1Y3KA

Solution structure of the apo form of the fifth domain of menkes protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3kA00
1R6YA 1TR0A 2W4DA 1V3ZA 1CPZA 1YJUA 2FTRA 2LDIA 3I9ZA 2N4CA 4NPOA 1SI9A 2OP5A 2QLWA 1Q4RA 2FHMA 3BM7A 4F67A 4A46A 1Y3KA 1FVSA 2OFHX 3KNGA 5B09A 2AJ0A 2K1RB 3HF5A 5A6WA 4Y2MA 3MCSA 2W4PA 1JWWA 2RMLA 3CJKA 1FE4A 5IXUA 4HH1A 1GXUA 1GXTA 4FNHA 1URRA 2LXFA 2PD1A 4OJ3A 2K1RA 3BB5A 1KVJA 5B0CA 1ULRA 3VTIA 2HLUA 3KG0A 2QYCA 4YDXA 2KT3A 1OPZA 1XBWA 2BJDA 2GFFA 1YRXA 1JK9B 4Y2KA 3IWLA 2ZDPA 4U9RA 2HLTA 5F0WA 2FB0A 3K7RA 5K9FA 1FESA 3IWXA 3BDEA 1Y0HA 1S6OA 1AFJA 1Y3JA 4OJGA 2W4CA 4ZA1A 3CJKB 2QLXA 1TL5A 1Y9OA 3QGPA 3HHLB 1Q53A 4DL0C 3TRGA 1OSDA 1MWZA 2HQIA 2LQBA 3KG1A 4DPOA 1FVQA 2AW0A 4A47A 2HFOA 1LQ9A 2BJEA 1YJVA 4ZOSA 1VQYA 4OIXA 1P6TA 3FGVA 1YJRA 3HHLA 3LGMA 2K7JA 3BN7A 3HDSA 2KYZA 1RJJA 1X7VA 2BUNA 4Y2IA 4A48A 2XMKA 4YEAA 5T7LB 1U7LA 2XMTA 2BBEA 3BR8A 3FRYA 3HX9A 3E8OA 2PGCA 2VV5A 5B0GA 4FNIA 1Q8BA 4Q2MA 1X0PA 3KKFA 3T9NA 1KVIA 5B0FA 2XMUA 1K0VA 5T7LA 3LO3A 4DN9A 2K7KA 2ASYA 1CC7A 5B0BA 2N7YA 2GCFA 3BF4A 2K2PA 2XMWA 2XMJA 1IUJA 1P8GA 1VQSA 2RU9A 1TZ0A 4EFAC 2HIQA 4HL9A 1FE0A 2IYIA 1Q8LA 4OJHA 3F44A 2GGPB 2Q3PA 3DXSX 2KT2A 2VH7A 3BGUA 1TL4A 1APSA 3WDOA 1CC8A 1OQ6A 1WD6A 1YJTA 2BYCA 2AJ1A 5B0DA 1QUPA 1N5QA 1FD8A 1OQ3A 2GO8A 2IFXA 2CRLA 2OD6A 1AFIA 3TNVA 2GV1A 2GGPA 2ZDOA 2EW9A 2G9OA 2XMMA 3HFKA 3LGNA 1TUVA 4HH0A 2OFGX 1N5SA 2JDJA 2AP6A 1N5TA 2HFNA 2ROEA 3MZIA 2OD4A 3FMBA 3HHLD 5B0EA 1W2IA 1FEEA 2OAUA 1N5VA 1MWYA 2IYGA 2RILA 2ROGA 4OJ1A 5B08A 5KAKA 4HI2A 3DCAA 3UDCA 4QOTA 1AW0A 2ROPA 2OKQA 1YG0A 2LQ9A 1X8DA 4HI1A 5B0AA 1SB6A 2KKHA 1S6UA 3HHLC 2ACYA 3QMQA 1SQEA 2FIUA 2GA7A 2OMOA 2RSQA 4NL5A 4Q2LA 1KQKA 3GZ7A 5F0UA 3TOQA 5A6PA 4A4JA 2N4DA 2QIFA 2XMVA 2L3MA
chains in the Genus database with same CATH superfamily
4DV0J 1CJTA 2HSEB 3MM8A 1OMSA 5J2MA 3MMCB 3R97A 5EX0A 2CVEA 2RE1A 1KBRA 4DR3J 2F1FA 2PD1A 4NLYA 4U9RA 3ENVA 3MM5A 2D3UA 3IC1A 3QSYB 3D3CJ 4H4MB 2EG1A 3UVJB 4PWDA 3LAKA 4QYRA 3GILA 5HQ8A 4KH0B 3RG6A 3B8HA 1RT5A 2RQCA 2YWFA 3NGRA 3LP1A 5T7LA 5KG3A 4RLEA 5BYRA 3H2UB 4X64J 1P1LA 4Y2CA 1NDKA 5I42B 4KGMA 4Q0BB 1NSQA 3P8BB 4CLWA 2WOMB 3IP0A 2QFJA 3Q8SB 1LKZA 4X4TA 1CVJA 4DL6A 2ZKTA 3MFIA 2GA7A 5KFBA 1UETA 1VQ4S 5K8OA 2V8PA 1KP6A 1FKPB 3KUHA 3HHNB 3P45B 3CD7A 1QTMA 5G0RA 2DNYA 4KYZA 2ZJRQ 1EARA 3PM9A 4CQ1A 2FHKA 3EICA 3GYXB 4Y6IA 1DQAA 2QX0A 4WYWA 1IBKJ 1TL5A 1Q53A 3TO8A 2J0SD 1S1UA 3Q8UA 2F9DA 3DYAB 2CQPA 3FGVA 5KOWA 5HBMB 3GFZA 1WWHA 4WCEQ 4DQSA 5KFHA 4IFYB 4MKAA 4ZP9A 2W2NP 3TQ1A 5H9FJ 4UOCA 2F5GA 1JB0C 3ITHA 1P9YA 2V34A 4A8QA 1X5PA 2JFDA 3JQJA 3C14A 4KJIA 1S79A 4ZPTR 4DV1F 3RGIA 2K8GA 4P72A 1FT8A 4R25A 1B70B 1N5SA 1UP1A 3HFZB 2UVRA 1T9WA 3H40A 3AD9C 2LQJA 1H73A 2IM3A 4O4RA 4LSLB 1H7WA 4HACA 4ZHRA 4OLPA 5L46A 2RRBA 5CH7B 1GTHA 1S12A 1B0TA 2MB0B 1VOMA 4GKKF 2UU9F 2DGXA 5C2GA 5EWFA 3QJPA 4MMOA 1RAJA 2RDDA 3OUYB 2XLJA 5L1IA 3JTPA 4ZCMA 1OY6A 4S0MA 4A8XA 4K4UA 2CWKA 1LW0A 5G4DA 2QTWA 1JLEB 1TQLA 4WKYA 4M8LA 4ZVQB 4DPUA 2BW7A 1P8GA 1I1GA 1S9GB 2M8HA 1E6YA 2OSQA 2IM1A 1XEZA 4RW8B 3GCXP 3GIIA 2GGPB 1HBUA 1J2VA 4ZMMA 4URGA 1VRUB 1PYOB 3VQTA 3KK2B 3DMJB 5EN1A 3ZZYA 1NZAA 3K5PA 1WELA 4B02A 3BQ1A 4IH7A 1H2VZ 5CZXA 4UQGA 3PNIA 3FRZA 5KFIA 5LSRA 3QQCD 4F02A 3MEGA 2Y0SD 2HHTA 3PYEA 1HWJA 3FBCA 5D0EA 3D68A 4AT1B 4MK9A 5GAGI 2DNQA 4PYAA 1CEZA 3T9ZA 2XB2D 3K8WA 3UQSA 1FFGB 2AYMA 1R8HA 2GJIA 4DUYJ 4MFBA 3TAQA 2LECA 4RW6B 3BBFA 1XQIA 3LQVA 1U0HA 1TUGB 5I3QA 2FC8A 2A2DA 1F60B 1IKVA 3PX6A 3QSIA 5B0GA 3J7YI 3IR6B 4JI6F 1TKDA 1T0TV 4KV8B 4NYOA 2N7YA 4J9PA 4DR7F 4C48A 2YKNB 2I0XA 2ZJQQ 3IAS9 5J2PA 1RYSA 2LA6A 2ACMA 1VCTA 2FGCA 2DHSA 4WYLA 5HSPA 4F3QA 2BRKA 2C1EB 3K58A 2OFGX 1M5OC 4YY3J 2P2CB 4ZJOA 1N8RT 3AXMA 4LRBA 1S48A 3H8YA 5DM7Q 2G0IA 2OPQB 2ACYA 1SQEA 3H25A 2EFQA 1M5VC 3TOQA 5DS7A 1HWUA 5F3ZA 1R8CA 1XR7A 2OEJA 1D1UA 2DGQA 3CJ4A 1HR0J 1M1HA 3RAMA 4PUOB 4OYAA 1N56A 4J7CA 4FNHA 2X7IA 4QIWD 2GMLA 1S1WA 1SUQA 2UP1A 2ZKUA 1BQMA 2MEWA 1U25A 2FB0A 2HZCA 2ZOGA 3G8SA 4F25A 2YNGB 4A47A 4AUKA 2CPYA 1RU2A 1WJ9A 3VQSA 1GFWB 1U1MA 2YBVA 2HHPA 3FZBA 4W4MA 4WWSA 4XAKA 5ETQA 4HR2A 5IT9Y 2M88A 3S01A 4RJVA 2E7WA 4RBVA 1MMDA 2W25A 3C3LA 2RNEA 1Q0NA 2GAGC 2C3PA 2YWHA 3GONA 4IRDA 4B9LA 4ZVHA 2JNJA 2UVVA 2GO8A 1FTRA 3ILIA 3KJVB 2DYAA 2DEJA 3A3OB 3MM9A 4GC6A 1X4CA 4ED1A 2QZ8A 2ZC3A 1T9XA 2FHJA 1FNMA 1RCXB 4QCLA 3D7SB 2ATCB 4J5OA 1I94J 3A8JA 2B9YA 3PO4A 4JI8F 2KU7A 1X4EA 4XPEA 1R89A 4L6V3 2OPPA 3D54A 3JSBA 1X9SA 2KRRA 3ZTQA 2IDLA 4W92B 4WJBA 3N5FA 5K20B 3DRRA 4RW7A 2CQ1A 5D77A 3IR7B 5DDQC 4UY85 3QBCA 2CQ4A 1WF2A 1BWEA 3HVTA 1T05B 2YNFA 1N0VC 4LF6F 2YX4A 2ZVIA 3PFOA 1G3OA 4RUBA 3RTVA 2HVDA 2H51B 4GKJF 1CQMA 1HBMA 2V94A 1F5BA 2JEGA 1IBLF 1F3FA 2M5YA 5KFMA 1SVDA 2G0CA 5HVFA 1YVFA 4M5JA 2CPXA 1F0XA 5GMEA 3MMBB 4N56A 5A6PA 3AOAA 4C11B 2KM8C 2ZUGA 3AB4B 1FX2A 4OL8A 1CLFA 1PIEA 4NLUA 4DFJA 3TX8A 1Y4ZB 4NXNF 1S49A 2HHXA 3Q8RB 1HYSB 2IJFA 3KDOA 3QLHA 5LL6d 2VG5A 2YH0A 2HZVA 1VC5A 2HWIA 5H9EJ 1WG4A 4ECQA 1F2HA 4FXDA 