1Y3KA

Solution structure of the apo form of the fifth domain of menkes protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
b'NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3kA00
2XMUA 4HI1A 4OIXA 3QGPA 2HIQA 2K1RA 1K0VA 1JWWA 2IFXA 1Y3KA 1OSDA 4OJHA 3HDSA 3BM7A 1TR0A 2RMLA 1FEEA 4Y2MA 1AFIA 2ROPA 2ZDPA 1VQYA 2OFHX 4U9RA 1YJVA 5B0BA 2IYIA 2N7YA 2Q3PA 3I9ZA 2BBEA 3LGMA 2FTRA 2KT3A 1N5QA 1N5TA 2XMKA 1ULRA 4YDXA 2GV1A 3F44A 4A4JA 3HHLC 1IUJA 1AFJA 2GGPB 2AJ1A 1X0PA 3HHLB 4NL5A 4DN9A 1Q53A 1U7LA 1RJJA 1Y3JA 2AW0A 2RU9A 2XMWA 3FGVA 3KG0A 4EFAC 1URRA 1YJRA 3HFKA 2VH7A 4A48A 2OAUA 1WD6A 2FHMA 2OKQA 3QMQA 4FNHA 2FB0A 5F0UA 1OPZA 3KKFA 2XMMA 2BYCA 3CJKA 4HL9A 5T7LB 2GCFA 2JDJA 3BGUA 2BUNA 4OJGA 2K7KA 2QLWA 1R6YA 2N4CA 2LXFA 3MZIA 2AJ0A 2W4CA 4ZA1A 5B0CA 5B0FA 1KVJA 2ROEA 4OJ1A 4YEAA 1MWYA 2GO8A 1FE4A 2KT2A 2QIFA 4HH1A 1KQKA 2HFOA 1S6OA 4FNIA 1S6UA 2AP6A 5B0AA 4A46A 1QUPA 1P6TA 1YJTA 2HLTA 1OQ6A 2W4PA 2LQBA 5A6WA 1KVIA 1P8GA 2KKHA 2GFFA 3BN7A 5A6PA 4A47A 2K7JA 2OMOA 4Y2IA 5K9FA 1TL5A 2ASYA 1XBWA 3BDEA 5F0WA 3FRYA 5B08A 3KG1A 4QOTA 2K2PA 4NPOA 1Q4RA 1FVQA 2N4DA 3VTIA 1YRXA 3HX9A 1N5SA 2QYCA 1FD8A 3IWLA 2EW9A 2BJDA 4DL0C 4OJ3A 1OQ3A 5KAKA 2L3MA 3IWXA 2XMJA 1TL4A 2XMTA 3T9NA 4F67A 1LQ9A 2PGCA 5B0DA 2OD4A 3TNVA 2ACYA 1X7VA 1Y0HA 3DXSX 1GXUA 5B0EA 1Y9OA 2FIUA 1SQEA 1CC7A 2HFNA 2GA7A 1FE0A 2GGPA 2HQIA 2OP5A 3HHLA 2KYZA 3TOQA 3UDCA 2PD1A 3DCAA 3GZ7A 2CRLA 2RILA 2IYGA 3E8OA 4DPOA 1JK9B 1FESA 3BR8A 3KNGA 4HI2A 1TUVA 1W2IA 1GXTA 2W4DA 2VV5A 5IXUA 3BF4A 3K7RA 3TRGA 3HF5A 5T7LA 1Q8BA 1TZ0A 1AW0A 1CPZA 3MCSA 3WDOA 1VQSA 4Y2KA 5B0GA 2K1RB 1CC8A 2ROGA 1N5VA 1YJUA 1V3ZA 2QLXA 2HLUA 3FMBA 4ZOSA 2ZDOA 1YG0A 1FVSA 2G9OA 4Q2MA 1MWZA 3LGNA 3CJKB 1SI9A 2OFGX 3HHLD 4Q2LA 1Q8LA 1SB6A 1APSA 3BB5A 5B09A 2BJEA 2OD6A 2RSQA 3LO3A 1X8DA 2XMVA 4HH0A 2LQ9A 2LDIA
chains in the Genus database with same CATH superfamily
1S1XA 4WFXA 1A9NB 5CA5A 3IN5A 2LMIA 5BYQA 2V2ZA 2AGQA 3VQTA 2HQCA 1QTNB 2YNHB 5KFDA 2C2DA 2MTLA 4KC5A 3T1HJ 1TVRB 3LAKA 4TLRA 2MQMA 3KHGA 1R3NA 3CJKA 4KO0A 3UD4P 4NCBA 1RT6A 3A13A 2YNGB 1ZOTA 1MWYA 1ACMB 2KFZA 2DNHA 3N01A 4LSNB 3R5JB 4KE5A 3QT8A 1XBWA 1FFGB 4DR5J 2EK1A 3I4PA 2EW9A 2GJ2A 2ZEJA 1RZMA 3E3XA 1Q1KA 5HQ8A 4TVAB 2NPFA 2R2UA 4ANCA 4FXVA 2MY7A 5KOXA 3CJRA 4P72A 2GQ2A 5KFZA 5A8KA 4N77A 3PYGA 5HANA 1NZ8A 4IH7A 4UT4A 3CCVS 5CCLA 1ZM4A 1VLOA 1XK8A 1VFJA 4NCGB 2OUGA 1T9XA 2F4VJ 1T03A 4DN0A 4ID8A 1S0VA 2EKNA 2NPIA 4EGLA 4I2PB 1UVNA 5BYSA 3OXGA 2XWYA 2C3MA 1ZAWA 1J5OB 1UTAA 4DG1A 1IUJA 2QRRA 4USHA 2I9SA 2Q6BA 3PRBA 3I9V9 3DDIA 1MG7A 1R8BA 2J76E 1VBKA 3N5BA 1KVJA 4M5DA 3HZGA 4ECRA 3P4UB 3DXBA 4O3NA 3EXCX 5GADU 3BDEA 3DFEA 3MD1A 1I6JA 1OWXA 2PSZA 4FVCA 3M7VA 5KFVA 2V8DA 2HS0A 4K4XA 1S6QB 1DTQB 3BGRB 2ZHAA 2DGUA 1UVJA 5EGYA 4F02A 4RW9B 4Q2LA 1ZM9A 5JXSA 3SZ2A 4NLOA 1S79A 3KK1B 1VHIA 2PN6A 3CD5A 2AJFE 5L38A 1YHQS 2ABYA 2XGPA 2XLIA 3CDEA 4CH7A 2R8GA 2JRSA 3I32A 1RHJB 2NXNA 2J0QD 1Y5NB 2DBBA 1HKAA 2VFSA 2VH7A 3GG0A 3MM7A 2HPUA 5F8HA 4O3OA 2DNPA 3CCJS 3Q8RB 2VPWB 2BW2A 1XEZA 1MN7A 1F0XA 2FVQA 4OI3A 4F4XA 1NDKA 3OR2A 2BABA 3BDPA 5KG6A 2ATCB 3CCZA 4B9LA 3KLIB 5IOLA 1FKOB 2B9YA 3AJDA 1JJHA 4JI3F 5JUMA 2OD4A 2Y1JA 3P3DA 3HSZA 3UVJB 4FS2A 5GAEI 2GIQA 1PJ6A 2NXEA 3MR7A 2ZH6A 2Q43A 3HSJA 2QG9B 4CLTA 2NZCA 3H2VE 5ETKA 2HWIA 5KFJA 2ZH3A 3N4WA 4Q45A 1RTJB 4NLXA 3V81B 4GVBB 4B3TJ 4M95A 1NK5A 4RPFA 2F7VA 2XYPB 2RUSA 3CVKA 3OR1B 3VHQA 5KFPA 3GV8B 2HAFA 1X4HA 3N6MA 5AJ3F 3W7BA 1RWKB 3CJ4A 4ES1A 2QSWA 1KVIA 3V6JA 2RKIB 1JLFB 2HMIB 1R0AA 2DHXA 4B02A 3KLEB 2A0FB 5MLCV 5C42B 4IYQA 5T41A 4FXDA 4P52A 1UVIA 4NOHA 3AD9C 4DX5A 2RQKA 1C1BB 6AT1B 3LP1A 5J1EA 3D28A 3PO5A 1KHVA 4C0OC 3G4SS 1VRUB 4IDKB 5HAOA 5L1IA 2DH8A 3M9OB 2F5GA 2DHAA 4DPXA 2GJFA 1XNQJ 3BS9A 2O67A 2CQ2A 4X62J 3T1HF 1NHUA 2GC8A 1VQ5S 3T1YJ 3P49B 1VIXA 3RUBL 5THWA 1NPPA 1L3SA 1RABB 1T3OA 1FFWB 4UZCA 2YWFA 1QDUB 3DLKA 2Y0BB 1FRHA 2E5JA 4CLLA 3BSNA 5KFRA 4U96A 4YHHJ 1VQMS 1DTTB 2CG8A 2CPJA 4OYPA 3M2UB 1OY8A 3HX9A 1LW2A 2IJNA 1VQ7S 1Q5VA 1O5JA 1YGYA 2A2DA 3H4BA 2AV5A 3W2VA 1WORA 3C6UA 1ZZNA 2BM0A 4CYUA 2YQ1A 3KLFA 5BR8F 1FXDA 1N36J 2G1DA 1V5VA 4JV0A 2AD9A 3HHLD 2I1RA 3DOLA 2LDIA 1OO0B 1RT5B 1BQNB 1TKTA 1WC1A 3R3TA 5HMYA 3H8YA 1YJVA 2UXDJ 2J5AA 2HGMA 2AYEA 4KSEB 2B4VA 4B17A 1UEUA 1YBUA 3R6GB 2OHDA 3HSGA 3IR6B 4OLOA 1UCNA 2MKHA 1SKWA 4WIQA 5DM6Q 1PJ7A 4OJ1A 3HVWA 2FLPA 2ZM6J 1U2CA 2FJWA 3TZWA 3KUEA 3EUNA 2OPQB 4Y2IA 1R27B 4GVLA 3CMAS 5HQMA 4YFUA 5J2NB 5HLFA 1E6VA 1KR4A 5B0EA 4NE9C 3EXYA 2XHWA 4QYRA 2OP5A 2CVIA 3NGSA 4ZHRB 2RHSB 1JKHA 1WEYA 2DXDA 2VV5A 1WJ9A 2I8EA 1HBOB 1VQSA 1S76D 4LF6J 2ZDOA 2Y3YA 2WONB 2YY3A 1Q7YT 3DRYA 2HWHA 1E6YA 1HNWF 3C6TA 4KV8B 2P9CA 3SV3A 4C9DA 3ZTOA 3K17A 3GQCA 1YVFA 4ZVSB 1GTHA 2QEXS 3UD3P 2VG5A 4W90B 3CSKA 3IBWA 4L74A 2HK2A 3IWNC 3DU6A 3TVKA 1UZHA 4MKBA 2EI5A 2O5DA 4DV2J 5SUHA 3X3UA 5D77A 1WC5A 3R7SB 3HKWA 2GNKA 1QSYA 2HQ3A 3TJ8A 2UUBJ 4MK8A 3UI3A 1FD2A 1GXLA 2XYHB 1QY7A 4JOUA 4H4OA 2GFFA 3PV8A 4K0KF 2QGFB 4L75A 3Q8YA 5F0WA 3FRYA 4LFBF 2ZC3A 4ED6A 