1Y3KA

Solution structure of the apo form of the fifth domain of menkes protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 22
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3kA00
1GXUA 2ROEA 1N5QA 4HH1A 2BJEA 1XBWA 4YDXA 3E8OA 5B08A 4A46A 1APSA 1Q53A 2QYCA 2BUNA 2XMWA 3MZIA 2LQ9A 3DXSX 1YJUA 2QLWA 2K2PA 1X7VA 4NL5A 4A48A 1Y3JA 2KKHA 1FESA 5A6PA 4HH0A 3KNGA 2BYCA 2GV1A 3IWXA 4OJ1A 3BDEA 3MCSA 2BBEA 1CPZA 2XMKA 1FEEA 1S6OA 2RILA 2ZDOA 4U9RA 4A4JA 5B0BA 3WDOA 4Q2MA 1QUPA 1Y3KA 2N4CA 2IYGA 1WD6A 2XMVA 5B0CA 1CC8A 1W2IA 3QMQA 4DPOA 1TL4A 1FVQA 2GGPB 5KAKA 3HHLC 1P8GA 3BR8A 3HHLD 1VQSA 3HX9A 2KT2A 3BGUA 1CC7A 1TR0A 2FB0A 5B0GA 4DN9A 4FNHA 2LDIA 2G9OA 2OD6A 1MWZA 2PGCA 3HHLB 1Y0HA 5T7LA 3F44A 1N5TA 3KG0A 3GZ7A 4NPOA 4OIXA 2HIQA 4YEAA 3TOQA 2OD4A 5B09A 3BF4A 3FGVA 4HL9A 1TUVA 1KVJA 1RJJA 1YJVA 2L3MA 4EFAC 2FHMA 4FNIA 4OJ3A 4DL0C 3BM7A 2HFNA 1X8DA 3CJKA 2XMMA 2K1RA 3HHLA 2W4DA 2QIFA 4ZOSA 4F67A 3QGPA 1IUJA 2K7KA 2OMOA 4Y2IA 1FE4A 5F0WA 2JDJA 3BB5A 2W4CA 1YJRA 2K1RB 3DCAA 1FD8A 3LGMA 2ZDPA 3CJKB 1AFJA 2RSQA 1TZ0A 2HQIA 2ROPA 1OPZA 4Y2KA 1JWWA 1U7LA 3VTIA 2HLTA 2KYZA 3HDSA 1OQ3A 1Q4RA 2RMLA 5F0UA 1KQKA 2HLUA 1AFIA 1SQEA 1YG0A 1AW0A 2FIUA 1YJTA 5B0DA 2ACYA 2LXFA 1K0VA 2N4DA 4A47A 1Y9OA 1SI9A 4OJHA 2OKQA 1OSDA 2K7JA 2GA7A 2QLXA 2XMJA 5T7LB 4QOTA 4HI2A 4HI1A 2ASYA 1S6UA 3BN7A 1GXTA 2ROGA 2IFXA 2VH7A 3FMBA 2RU9A 2GO8A 1TL5A 2N7YA 2XMUA 3HFKA 2EW9A 1V3ZA 2GGPA 2OFHX 3IWLA 1FVSA 2HFOA 3LGNA 3FRYA 3T9NA 1MWYA 2AW0A 5B0FA 2W4PA 1N5SA 2OFGX 1VQYA 1X0PA 1KVIA 2Q3PA 4OJGA 2BJDA 1LQ9A 1N5VA 2OP5A 2PD1A 2KT3A 3HF5A 2XMTA 3UDCA 2IYIA 5B0AA 3K7RA 2CRLA 2GFFA 4ZA1A 4Y2MA 3TRGA 3KKFA 1FE0A 1JK9B 1SB6A 4Q2LA 1URRA 1Q8LA 1OQ6A 1ULRA 2AJ1A 3LO3A 1Q8BA 1R6YA 5IXUA 2AJ0A 3I9ZA 3TNVA 2FTRA 2AP6A 2VV5A 1P6TA 2GCFA 2LQBA 5B0EA 5A6WA 3KG1A 1YRXA 2OAUA 5K9FA
chains in the Genus database with same CATH superfamily
2ROEA 3C14B 2VG5A 3FBBA 2CUYA 5KFDA 1SKSA 2DRDA 3HT0A 2DEJA 2NLWA 2CPJA 2K8GA 3OXLA 4OYBA 3HPOA 2MY8A 4LF9F 3AJDA 4BHQA 1PILA 5D77A 2JLEA 2HQCA 4OYWA 3W8GA 5IQ6A 4KGKA 4QYRA 5ETSA 2RE1A 3THPA 3ZTOA 1OPIA 4R8UA 4TY8B 3SIPB 2V2ZA 1TK5A 2DHGA 5EN1A 3G8TA 3D68A 4USMA 2HVIA 3WHIA 1FHTA 1CJTA 3KNGA 5CA5A 3D7SB 4N56A 2KRRA 2UUCF 1MMNA 2XHWA 3IWXA 3LTOA 4U95A 3TO8A 4FVCA 2HMIB 2LKZA 4QJVA 4J5OA 3D54A 3GSIA 1R6VA 2E5IA 2KYXA 3R5CA 5H9EJ 5LJ5Y 1SPBP 2V4QA 1U49A 4B9LA 1QUPA 1RHUB 1UWAA 2D3UA 2JC0A 3M8QA 1U25A 4JI2F 1GMWA 1FDDA 5KFEA 4C8MA 2B3TB 4ZKAA 4ZIVA 1TAUA 4RW8B 4WK1A 1JJCB 3M8RA 2DITA 1FVQA 1DTTA 3P4UB 5BYRA 1ZYQA 1K9MT 5KFJA 1RWXB 2OEKA 3OHBA 2R8JA 2UUCJ 3GONA 5U47A 1JKHA 2A3JA 2FB0A 1JLBB 2HS3A 4DFPA 3RBDA 2CPFA 4LIWA 2XLKA 2FJAB 2QA1A 4DOZA 3EJMA 1Y10A 3J7YU 5A2QY 2Q43A 2ZZNA 3UWTA 2YWGA 3ISZA 4NPOA 1O51A 1UVNA 3RW6A 1H6KX 5DG8A 3NGKA 3IO1A 3OXFA 1S4FA 2OD4A 4MIWA 2IRXA 3TQEA 1TUVA 1FK9A 4DG1B 1RJJA 3M6VA 4YMEA 1PJ7A 5KTQA 1YITS 2E1CA 1URNA 2XI2A 4F0MA 2UUAJ 2XMMA 1ZZFA 1RACB 2IAJB 5HJXA 5L9NA 1ITPA 1S49A 3D67A 2CQ2A 1YJRA 3T5HA 2NSBA 3SSSA 2Y1JA 2B6AB 2K1RB 1M5SA 3NG8A 5K14A 5KFFA 4WTYA 1SIZA 4I0WA 4KO0B 4PWDA 2MQLA 1RBOB 1EQ0A 3IR6B 3O8WA 1QTMA 3HULA 2W7AA 4BC9A 1M1KT 2WCXA 1PC4A 4AT1B 1GQEA 2QTWA 3UD5A 2OTLS 2D3OR 1YJTA 4PQUA 2QA2A 3FEXB 3X1LB 4I64A 2D74B 1Q79A 2Y0BB 4NZ0A 1OSDA 1Q1KA 2G0IA 1ZBTA 3AD8C 4CTAB 1M5OC 2OPRB 3C19A 4ZP9A 2RDJA 3CMQA 4FBUA 3FDSA 4IOCQ 4DV5J 2QE5A 1TTHB 2KM8C 3HFKA 5D78A 3KHHA 1S1VA 2OLWA 4NCBA 5ETVA 1RYRA 4WP3A 1GT8A 8RUCA 2WVFA 3AOBA 1VLOA 4URSA 2VBYA 1H2VZ 1NJIT 1FJGF 2BM1A 2GW8A 1OO0B 1N5SA 1HMVA 2CQ3A 3FCHA 5E2QA 4YR3A 1NRKA 5KG4A 4QWDA 3C6UB 4NLRA 3U1LA 1IBLJ 4ED3A 4L72B 2FLNA 3HF5A 4EUVA 5K5MA 2IYIA 2ZH2A 3BR9A 3RBXA 5CYQB 3V6DB 1F2HA 4EWTA 4Y2MA 4X65J 3G71S 2W8LA 1FE0A 4Q44A 5D8HB 1OQ6A 2B8PA 1W7WA 2XCPA 1VQ7S 1TELA 4CO5A 4PUOB 3ZZOA 1LWCB 2V8PA 4FF4A 2JEIA 1P6TA 1RK8A 2GZOA 4J9KA 3F56A 2ZNYA 4QIFA 2YWFA 2LQJA 3DI6A 4K8RA 5LXYA 1KQFB 2I5JA 1N0UA 2VC0A 4QR0A 3CCUS 3MUMP 4DV6J 5B08A 4JV5J 4CLKA 5IQQA 3MZIA 4DR5F 4DS5A 1T8EA 1HWJA 5DZ6A 4ZPTR 2VQFF 1YJUA 2E5JA 4LF4F 2KXNB 1FTRA 3VAFA 2MEWA 3DXBA 2CPZA 4DPXA 2XO6A 2JRSA 2X3GA 1U02A 1RAGB 3IP0A 2KVQE 4KFBA 4LBPA 2VBZA 3SQGA 5JVGQ 1FWPA 4C8ZA 4A8WA 1HNZJ 2HNZB 1S6OA 2LU2A 4YUDA 2Q1LA 3CDWA 3LOUA 5IS2A 3S6EA 1NAQA 3C16A 3PYFA 3WBZA 2CQHA 1T02A 1WD6A 3CF5Q 1PAEX 3IAS9 2AJFE 3THVA 3DRSB 1UA1A 1F9FA 4CM0A 1L3KA 2Y9HA 2HNZA 5LXRA 3R7NB 2DNPA 2C3OA 2FQQB 5DQIA 3TZYA 5H9EK 5ETNA 3IN5A 1B7FA 3GG1A 3Q8SB 1RKJA 1TL7A 2B9XA 4H54A 4NRUA 4W98A 3SCLE 2YH0A 1X4GA 1IM6A 1JNRB 3FSXA 3M1VA 4MJKA 2P6SA 4UT4A 1KTVA 3VALA 4S0MA 5DLFA 3MD3A 1H73A 5LM7E 2VPWB 5LL6d 1QE1B 2Z56B 2L3MA 4EFAC 4DL4A 4B3TF 2DPIA 2M88A 2R9LA 2BRKA 2YKQA 1EETA 5BR8J 3VQSA 2XM3A 1N36F 5FD1A 1U1OA 2EI5A 1KDNA 2XS7A 4ZOSA 4BWJA 2NQPA 4OYPA 3MAAB 3W9IA 1TVRB 2HW3A 4C11B 1YDLA 2BE2B 3CMAS 2W2MP 2F4VJ 1UFKA 4EI2A 4M5NA 1QSLA 2ZE2B 1IJFB 3IBWA 3NRBA 4ETZA 1RTZA 1KLMB 2HQIA 4MK8A 4Y2KA 4Q43A 5CQGA 4Q45A 1JLGA 1OQ3A 1U1KA 4C8LA 3X3UA 3N5FA 3MAQA 3M8WA 1VQLS 2CA9A 2UXDJ 4JP8A 1HWUA 3BPSP 