4LJMA

Crystal structure of c-terminal rna recognition motif of human etr3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
GPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords CUGBP Elav-like family member 2
publication title Crystal structure of C-terminal RNA recognition motif of human ETR3
rcsb
source organism Homo sapiens
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ljmA00
2F9JA 2HGLA 2FPHX 3SMZA 1W2BR 1SJ3P 1R8HA 3HI9A 1YIJS 1RKJA 1K9MT 1UW4A 2CQPA 2HVZA 4C4WA 1X5OA 3LPYA 2QA4S 1NU4A 2DH9A 3CC4S 4CQ1A 2KYXA 2OTJS 5IQQA 3EGNA 4Y0FA 2DNZA 2DGXA 2GHPA 1URNA 1SJQA 3VAHA 3NNHA 2MZSA 2J0QD 2MQLA 3G71S 2LA6A 1FO1A 1VQNS 5D78A 2ZJRQ 2YTCA 2MZJA 3CCVS 2M9KA 1X4EA 1QVFR 4LIRA 2XB2D 1PO6A 1WHVA 3S01A 2NZ4A 2CQBA 1U1PA 3MUMP 4WFBQ 3UD3P 2MZRA 3P6YC 2KH9A 2BZ2A 2DIVA 2YWKA 5LSOA 3CPWR 1HD0A 2DHGA 3ULHA 3DLLQ 2MGZB 2CQHA 3MI7X 2DO4A 1M5VC 1H2TZ 1VC0A 2LECA 2FHOB 2KG1A 3CCQS 5BJRA 3I55S 1NJIT 3VAMA 2A3JA 4CIOA 3G4SS 1NO8A 2J76E 4OZ1A 1X5PA 1VQ4S 2MQPA 1FHTA 1K73T 1WHXA 2MYFA 2VOOA 2DNRA 2CPXA 3VAGA 1VQMS 1S72S 1SJRA 3J7YU 2DHSA 2MPUA 2O3DA 5HL7Q 3US5A 1QVGR 1VBYA 3CCES 2D9OA 4Y00A 3IWNC 2CPEA 2DNGA 1JMTA 2KRRA 2RQ4A 2RS8A 2CQ1A 3U1MA 3MD3A 2DGUA 2CQ2A 2L41A 2MQNA 1AUDA 2VOPA 4IOCQ 2N7CA 2RS2A 3BO3A 1OIAA 1WG4A 2MQQA 3NS5A 1WTBA 1VQ7S 2CPYA 5GVQA 2KRBA 1X4FA 4WIIA 2MKJA 2PE8A 2PEHA 2DNKA 3PIPQ 1N8RT 5DETA 4YOEA 1Q7YT 2KG0A 1N54B 3H2VE 5DDPC 3NNAA 2U1AA 2DNOA 2CPDA 5D77A 2X1GA 2OIHA 4W90B 3P5TL 3VAIA 1UAWA 4TU8A 1FJCA 1HA1A 1Q86T 2MKHA 2KT5A 3LQVA 3V4MA 1P27B 1WI8A 3MUTP 4IUFA 2EK6A 2X1BA 2MSSA 3THPA 2L08A 2M0GB 1YJ9S 2RUGA 5GMKa 1CVJA 5JVGQ 4C7QA 2XS2A 3CXCR 1HD1A 2DITA 1VQKS 5HO4A 1YWXA 1SJ4P 2MY8A 4EGLA 1VQPS 2BOPA 3NMRA 2J8AA 1WEXA 2XNRA 1VBXA 3UWTA 2JVOA 2LEAA 4FXWA 1N52B 2CPZA 1FXLA 2DH8A 3S6EA 4C0OC 2D3OR 1XN9A 2F3JA 3CMAS 1QM9A 2DNLA 2OSQA 1K8AT 1KQSR 2DO0A 2MKSA 2G0CA 2RRAA 1M5PC 2MZ1A 2MHNA 4ED5A 2K3KA 2MZQA 1VBZA 1FNXH 4TU7A 2E44A 5GAGU 5LXYA 2RQCA 3Q2TC 3P3DA 2M8HA 4TLQA 5CXTA 5LJ5Y 2VONA 2CPIA 2DGQA 1UFWA 2XNQA 3S7RA 5DDQC 3UCUP 1D8ZA 2M70A 2N3LA 2MKCA 2L9WA 3TYTA 5GAEU 1L3KA 2WBRA 2HYIB 3N9UC 2DNQA 2DB1A 1U1LA 5DDRC 2LMIA 1Q81T 4F25A 3OW2R 5CA5A 2I2YA 3NNCA 2OTLS 4IO9Q 2NLWA 1FJ7A 2M52A 1H6KX 2DGSA 2MZTA 2Q79A 2KHCA 2M4MA 1H2UX 5CYJA 2ZJPQ 4WF9Q 3ZZYA 2LXUA 1U1RA 2F9DA 3D2WA 2DGTA 2DHXA 4WFNQ 3IRWP 2M8DB 2KXNB 1WHWA 1YI2S 1M5OC 1X4AA 3I56S 2OJ3A 2JWNA 1KOOA 4V19X 2JRSA 3JB9k 4FXVA 1D9AA 4WKRA 3UE2A 2AD9A 2DNPA 2K8GA 2YH0A 3G96A 3B4DA 1VQ8S 3BS9A 2CQ3A 1VQ9S 3S8SA 2RVJA 1G2EA 2KVIA 2HGMA 2MKKA 4PR6A 1WHYA 2ZJQQ 3ZZZA 1S79A 1DRZA 2JVRA 5GADU 1O0PA 5JVHQ 5LSLA 3CULA 1R8PA 3BO2A 3RW6A 2HZCA 1U1KA 4P6QA 3K0JA 2GO9A 2DNNA 2LKZA 3P49B 2AYBA 2KM8C 2N82B 2KFYA 2FY1A 2E5JA 5IM0B 2LEBA 2DK2A 2CPFA 4IOAQ 4PKDB 4YUDA 2CQIA 3FEYB 2CQGA 3R27A 3UCZP 1U1MA 2MQMA 3U1LA 3B4MA 2MJNA 1OO0B 1FT8A 3FEXB 1U1OA 1PGZA 4RU2A 2KXHA 1KC8T 3THTA 3MD1A 4F02A 1YITS 2DHAA 1JJ2R 1X4GA 1X4DA 5FJ4A 4BS2A 3VALA 3G6ES 1P1TA 3MOJB 1JJHA 2CJKA 3PIOQ 1VC5A 2DGWA 2X1AA 1HL6A 2AYEA 2RU3A 1BY9A 4U67Q 2XS7A 4WCEQ 1WF2A 1DHMA 4CH0S 1OPIA 1WF0A 2LCWA 1X0FA 3BEGB 4OZ0A 3TP2A 4LJMA 5IM0A 5LXRA 1OWXA 2M7SA 1WELA 1A9NB 2DNMA 3BO4A 5DM7Q 4F26A 3G8SA 1VQOS 4UQTA 5ITHA 2ERRA 3TO8A 1Q82T 4M5DB 1M90T 2YH1A 1VQ5S 1U6FA 2DGOA 1H2VZ 2KXFA 1X4CA 1U1QA 3EX7B 5DDOC 1YJWS 2KU7A 1VQLS 1X4BA 5LJ3Y 1U2FA 3CCRS 4UY8T 3VF0B 3CCSS 3CCUS 1KOHA 2QEXS 1X5TA 5H1SV 2AYMA 2G1DA 2MJUA 1DZ5A 1ZZNA 3SDEB 4Z2XA 2LYVA 4QQBA 2FC9A 3CTRA 3MDFA 2LA4A 2XSFA 2UP1A 3MURP 1WG1A 2J0SD 2I38A 3H2UB 1WEZA 1ZH5A 1WEYA 3Q2SC 3HHNB 1YTYA 4W92B 1X4HA 2DNHA 3VAFA 2D9PA 2V94A 2MY7A 5DM6Q 3MXHP 3CCLS 3VAKA 2MQOA 3UD4P 3R1LA 3G8TA 3CD6S 2CQ4A 2DH7A 5GAHU 2KM8B 3CC2S 2VODA 2X1FA 2DNYA 3DXBA 5MLCV 1DBDA 2RRBA 1YHQS 1WF1A 1B7FA 1VC6A 2AYGA 3UCGA 1WG5A 3CF5Q 3EGZA 5IFMA 1ZZFA 3SDEA 1KD1T 2CQ0A 1M5KC 1U6BA 2DIUA 2KI2A 3RW7A 2OSRA 2E5HA 2LXIA 3VAJA 2XS5A 2CQDA 1UP1A 4PRFA 2MGZA 2CPJA 4ERDA 1YJNS 1SJFA 2RT3A 2KN4A 2MMYA 2DGVA 2SXLA 2JX2A 2DISA 4YB1P 4QU6A 1WWHA 1WI6A 4WFAQ 4TU9A 1IQTA 3R1HA 3L3CA 2M88A 2G4BA 3CMES 3CCMS 1X5SA 4J5OA 2E5GA 1RK8A 2FC8A 2LQ5A 4A8XA 4QPTA 2MB0B 2MXYA 1FJEB 3SXLA 3CCJS 3CC7S 4ZKAA 2YKAA 2ADBA 4LMZA 1N88A 1U1NA 2B0GA 2CQCA 2RNEA 1A7GE 2ADCA 3MUVP 2QFJA 2EVZA 3J7ZT 2U2FA 1VQ6S 2MSTA 2N3OA 1JJ4A 3G9CA 1SXLA 2M2BA 2EK1A 2E5IA 3NS6A 5EN1A 4CH1A 1F9FA 2MKIA 2HGNA 1M1KT 2CPHA 3CUNA 4QU7A
chains in the Genus database with same CATH superfamily
