2DD8S

Crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
192
structure length
192
Chain Sequence
NLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG Heavy Chain
publication title Structure of Severe Acute Respiratory Syndrome Coronavirus Receptor-binding Domain Complexed with Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 37
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dd8S01
4XAKA 4KR0B 4L72B 3SCJE 2DD8S 3D0IE 3SCIE 3SCKE 4ZS6A 3BGFA 5DO2A 3SCLE 2AJFE 4QZVB 4ZPVR 4ZPTR 4L3NA 4KQZA 3D0GE 4ZPWR 3D0HE 2GHVC 2GHWA
chains in the Genus database with same CATH superfamily
1YJ9S 1Q78A 1CEZA 3H25A 3JTPA 2ZC4A 2PT0A 1FDBA 2AKWB 4FVCA 3PR5B 2R7XA 3VAGA 2ASLA 1SJ3P 3N4WA 4F2SA 4BC7A 3B82A 2ROEA 5DQIA 4LUBA 3PEJA 3C16B 1WC6A 1ELOA 4C0HA 5KT3A 1RT6A 1D8ZA 4MKBA 3DRPA 4FPIA 3KLFA 2AYGA 5AE1A 1FX2A 3AOAA 4KO0A 4Q2MA 4DPOA 3M2RA 1ZM9A 2BOAA 4BWMA 3NNHA 4RNHA 1M5PC 1FRIA 2DRAA 4RPFA 1XWLA 3SXLA 4F0HA 5DDRC 3PACA 1OSCA 2HZCA 5J2PB 4WXOA 3MM7B 3C66A 1VIOA 1FWPA 3KG4A 2CJQA 3KLEA 4P6QA 4HT7A 1HLWA 2G2ZA 2OHDA 2VFSA 2BQRA 1JLBA 2V9KA 3M30A 3L7PA 5DRKA 1LQ9A 1KC8T 5KFDA 2R7RA 4DG1A 4N56A 4LF9J 3NS5A 4E98A 1RK8A 2DO4A 2GO9A 2AJ2A 5HK4A 3KMQA 1HBOA 4O3NA 2M70A 2A2DA 3FUYA 3SFGA 2DCUB 4RW6A 4CLPA 5C2CA 1AXQA 2I1RA 2VPXB 1SBRA 3W2VB 4O4RA 1S1TB 1WSVA 4OV1A 4RNFA 2O3DA 4DR4J 3O5TB 5E3RA 2XWXA 3BGLA 4I7FA 2IC3A 3T6JA 1WHWA 4F3QA 3OHAA 5J2QB 3DRRA 4ZN3A 1EHWA 3WDOA 3AODA 4UW2A 4DU8A 1QSSA 1GXTA 2FJDB 5B0BA 1TL7A 3CMQA 2V4JA 3H40A 3TX0A 1IR1A 1V3RA 3RB6A 4U6PA 1FXRA 2ZD1A 1U26A 4KBIA 5HVGA 4A8WA 1GNKA 3LWLA 4H4MB 5CA5A 1RAHB 2AX1A 2HQ3A 2LA6A 3M8SA 4P7TA 4NE9C 1FJ7A 3D3BJ 2BW7A 4YHHF 4IH7A 2VV5A 4ZVPB 1VQSA 2HHHJ 4B3RJ 3WC2A 2LECA 4HT5A 4OZJA 1Y7PA 3B8HA 3M9OB 1IUJA 4FXDA 3WBZA 3KLGB 3DHWC 3I0RA 4K4XA 3P8BB 4BLGA 4I6YA 2F65A 3OV7A 3RTVA 1Q1KA 1C0TB 1QE1B 2FLOA 3V6HA 2DYAA 1B7FA 5J1PA 2B51A 4FDFA 3DNCA 1HQEB 3QT7A 4TVAB 1VCTA 3ULHA 5KFQA 1Q7YT 4C8KA 1HNXJ 1JIHA 2DISA 3O3LA 5CCLA 2QE5A 3RAQA 1X60A 4LSZB 4B3OB 2E5HA 1FKPA 1UEKA 3PX6A 1ZETA 5HO4A 4KV8B 4K7QA 3MM7A 5EX0A 5A6PA 1RLCL 1YJTA 3H5SA 1PCAA 3HT0A 3MCMA 2WB1D 1GT8A 2Z2LA 2IPOB 3CC2S 1GXLA 4Q5VA 3HJVA 1PGZA 3EGWB 1Y11A 2H9ZA 2LDIA 2P9CA 1T3NA 1C4AA 3C3LA 5C25A 2V67A 1VRUB 2XY5A 4QQBA 1TKZB 5D3GB 3M6VA 2R2SA 1FNOA 1D09B 1PSDA 1YDLA 4IO9Q 1HARA 2HRUA 2XY6A 1NSPA 4ZCKA 4AXJA 3T1YJ 4CLTA 2MGZA 2ASDA 4CLLA 3MOZA 2VF3A 3CJ2A 1O5JA 4NOHA 4Y2AA 2C2ZB 5L8RC 1U6ZA 3Q24A 2X3GA 3T1AA 3K59A 1UJ4A 1Y5LB 1R43A 1SV5B 4IRKA 4DL2A 4LF9F 4NLRA 1S1WB 2YNGB 1HPZA 3N5FA 2CZ9A 2W9AA 4IOAQ 4NZ0A 2J0XA 5J1EB 1IXKA 1EKSA 3MR5A 2ZE2A 4DQRA 4G65A 2L9WA 5U47A 4WF9Q 