4Q2MA

Structure of the e. coli yajr transporter yam domain combined iodine
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
PYVSSLRIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Major facilitator superfamily MFS_1
publication title Atomic resolution structure of the E. coli YajR transporter YAM domain
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2014-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q2mA00
2AJ0A 3BN7A 2N4CA 4A4JA 1TL4A 3BM7A 1APSA 1TR0A 2KKHA 4ZA1A 2RSQA 1SQEA 3FMBA 1AFJA 2QIFA 2ROEA 3T9NA 1SB6A 2HIQA 3MZIA 1Q8BA 2XMJA 2K1RB 2W4PA 2GA7A 2KYZA 1Q8LA 2HFNA 2OP5A 2GCFA 5A6WA 1P8GA 1X8DA 2GGPB 3LO3A 4HH0A 1LQ9A 3E8OA 1TUVA 1FE0A 2XMKA 3TNVA 1N5VA 4QOTA 4Y2KA 1CPZA 3HHLB 1FVQA 3QMQA 1YJRA 4OJ1A 3K7RA 4DL0C 2XMMA 1TL5A 1N5QA 1ULRA 5B0BA 1Q4RA 3HX9A 2Q3PA 4A48A 3LGMA 1CC7A 3KG0A 2KT3A 1R6YA 2KT2A 1S6OA 2QYCA 1V3ZA 1FESA 1RJJA 1YRXA 2ZDOA 3KNGA 3FRYA 1KQKA 2EW9A 1Y3KA 3CJKA 1OSDA 1P6TA 2N4DA 4OJHA 1Q53A 2LQBA 1QUPA 2K7KA 2ZDPA 3KG1A 1U7LA 1FVSA 2FB0A 4YDXA 3BGUA 1OPZA 3BB5A 2OD4A 1FE4A 1W2IA 1XBWA 2AJ1A 5A6PA 1GXUA 2VH7A 5T7LA 1SI9A 2GFFA 2LXFA 1Y0HA 5B09A 2K1RA 1VQSA 3GZ7A 3HF5A 5F0UA 4HL9A 2FHMA 2BYCA 3KKFA 1N5TA 4NL5A 2QLXA 2IFXA 3FGVA 3TRGA 2OFGX 2K2PA 2XMVA 2ROGA 2JDJA 2W4DA 1MWYA 2ROPA 1X0PA 3IWXA 5B0DA 4HI2A 2IYIA 4A47A 2AP6A 2FIUA 2VV5A 2OMOA 2L3MA 2LDIA 2PGCA 2RILA 1MWZA 3HHLA 3UDCA 4DPOA 1WD6A 1X7VA 4FNIA 1YJTA 2HFOA 3MCSA 5B0AA 2ACYA 1FD8A 5IXUA 5B0FA 2GO8A 2OAUA 3DCAA 5K9FA 5F0WA 4OJ3A 4Y2MA 1YJUA 2ASYA 1IUJA 3BF4A 4HI1A 1JWWA 2PD1A 5B08A 3QGPA 1TZ0A 2BJDA 1VQYA 2FTRA 1CC8A 2OD6A 2OFHX 1JK9B 3DXSX 1AW0A 4HH1A 3LGNA 2QLWA 4EFAC 2XMTA 1FEEA 1GXTA 1KVIA 4Y2IA 5B0EA 2GGPA 2RU9A 4DN9A 1K0VA 1OQ3A 3BR8A 1N5SA 2GV1A 2G9OA 2W4CA 2IYGA 2HLUA 3HHLC 3BDEA 3HHLD 4Q2LA 1YG0A 2HQIA 3I9ZA 5T7LB 1S6UA 1Y3JA 2CRLA 3IWLA 1OQ6A 1URRA 2BUNA 4OJGA 3VTIA 2BBEA 2N7YA 1YJVA 5B0GA 4YEAA 3WDOA 2OKQA 4A46A 1KVJA 2K7JA 5B0CA 3HDSA 2XMWA 2AW0A 2BJEA 2XMUA 4F67A 5KAKA 2HLTA 2LQ9A 3TOQA 4U9RA 4FNHA 4Q2MA 1AFIA 2RMLA 3F44A 4OIXA 3CJKB 4NPOA 3HFKA 4ZOSA 1Y9OA
chains in the Genus database with same CATH superfamily
2HHVA 4NXMF 4IG3A 2H51B 3M9NB 2QIFA 4QR0A 2U1AA 3LANA 3SDEB 2DT9A 4LSLB 3FEXB 3QMQA 1HW8A 5J2NB 1LK7A 2CWKA 4ES2A 1O0PA 1UCNA 2RHSB 3HMJG 2DNZA 4OHXA 2AYBA 3RZAA 3KG1A 3MDFA 3BB5A 1RAAB 3MEDA 4ZVGA 2FHJA 3JAMY 2NYHA 2D3O1 1GX6A 3HFVA 2RQKA 3OFFA 5IT0A 3BKUA 2F9JA 5ADZA 1KBRA 3BPDA 3T6BA 2O1PA 4LFBJ 4EYHB 2F4FA 3R27A 1UEUA 4UUWA 5A8KA 3KFWX 3GCXP 4KV8A 2XY6A 1U1KA 2CG8A 4WE1A 1VISA 4U9RA 5D6GA 3I9V9 2JJ4D 2AJ0A 2BQ3A 2G2YA 1RTDA 1UW9A 2UXCF 3GWCA 4I1TA 3T9NA 3SV3A 1Q8BA 3D6HB 9ATCB 4W98A 1TKXA 1N0UA 5DO2A 2J6TA 3HX9A 3OL9A 1Q79A 3NP5A 3EXYA 3BSOA 2DVIA 2OO4A 2AJ1A 4RU2A 5CYJA 3IWNC 3TYTA 1RTHB 1VC6A 1J5EJ 2CDRB 2WTFA 5ETPA 1UZDA 4OX9J 3P3DA 1HD0A 2UXBF 2ERRA 3GV5B 5GVQA 4QW9A 1AXQA 3HSJA 1C1CB 3PXGa 1XMOJ 3SMZA 2FHJD 1H98A 2ZE2A 3EWGA 4WXWA 4DV0J 1OO0B 4WFBQ 4OHVA 1VQ6S 4CYUB 4LF8J 2W2NP 4WP3A 4B9TA 1S5ZA 3CWJA 4DR2J 4OHYA 2V8VA 4URGA 5D4PA 4ENOA 2GAGC 3NMRA 1RYSA 1VLOA 3DOLB 5T41A 1TKZA 2UV8G 6FD1A 1N5QA 3UD5A 3NEKA 2GS8A 5F8GA 3EPGA 5CD4A 3B78A 2FC9A 3EE3A 3JSYA 3Q8SB 3SEOA 3G6YA 1TAUA 1S57A 4LRDA 4F8RA 1RT5A 3MCNA 2D3UA 4IFYA 4RNHA 2V8GA 2CJAA 2BYCA 1R3NA 1WEXA 3L09A 3PW7A 1NLKL 3DOMB 3RB6A 3M8QA 2L3MA 4DU8A 3ZTQA 4CH1A 5T14A 3CCUS 2EFNA 4JP8A 2ATCB 4ATNA 4OZ0A 3W5ZA 2MKKA 2XMTA 2VONA 2GGPA 4IOBA 1FDNA 5HVFA 4ZKAA 2XYHB 3S8SA 2ZWOA 1U0HB 2R8IA 4WPAA 1WOPA 4MYUA 2CQDA 3PIPQ 4OIXA 6AT1B 3HHKA 1HHSA 3U02A 4HVZA 4NOHA 4LF6J 5SZTA 3ZZUA 1YIJS 2MGZA 3N4WA 2ZJRQ 1WKKA 3JSMB 2VKZG 5L1IA 3NNCA 2HS0A 2WHOA 1YJRA 1MN7A 1O8BA 3CT9A 2EEYA 4O44B 1NJYA 3FSIA 1R0AB 2DPIA 1U1MA 4KTQA 2RQ4A 2ZD1B 3FZBA 3HKWA 1N52B 3MF5A 3ZZTA 3DGVA 1VYAA 3R2CJ 5MLCV 5KFGA 1HBMA 2NZ4A 1HMVA 4HI2A 2HBRB 1X7VA 3KHHA 2HFOA 2VF3A 4NLSA 1XMQJ 2L08A 1OJ4A 4WBFA 4QWDA 3DDIA 3MMBA 4GRSA 5ETSA 1BXNA 2EFQA 2JVRA 3VHQA 1WSVA 5LMNJ 3M2RB 3V2UC 4RWWA 2UUAF 1N0VC 5I3UB 4DL6A 1S1UB 1RHUB 2HK3A 4F4ZA 1RI7A 4B9NA 2BJEA 1VC0A 3CVKA 4A8MP 4OQJA 2HKEA 3IBFB 3IN5A 1RWVB 2GC8A 2QFIA 3CJ4A 2XWYA 2VD3A 2DR7A 1M5SA 1YBTA 1I94F 2DY9A 2RS8A 1S1XA 5F3TA 1FVQA 1U2CA 2QV6A 3AOAA 4D3GA 1ULRA 1BQNA 1J2VA 1XQIA 3LW5C 1FHTA 4YR2A 4B9UA 1E6VB 5CH7B 1N88A 5FJ4A 3BO4A 3CC2S 2MPUA 4G1IA 5ETOA 1U1OA 4IG0A 1N36J 2GFFA 4LR9A 2VDIA 2G4BA 1RABB 4IYQA 2CPHA 3M6VA 3A4TA 2VPYB 2VQEF 3QRRA 5A2QU 2IAJB 1SH3A 1VGYA 3M7VA 4YFUA 2AGOA 2HNDB 2MKYA 4RBVA 4F02A 1GXTA 3CPWR 3VF0B 4DR4F 2RE1A 4F4KA 2CRLA 3RYLA 3Q8PB 1UA0A 1HNZF 3A8IA 1FXRA 4OYPA 5KFLA 2ZM6J 1C1BB 2AJ4A 1FT8A 3SFUA 2XSFA 4RX6A 3LP1A 2XYPB 2WBMA 1AA1B 3GIMA 3JTOA 1YZ6A 4EO8A 1VOMA 1TL3A 4IO1A 4M5KA 2FC8A 3KG0A 5KFXA 2HVDA 4KAIA 3WZ0A 4MK8A 3AT1B 4WTYA 1OSDA 4U6PA 3OJUA 4ZJQA 4IH7A 5HLFB 3RGIA 2V4JA 3DLKB 5E5NA 1U1NA 2IMWP 1DRZA 2IJNA 4F4WA 1TV6B 1G7CB 1RE1B 4MFBB 3ICLA 4Z37A 4LRBA 2L9WA 5C2GA 3BBFA 1HNVA 2FJBB 2B56A 1IWAA 1BQMB 3KJVA 4RL1A 2MQPA 3H7HB 2XBPA 3NGSA 3EZ5A 4DN9A 2B8QA 3DRYA 3C14A 2AYEA 2UVWA 4K5SA 2NXNA 3BS9A 1RWKB 