1RT7B

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
435
structure length
415
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 113
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B03
3KHGA 2ZE2A 4O3PA 3RB3A 1RT7A 2D3UA 5KFWA 1RT2B 3T1AA 2V4QA 4ID5B 2W9CB 4ECZA 1CSJA 2J6SA 2UVRA 4NCGA 3GV5B 1KHVA 3H5XA 3PJXA 4H54A 5L1LA 3KLIB 1HMVB 5HROB 3T5KA 3OL6A 2JEIA 1RT5B 1XR5A 2VG5A 5KG6A 3SI8A 4R0EA 4J9RA 4K4UA 4QW8A 3UDLA 1T05B 3I0RA 3KMSA 5F8IA 4J9SA 4J9OA 4Y3CA 3LP1A 1ZETA 1REVB 4GC7A 4ECTA 5DG9A 4KE5A 3ITHA 1QAIA 3FRZA 2FVRA 4J9NA 3DI6A 5KFHA 4MIAA 1J5OB 1JLGB 1S6QB 4YR3A 2HNYB 1EP4A 4Y2CA 3MF5A 2OPRA 3IRXA 5EUHA 1GX5A 3PW5A 4MIBA 3BJYA 2YNGA 2I1RA 5KFTA 5K14B 4EBCA 4RUCA 3DRSB 4K4XA 4RW7B 3IG1A 4M94A 1RDRA 4ZP7A 3E51A 4WE1B 1KHWA 3I0SA 4IG0A 4J9PA 1S97A 1JLBA 5KFJA 3E01A 3JSMB 3TQ1A 3PR5B 1HARA 1RAJA 1LWEA 1N56A 4IRKA 4ECXA 3MFIA 5FDLA 1JIHA 3G6VA 3LANA 2R8JA 1XR6A 2HNDB 3RAXA 3V4IB 5DQGA 4ECRA 4IRDA 3KHRA 2IC3B 4G3IA 1S9GA 1T03A 2JEGA 4PUOA 4NLQA 4KO0A 2UVWA 4XO0A 4KHRA 5I3UA 4ED7A 5J2QB 3LP2A 2IM3A 4K4VA 4IFYA 3KK3A 5KFKA 2BRLA 3LALA 4TQSA 3PW7A 3BSAA 3DLGA 2B5JA 1RT6B 1TV6A 3DMJA 1IKVA 3DRPB 4ICLA 4QWAA 3PZPA 3RBEA 1RT4B 5CYMB 2ALZA 1LW0A 4Q8FA 2BQRA 3CO9A 1W25A 1C0TA 1I6JA 4KKOA 3I5CA 3M8PA 5HP1B 1C2PA 3C6UB 4FBUA 2B6AB 3IS9B 2OPSA 1S4FA 1S6PA 3IGNA 1HQUB 1RTIA 1TVRA 1RTDA 3MECA 3GIKA 5L1IA 2WB4A 1HQEB 5J2NB 3D5MA 3GV7B 4DL3A 5DG8A 4F4YA 4ID5A 3KJVB 4WFYA 1MU2B 3M8QA 2OPPB 5I42A 3DRRB 1S1VB 2D3ZA 2QV6A 4NLRA 1N48A 2IMWP 2EC0A 1RT3B 5F8JA 1K1QA 4WYWA 5HROA 2VG6B 2FVPA 4ZP8A 1JLFB 5L1KA 4DEZA 1Z4UA 1TL1B 4O3NA 3T5LA 3DOLB 2V0NA 3GIIA 4ED8A 4YR2A 1S1XA 4EYHB 4IDKB 5KG4A 2BQ3A 2HWIA 3NMAA 1GX6A 3QLHB 1S1TB 2VG7B 2YKMA 4I7FA 1RT1A 2ZD1B 3LAKA 1FK9A 3DM2B 5J1EA 4PWDB 4PQUA 5KFUA 1YVFA 3NBPB 1S6QA 4O3OA 3C6TA 2I5JA 3KK2A 5EDWA 3TAMA 4O3SA 4I2QA 3HVTB 4RW8A 3GIMA 4F4ZA 1LWCA 1JLAA 2RKIA 2B43A 1QAJA 3FFIA 4R5PB 3BR9A 2VA2A 5KFIA 3KLGB 2ZKUA 4URGA 4U7CA 3PVXA 2XWYA 3KLFA 1FKPA 1VRUA 3OL7A 4JV1A 3MTKA 2IAJA 4KBIA 4Q45A 2E9TA 3MEEB 5C42A 4ZP6A 1S9FA 4NYZA 4K4TA 1BQNA 1JKHA 1IKXB 2FLLA 2IJNA 2IC3A 5KG3A 4NLDA 4TYAA 4TLRA 2RDJA 3RB4A 1JX4A 4LQ3A 4IQXA 4DG1A 2C2DA 1QE1B 3OHAA 4YP3A 5JXSA 4WFZA 4FBTA 1EETA 3LAMA 2C28A 3V6DB 4F4XA 1JLQB 1C1CB 1DTTB 1NHUA 2RF2B 1RTJA 5CYMA 4ZHRB 2R8HA 3RB6A 3N6LA 5KFLA 2AGPA 1S9EB 3QGIA 3KNAA 5HP1A 3V81A 4B3OB 2B6AA 3BGRB 4KFBB 2R2RA 2HNZB 4IG3B 3G86A 3H2LA 4LSLB 5C24A 2WRMA 4Y2AA 4ECYA 1DTQA 4Q0BA 4KV8B 3BREA 1SUQB 2D41A 3GV8B 1S1UA 1JXLA 4Q8EA 4TY8B 3QO9B 3CDWA 3BSNA 1RYRA 4RNHA 3DOKA 4RW6B 4J9LA 5HLFB 4WYLA 4G1QB 4LSNA 3LP0B 1N6QA 3CJ5A 1RT3A 1JLEB 2ATLA 2XC9A 4K4ZA 2RDIA 1IKYB 5F8MA 4NLWA 1TL1A 5KFSA 4Q44A 2AQ4A 4ZP9A 3GILA 1HPZA 2YNIB 1N5YA 4MKAA 1K1SA 1RTHB 5KG1A 3GIJA 1FKOA 3KK1B 4YMEA 5C5JA 5DGBA 4PWDA 1LWFB 2YNHA 2UUWA 3CJ3A 3BQ1A 4EYIB 2WOMB 1LW2A 5KG0A 1U09A 4KB7A 2HAIA 5D3GA 4ED3A 2FJXA 1TKXB 2BE2A 1SH0A 4NLTA 3OLAA 1S48A 4TQRA 3SFUA 5HBMB 3EZUA 3H59A 3V6JA 1C1BA 4WFXA 1HNIA 1T3NA 3CDEA 4URSA 4RNMA 2CKWA 1KLMB 2WONB 1IKWA 5J2PB 4NLYA 4ZPAA 2R8KA 1SV5A 2V4RA 2YNFB 3ISND 2C2EA 3UQSA 2C22A 1MMLA 3H4DA 2GC8A 3MEDA 2OPQB 4NLOA 1HYSB 3JYTB 1WNEA 5J2MB 2FVQA 3H5UA 3DLEA 2FJWA 2D7SA 2FVSA 3CWJA 3D28A 4RW4B 4R8UB 5C25A 4YQWA 4H4MA 2BANA 1TKTB 3MEGB 2J6TA 4MFBA 3DLKA 3Q8QB 4DL5A 3N6MA 4DL6A 1HNVB 2IBKA 4I2PA 4O44B 3MR5A 3KLHA 4HYKA 3QIPB 2W8LA 2HMIB 2BQUA 1T94A 5KT6A 4NLPA 1S1WA 3KLEA 2JC0A 4IOBA 4ZVEA 4JUZA 3QZ8A 5F8LA 4TN2A 1TKZB 5T14A 4WZQA 1DTTA 1DLOB 1RT2A 2W9CA 1BQMB 3HKWA 4ZVFA 1S10A 1JLCB 2GIRA 4B3OA 3CJ4A 4TXSA 5KFZA 3MR2A 3KLIA 4O3RA 1HMVA 2IJFA 3H4BA 4NRUA 3OSNA 2ZE2B 2GIQA 4ECWA 1RT5A 1RT7B 2E9ZA 1XR7A 4K50A 4ZPBA 4X2BA 1T05A 4EBEA 4RW6A 4NCGB 4EEYA 1S0NA 1REVA 1TL3B 2CJQA 3RAQA 1NNDA 3ISNC 4K4SA 3H5YA 2QE5A 1J5OA 4NLSA 1JLGA 2VG5B 5KT5A 2HNYA 4IFVB 2AWZA 5DQIA 3PR4A 1IKYA 3I0RB 5KT3A 2VA3A 3T19A 4WXOA 3ICLA 2W8KA 1IM4A 3ITHB 4IR9A 1ZTWA 2R8IA 2R2TA 3DI6B 3NAHA 5KFRA 5K14A 3NGDA 4FS1A 3OL9A 4F50A 3DRSA 1EP4B 2OPRB 1C0UB 2WOMA 4RW7A 1VRTB 3IRXB 3H5SA 4QW9A 4K4YA 3IN5A 2C2RA 2E9RX 2WCXA 4NLUA 5KFCA 5DG7A 4WE1A 2YNGB 2XI2A 3HVWA 3JSMA 2W7PA 5HBMA 2IM0A 3PHEA 5F9NA 5KT7A 4K4WA 4QWDA 1RA7A 4KSEB 1S0OA 1TP7A 3I0SB 4ED0A 4RNOA 2JLEA 2YNFA 2HNDA 3DYAB 3E01B 3V4IA 1RA6A 4WZMA 3GQCA 1LWEB 2W9AA 4DL2A 2R2UA 2V9WA 3DDKA 5FDLB 4O4GB 5J2QA 5KFMA 3HHKA 3NAIA 4J9QA 2WHOA 1RT6A 2IM2A 1TKTA 3DRPA 1S9GB 4RUAA 1RT4A 1T03B 5KFOA 4PUOB 3QGGA 4EO8A 4KO0B 2AGQA 1HNVA 5I3UB 4M95A 3LP2B 3C6UA 4EBDA 4IFYB 5F9LA 3KK3B 2ASLA 3IS9A 2FJVA 3TVKA 5KG7A 4Q43A 5KFGA 1HQUA 3N6NA 2B5JB 4ICLB 3DLGB 1TV6B 3DMJB 1IKVB 1QUVA 3CDUA 4WXWA 4ZVGA 3KHHA 3EPGA 2ASDA 1HQEA 1LW0B 5J2NA 4IH5A 3QYYA 5L9XA 2XCAA 3NL0A 4KKOB 3M8PB 2J6UA 3RB0A 3FDSA 1BQMA 3KJVA 1S6PB 4KHMA 1MU2A 3QGHA 1TVRB 5F8GA 2OPPA 3CJ0A 3DRRA 1S1VA 3OL8A 2WTFA 2XI3A 3BSOA 3MECB 2UUTA 5EWFA 5KT2A 1R0AB 2VG6A 4MK7A 3T5HA 2XGPA 1JLFA 3H40A 1D0EA 2AU0A 3DOLA 5F8HA 4F4WA 4IH6A 3M8QB 3G6YA 4ECSA 5I42B 4IDKA 3KLEB 4ED1A 