5HROB 5AJ3J 2ACYA 5E3CA 4WKRA 1BE4A 5T7LB 1FNXH 2HZVA 3NEKA 3GFHA 2VF3A 3NGUA 3NCQA 4L74A 1XNRJ 5T41A 1N5YA 1UJ6A 2MGZA 1GXTA 2J7WA 5AT1B 4DR4J 1S1TB 5BYQA 5KG2A 1E6YB 4CH0S 1V3ZA 4KTQA 2M3DA 3UCZP 5L1KA 1U26A 4ECSA 3OFEA 2C2DA 3N4WA 4KH0B 3NBPA 3UN3A 2NCKL 4A8QA 1N34F 2FUG9 4QYZK 1X4HA 1TMMA 1C1CB 2HS4A 1LQ9A 2BJ3A 3FBEA 3EPIA 1VQKS 4CLPA 1RLDA 1WOPA 2JVRA 3MGJA 2MQPA 1NSQA 2YKAA 5DRKA 3KLGB 1S10A 4PUOA 4IR9A 3G82A 4JYAF 4JV1A 1IBMF 4CLZA 4QWCA 4RNHA 4KGMA 1HI0P 4LF5J 4NLPA 2AP6A 1PJ5A 3H7HB 5A6WA 2RUSA 1OSCA 1X5TA 3I5CA 2DGTA 2DNZA 3RU0A 3NGDA 3CCVS 1TKDA 3MPWA 4DSIA 1MU2B 5FLXU 4WZMA 1N32J 1WC1A 1GX6A 4KIAA 2IAJA 3FC9A 4Y6IA 3T1HJ 2Y3YA 1CLFA 2ZVIA 3JAMU 4DSFA 3OFGA 4CLSA 1S7IA 4LRDA 1Z2LA 3VWSA 3NAHA 1GMWD 3W9JA 1GAOA 2XMWA 3QWPA 4URQU 2W9BA 2MQQA 1BXNA 1SC1B 2VB6A 3J80Y 2B0GA 2QLWA 3OLAA 4ECQA 1XNQJ 3R5JB 3RZAA 4A48A 4DPWA 4ZVTB 2RF2A 3LAKA 1NJZA 1NSKL 1P9QC 1VHFA 2BYCA 2YX7A 3B4MA 4WE1B 3BDEA 3NWRA 1NHKL 4NLTA 1TL1A 2IRUA 1N4LA 4I6WA 3QRQA 3HD1A 3ZXWA 1O6XA 2GNKA 3MCOA 4V1Ak 1I5OB 2XG8A 1X5OA 3VZHA 1UVMA 5E5NA 5AXMA 4XTTA 3QJJA 3NMAA 3FCVA 4F0KA 1MW7A 1IN0A 3DLKA 3WIVA 4XO0A 3CPWR 3EDRB 3A8JA 2VICA 4K4ZA 3W2VB 5DGBA 1HARA 2B51A 2W8KA 1AB8A 1IKXB 2GGPB 4UTGA 3UNGC 2E1AA 2W7OA 5I3UA 3BR8A 1X9WA 3CIZA 3SZ2A 3M05A 2PC6A 3PXGa 2G0JA 2KT5A 2UXBF 1WF0A 2MJUA 2LEPA 3CGIA 5CXTA 1T95A 3QFHA 2HAIA 2ZM6F 1JJ2R 4NX9A 3TJ9A 1JXVA 1RTDA 3IAM9 5J1PA 1J5OB 3J81j 4OYAA 4E8UA 4B9VA 1RCOB 4OX7A 2ZJQQ 3M30B 1NK5A 4ELVA 4C0HA 2XNQA 4BBYA 3DOMA 3NOCA 5B09A 2R8KA 3PJWA 1RTIA 2MQNA 4TY8A 3DLHA 1YJVA 3W62A 2V2QA 2QL9B 5IT9U 2O3DA 2QGFB 1NSAA 1RDRA 4OX6A 1WKKA 1CBKA 5E3PA 4PZVA 5HO4A 5KFNA 2IVFB 1EAYC 3R5DA 2QIFA 4P73A 4DQIA 3NLCA 3QGPA 2EFNA 1S79A 3DLJA 4N7TA 3C3LA 4P75A 2PFDA 3NXZA 2HRTA 4ZLLA 1KSPA 1T11A 4HACA 1WC0A 1N54B 4KRWA 2WSCC 2YKMB 5J2MA 2VFVA 1FA0A 3MMCB 5F8HA 1X9MA 4CLYA 1R43A 5C2GA 3IRXB 3LH2S 2Y8YA 4M5LA 4LFCJ 2QN6B 1N33F 2NSCA 1IWGA 2HLTA 3GE9A 3MM5B 2DHSA 3R6LB 4OYMA 4MT1A 4X64J 2OH2A 2ZOGA 4NYOA 4ERDA 4FYWB 3THTA 5K8OA 3PO5A 3EVMA 4LFAF 1XERA 2DVIA 3B54A 2E7WA 2PMHA 4LRFA 1FFSB 3DHWC 1G7CB 1RGVA 3JSYA 3SDEB 2JLFA 3CMES 4JI7J 1B64A 1M1HA 4RW6A 3QBCA 4F2RA 2OKQA 2V68A 3N01A 1U2FA 3IMQJ 4J9VA 4YN3B 4F4WA 1NHVA 1RT5A 4AD6A 1YZ6A 5DQGA 4NI2B 4I7FB 3MHYA 2VH7A 3FMBA 4O3QA 1X4BA 4R8UB 2CQIA 2DNGA 2WOMB 3HD2A 4LF4J 1XQIA 3QT6A 4URGA 1NJWA 1FRIA 2V8HA 2MQMA 2J9DA 3K8VA 2FDNA 2OFGX 3DLLQ 2CQGA 2BJDA 2PD1A 4K59A 2XI3A 4HEA9 2FVQA 2DPJA 2Z2ZA 2J0SD 1S1WB 2LA6A 3F73A 3TEHB 1LW2B 4K4SA 3DRPA 4B3OB 1A9NB 2ZH9A 4QR1A 2UXCF 1URRA 3ZC4A 5IXUA 1HBOB 4J9PA 3PFOA 2FC9A 4C97A 3UW1A 4DV2J 4ZJQA 2EPIA 1KNZA 4WFAQ 2UVUA 3QIPB 4PG6A 3NGRA 4WJBA 5LMUF 5I3QA 1GXUA 2DK2A 4ED7A 2BQUA 3DLEB 2ZH7A 3W2VA 1S12A 3B78A 1S6QA 1V5VA 1XR6A 3TAMA 1BMQB 4JI1F 5CZVA 4ZVHA 1J2VA 4YDXA 3ILOA 3BGRA 3UD4P 1YHQS 5T14A 4CLTA 2J6SA 5IZHA 4ZVEA 4IH5A 1TKTB 1GNKA 4YY3F 2FD2A 1WNEA 4OHYA 1DY3A 4RBUA 5KT7A 1CJUA 1IBMJ 1RT6B 3LALA 1PGZA 4OZ2A 5AXKA 3Q8PB 3JSMB 4ZP6A 5L8RC 1SV5A 4ZVUB 3V81A 2MKIA 4HR2A 9RUBA 2J5AA 2ZHAA 1F9EB 1P1TA 5CHCB 5KFRA 4ES3A 8ATCB 2Y1IA 3J81Y 1ZTWA 4IOAQ 1KLNA 3K5OA 4IYQA 1W2IA 2B9EA 2CQCA 2C2OB 1WEZA 4RU2A 3QFWA 1PIEA 3KTQA 1HQEB 2YNIA 1IR2A 3D3CJ 1I1GA 2F3JA 3JS9A 1X9SA 2OTJS 3GIJA 1KTQA 1RXOB 4B08A 5G0RA 1NCLA 2IC3A 3A13A 3KFWX 2X7IA 4GKKJ 4CO3A 3KLGA 4ZVQB 2HIQA 2W24A 2PMWA 3PR5B 2JL9A 2VFTA 3G86A 3FRZA 1AT1B 2XTJP 3I82A 1C1CA 1DQAA 1PC5A 4FNIA 5M2RA 4A8KA 2CJQA 1F9HA 1KFSA 3Q24A 1JLAB 2P8IA 3T41A 3CJKA 1Z4UA 5IM0A 2DO0A 4M5MA 4O3PA 3H2UB 3TUJC 3M8SA 3HVTA 5KFYA 2J9DE 1UVLA 2EFQA 2VJUA 2CZVC 4ZPAA 3DLGA 3OL9A 1RADB 2B56A 3AA9A 1RT4A 4C8KA 1UW4A 2XYHB 1N5YB 1UVIA 3MM9B 3IBCB 2KM8B 2XC9A 2NZCA 2JX2A 2ZWPA 4JI4J 3FCWA 4FYVB 2DNNA 2ZDPA 2HSEB 3EVWA 4O23A 1TZ0A 2RDIA 1U1MA 3LANA 1U45A 4DV1J 2GC8A 3I32A 3UVJB 2ZBCA 3HDSA 4PEOA 2RMLA 2WAQD 3B4DA 3GIRA 4QWBA 2KG1A 4B3TJ 1SQEA 2PA3A 1RA6A 2IDLA 2OPQB 4CRJA 1IKWA 5D0GA 3ONQA 1JB0C 3NNAA 2BZ2A 2OEJA 3I6PA 3G6VA 3N0VA 3EYZA 3GIKA 2ZE2A 2N82B 4FF3A 3CJ2A 2MDAA 5HQMA 2MKKA 1TKTA 3QWUA 4DR6F 1KHVA 1KQGB 3KK1A 2MZQA 2ZUGA 3R5GA 4OZ5A 2D3ZA 2WSEC 2R2SA 1IM4A 3CJQA 5EGYA 4DZDA 3OUYB 3V5RA 2NUHA 2DNKA 3SCKE 4GC7A 3KOAA 1EETB 1G1XA 3FUYA 5K8NA 3ENQA 1RKIA 1N5VA 3QIPA 4J7CA 3HHDA 5KOWA 2XMTA 2QSFA 1DURA 5A8KA 2GFFA 4O4RA 2DH9A 4MK9A 3VGSA 2R8HA 4LF7F 4X62J 5KFPA 4YR2A 2GAHC 2MTLA 4ZITA 2RUGA 5HJYA 5LMUJ 2CJKA 2RVJA 1MLAA 2HURA 5DQHA 3KLHB 3BO2A 2GCFA 3VVTA 2UUAF 1ACMB 1UWBA 1S0OA 2W4CA 3H8YA 4NASA 1K44A 5IT0A 5AXNA 2DR9A 4B02A 1IQZA 5HP1B 2CJ9A 1N5QA 3BYPA 4K7QA 1Q81T 4TY9A 1TAQA 3V4IA 2IHR1 4L3NA 3CD0A 1ZETA 3CD7A 1XBWA 1FDNA 2NREA 2C3PA 4H4KA 3DNCA 2BUNA 3ZZZA 2KHCA 3DXSX 4FKYA 3PEHA 4O0IA 3HM9A 2V4RA 1RT5B 3TAPA 4RUAA 1HWLA 1U6BA 2KRBA 2DGXA 2VC1A 1PCAA 4OZLA 2FHKA 5L1JA 1TQLA 3AXKA 2XLJA 3LP2A 4RBTA 3SSQA 4X65F 2L41A 2XMKA 2YNFB 2VOPA 1YTYA 3H59A 5CD4H 1SKWA 3FQKA 4DQQA 5B7WA 2A0FB 3SXLA 4CCHA 5I42B 3MM5A 2AMCB 2R42A 1AXQA 2GO9A 3D6FB 4KV8A 4YB5A 4HT5A 5F41A 5MLCV 2R7XA 2GHWA 1YWXA 