1I94J 2VQEJ 1L3KA 2MQLA 2D69A 5LL6d 2M4MA 5KFAA 1CQMA 3AXMA 2RRNA 4DPUA 3GR1A 4BBYA 2YWGA 4LSLB 1Y3JA 5K20B 3T6BA 5F9LA 3WIUA 4DFJA 4FNHA 4HYKA 3AT1B 4DR4F 2E9TA 3CCLS 1JK9B 1ZYQA 2C42A 2W4PA 4J5OA 5HP1B 2ZOGA 1Q8KA 4TLQA 1U1LA 3CD7A 4GC6A 4IG3A 1VR6A 4P9SA 1C2PA 1DTQA 2F7VA 3H90A 3KLGA 2YKNA 5CZVA 2HNYA 4AL7A 1X9WA 4EO6A 1R8AA 1C0TA 4A8XA 2WB4A 3F44A 1XJWB 2V8HA 2HHHF 4B3RF 1TKXB 2MY7A 2AMCB 4JI7J 1WC5A 1O6XA 1X4BA 3J7Z5 2W2PP 4CYUB 1W26A 4DR3J 1WHXA 5DDQC 2FC8A 3FCWA 4F04B 3SYZA 1M5KC 3TOQA 3HSGA 5HBMB 3ADAC 2OTLS 2CQIA 3NLCA 4DDFA 1DURA 3BR9A 3TRGA 1HNXF 2BQUA 4M8LA 3OVSA 2EKNA 4UOHA 3KG1A 1R8BA 5D3GA 3NNCA 3TQ1A 1OY6A 3RUBL 2AYBA 4JV2A 5H9FJ 2WZ1A 2FD2A 5HQLA 4K50A 1NH8A 1RTJB 1T9YA 4KJIA 2G1HA 2KO1A 1F5BA 2LYVA 2J9DE 2L9NA 1P6TA 1DTTA 1S1WA 3EDRB 1QLNA 5A8RA 2VZ9A 4C0BA 2CNOB 1QSYA 4MTPA 4TQSA 1FRHA 2HEKA 3T1YF 3MWBA 4MIAA 2NZCA 1RUSA 2VICA 3Q0AA 4TU7A 1RA7A 1S49A 3N01A 4F4ZA 1YTYA 1PBUA 3BSOA 3AAWB 4M5IA 1MWZA 3W63A 3HHLA 3A1YG 1T7PA 4NMXA 3PYFA 2DPJA 3NWRA 3OFHA 3R7NB 3FDSA 1Q5YA 2K2PA 4PXCA 1HKAA 1T9WA 4AL6A 5HP1A 1I94F 1HYSB 2VQEF 2XMUA 3TZYA 2MZ1A 6FD1A 4F4KA 1NDKA 3MAHA 3QT6A 2AEJA 5EUHA 2HFUA 3RB3A 3ISND 3CJTA 2MQMA 4GKKJ 2XMKA 4CNZA 3CF5Q 2CQ4A 3IP0A 3ZTOA 2HBYB 4FS1A 4K2JA 4ITSA 4XAKA 3KLVA 3MECA 4WZQA 2EC2A 2DD8S 1VK8A 1S1VB 1F9HA 1HR0J 4R0EA 2HBQB 4JI0J 2KVIA 3TAPA 5LSRA 1U6BA 1CJKA 1N0UA 2JJ4D 3RZAA 3GIRA 1SIWB 4QOTA 1XERA 3UNYA 1RT3A 3AJ2A 4KGXB 3OJUA 2PC6A 3OHBA 5K8MA 2ZVSA 1J2VA 2M8DB 2MHEA 2VB6A 2I0XA 1X4DA 4GMKA 1BC6A 1N34J 3PW5A 1RAFB 3FRZA 1LOUA 1T03B 4JI7F 1T05A 1R0BG 1UA0A 4FYYB 4Q44A 2X1AA 4BDPA 4J9VA 4C3KA 4DR3F 3U02A 3MDFA 1U47A 3M8YA 2OEMA 1T95A 1RSCA 2PIIA 4A8OA 3DLGB 3BBCA 2D3O1 2DJWA 1S10A 3KMSA 4I2QB 1R6YA 2ZDOA 2QLBB 2YKMA 2FVQA 1OS5A 2KU7A 3OTEA 4NLUA 1VHFA 2VODA 1KLMB 3WZ0A 2QA4G 1IBKJ 2H3EB 3QJJA 3D0IE 2UXDJ 1MN7A 3LALA 4ETZA 1REVB 4EGLA 4P72A 2YX4A 1MW7A 4O0IA 2GO8A 3NCQA 3NS7B 3NXZA 1QD1A 4Y2IA 4HH1A 3NMRA 1KVKA 3K89A 3NGKA 5HQ8A 2BE2B 1RHRB 3ITHB 3Q8VA 3RRHA 3QIDA 4Y34A 3M9MB 1EIYB 1HYSA 4J9NA 2R7TA 2PEBA 3MHYA 1P1TA 5KOWA 2K3KA 3VQTA 5KFPA 1KOHA 1HNIB 1RHMB 3TX8A 4RWWA 5DZ7A 1RWNB 4MH8A 5D78A 4DUZJ 1NPRA 2JDJA 4NI2B 4TYAA 1NXIA 3N5BA 1Q8LA 3BGOP 4CWBA 1RTDB 2OUGA 3UN3A 5DGAA 3OD2A 4J9RA 1RZMA 3ICLA 1YJUA 3K5PA 2IMOA 2YNFB 5K5MA 1RT7B 3THPA 1BWVA 2GAHC 3KJVB 2LFVA 2CJYB 3NGUA 1C1BB 2V2ZA 3GYXB 3W2WB 2KT2A 3T5JA 4YR3A 1X9MA 2BKPA 2KT5A 3MTKA 1P9YA 2OPSA 3BKFA 2WSEC 4GKKF 1F5AA 2EG2A 2QYGA 3KFWX 4ZPVR 1WF0A 4EZ6A 2UUTA 2IAJA 2CQDA 4MMOA 2QT7A 1Q7LB 2W8KA 3W9IA 1L3VA 3MUVP 1H2VZ 1I1GA 1HR0F 1KBRA 1M1KT 4JI0F 2Y8YA 3FFIB 5GMKa 3BR8A 4M5MA 4OYOA 