3RBDA 2JEFA 2UVUA 5F8NA 1TL3A 1S1TA 2VG7A 2YKNB 2ZD1A 3QLHA 2F8EX 4RNNA 3M9OB 4XPCA 3DM2A 3NKYA 4YR0A 4KAIA 4O4RA 5KFPA 3NBPA 2W7OA 2BR0A 3G6XA 2FLNA 4IFVA 4MKBA 2IM1A 2AX1A 2ILYA 4TY9A 5CYQB 1S1XB 5KFNA 3HVAA 2YKMB 3EPIA 1RT1B 4I7FB 5J1EB 4PQUB 1FK9B 4IKAA 3HVTA 2WK4A 2ILZA 2W9BB 1C0UA 3FQKA 3C6TB 1VRTA 2I5JB 4TYBA 4QWEA 2ASJA 5EWEA 4R5PA 3Q8RB 3KK2B 3TAMB 2FVCA 3UR0A 4I2QB 4RW8B 3KLGA 3PW2A 3QIDA 1LWCB 1N4LA 1JLAB 1NHVA 2RKIB 4URQU 4H4OB 3SFGA 3FFIB 5DLGA 3MEEA 2OH2A 2JEJA 3DYAA 4IH7A 3KLFB 1IKXA 1FKPB 1VRUB 3Q8PB 3T5JA 3V6KA 1S0MA 2IAJB 3KLVA 4O4GA 1QE1A 5C42B 5DLFA 1BQNB 1JKHB 3I5AA 3V6DA 1JLQA 1UWBB 1D1UA 1C1CA 2BRKA 4ED2A 2RF2A 4ZHRA 4J9KA 3MR3A 2O5DA 4DG1B 1SH2A 2UVVA 4MH8A 1S9EA 3MR6A 1S49A 2R2SA 4RW9B 1EETB 3BGRA 4KFBA 2HNZA 4IG3A 5KG5A 4NRTA 4LSLA 4J9MA 3CIZA 5L1JA 5JUMA 4KV8A 4DL7A 5KFEA 3CVKA 1RTJB 1SUQA 3CJ2A 4ZVHA 4DL4A 4RZRA 5KT4A 4TY8A 3QO9A 5KFXA 3V81B 3VQSA 3KOAA 5HLFA 5C24B 5EWGA 2HWHA 4G1QA 1DTQB 4Q0BB 4JV0A 3LP0A 1JLEA 4NLXA 4ECUA 3V6HA 4HKQA 3PW4A 2JC1A 1S1UB 1R0AA 4ECVA 5KFYA 5KFDA 3I5BA 4NZ0A 5KG2A 3LP1B 3DOKB 3BQ0A 4JV2A 3PW0A 4MK9A 4QWCA 4MK8A 4LSNB 4O3QA 2YNIA 1N6QB 1TQLA 3OSPA 1RTHA 3FSIA 2YKNA 3KK1A 4U6PA 1LWFA 4NLVA 1RYSA 4QWBA 1OS5A 5KFBA 5CYQA 5DGAA 1TKXA 4NLGA 4LQ9A 1HPZB 1N5YB 3UPFA 5DQHA 5KFFA 2AGOA 5KFVA 1FKOB 2YNHB 3H98A 4RU9A 3IG1B 1LW2B 3GYNA 4IR1A 1KLMA 5D3GB 5KFQA 2WONA 5J2PA 2W9BA 4IG0B 2BE2B 3Q8SB 2DPJA 1JLBB 4ZMMA 3MFHA 4ZPDA 5KFAA 1C1BB 3QZ7A 4ED6A 2DPIA 1HNIB 4OL8A 4XPEA 2OPQA 1HYSA 3JYTA 1IKWB 5J2MA 4H4OA 1SV5B 4EO6A 4RW4A 4R8UA 1SH3A 3MEGA 3MEDB 2XCPA 4O44A 3PJWA 3DLEB 4QPXA 2XGQA 4RNFA 3M9NB 4IRCA 3KMQA 3QIPA 3IGVA 5C25B 2HMIA 2IA6A 4H4MB 3OLBA 2BANB 3KHLA 4MFBB 3DLKB 3BQ2A 1UWBA 1C0TB 1TKZA 4Y34A 3OHBA 3M9MB 4I2PB 4FS2A 1DLOA 3KLHB 2AX0A 2OPSB 1ZTTA 2R8GA 1RTIB 1JLCA 4RW9A 1RTDB 4ECQA 3FQLA 1S1WB 4ZPCA 2FLPA 3BSCA 4GC6A
chains in the Genus database with same CATH superfamily
2ZE2A 4O3PA 1HWKA 2DD8S 3GFHA 3GV5B 4FN5A 3T3FA 3ZTOA 2ZH6A 3OTOF 3OL6A 1GEHA 3ZZTA 4Y3CA 2M2BA 2BJ9A 2ZH7A 3CC7S 1JLGB 3EXYA 4C8LA 1VK3A 2K7JA 1AUDA 3PW5A 3E3XA 3HMJG 2GHWA 3IG1A 3IRWP 3E51A 1FRHA 4IG0A 1MMNA 3KWMA 3LGMA 4CO4A 1W26A 2YQ0A 2H5EA 2XQCA 3TX8A 4QU7A 5IT9U 1WSRA 1REGX 3OR1A 2LP4A 4GKKJ 1B0PA 3B54A 2Z2LA 4NLQA 4PR6A 4IFYA 4UY8T 4TQSA 1T9YA 4ZS6A 4QPTA 2ALZA 1UEKA 4DQRA 4ZLLA 4FBUA 2OPSA 3OUYB 1CG2A 3DGPA 3K2YA 3D5MA 3UVJB 1RWXB 4DR5J 2UUAF 4LF8F 1EX8A 4P7TA 4ZN1A 3MM8B 3K5NA 2VQEJ 2GVDB 4JI1J 1D8ZA 1RT1A 4I7FA 1QDUB 2WVCA 1FFGB 3HZGA 3P5BP 3GFYA 4BWJA 4DF4A 3WZ0A 1ZZNA 5HVHA 4NYZA 1NJYA 3NXZA 2QYCA 2IJNA 4OX7A 1YBTA 2RF2B 2WVEA 4B3OB 1OMSA 4NZ7A 4DQQA 5D0GA 3A8JA 2EI5A 4P2SA 2PFDA 3LP0B 1KLNA 2HZCA 3TARA 3G6ES 4DR2J 1X4HA 3HM9A 2VH7A 1FKOA 4YMEA 2WOMB 1QVGR 3T1HJ 1N32J 2W01A 1SH0A 5J1NA 4YHHF 1T3NA 3GFZA 3UQSA 3TUIC 2K06A 3D28A 2HFSA 5H9FJ 3T9ZA 4EFAC 3MR5A 4UY85 4NX9A 3NGKA 1S1WA 4IOBA 1VQSA 3QZ8A 2P9EA 4OZLA 1KKHA 2GIQA 1VC0A 1T05A 4NCGB 4EEYA 3PDNA 3RZAA 1TELA 1CJVB 3H5YA 1J5OA 3OVSA 3TYTA 2VA3A 2E1AA 3OL9A 2EK1A 2Q6CA 1YJ7A 4K4YA 3PJ9A 5E33A 5K9FA 4P71A 1Q5VA 5HBMA 2L9WA 1RA7A 1R27B 2HNDA 2MGZB 2GHVC 4YDXA 4DL2A 1OYDA 5KFMA 4A4JA 3L3CA 4DU7A 1BLUA 1KVKA 1FJ7A 1AW0A 2FJVA 1H0HB 2E44A 1DJ0A 4ZVGA 1QUVA 4GO7X 4AQYF 2KZZA 2AHOB 4KHMA 3W65A 3CJ0A 1VHFA 3ETMA 5KT2A 2HHHF 1Q8IA 1AUSL 4MIWA 1Q81T 2ZH9A 3DM2A 2V8GA 5KFPA 4OV1A 2YKMB 3U1MA 3K8WA 4LFBF 2ASJA 1KQSR 1B99A 2R7QA 5E3QA 3SFGA 1RCOB 3NGTA 4G65A 3MEEA 2MB0B 2OH2A 2EFVA 4CT8A 3BDEA 2Z8QA 2G1DA 3OXGA 2UVVA 4YB7A 3IP0A 4RU2A 1WC4A 5L1JA 4F3OA 2CJBA 4ZCLA 2B4OA 4K5RA 1FXLA 2XYPB 4RZRA 1G6BA 4YN3B 4P2MA 1JWWA 3GPAA 4GVBB 3PW0A 4MK9A 4QWCA 2DNRA 5ADZA 2NUUG 1ZPVA 1OS5A 1RAEB 2YQ1A 4LUBA 5KFQA 2JJ4D 2CIMA 3CD5A 3LH2S 2NXJA 3ET6A 3E8OA 2XNRA 1U1KA 2AYGA 1UFLA 4UOGA 1VR6A 3V5RA 5FLXU 3M8WA 3G8QA 2GMJA 5LSLA 2AX0A 3OTOJ 2R3VA 2E1MC 3R6LB 1RT7A 4ECZA 2FY8A 2X3DA 3K17A 1D8YA 3D2WA 3SSSA 1YG0A 2B9WA 2YQ3A 2GJIA 5F8IA 4OJGA 1U25A 2QN6B 4HVZA 3M6WA 1EP4A 5LMUF 3PYGA 3F56A 5K14B 4GMKA 4DV6F 1XNRF 1UZHA 2DY1A 1WEXA 4IRKA 4OJ3A 5B0CA 5F3ZA 5IC4B 4F4KA 2QLFB 3W60A 5T7LA 3CJ8A 2UVWA 2CUYA 1S77D 2HQDA 4U9RA 5C2CA 2UUAJ 2DRBA 2C2ZB 4IYQA 4LF8J 2GX8A 1WC0A 2HS4A 3MCNA 2LCWA 2EFNA 3BPDA 3N4WA 3MECA 4PG8A 3GIKA 2WB4A 5GAHU 3OJSA 4DL3A 2V4JB 4TU8A 2R7VA 3TUPA 1T11A 2Y8YA 4XTTA 2VJUA 5BR8J 1NPRA 1YKWA 1Q1KA 3NMAA 2EKNA 3LAKA 1S6QA 1MN9A 2RILA 4N47A 4DR1F 3BN7A 2D3OR 1HKAA 1ZAWA 2B43A 4B3MF 4CO3A 1S59A 3W9IA 4JV1A 1WELA 2GHPA 1QY7A 1IKXB 3HHLC 4JI2F 4I6YA 5JXSA 2D69A 3D0IE 3MCOA 4PXBA 3RB6A 2KRRA 2NXNA 3HPOA 4USWA 1F3VA 2KM8C 2LEAA 2VB6A 4Q8EA 1N5SA 3FC9A 4B9LA 4UOHA 2Z2MA 1UA1A 3CCSS 2VFTA 1V3ZA 2UUCF 2AQ4A 2GO8A 1FRMA 4YHHJ 1RTHB 3PFOA 3BQ1A 1X9WA 3SFUA 1WD6A 3KJFB 3ZTPA 2E5HA 2EK6A 2PEBA 3R7NB 3FEXB 1M5KC 1RHQB 2D9OA 3AD9C 3H4DA 5J2MB 5HN0A 3QFWA 4H4MA 1RHMB 3QT6A 1TKTB 3D3CJ 1OQ6A 1RBAA 2QIFA 2XMAA 1GQEA 4WZQA 1DTTA 3MMCB 5K8OA 2VF3A 2V94A 4TXSA 2COLA 3AB2B 4NRUA 3DRXA 4EBEA 3OFFA 4P75A 1FFSB 3JSBA 4NLSA 1JLGA 4FYWB 1FDDA 