1Y3KA

Solution structure of the apo form of the fifth domain of menkes protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3kA00
4OJHA 1QUPA 1Y3JA 2IYGA 1TR0A 3MCSA 2BUNA 2LXFA 1S6UA 3DXSX 2QYCA 2GV1A 1Y3KA 2HIQA 3HFKA 1Q4RA 1R6YA 2BYCA 2K7JA 2K1RA 3LO3A 4Y2MA 1MWYA 5T7LB 3TNVA 4EFAC 2K2PA 3FMBA 4QOTA 1KVJA 4DN9A 1GXUA 1SQEA 3KG1A 4DPOA 1APSA 4HI1A 5A6PA 4HI2A 5B0CA 3LGNA 1FVQA 1TL5A 3HHLD 1LQ9A 1FEEA 4OIXA 3FRYA 5F0UA 5B0AA 3VTIA 3QGPA 2GCFA 1ULRA 1YJVA 3K7RA 3BM7A 1KVIA 3KG0A 4ZA1A 2OFHX 2KKHA 3F44A 1Y9OA 2AP6A 1N5TA 3BGUA 2FTRA 4FNIA 5B0FA 1V3ZA 2W4DA 4Y2KA 2LQBA 5T7LA 5B0DA 2FHMA 1WD6A 2GO8A 1X8DA 2ROEA 2OAUA 2XMTA 2GGPB 5B0BA 1TZ0A 2BBEA 1YJRA 4A46A 1Y0HA 2RMLA 1K0VA 2VH7A 1YJUA 5B08A 2KT2A 2XMMA 1TL4A 3MZIA 5KAKA 4A47A 1VQSA 2ASYA 3IWXA 1FESA 1P8GA 2W4CA 2G9OA 2VV5A 2IYIA 3BDEA 2K7KA 4A48A 1AFIA 2RSQA 3IWLA 1N5VA 3BN7A 1OQ3A 1FE0A 4U9RA 4A4JA 4FNHA 5IXUA 2L3MA 2ACYA 2XMKA 2OKQA 3CJKB 2AW0A 4ZOSA 2IFXA 4NL5A 2ZDPA 3E8OA 5K9FA 2N4DA 2PGCA 2HQIA 3GZ7A 1CC7A 1AW0A 2LDIA 2QLWA 2XMVA 2HLUA 2HFOA 2LQ9A 4HL9A 4OJGA 5B09A 1Q53A 2XMWA 1JWWA 1XBWA 2KYZA 1P6TA 1X0PA 3UDCA 5B0EA 3QMQA 3HX9A 4Q2LA 2GA7A 2KT3A 1KQKA 2W4PA 1TUVA 4HH1A 1SB6A 5F0WA 1OQ6A 1U7LA 1X7VA 2JDJA 2HFNA 2OFGX 3CJKA 3LGMA 2QLXA 1YRXA 4HH0A 1N5SA 1YG0A 3HHLB 1YJTA 1RJJA 3KKFA 1FE4A 2AJ1A 1AFJA 2AJ0A 1OSDA 2BJDA 2N4CA 2FB0A 2N7YA 1CPZA 2GGPA 2BJEA 2PD1A 4DL0C 1IUJA 1Q8BA 1URRA 4NPOA 1Q8LA 3TRGA 5B0GA 2OP5A 3BR8A 2ROPA 1JK9B 1S6OA 1MWZA 4YDXA 5A6WA 4Q2MA 1CC8A 2HLTA 4OJ1A 4Y2IA 1N5QA 3BF4A 1VQYA 2ZDOA 3FGVA 3HHLC 2OD4A 3DCAA 2Q3PA 4YEAA 2RILA 3HHLA 1SI9A 2K1RB 2RU9A 3WDOA 1FVSA 3TOQA 4F67A 1OPZA 2OMOA 2QIFA 3I9ZA 2EW9A 1FD8A 4OJ3A 2CRLA 2ROGA 2XMUA 2FIUA 3HDSA 3BB5A 3HF5A 1GXTA 1W2IA 2OD6A 3T9NA 3KNGA 2XMJA 2GFFA
chains in the Genus database with same CATH superfamily
3OHAA 3L9ZA 3UD3P 5L1IA 3CC4S 4OHWA 3LGNA 1SJ3P 1HA1A 4DBQA 3BPDA 3CNQP 1RAAB 4TKTA 4A46A 2MLXA 1QD1A 2WHOA 3TR5A 2CZ4A 2XWXA 2D69A 2I38A 5K14B 4PQUA 5KOXA 3LUYA 5IWAF 1X0FA 3QYYA 1SC4B 5HP1B 1OY6A 1FE4A 2J9DA 3UCGA 1RTIB 2MJNA 4DUZJ 2R8KA 4DPWA 2ROPA 4A8KA 2BKOA 3UN5A 4FKXA 3NWRA 1LNQA 4LBHA 4RX6A 4C11A 3HF5A 2RHSB 3SCKE 2DCLA 2P2CB 2BZ2A 4RUBA 3Q8RB 2J9EA 4PRFA 1M1GA 2YNIB 2C1EB 1RHKB 3S7RA 4FYDA 4UUXA 1HNZF 4OLOA 3VTIA 1RAEB 4RUCA 4RNHA 3Q22A 3K57A 4Q5VA 5DZ7A 2KXHA 1FRJA 4M95A 2ROEA 3FDSA 5KFMA 2UXCF 1TZ0A 5BXIA 2APOA 3VAKA 1IVZA 1K1QA 3H98A 2VFUA 2J7UA 1BHNA 4DSIA 3WIUA 3KK1A 2C3MA 4JYAJ 4RW6B 2A0FB 3ENQA 3LP2A 4N7TA 2WW8A 3M30B 3I55S 2VFRA 4UTGA 1PC5A 3TJAA 1DAXA 2ZUAA 1JK9B 3MI7X 3N6LA 1UEUA 5HANA 4DU7A 4URQU 2VA2A 2G2YA 3UN2A 1SC6A 4FF3A 1B7YB 4MMOA 1VOMA 3MXHP 2VA3A 2MZ1A 3H5SA 4CLPA 3KLHA 3HI9A 2P6SA 5HMXA 1FVQA 2UUAJ 3IG1A 1QAIA 3RB4A 5FJ4A 3PW7A 3HULA 1J5OB 1RAHB 4OZJA 3HJFA 1U6BA 3RAXA 2QL9B 4NI2B 2QTWA 2MSSA 5GMEA 4RW9B 4I1TA 1IWGA 4UZCA 5D0HA 4J7CA 1NK7A 3G8TA 1AB8A 3S8SA 3DU5A 1XR6A 3MOJB 4K50A 4NZ6A 2OI2A 3BSCA 4ALZA 2WTFA 1RT3A 2L9WA 2XHCA 3J81U 3DDKA 3KNAA 1S76D 3ZTPA 2Y8WA 4K4ZA 1BE4A 1FFGB 3EDQB 4OJ1A 2E1AA 3W2VB 2B3TB 1T03A 3TUIC 1WWHA 4I2QB 1RISA 2MTLA 3IS9A 2DHHA 4DR1F 2C2KB 2DRAA 1PAEX 4X4SA 2AEJA 2N3LA 4CLWA 3IXQA 3UWTA 4LFBF 2XCPA 1T9YA 4HTIA 3J7YU 1KHWA 1RB0A 3TVKA 2QSWA 1RT7B 4OMFG 4DF4A 1HNXJ 4JI4J 2AEFA 4KHMA 4AL7A 3MMAB 1R8BA 1R89A 3DM2B 2ZH8A 2R8HA 2AWZA 3GE9A 4PEOA 1L3VA 3M2UB 3N28A 1HKAA 1ZZNA 1NPKA 4DFJA 4L72B 4NXNJ 5C25A 3T6BA 2KVQE 5LM7E 1YZ7A 1RT5B 4DWIA 1PCAA 5ETRA 2CIMA 3L95X 3AQOA 3HMJG 3KLEB 4J37A 1LWEB 3LA0A 2BQRA 4DR2J 1CC8A 3NP5A 4DV1F 1SJQA 3K5LA 3L7PA 4ED5A 2QL5B 4OYAA 2X1AA 2HS3A 3CCLS 4PUOA 4TU8A 4AQYF 2U1AA 3ISND 2R7RA 3N01A 2MQMA 5KFBA 3NOGA 5HQMA 3UD5A 2BMBA 3NGTA 4Q44A 1VLYA 3J7ZT 3OFHA 1IM6A 4WFZA 4X64F 3N5FA 3GFXA 2JEIA 4USJC 2PI5A 2DEIA 3Q8YA 3KYLA 1P8GA 5DDPC 3NAIA 3M1VB 2DY9A 4AE5A 5LMUF 3BH7B 3EVOA 4YN3B 1I5OB 2V63A 3H4BA 2JOQA 3CJ4A 4CCHA 4Q45A 1KWMA 2RS8A 1UWBB 1QVFR 2OO4A 2R42A 2Y0SD 3SBMA 1CQMA 5D0RA 1ZYQA 3MR5A 1VIXA 4HT5A 4DV3F 2I0XA 4M8LA 1TMMA 2GGPA 3SCLE 4YOEA 1VC6A 4NLXA 1FJCA 3CW2C 4OZ0A 1KONA 3V4IA 2B7CB 5D4NA 1JXLA 1LFWA 5DQIA 1P27B 4Y34A 2CQHA 3AAWB 2UXBF 4NLRA 1HL6A 4OZLA 2M2BA 4LQ9A 3NS7B 3GWCA 3DC2A 4QOTA 1W26A 2GIQA 1FO1A 5J2NA 3PRVA 4M5DA 1FXDA 1I51B 5G0RB 3R5DA 2W4CA 4ECTA 4B3SJ 1QM9A 2EBEA 1SKUB 2DH8A 4DX8H 4TU7A 1FKPB 4C8NA 1RAOA 2ZWPA 4IG0A 2XY7A 4UOHA 5B09A 1MG7A 2F63A 4CTAA 3N4WA 5F0WA 1CG2A 3HHLB 2VZ9A 3VAMA 1F3FA 4YR2A 3PIPQ 4LF1A 2YKMB 1VBXA 1FRLA 1S59A 3UVJB 3OXLA 5KG4A 2QO3A 2J9DE 4ZVGA 2AYBA 4CLKA 3EGWB 4MKVA 3VAIA 5EX0A 3KLFA 1NK8A 1FNOA 4K7QA 3B4DA 3UDVA 5FLXU 4OX7A 3DLBA 2HWTA 5IZHA 2V4RA 4BC9A 4J5OA 4F8RA 1O6XA 2NPIA 3F44A 5CA5A 2ZBRA 2HAIA 2RH3A 3BBCA 3PACA 3VGVA 2RMLA 3OXGA 2ZM6F 4NA2A 1KQSR 3BREA 3OD2A 1UCNA 2WCXA 3MOZA 4USTA 3PX0A 3LW5C 1GH8A 2RQCA 2CJXB 5GMDA 1NSKL 1U26A 3V81A 1GMVA 5K8NA 5K9FA 4H4OB 4ZPVR 2LDIA 2VG7A 3UR0A 1TQLA 1S1WA 5MLCV 1XMOF 1N52B 2KHCA 2CG4A 2GW8A 1ACMB 3CJKA 3TA1A 1TL3B 2IM2A 1S6PA 4U7UD 2DXEA 4OV6A 3J7AN 1H7WA 4W98A 3MM7A 4L3NA 2CXEA 