5ETNA 3T9ZA 1HHQA 5EWGA 5IT0A 2HIYA 5KG6A 3OR1A 4B02A 1LWXA 4ZP6A 3UD4P 2D1CA 4RBVA 2XGPA 2VFRA 3LANA 4PG5A 3IMQJ 2ZZMA 3MEDB 3VVTA 4X4SA 1N34F 1KQGB 2W9CB 3GV7B 1S79A 3CJRA 4I2QA 1BGXT 4YFUA 2Z0GA 2W9BB 3W8GA 1KFDA 2W4CA 5KFUA 2HYIB 4P73A 4R8UA 3VF0B 2K8GA 5CCMA 3F56A 2ZWOA 3CDUA 5DS7A 3P49B 5EDWA 3AFGA 2EBEA 2Z8QA 9ATCB 2HHUA 3QPIA 3FSYA 1ZA1B 5KFIA 4DU7A 3GCXP 2R4FA 3D6FB 4M1KA 4ZLLA 3TA2A 4O0NA 5KT5A 1FRXA 2U1AA 2PA8D 2XCAA 2UUCJ 1KHWA 3CVKA 1SVDA 1OYEA 3N6MA 4KGKA 5KFBA 3W65A 1IBKF 1L3UA 1WD6A 2UXDF 4ZVQB 4DV6J 2WOMB 2GNKA 2QC3A 1TP7A 5DLFA 1VQ7S 2WCXA 4OI0A 1HBUA 3MR6A 2RS8A 3NAIA 2KB2A 1CJTB 2JEJA 3OW2R 2DGUA 1V3SA 4OHVA 1ITPA 2C3MA 4USHA 1RAIB 5KT6A 1PJ5A 5GMEA 2ERRA 2MSTA 3VALA 2BJDA 1SJ4P 1CQNA 3W2WA 4RR5A 4ED4A 2IRXA 3M8QB 3MM5A 1JB0C 2XSJA 1F3VA 3UFCX 1F0XA 2I38A 4DUZF 3GFHA 1S97A 4CO3A 1W25A 3PJXA 3WX8A 3OR2A 1AZSA 5SUHA 5D0GA 1UEUA 1UVMA 1PC4A 3BDEA 2IRYA 4HVZA 4OHYA 1GMWD 2MLZA 1ZA2B 1Y9OA 3GYGA 2CYYA 2NXUA 4C11B 1UVKA 2XB2D 2IVMA 1KNZA 1N5SA 5FDLB 5KFXA 1CC7A 4O3RA 2J9EA 3HSZA 3CCES 3MM9B 2QTWA 2VDHA 4NMLA 1H0HB 3V4IB 4JI6J 2J7KA 2FVCA 1N48A 4O23A 4C0OC 5K8PA 2B7BB 3C19A 1JQGA 2E5LJ 4B9NA 3R97A 4Y28C 3FMWA 5B0CA 4PEOA 1HNWJ 4FVMA 5ETLA 3PJ9A 1NK0A 5D0HA 5KFRA 3OFEA 4DF4A 4DS5A 4ZLPA 5K8NA 4OYZA 4LBPA 4OYMA 2ZFHA 2BM0A 4F4XA 3IXQA 1WI8A 4Z7CA 3QAUA 2HW3A 1TQLA 1QAXA 1R8PA 3UN5A 2VC1A 3HXMA 3AB4B 4ZP7A 3PO4A 4DPXA 2XI2A 1HNZJ 4HHUA 2BJ1A 4QU6A 5DDOC 3IM8A 1F3FA 2KT3A 4WP9A 4B3MJ 3SSSA 2Q66A 3I4PA 2YKPA 2ZBIA 3B4MA 2E1RA 2ZJQQ 4YR0A 2DRDA 4TYBA 3M8PB 2UUCF 2XC9A 1PIEA 2IMWP 2MKKA 2AU0A 4DV6F 3W61A 4C8MA 4CO1A 2NQPA 3G6VA 2YVSA 2C28A 5DO2A 5B0EA 5MAOA 3R2DJ 5HSPA 3CW2C 1ZM2A 3KDOA 3LA0A 3R8YA 4UY85 4X62J 4H4KC 3M2UB 2O1PA 4F26A 4RW4B 3FNNA 1J5OB 1WJ9A 1ZAVA 1C4CA 3I5AA 1FA0A 2DGWA 1E6VB 4RNOA 4NLYA 4ES2A 3GIMA 3DI6A 3PFEA 1XQIA 2XGQA 2XULA 3HSDA 1FDAA 1IM6A 2V2KA 3W1YC 4PUOB 2KDOA 3ZNJ1 1WKLA 3NCRA 4CLFA 1RWKB 4I2PA 3M2VB 4O4GB 2PA3A 1FWLA 4IFVB 3NBPA 1TK5A 1WOSA 3EICA 4YY3J 1DQ8A 1VQ4S 1JX4A 4B9SA 2ACYA 2E5IA 2XTJP 3VZHA 2NXEA 1FO1A 3VAHA 1DQ9A 1YLXA 2NUHA 2ZOMA 3IWLA 2L41A 3A8KA 1WG4A 4EYHB 4NX9A 4WP3A 5E3AA 4N5SA 4EBEA 4KFBA 3LAKA 1IBLJ 3BDPA 4JI6F 5IC6B 1D0EA 3TJAA 2HWHA 1N56A 2F1FA 3HSJA 3EVOA 2E5LF 2FJXA 1X5TA 4KH0B 3MAQA 3IA0A 2CNLB 5FD1A 3DDNA 1HNWF 3LGMA 2H5IB 1QUPA 4OHZA 2DNNA 4LREA 3HX9A 3M6UA 3BB5A 3CDWA 4ZVEA 1RT5B 1FKAF 2XMAA 3P5BP 2DNPA 5A0YB 4KE5A 2KM8C 1G4CA 1MMDA 4DUTA 4FPRA 3NL0A 2YTCA 4IRDA 5KAKA 4EBDA 2DGQA 1U2CA 1S57A 2V8DA 3KHGA 2AWZA 1RTHB 3PVXA 4YR2A 3MOJB 1FFGB 1M5HA 1KDNA 3T5LA 2B4OA 1HNZF 1S77D 1QY7A 2UXCJ 2VPZB 4LBIA 4QR0A 3LP1A 1R0AA 3IWXA 