2N4DA 1N5SA 1CJUB 2CAJA 3MMBB 2WVCA 5EUHA 3D54A 3UDCA 1RYSA 3R5GA 2BRKA 5J2PB 5IV3A 3AOCA 4TLQA 5C5JA 2JX2A 5F8LA 3RG6A 3CCMS 4N8OA 1OJ4A 4F4AA 3MM8B 4DUZJ 1U2RA 4OX8A 3SSRA 3HKZD 1U1KA 2VBZA 2JHEA 3E01A 4Q43A 4DS4A 4B3TF 1NK7A 4DUYJ 4DI6A 1YITS 3ENQA 5C7PA 3LF0A 2VQEF 3HHLC 4QPTA 2XZWA 2HBRB 3Q2SC 4Q8EA 5DS7A 1NSQA 3DRXA 4YQWA 2FHKA 4B9UA 3NS5A 2COLA 2RVJA 4AUKA 1FWPA 4HHHA 4ZDNA 2IA0A 1SC1B 1RHKB 2H9ZA 4H4MB 4K2JA 4PUOB 5GAGI 2LEPA 3MM5B 3UWTA 3R2DJ 4KKOA 3UQSA 1GXUA 1Y9OA 1TVRA 4ECYA 2D3ZA 2AZ3A 2R3VA 4DQQA 3S6EA 4KAIA 3HHEA 1PYTA 4DU8A 2YNGA 4LREA 3HPOA 1RWPB 5KFWA 3GTYX 4LSNA 3I55S 4YY3F 4MT1A 4C48A 1VR6A 2J6UA 1XNQF 1NLKL 3K8VA 3HDSA 3TUPA 3O2IA 3EVWA 4TYAA 2DNQA 2PMHA 3QAEA 1U1OA 2QA4S 1HQUB 3SBMA 1YJ9S 3UW1A 3M32B 4CNZA 5FDLA 3FRZA 1N5YB 4CLKA 2MJNA 4AL7A 3RGIA 2KI2A 1DURA 4NCGA 4IRCA 4YHHF 1GAOA 4LF5J 3OHBA 2XZDB 2KTQA 4JI0J 1RT3A 2YPZA 2K7JA 3EE3A 4I2PA 4DV1J 4HT7A 1D9FA 2RDJA 5FD1A 2MGZB 3ZZZA 3CJ3A 1T9WA 1J5OA 2B6AB 4JYAF 2WSFC 3HT0A 4BLGA 3CGIA 3RZAA 3DRPA 4USVA 1PKUA 5KT5A 4B9SA 2DRDA 1UPPA 4DZDA 4WJBA 3W5YA 2XMVA 5HBMB 4HI1A 5ETLA 3MURP 3VR1A 4DR7F 1YBAA 4EO6A 3A8KA 2M70A 2N82B 2UXDF 2CDQA 4PPDA 3J7YI 3O8WA 1VYAA 1S0OA 4KFBB 1GEHA 1WDTA 4C6AA 3VAJA 1KTQA 1S6QA 1DTQA 5E3RA 1S1UA 3BGRA 4R25A 2MQNA 4RW4B 1NJYA 4ES3A 1R6YA 2DY1A 4ZVFA 2KT2A 4CLWA 3KK1A 1VJWA 3OXFA 1JLQB 3TYTA 1TL5A 5KFGA 3LOUA 2V4QA 2ZZTA 4FVMA 3R8YA 3L7OA 2DNGA 4LF7F 2HHPA 3VWSA 2PEBA 2B3TB 4B3SF 3TUZC 4NA3A 3C8YA 1RTIB 4ZJLA 1Q95G 4DPOA 3A8JA 4KGKA 3EX7B 4LF6F 2XY7A 3S7RA 1W2BR 1REVB 4J9SA 3Q23A 2JEGA 1T8EA 1S1WB 2C2NA 2MLYA 1VC0A 4W98A 2P6TA 2Y1RI 4ZPBA 2JWNA 3KLIA 3RR8A 1RBLA 1FKOA 1GMWD 3G86A 3CC2S 3HJVA 5KOWA 3FC9A 3UVJA 5KFEA 2F8HA 4PPZA 3HHKA 2R2RA 1I94F 2AWZA 4IFVB 3PG9A 1OYEA 4EI2A 2AQ4A 3GIKA 3NAIA 2DNYA 1BY9A 4OX6A 4TU8A 5HJXA 3KWMA 2YX4A 2JFKA 3HVRA 2CZ4A 2G13A 4O4RA 3HULA 3AJ1A 3TAMB 1S72S 1WF2A 1G4CA 3AY0A 2HBYB 2W4PA 4AXIA 1RTJA 2WSEC 3U1MA 2CQGA 3V81A 2OMOA 4GVBA 4ECWA 1WSRA 2E66A 3RW7A 4DL0C 3J7AN 3TUIC 2V2KA 5LMNJ 1UWAA 2LXIA 1NU4A 3OR1A 4ZPTR 1P1LA 3BKFA 3J81Y 2C2KB 3O44A 4P9SA 2DRBA 5A8RA 3MUTP 2RSQA 2RKIA 3NOCA 1FDDA 1JLFA 4WKRA 3M9NB 1FXRA 3OFFA 3MF5A 1S4EA 2HMIA 2H65B 3NNHA 4YUDA 3KLEA 3KDOA 2FD2A 5C42A 2EXUA 2GV1A 2Z30B 2MZTA 3OUYB 4M5GA 4PG8A 2CPHA 9ATCB 4L3NA 3G6VA 1C1BA 2LA4A 2JDJA 4EU0A 1VRUA 5D0GA 4IDKA 3D0GE 3PFEA 2XHCA 2VPXB 4ENOA 4KPYA 1VISA 3C15B 1GMVA 4KBIA 2DIUA 2HG4A 2RD5C 2B43A 4P73A 1HD0A 2QMWA 1K47A 4C98A 1F1BB 1AZSB 1VBZA 1B0TA 2V2VA 1GFWB 2W2MP 3JTPA 2IMWP 3CDBA 4A8SA 3CWJA 3GV5B 3PIOQ 1BD6A 5J2MB 5HATA 4RNMA 2HGNA 1B99A 1TU0B 2GQQA 3DOKB 4OZ1A 4O3SA 1AT1B 1DTTA 3OSPA 4ZP7A 5HP1B 4NZ7A 2GAHC 4DJBA 3NGTA 1NPKA 1YBTA 2W2QP 3CJ2A 1TL3B 4ZMMA 1KLNA 1NH7A 4LBPA 3GJRB 2H4YB 1B7FA 5DG8A 1SUQB 4UOGA 4NL5A 3CCRS 5LXRA 2FYXA 3I0SA 3QMQA 2FHOB 4LF5F 5D15A 4TQSA 4JI0F 3SCLE 2OIHA 1CJVB 1SV5B 3M8ZA 1RT5A 3WC0A 4F8RA 1ZBTA 1BQNA 4DV1F 2SXLA 5LJ5Y 2AF6A 2R7VA 4ZLNA 4OX9J 1UMJA 2J7WA 1IWAA 2KXNB 1H2TZ 2KH9A 5ETTA 5I3QA 5LJ3Y 2FY1A 2PD1A 4PG7A 3MPWA 3UCZP 3V6DB 4DCPB 1NNDA 2VJUA 1JJ2R 3CMES 1LWEB 2DGWA 4DOZA 1SQFA 4IOAQ 5KFIA 3POTB 4M94A 3VGTA 3M8WA 1RAOA 1GH8A 2OPQA 2XYGB 3CDAA 2Q79A 5B7WA 2M2BA 1SQGA 1VOMA 4HYKA 3LW5C 2DITA 2UXCJ 1X4DA 4X64J 4ZHRA 4CLUA 5LT5A 2B4PA 3JTOA 3C66A 5RUBA 1URNA 4ZCIA 4JI5J 2L48A 5AE2A 3MHYA 2POKA 2AJ2A 2WONA 3QQCD 1YSJA 1N32J 2BEFA 4JI4J 2AP6A 5KFAA 1XN9A 2XS2A 1OQ6A 4J37A 4O44B 1KEKA 3MEEB 4FS1A 3CW2C 1FVQA 2W9AA 2DGVA 3ZTRA 1UA1A 2VA2A 2U2FA 5M2PA 2DPJA 4K50A 1QLNA 3G87A 1QUVA 1IKVB 1F5AA 3DLEA 1FEHA 2GW8A 2DRAA 3I0RB 4CLPA 2A2CA 1CJKB 3MM9A 3Q8SB 3CMQA 1JXVA 1N33F 2M0GB 3MAHA 3TARA 4ZVPB 5J2QB 1JXLA 4Y6IA 3ET6B 1CJUA 2ZH7A 4ETXA 2A6MA 1JIHA 2PO4A 3MMBA 4ID5B 5CYJA 7FD1A 2WAQD 5J2PA 4IRDA 1IKXB 1Q53A 2RB7A 4WKYA 1CVJA 3OVBA 2DNLA 2XMMA 1RSCA 2HZVA 4WXOA 3MM8A 2BUNA 2AJ0A 4NLWA 1RE1B 2PFDA 4MJKA 2ZNZA 3KNAA 3B8HA 1EETB 2B8PA 1IWGA 2VZ9A 2WW8A 5HVGA 3NGRA 5GADI 2GJIA 1RCOB 2AEFA 4I67A 2RILA 2W2NP 1HPZB 1N56A 2V0NA 2OTLS 2O66A 3L7UA 4ED3A 3JTNA 2JVOA 1F3VA 4P74A 4IG0B 4DQSA 1G1XA 2FVCA 3QGIA 4MFBB 4H4MA 4P71A 1DRZA 3SQGB 4BWJA 5DGBA 1UKUA 2DHSA 3ZZTA 1K9MT 2PC6A 1IM6A 2LU2A 4GKKJ 4J9KA 1LWXA 2E9RX 1NJXA 1FNMA 3O1LA 3LP0B 3H98A 2CQ1A 2HEKA 3JQMA 4OHVA 3IS9B 3M8QB 3T9ZA 1MLAA 4FYXB 3CD7A 2DB1A 2UUTA 3L4BC 3GYNA 2DY9A 2BJ3A 1JX4A 3I4HX 4PYDA 1ZA2B 1EQMA 1Y11A 2IM0A 2CXEA 3A1YG 2MSTA 4DL6A 2A18A 4MKYA 2XMTA 1FNXH 1HQUA 3NKYA 2D9OA 1Q79A 1T7PA 2Z4PA 5LM7E 3M32A 2R7RA 4LF1A 3W8PA 4KPCA 2MKSA 2QA2A 2CNOB 2WRMA 2OI2A 4WK1A 4OV6A 2J9EA 1TUGB 1U25A 3V6HA 3JS9A 2YWEA 1HNXJ 1U1QA 3QJJA 2MGZA 1AFIA 4JI6F 3PHEA 2B6AA 3QYYA 3QIDA 4NRTA 2WCXA 3NG8A 4OYZA 4YDXA 2HNZB 2WBMA 3QZ7A 2HVHA 4M5KA 1VJQA 3K5MA 3TA1A 1PIEA 2CPFA 1LWCB 4HACA 2J7KA 4HL9A 1S9FA 4WIIA 3T1AA 1EKRA 1NK9A 5HBMA 3QIPA 1FRKA 3C19A 4PKDB 4NXNJ 1EKSA 3PZPA 3EJMA 2BX6A 3ZZRA 5B08A 2HHQA 2F3JA 1RA6A 1NSPA 2DGSA 4EYHB 4KYZA 1XNRJ 2FVSA 2YKNB 3SSSA 4OYBA 3PR5B 2RDIA 1SC6A 3CCTA 3AQPA 4H54A 4E98A 4RW4A 3NRBA 5IXUA 2FC8A 