4Q2MA

Structure of the e. coli yajr transporter yam domain combined iodine
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
b'PYVSSLRIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major facilitator superfamily MFS_1
publication title Atomic resolution structure of the E. coli YajR transporter YAM domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2014-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q2mA00
1TL4A 5KAKA 2FB0A 2LQ9A 2HIQA 1N5SA 2XMTA 3CJKB 4NL5A 1YJVA 3FMBA 3HHLD 4HH0A 1FD8A 1S6UA 2OD4A 4ZOSA 1FE0A 2GCFA 2RSQA 1GXTA 1OPZA 1K0VA 3F44A 2ASYA 1YJRA 2HFOA 2OKQA 2OP5A 1Q4RA 3BDEA 3TRGA 3UDCA 4YDXA 1KVIA 2EW9A 5B0GA 5B0DA 2QIFA 1MWYA 5F0WA 1KVJA 3IWLA 4DN9A 2QLWA 4ZA1A 1OQ3A 1Y3KA 2GGPA 1GXUA 5T7LB 1CC8A 1OQ6A 1Y3JA 4Y2KA 3BB5A 2OAUA 5B0EA 2K7JA 2W4PA 5B09A 1X8DA 3CJKA 2GO8A 2IFXA 3HHLA 2K1RA 3BGUA 2ZDOA 2FHMA 3TOQA 2GA7A 4F67A 3FRYA 2GFFA 4U9RA 3QGPA 3LO3A 4EFAC 2HFNA 2Q3PA 4YEAA 3BM7A 4HI2A 3BF4A 4HH1A 2BUNA 2BJDA 3DCAA 3VTIA 3KKFA 5F0UA 1AFJA 3GZ7A 3LGMA 2XMWA 4DPOA 3I9ZA 1CC7A 2XMJA 4OIXA 2W4DA 2HQIA 2JDJA 2G9OA 2FTRA 4FNIA 3E8OA 5B0AA 1XBWA 5IXUA 1YJTA 2QYCA 2ROPA 1SB6A 5B08A 1S6OA 1FEEA 1R6YA 1Y0HA 2OFGX 2RILA 4Y2IA 4HL9A 2GV1A 3KG1A 2KKHA 2HLTA 2OFHX 1ULRA 4A48A 1WD6A 2HLUA 2KYZA 3LGNA 1FVSA 1YJUA 2RMLA 2VV5A 3HHLC 1FESA 1Q53A 2XMKA 1X0PA 1AFIA 1Y9OA 2QLXA 1VQYA 2N4DA 1KQKA 1V3ZA 4OJ3A 2KT3A 2PD1A 5B0BA 5T7LA 1X7VA 4Q2LA 1YRXA 2ZDPA 1SQEA 3MCSA 1OSDA 4A47A 1MWZA 1P8GA 2OD6A 2ACYA 3TNVA 1APSA 3KNGA 3IWXA 2BBEA 3K7RA 1LQ9A 2W4CA 3QMQA 1Q8BA 4A46A 2LXFA 1U7LA 2FIUA 2L3MA 2RU9A 1Q8LA 2BJEA 2XMVA 1RJJA 4OJHA 1YG0A 1AW0A 2K2PA 1IUJA 1FVQA 1W2IA 1FE4A 2GGPB 4OJ1A 4Q2MA 4FNHA 2LQBA 1P6TA 3HFKA 1VQSA 2N7YA 2AJ0A 2CRLA 2IYGA 3HF5A 3MZIA 2KT2A 3BN7A 3HHLB 3FGVA 2N4CA 2K1RB 2BYCA 2OMOA 4HI1A 2AJ1A 4Y2MA 3HX9A 1JWWA 2XMUA 1N5VA 2ROGA 1CPZA 2IYIA 5K9FA 3BR8A 2K7KA 3KG0A 1N5QA 1URRA 3HDSA 3T9NA 1TZ0A 5A6WA 5B0CA 2ROEA 2VH7A 2PGCA 5B0FA 1SI9A 3DXSX 4NPOA 4QOTA 2AW0A 1QUPA 5A6PA 4DL0C 2AP6A 1N5TA 4OJGA 1TUVA 1TL5A 1TR0A 2LDIA 2XMMA 1JK9B 3WDOA 4A4JA
chains in the Genus database with same CATH superfamily
1IKWA 4RBUA 4WE1B 2MQ8A 2F1FA 3R3TA 3N5BA 1PG5B 1U25A 5D3GA 3M9MB 1WHWA 4ZPBA 4OYAA 4DS4A 5KG5A 1Q81T 2RQ4A 1XNRF 4A8YA 2HQFA 4MTPA 2GMJA 3D6FB 3IS9B 2ZEJA 1YZ7A 2ZM6J 2K06A 4D3HA 2MKIA 2VJVA 2OSQA 3NGSA 3TA1A 3UR3C 1XMQF 4C11B 1NK8A 1NRKA 4DR6J 3BV8A 4QIGA 1Q53A 2DEJA 1ZOTA 4M5DA 3S8SA 1U24A 4DQPA 1VI7A 4J9OA 4DLEA 1Z1ZA 1BD6A 1UJ6A 4I6AA 4DR5J 5H9EK 3SFUA 1CJKB 2MKKA 3BBCA 4FNHA 3K8VA 3UD3P 4ZP9A 4LF1A 2BYCA 2GHWA 4HT7A 3MMJA 3UNGC 3TUZC 2XEXA 3CMQA 5DQHA 2R2RA 4ZVRB 4M63A 2A6MA 2D3ZA 2MY7A 3R5DA 1FCAA 5B0GA 3ILLA 4ZVTB 2KHDA 1WKKA 3TWZA 4GKJF 1OY6A 5F8HA 4ITSA 4K4SA 4RJVA 2YKMB 3W5XA 1K8AT 2G2YA 2RD5C 4YEAA 4L6V3 2HIYA 3IRXB 1WC5A 1N5YA 2F40A 2DNOA 2RS8A 3T3FA 2M2BA 3BSAA 1TMMA 3C14B 2ZBQA 4Y0FA 2C1EB 3PFEA 4LF2A 2ZITA 3CPWR 4ECTA 3ZTPA 4K5RA 1P8GA 3M8SA 5K8MA 2IM2A 2IIHA 4TY8A 1SBRA 2D7SA 1CEZA 1JKHB 1HI0P 3DOMA 1UETA 4Y6IA 2QA4S 1CJUB 2GIQA 3M30B 4LF5F 3Q22A 2HHSA 3WIVA 1UVMA 4XTTA 2XGPA 4UQGA 4DUYJ 1LXNA 4RW9A 3HVTB 3FQKA 1N4LA 4O44B 4CLTA 3OTCA 1AT1B 3LP0B 4NRTA 1S72S 1U48A 4B3OA 3VGUA 1BXNA 2J6TA 3IO1A 1CC7A 3MEGA 2LLZA 1U1KA 5ETMA 1HWJA 3G4SS 2KH9A 4CRJA 1WD6A 4Q5VA 2RRNA 2P9GA 4OJ3A 4MYTA 2FD2A 2DH8A 3BZQA 1LV5A 3W60A 5HP1B 1L3UA 1N36J 4IQMA 2V8GA 5LJ5Y 4KHRA 2Y1RI 1FDNA 1GTHA 3U1MA 1R7IA 4PXEA 2BX6A 2DHHA 3D67A 1B7FA 1F9EB 4JI8J 4ED8A 1TK5A 3C19A 3G8SA 4PR6A 3EX7B 3PX4A 1HYSA 3MMBA 4I6WA 1LWEB 2E7WA 1KVIA 4FVMA 4AL6A 5DGAA 1KQGB 3OR1B 3R5BA 5FJ4A 4X4UA 2R9LA 2IRUA 2ZBPA 3DRXA 3C6TA 4G1IA 1J5EJ 4HI2A 3HD2A 1SVDA 2UXDF 4CNZA 4ZHRB 2VPXB 4JI0J 4DPXA 2C2OB 3KUHA 2AYBA 5CCMA 2RILA 2BANA 2UXCF 2IA0A 3M6UA 2HLTA 2HLUA 3DLGA 1HR0J 3SQOP 2OLWA 3MURP 4FYXB 4ES1A 2VB6A 3FQLA 1B70B 2DH7A 2UVWA 2HRTA 2FVQA 1BQXA 3TNVA 2VC1A 4QW8A 1M5OC 1JX4A 2MZTA 2W25A 4QZVB 2VFUA 2ROGA 1FX2A 3MEDB 4AXIA 1L3SA 1N5QA 2GHVC 3KUGA 3QGHA 4V1Ak 3C15A 3EE3A 2C2NA 2YBVA 2ZJPQ 3G8QA 1FK9B 3D9BA 3TQEA 1RTJA 2W9CB 3PYEA 1ZPVA 2MLYA 1MU2A 1KOOA 5HMZA 4JI4J 2KFYA 2CNOB 2O1PA 1PYSB 2DITA 2DGQA 3PKYA 5I42B 1UP1A 4JI3J 2CPYA 2FZKB 1VHIA 3KLFA 3SCLE 3CC4S 3MECA 4XK8C 2NYHA 1H74A 3NEKA 4KPCA 4ECXA 1RBLA 1GMWA 3FBFA 2BABA 3SSSA 3H98A 3TEGA 2ZH9A 1GMWD 2RIJA 5J2PB 4DFKA 3BPDA 3FSIA 2ZC3A 1HNXJ 4B3RF 3Q2SC 1REVB 1VRUB 1FXLA 1JLFB 2KDOA 5HROA 4RW6A 4DFMA 3JS9A 1IUJA 1RAAB 3TYTA 3P49B 1EX8A 4OI3A 2IAJB 1XERA 3D0GE 2UUCJ 4PYAA 4J9SA 2CJ9A 2BRLA 3HD1A 1WDDA 2XYHB 3KJVA 5G0RA 4G3IA 5EX0A 4RZRA 2RF2B 2QO3A 2EFVA 2GCFA 2W8KA 3G6VA 1FJEB 5C42B 3PV8A 5A2QY 3MM6A 1CJTA 1S1UA 2ZDOA 4M5JA 4URGA 2HFNA 3UCGA 2B4OA 3HKWA 5KG0A 4ZVFA 4XDCA 4A8WA 3CW2C 3AH6A 4ILRA 5KFTA 2VFSA 2X1GA 5DDQC 4LF6F 3QWUA 5FD1A 1S1XA 2DNYA 2ZOGA 1HHQA 4NASA 4DR3F 3WHIA 1RTIB 2N4DA 2QSFA 2H4YB 3ULHA 1S9EA 3WBZA 3TVZA 4N56A 3HT0A 1T95A 1HQ2A 3DU5A 4IOAQ 2F3JA 1X4AA 3B54A 3LANA 3PJWA 3GCWP 5HSPA 2V4QA 2KFNA 1OS5A 1TFWA 1JWWA 4AQYF 2HVIA 2HHHF 4N7TA 2A1BA 1NK6A 1PCAA 4JI2F 3I96A 1EIYB 