4LJMA

Crystal structure of c-terminal rna recognition motif of human etr3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
GPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of C-terminal RNA recognition motif of human ETR3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords CUGBP Elav-like family member 2
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ljmA00
2DGOA 1WTBA 1VQ7S 2XB2D 2CQ1A 4A8XA 2WBRA 2CPFA 1JJ4A 3UWTA 3UCGA 2KRRA 3VALA 1FT8A 2DNNA 4WIIA 2MPUA 2M0GB 1WWHA 2DNQA 2LA4A 4PKDB 2KRBA 5GAHU 2CQ2A 3S01A 1SJRA 3UD4P 1HA1A 1N8RT 1M1KT 2DK2A 1KOHA 3I55S 1S79A 1B7FA 2G0CA 3CC4S 1YIJS 4W90B 1X4HA 1D8ZA 2XS2A 2DNKA 2DB1A 3MXHP 2E5JA 1XN9A 2MYFA 2ERRA 1DRZA 2RRAA 2MZJA 2CQDA 3MUMP 2RT3A 1M90T 1KC8T 1M5PC 2G4BA 3UCUP 2CPZA 3CULA 1YHQS 1K8AT 2MMYA 1KOOA 2X1GA 5IM0B 3CC2S 3MD3A 1O0PA 2MJNA 1R8PA 1H2TZ 3LPYA 2D3OR 4WFAQ 1OWXA 3B4MA 2JVOA 4J5OA 3K0JA 1PGZA 3ZZZA 3SDEB 2MSSA 2KXNB 1X4CA 2RS8A 5GMKa 2ZJRQ 1U1OA 5HL7Q 1QVGR 1JJ2R 2AYMA 4IOCQ 2EK6A 2XSFA 2J0SD 3G6ES 3J7ZT 2FC8A 2L9WA 4TU7A 3TO8A 2VONA 2BOPA 5LSLA 1WG5A 3UCZP 1WHVA 2YH0A 2HZCA 2FPHX 2VODA 3BO2A 4YOEA 3CCRS 2KM8B 2I2YA 1VQ4S 5EN1A 3S8SA 5D78A 1WEYA 2M4MA 2DGVA 1Q86T 5FJ4A 2M8HA 2M8DB 1OPIA 2B0GA 3L3CA 3VAKA 1X4DA 4U67Q 4ERDA 2RNEA 5DETA 1W2BR 5DM7Q 1Q81T 2X1AA 2DNRA 1WEZA 1U1MA 2YH1A 1N52B 1WF2A 5GADU 1VC5A 5LXRA 2E5GA 5D77A 2LA6A 2Q79A 2X1BA 3RW7A 1X5PA 1PO6A 5LSOA 2DGUA 1X0FA 2KFYA 2DH8A 2OSQA 2DIUA 1QM9A 2K3KA 4ED5A 5LXYA 4F25A 2YTCA 2LEBA 1U1PA 1U2FA 3H2VE 2LYVA 3CCLS 3EGNA 3DLLQ 3MOJB 1QVFR 1WF0A 5GAGU 2NZ4A 3EGZA 2MKKA 4M5DB 2G1DA 1FNXH 3CMES 2GHPA 5GVQA 4WCEQ 2XNRA 2MJUA 3NNCA 2FHOB 4QPTA 1R8HA 1FO1A 3PIPQ 4CH0S 2KU7A 4TLQA 1M5VC 3CCQS 2RRBA 2J0QD 2F3JA 1UW4A 2KHCA 1CVJA 5DDRC 1X4FA 5IM0A 1G2EA 3PIOQ 1U6BA 1K9MT 1H6KX 2JX2A 4OZ1A 2E44A 2M7SA 1UAWA 2DNPA 3CTRA 1JMTA 1RKJA 3FEYB 3J7YU 3CCVS 2N7CA 1P27B 3VAIA 3CCSS 2O3DA 3G4SS 2YWKA 4IOAQ 4FXVA 2MGZA 5CXTA 4F26A 2KG0A 2HYIB 3MD1A 2DHXA 2M70A 1L3KA 4YUDA 5HO4A 2DGWA 1YITS 2X1FA 1BY9A 2I38A 3MURP 3G9CA 2N82B 1VQ9S 2ZJPQ 1H2UX 4LJMA 2MZTA 1VQMS 2JVRA 2MB0B 2KI2A 1JJHA 2CQPA 1X4AA 5BJRA 2RS2A 2E5IA 3HHNB 2FY1A 2HVZA 2F9JA 2KXHA 2KVIA 2U1AA 4QU7A 1DBDA 5ITHA 1AUDA 2L08A 2CQ4A 2MKSA 5CYJA 3BO3A 1FXLA 2DGQA 2OTLS 5DDOC 1M5OC 1URNA 3NMRA 1YJ9S 4WF9Q 1VBXA 3MUTP 2K8GA 2AYEA 2CPYA 2OSRA 5IFMA 2PE8A 1KD1T 3U1MA 4IO9Q 1WHWA 3R1HA 3SXLA 2DISA 2AYGA 4C0OC 2MQLA 2CQHA 2FC9A 2V94A 1X4EA 1N88A 2CQ3A 2CQBA 2MQPA 2OIHA 5DDQC 2N3LA 3H2UB 1U1KA 2KH9A 1FJCA 1WHYA 2DO4A 1HD1A 2LMIA 1U1QA 1A9NB 1DZ5A 1VBYA 3BEGB 4V19X 2DHSA 2MGZB 1VQLS 3CUNA 1P1TA 3I56S 3MDFA 2DNGA 3VAFA 2XS5A 2YKAA 1X4GA 2CPIA 2M88A 2MKIA 2LXUA 4CQ1A 3CCUS 2RU3A 5H1SV 1H2VZ 2KT5A 2DO0A 5LJ3Y 2F9DA 1FHTA 2JRSA 2MZSA 3CMAS 4WFBQ 1HL6A 2MZ1A 1DHMA 4RU2A 4C7QA 1K73T 1X5TA 1WI8A 3US5A 3VAMA 2XNQA 2L41A 1ZZNA 1M5KC 3VF0B 1RK8A 4LIRA 2MQNA 2XS7A 1Q82T 2DH9A 3RW6A 4FXWA 1FJEB 1VQ8S 1U6FA 2CJKA 4Y0FA 2AD9A 1WELA 2CPJA 1ZZFA 3CC7S 4TU9A 4PR6A 2CQIA 3R1LA 2LXIA 4CH1A 2QEXS 2MHNA 1VQOS 2A3JA 2HGLA 2OJ3A 1VQ6S 1VQPS 3V4MA 4BS2A 4IUFA 2CQ0A 2JWNA 1VC6A 2RQ4A 5DM6Q 3U1LA 4WKRA 1NO8A 2CPHA 3R27A 4CIOA 3TYTA 3ZZYA 5LJ5Y 3OW2R 1A7GE 1WG4A 1VBZA 2DGXA 4Z2XA 2CQCA 2LECA 2J8AA 2LEAA 2CQGA 2MQOA 3IWNC 1KQSR 1U1NA 2DGSA 3FEXB 3P3DA 4TU8A 2EK1A 1F9FA 2AYBA 1FJ7A 1D9AA 5IQQA 3EX7B 5JVHQ 3NS5A 1NJIT 2VOOA 1OIAA 3VAJA 3ULHA 1WEXA 2NLWA 2MZQA 2LKZA 1YI2S 2M9KA 4P6QA 2MKHA 2HGMA 1S72S 1WI6A 3G8SA 2OTJS 3P6YC 2M2BA 5MLCV 2ADBA 2CPDA 3UE2A 2MKJA 3VAGA 2DH7A 1X4BA 1WF1A 2CPXA 1YJNS 2KM8C 1NU4A 2DGTA 2D9OA 2PEHA 3VAHA 2N3OA 1SJQA 3BO4A 2VOPA 2UP1A 3P5TL 1UP1A 2KN4A 4YB1P 2CPEA 2EVZA 3CPWR 3CCES 2J76E 4UY8T 3BS9A 4WFNQ 2ZJQQ 2MY7A 2QA4S 3NNAA 1N54B 2GO9A 3NS6A 2MKCA 4F02A 2U2FA 3S7RA 4C4WA 2MZRA 2DHGA 1OO0B 1WHXA 2RVJA 2RUGA 2DIVA 2D9PA 4EGLA 2KG1A 1SXLA 2DHAA 2MQMA 1VQ5S 5GAEU 3THPA 3TP2A 3CCMS 4QQBA 3Q2SC 1YJWS 1VC0A 1IQTA 3JB9k 2DITA 3NNHA 3DXBA 4QU6A 5JVGQ 3S6EA 4Y00A 1YTYA 1YWXA 1VQNS 4UQTA 3IRWP 2KXFA 1ZH5A 3P49B 2LQ5A 2BZ2A 3G96A 2DNMA 3CXCR 1U1LA 3SDEA 3MUVP 4PRFA 2MSTA 4LMZA 3N9UC 3SMZA 1VQKS 1X5SA 2LCWA 3G8TA 3THTA 2E5HA 2SXLA 2MY8A 2M52A 3B4DA 1WG1A 3CCJS 1SJ3P 3UD3P 2MXYA 2DNZA 3MI7X 1UFWA 4OZ0A 2ADCA 1U1RA 2KYXA 5DDPC 3G71S 1HD0A 3CF5Q 3HI9A 2DNYA 2QFJA 3Q2TC 1X5OA 3CD6S 2MQQA 1SJFA 1SJ4P 3D2WA 3LQVA 4W92B 2DNOA 2DNLA 5CA5A 2RQCA 1Q7YT 4ZKAA 2DNHA 2HGNA
chains in the Genus database with same CATH superfamily