3C16A 3F44A 3OL7A 3GG1A 2P6SA 3OUYA 4RW4A 3MOJB 1O51A 4B3MJ 3M8PA 3NS6A 4MK9A 3R8YA 3MAAB 4F4XA 2HZCA 3DGPB 2MLYA 2MHNA 3QSIA 4LSZB 2DR6A 4WJBA 1U26A 4JI1F 2DIVA 4ZN1A 3Q86A 2BANA 2ZDPA 1DTQB 2YKNB 5KFZA 3KUEA 2DNPA 2DGOA 4PPDA 2VG6A 3GZ7A 5DM6Q 1XK8A 3S6EA 3HXMA 4K59A 5EUHA 3R5BA 1KTVA 3J81Y 3CUNA 3JSBA 1RU2A 5EWEA 5JXSA 5KFMA 2L9DA 3BGLA 4LF7J 1XNQJ 5D15A 1KFSA 5DS7A 1YG0A 4ETZA 3R97A 1HLWA 2IBKA 3CNQP 1BY9A 3BV8A 5LMUF 1Y10A 1QM9A 1GK8A 3MEEB 2CADA 1ZM2A 4I7FA 4O23A 2I9SA 2BA9A 1YGYA 1SIWB 3SI8A 1MU2B 2J6SA 4IRCA 2JH3A 1JLEB 4J9KA 1SQGA 2J8SA 1RT1B 2FLLA 1JJHA 1UAWA 4L75A 1N5YA 4YDXA 4ILRA 3U1LA 4DL4A 1XBWA 4NLXA 2ZZMA 1NK0A 2LEAA 3MM7B 2BE7D 3ISND 4J9PA 4DR6J 2AJQA 2CPDA 2KHDA 1KVKA 3VCDA 5K9FA 3DCAA 2GAHC 4PEOA 3T9ZA 4QIGA 3HHDA 1HYSA 2WVDA 4J9QA 3UFCX 1VQKS 1JLCB 5CYMA 2ASLA 3MHYA 2KYXA 1VRTA 2X51A 4ZLLA 2QZ8A 1QE1B 3CC4S 1J5OB 2N7YA 4CO1A 3DI6A 1NBEB 3PVXA 2R2TA 1E6YB 4RJVA 2HSEB 1KHWA 4DCOB 2PA8D 2C3MA 2MLZA 3BYRA 2ZH6A 4IR1A 4R8UA 1RTZA 4I67A 4RNOA 3E8OA 1FA0A 2YY3A 3AD7C 2EFGA 1PILA 3I31A 4X4TA 2VG5B 1U7LA 2KM8B 1K73T 3CTRA 4C3MA 4Q43A 5KG0A 4AXIA 3MXHP 4UOCA 5F41A 2GHPA 3OTOF 4KHPJ 3RBDA 2RS2A 4IR9A 4B9VA 1JK9B 2XWXA 1Q8IA 2OSRA 4HTIA 2B8PA 2ZBQA 3VTIA 1PCAA 1OYDA 4M5NA 2BZ2A 3FJ2A 3QAEA 1FRJA 2E7VA 1HBUA 5HATA 3JTPA 1PIEA 2H5JB 1SPBP 3H20A 5CA5A 1MSWD 1IR1A 3IRWP 1T7PA 1JNZB 3E01B 2R7WA 4ZCIA 1HA1A 1PGZA 1KWMA 4ZPCA 2V4RA 2OEKA 2Y1LB 2JEIA 4FBUA 4MAKA 1HBOA 3V81B 3MAQA 2FYXA 3M2VA 1FWLA 1IBMF 3NS7B 4Y2AA 5E33A 4LQ3A 2BM1A 3O8WA 4ALZA 1FKPA 5KFFA 1EHWA 2G2OA 4X4PA 3PTWA 4PWUA 2RU3A 3LA0A 5CYQA 3NWGA 2QA2A 3KLIB 3K5PA 2M70A 4U67Q 2GVDA 1SKUB 5LSRA 4RZRA 2B3TB 4O3NA 3R5AA 5EX0A 1Z1ZA 3QIDA 2YXLA 5J2QB 4EZ9A 3DRSA 1U49A 1HNWJ 4RKUC 1S9EA 3DLGA 4MK7A 2I6WA 4Y28C 3GV7B 3A8EA 2IRXA 3W3SA 4NZ0A 1ZS6A 2HRTA 3M1VB 1JMTA 4JI2F 2WOMB 1W25A 2ZH8A 1TU0B 4U7UD 3VAGA 1HQUB 2VC1A 4DV5J 4J9NA 3PR4A 1CG2A 3V4IB 4P75A 3VAHA 3VWSA 3RAQA 3I82A 4QPTA 3T1HJ 2B6AB 3R5CA 4KPCA 2LXFA 4PZVA 2BV3A 3SFGA 3NCPA 4NLQA 4ZITA 4B9SA 3MM8B 3IS9A 3QWUA 3GCWP 1VC5A 2PMHA 2Q6CA 4OI3A 4OV1A 3PYDA 2KM8C 1G2EA 3TJAA 2QSFA 4PABA 2B7CB 3TAQA 4DUYF 3HHLC 5AXLA 3ZZYA 1KQFB 1LXJA 3KK3B 1SC6A 3HHEA 4FF3A 1FWPA 5AE1A 2OGUA 4EGLA 2HWTA 1YJ7A 1RAGB 1ELOA 3EGZA 2W7OA 2J9CA 4FYDA 2V2KA 4DLGA 2MKHA 3FMBA 4ID5A 2XMJA 2MQOA 4E98A 1UWBB 3R5JB 4RNFA 4LSNA 4WU2A 1GMUA 3Q8RB 3PJ9A 5KFSA 3LAKA 2ZZTA 5HVHA 2C2EA 3K58A 2KVQE 3MUMP 3NGTA 3NBPA 3I55S 3OR1B 5A0YB 1WKJA 4G1PA 1LWFB 3LP0B 2CNLB 2FHMA 1HNXF 2XGPA 2LDIA 2BJ1A 2VBXA 2LFVA 2ZH7A 2YNIA 3SBMA 5DQGA 1JWWA 2C1EB 2V8PA 4KKOB 1YITS 2HAFA 1D09B 2DR8A 5KG7A 2NZCA 3QPIA 5C42B 3Q22A 1S77D 4XDDA 4DSEA 3MPDA 2W01A 4WIQA 5B0GA 5I42A 2W2QP 3SV4A 2ZC3A 3AFGA 2ZJPQ 2APOA 2ZJQQ 3CIZA 2Y1JA 4AQYJ 1F60B 2VPWB 2ROEA 2D41A 3D0GE 2XLIA 4EWTA 3ZNUA 3BSAA 1WC0A 5HROB 1FJEB 3ETMA 2W7PA 4ZPTR 2CQ3A 4I56A 3NGUA 2MQLA 1GAOA 1R89A 4C8OA 1T05B 3C6TA 5F8HA 3KG4A 3GR0A 5IM0B 3CCZA 4AL7A 3T1AA 2G0CA 3FCHA 2W2MP 1RT7A 2JLEA 4YHHJ 5E3CA 1T3NA 1RT3B 3KNAA 2HHUA 3RBXA 3EXCX 2CWXA 4BC9A 2VFTA 1QSLA 2BEFA 5C24B 1S0NA 1YZ7A 1H2TZ 4KFBA 4OJGA 3ILOA 3G82A 4FZVA 2XMUA 1GT8A 1RHRB 1X9WA 3SZ2A 3QIPA 3KLFB 2MSTA 2CVIA 1NJIT 1PYSB 5KTQA 2WONA 2NUUG 2J9DA 3DLLQ 2ZFHA 2YWEA 3OLAA 3TARA 1HHQA 4DQPA 4GC6A 3M32A 1HIYA 1TTHB 5D4OA 1FE0A 2YPZA 4TYBA 4KR0B 2EFPA 3MAHA 4DU7A 2MY8A 5F8NA 1WG5A 5F8IA 3KNGA 2HNZB 2V9KA 3L3CA 1RWOB 4UTGA 3MECA 4PG7A 4YUDA 4ANEA 1RCXB 3ULHA 1NJZA 4FBTA 2MYFA 2R7XA 4DV3J 2JEGA 4DL2A 2M4MA 1WC6A 1L3TA 4DSLA 1UVNA 1AUDA 4M5DA 4E0DA 1QAYA 5CABA 2AKWB 5FDLA 1FK9B 2I5JA 1WSRA 4DV1F 2G9OA 3CMAS 3CCMS 4WWSA 3PM9A 4XAKA 1P1TA 4LRCA 4H4OA 5L9NA 1S97A 2FZCB 4RW7B 1XERA 2DHXA 4Y3CA 4PQUB 5L39A 2KT5A 2PEHA 3P96A 4CLPA 1SC1B 1FFSB 1SQEA 1VS3A 2KN4A 3KWMA 2HBYB 5LXYA 1EJ7L 3A3NB 1IQZA 3T5KA 4LIRA 1NJWA 4JI5F 3BO3A 4RW8A 1NHKL 4I64A 3POTA 5DG8A 2ZDOA 5IV3A 3K2YA 4P71A 2HFZA 1CSJA 2MQNA 1WHYA 1HHTP 2R7VA 1Y4ZB 4M5IA 4OL8A 4C97A 4WFYA 1S6PA 2B4PA 4NLRA 2IY5B 4DEZA 3PW2A 4DPYA 2YKOA 5LSLA 3W7BA 1QSSA 1LOUA 5KFPA 4ZJOA 3OL8A 3BKTA 2CQ2A 2CPYA 3BREA 1Y3JA 3IR5B 5KG4A 1F3VA 1EETA 3C46A 3ILJA 3RTVA 1WG4A 3MGJA 1YTYA 1WC5A 1TVRA 1HBNA 3MR5A 4ZVOB 4QZVB 2ZC4A 4F3MA 2XS7A 1VQ5S 2CUYA 1R7IA 1VIOA 4LBPA 4DV7F 3MEGB 4JOUA 4DXLA 2QT7A 4RWXA 5E41A 2E1CA 4ELUA 3US5A 5CXTA 3J80Y 4NLGA 2BE9B 4RPFA 3CDUA 1VQOS 1X4CA 3PDNA 2GX8A 2N3LA 4F3QA 1XNRF 1MG7A 2QA4S 3M2UA 1M90T 3TW0A 3DU6A 3LPEA 4EFAC 4EBDA 1SJQA 3TA2A 4OV6A 3H98A 2DBBA 3ZZPA 3GU0A 3W9JA 3W9HA 2BKNA 5IS2A 1SL0A 3HSDA 3BDPA 1C0TB 3DDKA 2B9XA 2OLWA 2DGUA 1IBLF 2LU2A 1IKVB 2G0JA 1LKZA 4PAAA 4RR5A 4CTAB 5GAHU 4L76A 2KFNA 3MEKA 4X62F 1UVKA 2RIJA 1NK4A 1NZ8A 3O44A 1S6OA 4BLGA 4LUBA 3W5XA 2CNNB 3EX7B 3P6YC 2MEWA 3R3TA 3BPSP 2O01C 3ET6A 2RF2A 4BWJA 2CQ1A 5KFYA 2E5LJ 2C3OA 2RDDA 3D6MB 2V94A 1SJ4P 3Q23A 4PR6A 5KT3A 5HJXA 2W4DA 2BJ8A 3O1LA 1FRMA 1TKTA 2ASJA 1CJVA 2A6OA 4DV2J 3AXMA 3PYEA 2BW7A 2GZOA 1QAIA 3QGGA 1SL2A 1K9MT 4HI1A 1TL1B 2B5JA 1F9FA 2CVEA 4C3KA 4BBYA 4DX6A 2SXLA 1R0BG 4OZ5A 1PBAA 3G87A 3DYAA 4IDKA 5EDWA 2JRSA 4JI6J 2H5IB 