2D41A 3FZ2A 3R2CJ 3SV4A 1C0UA 2QG9B 5D78A 1UTAA 1FNMA 5F3ZA 4WFYA 3K5MA 2HNDA 2QLWA 4HKQA 3NAIA 3DGPB 1KWMA 4DPYA 3TZYA 2KM8B 2J5AA 3AOCA 1RT7B 2YPZA 3GYNA 3OR2A 1FO1A 4NCGB 1YJ7A 1NSPA 4H54A 1S9GB 3M8RA 2Q66A 4AE5A 3CCZA 4HACB 4J9QA 1FA0A 2EPIA 4IYQA 2DRAA 1JB0C 4DR1J 4ETZA 3OFEA 5KT3A 1RWPB 4K0KF 4C0OC 1X4GA 4HR2A 4F26A 2BR0A 3L9ZA 3W64A 3Q8VA 4HEA9 3T19A 5M2UA 4F36A 1RSCA 2D74B 2A10A 4DWIA 2MSSA 2ZZMA 4TU9A 4JI5J 1GT8A 3A8JA 4OZJA 3MFIA 2GVZA 3I0SB 5E2QA 2FY8A 1U0HA 5J2MA 1IWAA 2VL1A 5KT4A 3PKMA 2V2ZA 5CCLA 3HX9A 2YX4A 1HNVB 5K9FA 1XN9A 4JI7J 1B99A 4QPTA 4E98A 1QAYA 2LDIA 3N4WA 4ANEA 4O0IA 2DGSA 4LSLB 4WXWA 2CZ9A 4LIWA 2C2EA 3V4IA 2RDIA 5D0GA 2J0QD 2IRXA 4GO7X 5JUMA 4B3MJ 1IQTA 4CO2A 3EXYA 2IFXA 2QZ8A 5JXSA 3CWJA 3NOCA 5J1PA 4GVBB 2VBXA 1NLKL 2AZ1A 3TANA 4EBCA 1I6JA 2HZAA 1XBWA 2PT0A 5JMNA 4JYAJ 3OFGA 3I0RB 2LCWA 1X0PA 1F5AA 2DNNA 5J2QB 2HSEB 5DJBA 2Z2MA 4C11A 4IO9Q 3JSMB 3BSOA 3D28A 2LEAA 3DRRA 1BWEA 1N52B 5LMUJ 1R8HA 2NSBA 5LXYA 3DMJB 4F4YA 3SV3A 3BQ1A 2LQBA 1XMOF 1RT2B 4YQWA 1YRTA 4N41A 3QFWA 4M5IA 1F1BB 1TU0B 1CJKA 4DFPA 1VBXA 3BJYA 1RWXB 1F5CA 1XWLA 2EK6A 4CP5A 3TUPA 3PRDA 1IKVB 4X64F 2E7VA 4UOGA 4P73A 5D0HA 5F8MA 1SPBP 1I94J 2ATCB 2HQ3A 4ZK7M 3OJSA 2HVEA 3NMAA 1FJGJ 4C0HA 3GU0A 1WI8A 2MLXA 1CC8A 1EETA 2HMIA 3CCRS 3C3LA 2W4PA 1YRUA 1NK7A 2GA7A 1GNKA 4F67A 3PO4A 5CYMB 4FS2A 1UJ4A 3CJTA 4CM0A 1AZSA 2PMWA 3OVSA 2N3OA 2A2DA 2DR7A 2ZH7A 1HNIB 1HW9A 1CVJA 2HFZA 2E29A 2Q1LA 1VQ7S 3CJ4A 4ZCIA 1M5PC 4ZMMA 3U1LA 1ZA1B 2XM3A 2HW3A 2P5VA 3C14A 2XWYA 1RAHB 2IDEA 5G4DA 4ZCLA 3F0NA 4PG6A 2KT2A 4W92B 3T5HA 2I6WA 1R8CA 3UR0A 2DNZA 3I5CA 3MAQA 3QIDA 3MM5A 2ZOMA 4K4XA 1N8RT 4NYZA 2V9KA 1CJUA 3M30A 3HULA 1NJZA 3CC2S 1FJ7A 3S7RA 1NHUA 2JWNA 1TV6B 4OV6A 1FKPB 9RUBA 3NBPA 5J1EA 3DOKB 3FSXA 3EPIA 4CI0B 2V4JB 1VS3A 1VQ4S 2JLGA 4NZ0A 5E5NA 1U6BA 4CLZA 1HBMA 3ZC4A 1T9YA 1HBNB 2WVBA 1WTFA 3T1YJ 1FHTA 3US5A 1LOUA 5IFMA 4DV4F 3W63A 1UWBB 4WWSA 3BR9A 4ECUA 4ETXA 4OHYA 2EI5A 2ATLA 2WW8A 1TKZA 5HJYA 2B9XA 4DG1A 1VGYA 2A18A 4A47A 2MDAA 4DR2J 2R7QA 4CO1A 1IR2A 3M7VA 1WC1A 2AJFE 4OJ1A 1IVZA 4TQRA 2EK1A 1QD1A 2Z8QA 2K1RB 3KTQA 2HFSA 3B8HA 1JMTA 3VAIA 2MGZB 2HHQA 1Q1KA 2XY7A 5D4NA 1MNEA 4M5KA 2UVUA 3EZUA 2CPEA 2QIFA 5F0WA 1UCNA 3OPKA 2UXBJ 4LIRA 1B64A 4YB7A 3CJKA 4JB8B 1LWEA 3FCHA 3NCQA 1SUQA 1VRQC 2AYGA 1HHSA 4JI1J 5DDOC 2A3JA 2M3DA 3UD5A 3W8PA 2E44A 1YWXA 5ETNA 1H72C 3QRQA 3ITHB 3H4DA 3N6LA 2M70A 1RE1B 4ENOA 2GJFA 4NEZA 2F8HA 4QU6A 1LW2B 2WBRA 1HI8A 2ALZA 4NLYA 3VAGA 3IXQA 2L9WA 1FWKA 3ONQA 4QJVA 1WTBA 2AD9A 3BR8A 4WXOA 4U96A 1VBYA 4OZ5A 5IWAF 2MJUA 1NB7A 2OPPB 2ZFHA 2PE8A 1UEKA 4B3SJ 2PSZA 4HDGA 3C8YA 3RGIA 1IBKJ 2WTFA 4CIOA 2QMUB 2XMTA 2ASDA 3D66A 4GC7A 5M2PA 1EAYC 3BO2A 4W90B 3KWMA 4P2MA 4Y2AA 2WOMB 3GLJA 1T9WA 2HBQB 2CJAA 2W9CA 1KLMA 5HLFB 1BGXT 2CADA 1HWLA 2J7WA 4U9RA 2DHXA 4A8XA 1TL7B 1IKYA 4IQXA 2RNEA 5I42A 3TJAA 1BQMB 2OFGX 1VQ8S 4ELTA 3MUMP 2J8AA 2XS7A 1QSYA 3RR7A 3AODA 1Y9OA 4LRBA 2AYMA 3UNYA 4ICLB 2P2CB 1CSJA 5F8NA 2XQCA 5HBMA 4BWJA 2HYIB 2C2MB 2ZM6F 4FYWB 3VGSA 3DLEB 3JTOA 4IFVB 1REVA 1JLFA 2IYIA 3T6JA 1TL3B 3MAHA 4DR6F 2I1RA 5B0CA 5KFVA 1TKTB 4CH7A 5DM7Q 4IRCA 2J7UA 4WTYA 3JYTB 3OFHA 4DR5F 5KAKA 3NS6A 5KFMA 3R1LA 7FD1A 2UVRA 5L9XA 3AHPA 1SC4B 3GYXB 6FD1A 1ROFA 5GMKa 3LGMA 1TAQA 4IG0B 5EDWA 3P6YC 1JLQA 3OTEA 2V2VA 3HHNB 2KXHA 2DRBA 1O51A 4M95A 3O6QA 4OYIA 4PKDB 3D0HE 4Z7YA 4NX9A 1Y5LB 3AAWB 3DNCA 1OMSA 1HWUA 4WFXA 1QVGR 3P45B 5L46A 3PX0A 1IM6A 4KGXB 4USJC 2MHNA 2UU9F 1N88A 1VRTB 2AEJA 4F4XA 3VVTA 5THWA 1U6FA 3LALA 3FMBA 1L5UA 3H4BA 3HHKA 2UUWA 1HMVB 4WU3A 2J6SA 2XGQA 3DDIA 2ZHAA 2VQFJ 4J37A 4KFBA 2DNGA 1X31C 1ZTWA 1ELOA 2YH1A 1H6KX 3G8TA 2IMOA 2ZWOA 3LP1B 2HHUA 3LPYA 3ZNUA 3KLEB 2BQUA 4DUYF 2RMLA 3M6WA 2BE2B 2PA8D 1S9GA 1H98A 4HACA 2BM0A 3E51A 3MCSA 2RS2A 2C2DA 4OLOA 4C6AA 1DTQA 1GX6A 4WFBQ 2E9RX 1U1LA 3BQ2A 1WOPA 2CRLA 1H2TZ 1RT6B 5F8IA 3CCUS 2I8EA 1D8ZA 1QTMA 2FJBB 4XIUA 1VR6A 3H5XA 1RAOA 1DLOB 1X60A 1FE0A 1X9SA 1N36F 2XYGB 2HBYB 1VQPS 1JQGA 3JQMA 2FVRA 5KG2A 3TOQA 5GAGU 2LU2A 2FJXA 2LA6A 2C3MA 3QJLA 4ZCKA 1FWLA 1DAXA 3V2UC 3LWMA 5IXUA 4LBHA 1SB6A 2ZVSA 2CQ1A 1ULRA 4BLGA 1SL1A 2BOAA 4X66F 2ZNZA 2KXFA 1YJWS 5B0BA 3OHBA 4I56A 2IM3A 3I0RA 3QT8A 2CJBA 4IOCQ 1J5EF 1DY3A 3W66A 5K8OA 2BACA 4PG7A 1S59A 4JI0F 2GO9A 1P6TA 4DX7A 2D3O1 4KKOA 2CPZA 2FGCA 2W7OA 4UF4A 1F60B 2B4VA 1YJNS 3DMJA 5KFNA 2VG7B 2XI2A 1RT2A 4AFFA 1VC0A 2VG6B 2C2ZB 2JOQA 1LWCB 1IKVA 5KG3A 1HPZB 5HVHA 3PCOB 2MKHA 5E41A 4DDFA 4KY3A 3OV7A 2OEJA 4L73A 4RBVA 2BUNA 1QAXA 2YH0A 1D9FA 1OYDA 1VCTA 2DR8A 1WHYA 4UUWA 2IDLA 1FEEA 1MWQA 1AUDA 2HNYB 4RL1A 1H7XA 4RU9A 3SZ2A 3PW4A 3SFGA 4JI4F 1XNRJ 1RWNB 2MQOA 3DC2A 1HNIA 1LEOA 3TI0A 1WNEA 2WW4A 3KNGA 3BYPA 3JSRA 4M5NA 2VPYB 1TP7A 1FVQA 1E6VB 3QJJA 4MIWA 1RZMA 3BN7A 3IR7B 3H5UA 2XHWA 2IJRA 2PI5A 2F9DA 3MPDA 3ZZOA 1S79A 1U47A 1VDHA 2ZKTA 1CQMA 5KFHA 7AT1B 4WP3A 2XLJA 4A4JA 1NMEB 1LWXA 5HMWA 1RHUB 4ERDA 4ZVEA 3M4XA 4QU7A 1B0VA 4YR2A 4TLRA 5EWFA 4WU2A 2RU3A 2UUCF 1RDRA 1VK3A 4DV3J 2ZOFA 3A8IA 3D54A 3D1OA 1I3OB 1FF2A 2MZQA 3TJ8A 2AWZA 1RWUA 1FKPA 3THVA 