5KFVA 3A3OB 4B3MF 3D3BJ 2KFZA 2DH9A 2VQEJ 2WW8A 1OYEA 3NMAA 2OEKA 4DG1A 2ACYA 2A2CA 2GJ2A 3AOCA 3BN4A 2M9KA 2OI2A 2QGFB 4ED4A 4XK8C 1FDAA 3EDRB 2EI5A 2WONB 2WVBA 5BR8F 4O44B 1QSSA 4USKA 5HANA 4K4SA 1FNMA 3ILLA 2ZNZA 1UETA 3ILOA 1LWCB 4JI2J 1R6VA 3MEDB 3W2WB 1VQ4S 4K4VA 3AOBA 2JEJA 2ROGA 4IG3B 5HBMB 3TOQA 3CJ8A 1CPZA 1WKLA 4PXBA 2IMOA 3DI6A 3IG1A 1AA1B 2D9OA 3BSCA 2RS8A 2IIHA 1ZA2B 3RYLA 3OL6A 4JI7F 1T9TA 3M8WA 2HQGA 3NOGA 4OI4A 4MJKA 2MQNA 2P9CA 2V8DA 3BO3A 3HJFA 4PUOA 3CD7A 2V63A 3PJWA 4IDKA 2PE8A 4F0MA 3PIPQ 4JV1A 3A8JA 4I7FB 2V69A 2G0IA 5KOWA 2VC0A 4JI4J 2O01C 2KT5A 2QTWA 1MWZA 2QMWA 2HRTA 1KHVA 3IC1A 4RU9A 3TA0A 2CPZA 4NLUA 3N5BA 1QM9A 2NQPA 3RB3A 2DTJA 1RYRA 1S76D 1UVLA 2K3KA 2MZQA 3J7YI 4LBIA 1WKJA 4TU7A 3Q2TC 3G6XA 2M8HA 4ECYA 4YR0A 5B0CA 1RBAA 4ZVGA 5AE1A 3EZ5A 3EZUA 1LQ9A 1L3KA 2PA3A 1ITPA 1NDPA 2DB1A 2ZH7A 2IDEA 2M52A 1NPPA 4F4KA 2LXUA 2OPRB 3PNIA 1CC8A 3I87A 3W65A 1M5OC 3H20A 4V19X 2ZNYA 3LWLA 4ZVOB 3KDOA 2V5HG 2NSCA 1VQ8S 1RACB 3P5BP 2KZMA 4IYQA 4AXJA 1FKPA 1K47A 4OHVA 3E01B 4ED1A 2YKNB 3ZZZA 2VBZA 3W2VA 1QJHA 2IVYA 3CULA 5KFNA 3WC2A 2RD5C 3UN3A 4A48A 3NKYA 4GO5X 3WZ0A 1V3ZA 4PXDA 4RBVA 2GQCA 2QE5A 2AYBA 1S1VA 3CJTA 2IA0A 3NBPB 2DK2A 2ZC3A 4YB6A 1S9FA 2QT7A 4ZHRB 2VG6B 4OI1A 3DXSX 4M5IA 5ETRA 2HQ3A 1XMOF 5D4LA 4ATNA 1YITS 1JJ2R 4IFYB 4G1PA 2NPIA 1S0MA 1H72C 1X4GA 1GFWB 1IJFB 4BC9A 3TNVA 4CLSA 1OPIA 2XO7A 3MECB 2BBEA 1OWXA 5HMXA 1CS4A 1LXJA 2H65B 5DM7Q 4FP9A 2BABA 4PXEA 1PYTA 3NCRA 2EFQA 1Q82T 4YFUA 3KJFB 1RHRB 1YVFA 2W2OP 3N79A 2E7WA 3E3XA 4ZVHA 1ZBTA 3NG8A 4ETZA 1U2FA 4KGXB 1RHUB 4KY3A 4C0HA 2HFNA 1RU2A 2WOMB 4PQUB 2QV6A 2CJXB 1HWJA 2LYVA 2LA4A 4IRCA 1NH8A 3MURP 2D41A 2KFNA 4YMEA 3A3NB 4RW4B 3UNGC 1DTTB 3K8VA 1FX4A 4KGZB 1VJWA 3LO3A 4M5DA 4JI0F 4DEZA 4ZP9A 2WCXA 2AF6A 1UPMB 4JI3J 3ONQA 1FWKA 1RISA 3R97A 3GR1A 4K4XA 3EGZA 2OLWA 2HHWA 2HVIA 3DRPA 4LF4F 2VBYA 2J7WA 4IFVA 4LQ3A 3ISZA 1FRLA 1RAGB 2VFTA 3QIDA 1FF2A 4IRKA 2ZH9A 3DRRA 3ENVA 2CG4A 4P7TA 4IRDA 3UD5A 1HBNA 4UOHA 2BEFA 5K8PA 3AXMA 4L6V3 4EUVA 3MCNA 4HYKA 2V9KA 2MSTA 3PM9A 2N3OA 2M2BA 1FVQA 3FRYA 4F4WA 1Q53A 5E3CA 1KWMA 1U8SA 1YLXA 3L7PA 2C2NA 2UUBF 3SCLE 3M32A 1Q79A 2QA4S 2KT2A 1KFSA 4QIWD 2MZSA 4ZK7M 1UJ6A 2C3PA 1NSPA 2IM1A 2Y1JA 4DL0C 3CD0A 4DMZA 4M95A 5D0HA 1WHVA 4QIGA 3LALA 1MU2A 3HM9A 2NR0A 3HFKA 3ULHA 2ROEA 1OMSA 2H4YB 1RADB 2NZCA 3HLUA 4QR1A 5HVFA 2J6SA 1BQXA 2KG1A 4P9SA 2BX6A 2IBKA 1Q5YA 4OYMA 4CT8A 3QSYB 2MLXA 1WHXA 3HXMA 2BE2A 2HURA 4JB8B 3M8ZA 1S72S 1F5CA 4NLQA 2HRYA 3T5HA 4WZQA 3MFIA 4ES2A 2ZBQA 4G6VB 3L9ZA 2C2EA 5D0RA 4OYZA 1XMQF 4K5SA 3G82A 2DNGA 3N6LA 3V81B 2L41A 1IKYB 4PAAA 1HPZB 1SC3B 3QATA 1NMEB 1TL1A 1WKKA 1K44A 3PKYA 2J7UA 3BKFA 1ZM3A 2JSXA 3HT0A 3AQPA 3QRPA 2HFUA 4URSA 3IR7B 4ILLA 5KFSA 3LQVA 5K20B 3BYPA 3QPIA 2XS2A 5D6GA 3I9V9 4Y2IA 2UXBJ 4DQIA 3DGVA 1O5JA 1QSLA 3C15A 1RJJA 2MY8A 1VQPS 2BOPA 3UWTA 4K7QA 1YKWA 4M94A 1JIHA 3R5BA 5AXNA 4UTGA 4ED3A 2B51A 2MZ1A 3I96A 4TNOA 2LXFA 4IH5A 4DCJB 2IAJA 1I94F 4TLQA 4A8FA 1Z2ZA 2VPWB 4LSLB 1SH0A 2CG8A 5FD1A 2Y0SD 1Q8KA 1U1LA 1U45A 1LW2B 3KK3A 1AROP 2I2YA 2DGSA 3M8QA 3KG4A 4JOUA 1R89A 2CNOB 2N7YA 1IKVA 2M3DA 1RQ0A 1QE1A 4C8LA 4ECRA 5H9FK 3MMAB 1HHQA 1QD1A 3MR6A 4LF1A 3JB9k 5C42A 4J90A 4CT9A 1HNZJ 4NXMF 3HHLB 1IKWB 1PBAA 2VA2A 1AW0A 2AT1B 1SB6A 3Q8VA 2ZJQQ 2C28A 3OFGA 2HRUA 3BO2A 1RT3B 3KLFB 4CYUB 4LFAF 4ZCIA 9RUBA 1C1CA 4R25A 1T9YA 4RWXA 2VPZB 3U7JA 2ZKUA 2LEBA 1NZAA 4YUDA 4WU3A 4U96A 4FNIA 4JV5J 3TAMB 4JI5J 1S97A 2P6TA 1X4DA 4J9KA 1PKUA 3IBWA 1P1TA 4ZPCA 5T14A 3T1HF 5IXUA 2PFFB 3BKTA 4WKYA 1YJUA 5LXRA 3FQLA 5B09A 3RJMB 2E9RX 3LW5C 3G8SA 4UQTA 4OYOA 2K3IA 2XSJA 2NUHA 4PZVA 3EX7B 1RT6B 2W01A 1CULB 1X4BA 5FIIA 3OTEA 1XNQF 5C2GA 3K5NA 1N5SA 5F0WA 1FFGB 4OFZA 1NHKL 1ZETA 1UKUA 1S49A 4QPXA 4RW8A 3KLIB 4CWBA 3LTOA 1G6BA 2YNFB 1U2CA 1X4HA 1YRXA 2CQ4A 1JLAA 3KLEB 5DQIA 4RUHA 4UOGA 2AYGA 2OH2A 1APSA 3PW4A 1I3OB 2ZOGA 3SDEA 4CO0A 3GV8B 1IWGA 4K4UA 2FVCA 1DY3A 3PEHA 4U9RA 4QU6A 4WFAQ 5B0DA 4YHHF 2QYGA 3W2WA 4I69A 3GILA 4P52A 4OHYA 3GPAA 1TKZB 4CTAA 2O67A 1XBWA 1H3DA 4ZP7A 1F3FA 2FJEB 1RAOA 1C0TB 4FYYB 3RRHA 2EK1A 1SH2A 5LMNJ 2ZWOA 1KBRA 4LF7J 1JLCB 3BSNA 4JUZA 5L1JA 2ASLA 1HMVB 2R8IA 2GJIA 4DV1F 2PGCA 1WSVA 2JJ4D 4PG4A 5ETVA 5A2QU 3CC4S 4RLEA 1RTJB 1EB0A 3EGNA 3T1AA 5C24A 5KT6A 3IRXA 3RUBL 1RT5B 4GC7A 1NK8A 2HWHA 3PFOA 5DJBA 2IJNA 4NRTA 3CCVS 1HKAA 1X4EA 4DPWA 2IC3B 2FD2A 3HF5A 1UJ5A 3HDSA 3MUMP 3K59A 4ANEA 4NCGB 1NAQA 6FDRA 2XZWA 4FF4A 4CIOA 1XC9A 5DQHA 5BYRA 3MM7B 5DQGA 4DV5J 2CPXA 2VDIA 2QC3A 3HPOA 1NJYA 3SCKE 4EWTA 2Z2LA 1FRJA 3JTOA 3UDCA 1RDRA 2UUWA 4MKAA 1YBUA 2A6MA 3M6VA 4DF4A 2CQ1A 1S0VA 1SCJB 4USUA 4QCLA 1YQHA 2DR6A 3DM2B 2F4VF 3FUYA 2GZOA 3AH6A 2J7KA 2MQ8A 1Q7YT 2IRUA 1VRTA 2OPPA 3HKWA 1V9OA 1JLQB 5IWAJ 2V0NA 3KHHA 3THPA 1NK9A 4LRDA 3QO9B 2EFVA 3HKZD 1U6ZA 3E01A 2DXDA 1QAYA 5KTQA 1EETB 2NCKL 3C8YA 1TUGB 4MKVA 2VQEF 2FJWA 4EU0A 1H7WA 2G0CA 4JI8F 3GYXB 4CO4A 3PYDA 2CDQA 1M5HA 5LXYA 3KK2B 1R3NA 1WACA 1UMJA 2WVCA 1NZ8A 2DEIA 1D8ZA 2L9WA 3IBFB 3DMJB 1FJGJ 1J5OB 4MIWA 4C8YA 1CJUB 4JI2F 2WZ1A 1ZM9A 2KHCA 3E2EA 4OLOA 2VFSA 3D2WA 5ETNA 1L3UA 3OQ2A 7AT1B 1KOOA 1IBLF 2IM3A 1MMNA 2YH0A 1W25A 3UW1A 5CABA 2H9ZA 3AAWB 2J6TA 4NLDA 5A0YA 5H9EK 3TZZA 3NXZA 1VJQA 1S99A 1RI7A 1AZSB 3DRXA 1Z4UA 3T5KA 5GADU 1QTNB 2W7PA 5JVHQ 3VWSA 4UY85 4ECQA 1S1UB 4FXDA 4RW4A 1UJ4A 4AL5A 2AJFE 1NB7A 2RQMA 4WU2A 3UCZP 3W64A 1Q95G 3T3FA 1NUEA 2KL8A 4WZMA 1U1OA 3OXGA 2G2ZA 4PQAA 4FYDA 3DHXA 1BQMB 4Y3CA 5KG3A 1FKOB 3I4HX 4DFPA 3QT7A 2RU3A 4U67Q 1RTHB 2LCWA 4WP9A 1S9GA 2FJBB 5DG7A 4LT6A 2VPXB 2ERRA 5L1IA 1T3OA 3U27A 5LOQA 3M9NB 2W2QP 1HQ2A 1NHUA 5LJ3Y 1NK4A 1JQGA 4OZJA 3MM8A 5HVHA 4N8OA 2QEXS 