4IH6A 2RRBA 2CWXA 3FMBA 3GG1A 1EJ7L 1U0HB 3I6PA 4QU6A 3GV7B 3ZTSA 1JLQA 3VVUA 1TL7B 2CQIA 1F9HA 1VQLS 2M4MA 2E7WA 2CQ4A 4FYVB 1HWUA 4X64F 4ZP9A 3PIPQ 5D4PA 1BC6A 4QZVB 1RWMB 3OT9A 1V3SA 3TX8A 3D1HA 2QA1A 1UEKA 4KTQA 4A8YA 2IA6A 5ETQA 2MKKA 4QIFA 3NOGA 1REVA 1S97A 2JNJA 1L3UA 4ETZA 1S49A 1UA0A 1V5IB 1S1WA 3QATA 2OTJS 4DR3J 5DETA 3G71S 3KK2B 3RR7A 3C46A 3W9IA 5DM7Q 1D8ZA 4XDCA 4NPOA 2NXJA 3FEYB 4C7QA 3IWLA 3VGUA 2OO4A 2MY8A 4ED0A 3SQOP 2V8VA 4IFVA 4DDFA 4TXSA 1HNZJ 2FZCB 2RS8A 3H7HB 2U1AA 5F3TA 2YKMA 2LU1A 3KHRA 4DSLA 3CO0P 1VK8A 4MYUA 1S9GB 2ZOMA 3RBXA 3ISND 1TELA 2WB4A 3I5CA 2DHGA 4FYYB 4LRAA 3W61A 4WE1B 2WB1D 2RNEA 2GGPB 4DN9A 3H2UB 3FCHA 3ZO7A 4A8OA 4ZVTB 1WG1A 1TK0A 4EZ6A 1N48A 1IQZA 3BBFA 5T7LB 3LAMA 2FLLA 5IFMA 4TY8B 1D9DA 2QLWA 2CPDA 2NXUA 3NLCA 4LFAF 2LCWA 2D7SA 4YEAA 5D78A 4IFYB 5KT3A 1U6FA 5BJRA 3LWMA 4BC7A 3NNAA 1WKLA 3R5CA 1FKAF 4PEOA 1JLBB 2QX0A 1DQ9A 2ZBQA 2RT3A 2VG6B 3OUYA 3CCES 2D74B 4WXWA 3RB4A 2CG4A 4J9VA 2LECA 1IR2A 3MUMP 2W4DA 2AEMA 1NKEA 4RU2A 1CC8A 4CWBA 4ZK7M 1TV6B 4Q2MA 4Y65A 1RTHB 3C15A 2FLNA 4XDDA 1Q8KA 4LR9A 4IUFA 3KHHA 3W8GA 1ZTWA 3BGFA 3J81U 3CJ8A 3ENWA 3IRXB 1XMOF 1DQAA 5SZTA 1LW0B 1DY3A 2G2OA 2WVFA 1R8PA 1VQPS 2YBVA 4C8LA 3L95X 1U2FA 5E3PA 1WEZA 3FQKA 1NKCA 2B51A 5J2MA 4CH1A 3SCKE 3OL6A 3OLAA 4NX9A 3MR5A 1YJRA 1XMQJ 4PXBA 5A2QU 4UOHA 5HK4A 2EEYA 4LF4F 1M1GA 1FE4A 2QE5A 5HP1A 2CQCA 3AAWB 5ETMA 4DR6J 1TL3A 1MMDA 1ZPVA 2MZJA 1JLGA 3BH6B 1SUQA 3DMJB 2E29A 1B64A 2AEJA 3QT6A 2ZD1B 4Z7CA 4R0EA 5K8MA 1DLOB 1WG4A 1Q8BA 4DX6A 4OZ2A 2EFGA 5HVHA 4CNYA 2B4UA 1CJVA 1SV5A 2D41A 4X84A 1H7WA 1HNXF 4ANDA 1SIWB 5F3ZA 2LDYA 2F9JA 4KR0B 3QSIA 2XTJP 2J6TA 1GT8A 3QAUA 4K4WA 1OY6A 1FJCA 2FTRA 1OMSA 2VASA 1LEOA 4IQMA 4JB8B 3V6DA 5DLGA 1T9UA 3PYEA 4G65A 1LWEA 2H54B 3ISNC 4UZBA 2XC9A 3POTA 5F8MA 1RKJA 3M9MB 3W60A 2R8IA 5B0AA 1QUPA 1WC0A 2KZZA 2B7CB 2PIIA 2CA9A 4QOTA 4QWDA 2K2PA 1M1HA 3GLJA 2V63A 1XNRF 3FUYA 1Y0HA 1Y7PA 2J9DA 2V94A 4C2MA 4I64A 5DQIA 2FJAB 1KOHA 2IVMA 1A6LA 4OYAA 1QAJA 4RWXA 2F9DA 3D1OA 2EFVA 4YR2A 1HNIB 4WTOB 2K1RB 4BCAA 3AQOA 4RW6B 1J5EJ 2HVZA 6FDRA 5B09A 4O44A 3N79A 3MEEA 4WTYA 2UVWA 2MQPA 1W7WA 1IKYA 1YZ7A 2BE2B 3VVTA 4LR7A 3I0RA 1CJKA 1Q7LB 1N0VC 2YNIB 3AH6A 2ASDA 2HS3A 1X5PA 5H9EK 1KQKA 2QIFA 4UW2A 5J2QA 2XO7A 2B0GA 2J0WA 3ET6A 1P8GA 1MROB 1T9TA 2P9EA 3CPWR 3JXOA 1IKXA 3IR5B 2ASLA 2G1HA 3NCQA 3BR8A 1G3OA 5HROA 4LQ3A 4I7FB 2ZZMA 4ALZA 3KLVA 2XGQA 1QSSA 4JI7J 5EX0A 5D4LA 1EETA 4CO5A 2EBGA 4LBHA 2XCAA 3S1TA 2EWHA 2UP1A 2GHVC 4LIWA 3A3OB 3LUYA 3UDEA 5D4OA 5DQHA 4Y2MA 3CCQS 2MB0B 4B3RJ 2G0IA 5KFBA 1JJCB 2HQGA 3KJQB 5E41A 3QNWB 4EYIB 1HPZA 3DYAB 2BDPA 2LP4A 1XIQA 1X4AA 2VBWA 4LRFA 2VIHA 1V3RA 3RW6A 2QYGA 4IG0A 4C8MA 1HW8A 2JH3A 4JV5F 1WG5A 1ZM2A 4MFBA 1XTZA 3SQGA 1FK9B 2AU0A 4DV0J 2E1AA 4F3MA 3VAFA 3PKMA 4OYMA 3CJ0A 3TQEA 5K9FA 4JI2J 1UJ4A 1Q4RA 3CCWA 3HP6A 1X4FA 1UWBB 3LP0A 2P2CB 3PYDA 2XLJA 1Q78A 1FHTA 5GAHU 3IS9A 3M8QA 1PC4A 4L3KA 2PMZD 4NXMF 1TAUA 3C14B 2W1BA 4ECVA 2FJEB 2UUAJ 2JLEA 4G1QB 2R8JA 3Q0AA 1OIAA 2HZAA 2EFOA 3HLUA 3QGGA 1UZDA 3QO9B 5KT7A 2HBZB 4F50A 4ELTA 3MAAB 1H98A 2MKCA 5KFTA 4OI1A 5HMWA 2RRAA 1FTRA 3G9CA 4OYOA 1YWXA 2IM2A 1NUEA 1RT4B 2FJVA 5F0UA 4OI4A 4R5PA 1WKKA 2AJ4A 2BKOA 4PWUA 3DRRB 4USWA 1KFDA 5F8IA 4K59A 1WNEA 1ZTTA 1HMVA 2BJDA 5HN0A 2HHXA 3H59A 3UDLA 2HNZA 3VAIA 3DDNA 1S9EB 3OW2R 1LWCA 4Q7AA 1QVFR 4DFPA 2HRTA 5AE3A 2CQ0A 2HS4A 2IBKA 4L72B 4ELVA 1SVDA 1RAAB 3IR7B 4ITSA 4CO2A 4X65J 4HH0A 1NK8A 3BGOP 2V9KA 1K0VA 1WC6A 4ZJQA 1VQ4S 1XERA 4DX8H 1AUDA 5H9EJ 3EDQB 2YKNA 1SKSA 4PWWA 2HVDA 1N5TA 1H38A 1ULRA 2KFYA 3CC7S 2CPXA 4K4TA 2BANB 1DFDA 3RTVA 3CJQA 4HT5A 4YB1P 2IBOA 1U0HA 3Q8UA 1TL7A 4XPEA 4UUXA 1IBLF 3BN7A 1TAQA 2H3EB 4QBUA 4HEA9 2JVRA 5GMDA 4TN2A 4DV7F 5HO4A 3R7BB 3E51A 2R2SA 3M6WA 5CZVA 1SL1A 4OZJA 3RAQA 1U1PA 2CRLA 3DLHA 3RAMA 5AXNA 2JSXA 4XK8C 2VC0A 2E5LJ 2B7BB 4ATNA 1WEXA 4RBTA 1QM9A 2C42A 4ECXA 3RRHA 1DAXA 3JSMB 2FJDB 1HQ2A 2MHNA 2JC0A 4QJVA 4CH0S 3D0IE 4P2FA 4DV4J 1JLEB 4G6VB 1N52B 3KJFB 4D3GA 5D6GA 3BBCA 2KJWA 2VBXA 2MDAA 4QQBA 4DL3A 4DSJA 4A48A 2X3DA 2OEMA 2QC3A 3RRKA 1U49A 3R27A 2LXFA 2ZJPQ 1CBKA 1S9GA 2HGLA 4F0MA 2VQFJ 1UL3A 2DNMA 3B4MA 3H5XA 4GO5X 3K8WA 5DDQC 1G2EA 4NEYA 3AOAA 4PWDB 3BH7B 2CQPA 2OPPB 4WE1A 2FJXA 2GGPA 1WWHA 2YWGA 2LEAA 5CCMA 2JFDA 3HFVA 5CABA 5T7LA 2CFXA 4C11B 3R5DA 1RACB 4TY8A 2V50A 3TP2A 1HARA 3AD8C 4IFYA 1BWVA 1RISA 2AX1A 2CUYA 3D3BJ 2HQFA 1JLBA 4ZPVR 5E2QA 1C0TB 2IFXA 1NM2A 4A8MP 3QPIA 2VG6A 3U7JA 1WF0A 2J6SA 2YQ3A 4QR2A 1JXEA 1CJTB 2DTJA 3NWRA 3PJXA 5EWFA 1DQ8A 1TV6A 1WHXA 4FYWB 1RTHA 3EICA 2WK4A 3MZIA 1F6TA 1FF2A 2PEHA 4B3OB 3OJUA 3IRXA 1J2VA 1LW0A 3KG1A 2XLKA 3TJAA 3K5PA 1SJ1A 1GMUA 3VZIA 1VMBA 2AIRB 2DH9A 2WSCC 3UN3A 1PGZA 2EKYA 2ERRA 3FSIA 1SKUB 1KBRA 1U1NA 3KNGA 2BKPA 4ECSA 2OPRB 2UUAF 3KJVB 1AW0A 4FYDA 1RT7B 1LOUA 4LJMA 1ZZFA 1U02A 1IKWB 3MM6B 2DYAA 1RWOB 5L8RC 3DGPB 1C0UB 2MJUA 2C2ZB 5DDRC 1PCAA 4LQ9A 5A76A 4TYBA 3DMJA 3S01A 3RBDA 5CXTA 2W7AA 2YWWA 4RNNA 2ZD1A 4B3MJ 1DLOA 1T94A 2ZH5A 2HURA 2CPEA 1A7GE 5DO2A 3OTOJ 