2BA9A 2CQ4A 3ET6B 3DOKA 4Q43A 2LDYA 2V4JA 3LW5C 1S0VA 4MIBA 2XS2A 5DQIA 2DKOB 3IA0A 1WOSA 3LOUA 2HVHA 1I1GA 4LR8A 1G3OA 1WWHA 1UWBA 5IQQA 1NPPA 3W2WA 3R8YA 3EGVA 3RU0A 2D1CA 2BDPA 5A8RB 2VIHA 2JEJA 2JX2A 3CCWA 2HS4A 1RABB 3TZZA 3CJSA 4USUA 5AXNA 3NGKA 4UT4A 3MR2A 1T03B 3PXGa 2HKEA 2LMIA 3GV5B 4XDDA 1R0CB 2V67A 5SUHA 4TY9A 1PKUA 3BBFA 4ZA1A 2OHDA 3MAAB 5DETA 1M1GA 5D15A 2FGOA 3HVWA 3CNQP 1I51B 5D6GA 3FC9A 1FKOA 1NHKL 3KXDA 2VPZB 5BXIA 1S48A 1S99A 3D3CJ 1CBKA 3UPFA 3RRGA 1UW4A 1V6HA 4B17A 1HBUB 2E7XA 1FXDA 5IV4A 3EDQB 1RT5A 1YJUA 5A8KB 4YY3J 1HIYA 2CJKA 4P7VA 3AB4B 5KOWA 2HWTA 4UY8T 2W1BA 1X9MA 4Y3CA 2B4PA 1RAEB 1LXJA 4IRDA 2UZAA 1ZYQA 1QAJA 2DXDA 2CQ0A 1VQSA 2H51B 1LW2A 3R27A 4DR1F 2POKA 3TVYA 2XZTB 4ED4A 5HJXA 3DOLB 5GMEA 3UO0A 3RBEA 1YZ6A 1W26A 2G1DA 1MW7A 4JI5F 2FB0A 4CNYA 5IM0B 4RPFA 3VAJA 4HH0A 2E5LF 2OPPA 2ZKUA 2YNIB 2DNRA 4HTIA 4JI7F 3SBMA 4JV1A 4NLWA 1SJRA 4DR4F 1F3VA 3DCAA 4B9SA 2XCPA 4ED1A 2AZ3A 4B3MF 3U7JA 1TL7A 1FESA 3G71S 4Z7CA 1JNZB 4Q45A 5KFPA 3D0IE 2CWKA 2QA2A 2DR5A 5ETPA 2OEMA 5RUBA 3CDUA 1NPRA 5GMDA 4C48A 4PCQA 3MR5A 3WQPA 2UXDJ 4DPWA 1NJIT 4JYAF 2H1YA 2NLWA 2CJYB 3DLEA 1UZHA 2E5GA 4GO5X 2RUGA 1HKAA 3DRSA 3RZAA 3PY8A 1TL3A 2J8SA 3HSDA 1SC1B 4FPIA 2IBKA 4DI6A 1YJRA 2L9NA 3ILIA 3NNHA 5C2GA 4I2PA 1X8DA 1E6YB 4CO5A 4CZCA 4MFBB 2VU5A 4EMDA 2WVEA 2HK2A 5KFEA 2WONB 2C22A 1UVLA 2ROPA 1HL6A 4ED0A 2RUSA 3HCXA 5KG7A 4KAIA 4E0DA 1FJGF 3THTA 4LF7J 4IG0A 2Y9HA 4UZCA 4PYDA 3UWTA 1IKWB 4F02A 2LKZA 1FFSB 4Q2LA 4OX6A 2EFNA 3KHRA 4LRFA 3BGFA 4DV7J 3NWRA 1K44A 2IYGA 2CVEA 2MMYA 4CO4A 3AJDA 5KFDA 3N6NA 3X1LB 2J9CA 4DV2F 4I0WA 3I5AA 3VAFA 4B3RJ 1S0MA 4O3NA 2V63A 3BDEA 5L1KA 3Q8SB 3GG1A 4M5DB 3RYLA 5IOLA 1Q79A 5E3RA 5ETSA 3TQ1A 3MR7A 4F4KA 5AXMA 2HNZA 2B6AB 4Y28C 1PC5A 3ILOA 3MPUB 5E3CA 3OT9A 2DPJA 2NR0A 3QT5A 2KI2A 3VAHA 4A8OA 3AFGA 3ENAA 1FTCA 4R8UA 4OX8A 1EJ7L 4ZPAA 3C66A 1EZZB 2V0NA 2E5JA 3CCQS 2LP4A 4DU7A 1YQHA 4USMA 2ZJRQ 3E3XA 1MN9A 4A46A 1SQGA 5E3PA 4LF6J 3T1YF 3T41A 2DCUB 2AJ1A 4WFZA 3V6KA 2IC3A 1C1BB 1N5YB 2YXLA 4ZP7A 4ZCMA 2MZJA 3GMGA 1YJVA 1HNWF 4A8KA 4DV1J 3S01A 5KFZA 3T5JA 4ZOSA 3K59A 4RNNA 3FBEA 1FDAA 3T1HJ 3UCUP 1KS2A 4I4BA 1WHXA 1SQFA 3I55S 1UW9A 2HHHJ 1Y11A 2GC8A 5I3QA 4JI2J 4HTJA 4NI2A 3BM7A 2F7VA 4TY8B 4QIVA 2DGTA 2JLFA 5EWGA 4X2BA 3GYGA 4XO0A 2F9JA 2QYCA 2W2OP 1N6QA 3TARA 1Y0HA 5KFXA 3DOMB 3VVUA 4QIFA 4ECVA 1FRLA 2HVDA 1FVSA 1Q16B 2CPXA 5SZTA 1NJXA 2UXBF 3PIOQ 4TN2A 1U1MA 2M52A 2BBEA 4JI1F 3IG1A 2NQPA 3WZ0A 1X5OA 1MG7A 5KFQA 4J7CA 4MIAA 2FC9A 3BYRA 4K0KJ 4C3MA 4B3OB 3HDSA 4EO6A 3CXCR 4A8MP 4WJBA 3CCTA 2G2OA 1NDKA 2LYVA 3M8QB 3MEGB 1VISA 2NXCA 2GQ2A 3KMSA 1XC9A 5L39A 4TQSA 4DQIA 2CVIA 1RKJA 5KFAA 2Z30B 1RT4A 2J9EA 1UEVA 1QE1B 2R8GA 3EICA 3QT7A 5K14B 2OUGA 1NSQA 1DQ9A 3BDPA 3W2VB 3IAM9 2DR9A 2YNHA 1LWCA 3BO3A 3JSYA 4B3SF 2DNLA 1HPZA 4C8NA 5BYQA 2PMZD 1JXEA 1IBKF 4DN0A 5EGYA 1NZAA 2OH2A 5KT6A 4JV0A 4UQTA 1HHTP 2GZOA 3H2UB 6FDRA 3NS5A 2OTLS 1GFWB 3KUEA 3EXCX 5KFKA 2HNYA 2DR6A 2Y0BB 1NH7A 3MMBB 4YUDA 2R7RA 1Q82T 3IAS9 1H38A 3FBCA 3RB0A 2ILYA 4ANDA 4UOCA 1UJ5A 1HARA 4LF9J 4K4VA 4RLEA 4YN3B 3I5BA 3W8GA 1IBMF 3L7OA 2ADCA 1E6VA 3BQ0A 1T9VA 3IBCB 2NXUA 3OW2R 4NLRA 1NK9A 3EVOA 3DLGB 3W1YC 1BMQB 5L1LA 2HFUA 1CQNA 4OYZA 4FPRA 3NGUA 4F2RA 5B0EA 3DHWC 1QDUB 5GAEI 2CPIA 4DR7J 1HD0A 2XMWA 4TVAB 2ADBA 2AYEA 2IVMA 2I38A 2WVFA 3C15B 3CDBA 3WX4A 2HG4A 4DSKA 3Q8UA 1KP6A 3N28A 1MWZA 2APOA 2VDHA 2KXNB 1MU2B 1FWPA 5BYSA 4WBFA 1RWMB 1Q8BA 2VKRA 3R5GA 2F8MA 1DBDA 2MY8A 2W7AA 4YHHF 2DHGA 1RT3A 1A6LA 3KLFB 2ZBIA 4QWCA 1TUVA 3HJFA 4DUZJ 2DK2A 2BE9B 4AYBD 2DYAA 1F6TA 3AJ1A 3BN4A 4CLPA 4PRFA 4QWAA 2KO1A 3EPGA 2OD4A 2CFXA 1SJQA 2W9AA 5B0DA 3M8YA 1T03A 1T05B 2AJ2A 3GPAA 3MM8A 3W9HA 3HHLA 1N0UA 1NNDA 4L3KA 5CABA 5HROB 4RW6B 4PXCA 3I9ZA 3T9ZA 1DZ5A 2DGUA 3UD4P 2Q6CA 3MUTP 5AE1A 2W2QP 1RA7A 2X1FA 2HQCA 3I32A 5H1SV 3ADAC 1FRXA 4C8LA 2L9DA 1KC8T 2VQFF 4WZQA 4X4QA 3C16B 5D4LA 3ETMA 2ASJA 3H8YA 4V19X 4KGVB 2EFQA 4FVCA 5A8KA 3BS9A 3NL0A 3H0PA 2EFPA 4XPCA 5KT5A 1RU1A 4OLPA 1VQKS 3MM6B 5J1NA 4FF2A 1CJTB 3PYDA 4DPTA 4LRDA 4KYZA 4NA2A 1Q86T 3V81A 2MEWA 2X7IA 3PZPA 1CG2A 4IH7A 1NDPA 1S1XB 3DOLA 3D4JA 4CLFA 4CLYA 1YTYA 1GH8A 4ECRA 3OTOF 2AGQA 1N56A 3R1HA 2LEBA 1RA6A 4YB6A 1S9EB 4FKXA 2BQRA 1QUVA 4I64A 4TU7A 3I56S 2CPFA 5IT9Y 1XR6A 2ZBRA 1U02A 1UPPA 4B08A 3L4BC 4M5GA 3CO0P 2LXUA 3MR6A 2B9EA 2DIVA 1GXLA 1VOMA 3QGIA 1C0UB 4LVNP 2OD6A 1Z2ZA 2NZCA 2GJIA 2DNHA 3AD9C 3G82B 4Y00A 3NNCA 2JVRA 2GX8A 3MOZA 2BJ8A 3QNWB 4AD6A 5M2RA 1C1CA 1Y5IB 1TAUA 5CQGA 1WC0A 2EG2A 2IVYA 3VCDA 5GAGI 9ATCB 4QBUA 3HP6A 1Y7PA 1TL5A 4OJHA 4D3GA 4NWBA 2Q43A 1VQ9S 1P9QC 4DSLA 4ZP8A 3QT6A 3B4DA 3FMWA 1EQMA 2YQ3A 4GKKJ 2IMWP 2VFVA 3KOAA 2AGPA 1VIXA 3JQKA 3RG6A 1FRHA 1CLFA 2ASLA 4UOFA 1UA0A 4ZVOB 4NLVA 2GVZB 1U0HB 4CQ1A 1E6YA 2NXNA 5CD4A 5HQLA 4MFBA 4PPDA 2EBEA 4QR2A 3BKFA 2WONA 2O01C 1D9AA 2VUGA 3BO4A 2YQ1A 3ENQA 2YKNB 2G1HA 1IN0A 2RQKA 4ECYA 4EEYA 1Y4ZB 2FPHX 3N9UC 3TW0A 4O4GB 3Q8PB 3OSNA 4OYOA 5K5MA 3KG4A 4H4MB 1RACB 1TQLA 3HKZD 4P6QA 4DCOB 1S6PA 4TNOA 4OI0A 5DRKA 4P75A 4RX6A 4M5MA 4KRWA 1IR0A 