4TY8A 1A6LA 1PYSB 4NCBA 2E66A 2DT9A 2V94A 3UD4P 2KHDA 1TKTA 4C3LA 4ECZA 3CF5Q 3C14B 2EFGA 1RA6A 3CDEA 2A18A 2JFDA 3D67A 2HFSA 2Y0BB 3JQMA 2PO4A 2KI2A 1S6PB 2CQDA 2NXNA 4KO0B 4ZCMA 4A8QA 2DCLA 3TEHB 1XNRJ 3DRSB 1HYSA 3ICLA 2J9DE 2J0WA 4USVA 3HVAA 4X4QA 4DBQA 3M9OB 2MXYA 1HQEA 1JLBB 1RT1A 2BMBA 2QL9B 2OEJA 1U1NA 3VVUA 2IPOB 3F44A 3GCXP 1JK9B 4LR9A 2BJ9A 2YX7A 4CLTA 4Z7YA 4Q2LA 3MGJA 2WHOA 3JSMA 2PMWA 1REVA 1DFDA 3JTNA 1UW4A 1T05B 2YVSA 4J9NA 2H54B 3QLHB 3R5GA 1KDNA 5IT9U 2YKMB 2ZH8A 3QSIA 1XMBA 4OL8A 3G71S 4PYAA 3ZZTA 2UXDJ 1QVFR 2XZTB 2YNGA 1GQEA 2B9XA 4DL4A 3PFEA 1PC5A 5HJXA 1QAJA 2BZ2A 4FDFA 3DLLQ 2MGZB 3TX8A 2FHOB 4LSNB 4L76A 1NJIT 1AFJA 3NAIA 3FVYA 1B64A 1X5PA 4JI3F 2VOOA 3R7BB 5L9NA 8ATCB 3DKDA 4OZLA 1FFSB 5LM7E 4WXOA 4O3QA 5HL7Q 1VIOA 4YEAA 3EMTA 4HT7A 4RBUA 4LSLA 4KGVB 2W9AA 1H38A 2J5AA 3DGPB 4RW6B 3RTVA 1HBOA 4B9UA 2HBQB 1TFWA 3V4IB 1WC5A 4B9LA 3OD2A 4WTYA 1TFYA 3TJ8A 3ET6B 1N54B 3H2VE 5CYQB 2X1GA 4TU8A 2VQFJ 3CNQP 1P27B 4H4KC 3O1LA 3H42A 1HNIA 2QLXA 4ED7A 2FHJD 1ELOA 3CXCR 2ZHBA 2BKOA 3FQKA 1RUSA 2XNRA 3NL0A 2BM0A 3FJ2A 4O3NA 3CMAS 3TI0A 4DZ6A 3HHKA 3VGSA 2AKWB 3QFHA 1CJKB 1VBZA 2VFVA 2RQCA 3N6NA 5D4OA 1UFWA 3IS9B 1YJVA 3CT9A 3PACA 3UCUP 2ZUAA 1SH3A 3EDQB 4TVAB 2XYPB 4ELUA 2BE7D 1HHTP 2FZGB 1TELA 3CB4A 5KFDA 1FJ7A 3TA1A 2ATCB 1LNQA 1YJ7A 1EAYC 3H0PA 1U1RA 1J27A 1UPPA 3L7OA 1IKXB 3AB4B 1LK5A 3OLBA 4IG0A 2B5JB 4O3OA 4ILMA 1A0OB 1LW0B 1FDNA 3GB0A 2K8GA 4X84A 2XG8A 2AJQA 2F65A 4N41A 2V67A 4OHXA 2Q6CA 4PR6A 1TAUA 3PTWA 2C2MB 4C11A 3Q8PB 2E7VA 3LA0A 3K0JA 3FFIA 1S6QA 3MPVA 5AE2A 3HHLC 1S1TB 4IOAQ 3AA8A 3RB0A 1U1MA 2UXBF 1RYSA 4EZ6A 4K8RA 1Y0HA 2ABYA 1AT1B 2DRAA 1RWNB 2WB1D 2WSFC 5HI7A 3TR5A 4ZCLA 3D4JA 4BS2A 2UUAF 2VBXA 4RWWA 4DL6A 2V9WA 1SL2A 1B99A 2R4FA 3QT5A 2M7SA 1TUWA 3UVJA 3D0IE 2H48B 3GTYX 2IM2A 4ZN3A 1U0SA 4B9TA 2EC2A 2XLKA 3GG1A 2HS0A 4HLBA 4ID5A 2GA7A 3OVBA 4ZPTR 1VRUA 1JLCA 1VI7A 4QQBA 3WHIA 2FC9A 1C2PA 1RT4B 2XMWA 2D9PA 1REGX 4DS4A 2KM8B 2X1FA 1RT5A 3DXBA 2VKZG 1XR6A 4KH1B 3D5MA 3UCGA 3VZHA 2FQQB 4L73A 5IFMA 2CZ9A 4QYRA 3LPEA 5ETMA 3IR6B 4OQJA 1M5KC 1U6BA 4Y34A 4B3RJ 2XLJA 1JXLA 4NCGA 2YWEA 4X4RA 3AY0A 4ED6A 2MMYA 4Q44A 3PDNA 1HQUA 2Z2MA 4TU9A 5IT0A 3JYTB 3PY8A 1HR0F 4ZVPB 4FF2A 3EZOA 3CCMS 3MM7A 4WFXA 4JV5F 4GKJF 4QPTA 3CCJS 4JI1J 2P8IA 3I4PA 4ZKAA 3CC7S 2GO8A 2ADCA 2QFJA 5CZXA 2U2FA 1JJ4A 1H73A 4NLTA 5E3PA 5KFPA 3NGTA 5HP1A 5CYMA 6AT1B 2AJ0A 3ETOA 2ZITA 3K2YA 4DQQA 4P2SA 2CQPA 2EWHA 1NU4A 4DV3J 2YKPA 5IQQA 1OYDA 4Y0FA 2DGXA 2ZDOA 2ASDA 2W9BA 3DDIA 3OTOJ 4USIA 1B0VA 2BV3A 3Q8RB 2ZD1A 2HS4A 2NXUA 3UO0A 4K2XA 3SV3A 3BBCA 3RBXA 3BQ2A 5HQMA 1RU1A 1MMDA 4X4OA 3NCQA 3J81U 4BDPA 4CLFA 3KJQB 4QJVA 2NYHA 2HFOA 4WE1A 2DO4A 4ZOSA 3VAMA 3G4SS 4C6AA 4FYWB 3SQGB 5KFBA 1ZPVA 4CLPA 2CNNB 2HEKA 2JHEA 3QGIA 4FF1A 3R7NB 2MPUA 4ZVQB 2AGQA 1RTDB 3D54A 2O3DA 2XHCA 2IYIA 4I0WA 5K8MA 1DURA 4K4YA 1NLKL 4DR6J 3IXQA 1YJRA 4UT4A 1UA1A 4DSLA 3U1MA 3VCDA 1J5OA 2HZVA 3GV7B 2MLZA 2GQ2A 4OYAA 2QFIA 3HVTA 1EJ7L 3OBIA 1OPZA 3QWPA 4P74A 4NLOA 3TAPA 3NAHA 1XR7A 3Q89A 1MW7A 4DPUA 1HI8A 3AD8C 5DDPC 4P2FA 1BLUA 2CWKA 2XM3A 5E7OB 3V4MA 2EK6A 2Y1RI 5J2PA 3KHLA 2HHQA 4C7QA 1F6TA 2KO1A 3GYNA 3PX4A 3ILIA 1NPKA 1FRIA 3GV5B 4AL6A 3B82A 1F5BA 2MHNA 2OKQA 5CD4H 4C8KA 1K0TA 4IR9A 2V50A 1TVRB 3S7RA 4B3MJ 1RAAB 3EUNA 3PRVA 5KFYA 2BUNA 1R31A 1Q16B 2C3OA 1TMJA 4YY3J 2LMIA 3OR1B 3CO9A 2NREA 2CYYA 5GADI 2Q79A 2ZJPQ 4DV5F 2ZKTA 1RTHA 5ETLA 2DHXA 5BR8J 1JLFA 3H59A 1C0UB 4KV8B 1WHWA 3M9MB 2DNPA 3H5SA 3I9ZA 2V4JA 1PIEA 2QZ8A 2CJYB 1HWLA 2CQ3A 3CVKA 1TP7A 3H8YA 2KJVA 4DQRA 3MM9B 3GR0A 3H4DA 3HZEA 1R8PA 3EXYA 3RW6A 3GSDA 3HHDA 1V6HA 4JI7J 3EWGA 4AFFA 5IWAF 2FY1A 3CJKA 3ZC4A 2B7BB 3I0SA 2XYHB 4FVMA 2K1RA 1IR1A 2YPYA 1BQNA 3C14A 1KQKA 4IQXA 3MM6A 3THTA 2PD1A 2GCFA 1RCXB 1T94A 4OHZA 2X3GA 4DV4J 4KO0A 3RBEA 3HD1A 3T6JA 1Y9OA 4WCEQ 1NDKA 2KZZA 3DRSA 5U47A 4ECTA 4ECWA 2NXEA 2IVFB 2ASJA 3BO4A 1RZMA 1WNEA 2B6AB 4B9MA 3TO8A 1FJGF 1VK8A 1CJVB 3PJXA 4AUKA 4EO8A 1RT7A 1TQLA 4EYHB 2Q6BA 4J9MA 2OO4A 3OL8A 1TK8A 3WC0A 3D1QA 3OTDA 2PC6A 2QMUB 1WOOA 3R8YA 2XZDB 1WG1A 4O0IA 3MAAB 4DFKA 5HJYA 4DF8A 1WTFA 4NMLA 5DG9A 4I56A 4PG5A 4KHRA 5MLCV 4A4JA 3W61A 3N6MA 4R8UA 3MMJA 3AJ1A 1T3NA 1SJ1A 2PDAA 1R0CB 3ADAC 3GP9A 1B4SA 5KG4A 3RG6A 2VD3A 4ZP8A 2MGZA 4KJIA 3A8EA 1SJFA 4DL5A 2B9WA 1VQYA 2M88A 3BDPA 3ZTOA 2ZVIA 4F50A 4NLXA 1WC4A 3SCIE 4DG1B 2GJFA 3JAMU 4XDDA 4DUYF 2HQFA 2RF2B 2Y3YA 5M2UA 1K1SA 3GIRA 1UCNA 2PI5A 4QU7A 4DV7J 4NEZA 3V6KA 3MCOA 4O4GA 4TYBA 1KRPA 1YIJS 2ATLA 2G0JA 3V4IA 3GJQB 3G8QA 5I3UA 1HBMA 3TZXA 4ZJLA 5SUHA 1E6YA 4NPOA 5ETQA 1L5UA 5D78A 2XY6A 4QR0A 5CCLA 4OX7A 4WFBQ 3ZO7A 3AFGA 3P6YC 3PCOB 4U6PA 2R7SA 5IC4B 3I55S 3I82A 4MYUA 1GX5A 3W5XA 5HMWA 1OY9A 1F1BB 2MYFA 2VL1A 4IDKB 1CJKA 2C2KB 3ENAA 1U49A 3J7YU 3QGPA 5C25B 4UW2A 2UV8G 3FDSA 2JLEA 2R42A 1XK8A 5K9FA 1KEKA 3V2UC 4DS5A 1LEOA 1TL5A 3DLJA 4DR3F 2CPDA 4W90B 4XPCA 3VAIA 4GMKA 4N56A 5JXSA 5F8GA 2ZWPA 1LW0A 1U4BA 2AP6A 2ZE2A 2F4FA 4IUFA 4U95A 3UI3A 5HO4A 1I1GA 2W4DA 2AMCB 1N5QA 4B3TJ 1G7CB 1WDTA 5CH7B 3I5CA 1V5IB 2VC1A 3KHGA 3BF4A 5KFLA 