5F8GA 3V5RA 5DQHA 2E7VA 2NXJA 3HHLD 2CPFA 4RW6A 2VFRA 5THWA 2V69A 3OL7A 3VALA 1RTDA 4R25A 2CKWA 2XGQA 3PYGA 1FT8A 1RWPB 2XEXA 5F8NA 2R42A 2JOQA 4CDIA 4K4VA 4WIIA 1KNZA 2MPUA 4OYMA 3KK1A 1WWHA 1L3SA 1TL1A 4PKDB 1R31A 2CQ2A 2W7OA 4DX7A 3D0IE 4JYAJ 4FZVA 1VJWA 3TZXA 1SI9A 3VVTA 1N32J 1T9TA 1M1KT 2UUBJ 4A8SA 4EYHB 2R7UA 3CCWA 4NLTA 1KOHA 4QIGA 3IR6B 3O1LA 1V5IB 3HKWA 4GO7X 4JI6J 2VV5A 4TKTA 3EDRB 3T3FA 4KHPF 3AQOA 3MEGB 2OPPB 3MECA 1RT4A 1YIJS 1T0TV 4OHVA 1EB0A 1MWQA 1N6QB 2K06A 2XS2A 2APOA 4PWUA 2E5JA 1XN9A 2MYFA 3MTKA 4E8UA 1DRZA 2MZJA 3GJQB 2Z4PA 1PCAA 1S4EA 2GFFA 2YNHA 4YB5A 2XQCA 1G3OA 1KC8T 2EKYA 4OZ5A 4K4XA 1K1SA 1ZTWA 1VRUB 2A10A 3KLFA 1VYAA 1WACA 2EG1A 2FVSA 1EQ0A 3ZZOA 2X1GA 3DLKB 3IA0A 3J80U 4DUZJ 2UXDJ 3TUJC 3IG1B 1GX5A 1S1VA 1XC9A 2R7VA 2XHCA 1RT3A 4Q7AA 3Q89A 1MROA 2H4YB 3P8BB 4MIAA 2VJVA 3M30B 5L1JA 4JI8J 3LPYA 1JXVA 2VPXB 1KN6A 3MMBA 4PYAA 4QWCA 2RRNA 4JV0A 1C0TB 4BHQA 1JLGA 1F3VA 4ITSA 2MSSA 3KLFB 3N01A 2WVFA 4OLOA 1X4CA 3HSZA 4IFYB 1NZAA 3BR8A 3QRQA 5I3PA 1Z2ZA 2W01A 2EK6A 2XSFA 3PTWA 5F8MA 1AUSL 1HBUA 2CNOB 4RU9A 3MR7A 3J7ZT 1NSKL 2J6UA 3ZTRA 5FLXY 3OXFA 4J9LA 2BANA 2VONA 2IC3A 5B7WA 1WG5A 2CZ4A 1BMQB 1WHVA 1NUEA 5KFUA 5KFMA 4RR5A 5IV4A 1RYRA 4KV8A 3HO1A 4C9DA 5LMUJ 1L3TA 2GMHA 2J9CA 3CCRS 2F4VF 2I2YA 2QZ8A 3D1QA 5FDLB 1X7VA 4HL9A 1IXKA 1UWBB 2ALZA 4NZ0A 1J5EJ 1Q95G 3I6PA 1TV6B 4ID8A 2DGVA 1IKWB 1CJVA 3BBCA 1Q86T 4F4WA 5IC4B 2CIMA 2R7RA 3H5SA 1PIEA 1S0MA 1FJGF 2FHMA 4I2PA 1GX6A 1B99A 1S1TB 4CNYA 3JSYA 1CJTA 1SUQB 2F4FA 4NE9C 2B0GA 1FRIA 3HDSA 5DGBA 5IWAJ 2V8GA 4NXMF 3L3CA 3SFGA 4DR2F 4U67Q 4E0DA 3EUNA 7AT1B 2HVDA 1YRTA 5HVFA 3R5JB 4ERDA 3PACA 5HLFA 3N6MA 3N5BA 3TA0A 3EXYA 1Q81T 1VHIA 4ECYA 2DNRA 1JLFB 2IM3A 4KGMA 3WC2A 1U1MA 2ZZNA 2OJ3A 3M6VA 5GADU 2I5JB 2CWXA 1XK8A 2LA6A 2Q79A 3RW7A 4DV7J 3KXDA 3Q86A 1PO6A 2YBVA 4N8NA 2DGUA 3AFGA 2ZOGA 1X0FA 1VBKA 4ZN1A 2RILA 5FDLA 4JV5J 4IDKB 3P4UB 3BSNA 2OSQA 4ETZA 4Q8FA 3GU0A 3ITHA 1HBNB 5J1NA 3QGPA 2CZVC 4A8QA 1TL5A 2YTCA 4HT7A 4F25A 3LWMA 2LEBA 1Q8BA 4U7UD 2CJAA 1S1XB 4M1KA 2FYXA 3BPDA 4P2MA 5MAOA 3K58A 3H2VE 3RAQA 3MOZA 3U1NA 4F36A 3C8YA 4OI4A 4IFVA 3JSMB 3DLLQ 2WB4A 3MPYA 1FDAA 3NEKA 2W24A 4ELUA 3TUZC 2HW3A 1Q16B 1G4CA 3RGIA 3ENWA 4MIBA 4LSZB 4Y2AA 4FXDA 1IR1A 5G0RB 2XYGB 1AB8A 3QT6A 1S7IA 5GVQA 3GJRB 4ZK7M 2ZOMA 1UEUA 3PRDA 3NNCA 3HJFA 3HMJG 3LH2S 1S6QA 3M6XA 4HDHA 3VQTA 3MCMA 1OPZA 1YVFA 2KU7A 4DHVA 1BXNA 3PIPQ 2GA7A 2HNYA 1R8AA 1RWWB 3MCOA 3QGGA 4Y34A 1WC0A 3H4BA 4ILLA 2F3JA 3P96A 1R0CB 3AOBA 3DRRA 4ANEA 4O0IA 1CVJA 3MFHA 2NQPA 3DLKA 4LBPA 5D4LA 3HP6A 4GC6A 1RWUA 2BE2A 4ZPTR 1P8GA 4MKVA 1UWAA 3SIPB 3PIOQ 1G2EA 2AJ1A 4NYZA 5E3CA 2J0XA 1K9MT 2JX2A 2E44A 2BXJA 3FBEA 1UAWA 2YNIA 3CTRA 1FE4A 2BE2B 3EM1A 2ZM6F 2HNDA 1D09B 3GG0A 1ZYQA 4USWA 4U6PA 1FNMA 2VFVA 2N7CA 3VAIA 4F0HA 2HIYA 4DV4J 4IRCA 2PFFB 2YWKA 2E7XA 4DX5A 1BQMA 1T3NA 1RWMB 2MTLA 4MMOA 1P9QC 1RHKB 1LNQA 1M1HA 3LP0A 3T6JA 1S6QB 3R7BB 4A8OA 1NKCA 3DRSB 2IC3B 2IDEA 4DR4F 3D6FB 4X84A 3LAMA 4KIAA 1QY7A 1R7IA 2FLOA 2LEPA 4NOHA 1L3KA 3ETOA 3OL6A 4YUDA 3PYFA 5HO4A 2DGWA 4M63A 1EHWA 1Y7PA 3RJMB 3UN5A 4LFCF 3KLHB 4HHUA 3T1HJ 3G9CA 2N82B 1HYSA 1VQ9S 2RQKA 1H2UX 2V4JA 1EJ7L 3FCVA 4KTQA 3CDBA 3FFIA 2CQPA 2H5IB 2NUUG 4NPOA 4OZJA 4B08A 2E5IA 4YN3B 3AD9C 5D3GB 2J6TA 1JLQB 1HFEL 4FNHA 3QRPA 4HHJA 2F9JA 5U47A 3V4IA 3RB4A 1QAJA 3LP0B 2HFNA 2KVIA 1RDRA 3NWRA 3QFWA 4NLUA 4QWAA 3ICLA 2MQPA 4QU7A 1JLBA 5K20B 1AUDA 4X62F 4KQZA 3IP0A 1O8BA 4DU7A 4J7CA 4YDDB 2ACYA 2P6SA 5C24A 5A6PA 4ED1A 5DDOC 3SZ2A 2A18A 1KLMB 3NMRA 3C16B 1LWCB 4RBVA 5DLFA 5EX3A 4G1IA 3D0HE 2UXCF 3MUTP 1NK4A 4X64F 2UXBJ 2XZDB 3BV8A 2HQIA 4CYUB 2LDIA 3MOJB 2KVQE 2GVZB 4H4KC 1RA7A 2VD3A 4NLPA 4CI0B 1FD8A 5IFMA 3D28A 2RKIA 1TMMA 1Q79A 1FX4A 4AT1B 1KQFB 2WTFA 1ZM3A 4DQSA 2GIRA 2DISA 1FEHA 3NGSA 2DBBA 2MQLA 3FFIB 1MMLA 3TWZA 1RE1B 1JQGA 4C0OC 4XPEA 1NK5A 2FJVA 4J9UE 3HD1A 1C1BB 5HSPA 2BE9B 1B64A 4I7FB 4YB7A 1N88A 2AF6A 5L9NA 2KO1A 3GIJA 3I31A 2C2NA 2FZKB 3MEDA 1H73A 4WXWA 5SUHA 5L46A 1UJ4A 3AQPA 5C25A 5DQGA 3HT3A 3PHTA 3HXMA 3EVMA 2JFKA 2YX7A 3KLHA 1U1KA 4PQUB 3DNCA 1PJ6A 4MK9A 5GMDA 1OS5A 1RWNB 2VUGA 1EP4B 3QT8A 3T1HF 1UVIA 5L8RC 1RUSA 2LMIA 3T5LA 2PDAA 1U1QA 3HHKA 3I4HX 1A9NB 3GV5B 1R6VA 4DZ6A 1VBYA 3BEGB 4ED8A 3CUNA 3ILOA 3L95X 1NH8A 4KKOA 4ZPVR 4DL4A 1ZBTA 5ETPA 1T02A 1QDUB 2Q6BA 4G1QA 4KR0B 2C2KB 2P9GA 2GVDA 2JEGA 4DV1F 4PAAA 3PYDA 4I64A 4DV0J 1UW9A 3H5UA 3LP2B 4NZ6A 3H4DA 5KFRA 2J6SA 1TQLA 1HBMB 1RBOB 4B17A 2FJBB 2GIQA 2YNGA 3M9OB 4MJKA 1FHTA 2JRSA 4Y2MA 4Q5VA 1Y0HA 5A76A 2HBYB 3AY0A 4LQ9A 4I56A 1S6PB 4XO0A 1DARA 2NUHA 1DHMA 2MZ1A 1Y00A 1ZAVA 3NGDA 5A8KA 4C8ZA 1J2VA 3LW5C 3CB4A 4P72A 1NBEB 3V4IB 3Q24A 2DRDA 1OY8A 3NAIA 2V4QA 3DU5A 2QT7A 1HNVB 2LQ8A 4J9NA 1RTIB 1M5KC 5K14A 3ZTQA 3B78A 4RWXA 3RW6A 1N48A 1FNOA 4F0MA 4DV3F 1C1BA 4K0KF 1APSA 2CJXB 1GXTA 4O3QA 1VQ8S 3EZOA 1HI8A 1GMUA 1OSDA 1IBKF 1X31C 4O3PA 2VU5A 4F4XA 1HNXF 2DR5A 1HYSB 3Q23A 4DSIA 3D54A 4KPCA 4DQRA 3DKDA 3TA2A 3W5XA 3PV8A 4TU9A 3VQSA 1NSAA 1OJ4A 1NZ8A 3OVSA 4HHHA 5HJXA 3MR2A 2HZVA 2BJ7A 1AXQA 3QT7A 4HVZA 2QEXS 2ILYA 1JK9B 1FK9A 3SCLE 4R8UB 6FDRA 4JOUA 3V4MA 2B9XA 4BS2A 2CQ0A 3KTQA 4IUFA 4NXNJ 1H7XA 1J5OB 4EMDA 2XSJA 1AYEA 2HHHJ 4KHRA 1Q8LA 4ZP9A 4DSKA 3IS9A 5FD1A 4JV5F 3NMAA 1TVRB 3FDSA 1T03A 3Q8SB 2BBEA 3WQPA 4NLGA 5D8HB 2WCXA 4LSNB 3UDEA 3BGRA 2W4CA 1D8YA 4ATNA 3HHLC 2H4WB 3CT9A 5AXKA 2DGXA 2W7AA 5CQGA 4DV1J 2CQCA 4A8YA 1W7WA 3IBWA 3K2YA 4TYBA 5DO2A 4F04B 5M2PA 1BGXT 1FRJA 1Y3KA 2J8AA 4ILMA 3BN4A 1TMJA 2CQGA 4MKBA 1RWKB 1NDCA 1S9GA 4OYZA 4WPAA 1VLYA 4I2PB 4KC5A 4S0MA 1KQSR 3GZ7A 2HFZA 2DGSA 2DHHA 3FEXB 3P3DA 1CULB 3AT1B 5CYQB 2XI2A 3OFHA 1Q78A 5A8RB 1IBMJ 2BJ1A 3QNWB 