3PX6A 3OUYA 2PEHA 3JSBA 3QWPA 2WVDA 2YNGA 3OVBA 4R0EA 3K2YA 2YKPA 2MZRA 1NAQA 3DRRB 5E33A 3FRYA 2DB1A 2RQMA 2XO7A 4ED7A 2MSTA 4OZ1A 2BJDA 3MF5A 5KT7A 1EQ0A 1RKIA 2O3DA 1TL1A 5DGBA 1M1KT 5DZ6A 4KGKA 1N54B 5D77A 2W2NP 4M5LA 2CQ2A 2FLPA 2B6AA 1PGZA 4IUFA 2KU7A 1ZS6A 4FF4A 1T0TV 4DV3F 4OQJA 2FQQB 2VHGA 1APSA 2KYXA 3FEZA 3E01B 1AW0A 2FY1A 3ZZ0A 1CULA 1EETB 2HMIB 1CPZA 4F4WA 2R7WA 4ZJOA 3DHXA 5KFGA 4K59A 2AP6A 2B9WA 1AZSB 2WB4A 4J9PA 2BM1A 3QJPA 4DQSA 4IR1A 2Z2ZA 2I5JA 2AGOA 1Q5VA 1C1BA 5EHHA 4ED6A 4DSJA 5C2CA 3MI7X 4X65F 2FZGB 1GEHA 3B6BA 2UU9J 5H9FJ 2DISA 1CJVB 2CNKB 1HLWA 1AA1B 2YKAA 1N48A 3NRBA 4WPAA 2R4FA 2LEPA 1WEYA 1HWKA 2CIMA 3MM5B 1R31A 2IRYA 4NCBA 5EWEA 4NA1A 3MHYA 4NMLA 1RU2A 2YQ0A 3CCSS 2UV8G 3TUIC 4OI4A 2JH3A 3NCPA 1JNRB 1Z2LA 3NBPB 2RQCA 5J1EB 2AJ0A 5KFUA 3I9V9 1VQNS 2X1BA 4YY3F 4DBQA 1ZH5A 1HBMB 4NPOA 1AYEA 3IMQJ 2E9ZA 1S1TB 2OPQA 1B0PA 3DDNA 3P8BB 3EZ5A 5L9NA 4PG4A 3BH7B 3IM8A 2H54B 3M8QA 3MDFA 3TRGA 1TKZB 1R27B 4DG1B 3G6YA 5K20B 1M5HA 3LA0A 4O3RA 2HQGA 4DS5A 2NXJA 4MK8A 1QE1A 2HBRB 4CLWA 3R5AA 4NLSA 2N7CA 5K14A 4NZ7A 1CS4B 1F5BA 2XI3A 3GSDA 3W2VA 3SCKE 2FHOB 3AA9A 3EDRB 2OFHX 3FZBA 3GFYA 2E66A 3KLVA 2D69A 1ZETA 3OTBA 3NNAA 2UVVA 1JLGA 1S1VB 3V4MA 5BR8F 2PA3A 2J0XA 3CJQA 4WF9Q 3H2LA 2F63A 5HI7A 2MQMA 3ZTRA 3CJKB 4FXDA 1C0TB 2KRRA 3SSQA 2EWHA 5A6WA 1SUQB 4CYUB 5I3PA 8AT1B 4X66J 2I2YA 1SI9A 5L8RC 5H9FK 4LBIA 3HVRA 1FEHA 1XNQJ 1R8PA 2B51A 2BW2A 4M8LA 4S0MA 3U1NA 1TFYA 3JAMY 3TAQA 1KN6A 3OXGA 4DL4A 4KE5A 3GFZA 1OIAA 3R6LB 2QT7A 4RU2A 4P2FA 4N8OA 4CLKA 4FBUA 4HYKA 2VBZA 3Q86A 3DXBA 3OL6A 4ECZA 2E1PA 4LSNB 5KFWA 2ZJQQ 4ECWA 1PJ6A 3IFEA 4NZ6A 2DIUA 2KVQE 4O4RA 1RQ0A 3A4TA 2BJ9A 3AD8C 3QPIA 3QGGA 3G2XA 4PWUA 3M2RB 1KLMB 1XJWB 1KOHA 4LF7F 3AXMA 3LUYA 2FDNA 3CJ2A 1IKYB 2ZHOA 2XMMA 3W65A 2V4RA 1KD1T 2RH3A 1UAWA 3UDCA 4DV7F 5C24A 4LFBF 5HBMB 2OAUA 4DSIA 2FUG9 4C97A 2VZ9A 3THPA 4K8RA 1RUSA 2HRYA 1VHFA 1T05A 4G6VB 2W2PP 2XB2D 3K5LA 3MXHP 3FK4A 3B82A 2Y1IA 3EJMA 3BBBA 2GV1A 3UQSA 1FD2A 1VBZA 7FDRA 4Q8EA 3K0JA 2Q6BA 1RBOB 4KBIA 1OY8A 3GP9A 3AY0A 2GMLA 3WC2A 2ZVIA 1S49A 3L95X 4OHWA 1ZM4A 5IT0A 2ACYA 3TA0A 4USTA 3KDOA 3A13A 3C16A 1MMNA 2L08A 2JC0A 1WHVA 2AEMA 1B0TA 2B0GA 4PAAA 2BVZA 1SXLA 4ZN1A 2DRDA 2RAQA 1H0HB 2D3OR 2DBBA 1NUEA 2IM1A 3N5FA 4OV1A 1N0VC 4WYWA 1S76D 1RHMB 3ZZRA 1JLQB 3MMAA 4QR1A 3FRZA 1SH3A 1ZA2B 1FRMA 2XNRA 4U7UD 2FZCB 3MM9A 4J9MA 3MM7B 4DZDA 2XZDB 5LOQA 4NRUA 4RUCA 3OD2A 3RR8A 2N3LA 2W01A 5CYQA 3OVAA 1QSLA 2RKIA 2KVIA 5BYRA 4DV1F 4USHA 1YKWA 3QSYB 2AQ4A 4RWWA 3T1HF 1YK9A 3ZFVA 2CWXA 2QLXA 4CO0A 3RAMA 4LUBA 3VZIA 5T7LA 3K58A 1Q5YA 5E3QA 1N33F 4HLBA 1C4AA 4X84A 3NAHA 2GJ2A 3KJNB 5A76A 3SQGA 3F56A 4IDKA 4F3MA 4KFBB 1U0SA 4F7VA 3I4PA 4UY85 1DTTA 2WK4A 1U1RA 1Q7LB 1NXIA 1J27A 1R8AA 3G82A 4FN5A 1UFWA 2V8PA 2XO6A 1KDNA 5A0YB 1HQEA 1ITPA 3PW5A 3QRPA 3T6BA 1YITS 4WKYA 2BOPA 3L7UA 4LF4F 1X4FA 2H9ZA 3IBFB 4OYPA 5AT1B 3GILA 3MPYA 1BLUA 1YDLA 1JJ4A 3M2VB 5KT2A 3EUNA 1MWYA 3ZTSA 3MPWA 4I68A 2IM0A 1ZM3A 3I31A 2K7JA 2GVDA 3KLHB 3JB9k 1T3OA 1DTQB 1VJWA 3VALA 2DNQA 3DM2A 5C5JA 4DSFA 2C42A 2E5LJ 2RRBA 3UW1A 4TU8A 4BWMA 2B5JB 3AQPA 5F9NA 1LFWA 5ETQA 1LW0A 2HVZA 1HW8A 3CMAS 1FTRA 4P71A 4DR4J 4FF1A 1LQ9A 1S0OA 2QMXA 3VGVA 2D9PA 4ZITA 2QJ3A 4PWWA 2YKNA 3J81j 1RYRA 3CD6S 3EGWB 4O4GA 3AA8A 2JEGA 3DU6A 4H4MA 5ETLA 2PIIA 2HZCA 3N0VA 2Y1LB 1SKRA 3HVAA 1L3TA 2DGWA 2DTJA 1GXTA 3TEHB 1LK7A 2XBPA 3KMQA 4ECQA 4RUAA 1ZAWA 1FRJA 4C8ZA 1RXOB 2H48B 4USIA 4LF9F 3RBDA 3MMCB 4OHZA 4ZPTR 1TMJA 4LVOP 3BGUA 1S5ZA 3HZGA 3PM9A 4F0HA 4DV0J 3BF4A 1V5IB 3FFIB 5GAHU 4FNIA 4KKOB 1VC6A 4NLGA 2OPRB 1RADB 2QEXS 2VF3A 2WB1D 1RHQB 1KQFB 3AT1B 4WP9A 5GADI 3SYZA 4MYUA 2NZ4A 3OXFA 4BHQA 2GAHC 4DR7F 4DOZA 4C8YA 2GMHA 1JLEA 2B4UA 1WKJA 2CDRB 2HGNA 4KV8B 5ETRA 5KFJA 2UUAF 3EMTA 3PR4A 2JVOA 1VK8A 1VJQA 2QL5B 5JVGQ 1WF0A 5KFCA 1KTVA 2V9WA 3E01A 1PO6A 2ZC4A 1S9FA 2CQCA 2GQQA 4KR0B 5KFRA 2NS1B 5ADZA 5LL6d 1YI2S 4QR0A 4F8RA 3GE9A 3SDEB 2WZ1A 2NSCA 4KC5A 4DPUA 2K3KA 2H5JB 4CT9A 3G9CA 1QM9A 4HHHA 2XY6A 3ICLA 1OQ6A 2MYFA 4H4OA 2GO8A 3GR0A 2CYYA 2GFFA 4G1PA 4PQUB 5HMXA 3KKFA 4DUZF 4DV2J 1Q8KA 4FF3A 2H65B 4EU0A 4YOEA 2YY3A 1NJYA 1D9DA 1BQNB 4OZLA 1CJVA 3J7YU 2Z2LA 5IS2A 2QV6A 5HAOA 4KH0B 3IWNC 4RW4B 3BH6B 4ZDNA 2IVFB 1L3KA 2KM8C 1FFWB 2XMVA 1HA1A 2Z2YB 2MKJA 4FKYA 1W2IA 3AXKA 1RTHB 4B9UA 3HFKA 3CDEA 1TK0A 3VR1A 1JIHA 3JQJA 4OI6A 4HT5A 1TZ0A 2LECA 1V5VA 3P96A 1MROB 3OXLA 2XLKA 2WCXA 5HANA 3K5OA 3ETOA 1N5SA 4NL5A 1NO8A 4QPXA 2CPDA 5CHCB 4USVA 3H40A 4OZNA 1S1TA 2VKZG 1RWOB 1HBOA 4C98A 3W2WB 4FYDA 2E5HA 1C2PA 3IN5A 4MKVA 1PSDA 3AOAA 1HNWJ 1ZBTA 4X4RA 3KK2A 2HGLA 4L3NA 4DX8H 4DSEA 1BWVA 1CS4A 2QYGA 2X3GA 3GIIA 3PR5B 1H2VZ 4JBCA 2KG0A 2VQEJ 1NB2A 4WP8A 2AMCB 1YGYA 2HWHA 2SXLA 2W9BB 3MEEA 1A9NB 1S1VA 3GWCA 3TX0A 2XYPB 1RTDB 3A3PB 2R8KA 2GQCA 1FKOB 3B78A 2HZVA 1EB0A 2AW0A 2MQQA 1C0TA 2MHEA 3GV8B 4CYUA 1U2RA 2H3EB 1QVFR 1P27B 1RT5B 3GJSB 3LTOA 1YLXA 3DRPA 1QSSA 1UL3A 3UVJA 4IR9A 1S6QA 3CGIA 3HT3A 5CA5A 4FDFA 3GONA 4L74A 5B7WA 4UZBA 3OQ2A 8ATCB 4DL3A 4OZ3A 3NMRA 1EKRA 1XMBA 2ZE2A 2XMJA 3EVWA 4E2FB 