1RT7B

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
435
structure length
415
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 113
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7B03
3DM2A 4K4UA 1KHWA 1KHVA 1S4FA 1Z4UA 3PZPA 3BSCA 2AGPA 4O44B 4DL7A 2JEGA 4FBUA 4NZ0A 5F8JA 4H4OA 2R2TA 4IG3B 2XCAA 2D3ZA 4QW8A 4DL2A 4I2QB 4LSLB 2OPQB 5I42B 5KFBA 1TL1A 3I0RA 5F8MA 3MR5A 2W9CA 4K4XA 4K4VA 1HQEA 5F8IA 5KG7A 3DOKB 4Y3CA 3FDSA 4R8UA 5KFFA 4MFBA 2IA6A 4KBIA 1JLQA 4RW9B 4QWAA 1S1WA 1C1BA 1SV5B 1TKXB 3KHGA 4GC6A 3PW4A 1RTDB 3N6NA 5KT7A 3KLEA 3ICLA 5F9NA 5F8LA 3MR2A 1JLQB 4Y34A 3GQCA 1S1VB 3MEGB 4MK9A 2DPJA 4MKBA 1S6PA 2VG5A 3PW2A 3IRXA 3FFIB 3NL0A 2V4RA 4PUOB 4G1QA 3IGVA 4NLVA 4EBCA 2JEFA 5C25A 4ED8A 1D0EA 4GC7A 3CJ2A 2IM1A 3PJXA 2WONB 3DRPA 4I2PB 1SH3A 1S6QB 2B5JA 2JEIA 3CJ3A 4XPCA 2HNZB 2FLPA 4WE1A 3HVTB 2VG6A 5HLFA 3IG1B 4ZP9A 1TKZB 4M95A 2JC1A 2IC3B 3M8QB 3Q8QB 1RT4A 4ECUA 2ZE2A 2YNHB 2GC8A 3BQ1A 5KFNA 3H5XA 4YR0A 1HYSA 5K14A 2FJVA 2WOMA 1RYRA 4KO0A 1LWEA 2IC3A 4WZQA 3JYTA 1IKYA 3MEEA 5KFDA 4FS2A 1RYSA 3LP1B 4ZVHA 3IS9B 1T94A 1QE1A 2GIQA 3MR3A 1RT5A 1HPZB 3GV5B 3V81A 1S6QA 3E01B 4R5PB 4ED0A 3C6UB 1S97A 2RDJA 4Q0BA 2W8LA 2FLLA 1I6JA 3NKYA 4YQWA 1C2PA 2CJQA 1JLFB 3CDEA 2I5JB 1LW2B 1EP4B 1J5OA 1JLBB 4RNOA 2C2RA 3JSMB 3CJ0A 4YMEA 4KV8B 3PW0A 4EYHB 3OHBA 1S1TA 4I7FB 1XR5A 5DQIA 2E9ZA 3H5SA 1DLOA 3OLBA 4QWBA 1REVA 1RTIB 1IKVB 4RW9A 4RW7B 3D5MA 3G86A 3KK2B 3MTKA 4LQ9A 3BQ0A 1JXLA 5KG4A 4EYIB 3Q8RB 3MECA 2W9CB 3LAMA 1TV6A 1XR7A 4O3SA 1DLOB 3LP2B 3N6MA 3D28A 5KFCA 4ED1A 1VRUA 1TVRA 2AX0A 2XI3A 2ALZA 5DG7A 1HMVB 4DL6A 2R2UA 1EP4A 1J5OB 2VA2A 3BQ2A 1RT6A 3DRRA 1KLMB 4MK7A 4JUZA 4H54A 3H4BA 5KFJA 2E9RX 4KAIA 2XC9A 3M9MB 1RTJA 5KT6A 3UQSA 4OL8A 2FJXA 4IKAA 4IFVB 4O4GA 1TVRB 1FK9A 3N6LA 3NAIA 4Y2AA 2W9BA 2YNGA 4RW4A 2WHOA 3MR6A 2RKIA 2DPIA 4F4WA 4MIBA 3GIKA 3PW5A 1HARA 4ICLB 4URQU 1HNIB 2ILZA 3KK2A 5KFWA 3SI8A 3ITHB 4RUCA 3I5CA 1RT3B 4ID5A 4TY8B 4ZPCA 1HNVB 3NAHA 2J6UA 2OPSA 2OPRB 4ECRA 4ED7A 3HVTA 4NLYA 3IS9A 5KFOA 2YKMB 5L1IA 1S9EA 2HNDB 2B5JB 5C24B 2YNFA 1HNVA 1N48A 3Q8SB 1ZTWA 4WFXA 1N4LA 4RZRA 2B43A 4J9PA 2FVRA 5KG6A 5C25B 5KFMA 2FLNA 4FBTA 3LALA 4Q43A 1S49A 4KKOB 3FFIA 2BRLA 1JLGA 4RW6A 3C6UA 2RKIB 2UVRA 4RU9A 5L1LA 3EZUA 5FDLA 3TQ1A 2ASLA 4YR2A 2UVWA 2YNGB 5EWFA 3QLHB 4J9OA 3CIZA 4WXWA 3DYAB 3KOAA 3IGNA 1RTJB 1N6QB 1TL3A 3NGDA 4TY8A 4KO0B 1TQLA 4MIAA 5F8HA 4IR9A 1S0OA 1RAJA 4WYLA 1HYSB 1RTHA 3CDWA 4O3NA 3KLFA 4NLXA 2HNDA 4KSEB 4NLSA 3T1AA 3ISND 3DYAA 2W7PA 3RBEA 5DGBA 5KFTA 4H4OB 4J9RA 1BQNB 1RT2B 1RTDA 1BQMB 3GYNA 3DRPB 1LW0B 4I2PA 4KV8A 5J2MB 3QIDA 3OSNA 1S1XA 2AX1A 3DMJA 3GV7B 3ITHA 4G1QB 2I5JA 2FVQA 1RA7A 4KKOA 4O3PA 1RT1A 3M9OB 5DG9A 4ZHRB 4RNMA 2HNYB 1S9GB 1S1XB 5JUMA 1S1VA 3IN5A 2ASJA 2BQRA 3DLEB 4IG0A 1T03A 2V9WA 1BQMA 3LAKA 1VRUB 4EBDA 3DLKA 4NLOA 1RT5B 3DI6A 3DOLB 4RW6B 4QWDA 3KLFB 1RT7B 5DQGA 1RT6B 3OL8A 4FS1A 4NLUA 2V4QA 4JV2A 4WXOA 1U09A 4Q0BB 2XI2A 1DTTB 4RW8B 1XR6A 3VQSA 1LW0A 5J2MA 1N6QA 5I42A 4U6PA 4URGA 4RNFA 1JX4A 3BGRA 4ZVEA 1HPZA 3PR5B 3QIPB 3C6TA 3T5JA 1S1TB 5KFKA 2R2SA 1K1SA 4O3QA 2HNZA 1IKXA 2UVUA 1S10A 4ZVGA 3JSMA 5KFPA 4ECYA 4IOBA 4TXSA 5F9LA 1FKOA 5F8GA 3NBPA 4YR3A 3CDUA 1JLGB 3KMSA 1QAIA 5EWEA 5KFGA 3SFUA 1KLMA 1RT7A 2C2EA 3IRXB 1T05B 2C28A 1TP7A 2WB4A 2HMIB 4EO6A 2XWYA 5DQHA 2IJNA 1JLAA 2YKMA 3DLKB 5KFRA 3BGRB 3E51A 4MKAA 1LW2A 2UUTA 2VG7A 1DTTA 4RW8A 4F50A 1RT1B 4G3IA 5J2QA 3DRRB 3DDKA 4TLRA 4ECQA 2JLEA 2ZE2B 4ZPAA 3MEGA 1QUVA 3RB6A 2UUWA 2AWZA 1TL1B 3I0RB 3T19A 3DRSA 3LP2A 1S0NA 4IFVA 2YNIA 2F8EX 1OS5A 1S9FA 4ZHRA 1IKWB 1ZTTA 1RTHB 2VA3A 3FQKA 4Q8EA 3M8PA 1TKZA 3H4DA 4DL4A 3IG1A 3V6DA 2IM2A 4EO8A 3OL6A 3DI6B 3DOLA 5KG5A 4RW4B 4ECWA 3PW7A 1BQNA 1RT2A 3QZ8A 1S0MA 1FK9B 3T5KA 4H4MB 5DLGA 5EWGA 3V6DB 2HNYA 2ASDA 3M8PB 4MFBB 1SUQB 3NMAA 5HP1B 3I0SB 4KHRA 5KFLA 1HMVA 1RTIA 4ED2A 1HQEB 4IH7A 4Q45A 5C5JA 3MFHA 2IAJA 4I2QA 4LSLA 2W8KA 5KT5A 1S9EB 2W9AA 5DGAA 4J9MA 3UPFA 1JLCA 5J1EB 2O5DA 4Q44A 4NLPA 2D41A 3JYTB 4HKQA 4LQ3A 4QPXA 2WTFA 2FJWA 5JXSA 2AGQA 4K4SA 3H59A 5CYQB 3PJWA 4DG1A 5I3UB 3I5AA 4K4YA 1CSJA 2UVVA 1REVB 4MK8A 5KG0A 3TAMB 2WCXA 2FVCA 4R5PA 3QLHA 4WE1B 1VRTA 4NRUA 2AGOA 2WRMA 5FDLB 1JLBA 5KFUA 4O4GB 4U7CA 2W9BB 4IRCA 2OPRA 1TKTB 5J2PA 1T05A 3BR9A 1IKYB 1C1BB 1SV5A 3QZ7A 2IBKA 4XO0A 2IAJB 4IRKA 3DLGB 3KLVA 3GILA 1ZETA 4IDKB 4KE5A 4X2BA 5F8NA 3NBPB 1GX6A 1T3NA 4IH6A 4ICLA 4EBEA 2BANA 1RT4B 4IRDA 4WZMA 3E01A 4K4ZA 1NNDA 2QE5A 1IKXB 2VG6B 1RDRA 4NLDA 2OPPA 3KLEB 1MMLA 2JC0A 4WFZA 5J2NB 3QIPA 3PHEA 4DEZA 1TV6B 1WNEA 4ZMMA 3I5BA 3FRZA 1LWEB 2ILYA 4EEYA 2WOMB 3MEDA 4NYZA 1NHUA 3QGGA 1HNIA 4LSNB 2B6AB 5CYMA 3Q8PB 2IM3A 5HLFB 3KHLA 1N5YA 5DLFA 1SH0A 2D3UA 3QGIA 3RB0A 1N56A 2RDIA 4M94A 1MU2B 3MF5A 3TVKA 1LWFA 4NCGB 1R0AA 4YP3A 3FQLA 1DTQB 1S1WB 4TN2A 4B3OA 4ZP6A 4IQXA 3CO9A 4O3OA 3DOKA 2XGPA 4ZPBA 1JLEA 3G6XA 4IR1A 3KLHA 3H5UA 4ECXA 1C0UB 1UWBA 1S1UB 5HBMA 4XPEA 3HVAA 4B3OB 1JKHB 4IFYA 4KFBA 4TY9A 4ZVFA 4ED3A 4IG3A 2RF2B 4O4RA 1HQUB 5L1JA 3PR4A 4O44A 