1RT7B

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
435
structure length
415
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 113
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B03
5KT6A 2BANA 2D7SA 4ZP6A 4QWBA 1K1QA 2BQUA 3QZ7A 2UVUA 2FJXA 5KFXA 1QUVA 5F8IA 3DRPA 1TVRA 3KMQA 2FVRA 4GC6A 2J6SA 1S1UA 3DLGA 2ASLA 3KLFB 1I6JA 2C28A 5CYMB 4IH7A 2J6TA 4KBIA 2IJNA 3RAXA 4YP3A 4URSA 1S6PA 1S10A 4I7FA 2HNZA 4PWDB 4DL7A 4I2QB 5KFJA 4TN2A 3DMJB 3FSIA 3OL8A 2AWZA 4RNFA 4KV8B 5DG7A 3QZ8A 1BQMA 2IC3B 4HYKA 2AGQA 2HMIA 2ILZA 2R8HA 4DL2A 2D3UA 1EETB 5C42A 1RT5B 2FLNA 1RT4A 3OSPA 5I3UB 2ALZA 4Y3CA 4J9SA 1VRTA 1RT4B 3DI6A 3GV7B 1RT1A 3V81A 1C0TA 3GIMA 5KFNA 1R0AA 5HP1B 3I5CA 3I5AA 2D41A 3KLGB 2F8EX 1TKXB 3GV8B 1S0OA 2VG5A 2ZD1B 2XI2A 3DLEA 1GX6A 2RDIA 1VRUB 5F8LA 3CDEA 1LWCA 1DTTB 4ICLA 2D3ZA 4G3IA 1RYSA 3KK1A 5KFRA 3MEDB 2UVRA 5KG2A 3PJXA 4J9QA 3JYTA 2JEGA 4ZP8A 3DRSA 2V0NA 1RA7A 3CO9A 4NLWA 4M94A 1RTDA 4ED3A 1IM4A 2W9CB 3DYAB 2ZKUA 4NLGA 4KKOA 2RKIA 4Y2AA 4Y2CA 3LANA 1TV6B 3C6UB 1TL3B 5KFGA 2B5JB 2E9ZA 3CJ4A 1VRTB 3NKYA 1TQLA 3Q8RB 4F4WA 3BSOA 1DLOB 3HVAA 4R0EA 4IRDA 1KHWA 4WYWA 4IH5A 2R2TA 4IFVB 1BQNB 1BQMB 5KFTA 1S9GA 4J9KA 3LP2B 3C6TA 1S48A 4QW8A 1RT6A 3OHBA 2R2RA 3G6VA 5KT7A 4F4XA 2VG7B 3M8PA 4ZVEA 4RNNA 1FKPA 4I7FB 1TL1B 3FFIB 2QV6A 4QWDA 1S9FA 1S6PB 1C1BA 4RW9A 3IGNA 3KJVB 3BREA 4YR0A 2E9TA 3UQSA 1JLCA 2RF2A 4R8UB 2XCAA 1T94A 4IG0B 5HROA 3QLHB 5KFKA 4ZPDA 3G6YA 3JSMA 3JSMB 3RBEA 5KFUA 4NCGA 2W8LA 3FQKA 3LALA 3DDKA 3H4DA 4ZPCA 1LW0B 4IDKB 3KJVA 3ITHB 1C1BB 4RW9B 5J1EA 4ED1A 1TL1A 1FKOB 2GC8A 5J2MA 1LW2B 1JX4A 1RDRA 3H5UA 1RTJB 2BQRA 3KHGA 2YNIB 4XPEA 3CJ0A 3CDUA 1TKZB 1N6QB 4RNOA 3PW5A 4NLXA 4K4WA 1REVA 4YQWA 2R8IA 4TYBA 1JLQB 4ZP7A 1WNEA 4F4ZA 1SH0A 1S1TB 3V6HA 3Q8SB 2EC0A 4TQSA 4RW6B 3MR5A 1D0EA 4O3QA 2R8GA 2WRMA 3DYAA 2YNGA 1CSJA 1DTQA 2IA6A 4RUAA 1JLBA 5I42A 1HMVB 3KLEA 4MKAA 3MEDA 4QWAA 4ECTA 1RT2A 5J2NB 1S9EA 3MECB 4O44A 5HBMB 1S4FA 1FK9B 5KFBA 2CKWA 3QIPB 2UUWA 1SV5B 3E01B 1DTQB 2ATLA 2VG5B 2XI3A 3MEEB 4ID5A 3H98A 2WOMB 5J2PA 4NRUA 3SFGA 3MEGA 5KFZA 2VG6A 3KK3B 4EBEA 3N6NA 4WFXA 4WZQA 1HQUB 3V6DA 3V81B 5KFCA 3DI6B 4O3SA 1S1TA 4RNHA 4QW9A 3ISND 4J9RA 4MK9A 3TVKA 3BJYA 3OL9A 1S6QB 4LQ9A 1RT7B 2HNYA 3V4IB 2AX1A 1KLMB 2IC3A 4EBDA 2VG6B 3KK3A 2WOMA 2B6AB 5J2PB 3MEEA 4ID5B 5F8MA 4F4YA 1JKHA 4ECXA 2FLPA 2HWHA 1FKOA 3MF5A 1ZETA 4HKQA 5L1KA 1RT3A 5J1EB 5JXSA 5DLGA 3PR5B 3IS9A 2YKNB 3CDWA 4ED0A 1RYRA 1LWEA 4O4GB 4MH8A 5KT2A 2WONA 2W8KA 5EDWA 3GILA 2AGOA 4GC7A 2OPPB 5F8GA 3DRRB 5C25B 1T05A 2ILYA 4MFBB 1SH2A 1TVRB 1JLAB 4H4OB 2WCXA 3PW2A 1GX5A 1S0MA 4MK8A 4IH6A 4JV1A 2UVVA 2ZE2A 4ZVFA 4U6PA 4ED8A 4URQU 2BQ3A 3LP2A 3OHAA 4TY9A 4ED7A 1LWFB 4MIBA 3DLKA 3EPGA 4TY8A 1IKXA 3D5MA 2GIRA 1K1SA 2ZE2B 4ZMMA 4ECUA 1XR7A 2FVPA 3HHKA 3QGGA 5T14A 3Q8QB 3OL7A 1QE1A 4ZHRB 3QGHA 3PVXA 2RKIB 3FRZA 4O3NA 2R2SA 5KFPA 3DRRA 1T05B 1RTDB 4ZVGA 5EWEA 3H4BA 4ZPAA 2OPPA 3IGVA 3I0SA 5KFHA 4TXSA 2IM1A 3KLIA 4FBUA 4DG1A 3KHRA 3GQCA 3V6KA 2R8JA 4KHMA 5C5JA 2XCPA 2WHOA 2YKNA 1KHVA 4K4UA 3D28A 1RT3B 4X2BA 4JUZA 3UR0A 2OPQB 3G6XA 3UPFA 2IBKA 3IRXA 3VQSA 4J9MA 1HNVA 4IR9A 3CVKA 4EEYA 2ZD1A 4Q8EA 4LQ3A 3C6TB 2B6AA 1LWFA 1QAJA 2AX0A 5KFFA 4KO0A 1UWBA 3MR6A 4NYZA 5L1JA 2HNDB 4RW7A 3QYYA 3NBPB 1C0TB 1RT1B 2JC1A 1N48A 4WXWA 3QGIA 5KFLA 2AGPA 4NLQA 5KFAA 4JV0A 2XC9A 3NL0A 1YVFA 5KFDA 1HPZB 4J9OA 2XWYA 5J2QB 3RB6A 1EETA 5KFQA 2HMIB 2UVWA 2VA3A 2W9CA 3MEGB 5C25A 4YMEA 3H59A 1IKYB 2IAJA 2ASJA 3PW7A 4PUOB 1N4LA 4RU9A 4I2QA 4PWDA 1SH3A 4MIAA 3LAKA 5J2NA 5KFWA 3GIJA 3PW4A 3JYTB 1RT2B 1C1CA 4WYLA 4IFYA 1HQEA 4IG3B 4IFYB 4IG3A 1HQEB 1EP4B 1C1CB 3IG1A 2BE2B 4URGA 2OPRA 3TAMB 3BSAA 1VRUA 4NLUA 5KG1A 3DLEB 5KG0A 1JKHB 3GIKA 4B3OA 5K14A 2W9BB 4MKBA 2I5JA 3QIDA 4Q43A 2IM0A 2GIQA 3PHEA 4RNMA 1T3NA 1MMLA 1N56A 4XPCA 1TP7A 3FQLA 5EUHA 4RW4A 2FVCA 2DPJA 4G1QA 1SUQB 2FLLA 2ASDA 3OLBA 4H4MA 1RT5A 4K4TA 1ZTWA 1MU2A 4O3PA 1HARA 1REVB 5KG7A 4KO0B 1IKVA 2V9WA 3KLHB 3KHHA 4ECYA 1RTJA 4KAIA 4NLYA 5HBMA 2HNZB 5J2MB 1S9EB 4O44B 2IM3A 4DEZA 5EWGA 3M9NB 2JEJA 5F8NA 1RTIA 4LSLA 2IJFA 3EZUA 1HNIA 5KFYA 3SI8A 4DG1B 4NCGB 3HKWA 3I5BA 3I0SB 4I2PB 5CYQB 4I2PA 5CYQA 3DOLA 1JIHA 1S1XB 4RUCA 2DPIA 5F8JA 5KT4A 1S1UB 4K4SA 3DRPB 1JLCB 4J9PA 1RTHA 5DLFA 4RW6A 3BR9A 5DQHA 4ZP9A 4YR3A 4DL3A 1OS5A 1U09A 1RTIB 3TQ1A 3ICLA 2J6UA 3KHLA 2YKMA 2B43A 4RZRA 4WFZA 4DL4A 1RT6B 3BSNA 2V4RA 1IKVB 1S49A 4M95A 1XR6A 3N6LA 3KLVA 4KFBB 1W25A 2OH2A 4Q8FA 2AQ4A 3IN5A 2W7PA 2C2EA 4XO0A 2R8KA 5KG5A 3GYNA 4ECQA 1LW2A 1NHUA 4G1QB 2RDJA 4RW4B 1RA6A 2XGPA 4ED2A 5FDLA 1TKTB 3HVWA 4MFBA 4KKOB 3SFUA 5KT5A 2C2DA 4NLVA 4FBTA 5K14B 2W9BA 2FVSA 5DG9A 1S1XA 1XR5A 4B3OB 3T5KA 1ZTTA 4EBCA 1S1WB 3I0RA 4IG0A 4R8UA 4ECVA 4JV2A 2RF2B 1LWEB 4O4GA 4NLSA 4O4RA 3BQ2A 3BQ0A 3IS9B 1EP4A 3IG1B 1IKWA 4K4YA 3RBDA 4ZPBA 4OL8A 5L9XA 5C24A 2YNHA 3M8PB 4J9NA 3MFIA 3H5YA 4PUOA 3KLHA 1Z4UA 2HWIA 3MFHA 4LSNA 2YNFA 1N5YA 4IRKA 4PQUB 4TQRA 1R0AB 5DQGA 2WB4A 5DGAA 5J2QA 1DLOA 3OLAA 4YR2A 1SUQA 5D3GB 3CJ5A 5C42B 