3TW0A 3HHLD 2RRAA 5IZHA 2FGCA 1L3SA 2B8QA 1ACMB 2UU9J 5GAGU 3C66A 2HAFA 1T02A 1LWEA 3Q86A 3JTPA 2GIRA 1KQFB 2AEFA 3NRBA 2N3LA 3TYTA 4I6AA 1HNVB 3DOMA 4DOZA 2NLWA 2DVIA 3DDNA 1ZM4A 3W2VB 2ZZTA 3NGRA 4EBDA 3ZNUA 3HD2A 1S1VB 1UVIA 3NP5A 2RHQB 1QDUB 2EXUA 3QT8A 2R2SA 4FBUA 2EW9A 4AQYJ 3G96A 5DLGA 1XQIA 2VDHA 3BR9A 3S8SA 2W24A 1HI0P 5A8WA 3KG0A 3GONA 2VFUA 5J2QA 4WPAA 3W66A 2KFYA 4QWDA 3NGUA 3BB5A 1HNWJ 3R27A 1BMQB 4U7CA 1GMUA 4U8VA 4IH6A 4H4KA 5SZTA 1GXUA 4PEOA 1PGZA 3BZQA 1EZZB 3OR2A 1WUUA 2QIFA 4MK8A 3K89A 3J80Y 5HAOA 4DR4J 3VALA 2FUG9 1JJHA 3EVMA 2VKRA 1C1BB 4FPRA 1RA7A 1WF2A 1ZPWX 3BPSP 3NGKA 2HVHA 4OZ0A 2C2RA 4C3MA 1RWMB 2JFKA 3LH2S 5KFAA 4J9PA 4QR2A 1SBRA 3EPIA 5ITHA 4B9VA 4M5DB 1VQ5S 1TL7A 4ECVA 1X4CA 3MEKA 3OUYA 4L3KA 1OSDA 3MOZA 3DRPB 4C8MA 4IFVB 3CMQA 4Z2XA 4Q7AA 4TN2A 2I38A 2W2NP 1RWWB 2YQ3A 3CDUA 3Q2SC 4CNYA 2AGPA 4DLEA 3DRRB 2XMAA 1FEHA 2R7VA 1T7PA 5EX0A 4CDIA 1FI4A 2YX1A 3TARA 3PZPA 1HBNB 1EX8A 1ZOTA 4M5GA 2DHHA 3M6UA 3A8KA 3G6YA 1HFEL 3CJ4A 3V6JA 2VV5A 2VG5A 2AJ2A 3MAQA 4K5RA 1B7YB 3M32B 1RSCA 1I6JA 1X5SA 2AU0A 4P7VA 4J7CA 2GIFA 2ADBA 1RTDA 4LFAJ 5KG1A 1A7GE 3J7ZT 2YNHA 2I0XA 5E2QA 2E5IA 1RHMB 1M1KT 2OPQA 1MU2B 2FPHX 1UVNA 2RKIA 2Z2ZA 3KUEA 1FEEA 3M6WA 1BWVA 2ZZMA 3R2CJ 3PRBA 1FKAF 1CQMA 3LPYA 5A8KA 1N5VA 4IR1A 3OVSA 3CJRA 1GMVA 1WD6A 1URNA 1GMWA 4MYTA 2BE2B 4I1TA 3P45B 5KT7A 3T1HJ 1SI9A 2QJ3A 1NHVA 4FKYA 4N77A 2ASYA 3TAQA 4IKAA 4Y2CA 3G82B 3R2DJ 2NZ4A 3DOLA 3UQSA 3MM5B 3OTBA 3PJ9A 3UD3P 3C6TA 4K59A 3KG1A 3L4BC 2Y8YA 1T11A 4CP5A 1XNQJ 1TL1B 4OZ1A 1K73T 2G2YA 3LANA 1SJRA 1SV5A 2EFOA 3F41A 1NBEB 3CCES 4WK1A 4B3RF 1SC1B 4USMA 2DGUA 5E5NA 1U7LA 2VU5A 1DJ0A 1WG4A 3U1NA 5B0AA 2ALYB 1H98A 4FYVB 4ZVTB 1PG5B 4NE9C 4JI1F 1CC7A 1N36J 5KFJA 2U1AA 5D77A 3KMSA 1FJCA 1UAWA 3K5MA 4F7VA 1RAFB 2IAJB 4ECSA 1WI8A 4YHHJ 2HFVA 3O5TB 3KHRA 5GMKa 3G86A 4QIVA 2EFPA 2GVDA 1BD6A 3GG0A 2XMTA 2R2TA 3JXOA 2DH8A 3GE9A 2BKNA 2CVEA 4DL7A 4DL3A 1S4EA 3M8QB 1K8AT 4CLKA 3QZ8A 1IKVB 1O6XA 4I2PA 1QE1B 4WIQA 2OD6A 3PKMA 2DD8S 2DGQA 4PG8A 3SV4A 3W62A 2R2RA 3W1YC 4DV1J 1N48A 3PEJA 2Y1LB 3FZBA 4LQ9A 4YR3A 2HYIB 5KFFA 4F25A 5CA5A 1EQMA 1EHWA 2M4MA 2PMZD 5DGAA 2YXLA 3D0HE 3EE3A 5HLFA 1VDHA 2M8DB 2KXNB 2EPIA 3BV8A 3E51A 1C1CB 3K7RA 2B6AA 1Q8IA 1SKUB 1FRKA 1JLGA 2XQCA 2AV5A 2F1FA 1CJVA 3SIPB 1TKXB 3KJVA 2OMLA 1XJWB 2X51A 1IBCB 4KHPJ 5F9NA 5KFQA 3F56A 1S79A 4C0BA 2KTQA 1BGXT 1SUQA 1RAIB 4P6QA 1T95A 3BGRA 4F04B 1R0AB 2ZH2A 5KFXA 2E5JA 2XMUA 3M8YA 1NJWA 4PKDB 1RTIA 3KXDA 2CQIA 4DZDA 5ETOA 1N5TA 2HKEA 5D8HB 1SIZA 4OJHA 4N76A 3MD1A 3M8PB 2H4WB 2H5JB 5ETSA 2DHAA 1N0VC 1LXNA 1FFWB 3IAS9 2R7QA 3M1VA 3PIOQ 2DGWA 1XEZA 1YZ7A 4RW8B 2AGOA 3S1TA 1WSRA 1B3TA 2J9DA 1EARA 2IDLA 2RH3A 2JZ5A 3RB4A 1J5EJ 4FNHA 3FMWA 4LR8A 1JLAB 2FJAB 4YY3F 4JI8J 2D74B 3CCRS 2RF2A 2FDNA 3CCUS 1KOHA 3H98A 5ETKA 2G1DA 4UUXA 5F9LA 4R0JA 2FJXA 3SDEB 2HBZB 1AYEA 3M2RA 2RDIA 1WEYA 1C4CA 4KT0C 2DNHA 2ZHAA 3M2UA 5DLFA 2ZZNA 3D6FB 2Y9HA 2Z57B 4AYBD 2GAGC 3THVA 4CTAB 4DFMA 1HW8A 3D6TB 2V68A 2EG1A 2FVPA 5THWA 4F4AA 3ZXWA 2YPZA 4DPOA 2OPSA 1IBLJ 4HI2A 2XGQA 3BGFA 4OYPA 2E5HA 2LXIA 2W2MP 4MMOA 5E33A 4USTA 1WWHA 4F0HA 3EVWA 1RHKB 2QYCA 5D3GA 3MF5A 3HSDA 5BYSA 4MK7A 4USHA 2PT0A 3H2LA 2XMVA 4LMZA 1N88A 5C24B 3VGUA 3IRXB 1ZTWA 2R7XA 5C25A 4DV4F 5CCMA 1F9FA 4RZRA 1X60A 4V19J 5L1KA 2HGLA 3IWXA 3GFHA 1OQ3A 2DY1A 2R8KA 3FBCA 2HHSA 2GHPA 3FC9A 4A8MP 2LA6A 3T5JA 4DQPA 3UNYA 2PFDA 4Y2MA 2Q1LA 2MZJA 4HH0A 2ZDPA 2CVIA 1X9SA 4C8NA 4B3SF 3I5BA 2HIYA 1VS3A 2YWFA 3AD7C 4G3IA 1QSYA 4W4MA 3PO4A 2DIVA 5LSOA 1UWAA 1JNZB 3G6VA 5I42B 1FA0A 5AT1B 2RRNA 2J76E 1KVJA 4RNHA 1FHTA 2DBBA 1TAQA 2GC8A 2FYXA 1V5VA 2BANB 1VRTB 1SQEA 4JP8A 1F9EB 2OPPB 1FTRA 3U02A 4XDCA 2X7IA 4TY9A 3DOKA 2OD4A 4Q8EA 2BW7A 1HNVA 2ZBIA 2XY7A 5F8LA 4DSKA 5GMEA 3NS5A 4OZ5A 2CPYA 5GVQA 3TANA 4HKQA 1IM4A 1TKDA 4K0KF 3W9IA 1QAIA 2HK2A 1D1UA 5GAGI 4DXLA 3G87A 1Q86T 1CQNA 2FIUA 3A1YG 1D09B 4CLLA 3MUTP 4DV7F 4RW9A 4FVCA 3KUGA 2JC0A 3GJRB 1SJ4P 1R6YA 2NXCA 2XMJA 2VH7A 2UUTA 1FXLA 1XN9A 2F3JA 4PG6A 3QAEA 2DNLA 2OSQA 1XERA 4ZPVR 4QYZJ 4NZ0A 4G65A 1N56A 4RUCA 5DDQC 4ZIWA 4HEA9 5A0YB 3QYYA 3CJQA 4LVNP 4ZA1A 1C1BA 4MK9A 1HWUA 4WF9Q 3A4TA 4WFNQ 3OSNA 2WVFA 1U02A 4PWDB 3I56S 2V6AA 3JQJA 1RWVB 2DR5A 3B4DA 3DLKA 1VYAA 2AJ4A 3JS9A 2CJBA 3T41A 1FNOA 4JV0A 5IQ6A 3KLGA 1SQGA 2D7SA 2HMIA 1FRMA 4I2QA 3BH7B 3L7UA 2BYCA 2VICA 2QN6B 3QGGA 2DNNA 1RHJB 2B7CB 1S9GB 4RR5A 1KS2A 1KNZA 1RLCL 2CQGA 1GXTA 4C8OA 2N4DA 4B3TF 1C4AA 4NLGA 3H7HB 1BXNA 4YB5A 4KE5A 2M5YA 2B43A 4DFJA 4D3GA 3NGSA 4ZP6A 3MM8B 1WDDA 1MNEA 5D15A 1BY9A 4TY8B 4ZIVA 2UU9F 3PV8A 5IM0A 1TK5A 5E3QA 4F3OA 2XI3A 3CIMA 1X7VA 1VQOS 2FLLA 3JSYA 4ZVFA 2OP5A 1TKTB 3FSXA 2KU7A 4LRCA 5DGBA 3RRGA 1ZZNA 3DC2A 5AJ3J 5FLXU 4HHUA 4CM2A 1ZH5A 4OZNA 3KLHB 3SI8A 3ZTQA 2CAJA 4AQYF 1HYSB 3VAKA 2DH7A 2VODA 5K14A 2JLFA 1HQEB 1RT1B 1NCLA 1F0XA 4PCQA 3AHPA 2JC1A 2MHEA 2DIUA 2BRKA 2D69A 3MM5A 3W9JA 2YNIA 2BDPA 1J2VA 3SQOP 3JSMB 3I6PA 1REVB 5A8RA 1GX6A 5KFWA 1HNWF 4UOFA 4YB1P 3DHWC 2G4BA 3QT6A 2E5GA 2FC8A 3MR7A 4WTOB 4LIWA 4LBPA 3NEKA 2GMHA 1HBUA 4DR4F 1CBKA 