5KT3A 3K5LA 4WXOA 4L76A 1ZTWA 4ZKAA 1XWLA 1UEVA 4OI6A 4DV0F 5D78A 1Q82T 3R7BB 4QIEA 3MM5B 2J9CA 1RWNB 4CLUA 2H65B 2RAQA 1RHKB 2W9AA 4J9QA 1K44A 3MMJA 5KFOA 3THPA 2AGQA 5I3UB 3OUYA 2HHHJ 1CPZA 4B9VA 3UVJA 2CQ4A 3TWZA 2X1AA 3CXCR 3PFEA 5A8WA 1CEZA 3U1LA 1EZZB 2UUTA 3MM8A 4FXWA 1JNRB 1FWKA 3JXOA 4YY3J 3VGVA 5F8HA 2KFYA 4LFBJ 2F8EX 4Y28C 1QSSA 3FEYB 3RAMA 4IFVA 4ZIVA 4RUHA 3HVAA 2ATCB 4TLQA 2IDLA 2N82B 2CJXB 3S1TA 2FVCA 2O1PA 2LMIA 2BM0A 1WG5A 4Q2LA 4OI0A 5IWAJ 3QWUA 2PSZA 3W62A 3HXMA 2RF2A 4LF7F 4OYPA 1B70B 5KG5A 2GO9A 2O01C 3CVKA 4ELUA 5C7PA 1DHMA 3HFZB 2HLTA 3LP0A 2DR7A 1Y9OA 1NU4A 1KNZA 4MK8A 1Y11A 1FRKA 2WB1D 4OHYA 1RYSA 5CYQA 1X9MA 1SIZA 4FPRA 4DDFA 4RU9A 2B9XA 2W2PP 4Y2KA 2DGSA 2BBEA 4M8LA 2Y1RI 2O3DA 2YWHA 2AT1B 2ROGA 5K5MA 4N7TA 2DITA 2E66A 2RJZA 4DBQA 4MFBB 2I2YA 1EKSA 3S01A 4Y34A 2KJWA 4EI2A 2DCLA 2CJYB 3HP6A 1LEOA 3RTVA 2PA3A 4NCGA 1EIYB 1CJVA 3IXQA 1ICEB 3CCTA 2ZH2A 4J9RA 1M1GA 2IHR1 3OBIA 4HHHA 4DV6J 2Y8WA 5E41A 2ROPA 2H4WB 3N01A 4A8SA 2KU7A 2XWXA 4EBCA 2N3LA 1GMUA 1RDRA 1UA0A 4LIRA 2N3OA 2CG8A 3DRYA 2MGZA 4C48A 4I1TA 4M5KA 1T3OA 4USKA 2G2YA 4UT4A 2P8IA 3PIPQ 2VFRA 1QLNA 4DI6A 4K4VA 1U4BA 3AA8A 1SXLA 2K8GA 4Q8FA 1WUUA 3A13A 5C2GA 1GXUA 3BO4A 3WHIA 4ID5A 1MU2B 2J8SA 3CTRA 1K1QA 1GMVA 4WYWA 2VG6B 4DR1J 4JI8J 2W1BA 3T5LA 2V0NA 2V34A 1DQAA 3MCMA 2YKMA 2KG1A 2V2KA 4B3MJ 1BD6A 3ETOA 2E7WA 4X4OA 1AFIA 2DO0A 1GXLA 3POTB 1BE4A 4DXLA 1HD0A 2ROEA 4NL5A 3KUGA 2YX7A 5CH7B 2ZKUA 2PA8D 2HS0A 2KB2A 3TUZC 2IRXA 2LA6A 2R42A 2J0SD 4K4TA 2NR0A 2IC3A 3HSDA 1TMJA 3P49B 3FBCA 3HO1A 3UW1A 3FCVA 4ANDA 3ZZRA 5B0BA 2RQCA 3V6DB 4QYRA 1FEEA 4OI4A 5HJYA 1EAYC 2MQ8A 1V9OA 3D7SB 2GQCA 2EBEA 3MPVA 3CEDA 2NZCA 1WC3A 3PYEA 2XC9A 3GMGA 2K2PA 4JI0F 2ZVIA 1XMOJ 1JJ4A 3OVAA 1AA1B 1QAYA 5HSPA 1U8SA 4M5DB 2F9DA 4R25A 3QAEA 1TUGB 2FJXA 3F0NA 2MEWA 3W9JA 4I68A 2MQOA 1UAWA 3V6JA 3I82A 1A0OB 2DYAA 2XS7A 1HL6A 4DPOA 2ZH8A 3H5UA 1ZA1B 2KI2A 2NXCA 1NB2A 5L38A 5IM0B 4Q2MA 3QIPB 1UZDA 4LF9F 3TA0A 3MR7A 1XQIA 4ZVEA 3LO3A 4MTPA 5D15A 2R7TA 3H4BA 2KT5A 3MEKA 2YVSA 4N76A 1TL3B 3KG1A 2RQ4A 2J76E 1IBLF 4DV0J 2LLZA 3AJDA 5KFRA 4QR2A 5K14A 1S6UA 3SCIE 4X4TA 4ETZA 1CVJA 4EWTA 4DSIA 4DSEA 2KG0A 5F9NA 1NXIA 4OYMA 4ELTA 2W2NP 1H7WA 1KS2A 2YWEA 3ADAC 5D8HB 4OX8A 3HHKA 1OWXA 4RUAA 2LKZA 1DZ5A 3DMJB 4WXWA 3D0GE 4A8WA 3NL0A 3A12A 5CA5A 1BQMA 2V4JA 3HCXA 3UNGC 4UZCA 3W2WB 4IH6A 2UV8G 2YKNB 4QCLA 2FLNA 2CQ2A 5ETKA 2RUGA 1RBLA 3F73A 3KTQA 2EFQA 3FEZA 5F0UA 1CC7A 1C0UA 2I5JB 1T95A 1QAXA 3UWTA 4LF7J 2JEJA 4TVAB 1IKXA 2XZTB 3V6KA 3N79A 1FI4A 3LQVA 9RUBA 2QC3A 4P9SA 1DRZA 1UWBB 2FHJA 5K20B 3UR3C 2XZWA 3CULA 5CZXA 2MQMA 2P2CB 2QT7A 3W61A 4BS2A 4Q0BB 4V19X 2DNLA 2LYVA 4H4KC 3DOKB 4ZCMA 4O3QA 1TQLA 3GYGA 1RTHA 4U6PA 2HBRB 2ZWPA 4HL9A 5KFVA 1PC5A 1QM9A 4JI3F 2QX0A 5HQMA 2D3O1 3TW0A 4DPUA 3J80U 3CD6S 1U0HA 4CRJA 1P9YA 5DS7A 5J2MA 2Q43A 4EO6A 3Q0AA 5DETA 2QFIA 3W8PA 1W2IA 1SC1B 3PNIA 3DHXA 3UFCX 1RAFB 1RT2B 2W9CB 2MSSA 1WG4A 2MZQA 2CPHA 1KHVA 1UEUA 4F0MA 3BGFA 1K47A 5KG6A 4NMLA 4LRFA 1NDLA 4J9OA 4Q7AA 2B4UA 1AFJA 3OXFA 4RLEA 3PYDA 1NK5A 1M0SA 3NS6A 3IM8A 4K4XA 3MM5A 2DNGA 3JSMB 1I5OB 4DSJA 4OJ1A 2V67A 4ECRA 5I3UA 5J2QB 3TX0A 2KH9A 4ZN3A 3CO9A 2B6AB 3R2CJ 5J2NB 1NJXA 2JNJA 4KGKA 4ATNA 1RAIB 3GG1A 1MMDA 2OEJA 1NK4A 4EYHB 2MZ1A 3J7YU 2VG7B 2D3ZA 5KFUA 5K8MA 2I38A 1OO0B 2AJQA 1SVDA 4ZPTR 3GIMA 2ZFHA 3HJVA 2G0IA 1E6YA 3ZZUA 4DPXA 3CGIA 5LM7E 4ZP6A 2N7CA 2RDJA 1YJ9S 2LQ9A 5G0RB 4FBTA 4LF6F 4CDIA 1UCNA 1JLQB 1NSKL 2F5GA 4NEYA 1S9EB 1P8GA 1T9VA 2B51A 3VAFA 1VJWA 1LWXA 4G1QB 3ZXWA 1VMBA 3QBCA 1IKYB 4NLWA 2HK3A 4DN0A 3SMZA 3M6UA 2K1RA 2ZOGA 4A46A 1VYAA 2B3TB 5M2UA 1TKXB 2HKEA 5CHCB 3QSYB 3HHLB 2DHSA 1KLMB 3CCVS 1SBRA 4ZPAA 2V4RA 4LR8A 2ADBA 1MMLA 2CQ0A 3HSZA 4MFBA 2ZBPA 2CQDA 1T94A 2Y0SD 1GAOA 3N5FA 3SQGB 4TN2A 2ZBRA 3I4HX 4Z7YA 4AL6A 3QSIA 4V1Ak 4OLOA 1R6VA 2ZH1A 4WWSA 3MM7B 4PG6A 1U26A 2RS2A 3UN5A 2IVMA 4K4SA 3C14A 2VG5B 1X31C 2YPYA 4NA1A 1CJKB 4DFKA 4FS1A 1JNZB 3BF4A 4YDDB 3VWSA 5KFCA 1S57A 5D6GA 3HVWA 3MCSA 5HQLA 1YGYA 3D1QA 5ETVA 2DRAA 1PSDA 4ED0A 4RO0A 4HHJA 1LWEB 2OO4A 5A0YB 2XMKA 5LXRA 3PEJA 4PUOB 1L3UA 2CQHA 2PO4A 5DDQC 5KFGA 4ICLB 3RRHA 5HANA 2WBMA 1Y10A 1MU2A 3D66A 1Y4ZB 4IO1A 2VG6A 3T5HA 3TOQA 2XGPA 4OHZA 3R5CA 4JYAJ 3G6YA 3UDCA 2B8PA 5HMWA 3THTA 2FIUA 4O4RA 4CTAA 2BZ2A 3POTA 3BV8A 4I6WA 4DPTA 2ILZA 1VRTA 2XM3A 3VF0B 1F2GA 4QBUA 4OYBA 3CJQA 3UR0A 2QO3A 2DVIA 1CC8A 1SB6A 1NHVA 3MZIA 2PI4A 1FKPB 3Q8PB 5C42B 4WJBA 1PCAA 3V6DA 3BGUA 3KDNA 1UVMA 2ZZNA 3H20A 4RW9B 3IMQJ 2AV5A 2U1AA 3IO1A 2V50A 2J0QD 5KT4A 3OJUA 3Q8VA 2B0GA 4M5DA 2HQIA 3VCDA 1M5SA 2GAGC 2QG9B 3M8YA 5KFBA 3FUYA 4I56A 1GFWB 2LU2A 4IR1A 4OYZA 3H7HB 2CNNB 3AA9A 4RR5A 1U2FA 4ZPDA 2R9LA 4ED6A 1HNIB 1SV5B 2HYIB 2W24A 4C0HA 1RISA 5IM0A 4O0NA 3QIPA 4ZJLA 1FRJA 3A8KA 1TK8A 4USTA 4CQ1A 3ZZYA 1OSDA 3I4PA 4EU0A 4PXDA 4DX6A 1JJHA 5DZ6A 3L7PA 2DGQA 4DR6F 2J6SA 2UVRA 2YX4A 4KRWA 1HMVB 3M8SA 1RT5B 3UDLA 5IQ6A 3EWGA 1VCTA 4MIAA 4WKYA 4PRFA 1ZYQA 2AW0A 4CNYA 4RW7B 3HFVA 1S97A 2FTRA 5DM7Q 1KOOA 2A18A 4C7QA 