1RT7B

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
435
structure length
415
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 113
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B03
5EWEA 4YP3A 5J1EA 4KHMA 1VRTB 2OPPA 1SUQA 4MK7A 2R8KA 3T5LA 2OH2A 3ITHB 2RF2B 3EZUA 2R2TA 3DI6B 4WZQA 3MF5A 3T19A 4I2PB 2R2SA 3BSOA 4RNHA 2DPJA 1N56A 3KLGA 2HNZB 4F4YA 3IS9A 5C24B 1LWFB 3MR2A 2E9RX 5KFOA 3Q8PB 4O3SA 1DTTB 4TQRA 3KK3B 3KOAA 4NLUA 4XPEA 4IG0A 3E01A 1JLAA 1TVRB 2C28A 3I0SB 1S10A 3ISND 1MMLA 1K1QA 1S1XA 2R2RA 2FVQA 2XI2A 3GV7B 3DRRB 3BGRB 4KBIA 4KFBA 2ZE2B 1J5OB 1DTQA 3H98A 1C1BB 2BQUA 3I5AA 5C25A 3MTKA 1R0AA 3PZPA 5J1EB 3NMAA 2OPPB 2YNHB 1RT4A 1SUQB 3KHGA 1UWBA 2RKIB 3FFIA 3IRXA 4ZP6A 2CKWA 2IM0A 2IA6A 2ILZA 2J6SA 2UUWA 2UVUA 1IKVB 4K4ZA 3G6VA 3G6XA 2JEJA 3KLGB 4ECQA 3LAKA 5J2MA 3D5MA 4NRUA 1D1UA 4EBEA 4DL6A 3MR3A 2V4QA 3Q8SB 4IG0B 3E01B 1JLAB 4ICLB 5JXSA 4F4WA 4ECUA 4IG3A 3V4IA 2AX1A 3V6HA 1S1XB 2IJNA 5F8HA 1HMVB 1RTIB 2FLPA 4YR2A 3ISNC 5KFCA 4WXWA 4Y34A 2HMIA 2UUTA 5F9NA 5KFSA 2D7SA 5F8GA 1LWCA 3BJYA 1DTQB 1TQLA 4KKOA 3CJ0A 5C25B 1R0AB 1QUVA 1SH2A 3QIDA 3LP1A 5D3GA 4ZPBA 3NAHA 3KHHA 5J2PA 1RT4B 1S0MA 1UWBB 3FFIB 2E9ZA 2V0NA 2JEIA 3IRXB 5F8JA 4ECTA 3JYTA 4J9LA 4WFXA 4XO0A 1JKHB 2WOMA 1T3NA 4LQ3A 3TVKA 2OPRA 4O3QA 5KG1A 2ASLA 5J2MB 2XWYA 3KLIA 4O3OA 2HWHA 1S1WA 2WTFA 2W7OA 4NLDA 1HYSA 2RDJA 1TKZB 4IG3B 3V4IB 4YMEA 2FVSA 3KLEA 2IBKA 2IC3B 4FS2A 4NLSA 1N48A 5DGAA 3FQKA 4NLPA 2HMIB 3GQCA 5KT7A 3H4BA 5KT6A 1LWCB 4ED2A 1JLFA 2IJFA 4KKOB 4KSEB 4Y2AA 3GIMA 3DYAA 4J9PA 1RTHB 4DL3A 3LP1B 3LALA 5D3GB 4IH5A 2UVRA 4I2QA 5J2PB 4WFYA 2JLEA 3DRSA 1RDRA 4NRTA 4O44A 3JYTB 1QAIA 5KFIA 1QE1A 4HYKA 2ALZA 4IR1A 2IM2A 4IDKA 1JLGA 1T05A 4ECWA 2WB4A 2WOMB 4IRCA 4EO6A 2OPRB 2ATLA 4MFBA 4NZ0A 3KLHB 4ZVEA 3KJVA 1MU2B 4PWDA 3MECA 5KFNA 1SH3A 1S1WB 2XCPA 4IH7A 2R8IA 1ZETA 4RW9A 3UDLA 3DOLA 5KFPA 3KLEB 3BSAA 1N4LA 2FVPA 4MH8A 5KFRA 3H5UA 2FJVA 4ZVFA 3M9MB 1KLMA 5CYMA 3KNAA 1JLFB 3G86A 4NLVA 5DQHA 3BQ2A 3DYAB 4H4MA 2AX0A 4M95A 4I2QB 1OS5A 1HNVA 1RA7A 3DRSB 1CSJA 3V6KA 2ILYA 1RYSA 4O44B 2FVCA 1QE1B 4JV2A 4IDKB 1JLGB 1T05B 4HKQA 3M8QA 2J6UA 3QGGA 5K14A 3H5XA 1GX5A 3TAMB 4TY9A 1DLOB 4MFBB 3KK2A 3KJVB 4PWDB 1LW0A 3MECB 2RDIA 4MKAA 1RT2A 5KG2A 3PR4A 5I42A 2XGPA 1S9FA 4QWAA 5KFMA 2YKMA 4H4OA 1N5YA 4GC6A 2BANA 1S48A 4RW9B 4OL8A 3DOLB 3I5CA 2IAJA 4ZP7A 2FJXA 4R8UA 2FLLA 3HVTA 4URQU 2W9CA 5CYQA 4LSNA 4O3NA 4URGA 3OL7A 3DLKA 5L9XA 5F8LA 1KLMB 2YNFA 5CYMB 5KFFA 3RB3A 5F8NA 2D41A 3LP0A 5L1LA 4H4MB 3QGIA 5DGBA 1JLBA 1GX6A 1S4FA 1T94A 2QV6A 1HNVB 1C1CA 4ZPCA 1S6PA 3KHRA 4G1QA 5KFGA 1TKTA 3N6NA 3QZ7A 4DL4A 1S97A 2V9WA 4IR9A 3DOKA 2GIQA 4J9OA 5K14B 4ID5A 3TQ1A 5DLFA 3KK2B 2BRLA 2O5DA 5F9LA 5FDLA 1LW0B 2HAIA 4NYZA 5I42B 3SI8A 4TYBA 4QWDA 2YKMB 4H4OB 5J2NA 5KG0A 5DG8A 2BANB 4R8UB 3IN5A 3MEEA 4K4XA 2IAJB 2WONA 2F8EX 3GYNA 3DM2A 3GIKA 2AGQA 2W9CB 4FS1A 4LSNB 1S6QA 3KLVA 2W9BA 1RA6A 5I3UA 2W8KA 3BSNA 3DLKB 3SFGA 3PVXA 2C2RA 2UVWA 4PQUA 4IRDA 4O4RA 4JUZA 3IS9B 2W9AA 5KT4A 4ED8A 1SV5A 4K4SA 4Q44A 4O3RA 4ZMMA 1C1CB 1REVA 1S6PB 3MR5A 4G1QB 2BRKA 3GILA 1RT7A 1TKTB 4RU9A 2ASJA 4NLWA 3DLGA 3I5BA 3OL6A 3DOKB 4LQ9A 4RZRA 5KFTA 4KFBB 1T03A 4PUOA 4ID5B 1NHUA 4MK9A 3NGDA 1D0EA 3C6UA 5FDLB 5F8IA 1Z4UA 5KFHA 3UPFA 4YQWA 5KG5A 2R2UA 3VQSA 3Q8QB 5J2NB 4WFZA 2C22A 3MEEB 2WONB 3OLBA 3DM2B 2JC1A 4J9RA 1S6QB 2W9BB 4NLRA 1IKXA 5I3UB 3H5SA 4KV8A 1S9EA 4PQUB 3I0RA 3CDWA 4MIBA 3M9NB 3QIPA 4R0EA 3NBPA 4R5PA 4EYIB 4TYAA 2VG7A 3NAIA 2OPQA 3BQ1A 4ZP8A 4MIAA 1REVB 3T1AA 1HPZA 4QW9A 3N6MA 4WZMA 4WXOA 1RT7B 3OLAA 3EPIA 4ZHRA 4NLYA 3PW7A 4DL2A 3DLGB 2C2EA 3FSIA 2IMWP 4KB7A 1T03B 4PUOB 1RT5A 4Q0BA 1SH0A 3H4DA 4J9SA 2EC0A 3C6UB 3QLHA 1HQUA 1S9GA 3PHEA 3LANA 4MK8A 5KG3A 3HVWA 5EUHA 4Q8EA 3M8PA 1ZTWA 1JLEA 4ZVHA 5L1JA 3QO9A 4MKBA 1IKXB 3RB0A 2HWIA 2JEFA 4KV8B 1S9EB 2FJWA 2WRMA 3HKWA 2B6AA 1TL1A 3I0RB 3CDUA 2OPSA 4QPXA 1XR7A 4K4WA 3KMQA 4U6PA 3KLIB 3NBPB 4R5PB 2VG7B 1RT6A 3GIJA 1EETA 1HNIA 1HYSB 4F4XA 3HVAA 1BQMA 3BQ0A 1HPZB 4ZHRB 5KFDA 1C0TA 1JX4A 3C6TA 2D3UA 3SFUA 2B43A 4Q0BB 1RT5B 4G3IA 2FVRA 3QLHB 1HQUB 5HBMA 3GV8B 1RT3A 3BREA 2W7PA 5KFQA 4EBCA 4QWBA 4F4ZA 2JEGA 1JLEB 2C2DA 3H5YA 4YR0A 1S1TA 3MEGA 5DG9A 3OHBA 2IM3A 5JUMA 4RUCA 3QO9B 4EYHB 3LAMA 3PJXA 1S0OA 4IKAA 2BE2A 2I1RA 3UQSA 3G6YA 5L1IA 1TL1B 5KT5A 2OPSB 1JXLA 3CJ2A 2BQRA 4ZVGA 5KFEA 3HHKA 1RT6B 1S49A 1EETB 4WE1A 3IGNA 4IOBA 3DRPA 4RNNA 1BQMB 4NLOA 4TN2A 4NLGA 4RW6A 1KHVA 5HP1A 1C0UA 4RNFA 4DL7A 1C0TB 4EO8A 3C6TB 4RW4A 1ZTTA 1C2PA 4KE5A 2VG5A 3OSNA 3DLEA 4QW8A 4JV1A 5HBMB 5KFLA 3QZ8A 3OSPA 4DL5A 5DQGA 3KK1A 4NCGA 1IKWA 2AWZA 3LP2A 4ZPAA 1RTJA 4RW8A 2WCXA 4ECRA 3Q8RB 1S1TB 3RAXA 4X2BA 1XR5A 3RBEA 4ECXA 1RYRA 2R8GA 4ED7A 3BSCA 5KG6A 2BE2B 3M8QB 4ECVA 3PW0A 5KG4A 5F8MA 3T5JA 3DDKA 2YNHA 3BR9A 2RKIA 5KT2A 3MR6A 2HNYA 4M94A 3PW2A 1RT2B 3NKYA 5C5JA 2DPIA 5J2QA 4ED0A 1VRUA 1IM4A 1IKVA 3D28A 1N5YB 4WE1B 2D3ZA 3CVKA 1K1SA 3DRPB 2XI3A 4QWCA 4RW6B 4WYWA 2W8LA 3RAQA 5HP1B 1C0UB 3HVTB 2AQ4A 5CYQB 2ZKUA 1JLQA 