3IGNA 1R0BG 3O3LA 3NS6A 5KFTA 4Q5VA 2YNGB 5KFEA 1OIAA 2BR0A 2AZ3A 2P5VA 1SJ3P 4JBCA 2YWHA 2QMXA 1WC6A 3J81j 1E6VA 3Q23A 4OYIA 3OFHA 3HZGA 3BDEA 3RR7A 2UUAJ 5FLXY 4QW9A 3C6UA 3SYZA 4Q0BA 3JSRA 4DDFA 3WQPA 2P6SA 2YTCA 3KOAA 2ZOFA 3LAKA 4FS1A 5KFIA 4YN3B 1KR4A 3ZZOA 5K5MA 3SCJE 4DLGA 2KH9A 3EM1A 4X2BA 1H2TZ 3SFGA 3TQEA 2LECA 1K0VA 1HBOB 4GVLA 5KG2A 2LDIA 1GTEA 1UFLA 3NOCA 3WIUA 1KFDA 3DCAA 3WIVA 5J2NA 1HWIA 3M8SA 5ADZA 4G1IA 4FN5A 3EYZA 5G4DA 1CSJA 4OJ3A 2UXCF 3IWLA 2FVQA 1GK8A 1HNIB 4BWMA 4M5NA 1FTCA 3RBZA 1VQ7S 2V8GA 5D0GA 2RILA 1P9QC 2ZH6A 1N8RT 5L9XA 2NPFA 2DXEA 4DX6A 1O8BA 1HW9A 2D3UA 2ZM6F 4TKTA 2QO3A 1TKXA 1HR0J 2PMHA 2RUGA 3TZWA 4GKJJ 4DX7A 3N28A 4AXIA 3W3SA 5BXIA 1TV6A 4NYOA 2Z4PA 5B0FA 2FZKB 2D3OR 1S48A 1KTVA 2JEGA 1KQSR 2MKSA 3SFUA 3X3UA 1R0AA 4RUBA 4C9DA 5K8OA 3OV7A 2O66A 3RAQA 4IG0B 4DSIA 4DUZJ 4DV0F 2XNQA 2GGPA 4RW7B 4CLZA 4EBEA 1FRHA 4O3PA 1CEZA 3M8PA 2DNQA 4X65J 4NA3A 4PPZA 1Q81T 3OW2R 3ITHA 2MZTA 4O3RA 2QLJB 4C11B 2DPJA 4USWA 5IOLA 2L9NA 2DGTA 4GRSA 3CEDA 2CWXA 3KLVA 1CLFA 3FFIB 1S6QB 2HNYA 5J1PA 2AZ1A 3TQ1A 3IN5A 4P72A 2A10A 5A6WA 3KKFA 3H40A 2FLPA 1G2EA 4WFZA 1WHYA 2E9ZA 1NPRA 3CJSA 3D68A 3HFVA 1DRZA 2W9CA 1W2IA 1N36F 2GQQA 2HZCA 1LWFB 4ZLPA 5F0UA 2R7WA 4DCOB 5C2CA 4KGMA 3KK1B 3UVJB 3ZZRA 3MR3A 3ZZUA 4HHJA 2K06A 2IHR1 4I4BA 3FEXB 3POTB 3AA9A 4RU2A 3I32A 4PPDA 2FVSA 1VHFA 1UVKA 3M7VA 4NLYA 1QUVA 3BN7A 2ALZA 4ID5B 4K50A 3FNNA 1ZAWA 2WK4A 1VRUB 4WWSA 1WF0A 4LJMA 1N5YA 1Z2LA 2ZOMA 1WELA 1SKWA 3HVWA 4F26A 4WBFA 2UVUA 2BM1A 4LF6J 3IM9A 3VF0B 1U25A 3HSZA 5B0BA 4LR7A 2LP4A 5M2RA 3HMJG 2VJVA 2Z58B 4KRWA 1D9DA 2LFVA 3J7Z5 4HACA 3H2UB 4K4TA 3HHNB 1HQUB 3ZZ0A 1R43A 3WX4A 1S10A 4KIAA 2DNYA 4EI2A 4TQRA 4HT5A 4KHPF 3D6MB 3GCWP 4LF5J 3FK4A 2VG7B 3MPUB 2IJFA 1HHSA 2C1EB 3PVXA 3G2XA 2E7XA 4KKOB 2HNZB 3QRQA 1YJTA 2IYGA 4C98A 1RHQB 1PBUA 5HP1B 5CYMB 2Z2YB 4ZLNA 2QL7B 4ERDA 4QWBA 4J9QA 4Y2AA 5I42A 1N6QA 3L3CA 3LP2A 4E2FB 2BANA 2W9BB 3OFFA 5A2QY 2RU9A 2RNEA 2C3YA 5KFRA 5KFOA 2ZD1B 1UW9A 2APOA 4P73A 1KQGB 2CPHA 3UN5A 3SMZA 5J1EA 3EXCX 4XAKA 2V4QA 3FBEA 1LFPA 4OX9J 4WE1B 2FJVA 2L3MA 1J5EF 5E3RA 3IR5B 3FSYA 1MWYA 4KYZA 2F8EX 2UUCJ 5ETTA 3GFXA 2J0QD 4GO7X 1VQNS 2CUYA 2H5IB 3IO1A 2I5JA 4XO0A 4LSZB 2GX8A 1UZHA 1NM2A 4EFAC 2DHGA 4AL7A 2AEJA 5BJRA 3HVTB 1OY8A 2MTLA 3UPFA 3W8GA 4CLUA 4OJGA 4B3OA 3HO1A 1NSQA 5EWFA 4NLSA 4Q43A 2ILZA 1VQMS 1TR0A 5BYQA 2BXJA 1HNXF 2EBGA 1WJ9A 4BWJA 2AIRB 1JMTA 4NX9A 3CSKA 1NJXA 5IV4A 1R27B 3MD3A 4Y6IA 5B0EA 5J2PB 2Y1IA 5CZVA 3LGHA 4JYAF 2GIQA 2MQQA 2KRBA 1X4FA 1GTHA 4DPTA 2IVMA 4PWDA 1JB0C 1IBMF 3Q8YA 4A47A 3HFZB 3PR5B 1MROA 2ZHOA 3GSIA 2ZH1A 4C0OC 5EUHA 4DUYJ 4DQSA 5HROA 2JLGA 4IH7A 2V34A 1N33F 4R0EA 1JLFB 4BC7A 1U47A 5LJ5Y 2W25A 4DU7A 3QWUA 2ZFHA 3SEOA 1TK0A 4J37A 2QA2A 5GAEU 2V4JB 4ZPWR 2E9TA 3H25A 3QGHA 5KG6A 4DSEA 1U2RA 4X64F 5KFUA 2P2CB 1TL3A 4KSEB 1F5AA 1KP6A 5CYJA 2GW8A 1U8WA 1X4AA 2OUGA 3D0GE 2JWNA 4FXVA 3CJKB 1YG0A 2IA6A 2AD9A 2RUSA 1FERA 3I0SB 2K1RB 3VV2B 1BQNB 2KVIA 3MM6B 2K2PA 1V3RA 4RKUC 5EGYA 4RNMA 4LF2A 3K5OA 2AX0A 4CI0B 3SSQA 2WAQD 2LKZA 3H90A 3KLHA 1RBOB 3OFEA 1MG7A 3SSSA 4U7UK 2WTFA 1MN7A 2XULA 2VBWA 3U1LA 4DV2F 2F8HA 2GVZA 2HNDB 3VQSA 4DR3J 4LF9J 4DU8A 1RT7B 1VR6A 4KC5A 3B6BA 2X1AA 1R8CA 1EP4A 3MEGA 1L3VA 3QIPA 2OFHX 1RE1B 1Q7LB 1RT2B 4Q45A 4PWUA 4USJC 1H7XA 4MIAA 1V3SA 5I3PA 3DYAA 4R8UB 2LEPA 4LFCF 3DDKA 2AYMA 1Q5VA 4H4MA 1U26A 3ZZPA 3IM8A 4AD6A 4C97A 1RCOB 3OJUA 2V2VA 3OT9A 2N4CA 2GHVC 1M1HA 5E0OA 2BJ3A 2LVWA 3HJVA 4NLVA 1Y4ZB 3KFWX 2R8HA 5KFMA 4UZBA 5KFGA 1H0HB 1X0PA 3D66A 4DHVA 1HARA 3CIZA 3GU0A 2XI2A 1RWXB 2DISA 3GIMA 1FK9A 4O4GB 4PWWA 5I3UB 1F2GA 1HBMB 2MB0B 2IMWP 3EGVA 4ZN1A 1Y11A 3TA2A 1E6YB 4F4ZA 3BYRA 2B0GA 2CQCA 4LBHA 1L3TA 4A46A 1N0UA 5IT9Y 4KTQA 4HTJA 3ETMA 5JUMA 2HGNA 1UWBA 1AFIA 1AXQA 3NGDA 4Z7CA 4F4YA 2JH3A 4KB7A 1R8HA 3BGLA 1O51A 1XTZA 2LDYA 3BSAA 2HVZA 3H5UA 1DQAA 5JMNA 4XIUA 2OTJS 2PSZA 2DRBA 3VGTA 3VAHA 2FLOA 3IBCB 1BWEA 3TJAA 2G9OA 4B02A 2LQ8A 5AJ3F 3MTJA 2AJ1A 2E1AA 2YWKA 5F41A 3X1LB 1NKEA 3PW0A 4NI2A 2P9EA 3TVZA 2R9LA 4ECXA 2IM0A 4FPIA 1GAOA 2RAQA 3US5A 3DLBA 3D7SB 4RW7A 2RQ4A 2ZE2B 2J8SA 2FVRA 1RBLA 2QA4G 2QSFA 3BSOA 3L09A 4YOEA 3GIKA 4X4UA 3VZIA 3KMQA 2XTJP 3NNAA 1NK5A 3T1YJ 3P5TL 4YP3A 2O1PA 4Q8FA 1LWEB 1U09A 4LVOP 3FZ2A 4ZMMA 1YJ9S 5M2PA 1VQKS 1UL3A 4EGLA 3NMRA 2RSQA 1WEXA 1U0HA 2B3TB 1VBXA 3FEZA 3PYFA 4FXWA 3DOMB 1Q8LA 2ROPA 2XMMA 5EHHA 2DO0A 1JKHA 1LWFA 3GJTB 4M8LA 3MR2A 3NLCA 2I1RA 3KK1A 1PJ5A 3GJSB 3IA0A 3PHTA 1S1XA 2J0XA 3POTA 3MPYA 2COLA 3I0RA 1S57A 2WBRA 3CWJA 3N9UC 7FDRA 3RRKA 3DRYA 3QZ7A 2XHWA 2YKOA 1UTAA 3BREA 4H4OA 2HWIA 5A8WB 2HG4A 3KNAA 3N01A 2W1BA 3SBMA 5J2QB 2GNKA 5IC6B 4DR7J 3JSBA 1P6TA 3UE2A 1X31C 4I6WA 5JJBA 2R8JA 2KB2A 5L8RC 3JQKA 1VQ9S 1S9EA 3D3CJ 4J9UE 2MKKA 3OR2B 1LFWA 5L1LA 2VASA 2FHJA 2QSWA 2HFZA 1ICEB 4H54A 3P49B 1CJTA 3CJ2A 3A8IA 4MKBA 1PJ7A 2AEMA 4NLRA 3UFCX 4KPCA 1FT8A 3DN9A 4DR2J 1TL7B 2VG7A 3MHYA 2PN6A 3D6HB 5C7PA 4F02A 3OUYB 4KKOA 2HNZA 4KGKA 3K8WA 5T41A 3I5AA 4MFBA 4HI1A 2CJQA 4GKKJ 1S5ZA 2HBRB 4M5JA 4DX5A 5HN0A 3GIIA 4O23A 3O6QA 1LOUA 