1F9FA 2E1PA 5L1IA 4YMEA 1KP6A 5K8NA 2HFUA 4MFBB 1NH7A 5KG5A 4RZRA 3UDCA 2AX1A 3EWGA 4CH7A 1I3OB 1YZ6A 4Y65A 2XMJA 1N5YB 3N28A 1NJIT 2VDHA 4P2FA 1OIAA 4YEAA 4DL2A 2B6AB 1FWLA 2HK2A 2YVSA 3MEGA 4KV8B 4QBUA 1YI2S 1OYDA 4IFVB 3T5KA 4DPOA 3KK2B 3DHWC 2BJDA 2ZH2A 2DXDA 4DR1J 2XY7A 3FBCA 1WI6A 2OTJS 2XI3A 5J2MA 1I6JA 2COLA 3I5BA 4DMZA 1CS4B 4NI2B 5DZ6A 2ADBA 3UE2A 1NB2A 2BJEA 2FDNA 2MKJA 2R4FA 2R2RA 1X4BA 1W25A 4DPUA 2C28A 4FVCA 3TNVA 4K8RA 1NU4A 2FVCA 4QYRA 4ZVQB 3KFWX 2EBGA 3N4WA 5LM7E 3VAHA 2FB0A 1SJQA 5J1EB 2N3OA 4YY3J 4LR9A 2UP1A 2QLWA 3P5TL 5CYMA 3DRPB 3FMBA 3IR7B 3MMBB 3CDAA 3W7BA 2V0NA 3GQCA 1RTDB 3G86A 1IKVB 3SV4A 4LFBF 1GH8A 1Q5YA 4RNMA 4DL3A 2B5JA 2J76E 1I94J 3BS9A 4K4ZA 1QD1A 1HR0F 1NK9A 2XO7A 2VG7B 3BQ2A 1S5ZA 4AXJA 2XMWA 2MY7A 3UNGC 2VG6A 3AB4B 1N54B 3CJTA 4DUZF 2J7WA 4LRAA 1BQNB 3DRPA 1R8BA 4C4WA 4KT0C 2MZRA 3MPUB 3KOAA 1RT5B 1OO0B 3T9ZA 2RHSB 2ZH9A 2RUGA 2YWHA 3C66A 2VQEJ 4H4OB 2MQMA 1VQ5S 5KFQA 1S76D 3ZZRA 2ZHAA 2HWHA 1WC5A 2L9DA 3PR5B 3TANA 4WIQA 1TL3B 3MAAA 5KTQA 4B9LA 4ECSA 1LOUA 3PNIA 1V5VA 3MM6B 5CYMB 3THVA 3MF5A 2C3OA 3UFCX 2VJUA 8RUCA 4DR7J 2XMTA 2DITA 2ZH4A 1OMSA 3M7VA 3TQ1A 4ZDNA 1FFWB 2FGOA 3HK2A 5BYRA 2RE1A 1S12A 4K4YA 1L3UA 3CJ4A 3QIPB 2KFZA 4ZP6A 4A8MP 4GMKA 2R8KA 1RABB 1RHUB 5KT7A 3W2VB 2R7WA 1LWEB 2B7BB 2CRLA 1FVSA 3M2RB 2E1MC 3H90A 5A8RA 3WX4A 4JI4J 2XYPB 2LQ5A 5HK4A 3G96A 3SFUA 1R8CA 2FHJD 2GCFA 2HPUA 2WOMA 2VQFF 2VIHA 4ECUA 3RUBL 1RSCA 2ZBPA 4OJHA 4JI0F 3MUVP 2YPYA 2BQUA 4D3GA 2MSTA 4OI0A 2C3YA 3N9UC 1FEEA 1NB7A 4PRFA 3SMZA 4EO6A 3EMTA 2UV8G 4BC7A 1VQKS 1BLUA 3R6GB 1X5SA 4QR1A 1RCOB 5D0RA 4OZLA 3THTA 1NAQA 2SXLA 3HSGA 4LSNA 3G8TA 4EBDA 4GVLA 5L38A 1SJ3P 3JTNA 4OZ0A 2K1RB 4FYYB 5CYQA 1FWKA 1K0TA 3KLIA 4IQMA 1XMQJ 2KYXA 5DDPC 2N4DA 1TK5A 2PI4A 5C2CA 1AFJA 1B7YB 2EXUA 3AJ2A 3OJSA 3HI9A 2WBMA 3FC9A 2XM3A 3G6XA 5DG8A 4I2QB 3Q2TC 4LF7J 5J2NA 4L6V3 3GYXB 1ZS6A 3ISZA 2QRRA 4JI1J 3KNAA 2AJ4A 2ACMA 3D1HA 2Q3PA 3IM8A 3IAM9 4N77A 2MDAA 2FJXA 2WSEC 3LQVA 2FTRA 4W92B 4PQUA 1KVKA 4MKAA 4KSEB 4CLSA 4RUAA 2E7WA 2QLJB 2HQ3A 4KBIA 2DNLA 5CA5A 3LWLA 3EGWB 1NDLA 3DLGB 4LF9F 1AT1B 1ZPVA 2F1FA 3CWJA 5KFTA 1HQEA 1Y3JA 4HDGA 4ZJLA 4QPXA 1NRKA 4M5MA 2OLWA 2Y1RI 3K57A 1WTBA 1RT1B 3HFVA 3PDNA 4F0KA 4B9VA 4DUYF 1REVB 1XMBA 1KDNA 3IGVA 4N8OA 1JLCB 1K47A 2AZ3A 3UCGA 5KFWA 3VV2B 3SQOP 2XCAA 2OEMA 2CFXA 1ZAXA 4OI3A 5A8KB 4ID5B 3NP5A 1EETA 1EZZB 1NHUA 1JLAA 3IG1A 2KT3A 2L9NA 1X9MA 4DJBA 4I67A 4OHYA 2LA4A 4RX6A 2G2OA 2OELA 1U0HA 2HKEA 1HQEB 1R0AB 3VZHA 1Y9OA 1N8RT 3RRKA 4P75A 3TZYA 4MKYA 3Q8YA 5GMEA 1HBMA 2DXEA 3FQKA 3QIDA 4PG7A 2DK2A 3SCKE 4HTJA 2XZTB 1BE4A 2P9EA 3ELHA 3OXGA 3SSRA 5AJ3F 2ZC3A 4ZVSB 1QE1B 2CVEA 4K4SA 2LLZA 2XULA 4OI6A 3R3TA 2XMUA 4J90A 4K2JA 4JI2J 3ENVA 4NA3A 1FCAA 2DNKA 4GKJJ 3KUHA 4PXCA 4Q0BA 1AW0A 2DY9A 2WONB 1N33J 2IVYA 1VQYA 3HVRA 1N0UA 3BGUA 4UUWA 3J7Z5 1GFWB 5M2RA 3V6JA 4RW8A 4CLFA 2GMLA 3LP2A 4LRDA 3UCUP 5ETQA 3CULA 1SB6A 2ZH3A 4DR6F 3GCWP 2DTJA 2BQRA 4U95A 3KMSA 2MMYA 4FF2A 3RG6A 1N5TA 4KHPJ 2HLUA 1CJKB 3Q8UA 4FDFA 4IR1A 4FN5A 3I4PA 1R6YA 2DY1A 1TKTA 2MJNA 4LVNP 1R8PA 3JYTA 4HKQA 4DI6A 3RRGA 2FVPA 3JQJA 5JMNA 1VLOA 2JSXA 3NCRA 4TNOA 4WFAQ 4K59A 2MLZA 4TY9A 3K0JA 1PGZA 4JV1A 3QZ7A 1GMVA 1FJGJ 4X4OA 4DSEA 1C1CB 2FLNA 2RH3A 1T3OA 3DOKB 3KHHA 3FEZA 1U1OA 2A2CA 3GE9A 4WK1A 1UTAA 2GX8A 2CJBA 1RI7A 1X9WA 1JJ2R 1ZPWX 2UUWA 3EE3A 3G6ES 1VK3A 2FC8A 2QIFA 4AL5A 1L3VA 3OTOF 1FRKA 5GAGI 4L3NA 4PXDA 1P9YA 3OD2A 2IM0A 3TO8A 4CZCA 5LSLA 5CABA 1ITPA 4FYDA 3RB6A 1DFDA 3CJ0A 3NGKA 4P10A 3IWXA 1NSQA 4ANDA 4WYLA 1KS2A 2X7IA 3DOLB 4USJC 4CLYA 5DG9A 3BO2A 5AXLA 1IKYB 1IBCB 3Q0AA 2KM8B 4YOEA 1HKAA 1VQ4S 5HI7A 1NJYA 3BH7B 1NHKL 4CO2A 1S97A 2IRUA 1F60B 3DLJA 5T7LB 1X60A 1T9UA 2OMOA 4EZ6A 4PUOB 2QSFA 2CADA 3Q8VA 2GJFA 1VRTA 2AJFE 3C16A 3D68A 4Q2MA 4C11A 1QSLA 4DXLA 2E1CA 3B82A 2M8HA 1HHSA 1RTJB 4CM2A 1XMOF 4OYOA 1XR5A 4G6VB 4O3RA 4PZVA 4H54A 3W66A 1TL4A 4DR6J 2YX1A 1KR4A 4RWWA 3TJAA 1SL1A 1OY9A 1FF2A 4DR5J 2B5JB 2QJ3A 2IAJA 1HWKA 1FVQA 3CDUA 1I94F 2C2ZB 1UZHA 1PBAA 1WF2A 3TR5A 1KRPA 2HNZB 2QGFB 4USIA 2R8HA 3OFGA 3C19A 3I5CA 3A1YG 3MWBA 5LXRA 4OX9F 1HQ2A 2X1BA 2XSJB 2PI5A 4ELVA 1GMWA 5LMUF 2Y0BB 2ZZMA 4YY3F 3BM7A 3HHEA 3A3PB 2KFYA 1FFGB 2DH8A 2HBQB 2OPSA 4FYVB 1RWXB 5KFOA 1U26A 4M5HA 3J81j 3TJ9A 5LXYA 2V6AA 2JLGA 5KFIA 2YNIB 2HAIA 1HWUA 1U2FA 1Q8KA 4M5IA 4CO0A 3G6VA 3AOCA 3FMWA 3CCLS 1S1WA 2XWXA 4H4OA 1E6VA 1QVFR 4DV7F 1S9GB 5GAGU 2IBKA 2BM0A 2NZ4A 2CWKA 1KSPA 1TP7A 1BQMB 3BGLA 1WC3A 3EVWA 1Y4ZB 3KG0A 1RLCL 5KT6A 2HHQA 4W98A 3BB5A 2E1AA 3BF4A 3CMES 3RAXA 4ED3A 2FHKA 2YNFB 8ATCB 3CDWA 4MTPA 3V6DA 1NSPA 3N79A 2FHOB 3FCHA 4QPTA 1R8HA 4ZVRB 3C14A 3GSIA 5HN0A 4CH0S 2YXLA 3FBFA 3MR6A 4AL7A 3CCQS 3GCXP 1DAXA 2GZOA 4WU2A 4NYOA 3EVOA 5KT2A 4N7TA 4C8YA 2HVIA 1N5VA 3NAHA 1U7LA 4H4MB 4ANCA 1JNZB 1S9FA 2KHCA 1S77D 5IM0A 1CJTB 3QJLA 3WDOA 2DKOB 1K0VA 2XG8A 1D0EA 1LWFA 2OFGX 3KUGA 4KYZA 1LV5A 1G7CB 3DGPA 3A8IA 4OZ1A 1LQ9A 5EUHA 5KFLA 3NGRA 1T9VA 3CO0P 4X4QA 2LFVA 3J7YU 5CD4H 2LU2A 4C2MA 4TYAA 3CCSS 2O3DA 2NZCA 3TVZA 1KFDA 2BA9A 1RAJA 4M5DA 4NL5A 4IOAQ 