3D67A 1NAQA 1I1GA 2JZ5A 4XO0A 2IM3A 4KGZB 3DMJA 1RT6B 1RAOA 1I6JA 1RBOB 4P10A 3NRBA 4PPDA 2XSJA 4CT9A 3IGNA 1Y3KA 1M5VC 4OJHA 3CCJS 4ERDA 2IY5B 4HDHA 5HROA 3CCWA 2BJDA 2ZM6F 3G82B 2ZD1B 2X3GA 2Z2ZA 5GMEA 1KVIA 1T0TV 2I5JA 2MHEA 2WVFA 1MWYA 4O3SA 1IWGA 3PKYA 1KQKA 1AXQA 5ETPA 3MAAB 5L9NA 3HF5A 2AZ3A 2HQFA 5K8PA 1D9DA 4URGA 1WDDA 4LF6J 2V8PA 1NSAA 3M32B 2XG8A 3OFEA 2AD9A 4YP3A 3QNWB 1FWPA 4CLSA 1F2HA 2C2DA 1F5BA 3KKFA 5EN1A 4Q0BA 1MROB 2CPJA 2KVQE 4TY8B 1RYRA 2V6AA 3DOKA 2G4BA 2HHVA 3MAHA 2HURA 2HRTA 2DR5A 1O5JA 1NUEA 3K57A 4YUDA 5KG1A 4PWDA 1LWFB 4EYIB 3QJJA 2XSFA 3NOGA 1X7VA 2HHSA 2MPUA 5J2PB 1HBOB 3UCUP 1FTCA 2QEXS 2FJWA 4FDFA 4RW4B 4DSFA 1SJ4P 3I31A 2HMIB 2BQUA 5F8LA 1RT2A 2W9CA 3ZC4A 3MD3A 4KGXB 2P5VA 2DR8A 4TU9A 4RW6A 2CJQA 4IQMA 4OZNA 1F6TA 3PRBA 4BHQA 4OIXA 2VOOA 1IM4A 2GGPA 3SXLA 3QJLA 1IM6A 4C9DA 4L72B 1P9QC 4DR4F 1CQNA 1WHWA 3IR6B 3JSMA 4BBYA 5KT7A 1D9AA 2QL9B 2CADA 1NCLA 2CQIA 3VQTA 3DYAB 1ZZFA 3W8GA 4ZIWA 5J2QA 2DRDA 4NXMF 3MXHP 4FF2A 1AT1B 2I9SA 5ETTA 4I0WA 2J0WA 4Z7CA 1TV6B 3EPGA 3PHTA 4KQZA 5J2NA 3DGVA 1L3SA 4N77A 3K59A 1TVRB 5F8GA 3BSOA 3HHDA 2JLFA 4F4WA 2QL7B 2VG7A 3CC2S 2KRBA 3JB9k 4MKBA 2DH8A 1T7PA 4PQUB 3Q2TC 2WK4A 3ZTQA 2G13A 3MOZA 3J7A1 3KK2B 4ZA1A 2FHKA 1X4GA 2W4DA 3FFIB 5DLGA 1XIQA 4OZ0A 5AXKA 1VRUB 5E7OB 5G0RA 2GAHC 4X4UA 3L7UA 1JLQA 4OZJA 1S9EA 1F1BB 1L3KA 1XJWB 1H98A 3DU5A 1RADB 5B0AA 3TJ9A 4E98A 5C24B 4G1QA 2Z56B 3GYXB 2JC1A 4KTQA 1TL5A 1Q0NA 2MJNA 3OSPA 2EW9A 1YJUA 4M5HA 3IM9A 3HJFA 1TKXA 2H5IB 5CXTA 1N5YB 3UD5A 2RDDA 5DO2A 3DOMA 2BJ3A 1N34J 1KLMA 2BE2B 1OQ3A 2DIUA 1IQZA 3QFHA 1T9UA 4ETXA 3MGJA 2NS1B 5HI7A 5ETOA 2KKHA 4IRCA 3OLBA 4LBIA 4DR6J 3SQGA 2HSEB 4I2PB 1AZSB 1K0TA 1OY6A 2D3UA 2J7UA 3MM7A 2V4QA 1CSJA 4KH1B 1PJ5A 2HZAA 3H5XA 3KLIB 1FNOA 1M1HA 3T5KA 2VG5A 2NSCA 5IV3A 1CJKA 4F2RA 2VFVA 1KEKA 3FRZA 3MF5A 2H48B 3IR7B 2F4VF 1RGVA 2C2KB 3EGWB 5LSRA 3ILJA 1SJFA 4ZP7A 3VVTA 1T8EA 4NXNF 4WBFA 1F9HA 1HARA 1LWEA 3T6BA 2OHDA 2GZOA 3LANA 5A0YA 1KFSA 1MLAA 3BH6B 4IRDA 1H3DA 1FD8A 4PUOA 4LFCJ 4ICLA 2HAFA 1C0TA 1R31A 4EK2A 4FYVB 1FDNA 2GA7A 2ZM6J 2AJ1A 1VQOS 2XMMA 3ILIA 2RRAA 2RNEA 5F8JA 5GAEU 4ZP8A 2ZH4A 2ZKTA 1HI0P 5KG4A 1UTAA 3MWBA 3QLHB 2HFNA 1NEEA 1VQPS 4DLGA 4JI4F 4DS5A 3HKZD 1PBUA 2N7YA 3MHYA 4AFFA 2VD3A 4F0KA 2BE7D 1FKPA 3M1VB 5C42A 1HNWF 5HVFA 3PX4A 1YJVA 2RVJA 5H9FK 3LWMA 3OTCA 2QGFB 4JI7F 3GV8B 1FNXH 6AT1B 4IG3B 2DNMA 4KV8B 2NSBA 4L73A 4OHXA 1KBRA 3CJ5A 1RT3A 1JLEB 4PWWA 3BB5A 2MJUA 1BXNA 4ED3A 5DRKA 3JQJA 1LFPA 2QTWA 1KSPA 1HNIA 3JSRA 1SV5A 4OYAA 1RTZA 2MKJA 3ULHA 3DU6A 2FVQA 1NK8A 1YK9A 1XN9A 3ZTSA 5KT6A 1TKZB 1R7IA 3K5MA 1RWOB 2C1EB 4P73A 1HMVA 1VLOA 3HT0A 4N8NA 4LJMA 1RT5A 3K0JA 1NBEB 2G1HA 3RAQA 4DR4J 4F02A 4R0JA 4B3RF 2AWZA 3I0RB 3SDEB 3BO2A 4IR9A 3VAKA 2R8IA 4RW7A 1IBMF 3HZEA 5DG7A 4C97A 4Y0FA 1SI9A 4NXMJ 1WI8A 4WZMA 3GQCA 1ZOTA 2HVZA 3KUEA 1RT6A 4WF9Q 4X4QA 1WI6A 4KKOB 3FK4A 2CZ9A 1D0EA 2PIIA 4PG7A 2NZ4A 4NA3A 1RKJA 3G82A 2ZD1A 3MDFA 1U02A 1ROFA 2HHTA 3IBCB 2AX1A 4ER8A 3CCUS 4C2MA 5THWA 3FQKA 3MAAA 1R8BA 1HNXF 4QJVA 4RW8B 4OYWA 1PYSB 3PW2A 2QMWA 4DZDA 3MM9A 4CZCA 4K0KJ 3M32A 1R43A 3AY0A 2DXEA 3FKBA 1BQNB 4I69A 1MROA 4U95A 3B6BA 4TY8A 5KFXA 3V81B 4JV0A 2RQMA 2DCUB 2EXUA 2VJVA 3WIUA 4LSNB 2V68A 1LWFA 2ZH5A 2HHXA 5GAHI 4QWBA 9ATCB 3GYNA 2KN4A 3TNVA 3O8WA 3TR5A 3HI9A 2W9BA 5J2PA 1VIOA 4MJKA 1JLBB 1NSPA 1M90T 3ENVA 1B0TA 2HHWA 4FF1A 1FCAA 4KGVB 4ZLJA 2LXUA 2JH3A 2R4FA 4DJBA 2E5LJ 4AUKA 4I4BA 4LRDA 4RW4A 3CCQS 3A8IA 1SPBP 3MEDB 3NOCA 4RNFA 2HMIA 3UE2A 3VVUA 2IA6A 4ES1A 4UQTA 3ENQA 4CP5A 4OI3A 1RTIB 1RTDB 1R89A 3KHGA 3V4MA 3T1AA 4D3GA 2RSQA 3IAS9 4Z2XA 3IFEA 4J9SA 2J8AA 3LP1A 2MKHA 3CT9A 2D74B 2G9OA 4NXNJ 3I9V9 1VIXA 3D0HE 3EM1A 3BJYA 1ITPA 1TL7B 3MOJB 4YFUA 3IC1A 1RAJA 4OHWA 1H7XA 3RAXA 1HBNA 4DZ6A 3GCXP 4G3IA 3Q2SC 2NREA 1VQ5S 2BRLA 4P2FA 1SKWA 1TV6A 2CG4A 1EARA 4U8VA 5HP1B 3JTNA 3THVA 1TVRA 4X4VA 3GV7B 2ZHAA 1GNKA 1L5UA 4M5MA 2CWXA 2JX2A 1DQ8A 3KNGA 1M5OC 2CQPA 3G87A 1JLFB 5L1KA 4DEZA 4YB1P 1TL1B 4JI4J 2VPZB 2QJ3A 3SSRA 2KJVA 1Q7LB 4ED8A 2BQ3A 1GX6A 2YTCA 4PQUA 5HVGA 4DCJB 5J1PA 4HH0A 1NH7A 1BWVA 1JJCB 3KK2A 1EQMA 1FNMA 1MW7A 3PY8A 1HNWJ 1U45A 1YIJS 3FFIA 1SL0A 4LF1A 1FXDA 1VRUA 5ETMA 4TYAA 2AEMA 4LFAF 5H9EJ 2XULA 2R8HA 1PAEX 5KFLA 4HACB 2R7WA 2BEFA 3AQOA 3H2LA 3BZQA 5C24A 1WHYA 2LDYA 3C16B 3HULA 1YJNS 1TAQA 4O23A 5LJ3Y 4MMOA 3MURP 1VQYA 2XMJA 1L3TA 1S7HA 2K3KA 2HFVA 4NASA 1N5YA 1K1SA 4PCQA 1Q95G 2BE2A 1RHJB 3OFGA 2P9CA 2WONB 1RKIA 3EVOA 4WIIA 2M3DA 2KZMA 1UVIA 3K7RA 1WNEA 3R1HA 3Q8QB 3WQPA 5L39A 4I2PA 1AZSA 2V63A 1UW9A 3D6FB 5I3QA 1JLCB 2GIRA 5KFZA 3KLIA 2AEFA 3O3LA 3HK2A 2YWFA 1IBMJ 1NNDA 2RT3A 2HGNA 2CPIA 2PDAA 4DF8A 2CDRB 2H9ZA 3ISZA 5HL7Q 3TA2A 1X0FA 2DKOB 4F26A 3RGIA 2WBRA 2CQCA 1KWMA 3KJQB 4DX8H 1U1RA 1S9GB 1SQGA 4EO8A 3QRRA 4DSLA 3EZ5A 2CRLA 2G2ZA 4DFPA 3M8PB 2VV5A 2HVIA 2XI3A 1A7GE 3M8QB 4F3MA 3FCHA 4L74A 1ZBTA 3QLHA 1WORA 3TP2A 1HNXJ 2M8DB 4HLBA 3TO8A 3R2DJ 3C15B 3X1LB 2AYEA 8RUCA 3IR5B 3ILLA 4I2QB 4DLEA 4QIWD 2HGLA 3M1VA 2ACMA 3D1OA 