3C6UA 3PR4A 1HQUA 2HNDA 4WXOA 2JEIA 2R2UA 1UWBB 4Q44A 1JLFB 4KHRA 2WK4A 1J5OB 3KK2A 4Q45A 5KFEA 3LAMA 3T5HA 3MECA 2OPRB 3TAMA 3MR2A 1IKWB 3LP0A 5HLFB 2W7OA 3DM2B 4NZ0A 5DG8A 1S1VB 4ICLB 1DTTA 1LWCB 1JLBB 3GIIA 3KLIB 2IMWP 3NAHA 1IKYA 2IAJB 3H40A 4J9LA 3DLGB 3KLGA 5DQIA 2XGQA 4ZVHA 5HP1A 4IQXA 4DL5A 3FDSA 5FDLB 3H2LA 3CWJA 1HPZA 5EWFA 3RAQA 2OPSA 2JLEA 4NLRA 4H54A 1RTHB 3HVTB 3NAIA 3KNAA 4TY8B 3NBPA 1JLQA 4RW7B 4NLOA 1D1UA 4KFBA 2BRKA 3PZPA 3MTKA 3RB3A 4Q0BB 4RW8A 3NMAA 2YNIA 5L1LA 5F9NA 1S0NA 4ECRA 4NRTA 2OPQA 2OPSB 2W9AA 3UDLA 1S97A 3OL6A 1JLGB 4EO6A 3KMSA 4EO8A 1NNDA 1LW0A 4IDKA 4DL6A 3N6MA 3GV5B 3BSCA 3DOLB 3E51A 4TLRA 4ED6A 5HROB 3DM2A 3LP0B 5HLFA 4LSLB 3CJ2A 1JLGA 1QAIA 1JXLA 1NHVA 4K4XA 4K50A 1IKXB 2V4QA 1J5OA 3DLKB 1JLFA 4RW8B 4Q0BA 3M8QA 4KE5A 4K4VA 4QWCA 4WE1B 1RT7A 2HNYB 3BGRB 3QO9B 3V4IA 2JC0A 4H4MB 5D3GA 4O3RA 2BRLA 3T5LA 5KFIA 3BQ1A 3RB4A 3T5JA 3DOKB 2B5JA 3T19A 1C0UA 5KG4A 5KT3A 3ISNC 1TL3A 2VA2A 1TV6A 1JLAA 4H4OA 3KOAA 4PQUA 2I5JB 2YNFB 1N5YB 4EYIB 4Y34A 4NLDA 1SV5A 3E01A 5KFOA 3DRSB 1FK9A 2WONB 2FJVA 2YNHB 5C24B 1S1VA 2BE2A 3LP1A 3M9OB 1HYSA 4IR1A 1HYSB 3KK1B 3LP1B 2O5DA 5DGBA 4ECSA 4R5PA 1HMVA 3M9MB 5I42B 4NLPA 5F8HA 1S1WA 5KFSA 3KK2B 1JLEB 1TKXA 4FS1A 4QWEA 5F9LA 1KLMA 1S6QA 4KSEB 3G86A 2CJQA 4KB7A 4ECZA 1T03A 1RAJA 1T03B 5I3UA 4TYAA 3H5XA 2QE5A 3V6DB 4NLTA 3CIZA 4LSNB 3M8QB 4KV8A 1JLEA 4O3OA 3DMJA 4EYHB 1HNVB 3V6JA 3QIPA 3IRXB 2YKMB 3CJ3A 4WZMA 2I1RA 4R5PB 2UUTA 4IKAA 3ITHA 5KFMA 4QPXA 3KLEB 4FS2A 2JEFA 4WFYA 3I0RB 4MK7A 2IM2A 5CYMA 3KLFA 3QLHA 2YNGB 3RB0A 3EPIA 3MR3A 2FJWA 4ECWA 2E9RX 2BR0A 1C2PA 1TKTA 1QE1B 1HNIB 4ZHRA 2HAIA 3NGDA 4K4ZA 1C0UB 5JUMA 2C2RA 3DOKA 3FFIA 2FVQA 5KG6A 1FKPB 2BANB 2VG7A 3T1AA 5KG3A 2AU0A 3BGRA 3QO9A 5L1IA 2WTFA 3PW0A 4IOBA 4WE1A 4U7CA 1S9GB 5KFVA 1BQNA 2C22A 4IFVA 1TKZA 1N6QA 1MU2B 3H5SA 4F50A 3PJWA 3OSNA 4IRCA 3Q8PB 3HVTA
chains in the Genus database with same CATH superfamily
4QWBA 1K1QA 2BQUA 3QZ7A 4NA1A 5KFXA 5CCLA 1FD8A 2EBGA 2HGMA 1TVRA 4K8RA 1S57A 1UVIA 3P4UB 1S1UA 1UL3A 1T9TA 3WX4A 4DFKA 2X1BA 2ZH4A 3HKZD 1XN9A 1EKRA 4P2FA 4B02A 4F0HA 1UZHA 4IH7A 1G1XA 2XZWA 4KBIA 3MUTP 5HO4A 4OX9F 4YP3A 1S6PA 1IR1A 2MZRA 2YH1A 3I9V9 4PWDB 4PYAA 4DL7A 3OTOF 1FE0A 3WC2A 5ETRA 2LQJA 3F41A 4KV8B 2GHWA 5DG7A 4HYKA 3CC2S 2ILZA 2QTWA 1UJ5A 1F6TA 2H51B 1EETB 2R8HA 5A2QU 1IBLJ 4KR0B 2FGOA 3L4BC 3KUEA 1RT4B 3GV7B 3H42A 4RBTA 3V81A 1C0TA 5I3QA 3GIMA 1O5JA 1F9EB 2D41A 2F8EX 4Y6IA 3GV8B 1BD6A 2W24A 1U1LA 1S0OA 2VG5A 2H5JB 1GX6A 1S5ZA 2RDIA 1VRUB 2J76E 3A8KA 1J27A 2CWKA 3CDEA 2UV8G 4PPZA 1DTTB 1L5UA 1FRHA 4ZLNA 2D3ZA 4G3IA 1RYSA 2KXNB 5KFRA 2J7UA 4NMLA 4J9QA 3JYTA 2DIUA 3CJTA 4BC7A 3D6TB 3DRSA 1VC6A 2NSBA 5K8MA 3G82B 2HRUA 3R6LB 1RA7A 4QR1A 4YB7A 4M94A 1Z2ZA 1P27B 3W62A 1SJ4P 3KXDA 4OI0A 2FZKB 4NLGA 3DYAB 2ZKUA 1B0TA 2VU5A 2XMMA 3K89A 4P10A 5LSLA 4QU7A 2W4CA 2YWGA 3CMAS 5KFGA 1OY6A 3HSJA 4LF7F 2OKQA 2X3GA 3OXGA 1TUGB 1MN9A 2FIUA 4ES3A 1Y3JA 3UD5A 2FC8A 2OFGX 3A3NB 3HVAA 1KHWA 5E3AA 4F26A 4CH0S 1BQNB 2HHUA 4QW8A 2VDIA 4OZNA 1RT6A 1RBAA 2R2RA 4YB1P 4RNNA 1WKLA 4WBFA 3HCXA 3GB0A 1KFDA 2PD1A 1S6PB 2C3PA 3CW2C 3IGNA 2GVZB 3TZWA 3OR2B 2M52A 1TK8A 2RF2A 4E0DA 2XCAA 5LMUJ 4IG0B 3MPVA 5KFKA 2XLJA 3G6YA 2CIMA 3LGMA 4WJBA 2HQGA 1WOPA 1DZ5A 3TWZA 1DFDA 2XY6A 2IPOB 3POTA 3DXSX 3W5XA 3H4DA 2NZ4A 2XQCA 5AJ3J 5J1EA 2A10A 4ED1A 4DF4A 1TL1A 1CJKA 2P2CB 3CJRA 3IR5B 3NGUA 3T1YJ 1LW2B 4YUDA 2UP1A 1WI8A 4DPTA 3R5JB 4CI0B 4I67A 2YNIB 3CJ0A 4DUYF 1TKZB 1N6QB 2IBOA 5A6WA 5GAHI 1F3VA 2YX1A 3ILOA 2PSZA 3RBXA 1JLQB 4ZP7A 2XNQA 1OY9A 3BO4A 2ZC4A 2Y1IA 2V4JA 4CO5A 4F4ZA 1SH0A 2YQ0A 1FT8A 3MTJA 3TX8A 1XMBA 4MTPA 4USWA 3SYZA 1UVJA 4UY85 4O4RA 4FPIA 4O3QA 1RK8A 3ZO7A 4F3QA 2XYPB 3G71S 1LFPA 2MKHA 1K8AT 2PDAA 2LVWA 4OJGA 3MURP 2R8GA 1G2EA 3BKTA 1SC4B 3RUBL 1OJ4A 3BGUA 3R5DA 1SQGA 1Q86T 1TL7A 1VLOA 4KPCA 4LFBF 1MSWD 1HMVB 4ANCA 4KGMA 2VBXA 1PJ7A 5K9FA 1SI9A 3GU0A 3QIPB 4MKVA 2OP5A 5EN1A 1IWAA 2VPZB 3NS6A 4NRUA 3SFGA 2KH9A 4ZPVR 2IDEA 1R0BG 2VG6A 5KFZA 3ET6A 4ZPTR 3Q24A 4EBEA 4FYVB 1VDHA 4WZQA 4G65A 1QTNB 1P1LA 2LXUA 2MQ8A 3H2VE 5KFCA 1Q7LB 1X9WA 5B0FA 4QW9A 4DXLA 1HNXJ 4MK9A 4LFAJ 1VJWA 4DU7A 3SSSA 2HQDA 1RT7B 4C8OA 2OELA 2IC3A 1TUWA 3KK3A 2JNJA 2NPIA 1VGYA 4RR5A 1UVKA 5J2PB 4TNOA 5HQ8A 1GTHA 1RCOB 1U0HA 4X4RA 4CLLA 2G9OA 2M0GB 3JTOA 4MIWA 5LSRA 1NMEB 3FC9A 3MF5A 1CJKB 3U27A 5J1EB 2CQ1A 1CS4B 1T9YA 2RE1A 4F0KA 4DSLA 2YKNB 3CDWA 1PJ6A 3G8QA 2AP6A 3PNIA 2W8KA 1XWLA 4ILRA 4GC7A 2OPPB 3MMCA 1FF2A 2Q79A 2RS8A 3CMQA 3W2WB 2DXFA 3CC7S 3THTA 1FJEB 3QJJA 2C42A 3OR2A 3FEXB 2XHWA 3JSRA 1UA1A 2ZH7A 5A6PA 2PMHA 2ZE2A 3VAFA 2R42A 3GJTB 2YY3A 4W98A 4CLYA 4TVAB 3V4MA 4URQU 1X0PA 2C2NA 4W4MA 3ULHA 4JI8J 2ZH3A 2YTCA 3EPGA 1RAGB 2DH7A 2E7WA 2JZ5A 3OTDA 4ZMMA 4ECUA 2CZ9A 2KI2A 4A48A 2FVPA 3QGGA 5HL7Q 2Y1JA 7FD1A 1ZZNA 3W5ZA 5SUHA 1X31C 4DV7J 1DQ9A 2IRUA 3KWMA 4LRBA 3OVBA 2ZUGA 3GG0A 2VFUA 5EWEA 5KFPA 3DRRA 3X3UA 2DXDA 4LJMA 2M8DB 4U9RA 5KAKA 4N41A 2IM1A 1VBKA 3TVZA 4LRFA 4HDHA 4ZLLA 5HQLA 4LF4J 4E2FB 1KHVA 4EWTA 