2AGQA 2JDJA 2GGPA 2BW7A 3X3UA 4WZQA 4CO5A 1GK8A 2P5VA 2VB6A 4ZVTB 2WK4A 1FK9B 3VWSA 4F26A 5HMXA 5LSRA 2C2RA 4JI4F 2BJ8A 1FDNA 3D7SB 4M5NA 2M70A 3OL9A 2GQQA 2F65A 5D0GA 4CT9A 2X1FA 1BY9A 3GIRA 3F73A 1JLEB 3SV3A 3W61A 4ZIVA 4H4MA 1EKRA 4K50A 5IT9U 3C6TB 2F8MA 1T05A 5KFAA 3MPWA 2Y1IA 1QTMA 4LJMA 4M5JA 2MZTA 1JLGB 4CLPA 3I0RA 1V3ZA 1SQGA 2JVRA 4C8KA 1S1TA 2AX0A 1NMEB 2KI2A 4P71A 4USUA 3MCNA 4CLLA 1RAGB 1B0PA 5BJRA 3E51A 1N34F 1U47A 2NCKL 4O4RA 2FY1A 1UETA 1I5OB 1WJ9A 2I8EA 1FERA 1MU2A 4NLVA 3PY8A 2XWYA 3I0SB 3PCOB 3KLGB 5IWAF 5HLFB 1OY6A 3QJPA 3PKMA 2YKMA 2GVZA 3Q83A 2B56A 2L08A 2RJZA 3PFOA 2MKSA 5IOLA 4OX6A 4JI1F 2QTWA 2EFQA 2FLPA 1FXLA 3QBCA 2OTLS 4CTAA 3RBXA 4N5SA 3NBPB 1XWLA 1H7WA 2ZNYA 4J9RA 1VBXA 4WF9Q 3DCAA 1WC4A 3L7UA 5KFDA 3G87A 4UOCA 3DYAA 2I9SA 3JXOA 5HBMA 2OD4A 1JLBB 2CPYA 4F7VA 2R2SA 3KJFB 5HANA 3WZ0A 3RR8A 2DCUB 2C3UA 2OSRA 3CW2C 4P7VA 3W9IA 2NXNA 4QWEA 1N36J 4ZCMA 3J7YI 3U1MA 4QJVA 1Q5VA 3LAKA 4B3MJ 5I3UA 2MEWA 3SXLA 3HSDA 4F2SA 2UUAF 3HFKA 3W9JA 5ETOA 1B4SA 4IYQA 4AFFA 3E8OA 4M5LA 2CQBA 2R8IA 3M8RA 2Q6CA 2ROPA 4IH7A 5DDQC 3H2UB 3OR1A 4CWBA 2P9CA 4OX8A 1C4AA 3PJWA 3T19A 3J7AN 3QRRA 1RBAA 3NOCA 4DCPB 3OPKA 1KQGB 1LK5A 1MG7A 2WVEA 3E01A 4DOZA 1U2CA 3CE8A 3PM9A 1S0NA 2EBEA 2UXCJ 2BX6A 3CJ8A 2NYIA 2MGZB 4DN0A 2RUSA 2Z8QA 1AZSB 1RT6A 5IZHA 1VQLS 3DMJB 1YKWA 3I56S 1IKYA 4NLQA 2ASJA 4B9UA 3ZZ0A 5E33A 4B3OA 5KG3A 1N33F 2IMOA 3I0SA 3KLGA 3K5PA 2W1BA 1IWGA 2YKAA 3C6UA 2AHOB 2J7KA 4KAIA 4U8VA 4DG1B 2M88A 5IXUA 5F0WA 1FRLA 1NEEA 1QE1A 1R3NA 2R2UA 1JX4A 2F63A 4RLEA 1U2RA 2OP5A 4NX9A 1RT7A 1TU0B 2QMXA 2RU3A 5H1SV 3CCUS 1HWIA 2XMKA 2Y1JA 1OYEA 3WIUA 3IRXB 5IQ6A 4FVMA 2W8KA 2DO0A 2Z57B 2KT2A 1T7PA 1SPBP 2IHR1 2FHJA 3K5LA 5HAOA 3W3SA 1TFYA 3OSNA 3CMAS 4WFBQ 1VS3A 4DPTA 1N6QA 4NCBA 1TK0A 1RAIB 3RU0A 1X5TA 1TL7A 1WI8A 4X4NA 2XNQA 4LSLB 4MK8A 2L41A 5F9NA 3J7A1 5C42A 2DRAA 1ZZNA 2IA6A 3UD5A 2JC1A 3W1YC 1LW0B 4LIRA 2MQNA 3EXCX 1Q82T 1BC6A 2VG5B 3HCXA 1V9OA 4CO1A 1SIWB 4FXWA 2J8SA 4NMLA 3UDLA 2XMAA 3T1YF 3H5XA 3RYLA 1FKPA 1VHFA 3PKYA 4ZVPB 2HK3A 1U25A 2DXFA 2CJKA 1DJ0A 3MM8B 3R5CA 3E3XA 2KKHA 1WELA 5KFGA 4J9SA 3MMCB 3R5GA 2QYGA 4F67A 2PN6A 2ZE2A 1RTJA 5AT1B 4ZVUB 4LR8A 4JYAF 3MPVA 3HVTA 1VIXA 1RT7B 3F44A 1HNIB 3VGTA 1URNA 2LXIA 4CH1A 4YS2A 1NKEA 2EFGA 5J2NB 4RNFA 2NXCA 1LXNA 3R2CJ 4PUOA 2ASYA 2A3JA 5HMYA 2XZWA 2NXEA 2CDQA 4C8LA 3F41A 4OMFG 1VC6A 1WTFA 3CD5A 4L72B 4DFKA 5C24B 2Z58B 3WBZA 2W2QP 3JSRA 2PMZD 3FRZA 5K8MA 2GQCA 3U1LA 4WKRA 5E7OB 4ECRA 1NO8A 4J9PA 2CPHA 3DLEB 2QYCA 3QAUA 4WP9A 1XMOJ 2W25A 4I6AA 4DPYA 3TYTA 4CIOA 5C5JA 1RAHB 3ZZYA 2VG5A 4ZP8A 1WG4A 3M8PB 2EKNA 1WOSA 2AIRB 3VGVA 2QG9B 3NGUA 5ETKA 1MWZA 3K59A 2HBZB 3FRYA 2LEAA 3LOUA 5DRKA 4M8LA 3MMCA 1Z2LA 2UZAA 3NCQA 2G0JA 3H42A 1H0HB 3H5YA 4TU8A 4IQXA 1VDHA 2EK1A 4DV6J 4ZLJA 3TZWA 1LWEA 2YKNA 3M2RA 1CLFA 1EX8A 1ZM9A 3DRYA 3PO4A 1U6ZA 1CS4A 3LGMA 4NI2A 4ZLNA 4ZJQA 3NS5A 5L1LA 4IDKA 1RTIA 2VOOA 3NS7B 3G6YA 3VAJA 3HULA 3DM2B 3FKBA 2LKZA 2KYZA 3DRSA 2GHVC 2M9KA 2HG4A 3O5TB 3DYAB 4RW7A 4DZDA 4RBTA 1YZ7A 5L9XA 5HVHA 3PEHA 4RW8B 4LFCJ 1FKOB 2G1HA 2M2BA 3CDEA 1BHNA 1JLFA 2XCPA 1AZSA 1RT6B 2CPDA 1KTQA 3PW4A 1XNRF 2GQ2A 4IR9A 4CNZA 2DH7A 3GP9A 1LFPA 1UA1A 2DRBA 1YJNS 2YX4A 2ZDPA 4NZ7A 1N0VC 1UKUA 3VHQA 2E9TA 2EPIA 1JB0C 2Z2LA 5H9EJ 2HHSA 2VOPA 1PG5B 5F8HA 1ZTTA 2PGCA 5LMNJ 3AOAA 4YB1P 2CPEA 4IRDA 2EVZA 1FI4A 3M8ZA 4HACA 3CPWR 2OI2A 1T8EA 2HNYB 2C2MB 2YPZA 1SV5B 2GV1A 4UY8T 4LF8J 2HWIA 2V2VA 4PQAA 2QLFB 3I5AA 3UN3A 5L1KA 2H1YA 3X1LB 3QSYB 3N6LA 3M4XA 2ZVIA 3KLEA 5I3UB 2U2FA 3HHLA 2BMBA 2HEKA 4RNOA 2VHGA 3EPIA 1SUQA 4OJ3A 2ZH5A 3FCWA 2MHEA 2CJQA 4ZPBA 1HNWF 1WHXA 1GMWD 2RVJA 2XTJP 5I3QA 5I42B 2PA3A 3HF5A 3L9ZA 3A12A 2D9PA 4LFBJ 4OI2A 1SXLA 3QSIA 3JSMA 1N34J 2CNLB 2QX0A 1IJFB 1LW2A 1VI7A 2GMJA 3LTOA 1HR0J 4Z37A 4DV3J 4FNIA 3Q2SC 1XJWB 3PW5A 1CJUA 2HS0A 4LUBA 5KFFA 3N6NA 1Y5LB 4ZCLA 4B3RF 5M2UA 5GADI 3OXLA 5KOWA 1UVMA 1IQTA 3JB9k 4FS1A 2YKQA 4RUHA 1PSDA 2EW9A 2OO4A 3TRGA 2BANB 1RT2B 1FX2A 3AD8C 4G65A 2RDJA 1J27A 3MR5A 4Y00A 4IG3B 4LF4J 1YWXA 3CCTA 2IVFB 5C2GA 3H2LA 4I2QA 2ZHBA 3VCDA 1VQNS 1GNKA 2V4RA 2J5AA 4IG0B 1U8WA 2UUCF 4UQTA 4Z7YA 1TKTB 1N56A 4B9TA 1PILA 3IRWP 2KXFA 4Y2CA 2CNNB 4D3HA 1N5SA 2ZKTA 1ZH5A 4U7UK 1XERA 1TK8A 1HNXJ 4OZ2A 3P49B 2CUYA 2DNMA 4ZS6A 5E3PA 4CRJA 4UT4A 3GILA 3K89A 4Z7CA 2K1RA 3CIMA 3LF0A 4NYPA 4XAKA 3CXCR 3A3OB 1H72C 4HH1A 1EKSA 2EI5A 2ZBRA 2LP4A 3P5BP 4HI1A 4PWWA 2HVEA 4ER8A 2HMIA 3M9MB 2W4DA 4FPRA 4HT5A 2E5HA 1REGX 3GR1A 4O44A 4C6AA 3MM5A 1S1VB 2GHWA 2MY8A 4OYBA 3H20A 3ZTPA 3KJQB 2HS3A 3BPSP 2DNZA 3MI7X 5CCLA 2H54B 1FXRA 1B70B 1XR7A 1LK7A 3FBBA 3HFZB 5D6GA 2V4JB 3OVBA 2FGCA 4DR7F 2W2PP 3G71S 1WNEA 3NLCA 2G13A 4Q43A 4CLTA 4DV2J 2P6TA 2QLBB 3NGTA 2DNYA 4UOFA 3V2UC 3KG1A 2QFJA 3PX4A 4K0KJ 3CD6S 3T1AA 3FSYA 2ASLA 2LDYA 3PZPA 2MQQA 2DVIA 5BXIA 1SJFA 1HBUB 2N4CA 2D1CA 3D2WA 1SJ4P 1RTHA 1KVJA 4ZHRB 4ZVHA 4EU0A 5HQ8A 2OHDA 3R2DJ 3O44A 4USMA 1Q7YT 4R5PB 1NDPA 2HSEB 4GC7A 1FA0A 1I1GA 2ZEJA 1UPPA 3G2XA 4ZOSA 5KG4A 2DNHA 5FIIA 3ZNUA 1IBKJ 3KJNB 2JEIA 1C0TA 3OL8A 2AGPA 3CEDA 1TZ0A 