TC 2W7OA 3H8YA 3H59A 2UU9F 2CVIA 4A8FA 4ZP7A 4F2RA 1TL3B 4DR2J 3IS9A 1XNRF 4NA2A 3AXMA 1YJ7A 1IBMF 5KTQA 1F2HA 1M5SA 3KLFA 1BWEA 3FCVA 3SDEB 2K06A 1DLOA 2WHOA 1NDKA 4K2XA 4F0HA 1OQ3A 2OHDA 2PI5A 4ES2A 4ZJLA 4OZLA 3WBZA 3PX6A 5JVHQ 3SCIE 3CJTA 2BJ3A 1NDCA 2MSSA 4RZRA 3KLEA 2XI2A 3MEDB 1LV5A 2CJKA 3CCZA 1XK8A 2GV1A 4AXJA 2R8GA 2IAJB 2X51A 2OEMA 2VKRA 1C0UA 2XLKA 1ELOA 1MW7A 3GIKA 2AYEA 5B09A 3CO9A 2QRRA 3OLAA 4DUYF 3CTRA 1RK8A 5F8HA 3B82A 4B3TJ 2D3ZA 1RT1B 2WOMA 1AZSA 4UZBA 2MKYA 2OEJA 1FKOA 1J5EJ 5RUBA 4H4OA 4Y0FA 2ZDOA 2ZH5A 1HWLA 2F65A 1WC3A 5B0CA 1RWPB 2HURA 1T3OA 3GG1A 2QLJB 5KFUA 3W61A 1RT7B 3S6EA 1VQ6S 4LR7A 5AE1A 3O3LA 4LF8F 3HHNB 3PKMA 2B4PA 2XGQA 1PKUA 3H5UA 1PC4A 2KJWA 4KGXB 3K5LA 4LF1A 3TA0A 2RU3A 3C2PA 5D4PA 3DLKB 2DPIA 2UUWA 4DL2A 3V6JA 2Y1JA 1GX6A 3VAKA 2OPSA 1LQ9A 1RAOA 3DRXA 1JLQA 2GMJA 3MMCA 3LGHA 3E8OA 4ETZA 4U9RA 1GT8A 1YJTA 3F44A 1RT5B 1M5OC 1N0UA 3DDIA 1KONA 2HNYB 5DZ6A 2ZM6F 2E44A 3QBCA 1VQLS 1V3RA 4C3LA 2DXDA 3SYZA 4WJBA 4ER8A 1YJNS 4PUOA 2YKMB 1E6YA 2H1YA 3JSMB 1WF1A 1JWWA 2ZOFA 2AZ1A 2XZTB 5C5JA 3W2VA 5E3RA 3OFEA 2F63A 4I69A 2ZOGA 3DRRB 1N56A 1QAXA 5D15A 2O3DA 1NJYA 1YK9A 2FVCA 4L74A 4JI0J 3CEDA 1IWAA 1U1RA 1CJTB 1FJGJ 3VQSA 2YPYA 1JLAB 2A6OA 4I6YA 2RDJA 3E01A 2KN4A 2GW8A 1SL1A 4KTQA 1IM4A 3T41A 4ECVA 2HBZB 5A76A 3MCMA 1X4CA 2LDIA 3ZZYA 1LW2B 2M4MA 2BVZA 3PEJA 4CYUB 2N7CA 1RI7A 1R3NA 3IBCB 4N8NA 5IWAJ 5LMUJ 2WVCA 3MM9A 2GJIA 3ILIA 3UNYA 5LMNF 4NLWA 2G0JA 3LQVA 3P6YC 1R0CB 3GR0A 3W64A 2CPYA 5D4NA 3ENVA 2B51A 5BJRA 4DQQA 4HYKA 3GIIA 3P45B 3LGMA 2KVQE 1H7XA 1SJQA 5HMZA 5F8MA 2XC9A 2ADBA 3CCTA 1TQLA 4J91A 5CYMB 1UWBA 2WCXA 1WWHA 2YXLA 1U02A 4AD6A 3PX4A 3IM9A 1GTHA 2D69A 1R0AB 1TZ0A 3W5YA 1VQNS 5AE3A 4FP9A 4KGVB 4X65J 2W4DA 2AQ4A 2HMIA 4DR3J 1Q1KA 2DGVA 4E2FB 3GJSB 1AFIA 2XY7A 2B4OA 3R5AA 2FY1A 4WXWA 1S1WA 4ECSA 4MTPA 1RCXB 3IWLA 3EVMA 4LQ9A 5MAOA 4PZVA 3PYEA 1C1CA 2YNFB 2UXBF 1SCJB 1LEOA 1UEVA 3K89A 3SFUA 3OW2R 3PYDA 2F8HA 4RO0A 1HD0A 2EFVA 2RT3A 3FSYA 3QIDA 4H4KA 3OTOF 2PMWA 4LF9J 2I9SA 1FXRA 2VPWB 2ROPA 3S01A 3RBXA 2W2NP 1KOOA 3G86A 2BRKA 4IO9Q 4MJKA 1JLCA 5DQIA 5KFCA 3AJDA 4LR8A 3ONQA 4ID5A 3BV8A 2OTJS 3IR6B 4HI2A 1J2VA 3ICLA 1NSPA 3R27A 2DRAA 5KG3A 1XIQA 2M2BA 5HI7A 4KY3A 1Q86T 1MWQA 1YWXA 2L41A 2FGOA 4IDKB 2OUGA 2C3MA 2QT7A 4HKQA 2BJEA 1TKTB 2AHOB 2P9GA 2FLPA 2R2SA 2PA8D 1P27B 1YJ9S 3M6WA 3MECB 1FKPA 3DDKA 2Y0SD 2LMIA 4LSNB 2VFUA 2OPPB 4DV4F 3CCVS 4OI6A 1BC6A 3C15A 2AMCB 7FDRA 1TKXA 3L7PA 4ILLA 1TMJA 3IGVA 1TU0B 5IQ6A 2CG4A 3PDNA 4JOUA 4YMEA 5AJ3J 2HHWA 4JI7J 4A8WA 1HBMB 4FYVB 1LFPA 3KK2B 3LP1B 4EYHB 4YR3A 3BO4A 3RTVA 3PW7A 1BE4A 1FXDA 4M5GA 2MLYA 4DF8A 1UVMA 2QX0A 3HK2A 1UWAA 4YUDA 4C48A 2LXUA 2ZEJA 1F0XA 3KUEA 4LIWA 4QPXA 2WVDA 2V69A 3K5NA 1CS4B 2J9DA 2LQBA 1R8BA 1Y10A 