5M2PA 1HR0J 2ALYB 3T5JA 4GVLA 4ILMA 1JJ2R 2GQ2A 4LF4F 5KOWA 1FESA 2SXLA 1A9NB 1XNQF 1NJWA 1D1UA 4I64A 1X9SA 3L09A 1S49A 2OMOA 4IG3A 2FLOA 4KV8A 1MG7A 2AP6A 4J91A 2WVBA 1KVJA 1LQ9A 2C2OB 1V5VA 2CZ4A 2UUBF 1JLEA 4NLXA 7FD1A 1R0AA 4CI0B 4JV2A 1BQXA 1X5PA 1WOOA 4EZ6A 1PJ6A 2WW4A 5AXLA 3MFHA 1PYOB 3A1YG 4ILLA 3DXBA 1D3WA 3GJQB 3FNNA 2P6SA 3KHLA 1TKZA 1OYEA 2XY7A 4XK8C 2B8QA 2VPWB 3KLEB 4JI6F 4YR2A 2GFFA 5A8KB 2JEIA 2BKNA 2CQGA 3BKFA 3CUNA 3VAMA 3I0RA 2B7BB 4HH1A 3SDEA 2Y1LB 4XIUA 4PXCA 2FVRA 4KYZA 2R7SA 2C3MA 2I1RA 5AE1A 4J37A 2XEXA 3R5GA 3EUNA 1KHWA 5HMZA 3QPIA 3CCLS 4U96A 2VC0A 2ZITA 2C3YA 3UO0A 1P6TA 4KKOA 3I5CA 2AJFE 5L1IA 3MAQA 1T9XA 4WFYA 1J27A 2RD5C 4K59A 1KC8T 5CD4H 3CCZA 2W2OP 1RE1B 1O51A 3LUYA 5AJ3F 4RW8A 2DEIA 2M0GB 3J81Y 4LFAJ 2OKQA 4JI5F 4KR0B 2FZCB 2OLWA 1BQNA 2M88A 2Q1LA 2FLLA 1RWVB 1WOPA 4NLDA 4IO9Q 1SIWB 4WFZA 4L6V3 2OEKA 2CPEA 5CYMA 3QGIA 3V81A 2R2RA 3G86A 4LSLB 1RJJA 3J81j 3NGUA 2W7AA 1A6LA 2PI5A 3QO9B 3UNYA 4LSNA 4FNIA 3CJKA 5KFSA 4ZP9A 2YKOA 4JV5J 1S5ZA 2J7WA 4ES2A 2V8HA 1SQFA 4TQRA 3IWNC 1C4AA 2ZHBA 2OIHA 2R8KA 2YNFB 1WF2A 2V2VA 2Z57B 2CNKB 3MEDA 2Y9HA 4DMZA 5HK4A 4B3SF 3RRKA 4USJC 3PRDA 3PX0A 1HNVB 1N5VA 1FRXA 3KG0A 3I32A 5ETLA 5M2RA 1DLOB 3B82A 1NZ8A 2IFXA 4UQGA 1SC4B 3MR2A 2IJFA 2IA0A 1VQLS 3NG8A 1S0NA 3PRVA 2QE5A 3JTOA 5KT5A 3IAM9 3ICLA 4M5LA 1TAUA 3H90A 2MZJA 1B64A 4EGLA 4F50A 2OPRB 2GIFA 2CNOB 3SQOP 1K0VA 4A47A 4ZVOB 4A8YA 3I0SB 4B08A 1APSA 1RA6A 4KPCA 1UKUA 3WX4A 1NDPA 4AXJA 2WZ1A 4CLFA 3TVKA 1OPIA 3HSJA 3GONA 2J6UA 2G0CA 1U1NA 1DURA 3AH6A 1R8PA 4W90B 5T41A 3BBBA 4OZ2A 4NCAA 1JLFA 2MKIA 4X64F 4RNNA 2BR0A 3EGZA 3QRPA 1Y00A 1RHRB 3R6GB 2MZSA 5MAOA 2JFKA 1YWXA 4F8RA 3N28A 3F41A 3L7OA 5DDRC 4LF4J 3I6PA 4MKVA 5ETSA 1XNQJ 4H4OB 2LDIA 2HQCA 1KTQA 2V2ZA 4RBTA 4WFAQ 4F0HA 2XY6A 5RUBA 4OFZA 1FJEB 4O4GA 2VASA 5DLFA 3I5AA 5D0RA 4ED2A 1VQ6S 4G1PA 4ZITA 4DG1B 4HACA 1Q86T 1EETB 4NRTA 1WEYA 5GAGI 3C16A 2ZJPQ 2AKWB 2AMCB 2F1FA 4RBVA 3VR1A 4DV1F 5EWGA 3PYFA 2HVHA 4CM0A 4ECVA 2JWNA 4LT6A 3SCJE 3TJAA 2HK2A 3TZXA 1ZH5A 1VRQC 5DGAA 3UPFA 5ETNA 3DLHA 2OTJS 1FF2A 3IG1B 2B4PA 2E5IA 4WFNQ 4UOCA 2WONA 4IG0B 1TR0A 3Q8SB 4ZMMA 3J7YI 3QZ7A 4LR7A 4XPEA 4C3KA 3G8SA 3EMTA 2FGCA 4JI6J 2XCPA 3LW5C 3DLEB 3M9NB 1P1LA 3IGVA 4ZLPA 3N0VA 3MPDA 3BQ2A 4M5IA 4OI1A 4DR7F 2OPSB 1VQNS 1JLCA 3DGPB 2KT3A 3TZYA 4CO2A 1QSYA 3SBMA 3RB3A 2Y1IA 4RX6A 4OZ3A 2CAJA 2XHWA 2F7VA 2DHXA 4J7CA 1RAGB 3VV2B 2NLWA 2QMXA 1ACMB 4Y2CA 3TI0A 3VAHA 4M1KA 3ZNUA 1YJTA 3LGHA 4ZK7M 4HT5A 3BKTA 4C0OC 3PR5B 2JOQA 3GG0A 1BGXT 1QUPA 1N33F 3DCAA 1FA0A 1B7YB 1S9GA 4ED7A 1U1MA 3LALA 4LF2A 3OXLA 2X51A 2NQPA 1HBUB 1RT4B 4DPYA 1H6KX 3M8PA 3OQ2A 2VIHA 1S4FA 2EEYA 2L3MA 1FERA 2D9PA 3M8QA 2DTJA 3NLCA 1Z4UA 3W1YC 1TFYA 1CULB 3C15A 4QIVA 1ELOA 2HWIA 3MUVP 2RRNA 1XTZA 2XTJP 5I3PA 4JI5J 4I2QA 2GMHA 1YJWS 4F25A 2XWYA 1EHWA 5B0FA 5BJRA 4FVCA 1HIYA 4E2FB 4TLRA 4DV5F 4CLYA 2EFPA 5AXNA 3CC4S 2YH1A 4AQYJ 3M30B 2M8HA 2I0XA 2DBBA 4OYXA 1N36F 4CLWA 1UVNA 1HI1A 3DDIA 4QU6A 3CDWA 2X1GA 3B78A 4C6AA 5MLCV 2N4CA 4HTIA 2XYHB 4U7UK 4AYBD 5F8MA 3O5TB 2GVDA 3KK1B 3CJ3A 4DV2F 3NGSA 4KB7A 3L95X 3AOAA 3TJ8A 5HBMB 2B9EA 4B3SJ 3ILOA 2EVZA 3GCWP 3O1LA 3ISND 3BBCA 3U7JA 2C22A 2WAQD 3GR1A 3GB0A 3FGVA 4PXEA 2CPXA 2BOPA 1YRUA 3N6MA 3VGTA 3VZIA 2FJBB 2QLBB 3KLEA 2ZUGA 4RBUA 3MD1A 4B3TF 5T14A 2MQQA 5DZ7A 3HKWA 1S10A 4B3OA 3ZFVA 1T9TA 5A8KA 2BUNA 3OTEA 1KR4A 2R7UA 2OEMA 1QTNB 4WIQA 1S76D 2W8KA 3ITHB 1W2BR 2WOMA 4NA2A 2WCXA 7AT1B 2YNGB 4K2XA 4P6QA 1F9FA 4K4WA 1RWPB 1WC1A 2PT0A 3MPYA 1FRIA 2BACA 3SIPB 1KFDA 5LOQA 4YB5A 5KG7A 2E5JA 1BWEA 3JTPA 1IKVB 4A8XA 5GVQA 3AXMA 3QYYA 4M5GA 1HWIA 3IWXA 3US5A 2LXIA 4TKTA 1NM2A 1T02A 1BUXA 3LWLA 4K2JA 5LMUJ 3W5YA 1S99A 4QIFA 4IKAA 1XNRJ 3AOBA 3C6TB 3RRGA 1K9MT 3Q8RB 3T1HF 1RK8A 3TUJC 2HLUA 2POKA 5E0OA 5B08A 3T9NA 4C8YA 2W4CA 5U47A 3RW7A 3TEGA 4DV1J 2PC6A 5AE3A 2KYXA 2MY7A 4LSLA 1LXJA 4DL4A 3QO9A 3VQSA 4ED5A 1XMQF 4ES3A 3NNHA 3PW4A 1S1UB 5KFDA 1NKBA 5KG2A 2DJWA 2HQGA 3CW2C 1PKUA 1LK7A 1ZM3A 4BC7A 5AE2A 2P6TA 2AGOA 4V19J 5KFFA 1SC6A 3FSXA 4HTJA 1H2TZ 2KO1A 5D3GB 3FBFA 3SZ2A 1RXOB 2Z30B 3LPEA 2FZGB 4GRSA 2F4FA 1FFWB 4JI2J 3WX8A 1SH3A 4DUTA 2VBZA 1UVLA 4F2SA 2GW8A 3TAQA 1TTHB 1U7LA 4KH0B 3EVMA 3W7BA 2CQBA 4FS2A 1DLOA 3B4MA 1IR2A 1S12A 1UWAA 2BJ7A 2VZ9A 3NS5A 3EJMA 1R0BG 5D4OA 1TKDA 2UUCJ 3BO3A 4WK3A 4AT1B 1TK0A 5JMNA 4U8YA 1RWUA 4GVBA 2MKYA 4KE5A 1S6QB 2FDNA 1DY3A 2OPRA 5EUHA 2XLJA 5IQQA 1RABB 5KFTA 2DIVA 3DHWC 1IBKF 1FTRA 4PPZA 3I0SA 2FHJD 2BA9A 2R7RA 3TAPA 2QA4G 4ECXA 1PIEA 2RUSA 3RBXA 1N52B 1XR6A 3V4IB 5EGYA 2M52A 4LBHA 3QT7A 4DV7F 2V5HG 3RJMB 4B17A 4U67Q 2CJ9A 5KFKA 5B7WA 4ZVTB 4QWAA 3DRPB 2J9EA 4FYYB 3CJSA 5GMKa 5A8RB 4TNOA 3NGRA 2DH7A 4UUWA 2KXNB 1LFWA 1VS3A 2VBXA 1X0PA 2LQJA 2DO4A 1UW4A 3GIIA 3CCES 3NCQA 1S1TB 4NE9C 3M2RB 4CM2A 3NBPB 2CVEA 4EZ9A 4WU3A 1RSCA 1TL4A 2KDOA 1V5IB 1UJ6A 1QAJA 2MHNA 4DV5J 2ZHOA 1GMWA 4USVA 2LQ5A 2XZDB 3HHEA 1GTHA 2VBWA 4FYDA 5CZVA 3H25A 3T6JA 3OW2R 5LL6d 2J7KA 5KG3A 1JX4A 4DG1A 1WJ9A 1QE1B 1IR1A 1EETA 1VISA 1UVJA 