3E51A 3FQLA 2V4RA 4RW4B 2VA2A 1HARA 2YNFB 4ICLA 2VG5B 3DLEB 4JV0A 4B3OA 4K4VA 3PW4A 1RT1A 2ZD1A 3CJ3A 3LP0B 5EWFA 1HMVA 1RTIA 1TP7A 4IH6A 3KK1B 4IRKA 4NCGB 2JC0A 2BQ3A 1IKWB 1JLBB 3LP2B 3CIZA 4Y2CA 2XGQA 1RTJB 1TV6A 4RW8B 2HNDA 5EWGA 4Q8FA 5C42A 3QGHA 5L1KA 4Y3CA 2AGOA 3RB4A 4I7FA 4NLXA 2B5JA 4NLTA 2R8HA 1LWEA 2GC8A 4ED6A 4K4TA 1FKOA 4ED1A 3RB6A 5KFZA 3PW5A 4KHRA 1S1VA 2HNYB 3V6DA 3V81A 4RNMA 1IKYA 5KFBA 5J2QB 1VRUB 2XCAA 1JKHA 2WK4A 4IFVA 5KFUA 1EP4A 4EEYA 3ICLA 4ECYA 4WYLA 1JLQB 4LSLA 4O3PA 3DMJA 4FBUA 4K4UA 3EPGA 2WHOA 1TKZA 4F50A 4B3OB 1FKPA 1RT1B 1SV5B 2YNIA 2ZD1B 3CWJA 4TY8A 2IC3A 1I6JA 4RUAA 3RBDA 2VA3A 4J9NA 1LW2A 3MEDA 4YR3A 4K4YA 3H59A 1BQNA 4IFYA 1TV6B 4O4GA 2HNDB 3QYYA 3NL0A 5C42B 4J9MA 5KT3A 2E9TA 1RTDA 4J9KA 4GC7A 5DG7A 4I7FB 2B5JB 1RTHA 1LWEB 5KG7A 1FKOB 2XC9A 2YKNA 4TXSA 1S1VB 1HQEA 3V6DB 3V81B 2CJQA 1IKYB 3CDEA 4ECSA 4IFVB 3OL9A 4KO0A 1N6QA 3N6LA 1EP4B 3UR0A 2ASDA 3KLHA 1MU2A 3IGVA 1JLCA 3T5KA 4LSLB 4URSA 4ZPDA 4Q43A 4H54A 3DMJB 1QAJA 3CO9A 3MFIA 5HLFA 3PR5B 4KAIA 4K50A 1FKPB 2YNIB 4ED3A 3QIPB 4TY8B 1S1UA 4QWEA 3H2LA 1S0NA 4Q45A 2R8JA 1NNDA 1LW2B 3MEDB 2BR0A 1BQNB 4IFYB 2OPQB 4O4GB 5HROA 1JIHA 4DG1A 1FK9A 3OL8A 3MFHA 1KHWA 3CJ4A 4ZP9A 5KFXA 1WNEA 1RTDB 3IG1A 2QE5A 3CJ5A 3M9OB 1TKXA 3T5HA 2YNGA 2YKNB 3JSMA 1U09A 3PJWA 5DQIA 1HQEB 5KFWA 1S9GB 5KFJA 5KFYA 3GIIA 2FLNA 2I5JA 3M8PB 2AU0A 4XPCA 3TAMA 1RAJA 4KO0B 1N6QB 4DEZA 4RW7A 1DLOA 3KLFA 1TL3A 1JLCB 3KMSA 1YVFA 2VG6A 5EDWA 5KFKA 3FDSA 1VRTA 2B6AB 2UVVA 5HLFB 2GIRA 3ITHA 1S1UB 1XR6A 2RF2A 3GV5B 3DI6A 4I2PA 5HROB 1HNIB 5DLGA 4DG1B 1FK9B 2HNZA 4EBDA 3V6JA 5C24A 1LWFA 4ECZA 2J6TA 3H40A 5KFAA 3IG1B 4J9QA 1DTTA 3KK3A 1TKXB 2YNGB 1TVRA 3JSMB 3I0SA 1NHVA 1RT3B 2I5JB 3BGRA 3DRRA 2IM1A 2AGPA 4IQXA 4TLRA 4FBTA 4RNOA 5KFVA 4RW7B 4NLQA 3MEGB 3KLFB 1W25A 4TQSA 1TL3B 2ZE2A 1J5OA 3FRZA 5T14A 1C1BA 2VG6B 4U7CA 3OHAA 3KHLA
chains in the Genus database with same CATH superfamily
1NH7A 1IBMF 4G65A 3R6LB 1DTTB 2C28A 4XPEA 2B3TB 2Y9HA 1MMLA 2R2RA 4C8KA 3QT5A 2BJ1A 3NGUA 3H98A 3MPDA 5C25A 2QFIA 2BJ9A 2YNHB 2RJZA 3FFIA 3OJSA 3W61A 1Q53A 3G6XA 4D3GA 3AD7C 4P2MA 4FF3A 2E5LJ 1TKDA 4Z2XA 3QT6A 1VIXA 2AX1A 5LMUJ 4LRFA 2J5AA 2YX1A 3NG8A 1WG1A 1X9WA 4LRCA 3G4SS 2CQGA 2B4OA 1JKHB 4CYUA 1T3NA 3A8EA 3E2EA 2W7OA 4AXJA 4NLDA 3FMBA 3VZIA 1XNQJ 2Y8YA 1FERA 2PT0A 2J9EA 2MHEA 3VGTA 1FDAA 3DYAA 2ZH7A 4DV6F 3G96A 4KC5A 1MU2B 4PWDA 5KFNA 2Y0BB 4HT7A 1SKSA 3VAKA 3TO8A 2C2KB 1F5CA 3MWBA 1SL2A 2W2NP 3QMQA 5KFRA 5LJ5Y 5HATA 1B64A 3WDOA 4F2SA 5DQHA 2GVZA 3QATA 1HR0F 1FO1A 3FZ2A 1RAEB 3W65A 2HHQA 3QGGA 1GX5A 2NUUG 2YKPA 2VU5A 3KK2A 3SIPB 1U45A 1IQZA 3EGWB 4GC6A 2R7UA 3VGSA 1T9TA 5F3ZA 2DGQA 2M52A 3BKFA 2YNFA 1MLAA 1AFIA 2GFFA 1F1BB 1S4FA 4FVMA 1IQTA 3W3SA 1ICEB 2RU9A 1N34F 2WONA 2F63A 3KLVA 3NS6A 3AH6A 5HANA 4HH0A 2DKOB 2BRKA 1FX2A 4NLWA 3I5BA 3M1VB 4XIUA 2J0WA 5KFHA 4USTA 2R2UA 2HZAA 2CQIA 4DV4J 2FDNA 4PG4A 4DSJA 1IKXA 3AA8A 3CCLS 3RBXA 3W62A 2DB1A 4R5PA 4NWBA 4MIAA 4PUOB 3RYLA 2QTWA 5EUHA 1Q7LB 5D15A 1ITPA 4MKBA 2JEFA 3K59A 1LXJA 1HWKA 2E5LF 5LMUF 2P8IA 1RT5B 3M2UB 5M2RA 3VR1A 1JLEB 1VHFA 5DG9A 1FRXA 4F7VA 3TAPA 2G0CA 3QSIA 2BQRA 4EI2A 5KFEA 3HHKA 4IOBA 1C0UA 4EO8A 1XNQF 2DNHA 2IYIA 2HHTA 2U1AA 4C3MA 1HNXF 3FGVA 1TELA 2W2QP 1E6VA 1HBMA 3PO4A 1R8PA 3TNVA 3US5A 4EUVA 3R7SB 1F9EB 3I4HX 2XI3A 4WYWA 2AQ4A 4X4UA 2OD6A 1NDKA 3LO3A 4DF8A 1B3TA 2YNFB 1P1TA 3HJVA 4WIIA 4P75A 1RT1A 4GO7X 1WC6A 2P9GA 3RG6A 4ZJQA 2GC8A 5B09A 2W24A 1SKUB 1FRLA 5RUBA 2VQFJ 5E3AA 1D09B 5CD4H 1YBAA 3SZ2A 4FDFA 5G0RA 3U27A 1F0XA 2IC3A 4J9NA 1LW2A 3PYFA 3CMAS 1YJVA 3LW5C 2VV5A 4UQTA 1JLCA 2YKAA 2NUHA 1S1UA 3Q0AA 1HNWJ 2Q66A 4O4GB 5HROA 1WI6A 4DG1A 1R0BG 3KG0A 3PYEA 1RTDB 3M9OB 3M8RA 5DRKA 2YNGA 1I94J 2HVDA 3GIIA 2FLNA 2KZMA 4XPCA 4M63A 1KEKA 2R7WA 1TL3A 2ZDOA 1FXLA 2K8GA 3WX4A 5HLFB 3EVWA 1M1GA 1VLOA 2KJVA 4J9QA 2UXCJ 2G2ZA 2VFUA 3O3LA 4PRFA 3DRRA 2WW4A 3K57A 1X9SA 3ENWA 3G87A 5FLXU 1WDDA 3AJ1A 3D6HB 4LREA 3HJFA 5LOQA 2VPWB 4TKTA 1KD1T 3UVJB 4ZITA 1JJHA 4JOUA 2M4MA 3IR6B 1HKAA 2OO4A 3NMAA 1DARA 4ES3A 3EDRB 1S77D 1N88A 1WSVA 4RBUA 3CGIA 2ZH9A 3BBCA 1FF2A 2HBRB 3Q8SB 4F4WA 3E01B 3V6HA 4OI4A 4YR2A 2UUTA 2C3MA 3GR1A 3QIDA 1RHKB 4E0DA 4NA2A 4C3KA 1CS4A 2XNQA 2F4FA 2F65A 5J2MB 3L7PA 2Z57B 3I31A 2DK2A 3OD2A 4F0MA 2IC3B 5D4NA 3GQCA 2W7AA 4Y2AA 4YB5A 4JI2J 3OXGA 4IH5A 4DL3A 2LDIA 3GFHA 2H4YB 4LR7A 1XQIA 4NZ0A 3MECA 2UXDF 3BR8A 2G0IA 4I0WA 4CLTA 1GTHA 2HK2A 1ZZNA 3G86A 3HHLC 2KYXA 1HWIA 1YK9A 2Q6CA 1VK8A 1VLYA 5K14A 2DHAA 4I6AA 4MFBB 1PC5A 4DCJB 5EGYA 5KG2A 5IS2A 4RW9B 4URGA 1RQ0A 1HNWF 3SCKE 5CAAA 2QSWA 2LU1A 2C1EB 4CLSA 3R1LA 3QGIA 1GFWB 1QY7A 3N6NA 2I38A 1I94F 2CPIA 2GIQA 1EIYB 1RWUA 4TYBA 5DG8A 1TMMA 3B82A 3DFEA 2F8EX 2MKCA 3P45B 3PVXA 1K44A 1RACB 3M8WA 4I67A 1MN9A 4C0HA 4W98A 1NZ8A 2ASJA 1MWZA 4RZRA 4LF9J 1NHUA 1NK9A 3LPYA 1CJVA 5F8IA 2BJ3A 5J2NB 1T9VA 2XM3A 1YJ9S 2ZC4A 4R0EA 6FDRA 1JJ2R 4OJ3A 5EN1A 4LFBF 1PSDA 3BM7A 1XNRJ 5F3TA 3IR7B 2A2CA 5HMWA 4NI2A 3M8PA 3QJJA 1OQ6A 4JI4F 3D67A 4ZVHA 3PO5A 4KV8B 3AOAA 