4OX6A 2H48B 4ZN1A 1FTRA 4FBTA 4QIGA 4TN2A 1UA0A 3KJFB 2ZJPQ 5KT7A 2PN6A 1TKZA 3MMAA 2EFOA 1SH2A 2OTLS 1U6BA 1XNQF 4WP9A 2DGXA 2YWHA 1IR2A 1RLCL 2HQFA 4FVCA 4L76A 1QSYA 1TVRA 4ED2A 4DL7A 2BUNA 1SV5A 5AT1B 4M94A 3BJYA 2VG7A 2HWIA 1C1BA 3TZYA 5HQMA 5A2QU 2JEFA 2E7VA 3MGJA 4ED8A 5LT5A 1JKHB 4A8MP 4DUTA 1PJ7A 1WELA 3RBZA 4QIFA 3NG8A 8AT1B 4NZ0A 2X1GA 4DUZJ 4OV1A 1X60A 4IH6A 2DKOB 2DGOA 2FHJD 3N01A 1H73A 3AFGA 1Y0HA 2F9JA 5IT0A 2P6TA 3DXSX 4KHPF 2MZSA 2GIRA 4LSLB 4K4YA 2CA9A 2CJXB 3R5DA 2XMUA 4YP3A 3D9BA 4AT1B 1UTAA 1WOPA 2PMHA 2E1CA 3JYTA 2B8PA 4IOCQ 3SEOA 3EUNA 4F26A 2ACMA 4DX8H 5DG8A 4ZVUB 4W92B 1NDPA 3UVJA 3QJPA 4QR1A 3FFIB 4N41A 4P72A 2UUCJ 1F5AA 1N52B 3F41A 2RDDA 1M1HA 3PEHA 2ZH1A 4NLTA 4OL8A 2V50A 4NXMJ 3BBBA 1VC0A 5HN0A 1FK9A 2V0NA 2X1BA 2GNKA 4DV0J 2C2RA 3Q24A 2HRUA 1WC1A 2ASDA 3BQ2A 2VQFF 5D4OA 3O2IA 4DSIA 4CO3A 4USKA 2C2DA 4PR6A 3ZO7A 3ZXWA 2VJVA 2P9EA 5D0RA 4D3HA 2DHGA 1VK8A 4F67A 4QYZK 4RW7B 4RW9B 2HHHJ 1KTVA 4TLRA 3AJ2A 3PM9A 4Y2KA 3CC4S 2B5JA 2MZJA 4R8UB 2NPFA 2FD2A 5A8WA 5BR8F 3MAQA 4P7VA 4W98A 3QNWB 2D3O1 1JNRB 4H4MB 4JV5F 1O0PA 5U47A 2B9YA 1FRKA 4NCAA 2HQCA 3C46A 4J90A 1S1XB 2MLXA 2GVZB 1QTMA 3EGWB 2C2EA 1LWEA 1TL5A 1N4LA 2ATCB 3HSDA 5KFQA 3FDSA 1WG4A 1X9SA 2MQ8A 5E3QA 5KFPA 1RT2B 4NI2B 3HHLB 3WDOA 1R43A 2VA2A 1DAXA 2Q79A 2O67A 4GKJF 3THPA 2E9TA 1RHMB 2V5HG 1SKWA 1X8DA 4WZQA 3R5BA 1YG0A 3BSAA 3CIMA 3FMWA 3BSOA 5ETPA 2W1BA 2QA4G 1QY7A 1V9OA 4M63A 4G1IA 4ZPVR 2ZD1A 2E5GA 1X4DA 3H7HB 2HG4A 2KXHA 3N4WA 2MKKA 1B70B 5ETLA 3MEEB 2WAQD 4PWDA 2RQMA 4FYDA 5DO2A 3LAMA 3NGDA 3DKDA 4URGA 4C3KA 3F56A 4AL6A 4C0BA 3DCAA 4DU8A 4RBTA 2GAGC 4CLKA 3N9UC 1DTQA 3RW7A 1HBUB 3HSZA 2B56A 2F8EX 4OI3A 2VASA 1Q8LA 2Z2ZA 2ZUAA 2BEFA 1LW0B 4K59A 3MI7X 4QWBA 1OYEA 1VGYA 2C3UA 1B0VA 1VOMA 2V4JB 4X4RA 3J7ZT 1FHTA 4WU2A 2H4WB 3TA1A 4QWDA 2MYFA 1V3SA 2VG6B 4LFCF 4UOCA 2OPRB 4YB7A 5DDOC 1UFKA 2O01C 1B7YB 2VPZB 1IKYB 4HACB 9ATCB 2ZHBA 2EFQA 3RAMA 3BGUA 1T9WA 5D77A 2XZDB 4LUBA 3KTQA 3UD3P 4IFVA 1WG5A 4C0OC 3KLIB 2MTLA 1D1UA 2J9EA 4TQRA 1HNWF 3J7YU 3BKFA 1RAFB 3TUZC 3KLGB 2BQUA 1RABB 2VFTA 2RF2B 1EZZB 5HVHA 3DLJA 2HYIB 2OP5A 4CI0B 3BGLA 2UXCF 2JSXA 1WORA 4P2XA 3KK1B 2DNPA 1BQNB 3VHQA 2WRMA 3A4TA 4DQIA 3BGRA 3MM8A 3PY8A 4LVOP 4Q0BB 4KFBB 4CNYA 3HHDA 1HMVB 3ITHB 3M9OB 3FKBA 4Y3CA 4OMFG 1P8GA 3DOLA 4C11B 3GIJA 4Z7CA 3EYZA 1RAAB 4DX6A 5F8JA 1RT6A 2DNYA 4G1QB 2YKQA 3EGNA 2EK1A 4RWWA 1A0OB 1U1KA 5B0FA 4GVBB 2EWHA 5J2NB 1KVJA 3ILJA 1GTEA 4WFYA 2ZDPA 2J5AA 3VGTA 3DM2B 2VG5B 3KDOA 2YNGA 2KT3A 1U45A 2MQNA 1VHFA 2LQ9A 3RU0A 1J27A 4ID8A 1U48A 3T6BA 1W2BR 3A8KA 2Z4PA 2BXJA 5A6PA 5J1EB 3B6BA 4AL5A 1PYOB 3OUYA 3GV7B 4LRCA 3OXLA 4Y2AA 3P3DA 2NZ4A 4X4QA 3NEKA 3H5XA 1JQGA 3MM5A 2UV8A 1S4FA 2W24A 2CQ1A 1XMOJ 1ACMB 2ZC4A 4ZPAA 3RGIA 2Y1RI 3LH2S 