1WNEA 3ZZUA 4B3MF 4KTQA 1UFLA 1D9FA 4LR7A 2CXEA 2OO4A 3BO3A 3KTQA 2UVRA 3Q2SC 2F8EX 2LA4A 1J5OA 3EYZA 1FFSB 3Q8PB 3DFEA 2FZGB 3V2UC 1NO8A 1Q8IA 1MU2A 4AUKA 1M1GA 5DM6Q 5HL7Q 3CC7S 5CYQA 4YS2A 4E2FB 5F9NA 1U4BA 5KFGA 2CQHA 2HSEB 4PUOA 2XWYA 1Q95G 3VV2B 2BE7D 4X62F 4L6V3 4G1PA 1EQMA 3SSQA 1VQOS 3DOMB 3LPEA 3G96A 4NCGB 3NCPA 1RAOA 2XNRA 4ERDA 3OSPA 4IFVA 2UVVA 2FHOB 1MLAA 2KHCA 2DR6A 4I6WA 4KKOB 1WSRA 5BYRA 3MM6B 4K2XA 2NLWA 1RACB 4LSNB 1QTNB 7FD1A 2RD5C 2WW8A 5E3CA 5LSOA 4NYZA 3W9JA 2DR5A 2FQQB 4CTAA 3BYRA 1K47A 3K5MA 5BYSA 4YY3F 4DF8A 1H38A 1CG2A 4DZDA 5GAGU 3G82A 4J9UE 4KHRA 5HMYA 4MT1A 1X0PA 3CTRA 3V81B 3LP2B 2CRLA 4I68A 2AF6A 2DXDA 2XMTA 3Q2TC 3VAJA 4QIVA 3CJKB 1RT5A 1XR6A 1RBOB 4C8LA 1TFYA 2QSWA 4OI3A 3TUJC 2EK1A 1HW9A 5KG7A 1IBLF 4D3GA 3W64A 3PCOB 4V19J 1JXVA 5AT1B 2I9SA 3OXLA 2Z2YB 3A13A 3BN7A 1IWAA 4W92B 1AFIA 1EETA 5IT9Y 3UR0A 2BRLA 2VJUA 1OJ4A 3C14B 2X3DA 2D3OR 2V94A 1KWMA 5KFNA 1G7CB 1S9EB 3GB0A 3M7VA 3CCVS 2CQPA 5D4LA 2F5GA 5SZTA 2LP4A 2IM1A 4B9VA 5M2PA 2GQCA 4CO0A 3QZ8A 2G2YA 2OLWA 4AD6A 2EK6A 4CNYA 2QEXS 2DXFA 3KK3A 3R3TA 2DNZA 1N5QA 1BQMA 5KG2A 3WIVA 4OHWA 1LV5A 1S6UA 4PWWA 2KXHA 2VQFJ 1GTEA 4ZPTR 2KL8A 2M0GB 1HL6A 5A8KB 3KJFB 5K8OA 3B78A 2R8GA 3SMZA 4LRFA 4F0MA 3D67A 2UXCF 3OXGA 2ROGA 4J7CA 3KUEA 1N6QA 1EKRA 4NLVA 4NCBA 3RU0A 2UZAA 2RHQB 4ECQA 1BD6A 4NEYA 3FBCA 1Q8BA 2CJBA 4K5RA 4WFNQ 4NCGA 2ATCB 3BPSP 4G6VB 4U8VA 5KG0A 4O3QA 3BGRA 1RA6A 3CDBA 4NLOA 3GQCA 3CIMA 5CABA 3P4UB 1TKTB 2MZQA 5KT4A 2V6AA 3ZNUA 2YXLA 4CM2A 5K14B 1S6QB 3QSIA 5E5NA 3A3OB 4FXWA 4KT0C 2CPJA 4YN3B 1EAYC 1URNA 4JV0A 2G4BA 1RT1B 2DTJA 3ISZA 3FBBA 1RT4B 2GA7A 4OJ3A 1QTMA 4ZIWA 3GJQB 1J27A 2FHJD 5KG3A 3CCWA 3MPDA 4JV1A 2E1AA 3QLHB 4IG0B 3CDEA 2HFVA 2E66A 3I82A 4CO4A 2X1FA 2RIJA 1I6JA 2YNHB 2LQ8A 1Y5NB 2MKSA 4U7UD 1CJUB 1UJ6A 3J7ZT 4Z7YA 2RDIA 4ZP8A 1FK9A 5AJ3J 3BSAA 4WYLA 5T7LA 2F9DA 2HBZB 4DX8H 5LXYA 1DLOB 1JJ2R 1VISA 3RAXA 1NZAA 3DOLB 4ZS6A 4WP8A 2I5JA 2GIFA 3RYLA 1YI2S 4P7VA 2XZDB 1SL0A 4PYAA 2FTRA 1URRA 3CJ8A 3C14A 3MMAB 2KG1A 2DR8A 3V6KA 2FHJA 2CQ2A 5C42A 4G1QA 4ID5A 1RAGB 4KC5A 2JVRA 4E8UA 2JHEA 2VA3A 2B9EA 1WC0A 2Y1JA 4FN5A 3M6XA 2NYIA 1TK0A 1GFWB 2FJWA 2AEFA 1ZS6A 4J9QA 1IKYB 1SH0A 2HQDA 1SQEA 1TVRA 2M52A 3GG1A 2W01A 2WVCA 1OMSA 1M0SA 2YWHA 4CP5A 4H4OB 1NZ8A 4EZ9A 3K2YA 5KFYA 5GAHI 3DMJA 5B0AA 2NYHA 2CPXA 3A8IA 3DYAB 1N54B 2P9EA 4JB8B 4K4TA 1KR4A 4OZLA 2VQFF 2FIUA 4WJBA 1FDDA 1NLKL 2KHDA 1RCXB 3QAEA 2L08A 3IO1A 2H4WB 3HZEA 2YWKA 1UVLA 3W66A 5KFZA 1CSJA 4P71A 2BJ7A 4ZVOB 2HRTA 1SC6A 5K14A 2CG4A 2QV6A 3N9UC 2Y0BB 4CDIA 4GO5X 2L3MA 3MCSA 2AX0A 1RBLA 2A3JA 1MROB 4PQAA 2V9WA 1RT4A 2G1DA 1GXUA 4JI2J 