4K4UA 2J0QD 1RWXB 2MQMA 2QLFB 1VHIA 2OPQB 1CJUA 1TELA 1U7LA 3PG9A 1WOOA 1IVZA 3VQSA 4X66F 3CVKA 2JOQA 2KT3A 3GWCA 4JB8B 5GMEA 4LVOP 2AX0A 4CLFA 5BXIA 1H6KX 1EQMA 4NYZA 3DU5A 1AYEA 1JJCB 2XG8A 2LU2A 3QYYA 4PQAA 5E33A 1E6YB 1C0TB 3E3XA 2JC1A 3HD2A 3K5PA 3EMTA 4AT1B 4PKDB 5KFAA 3O6QA 2XC9A 5E3CA 5T7LB 4M5KA 1EETA 5KFQA 2UVWA 2AJ4A 2LEPA 4L73A 1RABB 3OJSA 2HS4A 2W9CA 3JTPA 4YMEA 2X1GA 3RW7A 1U47A 1PCAA 3H59A 5HAOA 2NXJA 4UTGA 1N4LA 2WVCA 1U0SA 2UUBJ 4PWDA 1MW7A 1SH3A 3FSYA 3R1HA 1Q7YT 1WF0A 3D0GE 1C1CA 2HFUA 4LR8A 4WYLA 1Q4RA 1HQEB 1EP4B 2HK2A 4LF1A 4URGA 2HZVA 2KFNA 1F0XA 3TAMB 3ZZ0A 1P9QC 4DV1F 1UMJA 1VQ7S 4A8FA 2XNRA 2Q6BA 5A0YB 4NLUA 1AUDA 3IBWA 3DLEB 3GIKA 2GV1A 1URNA 3N5FA 5K14A 1WC0A 2DNOA 3HFKA 2I5JA 5A8RA 4N47A 5GADI 3OFHA 3OBIA 3CULA 4A8XA 2MJUA 4OI1A 3MCNA 4HL9A 2ZJQQ 1MMLA 1T3NA 4XPCA 1TP7A 2VBZA 2DPJA 1YJUA 1SUQB 1PBAA 4RWXA 2GQQA 2B7BB 2M70A 3T9ZA 3OLBA 4AL6A 1NPRA 4P75A 2OMOA 2FJAB 4Y2IA 4WFBQ 1TUVA 4O3PA 2KG0A 1N88A 1REVB 3ET6B 4NASA 3OFGA 1OQ6A 1IKVA 3PX0A 1RGVA 1UETA 1IR0A 2AZ1A 4UQTA 3KHHA 4CRJA 2MZ1A 2HNZB 1RHJB 4DEZA 4FXVA 1PKUA 3K5OA 5BR8J 1RTIA 2IIHA 4EMDA 1N5QA 2Z2ZA 2K1RB 3KKFA 2GQ2A 3L9ZA 3CCZA 3AXMA 1HNIA 3AT1B 3EZUA 1C4AA 3MMAB 3UDEA 1NEEA 1T9UA 3JS9A 3M7VA 3SQGA 4GKJJ 1TL7B 2H48B 5AE3A 2G1HA 1V6HA 4OX7A 3MI7X 1NLKL 1SIWB 4DOZA 4J91A 2XMTA 3LPYA 3DRPB 3U1LA 5HSPA 5DLFA 2CPDA 2R8JA 3BR9A 2K1RA 4YR3A 2KM8C 4UZCA 4DL3A 1NSPA 1RTIB 2A6OA 1VI7A 3ICLA 3MM9A 3VVUA 3EZ5A 2EFPA 2X51A 2YKMA 2R3VA 4JI1J 4WFZA 2R7OA 4DL4A 4L72B 2DBBA 1RU2A 3AAWB 2V4RA 1IKVB 1S49A 2POKA 3TI0A 1XNRF 1LXJA 4ENOA 3KLVA 1FTCA 3M8ZA 4DUZF 3IN5A 1K47A 4K0KF 4DUZJ 2X7IA 1G6BA 1RKJA 1LW2A 3QQCD 1JNZB 2RDJA 4DPWA 4FXDA 3CPWR 4ED2A 4OJ3A 1H2UX 1KQKA 2VJUA 4XAKA 4DV0F 2UUAF 1L3SA 2GJ2A 3GJRB 4KKOB 5KT5A 2C2DA 4FBTA 2V2ZA 2UXDJ 5K14B 1S1XA 1NDCA 3VGTA 3VGVA 3EM1A 4PG7A 1S1WB 3QPIA 3PEHA 4DL0C 1RHUB 2M88A 4IG0A 3IA0A 3M2UA 4DV4J 4ECVA 4JV2A 2RF2B 1LWEB 1N0UA 1KWMA 1YRXA 2MTLA 2MZQA 3IS9B 1EP4A 1QD1A 3D3CJ 4KH0B 4K4YA 5L9XA 3GFXA 3SZ2A 2XS7A 5C24A 1KDNA 2W2NP 4LF2A 5CCMA 3MCOA 3Q8VA 1BMQB 3M2RB 4OYXA 1KTQA 4DV6J 2EFNA 1RACB 3UCUP 1Z4UA 1R89A 4LSNA 1N5YA 2BYCA 3MHYA 4PQUB 2CQ0A 1WG1A 3DOMB 3SXLA 1HNXF 2VC1A 4AQYF 3VAHA 4Z2XA 2VONA 4K0KJ 4YR2A 2QLWA 3CMES 1NB2A 4DV3J 4JI8F 1B99A 2FHJD 5C42B 4WTOB 3DDNA 1HHTP 1HQUA 2HFNA 1NK0A 5A2QY 2KJVA 4Q44A 2E5JA 3IBCB 2XY5A 1ROFA 3QT5A 1DQAA 3D0HE 3VGSA 4Q45A 4B3MJ 1FRMA 3QSIA 4LVNP 2DXEA 1QAYA 1CJUB 5KFEA 3T5HA 4KPYA 2HVIA 3DLHA 3N4WA 3MR2A 2EBEA 1IBCB 4C2MA 4BS2A 3VAKA 1X60A 1LK5A 4ITSA 1DTTA 1OPZA 4PWUA 4D3HA 4DSIA 3GIIA 3TJ9A 1KFSA 1F9HA 2IAJB 1HFEL 1U2CA 3H40A 1FCAA 4J5OA 1HBOB 3DLGB 4FVMA 3HMJG 1FRXA 3IWLA 5BR8F 4YFUA 1U2FA 1AA1B 2KU7A 5K5MA 2Z4PA 2LA6A 1HBUA 2AEJA 2YKAA 4IQXA 2M7SA 4LIRA 1YJTA 2EFQA 3QRRA 1HPZA 3DXBA 1KQSR 3LW5C 4Y2KA 3HHEA 3M2VA 2C2KB 3T41A 3J7ZT 5DM7Q 3M30B 1FJGF 2F4VJ 4XTTA 2QMWA 2J9CA 1RHRB 4RW7B 1P9YA 4C0HA 1KP6A 2HRTA 4NLOA 1D1UA 1CJTA 1HWUA 2BRKA 3MAHA 3A1YG 3NEKA 4NX9A 4BHQA 3PM9A 1PO6A 5L1LA 2DK2A 1SQFA 3EWGA 2FJEB 4ECRA 2EW9A 4QYRA 5HMXA 3S8SA 2W9AA 5HANA 1UVMA 2VC0A 4DR2F 1R0CB 1LW0A 1X5OA 3NNHA 2HQIA 2GMJA 2MKSA 1ZOTA 1LXNA 3N6MA 5B0AA 1YRUA 4CH7A 3FGVA 3BSCA 1T02A 3KUGA 4DZDA 3GV5B 1SIZA 2CQ2A 3A13A 2JVOA 4ANEA 1LQ9A 1ZAXA 2N3OA 1M5OC 4F2SA 2NZCA 4JI6J 3DM2A 1RWPB 3P5BP 3LP0B 5HLFA 4LSLB 4ZDNA 3O5TB 1IR2A 3O1LA 3PDNA 4KGXB 5H1SV 1A9NB 1NHVA 2AV5A 2ZBIA 4F4KA 3M8RA 4B9MA 1IKXB 2J9DA 1Z1ZA 4YY3J 3DLKB 3D6MB 1LV5A 1RE1B 3OT9A 4Q0BA 1FA0A 1G3OA 3HZEA 3O2IA 4X4UA 1RT7A 3QO9B 4P2SA 3TANA 2BRLA 3T5LA 3A8IA 5KFIA 4DQPA 3BQ1A 2LQ9A 2E1AA 2E44A 2B5JA 4DQQA 1U1RA 1DAXA 1K0TA 4CT8A 1J5EF 3P3DA 4H4OA 2E1PA 4USUA 2YNFB 4FF4A 4Y34A 1DURA 4C6AA 4ZPWR 2HW3A 2O1PA 2VPYB 5KFOA 4FZVA 3PIOQ 2PEHA 3MZIA 2YNHB 3W8PA 4L3KA 1YQHA 1GXLA 4IR1A 3KK1B 2O5DA 3MPDA 3BO2A 4R5PA 4PG5A 1HMVA 2ZDOA 3PTWA 3RJMB 3RZAA 1Q78A 2KT5A 2ZH6A 2ZC3A 1Q8BA 5KFSA 3KK2B 3JQMA 1WHXA 2YWKA 4WIQA 3ZZTA 1K9MT 3PO4A 1QDUB 1TKXA 2FD2A 3OW2R 4QWEA 2MGZB 2ZVIA 3MAQA 4KSEB 3QGPA 1BLUA 1KVKA 1XQIA 3W63A 6AT1B 2CG4A 4M5DA 1N32J 3H5XA 3M32A 2V4JB 1U8SA 3ETOA 4AUKA 3V6DB 2IA0A 1CJVA 4JBCA 5F0UA 1OO0B 3K59A 1FDBA 2DGWA 3OTOJ 3CIZA 3I32A 3MEKA 4PR6A 4QYZJ 2FJBB 4LFCJ 5IV3A 2DCUB 2I6WA 2VFVA 3N01A 3U7JA 3WX8A 2RQ4A 4AQYJ 3KJQB 3IRXB 2VZ9A 2HHSA 3KNGA 4GMKA 2BBEA 2J7KA 4QIFA 4IKAA 3SDEA 3HDSA 2OD4A 2ZUAA 1AZSA 1D9DA 3HHLB 2MLZA 4G6VB 3BPSP 4MK7A 5C2GA 3Q22A 1RUSA 4DV7F 2EKNA 2W01A 2VOOA 2MQNA 2MY7A 2B4VA 1C2PA 1YJRA 1QE1B 1V3SA 2V69A 3NGDA 1NH8A 1C0UB 1OQ3A 2O67A 1SXLA 2YQ1A 2FVQA 4HACB 4P2XA 1R8CA 3ZTSA 5L38A 3T1AA 2DGQA 2GMHA 3K8VA 2GGPA 3MMBA 4PPDA 2J7WA 1TKDA 3BGRA 3MM6B 2WTFA 2P6SA 4IOBA 4WE1A 4U7CA 3S6EA 3ZFVA 1BQNA 4FXWA 2WZ1A 1FDNA 2PE8A 3SV4A 3Q8PB 2FHKA 4LF9F 2DIVA 2CPIA 2KT2A 2BANA 3QT6A 1IBLF 1HWKA 1BWEA 2MY8A 3D4JA 3ENVA 2FJXA 3O8WA 4F04B 2OSQA 1HHSA 2D9PA 1CVJA 3KMQA 4B3RJ 2R4FA 2J6SA 3DLGA 2LQ5A 2AJ0A 1WTBA 3KLFB 1H7XA 1I6JA 3M05A 1YLXA 2DJWA 3D66A 2FYXA 2BE9B 3G82A 2V94A 2KHCA 