1P6TA 4O4GA 1PBAA 3T6BA 2XMKA 3PEHA 2ZUAA 3Q22A 2XMUA 2ASYA 1WHVA 2ABYA 5F8HA 2H5IB 2PO4A 1QAJA 1QTNB 1SC3B 3PCOB 2BKOA 2R2RA 2JLEA 4XK8C 3D66A 4OX9J 1SC1B 3HO1A 4OYBA 3NOGA 1Q78A 4F4YA 2GIFA 2FLPA 4I56A 4RUHA 3HSDA 2BKNA 4IUFA 3POTA 2XY5A 5L1JA 1RSCA 2MLYA 2YNIB 4GO5X 1NKEA 3EE3A 4B3TF 1JLFA 4Z7YA 4OZLA 1GXUA 2D9OA 4DF8A 4ES2A 3QAEA 2YXLA 1LW2B 3K7RA 2HAFA 1AYEA 3ZZRA 3UWTA 4HYKA 3IBWA 1MWZA 5M2RA 2OEKA 4KE5A 4ELTA 3KUGA 1RT2B 2E9RX 3B6BA 1N54B 3TZYA 3E8OA 2CQ0A 3KJQB 1KVIA 3GIRA 4KPCA 1TUWA 4Q8EA 4FS1A 2MZTA 4F04B 3DLKA 1PJ7A 4UW2A 1RAIB 2SXLA 3VZHA 2C2ZB 2V9KA 3E3XA 4ECXA 4KFBA 3I55S 1U2FA 3MECA 5GMDA 5C24B 5F0UA 2HWHA 4JV2A 2OO4A 1W2BR 3ILJA 3RBEA 2R7TA 2LVWA 3M6VA 4RWXA 4IOCQ 2LDIA 4K4ZA 2G2YA 1IN0A 4TVAB 1URNA 7FDRA 4KGVB 4PXCA 3R5GA 4L76A 5B09A 4DV2J 3LPEA 3FQKA 1RWXB 1K1SA 2VFRA 1F3VA 3K0JA 1KVKA 5IV3A 2HQCA 1RBAA 3CDAA 3WZ0A 2LQBA 3MPWA 1GTEA 4CI0B 1U1KA 4K4TA 3AODA 3OV7A 3G2XA 3MEDA 4Q44A 5LM7E 5IZHA 3OJSA 3L7UA 3J7ZT 4GVLA 3PW0A 3UW1A 2PFFB 3CMAS 4RWWA 1RT7B 3TNVA 5L8RC 3OBIA 3GFYA 3KLEA 1PJ5A 4C3KA 1TL7A 3KLHB 2E1AA 4AQYF 5B0EA 2ROGA 1YRUA 2HNYA 4YHHF 4WXWA 1C0TA 2N4DA 4O3PA 1B64A 1NDLA 4OHXA 4ZVTB 3H7HB 1S1TB 4P2FA 3ENQA 1X60A 4CLLA 2PDAA 4C0OC 1CJTB 4OJ3A 1S9FA 3FUYA 3G86A 2CG8A 2VG7A 1RADB 3MI7X 5FJ4A 3MPDA 1JKHB 4OV1A 3R3TA 3D6FB 5KFQA 4CO2A 1T95A 3DHWC 2OIHA 4X4VA 1M1KT 3UDVA 4DSFA 3UDEA 3H5UA 3F56A 4NXMJ 2BZ2A 4OZ5A 1BC6A 3H2VE 3WQPA 1U49A 1JLCB 1VQSA 4Q8FA 3L7OA 3AT1B 3V4IA 3NAHA 1HNWJ 3QIDA 2C2RA 4PRFA 5L9XA 3EZOA 2AT1B 2BYCA 1FDDA 1KSPA 1N33J 3KDNA 2L9WA 2VFTA 1RA7A 2UUBJ 2POKA 3TVKA 5A8WA 3GSDA 1VMBA 4YB5A 4FYWB 4LFAJ 2QLJB 4XTTA 4EEYA 2A0FB 4F4XA 4DUZJ 4ITSA 1NKBA 1YITS 2Q1LA 4P71A 1DLOB 4I2PB 2FJWA 2LA4A 2W2MP 3OFHA 2AJQA 5A76A 3ISNC 3IM9A 5LMNF 1IJEB 3DHXA 4FP9A 5LJ3Y 1LWFA 4KHMA 3D1OA 2J8AA 5MLCV 4PG7A 1NRKA 1YRXA 1ZZNA 5G0RB 1FESA 1RWPB 3OPKA 2DISA 4DR1J 5CAAA 2XNRA 3HHLA 3RR8A 4NA3A 3G82A 2PMZD 3BSCA 5HP1B 2HK2A 5M2PA 1L3VA 2APOA 2FDNA 3DDKA 3FRYA 2ZBIA 4QWCA 1IBMF 4ER8A 2UVWA 4OI6A 1CC7A 1JNZB 1GX6A 4ZPDA 2UXDF 3ILLA 4JBCA 3EGZA 2JEJA 1B99A 4E8UA 1D3WA 2FJDB 1VQ9S 3THVA 4B9TA 3C2PA 2XM3A 1OY9A 4FKYA 3C14B 3TZWA 3FFIA 3JQMA 3PRBA 4A8FA 4MT1A 4OZ3A 3N28A 2BE7D 4DSKA 2HQGA 1U26A 1SJFA 2GIQA 3VR1A 4DQRA 1S99A 4MJKA 1SKSA 3V6HA 1KEKA 4ZVFA 2B51A 1UWBA 5AE3A 2FTRA 1JLBB 2O66A 4RKUC 4EBDA 3V5RA 1FVSA 2E29A 3CJRA 4AD6A 4UOHA 5L39A 1PC4A 4TN2A 3G87A 3AA9A 1KVJA 3PKMA 2LQ8A 4ZHRB 3O8WA 3MF5A 2BMBA 3ZNUA 2XCAA 2BW2A 1SCJB 3NGUA 1N36J 3LPYA 1XNQF 1FRIA 1WDTA 4NLQA 2O01C 2HPUA 1JJ2R 2MQOA 2CJKA 4OYZA 2HVZA 5HQMA 3O6QA 3I96A 3Q83A 1XNRF 1HWLA 3VAGA 2IYIA 1YHQS 3DOMB 2VUGA 4FVCA 2ILYA 2MKIA 2V9WA 3V4MA 4KRWA 2RIJA 4B9MA 1E6YB 2HFNA 2O5DA 1QSLA 4Y34A 1S1VB 1HBUB 1P9QC 2GW8A 3J81U 4NL5A 3GZ7A 3VGSA 3Q2TC 5DDRC 4A46A 5IS2A 3MUVP 3FSIA 2KHCA 3CCMS 1JMTA 2VKRA 3FKBA 1RTJB 2D69A 4XDDA 2RU3A 4B3MF 4F4AA 4X62J 3MEGB 4MH8A 1LFPA 1HHQA 4JI4F 4P9SA 2XMAA 3VALA 3ETOA 3SMZA 4OJGA 4DV7F 2MZRA 4Z37A 2B56A 3JSMB 5K14A 2GQQA 4EGLA 1NSPA 4CLTA 3ELHA 5HROA 2HMIB 5GAEI 4UF4A 1RI7A 3KK3B 2NSBA 3B4DA 2EBEA 2EFGA 4AFFA 4XO0A 3CC4S 3BGUA 2B5JA 2PSZA 3EGNA 1GQEA 3BJYA 4K4YA 2CAJA 4DFPA 2JEFA 1ACMB 1LWEA 1TUVA 3PZPA 2BJ1A 1SH3A 1YRTA 3S7RA 1TMJA 1P27B 3KWMA 4JV0A 1FWPA 6AT1B 4KSEB 1XMOJ 1O51A 2B43A 3FVYA 1VRTB 2K1RB 5CHCB 5E0OA 4NRUA 4DR6F 2KXNB 2B9EA 2CPEA 2MKJA 4LR7A 5A8RB 3GYNA 4PQAA 2OHDA 1BQMB 1NCLA 1RAEB 4CDIA 2QSWA 3MR2A 3THTA 3I87A 3AJ2A 2BUNA 2RUGA 1HNVA 5KT3A 2CNKB 3HD1A 2V0NA 4K0KF 2CPIA 1JJ4A 3EVWA 2YQ0A 4DN0A 4ZVOB 1RDRA 2VASA 2W9CA 2QMWA 2AJ1A 2LCWA 3PACA 2UZAA 2IFXA 1QAIA 4QWDA 2Y3YA 4QBUA 4LIWA 4LF4F 2Y8YA 5F3TA 4LREA 2OAUA 4V19X 4OX6A 3LWLA 3M2RA 5CYQA 2R8GA 4Q2LA 2DO0A 3H5YA 4WP3A 1Q5VA 2MXYA 2JZ5A 1ZPVA 3CJQA 5CYJA 4IQXA 1NDCA 2JSXA 3PFEA 3ULHA 3EXCX 3MM7A 2DITA 3IGVA 3H5XA 3CCLS 4WE1B 2EXUA 5D4OA 2VPWB 1T03A 3EWGA 1IR0A 2RQKA 5F0WA 4P2MA 2RB7A 2DGVA 4ETZA 4EK2A 2QGFB 4RNFA 4LJMA 4KGZB 3HLUA 4WK1A 4G1IA 4HDHA 4IG3A 4DR2F 1N6QA 3DRRB 2VDIA 4LRDA 3TZZA 2IPOB 3BN4A 3RRGA 2WCXA 3SYZA 2HHUA 2A2CA 2A1BA 4WFNQ 1REGX 3OTEA 1EZZB 2R7UA 3KMQA 4C8ZA 5C7PA 2AJ4A 3DLEB 4KO0A 2BQUA 1WI8A 4UQTA 5KAKA 2WW4A 2J5AA 4LF7F 3X3UA 4YR3A 4FVMA 2XQCA 1HPZA 1M5HA 2FVPA 4OYMA 3M9OB 1VJWA 1SJ1A 2CJYB 5T41A 4DV1J 2GIRA 2GQ2A 3LGHA 2KRBA 4RUAA 1WKJA 2OEMA 1A0OB 4CH7A 2IAJA 5E3PA 4EI2A 4F0MA 2ZOFA 2BA9A 4A8KA 1LK5A 2CNNB 1AROP 2QV6A 2CPJA 3BSOA 2AX1A 3QLHB 2VG5B 1CSJA 5IWAJ 4Y2IA 1UL3A 1D09B 2VV5A 3QFWA 1IJFB 3NGTA 4ILMA 4GKKJ 3C6TA 2UU9J 4O4GB 3ZZZA 3L3CA 1UCNA 1TL1B 1UJ5A 4BCAA 4G1QA 4NLRA 4WFAQ 2AEFA 1KLNA 3D2WA 2DNPA 3EPGA 1Y5LB 4JI7F 1WORA 2KI2A 5DZ6A 3DOLA 1CQNA 1S1XB 3HHLC 3QMQA 5AE2A 4WIIA 3KJFB 4DV5F 3PDNA 2Z30B 2B3TB 2BOAA 4K4XA 4K4VA 4DR5F 4CTAA 1MN9A 4OHVA 1TMMA 9ATCB 1S5ZA 5KFRA 4N8NA 2UXCF 1NJXA 3CO9A 3GR0A 2V50A 4NWBA 5HMWA 1FA0A 4QJVA 6FD1A 1IQTA 2UUWA 2Z4PA 3CCZA 3I5BA 4CYUA 5KFAA 1ZM2A 3T19A 2N3LA 4IOBA 2PGCA 4M95A 1V3SA 1YLXA 1NSAA 3N01A 3NNAA 1QM9A 2CNLB 1FDBA 2LQ5A 1R7IA 2ZE2A 4DV3F 