5K8PA 2H3EB 3Q89A 1DJ0A 2D3UA 4G3IA 3HK2A 3GSDA 3BREA 4LFAF 2M9KA 3O2IA 5BYSA 4WK1A 3IR5B 3EX7B 2IBOA 1U1QA 1FDDA 1U1OA 4MKYA 4KE5A 3JB9k 4NCGA 1U47A 2NZ4A 1WEYA 1KS2A 4M94A 3CB4A 3PW2A 1AZSA 4K8RA 3DRPB 4ZLPA 1WHXA 3HFVA 1SC1B 1BGXT 4K4VA 1RWNB 1FKAF 4IRKA 1FHTA 3ZTRA 4IH6A 1IN0A 5EWGA 3QFWA 2MLZA 5L1KA 3PRDA 5E41A 2AGOA 3RB4A 3BO2A 3MCMA 1XMOF 5IT4A 3JQKA 4KHRA 2Z58B 1YQHA 4PXDA 5B0CA 4IFVA 2DEIA 1V3RA 3J7YI 3C2PA 4K4UA 1M5KC 4WFNQ 3I9ZA 1PKUA 2ASYA 3A3OB 1KQFB 2XQCA 3L4BC 3A1YG 4J9KA 4GVLA 1S0VA 3N5BA 2YKNA 4QPTA 3HSDA 1EKSA 1PILA 1YBUA 4URSA 4QIFA 1FX4A 1U0SA 3CO9A 4TY8B 3MEDB 4IFYB 2FJEB 1O6XA 1NEEA 2NZCA 1KWMA 3GFZA 4LRAA 5KFJA 4NI2B 3M8PB 1G1XA 5E7OB 1WWHA 1NSAA 1B99A 1CQNA 3GV5B 2V50A 4J9VA 2ZHOA 8ATCB 1HHTP 1N33F 3W2WA 2RUGA 4AD6A 1TKXB 3W8PA 3QJLA 4ZOSA 2E44A 3CCUS 1UW9A 5DDRC 2HZCA 3MAHA 3GFXA 4QCLA 2XBPA 3GR0A 4O3SA 1JLAA 3I0SB 2V8HA 4MJKA 1VC5A 3GJSB 3TOQA 1C1BB 1UPPA 2E29A 4M5MA 2OPPB 1FT8A 2LDYA 1YRUA 4U96A 2CKWA 2UUWA 2CNOB 1UL3A 4KGVB 1U0HA 1JXEA 4U8VA 2H5JB 2V2VA 4IG0B 1I3OB 4IUFA 2CQ2A 3NGSA 3EICA 5F8GA 4DFPA 1ACMB 2BJ8A 2WVDA 1QUVA 2CPEA 4XO0A 2DGVA 3MMBA 4WBFA 1HWLA 3I96A 2RHSB 4M5DB 2HFOA 3NNCA 4WU3A 4ED2A 1RWWB 4OHXA 3PKYA 7FDRA 2J9DE 3DCAA 1UKUA 1N4LA 1ZOTA 2FHMA 2BVZA 2G1HA 3S1TA 3BQ2A 1RB0A 4HR2A 4I2QB 4A48A 1HNVA 2AEFA 1U1PA 3BKTA 4I64A 3KJVB 3CJKB 2XGPA 3CCES 3BKUA 1DQ9A 1YZ7A 1JMTA 4B3MJ 5AE1A 2IYGA 4IOCQ 3IBFB 3W2WB 2B9YA 4E2FB 1CEZA 4IR9A 2J7UA 2PMWA 5K8NA 1FRJA 5IWAJ 5GVQA 3JTNA 3CXCR 2D3OR 3A3PB 3J7ZT 4V19J 4ID5B 3PCOB 3NGDA 1X4HA 4DR7J 2J8SA 3C6UA 1WC5A 2VBZA 5IT0A 1U26A 4P6QA 4MIBA 2NXJA 2DY9A 2HHHF 1RT7B 3NNHA 1V3SA 3QLHA 1HQUA 3HVWA 1HBOB 3D1QA 3HULA 2ZNYA 3PYDA 1GXLA 4WTOB 4K5SA 3CW2C 5H1SV 4MYTA 1RLCL 4CLPA 3GV8B 2UUBJ 3EXCX 1BY9A 4C8NA 3TARA 4G1PA 4KHPJ 5A8KB 4ZLJA 1SJRA 1KVKA 3UR3C 4NLOA 1KHVA 4DWIA 4DN9A 1ZTTA 3G82B 3NWRA 1RTJA 5DDPC 4OZ2A 2KI2A 4PR6A 3ZTOA 2E5IA 2CZ9A 2NS1B 3AB2B 3T5JA 2ZH8A 4F8RA 5C5JA 4PXBA 2W8LA 2ZKUA 3CCTA 4ICLA 2DH8A 1HMVA 4MKVA 2XGQA 3QGHA 3M6WA 3IWLA 1ZH5A 2B5JA 1LWEA 1S76D 1B7FA 3I9V9 1IKYA 1FFWB 2HBQB 4YDXA 4RBVA 2HNDB 4KH0B 2XSJB 1VCTA 5KT3A 4GC7A 2A6OA 1YHQS 5KG7A 3QAEA 2OSRA 4PAAA 3N5FA 4NASA 1QLNA 2FTRA 1O8BA 1PJ5A 2UP1A 3SDEA 1M5SA 3OL8A 3D1OA 2ZHAA 2XS2A 4DR7F 2PN6A 3Q22A 3MCNA 4FKYA 4IQMA 1N6QB 4RW7A 5B0AA 3NLCA 1K0TA 2DRBA 2EFOA 1VRTA 4NE9C 2UVVA 4ANDA 4X4TA 1F3VA 4EBDA 4DSIA 2KG1A 2E5HA 1RWMB 2YQ0A 3AT1B 5GADI 1AUDA 2V8DA 3D4JA 1R8AA 3T5LA 2R2TA 1FEHA 2R2SA 4WWSA 4RNHA 1LWFB 3MR2A 1B0TA 1TU0B 3TUZC 2ZM6J 4NLUA 1WEZA 2HVHA 3GV7B 2ZJRQ 2UUBF 3AHPA 2ZOFA 3W5ZA 1VQKS 5M2PA 1Q8LA 1X4DA 4ZP6A 3KLGB 1IVZA 5GAHI 4IOAQ 4ICLB 2HRTA 2XULA 2F40A 3BYPA 1KRPA 1HMVB 2PIIA 3ISZA 3HX9A 4Y34A 1NDLA 2BBEA 2H4WB 2D7SA 3GG0A 3KHHA 3CDAA 5D3GA 2WSFC 4A8WA 3DLBA 4GMKA 2MKSA 3HHEA 2AYMA 3MCOA 5EX0A 1XMQJ 2HQIA 4GKJF 2WAQD 3VCDA 3V4IB 1D9DA 1DQAA 2YPYA 5HVHA 2CG4A 5A6WA 1RAGB 3DRSA 2QGFB 3CULA 2IM2A 4IDKA 2YX7A 2VKZG 2DR5A 2UUAJ 2JLGA 1Q82T 4Q7AA 1S1WB 3TEHB 2V2QA 4DV0J 2ZNZA 2ADCA 1A9NB 2KXFA 3ZZZA 4H4MA 2OFHX 4DX5A 3B8HA 5J1NA 2CIMA 2JZ5A 4AL6A 1NHKL 1Z2ZA 2QLFB 2KYZA 1BLUA 4OL8A 3DOLB 4LSNA 3GYGA 3OL7A 3AXKA 2XY5A 4OI0A 3RB3A 4PG8A 3C46A 1JLBA 1GX6A 1CBKA 4ZPCA 2VZ9A 1U2CA 5AE2A 2YWFA 5FDLA 2JX2A 2DGSA 3J80U 2AGQA 4OYZA 4LF4F 3DLKB 3J81U 4RPFA 3HSGA 2XG8A 1OY6A 1S6PB 3CO0P 3SCLE 4LQ9A 4FPRA 1RAOA 2VF3A 4GKKJ 1KVIA 1ZZFA 5CCMA 4OYXA 4ZCLA 1U7LA 4K5RA 4KB7A 4OZ3A 4IO1A 4YY3F 2KHCA 4BHQA 3J7YU 3RB0A 4BS2A 1S9EB 2WRMA 4N5SA 3GE9A 3KMQA 3NBPB 1HFEL 2JVRA 4UZCA 2B8QA 4ZHRB 2B43A 1U1MA 3FBEA 5HBMA 2HQCA 1Y7PA 2FLOA 1U2RA 4QWBA 1L3VA 3NGKA 2BACA 3QO9B 4X65J 4I56A 4X66J 5L1IA 1OMSA 1Q16B 4DSLA 1XMQF 1HNZJ 1TAUA 1YIJS 2XMMA 2NCKL 3DLEA 3OSPA 4DV3J 1D9FA 1C4CA 1RYRA 2R7SA 2RUSA 4DPXA 3SMZA 2ZWPA 1DY3A 3BR9A 1UETA 3PTWA 1OYEA 4RW6B 1RK8A 2E5GA 2V4RA 4DV0F 1VBXA 1JLBB 2LKZA 4RW8B 3JQMA 3VAHA 2F9JA 2XMAA 3HHLB 2MZTA 1TL4A 4JI1J 1S1VA 1VRUB 1VQYA 3MM6B 4BBYA 4WYLA 1WOOA 4LSLA 4X62F 3DMJA 1WHYA 2MSTA 3FJ2A 1B0PA 4ED4A 1X5OA 2V94A 1BQNA 1TV6B 3NL0A 3UD5A 1RU2A 4X4VA 2IRXA 5D78A 3H2VE 3O8WA 4I7FB 3W2VB 4KPCA 2Q1LA 3D1HA 1HQEA 3V81B 1SJ4P 1SJ1A 3KLHA 5E3CA 5L9NA 4RUBA 4ZPDA 4OLOA 2RRNA 3EE3A 4QWEA 4DR6J 1IXKA 2YH1A 4E8UA 4A4JA 4ZP9A 2MQOA 2RAQA 4AXIA 5HO4A 1NSKL 4ZPWR 3MM7A 2OELA 2IRUA 3CCVS 3NMRA 1YBTA 2LP4A 4L3NA 5C24A 1EQMA 1CJTB 2K3KA 4JYAJ 4MMOA 2BA9A 3MPYA 2HS0A 4P71A 2C3PA 1VS3A 2GCFA 1Y3KA 1IWAA 3IS9A 3R2DJ 2G4BA 5FJ4A 4P72A 1BMQB 4TQRA 1S1XA 5LSRA 2J9CA 2WVFA 2VICA 4WJBA 2ZE2B 1NK0A 1N36J 4X66F 3CJQA 3EM1A 1FRHA 2M7SA 2LCWA 3PNIA 3ZNJ1 1HNZF 4UZBA 4O0NA 2CQDA 1TR0A 2O67A 2XYPB 4J91A 4DBQA 1YITS 1EX8A 2KKHA 4DR1J 3D6FB 2FHJD 1U25A 2JRSA 1GMUA 4CLZA 1KR4A 3PY8A 2V0NA 4B3RJ 1LOUA 4ECTA 2C2MB 1FD8A 4LRDA 3HLUA 2WOMA 2ASLA 1Q79A 1Y4ZB 4CIOA 1M1HA 4FF4A 1JQGA 2BJ7A 2WTFA 1Y0HA 4KIAA 3PFEA 3IXQA 3KLEA 1N48A 3FQKA 2B9EA 4NLPA 2D3O1 1UVLA 4LF5F 2UVRA 3MM8A 2FD2A 5T7LA 2JLFA 1QAIA 2RE1A 1O0PA 2M5YA 1G7CB 3VQTA 2ATLA 1X31C 3KLHB 2NLWA 4LF6F 3KUEA 