2BJ1A 1LK7A 2KN4A 4ILRA 1QAXA 2EFOA 1JLCA 4LRAA 4X4TA 3QMQA 3KJVA 1HR0F 4IFYB 4F50A 3DOKA 1U0HB 2JNJA 4DV4F 3AB4B 4NMXA 4F4XA 2NUUG 3RBEA 2GVZB 3PHTA 3WQPA 2LDIA 2G9OA 1NZ8A 1EQMA 4DU7A 5EX3A 2HHWA 3F44A 1N5TA 1LEOA 2LP4A 5DETA 1BD6A 1U2RA 5CYQA 4ZVGA 4AXJA 2OSQA 7FD1A 5HMXA 3V6DA 1N6QA 3JAMY 4C6AA 1OJ4A 4Z2XA 1UJ4A 2QLBB 3BREA 4LRBA 4N8OA 3SYZA 1HMVB 3OTOJ 2ALZA 1MMDA 2OPPA 1HNVB 1IKYA 4FPIA 1EIYB 1ZOTA 1HBMB 3LWLA 1IUJA 1CS4A 5KFKA 4CO4A 3MPYA 5KT6A 3OFHA 5IV3A 4WYLA 3W61A 1R7IA 4NMLA 4ILMA 2O5DA 4FPRA 2DT9A 1I51B 3IG1A 3TWZA 1FXDA 2BANB 3N28A 3CCLS 3IC1A 2WTFA 2ROPA 4TXSA 1JWWA 3GLJA 3MEGA 1GTHA 4UOGA 1U7LA 4WFYA 2VA3A 4PQUB 4K5SA 3LPEA 2HLUA 1RAHB 3TR5A 1Z1ZA 5DG9A 3PX6A 2VOOA 1TV6B 1T0TV 1YG0A 2H48B 1BWEA 4ZN1A 4OYOA 3NNCA 1TUGB 4J9SA 2MXYA 3OVSA 2MPUA 2ZH8A 3WC2A 1W25A 2N4DA 2G0CA 4NLSA 4QIEA 5RUBA 3G6YA 3TARA 5GAHI 2K7JA 2GA7A 1T3NA 2BANA 2XMJA 3GFXA 2B6AA 1S6PA 2U2FA 3J7Z5 4QWEA 5AE3A 2AQ4A 3VVUA 3BJYA 2HNYB 1SIWB 1T9VA 2ROGA 1I3OB 3O6QA 1BQMB 4TQSA 2HRYA 2XMUA 1U48A 2I9SA 1SJ4P 4U7CA 2D69A 1J5EF 3PKMA 1JQGA 5JUMA 1R8CA 1RTJA 2HVEA 3LQVA 2A1BA 5GADI 1Y7PA 2HRUA 5C24A 1YI2S 4DSLA 1F60B 4KSEB 1VI7A 2C2RA 3K7RA 2XQCA 1TL3A 4C8OA 2VONA 1EZZB 3MMAB 2CPHA 4KC5A 5CYMB 4F04B 3GJRB 3MOZA 1Q95G 4K4UA 4EBEA 4CDIA 5KFQA 3OSPA 2X1AA 2FTRA 1RT7B 2MZSA 4USIA 4OI3A 4P2XA 3US5A 1RHKB 1Z2ZA 3MURP 3RAQA 4DLGA 2OAUA 3AQPA 7AT1B 1D0EA 1R8HA 3MTKA 5K9FA 1OMSA 2QSWA 3CCTA 1A0OB 1HWIA 1JLCB 3O44A 4ENOA 4HH1A 3MR7A 4MTPA 1FWKA 1WI8A 2OPSB 3BBCA 2CAJA 2ZJRQ 1IR1A 3MXHP 4LRCA 1VBZA 2KZMA 1FD2A 1JMTA 2XGQA 5I42A 4NEZA 3IWNC 1KVKA 2FJBB 1VC5A 1JLQA 3KWMA 2FHOB 4KE5A 3C46A 4ALZA 1U2CA 1XMOJ 2YPYA 1VC6A 1LNQA 2KHDA 2AT1B 3TUIC 4I2PB 1LXJA 1WOOA 5CYJA 2VZ9A 1DAXA 1FX4A 1D09B 3AB2B 1HBNB 3GCWP 4RZRA 1RWUA 1DLOB 1XMBA 2BKOA 1GMUA 4P10A 3DFEA 3PRVA 3DOLB 2E7XA 3BKTA 1SKUB 3Q2TC 1HQUA 1Q16B 4M5JA 2DY9A 2PN6A 4P7VA 1UP1A 3ENVA 1T05A 5HP1A 4EEYA 2H1YA 3M7VA 2ADCA 3ZTRA 1FKOA 1QDUB 2JZ5A 4NLYA 4ZLNA 3N79A 5IC4B 2MKSA 4MKYA 2M8HA 1F3FA 4NXNJ 3QRRA 2AYGA 2BE7D 3I9V9 4FNHA 2PEHA 3KLHA 1TK8A 1MWZA 2FJVA 4GVBA 4AYBD 2VPZB 3MD1A 5I4MA 5ETOA 2LVWA 1WF1A 1K8AT 1KKHA 1B0TA 3OR1A 8AT1B 1KR4A 1REVB 3DYAA 4PR6A 2DTJA 5E33A 3I0RA 1QE1A 2I0XA 4NYPA 3W64A 3RAXA 2WK4A 1UPMB 2KH9A 3BF4A 4N41A 2DGQA 3ZTQA 1K1SA 1QM9A 1E6VA 3A3PB 5DS7A 5J2NB 3TA2A 5LSLA 5MAOA 2XY6A 3DRYA 3M1VB 4U96A 3OQ2A 3QJPA 2FGCA 2FY1A 3CJ0A 3TANA 3IM9A 1TL7B 2B43A 1H98A 4LF2A 2FHJD 2DCUB 2P9CA 1VRUA 2ZD1B 3ENAA 4FKXA 5ETLA 3GV7B 3CC2S 2P9GA 3T1HF 1CVJA 2DGVA 3CNQP 1FF2A 2CQBA 1KD1T 4AXIA 1NPPA 3CDEA 3GYGA 3PNIA 3QGIA 3U02A 2C2MB 1DQ9A 4DV0F 3H42A 3OL6A 4CYUA 4EGLA 4DZ6A 1HLWA 3C16B 3JTOA 3NCRA 4ZVRB 1NDPA 3J7ZT 1DQ8A 3BH7B 3TX0A 1NU4A 4DR1J 2XO7A 1YLXA 2DKOB 3OXGA 1G3OA 1YJNS 1FFGB 1C0UA 2LXUA 2YX1A 3GP9A 3GPAA 3ITHB 3RR7A 2CNLB 3I5BA 1NH7A 1AZSA 1XEZA 4J9LA 2PIIA 2RS2A 2VA2A 1RWMB 5KG5A 4M95A 1JX4A 2RQKA 4K4WA 4FYDA 1ZAWA 2FZGB 2M8DB 4K2XA 2GVDB 1FRHA 5A8RB 5HQLA 2RRAA 3K58A 3WC0A 2OSRA 4DV0J 1WHVA 4RUBA 2C3MA 5ETMA 4KKOA 2GO8A 4DR4F 3IWLA 2CADA 1Q7LB 1WEYA 1R0AA 5B0FA 1VHIA 1SVDA 3KXDA 2AEFA 2I5JB 1X0PA 1YZ7A 3MEEA 1WC4A 5LOQA 1B3TA 3GJSB 2BEFA 3BGFA 3HFVA 4LR7A 1RU1A 2MYFA 3ET6A 4IRKA 2HHHJ 3CD5A 3PY8A 4QU7A 2HS0A 4LFAJ 1VCTA 3MM8B 1FJGJ 4WXWA 4X64F 4OLPA 2X1BA 3KLIA 4ZA1A 4KHMA 3TRGA 1M5VC 2VODA 4IG3B 1I94F 1W26A 1XIQA 3UDEA 3DU6A 4DL3A 4ZMMA 3BQ2A 5BJRA 1UFWA 2HVHA 2YNIB 3P96A 1T03A 4OI2A 1VBKA 4LUBA 3M8ZA 2XZDB 2ASLA 3D0GE 3BEGB 3PYGA 4DX6A 3D1OA 1ZA1B 1KQSR 4LR8A 2JWNA 4C8NA 4QIWD 1S1UB 2EKYA 2XWXA 2HGLA 3C8YA 3I87A 2XY5A 5HATA 2Y0SD 3D6TB 3I4PA 4LF1A 1T03B 1M90T 1R3NA 2MZTA 1X7VA 4NL5A 1AROP 1PBAA 2KL8A 4H4OA 4ID5A 4F25A 1FESA 5CZXA 3JSMA 2SXLA 1BQNA 5J1NA 1RT6A 1ELOA 4HHHA 5D4LA 1KC8T 4QCLA 4G3IA 2MZJA 1J27A 3B82A 5J2PB 4JI6F 1IQTA 2ILZA 3MM7A 3MM8A 1BWVA 2ERRA 3CWJA 3PO4A 4C3MA 5DM6Q 4R0EA 3W63A 5BR8F 1SXLA 1N36J 4Q2MA 4ZHRB 2ZUAA 4JI2J 1UW9A 1KOHA 4X4QA 5JJBA 4DCJB 2M9KA 2IJRA 1RBAA 2XMVA 4PXCA 1CC8A 1VQNS 2J7KA 3PIOQ 2AKWB 2EKNA 5KAKA 1QAJA 4KKOB 2L48A 4M5HA 2RU3A 2V4JB 3EZUA 3B6BA 2OEMA 1JLFB 4X66J 3CW2C 4OX8A 5B0GA 3L09A 2GVDA 3DMJB 2YWKA 2UVRA 3R27A 2ZOMA 4PG4A 1SL0A 2V2VA 3NGSA 3SCIE 3H5XA 4CWBA 1HBUA 4F4YA 3ZZTA 1SC4B 2B4OA 5EWGA 4AL6A 5HLFB 1DZ5A 3D28A 4MKBA 3FGVA 2OMLA 2J8SA 3CO9A 3W5ZA 1RAFB 2EBGA 4PXDA 3OSNA 4DQRA 2DISA 2UZAA 5KFBA 4YHHJ 1XNRF 1O8BA 1EB0A 2XBPA 3AHPA 4DL0C 1HNZF 3SSRA 1HHSA 2LCWA 2WVBA 3M8PB 5D4PA 4YS2A 4JI4F 4YR0A 4QWAA 5L1LA 1FERA 5KG0A 2HHPA 2K7KA 2OMOA 2WOMA 3R8YA 3ZZPA 4DX7A 4LREA 1FE4A 3MR2A 1N32F 1AA1B 3BB5A 3C6TB 2EVZA 4OLOA 2Y1LB 3AFGA 2A6MA 4HKQA 1VRUB 2ZD1A 5I3PA 4PRFA 3UD3P 3BSAA 2HKEA 3KUGA 1MROA 4JUZA 2IM2A 2WW4A 1VIOA 2HBRB 3DDIA 3FK4A 3VF0B 5DLGA 5F0UA 4GKJJ 1N33J 4USUA 2VD3A 3U7JA 2W9CB 4YQWA 1WDDA 4ZVFA 6AT1B 3AOCA 4YDDB 1IBLF 2QZ8A 2D9PA 1KOOA 3PRDA 2JSXA 1S4EA 4OJHA 3EDQB 1SC3B 1G6BA 4F7VA 1NLKL 3H25A 3V6HA 4CZCA 1LXNA 1DBDA 4JI5J 1S6UA 2OO4A 4CP5A 3MR5A 2RU9A 2N7YA 2QA4S 2I8EA 4DPUA 4DV5F 1NKCA 1GEHA 2MZRA 4K0KJ 