2JVOA 2CWKA 4PEOA 1DTTB 4CNZA 4ZHRB 3N6LA 1X5SA 1DBDA 3DLBA 4NPOA 1FXRA 3AQPA 4DV2J 5HLFB 3B4DA 3BPSP 4BCAA 4RUBA 4MKAA 3GIJA 2ZBCA 2BYCA 2FHOB 1ZM9A 2HFOA 2BW7A 4RL1A 2B4VA 3M6VA 3EZUA 4M5JA 3WDOA 2QA2A 2C2EA 3HSGA 1NJIT 3AD7C 1HYSB 3VTIA 1CS4B 3DLEA 4B3TJ 2EFGA 1KQFB 3U02A 3EICA 3ZTRA 2FJEB 3MEGB 2HS3A 4Z37A 4PZVA 4HYKA 2CYYA 1ZAXA 2HBZB 4ILRA 3ZZOA 8ATCB 3H42A 3P4UB 1VLYA 1OSCA 3W2VB 1B4SA 2HIYA 5A8WB 3FZBA 1WG1A 1XK8A 2APOA 4ZPBA 4ZLNA 1JQGA 5E3PA 1TK5A 4IFVB 2VL1A 2F3JA 4B9MA 3T41A 5ETQA 3MTJA 1RUSA 5BR8F 4C3LA 3NS7B 3UDEA 2E9RX 1CJTB 4FPIA 2RB7A 2IM0A 3PHEA 1WOSA 2GS8A 1HI8A 2UP1A 5FDLB 3WIVA 4Y2IA 1BY9A 4FZVA 1FX2A 3OTDA 2WHOA 2CPYA 2IM2A 1TKTA 1HBUA 1RT4A 4KO0B 3KK3B 4CYUB 2ASDA 2DXFA 2M5YA 3MMCA 2ZBIA 1S6PB 2W2MP 3DNCA 3CMQA 1PAUB 1V3SA 1RZMA 4ZVUB 2DK2A 1CULA 5F8NA 3NNAA 4YR0A 1M5HA 4PABA 2W7OA 5EHHA 5GADU 4B9UA 5CYQB 4TYBA 3VAJA 2CQ3A 1YLXA 2FB0A 1JLAB 1HWLA 1S79A 2GMLA 1NK7A 2KXHA 1AB8A 3KLFB 1UP1A 5HMXA 4X4PA 3CB4A 2JRSA 2PN6A 1JKHB 1HWJA 2VBYA 3CD7A 3RG6A 1GK8A 3M30A 3BBFA 2XO7A 1XMQJ 3ZO7A 4PYDA 3IBFB 2OSRA 4J9MA 2KFZA 2DHHA 5BYSA 1HBMB 1UETA 1WWHA 2HEKA 3R1LA 3R3TA 3KK1A 1DQ9A 2RU9A 2C3UA 1T9WA 4PQAA 1VQMS 5GAEI 1VHIA 4UW2A 3B8HA 2X7IA 2BJEA 3VAIA 3DLLQ 2XO6A 2DNNA 2HFUA 2H3EB 5F41A 3UDVA 4X65F 1RAHB 2BANB 4N8OA 4KHPF 1R6YA 4ECQA 1YHQS 3KXDA 1U48A 6FDRA 4ID5B 3RYLA 3LF0A 4JI0J 4DS4A 3RW6A 4K4UA 2QSFA 3SI8A 1KN6A 5FIIA 1IBKJ 1REVB 4CO1A 3ITHA 4YY3F 4C8ZA 3MPUB 5A2QY 3K8VA 2YNGA 4CO5A 2EPIA 4M94A 3VALA 4WE1B 4J9PA 4DV7J 1S72S 5F3TA 3GWCA 4ITSA 5IWAF 3KHRA 2IC3B 4LF9J 1YRTA 5A6PA 5E2QA 1IKVA 3PZPA 3BDPA 2KM8B 2BQRA 1MN7A 2BXJA 1IXKA 2LXFA 4JBCA 1NLKL 4LIWA 1EQ0A 4DCOB 2EC0A 1IBLJ 4NLRA 2OELA 2MKCA 4O3NA 3AJ2A 1RHUB 4ZCKA 2CNLB 1YVFA 2G2OA 4P7VA 3C6TA 4KY3A 4KPYA 5BYQA 2V69A 2KVIA 5LSOA 3NP5A 3GFXA 1SJ3P 1VI7A 4UF4A 4UOFA 3UI3A 4ZDNA 5G4DA 1U2RA 3LOUA 3GSIA 2M70A 3O44A 4C8OA 1NHUA 2FJDB 4J9VA 3NWGA 3R9LA 3BGRB 1IBCB 1X4DA 3DKDA 3GIRA 4OZ5A 1HFEL 3PV8A 1S1UA 1DFDA 2DEJA 1ZA2B 3BSNA 4J9LA 2ZJRQ 4CLKA 1QJHA 2YNIB 5C5JA 2UUWA 4E8UA 5D3GA 3I87A 4WFXA 5CCLA 4NWBA 2DY9A 2K7KA 4GO5X 2HQ3A 1SKUB 3MM6B 2V8DA 4DHVA 3GJTB 2ZH3A 4DL6A 4O44B 3I55S 3Q8YA 2E29A 1Z2LA 1ZPWX 4JUZA 2IJRA 1LOUA 1BQMB 3P3DA 2R7OA 1HHTP 2ACYA 2BV3A 1UJ5A 1XR7A 2ZBQA 4X2BA 2FQQB 1IJEB 4DUZF 2DNPA 4JI3J 4JI8F 1IR0A 4DQIA 1FE0A 2R2TA 3NGDA 1Q4RA 1C0UB 1YZ6A 4PYAA 5GMDA 1X4CA 3UD3P 1E6VB 2HG4A 3M6XA 1S0OA 2RRBA 1VK8A 4QYZJ 1NMEB 3V4IA 3U1NA 4HHUA 1X5OA 3NAIA 3QJPA 3DRPA 2GVZB 5A8RA 3LP2B 1XMBA 2B5JB 3KHHA 4Q5VA 2YKAA 3MMBB 4X4SA 1VGYA 1I3OB 3OL8A 3GJSB 2WSCC 1Q16B 5KOXA 5D0HA 2CJAA 4ED1A 3J81U 1TL3A 1S1TA 1BMQB 3D6TB 3M2RA 4XPCA 3NBPA 5LXYA 3Q86A 3LGNA 1XMOF 3I96A 2UZAA 3EZOA 3PO4A 1U0HB 4IOAQ 2PGCA 3C8YA 2IMOA 4DV4F 1WTBA 2L9NA 1F5CA 4OYIA 4YB6A 2NXEA 3I56S 4W92B 2UXCF 1QE1A 1SC3B 4KIAA 4AE5A 2Q66A 4ZHRA 2A2DA 2R2SA 2IBOA 2KTQA 1RTJB 1ULRA 1SJQA 4DCPB 5JJBA 4OHVA 5HLFA 4DSKA 2LQBA 3EVWA 1ZM4A 3X3UA 3PACA 3BQ0A 3W2WA 2YKNA 1S0VA 4D3HA 2BX6A 1LNQA 1Y5NB 3CJTA 3UCZP 3Q23A 2CPDA 4WPAA 3R5DA 5DJBA 2CQ1A 4X65J 2DPIA 3CD0A 1HYSA 4ZCIA 1CS4A 4KHPJ 4MT1A 3MEGA 2OI2A 3AD8C 2ZDOA 2MQNA 4XDCA 1R8AA 3UCGA 5C25B 4LF5F 4DX5A 2XB2D 1UWBA 3M9MB 3W2VA 3KLHB 2IDEA 2R8GA 3BSCA 2HIQA 1VBZA 2N4DA 2QMUB 2H51B 5IS2A 4OV6A 3ZNJ1 1XR5A 3G4SS 5F0WA 1ZETA 1WF1A 2YWWA 2DNZA 3NWRA 3G2XA 5KFHA 4XDDA 5CD4A 2HVDA 1VQKS 1CJTA 2EFOA 2AJ0A 1VC5A 4K5SA 4M63A 3R27A 1I51B 2XLIA 3AT1B 2DNOA 1H72C 1FKAF 1E6YB 5FDLA 1JIHA 2QLXA 3LA0A 5D4LA 3I9ZA 4WTYA 4KO0A 3SV3A 2Z2YB 3KK3A 4CYUA 2C2NA 3D54A 4WP9A 1RU2A 1W25A 3H2UB 5H9EK 3IS9B 1S6PA 1G4CA 1UPPA 1U49A 2C3OA 1NK6A 3D9BA 1Z2ZA 5DG8A 2BW2A 4J5OA 1CJUB 2IMWP 3DRRB 2BMBA 3HHLD 2KYZA 3K5PA 3HVRA 3PM9A 1U1QA 2K1RB 1FWLA 8AT1B 1JLAA 2AIRB 1AYEA 2UV8A 2YKPA 3KLFA 3D4JA 1GH8A 2UXBF 3MTKA 2RH3A 1V3RA 1JKHA 1M5PC 2BOAA 5AXMA 2QA1A 4ZPWR 3EDRB 1PYTA 3LAMA 2ZDPA 2C28A 1C1CB 3W5XA 2MXYA 2J5AA 3KDOA 2B6AA 3W66A 4Y2AA 1HBMA 1OIAA 1HLWA 1SUQB 2OTLS 3M7VA 4RNHA 3IBWA 3MPWA 1U2CA 3C14B 2CXEA 3H8YA 3GILA 2L9DA 3GU0A 3H59A 1LKZA 4NLYA 3KJNB 2NPIA 5AT1B 2RHQB 2DR9A 1WDTA 4RWXA 1Y5IB 4BC9A 3C19A 3R5AA 2HRYA 4YQWA 3CPWR 2BANA 2IYGA 3BGOP 2IBKA 1FT8A 2O67A 2NXUA 4LVOP 3DXSX 1RI7A 2XY5A 4W98A 4DUZJ 1NJZA 1Y0HA 5D77A 3OSNA 2ZOFA 3GE9A 2HVEA 2E9ZA 2LEBA 1F9EB 1REVA 3EXCX 1S4EA 2PE8A 4CTAB 1GT8A 2OD4A 1JXEA 1IKYA 3T19A 4HT7A 1TFWA 3Q8UA 1VRTB 3IN5A 2HBYB 2VKRA 4NLUA 1YBAA 4WE1A 4A8MP 1NKEA 5IXUA 3C66A 3EYZA 5CYJA 4QWDA 3HHLA 2XS5A 1TP7A 1YZ7A 2BKOA 2V9WA 2PMWA 3L4BC 2MQLA 2IRUA 3PX6A 5DM6Q 4U7UD 4NI2B 4G6VB 2ZOMA 3QGGA 4KGMA 4NYOA 5DDOC 2HBQB 3DLGB 1C4CA 4LREA 4AD6A 1YITS 2JDJA 5EWFA 3GSDA 3QRQA 3CE8A 2OJ3A 2Z0GA 2VDIA 1B3TA 1PC4A 2ILYA 4YS2A 3EPIA 5J1EB 2J0XA 2XMUA 4DV4J 2X1BA 2AF6A 1Q8BA 2UXCJ 4P72A 1LWCB 3CIMA 1OY9A 2O5DA 3BGRA 4DFMA 1SL2A 1TUVA 2VUGA 2JVRA 3CIZA 5JUMA 2XYGB 2P9GA 3KOAA 2FD2A 3QT5A 1DTQB 2ZEJA 1P27B 5KFYA 2IVFB 2KXFA 3I5BA 4LSZB 2HWTA 1RU1A 2YNIA 1N6QB 2E1PA 3Q24A 4LQ9A 1OY8A 4FXVA 1LW2B 4L3KA 4QIGA 2DPJA 5KFAA 