2RS8A 2GO8A 3M9MB 4M5HA 2R7RA 4RWXA 1RYSA 2FZKB 2P9EA 3UN2A 2KFYA 5D4OA 5J1PA 5A2QY 1LW0A 5CD4A 2VQEJ 3LGHA 5CA5A 5LSOA 3VV2B 1EKRA 4DR6F 3POTB 2QV6A 1UVNA 1C1CA 4OZLA 1X5SA 3RUBL 1TKTA 3DXBA 3DOKA 4DUZJ 1FRMA 5F9LA 4DU8A 3MEEA 1XERA 4PQUA 4IRDA 3QJPA 1CJUA 3IS9B 4K4SA 4JYAF 2HG4A 2B4UA 1REVA 5CCLA 3U02A 3IP0A 5KFTA 4MK9A 4ZVPB 2JSXA 2FC9A 2QT7A 2NXEA 1ZM4A 4WFZA 2C22A 4I4BA 4DR3J 4FYYB 3M6XA 4CH7A 1N54B 4U8YA 1S12A 1F2HA 2BOAA 1QTMA 1RWKB 2IMWP 4WK3A 3DKDA 1S9GA 4NYPA 3TW0A 8RUCA 3VAMA 3Q23A 5T41A 4C48A 3R5AA 4QPXA 1TL1A 4HDGA 2IRYA 3MPWA 4U6PA 5K5MA 2PC6A 2VG7B 1RT6A 1UEKA 4YEAA 2P2CB 2YH0A 4DR1F 1PBAA 1QDUB 3DU6A 5A8RA 4FKXA 3OR2B 1RWOB 4B3RF 3MDFA 3UQSA 5KT5A 2LQ9A 4ZVGA 4ES2A 3IGNA 3R5GA 1RBLA 1BQMB 4NCBA 1C0TB 3CJTA 1C2PA 4WP8A 3ETMA 3NS7B 5KFLA 2ZH4A 4DR2F 1S1TB 5H9EK 1XR5A 1H2UX 2XS5A 2WZ1A 5GMKa 5KG4A 2C3OA 3OTCA 1WHWA 3NKYA 3SSRA 3VTIA 2HGMA 1DQ8A 1FXRA 3DU5A 2OHDA 2BDPA 3UE2A 1SXLA 2VA2A 1IKWB 3TAQA 5C7PA 4CWBA 5CH7B 4ED6A 1PJ7A 2NR0A 2HNYB 3V6DA 1OSDA 2BM1A 4MT1A 2DNNA 5J2QB 1KTQA 5GMEA 3ICLA 4C9DA 3MAAB 4OHWA 1TKZA 5HMYA 1FKPA 2E9TA 2SXLA 1ROFA 1X5TA 2AYBA 3MMCB 2BKPA 1EP4B 2HRUA 5A8WA 3DRXA 4ZVQB 3UCGA 1A6LA 5ETLA 1Q1KA 1X4FA 1S9GB 5A0YA 4DPOA 2APOA 4YHHJ 2V63A 2JFDA 3KDOA 3KLFA 4DV2J 1FD2A 1WDTA 2H54B 3S01A 5KAKA 3I56S 3DI6A 2V2ZA 4BLGA 4QZVB 3IG1B 4HHJA 3KK3A 1E6YB 1A7GE 2HAFA 2DCUB 4JI0J 2WVCA 1QSSA 1TFYA 1J5OA 4UOGA 3ZZPA 4H4KA 1M5PC 3EZUA 4WZQA 3T19A 2MLXA 5CQGA 3LUYA 3RR7A 4YFUA 1YSJA 3RTVA 5HK4A 4LR9A 1DTQA 3WIVA 4C0BA 2DNMA 5CHCB 5J1EB 2ROPA 1S99A 2YQ3A 2ILZA 3I82A 2FIUA 2G2YA 3D5MA 1D1UA 4EBEA 4B9NA 4DL6A 1QAXA 4ECUA 4LF8F 2QA2A 1VFJA 4X4PA 3CEDA 1X60A 4NL5A 3I55S 5F9NA 1TQLA 4KKOA 2F1FA 5J2PA 2EFQA 1UWBB 2E9ZA 2GS8A 4DQRA 3IRXB 4UF4A 4A46A 3HMJG 1Q5VA 1G3OA 2HLTA 2XWYA 3S7RA 1TKZB 3IO1A 4FP9A 1G2EA 2C2OB 2FGOA 1U1KA 2KT5A 1R7IA 2XEXA 1URNA 3CNQP 4ZVUB 3JYTB 2GZOA 4IRCA 4QYZK 3T41A 1MSWD 1AYEA 5B08A 2XCPA 3RAMA 5HN0A 2MQPA 4RWWA 2FJVA 2KN4A 4ATNA 3PRBA 1FCAA 5C2GA 4CLWA 5GAGU 2OKQA 4O44B 1QE1B 4JV2A 5I3PA 2F4VJ 4FVCA 3TVZA 5ETMA 4PG7A 3UN3A 1BQXA 2IDLA 4P2FA 3ZC4A 1T02A 2OP5A 2V68A 3KHRA 4G1QA 3VVTA 3VALA 3G8QA 1NKCA 4DV2F 1X4EA 3N4WA 5KG0A 2QYGA 1UFKA 4USIA 4O3RA 2Z2LA 5BR8J 2OI2A 4Q5VA 3RRGA 3M32B 1MROA 3IAS9 3DOMB 4OYPA 3MPVA 5M2UA 2QG9B 4DSFA 4RR5A 2W9BB 1T95A 3I0RA 2PFDA 3CDWA 4NA1A 1PO6A 5L46A 3KJFB 1WC1A 3T1AA 1HPZA 3GJRB 4QW9A 4ZPTR 3DLGB 3C15A 2F5GA 4ZPVR 2KVQE 3CJRA 3PHEA 1RHRB 1ZTWA 2P9CA 1PBUA 3UD4P 4OZJA 4LBIA 3AY0A 4I69A 3SV4A 4KPYA 1EETA 1H6KX 4F4XA 1OPZA 3JS9A 2DHGA 3C6TA 2PFFB 3OQ2A 2L08A 3T1HJ 4HTJA 1PJ6A 4HACA 3OHBA 3SQOP 4EYHB 5LM7E 3JAMU 5K20B 4TN2A 2KU7A 3WX8A 3TZZA 3ZZTA 2CQCA 3R9LA 1SL1A 3H42A 5GMDA 5AJ3J 4QW8A 2DGOA 2GGPB 2KRRA 3EGZA 4KRWA 2EW9A 3RAXA 4G6VB 4EK2A 4ED7A 4C8OA 3E3XA 2GHPA 2CJXB 3R5CA 5D0GA 4CTAA 3FKBA 4M5GA 2VHGA 5HP1B 5JMNA 2HWTA 4B3OA 5EWFA 2DIUA 2KFNA 1TP7A 3C14B 3CIZA 4Y2CA 5BJRA 4B9TA 2LQJA 1GAOA 2ZEJA 5L38A 3N28A 4B9SA 1GMWD 3QT8A 1YJTA 1S4EA 4LFCF 1JLQB 3CC2S 3EPGA 4YDDB 4UUWA 2YNIA 1SQEA 4JV5J 5C42B 4DQQA 4ANCA 1H98A 2LXUA 2FC8A 3AJ2A 2YWHA 2DHSA 1CG2A 3ZNUA 3OL9A 2WBMA 1D3WA 4J37A 2OGUA 4Q43A 4H54A 2QC3A 3PR5B 2M8DB 4DCPB 3CD6S 2R8JA 2IFXA 2NSBA 1FK9A 1KHWA 2O66A 3CJ5A 4FYWB 3FSXA 1F9HA 3CMQA 2Q79A 4ZJLA 2E7VA 3CDBA 1REGX 3QAUA 4CRJA 5D77A 1L3KA 3MTJA 1SQGA 3KMSA 1VK3A 2DNGA 1J2VA 5DETA 1M0SA 2RF2A 2FGCA 4I2PA 5GAEI 1HBUA 2MGZB 2B8PA 3TJ8A 2QMWA 2I5JB 3M6VA 2WB1D 1HL6A 4TQSA 5T14A 4U7CA 3G8TA 2FPHX 3M8SA 3ITHB 1H72C 3Q8PB 3V2UC 4F25A 1N8RT 2IPOB 3O6QA 2A2DA 1PYSB 3IC1A 3KHGA 4FNIA 2R4FA 3RJMB 1Q86T 4NRUA 5CABA 1Z2LA 1WKLA 3OTEA 4F4KA 2AP6A 2FLPA 4DPWA 5IT9U 2HMIA 3UW1A 2C2ZB 3B78A 4WFAQ 1RT4B 3C16A 2JEIA 3DGPA 3BH7B 3AD9C 3UDCA 4NXNF 4O3QA 3SEOA 3IBWA 4O23A 3SCIE 2AF6A 4M8LA 4NEYA 3W64A 4NLSA 3CCZA 2J9DA 1Q95G 3HHLD 2IJFA 4JI8J 2KXNB 4XAKA 3LWLA 2KTQA 1VQ8S 4W4MA 2OPRB 2CDRB 3TZWA 2YBVA 1SH3A 7AT1B 2R8IA 5KFPA 3HPOA 4Y00A 1TL5A 1KDNA 4P7TA 3TJ9A 5E3QA 1PGZA 4JI3J 1RA7A 3OFEA 2UXBJ 1SB6A 2HBZB 1BD6A 4ZA1A 4TY9A 2A0FB 2XLKA 4NXMJ 1S9FA 4H4OA 1N5YA 5I3QA 2IAJA 1T9WA 3HVTA 4URQU 3UFCX 2MJUA 1W2IA 2W9CA 3IAM9 3A13A 2RDDA 4UOHA 4Z7YA 5F8LA 5CYMB 2QJ3A 5KFFA 4CH0S 2GQ2A 1JXVA 3LP0A 1HI0P 2FYXA 2GMLA 1D9AA 1CC7A 3E8OA 3Q2TC 5HQLA 2J7WA 4F3MA 3GYNA 3DM2A 1S6QA 2C2RA 5I3UA 4WKYA 2BYCA 3SQGA 5IM0B 4Y2MA 3OV7A 2MZ1A 1NB7A 4K7QA 4CO3A 1VJWA 3BGFA 3GILA 4ANEA 1IBLF 3GSIA 5FLXY 4NOHA 3IA0A 3MUTP 4PEOA 1QJHA 4EMDA 3PW7A 2CWKA 3CPWR 4UUXA 1SH0A 2EC0A 1UFWA 3LANA 2RT3A 3ADAC 1M90T 5E5NA 2FJWA 3ELHA 1U4BA 5LT5A 3RW6A 3KXDA 4Y0FA 4C11A 2VPXB 1X4CA 3HD1A 5KOWA 4YR0A 3CMES 1UP1A 1UCNA 4QR2A 2HYIB 4K59A 1CPZA 4RNFA 4OHZA 5IQ6A 2W4CA 1GXUA 3F0NA 3CCMS 3LP2A 2WCXA 3HCXA 1ZM9A 2R8GA 1IWGA 4DX8H 2HFUA 3FMWA 3TRGA 1N5YB 1SI9A 3OPKA 2GQCA 1C4AA 3R5DA 3HVTB 5HL7Q 2AZ1A 1S57A 4N8NA 5AXNA 1NK4A 3LP0B 3EZOA 1G6BA 3M8ZA 1VQOS 4JI3F 1S79A 2UXBF 1MWQA 1FKOA 3RB6A 5KFZA 3PW5A 5HQ8A 4RNMA 3EXYA 3F56A 3KTQA 1ZA2B 1VI7A 1EHWA 3CCSS 4XDDA 1R27B 