5F8JA 3D66A 4DMZA 1DTQB 1Q5YA 2XS5A 1JXEA 4HYKA 3EGZA 2W4PA 3Q2SC 1S72S 3MOJB 2IBKA 4FZVA 2HHTA 3C14A 4TQRA 3DOLA 4V19J 4ELUA 4I4BA 2WW8A 4FXWA 3DOMB 4WFXA 2W2NP 3UE2A 2ILYA 1EX8A 4USVA 1WC3A 3HHEA 1Q0NA 1NXIA 4OZNA 5HMYA 3JYTA 3T5KA 1ULRA 5GMEA 4DF4A 2HNDB 4M5KA 5A0YB 1FXRA 2DBBA 2QLJB 4RLEA 4RW9A 1T9WA 4OMFG 4N8NA 5L46A 4C0BA 2HFSA 2WONB 3KHLA 3P5TL 4O44B 1XMOF 2FLPA 1FKAF 4TYAA 4HDHA 4ES2A 1IKXA 3KDNA 4KPCA 4WP8A 3BQ0A 3ZFVA 2R2TA 2HGMA 4WFNQ 2C2NA 1NK7A 1H38A 4FVMA 4O3NA 2XGPA 4RR5A 1WKJA 1I6JA 5C25A 4ELTA 4O3SA 2LQ9A 3KG4A 1VJWA 5D0EA 2DJWA 4CLWA 1HA1A 3HSZA 4ILLA 2FY8A 1UKUA 1B7YB 1WTFA 4QQBA 1RT7A 4RX6A 2KXHA 4NLUA 2RAQA 3DN9A 2AGPA 4G1IA 4EYHB 5CYMA 1WWHA 3MCSA 1RTHA 2W2OP 2VBWA 4ICLB 1CPZA 5C5JA 3AAWB 2QO3A 3UFCX 3D3BJ 1QSSA 4LF5F 2IPOB 3OTOF 2MLXA 2KDOA 3VQTA 1S77D 3MMBB 2RS8A 4RWXA 5C42B 3KHRA 5ETPA 2HFVA 3EE3A 4OI4A 5GAGU 1ZZNA 4K50A 1R0BG 3PW4A 1NK9A 2DR8A 3POTB 2HHVA 1TL4A 5CH7B 4LT6A 4WBFA 2F8MA 2NPFA 1T9UA 3W7BA 2MY7A 1B0VA 2FHJA 3HX9A 1XN9A 4RW4B 2VG6B 2MHNA 1RHQB 3MEDB 3Q8YA 2E29A 2GHVC 4NA2A 1M5HA 4UUXA 1H7WA 3UI3A 3ZNUA 3KG0A 4HTIA 2M70A 4AQYJ 4LF6J 2HEKA 1MSWD 4ED0A 1K0TA 3G82B 4Z37A 4X62F 4ED4A 1CQMA 3JSBA 4RJVA 1WHWA 1UJ5A 1ICEB 4ER8A 4YEAA 1TV6A 1K47A 1FX2A 2D7SA 5ETKA 3G9CA 2IVMA 1RAIB 4RU9A 3T3FA 3IS9A 3HCXA 4DUTA 2ACMA 2G1DA 4J9RA 1X4CA 1BUXA 4DFJA 2XHCA 4PAAA 2KTQA 2BM0A 2V94A 3SFUA 2UXDF 1YX2A 3HHLA 4DX5A 5C2CA 1D9FA 1U1NA 2HK3A 4KB7A 1WSRA 2V2KA 1E6YA 1OY8A 1SUQA 2WONA 1C1BB 2V50A 1IKVB 3FFIB 2JOQA 2KU7A 4RW9B 3DCAA 3PW5A 2RSQA 4FF1A 2HQGA 5F3TA 4P2SA 3KHGA 4LIRA 3BBBA 5HROA 1FKPB 2VDHA 3OJUA 2R7WA 1SL2A 1RCXB 4WF9Q 2VQEF 3R6GB 1CG2A 4NYZA 1IBKJ 4Z7CA 4EBDA 4QPTA 2E66A 2V63A 1EKRA 1Y9OA 3GMGA 1V5IB 5FLXY 1MWQA 2Q66A 4HI1A 2C42A 2GAGC 2GVZA 1CJKA 2NYHA 2VJVA 1U0HA 2AGQA 4MFBA 3LA0A 4IFYA 2HFOA 3A1YG 4LSZB 5KG7A 1MWYA 2R7RA 3KLVA 4QW8A 3HSGA 3HI9A 3K0JA 5DDRC 3R97A 3KLFA 2Q3PA 1KVIA 3ZZUA 2OP5A 2JVOA 2KT3A 2VPXB 3D6HB 5LMNF 4DR2J 1D3WA 1HKAA 2DB1A 2LDYA 4I68A 4FYXB 3SV3A 3ZNJ1 3U1MA 2YQ1A 4NA3A 1JK9B 2VKZG 1NB2A 3N6MA 3VAIA 3HSJA 3TQ1A 1I94J 2JEFA 1M5KC 2ZZMA 4LQ9A 2AJ0A 5KFVA 2P6TA 1UVJA 3E51A 4JV0A 3W60A 2BQ3A 2HAFA 4G1QA 4DSKA 4JI8J 2F9DA 4X66F 4NOHA 1X4AA 2QLFB 2VFSA 5H9FK 4AL7A 2FVRA 4Y28C 4X2BA 2ZNZA 4UOCA 3A3OB 2E5GA 3MWBA 2AV5A 1OIAA 1SQFA 3MI7X 1J5EJ 2A18A 3VV2B 4A46A 1MNEA 1SH2A 2EG1A 2EK1A 3AQOA 3PR4A 4DQSA 3TJ8A 1FI4A 1Q82T 4LFCF 1X0FA 1N0VC 3DGPA 5KT5A 3SQGB 5HLFA 1NUEA 2VFUA 1AYEA 1UAWA 2V9KA 2ZBQA 3NS6A 3LP1A 4F3QA 4USWA 4UZBA 1VQ8S 3BDPA 4OJ1A 4DL2A 4Q8FA 2BBEA 2DYAA 1QUVA 2EG2A 4L75A 5GMDA 1UZDA 2LU1A 1VQ9S 1RAEB 2CIMA 5DDQC 5G4DA 2IVYA 4LF9J 3J80U 1FNOA 2AZ3A 1JLEB 2DEIA 1MMLA 4ANDA 3ZTPA 1YRTA 1HHQA 5B0BA 3CXCR 4DV7F 5DGAA 3HJVA 4J90A 2BKPA 2N4CA 1SC6A 4DXLA 1OS5A 1RT3A 4Y0FA 3R7BB 3CCJS 3TYTA 1FCAA 1Q8KA 4DPOA 4OV6A 2NXJA 4F4AA 2FJWA 5D4OA 4ATNA 3DI6B 1WI6A 3CDAA 3HXMA 1VR6A 1NDKA 3HLUA 3M6WA 1YQHA 4U6PA 3DHXA 1SJ1A 4X4PA 1NHUA 2CDRB 4FP9A 3SQOP 1PG5B 1XR7A 2Z4PA 1ZPVA 2DGOA 3M9OB 1WOSA 2HWIA 2WVDA 3TVYA 4ED5A 2R7UA 1OY9A 2KG0A 3UN5A 3H2VE 2G2OA 3ZZ0A 3BSOA 2AEMA 4OIXA 4F02A 2RJZA 1GH8A 2OPQA 4CM2A 3PW0A 4IQXA 4C98A 2IA6A 3R3TA 3C6UA 2EEYA 2ABYA 1LFWA 4HHJA 3TZXA 1RSCA 4DJBA 3GJTB 1N52B 4KGVB 1NZAA 4ZDNA 4A8XA 4DR6J 2DRAA 1FRJA 9ATCB 3DDNA 3W3SA 1IKVA 3JQJA 3MECB 1SUQB 3HVWA 4DUZF 3NL0A 2B4VA 2G1HA 4IRCA 3DLGB 4RNMA 4UY8T 2MLYA 2AJ4A 4Y34A 1G4CA 4CLLA 1RAJA 1REGX 5THWA 3V2UC 3EGVA 3A12A 1FD8A 1HW8A 5HMWA 4F8RA 3UN2A 4FS1A 4TU7A 5F9NA 1OPZA 4PG5A 5JXSA 4IG3A 2KYZA 1PYOB 3MM6A 1Q4RA 3IR7B 4L6V3 2XEXA 2IY5B 4OV1A 1RWKB 2J9CA 4OQJA 4UF4A 3W8PA 4YB1P 1U6FA 4J9UE 1R8PA 2HQFA 2CNNB 2FIUA 2WVCA 4ZS6A 1VRQC 1UTAA 2FLLA 4DV1F 1GMVA 2JH3A 3FVYA 3H5UA 4CI0B 4CO1A 4KO0A 4RNNA 2CZ9A 3M9NB 2EC0A 1QAYA 2R7QA 3K59A 2VG6A 3MEDA 2AU0A 2VIHA 2IFXA 4O0NA 1LV5A 5C7PA 2QV6A 3IFEA 2XYPB 4ZVSB 1KQKA 3MFHA 4JV2A 5D0RA 1RAOA 3FRYA 1KEKA 3SEOA 2LXIA 4FXDA 4IFVA 2B8QA 3HHKA 2CDQA 5KFXA 1HNWJ 3P3DA 1RBLA 2H9ZA 5E3RA 1AZSB 1FK9B 3DGVA 4DG1A 3GSDA 4ZCKA 2PEBA 4CLFA 3GYXB 4KY3A 3UDCA 1S1XA 1EP4A 3D4JA 4C4WA 4TLRA 1ZTTA 3EXCX 4KHRA 1CJUB 3A4TA 1XC9A 1N8RT 2UXCJ 4DDFA 2HFZA 1S48A 4DCPB 1SJ3P 4U67Q 1JLBA 2IMOA 1JKHB 2XNRA 4Y65A 4OHZA 1Y4ZB 2OI2A 2F8EX 5IT4A 2JHEA 4CH1A 1S76D 1CJVA 1DTTB 2D1CA 4CH7A 4QBUA 3PIPQ 1QVGR 1PJ6A 4RW8A 1RWPB 4ZVPB 2ZHBA 2FVCA 1N48A 3AA8A 3NNHA 5F8IA 3UDVA 2Z8QA 4JBCA 3Q8QB 2HZCA 1U4BA 4DX8H 3A8IA 4J37A 3CJTA 2YVSA 2N7CA 1EARA 2R3VA 5IWAF 1T9YA 2MSTA 1VK3A 4OFZA 5F8NA 2VG7A 3RB4A 5HQ8A 1VQMS 2W9AA 1S9GA 4UZCA 3I0RB 1WHYA 4HH0A 2EFPA 4DI6A 2EBEA 2NXEA 3DYAB 2H3EB 5ETRA 3JYTB 2HBZB 2ZKTA 5A8WA 1LW2A 1T7PA 1F5AA 4TVAB 3O3LA 3CVKA 4E2FB 3CD6S 2DGSA 3TZWA 1RLCL 5J2QA 3HP6A 2BXJA 2BJ7A 3K5NA 2LEAA 1C2PA 2P9EA 3EM1A 4NEYA 1RWVB 2ZHOA 2M4MA 1HI8A 5H1SV 4EO6A 1S0MA 3SFGA 1TKXB 1F2GA 2VL1A 3PW7A 4DV2F 2VBXA 4NA1A 4N5SA 2VG5B 1UA0A 2E5LJ 2AX1A 2AJQA 1WC5A 4J91A 5F3ZA 1H2UX 2CVEA 3HHLD 5J2QB 2YKNB 4XPEA 1CC7A 3H4BA 1RT1B 2X1FA 4FN5A 2OD6A 2VFRA 4ZPDA 3IA0A 2RIJA 3AY0A 