3GIIA 3QATA 3IRXB 3FEYB 2O3DA 2CJ9A 2ZOMA 1ZAXA 2DNRA 1UVLA 1K0TA 2DPJA 3UR0A 1FF2A 3JQMA 2BM0A 1SL1A 4DV6J 2A2CA 2G13A 2LQ5A 4ZP7A 2W24A 3ZTSA 3GIJA 4OYWA 2MKJA 3ETOA 1OPZA 2MLXA 4LFBF 4R0JA 4G1QB 3L95X 4GO5X 3KHRA 3V5RA 2F3JA 2YH0A 3VGTA 3LP2A 2VQFF 2XSJB 2HWHA 1CULA 5B08A 2KRRA 4C8KA 4Y2IA 3D1OA 3BBCA 4I2QA 2PA3A 3GTYX 3IWLA 2HHPA 2Z2LA 4YP3A 4FF1A 1GTEA 4A46A 1S1TB 5DRKA 2HGNA 4QWCA 3F41A 5ETNA 2PT0A 3KLGB 1Q7LB 5DJBA 1RAHB 1FX2A 2R42A 4ZVSB 2XY5A 5A8RA 1UTAA 2J76E 4X64J 4EO6A 4JV0A 2VPXB 2WVCA 2WK4A 2GCFA 2AJ2A 2ILYA 4KPYA 4QWAA 2GJFA 1FTRA 4K0KJ 1RDRA 1L5UA 3U1MA 3GILA 1U1PA 4Q0BA 1J5EF 2EXUA 4WFAQ 4J37A 4OX9F 4TLQA 5K14B 3I5AA 4ZVQB 2DGXA 5HVGA 2KZMA 1JXLA 3EDQB 4ECVA 3DLEB 5FLXY 1YVFA 3TVYA 2MQQA 4HL9A 2YKQA 4ZVHA 5C7PA 2YPYA 2DNLA 7FD1A 4DV0F 1JXEA 4C0OC 5J1PA 3EYZA 3G6VA 4NCBA 2BRLA 2A6MA 2DISA 2OAUA 4LF8F 2DEJA 2PD1A 2MTLA 3EM1A 3U1NA 2CIMA 1JLBA 1VHIA 4DR2F 3GG0A 1UETA 3JAMU 1R8AA 4ZVPB 4KGMA 2JSXA 2UUBJ 2UUWA 2DNNA 4C8LA 4P74A 4LFAF 1FD2A 3UI3A 4DZ6A 3QGIA 2ZVSA 3MM5B 3OSNA 3RRKA 3A8KA 4CO5A 1UJ5A 2ZHAA 2KYZA 2KRBA 1F5AA 1CJTA 3W2VA 4F4AA 5KG2A 4CT9A 1Q81T 3EJMA 5B0BA 2GIRA 2Q3PA 3FRYA 3CJKA 2Y1IA 4HTJA 3NNHA 5LM7E 1S4EA 3MCMA 2BE2A 1L3VA 3CMES 2F1FA 4J9LA 4HHJA 3HHLA 4OI2A 2V63A 4GKKF 1R0CB 2RVJA 4C8MA 1CS4B 1V3SA 2EBEA 5J2MB 1IKWB 1FDBA 2JEFA 2WB1D 2O66A 3BBBA 2F40A 2YNFB 1U09A 4LF6F 4DI6A 3SQGA 4P6QA 3SSSA 1M1HA 1F2HA 4V19X 4IH6A 4X66J 3QLHB 1BQNB 2GIFA 3LALA 3K5LA 5KFBA 1U4BA 1SKRA 2MB0B 2F7VA 2FLNA 1IXKA 3WHIA 3CJ5A 2QA4G 4H4KA 4PQAA 3TNVA 5EGYA 2RQCA 2YNHB 8RUCA 2BJ7A 4URSA 1RHJB 4QU7A 1VBKA 3WBZA 4MMOA 1UFKA 3M9OB 3CD0A 1YJ9S 2IDLA 3KDOA 1S76D 4NMLA 5LMNF 3ITHA 2J7UA 4ED5A 1RSCA 1KLNA 1X5PA 2PFDA 2YWFA 1AUSL 3N6MA 3QGPA 2WSCC 4ZIVA 4UZBA 2D1CA 3HHLD 2HWIA 2HQIA 1NB7A 2I0XA 3AB4B 3QT8A 2ADBA 3P8BB 5F8JA 3ZXWA 1ZPVA 1O5JA 2LYVA 2X7IA 2MZTA 2K3IA 3BM7A 2DRAA 2Z2ZA 3TZZA 1T3OA 2VJVA 3AH6A 2BACA 5KT7A 3MMAA 1P8GA 2C22A 5KFAA 1SJRA 1SJ1A 2V67A 4JV2A 1NSAA 4B9MA 4NZ7A 3WC0A 2LXIA 2KT3A 5BXIA 1V6HA 1U2FA 1NKBA 2DCLA 1RT6A 2YWHA 4IRDA 3Q2TC 4K4VA 3UE2A 4J9MA 2DH8A 2X1AA 2XG8A 4MJKA 4CNZA 3C16B 5HO4A 4LF4J 2R2UA 1JLQA 3FCVA 4HT5A 4NRTA 1BWVA 1M0SA 1VQ9S 4NWBA 2ZM6F 3IA0A 1RAJA 3SDEA 2EK6A 4LSLA 3I96A 2YKAA 1GMVA 4TKTA 5M2PA 4ANDA 4NZ6A 2BXJA 2GQQA 4WZMA 2K7JA 2AW0A 3ELHA 4UQTA 2P5VA 1IBKJ 2QJ3A 2CPJA 2AEFA 1RXOB 3T19A 4OZJA 3OFEA 1NPKA 4EI2A 2RD5C 2XHCA 2RT3A 3W8GA 2CJYB 3I0SB 5JUMA 1X4DA 2ZOGA 3W64A 3TANA 2F8MA 1QDUB 3WC2A 2VOPA 3HT0A 4CO2A 1ZOTA 1IQTA 4YB7A 1N8RT 2XULA 3PRVA 1SI9A 4KE5A 4WXOA 4LFCJ 2VICA 1MNEA 3D7SB 2K06A 5BYSA 1P9YA 1EQMA 2CQCA 3FEZA 1T8EA 1H6KX 3RB4A 4CRJA 4N8NA 3I0RA 2R7TA 5THWA 2JLGA 4B3MF 3I32A 3BGOP 4DX7A 5L1JA 4O3SA 3CD6S 3Q0AA 5K8NA 1I1GA 1B64A 1HQEA 2QRRA 1IKYB 2RUSA 3W8PA 1TUGB 2U2FA 1NJXA 1Y9OA 1N5YB 3KJNB 2N4CA 3NCQA 3OFHA 3VZIA 1SB6A 1RTHA 4DLEA 3FUYA 2CJKA 2VBWA 3V6DA 1ZH5A 4EMDA 2Z58B 3M8YA 1REVA 3CJ0A 1PAEX 3RW7A 3AD9C 1YRXA 1QAJA 3HKZD 2HRYA 1VHFA 3HVTA 2QC3A 1C1CA 5H9FK 4LF7F 4NLWA 1LWEB 1MWQA 3O2IA 1XNQF 3NCRA 4PG6A 3CCJS 2E9TA 4U95A 4CYUA 2B0GA 3DI6B 4ED3A 1Q95G 4OHZA 2OTLS 1GXLA 4GKJJ 2HHWA 3ZC4A 2QSWA 4K4WA 2YWKA 1WC4A 4I6YA 1HNIA 1QTNB 3K17A 1Q5YA 1NMEB 2R8JA 3TOQA 5HI7A 4FNHA 3M8RA 2FJWA 4DF8A 2YWGA 3L7PA 5E2QA 3NWRA 4YQWA 3DOMA 2UV8A 3A12A 1GEHA 4LR8A 1JJ2R 2UVRA 2QTWA 3MM6B 3H2UB 4B3SJ 4U7CA 4NEYA 4TNOA 4DR6F 3ISNC 3DC2A 3LQVA 3DRRA 1YLXA 4ZVEA 2JC0A 2ZWPA 3D0HE 1B3TA 3RW6A 2VZ9A 3BSCA 3QZ7A 4LF2A 5KFCA 1M1GA 1ZZFA 3W63A 4HHHA 5IQ6A 4TXSA 3CCSS 2V34A 2IM2A 1VMBA 3VALA 1VRQC 3ENWA 3NAIA 1B99A 2UUTA 2J9EA 2LXUA 1HBUB 1F5BA 4FP9A 4QW8A 4J91A 2XO7A 1VR6A 2EBGA 1SV5B 3DLJA 1AROP 3J81U 2IRYA 1RTIB 4FPRA 3HDSA 4O44A 1R0AA 2ZD1A 3LF0A 4ZPWR 4DUZF 1NK9A 2J7KA 3M2VB 3IM8A 1QSYA 3OQ2A 4RU9A 2KKHA 2L48A 2AZ3A 1DBDA 5A6WA 4M5MA 2D69A 2ALZA 4WP8A 4PXBA 2XLJA 4KHPF 4J7CA 2HZVA 1UPPA 3HSZA 2GVDB 2MKIA 3PZPA 2Z0GA 2BVZA 1NHUA 2VU5A 3FKBA 2YQ0A 2NSBA 5I3UA 5G0RA 1S1UA 4JI7J 5AE3A 4CLUA 2VG7B 3W60A 3CB4A 3R2DJ 4XPCA 4USMA 4HDHA 3G8TA 1HI1A 1XNRJ 2NQPA 4LIWA 1VQ7S 1RWXB 4L3KA 1YK9A 4XPEA 4M5JA 3WIUA 3BH6B 3OW2R 3VAJA 5GAEI 1LV5A 1YJVA 2VODA 2KFZA 2GJIA 4F04B 2OHDA 4DL7A 2HFVA 2HFNA 4ZLJA 2A1BA 4YDDB 2ACMA 4YB5A 4ED7A 2ZHOA 4M5LA 3GJRB 2IAJA 3IS9B 4MIAA 4OI0A 1IR0A 1EP4B 4LVOP 4AL6A 3TO8A 4CIOA 4RUCA 3PX6A 2QL7B 4CT8A 2RB7A 3G71S 3KTQA 3AOBA 4OI4A 4IFVB 3HHNB 3ZTRA 1X9MA 2OFGX 1LEOA 5IWAJ 1UVIA 1NDCA 4FYYB 1ACMB 2V2ZA 1C1BA 2WAQD 4P9SA 3DFEA 4B3OB 1PC4A 4NLOA 1CBKA 3TZXA 4DR7J 1DARA 1AZSB 1FX4A 3OVBA 4ICLB 1WELA 2DR5A 4LSNB 1HPZB 4N7TA 5HMZA 1EIYB 1LW0B 3PEJA 2MJUA 3G2XA 1VBYA 3MOZA 2DHHA 4DV5F 1GX5A 1DURA 1EX8A 5HLFA 2C2OB 4OYIA 5HMXA 3T1HF 1TV6A 1A0OB 4F36A 2EVZA 2M88A 4HH0A 5B7WA 4C9DA 4I0WA 3D1QA 4WCEQ 1WG1A 1HI0P 2V50A 2QYCA 2WVBA 1BQMA 1RJJA 2NYIA 2W8LA 3RAXA 4TU9A 2E1PA 4Q45A 2AF6A 3SSRA 4MKBA 4OLOA 5A6PA 2FVPA 2H65B 3BZQA 2ZEJA 1Q0NA 4FVMA 3T6JA 3DMJA 2OPRB 2LCWA 2XEXA 1FXDA 3OTBA 2ACYA 3DLBA 3MMCB 4ILLA 1RZMA 5AT1B 1Y5LB 1R31A 2VQFJ 1WHXA 4PWDB 2FGCA 2F9DA 2OPSB 1KR4A 4KRWA 3MAAA 2VFVA 