4FBUA 2YXLA 3FZBA 3SQGB 4PG5A 3QT7A 3QPIA 2HFSA 1U48A 5MAOA 1D8YA 3LQVA 1WG5A 2W01A 4J9MA 1F60B 1YG0A 2CJQA 1CJKA 4X4SA 1UVMA 4QIEA 1VQ5S 2FZCB 3ET6B 4Z37A 4KAIA 2QA4S 3GCWP 3UCZP 3HFZB 2D9PA 3SYZA 5CZVA 1U09A 2EK6A 2CRLA 4KO0B 1ZAVA 3AOBA 1YVFA 1H0HB 1XR6A 4DV7J 4M5JA 2LQ5A 3W66A 5KTQA 3M2VB 2EFGA 5ETPA 3BGRA 1N5QA 3HFKA 3NP5A 2QLXA 4UW2A 1N56A 2P5VA 2E9RX 2R7OA 4KGKA 2DXFA 5EX3A 2CPDA 3NOGA 4ZIVA 3D0GE 1ULRA 2E1RA 2BMBA 2ZH1A 1NK5A 4ERDA 2HHVA 3WC2A 4LF2A 3VAGA 3PYGA 4F36A 1N5TA 4HI2A 3AOCA 3G6VA 2DBBA 1IBKJ 2CQ0A 2HRYA 4OX9F 1UJ6A 3ISNC 3T9NA 3NRBA 5C25B 3SV3A 2GMHA 3FFIB 2LYVA 5D0HA 1WEXA 2YKQA 4L6V3 5KG1A 1FDBA 2LQ8A 2F3JA 2K06A 2L48A 3DNCA 3KUGA 2HFVA 3MCSA 2DCLA 2KG0A 2GJFA 1JLFA 5H9FJ 9RUBA 2HW3A 1OWXA 1JLGA 1T05A 2BZ2A 4CYUB 2I2YA 4ER8A 2QRRA 3VGVA 4OIXA 2DITA 3L95X 1ZPWX 3GU0A 5E2QA 1ZETA 4A8XA 3H8YA 1IR2A 3QSYB 2GJIA 3QWPA 3ONQA 1K8AT 3K5MA 3DYAB 2V67A 2B7BB 2J6UA 3VAFA 4PWDB 5I42A 4YB6A 2YKMA 1UZDA 2BANA 4R8UA 2N3OA 2MTLA 4GVBA 4FF2A 1NKEA 3MM9A 2GVZB 1NRKA 2E7XA 2Y8WA 2DISA 3H7HB 2ZFHA 1YRTA 3QZ7A 4O0IA 3THPA 1RXOB 4B17A 3VAIA 1HIYA 1YRXA 3KK2B 5E3RA 1M5HA 2A1BA 1DFDA 3TX8A 4JI6J 4DQIA 5CZXA 4OI1A 2V2KA 1UJ4A 3CT9A 4WP9A 3M30A 3Q8YA 4P9SA 5B0EA 1T03A 5KG5A 2XMKA 3VQSA 2HZVA 2WONB 5KOXA 1KFSA 1Q4RA 2ZWOA 2C3YA 1CULA 1AFJA 4AT1B 3NAIA 4WXOA 2HIYA 4DL2A 5AXKA 1RI7A 2QO3A 2IA0A 2I0XA 4CO0A 1FNMA 3OT9A 4IYQA 1EQ0A 2COLA 2CVIA 3HT3A 1IKXB 1W7WA 3C19A 1VGYA 4R5PB 5IXUA 4B02A 5I4MA 2HBYB 1TUVA 1UMJA 2P6TA 1UFLA 4OJHA 2DR6A 4CH1A 5ETKA 1GK8A 2MQQA 4DV4F 3BN4A 3M2RA 2BE2A 4QR0A 2A10A 2RH3A 2V8GA 2IDEA 4WE1A 2G13A 1NJYA 2VG5A 3QZ8A 3KK1A 4ECRA 3DLHA 3UO0A 4JI5J 4PABA 1U1LA 1HLWA 1NO8A 3T9ZA 1HD1A 1TK8A 3C3LA 2D3ZA 4QWCA 2FY8A 5GAEU 3THVA 1LFWA 1KOOA 1C0UB 1FJGJ 3CSKA 3CJ3A 2ZD1A 2WSEC 2Y1LB 2LQBA 2BQ3A 2L3MA 1MMNA 3D2WA 2MXYA 1WSRA 1WOPA 1E6VB 1HBMB 3HVRA 4DV1J 1VQSA 1AROP 4HH1A 3W9JA 2E5JA 2K1RA 5DM7Q 4ETXA 3DHWC 1RT1B 4P7VA 2AJ0A 1I6JA 2D9OA 2VDIA 3HKZD 3GMGA 2UUCJ 1H7XA 4XDCA 3Q24A 2KXHA 4BWMA 4TXSA 3Q86A 4ECSA 3TQEA 4F04B 1UTAA 2GW8A 4JBCA 2CJBA 2VPZB 4NPOA 2BABA 5G0RB 1TL7A 3H2LA 1URRA 2PE8A 3T1YJ 1LW2B 2RU3A 1JIHA 2ZJQQ 4RL1A 5L39A 4OYBA 3I6PA 2MKJA 2AU0A 1DLOA 1BHNA 2K2PA 2XMTA 3SSQA 2K7KA 1JLCB 2VG6A 5EDWA 2VQFF 3KFWX 3K2YA 1S1UB 1KKHA 5HROB 5DLGA 4DG1B 2HNZA 2YNGB 1TVRA 5K8OA 1LKZA 2AGPA 4UTGA 2MKKA 3PFOA 1TL3B 3M2RB 3OHAA 5EWEA 4UY8T 1SUQA 4MK7A 2FUG9 3BSOA 2OMOA 1UPMB 4BC7A 3KOAA 4DX7A 4LBHA 1S10A 1V9OA 3DRRB 2J0QD 2L9DA 1CVJA 1YJRA 4PKDB 4F26A 1R0AA 5HQMA 4OZ5A 1XIQA 2QIFA 1UJ5A 4PXCA 3BO3A 1MNEA 3I87A 1U6BA 3RRHA 1OQ3A 2ZBPA 3AODA 4OYMA 4ECQA 2AJ1A 3K5OA 2UXCF 4IG3A 3FC9A 4MTPA 5KFSA 4TVAB 2AW0A 1LWCA 1NM2A 2VIHA 1NSQA 3LP1A 2JDJA 2U2FA 1WKKA 2ROGA 2K1RB 2HWHA 5IV4A 5A2QU 4EZ6A 2MYFA 4B08A 1RJJA 1EJ7L 4I1TA 2ERRA 5DGAA 3OVBA 3HHNB 1L3TA 1BWVA 1T7PA 2BX6A 1UA0A 2CPHA 2Z56B 3PIOQ 3BDEA 4WFYA 1VBYA 4NRTA 1SCJB 4WTYA 4IR1A 2CPFA 4HYKA 2ALZA 1KC8T 1WF2A 1CS4B 3I4PA 1YJWS 1QM9A 4WU2A 3KKFA 2PI5A 3GJTB 3TANA 1T11A 2R7XA 1KLMA 3JTOA 4B3TJ 2N4CA 3V6KA 3D6MB 3IWNC 1DLOB 2FHKA 2V6AA 2VA3A 3MECB 4QWAA 3EUNA 2M2BA 3I5CA 5E3PA 4CO1A 2FJXA 4B9VA 5U47A 1NAQA 1VC0A 2R7TA 2OMLA 2ALYB 5C2CA 4JI2F 3FEZA 2PEHA 4DL4A 1S97A 3ZZOA 1NU4A 5K14B 1R8CA 4C7QA 3WBZA 5IOLA 4QWDA 1DHMA 3IN5A 3ULHA 3TZXA 4ELUA 4FS1A 3CCWA 1PYOB 2W8KA 2EC2A 3MM5A 2Z2ZA 4N77A 4RU9A 3G71S 1T3OA 5F0UA 2ZJPQ 2XWXA 4TNOA 2DO0A 4EGLA 1HBNA 3ZO7A 2JC1A 1WF1A 1Y5NB 1FWLA 5DO2A 3VZHA 3OTDA 3EPIA 1XBWA 4Q0BA 1CJVB 3MZIA 5B0BA 1RSCA 3BBBA 3QRRA 3B54A 3W7BA 1U6ZA 2OPSA 3ILOA 2A18A 1NJXA 4HHHA 5KFDA 4IO9Q 1Y11A 2FVRA 4LF9F 2X7IA 2C2DA 4WPAA 1QVFR 2ACMA 2EFNA 3R1HA 4G1IA 2R9LA 5ETTA 4DL7A 2AHOB 4RW4A 1I1GA 3PV8A 2Y1JA 1A0OB 1XNRF 2FZGB 5CYJA 1VBKA 3O44A 4M5KA 2Q6BA 4OI3A 3MMAA 3PW0A 1YGYA 1YJNS 5KT2A 2RVJA 2WVEA 4LMZA 3HD2A 3FQLA 3HM9A 1YJUA 2EBGA 2FB0A 4BWJA 1GEHA 4NCGB 1I51B 2VJUA 3FBBA 4DPYA 1OJ4A 3PEHA 5ETOA 4W90B 2HQDA 1AZSB 2LA4A 3KG1A 2YWKA 4PXEA 2V69A 2Z2YB 1BC6A 2HS3A 3CWJA 3QYYA 4LF7J 1SL0A 3LA0A 3J80Y 1PIEA 1RHMB 4CQ1A 4IFVB 4NMLA 4M5LA 1S6OA 3J81Y 3OTBA 2CWXA 1XMBA 1FTRA 2W2OP 2VODA 4ZVTB 2QX0A 4X84A 5HJXA 4EU0A 3JSYA 2YKNB 3JSMA 5DQIA 4DI6A 2X3DA 1SQFA 2GIRA 3DLLQ 1SIZA 2B56A 1DRZA 4ZLLA 3V6JA 3Q2SC 1DTTA 1S59A 3A3NB 1MW7A 4CO2A 4DS4A 4YP3A 2GHWA 1UW4A 2OH2A 4ES1A 1KTVA 4F4YA 2FJDB 4LVNP 1UVIA 2QEXS 2VB6A 2FVQA 2XI2A 1PCAA 4KBIA 3PXGa 3H25A 4ZN1A 5A76A 2BQUA 2VUGA 3ILLA 1KQSR 3KDNA 3BDPA 2GAHC 2CZVC 2OSQA 4DV6J 4PPZA 4HLBA 5MLCV 1RAIB 4LT6A 4F2RA 1QD1A 5JVGQ 2RRAA 1V3ZA 1TK0A 3DHXA 1JLAB 2VASA 2OEJA 4DL0C 1Q81T 4J7CA 1HR0J 4AQYJ 2XZTB 2JHEA 1LV5A 1S0MA 2EK1A 2P6SA 2N7CA 1JNRB 2MQLA 4OX7A 2D74B 3HP6A 3W63A 1U0HB 4OYWA 3JQJA 3UCUP 2E7WA 3HO1A 2NYHA 4FS2A 1RAFB 5KT7A 3H4BA 4ENOA 1Y5LB 3JSRA 1RDRA 5KFIA 1OY9A 2WB4A 3PM9A 3MMBB 4ZVEA 1IJEB 4USHA 1FJ7A 1N34J 4U7UD 3VWSA 2ZH2A 1XJWB 2GIFA 1YTYA 4LJMA 4OLPA 4ZVFA 4EWTA 4NLVA 4B9UA 4CO5A 4TU9A 2QN6B 5KFMA 2ZBIA 1S48A 3DLJA 2MLYA 2NPFA 1HNVB 3GPAA 3M1VA 2EFVA 4J9OA 1R31A 2CPYA 