3I4PA 3IN5A 1UVMA 2QL5B 1EHWA 2DHXA 3MZIA 3P96A 4YS2A 4JI6J 3GIMA 5LMUF 1R0CB 4NZ7A 2C42A 1MW7A 2W2PP 4KFBB 4DR7J 2IA6A 4YUDA 1VC6A 4OFZA 1BHNA 3VGUA 3ZC4A 2GMJA 3CW2C 4ZVEA 1RTZA 5GAEU 3VHQA 3QZ8A 3NNHA 1AA1B 3VCDA 4WZQA 2V69A 4ES3A 1DAXA 2HLTA 4CWBA 1X4FA 3W2WA 2QLXA 4CZCA 1FNOA 3OR1A 4TNOA 3W7BA 2NXNA 4DG1A 2O67A 3CF5Q 3ET6A 3GR1A 3NS7B 2PT0A 4USWA 2Q79A 3NCPA 2Q43A 2GHPA 3GG1A 3HM9A 1UFKA 2XMWA 4ZP8A 1XN9A 2RKIB 1NB7A 3C15B 3OLAA 5D78A 4OYWA 1S6QB 2B8PA 2Y0BB 9RUBA 1AFIA 1D9AA 2CPZA 1JIHA 4IKAA 4I67A 3HD2A 2IYGA 1KKHA 3JYTB 4B3RF 4HI2A 2BRLA 5AJ3F 3CCJS 3MR7A 2J9DA 3C16B 2P9CA 2UXBF 4A4JA 4X2BA 5D3GB 5F8LA 3HK2A 4CLKA 2ADCA 3CEDA 2R7OA 3D1QA 1EP4A 5KFVA 5B0CA 4CO1A 3W63A 2YVSA 1T8EA 2GVZA 3MM6A 4H4OA 4R8UB 1HQUA 2YWEA 4DL4A 4JI8J 2DR5A 1I5OB 2RQMA 3BGRA 1LXJA 2FVCA 2VG7B 3TAMB 1RWUA 4PXBA 2LMIA 3D5MA 5ETSA 2HGMA 2VBYA 2E5IA 2YH1A 1U09A 2C2NA 4OZ1A 4QWBA 3MAQA 4C98A 4ICLA 4DPXA 2IBOA 3TX0A 1TL4A 2ASLA 1YJTA 4L75A 1TU0B 2HNDA 2DNMA 4ZCIA 2Y1RI 4DUTA 1BWVA 3P5TL 3BV8A 4LFCF 1HNXF 3AA8A 1M90T 3UN5A 3UN3A 1LWCB 4DFKA 1RABB 3KYLA 1TR0A 2HFSA 4Y3CA 1SV5A 4DQQA 4GKJJ 5A8WB 1YSJA 3OT9A 1AXQA 4KAIA 3HXMA 5C25B 1SXLA 1YIJS 1IBLJ 5C42B 2FJXA 4KHPF 1MG7A 2MDAA 4C4WA 4PG4A 2ZH7A 3IFEA 3JQKA 3M2VA 5HMXA 3W60A 1LEOA 3H5SA 1TFYA 3VAIA 3SQOP 1FXDA 2QL9B 2Q6BA 1RTIA 1AUDA 4NXNJ 4H4KC 1Q86T 4O3RA 4A8YA 1EAYC 4DR4F 2KHDA 3TA1A 3G82B 4J9QA 2DH9A 1RLDA 1CULA 3NCQA 2MQMA 2AKWB 4P10A 4V1Ak 4LRFA 3CCWA 2JEIA 1H0HB 1SJ4P 2UVUA 3GB0A 5C2CA 2ZC4A 2M7SA 3GJQB 2KYXA 3M30A 3SQGB 1MN7A 1RHKB 1X5SA 2A6OA 1Q7YT 3FFIB 1RHMB 3TWZA 5EHHA 3T5JA 5HATA 3HKZD 4L3KA 2EK6A 1K0TA 3LP0B 3KG0A 2QYCA 3RBZA 3SI8A 3T1HF 3R5CA 2MYFA 5EX3A 1X31C 2IVFB 3FDSA 2BQRA 2C22A 4J9LA 5HQLA 2IM2A 2CQDA 4OLOA 4B3TJ 5GADI 3CMQA 2XMTA 3KLFB 1RT3A 1V5VA 3I32A 1NHUA 2R9LA 1AB8A 4U7UD 2BJ8A 2YPZA 1GMWA 3JSYA 1X9WA 2HVHA 3LANA 2DXEA 3DDNA 2XZTB 3MEEA 1NB2A 1FD8A 4UZBA 1CJUA 5SUHA 2UV8A 5IFMA 1U8WA 3LP2A 3PRDA 1FO1A 2DNZA 1KTQA 2K06A 2CUYA 3OTOF 4EZ9A 3VVTA 2LQ9A 3TEHB 2VG6A 3FSYA 2HRYA 1ROFA 4LF1A 4PABA 2EFPA 2RF2B 3FCVA 2CPFA 4IFVA 1JLAA 2DTJA 2KH9A 1HNZJ 2MSSA 3G71S 1WTBA 2J6UA 2V2ZA 1NJYA 4X4RA 1GX5A 3GLJA 3KHRA 2BACA 4HEA9 5T14A 2ZBPA 1VI7A 3IRXB 3B78A 1DFDA 3FEXB 3DLLQ 4NZ6A 4TY8A 4DL0C 1A9NB 4LSNA 2DNLA 3QRQA 1AT1B 1MSWD 1VGYA 4FN5A 4M5NA 4U7UK 4NLSA 2Z58B 4F3MA 3RJMB 4ECUA 1IKWA 2RJZA 2ZH4A 3CVKA 4Q2MA 2ZJPQ 2OGUA 4IR1A 2WONA 3PIPQ 2DH8A 2YQ3A 4I6YA 2KTQA 3KHLA 2GC8A 4DQIA 2NPIA 2XHWA 5DG8A 1X4DA 1SL1A 1BLUA 4I6WA 1EIYB 3MUMP 2FY8A 2PEBA 1S57A 3U1MA 4ECZA 4DEZA 2J0QD 1QE1A 1LWEB 3OTCA 4ED2A 1H2UX 3IA0A 3OSPA 3IGNA 1IKXA 2CQIA 3HSGA 4YN3B 5MAOA 4ZKAA 5EGYA 1QLNA 1RWVB 1JLGB 5CXTA 2C28A 1GXTA 3OQ2A 4ANDA 4Q7AA 3BB5A 2HLUA 1N5YA 1FCAA 2PI4A 4YHHJ 3Q8VA 2KDOA 4J9UE 2FZGB 2C2DA 2BV3A 2OELA 2Z0GA 2D1CA 2VC1A 1RT1A 2XC9A 3TW0A 3I6PA 4DMZA 4M5DB 2W1BA 1UPPA 2PMHA 3QJJA 1S0VA 4E2FB 1U1NA 4HL9A 2PC6A 2N7CA 3HVRA 4ZK7M 3MUTP 1RKIA 2EK1A 2QSFA 4RW4A 1HA1A 2Y9HA 2DCUB 3DRYA 4IOAQ 3CMES 3A12A 3GIJA 1V3RA 4P74A 2HFZA 4AXJA 3PEJA 3QT7A 5IM0B 1RT6B 3BH6B 1TAQA 4M5KA 1W25A 3T5HA 1XJWB 3CJ0A 5ETPA 4P75A 2BQ3A 4I64A 1IM6A 3BKUA 2PIIA 4KQZA 4DWIA 1GXLA 3FJ2A 1OS5A 1D9DA 1LQ9A 3M32A 1BGXT 2UUAF 3M2UB 3M05A 3W3SA 1F9EB 5F8IA 5LMNJ 4L3NA 1RJJA 1UTAA 2HS4A 2DR7A 1CG2A 3TANA 1UEVA 2GVDB 1SJQA 1X5TA 1N6QB 1UA1A 3TUPA 2BANB 3QGIA 2EG2A 1FE0A 2ZHBA 2JOQA 4PQUA 5DLGA 3TUJC 2FJBB 2VZ9A 3PYFA 3J7Z5 3H0PA 4C8NA 1MU2B 4I2QA 1HLWA 2V63A 3WIUA 3K5MA 2U1AA 4GC7A 4ECVA 3FMBA 3NP5A 4UOFA 1HMVB 1IBMJ 4B9SA 4ID8A 4Z2XA 4PXEA 5M2UA 4JB8B 1H6KX 4DFMA 4A8SA 3E01B 3AB2B 4DR3F 1S10A 2BE2A 3MPYA 3W5YA 4CLZA 2E5HA 3R5BA 2HRTA 2KXHA 1X4BA 5IQ6A 1HPZB 2MY7A 3T5KA 1DTTA 3HI9A 2ZOMA 2GFFA 1PYSB 4U67Q 3HFVA 1MMNA 2QT7A 3W2VB 3BBCA 4UT4A 1HWKA 2LKZA 2HRUA 4KR0B 3TRGA 2B9WA 4K2XA 1D9FA 3B4MA 4CO3A 3IXQA 4P7VA 2JFKA 2NQPA 1YQHA 3CC2S 1F1BB 2DVIA 4B3OA 4PYDA 2HK3A 2YWGA 1S0NA 1WOOA 4OZNA 2IMWP 3MMAA 1C0UB 5H9FK 3CUNA 3PHEA 2L9DA 2KZZA 5HLFA 4YOEA 1VLYA 1XNQJ 1YWXA 4EWTA 2GQCA 3EDRB 4LBIA 1WSRA 4FXVA 4RNHA 4ID5A 3QGGA 3PJ9A 3OL7A 2H48B 3TVYA 1HQEB 2DNKA 4U8YA 1XNRJ 2XMVA 1M1GA 1CPZA 4ILRA 2A10A 1UEKA 2MQPA 1SPBP 5FLXY 1MROA 4V19J 2OPRA 2KFZA 5KFZA 5KFJA 3K5LA 4R0JA 3OFEA 2QC3A 2E5LF 3WBZA 5KG7A 1HBNA 3EUNA 4B3SJ 1BQXA 4NOHA 2BJEA 1S59A 4C9DA 1H7XA 4F0HA 3J81j 2QMXA 2EVZA 4B3MJ 2OLWA 2P8IA 5B7WA 2D3OR 3A3NB 1B4SA 3M8WA 4TLRA 1RTHA 4JI4J 1TKTA 4DV7J 2Y8WA 3KMSA 1PJ6A 1CJKB 2X3GA 4LF8F 2ALYB 1S7HA 2G9OA 1RUSA 5RUBA 1REVB 3MPVA 4R5PB 1KS2A 5ETVA 2X1GA 3FCHA 2F63A 1NJZA 3NLCA 4XDCA 4LSZB 2QIFA 2EFOA 1KHWA 1PGZA 4I1TA 2OPSB 1HHSA 1WOSA 1AUSL 3EYZA 1FXLA 2IVMA 1VISA 4CO4A 3H90A 1J5OA 3M1VA 1UFWA 4DPWA 2MQNA 4GVBA 1ZA1B 1E6VB 2ZD1A 2QE5A 1C1BA 2DGSA 1UEUA 5J2QB 1WF0A 3SDEB 2J9EA 5F41A 4NA2A 4DR6J 1NK4A 1RAFB 3MGJA 4ZVGA 1ZTTA 4YDDB 3ET6B 2Q3PA 3W8PA 2MZSA 3DGPA 1FEHA 4QWEA 1HIYA 4QIEA 2IA0A 1AZSB 3CDWA 3W8GA 4E0DA 4KH1B 3KFWX 4JI1F 1FJEB 1KFSA 3HJVA 1YG0A 4K0KJ 1SC4B 1SB6A 4NCGA 1T11A 4TU8A 4ECRA 4JUZA 5E3QA 