3BGRB 4YY3F 2ZOGA 2YNFB 2IM0A 3CGIA 4ICLB 3CB4A 2MQNA 4ZVQB 1HI0P 2ROGA 5BJRA 2BQ3A 3KJVA 2OUGA 3GG1A 3PFOA 3DI6B 1TP7A 1HPZB 3MPDA 3WIVA 4DEZA 3RBEA 2BM0A 1I94F 2FUG9 1APSA 1XIQA 4FYWB 1NZAA 2HHTA 2XG8A 3QO9B 4M94A 5DG9A 2OFHX 3AJDA 3U7JA 4X66F 2M8HA 5IC6B 4KGXB 2DGSA 1HNVB 1VRUA 4WIQA 1DHMA 4DR6F 4U6PA 5AXNA 2UU9F 5DLFA 4WFXA 1SVDA 1RHRB 3O1LA 1DRZA 3FZ2A 3FEZA 4MAKA 3WZ0A 3R5GA 3KK3B 3EE3A 4ATNA 2ALZA 4CIOA 2E5LF 1Q7LB 2MQOA 4YHHJ 3OL9A 3NKYA 3MAAA 4HH0A 3T3FA 2ATCB 3OSPA 4YUDA 3LTOA 1IR0A 3N79A 1RLDA 3J80U 1RI7A 5KFDA 4ZLLA 3OHBA 2DPJA 1U1QA 4K5RA 3DRSB 4ERDA 2J8SA 2DH9A 3W8GA 3T9NA 4C8OA 3D66A 4NCGB 5BR8J 4A8FA 2CPEA 5I4MA 3EMTA 3NNAA 1Y3KA 3H5XA 4QQBA 4IFVA 2UVRA 3BYRA 4FF1A 1UVKA 3MM8A 4ZVFA 5GMKa 2KXNB 3HT3A 5F8LA 1QSSA 4NMLA 1DLOB 2ILZA 4ZK7M 4A8OA 2RJZA 1VQMS 4KE5A 1S1UA 1X8DA 2OPSB 3N9UC 2D3O1 4E2FB 4OHXA 4ECSA 2MY7A 2VUGA 2R2UA 1UMJA 4MT1A 4CNYA 4FNHA 2R2TA 3FVYA 4RNNA 4ELVA 4LSLA 3DDIA 4G1QA 3HVWA 2FZKB 3QGGA 3PIOQ 5DQHA 2P9CA 2NUHA 4L76A 1NDKA 4WP9A 2N7YA 4P7VA 4J9MA 4CLUA 1UJ5A 3R5JB 4M5LA 1DQ9A 3BF4A 5D15A 1H7XA 4ES3A 5EWEA 1XERA 2D41A 3I4HX 1CJKA 2K1RB 3QWUA 1BC6A 1RDRA 2V2VA 3JSYA 3FK4A 3CXCR 3CD6S 4J9OA 2HZVA 1JLQB 3NNHA 4LFCJ 4R0JA 3BBFA 1ZZFA 1S6UA 1ROFA 3BH6B 4DOZA 4C9DA 4WYLA 1WDDA 1C0TA 3JSMA 3RB3A 3RB0A 5F8NA 1GTEA 2C2ZB 4G6VB 4RZRA 2L9DA 3T6JA 4LF6F 1LW0B 1WHVA 4F02A 1NDLA 1NM2A 3LPYA 4DV0J 2B7BB 2GMHA 1PYTA 4AYBD 1UFWA 1FJGJ 2JZ5A 3HKWA 4DL3A 4C11B 1YX2A 2CPYA 5IV4A 5B7WA 4DR3J 2ZBIA 4EI2A 1WC4A 1KOOA 2ASLA 3M05A 1WUUA 4IRDA 4JV5J 4CRJA 3TAMB 2PSZA 2ZZMA 3CCWA 1DQAA 2OTLS 1OPIA 2CQ3A 3K2YA 2Y1LB 1OSDA 2YWKA 4YDDB 3VGUA 2W9CA 1Q0NA 2XZTB 3V6DB 4X84A 2CJYB 1TELA 2LQJA 4NLQA 5A0YA 2RU9A 2AHOB 5H9FJ 4NXMF 3FSYA 3PR4A 2F9DA 4NE9C 1SL2A 1XNRJ 3DXSX 2ZJQQ 1JLFB 2OPQA 2LEAA 2EG1A 1C1BB 2XYHB 1X4EA 3LP2B 2CPZA 2JWNA 1HQ2A 4DR5F 2HBYB 4GC7A 3SSRA 1HBMB 1F5BA 5A8RA 5CCMA 4A47A 1NPRA 1Y00A 4KRWA 4UT4A 3TANA 2MEWA 4USKA 3UCZP 1H6KX 2RNEA 5HVHA 4UY85 4NL5A 1IBMJ 4KHPF 1FXRA 5L39A 1CC7A 4V1Ak 4QYZK 2ERRA 4RWXA 1NK9A 3THPA 2PT0A 3NXZA 1T9XA 4DLEA 1NBEB 3IG1B 3MECB 3DRPA 5KFIA 4P10A 1H98A 3Q8VA 1SUQB 2B43A 1X5OA 4FF4A 3MDFA 4TY8A 3FZBA 1AZSA 4CO4A 4HR2A 2H9ZA 2RILA 2IA6A 1XJWB 4Z7CA 1IKXA 3MR3A 2GMJA 1KD1T 3DU6A 3L3CA 2F8MA 3FMBA 1VDHA 2CPHA 1S97A 2HVIA 1H74A 3R6GB 2EKYA 2XMTA 3IAM9 4P6QA 4TN2A 2L48A 1X5TA 3CCRS 2DGTA 4O3NA 4F2SA 4QPXA 1S1TB 4FXDA 2KRBA 3BKTA 1T95A 2HFSA 4TYBA 2CNOB 2CAJA 5ETOA 2HRUA 5HATA 1GMUA 2KYZA 1SKRA 1KNZA 2RF2A 1LWFA 3P96A 2RKIA 2K06A 2XLJA 6AT1B 2JLEA 3NGSA 4N41A 1AROP 3H0PA 4AXJA 9ATCB 1FK9A 2IVMA 3JAMU 3W66A 3I31A 2OSRA 3MFIA 2V67A 2Z2MA 4C0OC 4J9NA 1S9GB 5F3TA 2KFYA 3CJ5A 1X4BA 3MCNA 3HXMA 3TJ8A 1QAJA 4QWEA 4LF2A 4DUTA 5T7LB 1KVJA 4C3LA 4C97A 7FD1A 5C25B 2BEFA 5KFNA 3QAEA 1JKHA 1SL0A 2CQ0A 4QR0A 4DI6A 3A3PB 1XR5A 1EZZB 3OLAA 2JC0A 1O8BA 1HHSA 2G9OA 4I7FB 4LREA 3Q8PB 1NB2A 3RYLA 5C2CA 3WX4A 2RSQA 1FI4A 4A4JA 1PBUA 3ZTOA 2Z30B 4C3MA 2UXDF 4LJMA 3O3LA 5DM6Q 2GQQA 2VPZB 1S0NA 2HHVA 2HFVA 2V8GA 5L9XA 1EETA 4MKYA 4KGZB 3J81j 4IKAA 1NK6A 1VLOA 4MTPA 2PMZD 1RQ0A 1YZ6A 1HWKA 4DQSA 4JI2F 4WPAA 4B3OB 5F8JA 3PYFA 4PXEA 3ZTRA 4KY3A 1VBZA 2FIUA 2XO6A 4P2XA 2LXUA 3NMRA 2RIJA 3P6YC 2AQ4A 3QRQA 3B6BA 2GVZA 3M32B 1RCOB 3R2DJ 4B08A 3EGVA 4PYDA 2J0XA 5HLFB 5I42B 2DNOA 5KG2A 5JJBA 4ZJLA 2WAQD 2GGPB 4ILRA 2YTCA 4GMKA 5IV3A 4YB1P 5EDWA 2VDHA 4B3TJ 3VAJA 2CA9A 2DHGA 2WB1D 1FRIA 2W8KA 2IFXA 5CYJA 1ICEB 5T14A 3W5ZA 3PVXA 2DPIA 2E5HA 2IM3A 1RACB 2YY3A 5LMNF 5BYQA 2DNGA 5H1SV 3OTCA 2HNYA 1HNIB 5J2NB 3SDEB 5A2QY 3MPVA 4J90A 2W9BB 3TARA 5LXYA 2PMHA 2ZBPA 1GTHA 3JYTB 4MFBA 3W9IA 3LGHA 2DGVA 3FBBA 1M5SA 4JI5J 2FC9A 1FD8A 4K0KF 1VYAA 4CH1A 1S99A 3D3BJ 3MUVP 4FXVA 1VRTB 3HFKA 4NRUA 1NPPA 3M6XA 2QYGA 1S79A 1N88A 2HQFA 2K2PA 2CFXA 1N36F 2HQDA 4IQMA 3D54A 1H3DA 1LQ9A 3FRYA 4KKOA 2AZ3A 2HHWA 3CDBA 3RB6A 1YGYA 2HNZA 4ES1A 5HROA 4NA3A 1XMQJ 2YKNA 3RRGA 2IC3B 3C14B 4HACB 4DG1A 1RT6A 4QIGA 2KH9A 2ZDPA 4HT7A 2IA0A 1RBAA 1N8RT 4K4WA 2A2CA 4IR9A 3IMQJ 4DV7F 1TVRB 3M2VB 3KUEA 2K8GA 3A3OB 1HMVA 2FY1A 2NUUG 5A6WA 5KFFA 4DHVA 1FNMA 1FERA 2PIIA 2C42A 4F0MA 2MZQA 2V34A 3SMZA 3G86A 1FTCA 1UW9A 1ZPWX 3ZZOA 1WKJA 1F1BB 4I67A 2F65A 4ZVEA 1YLXA 3V81B 4JI0J 3H4DA 3C16B 4QU6A 1V3RA 1TKXB 5HVGA 2F9JA 1FEEA 1S1WB 4DV5F 3AOCA 1NKBA 2Y0BB 2C3YA 3I5AA 1S6PB 5L46A 3OJUA 5KFVA 4NMXA 2YNHA 4I69A 1SJRA 5F41A 4N47A 1J2VA 3HFVA 3IR7B 4ED3A 3OR1B 3OJSA 4YP3A 3D2WA 2B9XA 2DNYA 1S9EA 2ACYA 4UOGA 1AUDA 1BWVA 4IUFA 3KJVB 2YQ3A 4WFYA 2WVEA 3SXLA 2MQ8A 5JUMA 1O51A 3SCIE 2W4PA 1TUVA 2DNZA 2UV8G 3DLEA 2ZD1A 1LW2A 2QFIA 1PBAA 2QRRA 5F8HA 1E6YB 2GX8A 4ZPTR 2F4VJ 3HP6A 3JXOA 1YK9A 4AT1B 1XR7A 3WDOA 3OVSA 3MCOA 3GQCA 5CYMB 4K4XA 5JVGQ 3D1HA 4DL6A 2VF3A 3H59A 3HKZD 2AJ2A 3G6XA 3PW4A 2VG6B 5F3ZA 1HYSA 3UO0A 1CJTA 4PAAA 3C6UA 3MPYA 4CZCA 3TX8A 4I64A 2Z0GA 1S4EA 5H9EK 3DHWC 3NBPB 2NXEA 3TJ9A 1ZA1B 2WVBA 3MAAB 5RUBA 3RRHA 1UWAA 4NLUA 4DV4J 4NA1A 1TKZA 2QMXA 2OPPA 4WFAQ 3OV7A 1YBTA 4EU0A 4A8WA 1L3SA 3ISZA 1VK8A 3UE2A 2K7KA 3FSXA 