3TP2A 3FSIA 1N32J 1JLEA 2HQCA 4DUZF 1MWQA 2XO6A 2HK3A 4PXCA 5J2MA 1ZYQA 1ZA1B 4X65F 2DGOA 3IP0A 1IN0A 5HATA 2UVVA 3KTQA 4GVBA 3AODA 5D0EA 1FE0A 1X5TA 1DTQA 4DSJA 3R5CA 1WC1A 4ZLJA 3LP1A 4CLYA 3E8OA 3V6DA 2VG5B 1GNKA 1WEZA 5AXMA 4OI3A 4I68A 2GS8A 1YTYA 4TLRA 2MY7A 4TYAA 3CD6S 3C16B 1VISA 1WF1A 4MTPA 1F9HA 2WVEA 3M30A 1VC6A 3MZIA 4F4XA 2FZCB 3WBZA 4ETXA 4N47A 4I67A 4C8ZA 2BJEA 3OSPA 1PCAA 2L48A 3AJ2A 2YNHB 1ULRA 4HR2A 3DLEA 4ZVEA 2BRLA 2BQUA 3W5ZA 2CPJA 3ZTSA 4DV6F 2OPQB 4ZLLA 3EVOA 1HIYA 2RKIB 1N34J 1RK8A 2R2UA 1FDBA 5A8KB 3B78A 2LQBA 2IRXA 2YKAA 3LP0B 2R8GA 4JV2A 2Z0GA 1S1WA 3AQOA 2DKOB 1MMLA 3K5LA 2XLIA 4A8KA 1VQ6S 3G9CA 5G0RA 3OLAA 4CH1A 4OZ3A 2W2PP 4MAKA 3B54A 1VHIA 4ILRA 3Q0AA 1T9VA 4P71A 2UVRA 1KLMA 3DOLB 1HLWA 2JEFA 3C6TB 1VIXA 3CJ5A 4NA2A 4QW8A 5T7LA 3MMCA 4X62F 1WOPA 4YB7A 2CZVC 4C4WA 1X5OA 3J81Y 2QL5B 4LF6F 1RTZA 4X4VA 5F3TA 4F2RA 4D3HA 4NXNF 1YX2A 1SV5B 4F2SA 4IOBA 4LIRA 3DLGA 5F3ZA 1EKSA 4ICLB 3S01A 1IBKJ 2DXFA 1LK7A 2HBYB 5RUBA 4XPEA 4G1QB 1PAUB 4LF5F 1PILA 3ZNJ1 4QIFA 3VAGA 1ZAVA 3BR8A 4CO2A 4R5PB 3MPDA 1VBYA 4CRJA 4M5KA 3RZAA 2CPEA 2WONA 4YS2A 4O44A 4DR5J 3OVAA 2B4UA 2V2QA 4M63A 2GVDB 1AUDA 2OELA 1LWCA 5DO2A 4IOCQ 3MEDA 1WTBA 4IO1A 2CA9A 4WIIA 3TRGA 2NYIA 4IG3A 5HBMA 2H1YA 5KAKA 4ZDNA 2LU2A 4TQSA 2OIHA 1HA1A 4I2PB 1RGVA 3CCTA 2MKHA 2A0FB 2DYAA 2YBVA 3PHEA 1VRQC 3HSGA 2V2KA 2CADA 4CO5A 5I3QA 3HP6A 5EX3A 5GAEI 1HD1A 2DITA 4OX9F 2J8AA 2EKNA 2E1CA 4F8RA 4Y2KA 3S6EA 4C2MA 3PX0A 2NXJA 2B9EA 4I7FA 1D9FA 2UUCF 1PJ6A 1VLOA 5HLFB 2E44A 5HMZA 1S4FA 2BOAA 3M2VB 3BBFA 1JLGB 1KONA 2MKCA 2F8MA 2HNDA 3BKUA 3D1OA 5D4PA 3KJVB 5L46A 2FHKA 1FWLA 1TUVA 2FB0A 4OX8A 2ZEJA 1ZS6A 5LSRA 4B3SJ 2E1RA 1YRUA 4ELTA 1SUQB 1BHNA 2IFXA 4CM0A 3BGRB 3N0VA 1D9AA 4WKRA 1RT2A 4HVZA 3TUPA 1RTIB 4QWEA 2XCAA 2WVDA 4NYZA 4EZ9A 2RJZA 1RWKB 1Y5NB 4RNFA 2RVJA 3FBBA 4DSFA 2JVRA 4DR1J 2OPRA 1SPBP 2LQJA 2PIIA 3M1VB 2GO9A 3HK2A 3CCWA 3V5RA 2B4PA 4OYBA 3DU5A 5KT2A 1VGYA 5L38A 4CZCA 4TXSA 3W5YA 1KC8T 2YKNA 4K0KJ 2PEBA 2YWWA 1FD8A 1S6OA 1OJ4A 3HT3A 4C3KA 3MOJB 1VC5A 1JX4A 3GMGA 5KFKA 2XS7A 1YRTA 3NBPA 4FZVA 4NEYA 4RPFA 2HSEB 2HZAA 2HPUA 3M2RB 3EJMA 4ZHRA 4Y65A 1UA0A 2VG6A 3ISNC 3CDWA 3M2UB 1BE4A 2YH1A 3H4BA 1U6FA 1H2VZ 4IFYA 1VQSA 3QAUA 2OPSB 1DZ5A 3MAHA 3PYEA 4KAIA 3LUYA 3MECA 2R7UA 2J0SD 4CCHA 5CQGA 1VOMA 5AXLA 3R6GB 2QX0A 5D3GB 3R1LA 5DS7A 1Q78A 3A12A 1YHQS 3CDAA 3BPDA 4DPYA 4YQWA 2OAUA 2W4PA 1R8AA 4QWCA 2IJRA 2WOMA 4PQUA 2CQ0A 2RMLA 3M05A 3JAMY 1I51B 3MPWA 3VVTA 2XS5A 3QJPA 2KN4A 4JI4F 2JX2A 1DTTA 3FMBA 3VGVA 5HSPA 3CMES 1TZ0A 3KYLA 2LQ5A 4A8XA 1VBKA 1MN9A 4LF9F 1QAXA 2B8PA 4NLWA 4ZITA 3VHQA 2XBPA 2FJDB 3QRRA 3FKBA 3CUNA 1DLOB 2XYGB 1W2BR 1RKJA 2YWGA 4EBCA 2LU1A 1K9MT 4X4NA 2OEMA 2GV1A 1FD2A 2G1HA 4N5SA 4M1KA 4OMFG 2KYXA 2DNZA 1SJQA 4ZS6A 2YQ1A 2MQLA 1WORA 4YR2A 2DR7A 1Y3JA 7FD1A 2DEJA 4Y28C 2XB2D 4OJ1A 3DOKB 4HDHA 3L95X 4BLGA 5KG5A 2ACMA 2OGUA 3GFYA 5HQ8A 2QRRA 5H9FJ 2MQPA 2KJWA 2DNRA 2V8HA 2B9YA 4MKYA 2FHMA 4OX6A 1T03B 2YKQA 1QVGR 3Q22A 5KOXA 3V6HA 5LT5A 2KDOA 4OZ2A 3GIJA 4RW9B 4ID8A 2C3UA 2AWZA 1GXLA 5FDLB 5KFCA 4X4SA 5A6PA 3ENQA 1XWLA 3DFEA 2FLNA 1NSKL 5HK4A 2WB4A 5DETA 1PSDA 1FXRA 1QY7A 4RBTA 3PXGa 4DN0A 2WBMA 2C2OB 3C2PA 1F2HA 2L08A 2BJ1A 3Q8UA 3V81A 1IKYA 4L75A 1HPZA 2PA8D 3R7SB 2RHSB 2LEAA 1R8BA 4ANCA 2HQIA 2EC0A 1T8EA 3PR4A 1FNXH 4ZPBA 4U8YA 1YZ6A 3P3DA 3K5PA 3QJJA 3H5XA 5CXTA 4CO3A 2VONA 4JI6J 2HHTA 3O2IA 4ZVUB 4WP3A 4ES3A 1RAHB 2Y8WA 2HHPA 3Q83A 3DLKB 4ED2A 1RAJA 3FGVA 5DDRC 2J9EA 4F3MA 2OTLS 4IO9Q 3KLGB 3ZZYA 3D9BA 5CAAA 2HMIB 2F9DA 4I2QB 5GMDA 4DUTA 2MDAA 2NUUG 2DR8A 3UR3C 3MWBA 4QOTA 1URRA 2QA1A 1W7WA 1FESA 1LW2A 1S7IA 2Z30B 4EK2A 2BKPA 1D0EA 3WX8A 2D3O1 3PW2A 2W7AA 4ITSA 1Y3KA 2IBOA 4IQMA 3MMAA 3T1YF 2UXCJ 1FE4A 2I8EA 3CJ3A 2Z8QA 2KM8C 4F67A 5IM0B 5AXKA 2CPFA 3OXLA 1YBAA 3C16A 4P2MA 3HHLA 3TVYA 1IKWA 2MJNA 3PX6A 2HHHJ 2R7TA 4MH8A 3T19A 1SIWB 2QLFB 2XCPA 2RE1A 2ZM6J 4PABA 1RT3A 3KLFA 1SKRA 2K7JA 4URQU 1VK3A 4CYUA 4KQZA 3GLJA 2AYEA 1DHMA 2J9CA 1LV5A 2A1BA 2DNMA 4QYZK 3CE8A 2KVQE 5AE3A 1LKZA 1DQ8A 1YGYA 1T9XA 2F7VA 3LP0A 3TAMA 2BJ7A 5K14B 2EEYA 1U1QA 4E98A 2E5LJ 1GT8A 4LRBA 2Q3PA 1Z1ZA 1B70B 4DV0J 3LAMA 3MCSA 4WJBA 3CTRA 2XSFA 2YNIB 4DR7F 1OS5A 5A8RB 2EG2A 3BQ1A 3TEGA 3KJNB 3CCLS 3AB2B 4RX6A 3OTCA 1P8GA 1RT6A 1IWAA 4RNOA 1CULA 1B7FA 4HHHA 2HAIA 1WG5A 2R3VA 4ER8A 2HWTA 2AW0A 4B9NA 1YK9A 1HBUB 1NNDA 2KKHA 4HH1A 4ICLA 1KD1T 2DJWA 1KVIA 4NCAA 2CNKB 4DL2A 2OSRA 3KLIA 2RIJA 1NSAA 4PRFA 4ED8A 4UUWA 4LFBJ 2HQDA 2YNFA 3MMBB 3PRDA 3CGIA 4G1QA 4PYDA 5CHCB 1PC4A 3R1HA 3NCPA 4X66J 3KLEA 1E6VB 1NKBA 4DR2F 1Y5IB 3R5JB 5CD4A 4R5PA 3ZFVA 2VB6A 2V4RA 2RQKA 3C6UB 3ENWA 2FY8A 4Q0BB 1VMBA 4GKKF 1NDLA 3D28A 4K2JA 4LF8J 1SVDA 1N32F 4E0DA 2CJAA 2RDJA 3TZYA 4WFYA 1KSPA 3CCZA 1TKZA 2MKYA 1T9WA 2PI4A 2P9GA 2DR9A 2ZJRQ 3K57A 5J2NB 1C0TA 3TUIC 4EO6A 3IAM9 5IS2A 4OYWA 1PO6A 1T9UA 4ZVSB 1NXIA 4E8UA 3HCXA 4KFBB 1NK7A 3NY0A 4GC6A 1HMVA 3GWCA 3MI7X 1M5VC 4J91A 5LMUJ 3LF0A 2HLTA 3MEEB 2QLBB 2O5DA 3NS7B 3OL9A 3LWMA 2FTRA 1HNZF 1RTJA 2Q43A 2WRMA 3UDEA 4EYIB 3NWRA 3I31A 2IC3A 4ZPDA 4WP8A 