1RBAA 4XPCA 1BQNB 3QLHA 4ED3A 4C8ZA 3CC4S 3AY0A 2GS8A 3CJSA 1JLAB 3W7BA 1CJVB 1EP4A 2HVEA 4U8YA 1PAUB 5LT5A 4YEAA 1RT2A 3IRXA 1SCJB 3D6MB 5G0RA 2OI2A 3J7A1 1GAOA 4ATNA 3AQOA 2K1RA 3H2LA 4EUVA 1U09A 1NK8A 1HBNA 5JMNA 2YKAA 4L3NA 1X8DA 4C97A 2B5JB 5LJ5Y 2A6MA 4ECXA 2J9DA 1LW0B 4KY3A 2Z2MA 2D9PA 5AJ3F 2XNQA 4LRBA 3JAMU 3OLAA 1NSAA 4BWJA 2FZKB 2VPWB 3O44A 4RW8B 4BC9A 1HIYA 1NHUA 4I6AA 2NS1B 2UVWA 3F0NA 4CT8A 4C6AA 1S1XA 4ZCIA 3LWMA 1SJ1A 2Y1IA 2BRKA 3CJ5A 1NSQA 2F8HA 4U9RA 4IO1A 3HVTA 3NAHA 4B3SJ 2HFZA 3PW7A 1CVJA 3SSRA 3ZZRA 4OI6A 3TA1A 3HM9A 2VKRA 1DZ5A 5F3TA 1SJFA 3NRBA 3E01B 1RWMB 3GFXA 1K0VA 3UCGA 1U8WA 2AYEA 2MLXA 2JLGA 5ETOA 3MEEA 1AYEA 3V4MA 2AJQA 3DLEA 1Z2LA 2U2FA 4MKAA 1TK8A 5I42A 2ZZTA 4AL5A 5IT4A 4FKYA 1JLEA 1YHQS 1SUQB 2WVEA 1NNDA 4QJVA 2JH3A 1YRUA 1DHMA 4DSEA 1EQ0A 4FS2A 3I96A 3EXCX 2MKIA 2HAFA 2MQNA 4TLRA 1YK9A 2J0WA 2OD6A 5JJBA 1K9MT 2AJ1A 1UKUA 2Y0SD 2AIRB 2DEIA 1PYOB 2CWKA 5BXIA 3G6ES 3ZXWA 3EUNA 1NH7A 5GAGI 2CNKB 1N36J 2JNJA 4PYDA 4M5KA 3HD1A 1LXJA 2WVFA 1BQNA 3J80U 1MWQA 2V0NA 4OX8A 4LJMA 5HATA 2UXBJ 1NM2A 3ZZTA 3UO0A 3GWCA 1Q53A 1CS4B 3MTJA 4USJC 2RDJA 5KFTA 2CADA 3MI7X 4X2BA 2VG6B 4ER8A 1H7XA 5HJXA 1HMVB 4JI2F 2CFXA 3AD7C 2FUG9 1V5IB 4EBCA 4DEZA 4Y3CA 3BH6B 2Z57B 2VG5B 4JI5J 3NKYA 1KQFB 5E7OB 1NMEB 3CMES 2SXLA 2CPIA 4RW9B 5KT7A 3OVAA 1Y3KA 5C2GA 4NZ6A 2B5JA 1TTHB 4CRJA 4TU9A 3OFGA 2NUUG 1FNMA 1P27B 4H4KA 3G8TA 1TU0B 2OFGX 4KRWA 3QWPA 4FF4A 1ZBTA 3VGSA 2OPRB 4QWEA 3Q89A 1JNRB 5EN1A 2XMVA 3GJRB 4DFKA 3OL8A 1KOOA 3G6YA 1DJ0A 2O67A 2XZWA 4EU0A 3KLHB 1SKUB 4C8YA 1RISA 1VQYA 1X4AA 2E44A 5KOXA 3KJQB 2EXUA 1L5UA 2V63A 4LVNP 3BO2A 2DGSA 2VA2A 2DIVA 4N8OA 2KG0A 3MPWA 4KR0B 1I51B 2LU2A 5KT2A 1QM9A 1DQAA 3GONA 4B3SF 1RWUA 1IKVB 2MMYA 2DHHA 2NSCA 1JNZB 4NLSA 3PXGa 3THTA 3I5CA 2C1EB 5IOLA 3C2PA 4FF3A 3ZC4A 1UW9A 1ZH5A 2YPYA 3ZTQA 4ZPWR 3O8WA 4UZBA 3GR0A 2L9DA 3NNAA 1FDNA 1FXLA 2R8IA 4RUBA 5CAAA 3EGNA 2GGPB 4LIWA 1Y4ZB 4FP9A 5HMWA 4Q45A 1MG7A 2QN6B 3QNWB 2YKOA 2DCLA 3TUPA 2MKJA 3CCJS 1D8YA 3PHEA 3OUYA 2K06A 3CPWR 4LBHA 4LF4J 1VQ5S 1G6BA 3K0JA 1UWAA 2DKOB 2JLEA 3NGRA 3N0VA 4WWSA 2QJ3A 1VRTA 2IYGA 3UWTA 1RWVB 4DL7A 2BABA 3M9NB 1N36F 1UETA 3GYNA 3HFVA 4M5DA 2OJ3A 1UEVA 4FF2A 1OY8A 2BR0A 1WC1A 4C2MA 2PD1A 4I4BA 4WIIA 2FJAB 2HNDA 3DLJA 3OBIA 2VG5A 2UXBF 2B6AB 2QA4S 4ECSA 4K4ZA 4DCPB 5FIIA 1RB0A 1NU4A 2HFOA 1UVIA 3HT3A 4NPOA 3OSNA 4M63A 4ED7A 2YNIB 3P45B 4EI2A 2MXYA 2J9CA 4K4SA 4DR7J 2D41A 2HKEA 4PR6A 3IRWP 1GQEA 5D0EA 1NDCA 4JI5F 3D68A 4TY9A 2A2CA 3J80Y 2NCKL 4AYBD 3CCMS 5H9EK 1YX2A 2Q79A 3ET6A 3KLHA 4NYPA 1UP1A 2Q6BA 2APOA 2IDEA 4ZVUB 3LP0A 3OTOJ 5L39A 2HHTA 1WG1A 3H98A 4RU9A 3SCLE 