1YBUA 3SQOP 1YTYA 1RTHB 2X51A 1WTBA 3RZAA 1FRKA 3IFEA 3PCOB 3KJQB 3GONA 3HX9A 1UPPA 2B8QA 1X7VA 3OL6A 4D3HA 3FQLA 3IO1A 3PEJA 3Q83A 3R6LB 1CULB 2BRKA 2JL9A 1JLAA 3KHRA 3NCRA 5J2MA 3WX8A 3Q8SB 4CLTA 3IBFB 1LOUA 1JLCA 4LF7J 4DPYA 2XI2A 2V50A 4OJHA 5GAGI 2VFSA 1DTTA 4G1QB 1NCLA 3MEEA 2A6OA 2PC6A 1KBRA 2F8HA 5KFUA 1J5EF 2MQLA 4LR7A 1W2BR 3ILOA 2AYEA 1PO6A 1OO0B 1VQ4S 4MYUA 4B3MJ 3AHPA 1FE0A 1IKWA 3R7BB 2FVRA 2CQ1A 1HI8A 2BANB 4TU9A 2HNDA 2DK2A 3W7BA 4J91A 1U45A 4CQ1A 3L09A 2DNRA 1C0TB 1B64A 1R8HA 4CT8A 4KB7A 1Q95G 2KXFA 2NPFA 4JI8F 4F4WA 2F4FA 4LQ3A 4ILMA 3NG8A 1RTJB 3M8WA 3M6VA 1E6VA 4IYQA 3KWMA 2XY5A 4CO2A 1NUEA 2FJDB 3QT8A 2VIHA 1U6FA 3UPFA 3HVTA 1WNEA 4F4XA 4ZJQA 4L74A 3OT9A 2CNNB 3GP9A 3H25A 4TNOA 4K2JA 1FDDA 5J1PA 4P73A 2FC8A 1KDNA 4UOFA 3QATA 2DR5A 2KT5A 2RT3A 3IP0A 1WC6A 2MXYA 5LSOA 2XLKA 1G2EA 4DR4F 3BYPA 4F3MA 1MWQA 1RWVB 4HHJA 1N33F 3CC2S 2OPQB 4HH1A 3ENAA 2B9YA 2DJWA 5K14A 3ET6B 2MDAA 1UL3A 4QWDA 4IQXA 1JNRB 4OV1A 2WVDA 4IDKA 2KJWA 1WC0A 2O01C 3P5TL 2GJFA 4DZ6A 2JHEA 2Q43A 4DV6F 5HP1A 2OHDA 5A8RB 3ZC4A 1RTIA 2QIFA 4R25A 3GSDA 1IBLF 2GMLA 3PDNA 1OWXA 3Q89A 1EQ0A 3IBCB 1EP4A 4OX8A 1S57A 5AE1A 4F3OA 3QPIA 1U0HB 2XSJB 1M90T 3J7Z5 4RJVA 2PA3A 1Y4ZB 4FPRA 3EWGA 3UDEA 2FHJA 4WKRA 4OHVA 2KZZA 2G1HA 1U1PA 3NGRA 4WJBA 2YNIA 3AD8C 1N0UA 2BBEA 4DDFA 4ECRA 1Q16B 2MZJA 3DNCA 1WACA 3K0JA 4B9LA 2ZUGA 5HN0A 3Q23A 4MIWA 2YPZA 4MIAA 3E01A 3OFFA 3U27A 2RQKA 5C42A 4DFKA 2GVDB 3UN3A 3CCVS 5D3GA 1JLBB 3Q2TC 3CCJS 2L9NA 4OYBA 4WK3A 4Z2XA 2OSQA 2YQ1A 5LSRA 3T1HJ 2F1FA 5KFRA 4RW6A 3BBBA 3G6ES 2VQFF 2DNQA 2FJBB 4E0DA 4EK2A 3TAQA 3W60A 3M30A 3HZEA 3CCUS 4G1PA 2H65B 2HKEA 1VHIA 3H2LA 1EIYB 2HAFA 4KV8B 4GKKF 3IR6B 1FKAF 5KFEA 5IT9U 2RHQB 4O0IA 2E1RA 5A6PA 4HI2A 2D3ZA 2H1YA 2MZSA 1RSCA 2RF2B 3ULHA 3CD0A 4G1IA 1CLFA 2I1RA 1IKYB 2AU0A 1TV6A 3ETOA 4LF4F 2DBBA 2MJUA 1J5OA 1D9FA 2ASDA 4NI2A 1HQUA 1NRKA 4X4TA 5EWFA 3F41A 4F0HA 3ZZUA 1UA0A 3C3LA 3WHIA 3CO0P 3OR2B 2UVVA 2XNQA 4DMZA 1UVMA 2Y3YA 2R7SA 3T41A 2E9ZA 1ZTTA 1NSAA 3QZ8A 1BLUA 4J9SA 1JLEB 3W65A 4IO1A 3R7SB 2DT9A 1U1RA 4QIVA 4DR7F 3OW2R 3UI3A 4C8LA 1RWNB 1UJ4A 2GQCA 3W2VA 2F3JA 4I2QA 2H54B 3MF5A 2R7TA 4JI7F 1Q81T 2ZEJA 5E7OB 1LK5A 1T3OA 4YB6A 1VCTA 2ZH2A 1WHYA 4FNIA 5HBMA 1SV5B 2UUTA 3N5BA 3VR1A 2B9EA 3AODA 3KUGA 2NZCA 1RT7A 3DYAB 1SJ4P 4BS2A 2L3MA 4XK8C 5T41A 5AE2A 1RT1B 4KIAA 1RWMB 2RVJA 3MMAA 1EKRA 4DN0A 4YMEA 3DM2A 2YH0A 1F2HA 1FWPA 4B9SA 4ZPAA 3MFHA 3M2UA 4PQAA 1YITS 1R0AB 3ZNUA 3IWNC 3HHNB 3CULA 3UNGC 3DLKA 2KM8C 1RT5A 1IKVA 3RW7A 2CJAA 2EFOA 2IDEA 2LFVA 2ZKUA 4NYOA 1DJ0A 2KI2A 1RGVA 1JMTA 3CC7S 2ZC4A 3F73A 2AT1B 3E3XA 2DGQA 4RNFA 2LKZA 2E1MC 2GIFA 5CYQA 3BGLA 3QLHA 1GMWA 4ID5B 4CO1A 4QCLA 3J80Y 2MHEA 3GR0A 3G2XA 4CLYA 4DV2F 5KFGA 2AKWB 2XMMA 5KAKA 5D77A 1HW9A 2ASYA 2W7AA 4MFBB 2H4YB 1T3NA 2AGQA 2EC0A 2XCAA 3M1VA 4DPUA 3I0RB 5LXRA 4HL9A 1Q53A 3CSKA 2MZTA 3RW6A 4AFFA 3D6TB 1UWBA 3A1YG 4NEZA 2R2RA 1B3TA 4RUHA 1N34F 2B4OA 2E5GA 1VQNS 1RE1B 4DLGA 3HCXA 1R0BG 2VKZG 2HNZB 4NEYA 4LR8A 4OJ3A 1U2FA 1QY7A 3D28A 5IC4B 3TWZA 2NQPA 3ZZRA 3UD4P 1YQHA 2OELA 2N3OA 3MEDB 4YB5A 3MM6A 2M52A 3K5MA 4C2MA 3ZXWA 1R31A 4ER8A 4QR2A 1QJHA 3G8QA 2NXNA 1KR4A 2FJEB 1M0SA 3U1NA 1WC3A 1NLKL 4K4SA 2KVIA 1D3WA 2WB4A 3QJPA 1VBKA 5G0RA 4NASA 4I6WA 4MKAA 2V6AA 2HG4A 2J5AA 2HZCA 2XEXA 5D4OA 1SIWB 2DISA 3PJWA 4HDGA 4DCJB 3AJ1A 1RLCL 3DKDA 2GO9A 4ED1A 4XTTA 4CLLA 1U7LA 1JJ2R 2VONA 6FD1A 1F0XA 1PG5B 1UW4A 4F04B 4A8XA 3HVRA 1BWEA 4Y2IA 3WC2A 3HHLA 2ABYA 2OMOA 4HVZA 2YKMA 2R9LA 4QW9A 5ITHA 1KHVA 2JFDA 3UVJA 1Q4RA 2ZKTA 2UV8A 2G2OA 3CCSS 2DNHA 4DFPA 2C22A 2ZHBA 1YI2S 4ZVHA 1DTQB 1PKUA 2X7IA 2ZNYA 2IBKA 4GVLA 1S0VA 5AJ3J 2QE5A 3P5BP 3DLEB 2J6SA 3AB4B 1RTDA 2GC8A 2OAUA 4NLDA 3TW0A 4DUZF 4Q7AA 2KT2A 3KXDA 3MTJA 4PXBA 1LWXA 2V94A 2VV5A 1BXNA 3CD7A 1D9DA 4LSNB 4A8MP 5K8MA 1WORA 3A4TA 1BQNA 1X9SA 3OFGA 4LRCA 2HGNA 3TVZA 3NL0A 4KH0B 4LIRA 1M5KC 2HBZB 1VQPS 4KPYA 4H4OA 3C19A 5E3CA 4DL0C 4RL1A 3TZWA 2Z2LA 2R7XA 5CAAA 5CABA 1TKZB 2OD4A 2OPPB 2QEXS 1TL3A 4O3PA 3G82B 5HL7Q 1F6TA 1XK8A 1XEZA 2LMIA 5GADI 4A8SA 1YJWS 3BGRA 3MEGB 2YNFA 3KK2B 4ZCMA 4UF4A 2B9WA 4DSEA 1GFWB 2QMUB 4QU7A 3RRKA 4DL2A 3NNCA 5ETVA 2MKIA 2KZMA 3HHLD 3NLCA 3OVBA 3DI6A 1LK7A 4OQJA 1HPZA 2F7VA 3CUNA 2JFKA 4WTOB 2EXUA 3RU0A 2LU2A 3EPIA 1RADB 1LV5A 1Y5LB 1RU1A 1RCXB 3QO9A 5KG7A 3UQSA 1AFIA 2VB6A 3EXCX 1UVIA 2C2RA 4ED7A 2HQIA 4G65A 1HNVA 2HHUA 3EICA 2VL1A 1CVJA 4JUZA 3SQGA 4ZIVA 4PCQA 4ETXA 1M5OC 1ZPVA 2UUAF 2BJDA 3LP1B 2CJ9A 3M6UA 4CLSA 3R7NB 3DLGB 1RWWB 2HQ3A 4W4MA 1HR0J 4ZPDA 4NLGA 3CJRA 1N34J 3Q8UA 3A3NB 5KT2A 2FJAB 1IKWB 3M8QB 1YIJS 5F9LA 5E3PA 2EFNA 1S6QB 1KLMA 5A2QU 2ZBQA 1FKOA 2HNDB 3FC9A 2BJ8A 2E7WA 2WOMB 4RBVA 3D67A 3K89A 4NCGA 4ETZA 1X4AA 2P8IA 1YKWA 2WZ1A 3Q8QB 2PMWA 1U1LA 2FHMA 2OPRB 3JAMY 1HHTP 3DRXA 3MTKA 2H5IB 3PHEA 1DLOA 2N82B 4ZN3A 5M2PA 3BN7A 3ZTSA 4JI3J 1FJ7A 3MEKA 4ZLJA 4X4RA 4PABA 2J7WA 1DARA 4LIWA 2NXCA 1OY9A 4Q2LA 3JQKA 3VVTA 1F9HA 3X1LB 3LGMA 3GV8B 3W9HA 4N56A 2J7KA 5B0GA 4IFYB 1HNXF 3SYZA 2MHNA 4JI4F 2XYPB 2WVCA 4C8KA 