3M2VA 4S0MA 4ALZA 1EQ0A 3W63A 1IXKA 4OI6A 4ZVRB 5H9EJ 1VFJA 3MCMA 2YY3A 3P8BB 1NKCA 3HULA 2VOPA 2HS3A 1N34F 1TV6B 3T5LA 2ZUGA 4ED0A 2KG0A 4JI5F 4OI2A 3Q24A 4UQGA 3AD9C 3DNCA 2G13A 5F8NA 2HVDA 5L39A 3MFHA 2XY5A 2GGPB 1YWXA 2XWXA 3DM2A 4RUAA 3J7A1 3ITHB 4B17A 1X9WA 2E1PA 4NOHA 2CRLA 1BUXA 3K17A 3BQ0A 1M1GA 1JLQA 1ZAXA 4K4ZA 4A8WA 3ZTRA 5C5JA 2HNYB 4J9RA 2XC9A 1KTQA 3QO9A 1IBKF 1KKHA 2BA9A 2M70A 1FXDA 4OV6A 2D3ZA 1EETA 1S7HA 2BJ8A 5HMYA 3NNCA 2Z56B 1H6KX 2W9CB 2AX1A 3IFEA 3IRWP 4FBTA 3ISND 3KK2A 1NB2A 4RJVA 2OJ3A 3ILJA 3J7AN 4NZ6A 5KG0A 2JOQA 3K58A 4K4WA 4DR5F 1PYOB 1OQ6A 1RP5A 3DMJA 1CJUA 5EDWA 2HGMA 4J9VA 1HNXJ 5MAOA 3OHBA 3W60A 4I6YA 1Y10A 4FYXB 1HWKA 2G2OA 2EKYA 2N82B 3BM7A 1X9MA 1N5YB 5LMNF 4JYAJ 1RLDA 1GEHA 4LF7F 3B4MA 1OO0B 4WYLA 3F73A 2BQRA 1T0TV 5B08A 2KXHA 2XEXA 1AZSA 3CW2C 2CXEA 1ZTTA 5K8NA 3G6ES 1IBMJ 2CJKA 5F8HA 1HL6A 3AOAA 1S1UA 3W8PA 5IT4A 4CH0S 3SZ2A 1X0FA 1OSCA 2XGPA 3CO0P 4HACB 4HL9A 4QIEA 1G4CA 2MLYA 1M90T 2ZBPA 3M4XA 2VIHA 4P2XA 3P96A 1TL4A 5DDOC 1N33J 1BQMA 3CCSS 3OXFA 1FKOA 2MJUA 3LGNA 1EIYB 4PG7A 4HTIA 1DLOA 5F8JA 2UP1A 5KT4A 2WSCC 4W92B 1SC6A 3MXHP 3TWZA 1N6QB 3G8TA 5GAHU 2JDJA 4X64J 3LP2B 1DBDA 2CFXA 1D3WA 3NWGA 4DJBA 1NH7A 2ZC4A 1Q8BA 4DR1F 4F0KA 5B7WA 4ELVA 2B4OA 3RW7A 1SL0A 1UZDA 3BGOP 1UP1A 2XWYA 2RT3A 1UEVA 3P4UB 2DGVA 3TVKA 2LQ9A 1BC6A 1IQTA 4OIXA 5J1EB 3GFZA 3M8RA 2GMLA 9ATCB 3SXLA 1NK0A 1T03A 4NASA 2CJ9A 3CD5A 2V8PA 4FF3A 2HLUA 2I5JB 2WSEC 1SXLA 6FD1A 1S6PA 5EN1A 3GQCA 3QMQA 3O44A 2F9JA 5FDLA 3FCHA 4LRAA 4DV2J 3N4WA 3O8WA 3GYGA 4QBUA 1F3VA 4CQ1A 1JLBA 1P9YA 1TU0B 4B3OB 1FRXA 1FO1A 3ELHA 1R7IA 5HVGA 4OV1A 2H51B 1Y00A 2ZVSA 1FWPA 3Q8QB 1U1PA 2MZRA 3AJDA 3CPWR 1VCTA 1HD0A 2NSBA 1T05A 2VA3A 3CCQS 3QLHA 1NO8A 3N5FA 4FKXA 4ZJOA 4LFCJ 2YKMA 2VFRA 1FCAA 3OPKA 1G1XA 5EWGA 1WOSA 1S6UA 3PW5A 4YDXA 4XTTA 2CQ2A 2AHOB 2WW4A 3VR1A 2C3MA 4LSNA 1MROB 1RWUA 2N7CA 2RS2A 2XMKA 3KWMA 1JNRB 2F63A 3VQTA 4BBYA 2PEHA 4NRUA 2DNKA 2CNLB 3OJSA 3T9ZA 8AT1B 1Q1KA 5HROB 4ZCKA 2GFFA 5HQLA 1YDLA 3T6BA 2YQ0A 2X1BA 3DGPA 4RW6A 2MSSA 2BE9B 4NZ7A 5KT3A 2A2DA 1S77D 1KLNA 1SKSA 1XMOJ 1N52B 4WK3A 3ET6A 2NS1B 1TL3B 1SC4B 3M6XA 5CYQA 1D8YA 3PO5A 4ED5A 1OY6A 1JWWA 3PW7A 4DX8H 2Q66A 4OYXA 3KUHA 2UZAA 3DI6B 3IG1B 1FX2A 3B8HA 1KVKA 2D1CA 4PUOB 4A8OA 4M5HA 3C46A 2VPYB 4UOCA 2QLWA 3CJ0A 3W9HA 2UVWA 4BHQA 1IJEB 5DZ7A 4UF4A 3IS9A 2JRSA 1DQ9A 4ZJQA 4DWIA 1W26A 4JI0J 5KFZA 5LL6d 4FS2A 1XNRF 2GVZB 3DU6A 2MEWA 3LOUA 3HSJA 4OLPA 1MLAA 1YSJA 4LF4J 4CLWA 3RGIA 5IV3A 1SQFA 5LSLA 1IKXA 1U24A 2L9DA 1U1KA 3T9NA 2GMJA 1EP4B 2BVZA 3MEGB 3MR5A 2B5JA 4ECUA 3QIPB 4RNNA 2C2ZB 2ZH4A 1JXEA 2CKWA 1NRKA 1PAEX 4Q2MA 1DARA 3GZ7A 1Y7PA 4EMDA 3DYAB 2RDDA 4DN9A 4QZVB 4N7TA 3BH6B 5FJ4A 2JL9A 2FGOA 2LLZA 8RUCA 3TJ9A 5EWEA 1QLNA 2H5EA 4O0NA 3A3PB 2F40A 4H4MB 3MMBA 2ZBRA 5I4MA 4LUBA 3BEGB 1S1TA 3LGMA 4JI6F 2UXDF 4L3NA 2ZH5A 2UUBJ 1ROFA 4DI6A 1RKIA 4ZPAA 3J80U 1RB0A 1VQLS 1M5SA 1AUSL 1FKPB 1KHWA 3Q8SB 3SSRA 3C19A 5H1SV 1RAEB 4OI0A 5A76A 1IUJA 3MDFA 3QQCD 5F8IA 3HHEA 5DG8A 1GMWD 2R7RA 4J9SA 2HIQA 2I6WA 1RABB 1FK9B 1S59A 2MQOA 4HDGA 3EICA 2RRBA 4WYWA 3UDVA 1XIQA 3R9LA 2UV8A 3R3TA 4LREA 4M5MA 2HHUA 2E29A 3KDNA 1ZZFA 4B9SA 3UN2A 1XMQJ 4KFBA 3TUZC 4RL1A 5E3AA 4L72B 5KFHA 4YDDB 1UWBB 3IGVA 1UVJA 1RT4A 2VQFF 3RAXA 3W7BA 3F0NA 4DCPB 2HVEA 3MEEA 1WI6A 1CS4B 1UVMA 2OFGX 3QJLA 4J5OA 2HHHF 4AE5A 2OHDA 3WDOA 3QBCA 1NK6A 4ANDA 2B4VA 3MUVP 2EVZA 4NMXA 1S12A 3R6LB 1IR2A 2GAHC 1WC3A 2HHVA 3R5AA 1RXOB 3JYTA 3HI9A 4A8YA 4NL5A 4P75A 4O4RA 4NYPA 4NI2B 2VZ9A 1UFKA 1B0PA 4BCAA 3QNWB 2E5LF 3NNHA 1TMMA 3VTIA 3TUJC 4ES1A 4F3QA 1I94J 4U7UD 2CQBA 2I9SA 4V1Ak 2CQHA 4KPYA 1VC0A 1RWOB 4P10A 2A3JA 4L74A 2CDRB 2R7OA 4X4PA 2QG9B 5DZ6A 1P1LA 1QTMA 3AXKA 2HHXA 2ZH3A 4NA1A 2DPIA 2DHSA 1NJZA 2ILYA 3RU0A 1M0SA 1K1QA 4KH0B 4Y00A 3IWNC 3HVRA 2KRRA 2GHWA 1IVZA 4LFBF 2DCUB 4NXMJ 2CIMA 3EGWB 1Q4RA 1QUPA 2EBEA 2KYZA 3A13A 1SL1A 4X66F 1JXVA 3SQGA 1XR5A 1U0HB 5F8MA 2MKJA 2C22A 3CDBA 1JKHB 2DNOA 4NWBA 4DV6J 3BJYA 4LF8F 3EPGA 2IRYA 2M0GB 4QWAA 1CVJA 5JVGQ 1S1XB 4O3SA 3RB6A 3I0RB 2EFNA 4M5LA 2BACA 4LRFA 2JVOA 4I64A 4KBIA 1X8DA 4J9OA 3PG9A 1CG2A 3UDLA 4H4OB 1FVSA 1M5PC 2A6OA 3RAMA 4J9LA 2W8KA 3OL7A 2OMOA 1WC0A 2CPIA 1MSWD 2W8LA 1F60B 4X62J 3TX0A 2BQ3A 5LMUF 3R5DA 2JNJA 1S9EB 4NXNJ 2IY5B 4W98A 1H2UX 1LWXA 3UR0A 3QFWA 1JJCB 2POKA 1YI2S 1CJTB 1TVRA 3FCVA 4CO1A 2RB7A 3HX9A 4A8SA 2KT3A 1DAXA 3BS9A 2AQ4A 4CNZA 4RO0A 3OR1A 3C15B 1FDDA 3ZTPA 1O0PA 4F36A 3BBBA 4MFBB 2YX4A 5J1NA 2VHGA 4MT1A 1C0UA 2V8VA 4KV8A 2JEIA 5DRKA 2DY9A 1S0NA 5B0GA 3FCWA 1IQZA 1JLEB 4C48A 3MTKA 3FEYB 3RR8A 2MQMA 3KNGA 5J2MB 4URGA 1B0TA 5KT5A 2BW2A 1N4LA 4DPXA 3MM9A 4GVBB 2W4CA 4DV3F 2VJUA 2C42A 3KK3B 1DTQB 2B56A 3OTOF 2CZ4A 4ENOA 3C3LA 3AT1B 1HI1A 3LP1B 1A9NB 4WXWA 3V6DB 1VLYA 3RBDA 5C42B 5GAHI 3OHAA 3FBFA 4NLPA 1I5OB 2DRDA 1AB8A 4KHMA 1G3OA 1NDCA 2KXFA 1UEUA 4AT1B 1YJWS 1GH8A 5ETPA 1IM6A 2V2ZA 4OHWA 2W7OA 3M30B 4UY8T 4B08A 3BGUA 1EKRA 3FRZA 4N8NA 4KR0B 4MIBA 4EEYA 3DLEB 3PYGA 5E41A 3D1HA 1Y5LB 4DR6F 1KN6A 4UZCA 3VAFA 5DM6Q 3CC2S 1RWPB 2K7KA 3DLHA 1Q0NA 2HW3A 1YBTA 1S1WB 1NEEA 5G0RB 2VUGA 3VAJA 1ZM2A 2VF3A 2F5GA 4CH7A 1YJNS 3MAAA 2SXLA 1KLMB 2E1MC 2BJDA 1UEKA 2ZBCA 4X4TA 5T7LB 3MMCB 3H5YA 4Z37A 2F4VJ 1S0OA 1FJEB 2H3EB 1U48A 2XSJB 2J6UA 5KG7A 2C2DA 1H74A 2X3DA 5D4NA 1IR0A 2MKIA 1TTHB 3DLGB 3IMQJ