1QAYA 4WTOB 3NG8A 3S1TA 1XR5A 2VJVA 1CBKA 1RWOB 3DRPB 1C1CA 3MTJA 2M70A 1WKKA 2ZDPA 1UZDA 2AMCB 1PG5B 2W2OP 4PAAA 2ZITA 3QGPA 8AT1B 1OO0B 2IC3B 1EKSA 1YK9A 3PV8A 1HQUB 4PZVA 3DI6B 3NOCA 4YEAA 2XG8A 2MZ1A 2LEPA 2YKMA 1U47A 3BPDA 4USIA 1Y11A 2ZVSA 5DQIA 3NNCA 2MZJA 2YNHB 3MCMA 2HS3A 1FD2A 4C8KA 3EGWB 3NRBA 2OD6A 4K7QA 4ZLLA 2I6WA 1H72C 2E5GA 3UDCA 2ASDA 2EKYA 1UAWA 3RBDA 1HKAA 3MCOA 3G6VA 2CVIA 5KFCA 1YJUA 3NAIA 1R6VA 2FJVA 1RA6A 2VBWA 4DL5A 3B54A 3SCLE 3H2LA 3MMCA 4MTPA 1D8YA 4JV1A 1N4LA 1S4EA 4C3LA 3ZZOA 2R2SA 3MR5A 4F26A 4F2RA 2HS0A 2BXJA 1QUVA 5L1KA 3I0RA 2MGZB 3UVJA 3O1LA 4J9OA 1Q8BA 1OJ4A 5D4NA 1PKUA 3NMRA 3M9MB 2HHQA 1HNIB 3CC7S 3W64A 1SKWA 1S0MA 2AWZA 1H98A 4K5RA 4JP8A 4DDFA 5I42A 2ROEA 3GFXA 3G6YA 2F4VF 2WOMA 1CULB 2QA4S 4NLXA 2FGOA 2V4JB 2NR0A 3GP9A 4G3IA 3B82A 3DGVA 2W4DA 3DU5A 5KFNA 3Q24A 1TKZB 7FD1A 3IS9B 5KTQA 3QAUA 3UD5A 2G4BA 1DQ8A 1VQ7S 1KN6A 3W1YC 1ICEB 1FKPA 4DU7A 2HBQB 1JWWA 2IMOA 1URRA 4JI3J 2DRDA 3VTIA 4JI7J 3R6LB 3EM1A 3L95X 3MFHA 3PW7A 2ZH3A 3ISND 4DV5J 3OLBA 3VAMA 4WP9A 2W9AA 4NASA 2XLIA 4BHQA 4DR5J 5D0HA 5FDLB 5JJBA 3DYAA 5H9EK 4ZCKA 3DRSA 4C3MA 5HBMA 1Q82T 2UXCJ 4P6QA 4IFYA 4FNIA 2FHJD 1CJVB 5J1NA 3RRHA 4M94A 3FEYB 3D67A 4CCHA 3R9LA 3UR0A 1RT3B 4RBUA 1N5QA 4NEYA 4O3QA 1ZM9A 4ED7A 3DU6A 3H59A 4I68A 1FEEA 2IRXA 2W7PA 1CJUB 4WFZA 2OMOA 1GH8A 1Y5NB 3I9ZA 1O5JA 2DNOA 1QSSA 1WKLA 4DV3J 3EX7B 3MCSA 1JLQA 4LSLA 1S6PB 1SH0A 2I5JB 4ZVRB 4DSLA 4B9NA 1FKAF 4J90A 5LMUJ 1T3OA 3J7AN 4H54A 3UCUP 4YR0A 4OHYA 2XS5A 2Z2LA 1VQYA 2HG4A 4ZLNA 2JLFA 2V4QA 5LXYA 2E44A 2FY1A 2IBKA 3CIMA 1KNZA 2Q6CA 1FKOA 3RAQA 1JLEA 2L48A 1IKWB 3DXSX 2CQCA 2VH7A 1OQ6A 2W9BB 1S9GA 4K4WA 3OR2B 4ZS6A 1BMQB 4RW8A 4IG0B 2VQEF 2GGPA 4L74A 1EETB 3MMJA 4CM2A 1R0AB 1VRUA 2P6TA 2Z8QA 2WVCA 3DMJA 1R3NA 5KFLA 1ELOA 1IM4A 4K59A 4LVNP 3C6UB 1NBEB 2CPDA 4TYAA 2H4WB 2MKCA 3SV3A 3P3DA 1IKXB 2KVIA 5J2NB 4B3RJ 2BJDA 5AJ3J 2UXBJ 1VK3A 4DX7A 3Q89A 4OI3A 2MQ8A 5KT5A 3QJLA 1N5YB 4JI2F 2DR9A 2K7JA 2FLLA 2WSFC 4K4SA 2XCPA 4RW6A 5J1EB 2LEBA 3JB9k 2DGTA 4DV6J 2BABA 3KHGA 2VFVA 4HHUA 2ZNYA 3BGLA 3HJFA 3R7BB 3MDFA 3N9UC 4KV8A 1IVZA 2QG9B 4QIFA 1QUPA 2YKNA 4EU0A 3KK1B 3W9HA 1PO6A 1K47A 2J9DE 3M8RA 1KQSR 2DRBA 1X8DA 3FC9A 3HSZA 2X1AA 2VD3A 1S6UA 3D9BA 2Z2YB 4I0WA 1ZM4A 3R1HA 2MSTA 2V67A 4ZPAA 2MJUA 1DURA 2OPQA 1S0OA 2OH2A 5ETNA 5FLXU 4NI2B 4NE9C 5E3CA 4PUOA 5J1PA 2NXEA 3MAAB 3OTBA 2GZOA 4LFCJ 2R7RA 1HNXJ 3R6GB 4X4PA 4IO9Q 4KKOB 1H74A 3ZTRA 2LDYA 5KT7A 2HQIA 5KFSA 3I56S 2V2QA 3AY0A 2YNGA 1DBDA 1EKRA 2BBEA 4KHPJ 1KDNA 3T6JA 5A8KB 2GCFA 3K5NA 1RGVA 2X3DA 3OHBA 2M8DB 1OWXA 3NEKA 4DPYA 2CA9A 2BX6A 2RH3A 2CFXA 1FFSB 3RRKA 4NMXA 5L1LA 1UA0A 4NLOA 1QD1A 1N5VA 4DR4J 3C46A 2ROPA 2WRMA 3UO0A 1RBLA 4I7FA 2JRSA 2HURA 3HT0A 2KKHA 1ZYQA 2HNZA 4OZ0A 4DX5A 1TKXB 2HHWA 2V2VA 5A0YB 4X84A 1RU1A 1NHKL 2XY6A 4ANEA 1SJRA 3PKYA 3QO9B 4ED6A 2NYHA 2WVEA 4P7TA 1WC6A 1Y0HA 5CYMA 2ZHAA 1HW9A 3V81B 1FRLA 2M4MA 2LEAA 4OIXA 1ZA2B 4YB1P 1FJCA 4CLFA 5DQGA 5HAOA 1F5AA 4USMA 5GMKa 3T1HJ 4KGXB 3BS9A 1T05A 1S9EB 1IUJA 3V6DB 2C3MA 2RUSA 4HTIA 1N33F 4D3GA 1RAAB 1U45A 2FVQA 3R5JB 3MTKA 3US5A 3LGNA 4B17A 2VDHA 2IVYA 1T3NA 1K8AT 4F3OA 3IR5B 1WOPA 3RB0A 3QWPA 5B08A 3BEGB 4OYIA 4P2XA 2CYYA 3CCQS 3PR5B 1A7GE 4B08A 5F9NA 2XI2A 3RR7A 3CDBA 5F9LA 1HI1A 2EC0A 4C11A 2QLBB 4IDKB 2XGPA 3PVXA 3IBCB 2CIMA 1ULRA 4HKQA 3OTOJ 1M0SA 3JTOA 3NBPA 2C2OB 1MROB 1HYSA 2YKOA 2I8EA 4ES1A 3HP6A 2E7XA 1RZMA 2YX1A 4DHVA 4DBQA 4N47A 2HVIA 3G96A 5JVHQ 4J9RA 3QIPA 2VU5A 2LP4A 1RP5A 4LF9F 4L72B 2KN4A 3DM2A 4AL7A 2WSCC 1YGYA 3OTDA 3M8QB 5KG0A 2R2TA 4DV4F 1MWQA 4ELUA 2QLFB 4C8YA 2MLZA 4X65F 2FJAB 2YKQA 5KT6A 2CG4A 2YTCA 2HBYB 1RTHB 1TKTB 1WDDA 2J76E 1R27B 3PG9A 3U27A 1RWMB 2JWNA 4UZCA 3CCES 5GVQA 2LU1A 1BQNB 2WVDA 5BYQA 3U1LA 2RDIA 1EJ7L 5JUMA 1RISA 1VQKS 3MWBA 3TYTA 5HMZA 1DJ0A 4RU9A 2AZ1A 4BDPA 3JTNA 1JNRB 1NZ8A 2DH7A 4U96A 1L3SA 3ILOA 3BDEA 2QL7B 2DK2A 2W4CA 3M1VB 4DS5A 1OSDA 5H1SV 1N36F 1VRQC 4LMZA 4NLVA 1WTFA 2DRAA 1WC4A 3QT5A 2DY9A 5DETA 3PX0A 4C8LA 2Y1IA 4USTA 3PW5A 3CD0A 1W26A 4P73A 1RT2A 1HBOB 3NWRA 3ICLA 1B7FA 3F73A 4OI2A 1NJWA 3AQPA 4M5MA 3TUZC 3L9ZA 1NH7A 3RB6A 1O0PA 1VQNS 3NS5A 4PWUA 3I9V9 3K2YA 1KHVA 1FRXA 3DFEA 3DGPB 4BWMA 3KJNB 3MM8B 3OD2A 2DHHA 2MQQA 2UUTA 1FRMA 5J2MB 1Q4RA 4OV6A 1ZS6A 3HF5A 5ETOA 2YKAA 1HARA 2RRAA 4I69A 4MK8A 5HK4A 3MM5B 3R2CJ 1GEHA 3LALA 1JK9B 4NLWA 5KFFA 4PWDB 2R7SA 1NDPA 4ENOA 2KM8B 2FLOA 1RT5B 1UJ6A 5HL7Q 4IQMA 2COLA 2XTJP 3LP1B 5T7LB 3HSJA 4KBIA 1F6TA 3M6XA 2AYBA 1HI8A 4N5SA 2MY8A 2I9SA 4ZIWA 1JJHA 7AT1B 1WSVA 1VQ6S 4EO6A 4O3SA 1U4BA 2UUAJ 2CRLA 4F4WA 4FPRA 4TQSA 1RT7A 3KXDA 2DNRA 1HQ2A 1MWYA 5D8HB 4GMKA 1T02A 4ED8A 1RQ0A 2FYXA 3K89A 3KLHA 3HHDA 2Z56B 2BM0A 2FC9A 1UWAA 1Y00A 2OP5A 3NGDA 3TI0A 3RB3A 4CLPA 1DRZA 3MOZA 2FLNA 1TV6A 3WHIA 1VQOS 1NLKL 4WZMA 1S1UB 4M63A 2W8LA 1S6OA 3VV2B 3DXBA 3ONQA 4DLEA 3HZGA 3MPUB 1FJGJ 1JKHA 2FZCB 3N6MA 4ALZA 2W2QP 2L08A 2CQ2A 3ITHB 1RHUB 2ZHOA 1JXEA 1WC5A 1ZPWX 3D0GE 3EVMA 1RTDA 3G8QA 4BBYA 3I0RB 3PW4A 3M8SA 2B4PA 3T1YF 2AQ4A 1TK0A 