1NHVA 1TKXA 4WFYA 5L1KA 3V4IB 5EDWA 3KLIA 2ZD1A 3KK3B 1GX5A 3BSOA 3T5HA 4MH8A 2IJFA 4PWDB 1YVFA 4TYAA 4WYWA 5DG8A 1JLFA 5EUHA 4JV1A 3FSIA 4F4XA 1EETA 4NLTA 3UR0A 3QO9B 1TL3B 3LANA 5D3GA 1SH2A 3KNAA 2BR0A 2BQUA 4TYBA 3KHRA 5KG2A 2J6SA 4PWDA 3PVXA 3GIJA 4NLQA 4I7FA 3H2LA 1TKTA 1LWCA 5J2PB 3SFGA 4R0EA 2ZD1B 3KHHA 4J9KA 4NLRA 5KFHA 3RB4A 3CWJA 3KK1B 2WONA 5C42A 4IH5A 3OSPA 2RF2A 1S48A 3C6TB 1D1UA 4KB7A 3DM2B 4IFYB 4KFBB 4PUOA 1JIHA 1RA6A 3M9NB 5K14B 2D7SA 1C0TA 3G6YA 4PQUA 1C1CA 5L9XA 3RBDA 5C24A 3UDLA 2AQ4A 3V81B 4O3RA 3KLIB 1QE1B 3KK3A 1JLCB 5J1EA 3LP1A 2XCPA 4Y2CA 4NRTA 5KFZA 3V6HA 1W25A 1VRTB 1LWCB 2BE2B 2QV6A 2R8HA 5KFYA 2FVSA 4ECSA 1JKHA 4PQUB 3GIIA 3EPIA 4R8UB 3TAMA 4ECZA 3KMQA 1S9GA 2YNHA 3I0SA 4ZP8A 2I1RA 4DG1B 2W7OA 4J9QA 2YKNB 4ECTA 5KFIA 4J9SA 3OL9A 2OPQA 2R8JA 4K4WA 5C42B 3MEDB 3H98A 3DMJB 2ZKUA 3CVKA 4F4YA 3V6KA 3QGHA 2CKWA 5KG3A 1FKPA 4DL5A 2AU0A 5KFEA 5KFSA 5HROA 3ISNC 4QWEA 3BSAA 5J2NA 4ZP7A 5KFXA 2R8GA 5KG1A 1N5YB 3LP0B 4NLWA 3HHKA 1C0UA 2YKNA 1K1QA 2B6AA 5CYMB 4LSNA 1S6PB 2VG5B 5KFQA 1JLEB 2J6TA 4J9NA 3KLGB 2E9TA 1SUQA 2BRKA 3RAXA 1IKWA 5J2QB 2FVPA 3CJ4A 3LP0A 1DTQA 3G6VA 3V4IA 2VG7B 2BE2A 3T5LA 4Q8FA 5HROB 4J9LA 1HQUA 3OHAA 4KHMA 2GIRA 3MECB 4RNHA 3GIMA 2JEJA 2R8KA 4ED6A 1MU2A 2IM0A 4RNNA 3MFIA 2R8IA 1S1UA 1JLAB 5HBMB 3EPGA 2HAIA 3KLGA 4ZPDA 3KLHB 3CJ5A 1C1CB 2HWIA 3BSNA 1IKVA 4RW7A 5T14A 2OH2A 5KFAA 4K4TA 1EETB 3HVWA 5KFVA 5CYQA 3BJYA 2V0NA 2YNIB 2WK4A 4NCGA 1FKOB 1R0AB 2YNFB 1FKPB 4RUAA 3OL7A 4URSA 5KT3A 4F4ZA 3DRSB 4JV0A 2C2DA 2BQ3A 2OPPB 3H40A 4QWCA 4ECVA 2HMIA 3RAQA 2OPSB 2BANB 3QO9A 1UWBB 5D3GB 2ATLA 1RT3A 4ID5B 1C0TB 2R2RA 5I3UA 4IDKA 3BREA 3DLGA 2XGQA 4HYKA 3KJVB 3HKWA 4TQSA 2IMWP 3H5YA 3V6JA 3KK1A 4NLGA 5KT2A 4QW9A 1QAJA 4K50A 1LWFB 2EC0A 4H4MA 3MEEB 3QYYA 2HWHA 3OLAA 3KJVA 1IM4A 5KT4A 3DLEA 4IG0B 1T03B 4DL3A 3RB3A 3GV8B 2C22A 4TQRA 5HP1A 3M8QA
chains in the Genus database with same CATH superfamily
3K8VA 3MM8B 3ZC4A 4PPDA 4ATNA 1KHVA 2V67A 3QWPA 1TTHB 1XMOJ 3PZPA 1VQOS 4YDDB 2BW2A 3HCXA 2KT3A 1S79A 1WKKA 5A8WB 1FDAA 1A6LA 1OMSA 4NXMJ 4B9LA 2R7UA 2AGPA 2XG8A 4O44B 5A2QY 2ZH7A 4H4OA 3FSXA 3VR1A 2XCAA 1SB6A 4OYXA 2VV5A 3CCTA 3F0NA 4OYZA 3H2VE 3WX8A 3CSKA 4BCAA 4CO2A 1TL1A 4K4XA 1MWYA 3PFOA 3AD8C 1F3VA 2YWEA 2FQQB 2WZ1A 2DGSA 3DOKB 2CQIA 2CYYA 1SKUB 4Y3CA 4C8KA 3TARA 1NK8A 4J37A 4YB5A 1JLQA 4RW9B 1O8BA 1S1WA 4DV6J 4WKRA 1SV5B 2DJWA 1TKXB 3MD1A 2GAGC 4UOGA 3PW4A 3PX0A 3J81U 2DBBA 3HX9A 4C7QA 2CXEA 2OJ3A 3KLEA 9RUBA 5F8LA 3MR2A 3CD6S 1U7LA 1I51B 2RJZA 3HHLD 2DPJA 4MKBA 5E3QA 5FIIA 3PW2A 4YB7A 4F2RA 3QT5A 3Q8YA 3QRQA 1WELA 1GFWB 2VONA 3OQ2A 5IWAF 3JQMA 3NL0A 3CD5A 3CC2S 2HW3A 4EBCA 1JMTA 2J5AA 2VUGA 1N52B 1Q4RA 3MOJB 3CJ2A 2IM1A 2WONB 4I2PB 3D6HB 2JEIA 3K7RA 1QAXA 4NI2A 2FLPA 3LW5C 1P27B 3HHLA 3OJSA 4JV5J 3EICA 5HVGA 2B9WA 4PXCA 5GADU 1TKZB 3M8QB 2AMCB 3O3LA 5J1PA 3BO3A 4ECUA 4PR6A 3PJ9A 2KVIA 3UDVA 2QA4G 1X60A 2QIFA 3BV8A 3CCUS 2FJVA 1JWWA 1FKAF 4A47A 1N0UA 1UTAA 1IKYA 3MEEA 2HK2A 3NS7B 1F2HA 4X66J 4FS2A 3PYDA 3WIVA 4EI2A 4F25A 2JL9A 4WKYA 1WEZA 1T94A 1VJQA 3A13A 2OP5A 1LOUA 2W25A 3M8WA 3QT8A 2G2ZA 5LOQA 1VOMA 4N76A 1VRQC 2FZCB 5CQGA 4DR6F 2W8LA 2FLLA 3KFWX 3D7SB 1C2PA 3HVRA 1S0VA 1YZ6A 1LW2B 3THTA 5A0YB 4A8FA 4JI1F 1N36F 3JSMB 3MMBB 1T9XA 4LBIA 4YMEA 1MSWD 2IHR1 1MROB 3EMTA 4I7FB 1T9YA 1H0HB 1NSQA 3H5SA 3OJUA 2V4JA 3CIMA 4FYXB 4CLWA 1T9UA 5BXIA 3D0GE 4OYBA 1YQHA 1RTIB 3I56S 1NB2A 4C0OC 5A76A 1ROFA 2VPZB 1KFDA 4CIOA 2KG1A 3DLLQ 3SXLA 3ZNUA 1U1LA 2WBMA 4ZVUB 2ZKTA 3NGRA 4BHQA 1TV6A 4CI0B 4O3SA 3PRVA 3LP2B 2FD2A 4LRAA 4DZ6A 1GTHA 1TVRA 2VQEJ 2JZ5A 5GAHI 2HHTA 1HMVB 4NA1A 1VDHA 4O0NA 5T41A 1MMDA 3MM5A 4CO4A 4XAKA 3GB0A 1VQNS 2LFVA 2YH0A 2M2BA 1UPMB 4E8UA 5B0GA 3NWGA 4MK7A 4JUZA 1CQNA 2AYGA 3H4BA 2E9RX 4KAIA 5KT6A 1AZSA 4OL8A 3UQSA 1X4GA 3LGNA 4IKAA 4Y2AA 4O4GA 1TVRB 3MHYA 4QR2A 3NAIA 3VZIA 4DPOA 2W9BA 1N34F 2HLTA 1YZ7A 2DEJA 3MAAA 4HVZA 1L3VA 1EQMA 4OI4A 4CO1A 4EZ9A 2CQCA 1YJVA 2RKIA 4L76A 2XY6A 1SQFA 4FYYB 5L9NA 2QFIA 3PW5A 1NK0A 1TU0B 1ZZNA 1NAQA 3CD7A 1HNIB 2YWFA 4K5RA 3TAQA 1NU4A 1TUWA 1X9MA 1NPKA 2ZH3A 4PAAA 3PYGA 1WDDA 1OY6A 3I5CA 1ELOA 4IYQA 2DR6A 4ZPCA 1Q78A 2NZ4A 1F5CA 1HNVB 1N36J 4Y2IA 3IA0A 2XMWA 1I3OB 2RIJA 2D9OA 3M2VA 1S5ZA 1WHYA 1H2TZ 3FGVA 3HHLB 3QPIA 2C2OB 5KFOA 3HK2A 1ULRA 2B4PA 2HHSA 2LECA 2HNDB 1S7IA 5C24B 4ZJLA 2GAHC 4K2JA 2B43A 2FVRA 1PIEA 4FBTA 5J1NA 3MURP 1PILA 3LALA 5ETPA 4ZJOA 1HBMB 1MW7A 1TL5A 2W2OP 3M32B 3KUGA 4K5SA 4WBFA 5K9FA 1RI7A 1RACB 4DFPA 4RW6A 1FWPA 2UVRA 4HR2A 3C2PA 1V5VA 3QAUA 3EZUA 5FDLA 3O6QA 4RU9A 2ZH4A 2UXCJ 4ZPTR 4DI6A 2GCFA 2MPUA 1SL2A 4QOTA 3QLHB 5EWFA 2FHKA 4CLUA 4I6YA 3QRPA 2F4VJ 3LA0A 1WC0A 1RHRB 4UOCA 2KRRA 2CPJA 5E3CA 2JRSA 3IXQA 1Q16B 1Q0NA 4BC7A 1FXDA 4DS5A 1S0OA 1VQKS 1Y4ZB 3D3BJ 2DGUA 2ZBPA 4ZVPB 1R0CB 2MQOA 3T1AA 2BJ8A 3PTWA 3ISND 1IBCB 1MN9A 2L9NA 2R7XA 5DGBA 4J9VA 5KFTA 2VQFF 4E0DA 4H4OB 2Z58B 4ERDA 4C97A 3FUYA 4FXVA 3GYNA 4I2PA 5J2MB 4KV8A 3MM9A 3OPKA 2QC3A 2F4FA 2P9EA 1YBUA 3QIDA 2AX1A 4M5MA 2BM1A 1EKRA 3NLCA 