chains in the Genus database with same CATH topology
2AJ0A 2P5VA 3ETOA 2ZITA 1DLOB 1W2BR 1SJ3P 4JBCA 3K2YA 1RKJA 5KFVA 2YWGA 4EBCA 2LU1A 1K9MT 4X4NA 2YWHA 2QMXA 4DQQA 2GV1A 4B3MF 4P2SA 1FD2A 4N5SA 1E6VA 2CQPA 2EWHA 4M1KA 3Q23A 3OFHA 1NU4A 2KFZA 3HZGA 2DH9A 2YKPA 4OMFG 3BDEA 3RR7A 2KYXA 5IQQA 2WW8A 5FLXY 4QW9A 4Y0FA 2DNZA 2DGXA 2ZDOA 2ASDA 2W9BA 3NMAA 4DG1A 1SJQA 4USIA 2ACYA 4ZS6A 2A2CA 3C6UA 2GJ2A 1B0VA 2MQLA 3SYZA 4Q0BA 2BV3A 3JSRA 4DDFA 3Q8RB 3BN4A 2P6SA 4YR2A 2DR7A 2YTCA 3KOAA 2ZD1A 2M9KA 2ZOFA 2HS4A 2NXUA 1Y3JA 3LAKA 7FD1A 4Y28C 4FS1A 2XB2D 4XK8C 1FDAA 4K2XA 5KFIA 4OJ1A 3SV3A 1KR4A 2EI5A 2WONB 3DOKB 3ZZOA 5BR8F 3BQ2A 4O44B 1QSSA 1MMDA 5K5MA 4X4OA 3SCJE 4HDHA 4DLGA 2KH9A 3NCQA 4K4SA 1FNMA 4BDPA 4QJVA 4X2BA 2HFOA 3L95X 2DO4A 4WE1A 1H2TZ 3SFGA 5KG5A 4ZOSA 2LECA 2ZNZA 1UETA 3GFYA 1K0VA 1HBOB 3VAMA 1LWCB 3G4SS 5HQ8A 3MEDB 5KG2A 3W2WB 3SQGB 5KFBA 2LDIA 2QRRA 1VQ4S 5H9FJ 2MQPA 1GTEA 1ZPVA 1UFLA 2KJWA 4K4VA 1KFDA 2DNRA 2V8HA 2JEJA 2JHEA 2ROGA 3DCAA 2B9YA 3QGIA 4IG3B 5HBMB 4FF1A 4MKYA 2FHMA 3TOQA 2MPUA 5J2NA 2AGQA 4OX6A 1CPZA 1HWIA 1RTDB 4PXBA 1T03B 3D54A 2O3DA 2YKQA 2IYIA 1QVGR 2IMOA 4I0WA 3DI6A 3IG1A 5K8MA 3M8SA 5KOXA 2D9OA 1DURA 3Q22A 4K4YA 3V6HA 5ADZA 5LT5A 4G1IA 3IXQA 3BSCA 1YJRA 4FN5A 3EYZA 5G4DA 1UA1A 4DSLA 1CSJA 2KDOA 2RS8A 4OJ3A 2UXCF 3U1MA 3IWLA 3VCDA 2FVQA 3RYLA 1J5OA 3OL6A 1HNIB 4JI7F 4BWMA 3GIJA 3GV7B 4RW9B 4ID8A 4OI4A 2GQ2A 4MJKA 2C3UA 2MQNA 3HVTA 2AWZA 2P9CA 2V8DA 1FTCA 1GXLA 3OBIA 5FDLB 1OPZA 5KFCA 3QWPA 4X4SA 5A6PA 3BO3A 3HJFA 4PUOA 3CD7A 4NLOA 1VQ7S 3ENQA 2V8GA 3TAPA 1XWLA 3PJWA 4IDKA 2PE8A 3NAHA 2RILA 3DFEA 2FLNA 1P9QC 2ZH6A 1N8RT 3PIPQ 1XR7A 2WB4A 5DETA 4JV1A 5L9XA 1PSDA 2NPFA 1MW7A 5FJ4A 1FXRA 1QY7A 1HI8A 4RBTA 4I7FB 3PXGa 5DDPC 1BLUA 1O8BA 4DN0A 1HW9A 2WBMA 5KOWA 2D3UA 2VC0A 2ZM6F 2O01C 2KT5A 4TKTA 3C2PA 5E7OB 3V4MA 2QO3A 1MWZA 2QMWA 2EK6A 1TKXA 2Y1RI 2L08A 3V81A 5J2PA 2PMHA 3KHLA 2RUGA 2HHQA 4C7QA 2KO1A 1KHVA 3GYNA 1IKYA 3N28A 1HPZA 2PA8D 3IC1A 4AXIA 3W3SA 4RU9A 3PX4A 2LEAA 1TV6A 1R8BA 4NYOA 3TA0A 2CPZA 2Z4PA 4NLUA 5B0FA 2D3OR 3N5BA 1S48A 1KTVA 1FRIA 1QM9A 2JEGA 2HQIA 3GV5B 1KQSR 2MKSA 4AL6A 2NQPA 3B82A 3RB3A 3SFUA 3X3UA 2DTJA 1R0AA 1F5BA 2MHNA 1RYRA 2OKQA 2EC0A 5CD4H 1T8EA 1UVLA 1S76D 2K3KA 2MZQA 3J7YI 3PR4A 1FNXH 4ZPBA 4TU7A 3Q2TC 3G6XA 3P3DA 4C8KA 2M8HA 3K5PA 4C9DA 5K8OA 4ECYA 4IR9A 3H5XA 5CXTA 4CO3A 2VONA 3OV7A 3QJJA 2HHTA 4YR0A 5B0CA 2O66A 3RAQA 1TVRB 3O2IA 4IG0B 4DSIA 4DV0F 2XNQA 4ES3A 3S7RA 4ZVGA 5AE1A 3EUNA 2GGPA 4RW7B 3EZ5A 3EZUA 1LQ9A 2HHPA 4EBEA 1FRHA 1L3KA 4O3PA 5KFYA 1CEZA 3DLKB 3M8PA 2DNQA 2BUNA 1R31A 2PA3A 4ED2A 1RAJA 2DB1A 3FGVA 4NA3A 1Q16B 2C3OA 5DDRC 4PPZA 2ZH7A 2LMIA 1Q81T 2J9EA 3OR1B 3OW2R 3ITHA 3CO9A 4F3MA 2NREA 2CYYA 4IO9Q 2OTLS 5GADI 2M52A 2Q79A 2MZTA 4O3RA 3KLGB 2ZJPQ 4DV5F 4F4KA 4C11B 3ZZYA 2LXUA 2OPRB 2ZKTA 2DPJA 2HMIB 1RTHA 2F9DA 4I2QB 2L9NA 3PNIA 2DGTA 1CC8A 2DHXA 3I87A 3CEDA 1JLFA 3KLVA 1CLFA 3H59A 3FFIB 1C0UB 2MDAA 4KV8B 1WHWA 1S6QB 1M5OC 3H20A 2NUUG 2HNYA 3M9MB 4V19X 2DR8A 5J1PA 3UR3C 2ZNYA 3LWLA 3MWBA 3TQ1A 2DNPA 2V5HG 3H5SA 3IN5A 3I9ZA 4QOTA 1URRA 2QA1A 2NSCA 1VQ8S 2V4JA 1CVJA 2KZMA 2A10A 2QZ8A 5A6WA 4IYQA 4AXJA 1FESA 1FKPA 3KKFA 1HWLA 2CQ3A 1LW2A 3H40A 2FLPA 4OHVA 1G2EA 3E01B 4ED1A 4WFZA 1WHYA 2E9ZA 2YKNB 1D0EA 3CVKA 1TP7A 3H8YA 3ZZZA 2KJVA 1DRZA 2W9CA 4DQRA 3PW2A 1W2IA 2VBZA 3MM9B 1QJHA 2IVYA 3W2VA 1N36F 2W7AA 4ITSA 3GR0A 2GQQA 3HZEA 3H4DA 3CULA 1Y3KA 1R8PA 5KFNA 3WC2A 3EXYA 3RW6A 2HZCA 2RD5C 2IBOA 3GSDA 3HHDA 4IQMA 3MMAA 4A48A 1V6HA 3NKYA 4GO5X 3WZ0A 1FE4A 1V3ZA 3T1YF 2I8EA 4PXDA 4RBVA 3CJ3A 2Z8QA 1LWFB 2GQCA 2QE5A 4ZLPA 2AYBA 2KM8C 1S1VA 4F67A 2IA0A 4AFFA 5IWAF 2FY1A 3NBPB 3CJKA 3ZC4A 5F0UA 5IM0B 2R7WA 5AXKA 2DK2A 2CPFA 2B7BB 2ZC3A 3OXLA 4YB6A 1S9FA 1YBAA 3I0SA 2QT7A 4ZHRB 4FVMA 4KGMA 3KK1B 2VG6B 2K1RA 3HHLA 3ZZRA 3MR3A 3ZZUA 4HHJA 3TVYA 1IKWA 3DXSX 4OI1A 2HQ3A 2MJNA 3PX6A 2IHR1 4I4BA 3FEXB 3POTB 2R7TA 1BQNA 3AA9A 4RU2A 1XMOF 1KQKA 5D4LA 4IQXA 3I32A 3MM6A 4MH8A 4PPDA 3THTA 4ATNA 2FVSA 2PD1A 1SIWB 3T19A 2GCFA 1YITS 1JJ2R 4IFYB 2RE1A 2XCPA 1VHFA 4G1PA 1UVKA 2NPIA 1S0MA 1X4GA 1IJFB 1T94A 4NLYA 4OHZA 1QUVA 3BN7A 2X3GA 1RT3A 3KLFA 2ALZA 2K7JA 4URQU 1SKRA 1VK3A 4BC9A 4KQZA 4ID5B 4K50A 4KO0A 2AYEA 3FNNA 1ZAWA 3RBEA 3TNVA 3T6JA 1Y9OA 2WK4A 4WCEQ 1VRUB 2KZZA 1DHMA 1OPIA 1WF0A 3MECB 2XO7A 2J9CA 1LV5A 2A1BA 2BBEA 4LJMA 1N5YA 1Z2LA 1OWXA 5HMXA 3DRSA 2ZOMA 5U47A 4ECTA 4ECWA 1WELA 2IVFB 2DNMA 3CE8A 2ASJA 1LXJA 3BO4A 4FP9A 5DM7Q 1SKWA 1WNEA 3HVWA 2BABA 5AE3A 4F26A 1LKZA 1DQ8A 2B6AB 4B9MA 4PXEA 1YGYA 2F7VA 3NCRA 2BM1A 2EFQA 3TO8A 1Q82T 2UVUA 4YFUA 1FJGF 1VK8A 3LP0A 1YVFA 3TAMA 5K14B 3N79A 2E7WA 1U1QA 4E98A 3E3XA 4ZVHA 1ZBTA 3NG8A 3PJXA 4AUKA 4ETZA 4EO8A 1RT7A 1U2FA 1GT8A 1TQLA 3VF0B 4C0HA 2Q3PA 1U25A 1Z1ZA 4EYHB 5B0BA 2Q6BA 4J9MA 2HFNA 5M2RA 3HMJG 2OO4A 2WOMB 4PQUB