3CMES 1FD2A 1NLKL 1IKXA 1W25A 5CZVA 1ZPVA 1ZM4A 1T0TV 3CF5Q 3PIPQ 1IKVA 4X66F 4DG1A 4HH0A 4HTIA 1HARA 3HT3A 4N77A 3Q2SC 1CC8A 3RRHA 2F1FA 4ZLPA 3K0JA 3WHIA 3L09A 1RWVB 1RUSA 2HVZA 1XERA 2W2PP 3D6FB 4ZVPB 1QE1A 1ZPWX 2DRDA 4CZCA 3ZTSA 4CM2A 3K58A 4C8OA 4I2QB 4C98A 3AH6A 4ED0A 3EWGA 1NHKL 4NLGA 3FRZA 1WOSA 3L3CA 2DY1A 2C22A 4DV3F 5KFLA 1NKEA 2Q6BA 1VBKA 1Q8BA 1ZAXA 4ZPBA 1JXLA 3R9LA 4N5SA 2MGZA 4QQBA 3UR0A 4Q5VA 2GIQA 3BR8A 3HO1A 2I5JA 1UMJA 4NX9A 1WJ9A 1T9TA 4ES3A 4TY9A 4C8YA 2PEHA 5M2PA 3MCSA 2F7VA 4ECTA 4U8VA 2QSWA 2NXUA 2UU9J 3WIVA 1Q8KA 1RWWB 3GONA 1XNRJ 1XEZA 2JC1A 1N54B 1IBMJ 3MAAB 1DURA 1WF0A 5HJYA 4B3OB 4DSLA 2VONA 4IQXA 5DQGA 1FX2A 2HKEA 1PJ6A 2X1AA 5T7LA 3FMBA 3FEYB 4A48A 3SQGB 3W62A 1T94A 4QPTA 2YQ1A 3M6UA 2XSJB 1B0PA 3ISNC 1DRZA 4B3RF 1UEKA 2AGQA 1NMEB 3MEGB 2VC0A 1FJ7A 3NBPB 3M2RA 1RSCA 2ZVIA 4WBFA 3QATA 1HW9A 5G4DA 5EWGA 5IFMA 3H2VE 1WKLA 2RKIB 3TEGA 3KG4A 2LLZA 2P2CB 3BGOP 4Y2MA 1HBNB 1RADB 2VPYB 2DCLA 3W1YC 3M8RA 4EI2A 2HLTA 1G7CB 1S10A 3NGTA 2N4DA 3UDLA 1EHWA 3MFIA 2V2ZA 5F41A 3K7RA 4UW2A 3G6VA 3W66A 2QLFB 4ES1A 2ZHOA 5G0RB 3IR7B 3W5XA 2HHXA 2K1RB 4ZP9A 3V5RA 4HTJA 2DXEA 1RTIB 2BKPA 5CHCB 1YHQS 2R7SA 4XPCA 4KQZA 4NL5A 2FLLA 1XQIA 1T9XA 2GMHA 1JJ2R 2J8SA 1R8CA 2CPIA 4IFYA 1S0NA 4UT4A 3AA9A 3T3FA 4ZDNA 2WW8A 2W9BA 1H72C 1Q82T 4X2BA 3DRPA 3QJLA 1S79A 4DL5A 2QLBB 1IQTA 1NK5A 3CSKA 4KKOA 2VZ9A 4OHYA 1NHUA 2BA9A 3VAIA 3V6HA 3QGPA 2DR9A 5DGBA 4F02A 2RS8A 1C0UB 3R1LA 2E9ZA 3A8EA 1YQHA 4K4WA 2ZM6J 5KFIA 3CJ5A 4NA3A 3I5CA 1TUWA 4OYAA 1AZSB 2W2OP 3T1YF 5SUHA 3MM6A 3B54A 1XBWA 3DYAA 4R0EA 1UJ6A 2CPZA 5IZHA 3PIOQ 4GRSA 4H4OB 2XY6A 2VV5A 3OTEA 2DD8S 3NOGA 2LA4A 3CDAA 3UDEA 4U67Q 1NUEA 3HVRA 1KQKA 4YOEA 1KVIA 5DM6Q 4W4MA 2XMWA 4KAIA 5HJXA 2W7AA 5HATA 2DHHA 2A3JA 4OX8A 3ADAC 1U0HB 4ENOA 5ITHA 4GO7X 1QDUB 1PC5A 1W7WA 4Y34A 1YRTA 1FNOA 3TUIC 1JLEB 5E33A 3UPFA 2IRUA 2OPSB 3F0NA 2R7VA 2DITA 1JLQB 2ZBIA 4QWCA 3QGGA 2XS7A 1WHVA 3X1LB 3H4DA 3EVOA 4YDDB 4DFMA 4TU7A 3AY0A 2HFOA 4NLYA 1IKWA 5LMNJ 1SVDA 1VJWA 2UXDF 2ZITA 3R7BB 1Y5NB 2BZ2A 3OQ2A 1TL7A 2AGPA 2CDQA 3M6VA 3H20A 1ZTTA 3TO8A 4DV2F 3R5CA 1E6YB 2NCKL 2IYIA 1PBUA 2XWYA 1KS2A 2F40A 2KZZA 3W2VB 2ZJQQ 1SJ3P 5C42A 2HK2A 2YWEA 1F5CA 5HK4A 1T05A 3KLHA 2KXNB 4USHA 1VCTA 2PD1A 2B4UA 1U1PA 3G71S 3NWRA 1Q95G 4ICLA 4GO5X 3ISZA 1RZMA 4OYXA 5GMDA 1WHWA 2LQJA 3HFZB 2R9LA 5D3GB 3VAJA 4PQUB 4DEZA 4ZITA 4ZP6A 3FUYA 3I9V9 3MR3A 4ZPWR 2Z2MA 1LXJA 5JUMA 2JHEA 1HNXF 1EETA 3W9IA 3RBDA 7FD1A 1F3FA 3P4UB 3FZBA 1SC3B 2EW9A 2QV6A 4MK7A 1HR0J 1S1VB 3B8HA 3UR3C 2R8JA 4QU6A 4BWMA 3F73A 4DPTA 1EJ7L 3GR1A 3CD5A 2QYCA 2FYXA 3V4MA 1CQNA 5KT2A 2LKZA 3Q8QB 4F8RA 1I94J 1UWBB 3FEXB 2I1RA 2MQPA 1E6VB 2FLOA 1KNZA 3FC9A 5C2CA 3KUHA 1XMQF 3MOJB 3R6GB 4A8KA 3HJFA 1CJUA 1R6VA 2LECA 4CM0A 4L75A 