1SC6A 3CIZA 1YZ7A 4J9KA 1JXVA 4OI4A 1APSA 1ITPA 1JLCA 1RHJB 1VQ5S 1B0PA 1HFEL 2R42A 3QGHA 5A2QY 3CCUS 1FRKA 4USHA 2CJAA 2QO3A 4X66F 4HDGA 5I4MA 1C4AA 4HACB 2DGOA 2R3VA 1R6YA 3LW5C 2LXIA 2N4CA 4OYXA 1DLOA 4I2PA 5DG7A 3GSIA 4N41A 5HJYA 2CQBA 2RS8A 3GE9A 4I6AA 3DDIA 5IT9U 3A13A 1KLMA 3V6KA 1LW0B 3CO0P 1YJRA 1WG5A 1U1OA 2DGUA 2AEJA 2MKKA 2QA2A 4IH6A 4XIUA 3BR8A 4CRJA 2HHVA 5HP1A 4TLQA 4MYTA 1U6BA 2AU0A 4W98A 2E5LJ 3ENWA 3UR3C 4O23A 5BR8F 3R7SB 3DRSB 1U6ZA 2I1RA 1QVFR 1WD6A 4QR1A 2JDJA 5D6GA 2U2FA 3T5LA 3DLGA 5ETMA 3BZQA 3TJ8A 1AW0A 1FDAA 3PYGA 1QY7A 1NPRA 2D41A 3NCRA 4LF8J 1BXNA 1JLBA 2WTFA 3DNCA 2C2MB 4MFBB 2ZNZA 4WPAA 3R2DJ 1G1XA 2IM0A 1VBKA 4F4ZA 1JLQB 1U0HB 5KT4A 2K3KA 1IKVB 5IWAF 2ZH5A 5BJRA 4ZOSA 2ZH8A 1SQFA 2V68A 4JYAF 1O8BA 1X7VA 2WK4A 3BH7B 3OXGA 2EWHA 4OX7A 2Q66A 2IRUA 3E51A 2GO9A 2O1PA 1BE4A 5J2PB 4LQ3A 4ED3A 2BJ7A 4C97A 1Q8LA 1FNXH 2M0GB 2H3EB 1J5EJ 4AYBD 2NS1B 1XMQF 1FKOB 2NLWA 2XMMA 2QMUB 2EI5A 3DOMA 4OJ1A 3GV7B 5JVGQ 3EZUA 1S1VA 1W7WA 2AF6A 1X4HA 4BLGA 4ECWA 1UVJA 4ED4A 2FHMA 3C8YA 2CQGA 4URQU 3UD3P 1S1WB 1SUQB 1XK8A 4C8OA 2AD9A 4K8RA 4NLTA 3RW7A 4DCJB 1VQMS 4JI1J 2GHVC 1I51B 1RTJA 3ZNJ1 2RAQA 3SSSA 1EQ0A 3W5XA 1X4GA 5LJ5Y 3C66A 2CJXB 3DLJA 4HT7A 4DZ6A 1ZBTA 3FBFA 3GQCA 4LBHA 2BE9B 5LSOA 1NK7A 5SZTA 3JSMA 2E5JA 3OFGA 1KFDA 1XTZA 2XHCA 4X4OA 1YTYA 5D4LA 3WC0A 2HMIA 4ED5A 3ETMA 3GYGA 3LTOA 3KK3A 3W62A 3OL9A 3AJDA 4QPTA 3MM9B 3GV5B 3I4HX 1WF1A 2ZDOA 4OZ2A 1Q8KA 3DRXA 1RK8A 2Z2ZA 3U02A 2ZH9A 2EKNA 3U7JA 3GU0A 1NM2A 4DU8A 2H9ZA 2OPPB 3DKDA 4U6PA 3R1LA 5DGBA 4WK3A 1V9OA 1WEYA 4LVOP 5DG9A 3L7PA 2M52A 2ZBRA 4A8WA 4RW7B 3FK4A 3VAJA 1VRTA 2K1RA 4CIOA 5KG5A 2KJWA 4RR5A 3VZIA 3I31A 4R0EA 3CCTA 2WVFA 3EVOA 2CKWA 3CCRS 3HVTB 1YJ9S 5A8RA 1FVQA 1B7YB 4Q45A 2YNFB 4USUA 2ZWOA 2DT9A 2DKOB 1Q81T 1ZZFA 3KKFA 2XO7A 1U0SA 1XERA 3RAXA 4AL6A 1HBMB 4ETXA 4ECTA 1KWMA 3QNWB 2DXDA 1VLOA 1U48A 2YWKA 1PAUB 2J7UA 4QIGA 1RLCL 2JH3A 3THPA 2XSJA 4RW9A 4K2JA 4MKBA 5ADZA 2KT5A 4N77A 3IWNC 2KXFA 3K8VA 2HGNA 4EBCA 1FWLA 2ZH2A 1RE1B 4KPYA 3N4WA 4WP8A 4G6VB 1UPMB 3EJMA 2JVOA 5HMYA 1M5SA 3N5BA 2BDPA 2B6AA 1ZTWA 2GJ2A 3KNGA 4I7FB 2IIHA 2W4PA 4NZ0A 2HNZB 1Q7LB 3DLBA 2F4VJ 3J81Y 1PILA 3IG1A 3IWLA 4WE1A 1K9MT 1ZOTA 3AAWB 5LXRA 1Z2LA 2C3OA 1N32F 3Q8PB 2QJ3A 2XYPB 1VQPS 5CYMB 2B0GA 1NJIT 2WZ1A 1U1LA 3OW2R 2V8HA 4MIBA 3HHKA 2V8VA 2PN6A 2OJ3A 3BF4A 1FK9A 1T9VA 1U02A 2PMWA 1IWGA 4QU6A 4ZN3A 2FVSA 2GAHC 5CQGA 1X4AA 4ZDNA 4QW8A 2D7SA 4Y00A 1R31A 4ZPCA 3I82A 1HHTP 3POTB 1YJNS 1JQGA 1TL3A 4FYVB 3DLEA 2RSQA 1Q95G 1FF2A 1MLAA 1JLFB 1U6FA 5E7OB 3TZXA 4CO0A 2P9GA 2Z57B 1SKUB 1JXLA 4DI6A 2RVJA 5AXMA 3ZTOA 3QT8A 2NPFA 1TFWA 2YQ1A 3NBPB 1V5IB 1YJVA 1WEXA 1RACB 2UV8G 5LOQA 4ZLPA 4WTYA 2WBRA 3SIPB 2J7WA 3DLKB 1EB0A 4USVA 4WIQA 2J6TA 3QIPB 4QWAA 3BQ0A 3RBXA 3DM2B 1X5OA 4RZRA 3WDOA 4OMFG 2HHHF 4B9UA 1OQ3A 4PEOA 4X4QA 1TL1A 2CDRB 3KLGA 5KFTA 2NUUG 5HVGA 3VF0B 3MECB 3QYYA 3UI3A 3MCNA 3KG4A 3Q23A 2D9PA 2VONA 4TU7A 1HL6A 1V3ZA 2CWXA 3J80Y 1S1XA 1VYAA 2HKEA 2X1FA 3AJ1A 2E9ZA 2UUCF 2ERRA 2D3O1 2VQEJ 4MIAA 1FE4A 2FJEB 5KFOA 3WX8A 2AJ2A 3LOUA 3TJ9A 4PR6A 2CZ4A 3A4TA 3EPIA 2PEHA 5DRKA 4Q5VA 4KY3A 2HFOA 2EPIA 2CDQA 1KC8T 3R7NB 1T7PA 3MEDB 1N34F 3ENAA 3BDPA 2IJNA 5BXIA 3HX9A 1NSKL 2Y1JA 4WFYA 5F8NA 3CJSA 3AQOA 3SCJE 3KLEB 4OI0A 1VQLS 1CC8A 3L4BC 4JI2J 1TL7B 3I0SA 4O44A 4IH5A 4OX8A 3CJ3A 4NCBA 5A2QU 3HVWA 2HNYB 5KFYA 2RILA 1C0TB 4CNYA 4WF9Q 4EUVA 4JI5F 3OVSA 2JVRA 3SCKE 5GAGU 4FF3A 2NYIA 4NPOA 3VWSA 1HNZF 2KZMA 3EZ5A 3T1AA 4LF5F 3HT3A 2B4OA 2DBBA 1QAXA 2LXFA 1VS3A 3PJXA 3SEOA 1OPZA 3IWXA 4RNMA 1YJWS 1Y3JA 1GMWD 3PXGa 5CD4A 4F0KA 3J7YU 4JI0F 2HBZB 3TR5A 4DS4A 4ANCA 2VA2A 2E1RA 1YBAA 5HANA 1UVKA 1S97A 2HQFA 3TA2A 3V4IB 3O3LA 1G7CB 1RCOB 4LF6J 3D1HA 2Z2MA 1WC0A 1UMJA 4CM0A 3BR9A 3UCZP 5DJBA 4ZP6A 2DB1A 3GTYX 1UFLA 2RKIA 3C15A 6FDRA 4HH0A 1F9HA 3W9JA 1WEZA 2AEMA 1S6QA 3IM8A 4ZLJA 3VAKA 5F8GA 4X4UA 2M2BA 2HVEA 3Q86A 2WW8A 1C2PA 1GAOA 2FIUA 5EDWA 3JYTA 3QWUA 2FZKB 1QVGR 3CULA 3C16A 1LWFB 3I5AA 4TU9A 2J0XA 5D3GA 4PG5A 2NCKL 1XR6A 1FHTA 1NPPA 2F7VA 2VC0A 3AD7C 2HHSA 2CXEA 2JX2A 2WSEC 2EEYA 4U95A 3H98A 1TV6B 3HHLB 3FBEA 4R8UA 3PTWA 3SSRA 2H5EA 3QPIA 1NAQA 1M5KC 3TA0A 2KYZA 4YB7A 4GO7X 4J9SA 1U2CA 1OY8A 4DPTA 3TAMA 3T3FA 2QYGA 4D3HA 2C2EA 3AHPA 1V6HA 5E5NA 1BY9A 3ZO7A 8RUCA 2VQFF 5F8MA 1RTDB 3PIOQ 2I2YA 2MJNA 1GT8A 2H54B 3GJSB 2VHGA 1FX4A 1UWBB 2WAQD 1DZ5A 5U47A 1R8BA 4OHWA 4WKRA 5AXLA 1TK5A 4PPDA 5ETRA 1LXNA 2QLWA 1LWCA 4FS2A 1Y3KA 3OXFA 2AJ0A 2H1YA 4ERDA 1VFJA 3LWMA 3KLIA 1VJQA 3JS9A 5CCMA 2W01A 3CGIA 3F0NA 5C25A 5C42A 1VHFA 2VODA 3C19A 2KO1A 4KIAA 2B7BB 5K8NA 5C5JA 2ZEJA 5K8MA 1Y9OA 1RAOA 2EFNA 4G1PA 3TUIC 3KG1A 4DPOA 2LLZA 3NGSA 1DY3A 4PXDA 3BSAA 5JXSA 2JL9A 3H42A 3PX4A 1O6XA 4Y65A 1DHMA 1U1QA 2E7VA 3MAHA 1KLMB 5CA5A 4EO8A 3AXKA 1IKYA 2J0WA 1KD1T 5I3PA 1TTHB 3IBFB 1BUXA 5EWEA 4PWWA 4LF9J 4OYOA 3DOKA 5AT1B 2WB4A 4EBEA 2EC2A 2G2OA 2XO6A 1NK8A 1N88A 4DV4J 2I38A 4FF4A 3DLGB 2XBPA 3AD8C 3O2IA 4X65J 3SQGA 2OTLS 1PC5A 2BJ3A 1NHVA 3UFCX 4YQWA 4RU2A 5KFUA 5IQQA 1TP7A 