1CULA 2CQ1A 2ZFHA 4A8XA 3GIKA 5I42A 4PXEA 4ZITA 1JJ4A 3EDQB 3UWTA 2DJWA 1C4CA 5BR8J 1LWXA 2VICA 4JV2A 5D0HA 3GG1A 1SC6A 2B8PA 2DNNA 2OFHX 4R0JA 4ED7A 4C11B 2VASA 1JNRB 5F8JA 5GAHU 3CGIA 3QATA 3S01A 4K7QA 1SJRA 4EO8A 3MAQA 2HFOA 5J2PB 1HA1A 1QTNB 3F56A 1NNDA 1VJQA 5KFYA 1KONA 4C3LA 1C0UA 3BYPA 4WE1A 1YBAA 3WX8A 2HHHF 2NR0A 1RTZA 1X9SA 2A6MA 2G2YA 2XYHB 2AMCB 1B3TA 3CMQA 3D5MA 1S79A 2OD6A 4URQU 2G0CA 2F4VJ 1D1UA 3J81U 3CC4S 4KY3A 4F3QA 3TVKA 4UQGA 1T9XA 1D8ZA 1UPMB 3IXQA 5DLGA 2Y8YA 5CCMA 4OZNA 5EHHA 1RJJA 3IGNA 1DURA 3MXHP 4DL6A 4X2BA 2RRAA 3TAMA 3I9ZA 2RT3A 4KE5A 3MUMP 4DUTA 2CG8A 1U45A 1HBOB 2G4BA 3WHIA 3HZEA 2H3EB 1H74A 1TR0A 2Z2MA 2ZWPA 3DDNA 3I96A 3LA0A 5A0YA 3TVYA 4X65F 1YHQS 3TAPA 3MM9B 3VR1A 2VFSA 4ZPDA 3KK1B 1SVDA 2DPIA 3EICA 2VH7A 1O0PA 4I1TA 2YWWA 2UUTA 2FJEB 1H2TZ 1N5YA 4ZP7A 1UEVA 3T6BA 4LF5F 1YJVA 2D3OR 4ZCKA 1Z1ZA 4ILRA 2BJ9A 1VRTB 3MGJA 4WK3A 4YP3A 1HNZJ 4J5OA 4ZMMA 3ZZZA 5F3ZA 3J80Y 3SDEB 3GPAA 3C46A 4OL8A 1HPZB 3KHLA 1GT8A 1S6PA 2IYGA 1M0SA 2OKQA 2Z30B 3DDIA 2KXNB 1HWJA 1QSSA 2B7CB 4B3TJ 2KB2A 3SQGA 2VQFJ 5HL7Q 5EWEA 1TL3A 2G9OA 1KHWA 1YJTA 1UVNA 2AYMA 1HIYA 3K5NA 4WP8A 4IOCQ 2J0SD 3DRXA 4NLRA 2PA8D 3DI6A 2L9WA 2AV5A 2HWTA 1S1WB 4TU7A 1TKDA 2K7JA 1IM6A 5H9EK 1RT5A 1YSJA 2YQ0A 1SKWA 2BOPA 3CNQP 3UCZP 4N76A 1RADB 4CLUA 2RSQA 3LGHA 2YH0A 2E9ZA 3KJVB 4V1Ak 5AE1A 4NASA 2VODA 2C3PA 2V8VA 3A13A 2RAQA 4KKOB 3R9LA 1ZM2A 5KG0A 3DOMB 3DMJA 2ZM6J 2W9CA 3POTA 2GAHC 5EN1A 2WZ1A 4K4UA 1WKKA 2ATCB 3SI8A 4PWDA 3LGNA 3AJ1A 3GR0A 3BSAA 5DJBA 1WEYA 2HQDA 3S8SA 1RA6A 7FD1A 3DLHA 2CNKB 1NHVA 4U9RA 3BJYA 1OSCA 1M5HA 3K8WA 5FJ4A 1EP4A 2L48A 5K8OA 5E0OA 4DBQA 3OHAA 3RAMA 4OIXA 2ALYB 4AD6A 4X66J 3RR7A 2DEIA 3DOKA 1X4DA 3JTOA 4EK2A 2RNEA 2YKOA 4HEA9 4DUYJ 4NWBA 5DETA 2BJ3A 2JHEA 1DTQA 1VR6A 4WKYA 4WWSA 4R5PA 1CQMA 3V6KA 2UVWA 2EG2A 4JI8F 1WEZA 3CVKA 3M05A 4NLXA 3Q22A 2HRUA 4KJIA 1VC5A 4DN9A 1S99A 4PG6A 2E5GA 3FK4A 5D77A 2F40A 2VKZG 3W8GA 3HSJA 1X5PA 1HW9A 2A0FB 4AQYF 5LSOA 2LVWA 2B8QA 2HFSA 3R5BA 5HBMB 2CDRB 2YWFA 2AQ4A 1QM9A 4F3MA 6AT1B 4EYIB 1F6TA 4YHHF 2UVRA 3MM7B 4YB6A 4MFBA 3OUYB 4DR4J 3K8VA 2HRYA 3IRXA 4CTAB 4E98A 1WKLA 4O23A 4YR3A 1C0UB 2ZHOA 3RRHA 1MSWD 4A48A 3MM7A 1NK0A 3C3LA 2HLTA 2K3IA 3EGNA 1UCNA 2GVDB 1RP5A 2GC8A 2V2ZA 4DG1A 4FP9A 5BYSA 4J9KA 4F50A 2A6OA 3NG8A 4EBCA 3ISNC 5DZ7A 1FXDA 4GO5X 1FNXH 2VDIA 3MZIA 2VL1A 1CC8A 4BCAA 3UDVA 2RB7A 5KFVA 1YJ7A 2XNRA 2MJUA 3OLAA 4KFBA 1TV6A 1FO1A 1RAFB 3OR2A 1NKBA 3MFIA 1RCXB 3E01B 3GLJA 2BDPA 2HVHA 1SIZA 2E29A 5B0FA 2RRBA 3DLGA 5ETVA 3C6TA 3TX0A 4ECWA 1T05B 5F8LA 4WU3A 4NXMJ 1UW4A 4K2XA 2AW0A 4RBUA 5DDRC 4ID5A 1RHRB 1X4FA 4OYXA 3ET6B 1Y11A 4JB8B 3MEDB 4AUKA 5B0BA 3HPOA 2IM1A 2OPRB 3GJTB 1U6BA 3PW2A 1H6KX 1RT2A 4Q8EA 2IYIA 2M7SA 3TUPA 1JMTA 2CXEA 2HS4A 3CO9A 2LQBA 3A8KA 4H4KA 2E9RX 1Q8IA 3FEYB 4BC9A 3QFHA 1W26A 2WONA 3ZO7A 4HI2A 3O3LA 2FQQB 1MWYA 2RKIB 4PPZA 5CHCB 2KZZA 2R7XA 1Y10A 1NPRA 4FXVA 1V6HA 1S49A 3OR2B 1T94A 1KQKA 5A6WA 2HYIB 3MD1A 4AQYJ 2DHXA 2VZ9A 4CO3A 3UW1A 4NLWA 2YNFA 3V81A 1KLMA 2QL9B 4QIFA 4ZCIA 5EWFA 2DD8S 1DQAA 1MROB 2W2MP 1U48A 4DQIA 1GTEA 3ZNJ1 3I87A 2Z56B 1IR2A 3SSQA 1KHVA 2GS8A 2VG6B 4FF1A 1S4FA 2D3O1 2C2OB 2PFDA 2Z0GA 2ZJPQ 5KT3A 4PG4A 2X3DA 1VQMS 1RB0A 2BR0A 3DXSX 4MIWA 5HMZA 1JJHA 1X4AA 1IKVA 1M1GA 3IWLA 2RS2A 1WSRA 1ZA2B 4FF4A 3HHNB 2E66A 3GIIA 2HVZA 2Q43A 3PW0A 2VPYB 2KXHA 4ENOA 1S48A 5IT0A 4OHWA 4G1QB 4ED6A 2HHWA 1RT4B 2U1AA 4J37A 1IN0A 1AROP 1OQ3A 2NSCA 5ITHA 4N56A 1RKIA 5DGAA 4ZHRA 2C1EB 3BO3A 9ATCB 3GTYX 1NPKA 2BUNA 4RKUC 2WAQD 2PEBA 3CCZA 2XMVA 4C98A 2UUCJ 1A6LA 2HQGA 2FUG9 2K2PA 2K8GA 3D6MB 2AYEA 1Y5NB 3B8HA 4O4GB 1CSJA 2O1PA 3HX9A 5IV3A 4OX9J 2I1RA 1KKHA 3PHEA 4QR2A 3U27A 4DCOB 4JI7J 1T95A 5RUBA 2I6WA 3AA8A 3CD0A 1KBRA 1Q0NA 3D0GE 3QWPA 4WJBA 4IO9Q 2B4OA 4I7FA 1FKAF 3SEOA 2QL7B 3R1HA 4RPFA 2AYGA 2A2DA 5LT5A 3W63A 2CQHA 2FC9A 3W2WB 3R7SB 2H65B 3DFEA 5CH7B 1XNQF 4KB7A 4BBYA 2D41A 4WYWA 2W9CB 4C0HA 2OIHA 2WSCC 5A8WA 2N3LA 2AJQA 1SH3A 3CJ3A 3OFFA 2PSZA 1Y5IB 3PYEA 2RQMA 3QO9A 4FYXB 3VGUA 4XIUA 1GAOA 1N36F 3H7HB 1WHYA 1OQ6A 3QGHA 2XGPA 4A8KA 3D3BJ 3PVXA 1HD1A 1SC3B 2LQJA 4HTIA 3IN5A 4I6YA 2VBZA 1IUJA 1M5SA 1DZ5A 5ETRA 3OUYA 2DHSA 3KK3B 2VBYA 3BDPA 1WSVA 1P1TA 5B0EA 4IG3A 2DNGA 3FVYA 4RW4B 3VAFA 1C1CA 2XS5A 2OEKA 3OTEA 2B51A 1UMJA 1RTHB 1HARA 4UY85 1RWVB 3MM9A 1X4GA 1SQFA 3MTJA 1CC7A 2K7KA 4CQ1A 1HNIA 2IA0A 3GSDA 3WIVA 4X65J 4DV2F 2OPRA 3IO1A 2V2KA 3L7PA 3QGIA 3EPGA 1X0PA 2KT5A 3U7JA 3KK3A 3ENAA 1U09A 5LJ3Y 3H8YA 4PG5A 1G6BA 3P45B 4RW9B 3GIMA 4DR5F 5F9LA 4LF5J 2HQCA 2QMUB 4QWBA 5KFXA 3FQLA 3HHDA 4IH6A 2AT1B 3MMJA 4OYWA 4C7QA 1K73T 4O3SA 1S6UA 3BGOP 3VAMA 4DR3J 4DSJA 4NA1A 4JI7F 4IRKA 1SL0A 2B4VA 2FZCB 2NSBA 3FGVA 4ZN3A 2HZAA 3R5AA 1CBKA 3D4JA 4OQJA 4AE5A 1RK8A 1NXIA 2D3UA 3R5DA 3M2VB 4RNHA 4WE1B 3BGRB 4NEZA 4XDCA 5E3QA 1CPZA 4U96A 1YJRA 2WRMA 4Y28C 2CJ9A 2NS1B 3BKUA 3W62A 2EC2A 1FJEB 2JEJA 1U6FA 1TFWA 4OJ1A 1IVZA 2AU0A 4I69A 1F9EB 3UR0A 1TTHB 3TA1A 3K17A 2CPJA 1ZZFA 2RIJA 2DR9A 3KNGA 2XMMA 3BZQA 3GONA 3PEJA 4NXNF 2CQIA 3ZFVA 4WP3A 4F2RA 2Z2YB 3LP1A 1U0HB 1R0AA 