1NSKL 1HL6A 5DG7A 2LFVA 3GJQB 4ZVEA 1A9NB 4B9TA 5CZXA 4PXCA 5F0UA 4OHXA 1P9QC 3QT5A 5KG6A 4RW4A 4Y6IA 4DV7F 4LIRA 2DH7A 2CPJA 4KV8A 4ALZA 3HSJA 3I5AA 3TA2A 3M7VA 4TLQA 2QA2A 1KRPA 2OEKA 5HBMA 3K8WA 4B08A 3H98A 3LUYA 2UUTA 4DQPA 5GMKa 3ELHA 4NZ7A 2L9WA 3KKFA 4I7FA 3RB4A 1SH3A 3I4PA 1NEEA 1ZAWA 5KG0A 1BLUA 1JLCB 3CCLS 3MPYA 4J7CA 3CMAS 1S9GB 4ID5B 2C3PA 3CWJA 3OR1B 1JJHA 2NPIA 3EPGA 1GQEA 1HWIA 1T02A 1N34J 2L48A 1HHQA 2RJZA 5CAAA 2OPQA 4ELTA 3LAKA 1IVZA 1NJIT 1RTHA 1YRXA 3R3TA 2M7SA 2HZCA 2F9DA 3MMBB 3QZ8A 2WBMA 1LWFA 2YKNA 1BWVA 3E2EA 1FE0A 2DK2A 2QFIA 1LWCA 2D7SA 2V4QA 2HNZA 3PJXA 2B9EA 2A0FB 4TQSA 2AZ3A 1XNQJ 2H5JB 5HROA 4LBIA 2A1BA 1C0TB 3C15B 3D3CJ 1RE1B 3N6NA 1Y7PA 4KO0A 2XO6A 2NREA 4X4OA 3D1HA 3AODA 4BWJA 3C6UA 4MKVA 1HNVA 3JAMU 4DPOA 1RA6A 1HPZA 1UP1A 3L7UA 1B0TA 4ITSA 4ZCLA 1P1LA 3FGVA 2CNOB 2O66A 2J9CA 2YWWA 3TVYA 8RUCA 5EDWA 3E51A 2NR0A 5IM0B 1VC5A 2EI5A 5KFNA 2RB7A 1XTZA 5KFTA 1I1GA 1RDRA 1X5PA 2OO4A 2MB0B 5KOWA 1KDNA 4TY8B 5A8RB 1MWZA 2BBEA 3OPKA 2BMBA 3D4JA 2LVWA 1GX5A 1S1TA 3B78A 2F8MA 4F4KA 1A6LA 5KFVA 4KHPJ 4NXNJ 1NJXA 1RYRA 3G96A 4CWBA 1FVQA 2QN6B 4CO1A 4KE5A 3SZ2A 1TKZB 1TV6A 2RUSA 2KVIA 4ZVHA 1U1OA 5A0YA 5C7PA 2ZOMA 2FC9A 3ENAA 4ATNA 3OL9A 2WONA 4K8RA 3QLHA 5DLFA 3UD4P 2ZZMA 3BDEA 4F36A 3OXGA 3KK3A 3QFWA 4K4VA 1O51A 1SQGA 3IM8A 3C6TA 1TVRB 4C8KA 3IFEA 3CDWA 5LJ3Y 4ZS6A 3BKUA 1S9EB 3JSBA 5KFBA 1U6FA 3BBFA 3ZFVA 1ZETA 4GVLA 2ZBPA 3BKTA 4IOAQ 5LM7E 3IGNA 3DHWC 5DRKA 4OI4A 3IBFB 3ZZOA 3MD3A 4CIOA 4DQRA 4USJC 3HPOA 4QYRA 1REGX 3W65A 1FJCA 2NZCA 3OTCA 1SL0A 2YH1A 2FDNA 4HDGA 1Q7YT 3DLHA 3G4SS 4CH1A 4ZLJA 4FXWA 5H9FK 4M5NA 5KFZA 4EFAC 1F3VA 5ADZA 2HVHA 2BJ1A 3LA0A 1NXIA 1D9DA 2UUBJ 3EXCX 1JNZB 2J0SD 2W01A 2CJAA 3GZ7A 2FQQB 3DXBA 3NLCA 2R8HA 2V9KA 3NGSA 4ED3A 2KRRA 5L9XA 2I8EA 3RZAA 3HZGA 3ZNJ1 3VAHA 3DRSB 3I0RA 1NKCA 1QJHA 3BB5A 3BH7B 3OVSA 3Q22A 4CLZA 2WSFC 1RACB 2DJWA 4HT5A 3IWNC 3PG9A 3CE8A 1PYSB 4LF6F 1IUJA 4GKJJ 4P7TA 3HFKA 1FK9B 3SBMA 4WXOA 5HP1B 3GIMA 1VRTA 4OYMA 5M2RA 5IC6B 1IR1A 2MMYA 1IJEB 1OSDA 4OQJA 4RKUC 4ED7A 3HZEA 2DBBA 4XDCA 2EKYA 4LSZB 2ZWPA 1TL4A 1VIXA 2CNNB 3K5OA 2CZVC 2R7QA 2HZVA 1MWYA 2DPJA 4OFZA 1FVSA 2O5DA 1KOHA 1QAJA 2G1HA 4P74A 3UWTA 3WC0A 1WTBA 2R8KA 1KHVA 3AD7C 1NNDA 2ZKTA 4I4BA 1D8ZA 3QGHA 3TVZA 1HNZF 2FZGB 4F25A 2AJ0A 1SIZA 1Q5YA 4C8ZA 3SMZA 4R5PA 4O44B 1VJQA 4LBPA 4ZIWA 2B43A 1BUXA 3HHLC 3VAFA 4TVAB 2IYGA 4WE1A 4U6PA 2DR7A 3PRBA 1FF2A 4DR6F 2E5LF 3IAM9 5FIIA 2D41A 3VZHA 4DV6F 4L3KA 2F5GA 4LFCJ 3MPUB 1RWMB 4HVZA 3UNGC 3FQKA 1GMWA 3CCQS 2FJXA 1NCLA 4FYWB 4TKTA 4B3SF 3Q8UA 1K73T 1LKZA 1OPZA 3CJ4A 4JI1J 3ULHA 4KB7A 4RLEA 2BOAA 3L95X 4ZJOA 3CMQA 4ECRA 1HNWJ 2B6AA 1JLFA 4DR7F 3DHXA 1X5TA 5C24A 4PWDB 3HULA 1IBKF 2R2TA 3T1AA 3TJAA 2UVRA 2UXCJ 2YPZA 2KZMA 3H40A 2IHR1 