3Q8VA 2FVPA 3KYLA 1M1KT 2IDEA 1O8BA 5F8GA 3UFCX 3OL9A 1UVKA 1H2UX 3FCWA 3J80Y 2VUGA 2VKRA 2H4WB 2O3DA 4LFCF 3NCRA 3SDEB 4DX7A 3FK4A 3CXCR 3HVTB 1VHFA 5JVGQ 1H2VZ 2E5IA 4DQRA 3QT7A 3KMQA 3CF5Q 4NCAA 2IVYA 1FT8A 1YLXA 4NASA 3PW0A 1Q0NA 4Y2CA 4KH0B 4DFJA 4ECQA 1HBNB 1HWJA 2E44A 4PAAA 2D69A 4RL1A 3H5UA 2CQDA 4HDHA 1N34J 2OGUA 2IJFA 5E7OB 1YJ7A 4O3QA 3V4IB 4JV2A 4OQJA 2YWKA 2XZTB 5B0BA 3D9BA 2M8HA 2BE9B 4Y34A 2HVIA 5E3QA 3ENVA 4A4JA 1Y3JA 1HNIA 2QLJB 1LV5A 4C3MA 4RW6A 2HIYA 2JC1A 1FDAA 2CJAA 1K1SA 2DJWA 3ZZOA 4OFZA 1TQLA 3P8BB 4HR2A 2F4FA 2VA3A 3JB9k 1YTYA 2BE2A 3T6BA 1RWNB 5D3GB 1PAEX 4FF3A 5G0RB 4WP3A 3ONQA 2HQIA 3DRSB 2P8IA 5ETVA 2ZVSA 2HBQB 2BJ1A 5LXYA 2YNIA 3M1VA 1IVZA 4QR0A 2HLUA 3MPVA 2UVUA 1SI9A 4BHQA 5U47A 1MROA 1H73A 3Q83A 2BV3A 3QGPA 3FBEA 5K5MA 3FZ2A 2VJVA 1IBKF 2CZ9A 2NCKL 2KT5A 3IGVA 3BQ1A 2HHVA 3HM9A 2J8AA 1M5OC 1NSAA 4U7UD 4X66F 2J9CA 4A8XA 3VGSA 1XJWB 3CC4S 2DVIA 2W9BA 3NWGA 3SCJE 4N8NA 2CJBA 2VQFF 1W25A 5LL6d 2B9EA 4EBDA 4YB5A 4QW9A 2HHSA 1QAXA 3IM9A 2CPYA 1T0TV 3DYAA 1RAEB 3BYPA 3J7A1 2EFQA 3LWLA 4D3HA 4DR2J 5AXKA 1X4GA 1XR7A 4MIWA 4UOFA 4RLEA 2NUUG 1YJUA 4AQYJ 3HO1A 2YKOA 5ETOA 3IC1A 1HWLA 4K5SA 1FK9A 3IBFB 3X1LB 3K89A 4Y00A 1Q8IA 4ZN1A 2MEWA 4MTPA 2KJVA 4C0HA 4RW8A 4IR9A 1Y3KA 4LVNP 3GPAA 1KONA 1YK9A 1D3WA 3I9ZA 1N5QA 1Z2LA 2Q66A 1DARA 2EC2A 4DV5J 1RBOB 1UETA 2A3JA 3C14A 4J9MA 3T5JA 1Z2ZA 4DR1J 4K4ZA 4G1QA 1MWQA 2LKZA 1S48A 2JEFA 2NR0A 4HH1A 3QO9A 4CI0B 1FO1A 2BQUA 1NEEA 3MAAA 1UVMA 3R9LA 2IRYA 2KVQE 3GB0A 1BE4A 2HW3A 1PYSB 3VZHA 5KFOA 3H0PA 4J9LA 4KHPJ 5LSRA 4FF2A 4DV3J 4LBIA 3O3LA 2Z2ZA 3PW7A 4ZVQB 2NZ4A 2G0CA 1T03B 1RA7A 3W5ZA 3HMJG 1L3TA 5DZ7A 3CDUA 3DRRA 2MHEA 4NYPA 4A8FA 4G1PA 2IC3B 4I68A 1RK8A 4DR4J 2MZ1A 3MECB 2HFZA 2GIFA 1DJ0A 1JQGA 4QR1A 5KT6A 1O0PA 2AX0A 1S9EA 2OSQA 2F8MA 1PG5B 4DR5F 2EG2A 1RJJA 2YKPA 3I87A 2KHCA 4Y0FA 3CJ5A 1WF1A 3MEDB 3ILLA 2W4CA 3ZZUA 3ZNJ1 3T6JA 1I1GA 4Q8FA 3W9JA 2ASYA 2Y9HA 4DSEA 5GVQA 4X4UA 4LF2A 2F4VF 4WFNQ 2ACYA 2G2YA 1FJGJ 2AYBA 2DO4A 2GA7A 2BANA 1IR0A 2R7OA 4WFAQ 1KQGB 2M52A 2YQ0A 3IBCB 1F5BA 2ILYA 1TMJA 2MKIA 3C2PA 1SB6A 3WZ0A 4RJVA 3LO3A 3IXQA 1KFSA 3ENAA 2KXFA 2CPIA 3DM2B 4J5OA 1EAYC 3CIZA 4TY9A 1X9MA 2BXJA 2CWKA 4DL2A 4LSLB 3NMRA 3VALA 4P75A 4CT8A 4WYLA 4PG5A 3A3NB 5JMNA 1S0NA 4QWEA 1H3DA 4KHRA 2HK3A 2R7SA 5ETSA 2FGCA 4QWCA 4OYIA 3CO9A 3UPFA 3JSMA 3T5HA 2RHQB 1XQIA 4PG6A 1S4FA 2UV8G 3RBEA 1I3OB 2J0XA 2GX8A 1VDHA 1RT2B 1KOOA 2R7UA 1FE0A 3UN2A 4J90A 1QD1A 4DPWA 1WACA 4WU2A 4RNHA 4ZPAA 2V4JB 3TO8A 3EM1A 5IQQA 2RQ4A 1F2HA 2LQJA 3OPKA 2DNRA 1ZA1B 3UR3C 5GMKa 5DQGA 2MZRA 2E1MC 4NEZA 3GSDA 4EO8A 2AZ1A 4B9VA 4PWDA 4ZKAA 5ETNA 2ZDPA 2OPPA 3CT9A 2XMAA 1C2PA 3QBCA 3PEHA 2V2QA 1Z1ZA 1X4BA 5E3CA 4C11A 1U4BA 2KFNA 2VC1A 4I69A 1VQ8S 3BGUA 3GE9A 1R31A 2QV6A 2XEXA 5IT9U 5IC4B 3KLHB 1BLUA 2XO6A 5H9FJ 2VBYA 1C0TA 2GZOA 5C2GA 4F04B 4XTTA 3QSYB 3OTEA 2K06A 3G6XA 2IRUA 4WPAA 3EGNA 1RAGB 3AXKA 3NS6A 2YX1A 1U26A 2MXYA 1CJTA 4QWAA 4DR2F 5EN1A 4HVZA 3U1LA 1VQ6S 4C3KA 1FKPB 4ZN3A 3QFWA 3W64A 1IXKA 5B0GA 1JJ4A 3I5BA 4JV1A 2FPHX 4LRDA 4PQUB 4WU3A 3FJ2A 4B3OA 1RLCL 4ZLPA 1YRUA 2V4RA 4NLQA 4CO3A 3LP2B 3B54A 4DQIA 2CJKA 5DDOC 3ETMA 4YDDB 2JJ4D 1AB8A 5I4MA 1CEZA 3VAGA 3JAMU 4DR1F 2OPRA 4O4GB 3KJVA 1N88A 1X60A 4K4UA 3D5MA 2ZITA 5KFUA 1IKWA 4A8KA 3UO0A 1XC9A 2YNHA 4F4ZA 3MEGB 3DGPA 2ZUAA 1C0UA 2DNKA 3MMJA 3N6LA 1SPBP 4DPUA 2OEKA 2RE1A 4WZQA 1UFLA 4EZ9A 3ILIA 5DDPC 1U1LA 2CQBA 4C97A 5FIIA 4I1TA 5DRKA 2PA3A 4LF9J 2HFNA 2VD3A 2XS7A 1KS2A 5L46A 2KB2A 4WK3A 1TKTB 2C2EA 4UOCA 1FNOA 4X62F 4K4YA 3TR5A 3T1YF 2FUG9 2C3PA 1X4EA 3K2YA 3ZC4A 1PYOB 2XMUA 5EWGA 2YH1A 4IOBA 1VIOA 3EWGA 3SDEA 3HVTA 3D6TB 3G96A 3NGKA 1BHNA 2EFNA 4MYTA 2OKQA 4ILRA 1GQEA 1SJ4P 1R43A 3TJ9A 2ADBA 2R7XA 1L3KA 3CIMA 1HBNA 3AJ2A 2AJQA 6FD1A 2LYVA 3TEHB 4CDIA 1FCAA 4K7QA 5IV4A 1FWKA 1N36F 3V4IA 1VQNS 1DBDA 2QL9B 1FD8A 1RHMB 4M5LA 2DKOB 1P1TA 4N5SA 1VC6A 2EC0A 2BOPA 4WCEQ 3W66A 2VOOA 2NYHA 4HI2A 4IO1A 4MIBA 2JL9A 5GAHI 3M8YA 3OVAA 4JI3J 1YIJS 1X8DA 3W62A 4ZIVA 5D0EA 2VFRA 1Z4UA 2ZC4A 5D3GA 2H5JB 1UW9A 4RW9A 1HIYA 1R8AA 2ZM6F 3THVA 1QE1B 4KJIA 4K2XA 2GQCA 4X4VA 1HI8A 3P45B 3DRSA 2C3OA 3RB3A 1X0PA 2AJ1A 5D4NA 4ILLA 2E5GA 3GCWP 4Q0BB 3SCIE 2ZVIA 2XM3A 4DFKA 4Q5VA 2ASJA 2N3OA 1P9YA 3OV7A 1RLDA 4J9UE 3OQ2A 3DU5A 2KM8C 2EVZA 3H5YA 4L73A 2UV8A 4DZ6A 1S7IA 1RT1B 2LXUA 2R4FA 2RQCA 4NYOA 1KP6A 5KAKA 4F7VA 1TK8A 2IVFB 2GVZB 2NSBA 4NLRA 1Y5IB 2XWXA 1ZH5A 1ZPWX 2KG0A 2QJ3A 4DLGA 2PA8D 4Y2KA 1N5VA 1JMTA 1TKZB 3CB4A 2BM1A 4JBCA 4DV2F 2P5VA 1MMLA 2X1FA 3G2XA 2HQDA 1ZAVA 1UFKA 3TZYA 1WOPA 1VQYA 2UUBF 1F9EB 5A8WB 2Q3PA 2D3OR 1KNZA 1PBAA 2QLBB 3ZZ0A 1WC3A 1NJZA 4EFAC 3RB0A 4QU7A 4N56A 4XPCA 2PI5A 3US5A 2FQQB 1MW7A 4OLPA 2YKQA 1S1TB 4DSFA 4KKOB 5KFYA 5KTQA 4O3RA 5I42B 1EP4B 4F0KA 4ICLB 4J9QA 4RUCA 4FPIA 3IP0A 1NK0A 2QYCA 4DUZF 5H1SV 3NL0A 1X9WA 2MSSA 4XAKA 1X4CA 3MTKA 3THPA 3AODA 4USMA 3KOAA 5L1LA 3D68A 2M5YA 4DUYF 4C8ZA 3NS7B 4WZMA 3F73A 2BVZA 4IKAA 4DCOB 3V5RA 5KFXA 4KY3A 4R0JA 3V2UC 2YXLA 3HHDA 4NLGA 1SJFA 2GIRA 4OZLA 4CO1A 2VL1A 