4G3IA 3OQ2A 2XC9A 2HGLA 2QE5A 2MLYA 4ICLB 3Q8QB 2HFVA 2CYYA 1VQPS 2DR7A 1CEZA 2JWNA 4PEOA 4TQSA 2ZDOA 3GWCA 2QL5B 2RQ4A 2FJDB 4DQQA 5DM6Q 4ZJOA 1FE0A 1REVA 1PYSB 5EGYA 4X4TA 3KK2A 2ZBIA 2FY8A 4FKYA 1N4LA 3L09A 2ILZA 2Q1LA 1JXLA 2H51B 3KWMA 3W5YA 1TKXA 5LJ5Y 2GJIA 4R8UA 5B09A 1AFIA 4J9MA 3WC0A 1A7GE 1BQXA 1LW0A 2ZKUA 1SKUB 2ZH6A 1TL1B 4W4MA 1SCJB 5J1PA 3BQ0A 1HI0P 3R6LB 3FNNA 5CZVA 4OYAA 3PO5A 3S1TA 4ZPWR 1E6YA 1F3FA 4QIVA 3HT0A 2VC1A 1MLAA 4DQPA 2J0WA 3K7RA 1YK9A 3ISND 3I9V9 4MK7A 1JXEA 1HHQA 2DYAA 4KO0A 3DN9A 3K5MA 4WTYA 4HLBA 3EX7B 3MAHA 4DR1F 2GJ2A 4Q0BB 2BKPA 1F2GA 1VQSA 4UOHA 4B9MA 3PRVA 2MQ8A 3ULHA 1YJUA 1B0VA 2MZQA 1TVRA 2ZC4A 3KJVA 1T03B 3C6UB 1UZDA 3UO0A 4CYUA 5GAEI 5GAHI 3IS9B 5ETLA 1NJWA 4PABA 1D9FA 3CJKA 4LFAF 2R7SA 2HHVA 5ETSA 4N47A 3D9BA 3EGVA 4O44B 3GB0A 1S72S 3TW0A 3P6YC 2JL9A 4M5KA 4XDDA 2UU9F 3O8WA 1KLNA 2Q66A 1WDDA 1SJ1A 5ETMA 5IT4A 2C3MA 4F3OA 1WF1A 3ILJA 2UUBF 5F0UA 4YQWA 1IBLF 2CPXA 2VKRA 3PFEA 4FYWB 2KM8C 2WOMB 2W9BB 3HVAA 1DY3A 2D9OA 2PEHA 2WW8A 1E6YB 1EAYC 2WW4A 3JTPA 3RBEA 4JI0J 4I0WA 1SL2A 1FDBA 3HKZD 5C25B 4UF4A 4C3KA 4NMXA 1IWAA 3CCES 1H38A 3R7NB 1S9EA 1WDTA 1XTZA 1UWBA 2F8EX 4Y2KA 2MLXA 4I6WA 1J5EF 2OPQA 2QA4S 4JI6F 3NNAA 2Y3YA 4J9VA 2MKCA 4B02A 2V63A 5C42B 4LF2A 2AEFA 4LT6A 5A0YB 1NK6A 1YG0A 3BBBA 3HZGA 3SCJE 4EEYA 3OFEA 2AEJA 2DHGA 4GKKJ 2R7TA 2BKNA 2GO8A 4ZLPA 1K1QA 1F5CA 4ZVGA 4EGLA 4DX6A 1KEKA 4RUBA 4NA2A 2A1BA 2ZITA 4TLRA 3C15B 5KT5A 2V34A 3RZAA 1QAIA 2VF3A 3M8WA 3AXMA 3CCMS 3POTB 4IFYA 3BQ1A 2BEFA 4O0NA 4J91A 3A3NB 3PJ9A 1RHJB 4QR0A 1BQNA 5BYQA 2ZWOA 3N0VA 3TARA 4MAKA 2HNDB 1YBUA 2F7VA 3MAAB 4DS5A 1NDKA 4V19J 2R2TA 5KFJA 4QU6A 2V9WA 4C8NA 3DGPB 3S6EA 5JVGQ 4LF6F 2P8IA 4TY8A 4BWMA 1YTYA 4B3OB 1YBTA 4DPWA 3DI6B 5ADZA 2XY5A 4F8RA 3FJ2A 1RAAB 1RT3B 1LEOA 5D3GA 2IJNA 3QYYA 3NOGA 4BDPA 1PC5A 3KDOA 2WVDA 2H48B 1TAUA 5C7PA 2UU9J 3I0RB 4IKAA 4NRUA 4P2SA 5JUMA 3M8SA 2Y9HA 1V3SA 1EQMA 1IBLJ 2QO3A 2XHWA 3NY0A 3QPIA 3SDEA 1U1LA 1BWEA 1FKPB 4ZVFA 4K4TA 1UVLA 2B4PA 3KUEA 1GQEA 5AE2A 4N41A 5JJBA 2LCWA 2XLIA 1BUXA 1JIHA 5E41A 2E1RA 3UN2A 4ECQA 3VGSA 3M9NB 2BABA 1WG1A 4LSLA 2KL8A 1G1XA 3UD3P 4YR0A 2BQ3A 1UFWA 2ADCA 1MN9A 1LKZA 2EWHA 4P52A 4LREA 4DF4A 4QCLA 2FIUA 1S1XA 4BWJA 1HD0A 3A8JA 2FJWA 3T41A 3W2VA 3NXZA 3QMQA 4A8FA 1IR0A 2PD1A 1GEHA 2GNKA 3VTIA 4CP5A 4Y2IA 3M8PA 1XQIA 3FZ2A 3ZXWA 1ZM4A 3MR3A 3EZ5A 1N32F 1DTTB 3VZIA 3QJJA 1X5OA 3VVUA 4ECTA 3MEKA 1VMBA 4ES2A 2JFDA 4EUVA 4AL6A 3ADAC 3KMQA 2EFOA 1F0XA 1TELA 1MN7A 2B6AA 4CLZA 3TI0A 2Y1LB 3QO9B 4J9OA 1XNQJ 1KFSA 1A0OB 2ZH8A 2RQCA 3E2EA 5IS2A 4K4WA 3O2IA 1SV5A 1U49A 2AP6A 3CD7A 3W5ZA 3CIZA 2DGOA 4M5GA 5A2QU 1VQ7S 1JLQA 3KDNA 3DLEA 3NKYA 1GXUA 2XB2D 3TQEA 2WBRA 3PX0A 1RAOA 4LF9J 2C2EA 2KRRA 2KHDA 4LBIA 1FDDA 1V3RA 3AHPA 3IBFB 3LALA 3M6WA 5KFPA 4KGXB 4LQ3A 2LQ9A 4KGZB 2M0GB 2DNQA 2Y8WA 4ZPAA 1MMDA 3W64A 2KRBA 2CA9A 1VOMA 1YX2A 2VG7A 5HQLA 3T5JA 3UD4P 2EC0A 4QOTA 1TKZA 2PO4A 5D15A 3EJMA 2QA2A 4QW8A 4DDFA 5CAAA 3TZZA 4QWDA 5H9FJ 2XO6A 5J2MB 4LF8F 3T5HA 3ZC4A 2JNJA 1SH0A 2HURA 3ZZPA 2ROEA 1Q53A 3I55S 3MM8A 1B7FA 5EX0A 1KVIA 2IPOB 1FWPA 1XEZA 1HMVB 2M3DA 4A47A 2W8LA 1X4HA 2W2NP 1RWOB 3BDEA 5LMNF 4FBTA 4W90B 4RW4A 2DB1A 2R3VA 5AJ3J 2WB1D 3BH6B 2VA3A 2V9KA 3BKFA 4LRFA 3H0PA 2CQDA 9RUBA 2ERRA 2AJ0A 5K9FA 1HNVA 2L3MA 1SBRA 5B0DA 1M90T 2BV3A 5E3AA 4L74A 1M5PC 5AE3A 3HM9A 2D74B 2CPZA 2XLKA 1SKSA 3HHLB 4DV6F 1TAQA 4JBCA 1K8AT 1BWVA 4F4AA 3GJSB 1KOOA 2ATLA 4ES3A 5IM0B 4ALZA 3CC2S 1VRQC 3MD3A 2HAFA 2ZUGA 3CJRA 2RMLA 4Y3CA 2IVMA 4BLGA 3GFYA 4PXBA 1QAXA 1NJXA 1ACMB 4TY8B 1ROFA 1OWXA 2VPWB 3B4MA 3MPDA 2JVOA 3GV7B 2HIQA 3OT9A 4MYTA 3PG9A 4RNNA 5T7LA 4OYIA 1WUUA 5J2QB 2BE7D 1O51A 2RS8A 3MEEB 3IAS9 5GMKa 2ZJRQ 2FVQA 1QVGR 1F5AA 2JH3A 2DR6A 2GAGC 3BYRA 2OMLA 1ZETA 2VPZB 4DPXA 4B9SA 4USVA 5JXSA 1Q1KA 1WORA 1HNZF 4E2FB 2VC0A 3L7OA 3NCPA 4EBEA 4M95A 2HZCA 3DM2A 2FPHX 4DFMA 2HRTA 1WOOA 2BM1A 2J7UA 2FJAB 2PC6A 2MKYA 1DQ8A 5B08A 2ROGA 2B3TB 3OBIA 5E3RA 3JSBA 2KFNA 1UJ5A 3U02A 1K44A 4KGVB 2AGOA 3H59A 3KG4A 5A2QY 1NJZA 3N5FA 4O4GA 5ETTA 3KKFA 3DC2A 1FFSB 5D78A 2M4MA 5K14B 1RU1A 1X8DA 3JS9A 3A8EA 3MM5B 1RHQB 1D9DA 5IC6B 2ZZTA 1JLAB 3JQKA 2R7OA 1XBWA 3OV7A 1FTRA 3BN7A 3UNYA 3AJDA 2WVBA 3Q8PB 2M8DB 1O6XA 1EARA 1OPIA 1S6OA 2J9DE 2VBXA 3ET6A 4PPDA 4Y6IA 4B3TF 2DCLA 4NEYA 2H5EA 4WFXA 3VAKA 1LXJA 4O3NA 2ZNZA 2CVIA 1W2BR 5K8PA 5FLXU 4DF8A 5DM7Q 1RHMB 2X1AA 3NBPA 2DPJA 3FSXA 4KFBB 4C3MA 3KHRA 1ICEB 5KG7A 3TX8A 1SH2A 2Z2ZA 1QSYA 2YH1A 1N52B 3Q8RB 4X64J 3MMAA 2IIHA 3M30A 3ONQA 4GKJF 2FLLA 2FD2A 1VCTA 4IH5A 2BKOA 2W9BA 3FZBA 4Q44A 3LUYA 4QW9A 1RGVA 2DIUA 1H98A 2OEJA 2K3KA 3G8QA 5B0GA 1U0SA 2V50A 8AT1B 3KYLA 2ASDA 2DR8A 4ED5A 1TUWA 1YQHA 2QA1A 3AD7C 3M32A 3HVTB 5ETNA 3SCIE 1B0TA 2I0XA 4I68A 1U1PA 2C22A 1SC4B 2UVVA 1ZAWA 5KT4A 3I32A 2LYVA 3BSOA 3SYZA 3QZ8A 1YLXA 4ZPCA 5KFEA 4DS4A 2NREA 3IBCB 1FESA 2V2QA 1WF0A 4P9SA 2ZBCA 3EGZA 2MKKA 4M5DB 2G1DA 4DWIA 5T14A 1VIOA 4OHZA 2GHPA 4HH0A 3IC1A 4WCEQ 4DV0F 1FD2A 2ZD1B 2VBWA 3H98A 3IFEA 4TXSA 2W7PA 2YKNB 4JI5F 3BKTA 2FVRA 1W2IA 4LBHA 5E5NA 3TAQA 4TLQA 1M5VC 