2WONB 3M2RB 2W01A 4MJKA 2QGFB 2EW9A 1Q8IA 1UJ6A 5CCLA 3BQ0A 1SQGA 3CE8A 1N4LA 3W63A 2K1RA 4IH6A 1TL7A 1I6JA 3BO3A 2VU5A 4NXNF 1JLQA 4R5PB 2R7VA 5EGYA 3MUMP 1UA1A 1ZAXA 3TEGA 4ELUA 4M5IA 2MGZB 1PJ6A 5KT6A 5KT4A 1RWXB 4LVNP 4IDKB 2DHSA 3D0IE 3SI8A 4DR2F 1VQSA 4F4KA 4RW8A 1LW0A 2IY5B 1ZAVA 4ECZA 1H0HB 3W61A 3DGPB 1Q1KA 4JP8A 3M9MB 3TO8A 4URGA 1EP4B 4NLYA 2CWXA 3QSIA 2CJQA 2I2YA 4IO9Q 2HHXA 2EC2A 2DIUA 4OI1A 3QBCA 4OL8A 1UVNA 1W25A 1G7CB 1IUJA 1SCJB 4O3QA 1HD1A 4TQRA 2R2SA 3MR7A 5EUHA 3TAMA 2LECA 1TFWA 1YRTA 2K3KA 5E2QA 4WWSA 1CJUB 4QWCA 3V6DA 2Y9HA 1N54B 1VS3A 3SFUA 5E41A 4DSKA 5D0GA 4ED0A 5G4DA 2HHQA 2GV1A 4M63A 2M9KA 1B7FA 3E01B 2BDPA 5EWGA 2DEJA 5GAEU 2MKYA 3W5XA 5C42B 2QA2A 1LEOA 2Z8QA 3Q0AA 5D3GB 2FTRA 1S12A 1JLFA 3P8BB 2LQBA 5J1EA 4JOUA 1HBOB 4R8UB 1HHQA 2E5IA 3R9LA 1C1BA 2IYIA 4FVCA 3MPWA 5KFAA 3PTWA 2ZWOA 2KG1A 3KLIB 1HBMA 3GSIA 2GJ2A 2LQ9A 2VOOA 3RGIA 2HFUA 3CCES 1AYEA 2RQ4A 4ZMMA 4C8MA 2M70A 3EYZA 2MLZA 5KG0A 2BW2A 1N5QA 2EEYA 3UR3C 2CQGA 1Q5YA 2ZE2B 5KOWA 1Z4UA 1KP6A 1TV6B 3MECA 3DHXA 4XIUA 4B3SF 2UUCJ 1SUQA 1B0TA 2COLA 2Q6BA 1HBUB 1S1XA 2GFFA 2XSFA 4F3QA 3MM9B 2JC1A 1G4CA 4O23A 4ZITA 1NEEA 1HQUB 1RHUB 3TNVA 3D3CJ 2W25A 3MAHA 2O67A 2Q6CA 3CCTA 4Y3CA 1U47A 3CMES 2XHWA 1NDPA 4MYTA 2V5HG 2FHOB 4OYZA 2DR9A 2FLPA 3PNIA 4K4VA 5HQLA 2BOPA 3M8PB 3I5BA 5KG5A 2C2NA 2OKQA 4ZOSA 5KFXA 2B0GA 3N6MA 2D74B 2FGOA 1RWKB 4KTQA 1T94A 1ZM3A 2AJQA 1S1TA 1SBRA 3I87A 3Q86A 3T1YJ 3QIDA 4OYXA 2CNLB 4X65J 2RUSA 1TL1A 4N76A 3BS9A 4USWA 3AXMA 4U95A 4LT6A 5HBMB 3M8SA 4W92B 2W2PP 3AOBA 4J9PA 3LWMA 3I9ZA 5IFMA 5GAHU 3FBCA 3OTEA 2HBRB 2YVSA 3DN9A 5CQGA 2RDDA 2DO0A 1Y7PA 1WOSA 3R5CA 3DRYA 3A8IA 4DF8A 3TUJC 1S9GA 3W1YC 4TQSA 3M6WA 2J8AA 4RKUC 4CT9A 1YHQS 4W90B 2NR0A 5T7LA 1U24A 2QLJB 4ED8A 2KO1A 1GX6A 2DGXA 3DLKB 3OL8A 1IKVB 2B5JB 1EAYC 3TYTA 3IWLA 2MQPA 2M0GB 3GJTB 1T0TV 3AD9C 4Z37A 4CDIA 3GU0A 4I7FA 2ZH5A 1N32J 1X0PA 4KFBB 1TKTB 3IRXA 2CYYA 3KUHA 5CYQB 5KG6A 1Y11A 3QLHB 4V19J 4P2MA 2D9PA 3QZ7A 2XWYA 3J7YI 1FCAA 2ZDOA 3CJ3A 4CO3A 1NK4A 4EBEA 2VFTA 1IBKJ 1QLNA 3L4BC 1RT2B 2KB2A 3M8YA 1OSCA 2ALYB 4M5MA 1D8YA 1HBNB 4B3OA 4O4GB 2UUBJ 4WXWA 1VFJA 4KHRA 4CWBA 5B0CA 1T05B 2HURA 4YHHF 3RTVA 2EG2A 4ZVOB 3NGUA 1X60A 3M32A 3G6YA 1Y10A 3IWXA 1N5YA 3OSNA 5HLFA 5I42A 1B0PA 4ID8A 3G8SA 4EZ6A 4DL4A 2QX0A 4TYAA 5BR8F 2PEBA 3NGDA 3GFHA 3MM6B 2LA4A 2BJ3A 1FX2A 4K4YA 3MMCB 2XM3A 3DMJB 1N48A 2FB0A 2PD1A 2RB7A 1X4GA 1JJHA 1ZAWA 1KKHA 1HNIA 2LXIA 3SDEA 3V6JA 3W2WA 4LF8J 4O3RA 2W9BA 1WKKA 1CSJA 5HVFA 4OZ1A 3P45B 1IXKA 3JYTA 4HDHA 3PR5B 3GB0A 2QYCA 4N5SA 4L6V3 2CZ9A 3GR1A 2EFVA 1SQEA 4YS2A 4IRCA 4M5KA 1IR1A 2XS2A 3GFYA 4NZ0A 3R27A 4AL5A 3NS6A 1VRTA 1OJ4A 2V8PA 2CWKA 3GG0A 3FEXB 4JI6J 4QIWD 3O2IA 3W3SA 2VFVA 2BJ1A 2NLWA 1RWUA 2Q1LA 4E8UA 2WSEC 4IG3B 2Z56B 4KO0B 4AD6A 1CS4B 4C0HA 2XS7A 2ZH4A 4LFCF 1T9WA 2IC3A 3C14A 4HACA 3NGKA 3PHTA 4USUA 2G0CA 1CEZA 2SXLA 5E3RA 2DNLA 2MKSA 4NOHA 5DG8A 2DH7A 1R7IA 2MMYA 1RTDB 3TQEA 1TVRA 5DGAA 3M2VA 1FXLA 4DV0F 1KSPA 2B8PA 3HPOA 1TK8A 2KJVA 3UNYA 4O3SA 5CD4H 4PWDB 1BQMB 3NOCA 1B99A 4FYXB 1FJGF 1BQNB 3OUYB 1UETA 3P3DA 2ZJPQ 2B6AA 2V8HA 4Y2MA 3D0GE 4DR3F 2V9WA 4ECUA 1VQ9S 4JV5F 1EJ7L 2ZITA 4FN5A 2C2EA 1U2RA 5HI7A 4EMDA 2VBWA 3MCMA 4EO6A 2PFDA 4ZCKA 1S0MA 3C16A 2XY6A 2FPHX 1TKXA 3K5PA 8RUCA 2EFPA 1GEHA 1ZETA 1TUWA 4I0WA 1REVA 2G1DA 4K2XA 4P75A 2NS1B 1XNRF 1MW7A 4XPEA 3OR1A 2V4JB 3VF0B 4RW4B 4B02A 4ZS6A 1BY9A 3I9V9 1Q82T 1MLAA 2BX6A 1SKSA 2FLLA 1M5HA 2X3DA 2Z4PA 1S0OA 2H4WB 4QBUA 2FDNA 2LLZA 1E6YA 2R7OA 3ZZZA 2BJ9A 2UP1A 1XC9A 2YX1A 1LKZA 1ITPA 2CQDA 4FPIA 1IBMF 1RABB 3PY8A 3PW0A 3PYGA 4LFAJ 5CYMA 4M1KA 1GXUA 3PRBA 1YSJA 4LRAA 2AEMA 5F0UA 3SQGB 4HKQA 1QE1B 4LRDA 2I8EA 2VG6A 3ITHB 4F36A 4X4VA 4PR6A 4WE1A 1ZM4A 1FJEB 1R6VA 3NBPA 3BDPA 3KMQA 4U9RA 4X4NA 3I0SB 1JB0C 5IT9Y 4RU9A 1ZBTA 4UUWA 3QFWA 1P1TA 3M7VA 1KLMB 3UDCA 5B0EA 1FKOB 3CPWR 5C24B 2D3UA 1RTHA 2AJ1A 1DY3A 1TU0B 2Z58B 3QGIA 1URNA 4OX9J 5ADZA 3RAQA 2A3JA 1DQ8A 1RZMA 4FS2A 3ZTQA 5JXSA 5ETMA 4IOBA 1P1LA 1CULA 1L3TA 1H2TZ 2R7WA 2EKNA 2LU1A 1FDAA 1U1KA 1H2UX 1FEHA 4U67Q 4EFAC 4DN9A 1NKEA 2CVEA 2HMIB 3S6EA 3PJ9A 1SC1B 2FYXA 1ULRA 4DQPA 2KKHA 1KFSA 5JMNA 3ZFVA 5E0OA 3JTNA 1DBDA 1YRUA 1X4HA 2QSFA 4Y28C 1UAWA 3JQJA 4X62J 4EYHB 1ZS6A 2XMKA 4HHUA 2RDJA 4BBYA 4NZ7A 3CJQA 2AV5A 2M8DB 2XTJP 5ETQA 2JJ4D 1NSPA 2QLWA 2KYXA 4R0EA 3IC1A 2NZ4A 2J0WA 1TL7B 1GK8A 2UZAA 2ZZNA 3HVAA 3VZHA 2BANA 2C2MB 2IAJB 4CYUB 1KLNA 5CD4A 4DUYJ 2DRDA 2E5JA 1YWXA 3FGVA 1C1CB 3H5UA 4QWBA 1EHWA 4ANEA 4RW8B 2DB1A 4LR9A 1NNDA 4UW2A 2OJ3A 1RTJA 4ELTA 3VQTA 5KG1A 2WRMA 1QTNB 4XPCA 3MM5A 1WI6A 4I6AA 2J76E 2H3EB 3N0VA 1M5PC 4OYOA 1SPBP 2ZZTA 3BN4A 2HYIB 1QDUB 4B9VA 1YJRA 2V2KA 3C15A 2FLNA 2IVFB 5A76A 3QIPA 3AJ2A 1RKJA 1UEVA 2HVHA 1GX5A 3LWLA 5FD1A 3LALA 3ZZTA 3GIIA 1P9QC 3IGVA 3HLUA 5GVQA 2NSCA 1T9UA 1MU2B 5DZ6A 3CJ2A 4WYWA 3GYGA 3BQ2A 4RUAA 3D9BA 4KH1B 1URRA 3FJ2A 4Q2MA 2PEHA 5J1EB 1HQEB 4PZVA 3ET6A 3LP0A 1JXVA 4Y2CA 1H72C 1KQFB 4FS1A 1M1KT 4B3TF 3W62A 4B3RJ 3KNGA 5FIIA 2LYVA 1FTRA 2VJVA 2MQQA 