4LRAA 1S7IA 3WX4A 4IR9A 1JJCB 1UVLA 3A3PB 2W24A 2L9NA 3KUEA 3OVAA 1LV5A 3G9CA 1T9UA 3NXZA 3LP0A 2EFVA 1DARA 5K14B 2N3OA 4DL3A 2ZM6F 3A8EA 2KG1A 5HROB 4HHHA 2V8DA 1NK5A 3BPSP 5IOLA 4TQRA 3EXYA 3ZZTA 2FVRA 3M7VA 1NMEB 2RS2A 2B5JB 2JLGA 3KLFA 3UN2A 1PBUA 2AYGA 5THWA 2GS8A 2E1MC 3HCXA 1OSCA 4BC9A 1NUEA 2B7CB 5KFWA 4CT9A 1PSDA 2D3ZA 2F9JA 3VVUA 3PW2A 4EYIB 2X1BA 1WHYA 4M5IA 2F40A 4AQYJ 3CNQP 5EWGA 4HLBA 4C0BA 2DR8A 2RRNA 1ZH5A 2NZ4A 4PG8A 4IRKA 3LA0A 1N52B 3BM7A 4C0HA 2JC1A 3PYDA 1EX8A 3OL6A 2RF2A 2RMLA 3F41A 4LQ9A 4HT5A 2E9TA 4Y28C 2ZH6A 2DIUA 1B3TA 1VQ8S 4UOGA 3M6UA 4DSJA 4C2MA 2AIRB 3UDLA 4B3SF 2HZAA 4NLGA 3OFFA 3CDEA 1ZAWA 4F4KA 4EZ6A 4F2SA 3IRXA 4LFBF 3LGMA 1HNVB 2L41A 3BN7A 2CJ9A 1WG1A 2RHSB 4KT0C 2CQHA 1IR2A 2W9CB 2K3IA 5E41A 1D0EA 1PYTA 1Q79A 3F44A 5DGAA 1KQFB 1CS4A 4J9VA 1B0VA 3CXCR 3HFKA 2XS7A 3M2RB 5CYQB 5IC4B 4FBTA 2R8JA 3PO5A 1UZHA 2BVZA 1T9YA 3RU0A 2A3JA 3UNGC 4N8OA 4O3OA 5I3UA 3N79A 3MM7B 2VPZB 1GMUA 4NYZA 1T03B 5A6WA 5E3AA 1X0FA 3SFGA 4JV5F 2P9EA 1JLGA 2RDJA 4IG3B 4PG6A 4F36A 5HN0A 4QQBA 2HFVA 4RUCA 1J27A 1Q16B 5KFEA 3AOCA 1Z2ZA 3MEKA 1SBRA 5KG2A 3KOAA 2HEKA 3FQLA 1QDUB 1KONA 1R8PA 2DY1A 3A8KA 1XIQA 1N0UA 4FYDA 4FXWA 3BREA 4Y0FA 2KL8A 2XMJA 2NSCA 1OIAA 3Q8QB 4DV0F 4M5DA 1FJ7A 2UXDJ 3UNYA 2DGWA 3IO1A 1WNEA 4KO0B 3KNAA 2KVQE 2D74B 3SBMA 1RB0A 3S8SA 4WU2A 2VPXB 3L09A 3UPFA 2XSJB 1LWXA 4KB7A 4RW9B 4CH0S 5IC6B 2F8MA 3DN9A 1SH2A 4WU3A 5CABA 3T1YJ 3J80U 2C2KB 2XZWA 2Y1LB 2BR0A 2VIHA 1T94A 2KJVA 1P1TA 2IAJB 2JHEA 5IM0A 1RT6A 1DQ9A 2W8KA 2B6AB 4ZVSB 2R4FA 2IDEA 4X66J 4H4KA 1FRJA 3BKFA 4NX9A 3JAMY 4X64F 3CD5A 2GNKA 1AFJA 4C6AA 4GRSA 2P6SA 2JC0A 2RHQB 2V8GA 3BYRA 3IG1B 3GJTB 4ZVPB 4EMDA 4CH1A 1QJHA 4ZN1A 3C6TB 2J7KA 3ZFVA 3M2UA 4MIWA 2YKPA 3LO3A 2GVDA 3ZZPA 3FEZA 4G1QB 2W7OA 4O3NA 4FYXB 3QATA 2GMHA 4QYZK 4P2SA 4FZVA 5D0RA 5ETLA 2BANA 2F8HA 4F7VA 4MK7A 2GV1A 4CLSA 1FK9B 2DPJA 3DOLB 2AP6A 1ZETA 1N5TA 4ZP7A 4J91A 2LXUA 4PKDB 1MU2A 2J6SA 2XWXA 3N0VA 4RO0A 1HMVA 4ATNA 3OVBA 1IBKF 5BR8J 4KHRA 3FZ2A 4CTAB 4DX6A 2F8EX 4RX6A 1TL3B 4F67A 5D0GA 2OFHX 1G4CA 2VFSA 1H38A 3GFHA 3E01A 2HW3A 3OJUA 1UVNA 2A18A 1G6BA 2OUGA 2XNQA 5AE1A 2GJFA 5DZ7A 4C8MA 4CYUB 1Q5YA 3M8ZA 1I3OB 2VOPA 3W2VA 3BO2A 2F3JA 2NREA 4J9NA 4LR8A 1FXRA 2VF3A 1DTQA 4O0NA 2YWWA 2ZE2B 5B0BA 4N7TA 4DSEA 3G6ES 3JSRA 4AE5A 3BO4A 4URSA 4O0IA 1S72S 4WFXA 1C0UA 2ZBCA 4FKXA 2VL1A 4ZJQA 4JYAJ 4KTQA 4K5SA 1SIZA 3KLGB 4IRCA 1RKJA 1HI0P 3MURP 5B0FA 2G1DA 2F4FA 4NLDA 3KLVA 2N82B 2ZH1A 2HYIB 3R5DA 1HQEA 5EUHA 3P4UB 1YI2S 4ZIVA 3W9IA 3FNNA 4UTGA 1XMQJ 1L3UA 4JI3F 2KG0A 1OYEA 3M8PA 2R8HA 3CJKA 4AL5A 1ZAXA 4F8RA 1GMVA 4OQJA 3W2WB 1XBWA 4TXSA 2MKSA 1Q8IA 4N76A 3D6MB 2MMYA 3OR1B 3X1LB 2H5JB 1NNDA 3MXHP 1K44A 4LIRA 2CQ3A 4DG1B 4RNOA 5D15A 4WXOA 4FF1A 3HDSA 1WI6A 2FQQB 4ZJLA 3TJAA 1N48A 5KFGA 2QA1A 2VKZG 3G8TA 2PA8D 2VOOA 2XGQA 2OSRA 4DL7A 2IJRA 1RT4A 1WHXA 2R7XA 1YBTA 4NLPA 1R0BG 4DZDA 3HULA 1CJKA 2M9KA 3M4XA 1Y7PA 4LF4J 3I0SB 2CNOB 4DUYF 4O44B 4USJC 1REVA 3NL0A 1TVRA 4R5PA 1UVIA 3PHTA 2NZCA 1RWWB 3TEGA 4U7CA 1EP4B 1SQGA 4DCPB 4WBFA 2R7QA 4ZPVR 2ZFHA 2OPSA 2GVZB 3MM6B 3BSNA 2R8KA 5K5MA 4HH1A 4H4OB 4UY8T 1KOOA 3GMGA 3TARA 5LT5A 4DX8H 1NEEA 1NK0A 2AGPA 3O5TB 4U8VA 3BGRB 1UJ4A 2WB1D 1E6VA 4QIVA 2JJ4D 3ZZUA 1VDHA 5FIIA 4DR2J 4Q43A 3BBBA 3ZZ0A 3VAHA 3R8YA 2RT3A 2RD5C 4YY3F 1U7LA 5L9NA 5J2QA 4ICLB 3K59A 1Z1ZA 4RPFA 3SDEA 1QSYA 2K7KA 2MPUA 5KT2A 2IHR1 3EMTA 3WIVA 3UD4P 3PY8A 2HNDB 2NXJA 1HR0F 4I4BA 3K5OA 4X4SA 2ZBQA 2H4YB 1NU4A 2AX0A 3HHEA 1VIXA 2FD2A 1VIOA 4YP3A 1RYRA 2OD4A 3SZ2A 1AZSA 4ZPBA 3K17A 4J37A 1UW9A 1SV5B 4CLYA 4NA1A 4LF7J 2E1CA 3FCWA 3V2UC 2VFUA 3ZTSA 2DEIA 3BQ2A 2AGQA 1LK7A 5KFPA 2V2KA 8ATCB 4DSIA 2PI5A 1VC0A 3IRWP 2XULA 4H4MA 5CZVA 4YDXA 3M2VB 2G2ZA 3W66A 3DRPA 1FDNA 1UKUA 4QYZJ 4A8MP 2YX7A 1RTIB 5KFXA 3PRVA 1NO8A 3W65A 3TAPA 1S4FA 4HVZA 4DV6F 2IC3A 4LRCA 5KFKA 2VJUA 4J9MA 3DI6A 2AGOA 1L5UA 4Q0BA 3CJ5A 1I94F 2VICA 1FI4A 2HIQA 2XY7A 5ITHA 2KT2A 3W5ZA 2YNHA 1N32J 4KC5A 4ED0A 5K8PA 2C3UA 2DHGA 3M30B 2LU2A 3MD1A 3BGOP 5IT4A 3PR4A 5JMNA 2BEFA 1NKCA 3VGTA 3S6EA 2ALZA 3NY0A 4P52A 2B9XA 4DF4A 3CWJA 2HAIA 3P5BP 2GX8A 2ASJA 3NS6A 3KHHA 2PA3A 1FFWB 3D3BJ 1SIWB 1I6JA 4NMLA 4FDFA 3CD6S 3RZAA 3MR3A 3D4JA 4ZA1A 1RWKB 3KLIB 4CLUA 1PAEX 2ZZNA 2G0JA 1Z4UA 2WHOA 3J7A1 3QZ7A 3CSKA 2J8SA 1SKRA 4ZCLA 2CADA 2MGZA 2WBMA 2J9CA 1RWNB 4DJBA 3MEEB 2CJBA 4EFAC 4YMEA 3R27A 1NXIA 3LP2B 1L3TA 4UUXA 2MKYA 5E33A 2MQLA 1NH8A 1IKYB 1HNIA 1IQZA 1YX2A 2VG6B 4DXLA 5BYSA 1YDLA 4LR9A 4QOTA 1F9FA 1G2EA 3MHYA 4HI1A 2AZ3A 4IFVB 1JLAB 2AHOB 2DNNA 3MR6A 2V4JA 4HTJA 3D0HE 3DOKB 1S77D 4PPZA 1WC3A 2HHHJ 3VAFA 5CD4H 1GK8A 4YFUA 1TKZA 3IS9A 4CNZA 1FWKA 2NXCA 4LBPA 3CT9A 1SJ3P 3OUYA 4BWJA 4TY8B 4LSNB 1T9TA 3JXOA 1VHIA 1FRHA 2BOPA 4OX9F 4IYQA 2UUCJ 3Q2SC 2WONB 1HW8A 1XWLA 2KFNA 2GHWA 1X0PA 3P6YC 2HQ3A 1K0VA 3K57A 5FDLA 1VBYA 3KK2A 3V6JA 2HWTA 2R7WA 3SV4A 2HBRB 1CJVA 4OJHA 3VGVA 1U1RA 5DDOC 3CPWR 2XLKA 1N34J 1QE1B 3N6LA 3FSXA 4FYYB 4DCOB 1HWIA 2YY3A 5DO2A 2W7AA 2QN6B 1H2TZ 3IAM9 4C7QA 2L3MA 3HKWA 5GAHI 