3F73A 3ITHA 3LWMA 4P72A 1JJ4A 2Z30B 2I5JA 2LA4A 4M5LA 3NCQA 3F44A 4OJHA 5LSLA 4W90B 1R8BA 2J0XA 2FJDB 4FF3A 1S1XB 2ASJA 1VHFA 3DLEB 4HDHA 2KJWA 4MAKA 3CJRA 3LAKA 1VS3A 1M5HA 2C3UA 3DLKA 2JX2A 4EBDA 1RT5B 2C3MA 2DNQA 3DNCA 3DOLB 4P52A 5HANA 3D3CJ 4HEA9 1X31C 5JMNA 1JJHA 2Z0GA 3SV3A 1YBAA 2HBRB 1WEXA 3KLFB 4GRSA 5DQGA 4HACA 4NLUA 2V4QA 4PG4A 4CYUA 4JV2A 4WXOA 3NWRA 1PYTA 1NZAA 2I8EA 1XR6A 3CCRS 2GHPA 1PBAA 4U6PA 1N6QA 1BMQB 4Z7CA 2HSEB 3PRBA 1KDNA 1JX4A 3CCVS 3PR5B 1TFWA 3QIPB 3KNGA 4QCLA 1S1TB 1NCLA 1IKXA 1YBTA 2E7VA 3CD0A 5LSOA 2IPOB 5IXUA 4OLOA 1NJZA 4LR7A 1U0SA 2IRYA 2ROPA 5AXNA 1U1OA 2W2NP 1FKOA 4DWIA 1QAIA 2BJEA 3K58A 1IBKJ 3FMWA 5GAHU 4YR3A 3MPUB 1CPZA 4JI0J 3SFUA 3UCGA 1KLMA 1OSCA 2C2ZB 2AZ1A 3GJSB 4F0MA 4PG8A 1HWUA 4Q5VA 1NJIT 3O44A 3IBCB 1HBOA 2R4FA 4HI2A 3GWCA 3DLKB 1RAAB 2I9SA 1VQLS 4KPCA 4TVAB 5JVGQ 3BGRB 3M2UA 3E51A 4LRDA 4DPYA 1SJRA 1DTTA 4F50A 5DDOC 1I5OB 3W7BA 3RTVA 5J2QA 5LM7E 2KRBA 2JLEA 1RTZA 1TUGB 1AB8A 1Z1ZA 2LYVA 4OX8A 3R7SB 2C3PA 3RB6A 1VBZA 4JI1J 3QGPA 5L39A 2YWHA 2KZMA 2DNYA 2IFXA 2E7WA 4IO1A 1U49A 1Q7YT 3IM9A 2ZC3A 2CA9A 3BN7A 2YQ0A 3D66A 3MOZA 3THPA 4DV4J 1ZBTA 3EXCX 3TUPA 1NO8A 1PYOB 4ZHRA 1ZTTA 2RDDA 4WU2A 2VQFJ 2A0FB 4LBHA 3Q86A 4QPTA 2QL7B 3O1LA 4NYPA 5D6GA 1HL6A 3IG1A 3CXCR 4EO8A 2CRLA 2XZWA 4NEYA 2C1EB 3DOLA 4NA2A 5KG5A 4RW4B 3FCWA 4ECWA 1FXRA 5B0EA 1S0MA 3GSIA 5LXRA 3T5KA 2HHHF 3P3DA 1IJFB 2KYXA 2LQJA 2MJNA 1ZPVA 2E66A 4UUWA 3T6JA 5HJYA 5KTQA 3J80Y 1MWZA 1DJ0A 3HHEA 4TLQA 1FTRA 1X4FA 3BGLA 2E1PA 4B02A 1CJVA 5HP1B 4CH1A 1Q81T 2WBRA 4JYAF 3BBBA 3LGHA 3PY8A 1FT8A 1IVZA 2XYGB 2JNJA 5B0DA 1UP1A 2GGPA 2YPZA 1HLWA 5B08A 1G7CB 4ITSA 3G8SA 4AD6A 2XSFA 3B6BA 3TAPA 2FPHX 3M2VB 4RO0A 1RBAA 3T9ZA 3UPFA 1JLCA 1GXLA 4P2FA 4Q44A 4FF2A 4DCJB 3JYTB 2MZ1A 4ANCA 4V19X 3H59A 5CYQB 2Q66A 3I5AA 5I3UB 3LGMA 2MGZA 2UVVA 2GO8A 5KG0A 2AJ2A 2FVCA 2QL5B 3QLHA 1CQMA 1VRTA 3T1HF 2EBGA 3X1LB 4NRUA 2KT5A 5FDLB 5EGYA 1GMWA 4O4GB 2W9BB 1EQ0A 3BR9A 1YHQS 3D9BA 4TNOA 3QZ7A 2IBKA 1TKDA 3RAMA 4F26A 4JI5J 4LFAJ 1F1BB 3DLGB 5F8NA 1Y5IB 2MZRA 4KE5A 2HG4A 3NBPB 1T3NA 2GMJA 5HATA 4EBEA 2M52A 4K4ZA 2PN6A 2QE5A 3EUNA 1KVJA 1LK5A 4PWUA 1J27A 2JWNA 4NLDA 2OPPA 2N4DA 1FE4A 1RQ0A 1TV6B 3I96A 2L08A 3PACA 3QT6A 5E7OB 1GXTA 3ADAC 3BZQA 1LWEB 2QLXA 4NYZA 1MMNA 1NK5A 1BXNA 2G0JA 1HNIA 3L9ZA 1VQ5S 4FF1A 2ZUAA 4OJ1A 4PXEA 2HBZB 3HPOA 2XBPA 9ATCB 3VVUA 2QFJA 2BVZA 5MAOA 1T3OA 4OZ0A 4M94A 3RW7A 1MU2B 1QVGR 3L4BC 5K5MA 3MF5A 1TL7A 5DDPC 4LFCF 2HGNA 1LWFA 1WF1A 4ALZA 3F41A 4YP3A 2F9DA 1RHKB 1M1HA 4B3OA 2PO4A 1VI7A 4IQXA 3WQPA 3MM6B 1S59A 3OD2A 3VV2B 4UZBA 2XGPA 1JLEA 4P2MA 3G6XA 4USWA 5LXYA 5KOWA 4ECXA 3MMJA 2DNKA 1P1TA 1YJRA 1MN7A 2MKSA 2XMMA 2JVRA 4I4BA 4DFKA 4U8YA 4O4RA 4QR0A 5L1JA 4WFYA 4LR8A 1VQYA 2VOPA 2ZNZA 5IM0A 3KLIA 3KK3B 1NPPA 2DGOA 3D1QA 1SQGA 2L9WA 2GZOA 3FBFA 3OR1A 1HI8A 1RE1B 3SQGB 5DG8A 5EUHA 2HRUA 2JFDA 4QQBA 2N7YA 2BE7D 3NP5A 4X66F 1EETA 4HT7A 4NLTA 3UR0A 1TL3B 3CCZA 5LMUJ 2BQUA 2V4JB 3K57A 4CO0A 5H9FJ 3L7PA 3SQGA 3GIJA 5F0WA 4I7FA 2J6SA 5GVQA 1HW8A 2QG9B 3Q8VA 4R0EA 1L5UA 5KFHA 5D4PA 1XWLA 3KWMA 2WONA 2WSCC 2B7CB 2XMKA 1S48A 1U2RA 1UL3A 1KLNA 3DM2B 1RKIA 3PO4A 4NASA 2UXBJ 4CRJA 4NEZA 2ACYA 1C0TA 5L46A 3M1VA 4UOHA 4PQUA 2CDQA 3OVBA 4F04B 1VISA 1DY3A 2VFTA 2YKOA 6FD1A 2UUCF 2XYHB 2Y8WA 5IWAJ 3VAHA 1JB0C 2C42A 1JLCB 4ZS6A 2J9DA 3IBFB 4NRTA 3UN2A 5F3ZA 1HWIA 4ZPWR 1NKBA 3AA8A 2R42A 2QV6A 3HT3A 4ECSA 2FVSA 1SQEA 2CNKB 3J80U 3NMRA 1LEOA 3QRRA 4JP8A 1S9GA 1RP5A 4ZP8A 4DG1B 3GR0A 2BJ9A 2VD3A 3Q24A 5HMZA 4ECTA 2ZHAA 4DV6F 3UD4P 2XY5A 3Q22A 5ETMA 2R8JA 1WTFA 4K4WA 5C42B 4UY8T 2J0WA 2J9DE 3RU0A 1S4EA 4AE5A 5KFSA 5HROA 3ISNC 1B0TA 3BSAA 4Y65A 1RWOB 3GU0A 3M7VA 4NLWA 2Y8YA 2OI2A 2CWKA 1ZOTA 4GO5X 3WBZA 3W5YA 1VFJA 2UZAA 5BYQA 3TZWA 1JLEB 3UCZP 2J6TA 3KLGB 3BB5A 2BOAA 2BRKA 3AJ2A 3I82A 2FVPA 3R1HA 1G3OA 1KNZA 2CPHA 3DN9A 2VG7B 2EEYA 4D3GA 1HQUA 1P6TA 2W01A 4KHMA 2R8KA 3MECB 2JEJA 2DNNA 1MU2A 2IM0A 1FDBA 4B17A 1U1NA 4LF1A 3PIPQ 1SJQA 3LF0A 4M5IA 2VC0A 2OHDA 2KM8C 1IKVA 4RW7A 4PYAA 4ZA1A 1HD0A 1F9FA 1HR0F 5CYQA 2K1RA 4A4JA 2BX6A 2YNIB 2CQBA 2WK4A 3I4HX 1WEYA 2YNFB 2HGLA 1LXJA 5EN1A 1FRXA 4URSA 3W9HA 1RBLA 3DRSB 3QT7A 4DPWA 2PI5A 4JV0A 1QVFR 1J5EJ 2OPPB 5E5NA 3ZFVA 4P2XA 3H40A 2X1BA 2DIVA 3DOMA 4LT6A 3G8QA 3RAQA 4CCHA 4X62J 3CCQS 3QO9A 2HVIA 2DNMA 2ATLA 1RT3A 4ID5B 2WSFC 3EGWB 5AJ3F 4C9DA 4A48A 3DLGA 2A18A 2IBOA 2FYXA 4WFAQ 2XGQA 1B0VA 1C4CA 2JLFA 3HKWA 4ER8A 1EHWA 2IMWP 4P7VA 3KK1A 4NLGA 2FIUA 4QW9A 1VIXA 2FLOA 3TJAA 2AEFA 4YDXA 5G0RA 2FGCA 1IM4A 1PYSB 3GYXB 5KAKA 3DC2A 4DR4F 5IOLA 5D0RA 5LJ5Y 3GV8B 1GAOA 3G71S 2HLUA 4TQRA 2C22A 4X4VA 4KQZA 4HI1A 5K8PA 2G0CA 3NGKA 3J7A1 1B3TA 2V94A 3CCWA 3BGUA 2VBWA 3OXGA 4JI4J 3AD7C 3FZ2A 5HN0A 1RLCL 2QLJB 2Z2YB 2CNOB 4NZ0A 4DL7A 2B8QA 2R2TA 2DGTA 3PV8A 1XNQF 2D3ZA 5HAOA 3MR5A 5I42B 2Y9HA 5A8KB 1XMBA 4LFBJ 2QA1A 2DGXA 3H42A 5FJ4A 3MR3A 1FJGF 1HW9A 3MPWA 4QWAA 2NXCA 1SI9A 3TYTA 2DH8A 3KHGA 4GC6A 4DFMA 3AB4B 4DLEA 2YWKA 3G82A 1X4EA 4K7QA 2RNEA 3AJ1A 1S6OA 3NNAA 2R7WA 5F9NA 