5EX3A 5KG7A 1U48A 1PO6A 1OSDA 4XIUA 1S5ZA 3EYZA 5FDLB 2XY5A 2HYIB 5BR8J 4B9TA 2B8QA 3SSQA 1YDLA 2J0SD 2X3GA 3MMAB 1WOSA 2WTFA 2V5HG 1RT3B 2FB0A 1OPZA 1B0VA 3M2VB 2D1CA 1T11A 1X5SA 2Y0SD 2NS1B 3ZXWA 5JVHQ 4HKQA 2IC3A 5KFQA 3M05A 3M8RA 4WYWA 2KKHA 3MECA 1Q5YA 3DRPB 2LA6A 3ILJA 5C24B 4LF9F 7AT1B 1ZYQA 1LQ9A 2B4OA 2B9XA 1FX4A 5E3AA 4ZCLA 3E8OA 3M2UA 2AYGA 1GXTA 1F5CA 2GMHA 3MEDA 2IM1A 4M8LA 4F4WA 1KSPA 3U27A 2Y1LB 2LQ9A 3AA8A 1B4SA 3KK3B 2IY5B 1S1UB 3KLGB 2CJXB 1CLFA 3MTJA 2KT3A 5JJBA 4MK9A 4CTAB 2OEJA 4J9PA 2HRUA 1URRA 1HNWJ 1JLCB 1H6KX 2M7SA 2DR6A 4MK7A 4X2BA 7FDRA 3C3LA 3SFUA 1VCTA 2KL8A 1FXLA 2LVWA 3MR6A 2HKEA 3G6YA 5HSPA 3WIVA 2IIHA 4JUZA 1YJWS 3DM2A 2XULA 4O0NA 1RWVB 4CP5A 4LSLA 2WOMB 2VPYB 2CZVC 2JLFA 4CLYA 3V6KA 3VAMA 2CQ3A 2HNDB 5J2NA 2HSEB 1BQMB 4CQ1A 4K0KJ 2ZH2A 1NMEB 2QLXA 1KQFB 3MPDA 4LFBJ 2LEBA 3PRDA 1JNZB 1B70B 2BRLA 4U7UK 1U09A 4KGZB 1RAFB 1HBOA 4WWSA 3UN5A 2XCPA 2I2YA 2ROPA 3NAHA 1RT2A 3D6HB 3IMQJ 4KGMA 3BO4A 3FFIB 3D2WA 4KV8A 2LQ8A 2G2ZA 4M5IA 4X4QA 1WSVA 2HZCA 1TKXB 2V4JA 1VBXA 5DGAA 1T9VA 5ETRA 4DL4A 4S0MA 2GHPA 3BBBA 1NB7A 4E2FB 1U8SA 4QIVA 4X4RA 4K8RA 3LPYA 2VQEJ 2Z2MA 1GX5A 4AD6A 4OYXA 1H0HB 3KTQA 1FDBA 3M6XA 2W9CB 2E9TA 5HMZA 1M5HA 2BA9A 5IWAJ 4NLVA 5A8RB 3DOMB 3HVAA 2R8HA 1JK9B 4OHZA 4ELUA 1SJRA 1TUVA 5CH7B 3R7NB 5DG7A 5J1PA 1FERA 5KFMA 3CJSA 1EB0A 5C25B 3FVYA 4I6AA 3KLHA 4KT0C 3AT1B 3ICLA 4R8UB 1CULB 2NREA 5AXMA 1FRMA 2K3IA 2B56A 1GTEA 1FEEA 4G3IA 3UCGA 2F1FA 2QSFA 1KN6A 1NCLA 4YR0A 4PCQA 4J91A 2KM8B 4F36A 3VF0B 3D4JA 1M5KC 1FKPA 4C0BA 3BQ2A 1Q81T 1SXLA 2OAUA 4WP8A 5K8PA 1R6VA 4YY3J 1M5VC 4PQUA 1HHSA 2QO3A 5LMNF 2MPUA 4RW7B 3TA0A 4RUAA 2OSRA 4GO7X 4A46A 2YX7A 3LP2A 4ZVEA 3KG4A 4I0WA 2HNYB 5HQLA 4YMEA 2W7OA 1QAIA 3GFZA 4ERDA 3PJ9A 4URGA 3IG1B 2QFJA 5E33A 2F63A 4O4GA 3BKTA 4PUOA 3CD6S 5ITHA 3MM5A 3N28A 1EARA 2EK6A 1NXIA 3OTDA 2QN6B 1RTDB 3M8PB 3MEGA 1Y5LB 1U45A 3BJYA 3GSIA 1LFWA 3DGVA 4K4SA 3BQ0A 4EBCA 4USUA 4JYAJ 4RKUC 3K59A 3HK2A 2UVRA 3I0SB 3PX4A 1U6ZA 3KDNA 3N5FA 3KUGA 4GMKA 1NK4A 1VQKS 4F2RA 1CSJA 4LUBA 1VI7A 3W63A 4LF8J 2CVEA 4V19X 1S12A 2XSJB 4ZVRB 4DR7J 2Q6CA 3GJTB 1HYSB 3R6LB 1UPMB 2AMCB 4PXDA 1N5YA 2DIVA 2MQOA 2HHHJ 3OVSA 4P6QA 3QJLA 2ZOFA 4QIGA 2XMJA 2UUWA 3T9NA 2MQQA 2PGCA 1X7VA 2FIUA 2L08A 4WF9Q 1W26A 1LNQA 1BMQB 5ADZA 1KWMA 2CNNB 1NJIT 4B9MA 4USTA 1PSDA 5IZHA 1HHQA 2YKAA 3EPGA 3K0JA 1NDCA 1M5PC 2EBEA 1LKZA 3FBFA 2KYXA 4LF7J 4B3SJ 2K3KA 4X4OA 1SL2A 5IT0A 1VRQC 2ZZNA 2R2TA 2UU9J 5KFLA 2IMOA 1LXJA 3CD0A 1OS5A 4QWBA 2JEJA 1O51A 3JYTB 3OXLA 4OI0A 4FBUA 3BPSP 3D6FB 3QFHA 4PXCA 4OX9F 2DNOA 1PILA 3DLJA 1LWFB 2M8DB 1S7HA 3LALA 4KFBA 5F9LA 3MWBA 4DEZA 4RU9A 2N4CA 4ZA1A 4NLYA 5DZ6A 4ED8A 3S8SA 2GMJA 1HFEL 2AYMA 3QJPA 1I94J 2W2OP 3HZEA 3DLEB 3AB2B 1QE1A 1NSKL 3MM9B 4Q0BA 2I5JB 4WP9A 4HHUA 2DGXA 2UXCF 3MOZA 1WKJA 3K5OA 4LR8A 3U1NA 1RTIA 2MKYA 2DGTA 3D3CJ 3PNIA 1RT1A 4JI5F 1GK8A 4ED2A 2ZH9A 3GP9A 2AHOB 1G7CB 4CO0A 2GVZA 1N32F 4JI4F 2N7YA 3EZ5A 3D7SB 2DEJA 5C2CA 3HT3A 2ACMA 2VG7B 3RYLA 3C16B 1U7LA 3W9HA 1NBEB 1MN9A 2C2RA 1EIYB 3OSNA 1TKZA 4DV6J 1OY9A 2H48B 3ZZPA 1FRXA 4J9RA 3ZTQA 3WX4A 5A8WA 1TL1B 3TAMA 2D3O1 5IWAF 3B82A 3F0NA 1KHWA 2W01A 1LXNA 2IYGA 2KO1A 2QZ8A 1I5OB 1TKDA 1WHWA 1W2IA 3K7RA 3FEXB 2A10A 3M2RB 4AXJA 3ZNUA 1S1TA 2LQ5A 5LSOA 1OPIA 1M5SA 2C28A 1KLMB 5I42A 1EP4A 3HCXA 4ICLA 2ZWOA 2DH7A 1HBMB 3JQKA 3BSOA 2DO0A 1JLAB 5J1NA 4ZP6A 3SFGA 1YX2A 4DXLA 2VKZG 8AT1B 2ZBCA 2E5HA 3DNCA 1SKRA 3GR0A 3A12A 1S6UA 1AYEA 4DS5A 3KFWX 1S6PB 2E9ZA 2FDNA 3RRGA 4YS2A 1YRXA 2VHGA 3I31A 4CIOA 1JNRB 1TL4A 1VGYA 4MIAA 3BPDA 3MMAA 4JI1J 4N41A 3M2VA 1AZSA 4UF4A 1L3VA 5DG9A 2ZJQQ 4GKKF 2A1BA 2O01C 3D0HE 1HNVB 1FRJA 3A8EA 3T41A 5C24A 1S77D 2Z8QA 3IAS9 2ZHBA 4ES2A 1UJ6A 2E7VA 3LANA 4NRUA 3DOKA 3KUHA 4HACB 3T3FA 1ZAXA 4ZPWR 1ZETA 1L5UA 3G8TA 2GAGC 4LF8F 3QIPB 3OFHA 3FGVA 3KG0A 3GIRA 1N0UA 3HFKA 1MU2B 4ZCMA 4C3LA 3PY8A 3T5LA 2NXCA 4AFFA 4EEYA 4ED7A 2R7TA 4OJGA 2P6SA 4DCJB 4TNOA 2FC9A 3PJWA 4FNIA 3I56S 3KK3A 5D0RA 2HHHF 2MQLA 5A6PA 2VPZB 2ZUGA 3B78A 3KLGA 3EGWB 3DN9A 1WELA 2RF2B 3MDFA 4ZLJA 2QL5B 4FPRA 2B5JB 1ZM3A 2GS8A 2X1GA 5IM0B 3DXSX 4M63A 4CTAA 4K5RA 1K0TA 3NEKA 1FESA 1JLCA 4C8NA 1K44A 3GIJA 4X4TA 3H42A 1AUSL 1FTCA 4YN3B 3W65A 1K8AT 1K73T 2C2OB 5KG4A 2W25A 2UU9F 5LSLA 2BACA 2JZ5A 1F60B 4QPXA 4J9NA 1AA1B 3GFYA 3QT5A 4N47A 5KFHA 3PXGa 3TVYA 1H72C 5BYRA 2WOMA 4NXNF 3D1QA 3D67A 2HNDA 2FJBB 1AFJA 1RWXB 2CNKB 1RWUA 1N33J 2HHUA 1BQMA 5LOQA 1LFPA 3KKFA 1D09B 2R7WA 2ROEA 2KVIA 3EVMA 3WQPA 2QMXA 3WBZA 3MCMA 1HQEB 1Q16B 2V8GA 3ZFVA 3OFGA 3CTRA 1M0SA 2E1CA 3AOBA 3EMTA 4FDFA 2ZBPA 3MUVP 1TP7A 3IWXA 4OI6A 4OV1A 1RI7A 4CM2A 3FFIA 3VGVA 5B0DA 1VLYA 2YKMB 3W3SA 3SMZA 3EVOA 4I2QB 2NUHA 3ULHA 1VQ9S 1OSCA 4U95A 1R8HA 1TKXA 3MCOA 2CIMA 3K57A 2OH2A 4CLSA 4IOCQ 2JOQA 4P10A 3D66A 2MMYA 1IKVA 1JB0C 2RS2A 4UUWA 1CQNA 5BXIA 3GFHA 1F3FA 2ZKTA 3MCNA 2Y8YA 4CRJA 2V67A 1HWIA 3MD3A 2W9CA 4DR3F 2QLFB 1IJEB 3DOMA 1KRPA 1RP5A 2FHJA 3MI7X 3R5BA 2KDOA 4AL6A 5DLFA 2IDLA 1M90T 5C25A 4DV6F 4E8UA 4ID5A 1U6BA 3R97A 4R8UA 3O6QA 