3PV8A 5DDPC 1PAUB 2CAJA 2IJNA 3T1HJ 1SJ3P 1PAEX 2CNNB 2DITA 2BJ7A 4JI7F 1HNWJ 2DGUA 1HWLA 3UCGA 1S10A 1NK8A 4I7FA 1WC1A 1UW4A 3UE2A 4WP3A 4MKYA 5LJ3Y 5KFJA 5IM0B 2E29A 4KYZA 2OEKA 2OHDA 3HHLC 3ZNJ1 2BM1A 4ID8A 4F25A 1VC0A 2H54B 1OPIA 3NGKA 1BQMA 2HMIA 4DL2A 2B9EA 1KN6A 5L8RC 4NL5A 5C42A 1MN7A 1RT5B 4X4TA 4C8LA 1G4CA 1RT4A 1IUJA 3TEHB 3OSPA 2ALZA 4Y3CA 2J8SA 5CABA 4J9SA 4B3SF 4LF5F 3DI6A 1YWXA 3NGRA 4ZN1A 3I5AA 3DOMA 2D3OR 5HK4A 3KLGB 3BDEA 2K7JA 4DBQA 2A1BA 4EO8A 1WSVA 4B9UA 2XMKA 4ZLPA 2DNHA 2FLOA 4ICLA 2C3OA 4OLOA 1ZA2B 4CDIA 1QSYA 4PXCA 3SCKE 1WC4A 3MAAA 3PJXA 4Y28C 4CYUB 5KG2A 2EKYA 4JYAJ 1WHWA 4Y2MA 1RWMB 4IRKA 2IHR1 4NLWA 4DPXA 1NK4A 4LF6J 1OYEA 4YEAA 4ETXA 4ED3A 2FY1A 1U1OA 3UI3A 2B0GA 4KKOA 5M2UA 1SJ1A 4DCJB 5IZHA 3GMGA 1TV6B 1TL3B 3AFGA 2DGSA 2HURA 3GONA 5AXMA 2E9ZA 2ACYA 3CD5A 1VRTB 3CJ4A 3NKYA 1V5VA 2IMOA 4N56A 2DO0A 4C3LA 3Q8RB 4NCAA 3EDQB 1FEHA 5ETLA 1U4BA 2V67A 3WDOA 2YKPA 4WYWA 4IH5A 2R2TA 4IFVB 2MMYA 3A3OB 3QATA 3R27A 5J1PA 1S9GA 3MDFA 4X4QA 3LP2B 2VD3A 4B3TJ 3C6TA 3G6VA 3OHBA 1EAYC 1S79A 2IVMA 4JI7J 1YZ6A 4XDDA 1Y00A 4ZVEA 3W7BA 5A8KA 3QRPA 4QYZK 3D1OA 1S9FA 3FFIB 3PYDA 1FNMA 1C1BA 2NQPA 3UQSA 3ZZZA 3UD4P 4RUHA 3LF0A 4R8UB 3CT9A 4KC5A 2BEFA 2P6TA 4K7QA 3BH7B 5CD4H 3TARA 2IVYA 1MROB 2DNNA 3JSMA 2XSFA 3JSMB 3RBEA 2ZWOA 3E2EA 1VOMA 4X65J 2Z8QA 3FQKA 3H20A 3DDKA 4IDKB 3LH2S 1C1BB 1VYAA 1FERA 3AXKA 2PFDA 2WB1D 3BDPA 1UFWA 4OZJA 5KOXA 4R25A 4J90A 3HO1A 4P9SA 1RDRA 1I1GA 1TZ0A 2BQRA 2Z2YB 1VISA 1PSDA 3KHGA 2V34A 5IS2A 3CCUS 4RNOA 1RQ0A 3EDRB 3R6GB 4NLXA 4K4WA 4DQIA 1REVA 2CNKB 4USKA 2PA3A 4FYYB 4Q2LA 1HW8A 3W8GA 1WNEA 4K59A 3ZC4A 2ZBQA 3UNYA 2UUCJ 1S76D 2YH0A 5CZXA 1M5PC 2HQFA 3DGPB 2EC0A 4ZKAA 3MR5A 1TK0A 1D0EA 1M5VC 4IO1A 1Q53A 3MXHP 5LT5A 4DU8A 2OLWA 3IM8A 5IQ6A 1HIYA 1NJWA 2G2YA 3IRWP 4HHHA 4V19X 1N5SA 2EFOA 2W7AA 4V1Ak 4RUAA 2R7VA 2M8HA 1HR0J 5I42A 2O3DA 4CYUA 3C14B 4C8KA 1KNZA 4QWAA 3GFYA 3U02A 3RR8A 1BGXT 4C4WA 1YG0A 5HBMB 1S4FA 3AD7C 1S4EA 3GG1A 5KFBA 1SKSA 2UUWA 3E01B 3P96A 1VQ5S 1DTQB 3IM9A 2MDAA 3H98A 3MEEB 3NS5A 4A8WA 4JI2J 1VBXA 3THPA 3PFEA 3LO3A 3L7UA 3NGTA 3LQVA 3DI6B 2HBQB 2H65B 2ZITA 3CTRA 4RNHA 2MQPA 1VQSA 2CADA 4ED5A 3BJYA 1Q8IA 2AHOB 2N7YA 1S6QB 3MCMA 4FVCA 4F3MA 4LQ9A 2JLFA 3Q83A 3BO3A 1KLMB 4O0IA 1VR6A 2WOMA 4OYPA 5F8MA 4ID5B 2XYGB 3HSGA 3NRBA 4C7QA 1JKHA 1UEKA 1WDTA 2FLPA 4B3SJ 2HWHA 2XMUA 1IJFB 1F2GA 1IBKJ 3TA0A 3VF0B 2VOPA 4FNHA 2XB2D 3PR5B 5JXSA 2KDOA 3UN3A 2WBRA 4ED0A 4O4GB 4UUWA 2Y8WA 5EDWA 3I56S 1UEUA 2AGOA 1S77D 2FTRA 2K3KA 1TFYA 3QNWB 1ZAWA 2Y9HA 4ZCKA 5F8GA 3DRRB 5C25B 3I55S 4JP8A 2RQMA 4USHA 1J5EJ 4MFBB 4UT4A 5HMYA 3D2WA 1X4EA 1JLAB 2VFRA 3TVYA 3P49B 2WCXA 2X1FA 1GX5A 4FYWB 2NREA 3HFVA 2BDPA 4JI5J 1U02A 3FCVA 4JV1A 1HWIA 3CNQP 4ZK7M 2LQ8A 4USTA 2VQFJ 5DJBA 4ZVFA 4RKUC 1N0VC 1H2TZ 1O8BA 1F5AA 1RXOB 3DNCA 3OHAA 4X4SA 1N36F 1LWFB 4QOTA 1NPKA 3W5YA 4MIBA 4TU9A 1P8GA 5G0RA 3D0IE 2DGOA 4BCAA 1EB0A 4NA2A 1YJ9S 3NNCA 1FE4A 5DETA 2ZE2B 2B9WA 3J81j 1FFGB 3FZBA 2HLTA 1MLAA 2B8PA 2CQ4A 3HHKA 3MMJA 1SVDA 4ZVTB 5CHCB 3OR1B 1LOUA 5HATA 1QE1A 3CJKB 4CM2A 3OL7A 4QIEA 3HVRA 3PVXA 1NJZA 4OI4A 2R2SA 4O3NA 4RLEA 4UF4A 3H4BA 4DR6F 4ZPAA 2OPPA 3I0SA 1VS3A 3RTVA 3KLIA 4B9LA 4DG1A 2RU3A 3GQCA 3KHRA 3QT8A 1O6XA 3UFCX 2XCPA 3HHLA 2YKNA 4WWSA 2HLUA 4AXIA 1CS4A 4ZVSB 4IYQA 4JI4J 4X2BA 5DRKA 5KFMA 4ILLA 2KVQE 1D8YA 1FWKA 4OV6A 3IRXA 4FKYA 4XDCA 1B70B 5E0OA 2IBKA 3CDBA 3K58A 4EEYA 1Y0HA 3BGLA 4LQ3A 3PKMA 2F4VF 4DR4J 3MR6A 4KO0A 1UWBA 2J9DE 1NKCA 3AJDA 2X1AA 4ZVPB 2B9YA 3NBPB 1RT1B 2ZOMA 1M1GA 2VDHA 3QGIA 4E8UA 2H5EA 4NLQA 2AJ1A 1H98A 1HBNA 4JV0A 2HHHF 4P52A 3SV3A 4HT7A 4JV5F 1VQPS 1D8ZA 3TQEA 3B78A 4PAAA 2VASA 3CDAA 2VA3A 1KR4A 4ILMA 4DCOB 3LOUA 1IKYB 1IBMJ 4LF4F 2ABYA 4PUOB 2LDIA 4I2QA 1HBMB 4LFBJ 4MIAA 5KFWA 3PW4A 4DR7J 2F4FA 1GXTA 2R7RA 4IG3B 3MPYA 4IG3A 3IG1A 4DR5F 2MPUA 4JI3J 2OPRA 2XZTB 3BSAA 3R5CA 5KG1A 5KG0A 3UWTA 4B3OA 1O51A 2AMCB 4FN5A 2W2QP 4CTAB 1HR0F 4WFAQ 3CD0A 3AODA 4Q43A 2ERRA 1S59A 1NXIA 3OVAA 3GR1A 3SSQA 2GS8A 1H7WA 4GO5X 3MM8B 1HBNB 2QSWA 3AOBA 2YX4A 1YSJA 4K4TA 1MU2A 1HARA 4JV5J 3SQOP 2XS2A 1WKKA 5KG7A 4KO0B 4H4KA 2UUCF 2KYXA 4DZ6A 3VZHA 2V5HG 3TAQA 4RBUA 5EWGA 3M9NB 4O44B 1X4GA 5F8NA 1GXUA 3PCOB 2GIFA 1CEZA 5B09A 4LSLA 1ICEB 2QA1A 4LREA 5B7WA 2CNOB 3HX9A 3POTB 4DG1B 2B9XA 2MJNA 4ATNA 3I0SB 2HHQA 4I2PA 4EFAC 1D9AA 4ZCMA 5KT4A 2E5LJ 1SB6A 3QJPA 1L3KA 1VIXA 3OR1A 4J9PA 2RUSA 4I6YA 1XMOJ 1OS5A 1YBUA 2A6MA 1JJHA 2IRXA 3ZZUA 4UOCA 2RNEA 5K8PA 3TJAA 1R27B 1XBWA 1RT6B 3EGVA 2BVZA 1XR6A 3N6LA 3BN4A 7FDRA 1HQ2A 1EIYB 2OH2A 3SDEB 2V8PA 4HR2A 4XIUA 2BX6A 2W7PA 4DV2F 4OYOA 2C2EA 2DNLA 3PEJA 2NLWA 4UOFA 4C98A 4WP8A 5IT9U 2B3TB 3D3BJ 1NHUA 4G1QB 2ZH5A 2UZAA 5B0DA 2J0XA 1WD6A 2XWXA 2LECA 4ERDA 4MFBA 3CO0P 4UOHA 3GP9A 4ZLJA 3OXLA 2W9BA 3T5KA 2ROPA 1CBKA 3HHNB 1ZTTA 5IWAJ 4OI2A 2KTQA 1FDAA 3HP6A 4O4GA 5M2RA 2D1CA 4EUVA 3BQ0A 3RBDA 2C28A 1SL2A 1U1KA 5CD4A 2MZSA 4OFZA 2C3YA 1U2RA 2DGTA 4DS5A 3M8PB 4DI6A 3U1MA 3MFIA 4OYAA 4CH1A 3KLHA 4PEOA 5F41A 5FD1A 3MOZA 4ZITA 4TQRA 