2VG7B 3RW7A 4DV1J 1FE4A 3PKYA 2MQOA 2GMLA 4OYXA 1S48A 1UJ5A 3BQ1A 4MAKA 3S01A 4FXVA 3TAMA 1PKUA 3ZTSA 4F36A 1U49A 4URGA 1IJEB 3RRKA 4Y00A 2PI4A 4ZVHA 1EZZB 2RQ4A 3BBBA 3BF4A 1RTZA 5IV4A 2GAGC 2POKA 3PRBA 2ZH6A 4XK8C 3R6LB 4RW7B 4TY8B 3JS9A 4ED5A 3I9ZA 3DOKA 3EGVA 3MM8B 2EFNA 2CDRB 2QLWA 2MQQA 5ETPA 1N5YA 4KYZA 2HK3A 2O01C 1JLGB 2B4PA 3KDNA 1SKSA 3QYYA 4KIAA 2Y8WA 4ED2A 2A10A 2K7KA 2ALZA 2G0IA 2KRBA 4UY8T 2HWTA 1T9TA 3CJ3A 3PYDA 2G0CA 2ZH5A 1OSDA 5GADU 1NB2A 1I3OB 2JFKA 4LF4F 5ETMA 2HVDA 3AA8A 5F3ZA 2KXFA 2V69A 1WF2A 5I3PA 3FRYA 3G6XA 1NKEA 1Z4UA 2RE1A 2DITA 3PX0A 1RU2A 3W5XA 5KFEA 2FYXA 1Q5VA 3M1VA 1PJ6A 2LEPA 4HACA 2B56A 2RVJA 1H7WA 4KGMA 3PV8A 4IDKB 3P96A 2R8HA 3E2EA 1LKZA 3HKZD 5IM0B 2UUWA 1R7IA 4X4QA 1S1UA 2J7WA 1RAJA 1IKWA 4C8NA 2XYPB 4KHMA 2HGMA 3GFZA 5CYMA 2J6UA 1REGX 1N4LA 2G13A 1T94A 2XQCA 4KSEB 1HQUA 2DY1A 1AUSL 2VPYB 4FYXB 4LFCJ 2HLUA 4DR7F 1FKOB 1RI7A 3PDNA 3J81Y 2YX7A 4DSLA 3BZQA 4LRDA 3KYLA 4EWTA 2J7UA 2VG7A 4TN2A 4ZHRA 3AD8C 4F0KA 3C6UB 3L4BC 4RX6A 3SBMA 2QFJA 3OTOF 1JXLA 4DN0A 2R7QA 4C3MA 5KFKA 5D8HB 4DSFA 3O6QA 1RQ0A 1X5OA 2Q6CA 4OJHA 1FEEA 2CZVC 4DV1F 3EE3A 4RW7A 1NK5A 3FSXA 4K0KJ 1RXOB 2ZUGA 4R5PB 2HQCA 3E51A 3IBWA 4XTTA 2VOOA 3I0SA 1T02A 3ENAA 3IC1A 1SKRA 1YWXA 4LF6J 1F5CA 3DHXA 4ANDA 4LF5J 1FRLA 1NPKA 1XR5A 2OPQB 4CLWA 3QRQA 2N7YA 2HNZB 1VHIA 3R6GB 5HANA 2C2KB 4LRCA 3VGTA 2IY5B 4J9KA 3MMCA 1H3DA 3BQ2A 1TUGB 4UUWA 3AOBA 2RH3A 4C7QA 4Q0BB 4OI2A 5L9NA 2IDLA 4P75A 4KH1B 2V5HG 1LNQA 4OQJA 2XEXA 3VHQA 2FLNA 5GAEU 1KTVA 3UVJB 2I2YA 3M8WA 3A3PB 5RUBA 1TL5A 1FJCA 3C16A 3BJYA 1QDUB 8AT1B 1T0TV 1W2BR 4ZCMA 1CLFA 4ELVA 5L1LA 2PFFB 3GJSB 5HN0A 1X4FA 5B09A 4URQU 2GV1A 3DRXA 3GCWP 3GV8B 3TYTA 6FDRA 3QBCA 4RUCA 2F8MA 2HLTA 1OY9A 4WE1B 4CO5A 2N82B 1WC3A 4I69A 5J2PA 1SIZA 4C3LA 1ICEB 4L72B 2EC0A 1D1UA 4QIFA 4EEYA 4DFMA 3HI9A 3BYPA 4DSKA 4ZVRB 3BGUA 2XYHB 1TAQA 2GMHA 1U0HB 5KFMA 1TL3B 4MFBB 1GEHA 3X1LB 3KOAA 4DV2J 2R8JA 4FKXA 3MAAB 2HS3A 4LFCF 3DLKB 5D6GA 3D28A 2BW2A 1UFWA 5CZXA 3IWNC 2EFOA 3W2VA 4ED8A 3I87A 3G2XA 1S1TA 4NZ7A 2M88A 1VK3A 3HPOA 4B9MA 2IA0A 4R5PA 3ENQA 4UOGA 2VBWA 3F41A 1U24A 7AT1B 2RU9A 4X4UA 5J2QA 4G1IA 3I55S 3SDEB 1C1CB 4YDDB 2JEFA 3JQMA 3VWSA 4IH5A 3TUZC 2BM1A 4H4MA 4K0KF 5B0DA 4PPDA 3K5LA 4P52A 4J9SA 2DPIA 2NR0A 2QSFA 2HMIB 3C8YA 2VFTA 4QU7A 1AFJA 3PR4A 4LRAA 4LF6F 3FEYB 4RL1A 1U6FA 3KK2B 1JKHB 4LF5F 4ANCA 1IKXB 3GZ7A 2RKIB 4OHXA 2WVBA 1IBCB 3BKUA 3UVJA 2IM2A 4DSIA 1QE1A 2OPPB 4TQRA 2DR9A 4DHVA 2BJ8A 1KONA 3I32A 4ZIVA 1TMJA 4PQUB 2E1PA 4F67A 1TV6B 3MFHA 1DY3A 1HQEA 4OZ3A 4X65J 3EZOA 3SCKE 4NXMJ 1HWIA 3GU0A 3VAKA 3MD1A 2BMBA 2RQMA 1OO0B 3CNQP 3U1NA 4KQZA 3MXHP 1U02A 