1VOMA 2XS7A 3X1LB 2ADBA 3MOJB 1VYAA 2YWWA 2ZDPA 2OEMA 3D3CJ 2JL9A 2QLWA 3UWTA 4ZMMA 3THTA 4PUOA 4RKUC 1EAYC 1YZ6A 4YQWA 3GB0A 2GNKA 4QOTA 2MHNA 3MEKA 3OLBA 4JB8B 4B3MF 1VR6A 3M9NB 1FVSA 2LXIA 2OPQA 1HA1A 4ZP8A 2QA4G 2OTLS 2C2EA 2KB2A 3FSIA 3J7AN 1RT5A 3V5RA 4FXWA 3C6UB 3DGVA 4CM0A 1KSPA 3M2UA 5IWAF 1N5SA 2EBEA 1JLEA 4USMA 1HNXJ 4CI0B 3NS5A 4YB1P 4P2XA 1XR7A 2H9ZA 3F73A 3CCJS 2HPUA 3K5NA 4YB7A 3BQ0A 4UOFA 3G2XA 1S7HA 4LIRA 2CFXA 4ZCMA 2BOPA 3QLHB 1HQUB 2H65B 2W7PA 4DUYJ 4AQYF 4F4ZA 2QMUB 5HMZA 3H5YA 2XO7A 4H4KC 5JUMA 1S0OA 2EVZA 1O51A 1X0FA 3B4MA 2YVSA 2NPIA 2VONA 1FJCA 1RZMA 4JV1A 2G2OA 4QYRA 3DDIA 2LVWA 3MR6A 4A8KA 4C0OC 1P8GA 1IKVA 3K17A 1K1SA 1KOHA 3KUHA 1IUJA 1VBZA 4F3OA 1JK9B 2CG8A 3AXMA 2JC0A 4KGZB 1RTJB 1RU1A 1HW9A 1Q78A 4Y3CA 4HVZA 3BB5A 4KHPF 2YTCA 2ROEA 4K4TA 2WBRA 2NXCA 1APSA 5A6PA 4C6AA 4ECYA 5D0RA 3T6JA 4F50A 4RUAA 3N9UC 5IQQA 4O4GA 2Q3PA 4USWA 1RTDA 5DG7A 2B5JB 1LWEB 1KNZA 2AYGA 1IKYB 3L3CA 3U1NA 3P5BP 3IGVA 1B0VA 5HLFA 5SUHA 2GO9A 2RILA 2MQMA 1FFGB 2OPQB 2H1YA 3MFHA 2AMCB 4ZVSB 3D0HE 5KFYA 4F3QA 4DHVA 2ZHBA 3W1YC 3TI0A 3SDEB 1LNQA 1JJ4A 1G4CA 4Y28C 3H40A 1LEOA 3UVJA 2XNRA 2XYGB 4L74A 2OEKA 4DX6A 4C97A 4FBTA 3OTOJ 2B4PA 4RW7B 1U02A 2F8HA 4E98A 1VRTB 4DSEA 3R6GB 1S5ZA 1JWWA 3RR8A 5KFOA 3E01A 1Z1ZA 2CQ3A 4KFBA 4DUYF 2BE7D 2VDHA 1KBRA 3I5AA 2LEBA 2RIJA 2V5HG 2IA6A 3W9HA 2J6SA 1IKVB 5ETVA 2JEJA 3BZQA 4USUA 4RLEA 2UXDJ 1FI4A 5J2MA 2DTJA 3JSBA 3R5JB 4OV1A 3L7UA 4ZVRB 3NXZA 4CLFA 3HT0A 4CP5A 3TUPA 2MEWA 4ETZA 2DGTA 4FZVA 3MGJA 1UEVA 1FRIA 2ABYA 2HIQA 2H48B 2QFJA 3R7NB 3T3FA 3U1LA 3LTOA 2ZM6F 4C2MA 3F44A 4OX6A 3OFFA 1QTNB 1MWYA 5IC6B 1HHSA 3EZ5A 5KT6A 4ELTA 2RQ4A 4B9LA 5D3GB 2QLJB 3BO4A 4NMXA 3CD5A 1S7IA 4MFBA 3PHTA 4CNZA 3HDSA 1EB0A 2CZ4A 4RW9A 5LSLA 3LH2S 3BSAA 4YS2A 2FVPA 2MZQA 3H5UA 2KVIA 4UT4A 4DV5J 1NKBA 3KNAA 5F0WA 1WD6A 4U9RA 4BDPA 4M95A 4CLYA 3DRSB 2V34A 1YJ7A 4IDKB 4UQGA 2L9WA 3G9CA 2AT1B 2RDIA 3TA0A 4C8LA 2XO6A 2NREA 1VJQA 1VQMS 5F8NA 2AJQA 2HK3A 4H4MB 3GJQB 3M7VA 4LFBJ 2J8AA 2V9WA 1WTBA 3HSZA 4NYZA 3R27A 2UUAF 4ED5A 4JI4J 5J2NA 2NYIA 4LSNB 1T0TV 3BSNA 3SFGA 1SJQA 4JUZA 2KH9A 4P2SA 2MDAA 2MKYA 1RHUB 2JJ4D 4KFBB 2IY5B 3OTOF 5FDLB 1AW0A 3NEKA 3EDQB 4LFAJ 2IVFB 1SPBP 1OPIA 3M05A 1HI8A 4NLRA 2VC1A 4KV8A 3M6UA 9ATCB 2V4JA 4CLUA 2G0JA 4WZMA 4L3KA 3OLAA 1R43A 3HZEA 1NPRA 1WOSA 1Q8BA 2WW8A 1TMJA 2H5EA 2DNOA 1V5IB 5L1JA 1OSCA 1Q8KA 2CADA 3HKWA 4K4WA 3RU0A 1U24A 4UY85 3IWXA 3HVAA 2DXDA 1FA0A 4OJGA 4KGMA 3MPUB 1X8DA 5DS7A 4OFZA 1EZZB 4V1Ak 1RT3A 2QLBB 1WI8A 4EBCA 2MMYA 1NK6A 1R8HA 4GKKF 2FHJA 1X7VA 1XMOJ 1FESA 1UA1A 1OO0B 2EXUA 2DR9A 3DRPA 3MURP 3HZGA 5D6GA 1XWLA 5EHHA 5HBMB 2AZ3A 3SXLA 3P4UB 2CNKB 3ZZUA 3UD3P 2MZJA 4ED0A 4EFAC 2ZBRA 3CVKA 5IV3A 2CVEA 2ZH3A 1LQ9A 3RAQA 4A47A 3E51A 4Y6IA 2CAJA 5SZTA 3DLEB 4DV5F 1RTIA 4KY3A 4KGXB 2GAGC 4DS5A 2R8HA 4NLTA 2Q43A 4X65F 2PEBA 2YX4A 4NA3A 3MUVP 1XTZA 2ZH5A 4K2JA 2MKHA 2XZDB 4DF4A 4TY8A 5AE3A 4DV3F 3MEDA 3N01A 4IFYA 1N33J 6FD1A 2N82B 3TZYA 4AYBD 1UZHA 1IJFB 1RTHA 4OZ1A 1S1VB 2C3UA 4PCQA 2HS4A 1ZYQA 4LSLB 3FK4A 3DMJB 3KJQB 3BPSP 1NPKA 3CJSA 2V4JB 4Q45A 2DR7A 6AT1B 1BQNB 1BE4A 4J9UE 3TA2A 2UV8G 3AB4B 1TKXA 3DDNA 3D68A 3PJWA 1HQEB 4JI1F 2DT9A 1T9UA 3ZTQA 2VFSA 5KFKA 3FDSA 4WIQA 1VQ9S 3H90A 3TEGA 1KN6A 5FIIA 2E1CA 3I0SA 2YKOA 1RT3B 3W5XA 1ZS6A 4FN5A 2IM1A 4DXLA 3WHIA 3MM7B 1NCLA 1C1BA 2OPPA 4WFBQ 2VC0A 2DGWA 4YUDA 4ELVA 5C24B 1WC4A 1TUWA 4IG0A 1FVQA 4F0HA 4ZDNA 1BXNA 4KT0C 4QJVA 1QAYA 2K3IA 3P49B 3JAMY 2IM0A 3CE8A 4ILMA 2A3JA 3LAKA 4K0KJ 1NMEB 2V8PA 3UDVA 1DZ5A 2CJ9A 2V4QA 4ILLA 4M5DA 1S1XB 5F8HA 1RTIB 3ILJA 1RUSA 1FE0A 1SH2A 3NAHA 4NZ6A 2ZOMA 1Q5YA 4WFXA 3TX0A 4ZLNA 3P5TL 2W2PP 3TVKA 3I32A 2XMUA 5LMNJ 1YWXA 3K5PA 2ZKTA 2RDJA 2IIHA 2O01C 3D0IE 2DXEA 5AXMA 4HHUA 1RTHB 3LALA 4I2QA 2I6WA 1N36F 2JLEA 2IVYA 5HMXA 1BUXA 2KM8C 5FD1A 2WOMB 4EO6A 2JOQA 3KJVA 3CJKA 1I5OB 3OVSA 4HI1A 3KLEB 1GQEA 1VIOA 3TYTA 2DNRA 4Y65A 1Y00A 1SKRA 3LPEA 2ZVSA 3MM8B 1TK5A 2E1AA 3A8IA 5T7LB 1CSJA 2ILYA 1P9QC 3HI9A 2FVCA 3SSSA 2KJWA 3EJMA 2HGLA 2FLLA 5CYQA 4O3NA 4I6YA 4RBTA 2D41A 2HHHJ 4X4NA 1FWPA 3QRQA 1T94A 2J7KA 1V6HA 1YX2A 4C3LA 4OQJA 4ID5A 2MJNA 5DLFA 2DIVA 2FJBB 5HAOA 2CXEA 1U2FA 4OZ0A 1LW0B 1VDHA 2MY7A 3GIKA 4AUKA 2XSFA 1Y5IB 1RAAB 5GADU 2ZOGA 4O4RA 4K2XA 4Q44A 1PYTA 2ATCB 2XY6A 1C1CB 1RT7A 1TKTB 4PYDA 1FNXH 3DOKB 1UWAA 4CLKA 3UPFA 1HBOA 3G6ES 2PA8D 1RCOB 2VQEF 1Q7YT 3MEEB 3GYXB 5E33A 4KYZA 3D3BJ 4PQUB 3D7SB 1CJUB 3QIPA 1REVB 1R6VA 1FWKA 2QA1A 4FXDA 4DUZF 3HXMA 3BYRA 5GAHU 1KQGB 3P96A 5A8KA 1YDLA 2AEMA 3D54A 2B6AA 3CDUA 3GLJA 1TTHB 5IZHA 4K0KF 5JVHQ 2HQ3A 1HNIA 3CC4S 4DU7A 5IT9Y 1JX4A 4M1KA 1U1NA 3G82A 4DCOB 4FPIA 3MEGA 4RUCA 4DR3F 3LAMA 3PJXA 2I1RA 2E1PA 3BH6B 1QVGR 1TL1B 1JXLA 2DEJA 2Z8QA 2B51A 1RT6B 5LMNF 1MN7A 2R7QA 4DQPA 1VQNS 5A8RB 2F9DA 1T9XA 2M3DA 3BSCA 4OMFG 3S8SA 4RU2A 1FXDA 3QFHA 3V4MA 1IM4A 4NX9A 1M1KT 2XTJP 5D0EA 4W92B 2NSCA 2XLJA 5CYQB 2W1BA 3GWCA 3R97A 4CT8A 3PW4A 4QBUA 2HNDA 2XSJA 2BKNA 1PG5B 4WP3A 2CQPA 4QU6A 4PG6A 4ED1A 2F7VA 1QSLA 2QYCA 2WK4A 