3ICLA 1EB0A 4Y34A 2H3EB 1F5AA 3QFWA 3CEDA 2XSJA 3IR7B 3BPSP 5IZHA 1S1VB 3MEGB 4MK9A 3G96A 4KR0B 1SL1A 2L41A 3D0IE 3QJPA 2VG5A 1NH7A 3ZZUA 2XS5A 4FKYA 3B4MA 3I32A 3TW0A 5A8KA 2V4RA 2BKOA 3IGVA 2K2PA 4NLVA 2JEFA 5C25A 4ED8A 2BBEA 4WIIA 3O8WA 5LJ3Y 4OX9F 2QGFB 1T11A 1UCNA 3PJXA 1WF2A 2P5VA 5I3PA 5GMKa 2VZ9A 5DJBA 1RUSA 1X4BA 3VGTA 4XPCA 4QR1A 2Q6CA 3TEGA 2ZH5A 4WE1A 3FBCA 1FRLA 3HVTB 2VG6A 2BZ2A 4M5DA 3AB2B 1OJ4A 3DXBA 1DQAA 5DDRC 4M95A 2JC1A 1L3UA 2YX1A 1RT4A 4HH1A 3WC2A 1KVIA 4X64F 5L8RC 5CD4A 3BQ1A 2J0QD 1M5KC 1O6XA 3H5XA 1EAYC 3LPEA 2WOMA 3MMCA 1RYRA 3Q83A 3T6BA 2NYHA 2LEAA 4LREA 1UFLA 1RWPB 1UPPA 3QAEA 4X4QA 3N5FA 2F3JA 1VMBA 2GVDA 2HFNA 2ZEJA 3QQCD 4JI6F 3MPDA 3NS5A 3W9IA 5KFDA 2RUSA 3LP1B 2MKHA 4ZVHA 1D9DA 1QE1A 2ERRA 2P9CA 2OO4A 1RT5A 2RE1A 2WW8A 3D6TB 2VFSA 3MM7B 1FTCA 1S6QA 3E01B 4R5PB 4ED0A 1GK8A 2HQFA 3IM8A 4Q0BA 4LF8J 1APSA 1I6JA 4QIGA 3ZZZA 3JTNA 2CJQA 3OT9A 1JLFB 3CDEA 4Q2LA 4DUYF 2I5JB 2K3IA 4FXDA 2CQ4A 2C2RA 4RNOA 1PJ7A 3BKFA 4BWJA 2YTCA 4KV8B 1U25A 3MM9B 2H5IB 3PW0A 3OHBA 1S1TA 1LK7A 1XR5A 3HD1A 2FHOB 4L75A 2YQ1A 1AZSB 1RISA 1KSPA 4NCAA 3QFHA 4DV0F 2XEXA 1JJ2R 1IKVB 4RW7B 4YN3B 4ZPVR 3SSQA 4N56A 3L7UA 1LFPA 3NCPA 3KK2B 3D6FB 3M6XA 2DB1A 3MTKA 4N5SA 1P9YA 2IIHA 5B09A 1JXLA 5KG4A 3VAFA 1O51A 1NJYA 1YDLA 3I87A 3PG9A 4Z7YA 4BDPA 3MECA 2W9CB 3LAMA 1K0TA 1X5TA 1XR7A 3DRXA 5B0FA 4YB1P 3OFGA 3N6MA 2WVBA 2EG1A 1FD2A 3IFEA 3T1YJ 2DHHA 2PGCA 1DURA 1Z2LA 2L9DA 5DG7A 1EJ7L 5E33A 1RU1A 4DL6A 2Y1IA 4ZVTB 3T1YF 4ZKAA 1RT6A 3DRRA 3BF4A 4C3KA 3BBFA 4Q7AA 4B3SF 1BC6A 2CQDA 3CTRA 3KKFA 4O23A 3MPYA 4P2SA 5KFJA 3M6VA 1RTJA 4N77A 4YB6A 2XC9A 1U48A 1HQ2A 2GMHA 2HHVA 2AYEA 1F6TA 4OI2A 1HNZF 3JTPA 2XO6A 3VVTA 2D3OR 2OFHX 2WHOA 2MHNA 2RQCA 1OY8A 1FNMA 1NDKA 2FJEB 2MZSA 2LLZA 2V8PA 2LQ8A 2X1GA 4MIBA 4USKA 3W9JA 3GIKA 1VGYA 3CF5Q 3FEZA 1XNRF 2HWTA 3VGUA 1A7GE 1B4SA 1WF0A 2A6MA 5KFWA 4WF9Q 4RUCA 1T9WA 4G1PA 3U1NA 1XTZA 5C7PA 2FZGB 5LMNJ 3MGJA 2CPDA 4PQAA 4DUYJ 4NLYA 1WTBA 2BA9A 2YKMB 4DQQA 2E1CA 4JI2J 5L1IA 1U0HA 3DLHA 2B5JB 1N48A 1HI1A 4BC9A 3VTIA 3HXMA 1N4LA 5A8RA 1CULA 2ZWPA 4AL7A 5KG6A 2RU3A 2E5HA 2OTLS 4Q43A 5K8MA 1S49A 2HHPA 4KKOB 2RILA 3FFIA 1FE0A 1HBNB 3SV4A 1JLGA 1QLNA 2KM8B 3G87A 1RWUA 4M8LA 3B78A 4JI8F 1NPRA 1YJ7A 4LF6F 3W3SA 1MLAA 4F2SA 1KR4A 2HS4A 1RSCA 1RADB 3S01A 1IQTA 3CIZA 4X64J 4OZ2A 5M2UA 3KOAA 2G1DA 1RTJB 3VQTA 1TL3A 2OLWA 1U1MA 2XY7A 2QMUB 4KO0B 2RMLA 4I56A 4IR9A 1Q95G 2OAUA 4WYLA 3DKDA 1HYSB 3OTEA 5BR8F 4IO9Q 5LL6d 5HQ8A 3J81Y 1HI0P 1TK8A 1KP6A 1OQ3A 1U0HB 2HS3A 2VFRA 3BS9A 1H2VZ 2H51B 4UF4A 3CCSS 1S77D 1URNA 2W7PA 3ET6B 2NXEA 1QJHA 1V9OA 5EHHA 1BQMB 1UFWA 3DRPB 1LW0B 2M5YA 2Y1RI 1RWXB 3H90A 2I0XA 1NKCA 2O01C 4G1QB 2FVQA 1RA7A 1EZZB 1VQPS 1Q5VA 4KKOA 1GXUA 3M9OB 1OWXA 2PA3A 5EX0A 2HNYB 1UEUA 1W7WA 2KXHA 5JUMA 3IN5A 4DV2F 4QU6A 1XQIA 3E3XA 1T03A 4JOUA 2FC9A 1BQMA 2FDNA 4CLTA 3PIOQ 2F40A 1R7IA 1FJGJ 3EGZA 3DI6A 3FCVA 5GAGI 1U6FA 1JQGA 4DR3J 1NM2A 4LUBA 2EFVA 4S0MA 2UUBJ 1RT7B 3R2DJ 4LFBF 1RT6B 3OL8A 1FXLA 3T9NA 1TZ0A 1U26A 1U09A 4C3LA 4Y0FA 4DJBA 2ZH2A 4Q0BB 2UU9J 4RW8B 4DQRA 3D1OA 2XULA 2ZH9A 4URGA 1T9VA 3HSDA 1VQSA 2R7OA 3T5JA 4DL0C 1ZA1B 2HQGA 3DGVA 5D77A 4O3QA 4NI2B 4J91A 2VFUA 2ROEA 3QMQA 3RG6A 2MQNA 3JSMA 3MMBA 4ZVGA 4M5NA 5KFPA 1S10A 2A10A 2QT7A 4DLGA 3R5CA 3R7NB 3I31A 3NBPA 5F9LA 1LWXA 1JLGB 2GQQA 5F8GA 5EWEA 2OGUA 4Y00A 2HAFA 3W62A 3LPYA 5KFGA 4ELUA 2BKNA 2E5GA 2G4BA 3FZBA 1U8SA 5HI7A 3AQOA 3TVYA 2C2EA 2AJFE 3LO3A 2ZVSA 3QJLA 3F56A 5DQHA 1NSPA 4B08A 2VJUA 3Q8UA 2UXDJ 2YKMA 1NK9A 2GHWA 4DR3F 1VQ8S 2UUTA 1PGZA 2GA7A 1F60B 5F3TA 4ETXA 1RT1B 4ED5A 1SCJB 2E29A 4ECQA 1WOSA 1CC7A 2LQBA 1LQ9A 3TNVA 4DX7A 4B3MF 1NHKL 2J76E 2LCWA 2GV1A 4FNHA 1IUJA 3MEGA 2WW4A 1BUXA 1GMWD 3MZIA 2UUWA 3EVWA 2V63A 1TL1B 3Q89A 5D0HA 4OZJA 2XZDB 2R8HA 1L3KA 1CG2A 1HFEL 5L38A 4CLKA 2HK3A 2CZ9A 2M8HA 3PKYA 3PX4A 3MDFA 2CZ4A 5E3PA 4C0BA 2C2KB 2FTRA 4OYMA 3FQKA 1D9FA 3ZZTA 2YWWA 4MYUA 3MXHP 3H4DA 4DDFA 2APOA 5FLXY 5JVHQ 4DL4A 1ZM4A 1V3ZA 3KG0A 4OI1A 1Q5YA 3P5BP 3PEHA 2XS7A 1LFWA 2HBYB 5CZXA 3L09A 2B4UA 4L6V3 1S76D 1BQNA 1RT2A 2XMUA 5BR8J 3K5MA 1FK9B 1A0OB 2FY1A 2JVOA 4H4MB 1WG4A 5DLGA 3K5PA 3HHNB 2GVDB 4USUA 4MJKA 2ASDA 2PFFB 2EFPA 2SXLA 5FD1A 5B0AA 1SUQB 3M30B 3VALA 3NMAA 1O0PA 4H4KA 2PMZD 3I0SB 2XMVA 3R5JB 1EARA 4L74A 4WIQA 2XSJB 3MFHA 2IAJA 1H73A 4ZVRB 2AHOB 5KT5A 1S72S 4P75A 1R8PA 5G0RB 4ILRA 3JAMY 2BDPA 3DHWC 4USJC 1L3TA 1NKEA 4J9MA 1XMQJ 5J1EB 2O5DA 3W8GA 5ADZA 2KFYA 1TAQA 2HBQB 5AXKA 4U7UK 2OEKA 4ZIVA 2G2OA 2QEXS 4LQ3A 4K4SA 5JXSA 2HFSA 3CMQA 4K4YA 1NDPA 5LMNF 1WI8A 1CSJA 5AXLA 4A46A 1REVB 1U1KA 4FF4A 5E2QA 2EG2A 4R5PA 3VAMA 2J9EA 3JTOA 4NZ6A 3CJSA 1XNRJ 3IR6B 1SKRA 4P9SA 1M5VC 4B9NA 1JLBA 2VKZG 1K73T 2OPRA 5J2PA 2H4YB 3M05A 4HH0A 5B7WA 1YJUA 3KG1A 2QMWA 3TUIC 2CNNB 4OYPA 4XO0A 2IAJB 3T41A 3MMCB 4N8NA 2JLGA 2B56A 1PKUA 2RRNA 4X4NA 2PE8A 1CLFA 1TUVA 1GX6A 2Z4PA 4ICLA 1OPZA 2BANA 1RT4B 1YWXA 2MTLA 1C4AA 2QSWA 2W7AA 4XDCA 2N82B 1X0FA 1NNDA 1BWEA 3MMAB 1IKXB 2ZHOA 2QX0A 2VG6B 1RDRA 4OZ1A 3P49B 3T3FA 