1UA0A 2GW8A 4DV5F 1N5QA 3D1OA 1DLOB 2J0QD 1S57A 3JYTB 2POKA 4IO1A 3NL0A 1WD6A 1CG2A 4PG8A 4USHA 1U24A 4ICLA 4WXOA 4ZVEA 2QFIA 1DQ9A 3B54A 5KOXA 2IBOA 3LANA 3IMQJ 5KG1A 1F5BA 2KTQA 2PT0A 1WOPA 1R0BG 2DNPA 4P74A 3OHBA 1RKJA 2M5YA 4EFAC 1IBMF 2V68A 4FBUA 3CCVS 4XTTA 1P27B 1PC4A 1ZA1B 4A8WA 4DSFA 1SC1B 3G4SS 2YKMB 4A46A 3RTVA 4F4YA 4F4KA 1IJEB 2MGZA 4X62J 1KWMA 2R7QA 2EFNA 2OPPA 3MECB 2V67A 4LIWA 4RW7B 3C14B 4C97A 2UUAJ 4WFYA 5DS7A 4JUZA 2KG0A 4JI3F 1JKHB 4USKA 4DEZA 2V5HG 1LWCA 4MYUA 4FS2A 3RBZA 1PKUA 3OTCA 3JQMA 2OUGA 3ZTSA 2UXBF 1D3WA 2NYHA 1HLWA 4RUCA 1YITS 1S10A 3MURP 1F9HA 2I38A 4QYZK 3RB0A 5HROA 2IM2A 1RISA 2W4PA 4RW9A 4O3OA 3SQGB 3KLVA 2H9ZA 1HHTP 1JWWA 1H3DA 1RU2A 2D69A 3B6BA 3OTDA 5D0EA 1HPZA 2IJRA 3C2PA 3AB2B 1HBOA 1T11A 3HVWA 4L73A 4CLWA 4X66F 2QC3A 3ZZTA 2ZD1A 1PBUA 1RT1A 3M6UA 2D7SA 1HBNA 1RBLA 3I82A 2OPSB 4KH0B 2VA2A 1TL7B 1F1BB 4UZBA 4C48A 1HMVA 2DEJA 4LR7A 3DOMA 1DBDA 4LRCA 1I51B 2CQ4A 2Y0SD 1MNEA 3FUYA 3O6QA 3H40A 4R0EA 5CYJA 4AXIA 2EFVA 2DGQA 4L76A 4UOGA 2BW2A 1M5OC 1NLKL 3QWUA 3PR4A 3ENQA 6FD1A 4NLYA 2ZUAA 1VISA 2KDOA 2RU9A 3DHXA 1YJ9S 5D4OA 2R8JA 4KPYA 4NCGB 3M8QB 2QV6A 1FRMA 2J9EA 3G82B 5DQIA 4PWDB 3AA9A 4HR2A 3BBFA 1L5UA 4OHXA 3R8YA 1IM4A 2B43A 3MHYA 2RDDA 4ECVA 3SSSA 2PE8A 4DFPA 2ABYA 1KD1T 3PXGa 2FZGB 1WHWA 2W2OP 5SZTA 3M2UB 2BACA 4LRBA 4ED4A 1S0VA 1UJ6A 1PYOB 2CG4A 1XR6A 3OLBA 2V94A 4QZVB 1X4EA 4X4UA 1S7HA 3UQSA 2QN6B 2YY3A 5HMWA 5D4NA 1FRHA 3HD2A 4ECXA 2CQ3A 2VFUA 4FKXA 4YR2A 4JI3J 5G0RA 5KFBA 3JAMY 4F4ZA 4OLPA 1UFLA 2F5GA 1RLDA 3NWGA 5D4PA 2KH9A 4GVBA 1FJCA 3FSIA 3GYNA 2QMWA 1JLCA 2DO4A 3D6TB 2ZBQA 3MCSA 4TVAB 4YDXA 3D6HB 4Q2LA 2OPQB 2PMHA 3M1VB 3QT5A 4B3SJ 4NCAA 2BOAA 1UL3A 3SBMA 1UFKA 2HBRB 4TN2A 1S9EB 4X4RA 4V19X 2GGPB 1RYSA 5HP1B 3W9HA 3MDFA 4URGA 3DU6A 2XLJA 5KFCA 1O5JA 4U7CA 4QIWD 3UI3A 1GTHA 3GMGA 1IQZA 1HQUB 3PX6A 4X4VA 4Q45A 1PYTA 1RZMA 2R9LA 2CPIA 3LO3A 2RF2A 3W8PA 2I5JA 2LXUA 2MKIA 2G0IA 2HNZA 4MT1A 4X4SA 4ECZA 2ZOFA 2OGUA 1LWFB 2VQEF 4P2XA 1C2PA 1H2VZ 3D3CJ 5EDWA 3H25A 1MMNA 2NPIA 2AJ2A 2F9DA 4UW2A 2RD5C 1TUVA 1RACB 3ITHB 3LPEA 1S1UA 2O5DA 3HLUA 2LU1A 2MZSA 2AZ1A 2IY5B 2JLEA 1HL6A 1P1LA 5B0AA 5CZXA 2QA4G 5J2QA 4RU2A 4DV4F 1NK8A 4LF1A 1MU2B 3US5A 1QAYA 3CJ5A 5H9FK 2CJYB 3T1YJ 4DV5J 4U8YA 2YNHB 3TUIC 1IKWA 1CJVB 1JKHA 1U8SA 1VGYA 3VF0B 2XS7A 2DH9A 2EFPA 2O66A 4NLSA 5AXNA 5HQMA 3CJSA 3W2WA 4ZIWA 2HHUA 4YHHJ 1WC1A 3AXKA 4Y0FA 2JEFA 1F2HA 4OV6A 2AD9A 3DOLA 1RQ0A 1U02A 4L75A 1CJUB 3JAMU 4USTA 3CC7S 2YKPA 2KJVA 4PR6A 4WZMA 4QYZJ 5KFSA 2RHQB 2V8DA 2ZVSA 3V81B 2X3GA 3PJXA 3UPFA 3R1LA 1XNRJ 4IG0A 1DTTA 3L4BC 2MHNA 2JJ4D 1VQOS 1HNWJ 1VQ6S 1TKXB 3CJ2A 4WBFA 3ZZUA 3ZTOA 2O67A 1UVJA 4B3MF 2QSWA 3TOQA 1MW7A 3NRBA 4HYKA 1CQNA 3ILLA 2W9AA 4DLGA 3D67A 4IOBA 4K5RA 4WFZA 5T41A 3KHGA 1IKXA 5EWGA 2UVUA 1NK7A 2X51A 4NLOA 2YQ1A 4ES1A 1YRXA 4DL7A 4FPIA 3R27A 4UZCA 4EWTA 4GKKF 2WSFC 4PYDA 3OW2R 4ED2A 2N7YA 2F8HA 1HWLA 4GVBB 4NRTA 4Z2XA 1VBZA 2LECA 2BYCA 1ELOA 3QQCD 2YWEA 3TJ8A 2MQOA 1QUPA 3HJVA 2B9YA 5KG6A 1R27B 3MEEA 4C0BA 4AYBD 5KG2A 1VRUA 2IMWP 3AAWB 5KFNA 3IWNC 2HHTA 4OX7A 1U1NA 2JC0A 1XIQA 1FTCA 3D66A 1WKJA 3GV8B 2ZH7A 3V6DB 2BRKA 1JLEA 2AYBA 4FF3A 4ZA1A 3PW7A 3OVAA 1FJ7A 1D9AA 1URRA 5IQQA 4JI5J 2GIFA 5JVHQ 4HACB 2HHPA 2AEMA 1WEXA 4OFZA 1R43A 2NLWA 4CT8A 2J9DA 4DLEA 2CZ9A 4JP8A 1E6VB 2V8PA 3G82A 2MKHA 4P6QA 1IKXB 3A4TA 3QAEA 3MMAB 2MB0B 2HGMA 1R89A 1HI1A 3BR9A 1UVKA 1PJ7A 5KFHA 3G8SA 1QLNA 1KTVA 2ZH1A 1T9YA 1S1UB 5HJYA 3F0NA 4KHMA 4LVOP 5MLCV 4OZ3A 4TQRA 4GRSA 5HP1A 3VAGA 1ZOTA 4A4JA 3UR3C 2UXDF 1VFJA 4YFUA 5CD4A 2AWZA 1FKOA 4XK8C 2OH2A 5AXMA 2WHOA 2VFTA 3W60A 4ELTA 1WC6A 1AA1B 2DGTA 2P2CB 2RF2B 4DFJA 5L39A 3BO4A 4DR2J 1PAEX 1QUVA 1UP1A 2KN4A 1HQUA 4JI2F 4K5SA 2CAJA 4J9QA 5KAKA 1SQEA 4PCQA 2IFXA 3QIPA 3AODA 2IAJB 3RBDA 1DTQB 3V6HA 1RAEB 1YGYA 4WFNQ 1QJHA 1LW2B 2IRYA 2ZJQQ 2C2DA 1CJKA 3M1VA 2O01C 2UV8A 4URSA 4X4PA 1U4BA 3NS6A 1YDLA 2GO9A 3DGVA 3M2UA 4UUXA 5G4DA 4F02A 2DT9A 3DDKA 3S7RA 1PJ5A 3ETMA 2R8GA 1YRUA 1T9WA 4KGKA 5I4MA 5B0CA 4DL0C 1NPPA 3KLEB 4RW6B 5BR8F 2D3ZA 5A8WB 1EIYB 3TAMB 2DIVA 2KG1A 5LL6d 2DHAA 3BSCA 5K5MA 3CSKA 3M8QA 5GAEU 1ULRA 2QLXA 2YNGB 4L3KA 3THPA 4EI2A 4ED0A 4QIEA 3TP2A 2KJWA 2NXUA 4QQBA 1YJWS 4CCHA 2ZE2B 1VC0A 4P73A 3W65A 3QLHB 1FRXA 3AH6A 4B9NA 3KLIB 3J81Y 2PIIA 3BREA 3EZUA 4NLDA 2JLFA 4ETXA 2G2ZA 2BRLA 5J1EA 4DR3F 2E5LF 2BVZA 2RDIA 4DSLA 3NNHA 3DXBA 1Z4UA 3IM9A 1HW8A 3C15A 4OJGA 4LFAJ 4LF4F 4C8OA 4LF6J 3M2VA 1SKRA 2IJFA 4NCGA 3UVJA 1JJCB 1GXLA 2IRXA 3EYZA 4DCJB 3DRRB 1EETB 2WVCA 3GYGA 3IR5B 2C42A 4P7TA 2YQ3A 4XPCA 1DLOA 3BGFA 5F3TA 4MH8A 4ZLLA 2BZ2A 2H5JB 4EZ9A 3R97A 2YWGA 7FDRA 5HVGA 5F41A 1NCLA 3RB3A 1XMQF 3DLBA 4C8MA 4UTGA 5DG7A 3ILIA 2XY6A 4LMZA 5HROB 2XBPA 3GFXA 4RO0A 3UVJB 4WTOB 1UEKA 3OTOJ 4OI1A 4LF7F 3PRBA 4ZVOB 1TUGB 2LXFA 3GFHA 2M52A 3B4DA 3CCJS 3OSPA 2B9EA 4M94A 1PAUB 2MXYA 2IDLA 1RXOB 1U1RA 2NPFA 1P6TA 4KH1B 1BD6A 3MM6A 2B4UA 4DX8H 5CXTA 4CO4A 3CF5Q 3OJUA 4OYPA 1S59A 3M32B 3TEGA 2EEYA 1TKZB 3OTBA 1Q4RA 5HATA 1Q7LB 5F8IA 4DU8A 5J2PA 4B3SF 1LFWA 3CJQA 5KFZA 2V8HA 3LP1B 4DL5A 3T9NA 3TEHB 3CJKB 2PMWA 4RJVA 4CLKA 3GFZA 3K5OA 5KFKA 5E2QA 4KRWA 5IT9Y 2B9WA 2HQFA 3OR1B 3QLHA 4B3RJ 2OAUA 1S0OA 4OV1A 2HHXA 2JZ5A 2DNOA 4RL1A 5LOQA 4CM0A 1VK8A 1J5OA 2HMIB 2KZMA 4KO0B 4ZKAA 2AKWB 1NM2A 4I4BA 3M8YA 2HGNA 2E5LJ 4G1PA