4ER8A 2M9KA 1CULA 3W1YC 4DHVA 1HNZF 5A2QY 4PZVA 4RWWA 3FQLA 1PBUA 4MKVA 3TWZA 5F41A 4P2SA 3ADAC 4RZRA 3LA0A 4OJ3A 4F67A 4BWMA 3L3CA 1V9OA 2HFUA 3TAPA 1KC8T 3UNGC 2DT9A 3HF5A 2XB2D 4OYWA 4RW7A 2DD8S 3G6ES 3THTA 2V68A 3MEKA 1F9FA 2X1AA 2HNYA 3Q8PB 1NHKL 3G82B 4A8QA 2FZKB 3DHWC 3IG1A 4A8WA 2PI4A 5I3PA 3TZZA 2XQCA 3M30B 5L39A 5EDWA 3HHLB 2C3YA 3HSDA 2BJ7A 2V8PA 1Y4ZB 1RTDA 3M8PA 4ANEA 4FF1A 4MH8A 1RXOB 1SH0A 2ALZA 1TMMA 3PEJA 3OLBA 4DU7A 4JI6J 1JLGB 4M5MA 4PQAA 2QA4G 4V1Ak 3QWPA 1WHYA 2BZ2A 2YWHA 2IAJB 4DPTA 3WHIA 3LTOA 4DPYA 2LFVA 3Q24A 1T3NA 3MGJA 2F65A 3CEDA 4JI1F 3E2EA 3M6VA 1KQSR 2F8EX 2XSJA 3PVXA 4MMOA 1QJHA 1HYSA 5F9NA 3LPEA 4YB6A 4USKA 2GMLA 1BQXA 1Q8LA 3VAHA 5L1KA 3DLLQ 1C1CB 3P96A 3RBZA 2DXFA 2X7IA 3OJSA 2HIQA 4X4PA 1XMQF 1RKIA 4G1IA 1SH2A 4OJHA 3RU0A 3K5LA 2OFHX 4P2XA 2QMUB 4NYZA 3Q86A 1BUXA 3QGHA 2DISA 3IGNA 4DR6F 4F3OA 2DK2A 1WD6A 4RNFA 4IG3B 4NA1A 4YR3A 1HL6A 1RCXB 3TAQA 1U47A 4CT9A 4KGXB 1XWLA 3W2WB 2HWTA 1HHTP 4F0HA 5KG0A 3GCXP 3UNYA 4OZ0A 3R2CJ 1REGX 2ZE2B 2Z0GA 1Y10A 1N6QB 5FLXY 1BWEA 2L9NA 3JYTA 5KFNA 2CPZA 4U8YA 2RJZA 1U1RA 2KYZA 3L7PA 2M3DA 3GZ7A 2W8LA 1LWFA 3BREA 4FKXA 4FZVA 4ED1A 3TRGA 2H1YA 2PT0A 4XO0A 1T05B 1IBMJ 3DDKA 3PKYA 1IKYB 5D8HB 1RHRB 1MMNA 1UAWA 2VONA 3T5KA 4PABA 3J81j 2EG1A 3UCUP 4N76A 4LRCA 4P7VA 2DNNA 1S0MA 5KFKA 3PW5A 2I5JA 2RU9A 1R0BG 3EPIA 2RUGA 4H4KC 5IS2A 4V19J 2R42A 4WFZA 4ZPCA 1H7XA 1RU1A 3P5TL 1ELOA 4X4NA 1N8RT 1Q86T 3GILA 5L9NA 4NWBA 3ITHB 3BZQA 2RAQA 1J5EF 2DEIA 4IH5A 2L3MA 3I82A 2OPSB 2VG7A 5HROB 4RX6A 4EK2A 5AXLA 4MKAA 3KK2A 3C16A 5LMUJ 2B9WA 3BN4A 2K8GA 2WZ1A 4LFAJ 2O1PA 1WI8A 4TQRA 1D1UA 1PJ5A 1O6XA 3SI8A 4UQGA 2DGOA 3M6UA 3QRPA 4LVOP 3JSRA 4GRSA 4CLZA 1FX2A 3RB6A 1S57A 2IM3A 3DLGB 1IJFB 5EHHA 4ZLLA 3FKBA 1UFWA 2F40A 5K20B 4QCLA 2QFIA 5E0OA 1X0FA 1TL1A 2RMLA 3BKUA 1XR5A 3O5TB 1WTFA 4DMZA 1VK3A 5MAOA 1RBAA 4DBQA 2Q1LA 4DLEA 4KRWA 3H5SA 2GVDB 3M2RA 4KIAA 3VQSA 4ZPDA 4L6V3 4F2SA 5CHCB 4C8OA 2UVVA 2CADA 1XMOJ 1KLMA 2K7KA 4HTJA 1IQTA 3OL8A 5B0CA 4EMDA 4W92B 1YJTA 1HBMA 4DL5A 2Z2YB 2LLZA 3PCOB 2UXBJ 4NA2A 4GC6A 3OTBA 1G6BA 2NSCA 1GNKA 5CD4H 1JLAA 1OQ3A 4C8KA 4ECUA 4JI7F 3QWUA 1HLWA 2ZWPA 1UJ5A 4KB7A 2L41A 4ZIWA 4U7CA 4LF4J 1AROP 2OMLA 3RAXA 2R9LA 3MMCB 3BF4A 3BGLA 4NI2B 1B7YB 1RHUB 2VDIA 4I4BA 4B3RF 4B08A 3DI6B 3SV4A 2OFGX 1YKWA 2VU5A 3CUNA 3GJQB 3QLHB 2OD6A 2YNFB 1TTHB 2R7QA 1S6PA 3CULA 5IT4A 3PO4A 2RH3A 1AXQA 4B9NA 3AB4B 2OELA 4R5PB 4UY8T 4DV0F 4Y3CA 1VC5A 3W5XA 2G0JA 4JI2F 3TI0A 4GC7A 3ZTPA 2PFFB 2XY6A 2N3LA 1VQOS 2BYCA 1NH8A 3FEZA 1HNVA 1R8CA 2BR0A 1HMVB 3GFXA 1B0PA 1FRLA 3BO2A 4K4VA 3H4DA 2KG1A 2HFOA 4J7CA 3P5BP 1SJ3P 1DHMA 3BEGB 2H5IB 4ZP8A 1X5OA 1WOOA 1SCJB 2L9DA 1RU2A 1P27B 2XNQA 4AL5A 2RDDA 5GAEU 2RIJA 4OZ5A 1QSLA 3TNVA 1OYDA 1IM4A 4HLBA 5KT2A 3MR3A 4LMZA 1MU2A 3GYXB 4ECZA 2DR5A 3G8SA 4URQU 5CYMB 3ETOA 2WVEA 1V3ZA 2L9WA 2J8SA 2QT7A 4I6YA 2ZNYA 4KH1B 2DR8A 4EWTA 2Z57B 1SC4B 1LK7A 2CYYA 3MR2A 3UR0A 4C4WA 1P9QC 2RF2A 2Z56B 1S1VB 4JI8J 2B5JA 5K8OA 1WC4A 1KKHA 5IM0A 5DJBA 2BBEA 2V9WA 3PX0A 2VFUA 1HBUB 4USIA 3PR4A 4ZVOB 4TU9A 4RBVA 1U8WA 4CM0A 1EHWA 3GONA 4DQPA 3NBPB 1LK5A 3LQVA 4NMLA 3MXHP 4QIEA 3NY0A 4YOEA 3QRQA 2ZHOA 3OTCA 4ZCKA 4F3QA 3EGZA 2AT1B 2BJ9A 1N4LA 1FDNA 3PFOA 1FJEB 3PYFA 4X65F 2VFVA 1UP1A 1S10A 3T19A 4Z37A 2BQRA 3CE8A 2V6AA 2KZMA 5AT1B 1SIZA 1TZ0A 4OHXA 1IBMF 5HVFA 3TW0A 5CYQB 1HR0J 1TFWA 3CCSS 1YJNS 2ATLA 3WIUA 1HQEA 3JQJA 3CCUS 3V4MA 2ALYB 2K1RA 1BGXT 3A4TA 3NGDA 8ATCB 2BE7D 3MAQA 3A8IA 4CLFA 3OFEA 4U9RA 2J9DE 1QVGR 4I2QA 2DXEA 4EBEA 3FSYA 3CDWA 3EZOA 1A0OB 4ZS6A 4F25A 5K14B 2DCLA 1NHVA 2MZQA 3IA0A 4KGVB 4LIRA 4HDGA 1WTBA 1WI6A 4TKTA 3BSAA 4LT6A 2CJYB 2XNRA 3M4XA 1HW9A 3F41A 4UTGA 4QIWD 5D0HA 2HLTA 2LQBA 5A6WA 4OL8A 2UUCJ 2E5LF 3OL7A 1XMBA 1TUWA 2WBRA 4J9OA 5E5NA 2ZH8A 5LMUF 1Y00A 4X4SA 1CS4B 1VRTB 3GIIA 4JV5J 3K58A 3CCLS 1ICEB 4M5HA 3IRWP 1X9SA 1T95A 4DV4F 3J7ZT 1NRKA 3I96A 3SYZA 5CZXA 2HAIA 3LGNA 1YQHA 5HJYA 2KRRA 4Y28C 4U8VA 2E1PA 2IJRA 5A0YB 5CAAA 2MLZA 2FZGB 5IQ6A 1GX6A 2BOAA 3H90A 4I7FA 2BQ3A 4RR5A 1K1QA 4NXMJ 4N7TA 4M5NA 1NJWA 4NZ6A 2RQMA 3DC2A 3IO1A 4W4MA 5ETPA 1RAJA 1HI1A 3PTWA 2XMWA 4I56A 4RUBA 1FA0A 1U1MA 3JSBA 2G4BA 4Q44A 5I3UB 3FDSA 1NAQA 4U67Q 1EQ0A 4HHJA 3G8QA 3CJTA 3TZXA 4DWIA 5L9XA 3G82A 4DF4A 2UXBF 4U6PA 4GKJJ 4OI2A 4ECTA 2QL7B 1FJ7A 1S1XB 2OJ3A 1UEVA 4IQXA 2VODA 2DHHA 3EZUA 3FBCA 2D9PA 3PW2A 3M30A 2NLWA 3HHLA 4OZNA 3IAM9 3KHLA 2Y1IA 4WFYA 3MCSA 3SIPB 2ROGA 1WUUA 2ZBRA 3CJKB 3N0VA 2HRYA 4KO0B 3UD5A 2VFTA 1UWBA 4FF4A 1RT6B 4F4YA 2HFSA 8RUCA 3FZBA 3Q2TC 3PW4A 3F56A 1NZAA 2IAJA 1N54B 2KRBA 1YRTA 4ZVUB 1IN0A 1R89A 2IHR1 3HD1A 3HD2A 1RUSA 4FNHA 5A8KB 5K8NA 2HVEA 3PRVA 4BBYA 5B0FA 3FMWA 1C1CA 2WVDA 3DHXA 1RT4A 4O23A 3Q22A 3ZZYA 4RBUA 4IO9Q 2BJ8A 1NDPA 2FVRA 5H9FK 2VF3A 3GU0A 3K5NA 4WBFA 2Z58B 3HFZB 4PXEA 1NDLA 1CC7A 3VAKA 1TFYA 3FNNA 1RHQB 3UE2A 4DG1B 2YVSA 3U02A 5KFSA 4IG3A 1SBRA 1WHVA 3MPUB 1IBLJ 3RJMB 1RYRA 3NNCA 4QYZK 4URSA 3W2WA 4B3MF 3R5AA 2WW4A 4DV7J 4M5DB 4DSKA 3OTOF 2ZE2A 1D9AA 1N6QA 4JI8F 4I6WA 2DPIA 4FXWA 1T9YA 