2F3JA 5DQGA 2WB4A 5DGAA 5J2QA 1DLOA 1L3UA 2D9OA 1HNZF 1QSLA 1KSPA 1RCXB 2RDDA 3C6UA 3PR4A 8RUCA 4DFPA 4DR4F 2JEIA 2HS0A 3DGVA 1NK5A 3CC4S 3QMQA 3HT3A 1CG2A 1FXDA 4KHRA 1VFJA 2DNRA 1PILA 2HRYA 3NS7B 1YJ7A 4UUXA 3MM7B 4OQJA 3FZ2A 2ZBPA 4C0BA 2Y0BB 3VWSA 3LTOA 3PRBA 1XJWB 2Z0GA 4NCBA 5DG8A 3JAMU 1M0SA 5HVGA 3CCTA 3U1NA 1BQXA 5HMZA 2ZNZA 2ZZNA 3MD1A 2FZCB 4J9LA 3EX7B 2MKJA 2HG4A 3C46A 5ITHA 3VAIA 5HP1A 3RRKA 2VODA 4DL5A 1SJQA 1X9MA 2MZTA 1GEHA 3P45B 3HLUA 5EWFA 3CCSS 3QT7A 3LA0A 4HT5A 4DR1F 3RAQA 1N36J 5CH7B 2XO7A 3HVTB 4CNYA 1YHQS 2KZZA 3C2PA 3KNAA 4PYDA 2DR6A 4LF5J 2HBYB 3UCZP 3FBFA 4LR7A 4LF7J 3RB3A 3MTKA 4RW8A 2OO4A 2XZDB 1DARA 2HHHJ 3TA1A 2P9GA 4U96A 3W9JA 1JJ4A 2HKEA 3J81Y 3HM9A 2YQ3A 2HVEA 2OPSB 3CD7A 3DCAA 3MM9B 5GVQA 3UDLA 2F1FA 1JLGB 3OL6A 3R7SB 5AXKA 4IDKA 2IYIA 2J5AA 1AXQA 1P1TA 2YBVA 2CXEA 4KY3A 2ADCA 3HJFA 4DSKA 1QAXA 1KQFB 4A8SA 2EVZA 2VUGA 3E51A 3GYXB 1ZM2A 3J7A1 1NPPA 3EXYA 3HHDA 3D6FB 2NPFA 2GO9A 4TU7A 2BE7D 1UA0A 3BN7A 5D0RA 1RAIB 3QJLA 2H4YB 3OD2A 4OYMA 1JLGA 3WIVA 2JRSA 3ZXWA 4J9UE 1NKEA 4K50A 2ZEJA 2V4QA 1J5OA 2RH3A 1JJ2R 1TR0A 1JLFA 4RW8B 2W1BA 2FLLA 3MGJA 4FPRA 2XEXA 4WF9Q 3NNAA 2HFZA 4NLYA 2HNYB 3V4IA 1VC5A 2JC0A 2LP4A 4KT0C 5D3GA 5F0WA 4O3RA 2RB7A 5E3QA 5BYRA 5BYSA 2V63A 3BS9A 3DOKB 4HVZA 1GK8A 1NAQA 2F5GA 3DU6A 3MM5B 1TL3A 3K57A 4DV5F 1TV6A 4N76A 1RJJA 2N4CA 2I5JB 5A8RB 3EVWA 4EYIB 5DDQC 2CJ9A 3LUYA 4USJC 1VBYA 1SV5A 2QMUB 1FK9A 2WONB 2FJVA 1CLFA 1ITPA 1XK8A 2RIJA 4KGKA 4DWIA 2DT9A 1HYSB 2BKOA 2NSCA 3GSIA 5C7PA 1RAHB 3R7NB 4A46A 3DFEA 2YWHA 3AY0A 4NLPA 2W4PA 2ZBCA 6FDRA 4W92B 4B3RF 3D7SB 1T7PA 2ZVSA 2QN6B 1JLEB 1JK9B 3GPAA 1GTEA 4U8VA 5F9LA 3J7YI 1YJVA 2IRYA 2GNKA 3BH6B 3QAUA 2CJQA 3CJSA 5HMWA 4CO0A 1JQGA 1M5KC 3VAJA 2DHGA 5HI7A 1RAJA 1T03B 2K2PA 4TYAA 3TJ8A 3VHQA 1SL0A 2BZ2A 1U1MA 1E6YA 2H4WB 1WJ9A 2K8GA 4LFAF 3M8QB 1WC3A 2QA2A 1UZDA 3SSRA 2V8VA 1PG5B 2ZFHA 3LPEA 3N79A 2GZOA 3RYLA 3T6JA 3ZZYA 2EPIA 2V2VA 4EYHB 2I2YA 1DY3A 1X5TA 2NS1B 2VPXB 3KLEB 2CPJA 2CPYA 1WEXA 3M1VB 4QPXA 4I64A 1U48A 2JEFA 1UJ4A 2C3MA 3NMRA 4GVBA 5EGYA 2IM2A 4ER8A 4DR3J 5DM6Q 3KLFA 3QLHA 1FO1A 5B08A 2YNGB 1EX8A 1E6VA 3EPIA 4HI1A 4ECWA 1RWVB 5CXTA 3EE3A 4CO3A 3A8JA 2VQEJ 2NR0A 3R2DJ 1XNQJ 3PO5A 1OSCA 2G0IA 2C2RA 5E3PA 1IBMF 1FKPB 2CWXA 2BANB 3CJ8A 2VG7A 3NOGA 4I56A 5ETVA 2Z2LA 3BGOP 1YBAA 3G8SA 3GCXP 3PW0A 1PYTA 1PYSB 2Q66A 1NU4A 2B8QA 3UNGC 1S7IA 3QSYB 1APSA 2Y1LB 2ZKTA 3H5SA 3M8YA 3OSNA 3AJ1A 1C4CA 4YOEA 3I87A 1W7WA 1HL6A 5KT6A 1X4BA 3C19A 4ZP6A 3NCRA 3WIUA 2UVUA 1AT1B 3I6PA 1HD0A 5F8IA 1N5TA 4CLKA 3T1YF 1SL1A 1U6ZA 2ASLA 4NI2B 1WORA 1Q8KA 4ZIVA 3G6ES 3TNVA 2AT1B 1F9FA 2KJWA 1N34F 4F02A 1VMBA 1YJNS 3I96A 2DNMA 2EI5A 4Z37A 2QFJA 3FCWA 1Y5LB 5B0BA 4QBUA 3CCJS 3RAXA 3GTYX 4PG8A 7AT1B 2BJDA 4MJKA 4URSA 1W26A 2GVDA 4KIAA 4MAKA 3PRVA 1OSDA 2GJIA 1S12A 3SBMA 4TN2A 4M5LA 4ZVRB 3UW1A 3FSIA 3OL8A 2AWZA 1QSSA 2ZH1A 3ZTOA 2HWTA 5CAAA 4DSEA 3IBFB 5EX0A 3PACA 2IC3B 3AHPA 4B9SA 2AGQA 1JXEA 3C16A 1U24A 2R7QA 1BC6A 4USMA 1WACA 2A2DA 2CFXA 3M32B 2ALYB 4ZJLA 2FLNA 1URRA 1VQ8S 1FWLA 2KFYA 4NXNJ 1F5BA 4C3KA 4LRAA 2C2MB 1R0AA 3I5CA 2L41A 4O0NA 2HHTA 1B7YB 2LXIA 4KAIA 4NYOA 4I69A 2CDQA 2MGZA 1TKXB 2QRRA 2UXBJ 2ZD1B 1RWKB 2XI2A 2PI5A 3T1HF 1LWCA 1UPPA 2FQQB 1HNWF 3IR7B 2VHGA 2ZH8A 3KK1A 2UVRA 3G96A 3NWRA 4MMOA 2JEGA 2W4DA 2GHVC 4ZP8A 1RADB 2V0NA 4G1PA 4DV1J 3VCDA 2PI4A 3TZZA 3F73A 1RTDA 4PG4A 4LSZB 1AFJA 2RKIA 4NWBA 4Y2CA 2OI2A 2ZOFA 2DGXA 1NJYA 2B5JB 2QIFA 3HZGA 4I0WA 5SZTA 4XK8C 4DLGA 2CUYA 1TQLA 1W2IA 2RMLA 3UVJB 4X4PA 5GMDA 3CCRS 4F4WA 3IWXA 3DRXA 2KXFA 3OQ2A 4M63A 1UFLA 3GE9A 1FRLA 2NUUG 4J9KA 2HYIB 1SJFA 4OHXA 2KFZA 1TAUA 4U95A 3D9BA 1ZH5A 1P6TA 3NLCA 4U7UK 2L9WA 2SXLA 2Y0SD 3CXCR 5KT7A 1XNQF 4F4XA 2E1RA 4DCPB 4BWJA 1TL1B 2DNQA 2GVDB 8AT1B 5HJYA 3BREA 4YR0A 2CQDA 1JLCA 1VQMS 3B6BA 1Y3KA 4JI3F 2DNYA 2V2KA 3FVYA 2L08A 4ZPDA 3ENAA 2NXUA 4NCGA 3M8WA 5D6GA 2EFVA 2MHNA 3W60A 1IBKF 2OD6A 1LW0B 3C15A 3ILJA 2GVZA 3ITHB 4DF8A 3PIPQ 1B3TA 4KJIA 3BYRA 3O3LA 4OLPA 4DR6J 1FKOB 1X4DA 5J2MA 2GC8A 2HS3A 3ISZA 1JX4A 4ELUA 1RTJB 2B7CB 2CA9A 3SCLE 5A8WA 2LDYA 5F3TA 2J8AA 4XPEA 3CDUA 4USVA 3PW5A 4EGLA 2AIRB 4LR9A 2QGFB 3TO8A 5K8NA 3KJNB 4TYBA 5L9NA 3H0PA 3IAS9 4OJ1A 5GMKa 4UY8T 1FJCA 2PMWA 3M30A 4RO0A 1XNRJ 3KYLA 1S1TB 1NDLA 1Y4ZB 4AXJA 1RWUA 4RW6B 5D4LA 5E41A 5K8OA 4DPUA 4F3OA 1E6VB 3DYAA 4HH0A 2YNGA 1T95A 4DR1J 4DR5J 1CSJA 4LIWA 2AYBA 3RRHA 2M4MA 3EYZA 2IA6A 1TTHB 2XLKA 1GMVA 2FHJA 4HTIA 1SKWA 1R6VA 3HULA 5GAGU 3KLEA 1D09B 3M1VA 4ECTA 3H8YA 4UOGA 1VQ9S 1RTZA 3MWBA 5J2NB 1S9EA 3HSDA 4ZVQB 2ZHBA 2CKWA 1H0HB 5K20B 2VG5B 4ID5A 2W25A 2WOMB 3J80U 3MEGA 2O01C 4OYIA 4UQGA 3N6NA 4WFXA 4C3MA 4DX5A 1REGX 1HQUB 3QRQA 3OTBA 3V81B 1RI7A 4YS2A 3AOCA 2D69A 4W90B 1S1TA 3TR5A 4OX8A 2KZMA 2CJXB 4J9RA 3TVKA 4TLQA 2QO3A 3I4HX 4Y65A 4LBIA 3W2VA 3PHTA 1RKIA 1NZAA 4NZ7A 3LWLA 3Q8UA 4EBDA 3K5MA 4ZA1A 3BF4A 2B6AB 3MEEA 1U25A 4KQZA 3H7HB 4ECXA 2FJDB 1NDKA 3M2RA 1WC5A 1FKOA 4X64F 1SBRA 3M6UA 1A6LA 2AKWB 1N33F 4X62F 1RT3A 1B4SA 2QLJB 4HH1A 4YDDB 5DLGA 