chains in the Genus database with same CATH topology
5F8GA 3V5RA 5DQHA 3HHLD 4RW6A 2CPFA 2VFRA 5THWA 3OL7A 3VALA 1RTDA 4R25A 2CKWA 2XGQA 1FT8A 2XEXA 5F8NA 2JOQA 4K4VA 4WIIA 1KNZA 2MPUA 3KK1A 1WWHA 1L3SA 1TL1A 4PKDB 1R31A 2CQ2A 2W7OA 3D0IE 4FZVA 1VJWA 1SI9A 1M1KT 4A8SA 4EYHB 2R7UA 3CCWA 4NLTA 1KOHA 4QIGA 3IR6B 3O1LA 3HKWA 4GO7X 2VV5A 4TKTA 3T3FA 4KHPF 3AQOA 3MEGB 2OPPB 3MECA 1RT4A 1YIJS 1N6QB 4OHVA 2XS2A 2APOA 4PWUA 2E5JA 1XN9A 2MYFA 3MTKA 4E8UA 1DRZA 2MZJA 2Z4PA 2GFFA 2YNHA 4YB5A 1G3OA 1KC8T 2EKYA 4OZ5A 4K4XA 1K1SA 1ZTWA 1VRUB 2A10A 3KLFA 1WACA 2EG1A 2FVSA 3ZZOA 2X1GA 3DLKB 3IA0A 3TUJC 3IG1B 1GX5A 1S1VA 1XC9A 2R7VA 1RT3A 4Q7AA 1MROA 4MIAA 5L1JA 3M30B 3LPYA 2VPXB 1KN6A 3MMBA 4QWCA 2RRNA 4JV0A 1C0TB 4BHQA 1JLGA 4ITSA 3KLFB 2MSSA 3N01A 4OLOA 1X4CA 4IFYB 1NZAA 3BR8A 5I3PA 1Z2ZA 2EK6A 2XSFA 5F8MA 4RU9A 1HBUA 3J7ZT 5FLXY 3OXFA 4J9LA 2BANA 2VONA 2IC3A 5B7WA 1WG5A 2CZ4A 1WHVA 5KFUA 5KFMA 1RYRA 4KV8A 3HO1A 4C9DA 1L3TA 2GMHA 2J9CA 3CCRS 2F4VF 2I2YA 2QZ8A 3D1QA 5FDLB 1X7VA 4HL9A 1IXKA 1UWBB 2ALZA 4NZ0A 3I6PA 1TV6B 4ID8A 2DGVA 1IKWB 1Q86T 2CIMA 2R7RA 3H5SA 1S0MA 2FHMA 4I2PA 1GX6A 1S1TB 4CNYA 3JSYA 1SUQB 4NXMF 5DGBA 2B0GA 1FRIA 3HDSA 2V8GA 3L3CA 3SFGA 4DR2F 4U67Q 4E0DA 3EUNA 4ERDA 1YRTA 3PACA 5HLFA 3N6MA 3N5BA 3TA0A 3EXYA 1Q81T 4ECYA 2DNRA 1JLFB 2IM3A 4KGMA 3WC2A 1U1MA 2ZZNA 3M6VA 5GADU 2I5JB 1XK8A 2LA6A 2Q79A 3RW7A 1PO6A 4N8NA 4WZQA 2DGUA 2ZOGA 1X0FA 2RILA 5FDLA 4IDKB 3BSNA 4Q8FA 2OSQA 4ETZA 3ITHA 1HBNB 5J1NA 3QGPA 2CZVC 4A8QA 1TL5A 2YTCA 4HT7A 4F25A 3LWMA 2LEBA 1Q8BA 2CJAA 1S1XB 4M1KA 5MAOA 3K58A 3H2VE 3RAQA 3MOZA 3U1NA 3C8YA 4OI4A 4IFVA 3JSMB 3DLLQ 2WB4A 3MPYA 1FDAA 2HW3A 2W24A 4ELUA 3TUZC 1Q16B 3ENWA 4MIBA 4Y2AA 4FXDA 5G0RB 5GVQA 4ZK7M 2ZOMA 1UEUA 3PRDA 3NNCA 3HJFA 3HMJG 3LH2S 1S6QA 3M6XA 4HDHA 3VQTA 4DHVA 1OPZA 1YVFA 2KU7A 3PIPQ 2GA7A 2HNYA 1R8AA 3QGGA 4Y34A 3H4BA 4ILLA 2F3JA 3P96A 3DRRA 2NQPA 4O0IA 1CVJA 3MFHA 3DLKA 3HP6A 5D4LA 4GC6A 1RWUA 2BE2A 4ZPTR 1P8GA 3PIOQ 1G2EA 2AJ1A 4NYZA 5E3CA 2J0XA 1K9MT 2JX2A 2E44A 2BXJA 1UAWA 2YNIA 3CTRA 1FE4A 2BE2B 2ZM6F 2HNDA 3GG0A 1ZYQA 4U6PA 1FNMA 2VFVA 2N7CA 3VAIA 4IRCA 2PFFB 2YWKA 2E7XA 1T3NA 1BQMA 4MMOA 1P9QC 3LP0A 3T6JA 1S6QB 4A8OA 3DRSB 2IC3B 4DR4F 4X84A 3LAMA 4KIAA 1QY7A 1R7IA 2FLOA 2LEPA 4NOHA 1L3KA 3ETOA 3OL6A 4YUDA 5HO4A 2DGWA 4M63A 1Y7PA 4LFCF 3KLHB 3G9CA 2N82B 1HYSA 1VQ9S 2RQKA 1H2UX 2V4JA 4KTQA 3CDBA 3FFIA 2CQPA 2NUUG 4OZJA 4NPOA 4B08A 5D3GB 2E5IA 2J6TA 1JLQB 1HFEL 4FNHA 4HHJA 2F9JA 5U47A 3V4IA 3RB4A 1QAJA 3LP0B 2HFNA 2KVIA 1RDRA 4NLUA 4QWAA 3ICLA 4QU7A 1JLBA 1AUDA 4X62F 4KQZA 4YDDB 1O8BA 2ACYA 2P6SA 5C24A 5A6PA 4ED1A 5DDOC 3SZ2A 2A18A 1KLMB 3NMRA 4RBVA 1LWCB 5DLFA 5EX3A 4G1IA 3D0HE 2UXCF 3MUTP 1NK4A 4X64F 2HQIA 2LDIA 4H4KC 1RA7A 2VD3A 4NLPA 4CI0B 1FD8A 5IFMA 3D28A 2RKIA 1Q79A 1KQFB 2WTFA 1ZM3A 4DQSA 2GIRA 1FEHA 2DISA 4C0OC 2DBBA 2MQLA 3FFIB 1MMLA 4DV4F 1NK5A 4XPEA 2FJVA 1C1BB 1B64A 4I7FB 4YB7A 1N88A 2AF6A 5L9NA 2KO1A 3GIJA 3I31A 3MEDA 2MQPA 3HT3A 5DQGA 4WXWA 5SUHA 1FJGF 1UJ4A 3AQPA 5C25A 3HXMA 4PQUB 1U1KA 3KLHA 2JFKA 2YX7A 3DNCA 4MK9A 1OS5A 2VUGA 1EP4B 3T1HF 5L8RC 2LMIA 3T5LA 2PDAA 1U1QA 3HHKA 3I4HX 1A9NB 3GV5B 1VBYA 3BEGB 4ED8A 3CUNA 3L95X 1NH8A 4KKOA 4ZPVR 4DL4A 1ZBTA 1T02A 4G1QA 2Q6BA 4KR0B 2P9GA 2JEGA 4DV1F 4I64A 3LP2B 3H5UA 4NZ6A 5KFRA 2J6SA 1TQLA 1HBMB 4B17A 2FJBB 2GIQA 2YNGA 3M9OB 4MJKA 1FHTA 2JRSA 4Y2MA 4Q5VA 1Y0HA 3AY0A 4LQ9A 4I56A 1S6PB 4XO0A 1DARA 2NUHA 1DHMA 2MZ1A 1Y00A 1ZAVA 3NGDA 5A8KA 4C8ZA 1J2VA 3LW5C 3CB4A 3V4IB 3Q24A 2V4QA 3NAIA 3DU5A 2QT7A 1HNVB 4J9NA 1RTIB 1M5KC 5K14A 3B78A 4RWXA 3RW6A 1N48A 1FNOA 4DV3F 1C1BA 1APSA 4O3QA 1GXTA 1VQ8S 1HI8A 1IBKF 1OSDA 1HNXF 2DR5A 4O3PA 4F4XA 1HYSB 3Q23A 4DSIA 3D54A 4DQRA 3TA2A 3PV8A 4TU9A 3VQSA 4JYAF 3OVSA 3MR2A 2QEXS 4HVZA 1AXQA 2ILYA 1JK9B 1FK9A 3SCLE 4R8UB 6FDRA 4JOUA 3V4MA 2B9XA 4BS2A 2CQ0A 3KTQA 4IUFA 4GKKF 1H7XA 1J5OB 2XSJA 4KHRA 1Q8LA 4ZP9A 4DSKA 3IS9A 5FD1A 4JV5F 3NMAA 1TVRB 3FDSA 1T03A 3Q8SB 2BBEA 4NLGA 5D8HB 2WCXA 4LSNB 1D8YA 3BGRA 2W4CA 4ATNA 3HHLC 3CT9A 5AXKA 3T5KA 2DGXA 2W7AA 5CQGA 4F4KA 2CQCA 4K0KF 3IBWA 3K2YA 4TYBA 5DO2A 5M2PA 1BGXT 1FRJA 1Y3KA 2J8AA 4ILMA 3BN4A 2CQGA 4MKBA 1S9GA 1VLYA 4I2PB 4KC5A 1KQSR 3GZ7A 2HFZA 2DGSA 3FEXB 5CYQB 3P3DA 1QSYA 5A8RB 2XI2A 3OFHA 1Q78A 1F9FA 5L1IA 4YMEA 4MFBB 1NH7A 5KG5A 4RZRA 3UDCA 2AX1A 4CH7A 4Y65A 1N5YB 2XMJA 3N28A 1NJIT 1OIAA 4YEAA 4DL2A 2B6AB 4KV8B 2YVSA 3MEGA 4QBUA 1YI2S 4IFVB 4DPOA 3KK2B 3DHWC 2BJDA 2ZH2A 2XY7A 1WI6A 2OTJS 2XI3A 5J2MA 1I6JA 2COLA 3I5BA 4DMZA 2ADBA 3UE2A 2R4FA 2MKJA 2BJEA 2FDNA 2R2RA 1X4BA 1W25A 2C28A 4FVCA 3TNVA 1NU4A 2FVCA 4QYRA 3KFWX 2EBGA 3N4WA 3VAHA 2FB0A 1SJQA 5J1EB 2N3OA 2UP1A 2QLWA 3P5TL 5CYMA 3DRPB 3FMBA 3IR7B 3MMBB 3CDAA 3W7BA 2V0NA 3GQCA 1RTDB 3G86A 1IKVB 3SV4A 4LFBF 1GH8A 4RNMA 4DL3A 2B5JA 2J76E 3BS9A 4K4ZA 1HR0F 1NK9A 2XO7A 2VG7B