3C46A 3PIOQ 3PXGa 4WFBQ 4LF5J 3CF5Q 1IKWB 3S8SA 3MM6A 2CJKA 2DXDA 3E2EA 4OX9F 4DN9A 3TZZA 3M4XA 4O44A 4ZVSB 2HHQA 4S0MA 1TUWA 4MYTA 3DLKB 3OHBA 2XSJB 4RW9A 4ZPCA 2ATLA 1ZM2A 3CNQP 5KFWA 5JVGQ 2ADCA 3EE3A 4H54A 5HROB 5E5NA 4QW8A 3KMSA 2GQQA 5DG9A 1FVSA 4JYAF 2C3PA 1R8HA 1JXVA 5HQ8A 4UTGA 2FYXA 5LMNF 1KTVA 3DRSB 1E6VA 2H5JB 2DISA 3JAMY 5KFJA 4WCEQ 5EX0A 3MFIA 4JOUA 4TU7A 4X66F 2HHPA 2FY1A 2GVZA 2JEGA 1XERA 3LP2A 3VHQA 1Y5LB 4CLZA 2B5JA 2R8JA 1MSWD 3MMBA 1IUJA 2NYHA 1XC9A 2CA9A 3KJVB 4J9UE 1S1VB 1N48A 2QLWA 2FVPA 4IDKB 4PWDB 1H74A 3QATA 2RS8A 4QR0A 1X5TA 1Y3JA 2DNYA 1H2VZ 2UXBJ 3HVTB 2Z4PA 4F4ZA 1KP6A 1YBUA 1SQEA 4R5PB 1XBWA 1URNA 3G96A 7FDRA 3OL7A 2CZVC 5CCMA 5HMYA 1N8RT 4KBIA 3FBEA 1MNEA 2K3IA 3RB4A 1IVZA 1VQ8S 1YX2A 5KAKA 1VJQA 1RTJA 2F40A 4A8KA 2A6OA 5E3AA 1O0PA 1Y7PA 4KFBB 2HNZB 1JMTA 1U6FA 4X4RA 3BREA 2C42A 1FHTA 1JXLA 2VQFF 3W64A 4RW6B 2VPXB 1Q53A 2F9JA 2B7CB 2GGPB 2DT9A 3SV4A 2OFHX 4CCHA 3FVYA 2OFGX 4NZ6A 1IJFB 4EMDA 4RKUC 3VAGA 3CDBA 1N88A 3IA0A 1IN0A 3CDEA 1J5EF 5ITHA 3AODA 5GAGU 1HWUA 5B0GA 3SYZA 2OPQB 2D7SA 2FVSA 4C8MA 4DWIA 4R8UB 5C25A 2YPZA 2DR6A 4DL5A 4F67A 3KLHA 2H54B 1SCJB 2DGWA 2JC0A 1LK5A 3HDSA 2VICA 4ZVFA 4ZVQB 4FXDA 2MMYA 3CJ4A 1HW9A 2QLJB 2YX1A 3A3OB 2O66A 1S7IA 1U1PA 3OD2A 1SKSA 5DQIA 5JVHQ 1R0CB 1FJCA 1G3OA 2C2RA 2FC8A 3R8YA 2KFNA 5SZTA 1HBOA 3O6QA 4AL7A 3E01B 4ANEA 6FD1A 2FC9A 5IC6B 4QOTA 4DPWA 4E0DA 2MY8A 2YH0A 1M1KT 5IOLA 2HZVA 2RE1A 1PG5B 4BDPA 3MUMP 1W7WA 3W3SA 5F9LA 3IS9A 3A4TA 3G8TA 3N6NA 5L46A 3PCOB 3M8RA 1LW0B 4GKJF 4IH5A 4FKYA 2PMZD 5IT9Y 2VC1A 3RB0A 2ZUAA 3QGHA 1CJUA 3DRRA 2WTFA 4LRCA 1U8WA 4K7QA 4C98A 3MI7X 2AU0A 4ECSA 2GNKA 2VHGA 1RWMB 2ZNZA 2F4VJ 1LXNA 5KFNA 1FK9B 3DOMB 1VOMA 1K8AT 3PEHA 1NDKA 3TAMB 5HATA 3QIDA 2FPHX 2Y3YA 4DUYF 1Q78A 3FMWA 4HI1A 5ETRA 3DYAA 4RPFA 4USHA 2IAJB 4C11B 4F04B 2MLXA 4ZVPB 1C1CA 4MH8A 3MR6A 1SUQA 2ZVSA 5IZHA 2GJFA 2B56A 2EG1A 1U1OA 4QR1A 2LECA 4ELVA 2GJ2A 3FSIA 3RR7A 3GZ7A 1RAAB 1HD1A 2ZNYA 3AJ1A 3RUBL 3A3NB 1PGZA 1HPZB 2A6MA 3AFGA 1PILA 1KD1T 4OX9J 1WEZA 2L48A 1C1BB 2WSFC 1NSQA 1RACB 2LU1A 2EC2A 4CH1A 2XGQA 3BN4A 1QVFR 1NO8A 4JI7J 1FDAA 3ZZ0A 1C0TB 4LRBA 4AL5A 1ZTTA 3ENAA 2R7XA 2FLPA 1HNZF 2DH9A 4GC6A 2QA4S 3GR0A 1URRA 2U2FA 1WKJA 1O8BA 5LMNJ 1UPMB 4ECTA 3D68A 4FNHA 1QAIA 1Q8LA 4IUFA 4RUCA 1TU0B 4X66J 1UMJA 3Q89A 1H38A 5B0EA 3TQ1A 1NH8A 3VGSA 2DGTA 1OJ4A 5CABA 1G7CB 3P45B 4NI2A 2BE9B 5A76A 2EKYA 4P2XA 2XMTA 3DLGA 2ASLA 4KJIA 3CMAS 3SSQA 4DV3F 4H4KA 2Q3PA 1HQEB 3TZWA 3BS9A 3MMAB 4CLPA 4F4AA 4B3RJ 3GJRB 1RT3B 4UUXA 3J7ZT 3TANA 1NRKA 3DLJA 2VOPA 2PFFB 2F8HA 5EX3A 5J1EA 1RQ0A 4PG4A 5CAAA 4O3OA 1O6XA 2JLGA 3WBZA 2AYBA 2ZJQQ 1LWCA 3HD2A 3IWLA 2MSTA 2OP5A 3BR9A 2VA2A 2M9KA 5KFIA 2BABA 1N34F 3KLGB 4ALZA 4U7CA 2BJ1A 1AROP 3ENWA 2J9DE 2NYIA 1ZS6A 3FMBA 2VQFJ 3RR8A 3WC0A 2AGPA 1J2VA 2DNKA 4ECYA 1DTQA 1HHQA 2D41A 2OD6A 4WYLA 3TRGA 1HA1A 1N6QA 1UL3A 1N0VC 5FD1A 4KC5A 4ANCA 2WVDA 4J90A 1R3NA 4OX6A 1J5EJ 3D3BJ 2E1CA 2HFZA 1WACA 5DGBA 3OFHA 4UZBA 1LW2A 2HAIA 3AXKA 1S48A 2PMHA 1D9FA 1R8CA 4LMZA 3KG4A 4C0BA 3BKUA 1IKWA 4WU2A 4WP8A 3T1YF 2IPOB 2GC8A 4FP9A 3JYTB 3CWJA 4LR9A 3DLKA 2DB1A 1FD2A 1N0UA 3SEOA 2MTLA 1CBKA 1NK0A 2AYMA 1YQHA 4HR2A 4ENOA 4LFCF 3W63A 3HD1A 1NK9A 5A2QU 3HHNB 2KL8A 4CH7A 3M2UB 2WSEC 3J7Z5 3DDNA 4DR3F 5FLXY 2RU3A 1SJRA 3P5TL 4WKRA 2WW8A 2VFUA 3A8EA 1MWZA 4DX7A 2EBGA 3DI6B 1VBYA 2VU5A 1UFWA 3DRSA 3CCRS 3IRXB 1B0VA 5CQGA 2IYIA 4KSEB 3MM9B 4F7VA 4RNOA 2JLEA 1FE4A 2R2UA 4FYXB 4OLPA 2VPYB 4GKJJ 2AZ1A 1VQ4S 3AOCA 1T03B 4EUVA 4EBDA 2EWHA 2A3JA 3QAUA 5L9XA 2XCAA 1FJGF 1L3VA 3FSYA 3KJVA 4LVNP 3CSKA 1S1VA 4O0IA 2LA4A 3FZ2A 2UVUA 5I42B 4IDKA 1KQGB 1RWKB 5BXIA 1PO6A 3M9OB 4RJVA 4FF3A 1G1XA 1DAXA 2IM1A 1S1XB 1JK9B 4DUYJ 3HVTA 2W9BB 1SJ1A 2M4MA 4QWEA 2ZZTA 5EWEA 4R5PA 5E3RA 2FJAB 1HHSA 3BYPA 1N4LA 1RLDA 2RKIB 2BKPA 4ZVRB 3JQKA 2H1YA 2UU9F 2KHDA 3LPYA 4USUA 2I6WA 3MR3A 1P1TA 1QD1A 4KFBA 2HNZA 3FRYA 3CJ2A 3DFEA 4I67A 4ECUA 3VGUA 4ZJOA 3LP1B 3D6HB 3S6EA 2E5GA 2KT2A 1NPKA 1WHVA 5DQHA 2YNHB 1S6OA 3NCRA 2IIHA 2OPQA 3U27A 2BJ8A 4R8UA 2ASYA 1HBNB 1U6ZA 3D6MB 3DN9A 4DQSA 5IT4A 1HNZJ 2Z58B 1U6BA 3PJWA 3KMQA 3D1HA 3KUHA 5HJXA 4USIA 2MQPA 1BHNA 3FQLA 2NCKL 2YY3A 3CMES 2BVZA 4HDGA 4OZ1A 3CJRA 3PJXA 3AAWB 4R0EA 3WC2A 3R7SB 1KDNA 4J9NA 4JP8A 2JSXA 3UN2A 4YR3A 2HNYB 4CLTA 1PJ7A 2F65A 4MAKA 4MIBA 1NB7A 4BLGA 3EDQB 2XMVA 1Q7YT 4K8RA 1WKKA 1JLBA 3ONQA 3TQEA 3E01A 5D4PA 2V9KA 1N56A 5HO4A 1WKLA 1WTFA 3G6VA 2V2QA 3PO5A 5DQGA 2B9YA 2A10A 4DV3J 1RCXB 1YSJA 4K0KF 4F3QA 1IWAA 4C3MA 3PW7A 1YI2S 1CQMA 4XAKA 1LW0A 1X4FA 3C6UB 3CDAA 4Y6IA 4ZJQA 1HQUB 1RTIA 1RTDA 1HQ2A 2QZ8A 2LVWA 1I94F 4X84A 1V6HA 2OPPB 2X1FA 2GV1A 2ZC4A 3DOLB 4P52A 2RQKA 3JQMA 3OV7A 1YRXA 1FK9A 1BC6A 4JB8B 3TVZA 3TAMA 2JL9A 1RWWB 1TL7A 2OMLA 3PVXA 4Y2MA 2IAJA 5K8NA 4C11A 2E5LF 2JFDA 4G1IA 2OSQA 4F36A 4F4XA 1H73A 3KNAA 5HP1A 4X4NA 2WRMA 2UXDF 1K73T 2BDPA 1FDBA 3OR2B 4B02A 2L41A 3Q83A 3N5BA 4KT0C 4K4ZA 3HLUA 2RDIA 1X4BA 4Q44A 1TL1A 5LT5A 5IT0A 1HPZA 2DHAA 3T1YJ 3AHPA 3M05A 3OLAA 1C1BA 2FGOA 2CKWA 