1VRTB 3L9ZA 2HK2A 2CYYA 2AYMA 2DHXA 2XZTB 4P71A 5F8MA 2YQ3A 2EC2A 2W2PP 3KDOA 3PM9A 3GR0A 1CULB 3RB3A 2ZKUA 2W7PA 3OV7A 2C3YA 1JLQB 3GU0A 2W9CA 4ECXA 2KFNA 3KJFB 4ED2A 3O5TB 4HHUA 2JEGA 1LWXA 2IM1A 1UFLA 2YKPA 3DM2B 3TI0A 2IM3A 4NXMJ 4M1KA 2ZC3A 1VRTA 3CSKA 3IRXA 3M6XA 5EUHA 3G96A 2W4DA 2R8IA 3MMCA 2VUGA 3I56S 1CJVB 3C6TA 5F0WA 3U27A 3CT9A 1NJYA 1WJ9A 2RHSB 4W4MA 3U1NA 1HR0J 3L7OA 4PWWA 2ATLA 5JMNA 3HJFA 2AX0A 4ECRA 3C2PA 1WELA 1TKXA 3M2VB 3M8PA 4Y3CA 1ROFA 5FDLB 3PEJA 5GAHU 4KHPF 2RRBA 4PYAA 3KMSA 1IVZA 3T1YF 2DGWA 2FPHX 3OL7A 1EP4B 1PYSB 2Q79A 4ZJOA 4NLXA 4LQ3A 3M30A 4M5DA 1HNIA 4WWSA 5IT9Y 3CDBA 1SJFA 3BN4A 1L3SA 1HBUB 1FEHA 2XSJA 1C4AA 1UZHA 4Y2AA 3GYNA 3T1AA 5KFLA 4ZLPA 5JVHQ 1RTDB 3PFEA 4O3OA 1CEZA 5E3QA 4FF2A 4B3MF 3KMQA 4RO0A 2YKOA 3HVRA 3SV4A 4E98A 3MEKA 1BQMA 3NS5A 2LQ5A 5I3UB 4IUFA 2C2EA 2HNYA 4OYZA 5BYSA 3CJ4A 2C3UA 1NPRA 3ZTSA 3OLBA 4KGXB 4JI1J 2R2RA 2VQEJ 1OWXA 1NBEB 3DLKB 1SH0A 3QAUA 4X4OA 1JXLA 1VQYA 1PSDA 1T94A 1MN9A 5L9XA 3DKDA 4ZHRA 5KFMA 3T5LA 2CNOB 4GKJF 1BLUA 2P2CB 5D3GA 3ILJA 3GILA 4RBVA 1F0XA 3QZ8A 2R7SA 4DUYJ 4DSJA 3LWMA 4P72A 5ETQA 2YY3A 4Q2LA 3FKBA 5J2PA 4HVZA 2OGUA 4CO2A 1FRMA 1Q8BA 1BQNB 2MKHA 3CJRA 5HI7A 7FDRA 1HNXJ 4H4OB 2VASA 5KOXA 4BDPA 3MAHA 4UW2A 2DNRA 2DR5A 1VBXA 1KHWA 3FBCA 4MH8A 2W9BB 2GMJA 4OX9J 2AZ1A 2O67A 3KK3A 4IKAA 1HBMA 3OFFA 3W2WA 3MFIA 1IKYB 1S7HA 2CJYB 1HNVA 4FXVA 3I55S 2OPPB 4PWUA 3VGVA 2GS8A 1RUSA 1VQ5S 4XDDA 3JTNA 3IXQA 3OR2A 2PO4A 2MHEA 4ZP8A 2UUTA 4GO5X 4J9OA 2QG9B 3R5AA 2CZ4A 2KKHA 3HVAA 5A6PA 3ENWA 3QPIA 2D9OA 3M2UB 3P8BB 1RWNB 1ZM3A 4TNOA 1U09A 1NDCA 3H20A 4YB7A 3KYLA 4K4XA 2YX4A 3NOGA 4DF8A 4IDKB 4O4GB 3ET6B 3GFYA 3S1TA 3LP0A 1KRPA 1QTNB 2RILA 3H98A 4U9RA 1RWOB 1Q5VA 3I4HX 3MM6B 4LSLB 3GV8B 3KJVB 1Y5NB 3NBPB 3EWGA 4NLQA 4KGZB 2DRBA 1AW0A 2UVWA 4DS4A 4KH1B 3D9BA 3TA0A 4F4ZA 4CLUA 4KV8B 4OZ1A 2CPXA 1FJEB 1HPZA 2WVEA 3PTWA 3MECA 5DJBA 1U8WA 4R5PB 3E01B 2FVSA 5T7LA 3Q83A 5HVHA 2V67A 1UMJA 5DM7Q 4IG0A 1NPKA 3GZ7A 4GC6A 4X4SA 3KK2A 2BACA 2GX8A 2ZITA 4RL1A 3F0NA 1XMQJ 4E0DA 4LF8F 4J9MA 2QL7B 4AUKA 4K4TA 1D8ZA 2CPDA 2PA8D 3HZEA 1RA7A 1LWEB 4PABA 1KLMA 1VK8A 2V8GA 5F8GA 4QYZJ 4DR3F 3ELHA 2C2KB 4F67A 2QMXA 2Z2LA 4UOHA 2HHQA 3NWGA 2V8DA 3PJXA 1HNXF 4ED8A 2E5HA 2H5EA 2BJ8A 1WG4A 4G1QB 3L7PA 2P5VA 3PKYA 4KPYA 2JC1A 5IV4A 2W01A 4F3OA 3BV8A 4C8YA 2FYXA 2B9YA 2ZFHA 2FC8A 3HKWA 3CULA 4PCQA 1WG5A 4OI0A 2CWKA 1LKZA 3S8SA 4U8YA 3KJNB 5HN0A 4P6QA 4EZ6A 4GRSA 1RB0A 2A2CA 2FJDB 3DRRA 5DO2A 4B9TA 2M5YA 1UL3A 2F7VA 3DRRB 5E3AA 1FJ7A 1NEEA 1REVA 4ID8A 3K89A 2WBRA 4UUWA 2QLXA 4M5GA 4JI5F 4ES1A 2R8GA 2K3IA 3BN7A 2LA4A 4P7TA 4ECVA 4ZCLA 3FQLA 2IMWP 1KP6A 1NSPA 2FLOA 1L3VA 1DARA 2GMHA 2BOPA 1TL5A 3TVKA 2EW9A 3DRSA 1DHMA 3I96A 4I1TA 3EMTA 2UVVA 2DXDA 3V4MA 3Q8VA 1HQUB 2IDEA 2WSFC 3VAGA 3GQCA 3P49B 2YWEA 1DLOA 1N88A 2K06A 4F26A 1SQGA 4KFBB 3T6JA 1U0SA 1BHNA 2BMBA 2G2YA 4L73A 1YJWS 3H5SA 1L3TA 3QO9B 1JJ4A 3UVJA 4I2PA 2DNMA 4IG0B 3KUHA 1Q8LA 3AODA 5LT5A 3TUPA 4C9DA 4OL8A 6FDRA 2J8AA 2DR6A 3AJ2A 2Q6BA 3E01A 4DV3J 3RRHA 4PYDA 3PG9A 2KO1A 4NXMF 1VGYA 4BLGA 2BOAA 2AHOB 2F4FA 3FZ2A 1S0VA 2DNYA 3BKFA 2CG4A 4USHA 1H3DA 4P2FA 5KFCA 2IJNA 5IM0B 1JLAA 5GAEU 3C15B 4F4KA 3E8OA 3D2WA 2E9ZA 3IS9B 3J81U 2COLA 2NS1B 4R25A 1ZM2A 4OZ3A 5D4NA 2B4UA 2K2PA 4C7QA 2IA0A 1LWCA 4DU8A 1DFDA 5SZTA 1Y5LB 3M2UA 3PW2A 3HZGA 5AE2A 2IC3B 3CC4S 1LOUA 5G0RB 4ZCIA 5M2PA 5F8LA 1HL6A 3MMAA 1UCNA 3MUVP 3O1LA 1N56A 2YTCA 1Q86T 4BCAA 3NMRA 1X5SA 2PSZA 3FEZA 3QQCD 1FEEA 1GXLA 2CPIA 4TLQA 4RNFA 4A4JA 1KN6A 2APOA 5C24B 5ETTA 5KT2A 4ZP7A 1V6HA 4KT0C 2QT7A 2BE9B 4NLWA 2F65A 3ICLA 4UOFA 4Q8EA 2DNOA 5K8MA 2F5GA 4XK8C 2G2ZA 5B0CA 1U1PA 3CCES 2ZVSA 4ED1A 4NCAA 4LFBJ 1C1BA 2HGNA 1S1VB 3MMBA 3JXOA 3G2XA 4DPTA 4DWIA 1VQ6S 2KT2A 3NKYA 1H74A 1TR0A 4PPZA 5GMKa 1S9EB 4C3KA 2HYIB 3HHLB 1NK6A 1F5BA 2GJFA 4YP3A 2F1FA 2V5HG 4DR7J 3OL8A 1SJQA 4JI0F 3CJ3A 2ZEJA 2Z30B 5IOLA 4WCEQ 4UY85 3FSYA 4HL9A 1D1UA 4Y00A 4P52A 4K5RA 4OJ3A 4USTA 2NPIA 3FJ2A 1TKZA 3QNWB 1QSYA 3E3XA 4WYWA 2K1RA 3FEYB 2DH8A 2O01C 3IG1B 4IOBA 4NLGA 1S9EA 3OVAA 4WKYA 4RNOA 4ZPBA 2OELA 5HAOA 3WZ0A 4O44A 2F9JA 1BQXA 1DRZA 1D9DA 2XB2D 3Q89A 1SH3A 2L08A 1OYDA 2BJ9A 1B99A 3POTA 3RG6A 5KG6A 4F36A 1K73T 3DRXA 3I31A 1FO1A 1AFJA 3J7AN 5C42A 2XSJB 1KWMA 3K5MA 4TN2A 2UU9F 5AE1A 1X4FA 2YWHA 4WIQA 2DH7A 2AWZA 4FDFA 3QJLA 4ANCA 2CJAA 1XMQF 3MR3A 1N6QB 3RTVA 2WB4A 4B3SF 1RHMB 1U6ZA 4ICLA 3TEGA 3DC2A 3LUYA 5B0DA 5EWEA 1FRKA 4MAKA 4A47A 4IO9Q 2ZH6A 1H2TZ 1SI9A 1D9AA 3PACA 1YBTA 5FDLA 3AT1B 5ADZA 4CIOA 3M2VA 2J6TA 2IBOA 3IBFB 1X4EA 4GKKF 1L3UA 2LFVA 3AJ1A 3M32A 1XR5A 2AJ2A 2DNHA 3ZZYA 1F6TA 4A8FA 2KFZA 2GQQA 2HFUA 3DOKB 5D15A 3HSDA 3OTDA 2V8VA 2J9EA 2CKWA 3C15A 3QYYA 4L3KA 2KVIA 3AXMA 3LPYA 2DHAA 4DSEA 4A8MP 3HO1A 4I2QA 1X4DA 4OZ0A 4X4UA 4NCGA 3CDUA 3TZZA 3SDEA 1MN7A 4N47A 3H4DA 2FJEB 5F9LA 3PRBA 1EHWA 1PAUB 4LJMA 2B7BB 4R0JA 2HMIA 3Q0AA 3PYEA 3CEDA 1M0SA 2IIHA 3QT5A 3PV8A 1BY9A 4PQAA 3TJAA 2H65B 5B0EA 3BGLA 4RPFA 1FDAA 2YKNA 1YRXA 3PDNA 2AYBA 5IWAJ 1N34J 1NMEB 5IC6B 2H4WB 4CO0A 2G13A 