2GX8A 1Q0NA 3IS9A 3TYTA 1B7FA 1SC6A 1YDLA 1S0VA 1LWEA 3OJUA 1S72S 4HI2A 3WZ0A 4DHVA 4LBPA 1CPZA 2WONA 1DQ8A 2I9SA 2WAQD 4CCHA 1BE4A 1U6BA 4X4NA 2EG2A 4CWBA 2MQQA 3AOAA 1T05A 1EHWA 1HHQA 2ILYA 4WP9A 1SH2A 1IJEB 1TVRB 1FXRA 1WUUA 2Y1RI 4DR7F 2JFKA 2OTLS 2UUBF 2CQCA 2GFFA 2Y3YA 4IH6A 1QTMA 2RRAA 2UVVA 3UR3C 4J37A 1RWNB 3JQJA 1N52B 1HNZJ 3A12A 3X1LB 4U6PA 3D1HA 2MKIA 4L6V3 4ED8A 1XIQA 4ED7A 2JJ4D 2E5HA 3H90A 1NJIT 2HHXA 1RAAB 1RISA 4TY8A 3OTEA 3D5MA 5AJ3F 3L3CA 1YIJS 1K1SA 3UVJA 3MPWA 3O44A 5LOQA 3K5NA 3Q8QB 2BJ1A 3SIPB 3Q86A 4DUYJ 1ZS6A 3QWUA 4CT9A 2AD9A 4ZHRB 3QGHA 3BBFA 2RKIB 1V3ZA 3FRZA 2HFSA 1RTDB 1MWQA 2JX2A 4FBUA 4HHUA 2DH9A 2DHAA 1T8EA 2MKYA 1YITS 4KHMA 5C5JA 4OHYA 4WKRA 1KVJA 4UW2A 1ULRA 4LMZA 5DZ7A 3D28A 4P71A 5I3PA 1NUEA 3UR0A 1VRQC 4WCEQ 1PJ5A 3G6XA 3UPFA 2OGUA 2RD5C 3TEGA 4J9MA 4IR9A 5LSOA 2ZD1A 1FRKA 3C6TB 3PKYA 1RWOB 2N4DA 4LF9J 2IY5B 2HNDB 3BB5A 1FX2A 1MMDA 2RAQA 2WVBA 3IXQA 4I4BA 5KFDA 1MMNA 5H9EK 3W64A 4J9OA 2XWYA 4DJBA 3J7AN 2OMLA 4ZCIA 3C16B 3IR6B 5D15A 3BPDA 4P72A 1FVQA 1U6FA 2LXFA 4Q5VA 2YXLA 1NJXA 2ASJA 2BJ8A 1X5PA 2DO4A 3AH6A 2PIIA 5ETTA 4RU9A 5GAGI 4ES1A 3D6HB 3GIJA 2QA4G 4OYBA 1RT2B 4F2RA 4QZVB 1HQEA 5FIIA 3CCVS 1C1CB 3AQPA 2BE2B 2QT7A 3TUJC 5D4PA 1KC8T 3ETMA 2MEWA 1F1BB 1NSQA 4HLBA 3K5LA 2RUGA 2IM0A 2GIQA 3EGNA 3IP0A 5ETMA 4JI0F 5L39A 4IOAQ 1N56A 1UAWA 1VLYA 2B4OA 3FQLA 4RW4A 5D0EA 5EUHA 5T7LA 2P5VA 5LMNJ 5THWA 2Z57B 1RT5A 2V8GA 1ZTWA 4M5MA 3W3SA 1J2VA 2BOPA 2AYMA 2EXUA 2G13A 2V9WA 2FC9A 1NZ8A 4IUFA 5FJ4A 3TUZC 3KLHB 4DQSA 3B82A 1RAFB 2QFIA 5IM0A 3DHWC 3T3FA 2IM3A 2OUGA 1S9EB 4NYPA 3HK2A 3VV2B 4LF6F 1WHYA 3ENWA 4YN3B 2C1EB 2I8EA 1RZMA 1V9OA 3KG1A 2CQPA 5ETOA 5KFYA 3SI8A 3DRYA 1WELA 4ZN3A 3DLBA 5HN0A 4DUTA 2H3EB 3QAEA 5CYQB 5LM7E 1UW9A 5CYQA 2XMWA 1PYOB 1NK7A 2MSTA 2APOA 1FVSA 4A8KA 1NH7A 3T9NA 4K4SA 2JWNA 1QJHA 4DPYA 2ROGA 3E8OA 4RW6A 2DTJA 1R8PA 1IM6A 1GMWD 2VBWA 4ZP9A 5DQHA 1AW0A 5BJRA 2J6UA 1I51B 3KHLA 2H9ZA 3HI9A 3TW0A 4RZRA 5HVHA 2HQCA 2YPYA 4BWMA 4CM0A 4S0MA 1M1KT 4F4AA 5U47A 4DX8H 1WC6A 3CCQS 4OI6A 2QJ3A 3EGZA 4C9DA 1R8HA 1W25A 3ELHA 2AQ4A 3EICA 2E1CA 1QY7A 4A8QA 1N8RT 2Y8YA 5KG5A 3GYNA 2YVSA 3M4XA 4CLZA 5GAEI 1T9WA 1WF1A 3BKUA 3JAMY 4RW4B 4X66J 1KOHA 4M5HA 4CQ1A 4N5SA 5FDLA 4RUBA 2XGPA 1OMSA 2QYGA 2XYHB 4YDXA 4K2JA 3G8TA 1WOSA 3SFUA 1WEZA 2XSJB 3W2WA 4ELTA 1Q1KA 1Q82T 2FVSA 5DG9A 1XR5A 2MZJA 3GLJA 3G87A 4EBCA 8ATCB 1KEKA 4RU2A 4OZ1A 2BKPA 1VQYA 3VAGA 2VL1A 3BQ2A 2HSEB 4ZPBA 5ETQA 1RWWB 2HHVA 3NXZA 4J9NA 3EXCX 3H5YA 3VZIA 1PBUA 4DR2J 2AJ2A 2BABA 3BBCA 3R9LA 4B3MF 2HIQA 2VICA 3HSZA 3Q89A 4N7TA 2DYAA 1Q8LA 4PXEA 2EK6A 4CZCA 2X3DA 2OSRA 2RU9A 3B4DA 3OLAA 2OFHX 1LEOA 2DH8A 4OZLA 2DRDA 4M5DB 1CC7A 4HDGA 3FJ2A 5D3GB 4YB5A 5LXYA 1FJGJ 2Q43A 2IDLA 1X8DA 2LQBA 2HNDA 2NXEA 3VALA 4NXMF 5D8HB 1EJ7L 1VIOA 2IJRA 1T0TV 2K3IA 2RHSB 3L95X 1JLFB 5E7OB 4JI0J 2WK4A 1J5OB 3KK2A 3CF5Q 4DV4F 3LAMA 1FNOA 4BDPA 2OPRB 2L9NA 3S01A 2ASYA 1IKWB 3PX6A 2D74B 4NZ0A 1OY8A 2EFGA 1GFWB 1YX2A 2GQCA 1LWCB 2WSCC 4BLGA 2WVFA 1U26A 3NAHA 5AXNA 1IKYA 4C48A 3I4PA 3KFWX 1YTYA 4DMZA 5DQIA 3CD6S 4OIXA 4ZVHA 1VBZA 2GHPA 3FDSA 2WVDA 2Z2MA 3H2LA 3ZTQA 3HF5A 2ZH2A 2OPSA 1WHVA 3AJ2A 4NLRA 4QU6A 3HHLD 2HK3A 1RTHB 3R97A 1RBLA 2DGVA 3NBPA 1JLQA 1Q5YA 2P9EA 2VFTA 4TY8B 3RAMA 3FK4A 1L3VA 4KFBA 3PZPA 4Q0BB 5ETSA 1T9VA 1N5VA 2UXCJ 1HI8A 4M5NA 2YNIA 4PRFA 4AYBD 4NRTA 5IT4A 2N3LA 3L7OA 1S97A 3UN2A 4EO6A 1H74A 2JLGA 3PY8A 2AEMA 2FUG9 4DFJA 2NUHA 4ZJQA 1SQEA 1WI6A 2XMAA 3RBZA 2V8DA 3DOLB 1X9SA 4WK3A 4CIOA 2V6AA 1VHFA 2WW8A 4QR0A 4TLRA 2DNPA 2E7XA 2MHEA 4N8OA 4NI2A 3GR0A 4QR2A 1Q5VA 4DS4A 2CYYA 5DS7A 3CJKA 3H2UB 9ATCB 3NCQA 4MT1A 1JXLA 5JVGQ 2UXDF 1L3TA 2FZGB 4FNIA 4NXMJ 2G2ZA 4ZJOA 4K4XA 4Z7CA 3EUNA 1Y9OA 1H72C 2CPEA 1B0VA 1K73T 3VR1A 4KE5A 4K4VA 4QWCA 5IV4A 3NY0A 2MXYA 1T11A 3W2VB 2BM0A 3FRYA 4H4MB 1F2HA 3M6XA 2NXCA 3M2VB 3ZNUA 4KHPJ 3RB4A 4B08A 3T19A 5KG4A 3WQPA 4PXDA 3PYEA 3ISNC 4DQRA 2YKOA 1JLAA 4OHVA 3Q23A 4FYXB 4DV6F 3G4SS 1FFSB 4KH1B 1YZ7A 2KG1A 2GMLA 3KOAA 1HBOA 5IXUA 4JI4F 2CJKA 1X4AA 3TX0A 4NLDA 5B0GA 4F7VA 5ETKA 3DRSB 2OIHA 4AL7A 1ZYQA 2JSXA 1IXKA 2VB6A 2Q6CA 3LP1A 2L48A 3MPUB 2WW4A 3BR8A 4MYTA 4PG6A 4OHZA 3LP1B 4ECSA 5DGBA 3OFEA 1HWJA 2ZZMA 3FEYB 2DNKA 1DBDA 2FB0A 3I9ZA 2CDRB 1RAOA 4A8OA 1SC3B 3ENQA 3EZOA 2ZH9A 1R31A 3R1LA 4I68A 4FS1A 1QM9A 1KLMA 3AB4B 1CULB 2QX0A 2V68A 1S6QA 3G86A 2CZ4A 3GSDA 4KB7A 4L74A 2DRBA 4H4KC 1PIEA 2KKHA 1T03A 1DHMA 2YWWA 2D3O1 4PABA 2QE5A 3T6BA 4DN9A 1KQGB 1SKUB 2XM3A 4IOCQ 4AE5A 5EHHA 4LSNB 4OZ0A 4CLWA 4KV8A 4LBHA 1JLEA 2CNLB 4O3OA 4EZ9A 1YK9A 1UP1A 1IQTA 1HNVB 5A8WB 3J7YU 3CJ3A 3A8EA 3HT0A 4WZMA 1NSKL 2RSQA 2XULA 1U49A 3W66A 1ZM9A 3ITHA 1FFWB 3AA9A 1EARA 1TMMA 1FRJA 1Q16B 3C15B 3C14A 3JQKA 4NA3A 5ADZA 4HHJA 2MQOA 5B0CA 3MUVP 3M2UB 4USIA 4FS2A 3V5RA 4C0OC 3IAM9 4ZIWA 5D4NA 1NCLA 1KTVA 2E9RX 2QL7B 2B4PA 2BR0A 4RX6A 1ZAVA 1KD1T 2HAIA 2XS5A 2ZDPA 1RAEB 2PEBA 1UVLA 3MM5A 5JUMA 4LF8J 3DOKA 3TRGA 1TL5A 4LUBA 2P9CA 5KG3A 4AD6A 2V9KA 3IO1A 5L1IA 1IQZA 2NCKL 5KFVA 2AYGA 1FEEA 2C22A 