2YQ0A 3O1LA 1DJ0A 3K5PA 4KR0B 2AX0A 2J9DE 2XG8A 2AGOA 1F6TA 4EK2A 1WG1A 4BC7A 3M2VB 3HVTA 4M5JA 2J7WA 2AYGA 3O5TB 5D8HB 5J2QA 5BYRA 1OY9A 2AJ1A 1UCNA 3NWGA 2ROGA 2C2NA 3CDUA 2DHAA 3U02A 3EX7B 3DU6A 3IBWA 1VS3A 4X4NA 2YVSA 1EKRA 5IS2A 3HKWA 3TOQA 5K8MA 1N36F 1FFGB 3PO5A 3U1LA 4DV5F 5KT3A 2FVRA 4DCPB 4UQGA 3VAMA 1VYAA 1JJ4A 3VR1A 1FRJA 1RBAA 1TKDA 4GKKF 4MT1A 1N6QB 2AEJA 4IFVB 4K5SA 2IJRA 3V6DA 2D3UA 5LSOA 3EVWA 4LR9A 1TL3A 2AEFA 1CG2A 5SZTA 4DR1F 2OFHX 2XLIA 2UUAJ 2YKAA 2RRBA 3LPYA 2KHCA 2X1FA 4OYZA 3SDEA 2G2ZA 4Y2IA 1FE4A 1R27B 3CJSA 4KH0B 1FDDA 2FHKA 3BSNA 3BN4A 1ZM3A 2QMUB 3BZQA 1YJUA 2ATLA 4OJ1A 3CC2S 1DQ9A 3VGVA 1KLMA 4YEAA 3NAHA 3RRKA 2DEJA 3MD1A 2ZBCA 3BGRB 3MM8B 4PABA 3GQCA 3MEDA 2CPHA 1RQ0A 3D1QA 1KQFB 4JB8B 4HR2A 3A12A 3CULA 2IAJA 1RAHB 3M9MB 1RT6B 4LBHA 4K0KJ 3ZZPA 4DLEA 4PQAA 1UA1A 3J80Y 5KFYA 3GSDA 1RT1A 3I5BA 2E7WA 2YNHB 5T41A 1GNKA 3LWMA 2YNGB 1RWUA 1RU2A 2CQHA 2Q66A 1U8SA 2PC6A 1RGVA 4PPDA 4YY3F 2R7UA 2LQ8A 2DGQA 3UN2A 2G2YA 3AOBA 1K1SA 1K8AT 3OUYB 3W8PA 2BKOA 3LANA 3RB0A 3L4BC 4DV3J 3OHBA 4NPOA 1FT8A 2ZH7A 4ZP8A 3G6XA 3MM5B 3HVAA 5KG1A 1Q5VA 1LXNA 2XI3A 3KXDA 1PO6A 3GFHA 5K14A 3TP2A 2EVZA 2FJDB 1S77D 2CJQA 2J76E 3MDFA 1VR6A 1U2RA 2BE7D 3DLKA 3UW1A 3CCSS 3W63A 2RAQA 2X7IA 1HWKA 2QE5A 4ZPDA 3T5KA 4OI0A 2MY8A 1IKVB 4RW6A 4Q8FA 4DG1B 4IR9A 2HNYA 2JFKA 4IRCA 2POKA 3H0PA 4B3TF 3TRGA 2ZWOA 1VFJA 1UJ5A 2CPDA 1WACA 4B9LA 4IG3B 3PX0A 2FIUA 1VLOA 1IBLJ 5D0EA 4B3RJ 4L73A 1QE1B 2MQOA 4CO0A 2CIMA 1TAUA 1J5EF 5B0EA 3TANA 2W7PA 1NJWA 4ZVFA 3DRRA 3J81Y 2GFFA 3QT7A 5CYQA 2HS4A 1WEXA 2Z58B 3KG1A 4QIVA 1XN9A 3M32B 2EC0A 4DHVA 3OFHA 2Y1LB 2WSEC 2NXCA 1MMNA 5C2GA 1HFEL 1CJKA 4RNFA 4ZHRB 1JLAA 3MCOA 1NKBA 2KO1A 4O4GB 2OMLA 2P8IA 3LALA 5DLGA 2NYHA 2QA1A 3QSIA 3WQPA 5KT6A 2BE9B 1Y9OA 2HSEB 4NYOA 2Y0BB 4MFBA 2RU9A 2HHTA 2KL8A 4RU2A 1FEEA 1U6ZA 2HQDA 3C16B 3Q83A 1HQEA 1RP5A 3CIZA 5IV3A 2EK6A 1DQAA 1JB0C 4DS4A 1O8BA 2E29A 4KRWA 3DNCA 3M30B 4O0IA 1P1TA 3D0GE 2WVBA 3I31A 1UKUA 1R0BG 2CNKB 1WKKA 1RLDA 2D9OA 2W2MP 2Y3YA 4J5OA 2XLJA 2E1RA 2BYCA 1S12A 3M2RB 4JI4F 3ZTRA 4ZCMA 1RA7A 4V19X 5IXUA 3FVYA 2IIHA 3GU0A 1EP4A 1R0AA 4ZCIA 1NSQA 4K4ZA 1O6XA 4WIQA 1LWXA 4RWXA 1GK8A 1KR4A 4LRFA 4JI0F 1YRUA 1OO0B 3QYYA 4CDIA 1NSAA 4ZKAA 3ETMA 1SUQB 3C8YA 2DTJA 1L3TA 2QTWA 3KHHA 1VISA 2KH9A 4ECQA 3T1YJ 4CLWA 3X3UA 3N6LA 2J7KA 1UVIA 2GGPB 2BW2A 4RW8B 1VQ9S 4MYUA 2ASYA 4U95A 2HQ3A 2FTRA 2JWNA 2BABA 1DTTB 3UQSA 5IWAF 5LMUF 3EDRB 2R7WA 2RUGA 1GAOA 1CJVB 2H3EB 5HANA 2PDAA 1S0MA 1BQMA 4FKXA 3H5SA 3DC2A 2MEWA 2PA3A 4IFYB 4C7QA 4PG8A 5F3TA 3J80U 4QR2A 2CQDA 3HFVA 2W9BB 1K0VA 5ETQA 1CVJA 4WZMA 4OZ0A 2IY5B 1ZBTA 4USIA 3K5MA 3NOCA 2BM1A 4X4PA 3JTOA 3C14A 2CZ4A 2BR0A 4O4RA 2UXDJ 4NE9C 5J1NA 4IDKA 4JI6F 1AT1B 4LQ3A 4B02A 2AV5A 3T6JA 1TKTA 4FKYA 