3CE8A 2XZDB 2OTJS 2QA4G 2XI3A 1XMBA 5IXUA 5D4PA 3M8YA 5AXKA 3ZXWA 1S6PA 3SFUA 2I5JA 4JI5J 3JAMU 1M5PC 2CPHA 3QRRA 1U8SA 3NMAA 3D6TB 5DM6Q 2AW0A 2DJWA 2R2UA 2YPYA 4OHZA 3D6HB 4LF5J 1S76D 1RT1B 4MKYA 4ZITA 4NCAA 3IMQJ 2DPIA 2CJQA 1LOUA 2VA3A 1RAGB 1HD0A 4BC7A 1RXOB 2RU9A 4NEZA 1R43A 2DIVA 1RAHB 5DQHA 3NKYA 4G65A 5IV4A 1F5CA 3HMJG 4RW4B 4DV2F 4JI0J 3U1NA 4B9VA 4DQPA 1NK9A 1NPKA 2W9BA 2XS2A 1IBCB 2P5VA 3OR2A 4LUBA 2XSFA 2LYVA 4IG0A 1CS4B 4M5LA 1RHQB 1YZ6A 2V4RA 1RHRB 5HJXA 1EETA 1R0AA 3DLHA 2OI2A 5HO4A 3R5AA 2AYEA 2KB2A 3OXLA 3AOBA 3I5CA 4M1KA 3C6UA 2IRYA 3CB4A 5KG6A 3GPAA 2DR6A 5AXNA 5I3UB 1TELA 2A6MA 3M32B 5J2NA 1Q1KA 4ILLA 2E1PA 3UCGA 2AV5A 2FHOB 4WFBQ 2BJ9A 5L38A 2VB6A 4AXIA 3GG0A 3LAMA 3OHAA 3NWGA 3H20A 1SL2A 3QRPA 5J1EA 4PQUB 2NUHA 4CO5A 2DHAA 3KJVA 1PCAA 2XYHB 1BD6A 4I2QB 3H4BA 3GCWP 4X4NA 4QR2A 3BKTA 3RUBL 1W2IA 3KK1A 2NXUA 2OKQA 2X51A 2AJFE 3NGKA 3M9NB 1HD1A 1SL0A 2BE2B 3RB4A 5KG1A 2QRRA 4LT6A 3MD3A 2VQFJ 1X9MA 3TVZA 1DTTB 5KG4A 2ZZMA 5E3RA 5HI7A 4NXMF 1TAUA 4FBUA 2B4UA 2VBXA 3AH6A 4NI2A 3BO3A 3CTRA 3MAAA 4QZVB 2MHEA 2PFDA 4TKTA 2R7VA 1HNWF 4NYPA 4KKOA 2BKPA 4B3OB 3DC2A 2EBGA 1ZAVA 4DOZA 3QFHA 4A48A 2UUBF 1GNKA 3MMAB 4M5HA 4LFAF 3T9NA 1JX4A 5HLFB 3RYLA 4K50A 4TY9A 4DUZF 5CCLA 3M6WA 5A8KA 1U1PA 3MMBA 3LUYA 4ID5B 2EW9A 2XYGB 1OYDA 4ELVA 3AFGA 3Q0AA 2ATLA 2IY5B 2HFUA 2V5HG 5B0AA 2MKHA 4QU7A 3T41A 3GIKA 1VR6A 5F8JA 4E98A 3CCVS 2CZVC 4USKA 4DR1F 1IWAA 4KGKA 1LFWA 2OPRB 4ZVUB 1VBZA 1IXKA 4OYPA 3N6NA 1EQMA 1TKXA 4OI1A 5A0YA 5LSLA 1HBNB 2H65B 4MYUA 3SCIE 4Y2KA 5FD1A 1K73T 1F2GA 2M3DA 3QO9A 1FJGF 1K1QA 4L73A 4NRTA 1C4CA 2MLXA 3E2EA 5KFDA 3D28A 4LF2A 1VBXA 3V81A 2QFIA 3G4SS 1KRPA 3A8IA 3RW6A 4EYHB 4JOUA 2K2PA 3H4DA 1KR4A 3ZTPA 2DO4A 2VBZA 2ZM6J 3CJ8A 1OPIA 5DDPC 1DTQB 1S9EA 3CJ2A 3V6DA 4W90B 4TYBA 4CP5A 3HHLD 2DNHA 2DXFA 4M5GA 2ADBA 2YNIA 3DCAA 3EDQB 5E2QA 3CDUA 4DL2A 4Y2AA 4IO1A 4DLGA 2V6AA 4PCQA 1L3KA 1YBUA 4BS2A 1IR1A 2QEXS 4F50A 1SI9A 2ZWPA 4ECSA 1J5OB 4YR2A 2MTLA 1LW2A 2C3YA 3ISZA 1KQGB 2MZQA 3SSQA 3FMWA 4GVBB 3QT6A 1H3DA 4ZPWR 1WACA 4IDKA 3O44A 2KT3A 3EGVA 2ZD1B 3BYPA 1D8ZA 3M8PB 4XPCA 1C1BB 3CJKB 4QPXA 5GADU 1Y10A 1XC9A 2XEXA 3FBBA 2G13A 3WC2A 2WVBA 1RBOB 2B4VA 3TP2A 2HIYA 2FPHX 1TK8A 3OSNA 1UW4A 1KOHA 5DLFA 4RBTA 3OL8A 2R8IA 5KOXA 1TZ0A 5GAHU 1R8AA 3M8QA 4FF2A 3P49B 5B0DA 1FERA 4LFBJ 5C24A 3TQEA 5IT0A 2G1HA 2DCLA 2VPYB 1WHWA 1RT4B 4NCGB 2FUG9 4OZJA 3GWCA 3LF0A 4X62F 5HVHA 3GV8B 2XWYA 4HHJA 1WUUA 1FTCA 1VK8A 2DD8S 3G6XA 2ILZA 4UUWA 3UE2A 4CT8A 3HPOA 1BQNA 1C1CB 4Y2MA 4RNNA 3GJRB 1TVRB 3A1YG 1MNEA 3LH2S 4QW9A 1U24A 5K9FA 3PJWA 4RL1A 4FPIA 2DNGA 2O3DA 3CJTA 1Y5IB 1NK6A 4MAKA 3HVAA 5ETTA 1U2RA 2MHNA 2YKMB 2BM1A 2CZ9A 2KFYA 1WC1A 2LFVA 1ZM3A 3HZEA 3KTQA 4ECYA 1A6LA 1YJ7A 4JV5J 4Z7CA 3W61A 2HQDA 3D0IE 4DN9A 3CCSS 1YKWA 3MOJB 2HGLA 1J5EF 1XMOF 2F65A 1HBOA 1MMLA 3Q8YA 1LNQA 2OMLA 3BGFA 4A8OA 4YB6A 2E66A 2RQ4A 3ADAC 3SXLA 5ETKA 1KTVA 4QR0A 2PE8A 1S1TA 1KQKA 2ZZTA 2B8QA 4MKVA
chains in the Genus database with same CATH topology
4ZPAA 2MJUA 3PDNA 1DURA 3DLGB 3MM8A 2XBPA 3O2IA 2OPQA 3SQGA 1S0OA 2OTLS 2B3TB 2OH2A 1PC5A 1NHVA 3UFCX 4K4XA 4K4VA 4YQWA 4DR5F 5J2MA 4CTAA 3MMCB 4RU2A 5E3CA 4OHVA 5EX0A 2CVEA 2RE1A 4PUOA 5KFUA 5IQQA 1TP7A 2F1FA 5J1PA 2PD1A 5KFRA 4N8NA 3WX4A 3OTBA 4IR9A 2UXCF 1UVLA 1NJXA 3CO9A 2W24A 3GR0A 2L9NA 4NLYA 3OVAA 2R7RA 1LV5A 4NWBA 5HMWA 3G9CA 4U9RA 1FA0A 4X4PA 4IO9Q 4KKOB 4QJVA 6FD1A 3LP0A 3ENVA 2LDYA 1IQTA 3MM5A 2EFVA 2D3UA 5KT7A 1DARA 5K14B 2UUWA 3IC1A 2N3OA 4DL3A 2Z4PA 3CCZA 2ZM6F 3I5BA 2HQIA 4H4MB 5KFAA 1ZM2A 2EG1A 3A8EA 3T19A 2KG1A 4PWDA 3LAKA 5KFSA 5HROB 3I56S 2V8DA 3AY0A 4QYRA 3GILA 5HQ8A 1NK5A 2YNGA 1DBDA 3B8HA 1RT5A 2N3LA 4TQRA 3EXYA 2RQCA 2BBEA 4IOBA 2PGCA 4M95A 3ZZTA 2YWFA 1V3SA 2FVRA 3T6JA 3LP1A 5T7LA 3N01A 5KG3A 4RLEA 3NNAA 1QM9A 2RS2A 5BYRA 5A8KB 2B5JB 2GCFA 3H2UB 3K5NA 2JLGA 3KLFA 1P1LA 4Y2CA 1RGVA 1FDBA 3OHBA 2LQ5A 2M8DB 1R7IA 1OWXA 2ZE2A 2AYGA 5THWA 2RH3A 5I42B 4KGMA 4DV3F 4Q0BB 2CFXA 3I4PA 2E1MC 3RRKA 3IN5A 2WOMB 1UVMA 1OSCA 5L1LA 1UA0A 4BC9A 2QFJA 4NLOA 2B7CB 5KFWA 1LKZA 2DHXA 4X4TA 4CT9A 3Q8SB 1PSDA 2D3ZA 1CVJA 3MZIA 4DL6A 2F9JA 3PW2A 4EYIB 1N5VA 2X1BA 1WHYA 3C46A 2ROPA 2WRMA 2ZKTA 3P96A 4I7FA 2F40A 3MFIA 2JRSA 3GIMA 5LMUF 4NZ7A 5EWGA 2KKHA 1ZYQA 2GA7A 4HLBA 2C42A 4C0BA 2DR8A 1MW7A 5KFBA 1UETA 2RRNA 4KFBB 5K8OA 1VQ4S 2HNZA 1ZH5A 2NZ4A 4OZ0A 3ULHA 4PG8A 2IA6A 4IRKA 1FKPB 1N52B 4YUDA 3BM7A 3HHNB 1TKXB 3CD7A 4OFZA 4C0HA 2JC1A 1VC6A 3ZC4A 2HHWA 2GMJA 4X84A 5A0YB 3OL6A 1QTMA 5G0RA 4ZVEA 2RF2A 2XY6A 5GAEU 2DNYA 2RMLA 3QZ8A 1SJRA 3F41A 3NNHA 2ZJRQ 4LQ9A 3PKYA 3PM9A 3QO9B 3VCDA 4HT5A 4CQ1A 2FHKA 2E9TA 4WZQA 4ED6A 4Y28C 4Y6IA 3GYXB 2ZH6A 4ES3A 1DQAA 2DIUA 1VQ8S 1DAXA 2HLTA 3M6UA 4DSJA 4C2MA 4P7TA 3UDLA 4B3SF 1X4FA 1Y0HA 3W2WA 4WYWA 5CYMA 4NLGA 3OFFA 3CDEA 1ZAWA 2QLXA 1TL5A 4CZCA 2ZHAA 4F4KA 1Q53A 4EZ6A 3TO8A 1HW9A 4F2SA 2J0SD 3V81B 1FNOA 1S1UA 3OR1A 1FRLA 3IRXA 2M4MA 2LEAA 2F9DA 3DYAB 2CQPA 4OIXA 3FGVA 5KOWA 5HBMB 4LFBF 3LGMA 1HNVB 4TNOA 4YB1P 3W7BA 1FJCA 3GFZA 