2KM8B 2JVRA 4U7UD 2VV5A 2WSFC 4C8MA 1MU2B 1ZPVA 4IRCA 3PJWA 2KRBA 1RTHA 3H5UA 1RB0A 3N0VA 2F9DA 2CJBA 2D7SA 2ZM6F 2AJQA 2J0SD 1QUVA 5FLXY 3V2UC 2R7WA 3DRPA 4YY3F 3PXGa 2FVRA 4GC6A 1UWAA 4P2MA 1WWHA 5KOWA 3BV8A 1W2BR 5FLXU 2J9EA 4K2XA 1R43A 3BGFA 4ED4A 5CYMB 3NG8A 2GJFA 2W2PP 4C11B 2IFXA 2J6TA 3SQGB 2CPZA 1G7CB 1GNKA 2BXJA 1A0OB 4WIIA 5IFMA 1FI4A 3OUYB 4K5RA 4J7CA 1QVFR 2HNZA 2VBYA 4QIGA 1R8AA 1M90T 4I2QB 1HBMA 1XMQF 4QPTA 3DMJB 2KXHA 1BY9A 2GO8A 4RNFA 3QZ8A 3D67A 4OYWA 4P7VA 1OYDA 1VQOS 2CG8A 2D3UA 2DNZA 5HVFA 2Q1LA 1VQNS 5I3UB 1N54B 1VRTA 2HVZA 3GIRA 2XLIA 1GAOA 1RT1A 1F3FA 4ETZA 3WC0A 5KFNA 2R7TA 2LEBA 5HP1B 3LGHA 4X4OA 2HHWA 3LWMA 5HJXA 2F63A 1CQNA 2IYGA 1M1HA 2LLZA 2CZVC 3IFEA 3S7RA 1FX4A 4M5IA 4DX7A 5JMNA 3C66A 3DLEA 1QUPA 4RJVA 1OIAA 5F8LA 5A0YA 4HTJA 2VQEF 1MNEA 1YRTA 3MEDB 4KTQA 1IN0A 1N34J 2LU1A 1D9FA 4B9NA 5E5NA 2CQGA 2QL5B 3NGSA 3MM7A 3C3LA 5CA5A 3CO9A 2ACMA 1FKAF 2BJ9A 4HEA9 5IQQA 1IM4A 2W9CB 5H9FK 1FHTA 2XSJA 4GO7X 4Y2AA 3LANA 2AEFA 3C6UB 4F67A 3R8YA 3P5TL 4MYUA 3CCES 2KN4A 2DEIA 3DC2A 4Y00A 1T9XA 3CSKA 3BSOA 1DLOB 2VFSA 4R0EA 4IRDA 4P7TA 4ZCLA 5KFTA 1BQMB 2AJFE 2BACA 2E5GA 3CB4A 4KHPF 1S48A 2ROEA 2G0JA 2XMJA 4LT6A 1HI0P 1VQ4S 3RG6A 4OJHA 2VG7B 3M8PA 2PMZD 4CNZA 4OX9J 1FKPA 4I7FB 1FRIA 2B51A 1VCTA 2QV6A 4NPOA 4QWDA 4RW9A 1DRZA 4U8YA 3KJVB 5AXLA 1XMQJ 2E9TA 2JFDA 1WDDA 3FKBA 4OZ2A 2XTJP 1XC9A 1TFWA 1T94A 3HPOA 5GAEU 2EWHA 3UDCA 5HROA 3QLHB 2CQ3A 5G4DA 1X0FA 3NOCA 1O0PA 1XERA 3Q2TC 5KFUA 3TP2A 4C8NA 4X65F 1X4FA 2W8LA 2CPXA 1HA1A 3GJSB 3ZZPA 1SCJB 3LALA 2I38A 4ZPCA 4NZ6A 3KJVA 1MWZA 1ZM3A 4RW9B 2VKZG 4D3GA 3KUHA 3IWNC 4M8LA 2C2OB 1Y5NB 2N7CA 4N8NA 1QLNA 3D68A 1JMTA 4DLEA 2R8IA 4YQWA 1GH8A 1N32F 2BJEA 4ZVUB 1NB7A 5D0HA 1T3OA 1R6YA 2GGPB 3FSXA 2FHOB 3MMBB 1SC1B 2KRRA 3RW6A 1ACMB 2CVIA 4EU0A 2F9JA 3V6HA 2HZCA 3ILIA 4JOUA 3Q8SB 4TQSA 3CGIA 1BUXA 3PYGA 2WRMA 3MUMP 3BKFA 4NOHA 2V2QA 3MMCB 1UVNA 1DTQA 4FF3A 2FDNA 1YKWA 1JLBA 1FDDA 4J9VA 3MOJB 1Y7PA 2U2FA 4ES2A 3RRGA 1Q95G 1RLCL 1AZSB 2F40A 2ZHOA 3C8YA 3QBCA 4MKAA 4Q2MA 3MEDA 2C3UA 1S6UA 3WBZA 2UU9F 1RT2A 2KVIA 2PN6A 4FP9A 4O44A 3MECB 2L3MA 1FK9B 3R3TA 2DD8S 1SV5B 2ATLA 2XI3A 1U0HB 2G0CA 5J2PA 2QEXS 4OHWA 3KK3B 4FF1A 1TAQA 1SPBP 1CJVB 3OFFA 4L76A 3V6DA 2H5IB 2WBMA 3DGPA 1WF2A 4O3SA 4A47A 2BJ3A 2HGNA 3ISND 1A7GE 4Q7AA 4YB6A 3MM8A 1U45A 5A76A 4C8YA 3OL9A 2HFVA 3GFHA 2HNYA 3V4IB 2AX1A 2W2MP 3J80Y 2P8IA 2VG6B 1JB0C 1RHKB 2RT3A 4Z7YA 2I0XA 2F8HA 2GAHC 4GVLA 2QZ8A 4CP5A 4F4YA 3GFZA 2DEJA 1Q81T 4FDFA 1R3NA 2UV8A 2A0FB 2BKNA 3I82A 4WTYA 1ZETA 4HKQA 3OUYA 5L1KA 3UD3P 5I4MA 1H3DA 2OTJS 3BZQA 3CE8A 1RYRA 3K0JA 5CQGA 4MH8A 5KT2A 1KRPA 1SJRA 1M5HA 3A4TA 4C11A 2OAUA 4AFFA 3GILA 3B54A 2N82B 4A8YA 3FMWA 1M5SA 2KHDA 2HVHA 2KB2A 3EGWB 3GJQB 4H4OB 2BUNA 2C2ZB 1JXVA 3PW2A 1S0MA 1RLDA 4MK8A 3ZTPA 2ZJRQ 3J7Z5 2RVJA 3SCIE 3BM7A 3VAMA 1V5IB 5DO2A 1OWXA 9RUBA 2NXNA 2QC3A 5IOLA 4DV3F 2HFOA 1YJWS 2CPHA 3R7BB 3LP2A 1B0PA 2F7VA 3CCWA 1UTAA 1IWGA 1ZZFA 2VPWB 2B4UA 4RBVA 4TY9A 3RGIA 5GADU 1VQ6S 3DLKA 3N9UC 1IKXA 1F60B 1QVGR 3PX4A 2HEKA 2DHSA 2CRLA 2GIRA 2R7SA 2BV3A 1XR7A 4A4JA 5T14A 2E5LF 5E2QA 2RQCA 1K0VA 4JI2F 2MKCA 5T41A 2HBRB 2MB0B 1T05B 3KG0A 4NMXA 4ZVGA 3P8BB 2OEJA 4KGVB 3IGVA 5KFHA 3W61A 4TXSA 2V8HA 3V6KA 1NRKA 1DJ0A 3EVMA 4FKXA 5IT9Y 3OTCA 1WEYA 2BW7A 2WHOA 3FBBA 3PFOA 3MAAB 1ZBTA 3F56A 4ZVOB 1NK9A 4LFCF 2DNGA 1RT3B 2FY8A 1YI2S 2O66A 2DY1A 4JUZA 2VF3A 3US5A 2PFFB 5LXRA 2YWFA 3K7RA 3N28A 2QMXA 2GAGC 2XBPA 1HNVA 1KOOA 1GQEA 2RRNA 4WPAA 4Q8EA 2B6AA 1LWFA 1QAJA 2YX7A 5KFFA 2RRBA 5L1JA 1CJTB 4BC9A 2F65A 4P6QA 4RW7A 3K17A 1MWYA 3TUIC 2UXCF 1N48A 1JWWA 4M5GA 4WXWA 5D77A 5JVHQ 5KFLA 2AGPA 3NL0A 4RPFA 3VVTA 2M2BA 1I94F 1YVFA 3AB2B 1HPZB 4WKYA 3F44A 1X7VA 4FF2A 5J2QB 2E5IA 3RB6A 2DHHA 1HBUB 4X4VA 2DY9A 1CULA 2HMIB 2G4BA 2HBZB 3ADAC 4X84A 2GCFA 3MEGB 5C25A 3HFZB 4IQMA 4F8RA 2LKZA 3SCJE 2IAJA 1RHMB 4I1TA 3JXOA 3PW7A 3AA8A 1FD2A 3LAKA 5J2NA 3KG4A 3JYTB 1R7IA 5L46A 2OJ3A 5D78A 4IFYA 2PO4A 4IFYB 2HAFA 5LMUF 3ONQA 2HVDA 4GKKJ 2EC2A 2HIYA 1HW9A 4EZ6A 1BWVA 2BOAA 4G1IA 1VRUA 5IC4B 2ZOGA 1FJ7A 3VQTA 1JKHB 3FEZA 5F3ZA 5JJBA 4CLSA 3JTNA 5C2CA 2W9BB 2XY7A 3TAPA 1FTRA 3QFWA 4MKBA 3ZZRA 3QIDA 4NXNF 2NYIA 1Q79A 1NSAA 1I5OB 3PHEA 1S7HA 4RNMA 4ELVA 1AFIA 2CQIA 1EZZB 2FVCA 3F0NA 2KYZA 4G1QA 3GYGA 1PC4A 5E3RA 1F5CA 2RS2A 2ASDA 1TK5A 2UXBF 4H4MA 3DKDA 1NHKL 2LYVA 4LRCA 6FD1A 4JI1F 1H38A 4P74A 3LGNA 4RL1A 4WU2A 5DDOC 4LF8F 3DLJA 3CEDA 2F8MA 4TU8A 4ECYA 1RTJA 1H73A 1HLWA 1NO8A 5HBMA 1LFWA 5J2MB 2E1MC 3BEGB 3GCWP 3R5AA 4QJVA 2JEJA 2DCLA 4BBYA 2YPZA 3NP5A 2PA8D 3D1QA 2IJFA 3PJ9A 4EI2A 2XMVA 3FUYA 4GKKF 2CPFA 3TZYA 1KVIA 1Y10A 4NCGB 2COLA 3HKWA 3I5BA 2MSSA 4DDFA 4I2PB 2E66A 1JIHA 2QL9B 3DOLA 4KGZB 1S1XB 4RUCA 2DPIA 2KO1A 5F8JA 1S1UB 2VJVA 1JLCB 1ZM4A 3N5BA 3TQ1A 4F0MA 1U09A 1U8WA 3AD8C 2V50A 3W65A 1WG5A 3CCLS 2CQHA 3L09A 4IO9Q 1GT8A 2B43A 1U1PA 3J81U 3BSNA 2ZWPA 2HPUA 3NWGA 4ZOSA 3QWPA 5MAOA 4M95A 2VIHA 2FHMA 3JSBA 4KFBB 3L7PA 4Q8FA 2IVFB 4DV2J 2LFVA 4U67Q 1X5SA 4XO0A 1TL4A 3B8HA 2R8KA 