1IBLF 4JI7F 3QIPA 2IA0A 3EGNA 1RAGB 2IJRA 3PHEA 4AUKA 1YJTA 2CVEA 2M4MA 2RRAA 1B7YB 3EVMA 2CJKA 3MTJA 4OYWA 4EEYA 1SIZA 2YY3A 4DBQA 3OUYB 2ZBIA 1VLYA 5SZTA 4QU7A 2M7SA 4PCQA 1HHQA 1UWAA 3DCAA 3Q8PB 4YY3F 5HLFB 2YH1A 4F02A 4WU3A 5DLFA 2D3UA 1RGVA 4A8XA 2QTWA 3AAWB 1RAEB 3GE9A 1N56A 3RW6A 4M5JA 1FFGB 4OYAA 1A9NB 1WG1A 3A3PB 2DRBA 2DNHA 3LWLA 1IJEB 5G4DA 3FQLA 3SDEA 4C8ZA 2ZOMA 1GNKA 1DTQB 2F7VA 3HSZA 4ENOA 1UMJA 2VICA 3HT0A 1YITS 3VGVA 2MJUA 3R6GB 3SZ2A 2MY7A 3M2RA 4LVNP 1KS2A 4G6VB 3HVAA 4TY9A 2NXJA 4KFBA 1RWMB 4EMDA 3I9V9 4ED3A 1PBUA 2XYPB 2RF2B 1HQUB 2V68A 2Y0SD 2ZNYA 1NHVA 2CZVC 1WC4A 4LF8F 1UZDA 5IT9U 1S12A 5EDWA 1AW0A 2ZD1A 2YXLA 1GX5A 1QTMA 4UZCA 2QRRA 4GVBB 3ULHA 4ED4A 2IJFA 4JV1A 4WYWA 2OD6A 4PEOA 3FBBA 3RBXA 2FGOA 3AA9A 1DBDA 5D3GA 3KNAA 1URRA 4DV3J 1RHJB 1X4AA 3I9ZA 3AOCA 3EM1A 1TKTA 1Y0HA 4LIWA 4NLQA 1GH8A 1BGXT 1VK8A 4WTOB 1U4BA 3FK4A 3KK1B 3OSPA 5C42A 1K8AT 3W63A 1NH8A 3EYZA 1OYDA 1ITPA 1JIHA 1RA6A 4PUOA 3UDCA 1VQMS 3C3LA 5K14B 3HJFA 1GMVA 2D7SA 2CQ2A 3K17A 2P6SA 1PSDA 1C1CA 2HVZA 4CM2A 3SBMA 4OX9J 5C24A 2H5EA 1FERA 2GVZB 3A8EA 1RXOB 2C3YA 1WC1A 3FSYA 3KLIB 3KK3A 2M9KA 2NSBA 2BEFA 2VU5A 1FRJA 2VPWB 1U45A 2XMAA 5THWA 1M5SA 3R5BA 5CH7B 2XS2A 4F8RA 1ACMB 1JNRB 1VJWA 3CC4S 4B3RJ 2C2NA 4J7CA 3UNGC 2W2QP 4PQUB 2XHWA 1QM9A 4R8UB 3TAMA 4ECZA 3ZTOA 3CMES 3KMQA 4RL1A 3VWSA 1IQZA 2IRUA 4OYOA 4USIA 2W7OA 3U27A 2DR9A 2RB7A 2QO3A 3O5TB 1SJ3P 2KXNB 2D74B 1NLKL 2L3MA 4CNZA 1QTNB 4J9SA 3OL9A 2HHUA 3KUEA 3MAAB 3CVKA 1M1GA 1ZAWA 2BJ3A 2W4DA 4DUZJ 3GR1A 3WZ0A 3V6KA 1FKPA 2GJIA 4KGMA 2VPXB 1TL7B 5AE2A 3C15B 1KRPA 3DDNA 1JJCB 1AROP 4QYZJ 2Z8QA 2OELA 2DNGA 3HHKA 3UNYA 1J2VA 5DRKA 2IVYA 2IYGA 2DISA 4PXDA 5D0GA 2MB0B 1S6PB 5KFQA 4P74A 1X5PA 5HK4A 3W66A 4ZN1A 4J9NA 2E9TA 3BDPA 3RAXA 5K20B 1IKWA 2HHHJ 3CJKB 4B9TA 1CJUB 2HFVA 1KOOA 2DR5A 3T5LA 5HROB 4ZDNA 3BYPA 3D67A 1TFYA 2MKCA 2GIRA 4RNHA 3PYEA 4ED6A 4C3MA 2MKKA 3TANA 2EFOA 1CJUA 2V8VA 3NRBA 4DR4J 1JLAB 3GFYA 3NY0A 4RBVA 4Y2MA 3RUBL 4PWWA 4QYZK 4ZPDA 1C1CB 3GTYX 3W8PA 3BSNA 3NG8A 5HJXA 2OH2A 4MKVA 4K4TA 1EETB 5HSPA 3CC7S 2V0NA 2CQGA 1X5SA 2AKWB 3KJNB 1FKPB 4CLFA 2AEJA 1SVDA 1IR1A 4X62F 2V2KA 2BQ3A 1IXKA 1CS4B 1SIWB 4ZVQB 1WI6A 3DLJA 5T7LB 2AD9A 2P8IA 4W92B 1D9AA 3A3OB 3W61A 3K59A 5D3GB 4DX8H 2CQ1A 5LT5A 2R2RA 1C0TB 5I3UA 1Q8BA 4IDKA 3A1YG 3EDRB 3N4WA 4WJBA 2MGZB 3C16A 3KJVB 1CC8A 2KYZA 4F4KA 2MLZA 2DIUA 2MQ8A 1U24A 5AXMA 1RKJA 3AHPA 4OLPA 3PVXA 3MCSA 1LWFB 2Y3YA 3MEEB 2UUAF 2HZVA 5MLCV 5EX3A 3A12A 3GJQB 4ZVSB 1P9QC 2GVZA 4I6WA 3V2UC 3AY0A 4AYBD 3OLAA 4GKKF 4IG0B 4DL3A 3RB3A 3S7RA 3ENWA 3EVOA 2WSEC 4YFUA 1YSJA 5HP1A 2LXFA 3M8QA 3JS9A 2MQQA 3JAMU 3HSJA 3P45B 1TR0A 1KHWA 4B9SA 2AV5A 1S4FA 2GO9A 3MPVA 4LF4F 3HKZD 4J5OA 4DN0A 3C14B 1SC1B 1Y5NB 3BSCA 1CEZA 4FDFA 4HTJA 2DYAA 2JEGA 4FBUA 3ZXWA 1SKSA 1SC6A 2KKHA 2R7SA 4QW8A 2OPQB 5KFBA 1WG5A 2W9CA 4WK3A 1N88A 4OJGA 1M5OC 5D0EA 5A6WA 5F8IA 5KG7A 3WIUA 1T95A 5IC4B 2R7RA 4USHA 3FDSA 3MM6A 5HO4A 4MFBA 3WHIA 1PCAA 4V1Ak 2Q3PA 2KG0A 2IA6A 2DGWA 2XNQA 3R2CJ 5DO2A 3NNCA 1B64A 3N6NA 4H4KC 1LNQA 2E1AA 3C15A 4CT9A 3CCES 1H98A 2PSZA 1X9SA 2F65A 3LUYA 2MLYA 1JLQB 2NUHA 4NWBA 3FNNA 2R7QA 3CT9A 4DQIA 2HHWA 4NZ7A 3IRXA 3AODA 2UUCJ 4DSEA 4L3NA 2EW9A 3D68A 1Y00A 1PC4A 4X4OA 4GC7A 2PIIA 1N33F 1SH3A 2QYCA 1S6QB 2V8GA 2W2MP 2XWXA 3CJ3A 8RUCA 4JI3J 2HNZB 1HNWF 1D3WA 5HLFA 4G1IA 3IG1B 3BM7A 3DU6A 2IC3B 3Q8QB 4LVOP 2ZE2A 2YNHB 2GC8A 2F4VF 5KFNA 2E44A 4M5GA 4YR0A 2CQPA 5K14A 2VBXA 4AL5A 2EXUA 3RR8A 2OKQA 3OBIA 1SJ1A 4AFFA 4DUTA 1DFDA 3G2XA 2M70A 4FNIA 4OHVA 2BYCA 1U2CA 1FA0A 3OXFA 3RJMB 3TX8A 3OTOF 1YI2S 4KHPJ 3TUZC 3N9UC 4M5DB 1O5JA 2HVHA 3IS9B 1Y10A 2GIQA 2ZOGA 3AJDA 4ES2A 1KTVA 2HGMA 4OQJA 2YX7A 3GV5B 3V81A 2Z56B 4HTIA 1UFKA 3CDAA 4U95A 3C6UB 1S97A 1RWVB 2RDJA 1NDLA 1RBOB 3JQJA 2PEHA 3PNIA 4MT1A 2ZH8A 4PYDA 3NKYA 5BYRA 2LU1A 3AXKA 4F0KA 4LBPA 4CYUB 4ZOSA 1AUDA 4PZVA 3AOAA 5HL7Q 1XBWA 3PM9A 1EP4B 1J5OA 2KHDA 3GLJA 3SQOP 2A3JA 1JLBB 1XJWB 4UUXA 1HKAA 3EGVA 3CJ0A 2KXFA 1VQ6S 1VC0A 1WDTA 4KY3A 4EYHB 2WVFA 3Q2SC 4OZ5A 1DLOA 1Q53A 3AD9C 3CB4A 3OLBA 2GGPB 4QWBA 1REVA 1R8AA 2N7CA 3A8JA 1JXVA 4W98A 1WUUA 3N0VA 3D5MA 1SL0A 3ENQA 4FYDA 3BEGB 4WK1A 4XIUA 1N34J 2G13A 4K59A 3Q8RB 3IWNC 4L72B 7FD1A 3RYLA 4CLYA 4HT5A 3DRYA 2ZZNA 1DLOB 4DV1F 4ED1A 5KFCA 4U9RA 1Q8KA 5DM7Q 1M90T 4LR9A 3TQEA 2B4OA 1P1LA 2YX4A 4HL9A 4MKYA 1RAHB 5CCMA 4WTYA 1XMQF 2R2UA 1T8EA 1EP4A 1J5OB 2CJAA 2VA2A 1N0VC 3BQ2A 1KLMB 4MMOA 2G1HA 1CJKA 4C8NA 3ZZOA 5H9EJ 5HMXA 3OUYA 4H54A 1OPIA 4C8LA 3GIRA 2HRYA 3M9MB 4RBTA 1K9MT 6AT1B 1XN9A 1Y3JA 2FJXA 3G9CA 3N6LA 1FK9A 1TMJA 3D1HA 1PAUB 3HDSA 2UV8G 2OSQA 4OI3A 2DR8A 2OFGX 4JI5F 5E3AA 3QSYB 3OW2R 5D8HB 2O67A 4P10A 5ETTA 3S6EA 2MLXA 1HARA 3SCKE 5GAGU 4ICLB 4URQU 3D6MB 2AYMA 3T1HJ 1XC9A 1MWQA 3ITHB 3HHDA 4OMFG 4AL6A 1RT3B 4ID5A 3D0HE 4HACB 3GONA 2VDHA 4TY8B 4TU7A 3A4TA 3NAHA 4KH1B 2OPRB 2FJBB 1ZA2B 4QBUA 3FMBA 3VAJA 1WD6A 4ED7A 1MG7A 3C66A 1Q8IA 4UW2A 1S9EA 1V3SA 5DZ7A 3MCOA 4UQGA 1U1QA 1QDUB 2ZJQQ 2YNFA 1HNVA 2KU7A 4DR6J 2D3O1 4RZRA 