2G9OA 4UQTA 1KQSR 1M5PC 2Y8YA 3OJSA 4DV2J 4WK1A 1DHMA 4KPYA 1A7GE 1S59A 4PYDA 4LSNA 2BX6A 2GQ2A 1RHQB 1U25A 3O8WA 4OIXA 4WU3A 4B9VA 1HQ2A 1WKJA 3MPDA 4A8OA 3CCUS 2JLEA 2BANB 5KFKA 4JBCA 1U2FA 3A8JA 3BN7A 2FJWA 4B3MF 5B7WA 2IVYA 3VVTA 4FN5A 4F3QA 3JB9k 4DX7A 1HBMA 1FFSB 2MKSA 3KK2A 1UVJA 5CCMA 5DQHA 3LP1A 5L8RC 2LXIA 2KT2A 3OHAA 1G2EA 2VBYA 2M8HA 1X4GA 2UZAA 3A3PB 2EFNA 3Q8SB 3TJ8A 2HRTA 1CPZA 2ZFHA 3SI8A 1HNXJ 1IBCB 2MZQA 1H2UX 3J81U 2CQCA 3GJRB 2LXFA 2I6WA 1FD8A 2YWGA 1DZ5A 3M8PA 2R7RA 3LP0B 3EICA 3CD7A 1TR0A 1M0SA 4CNZA 2DR5A 1TL7B 1D9AA 4A8YA 1R8AA 3OLBA 3CJRA 3SCJE 4NOHA 3MHYA 4F0MA 1N8RT 1IQZA 5L46A 1YDLA 3CCMS 1V5VA 3CDEA 3TAMB 3RAXA 3EE3A 2AD9A 4XTTA 3R8YA 1XMQJ 2FHOB 3ETOA 1T05B 3PVXA 1Q81T 1PAUB 4QR0A 1QUPA 2DNLA 4DV1F 1CULB 5AJ3F 3M4XA 1SKSA 3ZZZA 2QLWA 4DJBA 1GXUA 4I2PA 5A2QY 1SB6A 5IOLA 2YTCA 1TUVA 1H2VZ 4C9DA 2BDPA 3IXQA 4CTAA 5F8NA 2E5IA 4URSA 4O3PA 4DV7J 3J7YI 3RR8A 3DLLQ 4K50A 4MMOA 1JKHA 4RUHA 4EMDA 1SJ4P 5D0HA 1RHJB 4DZDA 2HQGA 4YHHJ 2JL9A 1EETB 4A46A 4ZVTB 2COLA 1HNIB 2HS0A 2NSCA 3HJVA 2ZC3A 3Q8RB 3IWXA 2V2KA 5FD1A 4ZN3A 5KAKA 1X4BA 3GP9A 3HMJG 3C3LA 2H54B 1UAWA 3MPWA 2HFSA 4OHVA 3TW0A 4LSLA 3UCZP 5LXYA 2KI2A 1ZM9A 3TR5A 3DI6A
chains in the Genus database with same CATH topology
2ILYA 2ZZNA 4DFKA 1JLGB 1IJFB 2DHSA 1VQ7S 1SC6A 2EPIA 2IVFB 2MKJA 2J0QD 3KFWX 4OX7A 4WE1B 3NS5A 2CQBA 3M1VB 3IR5B 4X4VA 2I38A 2FHMA 4TU9A 2ZHAA 1ULRA 2P5VA 4ECWA 4NA3A 4EBDA 4TYBA 1KHWA 3I5CA 4U7CA 2HS3A 3OR2A 4PG7A 3ZZRA 4QWEA 3T1YF 5SUHA 3M2VA 3MM6A 1X0PA 2VKZG 1XBWA 1SV5B 2MJNA 3DYAA 3JSYA 4R0EA 1UJ6A 2J6UA 2CPZA 2XS2A 2VH7A 2CYYA 5IZHA 3PIOQ 4A8XA 2F3JA 4H4OB 4QWAA 2VG7B 2XY6A 2VV5A 1FNMA 3OTEA 1XMOF 2ZKUA 1C1BB 3I0SB 4ED1A 2DD8S 4QCLA 3G8TA 4MIBA 2OLWA 1M5HA 4IH5A 2LA4A 3CDAA 2XMKA 2NSBA 4NRTA 5L38A 4ED6A 3FSXA 4U67Q 4NLSA 5GVQA 3RAQA 4I68A 3HVRA 3P96A 1KQKA 4YOEA 4EYIB 3PW0A 2P9CA 2XNQA 3K59A 4OJGA 4JI8F 1KVIA 1M5VC 5J2PA 5DM6Q 1X7VA 1X4EA 4RW4B 2XMWA 4KAIA 5GAEI 2W7AA 2AWZA 2NYIA 1ZH5A 3I55S 3MTKA 2A3JA 2HPUA 1K1QA 4OX8A 2DNQA 1VQYA 1JLFB 2W9AA 4A8QA 1TK8A 1RT3A 5ITHA 1S6QB 1RTJB 4GO7X 1N32F 5IQQA 5C24B 2K3KA 4XIUA 3J7Z5 1PC5A 4Y34A 2YWKA 1N6QA 2WBRA 4JI1F 3LW5C 2CQ2A 5HBMB 1YRTA 1HQUB 1FNOA 1WF2A 4E8UA 3TUIC 3C66A 3IAS9 3FEZA 2Q6CA 1JLEB 2XS5A 5E33A 3UPFA 2IRUA 3NMRA 2OPSB 3DOKB 5AXNA 2R7VA 2DITA 4DFJA 1KFSA 4N47A 2E66A 3TAPA 1JLQB 4Z2XA 5KFSA 2XCAA 3POTA 4RNNA 2ZBIA 4QWCA 2BJDA 3QGGA 1WHVA 4OJ3A 2VC1A 3H4DA 2DGTA 2XSJA 2MKIA 3UCUP 2XS7A 5D6GA 3X1LB 4YDDB 3OBIA 4DFMA 4ETXA 2DNZA 3WX4A 2GC8A 4TU7A 3MEGA 1B7FA 3JYTB 3AY0A 4R25A 1VBZA 2HFOA 4NLYA 4RW7A 2KXFA 4RW9A 3SSRA 1IKWA 2HGLA 3PW2A 2RIJA 3NBPA 1VJWA 5A8KB 3HVTB 4IUFA 2UXDF 2Z0GA 2ZITA 2GHVC 1VMBA 3NP5A 4OX9F 1Y5NB 2LYVA 4NZ6A 1RTDB 2BZ2A 2LEAA 