4JI5F 1PC5A 4YHHF 4CO2A 1D3WA 4ECQA 2U1AA 1EQ0A 3ZZOA 1RA6A 4UZBA 1VJQA 2VQFF 3JSYA 4B17A 4WK1A 1MG7A 1TKTB 1BHNA 3HVWA 3OPKA 5J1NA 3UDVA 3UO0A 4NLVA 3K2YA 3BYPA 1VK3A 4CTAA 4B3OB 4R0JA 2UU9J 2DB1A 2VH7A 3TZXA 1S99A 1V3RA 3I0RA 2JL9A 2Z58B 3MCSA 3TOQA 4R8UA 4X62J 2MQLA 4NLSA 3RB0A 4DR3F 3GZ7A 5AE1A 3IG1B 1IKWA 1RHQB 1XEZA 5GAHU 1UEVA 4OL8A 2AF6A 4OV1A 1JNRB 3W9HA 1HD1A 2YNHA 3IC1A 5KTQA 5A8KB 3G9CA 4DV5J 1KBRA 3DHXA 4PUOA 4M1KA 1Z2LA 4NEZA 2HWIA 2A18A 1S6OA 4ANDA 3MFHA 2LA4A 2YNFA 2DHXA 1R0AB 3OXFA 1LKZA 5AT1B 2QG9B 4CO1A 4O23A 2AYEA 4WFNQ 3R2CJ 2A3JA 2YWEA 1SUQA 1RBOB 1RU1A 1NDPA 4NEYA 2MKKA 2ADBA 3CJ5A 5ETPA 4OZ3A 2ATCB 4TKTA 4WXOA 2E7VA 2H1YA 3ILLA 1CC8A 1WG4A 3KJFB 2R2UA 1UWBB 4QIVA 5LL6d 3S1TA 2BQ3A 2HZAA 3PRDA 5D4OA 2R7XA 2ZNYA 1AB8A 3K8WA 2PC6A 1RSCA 1XMOF 1UJ6A 3MECA 2L9DA 3TAMA 1HKAA 1Y11A 2DKOB 1YBTA 2K06A 3B4MA 3FCHA 3QFHA 4NE9C 3LP0A 5HLFB 2W7OA 3DM2B 2CJAA 3KTQA 2LEAA 1S1VB 1YGYA 4ICLB 1TMJA 1JLBB 2CQBA 4K5SA 3KLIB 4L75A 1ZA1B 2ZJPQ 2IMWP 2JH3A 1UCNA 3H25A 2Z30B 3M8SA 1U1NA 3KLGA 5DDRC 4YHHJ 1VK8A 3UN5A 1NBEB 2XGQA 4V19J 4PXBA 5FDLB 1GMWA 3CWJA 1EKSA 4QCLA 3VTIA 4DPOA 2JLEA 4P73A 1R8BA 3NCPA 2LMIA 5M2PA 4H54A 4DV0J 2UUAJ 2RILA 3NAIA 4E98A 5G0RB 1GMUA 1AUSL 4PCQA 2ZM6J 1UPMB 2DR7A 2CJYB 3W1YC 1SKRA 2CVEA 1I94J 3NMAA 5LMNF 3AD9C 1PGZA 3BBBA 2K7KA 5F9NA 1S0NA 3FNNA 4OZ5A 3HD1A 1WSRA 2DRAA 1FXLA 2OPQA 2JHEA 3KMSA 4QQBA 3Q0AA 1NNDA 1X4CA 5CYJA 3ZTRA 4DL6A 1U1QA 1BXNA 4Y0FA 2GA7A 4F36A 2M5YA 4EK2A 3M6VA 1NM2A 3A3PB 4ED6A 5HROB 2B56A 2RHQB 4GVBB 4PWWA 3RU0A 1FESA 2JDJA 4CLUA 2ZHAA 3CJ2A 1QAIA 2OEMA 4ALZA 3DDIA 4GKJF 2QSFA 3IMQJ 1KKHA 2PGCA 1XTZA 4WU3A 1KONA 4CLPA 3R5GA 4X64J 1N33J 3M8QA 4B9TA 4WE1B 2EK1A 3I31A 3WHIA 2RQKA 3BGRB 1X4HA 3MM6A 1HI1A 1WKJA 1Y5IB 4OX6A 2DVIA 4B3TF 4C8ZA 2EG1A 3CIMA 2NYHA 3FBCA 3MD3A 4M5JA 2ZBRA 3FBEA 4LRDA 4PZVA 4OYZA 2DR5A 4HACA 3T5JA 1C0UA 2FPHX 5KT3A 2BW2A 2QA4S 1CQMA 4I6AA 3SMZA 1VQKS 1WTFA 2VA2A 4C97A 4PQUA 2FGCA 2GW8A 1N5YB 2ZZTA 4N77A 1AROP 3THVA 3CCMS 4JYAF 3OV7A 3E01A 1LWXA 4JI6F 3D54A 5CZVA 2W2OP 4ZS6A 5C24B 1S1VA 2BE2A 1TU0B 3CUNA 2QLBB 1HYSA 4CO4A 3M9OB 3RR7A 3KDNA 3M9MB 2BA9A 1K44A 5I42B 1LK7A 1FWPA 4L3NA 5F8HA 4AL5A 1S1WA 1ZPWX 2M9KA 1NK6A 2VKRA 2XHCA 5D0GA 5DZ6A 2BMBA 5B0EA 2QLXA 3Q2SC 5HQMA 4ECZA 2MYFA 4DSJA 2AZ3A 4CLTA 2HGLA 4B9VA 2KL8A 2LCWA 2EEYA 3W9IA 3DLLQ 3JB9k 5I3UA 2QYCA 1I3OB 4NLTA 1FNXH 3MR7A 2Q3PA 5MLCV 3P6YC 4OMFG 2G2OA 2WSEC 3DMJA 1ELOA 3CJQA 3V6JA 3QIPA 5LJ5Y 2YKMB 2M3DA 4DX6A 3M6WA 4DSFA 4KRWA 3EJMA 2I1RA 4R5PB 2PT0A 2DISA 2UUTA 2Z56B 4FYDA 2MLYA 5IWAF 5IT0A 1H2VZ 3HXMA 5BYQA 3TA2A 5H9FJ 4WFYA 3I0RB 2WVEA 3DN9A 3R5BA 2DR8A 1NKBA 5CYMA 1KS2A 5AE2A 1UFKA 1MROA 2XO6A 3HJVA 2RJZA 2J0WA 2G1DA 2A2CA 3G2XA 5IC6B 3MR3A 2FJWA 1B64A 4GRSA 1TKTA 4ZHRA 1HNIB 1LNQA 3MMAA 2R9LA 2DR9A 4OI3A 4K4ZA 2R7UA 4DFMA 3KDOA 4QIWD 4DN0A 4A8MP 3FFIA 2AW0A 3PYFA 5ETNA 5KG6A 1RP5A 3Q8YA 5EX3A 3FMBA 1UKUA 1KLNA 2MLXA 2AU0A 3QO9A 2HHPA 3OVSA 3TUPA 4RWWA 1S9GB 3AQOA 4IFVA 1TKZA 1N6QA 4I6WA 3VGUA 1VQLS 3SEOA 3EVOA 4F50A 5RUBA 3HVTA 2HQ3A 5H9EJ 2YKQA
chains in the Genus database with same CATH topology
4QWBA 1K1QA 2BQUA 3QZ7A 4NA1A 5KFXA 5CCLA 1FD8A 2EBGA 2HGMA 1TVRA 1UVIA 1S1UA 1UL3A 3WX4A 4DFKA 2X1BA 2ZH4A 3HKZD 1XN9A 1G1XA 4B02A 4IH7A 2XZWA 4KBIA 3MUTP 5HO4A 4OX9F 4YP3A 1S6PA 2MZRA 2YH1A 3I9V9 4PWDB 4DL7A 3OTOF 1FE0A 3WC2A 5DG7A 2LQJA 3F41A 4KV8B 2GHWA 4HYKA 3CC2S 2ILZA 2R8HA 1UJ5A 1EETB 4KR0B 2FGOA 1RT4B 3GV7B 4RBTA 3V81A 1C0TA 5I3QA 3GIMA 1O5JA 4Y6IA 2D41A 2F8EX 3GV8B 1BD6A 2W24A 1U1LA 1S0OA 2VG5A 1GX6A 2RDIA 3CF5Q 1VRUB 2J76E 3CDEA 2UV8G 4PPZA 1DTTB 1L5UA 1FRHA 2D3ZA 4G3IA 1RYSA 2KXNB 5KFRA 2J7UA 4NMLA 4J9QA 3JYTA 2DIUA 4BC7A 3DRSA 1VC6A 2NSBA 5K8MA 2HRUA 4QR1A 1RA7A 4YB7A 1SJ4P 4M94A 1Z2ZA 1P27B 4OI0A 4NLGA 3DYAB 2ZKUA 1B0TA 2XMMA 5LSLA 4QU7A 2W4CA 2YWGA 3CMAS 5KFGA 4LF7F 2OKQA 2X3GA 3OXGA 2FIUA 4ES3A 1Y3JA 2FC8A 2OFGX 3HVAA 1KHWA 5E3AA 4F26A 4CH0S 1BQNB 2HHUA 4QW8A 4OZNA 1RT6A 2R2RA 4YB1P 4RNNA 3GB0A 1KFDA 2PD1A 1S6PB 2C3PA 3IGNA 3OR2B 2M52A 1TK8A 2RF2A 4E0DA 2XCAA 4IG0B 3MPVA 5KFKA 2XLJA 3G6YA 2CIMA 3LGMA 4WJBA 1DZ5A 1DFDA 2XY6A 3POTA 3DXSX 3H4DA 2NZ4A 5J1EA 2A10A 4ED1A 4DF4A 1TL1A 3IR5B 1LW2B 4YUDA 2UP1A 1WI8A 4CI0B 4I67A 2YNIB 3CJ0A 4DUYF 1TKZB 1N6QB 2IBOA 5A6WA 5GAHI 2YX1A 2PSZA 1JLQB 4ZP7A 2XNQA 2Y1IA 3BO4A 2ZC4A 2V4JA 4CO5A 4F4ZA 1SH0A 3TX8A 1FT8A 3MTJA 1XMBA 4MTPA 3SYZA 1UVJA 4UY85 4O3QA 1RK8A 4F3QA 3G71S 2R8GA 1LFPA 2MKHA 1K8AT 2PDAA 2LVWA 4OJGA 3MURP 1G2EA 3BGUA 3R5DA 1Q86T 1MSWD 1HMVB 4KGMA 2VBXA 5K9FA 1SI9A 3QIPB 2OP5A 5EN1A 2VPZB 2KH9A 3NS6A 4NRUA 3SFGA 3Q24A 4ZPVR 5KFZA 4EBEA 2VG6A 1M5KC 4ZPTR 4WZQA 1P1LA 2LXUA 3H2VE 5KFCA 1X9WA 1Q7LB 5B0FA 4QW9A 4MK9A 1VJWA 3SSSA 1RT7B 4C8OA 1FNXH 2IC3A 1X9SA 3KK3A 2NPIA 1VGYA 4TNOA 1UVKA 5J2PB 5HQ8A 1GTHA 4X4RA 2G9OA 2M0GB 3JTOA 4MIWA 5LSRA 3MF5A 3U27A 5J1EB 2CQ1A 2RE1A 4DSLA 2YKNB 3CDWA 3G8QA 2AP6A 3PNIA 2W8KA 1XWLA 4ILRA 4GC7A 2OPPB 3MMCA 1FF2A 2Q79A 2RS8A 3W2WB 3CC7S 4LFBF 3THTA 1FJEB 3QJJA