5KFIA 4KB7A 3BGOP 2E1CA 1PIEA 1F9HA 3OL7A 4GKKF 2R7VA 4AXJA 2R7UA 5ETTA 3C6UB 1HWIA 3B4MA 4LSNA 2C2KB 3HFZB 1HQUA 3P5TL 1X5PA 2CQPA 2OGUA 1T7PA 3KK3A 3TAMA 1OJ4A 2FIUA 1Q8LA 1FXRA 4U6PA 4RUHA 1U8SA 1PYOB 3V6HA 1REGX 2OMOA 3A8EA 3POTA 3GQCA 2MLZA 2VH7A 2VBWA 2B43A 3M2RA 2ZH4A 2G2ZA 1D8YA 3V6JA 4OFZA 4MKBA 4TYBA 1G6BA 4PUOA 5DG9A 2C3OA 2NYIA 4CCHA 2BZ2A 4G65A 2Y8YA 5DDRC 1RT1A 5T14A 4FP9A 2BKOA 5AJ3J 2ALYB 1IBMJ 1S77D 2Q3PA 2JEIA 1X4EA 5GAEU 3H5SA 2JDJA 2YWWA 1YVFA 3ZXWA 2M7SA 3DFEA 5ETKA 1YJTA 3IBWA 3IRWP 1G7CB 3R5JB 4B3TJ 4G1QA 2J9DA 2KL8A 1F2HA 2R2SA 1IBLF 4YFUA 4FYYB 3DRSB 1U09A 1PJ7A 3MUVP 4EK2A 1WEZA 4LQ3A 2LU1A 2ZNYA 2XG8A 2LQ5A 4H4KC 2YWKA 3KDNA 1SIWB 2QLFB 3FBBA 1RCXB 3SIPB 2XNQA 3TZXA 4C4WA 4I2PB 4OX9J 4PWDB 2N7YA 4NCAA 2QC3A 1WC6A 4QQBA 1KONA 1QAIA 2BMBA 2C3YA 1D09B 3L7PA 2LQ9A 2XHCA 1XR5A 4NLDA 3MD1A 3SMZA 2PN6A 1IJFB 4KIAA 1FFGB 4DN9A 1DURA 3DI6B 1GXUA 4YHHJ 1N34J 3OJUA 5J2NB 4DF8A 3LO3A 4JP8A 5AXKA 4OZ2A 3J81U 2JC1A 2R7XA 3MM7A 2HQIA 4IKAA 3NLCA 1NSKL 4K2XA 4B9MA 1S7IA 4IG3A 4ZIVA 3VV2B 4U8YA 2FVPA 3DLKB 5E0OA 4U67Q 4O3OA 5K8NA 3CDAA 3CJ3A 2Z0GA 1NSAA 1MSWD 2P6SA 4WK3A 2FLNA 4ZP6A 2XMAA 1WC3A 2HEKA 4M94A 1URNA 2XSJA 4DV5J 2PGCA 2HNZB 1YX2A 2DNKA 3NCRA 4AUKA 1JJCB 5HVFA 3CB4A 4PXDA 4JOUA 3GIJA 4R5PB 4KO0A 2KJWA 2A6OA 4R8UB 5A0YA 1P9YA 2CQ3A 2J7KA 3GB0A 3BGRA 2GGPA 1Y3KA 3M8PB 2MJNA 4OI1A 1YBUA 2FVCA 2CDQA 2VD3A 1U49A 3M2VA 4ZPCA 2XLIA 2LXIA 4LBPA 3TO8A 4JV5F 1R8BA 2YWHA 2V50A 3KLHA 4N47A 4WIQA 2OJ3A 2I0XA 3W9JA 5AE2A 1K1QA 1HI1A 3MFHA 3OTOJ 4NE9C 2KFZA 2IC3B 2ZH3A 3H20A 3RAXA 4YDDB 3EWGA 2B5JA 4RNFA 2FJAB 5C25A 5FLXU 2B7BB 2DNPA 5D0EA 1U2FA 4QIWD 1Y10A 4KGMA 4N77A 2QA4G 2K2PA 3MD3A 4Y65A 3FGVA 2MKSA 5KFFA 1XQIA 2HQDA 1S0NA 3D68A 3HM9A 3ZO7A 4NI2B 2VASA 4NA3A 3WX8A 1HFEL 1AB8A 5LJ3Y 3PVXA 1FJCA 1N6QB 2JFDA 2QFIA 4V19J 4A8QA 2OPSB 1FI4A 4KTQA 1J5OA 1Q4RA 3BREA 4NXNJ 2V8HA 1IWGA 3W7BA 3DLJA 3V6DB 4OYXA 4C9DA 2AHOB 3CO9A 3R6GB 3IG1B 4RNMA 2GS8A 2R2UA 3MMCA 2IA6A 1XNQF 4IO1A 5AXLA 2RDDA 4W4MA 1NZ8A 3H25A 5D0RA 3FFIA 2V34A 5CZXA 1NH8A 5L38A 2OPRA 1U2CA 1YRXA 1UVKA 1D3WA 1RT4B 4J9VA 4QIEA 4C7QA 1MMLA 3LF0A 4DHVA 4NYPA 5FDLA 1G4CA 3O5TB 1M1HA 3K17A 3T5LA 1UZDA 3Q8YA 4AT1B 2YNHB 3T9NA 3O2IA 3RRKA 4X4SA 4KV8A 2GIFA 2ZH5A 4ATNA 4CTAB 4K4WA 3UFCX 4WIIA 3DYAB 1GMVA 3J7ZT 5I3UB 2ZHBA 3ENVA 2IY5B 1XEZA 1GTEA 1RHKB 1W7WA 1EARA 3CUNA 3SDEA 2Y1JA 4URQU 1AFJA 5F0UA 2G4BA 1T9TA 3KHLA 4J9RA 4I67A 2W2MP 5F41A 2HWIA 4PQUA 4OHVA 2NPFA 3TP2A 2VV5A 3OL8A 5DM6Q 3ZTOA 4DF4A 1DRZA 1BQNA 3KK1A 3UN5A 2PFDA 2HK3A 1JLBB 1M90T 5KOXA 3MOJB 3IM9A 3GIKA 1WG4A 2IJNA 2MPUA 3ZZZA 4RW4A 4ZVSB 1TKXA 1RTHA 1N32J 2O67A 5T41A 3PYGA 2ZH6A 4EI2A 4LFAJ 1MROA 1H7WA 5CYJA 2BXJA 5FIIA 1IR1A 1R0BG 4UTGA 3HXMA 3HMJG 4ZN3A 4H4KA 4ZLLA 5F8LA 3MWBA 2WVCA 4OI2A 5MAOA 4DLGA 1JLCA 2YNFA 2HPUA 1UVJA 1WSVA 3GFXA 4ES3A 4P2SA 1RT3B 1ACMB 4ZVPB 2R7TA 1AFIA 3RBZA 3K57A 4X65J 4IOBA 5A8WB 1WJ9A 1OSDA 4CM2A 2XTJP 3W5ZA 1M5VC 2OO4A 5ITHA 3A12A 1ZTTA 4I1TA 2FJVA 3MM8B 3HHLB 2L48A 3W62A 4BCAA 2LFVA 2W9BA 3SI8A 5LXRA 2K3IA 1RTDA 5F3TA 3X3UA 1NKEA 1FDBA 1OSCA 3PW2A 2HFOA 2VJUA 2M5YA 2EW9A 3GIMA 5I4MA 1UA1A 4RNOA 3CSKA 2LQ8A 1X4BA 4RW7B 3R97A 3KLIA 3CC7S 1IKXA 1TTHB 2HHWA 4B9NA 4KHPJ 3ISZA 3VTIA 1TKDA 3UE2A 5HN0A 3PEHA 1T02A 5B0AA 2AT1B 2DPIA 1EP4B 4WE1A 1ZM9A 2KTQA 1SL0A 4PG8A 3V81B 3LH2S 1HNZJ 3K5NA 1WUUA 3PACA 1F2GA 4CO3A 2IPOB 1WSRA 2DH9A 4LT6A 2OTJS 5JVHQ 5KG6A 3IS9A 4CLUA 3K7RA 4Q0BB 3CVKA 3C6UA 2JNJA 2DD8S 2CQGA 5HO4A 4PABA 4FXWA 1U1NA 3UN2A 4ZVQB 4IRKA 2Q79A 1VQOS 1VQLS 3G96A 3P4UB 4HH1A 3GJTB 4WCEQ 4RR5A 4KHMA 1SKWA 3VGTA 2ZUGA 3GFHA 5BR8J 4L72B 1EKSA 4DX5A 2RSQA 3PIPQ 3M32B 3S6EA 4PPZA 1UWAA 2E9TA 2NUUG 5B09A 3RW6A 2DXFA 2QX0A 2H5IB 3Q8QB 2ZZTA 2J0SD 4NMXA 1C1CB 4YB5A 5DS7A 4RO0A 2W7PA 3UN3A 1SCJB 2MQPA 2QL9B 4X62F 4C3KA 2HS0A 1VQYA 1ICEB 3HZEA 2B3TB 2AV5A 3KLGB 1RB0A 4DV0F 2YX1A 2Z57B 2AX1A 3FJ2A 2YKMA 4CDIA 1RP5A 3VQTA 2BJEA 2EC2A 1WELA 2OELA 3IRXA 2RRAA 2H4WB 1NU4A 2QTWA 2XMUA 1KFSA 4F25A 2V8DA 4PWDA 4ES2A 1B4SA 5GAHI 5C7PA 2GNKA 1VYAA 2QLJB 1S6UA 3T1AA 2ZD1B 2OP5A 3ILJA 3D1HA 3MEKA 4RNHA 1B3TA 2RJZA 1FT8A 3AOBA 1OQ3A 3FCVA 4PXBA 1JKHA 3J7A1 2QFJA 1NPKA 4BDPA 4X4OA 3QLHB 2VG5B 3PW0A 1Z4UA 3GV7B 3M1VB 3TX8A 3DI6A 1FERA 4ED3A 2AKWB 1FDDA 4GC6A 4DV6J 2M8HA 5J2NA 1S6PB 1WORA 2HHPA 4MK7A 3DN9A 3FUYA 3TUJC 5DDPC 3HHLC 4Z37A 4F04B 3HVTA 4QYRA 5K8PA 4LFBJ 1UEUA 1VQ5S 4O44A 2FYXA 3OUYB 2J76E 4A8FA 3ENWA 2CUYA 3LP0A 1NKCA 4XAKA 3DLKA 2YNGB 4WKRA 2V8VA 4URSA 3R2DJ 1RK8A 1JJ2R 2P8IA 4L75A 3FKBA 1LKZA 3DKDA 3V5RA 2E5IA 3TAPA 4OYWA 1A0OB 3CD5A 4OMFG 4DL0C 1TL1B 3NG8A 1NKBA 2VFTA 2YX7A 1R0AB 1KRPA 3W61A 1SH2A 1RYSA 3PEJA 5HP1A 3K89A 3J7YI 2ILZA 1WDTA 4LF8F 2JL9A 4R5PA 3A3OB 1T94A 4DFJA 1X9WA 1S4EA 3D2WA 4NLPA 1R3NA 3J80U 1F3FA 3M8PA 4FZVA 1S7HA 1CULB 2N82B 2CKWA 4DU8A 2DGOA 2EKNA 3SXLA 2F4VF 2UUBF 2PFFB 2PI4A 3KG1A 4LREA 1P1LA 4LSZB 2DT9A 3OR1A 2PD1A 1VIOA 5ETVA 5KFLA 5IC6B 4DCPB 2ZZNA 1KQSR 2I5JB 1VQ6S 2VOPA 3KJQB 2FHKA 2GIRA 2Y3YA 2VC0A 4ZLPA 2AJQA 3LWLA 3UCZP 2CPJA 4ZHRA 4ZVUB 4A8SA 