2DNMA 2L41A 4IH7A 2DNKA 3SV3A 3FRZA 2QA4S 4ZPWR 1KS2A 2KHDA 3R2CJ 3PW5A 1U0HA 2XSJA 3ICLA 4KJIA 2NYHA 1HWUA 3ILIA 2POKA 4L73A 2GAHC 4BWMA 5C2GA 2ZOFA 4JI5F 3LANA 4QYZJ 2CPFA 3ELHA 5J2QB 2FJVA 1S1XB 4KT0C 1IBCB 3ONQA 2BVZA 1D9AA 2YWWA 4RW7B 2LDYA 4CI0B 3EGZA 2JNJA 2JRSA 2HQCA 3EM1A 3G6VA 4LF5J 1RUSA 3K17A 4IOCQ 2GVDA 1JLBA 2YKPA 1SQFA 1T9TA 1OIAA 4CO0A 4ZN1A 1XMQF 5KT3A 2XBPA 4FVMA 1C4AA 2ZVSA 1HNWJ 1OMSA 3TQ1A 4CM2A 3TUPA 4I6YA 2IYGA 1TR0A 2DGWA 3JTOA 4F26A 1MMDA 3AB2B 5L38A 5CXTA 2IMOA 2V68A 5BYSA 3KDOA 3FCVA 4RU2A 4NX9A 2D1CA 3DLHA 4MIBA 5HQ8A 4F7VA 4UOCA 4KV8A 4IRKA 1TL1B 4PWUA 3E2EA 1MROB 2VH7A 1C0UB 1X4DA 1WF0A 2KRRA 2AD9A 4QR1A 2XLIA 1TFYA 3GPAA 1IKYA 4RBUA 1HWIA 3QJJA 5M2RA 4JI0F 3KDNA 1KQKA 4GKJJ 2RQMA 3CWJA 4H4KC 4JI1J 1SJFA 3GLJA 4M5GA 2DGOA 2V69A 2D3OR 1RU2A 3X3UA 1XNQJ 1AT1B 1K9MT 4GVBB 4ED6A 2HLTA 5K8OA 1JXEA 4I2PB 2FY8A 3OR2A 1WG1A 2JLGA 1FWLA 3DOKB 3PW2A 2YNGA 3NRBA 4Y6IA 1F3VA 5KFWA 3ZZYA 4EGLA 4OYMA 3GJRB 3K58A 1JLEA 1G6BA 2BA9A 1TAUA 3KG1A 4RR5A 5ETLA 1X9MA 3T5HA 3IRXB 1AUSL 2C3PA 2RUGA 3MD1A 2WW4A 3W8PA 5IM0B 1RHJB 1X5PA 3HM9A 2QN6B 2F4VF 2EBGA 2FJWA 1C4CA 2IJNA 2J0QD 1VISA 5I3UA 2ZJRQ 3OTOJ 4JV1A 1VI7A 4PWWA 2JEJA 4B17A 3H42A 1SV5A 2LCWA 4PG4A 2XQCA 5IT0A 1FX4A 2YQ0A 2AJ4A 5A8WB 3DYAA 3MMJA 2E1CA 3HJVA 3QMQA 4C4WA 4RBTA 2VQEJ 5CH7B 1RT1A 3NMAA 1YG0A 2HHHJ 2KG0A 2Z2YB 4I4BA 1NDCA 2OH2A 1KQGB 4DV4F 4KBIA 1D8ZA 1U8SA 2FJXA 2DR6A 1N5YB 2BACA 3LOUA 1R0AA 3TA0A 2MZRA 2CRLA 3VALA 5HJYA 3GIKA 1PIEA 4P52A 1YJ7A 1NK0A 4K4UA 4XO0A 2H51B 2RE1A 4Z7YA 3VAFA 1IR2A 4Q43A 1H2VZ 3VVUA 1I3OB 3RR8A 1R0CB 1IQZA 3MWBA 2I5JA 1FDNA 2Y1JA 3EXYA 4USHA 3VV2B 1NB7A 1WOPA 4ID5A 4LUBA 3MR2A 1RAJA 2W2MP 3VAGA 1TMJA 3W2WB 3SV4A 4OZ5A 3AD7C 4CNZA 2HSEB 4LF7F 2LEBA 5KFKA 1HD0A 2HFOA 4F0KA 4EBCA 5A8KB 3EZ5A 2IHR1 2E1PA 2VODA 3SEOA 1AFJA 3DFEA 2AF6A 3I0RA 1KC8T 1WELA 3FUYA 4ED4A 4DS4A 1SI9A 2HPUA 2XMUA 1OYDA 4B3MF 2QLFB 3VGSA 5IWAJ 2DTJA 1HI1A 3G4SS 1KOHA 4OZNA 4HLBA 4MK9A 3KHLA 4J9QA 2ZH1A 1UPMB 3FMWA 3QGPA 2R7UA 1S77D 1Q86T 3K59A 4BLGA 2IM1A 1H73A 1VQ6S 3BPSP 1SL1A 3MEDA 2W7OA 3KLGA 2OIHA 2UUWA 5J2PB 1P9YA 3H20A 2GS8A 2GIRA 3C6TA 2RRBA 2ASJA 1KFDA 1LWCB 4X4QA 3NCQA 1NSQA 4EWTA 1HNZJ 2B6AB 1XQIA 2GA7A 1OQ6A 2OFGX 2AZ1A 4F4ZA 2HEKA 2P5VA 2UXCJ 4RO0A 1U2CA 3AQPA 5CZVA 1A6LA 2ADBA 5EHHA 3P49B 3PM9A 1JJ4A 3D6FB 2C28A 2J6UA 3W5YA 3NS5A 2B51A 3CF5Q 3UFCX 1REVB 4QWAA 5KT5A 4FZVA 1K8AT 1R6YA 2WBMA 4B9UA 3C2PA 3SSSA 4C48A 3TI0A 1NJXA 1FD2A 4OX6A 2RS2A 1V3SA 5D0EA 3KG0A 2CADA 4L3KA 1QAXA 1Y9OA 4PPDA 2CQ4A 3MMBA 4TY9A 2JX2A 1DTQA 4DPTA 1TKDA 2W7PA 3M8RA 2EWHA 1B70B 4ANDA 2DITA 1FESA 1RTZA 4QIEA 1JLGA 5C5JA 5AXLA 3PYDA 4PYAA 2ATLA 3QRPA 1HLWA 4NLWA 2YX4A 3BEGB 1WI8A 1MSWD 3PO5A 4PG8A 4LSNA 1CBKA 3ISNC 4QW8A 5L1JA 3CJTA 1O0PA 1SIZA 2ZFHA 1KRPA 2YKQA 5FDLA 3D6HB 4KGKA 1N0VC 4ZPBA 1A7GE 5JVHQ 2E66A 2ZHAA 2UVUA 4QIFA 1SH0A 4WE1B 3MURP 2CPJA 1F9EB 1GXTA 4ZP9A 2G0JA 4O44B 2VG5B 5H9EJ 3HHEA 3G82A 1N6QB 2D9OA 1NKCA 4NCAA 1NJZA 1UVLA 3MEGA 3KOAA 1RYRA 3KK2A 2CZVC 5KFHA 3GCWP 3GV7B 3T1HF 2ADCA 1S49A 1K0VA 3FCWA 3MZIA 5KFPA 1KN6A 1OY8A 4DR1J 1N5VA 4EO8A 1AA1B 3FEYB 4LFBJ 2Q66A 3PKMA 1G3OA 4NWBA 2XO7A 1FF2A 1K47A 4BHQA 1H38A 2BE9B 4MK7A 2QLXA 2YWGA 2V2ZA 4NLOA 2GZOA 4UQGA 4NPOA 1XTZA 3OBIA 2HK3A 2OP5A 3RBXA 1MWZA 2IBOA 2RRNA 1CQNA 4M5NA 2QLBB 1PYOB 1DURA 1U09A 4M5JA 3T5LA 3GJSB 3LP1A 2HWHA 3MGJA 3N6NA 3EGNA 1JNZB 5CZXA 1W2IA 3DLGA 3T19A 2LXFA 2U2FA 1TTHB 1VQOS 3HHKA 1UFKA 2NXJA 4KQZA 1RKIA 3QNWB 2PN6A 3A13A 2G0IA 2GCFA 3M8QA 5DDOC 1R8PA 3JSRA 1S6QA 5B0FA 4DV1J 4A8QA 1NJWA 2WOMA 1YJUA 3T5KA 3RAMA 1YJ9S 4ZHRA 4WKYA 4AQYJ 3OTBA 1R3NA 1WHWA 2HBQB 2OPRA 4U96A 2YH1A 3FFIA 3HD2A 1NJIT 4ECWA 3SIPB 3ENWA 3GZ7A 2V0NA 2XMVA 2FQQB 5BYRA 1S7HA 4QYRA 4X64J 3MM5B 1A9NB 2QA1A 3BR8A 3LQVA 2G2ZA 4WFBQ 5F8IA 5LMUJ 3C15B 2HS4A 1BD6A 2QT7A 3QIPB 1TK5A 2BQUA 1OYEA 4IFYA 1RHQB 3U1LA 4ZDNA 4X4UA 1UZDA 4JV2A 3GMGA 3EJMA 1CJVB 2WONA 3M2RA 4ECXA 3AH6A 4DSFA 1NXIA 4HI1A 4DV3J 4C7QA 2HK2A 1KVIA 3DOLA 4RPFA 3PXGa 4HTJA 2AP6A 3BGUA 2VBZA 1V6HA 2BJ7A 3T5JA 4R5PA 3HD1A 2CPDA 4IOAQ 2CJKA 2MGZA 5CHCB 2UXBJ 2IRXA 3LP0B 3US5A 1QSYA 2JVRA 3VCDA 1FWKA 2BE2A 3R5BA 3ENVA 2HVDA 3CIZA 2Y8YA 1WDTA 2BKNA 3VHQA 3DGPA 1MMNA 3VQSA 1HARA 3H8YA 4P7TA 1PJ5A 1IN0A 2BM1A 4H4MB 2PI4A 1ZTWA 3DCAA 4ZJOA 2OLWA 4N77A 1RAFB 1XN9A 4OI3A 3BB5A 1NMEB 4Y65A 3BSNA 1QUPA 2BUNA 2QMWA 2MPUA 2KFZA 3IAS9 3GIMA 1MWYA 2GAGC 3GYXB 1CJUA 1PYSB 2KTQA 2JH3A 1TL5A 1Q8KA 3CJSA 3H5YA 3BM7A 3EVMA 5DO2A 3K8VA 5F9NA 5B0DA 2MLYA 4RWWA 1WG4A 5J1NA 4PQUB 1S5ZA 2IVYA 3KFWX 5SUHA 4WTYA 3C46A 4NLSA 1Z2ZA 1HBOA 4CO5A 4R8UA 1VQ7S 3B78A 2BOAA 1FT8A 2KU7A 1KTQA 5KG3A 4GC6A 3DLLQ 3ETMA 2O66A 4JV0A 3C8YA 3KLIA 3AA8A 3DOMA 3KKFA 5D4PA 2MKKA 1V9OA 3ZNJ1 3A8EA 2C2OB 2ZM6J 1MN9A 2DNNA 4NYZA 4I68A 1UEKA 3BSAA 3IGNA 1NHKL 2CPIA 3KHHA 3HDSA 4DSLA 3R1HA 4DX6A 1U0SA 5H9FK 1JQGA 3LAKA 1WTFA 2HVEA 2ZE2A 2QFJA 1RAGB 3JS9A 3LO3A 2O3DA 1XMOJ 5AE3A 5SZTA 4PG7A 2GNKA 5K20B 1HBUA 3OXFA 3K7RA 3H7HB 2FHJD 3MM9A 3TAPA 1S4FA 1NHUA 4CM0A 