3V4IB 4KAIA 4MK7A 3NP5A 3ZO7A 2DGUA 4RUCA 4X4RA 4F2SA 4B9MA 2HHXA 2R7TA 1APSA 2AIRB 3GFZA 3IR5B 3BSCA 1KFDA 1ZPWX 3BGOP 1UWBB 3GR1A 3N6LA 4WU2A 1HNWF 2HBYB 4WP9A 1F1BB 4WFBQ 2QYGA 4BC7A 5LSOA 3EGNA 2I6WA 1VMBA 2MKCA 3EVOA 2EFVA 4K2JA 3T6BA 2GV1A 2XLIA 1FT8A 4XIUA 2RB7A 3CCSS 4A8SA 1D8YA 3FBFA 4ZN3A 4TKTA 2BDPA 2E44A 1QVFR 3DMJA 5A8KB 3CCMS 1S9GB 2VG7B 1GFWB 2RQMA 4M63A 1RT2B 2UUWA 4QR2A 3VCDA 2DR7A 3SI8A 1UEUA 1U1RA 4N77A 4HTJA 1ZAVA 2M7SA 5AXLA 2RDDA 4DL6A 1RYSA 3CJ8A 3N6NA 2R7OA 1NO8A 2HZAA 3BZQA 1JIHA 2CPEA 1VOMA 2HVZA 4PG7A 5EX0A 1P8GA 4F3MA 4RUHA 4DR7F 4B3RJ 1IBKF 4M8LA 3WX8A 3KK1B 3GIMA 5H9FJ 1VYAA 5J1EA 3RRGA 3NAIA 2I2YA 1QAIA 3OBIA 3QT7A 4Q7AA 1Y0HA 3M2RA 2CXEA 1OY6A 5CCLA 1LWEA 4ECZA 2YNGB 4WE1A 2BW2A 3JTPA 5D0HA 2K3KA 4Q5VA 2RKIA 1L5UA 2RF2B 3TW0A 2ZH4A 3G6XA 3CJ5A 1R0CB 3MCNA 2E1RA 2C2ZB 3Q8RB 1IBCB 2R4FA 2Y1RI 1PYTA 2N3OA 2XCAA 3KLEA 3EZOA 2DIVA 1RQ0A 2MSSA 3W65A 1S1UA 2J76E 2XS2A 2QX0A 3G6ES 4R5PA 4C3LA 2QMWA 2YPZA 2ZH5A 1JLFA 2RRNA 3UDLA 3N5BA 1HW9A 4QIGA 1FFWB 4X84A 4B9NA 3M8YA 1KS2A 4NLDA 3EZ5A 1SKRA 2NZ4A 1LWFB 2M2BA 1WEXA 3NY0A 3QZ7A 3QT8A 3PYDA 5KFIA 3CJKB 4DBQA 1XWLA 2QFJA 1ZS6A 4LSLA 2LECA 3KLIB 2A10A 2Z58B 2IJFA 2ZH1A 3LP0B 2V0NA 3BS9A 4IDKA 2MJNA 4O4GA 1R8BA 5FIIA 4NWBA 2KI2A 4IH6A 1IR0A 5KFUA 3MR6A 1U1QA 4Z7YA 3A8EA 3MEEB 3PHEA 4DFMA 1JJHA 2HQ3A 2DD8S 4LSNA 4OHWA 2KJWA 2XMAA 1Q7YT 4ZIWA 5A2QU 4ID5B 1R0AB 2DHHA 3IRWP 1BGXT 4OI1A 1LWFA 4UQGA 3R1LA 1WKLA 1RAAB 2Q6CA 3ETOA 4NXNF 4USKA 2VQFJ 5KFSA 1NNDA 3OR2B 2J0QD 5K20B 2PI4A 1LFPA 2OFHX 5E41A 3LGNA 5GVQA 3FMWA 2L9NA 2BRLA 3AD7C 5A8RA 3AD9C 5DDOC 2BX6A 2QEXS 1G2EA 2YNHA 4YOEA 3W2WB 4I6AA 4EU0A 3HMJG 3HT3A 2VDIA 1HYSB 2BABA 2FZKB 2W1BA 1RI7A 2B5JB 5KG1A 3KLEB 1YIJS 2WHOA 1KONA 2R7VA 1Q78A 1UPPA 1B0PA 5B0AA 5DDPC 2POKA 3FSIA 3HHNB 4P9SA 3KKFA 2RKIB 1JLGB 2I1RA 2OJ3A 2CVIA 4TYBA 3RYLA 1R6YA 3M2RB 3ULHA 3CIMA 1RWWB 4CYUB 1VIXA 4ZCMA 2LQBA 3UO0A 4B3MJ 1XK8A 5EHHA 5D3GB 3E2EA 2BE2A 3WIUA 3J7YI 2G4BA 3BGRB 2CQ1A 3L95X 2DIUA 5KFZA 1IWAA 1SBRA 3MAAA 3CCRS 4DV7J 3KJQB 4WU3A 1SJRA 3TAMB 1CSJA 2FJXA 3BPDA 4ZK7M 1OYEA 3RR8A 1HD0A 1FTCA 3H2LA 2MQOA 1RHJB 2QYCA 5HSPA 4NZ6A 1RT2A 4JOUA 1E6VB 2MZ1A 4BS2A 4XDCA 5L1IA 3VGTA 2LLZA 2E9RX 2GHPA 1F5CA 4DCOB 1TU0B 1VFJA 5E7OB 4DV3F 1WORA 3I0SA 4EO8A 2WRMA 3H40A 3OR1B 3R1HA 3CB4A 2BA9A 3LP1B 3T5JA 3J7A1 4B3OA 4NLOA 3OTCA 4M5DB 1RP5A 3ISND 4Q0BA 2JFDA 5KFHA 2GQ2A 1FRXA 2BQRA 3W66A 2M52A 3CCWA 1BC6A 3GIIA 1FKOB 4B3RF 4NE9C 2DXEA 1W2BR 2V6AA 3LF0A 4C0OC 2IYGA 3RJMB 1YSJA 3TA1A 1T05B 3GB0A 5A76A 2LMIA 3G8QA 1YK9A 5KG3A 3K2YA 3T1YJ 3HHLC 4KJIA 4WZQA 4HLBA 2E9TA 3RRKA 3VHQA 4NI2A 3BGUA 1T9TA 1GK8A 1HBNA 2RT3A 2N3LA 4O3RA 3ILLA 3K5PA 3TP2A 3OVBA 4DR2F 2HWTA 2E7VA 2V69A 2PDAA 2Y8WA 3RGIA 3CC7S 3EXYA 3CCZA 4G1PA 2QA4G 4JV5F 3K5LA 3EGWB 5L38A 3P5BP 4H4MA 3I5AA 3UNYA 2E1MC 3TOQA 1QJHA 3VAMA 2XWYA 1EJ7L 1U24A 1CULA 2C1EB 1KVJA 4QZVB 2MB0B 1S57A 3Q86A 4NCGB 2FHMA 3NS7B 2M0GB 4XAKA 4A8OA 6FD1A 4K4YA 4I2QB 4JI8F 1NH8A 2NXNA 2OPSA 3D0HE 2AD9A 4GVBB 2DY1A 2L9WA 4N76A 3K17A 3MMJA 4CNYA 4MFBB 3T9ZA 2AGOA 4HACB 3CE8A 2CQDA 3M32B 1WSVA 4XPCA 4RKUC 3L7UA 2U1AA 4YB6A 1C4CA 2H51B 3ETMA 2GMLA 5GAGI 2QFIA 3MUTP 2UU9J 3GTYX 3LW5C 4JI7F 3VTIA 1QLNA 4AL5A 4ANEA 4USJC 2HHUA 1TL3B 3D1HA 3UR3C 1RTIB 2UXBJ 3MPUB 5ITHA 4EBCA 3K8WA 1EKSA 2UP1A 4DL7A 5A8WB 1UEKA 1P27B 2EFGA 2H5IB 4G65A 4WPAA 5KFGA 3W1YC 1J5OA 2OIHA 1RTJB 3RUBL 1QY7A 3UCGA 4QOTA 3M4XA 4DR3J 3FFIA 2ATCB 4ITSA 4QU6A 4V19X 2HWHA 3JQKA 1B70B 3G87A 2BKNA 3LAMA 2MKJA 1S59A 3OD2A 2GGPA 4NRTA 3RW7A 1HHTP 5L39A 4IRDA 1YRUA 3BSNA 4LFBF 2AW0A 4CTAA 1PO6A 3OJSA 1NK4A 1TKZB 2D41A 4C2MA 2VKRA 4ZPVR 2KJVA 3EUNA 2PI5A 1V3RA 3IM8A 4ZLJA 3BO3A 2DCLA 3QGHA 3BO4A 4I56A 3VAHA 2QC3A 3T19A 1WF2A 1MG7A 2DO4A 1TL1B 3AH6A 2WBMA 2NYIA 4Y2CA 1SB6A 2ZC4A 4PWDB 3BQ1A 3M6UA 2BV3A 3I9ZA 5CAAA 5M2UA 3D1QA 2UV8G 1R89A 1RE1B 2VV5A 2W2QP 4U7UK 1S1XB 3EX7B 1AUDA 2RHQB 1QD1A 3CO0P 2BR0A 3TX8A 1TK0A 1HWKA 4DV4J 2H5JB 4P2MA 2E1PA 1GTEA 3GG0A 4M94A 3KNAA 4KR0B 4K4VA 3AOAA 2ZBIA 4HDGA 2PE8A 4IFVB 1FWLA 3MTJA 3R9LA 2BJEA 2KB2A 2JJ4D 2OUGA 4OI6A 2HHHF 2IRYA 1Q53A 1MU2A 1K1QA 1ZH5A 2XZWA 1JNZB 2BVZA 4L76A 2QMUB 2BW7A 1LK5A 1B4SA 1Y3JA 2DNQA 1S6PB 3NCPA 1XTZA 3VGUA 3CUNA 3EICA 2AYEA 4AE5A 1IXKA 2PFFB 5CD4A 1IJEB 4LVNP 4EK2A 1VLYA 2ZOFA 4B3SJ 4FS2A 2PMZD 4D3GA 5AJ3F 1VC0A 3D5MA 3UQSA 3QSIA 4TU8A 2R2UA 3CCQS 2B7CB 5LMNJ 2UUBF 4EZ9A 2ZDOA 2O1PA 4LR9A 4ZJLA 3WDOA 5C25B 1CQNA 3Q23A 1ZM9A 5GADU 4JYAJ 3MEGB 1Y3KA 3K57A 5D6GA 1RISA 3C66A 5KT3A 2NR0A 2QL5B 3MDFA 4QW9A 3M8QB 3GWCA 3RBZA 3GV5B 3JSRA 2HG4A 4I69A 4FBTA 1VQSA 1S1TA 2IM0A 2ZJPQ 1H72C 2LYVA 1UEVA 4DN9A 1CS4B 2HBQB 2NXCA 2MGZB 1TMJA 2HPUA 4YY3J 2PGCA 4JI6J 2XSFA 5K8PA 3O2IA 2CNKB 2HNDA 3LP2B 4FYYB 4QIVA 2L9DA 2J0XA 3QO9A 2JEJA 1CJTB 1NM2A 1SCJB 1X60A 2CJBA 2H54B 2KXFA 3BBFA 4NZ7A 2X3DA 3LGHA 2XULA 3QIDA 2CWXA 4LF8J 5FJ4A 4OYXA 4ZPCA 4MYTA 4ECTA 2Z2MA 3BM7A 4PG8A 5HMZA 2HFNA 1X8DA 4OYIA 5BXIA 2C22A 1UETA 1DTQA 2ZZTA 4DLEA 3G4SS 1HI1A 2MQ8A 4OX9F 2JDJA 3QATA 4C11A 