2P9GA 2W2PP 3BM7A 4PYAA 2PDAA 3NXZA 2DR7A 3BYRA 3QZ8A 4BS2A 3LGMA 4UQTA 2Z2LA 1NO8A 1R7IA 3PX6A 1T05A 2QTWA 2GCFA 1SJQA 1RGVA 2ZOGA 1NPRA 5GAGU 2CJ9A 3TANA 4ED5A 1IBCB 1S6OA 2V8HA 2YH0A 2MKJA 2DR9A 3TX0A 1D8YA 1EZZB 2EPIA 2ZKUA 2W7PA 1FWLA 3LGHA 2I6WA 3GIMA 3Q89A 4RNOA 3M1VB 1SQEA 2BW7A 1N34F 3I5AA 3QRRA 4NLTA 3TOQA 4F26A 5FLXU 1VBYA 5CQGA 1FI4A 5M2RA 3VV2B 2C1EB 2H5EA 4ZVGA 2C22A 4CCHA 4ZJOA 1HR0F 3MM7B 5KG3A 4NLUA 3MOJB 4NLPA 3BB5A 3SEOA 2BJEA 1PC5A 5G4DA 4EUVA 3ITHA 1JWWA 4WFBQ 3OR2B 3ILOA 3DKDA 5GMEA 2OPSA 2VDHA 5F8JA 2IYIA 3FBBA 2W9BB 3JSYA 1HWKA 3A3PB 4O0IA 2H51B 5AE1A 4NLSA 1JLEA 4AYBD 1SC3B 3H2LA 3BR9A 3AFGA 2NYIA 2PMWA 3DLGA 4ZVHA 1S99A 2V69A 1B3TA 2AGOA 2UUCF 1RQ0A 2DNZA 3ISZA 3UDVA 1QAYA 1D0EA 1KDNA 1RB0A 2FGOA 4BC9A 2Y8WA 3PACA 4CZCA 1X5TA 2BKNA 3TEGA 3DCAA 2HFVA 4RUHA 3GJSB 2GVDA 2MLXA 2XS5A 2UZAA 3H20A 5HMXA 3SXLA 1EX8A 3MFIA 3BO3A 4KQZA 4RW8B 1VS3A 3LH2S 3HHNB 5KFFA 1ROFA 2XI2A 4OMFG 2E7XA 2PE8A 1C4AA 3J7YU 5IC6B 5HI7A 2E1RA 2A6OA 2APOA 5HL7Q 4OIXA 3H25A 3N6NA 1MSWD 3EGVA 4DSIA 1DZ5A 1WDDA 3OD2A 4P7TA 2ZJRQ 4HTIA 4UY85 1R0AB 2XMKA 4QW8A 4P2MA 1IR1A 3MMCA 4NI2A 2VOPA 3M8SA 2FHMA 4F4KA 1HD1A 3DI6A 3EDRB 1RTZA 4YP3A 4YB7A 2AKWB 4O3PA 3LP1B 5J1EB 3QLHA 3MFHA 2YNFA 2FHJD 1RAIB 1X31C 4NLDA 4GKJF 1P6TA 3L9ZA 2YPYA 4ILMA 4AQYF 3R1LA 3BV8A 4QYZJ 1FFSB 1C4CA 1H74A 3MPYA 2IRXA 4M5JA 2CKWA 3DLBA 4OZ3A 1T02A 2M88A 1F2GA 2BMBA 3NCPA 3B4DA 4FP9A 3TQ1A 1U24A 3WDOA 1J27A 3DLKB 2X51A 4DV5F 1NKBA 4LFCJ 3HI9A 3N9UC 2CDRB 1RT7A 2D3UA 2HHTA 1TR0A 1XR6A 4USJC 1LW2B 3MM6A 1KVKA 4FBTA 3PHTA 3WC2A 4Y2AA 4ED4A 1UW4A 2XBPA 2MQ8A 3TUJC 4FN5A 1YZ6A 3FCVA 2JEIA 1SL0A 5CYMA 5KG1A 3W2VB 3C6UB 1PAUB 4KHPF 4CYUB 4IR1A 4MAKA 3KJNB 4DV3F 1U0SA 3KLFB 4BDPA 5KG2A 2ZH4A 4DUTA 2NQPA 4OHWA 1NB2A 5M2UA 3DOLB 2MZSA 2GHWA 4FKYA 4Z2XA 4A47A 1S1VA 2ZFHA 3PM9A 3TA2A 2WVBA 2JLGA 2XSFA 1HBUA 4LSZB 1R0CB 3AD7C 4DR4F 2EFPA 4L76A 2I0XA 3D6MB 1ZS6A 1TK5A 2HHWA 2N7CA 1CPZA 3NBPA 1HI0P 1GMWA 4AE5A 1S59A 5KFCA 1APSA 3B6BA 1NK6A 2XI3A 2CJQA 4Z7YA 5CD4A 3OHAA 1CQMA 3OBIA 3IM8A 2W24A 4NMXA 2FY8A 4OHYA 2KN4A 5HLFB 1E6VB 3R1HA 3AA9A 5F8NA 4CO4A 2AW0A 3ELHA 3BSCA 1JKHB 1BXNA 2AGPA 5CYQA 1FJGF 1FRIA 1IBKJ 2C3UA 2KHDA 2KXHA 4C8YA 3J80U 1MNEA 4RO0A 5FJ4A 4PG4A 5KG5A 1E6YB 5IT9Y 3GMGA 3C6TB 4PR6A 3VTIA 4X66J 2J7UA 3KMSA 2VG5B 3GYGA 2DGQA 9RUBA 2IPOB 1SH3A 2CNLB 5K14A 2DCUB 5EWEA 2W8KA 1CG2A 5T14A 4DFMA 3J7Z5 2I38A 5G0RA 2V34A 2ZH1A 4ZOSA 1FVSA 2G9OA 2VICA 4NZ0A 2ILZA 3NP5A 2OLWA 1ITPA 2CQHA 3NMAA 1RAHB 3NGUA 4H4OB 2WHOA 1KD1T 2VB6A 5L1JA 2YTCA 4ZITA 2ZBIA 5KT4A 1CS4A 1VRTA 3FSXA 2C2MB 3F44A 2RRNA 1QTMA 1RDRA 4IRKA 3GWCA 4JP8A 3CNQP 3JAMY 3AXMA 3WX8A 1KTVA 3HJFA 3L09A 5A0YA 2GO8A 2GO9A 5AJ3J 4AT1B 1HA1A 1Q82T 2KU7A 3TVZA 3PDNA 3E01B 4H4KA 2MYFA 3Q8QB 1I51B 2XG8A 1YI2S 1V6HA 4TU7A 2FLOA 1RADB 4LRBA 4OX7A 3KXDA 3HXMA 2X1BA 4DL7A 3AHPA 2R8KA 4DF8A 3P6YC 3H40A 4KHMA 5I3UA 2RU3A 1YG0A 1MWZA 1UVLA 4E0DA 3GR1A 2ADCA 1RWWB 3IFEA 4PRFA 3VCDA 4M1KA
chains in the Genus database with same CATH topology
4UUWA 3IXQA 1CQNA 1S1XA 3GFHA 2YWEA 1KFSA 4WFXA 2KXFA 2ZKTA 1A9NB 1U1QA 5CA5A 3IN5A 2CPIA 3QJJA 2LMIA 5BYQA 3DM2B 2MGZA 4J5OA 3CIZA 1HWIA 3MD3A 1AFIA 4JI6F 2W9CA 3PHEA 2B6AA 4TY9A 4DR3F 2AGQA 3QYYA 1X9MA 3VQTA 2BXJA 4DL2A 3QIDA 4NRTA 2WCXA 4LSLB 3NG8A 3NMRA 1IJEB 2YNHB 4YDXA 5KFDA 2HNZB 3DOMA 2C2DA 3VALA 1KRPA 2WBMA 1RP5A 4KC5A 3QZ7A 2HVHA 1TVRB 4CT8A 2FHJA 3K5MA 3MI7X 3R5BA 2KDOA 4WYLA 3TA1A 3LAKA 4PG5A 4AL6A 4TLRA 5DLFA 2CPFA 1LWCB 1S0NA 4QWEA 1H3DA 2MQMA 4KHRA 1M90T 5C25A 3KHGA 1R3NA 4DV6F 2J7KA 3CJKA 4KO0A 4HL9A 2R7SA 3UD4P 4E8UA 4NCBA 4ID5A 1U6BA 1S9FA 1RT6A 4WIIA 3T1AA 4R8UA 3O6QA 2YNGB 2M9KA 2FGCA 4QWCA 1NK9A 1ZOTA 1MWYA 4DHVA 5HBMA 3QIPA 5A2QY 3CO9A 1HNZF 1FRKA 3UPFA 2KFZA 4PKDB 3JSMA 2DNHA 3T5HA 4RWWA 3N01A 4LSNB 3FQLA 3PZPA 5F41A 4KE5A 3ZZRA 1XBWA 4P2SA 4PG6A 1S4FA 2EK1A 2UV8G 5B08A 3I4PA 2HHQA 3RBEA 2J0XA 4RZRA 2F3JA 2EW9A 2GX8A 1RA6A 4OJ3A 2GJ2A 4F67A 2DGSA 3E3XA 1Q1KA 5HQ8A 4EYHB 1RT2B 4BWMA 2NPFA 2R2UA 1KOOA 2FVSA 4FXVA 2R7UA 1FE0A 2YKNB 3L3CA 2MY7A 5KOXA 1V9OA 3SSSA 3TAPA 1KC8T 3PR5B 2RDIA 1SC6A 2GQ2A 3AQPA 3CCTA 4H54A 5KFZA 3UNGC 4E98A 5A8KA 4N77A 4RW4A 1WACA 3NRBA 5IXUA 4WU2A 2DT9A 2FC8A 3HF5A 4IH6A 4RNHA 4ZPAA 2V4JB 2XB2D 2RRBA 3TO8A 4IH7A 3FMBA 3GG1A 3CCVS 5IQQA 2RQ4A 2LQJA 3I6PA 5CCLA 4RW7A 1ZM4A 4QU6A 2DD8S 1XK8A 3OPKA 3GV7B 1VFJA 1JLQA 4NCGB 3G6ES 2DNRA 3THTA 3UR3C 1T03A 3MEKA 4DN0A 1F9FA 5GMKa 2HNYA 5DQGA 4ID8A 2CQIA 3Q8PB 2X1AA 1VQLS 2MZRA 2E1MC 3GSDA 1S0VA 2M4MA 4EO8A 2NPIA 2E7WA 2CQ4A 4EGLA 4A8QA 4B9VA 4I2PB 1UVNA 3DHWC 3IG1A 4PWDA 1HWUA 4X64F 4ZKAA 5BYSA 3OXGA 2XWYA 4ZP9A 3PIPQ 2ZDPA 5D4PA 2OPPA 4A8WA 2C3MA 2PI4A 4QZVB 1BC6A 5I3PA 3CT9A 1V3SA 1ZAWA 3D1HA 3TX8A 1J5OB 2QA1A 1C2PA 3M30B 4KTQA 4DG1A 1IUJA 3PEHA 5L39A 2QRRA 5EDWA 4A8YA 2IA6A 3HHLB 1Z1ZA 2MKKA 2C3YA 4QIFA 1X4BA 5E3CA 4C11A 1REVA 1S97A 1U4BA 2KFNA 4USHA 2I9SA 2Q6BA 1Y4ZB 4ETZA 3PRBA 2VC1A 3M8PA 1L3UA 1RTDA 4I69A 4FF1A 1S49A 1VQ8S 4MH8A 1UA0A 3I9V9 1R8BA 1SH0A 3BGUA 2J76E 