2HNYA 3DGPA 4AL5A 2E1RA 2R7RA 5E3PA 5C2CA 2ZH2A 4HHUA 2DXDA 4DFKA 1Z2LA 1JQGA 4NPOA 4AFFA 2LKZA 4DFPA 4I2PB 1URRA 2XO6A 4NLUA 4B3TJ 3BJYA 5D0RA 1RAOA 2IC3B 2RSQA 3M6WA 3QQCD 4ES1A 2HK2A 1VBZA 5HP1B 2DHGA 2GW8A 2RKIB 3UCUP 1PSDA 1RHKB 2ZBCA 5DLFA 3IR7B 3MI7X 3IBWA 2J8AA 1DJ0A 3J81j 3PKYA 4NA2A 3VGVA 4FYXB 2ROPA 2NREA 3FFIA 1LW2A 3RBEA 3ENVA 4OZ3A 4FF2A 3MEEA 1LK5A 2WCXA 1LWCB 2FZKB 4LF1A 4MTPA 5BYQA 2WONB 3LH2S 1L3KA 3SCJE 1EZZB 1M5HA 1MU2A 2LA4A 2FUG9 2QO3A 2VA3A 2X1FA 4AQYF 1IM4A 4LJMA 2IYGA 3VZHA 2Z2MA 1T9WA 5I3QA 4DG1B 3TZWA 4LFAJ 4ELTA 2YTCA 1UP1A 4J9VA 3PO4A 3ZTPA 2J9DE 3MR6A 1QTMA 1OSCA 4IO9Q 1XMBA 1BUXA 3KK1B 3M05A 2W4PA 3MM7A 3ZZZA 1C4AA 3PRDA 2C2NA 2A18A 2IDEA 4Z7YA 2HQGA 1M5KC 4C0BA 2XTJP 3GV8B 4NLPA 1NKCA 1SKSA 1VRUB 2CZ4A 5E0OA 4YHHF 3J7AN 4CLKA 1VIXA 1QE1A 4ECUA 1J5OA 2AX0A 2W9AA 2VDHA 4KT0C 2JDJA 3EZOA 3CC7S 4JYAF 4DPOA 1H0HB 3CF5Q 4IRKA 3CW2C 4GKKJ 3BH7B 1H7XA 5AJ3J 4DQIA 3V6HA 2XZWA 3CCTA 3ADAC 4USVA 5JVGQ 4B9LA 1AYEA 4DCJB 3FBFA 3EVOA 5HQLA 3NMAA 2LU1A 2MKSA 2H48B 1ZTWA 2GQ2A 3V4MA 1T03B 1G4CA 3FBEA 4EYIB 1OPIA 3OR2B 2BQRA 3KMSA 4ZVRB 3OTCA 1Q82T 2ZVIA 1N5VA 1S6PB 4DV3F 2HGMA 4K4SA 5CZVA 5RUBA 3KMQA 2PSZA 1UL3A 2JLFA 2YNGB 4K7QA 5D4NA 5F9LA 2LQBA 3SQOP 3NLCA 1FVSA 3D1HA 1S99A 2QMXA 1PKUA 3D28A 3GLJA 2J7WA 5F0UA 4IOCQ 3BEGB 3TRGA 1VCTA 3CJQA 4C0HA 2AP6A 1RAEB 2DEIA 2HMIB 1FD8A 4I6AA 3TUJC 5A8WA 3HO1A 2HHXA 1IN0A 2KH9A 1KS2A 4CCHA 3VVTA 3E01A 2X1BA 2AYMA 2ZNZA 2P6TA 3NL0A 2HLUA 3RU0A 4CDIA 2DJWA 3GSDA 2IPOB 3SIPB 2ZH4A 1BGXT 2W9BA 4P2XA 3H2LA 1N34F 2KTQA 1ZPWX 2LEPA 3V81A 4L74A 3K8VA 4C8NA 3DU5A 3H5SA 2V6AA 3SCKE 3G8SA 2HIQA 2M8DB 3LWMA 1PYOB 2PDAA 2CPIA 1XWLA 2GMHA 2AD9A 2CZ9A 4OMFG 4C2MA 1WI8A 3AHPA 1I5OB 4A48A 1F3FA 3M2UB 3KLIA 5F9NA 1D9FA 1N32J 2ZKUA 2K7KA 2E5JA 1HWIA 4TU7A 2FB0A 4HEA9 1J27A 5L9XA 2DNMA 3BGRA 4Y2CA 5J2QA 1PO6A 2OTJS 1RT4B 2HS3A 3BKFA 4JV5J 2V5HG 2ZOFA 3UO0A 4TLRA 5DG7A 1VJWA 1G6BA 1L3SA 2FY8A 3TJ8A 3M1VA 1JKHB 4C8ZA 4E8UA 4Z2XA 4YY3J 5F8MA 3UCGA 2YQ1A 4NA1A 4NCGA 4F0KA 4HYKA 1HQUA 4DFJA 5DM7Q 2PC6A 3V4IA 3R1LA 2X3GA 5L8RC 2B6AA 1FRIA 2MKCA 4QCLA 2IVYA 2IA0A 3FC9A 4CLTA 4QIVA 3CJ2A 3MM8A 2P9GA 1S4FA 4DL0C 3KOAA 3B6BA 5IQQA 4DSJA 2DGTA 5K8MA 2XM3A 2R2RA 1FXLA 1HKAA 4E2FB 4OX8A 1Y00A 3BGUA 2B43A 2Y8WA 4I6WA 4GVBB 2HVEA 3B4DA 1C0UB 1ZTTA 3KK3A 3C6UB 5DDPC 3RG6A 2B4UA 1RK8A 1U6BA 3MR7A 2GO8A 3JYTB 1KLMA 1RYRA 1WJ9A 1FWKA 2BOPA 3FNNA 4DFMA 3EVWA 1S7HA 1UWBA 1K0VA 5D0HA 4CLZA 3WQPA 4OYXA 1TQLA 5E3RA 4FXWA 3IR6B 1B70B 4X84A 5HMYA 4DR3J 1U6ZA 1NEEA 4OZNA 3TAPA 3FVYA 2C28A 2Z2YB 3TWZA 5KFJA 3OR1A 2RRBA 4LT6A 4A8QA 2KO1A 1S1WB 1LWFA 3LP0A 2QLJB 1T0TV 2CA9A 3PNIA 3FCWA 3THVA 2E5LF 1KQSR 4USJC 3EGNA 4QWBA 4QOTA 1CPZA 1IM6A 3UVJA 4PUOB 1YBUA 3OVAA 4N56A 2L9NA 4KKOA 4DV2F 4DPXA 4BWMA 1CULB 2MMYA 1VJQA 1QUVA 4JI3J 3DXBA 2VFRA 1DLOB 3GR1A 5C42A 3W65A 2KXNB 3KK2B 4WYWA 4XDCA 5E3AA 2CQHA 4QJVA 3OTDA 2D9PA 3N9UC 3EDRB 4DMZA 1EAYC 1X31C 3UQSA 4JI6F 4USTA 4C7QA 3RR8A 5F3ZA 3J80U 4CNYA 3QGHA 4MKVA 8AT1B 1ZM3A 3KJQB 1KVIA 1F0XA 1Y7PA 5DZ6A 4CI0B 1N5SA 4LF9J 3K5NA 5HROA 2ZH1A 5GMEA 3AQOA 1ZA1B 4Q0BB 2DO0A 3MPVA 4DV6F 1FNMA 4P52A 2OPQB 3HFKA 1WORA 2LQ8A 5CCMA 2ADCA 1T05A 3QJLA 4S0MA 4RO0A 5CQGA 3LGHA 4KHMA 1VI7A 4DL5A 5D0EA 1DZ5A 2QL5B 2UZAA 4WTOB 2VJUA 3GQCA 4UY85 5D3GB 2XMMA 4EK2A 2EC0A 3DRPB 1TL7B 3MURP 4P2FA 1L3UA 1RT3A 1HR0F 4U8VA 2E5GA 3KLEA 4KO0A 3X1LB 3G4SS 1VQSA 4GO7X 2FDNA 4B02A 3IO1A 5EWFA 4NASA 3KLFA 2N3OA 3V6KA 2A0FB 3KUHA 1G3OA 1MMLA 2CZVC 1YDLA 4NLDA 1FEEA 4KHRA 4X64F 3FSYA 1KNZA 2WSEC 8ATCB 2YX1A 1NSQA 1RT2B 3HZGA 2IJFA 2HNZA 5KFKA 4K0KF 5DETA 1GNKA 4TY8B 3CJKB 5J2PA 1U8WA 4USUA 2OH2A 2C3UA 4DUZJ 4DR1J 1QJHA 4HT7A 1X5SA 2E44A 1APSA 1IJFB 4LMZA 2G1DA 4RNMA 4L72B 3CJ3A 1N54B 1PYTA 5E7OB 2HQDA 2DYAA 3G6ES 2RUGA 1X8DA 4ECQA 1S49A 3HHLB 5KFQA 4WYLA 3PHTA 2HW3A 3H5YA 2CYYA 1FK9A 1D9AA 4N5SA 1IWGA 2KFYA 2ABYA 1X5TA 3SQGB 4OYMA 4V1Ak 3W5YA 3FGVA 4CZCA 4M5GA 4NE9C 1T9UA 2UUBF 3CDEA 5HN0A 2B7BB 4F0MA 1V3RA 4OX7A 1CJUB 2NS1B 4PQUA 4U8YA 2C3PA 1NK7A 3UDVA 2LEBA 4BC7A 4JI4J 2G0IA 1TK0A 1XR7A 1F2GA 5K5MA 4Q2LA 1HFEL 5HBMB 5IV4A 1G1XA 4P2SA 4LRFA 1H2VZ 3JS9A 1IKXA 3TAMA 2XLKA 2UXDJ 2LLZA 3UCZP 2JNJA 3PJXA 3CCVS 3RB0A 3QBCA 4NXNJ 3BN7A 5ETKA 1UKUA 1YWXA 2Q6BA 4R5PB 1XR6A 2VBYA 1X5OA 2YKPA 2Y0BB 3ITHB 1H38A 2W25A 3SCLE 3NGKA 2VOOA 4XK8C 4P72A 2AJFE 1PJ6A 1MROB 2WW8A 4PYDA 4KC5A 5A76A 3NRBA 4QIWD 1HWLA 3W2WB 5HQ8A 1CJKB 2AU0A 5JVHQ 4Y65A 3I5BA 5ETVA 2PE8A 4CO4A 4NMXA 3OXFA 5FD1A 1QVFR 3I5CA 3CIMA 4OYAA 4K4TA 4IH5A 2OMOA 4C8YA 4TYAA 3RAMA 4DQSA 1RWNB 2Q79A 3EVMA 4X66F 4ED2A 2OPPB 2Z57B 3R1HA 4KGKA 5FLXU 1U47A 3H5UA 2F8EX 3MMAB 2GV1A 3FQKA 3MEGA 1Q86T 4GC7A 4Y0FA 5E3QA 4N77A 2IHR1 3DM2B 3BYPA 3CXCR 2Z8QA 2DD8S 1WDTA 1RT6B 3P4UB 4HLBA 2W2OP 2MJNA 3HULA 4FPIA 1U1LA 1UPMB 3QO9B 2HS4A 2UVUA 2KL8A 2BX6A 2HVHA 2FHKA 1RBAA 4FKXA 2ZNYA 1S0MA 3PG9A 4DDFA 4FS1A 2XI3A 1XTZA 4K4UA 1UJ4A 1HL6A 3MTKA 3OT9A 1C0TA 2JEJA 2C3YA 2C42A 1WD6A 4WFZA 2YBVA 2MQ8A 1IKVA 5IC4B 4EZ6A 3FBCA 4A8KA 1S1VB 4F7VA 4ZHRB 1ZZNA 4J90A 4CTAA 5MAOA 1U02A 