3HZEA 4J9PA 2D9PA 3QNWB 1ZZFA 3KXDA 3U1MA 3KTQA 2BJDA 2BJ1A 1Q8LA 4KHPF 2BM0A 2LVWA 1FJCA 3C6UA 2RKIB 1X4DA 1I1GA 2COLA 4ZLJA 1VQ9S 4R25A 5D78A 4LF5F 2B9YA 1RHQB 4PG6A 4J9OA 5H1SV 4B9VA 3GJTB 3MWBA 5E3RA 1NBEB 4X4RA 3PKMA 1WHWA 1BLUA 1N6QB 3NGDA 5E41A 2DO4A 5ITHA 3M32A 4FP9A 1TQLA 4MIAA 4JV5F 2JHEA 5GADI 4N8OA 2F63A 1VBXA 3QSIA 1N32F 1RTHA 2RU9A 3CDWA 3EE3A 4O3NA 2JOQA 1H6KX 3KLFA 1V3RA 4NLXA 2HHQA 1N33J 2HNDA 3PRDA 4HLBA 2DGQA 3BN4A 3NXZA 1M5PC 5FLXU 3RBEA 1F2GA 3THVA 1BQNB 1RT2B 1RTDA 2EK1A 2VL1A 3OSNA 1XIQA 1S1XA 3U1LA 2E5LF 2EPIA 2U2FA 3PFEA 3UFCX 4ZIWA 3D54A 5HVHA 2N4CA 1YJWS 2RQ4A 1UA1A 2ZITA 5DG9A 4RNMA 4ILMA 3OTDA 4QIWD 1S9GB 2Q6BA 2PD1A 3R8YA 4WWSA 2BQRA 4IG0A 3KDOA 1WOPA 3FRYA 3R97A 2V9WA 4KGXB 4QZVB 4BWMA 4WCEQ 1VRUB 3ZTRA 1MROA 2ZH6A 2OTJS 1QD1A 3OR2B 4XK8C 4RR5A 5CHCB 4QWDA 4I0WA 4P71A 3C16B 4FS1A 1VYAA 3JQKA 2NUUG 1GEHA 5D4NA 3W60A 4BS2A 2XI2A 3VQSA 5K8OA 3HLUA 1LW0A 1R8HA 3GFXA 4WP9A 1WHXA 4RNFA 4ZVEA 1XMOF 3TRGA 1FJ7A 1WKJA 5IS2A 5KFKA 2R2SA 1K1SA 1VC5A 3H8YA 3VAIA 2UVUA 1WHVA 4F3QA 2WVDA 3J81j 2H48B 4TXSA 1KWMA 3A3NB 2GJFA 3DGPB 3LOUA 4NA3A 4Y6IA 3W2WA 2LU2A 2HQIA 5I3QA 2F5GA 3KMSA 1YRUA 3W65A 2KVQE 2UUAJ 4F4AA 2GQ2A 1T05B 3C46A 1TP7A 2HMIB 4F7VA 4ZN3A 5ETQA 1T9TA 2IJNA 1JLAA 1H7XA 1S7HA 3MAHA 2MKIA 3CCLS 4DPTA 2DNOA 3PX6A 2BXJA 4TKTA 4MKAA 4WFBQ 1LW2A 5A0YA 1RLDA 1KFSA 1YGYA 4RW8A 1D8YA 4G3IA 1FFSB 3DRRB 3D4JA 2DNZA 5A8RB 2JSXA 3DGPA 4CLZA 1WC3A 3LQVA 1K44A 4OI6A 1UJ5A 2HVEA 2XB2D 2KH9A 2BJ7A 3I0RB 3T19A 5T7LA 2RSQA 3IC1A 3TWZA 4DCOB 4ZK7M 3OVAA 3J7AN 2WB1D 4K0KJ 2NCKL 4K8RA 2XQCA 1FESA 2M8DB 2ZDOA 2E5LJ 4EZ6A 5K8NA 3SCJE 1YKWA 3EX7B 5HMWA 4D3HA 3CCJS 1YJNS 2DKOB 1QUPA 4Z2XA 1RTHB 1Y5LB 3AT1B 1FDDA 4JB8B 4C11A 2A1BA 4DX6A 7AT1B 3UW1A 2ZJPQ 2VHGA 1YIJS 3MM5B 3JSBA 1TKZA 2PI4A 1WJ9A 2BE9B 2IM2A 3BGFA 2BABA 1RAIB 4HHHA 3GG1A 4QIFA 2W2PP 3UN5A 1YJ9S 3QZ8A 1N32J 2QZ8A 2CPFA 1NSAA 2QLBB 2OMOA 2CFXA 1FRKA 1VBYA 3NOCA 1ZM2A 4KIAA 2MY8A 3V6DB 3KG4A 1IBMF 5GMEA 1TELA 3HI9A 1X4CA 3M8PB 1VC6A 2B0GA 4P73A 4R0JA 7FDRA 3PO5A 2DVIA 4LF5J 2UXCF 2FJAB 3BBCA 1RTIA 4ED2A 3AOBA 1HQEB 4IH7A 5HVFA 3CJQA 4DUZF 3BKUA 2DH7A 4I2QA 4LSLA 2RQKA 2W8KA 2NLWA 1S9EB 2VKRA 2W9AA 4ZCIA 1KN6A 3NGUA 1GTEA 1NK7A 4C6AA 1YX2A 4CLPA 8ATCB 3B4DA 1X4HA 1S9FA 2D41A 1NEEA 2DXEA 2O1PA 3MUVP 1FNOA 4DN9A 4EGLA 3M8RA 1HBNA 2WTFA 2FJWA 4DR2J 5BYSA 2AGQA 3OXLA 4OX7A 1UA0A 4NOHA 4ID8A 4MK8A 3EZ5A 3TAMB 4A8WA 4USTA 4OHZA 2GNKA 3Q23A 4FPRA 4WE1B 2XO7A 1RZMA 2AGOA 1QSLA 1HIYA 1KBRA 3LTOA 1AUSL 1IN0A 2CAJA 2GX8A 1IKYB 4DFJA 1AFIA 1SV5A 3MM8A 4RLEA 3FEYB 2B9XA 4ELTA 4ELVA 1RJJA 3GILA 2VOOA 2OEMA 4P6QA 4X2BA 1R27B 3KJQB 1WSVA 4IRDA 1NSKL 2VB6A 3E01A 4WP3A 4DZDA 5DM6Q 3CMAS 2POKA 3MM7A 5H9FK 4DV3F 2JC0A 1KOHA 5J2NB 3PCOB 2V2VA 2FHJA 4LRBA 4WFZA 3BYRA 3IRWP 2ZJRQ 2X1AA 1UVKA 3HJVA 1ZAVA 3NS6A 2FZKB 2GIFA 3FRZA 2RAQA 3I5BA 4XTTA 3ZZRA 2WOMB 3MEDA 2X3GA 2VQEF 5AT1B 4UY85 4DR1J 3BDEA 4DV1J 2DNPA 2J7KA 2KI2A 4Q2MA 1WSRA 1FRIA 3ZTPA 1CJTB 2B6AB 2J8AA 2H54B 2IM3A 2HS0A 3HFVA 1N5YA 1DHMA 1SH0A 2V69A 3RB0A 2MZJA 3LH2S 1R6VA 1FF2A 2DTJA 2NXNA 1OSDA 1RAOA 4NCGB 1R0AA 3TVKA 3SCIE 5B0BA 4O0IA 4B3MJ 1M0SA 2ZFHA 3BH7B 4ZP6A 1S1WB 1ZH5A 3MMAA 2EK6A 4B3RF 4O3OA 4G65A 4DSFA 3PHTA 3DOKA 1UW9A 4K2XA 4ZPBA 3MAQA 2D1CA 3KLHA 3DXSX 3UVJA 5A2QU 2CJXB 3FBEA 1C0UB 2V8HA 1UWBA 1S1UB 5HBMA 4XPEA 3I6PA 1KVKA 1JKHB 4IFYA 2IVFB 1LXNA 3H7HB 2QLFB 3GPAA 3BO4A 1WACA 3SDEB 4X65J 4I67A 1IM6A 3PR4A 2XHCA 4O44A 3TX0A 4DHVA 5L1KA 3V4IB 5CD4H 3JXOA 1H3DA 3BSOA 3GSDA 4CH0S 3T5HA 3ZTQA 4MH8A 4DCPB 4PWDB 4TYAA 2Z2ZA 3CGIA 1JLFA 2JJ4D 5F41A 3CW2C 2CNLB 1QSYA 4RPFA 3OTOJ 2I2YA 2CUYA 3QO9B 2ZBRA 2BUNA 3G4SS 3KYLA 3R3TA 4CTAA 3DOMB 5CABA 1IBLJ 2CIMA 4PWDA 1RABB 2X7IA 1RAFB 1W2IA 2YPYA 2EKNA 1LWCA 3H2LA 3NOGA 4OV6A 4OX6A 1BY9A 4ZLPA 3KHHA 4J9KA 4AXJA 1IR0A 3CWJA 3B82A 3RRKA 4EU0A 4GKJF 2B4VA 4OIXA 4KB7A 1D1UA 2QL9B 2VODA 1HNWJ 1F9EB 2QN6B 3GCWP 4IFYB 2MMYA 4ZCLA 4CM0A 4JI3F 3M8YA 4NPOA 5IC6B 5SUHA 2H65B 2LXUA 4AXIA 3G6YA 2DITA 2RT3A 3ILLA 3PXGa 2ZM6F 4O3RA 1DAXA 3K5OA 3V81B 3ZZPA 2RUGA 4CWBA 4MIWA 2AQ4A 4AQYJ 4DF8A 2XCPA 4Y2CA 3W64A 2ZZMA 3V5RA 2E1MC 3CE8A 4USMA 2HPUA 3S8SA 2MXYA 1U47A 2I38A 1S57A 3QATA 1W25A 1CVJA 1LWCB 4DU8A 4I69A 5KFYA 2K7JA 4ZJQA 5CAAA 3SIPB 3W2VA 3GIIA 2DRDA 5GAEU 3J7YI 2LP4A 2YNHA 3GFHA 3M8SA 4A8YA 3MUMP 1U2FA 3GYGA 2GQCA 4DPXA 2NZCA 1UVNA 2OPQA 2EKYA 1G4CA 3PDNA 1WC5A 2D69A 3MEDB 3H98A 2A6OA 4F4YA 2MDAA 5KG3A 2CKWA 2QJ3A 4FKXA 4KC5A 3R5DA 2AU0A 2MZQA 5KFEA 1V5IB 3B54A 8AT1B 4QWEA 2P9GA 5J2NA 3R5GA 4ZP7A 5KG1A 3LP0B 2IRXA 1C0UA 1K1QA 5HQLA 5CYMB 2QYGA 4LSNA 5GMDA 4NYOA 4OYIA 4NXMF 1SUQA 3M30A 3POTB 1FEEA 4KGKA 3SMZA 4Q8FA 2BOPA 2GS8A 3P8BB 1ZM3A 4X4TA 4J9LA 3WC0A 2J8SA 3OHAA 4F0HA 5IV4A 4YOEA 4IQMA 3OTBA 2Y0BB 1FFWB 3MFIA 1F0XA 4GKKJ 1BE4A 2GJ2A 1UJ4A 3KLGA 4DR7J 4KRWA 2R7VA 3M8ZA 5DETA 2MHEA 2YKQA 4C0HA 3HVWA 1JNZB 5KFVA 2LDIA 4PG7A 2K7KA 3M6UA 2P6TA 1RHUB 4E2FB 3UD3P 2AJ1A 4ZCKA 4IUFA 4C2MA 4F4ZA 3AQPA 2C2DA 4KH0B 5AE3A 1PG5B 1TK0A 2NR0A 2CG4A 