4DN0A 4DUZJ 1TVRA 5LSRA 1RT3B 4U7UD 2D3O1 3LGMA 2AEJA 1FRLA 3D6MB 4OHVA 2V34A 3QAEA 1O0PA 1ZA2B 4KYZA 1JLEA 3FZBA 4QPXA 4YHHF 4DUYF 4ECUA 4ED6A 5E0OA 5HK4A 2O66A 3OW2R 4G6VB 2HVDA 2YNFA 5GAEI 5KFOA 3RB6A 3GJQB 4H4MB 4JI0J 1Y11A 3UCUP 2ALYB 3R2DJ 2LXFA 1K0VA 2X1GA 3KUEA 4LBHA 2QRRA 4OHXA 3WX4A 1MROB 1VQOS 4DQPA 4WIIA 4B9SA 4HI2A 2DNLA 3SMZA 4B9UA 1F3VA 3DGPB 4U8VA 5IFMA 3V6JA 3DU5A 4MKVA 5CABA 4KQZA 1WG1A 2RQ4A 2UV8A 2Z2YB 3QLHB 3T9NA 1UVKA 2Z57B 1FVSA 3TUZC 3TAQA 3V6KA 1YGYA 2JFKA 3PCOB 4IO1A 1WUUA 3DLBA 2NXUA 3PX4A 1H7XA 4EMDA 5HBMA 4OJGA 4DR1F 4LMZA 5HL7Q 5CCMA 3EPGA 4I67A 3R7SB 2F8HA 2CQ4A 2LQ8A 4WFZA 3M9MB 4NLVA 2X51A 1KBRA 4DV6F 1X31C 1S97A 2J6UA 3CJSA 3KK2B 4Q0BB 3HK2A 1VQPS 4Y2IA 5DG7A 2AJ1A 1VDHA 1TFYA 3UPFA 1S9FA 2MLZA 3I0SB 3TNVA 1Y00A 2FVPA 1HIYA 3MM9A 3UR0A 1O5JA 2RNEA 3PX0A 4W90B 2VPYB 3DDKA 2V4JA 1HPZB 1YVFA 4PXBA 1VJQA 3SCJE 1VBYA 4W92B 2CPYA 3W5XA 3ILIA 2WZ1A 1T3OA 3KLFB 5KFWA 1SL1A 3HVTB 1U8SA 2GJIA 4JB8B 2FZCB 4RW7A 2CQ0A 1A6LA 5SUHA 3OUYA 2KFYA 4LVOP 2AF6A 3OHAA 2ZH3A 2A6OA 4OZJA 2GIRA 2RH3A 1WDTA 4CQ1A 3TVZA 4YFUA 3N9UC 2J0WA 2HHSA 2ZM6J 1YJ9S 3L3CA 1CJKB 3W5YA 4P74A 2VU5A 3QGGA 1C0TA 3MM7B 3F41A 3L4BC 1VISA 2CFXA 1YBUA 3MPVA 1RABB 2CQPA 5KFAA 4X4VA 1YKWA 2ADBA 4GO7X 1IKWB 1P9YA 2B9WA 4GMKA 5EWFA 4KBIA 3S7RA 3BYRA 3JB9k 3W9HA 1GX5A 1VQ4S 2B5JA 1FKPA 2CG8A 1T9XA 1LW0B 2WB1D 3HFZB 3OT9A 2EXUA 2HQDA 3R5BA 1WC6A 2ZBPA 1HYSA 1RHRB 2ASJA 2YXLA 4JI3F 1HD1A 5DZ7A 2YNHB 2HIYA 2MMYA 1DJ0A 1X5PA 2MKYA 1VS3A 2GJ2A 4ECYA 3KK3B 3P6YC 1V9OA 3S01A 3VAJA 1RT4B 1S5ZA 1RU2A 1R8AA 1LW0A 2EK6A 4B17A 2ZWOA 2JLGA 4PKDB 1WHXA 2YBVA 3P45B 4ZPWR 4DPYA 5EDWA 2OPRA 3VAKA 3PVXA 2EWHA 4I6YA 1XNQF 4LSNB 1RZMA 4MMOA 5HANA 4AFFA 4GVLA 3G8SA 3BH6B 4LF7J 1TFWA 1R27B 1S99A 3NGTA 1NB7A 1C0TB 3Q8UA 1WACA 4CNZA 4JI3J 4WTOB 1R31A 4DHVA 4MKAA 1FNMA 2A2DA 3ADAC 4WXOA 4MIBA 3VZIA 2GIFA 3PZPA 3MF5A 1AUSL 2KZZA 1TP7A 2F40A 5K14B 4RW7B 3Q22A 3R2CJ 3IGVA 1WTBA 3IGNA 4CT9A 4RW4A 4MIAA 4J9NA 3D0IE 5HVFA 1HQEA 2LEBA 3H90A 5LJ3Y 4AQYF 4CT8A 2OHDA 4LF6F 2ZBRA 3CTRA 3ISNC 3B8HA 1A7GE 3A8KA 3FNNA 3GCXP 1S0NA 1HNIB 2UUBJ 1M1GA 1AFIA 2DXFA 1C0UB 3BKUA 3ITHA 3MCMA 4UQTA 5HVGA 2GQCA 2J7UA 1FXLA 2YH1A 1HQ2A 1SV5B 3V81B 2W25A 4J9QA 1TUWA 3H0PA 1RTHB 2XYGB 2VHGA 5HBMB 1Q8IA 3VR1A 3RB0A 2YNGA 4EYIB 3OTBA 4WK3A 3QRPA 3JQMA 4DFKA 2YQ0A 4PXEA 2ASYA 2I38A 5J1EB 2GIQA 3QLHA 1PBUA 2F63A 4K0KF 2H4YB 4BWMA 5KFTA 1M5PC 4I7FA 4M5IA 4MYUA 1NKBA 1FDBA 2XY7A 1S6QB 1YBAA 1YJ7A 4F0HA 1U1LA 1NK8A 3OPKA 3DLEA 4PPDA 4ZVOB 4RW6B 3DM2A 3ZZRA 4DR5J 4RWWA 2B4PA 2Z0GA 3A3NB 3QSYB 4C48A 2ASDA 2QJ3A 2E5LF 4A8YA 5J2NA 2C28A 4D3HA 4H4KC 1ZM4A 1HFEL 2RD5C 2F4VF 2CRLA 3SBMA 1P1LA 5A0YA 3PJ9A 3MPDA 4HT7A 1U47A 5KT4A 1HBOA 4ECWA 3LO3A 4IR1A 1ZAXA 4KHPJ 1NK0A 1FJCA 1XJWB 4IH7A 3HKZD 4DEZA 1Y5IB 1V3SA 3DRPB 2RQCA 1H0HB 4X4NA 1RT1A 2YWWA 1S1WA 2PT0A 4ETXA 2V9WA 1PKUA 3KG1A 2YKMA 3OTEA 5J2MB 1NDLA 4LBIA 4TU9A 3H5YA 4IQMA 4DL5A 2CJXB 1NKEA 2FGOA 1NJXA 3RAMA
chains in the Genus database with same CATH topology
2ROEA 5KFDA 2VG5A 1SKSA 4LF9F 2NLWA 2CPJA 2K8GA 3OXLA 3HPOA 2MY8A 4BHQA 1PILA 5D77A 2JLEA 5IQ6A 4KGKA 4QYRA 3THPA 2RE1A 1TK5A 1OPIA 4R8UA 4TY8B 2DHGA 5EN1A 3G8TA 2HVIA 3KNGA 5CA5A 4N56A 2KRRA 2UUCF 1MMNA 2XHWA 3IWXA 3TO8A 4FVCA 2HMIB 2LKZA 4QJVA 4J5OA 3D54A 2E5IA 2KYXA 3R5CA 5H9EJ 5LJ5Y 2V4QA 1U49A 4B9LA 1QUPA 3M8QA 4JI2F 2D3UA 2JC0A 1U25A 1FDDA 5KFEA 4C8MA 2B3TB 4ZKAA 1TAUA 4RW8B 4WK1A 3M8RA 2ZZMA 2DITA 1FVQA 1DTTA 5BYRA 1ZYQA 1K9MT 5KFJA 3OHBA 2R8JA 5U47A 3RBDA 1JKHA 2A3JA 2FB0A 1JLBB 2HS3A 4DFPA 3RB4A 2CPFA 4LIWA 2XLKA 2FJAB 2QA1A 4DOZA 3J7YU 5A2QY 2Q43A 3UWTA 2YWGA 3ISZA 4NPOA 1O51A 1UVNA 3RW6A 1H6KX 5DG8A 3NGKA 3IO1A 3OXFA 1S4FA 2OD4A 4MIWA 2IRXA 1TUVA 1FK9A 4DG1B 1RJJA 3M6VA 4YMEA 1YITS 5KTQA 2E1CA 1URNA 2XI2A 2XMMA 1ZZFA 2IAJB 5L9NA 1S49A 2CQ2A 1YJRA 3T5HA 2NSBA 3SSSA 2Y1JA 2B6AB 2K1RB 1M5SA 3NG8A 5K14A 5KFFA 4WTYA 1SIZA 4I0WA 4KO0B 4PWDA 2MQLA 3IR6B 3O8WA 1QTMA 4BC9A 2W7AA 1M1KT 2WCXA 1PC4A 1GQEA 2OTLS 2D3OR 1YJTA 4PQUA 2QA2A 3FEXB 3X1LB 4I64A 2D74B 1Q79A 4NZ0A 1OSDA 1Q1KA 1ZBTA 4CTAB 1M5OC 2OPRB 4ZP9A 2RDJA 4FBUA 3FDSA 4IOCQ 2QE5A 4NCBA 2KM8C 3HFKA 5D78A 3KHHA 1S1VA 2OLWA 1RYRA 1GT8A 4URSA 1FJGF 2VBYA 1H2VZ 1NJIT 2BM1A 2GW8A 1OO0B 1N5SA 1HMVA 2CQ3A 3FCHA 5E2QA 4YR3A 1NRKA 5KG4A 4QWDA 3C6UB 4NLRA 3U1LA 4ED3A 4L72B 2FLNA 3HF5A 4EUVA 5K5MA 2IYIA 2ZH2A 3BR9A 5CYQB 3V6DB 4EWTA 4Y2MA 3G71S 2W8LA 1FE0A 4Q44A 5D8HB 1OQ6A 2XCPA 1VQ7S 4CO5A 4PUOB 3ZZOA 1LWCB 4FF4A 2JEIA 1P6TA 1RK8A 4J9KA 3F56A 2ZNYA 4QIFA 2YWFA 2LQJA 3DI6A 5LXYA 1KQFB 2I5JA 1N0UA 2VC0A 4QR0A 3CCUS 3MUMP 5B08A 1T8EA 5IQQA 3MZIA 4DR5F 4DS5A 1HWJA 2VQFF 4ZPTR 1YJUA 2E5JA 4LF4F 2KXNB 1FTRA 3VAFA 3DXBA 2CPZA 2JRSA 2X3GA 5JVGQ 3SQGA 4KFBA 2VBZA 4C8ZA 4A8WA 2HNZB 1S6OA 2LU2A 4YUDA 2Q1LA 3CDWA 3LOUA 5IS2A 3S6EA 1NAQA 3WBZA 2CQHA 1T02A 1WD6A 3CF5Q 3IAS9 2AJFE 3THVA 3DRSB 1UA1A 1F9FA 1L3KA 2HNZA 5LXRA 5DQIA 2DNPA 2C3OA 1B7FA 3IN5A 3GG1A 3Q8SB 1RKJA 2B9XA 4H54A 4NRUA 3SCLE 2YH0A 1X4GA 1JNRB 3FSXA 3M1VA 4MJKA 