2DNOA 1KKHA 4FS2A 3PYFA 2R7QA 3EICA 5T7LB 4X4RA 1NDLA 2V68A 3T3FA 1XR5A 5KAKA 2YVSA 2BKPA 1P27B 1C4CA 3O5TB 1B0TA 5IT9Y 2HIYA 3I4HX 2DNGA 4N47A 4FVCA 3T5LA 3I6PA 9RUBA 4NA3A 3MZIA 2XNQA 2BOAA 4H4KC 4J9UE 1IVZA 2QLBB 2FJAB 2R3VA 3DLHA 2IJRA 5C25B 3FBBA 4J9SA 2KU7A 4RW9A 1V3ZA 1FKOB 1TL1A 4LF4F 2IMOA 4RW6B 3I0RB 1QY7A 2DTJA 2HVIA 5DDQC 2Y0SD 2FVQA 1RADB 3TUPA 1NKEA 4K5RA 2R8KA 1NK8A 4L6V3 4LF5F 3IFEA 4NL5A 1YHQS 3Q24A 1WUUA 3IWXA 2MZQA 3TQEA 2L41A 2LA6A 1HQEB 3IRXA 1YJTA 2VA2A 4ECWA 3E51A 5C5JA 1N6QB 5HANA 1IBKF 4DX5A 1DY3A 5GADU 3V6DB 1S9GA 1REVB 3ENQA 4LBHA 3CD5A 2KXFA 4DZDA 4QR2A 2VFSA 4O0NA 3MPYA 2F8HA 3E2EA 3HVTB 2VASA 1SUQA 3JQKA 1WWHA 3R5GA 1NSKL 3F73A 4G1QA 2NPFA 2IBOA 1X4FA 2IVFB 2CAJA 3BSNA 4UZCA 4LFCF 2B9WA 4ZPVR 5J1EB 2XSJA 2PMZD 1S0OA 2QYGA 1GH8A 4WFXA 3M30A 1YSJA 3T1YJ 4LREA 2YWWA 5BR8F 3J7A1 2V9WA 3QFWA 2VH7A 1HNIB 2R2SA 1ZM4A 1S1TA 4K2JA 3KLGA 5CZXA 1RWPB 2HBZB 1T9YA 4JYAJ 4Z7CA 1HARA 5ITHA 5KFNA 1JLFB 3OHAA 4TQSA 3V6JA 3WIVA 3UD4P 4ZP8A 3EGVA 3C8YA 3C15A 2ZH3A 2E1AA 4ECZA 3PW0A 2VIHA 1S6UA 1FNOA 1R27B 4FXDA 5B0CA 5K14A 1WC1A 2AEMA 3DRRB 2LQ9A 4ECSA 1GQEA 4WU3A 3T41A 3DLEA 3D0IE 3PX4A 2HGLA 5GMDA 1UVJA 4DOZA 1HW9A 1UMJA 3R5DA 2UVVA 2OELA 5KFTA 2P9CA 2GVZB 1VFJA 4X4SA 3H5XA 1JLGB 2Z56B 1U2RA 3GP9A 4ITSA 3HT3A 4JI0J 4IKAA 3X3UA 4GKJF 1U0SA 4ECYA 4PXEA 4MKYA 2OD4A 5LSOA 3N5FA 2K1RA 3UPFA 3HF5A 5K8OA 3BQ0A 4GVLA 2HHTA 2K2PA 5B0DA 1RWWB 1S6QA 1BC6A 4YB1P 1YX2A 2WVEA 5DZ7A 4H4MB 3MM5A 1TELA 6FDRA 5LOQA 2V0NA 4AUKA 1OY6A 1R6VA 1YJUA 3SCIE 2MZ1A 3D6FB 3K5MA 3H4BA 1VLYA 4HACB 2EK1A 1QD1A 3LGNA 2B4VA 5KFDA 1YI2S 2HHSA 3BR8A 4O4GB 2ATLA 2CG4A 5DGBA 5L1KA 5LL6d 5D78A 4C3LA 4KB7A 3GB0A 4B3SF 3T5JA 1N34J 4YB6A 4ZOSA 2M3DA 1RHMB 2FD2A 2Z4PA 4DS4A 3HSGA 2QN6B 4QIFA 4XIUA 5G0RB 1HI8A 3AOCA 1TUVA 3W1YC 4P10A 2FJDB 1CS4A 2KT2A 1RAFB 2D3ZA 5LXRA 4PG8A 2IVMA 3AJ2A 2VBZA 5DDRC 1IKWA 5J2MA 1YJNS 2QA1A 1Q53A 4DHVA 1FDDA 4NI2B 3IBCB 3NXZA 2YNFA 3Q2SC 4PKDB 2E7WA 5GMKa 5HL7Q 1DTTB 3TQ1A 3KJFB 4ETXA 2XZTB 2BRKA 1ICEB 3ILLA 2Q66A 4Y34A 1X4EA 3QLHA 4A47A 1K1QA 2FIUA 4LQ9A 3JB9k 3DOKB 4UF4A 2NXEA 4YS2A 2BJDA 3TI0A 3DXSX 1AW0A 1OY8A 4HR2A 1URNA 3HZEA 3KLHA 1K1SA 2YNHA 5CD4H 2RQMA 3CULA 2WVFA 4ZCMA 3LUYA 3M8ZA 4R25A 1A9NB 4ZCLA 4WF9Q 4JI8F 2J0SD 5KOXA 2EFVA 3P49B 1XC9A 4N76A 3RUBL 4F50A 1B0VA 5GAEU 4JI7F 2MQMA 4NLTA 4R0EA 3D67A 2R7UA 4DQQA 1X4GA 4YR0A 3IAS9 3TR5A 2LDYA 4UY8T 1XIQA 1SBRA 2VFUA 1FE4A 4IG3B 1RCOB 3QNWB 2H1YA 4G6VB 2BQUA 1WKLA 2BW2A 3HM9A 4D3HA 2VV5A 2FY1A 1S79A 2JFDA 1TUWA 2HBQB 2M0GB 5F0WA 4X2BA 2E5IA 5FIIA 1S9FA 4ZK7M 1SH2A 1P9QC 5I3PA 1KN6A 2UUCJ 2W4CA 3IAM9 3MEDB 1RWUA 3D4JA 3W62A 2OSQA 2JZ5A 3GJTB 4Q2MA 2O67A 4C6AA 4BDPA 2QL9B 3ZZOA 3NGDA 1X4BA 2Y3YA 1KP6A 2MZJA 2IRUA 3DMJB 4DSKA 2AWZA 5A8KB 2ZZNA 1VDHA 2LQJA 4KV8B 1WHWA 5IWAF 2FVCA 3QT5A 4WE1B 1PG5B 2GNKA 3CJRA 4OJHA 1NPRA 1KDNA 1RACB 1CQNA 1GFWB 4EEYA 4DR7F 2HNYB 4X4VA 3IP0A 1RTDB 4NLYA 4QYRA 3SXLA 4ZN3A 3FQLA 4DWIA 3LPYA 4YMEA 1JXVA 1X0PA 2OUGA 3NKYA 1TKXB 1RQ0A 3QZ8A 4MIWA 2AEJA 5B0FA 1NH7A 5ETTA 2WZ1A 3F56A 3I0SA 3W66A 1K44A 4DX8H 3AXKA 5D8HB 3MR3A 4CP5A 2K3KA 2HFSA 2D7SA 5KFEA 3K8WA 3TA1A 3I56S 4ZVTB 2CDQA 3D68A 2C2RA 4DR5J 4IQMA 3GJSB 2VC0A 4FKYA 1SQFA 2OEMA 4ZA1A 4J9OA 2P8IA 4NLVA 2CFXA 2ZE2B 3HJVA 2POKA 3FFIB 1LW2B 4L73A 2VKRA 5IT4A 2DH9A 2DGWA 2RJZA 4IQXA 4B3RJ 4Y6IA 2I38A 5H9EJ 3JTNA 3CE8A 4WKYA 1X9SA 1HR0J 3HVWA 3NGRA 3ILIA 5AXKA 4CM0A 2DNYA 3A3OB 2JC1A 4MIBA 4X65J 1UEVA 1IKYA 5J1NA 1TKZB 2E5HA 4ZS6A 3MFHA 1RHQB 1K47A 4GMKA 4ZLNA 4A8YA 4B3TF 1FJGJ 4F2SA 2EWHA 4ZMMA 1RT5B 2W1BA 3O3LA 2FLOA 4IFYB 4MYTA 2AT1B 1CQMA 1RBLA 2M52A 3LTOA 2OKQA 4TN2A 2XMWA 5EX3A 1R8CA 3M8QB 1AFIA 2E9RX 1LWEA 4YN3B 2QMUB 3KHLA 1RU1A 4HDGA 3UN2A 3NOGA 5GAGU 3DRXA 2YX4A 3MM9A 3D5MA 3VAFA 4O3QA 1NPPA 4QIEA 3ZFVA 4ED0A 1D8YA 1CEZA 2XGQA 2GGPB 3MMJA 2DKOB 4WZQA 1NDKA 1NK6A 3VAIA 4C11A 1REGX 4A8OA 2R4FA 1JJ4A 3Q8YA 4AYBD 3CCWA 1OYEA 5KT2A 1EKRA 3QSYB 2B9YA 1NHVA 1QUPA 4ZVUB 3ZO7A 4RNNA 3H59A 4CWBA 2W9CA 3C19A 1P1LA 5M2RA 3NY0A 2MGZB 3KHGA 4NRUA 1AB8A 2XI2A 4JUZA 3CDWA 4A8FA 1IUJA 3IG1A 1RAIB 4AXJA 1RLCL 1BE4A 3MM6A 4P73A 2P2CB 2HHHJ 1S72S 1ZETA 1HBMB 1V5VA 1HMVB 4OX6A 3VAKA 4ERDA 1RTJA 1B7YB 2AX1A 3HP6A 1NRKA 3MMBB 3OHBA 4JB8B 4HKQA 1TMJA 1Z2ZA 1DQ8A 2EI5A 5HJYA 3R7NB 4CQ1A 3GYXB 2UP1A 1CC7A 5A8WB 2F63A 3R7BB 5CAAA 4M1KA 2BMBA 2FHOB 2DRDA 2Y9HA 4QBUA 4KY3A 5HAOA 5AJ3F 1H7WA 2V2VA 1SV5A 2X1GA 3Q89A 1GXUA 2C2MB 4PG4A 4OYOA 1TK5A 1RTIA 4KGZB 2CQIA 2PO4A 2J6UA 2W9BB 1S1XB 1HD1A 2FQQB 3QT7A 1GMWA 5F8LA 3BF4A 1D1UA 2ZBIA 1ZM9A 2QEXS 2JFKA 2M9KA 5AXNA 1U24A 3CJTA 4IG0B 4PWWA 3MR2A 3NOCA 1FTCA 5DG9A 1RA7A 1Q16B 3QFHA 4DV4J 2KI2A 1Q78A 3AJDA 4CO3A 3C3LA 3PFEA 3MFIA 1VQ4S 3EZUA 3BGRB 2VG7A 5D77A 3VAMA 1Q4RA 4BS2A 4CLLA 3GE9A 2F4VJ 4WP9A 2IIHA 4NXMJ 2QLFB 3DHXA 3SYZA 1JLAA 1VQNS 3OJSA 4NCGB 3LP1B 1WF0A 4DN0A 3FK4A 2AZ1A 1TL3B 5KFWA 2DNQA 4OI6A 2EG1A 3MCSA 3BR9A 2OIHA 3AB2B 3D54A 2I2YA 1SC3B 2FJEB 1M5OC 3AA8A 4F25A 3KDNA 1HQ2A 2YH1A 2GO9A 4Q5VA 4O4RA 2W8KA 5KFHA 2LMIA 5KT4A 2V4JB 1OWXA 1RKIA 4ZPDA 2BKOA 1FCAA 