2C2NA 1HW8A 2YQ1A 3SCJE 5KFUA 4Y2KA 2XHCA 5B7WA 3NGRA 2XMJA 4YR3A 3H59A 1ZM2A 2XC9A 2NXUA 3V6DB 3D6TB 1VHIA 1N6QA 4PQAA 4A8MP 1VQPS 2IHR1 1FKPB 3OUYA 3QIPB 1NNDA 3CJ4A 1AXQA 2M88A 3T5HA 2VD3A 2HLUA 5A8WB 1RLDA 4U95A 2B6AB 3R5BA 2WSCC 1HNIB 4N41A 4DMZA 1LWFA 3QRPA 3N79A 4A8QA 1YKWA 2RRBA 5A0YB 4BC9A 4TLRA 1YI2S 3MEGB 3KLFB 3FRZA 1NUEA 4KHMA 2R8KA 4FYXB 1K47A 3DI6B 1RE1B 2CPXA 4QU7A 2DPJA 3BEGB 3KLGA 1PAEX 1AUSL 3PDNA 4GKJJ 3KK3B 1NZAA 2VBWA 3ISND 1RKIA 3ZTPA 3AQOA 1WACA 4YHHF 1J5OB 2XHWA 3MTKA 3QGPA 2J0SD 2CJYB 1ZAXA 1M5OC 2UVUA 1P6TA 2YWGA 1K0VA 1JNZB 3A8KA 1XEZA 4P73A 4PPDA 4FYVB 3V4IA 3DXSX 5B0GA 1SC6A 2K7JA 1RWPB 5KFCA 1N5VA 4CLLA 4JI0F 1NJIT 3FBCA 4FXVA 1DTQB 3CJ0A 2KO1A 4ZPBA 1RWXB 2ZZTA 1NK8A 2VFRA 3BGOP 2CDQA 3A12A 1S1WA 1UAWA 4QIGA 4NCAA 4MAKA 3AFGA 4USKA 3MXHP 3WZ0A 5ETNA 4J90A 2RQCA 4KKOB 3GIMA 4J9PA 1H2VZ 2DNKA 5J2PB 3BS9A 5AT1B 2DH9A 2IMOA 2O1PA 1NJWA 3FCVA 1KQKA 3DOLA 4LF4J 1GMWA 1B4SA 3OUYB 4C8YA 3GIRA 3A4TA 3M8QA 1N32J 4TU8A 3PR4A 3JXOA 2AJFE 4X64J 1TFWA 3DLKA 2L9NA 2DYAA 2HHSA 3LOUA 4ZS6A 2EEYA 1QSYA 2BEFA 1GNKA 1S6PA 2JVOA 5KFGA 3OXFA 2BRLA 2O5DA 2HGNA 8AT1B 3SI8A 4YY3J 3UNGC 3M8YA 2UVWA 4GO5X 2W9AA 5KT4A 4LSZB 2ZH6A 3EGVA 1FTCA 4G1QB 1NK7A 4HEA9 2F4VF 2BM0A 2D69A 4FNHA 1IR1A 1KP6A 3Q8QB 3QBCA 4MIWA 2OFGX 4J9RA 4QQBA 1S9EA 2EKNA 5DDQC 3L9ZA 3NBPA 4EYIB 4A8OA 1F6TA 4ZHRA 4NLYA 1MROB 2LXFA 3VHQA 3NCRA 4MYUA 3OW2R 2JH3A 2CYYA 3QO9A 2HHXA 2EI5A 1IR0A 1PAUB 3I0RB 2DY1A 2FHOB 2W4DA 3RZAA 1N0UA 5AXLA 3GIJA 5BR8F 1HPZB 3C15B 3OFGA 2R7VA 1RHJB 3BBFA 2JEGA 3AJDA 3L7OA 3FCWA 2DO4A 4IKAA 3G6YA 1EETB 4RW6A 1QUPA 4X62J 3C6TB 1Q0NA 1OIAA 1W2BR 1OY8A 4I6WA 1NJZA 2FQQB 3Q8VA 2VOPA 4ALZA 2OTJS 2EG1A 4RW8A 4B9MA 3Q8RB 3O5TB 4HACB 5L8RC 4X2BA 4ITSA 4ECXA 2GV1A 5KG6A 3M8QB 3HHLA 3OR1A 2PDAA 1HHQA 5B0FA 5LL6d 3PG9A 2ZITA 2DPIA 1VRUA 3D28A 4USVA 3FNNA 3MM6A 2DH7A 4HTIA 2RSQA 4LIWA 3WC0A 1L5UA 2Y3YA 4OV6A 3LWMA 2X3GA 1TV6A 3T1HF 3J7A1 2Z0GA 1NSPA 4I7FA 3W2VA 1N32F 3V81A 3K89A 4CTAB 2XCAA 4PYAA 1H3DA 2OLWA 3DRYA 4X64F 4LF1A 2HEKA 4WF9Q 4B3OB 5AJ3F 4AL7A 4K4YA 1ELOA 1X4GA 4QIWD 2LMIA 1WKJA 4FYDA 2HHWA 4AL5A 5JJBA 3CDEA 5GAGI 2JFKA 3O1LA 1FNOA 5ETRA 3MFIA 2YNIB 3EVMA 4P10A 3GFYA 5BYRA 5DDOC 4DR4J 1GH8A 3M4XA 4N47A 3R3TA 1CJTA 2BE9B 1U49A 5DJBA 3B4DA 1AT1B 2ZBCA 5KFWA 1NH8A 2X1AA 2HFZA 4DSKA 1SBRA 1K73T 4DEZA 3R8YA 4OJ1A 4CCHA 5K8MA 2MKIA 1OYDA 1WF0A 2LLZA 4JV5F 1FK9B 3P6YC 5D8HB 1ZM3A 2B9WA 3FRYA 4LBPA 1LXNA 4LRBA 2ZBQA 2ZE2A 4DPUA 2ZZMA 3KHLA 4V19X 2RF2B 2L41A 4NEZA 4I2PB 2O3DA 2Z2MA 4CM2A 1P9YA 1HBUB 4D3HA 2BJEA 1RAHB 1VRQC 4OYIA 4LF5J 3OR1B 3AAWB 3AD8C 1WORA 3RGIA 1LK7A 4K4ZA 3UN5A 4LF6J 4TLQA 3MR3A 1WG4A 2N4DA 4L76A 3ZZRA 2BJDA 1FFSB 1WJ9A 3GTYX 3N0VA 1F2GA 1WTFA 4USJC 3OJUA 2LECA 4LQ3A 4YN3B 2N7YA 2M0GB 4O3OA 3CD7A 1HYSA 3LGMA 5K9FA 1L3SA 4YMEA 2HMIB 1AB8A 3K58A 2KT2A 1VQ6S 2RHQB 2PGCA 3C16B 3MAQA 5BXIA 3DGPB 1KLNA 4ECWA 2MPUA 1H7WA 4Y2IA 5ETQA 2RS2A 3K8WA 1H73A 1Y9OA 4IH7A 2M8HA 2AYEA 2V8VA 2H51B 3POTA 4A8FA 1ZA1B 1OS5A 4X4QA 4HKQA 2DRDA 5DM6Q 1RT2A 2LEAA 2HURA 1X4BA 3ZTSA 1IM6A 5D4LA 2VFVA 5HSPA 1NBEB 5IC4B 2HVEA 4ZCIA 4U67Q 4KJIA 2G1DA 4DR4F 5L1LA 4M5IA 4JI8F 1X0PA 5DGBA 3IFEA 1RADB 2ZC3A 2FJAB 3U1MA 2VPYB 4R25A 2Y0SD 1R89A 3VGUA 4ZCKA 3BV8A 4H4OB 4N8OA 3RRKA 4K4XA 2IAJB 2B4VA 2W9CB 1RP5A 2B7CB 5LJ3Y 2R3VA 1GTEA 2DNPA 2PD1A 4Q2LA 1Q8IA 3MI7X 4YOEA 2VL1A 3ENQA 2R42A 4NXMF 3CD0A 4P74A 2CA9A 3DM2B 2DNYA 2W25A 1S6QB 3ETOA 5I3UB 1IBCB 1R8BA 5THWA 2VG7A 3BQ1A 3IBCB 2POKA 3KWMA 2WVBA 2Z4PA 3H4DA 4A8SA 1FEEA 1NDPA 3QQCD 5KG3A 1Y10A 4DR2J 2X1BA 3Q83A 4DDFA 3OR2A 2HWIA 1HYSB 1BQMA 2EG2A 1X9MA 4F4AA 1KONA 1C0TA 4S0MA 3HHDA 3K5LA 2DR8A 4CT9A 4P52A 2LFVA 1F3FA 5DZ7A 5KFQA 4PZVA 1CC8A 1S1TA 3C66A 3T6BA 2IM3A 2XMVA 3PEJA 2KT3A 1T9YA 2OD4A 1XN9A 7FD1A 4C11B 3TUIC 3ZZYA 4N76A 5BYQA 2DHHA 2OAUA 3OSNA 4DFJA 4DL5A 2DGUA 1IKWA 2BW7A 3KG4A 2J76E 3MD1A 2HNYA 4C98A 1RT2B 4AE5A 5J2QA 2KM8B 3PACA 3ZFVA 1ZPVA 1EARA 1SC3B 3MAAA 1H2TZ 5ADZA 2OJ3A 5HVFA 3LP2B 2B9XA 2D1CA 4OI2A 4Q8FA 2CQBA 1RKJA 5H9FK 4QIVA 4ZKAA 3UDEA 2XB2D 5KFBA 3FVYA 1VQ4S 3C8YA 3MMCA 1EP4A 2CNLB 4EEYA 1MMDA 4J5OA 4OYOA 4JI7J 4KQZA 4PWWA 3HSJA 2WHOA 2HHUA 3RBDA 2CJAA 4JP8A 1FKOB 2BW2A 4RX6A 1VISA 1X5PA 3TA1A 1UEUA 3GP9A 2MSSA 2ASDA 4ED3A 1SC4B 3H20A 2BR0A 3KNGA 3OFHA 5KFXA 3FCHA 3IG1A 2QE5A 1E6YA 3FEXB 1YLXA 1CJKB 3TAMA 2GA7A 2MQNA 1J5EJ 2GX8A 1SKWA 4Q2MA 1S6UA 4ZK7M 2XLIA 1F9FA 4LF8J 2DHXA 1T8EA 2W4PA 4IQXA 4KH1B 1HWJA 1W25A 5J1EA 1FE4A 2PMHA 3OVAA 2HQGA 2UV8A 2KHDA 2X1FA 2GQQA 1WC3A 2DNLA 4DLGA 3BGRB 2EPIA 5IFMA 4OHYA 1TZ0A 3ZZ0A 1UWBA 5G4DA 2RQKA 3IRXA 2QL7B 4DV7F 2UU9J 2OIHA 3BN7A 5JXSA 1HI1A 2BUNA 2GJ2A 2IJNA 4F67A 2RD5C 4WXWA 2VJVA 3BJYA 5H9EJ 4N7TA 4ZN3A 5F8JA 3JYTA 4J9LA 2GHVC 3KLIA 3S6EA 4C8ZA 2DJWA 3GONA 3HF5A 2NQPA 2IBKA 2MY8A 4DPTA 4DZ6A 3PJ9A 1B7YB 2IJRA 3SBMA 1NB2A 4KSEB 1XK8A 3BGUA 1RISA 3NNAA 4O44A 4BCAA 2DNZA 1QE1A 1IBKF 4JI7F 4X4OA 4L72B 4MH8A 5ETSA 1V5VA 1N52B 1JLFB 5F41A 2M70A 1AA1B 3RBZA 2AX0A 1NPPA 1JLGB 1T05B 2CPJA 3J7Z5 