4JI2F 3OQ2A 4J9OA 1T3NA 4DL0C 2AGPA 5D4LA 4R8UA 2CDQA 1L5UA 2ZH6A 4NRUA 4ZPTR 3M6VA 4JI5F 4FPRA 3T5HA 5F8GA 3TI0A 1VQ5S 5HMYA 2EBGA 4NLRA 3H20A 3KHGA 2XMVA 2DNGA 4HEA9 3IO1A 4H4MA 1W2IA 4AE5A 1ZTTA 4EUVA 1DFDA 3TO8A 1T95A 3CJ3A 4DV2F 3R5CA 1R8PA 3CJKB 1E6YB 1V3ZA 2IYIA 2YNIB 2KB2A 5I3PA 3GV8B 2XWYA 3QJJA 1WNEA 1KS2A 2F40A 2ZNYA 2KZZA 1S1XA 2RDIA 3W2VB 2JFDA 1OIAA 3BO2A 5T14A 2ZJQQ 2IMWP 1FA0A 1AROP 3IRXA 1SJ3P 3D2WA 2R2RA 2BE2B 2QSFA 1WD6A 1JMTA 5C42A 4CQ1A 4FXDA 4YR0A 2YWEA 1OWXA 3TARA 1F5CA 1BGXT 2VBWA 2MSTA 1T05A 3KLHA 1SIWB 2UUCF 4WYWA 3Q2TC 2KXNB 5KT4A 2E1AA 4USHA 4XAKA 3H8YA 2W7OA 3H59A 2PD1A 1URRA 2B4UA 1U1PA 3G71S 2NLWA 2UU9F 2CPEA 1RT2A 3GILA 2CVIA 4AL7A 1T03B 2BOPA 2PO4A 3HHLA 2YKNB 1LWFB 2GCFA 4ZP7A 4A8FA 4ICLA 4F2RA 2YNHA 4GO5X 2R7TA 1TL3B 2KHDA 4B9UA 2V8DA 3ISZA 3IS9A 3QWUA 5EWEA 1U1NA 1XNRF 2CQPA 1LWCB 2JX2A 4NXMF 2QEXS 2J6TA 4NA2A 1WHWA 4DFPA 2HNZB 1KQGB 2G0CA 4DF4A 1KFDA 4A4JA 1NK0A 5KTQA 1IBMF 2LQJA 2IM3A 2R9LA 5D3GB 3IG1B 3VAJA 1M5KC 1M5SA 3KLFA 3V81B 1BWEA 1S1UA 3SDEB 2AJQA 1DLOA 5LJ5Y 3MFHA 2WHOA 3RBEA 4LF5F 4DV0F 2IBOA 4PQUB 4K2XA 3BREA 4DEZA 1OQ3A 2ZNZA 3GYNA 4ZP6A 3Q23A 3I9V9 1K0TA 3MR3A 4BS2A 1B64A 4ZPWR 2B5JB 2IRYA 2RD5C 3I6PA 2PI5A 2Z2MA 3IRWP 4ES2A 2JVOA 1LXJA 5JUMA 4OZLA 2JHEA 3VZIA 3WBZA 5KFXA 3PX6A 3C6UB 4UUWA 4N56A 5A8WB 2UUAF 1HNXF 1EETA 5BYQA 5JVHQ 2AYMA 5FDLB 3SCIE 3QWPA 3RBDA 1HNVB 1NJZA 5DDRC 7FD1A 2XMTA 4J9RA 2MSSA 3FZBA 4RZRA 3KLEA 2XI2A 3MEDB 2HQIA 2VPXB 2QV6A 2EW9A 1LV5A 2CJKA 5AXKA 4K4XA 2HHHF 4MK7A 3MEEA 4PWUA 1S1VB 3B8HA 3UR3C 3CCZA 2R8JA 4QU6A 1XK8A 4BWMA 2XGPA 3F73A 1S0VA 3W7BA 2GV1A 2KU7A 1T7PA 4C8NA 4AXJA 2R8GA 2IAJB 2X51A 2ZE2A 2VKRA 3GR1A 1C0UA 3CD5A 2DNMA 1LWEB 2QYCA 3PFEA 5THWA 2XLKA 1ELOA 1MW7A 3V4MA 1CQNA 3GIKA 2AYEA 2LKZA 5B09A 1Q7LB 1X5OA 4DN9A 5KT2A 3Q8QB 1ZTWA 5DG9A 1JLGA 3CO9A 4YFUA 4F8RA 2QRRA 1IN0A 4YQWA 3OLAA 4DUYF 3CTRA 1UWBB 1RK8A 3FEXB 5F8HA 3M1VA 2I1RA 1X9WA 2K3IA 3B82A 2DGSA 2H5EA 4DLGA 3R1HA 2D3ZA 5GAGU 3TYTA 1G6BA 1RT1B 2MQPA 3VTIA 4M95A 2J0WA 1E6VB 2FLOA 2WOMA 1S1TB 3THVA 1KNZA 4I64A 4MKAA 5M2UA 5DJBA 1YJWS 3I32A 1NK7A 1XMQF 3MOJB 1FKOA 4MK8A 5E3CA 3NNAA 1R8HA 4A8KA 4H4OA 2R2UA 5B0BA 3HJFA 4Y0FA 2ZDOA 2LECA 4IO1A 4K0KF 3I0SA 2ZH5A 2V4JA 1HL6A 5DG7A 2DRBA 1HWLA 3Q8PB 1QSSA 1N48A 5EUHA 4QBUA 5B0CA 4CT8A 4ZVEA 1A9NB 2M5YA 3HVWA 3DN9A 4B9TA 5CZXA 1TV6B 4IG3A 5K8OA 2G1DA 4F50A 4PXCA 1T3OA 3GG1A 3NRBA 5F0UA 2KFYA 5KFUA 5DGAA 4OHXA 1P9QC 2ZD1B 4FF4A 3OV7A 4O23A 1RT7B 3S6EA 3MR2A 1VQ6S 4CT9A 1UJ4A 3H2LA 5AE1A 5KG6A 4RW4A 4C97A 3QLHB 3CT9A 4Y6IA 4DV7F 4LIRA 3O3LA 3OVBA 2R7XA 2DH7A 2CPJA 2GQCA 4LF8F 4KV8A 1IKYA 2GHWA 4M5DB 3HHNB 3PKMA 2B4PA 2XGQA 1S6QA 1RTJA 3H5UA 3V6KA 1PC4A 4ALZA 4YB1P 4K4TA 3I5AA 2KJWA 1U47A 3TA2A 3K5LA 4TLQA 3M32A 3TA0A 