2MKCA 4B3OA 2HBRB 1D9AA 4KV8A 2CPYA 1WELA 2KI2A 2R7SA 3UCUP 4DBQA 4OZ0A 3MPUB 3S6EA 2AZ1A 3PM9A 2BANB 5F8NA 5M2UA 2KRRA 2EKYA 2DNLA 2MKHA 2PMZD 5B0GA 5M2RA 4ZVFA 2DHSA 3QMQA 3DLHA 1VRUA 1KS2A 3HHLD 1TKZA 2NZ4A 4PCQA 3MEKA 2ZH3A 2MZSA 1C0UB 2RMLA 1VRQC 1B99A 1CPZA 2J0SD 4GVBB 4OX7A 3TANA 2ZKTA 2LEAA 2FVPA 1SV5A 1KQSR 1CBKA 4NA1A 4DI6A 4ED6A 1VOMA 2YNGA 5F0WA 4DR2J 1N0VC 1NK6A 5J1EA 4DV2F 4DXLA 1EB0A 1LK7A 3V6JA 5E3QA 4J9LA 1RJJA 3GMGA 3BBFA 5CYJA 3SI8A 4AE5A 3R7SB 4C9DA 1TL4A 2UP1A 1GMUA 4Q43A 2YQ3A 2CJKA 4XDDA 2PEHA 4LSLA 2FHMA 2CPFA 1SC3B 3ILOA 2V8VA 4I56A 2P2CB 5IV3A 5GADI 3B6BA 3N28A 2MEWA 1AW0A 2MZJA 3NEKA 1FRMA 3K17A 2DGTA 2M5YA 1HNVB 2N7CA 8ATCB 4WIQA 1SC4B 1Y10A 2OKQA 1LW2B 2LXUA 3FCHA 2Q3PA 1XMOJ 2MLYA 2OSRA 1UVJA 2EG1A 4DL6A 2FZCB 4X84A 2MYFA 2HFNA 1WC4A 2XM3A 3RB4A 1WWHA 4DV7J 4QWDA 3TQEA 5EGYA 4PWDB 5C24B 1WACA 3U27A 1S9GB 1TKXA 5CQGA 2E7VA 4JI8J 1JLCB 2IM3A 3IG1B 2XMWA 1S6PB 4CYUA 2QLFB 4A48A 5MLCV 4W4MA 2UU9F 2JVOA 3FJ2A 2ADCA 4ICLB 3C6TB 5HBMA 1R89A 3K8VA 4QBUA 2XLJA 2JOQA 2H1YA 1WOOA 4X65F 4NXMF 4MYTA 1RKIA 3B4DA 4RBUA 3BGFA 3TWZA 2W25A 5L38A 1ROFA 4U96A 4DPTA 4ALZA 2QMWA 2I6WA 1UL3A 4LF1A 2HHWA 4LIRA 3NOGA 3EVMA 1G1XA 2E29A 3FK4A 3FQLA 3H0PA 3FSIA 3MMBB 4CCHA 4C98A 2DGXA 1S12A 2G2OA 1NK9A 1RTJA 1HBMB 1NKBA 2J8SA 2LXIA 3E8OA 3PW2A 3PTWA 4JI4J 4O44B 1NK7A 1S6OA 4DR6J 1T9UA 1I5OB 4UT4A 3D1OA 1TL1B 2ZUAA 1WEXA 3IS9B 3KK1B 4Z2XA 3OLBA 3ISNC 4J90A 4P2MA 1K73T 2JLFA 3M32B 2IIHA 5E3PA 3A8JA 1YGYA 3U1MA 2XS5A 4DUYJ 2AHOB 2LLZA 2AZ3A 4DR2F 1SC1B 2F63A 2WONB 1LWCB 1VQNS 2E9ZA 2FDNA 3OVBA 2RUGA 4DOZA 2ZHOA 4HHHA 3GP9A 4OYWA 2PDAA 2YWEA 2QG9B 1HNVA 5GAEI 3V6DB 2W4DA 2DHGA 3DU6A 1KP6A 4W98A 4PG8A 3DGPB 4YB7A 2GJFA 2M9KA 1WKKA 3ZZOA 4OLPA 3GILA 4DX6A 3DCAA 2X1BA 1S1VA 2F3JA 2BBEA 2DHAA 2P6TA 3R5AA 3K7RA 4QW9A 4OIXA 3MR3A 4WFZA 1XMOF 2Z2ZA 4KHPJ 2EVZA 3IG1A 4Q7AA 1KKHA 1S6PA 3QRRA 3MCOA 4XO0A 1UZDA 2P8IA 1RT6B 1R8CA 4DV7F 3DRPB 3KLFB 2F9JA 2JL9A 4F8RA 3NOCA 1TFWA 1R27B 1OQ6A 3M2RB 2MHNA 2AQ4A 3LO3A 3HJFA 4JI8F 1T03A 2MY8A 3R27A 4D3HA 1YQHA 2C2NA 3KLEB 1X9SA 2CIMA 1QUVA 3L3CA 3AHPA 5HROB 1JLBB 1FCAA 3M30B 4PXBA 2L48A 3EWGA 2EW9A 4ZOSA 2R7VA 4TU8A 2QRRA 5DQHA 2EEYA 4DG1B 2RF2B 3WX4A 3HVRA 4DL0C 2YPZA 5IFMA 3DLGA 3TZZA 1X5PA 5JUMA 2BOPA 2GHVC 1HBMA 2DEJA 1WTBA 1H2UX 1HBOB 1O0PA 3DRYA 3PY8A 2ILYA 4X4VA 3IFEA 4O44A 3D4JA 4GO7X 5HMZA 3MZIA 2UV8A 2KVQE 2BXJA 2FJEB 1VGYA 2DNHA 2B0GA 3AJ1A 4QYZJ 1FHTA 1ZZNA 4RWXA 2DNYA 5J2NB 4P74A 2DH9A 1KLMA 2R8KA 1F60B 4NXNJ 1REVA 3M32A 3W60A 3DC2A 3R9LA 4JI4F 4DV4J 1WORA 4X64J 2IC3B 1U0SA 2R2RA 3CIZA 2WW4A 1U25A 2WONA 1QVFR 1OWXA 5D4PA 2BE2A 3DRRB 4A47A 