3GE9A 1S1WA 1R31A 2ALZA 3N5BA 2QV6A 3PEJA 2XEXA 3OLBA 1KVJA 2OTJS 4M5DA 5DETA 3G71S 3HZGA 1JLGB 3KLHB 4ECRA 1BLUA 3KK2B 3RR7A 4PQAA 3C46A 5H9FJ 2QA4G 3DXBA 4O3NA 2VBYA 3EXCX 1C0TA 5DM7Q 1D8ZA 5GADU 3BDEA 3DFEA 3QWPA 4XDCA 3MD1A 4NPOA 3OTEA 3FEYB 4C7QA 1I6JA 3G6XA 1WHYA 2BZ2A 2IRUA 3IWLA 3EGNA 1OWXA 2YWHA 2IAJB 2PSZA 4FVCA 2OO4A 3NS6A 2MY8A 4ED0A 3Q24A 1T3NA 3MGJA 2YX1A 3CEDA 4JI1F 1U26A 2V8VA 4IFVA 4DDFA 2MXYA 3E2EA 4QWAA 3M6VA 4DR2F 5KFVA 5EN1A 4HVZA 4TXSA 1KQSR 3U1LA 2V8DA 1VQ6S 4C3KA 2HS0A 1FKPB 4K4XA 2F8EX 2RS8A 1S6QB 2U1AA 1DTQB 2XSJA 3PVXA 4MMOA 1IXKA 3BGRB 5B0GA 2ZHAA 1JJ4A 2DGUA 1UVJA 1QJHA 5EGYA 5F3TA 5F9NA 3I5BA 4JV1A 2YKMA 4F02A 2LU1A 1HYSA 2FPHX 4YB6A 3KHRA 4RW9B 4PQUB 4WU3A 3FJ2A 1ZM9A 2GMLA 4Q2LA 1BQXA 1Q8LA 5JXSA 3VAHA 4DSLA 3SZ2A 4NLOA 1VK8A 1S79A 1YRUA 4ZLPA 2V4RA 5L1KA 4MYUA 3DLLQ 4NLQA 4CO3A 1C1CB 3P96A 3KK1B 1S9GB 2ZOMA 3OJSA 2PN6A 3CD5A 2HIQA 2AJFE 4X4PA 3LP2B 3ISND 1XMQF 5L38A 1YHQS 2ABYA 1RKIA 4G1IA 1SH2A 4OJHA 2XGPA 3RU0A 2CJKA 4DQIA 2WB4A 5DDOC 2XLIA 3K5LA 2OFHX 3CDEA 4CH7A 4YDDB 3I5CA 2R8GA 4NYZA 2JRSA 3I32A 2DHGA 2JJ4D 3QGHA 5I4MA 1CEZA 2DISA 4WE1B 2J0QD 3IGNA 2WB1D 2RNEA 2GGPB 4DR6F 3VAGA 4DN9A 1Y5NB 3H2UB 2DBBA 3FCHA 4DR1F 2OPRA 2DK2A 4O4GB 4F3OA 4A8OA 3KJVA 2VFSA 2VH7A 3GG0A 1WD6A 4RNFA 3MM7A 2HPUA 1N88A 4IG3B 1WG1A 4NA1A 1TK0A 4EZ6A 5F8HA 1IQZA 1N48A 3D5MA 4K4UA 4YR3A 2ZITA 4O3OA 5KFUA 1HL6A 5T7LB 3LAMA 2DNPA 3TAQA 2FLLA 1IKWA 3CCJS 4CT9A 4A8KA 1U47A 3Q8RB 2VPWB 2BW2A 4TY8B 5IFMA 1XC9A 2YNHA 1D9DA 2QLWA 2CPDA 1XEZA 2NXUA 3MEGB 3NLCA 1XWLA 4F4ZA 4LFAF 2LCWA 2D7SA 1F0XA 3W2WB 4YEAA 2HWTA 5D78A 4IFYB 5KT3A 2FVQA 3DGPA 1C0UA 2DNKA 3MMJA 4OI3A 1HHTP 3N6LA 1U6FA 5KG0A 5BJRA 4F4XA 3LWMA 2RE1A 4BC7A 4WZQA 3NNAA 3OR2A 1UFLA 4OZ0A 4EZ9A 5DDPC 1U1LA 2BABA 2CQBA 2ZE2B 3BDPA 3R5CA 5KG6A 2Z0GA 1FKAF 1N6QB 1JLBB 4C97A 5FLXY 3CCZA 4B9LA 5FIIA 3KLIB 1DQ9A 4I1TA 1BWEA 1FKOB 2B9YA 2L9NA 3JYTA 1JJHA 5DRKA 4JI3F 2RT3A 5JUMA 2PA3A 5KFNA 2OD4A 2VG6B 2CPZA 2Y1JA 3P3DA 4B3OA 2HFNA 2RJZA 2VD3A 3OUYA 1U1RA 2KYZA 3CCES 2D74B 3L7PA 1KS2A 4FS2A 2XS7A 2M3DA 3GZ7A 4WXWA 2CG4A 3RB4A 2W8LA 1LWFA 2LECA 3BREA 3MUMP 5GAEI 2W4DA 2GIQA 2KB2A 4FZVA 4ED1A 4WK3A 3TRGA 1NKEA 4RU2A 1TKTB 2C2EA 4UOCA 1FNOA 2PT0A 1CC8A 4X62F 4K4YA 2ZH6A 2Q43A 4XO0A 1T05B 4ZK7M 3TR5A 1TV6B 3T1YF 4Q2MA 3DDKA 2FUG9 4Y65A 3H2VE 2C3PA 3PKYA 1X4EA 1IKYB 1RTHB 5D8HB 2HWIA 5KFJA 2ZH3A 2UP1A 2FLNA 3K2YA 4XDDA 3N4WA 3ZC4A 1MMNA 4Q45A 4IUFA 3KHHA 2XMUA 1UAWA 2VONA 5EWGA 1ZTWA 3BGFA 1RTJB 4NLXA 3ENWA 3IRXB 3V81B 4IOBA 3T5KA 2YH1A 1XMOF 1DQAA 2EG1A 1VIOA 5SZTA 3UCUP 1LW0B 4N76A 3SDEA 1R8PA 1VQPS 4P7VA 2DNNA 3HVTA 4C8LA 3L95X 4M95A 1U2FA 5E3PA 1S0MA 1WEZA 3FQKA 3G96A 1NK5A 5KFKA 3PW5A 2I5JA 1NKCA 2B51A 5J2MA 3NGKA 4CH1A 3SCKE 3OL6A 2F7VA 3OLAA 2RU9A 4NX9A 3MR5A 2EFNA 1YJRA 3CVKA 3OR1B 4MYTA 5KFPA 2OKQA 3GV8B 3EPIA 4ILRA 1GQEA 1SJ4P 1R43A 2ADBA 2RUGA 4H4KC 5IS2A 1X4HA 4V19J 1L3KA 3CIMA 2R7XA 3N6MA 4PXBA 1HBNA 3AJ2A 4WFZA 4ZPCA 2AJQA 1H7XA 6FD1A 2LYVA 5AJ3F 4LF4F 3P5TL 1ELOA 4X4NA 1FE4A 2QE5A 3W7BA 3CJ4A 4ES1A 1N8RT 2QSWA 1FCAA 5HP1A 2CQCA 1Q86T 1KVIA 3V6JA 2RKIB 3AAWB 3GILA 1N36F 3V4IA 1VQNS 5L9NA 1DBDA 1JLFB 4NWBA 3ITHB 1TL3A 3BZQA 1FD8A 1MMDA 1J5EF 1ZPVA 2MZJA 4IH5A 2L3MA 2HMIB 3I82A 2OPSB 1R0AA 2VG7A 1P1TA 5HROB 2DHXA 4B02A 4RX6A 4N5SA 5AXLA 1JLGA 4MKAA 3KLEB 1VC6A 1SUQA 3DMJB 3KK2A 2E29A 5MLCV 2BOPA 4WCEQ 2EC0A 2B9WA 1B64A 5C42B 3BN4A 2K8GA 4IYQA 2ZD1B 2VOOA 2O1PA 4R0EA 5T41A 4FXDA 4HI2A 1WI8A 4IO1A 4TQRA 5K8MA 1DLOB 1D1UA 1UVIA 1WG4A 4NOHA 4MIBA 1Q8BA 4UQGA 2DGOA 3SI8A 3M6UA 4LVOP 3JSRA 2RQKA 2EFGA 1C1BB 2JL9A 3RB6A 3LP1A 5J1EA 3D28A 4CNYA 5GAHI 3PO5A 2IM3A 1KHVA 2B4UA 4C0OC 3G4SS 3DLGB 1SV5A 1VRUB 4IDKB 3OVAA 5L1IA 1IJFB 1YIJS 1X8DA 2DH8A 2D41A 4X84A 1H7WA 5EHHA 3M9OB 1HNXF 2DHAA 1SIWB 5F3ZA 2VFRA 1UFWA 1Z4UA 2F40A 2LDYA 2F9JA 2ZC4A 4QCLA 5D3GA 4KR0B 5E0OA 4RW9A 1X0FA 1TL1A 2RMLA 1R8AA 2J6TA 3BS9A 2ZM6F 1GT8A 1XR5A 3THVA 2O67A 3O5TB 3QAUA 1WTFA 1QE1B 2CQ2A 3T1HF 4DMZA 4KJIA 4K4WA 4K2XA 1NHUA 1VK3A 2FTRA 2GC8A 1HI8A 2GQCA 1VQ5S 4X4VA 5MAOA 4DBQA 3P49B 1VIXA 2VASA 3DRSA 5THWA 2C3OA 3RB3A 4IQMA 1L3SA 1X0PA 2AJ1A 5D4NA 2Q1LA 1T3OA 4DLEA 3V6DA 4ILLA 2E5GA 5DLGA 4KRWA 4Q0BB 3H5SA 3SCIE 2YWFA 4DFKA 3M2RA 4KIAA 3VQSA 4Q5VA 4ZPDA 1LWEA 3DLKA 3ISNC 4L6V3 4F2SA 5CHCB 2ASJA 2N3OA 1FRHA 4C8OA 2E5JA 2UVVA 2XC9A 3OV7A 1KLMA 3POTA 2K7KA 4HTJA 5F8MA 3BSNA 3OL8A 5KFRA 1RKJA 1IQTA 5B0CA 3OQ2A 3DU5A 2KM8C 3M9MB 2EVZA 3H5YA 2R8IA 4W92B 5B0AA 1QUPA 2UV8A 1VQMS 1YJTA 1DTTB 2CPJA 1HBMA 4DL5A 2KZZA 2LLZA 1RT1B 2B7CB 2LXUA 2R4FA 2RQCA 2PIIA 3M2UB 4QOTA 4NA2A 4QWDA 2K2PA 4GC6A 3OTBA 1G6BA 2NSCA 3HX9A 1GNKA 5CD4H 1LW2A 1XNRF 2IJNA 4NYOA 1JLAA 1OQ3A 5KAKA 1TK8A 1VQ7S 4C8KA 4ECUA 4JI7F 2IVFB 3QWUA 1Y0HA 1Y7PA 1UJ5A 2NSBA 4NLRA 4KB7A 2J9DA 2V94A 2L41A 1Y5IB 2XWXA 4C2MA 4I64A 5DQIA 2FJAB 1KOHA 2IVMA 4U7CA 1A6LA 1O5JA 1YGYA 1ZPWX 2A2DA 3H4BA 1ZH5A 1AROP 2OMLA 3RAXA 2AV5A 3W2VA 3C6UA 1ZZNA 2BM0A 1QAJA 4RWXA 2KG0A 2F9DA 3D1OA 2R9LA 3MMCB 3BF4A 3BGLA 2EFVA 4YR2A 4DLGA