5GADI 2OUGA 2Q6BA 3H0PA 4L75A 2QL5B 4NLOA 2YKQA 4YOEA 2IRYA 1D09B 4CWBA 2J6TA 4LBPA 1B7FA 5HAOA 3M2VB 3NY0A 2W8LA 2XS2A 1JB0C 1Q8KA 4NLPA 2XMWA 4DR3J 3DC2A 2UUBJ 4OQJA 2RMLA 1WC5A 2CPZA 1UVKA 2L08A 3P96A 2ZE2B 3Q22A 4WP3A 4ECWA 1N5QA 2A2CA 4LRAA 2AJ4A 3M8ZA 5B09A 1U47A 3ISNC 1NZAA 3PR4A 4Y65A 3NNCA 1F3FA 2AJ2A 2VODA 3CO0P 4HI2A 3LTOA 3QMQA 3KFWX 5DDPC 1NKCA 4DL0C 3OTBA 1EJ7L 3OR1B 2LEPA 1FJGJ 5IFMA 2LQ8A 4IFYB 2M7SA 2H4YB 4L3NA 1Z1ZA 1HQEA 2DGVA 2V8VA 5D4NA 3MMAA 1Q79A 3BH7B 3QGPA 1R0AB 4MK7A 1LV5A 4NEZA 4CO0A 4X62F 4C4WA 3RBDA 1X8DA 2JEFA 5D0EA 3GTYX 3NKYA 4KAIA 1VDHA 2XBPA 3G6XA 1X60A 2HHUA 3R5JB 1RT1B 4I7FB 5L8RC 3RU0A 4FVMA 2UU9J 2I8EA 2GCFA 3KLGA 3TVYA 3JSYA 1S0MA 3OVBA 2F63A 1GTEA 4PG5A 2BRKA 4J9KA 2MLYA 1VC6A 2FZKB 4DL7A 3L9ZA 2MZTA 3K89A 5KFEA 2MDAA 4ZVHA 2QRRA 1WHXA 3BEGB 2YBVA 3V6HA 4HKQA 1UFKA 4N5SA 4NZ0A 1SKRA 3PKMA 2VONA 2KHCA 5AJ3J 1G2EA 1FX4A 4NMXA 1U24A 1FKOB 1YJRA 4AXIA 4IOCQ 3ELHA 3BM7A 2XNQA 4YEAA 3PG9A 1X4EA 4DFJA 3JYTA 4BWMA 3J7AN 1VBKA 2Y1JA 3BR8A 2QYGA 4B9NA 2C2MB 3TEHB 5A6WA 1F0XA 1S1WB 3EX7B 4NCBA 3BGLA 3M2UA 3NCPA 5L1LA 1PBAA 4W4MA 3C3LA 2PEHA 2W25A 1T05B 4GC7A 1KOHA 1F60B 2ZWOA 3DI6A 2DNHA 2NUHA 1J5OB 3R5BA 5I4MA 3IRXA 1GX5A 3P8BB 4A48A 2J9DA 2XHCA 4DU8A 2VDHA 1RP5A 1H2UX 2FUG9 1QSLA 3W9HA 4CIOA 4Y00A 1FVQA 3HX9A 4OMFG 2F8MA 2HNDB 1T03A 1EKRA 4KHRA 1HR0F 2LFVA 4WTOB 4CH0S 2CPFA 1CLFA 2JHEA 1I94J 3BSAA 3RBEA 5CYMB 2DHGA 4GKKF 3RBZA 1C2PA 1ZAVA 3KYLA 2QFJA 4M5NA 3K5OA 3UD4P 4F4YA 4MKYA 5I42A 2QV6A 1IQTA 3EGNA 1U1LA 2ZC3A 3CJKB 2Y0BB 3S7RA 1S1XA 4DR5F 3DM2B 3TA1A 3K58A 1TMMA 2MKKA 4QQBA 5EDWA 4DOZA 3V2UC 2VQEF 4A8OA 3QWPA 4JI1F 2RKIA 3NEKA 4ED4A 5B0DA 2CFXA 2ABYA 4Q45A 2E9TA 3MEEB 1S9FA 4LQ3A 4OYOA 2VKZG 4IQXA 2E7VA 2UXDJ 3OHAA 2FHMA 2OGUA 3P6YC 3R97A 1Q5YA 1WSVA 1YDLA 3BYRA 1U0SA 3O2IA 4X64J 5IV4A 3OT9A 3AB4B 2E1RA 3CCMS 5H1SV 3A3PB 2MZRA 3ZZZA 2YNHA 3MUTP 5KG0A 1U09A 3SCKE 2A1BA 4NLTA 2ERRA 4DR2F 2PD1A 2YXLA 4URSA 4RNMA 2W4PA 5LJ5Y 1N32F 3NMRA 4A8FA 4QYZK 3H2VE 1F5AA 2MLZA 3ET6B 4HEA9 3QT8A 4USMA 2MKSA 3HFKA 3J80Y 4NOHA 2BM1A 1NDCA 1MWQA 1WC6A 4FKXA 2VFSA 4O3RA 4CLLA 4K50A 1RT7B 2QSWA 2YWGA 1XEZA 3JAMU 3GLJA 2HNYA 4C8NA 3QQCD 1GMWD 1RB0A 3NAHA 1EP4B 3H5SA 4QW9A 1NPPA 2IVYA 2XI2A 2W7PA 1NHKL 4MYUA 2EG2A 4C8KA 2YNFA 4P74A 2CDQA 4B9SA 3DDKA 4O4GB 1OPZA 5E3CA 4B9TA 4DR7J 4RWWA 5T7LB 1KRPA 1HNVA 4M95A 3ZZPA 3C6UA 4Q43A 1HQUA 1FEHA 3CDUA 4X62J 1VBXA 1YTYA 4ID8A 1FO1A 3FDSA 5KTQA 2OPPA 3MECB 1DARA 3H40A 3DOLA 3FJ2A 4FF4A 4I6AA 4N41A 3N9UC 4DQPA 4TY9A 2HPUA 4QZVB 4ZOSA 3UN3A 1SL1A 4A8QA 1WF0A 2W2QP 4PAAA 3W5ZA 3EGVA 2XLKA 5FJ4A 5SUHA 3G9CA 3GP9A 4JV5F 1N33J 2DGUA 4URQU 4IH7A 1QTMA 2DGOA 1N5TA 3KLVA 2D1CA 4NYPA 2Q79A 1GXTA 1TZ0A 2MYFA 2OAUA 1SH2A 1RLCL 4N56A 2DNQA 3OR2A 4ZPVR 3C2PA 3HT3A 2HWHA 3FBBA 3F44A 2E7XA 3PTWA 2AEJA 4WK1A 2HRUA 1EB0A 2HGMA 2A0FB 4PKDB 4NLVA 1X4AA 3VZHA 3SCLE 1N54B 2YWKA 4NLGA 2RHSB 2ZZMA 2RIJA 3H98A 5BYRA 3FCWA 1UJ4A 4OL8A 4H4OA 1FRLA 2G0JA 3M2VA 1HW8A 4QPXA 1KONA 4OI2A 2NPFA 4H4MB 3JS9A 2DGXA 3G71S 1N36J 4PWUA 2CVIA 2HW3A 1VQ9S 3OPKA 1VFJA 1VQ7S
chains in the Genus database with same CATH topology
3I4PA 4EU0A 1QSYA 4PXDA 1JJHA 2ZE2A 4O3PA 1HWKA 3L7PA 1ZM2A 3RB3A 2DGQA 5KFWA 5JVGQ 4DR6F 2Y1IA 2DD8S 4RX6A 3GFHA 2J6SA 2UVRA 2YX4A 2ADCA 3GV5B 4FN5A 3T3FA 4H54A 2ZH6A 4KRWA 1HMVB 3M8SA 5HROB 3OTOF 3OL6A 1RT5B 5E5NA 4QW8A 2XHWA 2F7VA 3UDLA 3KMSA 2GQQA 4Y3CA 3ZZTA 5IQ6A 2DHXA 2M2BA 2ZH7A 5DG9A 1FVSA 4JYAF 4MIAA 2NLWA 2QMXA 4WKYA 2C3PA 3CC7S 1JLGB 3EXYA 4C8LA 1VK3A 4Y2CA 4PRFA 2K7JA 1R8HA 1AUDA 3TI0A 3VAHA 3PW5A 4M1KA 3E3XA 5HQ8A 1ZYQA 1YJTA 5LMNF 3HMJG 1KTVA 3DRSB 1E6VA 2AW0A 2GHWA 4CNYA 4RW7B 3IG1A 3IRWP 4ZK7M 4HT5A 3E51A 1FRHA 4IG0A 1MMNA 3KWMA 3LGMA 4CO4A 2DISA 3JAMY 1S97A 4C0OC 5KFJA 2FTRA 3PR5B 2JOQA 5DM7Q 3GG0A 4WCEQ 5EX0A 2H5EA 1KOOA 2A18A 4C7QA 3TX8A 4QU7A 1BGXT 3MFIA 1QUPA 1NAQA 4JOUA 1N33F 3DCAA 1FA0A 3OR1A 4TU7A 1I1GA 2JZ5A 4X66F 2HHPA 1B0PA 2FY1A 1S9GA 2JEGA 2Z2LA 1XERA 4NLQA 4XO0A 4ED7A 1U1MA 3LP2A 4PR6A 2IM3A 4IFYA 4UY8T 3LALA 1Y5LB 4TQSA 3OXLA 2B5JA 3DMJA 1RT6B 2X51A 2R8JA 2NQPA 1HBUB 4ZS6A 1RT4B 4QPTA 2ALZA 1MSWD 3MMBA 4DQRA 1I6JA 1H6KX 3M8PA 4FBUA 1IUJA 3OQ2A 3NRBA 4PPDA 2OPSA 1S4FA 2XSJA 4CT9A 3IGNA 1Y3KA 1CG2A 3DGPA 3OUYB 3K2YA 1M5VC 2L3MA 4OJHA 1XC9A 3D5MA 3CCJS 4ERDA 1FERA 2D9PA 3KJVB 2UUAF 3M8QA 2DTJA 3NLCA 1S1VB 1N48A 2QLWA 4LF8F 4P7TA 3MM8B 4HDHA 5HROA 3CCWA 2FVPA 1Z4UA 3K5NA 1TFYA 4IDKB 2BJDA 4QIVA 1ELOA 2ZM6F 2HWIA 3MUVP 2ZD1B 1D8ZA 1RT1A 4I7FA 4PWDB 2X3GA 2RRNA 1XTZA 1KVIA 2RS8A 4QR0A 2I5JA 2MHEA 1X5TA 1MWYA 1Y3JA 2DNYA 5I3PA 4O3SA 1H2VZ 4I2QA 3HVTB 2GMHA 2Z4PA 3PKYA 4F4ZA 1KQKA 3HZGA 1YJWS 1AXQA 3GFYA 4BWJA 1SQEA 5L9NA 3HF5A 4DF4A 4R5PB 4F25A 5K8PA 1XBWA 1D9DA 1URNA 4URGA 3WZ0A 2XWYA 3G96A 1ZZNA 7FDRA 5B0FA 2CZVC 3OL7A 5CCMA 5BJRA 5HMYA 1N8RT 4FVCA 4KBIA 1MNEA 4NYZA 3M32B 1NJYA 2QYCA 2IJNA 2XG8A 2K3IA 4TLRA 4DV5F 3RB4A 1VQ8S 3OFEA 2AD9A 5KAKA 4YP3A 2EFPA 5AXNA 4OX7A 3CC4S 4K4ZA 2YH1A 3M30B 2RF2B 1RTJA 2F40A 4A8KA 5E3AA