1WF1A 1Y0HA 4YY3J 3KK1B 1VGYA 5C7PA 2DCUB 2B4UA 2I6WA 1D0EA 3QGHA 3NEKA 2MYFA 3DDNA 4YR3A 1TUGB 2YNGB 4F4AA 2HWIA 3PX6A 4DFMA 2VD3A 1I94J 3M8PA 3D4JA 1NU4A 3BJYA 4FYVB 3TVYA 4DXLA 1F5CA 3FBFA 3H2VE 5KTQA 2CVIA 3TEHB 4X66J 1VJWA 5AJ3F 2DHAA 2F40A 2R8IA 4KSEB 1EKSA 3UW1A 3SZ2A 4DR6J 2NXUA 4FKYA 2DD8S 2UU9J 5DETA 3KLHB 5I3UB 2W24A 4YQWA 8ATCB 2HQGA 2MKJA 1SC3B 4U8VA 4TXSA 2E5LJ 4IR1A 1R43A 3RUBL 4FXWA 1ZH5A 3TP2A 3MD3A 3EZUA 1UKUA 4ZVUB 1TK0A 3LF0A 5KFZA 4ZIWA 2WVFA 1C2PA 4DQQA 3CD5A 1YDLA 2HHSA 2CKWA 2E9TA 1L3UA 4WCEQ 4DL5A 4ZVSB 1RT3B 5DDQC 4OHZA 3BQ1A 1VQ8S 3A8JA 2B5JA 1F2GA 1L3KA 2GQ2A 1T03B 3GYNA 5KFOA 4ILLA 2AJFE 4O3OA 2E29A 1LXJA 2YX7A 3IS9B 1GXLA 2I5JB 4KFBA 1TKTA 2YWFA 2FLOA 1HWLA 1RA6A 5DJBA 4D3GA 4F25A 4YFUA 3HK2A 3H2UB 5DGBA 1S1VA 1HIYA 3A12A 4X4OA 3EPGA 1FRMA 4DSJA 2ZOMA 2RDIA 2V8DA 3HSGA 5I3QA 3CJ8A 1M1HA 2QA4G 3RJMB 4XDCA 4BCAA 4Y00A 1RT2A 1WF2A 2ZH9A 1W7WA 1X31C 1HBNA 4ENOA 4O4GA 1WD6A 2FVSA 3CIMA 3BGFA 3IM8A 2FVCA 1T05A 4ED2A 2DHXA 2M7SA 4C8ZA 3ZZ0A 2IIHA 1IJFB 2NREA 2E44A 4DCOB 5DG7A 1HR0F 1ZA2B 3WC0A 3VAHA 2R8JA 2CNKB 3S01A 2R8GA 4QJVA 4ZP7A 2CQBA 2X1BA 4OYIA 4X2BA 3VZIA 3HFZB 3V2UC 5HO4A 2DO4A 4J9VA 2E7VA 4LF6J 3OVAA 3LAMA 1BGXT 3CO9A 1PSDA 1U49A 5HK4A 4PUOB 3THTA 2BV3A 3CTRA 4DCPB 3Q24A 3QT7A 2HRYA 4TVAB 2QV6A 3MMCA 3DMJA 3TOQA 4GO5X 4CLFA 5DQGA 3KLGB 4JI3F 1VK3A 3C6TB 2RU3A 3MCSA 1L5UA 3HSJA 4KAIA 3R8YA 1MN7A 2DR8A 1GMWD 2DNPA 2V4QA 4ZA1A 1U8WA 2A1BA 1SXLA 1N5TA 3B82A 4U7UK 3FNNA 3DRRA 3HSDA 1F9FA 4KC5A 1NK5A 3C66A 4ITSA 4NXMJ 3R3TA 3QJLA 1R27B 2JSXA 2P6TA 1V5IB 4DPXA 3T1AA 5KFJA 2B4PA 3MPUB 1WEYA 4E98A 2LVWA 3KJNB 3PRDA 1FDBA 3V4IB 4IG3A 4KO0A 1N5SA 2FZCB 1CS4A 3D1QA 4DR5J 5EN1A 1PAUB 5THWA 3MMBB 4GRSA 4OI2A 4HHHA 2CPXA 1X9WA 1JLGB 4KHPJ 3DXBA 3PZPA 2JEGA 1Y3JA 5D78A 4M5DB 4V19X 3KTQA 2CQCA 1G1XA 3GV5B 3TZYA 4J9RA 3R97A 1GAOA 5M2UA 4PWDA 1BQMA 3POTA 2AX1A 3F56A 3OUYA 3BR9A 5AT1B 2ZBCA 2GO8A 4P9SA 3OPKA 5KFSA 3QRRA 1RYSA 2XB2D 4IG0B 5FDLB 1VQKS 2WSFC 2BABA 2LQ8A 4CTAB 3FKBA 4NRTA 4QZVB 2MY8A 4N8OA 1Z1ZA 2QC3A 4I56A 2W2QP 4CLZA 2HFNA 4PXCA 3CCMS 2M4MA 4AL6A 2W2NP 5ETKA 2RD5C 1WC1A 4P71A 3KLFB 2V4JA 4RW4A 3WBZA 1BQXA 1U1OA 2X3GA 4YEAA 2KN4A 4OI6A 1U48A 1T8EA 2ZVIA 2YWEA 4L75A 3HSZA 1QVGR 1WEZA 1Z2LA 3DGVA 2AGOA 4K4TA 3RR7A 1LXNA 4K5SA 2VPWB 4UZBA 3T9ZA 2W4DA 1NJYA 3JQMA 5LJ3Y 4OYWA 3D7SB 5KFQA 1PGZA 2E9RX 3PV8A 4ES2A 1GQEA 1QE1A 2EVZA 2VG7B 2DYAA 1OQ3A 3K5OA 1SH2A 3ITHA 2UUCF 4PXDA 2Y1IA 3CJKB 2N4DA 4ECYA 5KT7A 1U6ZA 1QUVA 4B9MA 1XMBA 5D8HB 1S72S 5L9NA 3MM7B 3I0SA 1R8AA 1VJQA 1SB6A 3V4MA 5DS7A 5HJXA 5IS2A 4EYIB 4JBCA 4IH5A 3TRGA 1REGX 3G9CA 4NLTA 1FRHA 5C24A 4LRFA 4ZHRB 2UXDJ 4JB8B 1ZM2A 4PG6A 1IQTA 3FFIB 4USIA 3DLJA 3JTPA 3GFZA 3BV8A 5B0AA 5IXUA 1VRUB 1QSLA 2BW7A 3CMQA 4K59A 5IQQA 2VDIA 3T1YF 4X65F 4NYPA 4WIIA 3FBEA 4JI2J 5KFYA 5GAGU 2HMIA 3BO2A 4WU2A 1PJ7A 4PKDB 4A48A 3ILJA 4ZP8A 1EX8A 4S0MA 1RA7A 2AW0A 1VBYA 4ZKAA 3A8KA 1IM4A 4HEA9 5F8MA 3KHGA 2ILYA 2YKOA 4TLRA 2HRTA 4OJGA 2R7QA 1XBWA 2CDQA 3AT1B 4DQRA 4CP5A 3O6QA 1D09B 4KGMA 2OTJS 2AMCB 3BKFA 3DOLB 3HZGA 5E3QA 3R1LA 1UZHA 1WJ9A 3GJQB 1DZ5A 3BKUA 4IFVB 4C6AA 3QSYB 1KEKA 3MM8B 2IAJA 4CYUA 1TAQA 2J6TA 1RT4A 2VJUA 3I32A 1C1CA 2J0SD 2HIQA 2DVIA 5LMNJ 1S1UB 2BE2B 3BZQA 1MMLA 2QJ3A 2W2OP 2ZH7A 1N32F 5HAOA 4PG5A 1KTVA 2AIRB 2CDRB 2AYGA 2XZDB 2NSBA 4LSLB 1FFWB 4H54A 3J81Y 2N7CA 4K0KJ 2HVZA 5KFTA 2KM8B 1Y5IB 2W8LA 2LP4A 3KJFB 1IBKF 2P9GA 1VIOA 2VC0A 4GO7X 2A10A 2HLUA 1N36J 2WSCC 2DR7A 1WEXA 1JWWA 1BUXA 5HMZA 2OEKA 1ELOA 3LPEA 2UUBF 4HYKA 1CJKB 4USVA 4KGVB 2HGLA 3M9OB 2HGMA 5LT5A 4BDPA 4UQTA 4YDXA 2YKAA 1MU2A 2DKOB 1VC5A 2DIVA 3NY0A 3U1MA 4OLPA 2XGPA 1OPZA 3I96A 2V2QA 4B9NA 3JSMB 1HQEA 3M9NB 5L1KA 3UDLA 3D6MB 3MAQA 2O1PA 4TLQA 3RG6A 4DV7J 2LQ5A 3I56S 2DRBA 4OFZA 1NZ8A 5DM7Q 1U25A 3L7UA 4OZ3A 3AXKA 4ZLPA 1HFEL 1ZM9A 2C3UA 3ADAC 3DOMB 2AYMA 2VBYA 1K0TA 2BXJA 4YR0A 3CEDA 3H40A 8AT1B 2XC9A 2HFZA 4Q0BA 5IT4A 1S9FA 3EDRB 4ECQA 4LMZA 4LF8F 1U4BA 3CDEA 4P74A 2XS5A 3AFGA 3E8OA 2VC1A 3L7OA 4FF2A 1AW0A 4WZMA 2W9CB 4EZ9A 4Y2AA 4YB7A 1I1GA 4DV5J 1RHMB 2XNRA 3EVWA 4XDDA 1YJTA 1RJJA 5A0YB 5J2QA 2AJ0A 3Q2SC 1VR6A 2W1BA 3V5RA 1Q8BA 3M8ZA 3CDAA 4RW7A 2OEMA 4RNOA 4J9KA 3PYEA 3IBWA 4JI6F 5GAEI 2HIYA 3I5CA 1FFSB 4MK8A 3TZXA 2MKHA 2FZGB 5K8PA 4OI0A 1QAYA 1JX4A 1Q7YT 1PILA 4WF9Q 2OGUA 2DGUA 3QT5A 2IJRA 1K44A 1R8CA 4EEYA 4ECVA 2ZC3A 2A2DA 2ZHOA 2E7XA 2IDLA 4Y2KA 4DJBA 2LEPA 3QT6A 2DY1A 2H48B 3EX7B 3RBDA 4A8YA 3P4UB 2X1GA 3LH2S 1N56A 2Z2ZA 1MROA 1C0UA 2XGQA 3SSQA 3DRPB 3IR5B 3K5NA 2YBVA 2R3VA 4TY8B 5MAOA 3QFHA 1AZSB 2V8VA 3OTDA 4C98A 3D68A 3GTYX 1WC5A 1IKXB 4MH8A 3D5MA 2HS0A 2OEJA 3V6HA 1K1SA 2EFGA 3I82A 5AXKA 1LFPA 2JLFA 2YWHA 4OI4A 4GVBA 2EPIA 2QL7B 3PEHA 2KDOA 2X1FA 3GCXP 2XMJA 1GT8A 4I2PA 1VRQC 3PFEA 1HW8A 3CCQS 3DOKA 2AGPA 4AUKA 1AXQA 4ZPCA 2Y1RI 3PO4A 5ETPA 2G13A 1ZOTA 4J9LA 3D1OA 3QAUA 3HT0A 2V9KA 3I4PA 2XULA 4LSZB 4MKBA 3I6PA 5IOLA 2NYIA 2CQ2A 2B56A 4X4PA 4DZDA 2XZWA 1UTAA 5IM0A 3J7A1 1S1VB 1LWFB 1VHFA 2GJIA 2RKIB 2ACMA 5GAHI 4LFAF 4M5HA 1FK9B 