1EP4A 1GMWD 1HWKA 3W9IA 2DGVA 5ETQA 4M95A 1T9VA 3RRHA 1HNVB 4A4JA 1N32F 4IFVA 1MMNA 4DPWA 3KJVB 3A3PB 2FLPA 1FRKA 3UR3C 1M5PC 1R8PA 3C14B 1T94A 1WF2A 2OJ3A 2YKMA 4JV1A 1WTFA 4B3OA 4L3NA 1A7GE 1KLMB 4JV5F 4EU0A 2KG1A 4Q8FA 2R7OA 4CH0S 2UXCJ 5KOWA 1AZSA 1RB0A 3OUYB 2FJXA 4RW4B 4ICLA 5H9FJ 1V5IB 3M8PB 1NU4A 3CSKA 1HPZA 1NAQA 3P5TL 4LF5J 4YY3F 1LW0A 1T9TA 5HK4A 3A1YG 2F5GA 4UQGA 5B0AA 4QYZJ 5J2NA 4QR1A 4ILMA 2HURA 2CPFA 2BJ3A 1YQHA 2BANB 1MN9A 2I8EA 2QLWA 2QX0A 2PIIA 3ZZ0A 2KJWA 1X4HA 1I3OB 4ZP9A 2HYIB 1UJ6A 1PBUA 3PR5B 2VG6B 1LWXA 2UXBJ 4ZPBA 3AY0A 3UVJB 3VQTA 1T95A 4U7UK 1UW4A 2RH3A 1AT1B 4IOAQ 2LVWA 3TEGA 2OPRA 3L4BC 5GADI 3AD8C 2HVZA 3MMCA 3FRZA 4PWDA 2H5EA 3GMGA 2XS2A 1DAXA 2OPSA 1TMMA 4ED1A 2Q43A 1FDAA 4ZPAA 2IA6A 3UD3P 3OVSA 3VVUA 3S7RA 4I7FB 3OV7A 5BR8J 3MTJA 1Y0HA 5AXMA 1U25A 1I6JA 1PC5A 1NZAA 3K0JA 4I2PA 1NB2A 4DR3F 3MPWA 1U1RA 3H25A 1X0FA 2IC3A 1VQLS 2J5AA 4ER8A 5HP1A 4AE5A 1OQ3A 2RKIA 5CCLA 4W4MA 4DF4A 1N33F 3M4XA 4Q8EA 4G3IA 4WFNQ 2Q1LA 1SCJB 3U7JA 1R43A 1X4AA 1WTBA 3HK2A 2K8GA 3KLEB 1TL4A 4KO0B 1D3WA 4JI3F 1HYSB 3HD1A 1TKDA 1FERA 3H2VE 4PCQA 2RHQB 5CYMB 3SSQA 1RA6A 3PY8A 1VRTB 4OZ1A 2XZDB 4ECTA 1LWCA 2GQCA 1ZA2B 2AYGA 1S12A 3B82A 1H74A 1Z4UA 1ZYQA 5L38A 5A2QY 4XO0A 1FRXA 3UWTA 5I4MA 2JL9A 3BQ1A 3CD7A 4RUBA 4F0HA 1EQ0A 1TP7A 5U47A 3TP2A 4WIIA 4OI1A 1N56A 5CHCB 3QYYA 4FF4A 4DJBA 4DG1A 4LF9F 2QFJA 3DOLA 4R8UB 5DQHA 1WOOA 5JMNA 3N0VA 3D3CJ 5J2PB 4KH0B 2VHGA 3KK1A 2AQ4A 2EFOA 1LNQA 5KG6A 2VL1A 3P45B 3D3BJ 3AAWB 3DHWC 2KDOA 2ZBPA 4PPZA 2RRAA 3CDBA 1VK8A 3Q8QB 1VRUA 3BQ2A 1RLDA 4V19J 1N4LA 1YJWS 1TR0A 2UUAJ 2AHOB 1WDDA 3THPA 5IZHA 2HHQA 2A2DA 3K89A 3S01A 4ED6A 1U0HA 1KHVA 2B4OA 4UT4A 4UUXA 3UDLA 3H90A 3VQSA 2EW9A 5IC6B 4I69A 1I94J 1RISA 1TAQA 1XJWB 2E7XA 2NUHA 2H4WB 3TJ9A 2HEKA 3UN5A 2V69A 3NNAA 3A8JA 3JSMA 4FDFA 3IXQA 5DGAA 1WOSA 2M8HA 3QT6A 1IKXB 1UFWA 3VV2B 3PCOB 2E1MC 3TAMB 1T03A 2OEJA 1UEKA 7AT1B 3OR2A 2NXCA 4OZ2A 2R9LA 1HBOB 1W26A 4RLEA 4DR1F 3HJFA 1FJCA 2ZUAA 3CO9A 3B4MA 3QRPA 2VQEJ 4FXVA 1FKPB 4F67A 2YNGA 3R6LB 1KC8T 3B8HA 4A8WA 4LVNP 1ZAVA 5CYQB 3A13A 3R9LA 4JI8J 4DR4J 2QE5A 3M2RA 2ZH5A 3DDNA 5DLGA 5IOLA 2D3OR 1HNZJ 4CLFA 2HMIA 2XY7A 3TUIC 4QWEA 1LFPA 3CJ8A 3QJPA 3DRSB 3MCOA 4N41A 2ASDA 5LT5A 1S9EB 2N4DA 3DLGB 2KHCA 3WX4A 3M9MB 3N5BA 2BR0A 4MH8A 5G4DA 4JI4F 3KKFA 2IFXA 4O3OA 1KOOA 3RBZA 2X3DA 2DGQA 2XMAA 1E6VA 1O6XA 3K59A 2UXDF 2OMLA 1VQYA 2DNKA 3N79A 3TVZA 4NXNF 1CLFA 1JIHA 3PFOA 3N28A 1D8ZA 2DHAA 4K50A 3BGFA 3QRQA 2PI5A 2WB4A 4F2RA 3R7SB 4YEAA 2Y1RI 3KXDA 3NG8A 1W7WA 1M5VC 4LBIA 3HLUA 4URQU 3J7Z5 2DO4A 5HMWA 2HNDA 2CPEA 4CLYA 3TZYA 3KUGA 1Q8LA 1RBOB 3K5OA 3LO3A 3EPIA 4C4WA 1RT4A 5IFMA 2MZSA 1FKAF 1T9XA 3GSIA 1B4SA 2R8GA 3J7YU 3JSRA 5L46A 2NXUA 2UU9F 4NYZA 3IGNA 2WW4A 3R6GB 1JKHA 4C48A 2EC2A 2CNKB 2BJ9A 2XC9A 4ID5B 2HZAA 1FFWB 4DL3A 3UN3A 2PGCA 4JI1J 4TVAB 5IXUA 3VGUA 4USHA 4PXCA 2OFHX 3NAHA 3HCXA 4J9RA 3NBPB 3DLKA 3GPAA 1D0EA 3PJWA 2NSCA 4USKA 2CJQA 4MFBA 1KVJA 4RW9B 1FJ7A 2XCAA 4DPUA 2NLWA 2CXEA 3ZZRA 1MW7A 3OPKA 4GVBA 2YNIB 4USIA 1C0UA 3IMQJ 3C6UA 3PYGA 2FVSA 5KFRA 1IR2A 5LMUJ 1WC3A 4Y2KA 3JYTA 2FPHX 2V8HA 1EB0A 5I42B 2KJVA 2Y8YA 1P6TA 2HFUA 4XTTA 1Y5IB 4X4NA 1YRUA 2VB6A 1PJ5A 1S9GB 3LAMA 3W61A 1MWYA 2IYIA 4OYBA 4K4YA 2AGQA 3L7OA 1D9DA 4AD6A 5DDOC 1KEKA 4KGVB 2MZRA 1SUQB 2DHSA 2HQ3A 4DCPB 1S1WA 2GMLA 2KVIA 1DQAA 1H2UX 2QGFB 1DTQA 2YKNA 3QJJA 3GIKA 5B0EA 4ZVFA 2XS5A 2VPZB 2DRBA 4PUOA 3C6TB 1TFWA 1S59A 5KFUA 4UOGA 1DLOA 1C2PA 1RT7B 3M30B 7FDRA 5KFVA 2NCKL 3RB3A 2ZITA 4FYWB 3KK2A 2H3EB 3PV8A 3VR1A 3L7UA 3M6UA 1NSPA 4B08A 3M8SA 3K7RA 3I4PA 4KFBB 2CQPA 5K20B 5D0GA 3G82B 3UNYA 2J0XA 4RUAA 2CQ0A 5HQMA 2LECA 3LOUA 3QIPB 4K8RA 4P2MA 1U45A 1UZHA 3ISZA 5GAGI 4F26A 3C15B 2AV5A 3Q8UA 4M5HA 3N6LA 3M32B 1TK8A 1JLEA 1WHVA 3CCRS 1V9OA 2OPQA 3HFZB 4CLWA 1BD6A 1RT1A 2HG4A 1Q7YT 4Y2MA 1PJ7A 1NXIA 3IC1A 2FTRA 2OD6A 5HSPA 3DKDA 4USWA 1XMOF 2CPXA 3MECB 2FGOA 4O0IA 1KQGB 2EG2A 3FMWA 3H40A 2QG9B 5D3GA 3OTOJ 5D4LA 3DRPA 1H3DA 1TL7A 5ETLA 3CCLS 4CO0A 3TX0A 2PMWA 3AJ1A 2DXFA 2GHVC 4M5DB 4RBUA 1JLCA 3T1YF 2OI2A 5FDLB 2K1RB 2I5JB 2GA7A 3AQPA 1B0PA 1MMDA 3B54A 2HRUA 1S6QB 4PG5A 2XB2D 4NCAA 4C98A 1E6YA 3TA0A 3H42A 5IT9U 4DS5A 2CJXB 1SXLA 4H4OB 1ITPA 4PXDA 1OS5A 1WI6A 5EN1A 1WEZA 1F1BB 4LR7A 2DXEA 1RT2A 3G96A 5H9EK 4EBCA 4TY8A 4RW8B 2AMCB 1F9EB 2F65A 3E3XA 3POTB 4P7VA 2VG5A 1IBMJ 2MXYA 3HPOA 4ZIWA 3RJMB 3CO0P 2KB2A 2BUNA 1NH8A 1NCLA 1OY9A 2KZZA 2HLTA 2B9EA 1VK3A 1RGVA 3PACA 3THTA 4KJIA 2CPZA 4EBEA 3HD2A 4JI0F 1FNXH 2CNOB 4JBCA 3MUVP 4Y00A 3TVKA 2OP5A 4ZP6A 3QAUA 1B7FA 2KXHA 4DQRA 1CJUA 3CEDA 1EETB 4KGXB 2BABA 1KQKA 4YR3A 1U1QA 5KG1A 1RP5A 4P7TA 1U6FA 3RRGA 1TVRB 5SUHA 1HBNB 1JJCB 4U96A 1W2IA 5HBMA 4JI2J 3PX0A 2XHWA 4ANCA 2RNEA 3KLHB 1BLUA 2D74B 3UDCA 4ZJLA 1TFYA 4MKAA 4MT1A 1XMQF 1NO8A 4OJ3A 2W7AA 4I68A 2FVRA 5JJBA 3GYNA 1SJFA 1CC8A 4R5PA 2FZGB 2DK2A 2ZKTA 1YBAA 1DHMA 3OD2A 3D6TB 4OYZA 4CM2A 3UNGC 1FEHA 4G65A 1MROA 4OHWA 3ZTOA 4A8SA 3M6XA 3TUZC 3W2WA 5M2UA 2E9ZA 1CJKA 5H1SV 4DPTA 1Q1KA 1KFDA 1H72C 4DUYJ 3EGWB 4K4XA 2FJVA 4FYVB 4RBTA 3FZ2A 1ZBTA 