3J81Y 4USKA 4I6YA 3JXOA 3UDLA 1Q78A 1OYEA 4DL5A 2XCAA 2V6AA 3HJVA 2RVJA 5KFYA 4OYBA 3GIRA 2HGMA 1B7YB 2VQEF 1F0XA 1N33J 1SIZA 1VLOA 4DL6A 3I87A 2LQJA 1KVJA 2K8GA 4ZJLA 4NYOA 4LFCJ 1JLAB 4K7QA 3G6ES 2OPSA 1Y3JA 4TYAA 4J91A 1FNOA 3MR3A 3MEDA 3N01A 4HHUA 4P7TA 3NXZA 2KG1A 3MCOA 3V6DA 5DG7A 1O6XA 4LF4J 2MTLA 1FK9A 1MMDA 2BEFA 3CMES 3BPSP 2KZZA 3ZZTA 3PRVA 1IM4A 2XWXA 2DEIA 2OPQB 5CD4H 1S57A 2YKQA 3OFFA 1RLCL 4Y34A 4F4AA 3OBIA 3DDKA 4RW8B 4B9VA 5F8JA 4MKAA 3TR5A 4EZ9A 4NLTA 2AX0A 3HF5A 3F41A 1W25A 2P6TA 4ED5A 2O66A 3CCMS 1A7GE 1QUPA 2F65A 4I2QB 1TUGB 2CG8A 5J2PA 4NXMJ 3C2PA 1ZPWX 2HAFA 1O0PA 3BEGB 2A0FB 4B9LA 1VRUA 4ZIWA 3QQCD 4YDXA 3O8WA 4CTAA 4X4VA 1VFJA 2CZ4A 1JLGB 4R0JA 5FLXY 2IAJA 3DYAA 1UFKA 4F0KA 5I3UA 1OY9A 3QZ8A 2KN4A 5LMNJ 1NEEA 5B08A 2RF2A 2BRKA 3OTDA 2QLBB 1WC4A 2HAIA 5C42A 2F4FA 3WC0A 3VAKA 2MB0B 1UPMB 1X7VA 5AJ3F 3HSJA 1TUWA 3GSIA 3QIPB 4ZPDA 3CCLS 1XR7A 5GADU 4ILLA 3IWXA 5F9LA 2YWGA 1DQAA 5LSLA 5DLGA 1JLBA 4B3TF 2MZ1A 4EO8A 4B9TA 1RI7A 2C3PA 2NXEA 1RTIA 2BE7D 4P9SA 4X4PA 3O1LA 3TVKA 2EEYA 2RE1A 2BKPA 3MCMA 4ID5B 4F0MA 3QATA 2UUAJ 4OX9F 1S1WB 2GAGC 1X4DA 1AROP 2M4MA 3QAUA 2WAQD 5KFBA 1W2BR 2ZBCA 1FKAF 3K5PA 4UUXA 2KYZA 3M8WA 5KFOA 4YMEA 4U7CA 2CQIA 3MPVA 1U6ZA 1S10A 2CA9A 3AD7C 3GJRB 4IFYB 1N34F 3PHTA 4N76A 2HHTA 3DGPA 3LGHA 4P72A 3OSPA 1RT7A 3CDWA 3CIZA 3JTNA 4RWXA 5C24B 4NCGA 3FEXB 2M9KA 5A8WA 1X5SA 3M8ZA 1PYTA 4U95A 2UUTA 4OYMA 3IP0A 1TL4A 4ELVA 4KJIA 4ZS6A 3HPOA 2RDJA 3HHLD 3PG9A 3QBCA 3QRRA 3HLUA 3NP5A 3SEOA 3R7NB 3I0SA 3H42A 4DV5F 3KFWX 3BSNA 1P1TA 1HNVA 1IXKA 1KKHA 2MQLA 3MCNA 1XK8A 1TVRB 4LSLA 4QCLA 4RW7A 1KTQA 3Q24A 1EHWA 2CJXB 1YIJS 2COLA 2E1AA 4N5SA 2Y8WA 2ZWPA 1HD1A 4I7FB 5E7OB 2DJWA 4KT0C 2EXUA 3KJFB 3DRYA 3MMAB 1EP4A 3PFOA 1U26A 4JI8F 3M6VA 2CQDA 1K47A 3I4HX 1AXQA 3TJ9A 4NOHA 2FJWA 4GVBA 3MM9B 1YG0A 2CXEA 3CJ0A 4U7UK 4HI1A 3DLLQ 3MTJA 2XY5A 3UDVA 5CYQB 2DHAA 3CJRA 4Q0BA 3ZTQA 4CT8A 2DCLA 2RKIB 3BSCA 4OJGA 1TR0A 5J2QA 4FXVA 3GJQB 3W9IA 3JSMA 4WZMA 1HR0F 5JJBA 4WYLA 5T7LB 4Y2KA 2KJVA 4R25A 4AL7A 2C28A 3PJ9A 2CNLB 3QGPA 3M32A 3CF5Q 3SQGB 4IDKB 1RAFB 4AL5A 4NLOA 1QY7A 4ZLJA 1DTTB 3BKTA 1X4CA 4E8UA 4A48A 3Q23A 5LM7E 4NXNF 1KNZA 1T8EA 1HQEB 4JI6J 2OI2A 1SH0A 1Q7YT 1SJ4P 5KTQA 2R8HA 3CT9A 1GAOA 2AJ4A 5CYMA 4HVZA 1SL2A 2P9EA 3KLGA 1DQ8A 2DY9A 1RHJB 4USWA 1ZM2A 2GVDB 2WSFC 3HHEA 1RISA 3CULA 1FRKA 1JJHA 3KG0A 3PO5A 2MKCA 4JI3F 4K4TA 1YBTA 3DXSX 5HL7Q 1Q0NA 5D8HB 2C2RA 3D6HB 3DM2B 4N8NA 2XC9A 3WDOA 2OMLA 4EBEA 2QN6B 3A8KA 1XMQJ 1LWFB 1WEXA 2E1RA 3VZHA 1RHRB 2OKQA 1X5TA 5DZ7A 4IH6A 1RGVA 2X3DA 3VQSA 1LW0B 1V3RA 2WHOA 4EBDA 3ZZYA 3I6PA 1HNXF 4ILMA 2ZD1A 5DG8A 1WF1A 4J9LA 1R43A 2EG1A 4OIXA 3RB6A 2HURA 3W5YA 4J9NA 4UW2A 2R3VA 4Y2IA 3QLHA 2VG5A 4ECSA 4DMZA 2BV3A 2KKHA 3M1VA 2QGFB 5BJRA 1ZZFA 2RHSB 4C8OA 1TV6A 5LSOA 4P74A 1AUSL 2DO4A 4K4UA 2WSCC 3O3LA 3CCVS 4KQZA 2L41A 5LT5A 2IHR1 1IQZA 4F3QA 3Q8RB 1S12A 2DGVA 4EWTA 1HBNA 2J6UA 3EM1A 4GKJJ 3VAMA 1ZAXA 4DZ6A 5ETOA 1BY9A 5AE3A 2CQBA 3FNNA 3D1QA 1IBLJ 5A6PA 1MN7A 4B02A 5IT9U 1FRIA 4O3SA 4FS1A 2EFGA 4CLSA 3QO9B 4DQQA 4IH5A 2OSRA 1KR4A 3G86A 4WFNQ 4LRCA 1R0AA 4OHXA 1NK4A 4O23A 2K1RA 2XZWA 4L76A 1RBAA 1V9OA 1JLEB 1N32F 2O5DA 1SC3B 4LQ9A 2VODA 2R8JA 2W4DA 4P52A 2MGZA 4WK1A 2R7SA 1GX5A 3RB4A 1S6OA 1R6YA 3RTVA 4LFAF 4F3OA 4X4NA 1NCLA 3FVYA 2ACMA 1D0EA 3LP2B 2R7OA 4DQRA 4JUZA 5KG4A 2CAJA 4LF5J 1VQMS 3ISNC 5IC4B 3CD7A 2PC6A 2FJDB 4DEZA 1RTZA 3ZZPA 2BJ3A 4I69A 2FVSA 3SCJE 2Z58B 3D5MA 2QE5A 4H4OB 3T5KA 1VMBA 2G0JA 1URRA 2XSFA 2FC8A 4HHJA 1PAUB 4MMOA 2VDIA 2V69A 1N5TA 3ITHA 3CCJS 1VLYA 2BQ3A 3PDNA 1SC6A 1GK8A 3AB2B 4DPOA 2RB7A 1JXLA 1UVNA 3IWLA 3IGVA 4EYHB 4BBYA 4M1KA 2QA1A 1M5SA 2YVSA 5KG1A 2NUHA 3MGJA 2EVZA 3EVMA 1JLAA 3UDEA 3NGTA 3ELHA 1L3VA 3M9NB 1K73T 3WIUA 1RCOB 2YWEA 1TELA 5HK4A 3LGNA 4GVLA 2XMKA 5HATA 3S1TA 1M5KC 4ED2A 2WOMA 3H90A 3M2UB 4KPYA 3NGRA 4U8VA 3CJ5A 1K1SA 3R7SB 5HLFA 4NEYA 3CEDA 1MLAA 2R42A 4KHPF 3DLBA 4JV5J 3Q2TC 2LXFA 1HBOB 4ZPVR 1F9FA 4TXSA 3E2EA 4RW8A 1BQMA 1NDCA 3J80Y 1DJ0A 4MT1A 4PEOA 8RUCA 3RJMB 5DLFA 1HNZF 4YP3A 4QOTA 4Y2CA 3H5YA 3H2VE 3D7SB 4OZ0A 1NM2A 1FNXH 3HO1A 4QWBA 1U8WA 4Q44A 4ICLA 3EGZA 3KK2B 2JZ5A 2AU0A 2CQHA 3HSZA 2UXCJ 2NPIA 5EX3A 1YHQS 3IGNA 1K0VA 4I2QA 3I82A 2LA4A 3P5BP 1QLNA 2CPHA 3VF0B 2G13A 3CE8A 4IFVA 3IC1A 6AT1B 3DLHA 4PG5A 2KRBA 1YJ9S 2EFOA 4DUTA 3NY0A 4LMZA 2KB2A 2Z4PA 3DGVA 4YB1P 5LMUF 4QYZJ 4UOHA 3MEEB 1TKTA 3CIMA 3NWGA 1KEKA 2V2QA 3SCIE 3JYTA 2VPWB 3GTYX 5F8GA 2ABYA 2CJQA 1U4BA 1KHVA 1DARA 1BE4A 1SJ1A 1WOOA 1SV5B 2ZH8A 3RB3A 3M9OB 4QWEA 2YWFA 1BUXA 1I94F 3DRPB 3UVJB 2Z56B 1S6QB 1XIQA 4Q2MA 2WSEC 3QIPA 2MXYA 1N5VA 2HHXA 3NKYA 1R6VA 2YTCA 2ZE2B 2PMHA 1NJWA 4F50A 5D3GB 4CLLA 2JLEA 4KSEB 4CH0S 4QWDA 3KHGA 3RRHA 4F2SA 2BJ1A 1Q95G 4O3PA 1K0TA 5EUHA 2HHVA 4ID5A 2QRRA 1HQUB 2XS5A 3KK3B 3TAMB 2HFVA 2EC0A 2CNNB 1S1WA 2V68A 3J7Z5 1VRTA 1RLDA 2PO4A 1UMJA 2G0IA 3POTB 5HQMA 3PW7A 1H3DA 2U1AA 4HDHA 3QZ7A 2QL7B 5DO2A 1HMVA 4X4TA 3Q83A 3L09A 3FSYA 1WG1A 1RAIB 3P3DA 2M0GB 1U1OA 4IFYA 4PUOB 2L3MA 3A3NB 4DV6F 3LP1A 4ALZA 4XPEA 3FEYB 3NOGA 3KLEA 1RT1B 2GW8A 