1XK8A 4QWCA 4ECVA 2HMIA 3EJMA 2IDEA 4WZMA 2F8MA 4A8OA 2YWGA 1R43A 1Q1KA 3J7ZT 3ZZYA 2R7TA 1N5VA 4HYKA 3W2WB 1KC8T 4LF7J 5IM0B 3H5YA 3V6JA 5A6PA 3DFEA 1QAJA 1OY9A 3J7Z5 1K0VA 4CDIA 1CBKA 2HWHA 3KJVA 2QA4S 1S6UA 5ETVA 1T7PA 1T03B 2K1RB 4OZNA 3M1VB 1UZHA 1RWNB 2CJYB 2FHJD 3DDIA 3IBWA 4DMZA 2FC8A 4DV5F 2UVWA 3NGSA 3DM2A 2YKPA 3AXMA 4K4UA 2V6AA 2ZWOA 3ENVA 1Z4UA 4C11B 4NXNF 1CS4A 2QA2A 2YBVA 3AH6A 5IT0A 2NQPA 1PAEX 2FUG9 2OMLA 2WAQD 2CPIA 2B7BB 3OR2A 1LKZA 1Y3KA 4L3KA 3ZNJ1 4ZCMA 1HWJA 4OZ3A 1NK4A 2UU9F 5F8JA 2CQHA 3RZAA 4IG3B 1TL4A 2DK2A 3TA1A 4DL2A 3UN3A 5DGAA 4I2QB 4LSLB 4LF9J 1WORA 3US5A 3I0RA 2N3LA 5F8MA 4K4VA 3GP9A 1HQEA 4FXWA 1KEKA 5CYJA 2YVSA 4CT8A 1DQ8A 2HRTA 4R8UA 1E6VB 5KFFA 1OYEA 2RD5C 4KBIA 1BD6A 2O3DA 1C1BA 3SSRA 3GCXP 1RTDB 2K3KA 3BKTA 4QIVA 5KT7A 1VLOA 2HIQA 2VFVA 4OFZA 5D15A 3GQCA 1UVJA 3FKBA 3CJKA 4X4SA 2Z2MA 5RUBA 2XNRA 3K8WA 1S6PA 4F67A 2M0GB 4B9UA 2U1AA 3B8HA 1NXIA 3FFIB 1NZ8A 2XMTA 4PUOB 4G1QA 5GAEI 3J7YU 4DR5F 4I68A 4B3TJ 4I64A 1D0EA 3DRPA 2MQMA 3EZOA 3HP6A 2XZTB 2B5JA 2MZTA 1REGX 2RHQB 4A8SA 1KQGB 1X5OA 3H2UB 1FRMA 2FHMA 3L7OA 4LSZB 4M5KA 1NB7A 1BWVA 2KDOA 4ZP9A 2PMWA 1FVSA 2VASA 2G0IA 2HQDA 2LQ9A 1H74A 1HYSA 1B70B 3DU5A 5ETRA 4WFNQ 1HNXF 4KO0A 1LWEA 1GT8A 2XTJP 4WZQA 3JYTA 2DHGA 4LF6J 4BBYA 1SJ4P 4JI8J 3ENAA 1FX2A 3U02A 1ZAXA 1RYSA 1FI4A 3M6WA 3ILJA 5DDQC 1SXLA 4JBCA 3CUNA 1HPZB 3RRGA 4DQSA 1BHNA 3S1TA 1H38A 1JXEA 2CDRB 1TMMA 4MYTA 2M88A 1W26A 3TA2A 2MQPA 4OI0A 3WDOA 4YQWA 4DSJA 2E5IA 3OFEA 4DF4A 2HFUA 2AJ4A 1VQ7S 3OR1B 3OTCA 4KGVB 4CO3A 1U6ZA 4AT1B 2NS1B 4IOCQ 2KTQA 4PG5A 1F3FA 1EX8A 1Q79A 2HVDA 2GHVC 2V34A 5DQIA 1PJ6A 2E9ZA 3TJ8A 2ZZTA 4YHHF 4PPZA 4OHYA 5IT9Y 4RW9A 5AE1A 3G86A 4EFAC 2V50A 1FHTA 1UEVA 3H20A 4LQ9A 4X4PA 3BQ0A 4FYWB 2QSFA 2RS8A 4YY3J 4EYIB 3FVYA 1HNZJ 1YLXA 3QWUA 1FNXH 2NYIA 1R0BG 1I94F 3JSYA 2G9OA 4FVMA 2CQ3A 2KO1A 4B3SJ 3D28A 4C4WA 1VRUA 4A8QA 3IR5B 2VH7A 1UETA 1ZPWX 2HFZA 2XI3A 2AX0A 2DXFA 4NX9A 4DV7J 4ILLA 3CJ8A 2ALZA 2HIYA 3VZHA 3GG0A 4DV7F 2A2DA 2LXIA 5ETKA 4LJMA 2XMJA 1X0PA 2V2QA 3ZZ0A 2AZ3A 3EXYA 2BW7A 4W4MA 3RR7A 4C8YA 2VC1A 4CZCA 1XERA 2Z2LA 4IFVB 1Z2ZA 3IO1A 3JSRA 3TEHB 3MR7A 3VAGA 1G1XA 2YNGA 1JK9B 3OFHA 4RW4A 1DQ9A 1HBOB 1WC6A 3L3CA 3MR6A 2DPIA 4F4WA 3EWGA 4DV0J 3SSSA 3K89A 2ILZA 1WKLA 4FN5A 3OFFA 3KK2A 2MEWA 2QMXA 3SI8A 1ZM9A 2ROGA 3CJTA 4U8VA 1HBUB 6FDRA 1E6YB 1N5TA 2C3OA 1EKSA 2H9ZA 4KT0C 4F3MA 5CA5A 2OPSA 2DNLA 3UDEA 2J6UA 4ECRA 2NREA 1FWLA 3HVTA 1FX4A 3QJJA 3IS9A 1K47A 2Y1LB 3IWLA 4N7TA 4LF4J 1B99A 1UKUA 2CPXA 3Q8SB 1ZTWA 4WFXA 1U8WA 1UAWA 4RUHA 1NUEA 3ILIA 1HBUA 5B0CA 2BKPA 5BJRA 5C25B 3P96A 5F0UA 5KFMA 1PC5A 3HHLC 2FLNA 1CJKB 1QAYA 1NDCA 2LA6A 2BRLA 5E0OA 3R27A 4N47A 2K06A 3TO8A 2DD8S 1HHTP 1VR6A 5L1LA 1AA1B 3H25A 3TQ1A 2MKYA 2ASLA 1R3NA 3KJFB 4U96A 4YR2A 1LV5A 5IT4A 2YNGB 2ZBQA 4Y2KA 3N28A 4WXWA 3DYAB 2MSSA 3G82B 3O2IA 1RHMB 3IGNA 3OVSA 2R3VA 1FJEB 1QSSA 3UI3A 3CDBA 4TY8A 3TR5A 3UD5A 2KT2A 5F8HA 1RAJA 1U1RA 5IFMA 1HWLA 1D8ZA 3RGIA 4KSEB 4NLSA 2GFFA 2ZVIA 5ETLA 4B3TF 3DYAA 4CLSA 1SC4B 4J9RA 4QIEA 2OIHA 4P7TA 2XLJA 3P4UB 3UVJB 3DMJA 3GV7B 1NJWA 2ABYA 2GW8A 2CJ9A 2ACMA 3GZ7A 4O3PA 1UW4A 1RT1A 3TJ9A 4ZHRB 1RU2A 4RJVA 3W5ZA 2EI5A 1S1VA 3G8TA 2PDAA 2H5JB 4L73A 1Y11A 4OV1A 3BO2A 4DU7A 3WX4A 2QLWA 3C19A 4Y28C 3BPDA 5H9EK 2AYBA 1EIYB 4NLOA 2UP1A 3SEOA 2B3TB 3HD2A 1U1PA 4DSKA 4RW6B 2DO0A 3C14A 4ANEA 2HKEA 1CJTA 4RWWA 3VCDA 1KQKA 3TZYA 4GVLA 2UXDF 4C48A 1HA1A 1N54B 3FJ2A 2L48A 1R89A 4EWTA 1R8CA 4N41A 2B9EA 2MSTA 2DRAA 2H4WB 1DTTB 3MEKA 2OEJA 5J2MA 5I42A 2EFNA 2ZOFA 4DQPA 3BGRA 3M2UB 1HPZA 4NXNJ 4IOAQ 3C6TA 2DXDA 3SCLE 2DEIA 2V5HG 4A8KA 2HNZA 3QBCA 1SBRA 2RH3A 4DV5J 1R31A 4J90A 4ECYA 2E7XA 4IOBA 4RBUA 2AIRB 2V8DA 3A8KA 2DHSA 4C98A 3CDUA 4ZLNA 3ETOA 2J7UA 1S99A 3ONQA 2BV3A 4YS2A 2NXUA 4TU8A 5ETNA 3K2YA 1RT7A 4FZVA 3IRXB 3G6ES 2C28A 3IP0A 2WB4A 4GMKA 2HQ3A 4EO6A 1DARA 3IMQJ 2XWYA 2XM3A 2CG8A 3L95X 1BQXA 4DPUA 2HURA 5KFRA 2UUBF 4RKUC 4DS4A 1YRTA 4UT4A 3FCHA 1G6BA 1VK3A 2VG7A 2LKZA 2V9KA 4UQTA 1HBMA 3SYZA 2ALYB 1FWKA 2VDIA 3DDKA 4TLRA 5ETOA 3TI0A 1J5EF 2WVCA 2ZE2B 4ZPAA 1AXQA 4ETZA 3VHQA 1QUVA 4DV2J 1SKWA 4F3OA 2AWZA 4FVCA 2VF3A 2R9LA 1Y7PA 3I55S 1KD1T 2JFKA 2LMIA 1FVQA 3DRSA 3ET6A 3LP2A 4M63A 4MTPA 1S0NA 1HR0J 3GJRB 4IFVA 3P5TL 4USVA 2ZDPA 2YNIA 2F8EX 2J7WA 2YKAA 4DSLA 1OS5A 2Z57B 1IKWB 3UCUP 1RCOB 2B8PA 3U7JA 2CPEA 3UR3C 1Q86T 4Q8EA 3M8PA 2W24A 2EWHA 1HD1A 3N5BA 4LRFA 3CCMS 2HZAA 3V6DA 1IWGA 2G2YA 3C8YA 3UE2A 3DI6B 3OL6A 1RWKB 3PW7A 1NK6A 3CPWR 2VPYB 3KDNA 1X9WA 1RCXB 3R9LA 4WPAA 5EWGA 2HNYA 2AJ0A 2M3DA 2Y1JA 1UJ6A 2KN4A 1KTQA 4KYZA 3TP2A 2XLIA 2RS2A 1SJFA 4MFBB 3E8OA 5JJBA 5LSRA 2VJVA 2V2ZA 4KHRA 5KFLA 2AEMA 1HMVA 2DNRA 1CULB 2JH3A 2X51A 3H0PA 3MCMA 3N79A 3PEJA 1WOOA 2F8HA 2PA8D 5C5JA 5KOXA 4Q45A 3K5LA 1B7FA 4WP8A 1Y9OA 2N3OA 2CQ0A 1H7WA 4CH7A 2EBEA 2XLKA 2PT0A 4QJVA 1RK8A 4DR2F 2AJQA 4GO7X 3BH6B 3R1LA 1B0PA 3FEXB 2DH9A 4HKQA 1E6VA 3M4XA 2BACA 4NLPA 3UO0A 4CNYA 3CO0P 4JI2F 4QPXA 3X3UA 3HMJG 3PJWA 4DG1A 4CO5A 3OV7A 1FRHA 4M1KA 3ISZA 2F9JA 