4KH1B 4OFZA 3FDSA 1ROFA 3D66A 1F9HA 1NK5A 2V8DA 2OPPA 1FESA 3G86A 5EWGA 3CJSA 3KYLA 3GONA 1N36F 4M63A 3CDAA 4H54A 4ID8A 1JNRB 5BYRA 2WOMA 3PO5A 4NX9A 1Y11A 3DM2A 1R8BA 1RUSA 2EPIA 4LRAA 4J5OA 1X60A 1VBXA 5BJRA 1FFGB 2B51A 1TZ0A 2DITA 1GTHA 5KG5A 1RWMB 3ET6B 1HNXJ 1SC4B 2RF2B 4TQRA 3G9CA 2MY7A 3QO9A 3M8WA 3UDEA 1WACA 2WSFC 3FSXA 3H0PA 4X4UA 3Q83A 2CQGA 1SKWA 4RUHA 4FN5A 2DR9A 1TKTB 3OFGA 1CJVB 1T11A 4ZLPA 3O6QA 1MLAA 3VGSA 1Q5VA 2H4YB 1IBCB 1AFJA 2B5JB 2WBRA 2XNRA 1KOHA 4BHQA 2I1RA 2CQ4A 1JX4A 4KBIA 3DYAB 4IDKB 4UOHA 2MHEA 4DUTA 3RR7A 2GMJA 4NEZA 2M2BA 1S1VA 4ZHRA 4KQZA 2RDIA 1VQMS 3AODA 2EKNA 2DCUB 3HVAA 1FI4A 2RRNA 3N01A 1PAUB 5T7LA 1BHNA 2PFFB 4YOEA 2UUCF 2CJBA 2ROGA 4W92B 4PYAA 2C2KB 3S1TA 1XEZA 4ED8A 2A10A 1Q8KA 2G2ZA 2J0QD 2M5YA 2NPIA 1U48A 3CMQA 3EUNA 2DGSA 2ZHBA 2JWNA 3JQJA 4Q7AA 5KT6A 2IM1A 3BO2A 1FO1A 3OLBA 5A0YA 3PKMA 2E29A 1T02A 3K57A 5C25A 4O3PA 1UA1A 4K4ZA 1N33J 2Z30B 4PRFA 1FKOA 3IM9A 4RW6A 2D9OA 1QAXA 2BDPA 2PEBA 2NR0A 3LP2B 2YX7A 3PEHA 1S10A 4QQBA 3D9BA 1CVJA 1S7IA 1OIAA 2COLA 2DY1A 5KT5A 1N48A 5ETMA 3OXLA 5L1LA 2N7CA 2DH7A 2QMWA 3N6NA 4I2QB 2J0WA 1N6QA 1R6YA 2H54B 4DBQA 3OSPA 3JXOA 1BWEA 4I4BA 1FRLA 3OTEA 1IJEB 4M94A 1VQ8S 5A8RB 3UW1A 3DN9A 3LWLA 4WK1A 2V2QA 1N5TA 1KSPA 2QLXA 1SH0A 1NNDA 1S48A 3WX8A 3TEHB 2VUGA 2RILA 4DSIA 1BMQB 3PHEA 1Y5NB 3GFZA 3KLVA 3CCQS 1H73A 2CKWA 3Q8VA 3MPUB 2DNHA 3MM9B 3PRBA 4DR5F 3CGIA 4HH1A 4QYZK 3NS5A 2V4QA 1UWAA 2P9EA 4K2XA 2AIRB 4EUVA 3TX8A 4OZLA 3PW4A 2YQ3A 5J1EA 5IM0A 4C11B 3C66A 2IM3A 2HPUA 2MDAA 1SJ3P 3IGVA 1KONA 3PIOQ 4B3RF 4WKRA 2C2DA 1ZAWA 2JX2A 5AE2A 4DV1J 1KRPA 2JHEA 3MD3A 1U8SA 4W90B 1JLBB 2W9CB 3PW5A 4O3RA 5C24A 4OLPA 4CH7A 3L9ZA 3J7ZT 4M8LA 1JLFA 4X65F 3LGMA 4F3OA 1OMSA 3T5HA 1NDPA 1Y3KA 1YRTA 3U27A 2G1HA 1R8HA 3IG1B 4KSEB 5B09A 2ALYB 4JI5J 1FJGF 4QPXA 4B17A 5K8PA 2XMVA 3OL6A 1CJTB 1WEYA 3W2VB 1MWZA 4FNIA 1RTJB 5LJ3Y 5ETRA 1S0VA 2C2ZB 2DB1A 4DSFA 2ASYA 4QU6A 1RKJA 4ECRA 3MD1A 2NXJA 3GIRA 1LXNA 1KD1T 1NM2A 2E66A 2RU9A 4ZDNA 2H9ZA 2BE2B 3BN4A 2GVZA 3CCES 1XN9A 1UFLA 2LP4A 3WDOA 1JLGA 4KIAA 1YKWA 2GJ2A 2WRMA 5KFOA 4ES3A 2ZBRA 2MSSA 2PI4A 2XCPA 3ZNJ1 3ONQA 3OXGA 1HWUA 3DNCA 3GFXA 3GYGA 4UW2A 2XMKA 4H4MA 3H8YA 3MWBA 1WNEA 1TL5A 2GIQA 4ZCKA 5KFIA 5EHHA 3GFYA 1JB0C 3P5BP 4RW7A 2RDJA 4HACA 3C2PA 2JOQA 1DQ9A 3AA9A 2A3JA 3GJQB 4O4GA 3HVRA 3OBIA 2PN6A 2EKYA 2HQCA 4DV7J 4IUFA 1DFDA 1A6LA 2HHHF 1K8AT 2M7SA 4ELVA 1SVDA 5DQIA 1QLNA 4TY9A 4ED4A 1UVMA 2DIUA 2R7SA 3G6XA 4NYPA 4F4YA 3ENAA 2R8HA 4CLSA 1OQ6A 1F5CA 2KG0A 2BBEA 2ZUGA 4TU8A 2O5DA 1EKSA 2RMLA 3EMTA 1EARA 4NI2A 1QVGR 3QWPA 1DTTA 1JLAB 2JVOA 1SIZA 4NYOA 1M1KT 2IM0A 1HWJA 2AGPA 1LQ9A 2RAQA 5LJ5Y 4BCAA 4OJ1A 3DOKA 1IBLJ 2W2PP 1LFWA 2N82B 2UU9J 4N8OA 3H4DA 2XYGB 3HI9A 3G8QA 4X4OA 3MUTP 4A8XA 3I87A 4X62J 2XQCA 4ECXA 3F0NA 4AT1B 1W2BR 4Q44A 1F6TA 2ILZA 1KTQA 2HAIA 2HQFA 3GFHA 3J7YI 4DV4F 2GHWA 5KG3A 1FRHA 5GAHI 4WK3A 4X4QA 1I51B 3BDEA 4KYZA 1BQXA 3I9ZA 2ZH9A 2YKMB 1WF1A 1HNWF 4UOFA 1VQPS 1NUEA 2F4VF 1JLQB 3D2WA 2CQBA
chains in the Genus database with same CATH topology
1LKZA 2MKCA 1HNVB 2HHVA 4A4JA 1N32F 4IFVA 4NXMF 4IG3A 1MMNA 3KJVB 3M9NB 2QIFA 4QR0A 4QCLA 4CTAB 2U1AA 5GAHU 2IVYA 2FLPA 1FRKA 2IA0A 2KFNA 4QIVA 3CJ2A 3MEKA 3LANA 3UR3C 3SDEB 4X62F 3MM8A 1UVKA 2DT9A 2P9GA 4LSLB 1S4FA 1R8PA 3FEXB 1T94A 2RIJA 1M5PC 1WF2A 2OJ3A 3QMQA 4DL0C 1NK4A 2YKMA 1HW8A 5J2NB 1LK7A 3KOAA 4JV1A 1WTFA 4ES2A 4B3OA 4L3NA 3O44A 5IQQA 4DSJA 1S6OA 2DGTA 5K8MA 1O0PA 1A7GE 4LUBA 1KLMB 4JV5F 2R2RA 3HMJG 1FXLA 3EX7B 2DNZA 4EU0A 4OHXA 2KG1A 2AYBA 4Q8FA 3RZAA 3P6YC 2R7OA 3R3TA 4CH0S 3KG1A 4OX8A 5KOWA 2O01C 2RF2A 1Y00A 3OUYB 4BWJA 2FJXA 3MDFA 3BGUA 2CQ1A 4RW4B 2B43A 5KFYA 4ICLA 3BB5A 4I6WA 2C3OA 5H9FJ 3M8PB 2V94A 1NU4A 3B4DA 3MEDA 1SJ4P 3CSKA 1HPZA 1NAQA 1C0UB 3Q23A 3P5TL 1ZTTA 4PR6A 4ZVGA 3KK3A 3C6UB 4YY3F 2FHJA 1LW0A 5KT3A 3JAMY 2W4DA 1GX6A 3O1LA 1FRMA 5DDPC 1TKTA 2B4UA 2RQKA 3OFFA 3A1YG 4UQGA 2ASJA 5B0AA 4QYZJ 5IT0A 5J2NA 1RK8A 4QR1A 1U6BA 1QAIA 3QGGA 2GO8A 3JYTB 1SL2A 4ILMA 1KLMA 1RYRA 2F9JA 1K9MT 5ADZA 4HI1A 2BOPA 2CPFA 3FNNA 1TL1B 2B5JA 1YQHA 2BANB 3T6BA 2I8EA 1F9FA 4DFMA 2O1PA 1S7HA 2CVEA 2QLWA 2PIIA 4C3KA 1UWBA 3ZZ0A 4EYHB 4BBYA 2KJWA 1X4HA 2SXLA 1K0VA 4ZP9A 2HYIB 1UJ6A 3R27A 4OZ5A 3PR5B 1UEUA 1TQLA 4UUWA 2VG6B 5A8KA 3DYAA 4IDKA 5E3RA 4FXWA 3KFWX 5EDWA 4KV8A 3IR6B 4ZPBA 3AY0A 2XY6A 2JRSA 4X84A 5HMYA 1U1KA 4WE1A 1U6ZA 1NEEA 3VQTA 4OZNA 1T95A 4U9RA 3GIIA 3TAPA 3IRXB 5D6GA 3I9V9 4U7UK 3FEYB 3FVYA 2C28A 5KFJA 2JJ4D 3OR1A 2O3DA 1UW4A 2RRBA 2AJ0A 2CJ9A 4LT6A 2ZOMA 4A8QA 1ZAXA 2RH3A 2KO1A 2BQ3A 1S1WB 2DNRA 1RTDA 1UVLA 2UXCF 1LWFA 3LP0A 3GWCA 4I1TA 3T9NA 3SV3A 1Q8BA 3PNIA 4IOAQ 3THVA 2E5LF 1KQSR 2LVWA 1K0TA 4USJC 2OPRA 3EGNA 1TKXA 5GADI 4QWBA 4QOTA 2DPJA 1CPZA 3UR0A 1N0UA 1FF2A 4PUOB 5DO2A 2HVZA 3MMCA 2BM0A 1SL1A 3HX9A 3OVAA 2J6TA 2A2CA 2G13A 3FRZA 3OL9A 4N56A 1Q79A 2L9NA 3NP5A 2LQ5A 4ZP7A 4PWDA 2H5EA 3GMGA 2XS2A 1DAXA 4KKOA 2OPSA 4DV2F 4ED1A 4F2SA 4BWMA 2MMYA 2Q43A 1FDAA 4ZPAA 2IA6A 2W24A 1QUVA 3EXYA 3DXBA 3GIJA 2VFRA 1DLOB 3BSOA 3UD3P 2DVIA 2MKJA 3OVSA 3ETOA 2OO4A 