2P6SA 1KTVA 3VALA 5DLFA 3MD3A 2VPWB 5LL6d 1QE1B 4DL4A 2L3MA 4EFAC 4B3TF 2DPIA 2M88A 2R9LA 2BRKA 2YKQA 1EETA 1N36F 3VQSA 5FD1A 1U1OA 2EI5A 2XS7A 4ZOSA 4BWJA 2NQPA 1TVRB 2HW3A 4C11B 2BE2B 3CMAS 1QSLA 2ZE2B 1IJFB 3IBWA 3NRBA 4ETZA 4Y2KA 1KLMB 2HQIA 4MK8A 4Q43A 5CQGA 4Q45A 1JLGA 1OQ3A 1U1KA 4C8LA 3X3UA 3N5FA 3MAQA 1HWUA 5HROB 2ACYA 5E3CA 4WKRA 5T7LB 1FNXH 3GFHA 3NCQA 5T41A 1N5YA 1UJ6A 2MGZA 1GXTA 2J7WA 1S1TB 5BYQA 5KG2A 1E6YB 4CH0S 1V3ZA 4KTQA 2M3DA 3UCZP 5L1KA 1U26A 4ECSA 3OFEA 3N4WA 3NBPA 4A8QA 1N34F 2FUG9 1X4HA 1C1CB 2HS4A 1LQ9A 3EPIA 1VQKS 2JVRA 3MGJA 2MQPA 3KLGB 2YKAA 5DRKA 1S10A 4PUOA 4IR9A 4JYAF 4JV1A 1IBMF 4QWCA 4RNHA 4KGMA 1HI0P 4NLPA 2AP6A 5A6WA 1OSCA 1X5TA 3I5CA 2DGTA 2DNZA 3RU0A 3NGDA 3CCVS 1TKDA 3MPWA 4DSIA 1MU2B 4WZMA 4Y6IA 1GX6A 4KIAA 2IAJA 1CLFA 4DSFA 3OFGA 1Z2LA 3VWSA 3NAHA 1GAOA 2XMWA 3QWPA 4URQU 2W9BA 2MQQA 4ECQA 2VB6A 3J80Y 2B0GA 2QLWA 3OLAA 3RZAA 4A48A 2RF2A 3LAKA 1NJZA 1P9QC 3B4MA 1VHFA 2BYCA 2YX7A 4WE1B 2NR0A 3BDEA 1N4LA 4NLTA 1TL1A 2IRUA 4I6WA 2GNKA 2XG8A 1X5OA 3VZHA 1UVMA 5E5NA 5AXMA 3NMAA 3QJJA 1MW7A 1IN0A 3DLKA 3CPWR 4XO0A 4K4ZA 3W2VB 5DGBA 1HARA 2B51A 2W8KA 1IKXB 2GGPB 3UNGC 5I3UA 2E1AA 2W7OA 1X9WA 3BR8A 3CIZA 3SZ2A 3M05A 2PC6A 3PXGa 2KT5A 1WF0A 2MJUA 2LEPA 3CGIA 5CXTA 1T95A 2HAIA 2ZM6F 1JJ2R 4NX9A 1RTDA 3IAM9 5J1PA 1J5OB 4E8UA 4B9VA 4OX7A 2ZJQQ 3M30B 1NK5A 4ELVA 4C0HA 2XNQA 4BBYA 3DOMA 5B09A 2R8KA 3PJWA 1RTIA 2MQNA 4TY8A 3DLHA 1YJVA 2O3DA 4OX6A 1RDRA 5E3PA 5HO4A 5KFNA 2IVFB 3KMQA 3R5DA 2QIFA 4DQIA 3NLCA 3QGPA 2EFNA 1S79A 3DLJA 3C3LA 1KSPA 1N54B 4KRWA 2WSCC 2YKMB 5J2MA 2VFVA 1FA0A 3MMCB 5F8HA 1X9MA 1R43A 3IRXB 3LH2S 1N33F 2NSCA 2HLTA 3GE9A 3MM5B 2DHSA 2OH2A 2ZOGA 4NYOA 4ERDA 3THTA 5K8OA 4LFAF 3PO5A 1XERA 2DVIA 3SDEB 2E7WA 2PMHA 3CMES 3DHWC 3JSYA 1G7CB 1RGVA 1B64A 2JLFA 4RW6A 4F2RA 2OKQA 3N01A 1U2FA 4F4WA 1NHVA 1RT5A 5DQGA 4I7FB 3MHYA 2VH7A 3FMBA 4O3QA 1X4BA 4R8UB 2CQIA 2DNGA 2WOMB 4URGA 1NJWA 1FRIA 2V8HA 2MQMA 2J9DA 3K8VA 2FDNA 2OFGX 3DLLQ 2CQGA 2BJDA 2PD1A 4K59A 2XI3A 4HEA9 2FVQA 2DPJA 2J0SD 1S1WB 2LA6A 3F73A 4K4SA 1LW2B 3DRPA 4B3OB 1A9NB 2ZH9A 4QR1A 2UXCF 1URRA 3ZC4A 5IXUA 1HBOB 4J9PA 3PFOA 2FC9A 4C97A 3UW1A 2EPIA 1KNZA 4WFAQ 2UVUA 3QIPB 4PG6A 5LMUF 4WJBA 2BQUA 5I3QA 1GXUA 2DK2A 4ED7A 3DLEB 2ZH7A 3W2VA 3B78A 1S6QA 1XR6A 3TAMA 4JI1F 5CZVA 4ZVHA 1J2VA 4YDXA 3BGRA 3UD4P 1YHQS 5T14A 2J6SA 5IZHA 4ZVEA 4IH5A 1TKTB 1GNKA 4YY3F 2FD2A 1WNEA 4OHYA 5KT7A 4RBUA 1RT6B 3LALA 1PGZA 5AXKA 3Q8PB 3JSMB 4ZP6A 5L8RC 1SV5A 3V81A 2MKIA 2J5AA 2ZHAA 1P1TA 5CHCB 5KFRA 4ES3A 2Y1IA 1ZTWA 3J81Y 4IOAQ 1KLNA 3K5OA 4IYQA 1W2IA 2CQCA 1WEZA 4RU2A 3KTQA 1HQEB 2YNIA 1I1GA 2F3JA 1X9SA 2OTJS 3GIJA 1KTQA 4B08A 5G0RA 2IC3A 3KFWX 4CO3A 3KLGA 2HIQA 2W24A 3PR5B 2JL9A 2VFTA 3G86A 3FRZA 5M2RA 1FJEB 3I82A 1C1CA 1DQAA 1PC5A 4FNIA 4A8KA 2CJQA 1KFSA 3Q24A 1JLAB 3CJKA 1Z4UA 5IM0A 2DO0A 3TUJC 4O3PA 3H2UB 3M8SA 1UVLA 3HVTA 5KFYA 2J9DE 2EFQA 2CZVC 4ZPAA 3DLGA 3OL9A 3AA9A 2B56A 1RT4A 4C8KA 1UW4A 1N5YB 1UVIA 3MM9B 2KM8B 2XC9A 2JX2A 2DNNA 2ZDPA 4O23A 1U1MA 1TZ0A 2RDIA 3LANA 1U45A 2GC8A 3I32A 2ZBCA 3HDSA 4QWBA 2RMLA 2WAQD 3B4DA 2KG1A 1SQEA 2PA3A 1RA6A 2OPQB 1IKWA 3ONQA 1JB0C 3NNAA 2BZ2A 3I6PA 3G6VA 3N0VA 3EYZA 3GIKA 2ZE2A 2N82B 4FF3A 3CJ2A 2MDAA 2MKKA 1TKTA 3QWUA 4DR6F 1KHVA 1KQGB 3KK1A 2MZQA 2ZUGA 4OZ5A 2D3ZA 2WSEC 2R2SA 1IM4A 5EGYA 3OUYB 3V5RA 2NUHA 2DNKA 3SCKE 4GC7A 3KOAA 1EETB 1G1XA 5K8NA 3ENQA 1RKIA 1N5VA 3QIPA 3HHDA 5KOWA 2XMTA 2QSFA 1DURA 5A8KA 2GFFA 4O4RA 2DH9A 4MK9A 2R8HA 4LF7F 5KFPA 4YR2A 2RUGA 2CJKA 2RVJA 5DQHA 3KLHB 3BO2A 2GCFA 2UUAF 1UWBA 1S0OA 2W4CA 3H8YA 5IT0A 5AXNA 2DR9A 4B02A 1IQZA 5HP1B 2CJ9A 1N5QA 1Q81T 4TY9A 1TAQA 3V4IA 2IHR1 4L3NA 3CD0A 1ZETA 3CD7A 1XBWA 1FDNA 2NREA 2C3PA 4H4KA 3DNCA 2BUNA 3ZZZA 2KHCA 3DXSX 3PEHA 4O0IA 3HM9A 2V4RA 1RT5B 3TAPA 4RUAA 1HWLA 1U6BA 2KRBA 2DGXA 2VC1A 4OZLA 2FHKA 5L1JA 1TQLA 2XLJA 3LP2A 4RBTA 3SSQA 4X65F 2L41A 2XMKA 2YNFB 2VOPA 1YTYA 3H59A 5CD4H 1SKWA 3FQKA 5B7WA 3SXLA 4CCHA 5I42B 3MM5A 1AXQA 2GO9A 4YB5A 4KV8A 5MLCV 4HT5A 5F41A 2R7XA 2GHWA 1YWXA 2KN4A 1LK7A 4ILRA 1QAXA 2EFOA 1JLCA 4X4TA 3QMQA 3KJVA 1HR0F 4IFYB 4F50A 3DOKA 3RBEA 2FLLA 4DV4F 3AB4B 4F4XA 2NUUG 2LDIA 2G9OA 2HHWA 5EX3A 3F44A 1N5TA 5DETA 1BD6A 1U2RA 5CYQA 4ZVGA 4AXJA 2OSQA 7FD1A 5HMXA 3V6DA 1N6QA 3JAMY 4Z2XA 1UJ4A 3BREA 4N8OA 3SYZA 1HMVB 2ALZA 1MMDA 2OPPA 1HNVB 1IKYA 1ZOTA 1HBMB 3LWLA 1IUJA 5KFKA 5KT6A 4CO4A 3MPYA 3OFHA 4WYLA 1R7IA 4NMLA 4ILMA 2O5DA 4FPRA 2DT9A 3IG1A 1FXDA 2BANB 3N28A 3CCLS 3IC1A 2WTFA 2ROPA 4TXSA 1JWWA 3MEGA 1GTHA 2VA3A 1U7LA 4WFYA 4PQUB 4K5SA 2HLUA 3TR5A 3PX6A 1Z1ZA 5DG9A 2VOOA 1BWEA 1TV6B 1YG0A 3NNCA 4J9SA 2MXYA 3OVSA 2MPUA 2ZH8A 3WC2A 1W25A 2N4DA 2G0CA 4NLSA 4QIEA 3G6YA 3TARA 5GAHI 2K7JA 2GA7A 1T3NA 2BANA 2XMJA 3GFXA 2B6AA 1S6PA 2U2FA 3J7Z5 4QWEA 5AE3A 2AQ4A 3BJYA 2HNYB 1SIWB 2ROGA 3O6QA 1BQMB 4TQSA 2HRYA 2XMUA 1U48A 2I9SA 1SJ4P 4U7CA 1J5EF 3PKMA 5JUMA 1R8CA 1RTJA 3LQVA 2A1BA 5GADI 1Y7PA 2HRUA 5C24A 1YI2S 4DSLA 1F60B 4KSEB 1VI7A 2C2RA 3K7RA 4C8OA 1TL3A 2VONA 3MMAB 2CPHA 4KC5A 5CYMB 3MOZA 4K4U