2WCXA 1VHIA 4AQYF 2E1RA 2EFGA 1V6HA 2E5JA 3NCRA 1UVIA 2LQ5A 2WRMA 4HHJA 5IV3A 2ZM6J 1G2EA 4IRCA 5KFUA 1SPBP 4U7CA 1TKTB 2CJBA 2UXBF 1T05A 3TA0A 2I6WA 1C1BB 4FPIA 1D09B 4IRKA 4QYRA 3KLVA 1ZETA 4IDKB 2PC6A 3W5XA 3HULA 4GKJJ 4B9MA 4IH6A 2BMBA 3ELHA 3K0JA 3IAM9 3R6LB 1AT1B 2K8GA 2CPZA 4GVBA 2OD4A 2DT9A 3KLEB 1MMLA 4OHWA 5ETSA 4M5HA 2A2CA 4UTGA 5LMUF 4DEZA 2KHCA 1WNEA 2DY9A 4ZMMA 4KGZB 4OZLA 3Q2TC 2ILYA 4HDGA 4F36A 5DZ6A 3HFZB 1H72C 1AYEA 1NHUA 2CWXA 2ZUGA 3POTA 2JDJA 3QGGA 1I94J 2AP6A 4LSNB 2ZBCA 5CYMA 1M1KT 2B51A 1KONA 1VCTA 4X65F 3KHLA 3W1YC 3PYFA 3QGIA 4RU2A 1VQ4S 1F5BA 2RDIA 1PJ5A 1XEZA 1NJXA 4JI7J 3E2EA 1H2UX 1HHSA 4YHHJ 2LDYA 1FCAA 4TN2A 1MNEA 4FYVB 1RB0A 2X1FA 3CO9A 4PKDB 1DRZA 2IVMA 2W4PA 4IR1A 2KJVA 1KQFB 2KFNA 4LFCJ 3H5UA 2F1FA 4ES1A 4CP5A 4PRFA 3VF0B 1DZ5A 2ZH1A 4B3OB 2YQ3A 4ZVFA 3HZGA 4RWXA 5CCLA 4IG3A 2OUGA 1N5SA 2VA3A 1T02A 3CULA 2NSCA 2RRBA 2PMHA 1TKXA 1KQSR 4EUVA 2MKJA 1P8GA 3GMGA 4DR1F 4V19J 3MD3A 4ZVOB 1NRKA 1R6YA 1YVFA 2CVIA 3FSIA 4F4XA 4JI6J 2DHAA 3LANA 4HHUA 1SH2A 2Q43A 2KFZA 4U67Q 2BR0A 2CPYA 4PXBA 4CLLA 4DX5A 2EFQA 3ETMA 4OJ3A 4TYBA 1N5QA 5I4MA 3IWXA 5KG2A 3KHRA 3NNHA 5J2PB 1HNXJ 3SFGA 3R5AA 2ZD1B 1OQ6A 4NLRA 3RB4A 2RVJA 2HEKA 2NPFA 5A8WA 4OHXA 2DCUB 4IH5A 4X84A 3P6YC 2RF2A 3C6TB 4LRCA 3R7BB 4CQ1A 3CNQP 3HF5A 3K5NA 4LFAF 4KFBB 5IQ6A 3EDQB 3ZTSA 1T0TV 3TOQA 5C2CA 2GMLA 3HFKA 3M9NB 4KPYA 3M2RB 2IYIA 2P2CB 2Q79A 5L9XA 3RBDA 1YTYA 2KB2A 2DR7A 3UDLA 2HHXA 5M2PA 4DR5J 2VBYA 4C8OA 4ES3A 4ANDA 1TAUA 1QE1B 4I6AA 5J1EA 3LP1A 1RWWB 2EC2A 2DCLA 4C8MA 2FB0A 3V4MA 2KZZA 2OSRA 3NEKA 5KFZA 3V6HA 1Q82T 2IDLA 1VRTB 2HZCA 2BE2B 2FY8A 2PFDA 3MUTP 5U47A 1ICEB 5HQMA 1JKHA 2EVZA 1IR2A 1YRXA 3EPIA 2UV8A 3I4PA 4KTQA 5HMYA 3I0SA 3AFGA 2IMOA 2I1RA 2MYFA 4NE9C 3Q0AA 4J9QA 2DHXA 2YKNB 3MCNA 5D4OA 5KFIA 3HSGA 1IWAA 4UOFA 3W2VB 2LEPA 3DMJB 1GMUA 2ZKUA 1ZS6A 2IY5B 3QGHA 4YUDA 1YK9A 4DL5A 4ZITA 3VGSA 4JYAJ 1OO0B 5CZVA 2AF6A 2HFOA 5KFXA 2AW0A 2Q1LA 3RRHA 1L3SA 2R8GA 1XNQJ 1N5YB 4LF9F 5IQQA 2HQCA 4NL5A 2YKNA 1HWKA 2B6AA 1UEKA 4NCBA 1TK5A 2VG5B 4KJIA 2HYIB 2PEBA 1IBMJ 1CJVB 4JI4F 4U7UD 4RUBA 3HM9A 2CADA 2KL8A 5J2QB 4DOZA 2AT1B 3CJ4A 1VBKA 3LP0A 2MQLA 1N8RT 1DTQA 4DSIA 3G6VA 3V4IA 1FD8A 2BE2A 4ZLLA 3HO1A 1X8DA 1SC3B 1FDNA 3JB9k 2H1YA 1NMEB 3GIMA 4RNNA 2O66A 2DY1A 3DHXA 4I1TA 2R8IA 1S1UA 5HBMB 2WVEA 3RBZA 3EPGA 2HAIA 2ATCB 3TZZA 1AFJA 1ZYQA 3KLHB 3CJ5A 2LEBA 4CTAB 1UVLA 2HWIA 3GFZA 4EK2A 3NGTA 5T14A 4BLGA 4TU9A 2VIHA 2W1BA 5KFAA 4DV4F 4A8MP 2VBZA 4LF7F 3TUJC 1FO1A 4NMXA 4K0KF 3BJYA 4DXLA 3IAS9 2RHSB 4NCGA 1FKOB 1R0AB 1YG0A 3BGOP 3MI7X 5AJ3J 4LIRA 1W2BR 4RUAA 3TVZA 4J9UE 3OL7A 4Z37A 5KT3A 2ADBA 1VIOA 2ADCA 3KUHA 2DGVA 3DLBA 4LF2A 2OPSB 4XDDA 3FC9A 2RQMA 2BANB 3ILOA 1UWBB 3D2WA 4NMLA 4X4UA 1E6YA 3ZO7A 2ZC4A 2NPIA 3BREA 4RX6A 1PO6A 1FEHA 2ZHBA 4TQSA 3TZXA 1OIAA 2C2MB 5D4LA 3N01A 2W4CA 3UWTA 3A8IA 1KKHA 5KT2A 5CXTA 2J9CA 4K50A 4PABA 5M2RA 1X7VA 1UVMA 4H4MA 4YEAA 2EC0A 4DR7F 3VAKA 3QYYA 5DS7A 1U6BA 1U02A 2ASYA 5KT4A 1IBKF 4LMZA 1Q7LB 3DLEA 1WWHA 1QY7A 4JI0F 3BR8A 5C2GA 1F9HA 1GQEA 2X3DA 4E98A 2IC3A 2J0SD
chains in the Genus database with same CATH topology
3K8VA 3MM8B 3ZC4A 4PPDA 4ATNA 1KHVA 3QWPA 3PZPA 1VQOS 2BW2A 2KT3A 1S79A 5A8WB 2R7UA 1FDAA 1A6LA 2AGPA 2XG8A 4O44B 5A2QY 2ZH7A 4H4OA 3FSXA 3VR1A 2XCAA 1SB6A 4DFKA 2VV5A 3CCTA 4BCAA 3H2VE 3CSKA 4CO2A 4K4XA 1TL1A 1MWYA 3PFOA 2YWEA 2DGSA 3DOKB 2CQIA 2CYYA 4Y3CA 4C8KA 3TARA 1NK8A 4J37A 4YB5A 1JLQA 4RW9B 1O8BA 1S1WA 4WKRA 1SV5B 2DJWA 1TKXB 3MD1A 3PW4A 3PX0A 1DFDA 2DBBA 3HX9A 4C7QA 2OJ3A 3KLEA 5F8LA 3MR2A 3CD6S 1U7LA 2RJZA 3HHLD 2DPJA 4MKBA 5E3QA 5FIIA 3PW2A 4YB7A 4F2RA 1WELA 2VONA 3OQ2A 5IWAF 3NL0A 3CD5A 3CC2S 2HW3A 4EBCA 1JMTA 2J5AA 2VUGA 1N52B 1Q4RA 3CJ2A 2IM1A 2WONB 4I2PB 2JEIA 3K7RA 1QAXA 2FLPA 3LW5C 1P27B 3HHLA 3OJSA 2B9WA 4PXCA 5GADU 1TKZB 3M8QB 3O3LA 5J1PA 4ECUA 4PR6A 2KVIA 2QA4G 2QIFA 3CCUS 1JWWA 2FJVA 1FKAF 4A47A 1N0UA 1IKYA 3MEEA 4FS2A 4F25A 2JL9A 4WKYA 1WEZA 1T94A 3MR3A 2OP5A 1LOUA 2W25A 4N76A 1VOMA 5CQGA 4DR6F 2W8LA 2FLLA 3KFWX 1C2PA 3HVRA 1S0VA 3THTA 1LW2B 5A0YB 4A8FA 1N36F 3JSMB 3MMBB 4YMEA 1MSWD 2IHR1 1MROB 4I7FB 1H0HB 3H5SA 3OJUA 2V4JA 3CIMA 3D0GE 1YQHA 1RTIB 3I56S 4C0OC 1ROFA 2VPZB 1KFDA 4CIOA 2KG1A 3DLLQ 3SXLA 1U1LA 2WBMA 2ZKTA 4BHQA 1TV6A 4CI0B 4O3SA 3LP2B 2FD2A 1GTHA 1TVRA 2JZ5A 5GAHI 2HHTA 1HMVB 4NA1A 5T41A 1MMDA 3MM5A 4CO4A 4XAKA 3GB0A 1VQNS 2YH0A 2M2BA 4E8UA 2AYGA 5B0GA 3NWGA 4MK7A 4JUZA 1CQNA 3H4BA 2E9RX 4KAIA 5KT6A 3UQSA 4OL8A 1X4GA 3LGNA 4IKAA 4Y2AA 4O4GA 1TVRB 3MHYA 4QR2A 3NAIA 3VZIA 4DPOA 2W9BA 1N34F 2HLTA 4HVZA 1L3VA 4CO1A 4OI4A 2CQCA 1YJVA 2RKIA 2XY6A 5L9NA 3PW5A 1NK0A 1ZZNA 1NAQA 3CD7A 1HNIB 2YWFA 4K5RA 3TAQA 1NU4A 1X9MA 2ZH3A 3I5CA 4IYQA 1ELOA 4ZPCA 1Q78A 2NZ4A 1F5CA 1HNVB 4Y2IA 3IA0A 2XMWA 2RIJA 2D9OA 3M2VA 1WHYA 1H2TZ 3FGVA 3HHLB 3QPIA 5KFOA 3HK2A 1ULRA 2B4PA 2HHSA 2LECA 2HNDB 5C24B 2B43A 2FVRA 4FBTA 5J1NA 1PILA 3LALA 5HO4A 1HBMB 1MW7A 1TL5A 3M32B 5K9FA 4K5SA 1RI7A 4DFPA 3C2PA 4RW6A 2UVRA 3QAUA 4RU9A 3EZUA 5FDLA 3O6QA 2ZH4A