4FBTA 4P2SA 1J5EJ 5A8WA 2F8EX 5FLXY 4WP8A 1KVKA 3SCJE 2Q79A 4RW9A 2NCKL 3QQCD 3JB9k 5KFLA 3W9JA 5E33A 6FDRA 1MNEA 9RUBA 4LVOP 2B4VA 4DU8A 1EB0A 1JKHB 3CVKA 3CT9A 3CDUA 1VQ5S 2LA6A 3BSOA 2G4BA 1BMQB 4JI8J 3PG9A 1X4FA 5B0BA 1JJCB 3IM9A 5B08A 4P72A 4OX9F 3NCPA 4OHYA 3BDEA 1EETB 1GNKA 4WBFA 3NAHA 2IRUA 4J9UE 2VKRA 2BRLA 3O44A 1RWPB 4WU3A 2P9EA 1OS5A 1S48A 4DL7A 3CCZA 2J9CA 1NHVA 3THVA 4KYZA 2BR0A 4ZVTB 2RAQA 5ETNA 4ZVRB 5DRKA 5A8KA 3B4MA 3H90A 3DRRB 3FQKA 2ZNZA 2EFQA 3O5TB 5D6GA 1UFLA 5D4LA 1A0OB 2GVZB 4DR4J 1FNXH 4X62F 2O5DA 4F50A 3PX4A 3S1TA 7FDRA 2FVPA 1N33J 2MSTA 4ZCLA 1VQLS 4PPZA 2C3OA 2VICA 4NLPA 5ETSA 3GIJA 1YBAA 4OIXA 3KLEA 4LBPA 1LWEA 2IJFA 4OZ2A 2EK6A 3GILA 4WZQA 1J27A 1PC4A 3IA0A 2AX0A 4DV6J 4DUYF 4ZCIA 2W9AA 1IBLJ 1EARA 2HNYB 2DXDA 3PKYA 1RP5A 4UY8T 5J2PA 2XMWA 1P6TA 4XAKA 4P2FA 3MUTP 2CJBA 1LWCA 1V5VA 7AT1B 3HHDA 1M5VC 3POTB 2BJEA 2XMAA 1Q8LA 1YJNS 3OLBA 3GIRA 3B8HA 2JEFA 4NCBA 5L1LA 3E51A 2Q3PA 1NH7A 5K5MA 3K8WA 1WSRA 4USMA 4F67A 3TUZC 1JIHA 3TZZA 2HW3A 4EBDA 2EK1A 4KKOB 3OQ2A 4FBUA 1FA0A 2K7JA 1UP1A 4DPOA 1EQMA 5HROB 2A18A 3R5AA 2YKNB 1YJVA 3G87A 2VQFJ 4DG1B 2F5GA 1RT6B 3RBZA 1F60B 2R4FA 2DXFA 3UCUP 2CQIA 5DLGA 1TL4A 2JVOA 1K73T 4WK1A 5HMYA 3KMSA 1WKLA 1SKWA 1VMBA 2GHWA 5HMWA 2PO4A 4GKKJ 2VHGA 4BWJA 4B9TA 4B3RF 1HMVB 2HZAA 2YXLA 2ZH6A 2VBXA 3NWGA 4DX7A 3B54A 1Q5VA 2BKPA 2K3IA 4QPTA 4LF9F 1IWAA 2C2DA 4LF4J 1NAQA 4CH7A 3IRWP 2GHVC 2CQPA 1WG5A 1FKPA 1RK8A 1Q79A 3TA2A 4AXIA 3G96A 5DDRC 4LRBA 4U8YA 1B0VA 1VC0A 1WSVA 1X5SA 2PA8D 2UVWA 2PE8A 2YNHB 3CJ0A 2M3DA 5I3PA 4O4RA 2KFNA 1RBLA 3U02A 4RLEA 5ETTA 4O44A 2VG5A 3WQPA 4EUVA 5E3AA 1V3ZA 1S9EB 3FCHA 1N6QA 5GADU 3HO1A 1XWLA 3QWPA 4LF5F 4DR7J 3KG4A 1S7IA 1QTMA 2IMWP 1U1NA 2CUYA 1RWOB 2RRAA 1UVJA 4O0NA 5L8RC 4WFNQ 1HNWF 4WP3A 2FVQA 2ZD1B 1LW2B 2PDAA 1T7PA 2CG8A 1D1UA 4Q8EA 4JI7J 3AA9A 3SFGA 5E5NA 4ZVPB 3AY0A 4C8YA 2JDJA 1YRXA 5U47A 4ANCA 2M5YA 2M88A 4F4YA 4Q8FA 2EI5A 2KL8A 1T11A 3IN5A 1U1MA 1T9VA 1HYSB 1CJTB 1FVSA 1RAIB 3C6UB 4CH0S 2QG9B 5F8GA 4WXOA 2BYCA 2H5JB 1SH3A 1Y5NB 4FP9A 3W64A 1CPZA 4FYYB 4GKJF 3CDWA 4JI1F 4G3IA 2VPYB 1XNQF 1FRXA 4ICLA 5IQ6A 4JYAF 1T02A 1RBOB 1FHTA 4LBIA 2VASA 3VWSA 2XI3A 3ILLA 3ZZPA 3PJXA 1O5JA 2D7SA 4Y0FA 5LJ5Y 1RT4B 4DX5A 4KPCA 1NO8A 1JLAB 4C0BA 3AOAA 5KFCA 2BE7D 5J2MB 1B4SA 2FD2A 4DV2J 2A6MA 4H4KA 2N4CA 5EX3A 1JLCB 2XYGB 1HWJA 1YVFA 1VQYA 2GHPA 3M4XA 1DTTB 4F2RA 2MKCA 2HHPA 3OTOF 4K8RA 3MEEB 3KK3A 1S10A 1IJEB 2VPXB 3O8WA 2IPOB 2FGCA 2IRYA 2FHKA 4ZP6A 1X4CA 2ZH3A 3V6KA 4ZLNA 4N8NA 2QZ8A 5LSLA 3F0NA 2WK4A 5LL6d 1RXOB 2MB0B 2VQEF 4DS5A 3FSIA 1CJVA 4U7CA 2HHHF 1U02A 3G71S 3KLVA 2VOPA 4FDFA 1Q78A 1NH8A 4DQIA 3DRSA 4NLVA 4URSA 2I9SA 4KR0B 1WOOA 3CMAS 1SJ1A 4BC7A 3MR6A 1DFDA 2YPYA 2PGCA 2H5EA 3MHYA 2OMLA 3ZO7A 2PFFB 3JSBA 3OFEA 3BO4A 2KT3A 3D0HE 3EZOA 1F5AA 3EUNA 1WHXA 1E6VB 2OPSA 3OL7A 3TX0A 5LOQA 1S6OA 5AXMA 3HHLC 4RNMA 2L08A 3BGOP 4OYPA 5HSPA 3VGTA 2Z57B 4C3KA 4LF9J 4Q0BB 3HVTB 2OD6A 2WBRA 4H4MA
chains in the Genus database with same CATH topology
3OHAA 2MKJA 3PR5B 3GB0A 3H59A 2QYCA 3HKZD 4N5SA 3G6XA 3PW4A 4TXSA 3UD3P 2VG6B 4L6V3 5F3ZA 1HYSA 4IR1A 1R43A 3GR1A 3C6UA 2EFVA 3MPYA 1SQEA 4CZCA 5L1IA 4FXWA 4IRCA 3TX8A 3CC4S 4I64A 1ZH5A 2Z0GA 4OHWA 3LGNA 2XS2A 3GFYA 1SJ3P 4NZ0A 3TP2A 3DHWC 3R27A 4AL5A 3NS6A 3NBPB 1HA1A 1VRTA 3MD3A 3EZUA 4DBQA 1UKUA 3RRHA 1TK0A 3LF0A 5KFZA 4NLUA 4NA1A 1C2PA 3GG0A 1TKZA 3FEXB 4QIWD 2QMXA 4TKTA 3O2IA 4DQQA 4A46A 2OPPA 3W3SA 4WFAQ 3CD5A 3OV7A 2VFVA 2WHOA 2NLWA 4EU0A 4A8WA 1L3SA 3ISZA 1VK8A 3TR5A 2HHSA 2CKWA 3UE2A 2K7KA 3FSXA 2CZ4A 2XWXA 1RWUA 2E9TA 1L3UA 4WCEQ 2Q1LA 4E8UA 4DL5A 2I38A 2WSEC 1RT3B 5DDQC 4IG3B 4OHZA 4KO0B 1YTYA 5K14B 3BQ1A 4PQUA 1RTHB 2X51A 5KOXA 1WTBA 3RZAA 4C0HA 2XS7A 2ZH4A 4LFCF 3LUYA 5IWAF 1FRKA 1VQ8S 3IFEA 2B5JA 2IC3A 1F2GA 1X0FA 3NGKA 1L3KA 3HX9A 3QYYA 2GQ2A 2G0CA 1T03B 3GYNA 1X7VA 3OL6A 5KFOA 4ILLA 4D3HA 5HP1B 3FQLA 3IO1A 1FE4A 2AJFE 1CEZA 2J9DA 3PEJA 4O3OA 3UCGA 2E29A 2SXLA 5E3RA 1RTIB 2MJNA 1LXJA 2DNLA 2YX7A 2R8KA 2BRKA 3IS9B 2JL9A 1JLAA 3KHRA 2MKSA 1GXLA 4NOHA 5DG8A 2I5JB 2ROPA 3NCRA 4A8KA 4KFBA 2DH7A 1TKTA 2YWFA 2FLOA 1R7IA 2MMYA 1RTDB 1HWLA 1RA6A 1TVRA 5J2MA 5DGAA 3M2VA 5DJBA 4D3GA 1FXLA 4F25A 4YFUA 3Q8SB 3HK2A 4DV0F 1KSPA 3H2UB 5DGBA 3HPOA 1TK8A 2KJVA 1S1VA 4RX6A 4O3SA 4C11A 1LOUA 3HF5A 1JLCA 4X4OA 5CD4H 4PWDB 1BQMB 1FRMA 3SCKE 3EPGA 2XI2A 2DCLA 4DSJA 2ZOMA 4OJHA 2BZ2A 5GAGI 1FJGF 1BQNB 2RDIA 3OUYB 1UETA 3P3DA 2VFSA 2V8DA 2ZJPQ 2V8HA 2B6AA 3Q8RB 2J9EA 4PRFA 4Y2MA 2YNIB 3D0GE 1DTTA 4G1QB 5I3QA 4DR3F 2V9WA 3S7RA 2QA4G 4ECUA 4FYDA 4UUXA 4XDCA 1HNZF 4BCAA 1VQ9S 4OLOA 4Y00A 1RT2A 3MEEA 1WF2A 4JV5F 2ZITA 3VTIA 2ZH9A 4FN5A 4RUCA 4RNHA 2C2EA 3Q22A 1U2RA 2PC6A 3K57A 5HI7A 1HBNA 4Q5VA 2VBWA 2KXHA 1FRJA 2F8HA 4O4GA 4EO6A 5KFUA 4M95A 1J5EF 2ROEA 1WD6A 4ZCKA 1S0MA 3FDSA 5KFMA 2FVSA 3CIMA 2UXCF 2MQLA 2XY6A 1TZ0A 1W2BR 2FPHX 3BGFA 1TKXA 3K5PA 2FVCA 2AYEA 2EFPA 1T05A 1PO6A 2APOA 2DHXA 4ED2A 1OO0B 1VQ4S 4MYUA 3VAKA 2M7SA 4C8ZA 1ZETA 3ZZ0A 3AHPA 1IJFB 1FE0A 1K1QA 1IKWA 4I0WA 