1KFDA 3TAMB 2G9OA 1ZBTA 4RUHA 2KFZA 3D9BA 2AKWB 1R6YA 2H5IB 3RW7A 5L9XA 4WKRA 3WQPA 2X1GA 4XK8C 4N56A 1FJEB 2GVDA 1VMBA 3M32A 2VH7A 3EVOA 3TQ1A 3CF5Q 3DOMA 1HQ2A 2CQ4A 5I42B 4CO4A 2YKMB 2HKEA 2N3LA 4X4RA 2BANB 4R8UB 1J5EF 4HDHA 4GVBB 2W9BA 2MZSA 2Z30B 1J27A 3MM9B 1SVDA 2RMLA 4ED8A 3EMTA 2ZZNA 4UOCA 3W5YA 3MR5A 3LF0A 4WCEQ 3DLGA 4CDIA 4B3SJ 1D0EA 3CCQS 3MHYA 4DFKA 1D8ZA 2VKRA 2DVIA 3H5SA 3F41A 3W60A 2NXNA 3M30B 3N6MA 3TP2A 1WC0A 1T03B 4J9SA 4OZNA 3K7RA 3H0PA 3FUYA 4A8YA 3NCPA 4ZJOA 3P8BB 2X51A 4JI6F 3FBFA 3A8JA 3BGLA 1UVJA 3FSYA 2UU9F 1RTZA 1CULB 1LFPA 5HI7A 3KLIB 2CNNB 3D66A 4DOZA 2HSEB 2MZRA 4DJBA 3G8SA 4F0KA 4L75A 2GGPA 2XMWA 3IMQJ 3CJ2A 1S49A 4RNNA 4NLGA 4LFCJ 5CXTA 5HP1A 3R2CJ 2HQFA 1F5BA 4ID8A 2QZ8A 3ZXWA 2Y1IA 3C14A 2AWZA 4ZPAA 3RBEA 2BE2B 2PI4A 3X3UA 5F8MA 3DDKA 2RKIA 3UNYA 1RGVA 1RHQB 3NWGA 2EKYA 4WE1B 1NLKL 4QYZJ 1W26A 1SJ3P 4EZ9A 1JLQA 4ZIWA 2QL5B 4M5NA 2VG5B 3QWUA 4JV0A 3GZ7A 3KK1B 1L3UA 3MD3A 3IRWP 2QMXA 5C42A 1FRKA 2GVDB 4NLXA 1R3NA 3CC7S 3K8VA 5ITHA 2ZD1B 3NGTA 2HFNA 2ZUAA 1DBDA 4JI5F 3NCQA 5E0OA 2C42A 3CIMA 3CCRS 3EWGA 3UR0A 3MUMP 2VFTA 1FJGF 4I68A 3MMJA 4K50A 1WNEA 4DLEA 3PKMA 1X4AA 2MGZA 4B3SF 2FY1A 2CUYA 2ACYA 2E1MC 2XY7A 2I5JA 3OBIA 2F8MA 4DV1F 1RAJA 1U1RA 2I9SA 2EFPA 1Y3JA 3ITHA 1TL7B 2VOOA 5LXYA 2ZVIA 2OUGA 5B0DA 3P3DA 2J6TA 2UUCF 1RBOB 1B70B 4LR8A 2J0XA 1NHVA 3OXLA 1RABB 3NOCA 5KFVA 4NLQA 3J81j 2VG6B 1BWEA 2DRAA 1H38A 3MF5A 4NXNJ 3T1YF 2Y1RI 2HNZB 1UVKA 4OX8A 1N0VC 3EGNA 1R0CB 3FEYB 1TVRB 1K1QA 3GG1A 2VBYA 3PIPQ 3PZPA 1RT4A 1SUQB 2RKIB 1WHVA 1SJFA 4HL9A 2PA3A 5HJYA 4DFMA 2RNEA 1S72S 2HVIA 2KL8A 3CTRA 1LK5A 1R0AB 1GMVA 3Q8UA 2HHPA 2OPRA 2BXJA 2MB0B 3K0JA 1MG7A 3VAJA 4IG3B 1DAXA 2FVSA 2CJKA 1CQMA 3JTPA 4LVOP 1LWCB 1F5AA 4DZDA 3LP1B 2JNJA 5D4PA 2AD9A 3PX6A 2BKOA 3W9IA 2YWEA 3L09A 4NYOA 3UDLA 2DNQA 2PMZD 3KYLA 4QR1A 1DURA 5CYMA 5DZ6A 3MR7A 3U7JA 1M5VC 1U6FA 4RO0A 2HVZA 3H5XA 1JJCB 1U8SA 1IBLJ 1ZAWA 4MKAA 4AFFA 4KR0B 3MOZA 4ZP7A 3NY0A 4XTTA 4KTQA 1VQLS 3PX4A 1TAQA 1O5JA 3DN9A 2MQ8A 1KLMB 5IM0A 3AA9A 2E66A 4L73A 2HAIA 3ENVA 1SIWB 1U8WA 2B0GA 3ENAA 2LU2A 4R0JA 2LA6A 4DR5J 1RA6A 4C4WA 2AIRB 2IVMA 3W8GA 1SV5A 1FDNA 4B3TF 3BPDA 2ZUGA 3TWZA 1LWXA 4ZVOB 4GRSA 3OL6A 2EWHA 1KVJA 2GMJA 1Z4UA 1JB0C 1GXTA 4Z7CA 4OHVA 2W2MP 2UZAA 3MM5B 2VBXA 4TYAA 4CNYA 3TJAA 1H74A 4MK8A 4Q8EA 1HBNB 4LUBA 1CLFA 1HWUA 3UI3A 1IBMJ 2DGXA 1PC4A 3QNWB 2YPZA 4DQSA 2V9KA 2CPZA 3SFUA 4Q0BB 4F02A 4FF1A 4ILRA 2PSZA 3TVYA 3IM9A 1WUUA 2CQ1A 3GCXP 4OI6A 2OPSB 3LGNA 1WELA 2AV5A 3ILIA 2AJ2A 3VVUA 1GT8A 2CQHA 2I8EA 3VF0B 5LXRA 2A6MA 5DQGA 2AEJA 3KJNB 3TR5A 4ECVA 2YNHA 3PX0A 2BV3A 3AQPA 1P27B 4RW4B 1HARA 2KZZA 1TUGB 4U7UK 4NZ7A 4C8MA 1P1LA 2RB7A 3MMAB 2PO4A 4PWUA 1HD0A 2XYHB 1JKHA 1K9MT 4OYAA 4O3PA 2LEPA 3ET6A 3CJ8A 2KDOA 1SV5B 1RCXB 4DUTA 2RQMA 2DD8S 1NXIA 3H2UB 3PRVA 4KO0A 3N6LA 1MU2A 3BF4A 3T5KA 2AJ4A 4DR5F 1QAJA 2XZWA 3EYZA 4TU7A 1S0NA 3TUJC 3M2VA 2QSFA 3DC2A 2KRBA 1VQ7S 4CZCA 3WIUA 2YY3A 2QL9B 5HVGA 1XC9A 1RWVB 3B6BA 1NDCA 1VC6A 4HT5A 1RBAA 4DN0A 4ECZA 4LF7F 5KFAA 4OX9J 2JWNA 3JSMB 3IM8A 3CUNA 3R7BB 4RNOA 4RJVA
chains in the Genus database with same CATH topology
5EWEA 4KHMA 4UY8T 1SUQA 2C3PA 1VS3A 4MK7A 2R8KA 2FUG9 1NH7A 1IBMF 2GCFA 3DI6B 3BSOA 2CPXA 2OMOA 1Y3KA 4QU7A 2DPJA 3BEGB 3KLGA 3IS9A 2G4BA 5FJ4A 3PDNA 4BC7A 1DTTB 4TQRA 3KK3B 1NZAA 2C28A 4XPEA 3KOAA 2VBWA 2B3TB 1S10A 1V9OA 3ISND 1MMLA 1S1XA 2R2RA 1RKIA 4C8KA 3DRRB 3AQOA 5LSRA 1WACA 2J9CA 2J0QD 2L9DA 4YHHF 4WJBA 1CVJA 2ZE2B 1J5OB 1YJRA 3H98A 1NK0A 4PKDB 2XHWA 4F26A 5C25A 3MTKA 1R0AA 3QGPA 2J0SD 4OZ5A 2QIFA 4X66F 2YNHB 2RJZA 1UJ5A 3FFIA 4PXCA 1ZAXA 3BO3A 1MNEA 3I87A 1FRHA 2M7SA 2LCWA 1M5OC 1U6BA 2UVUA 1P6TA 3OJSA 3RRHA 1OQ3A 3PNIA 1Q53A 2YWGA 3G6XA 1K0VA 4D3GA 1HNZF 1JNZB 4ECQA 2AJ1A 2CQDA 1TR0A 4FF3A 1TKDA 3K5OA 4Z2XA 1XEZA 2UXCF 4PPDA 4IG3A 3V4IA 1VIXA 2AX1A 2O67A 1SC6A 3DXSX 5B0GA 4MTPA 4DBQA 1YITS 2K7JA 5KFCA 2KKHA 1N5VA 4JI0F 2FHJD 2J5AA 1U25A 5KFSA 2AW0A 1NJIT 1LWCA 2YX1A 1DTQB 4FXVA 2JRSA 3CJ0A 1KR4A 3NG8A 3PY8A 1WG1A 2KO1A 3LP1A 2JDJA 4ZPBA 2U2FA 2V0NA 1X9WA 1LOUA 4ECTA 3G4SS 2CQGA 2B4OA 1FD8A 1JKHB 3HLUA 2WOMA 2ROGA 1T3NA 1NK8A 2ASLA 2VFRA 1Q79A 1Y4ZB 2CDQA 4CIOA 4FF4A 2K1RB 2HWHA 3A8EA 3E2EA 1S1WA 2MYFA 4EZ6A 1UAWA 2WTFA 2W7OA 4AXJA 1Y0HA 1RJJA 4KIAA 4NLDA 4B08A 4QIGA 3FMBA 3PFEA 4NCAA 4MAKA 3IXQA 3KLEA 3VZIA 4I1TA 1N48A 2ERRA 5DGAA 3OVBA 3MXHP 3FQKA 3HHNB 1L3TA 4NLPA 1T7PA 1FERA 3WZ0A 2CPHA 1UA0A 2RQCA 2PT0A 3PIOQ 2J9EA 4KKOB 2MHEA 3GIMA 1FDAA 3DYAA 2ZH7A 4J9PA 4LF5F 1UVLA 1H2VZ 3BDEA 2UVRA 2DNKA 3MM8A 5J2PB 4WFYA 2FD2A 3BS9A 5T7LA 4NRTA 1VBYA 2DH9A 2IMOA 3G96A 4WTYA 2JLFA 1QAIA 2CPFA 2RE1A 4DV6F 1O0PA 4HYKA 2M5YA 1G7CB 2ALZA 1KC8T 4KC5A 2O1PA 3VQTA 1WF2A 2ATLA 1NJWA 3I4PA 3KLHB 1MU2B 4PWDA 1YJWS 5KFNA 2NLWA 1QM9A 4LF6F 4HT7A 1SKSA 1KQKA 4WU2A 3KKFA 3DOLA 3VAKA 3TO8A 3OUYB 2RS8A 2PI5A 4C8YA 2GO8A 1F5CA 3MWBA 1SL2A 3QMQA 5KFRA 5LJ5Y 3TANA 2R7XA 3M9MB 1KLMA 2R7RA 1B64A 3WDOA 3JTOA 4F2SA 5DQHA 1HR0F 1FO1A 2N4CA 3FZ2A 4RWXA 3V6KA 1RYSA 2HHQA