4EYIB 2B7CB 5IV3A 4EGLA 2MKYA 2X1AA 2BE2A 4J5OA 4M5HA 1WG5A 2EKYA 1RAGB 4QYZK 3AQOA 4G1QB 2IBOA 4ZJQA 1FD8A 1T11A 3A1YG 4DR3J 4GMKA 1WACA 4F4ZA 1NBEB 3PNIA 3OL9A 4DJBA 4ZKAA 4ZPWR 3JTPA 1RAJA 1RT6A 4LR7A 4C8KA 4DR2F 1U1QA 2DNMA 3GCXP 1UKUA 1NK0A 5D4PA 3E8OA 3GG0A 1DLOA 2AIRB 4DX6A 4AQYJ 5HVGA 1TVRA 4ID8A 3F73A 4ZVGA 2BJ7A 2I9SA 1JXVA 2GHPA 2NCKL 1KSPA 1D1UA 1SQEA 2HS3A 2W24A 3LPEA 4YR0A 4I7FA 3M6XA 4DL2A 4Q7AA 1LNQA 5DQGA 4NLQA 1FX4A 1R89A 4K4YA 3OLBA 3JAMU 3C46A 2B56A 2D9OA 3QSIA 2DXEA 4RW9B 3PTWA 2VOOA 4OL8A 4P2XA 1WI6A 2M88A 3Q89A 1UVIA 5U47A 2VBYA 4EZ6A 4DL7A 4ANCA 3NGDA 4IG3B 3BGLA 3LAKA 4ER8A 3ISND 3FDSA 2HRUA 4ZLNA 1RWKB 3LQVA 2KZMA 3O44A 3MTKA 3N79A 1S97A 4LRAA 2VG7A 3KYLA 1YSJA 2ERRA 3VHQA 3PRBA 1PILA 3TZWA 4MKYA 2XSJB 2MZSA 4EUVA 2ZH1A 3IR5B 3R7BB 4BC9A 2VICA 3Q0AA 1NK5A 2VG6A 1C4CA 1YBAA 3H7HB 4LFCF 4MH8A 1X4HA 2DGXA 2D3UA 2KT3A 2F5GA 1ZZNA 3QAEA 2V5HG 5CZVA 4KO0B 3HSGA 4MAKA 4PQAA 5MLCV 2P9CA 2RHQB 3D3BJ 3BGRB 2GGPB 2DHSA 4CH1A 3HK2A 2N4CA 3L3CA 5CAAA 1HYSB 5B0FA 2VA2A 3EYZA 4C2MA 5KFSA 3FCWA 2AF6A 3AJ2A 2EBGA 1OWXA 1OPZA 3W3SA 1T3NA 5E3AA 3C6TB 1J2VA 4K50A 4RBTA 3R9LA 2VONA 4RUBA 3G6XA 1LWFA 2XULA 1PAEX 2FHMA 2RT3A 5C25B 1SJ3P 2BANB 1BC6A 1PJ5A 4ZVHA 2ZH2A 3GZ7A 1QJHA 4NXMF 2W8LA 4J90A 2PEBA 2KHCA 1XMOJ 4HL9A 1DHMA 1TK8A 5IQ6A 1KBRA 3EZOA 4J9KA 1KLNA 3QYYA 1VBKA 1G2EA 5EN1A 4X64J 2AEFA 3D6MB 3GR1A 3J7AN 1J5OB 5A2QU 4Z2XA 3HFVA 3RBXA 2RU9A 1RJJA 2R2TA 5LMNF 3CTRA 3ET6A 1PC4A 4Y2MA 2ZUAA 4X62J 3RUBL 1RTJB 2HBZB 2JEFA 2ROEA 3ZZUA 4K4ZA 4WTOB 2BW7A 1H73A 4FYVB 2HIQA 4K5SA 3N6MA 2JJ4D 4C8MA 1U45A 3RW7A 1LFPA 3U02A 2ASYA 3OLAA 5A8RA 3G87A 2FLLA 3NS7B 4OX7A 2QMWA 3MECB 2VFRA 1IBCB 4O3QA 3QO9A 3PJXA 1WF2A 3M05A 5HQ8A 2C3UA 2BKNA 2JHEA 5FDLB 1LK5A 2PDAA 1SJFA 2DVIA 4JV2A 2G9OA 2FTRA 4C0BA 1M0SA 2JSXA 2CZVC 4PZVA 2J9DE 5CH7B 1KQKA 1V3ZA 4ELUA 2WBMA 1SKSA 3MAAA 2V94A 3LP2A 3UI3A 2NREA 2W4CA 2U2FA 5GVQA 3KJVB 5G0RB 3CCES 3OHAA 2JFKA 2DO0A 1HBUA 4TLQA 2WRMA 4WFAQ 1KVKA 3ZNJ1 2A2CA 3K8WA 1IJEB 2B8QA 4DV4J 1I5OB 1S1UB 3BKUA 3VWSA 1DFDA 1T9XA 1NHVA 3QFHA 5IT4A 1S4FA 4BS2A 3EGNA 3KK1B 3U27A 3BB5A 1OPIA 1O5JA 1GMUA 1KFDA 1QTNB 2DY1A 3PHEA 5L1IA 3LAMA 3HHDA 5IM0A 1U1PA 1OO0B 2M8DB 4YS2A 1TKXB 1RWVB 4LF8J 5D4OA 3RAQA 2YNIA 3R5CA 1GQEA 1WKLA 4W98A 5HMYA 4NLXA 4RKUC 2R8IA 4DCJB 3KHHA 4TKTA 4KGZB 2LVWA 4Q8FA 4K2JA 3M2UA 2F4VJ 3MZIA 2UUBJ 1NDLA 4O0NA 2K7KA 2E1MC 1JLCB 2YNFB 2J0WA 1ZAVA 1PBUA 3CD0A 2VA3A 2IJFA 2HNDB 1T9UA 3PYFA 2QSWA 2YPYA 5LSRA 2FHJA 5H9EJ 5CXTA 1V3SA 2UV8A 5L1JA 3F44A 1VC5A 1H2UX 2FHJD 1KHWA 3OR2B 5IZHA 1O8BA 4LJMA 4GRSA 4YR3A 4QW9A 4EFAC 4KH1B 2FJEB 1SKUB 1Y00A 1Y5NB 3KNAA 4P10A 2YKOA 2UP1A 4J9UE 1Q8IA 4MK9A 2MQNA 3IR6B 2OIHA 4FBTA 3CJ8A 5IWAJ 2OEKA 3H59A 2B8PA 4NLUA 1BHNA 5J2MB 1PBAA 2ZDPA 3D6TB 1G1XA 2X51A 3QMQA 3SSRA 4DXLA 1UFLA 1U7LA 3HI9A 1SV5A 1FE4A 2FLOA 4CWBA 4MJKA 2H5EA 2V2KA 2G0CA 2CG4A 2JRSA 3KLIB 2KT5A 1IKXB 3V4IB 1RWWB 2F8EX 2B9YA 1K9MT 1X0FA 4LR9A 4JI6F 1XTZA 2Y0SD 4BC7A 3TA2A 1JK9B 4C3LA
chains in the Genus database with same CATH topology
1JLQB 1IKWA 3MMAA 4RBUA 4QR1A 2VQEF 5HMWA 4WE1B 1F0XA 2F1FA 3FRZA 4ERDA 1SH3A 4ZVEA 3R3TA 3M4XA 4QU7A 1SIZA 1FRMA 3N5BA 2XNRA 1B0VA 1U25A 4YR2A 4DL6A 5D3GA 4TLRA 1WHWA 3M9MB 3I87A 2LQJA 5EWFA 4ZPBA 1KVJA 3MM9A 2K8GA 4WU2A 4NYOA 2RU3A 2UUCF 4DS4A 1JLAB 4J9MA 1RDRA 3MM7B 5KG5A 2OPSA 1Y3JA 3G6ES 4TYAA 1Q81T 1VK3A 2RQ4A 1XNRF 4A8YA 2ZOFA 1FNOA 4MTPA 3D54A 3D1OA 3MR3A 3MEDA 1FF2A 2GMJA 3IS9B 3N01A 4NRUA 4RUCA 2MZQA 3RR8A 2AWZA 2N3LA 5CYQA 4P7TA 3OVAA 1RWUA 1FKPA 3THVA 1QSLA 4D3HA 2BA9A 2RKIA 2CQ4A 2MKIA 2KG1A 2KVIA 3DOKA 3V6DA 4Q43A 2LDYA 5DG7A 2V4JA 3LW5C 2OSQA 5BYRA 4DV1F 4USHA 1FK9A 1MMDA 3TA1A 3UR3C 1XMQF 1S0VA 4C11B 3CMES 1NK8A 4MIBA 2KZZA 2AQ4A 3ZZTA 1NRKA 2XS2A 5DQIA 4RWWA 3IA0A 3LOUA 3T1HF 1IM4A 2XWXA 3ZFVA 4QIGA 1Q53A 2HVHA 1I1GA 4CO0A 2QLXA 1G3OA 3RAMA 2OPQB 4LUBA 3VZIA 1ZOTA 1WWHA 5CD4H 1UWBA 4M5DA 5IQQA 5T7LA 3S8SA 3K58A 2YKQA 1U24A 3OFFA 1VI7A 4Y34A 4DQPA 3OBIA 3DDKA 3W2WA 4J9OA 5E3QA 4DLEA 3RU0A 4RW8B 1N33F 4B9VA 4HLBA 1C4AA 1Z1ZA 2D1CA 2BDPA 1BD6A 5F8JA 4X84A 4MKAA 3TR5A 1UJ6A 4EZ9A 4NLTA 3NAHA 2GJ2A 5A8RB 4I6AA 2AX0A 2JEJA 2JX2A 3SFUA 3CCWA 3SQGA 2MKKA 2HS4A 3F56A 4IDKA 4F3MA 4KFBB 4FNHA 3K8VA 3UD3P 4ZP9A 3HF5A 3F41A 1W25A 3I4PA 2BYCA 2P6TA 1DTTA 4UY85 2WK4A 2GHWA 4ED5A 2O66A 1U1RA 3CCMS 1Q7LB 1R8AA 1A7GE 4HT7A 5AXNA 3MMJA 4FN5A 3NGKA 1UFWA 1QUPA 4I2QB 5A0YB 1HQEA 3PW5A 5J2PA 3T6BA 3MR2A 3C2PA 1ZPWX 3UNGC 3TUZC 1YITS 1T03B 4WKYA 2BOPA 3PXGa 2XEXA 4LF4F 1X4FA 2H9ZA 1O0PA 5DQHA 3GILA 3MPYA 3BEGB 2R2RA 4B9LA 4M63A 1VRUA 2LMIA 1BLUA 3GV5B 2D3ZA 2MY7A 4XDDA 1JJ4A 3R5DA 1FCAA 3M2VB 4YDXA 5B0GA 5SUHA 2KHDA 3EUNA 1MWYA 4TY9A 5KT2A 3O8WA 3MPWA 4I68A 2IM0A 4CTAA 4X4VA 1VFJA 1ZM3A 2CZ4A 4ZA1A 4GKJF 1JLGB 5DETA 3I31A 4R0JA 5FLXY 2K7JA 2FGOA 2IAJA 3HVWA 5F8HA 3DYAA 4ITSA 3KLHB 4K4SA 2YKMB 5D6GA 1K8AT 2RD5C 3JB9k 1FKOA 1T3OA 4YEAA 4L6V3 5I3UA 2VPZB 1DTQB 3QZ8A 1S48A 1VJWA 3IRXB 3VALA 1S99A 2DNQA 2KN4A 3UPFA 3DM2A 5C5JA 1N5YA 1NEEA 2F40A 2DNOA 4DSFA 3RRGA 5B08A 2RS8A 1UW4A 