2QA2A 1KRPA 2N4CA 3C6TB 2DIVA 5HBMA 1HQUA 3K8WA 4BCAA 1TP7A 4B08A 2RU3A 3C2PA 5D4PA 2C28A 3H98A 3DLKB 3LUYA 3KLIA 4BBYA 2DPIA 2UUWA 4DL2A 3MPVA 3V6JA 2Y1JA 1GX6A 4WFNQ 3GG0A 4YB6A 2AJFE 3VAKA 6FDRA 3ISND 1KC8T 2OPSA 4ZHRA 1LQ9A 3DRXA 2UUTA 1JLQA 2GMJA 4DQPA 5GMKa 2OMOA 2OSRA 5KG2A 1XR7A 3MMCA 1T8EA 1SXLA 3MUTP 3CDBA 2M88A 2GO9A 4NZ7A 1DTQB 2L9WA 4O4GA 2B0GA 3E8OA 3QIPB 4ETZA 2KTQA 4U9RA 2MZRA 2RF2A 3KKFA 3MOZA 2XB2D 1GT8A 1YJTA 2D1CA 3F44A 4I7FA 3RB4A 1RT5B 2RQCA 3TAQA 1M5OC 1N0UA 1KONA 1SH3A 3I4PA 1NEEA 1ZAWA 2DH8A 5KG0A 3FZ2A 1BLUA 2HNYB 1RTDA 4MKBA 2ZM6F 1JLCB 2E44A 2PIIA 2Y1IA 3CCLS 3MPYA 3CMAS 1S9GB 1H7WA 1VQLS 4ID5B 3KK1A 3LWLA 2SXLA 1V3RA 2C3PA 1WEYA 3CWJA 4C3LA 4EU0A 3SYZA 2AJ4A 3OR1B 2XMJA 3AA8A 1F60B 2A10A 4WJBA 3MUVP 2JEJA 4Q0BA 1JJHA 1YJNS 4PUOA 4KFBA 4U7UK 4WKRA 2YKMB 2NPIA 1HMVA 3CJKA 1E6YA 3ITHA 4UY8T 3JSMB 3EPGA 1WF1A 1TFWA 1JWWA 2ZOFA 3QAEA 1U49A 5FLXY 1GXLA 5C5JA 1GQEA 3W2VA 1VLYA 3GFXA 1HWIA 1T02A 3MM7B 3OFEA 5E3RA 4DSJA 4I69A 1N5VA 2BE2A 2ZOGA 3DRRB 1N56A 3M30A 4JI3F 1QAXA 2L48A 4G1QA 4DN0A 2O3DA 1NJYA 2RJZA 4OI1A 2XNRA 3I82A 3MF5A 1H3DA 2APOA 2FVCA 2OPQA 4PXBA 4ELTA 1HD1A 3LAKA 4NCGB 4TNOA 1NJIT 1RTHA 1YRXA 3R3TA 2M7SA 1FEHA 5KG4A 3CEDA 1IBLF 2HZCA 2YX7A 2F9DA 3MMBB 3N28A 5J2NA 3QZ8A 1U1RA 2WBMA 2CRLA 4PXDA 1T03A 1LWFA 2YKNA 1FRMA 3VQSA 3PW4A 4D3GA 3WC2A 3E2EA 1FE0A 2RMLA 2DK2A 1R31A 1JLAB 1LWCA 4I6YA 3ENWA 5DDQC 2D7SA 4WFBQ 2V4QA 2HNZA 2GO8A 3PJXA 4FBUA 2RDJA 3E01A 2KN4A 4TQSA 2GW8A 1SL1A 4KTQA 5F0WA 4EZ9A 3DMJB 5HROA 1NK6A 3HF5A 4BHQA 2YX1A 3V81A 1IM4A 5J1PA 4ECVA 3I0RB 5IT4A 2A1BA 1C0TB 3CCWA 4XK8C 2DR8A 2GHPA 1TAQA 1X4CA 2LDIA 4F3OA 3N6NA 5J1EA 1Y7PA 2RH3A 4KO0A 3ZZYA 2NREA 1LW2B 1O5JA 1SUQA 2BVZA 2M4MA 3D1HA 4X4OA 3PEJA 3CGIA 2N7CA 1RI7A 4BWJA 3IN5A 1R3NA 3C6UA 3MTJA 4F4YA 1NK4A 1HNVA 4N8NA 2CFXA 1UL3A 4DPOA 1RA6A 1X4HA 2ZH2A 1HPZA 3MM9A 3QMQA 4Y28C 1UP1A 2GJIA 1B0TA 5LMNF 4ITSA 2GGPA 2LCWA 1YI2S 4NLWA 4Q2LA 4ZCLA 3MUMP 3LQVA 3P6YC 2QFJA 1P1LA 3U1MA 1AW0A 1CC7A 3FGVA 1H2TZ 4JYAF 3GR0A 1AFJA 5KT5A 4Y65A 2O66A 1NAQA 2CPYA 2J9CA 4RW8A 5D4NA 5HQ8A 3K57A 3ENVA 1S9FA 3G8SA 3DOLB 1PSDA 2OJ3A 4DR4F 2B51A 5BJRA 4DQQA 3J7A1 3TVYA 4HYKA 4WCEQ 1LK5A 2FJBB 3GIIA 4KIAA 3E51A 3LGMA 5EDWA 2NR0A 1H7XA 3BS9A 5IM0B 3BO3A 1SJQA 1VC5A 1DTTA 4IG0B 3M2UB 2EI5A 5KFNA 3T9ZA 2RB7A 5HMZA 5F8MA 1XTZA 5KFTA 2J7UA 2XC9A 2ADBA 5L1KA 1I1GA 2BQRA 1R6YA 1M1KT 2OH2A 1RDRA 2HHPA 1F5BA 1X5PA 2OO4A 3CCTA 1TQLA 5CYMB 2MB0B 5KOWA 4B9SA 5E41A 1UWBA 4TY8B 2VUGA 1WWHA 2WCXA 4HHJA 2C3YA 4CO2A 5A8RB 1MWZA 4MYTA 4N8OA 3UE2A 1PILA 4FNIA 2F4VF 1URNA 5KFJA 2BBEA 3OPKA 2LVWA 1GX5A 3PX4A 1S1TA 3B78A 3DLGB 4F4XA 1GTHA 3ENQA 2F8MA 5K8NA 4F4KA 2L9DA 1A6LA 1X5SA 5KFVA 1R0AB 2Q1LA 4PKDB 5L1JA 1TZ0A 1NJXA 1K9MT 4HI1A 4B9NA 2HFNA