1REVA 2E44A 5DG7A 2NREA 3H98A 1HR0F 2VFUA 2CQ1A 2FVRA 2J7UA 3WC0A 4DSIA 2G1DA 1HI8A 3VAHA 3KK1A 2R8JA 2C3MA 4K2XA 2BANB 2NS1B 3S01A 2HNDA 4RW6B 4TU9A 1XNRF 2DK2A 3W7BA 2R8GA 4QJVA 4ZP7A 1U45A 1MW7A 2CQBA 4CQ1A 4XPEA 3OR1A 2X1BA 3L09A 2DNRA 1C0TB 2V4JB 3ENQA 3VF0B 4RW4B 4B02A 3VZIA 4X2BA 1B64A 4ZS6A 1BY9A 3I9V9 1R8HA 3LP2A 3V2UC 4CT8A 5HO4A 2DO4A 4KB7A 1Q82T 2KXFA 1SKSA 3OVAA 2FLLA 2WW8A 3M30B 1M5HA 3LAMA 1BGXT 3CO9A 1PSDA 2NPFA 3I55S 1U49A 4JI8F 2VFRA 1PC5A 4PUOB 1DAXA 4F4WA 2Z4PA 3THTA 1JK9B 4LQ3A 3MI7X 2BV3A 3N6LA 3CTRA 1UEUA 3Q24A 1S0OA 4ILMA 3NG8A 2HRYA 4URQU 1RTJB 2VA2A 4QBUA 3M6VA 2QV6A 2FDNA 1E6VA 2LLZA 3MMCA 1SC6A 3DMJA 3TOQA 1E6YA 2R7OA 4GO5X 4IYQA 3KWMA 3ZZZA 2UP1A 5DQGA 4FF3A 3KLGB 2XY5A 4CO2A 4MMOA 1XC9A 1VOMA 2YX1A 1LKZA 4JI3F 2FJDB 1VK3A 3MXHP 3C6TB 2RU3A 2VA3A 3MCSA 2CQDA 2MZ1A 3H5SA 1L5UA 1IBMF 4KAIA 3PY8A 3PW0A 1U6FA 3UPFA 3KLHA 5CYMA 4M1KA 1GXUA 3PRBA 1YSJA 3HI9A 2P6SA 3HVTA 5HMXA 1FVQA 1WNEA 4F4XA 3SQGB 3IG1A 5F0UA 2DR8A 4HKQA 2DNPA 1QE1B 2V4QA 1QAIA 3RB4A 4ZA1A 2A1BA 5FJ4A 1SXLA 3H25A 3PW7A 1J5OB 1N5TA 4TNOA 2I8EA 4OZJA 3HJFA 2VG6A 3B82A 4U7UK 1U6BA 3FNNA 3DRRA 3ITHB 3RAXA 4X4VA 1F9FA 1FDDA 4KC5A 5J1PA 2FC8A 1NK5A 3C66A 4PR6A 2MSSA 4ITSA 4WE1A 3R3TA 1ZM4A 3QJLA 4RW9B 4I1TA 2DR5A 1FJEB 2KT5A 2RT3A 1R27B 2JSXA 2P6TA 3NBPA 3BDPA 3KMQA 4U9RA 4X4NA 3I0SB 1JB0C 2MXYA 5IT9Y 1NK7A 3T1AA 5KFJA 2B4PA 5LSOA 2XLKA 3G8TA 4RU9A 1G2EA 4DR4F 4F3MA 1WEYA 1ZBTA 4UUWA 3S8SA 4HHJA 1N33F 4E98A 3DU5A 1P1TA 1XR6A 2LVWA 3CC2S 1KLMB 3UDCA 5B0EA 1FKOB 3PRDA 3MOJB 4K50A 4NZ6A 2OPQB 1FDBA 3BSCA 3CPWR 4ALZA 3V4IB 4HH1A 2WTFA 5C24B 1RT3A 4IG3A 4KO0A 2B9YA 2DJWA 2L9WA 1N5SA 2D3UA 5K14A 2MDAA 1UL3A 1RTHA 2AJ1A 4QWDA 4IQXA 3D1QA 3DDKA 1JNRB 4OV1A 3KNAA 4IDKA 3QGIA 5EN1A 2KJWA 1S76D 1URNA 4K4ZA 2O01C 5THWA 5ADZA 3RAQA 2A3JA 1DQ8A 3P5TL 4OJ1A 3MMBB 2E1AA 4FS2A 3W2VB 2B3TB 1T03A 3TUIC 4OI2A 1WWHA 4I2QB 1RISA 2JHEA 2CPXA 2Q43A 5JXSA 4DV6F 5HP1A 5A8RB 4IOBA 1P1LA 1RTIA 3ZC4A 2QIFA 1X9WA 1L3TA 1JLGB 3JYTA 4R25A 3IS9A 4DR1F 1H2TZ 3DXBA 2DRAA 2R7WA 3GSDA 3PZPA 1IBLF 4X4SA 2JEGA 2GMLA 3PDNA 1OWXA 2N3LA 2LU1A 3IXQA 1Y3JA 5D78A 4M5DB 1FDAA 3UWTA 4LFBF 4V19X 3KTQA 2CQCA 1U1KA 1G1XA 1H2UX 1EP4A 4OX8A 3GV5B 5AE1A 1FEHA 4U67Q 2XCPA 4F3OA 4EFAC 3QPIA 2XSJB 4J9RA 1M90T 3J7Z5 4DN9A 1GAOA 4HTIA 5M2UA 3J7YU 1KHWA 1NKEA 2PA3A 1Y4ZB 2CVEA 2HMIB 3S6EA 4FPRA 4PWDA 1BQMA 2QSWA 3TVKA 3POTA 2AX1A 2FHJA 1ULRA 3F56A 4WKRA 4OHVA 4DQPA 2KZZA 3OUYA 1RT7B 2KKHA 3BR9A 1KFSA 4OMFG 1U1PA 2ZBCA 4DF4A 4WJBA 2YNIA 2GO8A 1N0UA 2BBEA 3OPKA 5E0OA 5KFSA 3ZFVA 3JTNA 4KHMA 4AL7A 4DDFA 1DBDA 1YRUA 1RYSA 1X4HA 2XB2D 4ECRA 4IG0B 5FDLB 1VQKS 3MMAB 1HNWF 1Q16B 2QSFA 2WSFC 2MZJA 1R8BA 3DNCA 4Y28C 1R89A 3DM2B 1UAWA 1WACA 2BABA 4CTAB 4EYHB 4B9LA 3K0JA 2ZH8A 2R8HA 2ZUGA 2XMKA 5HN0A 2AWZA 4NRTA 2RDJA 4QZVB 3GE9A 4BBYA 4NZ7A 2AV5A 2M8DB 1L3VA 3M2UB 2MY8A 4N8OA 3Q23A 4MIWA 3N28A 4MIAA 2JJ4D 1ZZNA 2QLWA 2KYXA 3E01A 1Z1ZA 4DFJA 3OFFA 4L72B 4R0EA 3U27A 3IC1A 5C25A 3T6BA 2RQKA 4I56A 5C42A 2NZ4A 4DFKA 2J0WA 3CCVS 5D3GA 1JLBB 3Q2TC 1RT5B 3CCJS 4DWIA 2L9NA 2UZAA 4WK3A 2ZZNA 4Z2XA 2HFNA 2OSQA 4PXCA 2CIMA 3CCMS 2M4MA 3L95X 3AQOA 3HMJG 3HVAA 5LSRA 2F1FA 5KFRA 3VZHA 2BANA 4AL6A 4RW6A 3KLEB 3G6ES 4J37A 2VQFF 2IAJB 2RD5C 1KLNA 1LWEB 2BQRA 3KLFB 1CC8A 2DNQA 3NP5A 2FJBB 2V4JA 2E5JA 4E0DA 4RW4A 1YWXA 4DV1F 3FGVA 1C1CB 3TAQA 3H5UA 1SJQA 4QWBA 1BQXA 3WBZA 1U1OA 3K5LA 2X3GA 4YEAA 3L7PA 3M30A 3HZEA 4ED5A 2KN4A 4OI6A 3CCUS 4G1PA 1U48A 1T8EA 2X1AA 2HS3A 3CCLS 4PUOA 4RW8B 2DB1A 4TU8A 2YWEA 4AQYF 2U1AA 1NNDA 3ISND 3N01A 2R7RA 3H2LA 1QVGR 1WEZA 4UW2A 2OJ3A 1RTJA 2MQMA 5KFBA 4KV8B 4GKKF 4ELTA 3VQTA 1Z2LA 3IR6B 2AGOA 5KG1A 4K4TA 3RR7A 1FKAF 5KFEA 1LXNA 2WRMA 4K5SA 4XPCA 4O0IA 2E1RA 5A6PA 3MM5A 2VPWB 4HI2A 1WI6A 2D3ZA 4I6AA 4Q44A 1VLYA 3J7ZT 3OFHA 2J76E 3N0VA 2MZSA 1M5PC 4WFZA 4X64F 2RF2B 3ULHA 3N5FA 3CD0A 3T9ZA 3BN4A 2W4DA 3GFXA 1NJYA 2HYIB 5LJ3Y 2JEIA 4USJC 4G1IA 4B9VA 1YJRA 5KFQA 2PI5A 1PGZA 2V2KA 2E9RX 1CLFA 2FLNA 2I1RA 1IKYB 2AU0A 1TV6A 3ETOA 3KYLA 3PV8A 4ES2A 2IVFB 1P8GA 1GQEA 3QIPA 3NAIA 3M1VB 1QE1A 5DDPC 4LF4F 3AJ2A 2EVZA 1RKJA 2DBBA 2VG7B 4AE5A 2MJUA 5LMUF 1J5OA 1D9FA 1OQ3A 3K5OA 1SH2A 1UEVA 2HVHA 3H4BA 3ITHA 2JOQA 2UUCF 4PXDA 2Y1IA 3CJKB 2ASDA 1GX5A 3CJ4A 4CCHA 3LWLA 5FD1A 3LALA 3ZZTA 4Q45A 1HQUA 2N4DA 2RS8A 1NRKA 1UWBB 4ECYA 3GIIA 5KT7A 1P9QC 1U6ZA 3IGVA 1QUVA 3HLUA 4X4TA 4B9MA 2OO4A 5GVQA 5EWFA 1QVFR 1XMBA 2Y0SD 3F41A 1CQMA 5D8HB 1S72S 2NSCA 1ZYQA 5L9NA 3MR5A 1MU2B 3MM7B 3I0SA 3CJ2A 1R8AA 1VIXA 3ZZUA 1SB6A 4HT5A 3V4MA 1UA0A 4WYWA 4DV3F 3C3LA 5DS7A 3BQ2A 2UVVA 3OR2B 4RUAA 5IS2A 2XNQA 4DMZA 4EYIB 1UVMA 2I0XA 4M8LA 2GGPA 3SCLE 4YOEA 2R7SA 1VC6A 1URRA 4JBCA 1ZTTA 2E9ZA 4IH5A 3FJ2A 3TRGA 3QZ8A 4NLXA 1BLUA 4J9SA 4Q2MA 2PEHA 3G9CA 1FJCA 5J1EB 1JLEB 1HQEB 4IO1A 4NLTA 1FRHA 4OZ0A 1KONA 3V4IA 5C24A 2DT9A 1U1RA 2B7CB 3LP0A 4QIVA 5D4NA 1JXLA 4Y2CA 1KQFB 4DR7F 1LFWA 5DQIA 1P27B 3OW2R 4Y34A 4FS1A 4ZHRB 3UI3A 2CQHA 1M1KT 4B3TF 4C8LA 3AAWB 2UXBF 1UJ4A 1ZM2A 3KNGA 5FIIA 2GQCA 2LYVA 4NLRA