3GR1A 3S7RA 4I7FB 1OPZA 5C42A 3OV7A 2AJ1A 4LFBF 2KXNB 4R0JA 4RU2A 3MTJA 1Y0HA 5AXMA 5CYJA 3KK2B 4G1QB 3IWNC 3L95X 4WYWA 4XDCA 3TYTA 1U25A 1RTHB 1VC6A 5E3AA 2CQHA 1I6JA 4GO5X 4QJVA 3OTDA 2D9PA 3KHRA 3N9UC 3V5RA 2F3JA 2WTFA 4DMZA 2YH0A 1PC5A 3P3DA 1HD0A 2UXBF 3UQSA 1NZAA 2ERRA 3K0JA 3LP2A 4JI6F 4I2PA 4DR3F 4C7QA 3MPWA 3GV5B 3RR8A 5GVQA 2VQFF 4QW9A 1U1RA 1AXQA 2XSJB 3H25A 1X0FA 2HWHA 5B08A 2IC3A 5F3ZA 4CNYA 3QGHA 1VQLS 2KRRA 4FF2A 1C1CB 4C8KA 1ZM3A 2J5AA 3PXGa 1F0XA 1KVIA 4Y2IA 3SMZA 2FHJD 1Y7PA 1H98A 5HP1A 4CI0B 2ZE2A 1OQ3A 4AE5A 3D1OA 1N5SA 4WXWA 2RKIA 5CCLA 3K5NA 1OO0B 4I2QA 4WFBQ 2PA3A 3IWLA 5HROA 4DF4A 1N33F 3M4XA 2HHPA 2Z2LA 4YP3A 2ZH1A 4FF1A 1GTEA 3AQOA 4OHVA 4A46A 4Q0BB 1S1TB 2DO0A 2HGNA 5DRKA 3F41A 4WFNQ 4QWCA 4Q8EA 4G3IA 1VQ6S 2Q1LA 3MPVA 2PT0A 3KLGB 1Q7LB 4B9TA 4DV6F 1FNMA 3CWJA 5DJBA 3U7JA 2OPQB 1R43A 3HFKA 1X4AA 5CCMA 1WTBA 3HK2A 2ADCA 1T05A 2XY5A 2K8GA 3QJLA 5A8RA 3KLEB 4OHYA 2J76E 1TL4A 4KO0B 2V8VA 5CQGA 1D3WA 4KHMA 4EO6A 4JI3F 4JV0A 1VI7A 4DL5A 4URGA 2VPXB 1HYSB 1TKDA 1FERA 3H2VE 4PCQA 2WK4A 2GCFA 5CYMB 5D4PA 3SSQA 2ILYA 1DZ5A 2UZAA 1RA6A 3PY8A 3NMRA 4KPYA 1VRTB 4OZ1A 1RYSA 3DOLB 3GQCA 4QWAA 5T41A 1TKZA 4UY85 2UV8G 5D3GB 1FTRA 1LWCA 4ECTA 6FD1A 2GQCA 2XMMA 1N5QA 1RDRA 2EC0A 3DRPB 3U1MA 3GILA 1U1PA 1L5UA 2AYGA 1J5EF 4Q0BA 3B82A 4WFAQ 3MURP 1Z4UA 4J37A 1ZYQA 5F8GA 3EPGA 1L3UA 4OX9F 4TLQA 3B78A 2FC9A 3JSYA 3Q8SB 5K14B 1RT3A 3I5AA 5L38A 5A2QY 4XO0A 1FRXA 2DGXA 3UWTA 3SEOA 3G6YA 1HR0F 1TAUA 2E5GA 5I4MA 2JL9A 3KLEA 2KZMA 1JXLA 3BQ1A 3CD7A 4KO0A 4F8RA 1TP7A 1RT5A 4ECVA 5U47A 3X1LB 3DLEB 3TP2A 5FLXY 2D3UA 4IFYA 4RNHA 4WIIA 4OI1A 3G4SS 5CHCB 1N56A 1YVFA 3QYYA 2V8GA 3TVYA 2MQQA 1VQSA 2CJAA 4FF4A 4HL9A 2YKQA 2BYCA 1R3NA 4GO7X 2FDNA 4ZVHA 1WEXA 3L09A 4B02A 4DJBA 4DG1A 2DNLA 3IO1A 7FD1A 5EWFA 4LF9F 3PW7A 4DV0F 2QFJA 3RB6A 3DOLA 4R8UB 1JXEA 3M8QA 4C0OC 5DQHA 5J1PA 2L3MA 3EYZA 3KLFA 3G6VA 4NCBA 2N3OA 3V6KA 3N0VA 2BRLA 2OAUA 2DISA 4LF8F 4CH1A 5T14A 5J2PB 3CCUS 2EFNA 2PD1A 3KK1A 2AQ4A 3U1NA 1G3OA 2EFOA 4ATNA 4OZ0A 1MMLA 2CIMA 2CZVC 1JLBA 4NLDA 5KG6A 2MKKA 2XMTA 1FEEA 4DR2F 2VL1A 4KHRA 2VONA 2GGPA 4X64F 3FSYA 1KNZA 3GG0A 4IOBA 1FDNA 1UETA 4ZKAA 1R8AA 4KGMA 2JSXA 2WSEC 3S8SA 2UUWA 2YX1A 2DNNA 1RT2B 4C8LA 3HZGA 3AAWB 4LFAF 2IJFA 1FD2A 2HNZA 2KDOA 3DHWC 5KFKA 2R8IA 3UI3A 4PPZA 4MYUA 4K0KF 2CQDA 5DETA 2RRAA 3CDBA 3QGIA 3PIPQ 2ZVSA 1GNKA 1VK8A 1FRIA 4TY8B 4OIXA 3Q8QB 1VRUA 3CJKB 3BQ2A 3MM5B 5J2PA 4V19J 3HHKA 2OH2A 2C3UA 1HHSA 1QJHA 3OSNA 4HT7A 1N4LA 1X5SA 1YJWS 3RRKA 2E44A 3U02A 4CO5A 4HVZA 4NOHA 1APSA 1IJFB 1TR0A 5SZTA 4LMZA 2G1DA 3ZZUA 1UJ5A 2MGZA 1YIJS 3N4WA 4RNMA 2ZHAA 2KYZA 2KRBA 4L72B 3CJ3A 2ZJRQ 1N54B 5E7OB 3G6ES 1F5AA 2RUGA 1X8DA 3THPA 5IZHA 4ECQA 1S49A 2HHQA 3W2VA 3JSMB 2VKZG 5L1IA 5KG2A 3NNCA 2A2DA 3HHLB 2HS0A 4CT9A 1Q81T 5KFQA 3S01A 2WHOA 1YJRA 4ED6A 4WYLA 5B0BA 1O8BA 2GIRA 3CT9A 2Q3PA 1KHVA 2B4OA 4UUXA 3UDLA 3VQSA 4O44B 3FRYA 2HW3A 3H5YA 2CYYA 2EW9A 1NJYA 3FSIA 3CJKA 1R0AB 2Y1IA 2DPIA 4I69A 1FK9A 1U1MA 4KTQA 4HTJA 3NNHA 1D9AA 2RQ4A 2ZD1B 3FZBA 2BE2A 2JEIA 1L3VA 1RISA 1TAQA 3HKWA 3CMES 2F1FA 1N52B 2E7XA 4N5SA 4J9LA 3MF5A 2NUHA 2KFYA 2ABYA 1X5TA 3ZZTA 4HHJA 3SQGB 3FGVA 4CZCA 5MLCV 5KFGA 3NNAA 1HBMA 3JSMA 2NZ4A 1HMVA 4HI2A 3IXQA 3HHLA 4OI2A 5DGAA 2M8HA 3CDEA 5HN0A 2B7BB 2UUBF 1X7VA 3KHHA 2HFOA 1IKXB 1V3RA 4GKKF 1UFWA 4OX7A 4NLSA 2NS1B 2E1MC 3TAMB 1T03A 2RVJA 4C8MA 4PQUA 2L08A 4QWDA 1V3SA 2C3PA 3MMBA 2EBEA 3OR2A 1NK7A 5J2MB 1IKWB 2R9LA 1HBOB 2EFQA 4RLEA 1FDBA 2JVRA 4DR1F 3HJFA 2JEFA 1FJCA 2WB1D 2LEBA 4BC7A 2O66A 3M2RB 3V2UC 2F40A 3CO9A 4RWWA 1TK0A 1XR7A 2YNFB 1U09A 2UUAF 1F2GA 4LF6F 5K5MA 4Q2LA 1N0VC 1HFEL 5HBMB 3SQGA 3B4MA 4P6QA 3SSSA 5I3UB 4DL6A 1G1XA 1S1UB 4V19X 4P2SA 1H2VZ 4FXVA 4F4ZA 1RI7A 4B9NA 1FKPB 4IH6A 2BJEA 4F67A 1VC0A 2YNGA 3QLHB 1BQNB 1IKXA 3CVKA 3TAMA 2XLKA 1KC8T 4A8MP 2LLZA 3B8HA 4A8WA 3LALA 4OQJA 3K5LA 3UCZP 3PJXA 4LVNP 3CCVS 3RB0A 5KFBA 3IN5A 1U4BA 3BN7A 1ZAVA 5CYQB 1SKRA 2MB0B 1UKUA 2GC8A 3CJ4A 2F7VA 2XWYA 2FLNA 1YWXA 1IXKA 2QE5A 2Q6BA 3M2RA 4R5PB 2VD3A 2DR7A 1XR6A 1M5SA 3CJ5A 2ZH5A 2VBYA 3DDNA 2QA4G 4H4KA 1I94F 5DLGA 4PQAA 1X5OA 2YKPA 3ITHB 2D3OR 1H38A 2RS8A 1S1XA 3TNVA 5F3TA 2W25A 5EGYA 2XY7A 2HMIA 3SCLE 1FVQA 3TUIC 3NGKA 2RQCA 2QV6A 4D3GA 4QWEA 4XK8C 1ULRA 2YNHB 1LFPA 2VOOA 2AJFE 1MROB 2WW8A 1BQNA 3QJPA 1J2VA 3LW5C 1FHTA 4YR2A 3DRSB 4URSA 4B9UA 4N41A 4KC5A 1E6VB 5CH7B 2ASDA 5LT5A 1N88A 1S9EB 2N4DA 5FJ4A 3NRBA 4QIWD 3BO4A 1HWLA 3DLGB 3W2WB 2KHCA 5HQ8A 3CC2S 4QU7A 3WBZA 4MMOA 2MPUA 3WX4A 4G1IA 3M9MB 3M9OB 2AU0A 3CD0A 4Y65A 5JVHQ 1YJ9S 3I5BA 4IG0A 1U1OA 2PE8A 1S76D 2GFFA 3N5BA 4NMLA 4CO4A 2BR0A 3OXFA 4MH8A 5LMNF 5G4DA 2G4BA 5FD1A 3KKFA 4JI4F 3I5CA 1QVFR 2IFXA 4O3OA 1KOOA 4IYQA 3CIMA 3ITHA 4K4TA 2J7UA 4IH5A 2CPHA 2OMOA 4C8YA 4TYAA 3RAMA 3M6VA 4DQSA 4ED5A 2VPYB 2VQEF 2Q79A 4X66F 2DGQA 1KLNA 2IAJB 4ED2A 1X5PA 1SH3A 2YWFA 1VGYA 2OPPB 1E6VA 3K59A 3N6MA 4YFUA 3QGPA 2AGOA 2HNDB 2UXDF 2OMLA 3R1HA 4RBVA 1VQYA 2DNKA 3N79A 3TVZA 4KGKA 2WSCC 4NXNF 4F02A 1CLFA 1GXTA 3CPWR 3VF0B 1U47A 1JIHA 3H5UA 2F8EX 3PFOA 3MMAB 3N28A 1D8ZA