1WWHA 4WCEQ 2L41A 4DQSA 3BN7A 4IFYB 5KFHA 2CJ9A 4MKAA 4DG1A 2O67A 4ZP9A 5DQGA 3CF5Q 1F5AA 3TQ1A 5H9FJ 3GR1A 1WG1A 4UOCA 2PT0A 4KT0C 2CQHA 2Q79A 2W9CB 5GMKa 1JB0C 3ITHA 3NCPA 3BS9A 2K3IA 2Q43A 2GHPA 3GG1A 5E41A 1T05A 1D0EA 3HM9A 4A8QA 1S9EB 2XMWA 4ZP8A 1IUJA 1X5PA 3V6DB 1XN9A 2C3MA 2JFDA 2RKIB 4KJIA 1NB7A 4HTIA 1Q79A 3OLAA 1N33F 3F44A 5D78A 5DGAA 1S79A 1S6QB 1KQFB 4D3GA 4ZPTR 4DV1F 2K8GA 1U45A 1FT8A 2FVQA 1B0VA 3MTKA 1AFIA 1D9AA 2CPZA 1JIHA 4R25A 3US5A 3CXCR 4IKAA 4I67A 3LGNA 4B17A 3HFKA 2IVYA 1T3NA 1N5SA 1UP1A 2XS7A 1K8AT 4F3OA 3M2RB 3IR5B 5CYQB 3RB0A 3QWPA 2UVRA 4FBTA 2IYGA 5B08A 4B3RF 3BEGB 3JYTB 4HI2A 2R8JA 3PO5A 2BRLA 3H40A 2BVZA 5AJ3F 2CYYA 3CCQS 2LQJA 3PR5B 3CCJS 3RU0A 2J9DA 2A3JA 2P9CA 2UXBF 3UNGC 4A4JA 1A7GE 4N8OA 4O3OA 4B08A 2IM3A 4O4RA 5F9NA 4X2BA 5D3GB 5I3UA 4LSLB 1H7WA 3N79A 3MM7B 5F8LA 3HK2A 2XI2A 3RR7A 3CDBA 4ZHRA 5F9LA 2ADCA 1HI1A 2VPZB 3CEDA 4NYZA 4OLPA 2EC0A 4C11A 1T03B 5A6WA 5E3AA 1X0FA 4IDKB 2RRBA 5CH7B 1GTHA 2R7OA 2XGPA 3SFGA 3D1QA 3PVXA 1B0TA 2CIMA 1EP4A 5KFVA 2MB0B 5B0CA 4CO1A 4JV5F 1ULRA 2P9EA 4HKQA 2YVSA 1VOMA 1M0SA 3JTOA 3NBPA 1T8EA 3MM6A 1JLGA 4GKKF 2RDJA 4H4OA 4R8UB 1HQUA 2UU9F 2YWEA 1MROB 4IG3B 2DGXA 4DL4A 1HYSA 2YKOA 2I8EA 4PG6A 4ES1A 3HP6A 2DR5A 5EWFA 3QJPA 2E7XA 4MMOA 5HN0A 4QQBA 4RUCA 1Q16B 1RAJA 5KFEA 2RQMA 1Z2ZA 3OUYB 3MEKA 2XLJA 1SBRA 2YX1A 4DHVA 4DBQA 5KG2A 5L1IA 4N47A 2HVIA 3BGRA 1LXJA 3KOAA 3G96A 3JTPA 5JVHQ 4J9RA 3FQLA 3QIPA 4ZCMA 2FVCA 2VG7B 4A8XA 4K4UA 1RP5A 3TAMB 1RWUA 4PXBA 2LMIA 4LF9F 1LW0A 5G4DA 4L72B 2KN4A 3D5MA 1KONA 2HGMA 2VBYA 1JLEB 2E5IA 3DM2A 1R8PA 1TQLA 2YH1A 1U09A 4WKYA 4AL7A 2WSCC 1N0UA 1YGYA 4M8LA 4OZ1A 4FYDA 3OTDA 3M8QB 4FXWA 4QWBA 3BREA 5KG0A 4Y0FA 3MAQA 4C98A 2R2TA 2XMJA 4DV4F 2NSCA 1P8GA 1I1GA 1OIAA 1S9GB 4ICLA 4ELUA 2M8HA 3Q8QB 1E6YA 2OSQA 4DV0F 2IBOA 4C8YA 2IM1A 1XEZA 4RW8B 4M5DA 3GIIA 1FJ7A 2GGPB 4X65F 2FJAB 2YKQA 1TL4A 1HBUA 5KT6A 2DGWA 1J2VA 3IO1A 1YJTA 2CG4A 2ASLA 1WNEA 4ZMMA 4URGA 1VRUB 4KO0B 3KNAA 2YTCA 3VQTA 3KK2B 3DMJB 2D74B 2HNDA 2DNMA 1RTHB 5EN1A 1TKTB 2J76E 3ZZYA 1NZAA 4ZCIA 3K5PA 1WELA 1R27B 2Y1RI 3S8SA 4B02A 4WU2A 3BQ1A 4IH7A 3U27A 3P5TL 2JWNA 1H2VZ 2VPXB 4LFCF 3L09A 3UPFA 5CZXA 2XSJB 1HNXF 3AA8A 4KB7A 4RW9B 3CCES 1M90T 5GVQA 4UQGA 3PNIA 2LU1A 1LWCB 3FRZA 4CH0S 4DFKA 5KFIA 2F8MA 3DN9A 1BQNB 1SH2A 3KYLA 4WU3A 5LSRA 1TR0A 4Y3CA 5BYQA 3U1LA 4F02A 1SV5A 2RDIA 4DQQA 5A8WB 2XZWA 3MEGA 1YSJA 5JUMA 2Y0SD 2HHTA 1RISA 1VQKS 2BR0A 1HWJA 1AXQA 4KAIA 1T94A 2KJVA 3HXMA 4MK9A 1P1TA 2DNQA 2IAJB 2JHEA 3MWBA 3TYTA 5GAGI 5C25B 1SXLA 5IM0A 5HMZA 1YIJS 1RT6A 1DJ0A 5C42B 1CEZA 2FJXA 4RU9A 1DQ9A 3T9ZA 2XB2D 4KHPF 3K8WA 2W8KA 3UQSA 2B6AB 4BDPA 2MDAA 3JTNA 4C4WA 2AYMA 4PG4A 1JNRB 1R8HA 2DH7A 2R4FA 2ZH7A 2GJIA 4H4KA 4MFBA 1L3SA 1FRJA 3JAMY 4NX9A 3TAQA 3IFEA 4X64F 3CD5A 3BDEA 2GNKA 1AFJA 2DK2A 2W4CA 3M2VA 3M1VB 4DS5A 2LECA 2P6SA 1OSDA 5HMXA 5H1SV 1N36F 2JC0A 4LMZA 4RW6B 2V8GA 3H5SA 1TFYA 3IG1B 4NLVA 1WTFA 3LQVA 3VAIA 1FXDA 2DRAA 4CH1A 2Q6BA 5DETA 1RTIA 5I3QA 1AUDA 1QJHA 3PX0A 2FC8A 4C8LA 2A2DA 2Y1IA 1F60B 1IKVA 3PW5A 3C6TB 2J7KA 3ZFVA 3CD0A 4H4KC 3M2UA 1Q86T 3PX6A 4O3RA 4A8YA 4DR4F 2KHDA 5B0GA 4MIWA 3TA1A 1RT2A 3J7YI 3IR6B 4JI6F 1TKDA 2YKPA 3LO3A 1HBOB 4KV8B 4NYOA 2N7YA 4J9PA 3ZZPA 3FEZA 3ICLA 4G1QB 2W7OA 4DR7F 4J9QA 1B7FA 2DH9A 2YKNB 4O3NA 3F73A 2I0XA 2ZJQQ 3IAS9 5J2PA 4OI2A 2GMHA 1NJWA 4P2SA 3AQPA 1RYSA 2LA6A 2FGCA 2DHSA 4FZVA 4WYLA 2BANA 2F8HA 4F3QA 3TUZC 1NH7A 2BRKA 3NCQA 3RB6A 1O0PA 4MK7A 2MQMA 1VQNS 2GV1A 3K58A 3NS5A 1FK9B 4PWUA 2DPJA 3I9V9 2OFGX 3DOLB 3K2YA 1M5OC 1KHVA 2AP6A 1ZETA 1N5TA 4ZP7A 1FRXA 2LXUA 1N8RT 3DFEA 3CCWA 2JEIA 1H0HB 4PKDB 1SJ4P 2UVUA 1MU2A 3GB0A 1S48A 3H8YA 4BWMA 2ZC4A 2M7SA 5DM7Q 3MM8B 2XWXA 2J6SA 2OPQB 2KYXA 3M30A 3N0VA 2ACYA 1SQEA 3SQGB 3H25A 1HMVA 2EFQA 2MQQA 3TOQA 4ATNA 1M5VC 5DS7A 3OVBA 1IBKF 1X5SA 1HWUA 4KHRA 2UUTA 3FZ2A 5F3ZA 1R8CA 1Q7YT 1XR7A 1FRMA 3FFIB 4CTAB 5EHHA 5J2MB 3T5JA 2F8EX 1D1UA 2DGQA 3CJ4A 1Q4RA 3RAMA 4RX6A 4PUOB 1TL3B 4F67A 2OFHX 3HF5A 3HKZD 1H38A 2VFSA 3GFHA 1N56A 2YKAA 3E01A 2HW3A 1HARA 3OJUA 2EK6A 4FNHA 2RRAA 1K0TA 4I69A 4QIWD 2GMLA 1UVNA 4MK8A 1S1WA 1SUQA 2UP1A 2A18A 2ZKUA 1BQMA 3KG0A 1G6BA 2QYCA 2XNQA 3LP0B 3MM5B 5AE1A 3SI8A 3LALA 3T1HF 1JK9B 4NLWA 1U25A 4C8MA 3R5CA 2FB0A 2MYFA 2HZCA 5EX3A 2ZOGA 5KFFA 3G8SA 4PWDB 2IVFB 3FDSA 2VOPA 4F25A 2BQRA 2C22A 3W2VA 2R7SA 4J9LA 2YNGB 2KM8B 4A47A 2FLOA 4AUKA 1RT5B 2CPYA 2IM2A 1UJ6A 5HL7Q 3VQSA 4IQMA 3BO2A 2COLA 2CQDA 4OLOA 1U1MA 3LP1B 2HHPA 5GADI 3FZBA 5T7LB 2XMTA 2F3JA 2NREA 4KBIA 4J9NA 4XAKA 1FXRA 5IT9Y 3KLFB 1DTQA 2M88A 1RT3A 3I32A 3S01A 1NHUA 2R9LA 2E7WA 3M6XA 2AYBA 1HI8A 4N5SA 2MY8A 4RBVA 2ZE2B 1MMDA 5B0BA 4DSEA 2I9SA 3G6ES 3JSYA 1X9WA 2W25A 3JSRA 2HVHA 3C3LA 2RNEA 3LANA 4AE5A 1JJHA 2C3PA 2YWHA 3DDNA 3BO4A 4URSA 4IRDA 4O0IA 4B9LA 1VQ6S 4EO6A 1S72S 4O3SA 3MEEA 4WFXA 1C0UA 1FD8A 4ZVHA 1U4BA 2UVVA 2GO8A 1FTRA 2CRLA 5SUHA 4F4WA 2ZBCA 2VL1A 2UV8A 4FPRA 5IFMA 3KJVB 3MM9A 3LP2A 4TQSA 3PRDA 1FO1A 2DNZA 4GC6A 4KTQA 1X4CA 1RT7A 4ED1A 1KTQA 2DNRA 2QZ8A 2ZC3A