1V6HA 2C42A 4B17A 2RF2A 1HBUB 2E7XA 3T3FA 1FXDA 2M2BA 2BRKA 2RRBA 3BSAA 3OTDA 3UW1A 4TU8A 4BWMA 2B5JB 1RT5A 1YJUA 3AQPA 5A8KB 5F9NA 1LFWA 2CJKA 4P7VA 2HAIA 3AB4B 4Y0FA 5C42A 5KOWA 3WC0A 1LW0A 3PFEA 2HWTA 2ZITA 2HVZA 3VAKA 2MB0B 4UY8T 1X7VA 5AJ3F 3CPWR 4ECTA 1HW8A 4K5RA 3CMAS 1X9MA 1FTRA 3QIPB 1P8GA 4Y3CA 4ZPDA 3M8SA 2B4PA 5K8MA 3CCLS 1XR7A 5GADU 1LXJA 4ILLA 4FF1A 3IWXA 1LQ9A 5F9LA 4IRDA 2IM2A 2UZAA 1S0OA 2YWGA 2QMXA 2D9PA 4TY8A 1DQAA 5LSLA 1ZYQA 1QAJA 5DLGA 1JLBA 2CQ0A 2YKNA 1SBRA 1VQSA 3R27A 1LW2A 4DR1F 4B3TF 2D7SA 1CEZA 2POKA 3TVYA 1JKHB 2MZ1A 1RYRA 1HI0P 4EO8A 4B9TA 3CD6S 3RB4A 1RI7A 3DOLB 3DOMA 1UETA 3EGWB 2C3PA 4Y6IA 3RBEA 4O4GA 2QA4S 2G1DA 3AA8A 1MW7A 1RTIA 2JEGA 3DU6A 2GIQA 3M30B 4H4MA 4LF5F 2PIIA 3Q22A 4X4PA 4JI5F 2HHSA 2FB0A 2HZCA 3O1LA 3TVKA 3N0VA 4CNYA 5IM0B 1SKRA 3VAJA 3HVAA 4HH0A 2RE1A 1L3TA 2DGWA 1UVMA 2DTJA 2E5LF 2OPPA 2XGPA 4ID5B 4UQGA 1GXTA 1LXNA 1LK7A 2ZKUA 2XBPA 4RW9A 3HVTB 3KMQA 4ECQA 4RUAA 1ZAWA 1FRJA 4C8ZA 3FQKA 4OX9F 2YNIB 1N4LA 1S1WB 4O44B 4USIA 4LF9F 3RBDA 2DNRA 3MMCB 4HTIA 4OHZA 4ZPTR 3OTCA 4LVOP 3LP0B 4JI7F 3BGUA 4NRTA 1S72S 1U48A 4JV1A 3HZGA 3PM9A 4B3OA 1X4DA 4NLWA 1AROP 1SJRA 2M4MA 2J6TA 4DR4F 3QAUA 3BF4A 3DCAA 3IO1A 3FFIB 1CC7A 3MEGA 2WAQD 5KFBA 5GAHU 4B9SA 2XCPA 4FNIA 4KKOB 1W2BR 1VC6A 2ZBCA 4ED1A 1FKAF 4NLGA 2OPRB 2LLZA 1U1KA 3K5PA 1HWJA 3G4SS 4UUXA 2KH9A 4B3MF 3U7JA 1WD6A 2KYZA 4Q5VA 2RRNA 5KFOA 2QEXS 4YMEA 1FESA 2WB1D 4U7CA 3G71S 2CQIA 3MPVA 1U6ZA 1S10A 1JNZB 2P9GA 1KQFB 4Q45A 4IFYB 1N34F 5KFPA 4OJ3A 3D0IE 4MYTA 5GADI 2FD2A 3SYZA 4MYUA 2QA2A 2NZ4A 3OXFA 2DR5A 2DH8A 3BZQA 4BHQA 4N76A 2HHTA 3DGPA 4DR7F 1LV5A 3CDUA 4DOZA 4C8YA 4PCQA 3MR5A 3OSPA 5HP1B 2GMHA 1JLEA 1RT7A 2B4UA 3CDWA 3CIZA 3JTNA 4RWXA 5C24B 2HGNA 4KV8B 4NCGA 1L3UA 5KFJA 4IQMA 2UUAF 3FEXB 2V8GA 2M9KA 5A8WA 5LJ5Y 3PR4A 2JVOA 1X5SA 4KHRA 1VK8A 1NJIT 2Y1RI 1FDNA 4JYAF 2NLWA 5JVGQ 1WF0A 5KFCA 1KTVA 1GTHA 2UUTA 2V9WA 3E01A 3U1MA 3DLEA 1R7IA 4PXEA 2E5GA 1PO6A 2ZC4A 1S9FA 1B7FA 4GO5X 2CQCA 2GQQA 1TL4A 2RUGA 4ELVA 4ED8A 1TK5A 4KJIA 4KR0B 3DRSA 3RZAA 4ZS6A 5KFRA 3HPOA 4PR6A 1TL3A 2NS1B 3G8SA 3PY8A 5ADZA 3EX7B 3PX4A 5LL6d 1HYSA 2RDJA 1YI2S 3HHLD 2IBKA 3MMBA 4QR0A 4F8RA 4I6WA 1LWEB 1YJRA 2E7WA 3GE9A 1KVIA 4FVMA 3SDEB 2L9NA 4AL6A 2NSCA 3HLUA 3NP5A 4KC5A 3SEOA 2K3KA 5DGAA 1KQGB 3OR1B 3R5BA 3NNHA 5FJ4A 3I0SA 4X4UA 4CT9A 3G9CA 1QM9A 2R9LA 2XY6A 2IRUA 3ICLA 1OQ6A 4I2PA 2MYFA 4H4OA 4DV5F 3KFWX 1X8DA 1E6YB 2GO8A 3BSNA 3GR0A 1P1TA 4CO5A 2CYYA 1HNVA 4CZCA 1IXKA 2GFFA 3DRXA 4G1PA 4MFBB 3C6TA 4G1IA 4HI2A 2MQLA 4PQUB 5HMXA 3KKFA 4DUZF 1XK8A 2UXDF 4FF3A 4CNZA 5KFEA 2WONB 1TVRB 4ZHRB 2VPXB 2C22A 4LSLA 4EU0A 4QCLA 4YOEA 1UVLA 2ROPA 2AYBA 2YY3A 4RW7A 1NJYA 5CCMA 1HL6A 1KTQA 2RILA 2BANA 1BQNB 2IA0A 3M6UA 1D9DA 2UXCF 3Q24A 2HLTA 4OZLA 4ED0A 2HLUA 1YIJS 3DLGA 2COLA 5KG7A 4KAIA 3J7YU 4E0DA 2E1AA 3THTA 2OLWA 4N5SA 3MURP 1FJGF 1HD1A 4I7FB 2Z2LA 4IG0A 5E7OB 2DJWA 4KT0C 4ES1A 5IS2A 2VB6A 3DRYA 3FQLA 3UWTA 1IKWB 2QV6A 3MMAB 1EP4A 4F02A 2LKZA 2DH7A 3PFOA 1U26A 2UVWA 4JI8F 3M6VA 3IWNC 4Q2LA 4RW4B 2CQDA 2FVQA 1BQXA 3I4HX 4ZDNA 1AXQA 1L3KA 2IVFB 4OX6A 3TNVA 2EFNA 2KM8C 2VC1A 3KHRA 4NOHA 2XMVA 1HA1A 2FJWA 4QW8A 2MKJA 3MM9B 1M5OC 1YG0A 1JX4A 3CJ0A 1W2IA 3BGFA 4U7UK 1RTHB 4B9UA 2MZTA 2W25A 3HFKA 4QZVB 2IYGA 4HI1A 3DLLQ 3CDEA 2CVEA 2MMYA 3MTJA 1TK0A 3VR1A 2VFUA 1JIHA 2ROGA 4CO4A 4OI6A 3MEDB 4AXIA 5KFDA 1L3SA 4HT5A 1N5QA 1TZ0A 2XY5A 2GHVC 2LECA 5CYQB 2DHAA 3P96A 3N6NA 3QGHA 4Q0BA 4CT8A 2DCLA 1MROB 3OXLA 3X1LB 2XLKA 2RKIB 3BSCA 2WCXA 2J9CA 4OJGA 1TR0A 4DV2F 4I0WA 3K5OA 5J2QA 4FXVA 3ETOA 3I5AA 3VAFA 2ZJPQ 3G8QA 1FK9B 1N5SA 1RTJA 4NL5A 1S0MA 4O3NA 1NO8A 2W9CB 3JSMA 4QPXA 2CPDA 1ZPVA 5CHCB 3H40A 4OZNA 4WZMA 1S1TA 1MU2A 1HR0F 2VKZG 3BDEA 5L1KA 1KOOA 3Q8SB 1HBOA 5HMZA 5JJBA 4C98A 3GG1A 4M5DB 4WYLA 3RYLA 5T7LB 2KFYA 2O1PA 4Y2KA 3W2WB 4FYDA 2DITA 2DGQA 1Q79A 5E3RA 5I42B 3PKYA 3TQ1A 2KJVA 4R25A 4AL7A 2C28A 1UP1A 2CPYA 3QGPA 3M32A 2E5HA 1C2PA 4F4KA 3KLFA 5AXMA 2HNZA 2B6AB 4Y28C 3SCLE 3CF5Q 1PC5A 3SQGB 3CC4S 3MECA 4IDKB 3IN5A 5E3CA 4XK8C 4AL5A 4NLOA 1PSDA 2DPJA 1QY7A 4ECXA 1DTTB 1ZBTA 4X4RA 3KK2A 1X4CA 2NR0A 4E8UA 2KI2A 2HGLA 4L3NA 4DX8H 3VAHA 4DSEA 4A8OA 1FTCA 4A48A 2BABA 3Q23A 3SSSA 3H98A 4NXNF 2ZH9A 4R8UA 1KNZA 2X3GA 4OX8A 1T8EA 1HQEB 2RIJA 5J2PB 4DFKA 1SH0A 3GIIA 1SJ4P 1Q7YT 4ZPAA 3C66A 3PR5B 3FSIA 1H2VZ 2ZC3A 4JBCA 2V0NA 5KTQA 2KG0A 2E5JA 3CT9A 2R8HA 3CCQS 4B3RF 3Q2SC 1GAOA 1REVB 2AJ4A 1YQHA 1VRUB 2ZJRQ 1FXLA 1JLFB 3E3XA 2KDOA 5CYMA 4A46A 1YGYA 2HWHA 5HROA 4HVZA 4RW6A 4DFMA 2SXLA 5E3PA 1SL2A 2W9BB 2P9EA 1IUJA 3TYTA 3T1YF 3P49B 3KLGA 4OI3A 1DQ8A 3MEEA 1A9NB 1S1VA 3GWCA 2IAJB 1XERA 2DCUB 3D0GE 1ZM2A 2WSFC 3HHEA 1RISA 2AJ1A 4J9SA 4WFZA 1RTDB 3CULA 1FRKA 3V6KA 2CJ9A 1JJHA 2GQCA 3KG0A 2R8KA 2BRLA 3PO5A 1FKOB 3B78A 2MKCA 4JI3F 4K4TA 3DXSX 2AW0A 5HL7Q 2IC3A 5D8HB 1C1BB 2C2RA 2MQQA 3KJVA 5G0RA 4N8NA 3DM2B 2XC9A 4G3IA 1C0TA 5EX0A 3WDOA 1N5YB 4ZP7A 4ZCMA 2OMLA 2MHEA 4EBEA 2MZJA 4RZRA 3GMGA 3GV8B 1YJVA 2RF2B 1HNWF 1U2RA 4A8KA 3S01A 5KFZA 3T5JA 1QVFR 4ZOSA 2QO3A 2EFVA 1LWFB 1P27B 1RT5B 1WEXA 2GCFA