4DR6F 3T3FA 3WC0A 2QMXA 2WK4A 4RLEA 1TL7B 1UAWA 3T5KA 3ITHA 4H54A 1BHNA 2V4JB 1RE1B 2WTFA 3PEHA 2KFYA 1QSLA 2Y3YA 4OV6A 2RQKA 2PO4A 5G4DA 3TI0A 1T11A 1HNIA 1A7GE 1S4FA 1XTZA 4DUYF 4NI2A 1IN0A 2ZHAA 2M2BA 1RTDA 1TKDA 3QSYB 1NDLA 1YBTA 2IHR1 2ZVIA 3I0RB 2YNFA 1YJWS 1RT7A 2X7IA 3KJVA 4HR2A 3VAFA 1UPPA 1U45A 4OFZA 1C1BA 3I31A 3MMJA 3OJSA 2XY7A 4NYOA 4ILRA 4J91A 2DBBA 1U2RA 3CEDA 3IGVA 2ASJA 2R2UA 1ZOTA 1Z2ZA 4FF1A 2MJNA 2NXCA 4MJKA 1LK5A 4Q8FA 1UW4A 3AJDA 1F9EB 2QZ8A 3CXCR 5A6WA 1M5OC 4QW8A 1RWOB 3L7OA 2PMHA 5KFSA 1RHJB 3H4DA 3MR2A 1KHVA 2V8PA 4ENOA 1KSPA 3FFIA 1FKPB 1U1MA 5HJYA 3DGVA 2E1CA 3O2IA 3HZGA 1CULB 4KHPF 2IVYA 2CKWA 2AJ0A 5HROA 1UPMB 3G86A 4NASA 2XS7A 5L9XA 3UE2A 3FVYA 1VLYA 3CT9A 2RF2A 3MEDA 2B9WA 1M5SA 2W9CA 5C25B 1V3ZA 5DG9A 2Y1RI 3OL6A 2W7OA 4ZA1A 2FLPA 2PI5A 2PE8A 3BH7B 2W9BA 2P9GA 1P1LA 1M90T 1RYSA 2ILZA 5DG8A 2XHWA 2MGZB 2JRSA 3TUIC 5KFFA 2ACMA 2E5JA 4IUFA 3FKBA 2ZITA 3EPGA 3CDAA 5J2NA 2IJFA 4K5SA 4FNIA 2R7OA 1R6VA 2C3UA 4CO2A 3ILLA 1HPZB 3K5OA 1K1SA 2B8QA 3SEOA 1G3OA 3UD3P 3D7SB 4K4YA 4QPTA 2ZE2B 4DV3J 4F4YA 2IBOA 2AGQA 3TZWA 2QO3A 3IAM9 1Z1ZA 5F8LA 4ZPAA 4B9LA 1DRZA 1NBEB 5L46A 3ILJA 4EYIB 1ZTTA 2QL7B 5CH7B 4A46A 5AE3A 2WOMA 4NXNF 4RU2A 3VR1A 3MFIA 1LFWA 2R3VA 3FBEA 3F73A 2ZDPA 1XIQA 2N3OA 4DV4F 4X64F 2RNEA 1SQGA 2K7JA 2DH7A 1RKJA 1CJTA 2FC9A 4PZVA 4IG3B 2CQ0A 1DTQB 5E33A 2J0QD 1F9FA 2BX6A 1U1RA 4WXWA 3EGZA 2YKNB 2HNYB 3TEHB 4RKUC 2CWXA 4V1Ak 2ABYA 1X4CA 1KN6A 1RWXB 3TJ9A 2B4UA 4Y6IA 3B54A 3LF0A 5JVGQ 3M8QA 1ZAWA 3FZ2A 2RHSB 1RADB 1MWYA 4LQ3A 2CQ3A 2HGNA 5EHHA 2CQ1A 2Z4PA 1ZPWX 1NRKA 1HHTP 5F8HA 2N4CA 3S7RA 1QAYA 2NPFA 4B9TA 3GIJA 2X51A 1CULA 4C11A 2HAIA 2DNRA 3HDSA 4CLUA 1ZTWA 5GAHU 3KLIB 4HKQA 4M5NA 4N47A 1HWUA 4WFXA 2OEKA 3FC9A 5FDLA 1NSKL 1YSJA 3G8QA 4DL5A 4RUHA 2IYIA 3MM9A 3L09A 2AV5A 5EX3A 4OL8A 4DSJA 4I0WA 1LFPA 3RBDA 2IRUA 3V4IA 4EO8A 2HHPA 3CO9A 3ENVA 5B0FA 1HD0A 1NJZA 1FT8A 4K8RA 4QPXA 2GIRA 1TAUA 3J7AN 3R5JB 4NLXA 3ZZZA 2EFVA 1FNXH 3QFWA 4E0DA 1DTTB 2BQ3A 4NLQA 5A8RB 1QVGR 1UZHA 5THWA 2PMWA 3CGIA 4X4RA 2ADBA 1WF1A 1PC5A 2CJXB 2ZH4A 2VL1A 2IVFB 2OAUA 1R3NA 5GVQA 2FPHX 2ZWPA 3KJNB 2BJ9A 2JZ5A 3HHLB 2R2TA 3CD6S 4PKDB 4ILLA 1OQ3A 3CJ4A 3SQOP 1XMBA 1B7YB 5J1NA 2C3PA 2XHCA 2A18A 3Q8QB 4DV3F 1FTCA 4PG4A 2Z56B 4X4TA 3HULA 1WDTA 3M8PA 2WSCC 3DN9A 1U1OA 3OXFA 4QR1A 1V9OA 2FVSA 2RAQA 2A6OA 4OI1A 3OPKA 1FERA 1FRKA 3QIPB 1IM4A 3PHTA 1FD2A 3HO1A 1H72C 2KYXA 2CA9A 2V2VA 3IGNA 1UCNA 4PAAA 1Q82T 2ATLA 1NPPA 3US5A 1JWWA 3MECB 5D77A 3POTB 3M2UA 4WFBQ 3R7BB 1FFWB 3OFFA 4WKRA 4J9MA 4RW4A 1T9VA 1SJRA 1XC9A 1K0TA 4OYPA 4PXDA 1E6VA 1G2EA 1CJKB 4TKTA 5E41A 2Y1LB 2OEJA 2VD3A 3FGVA 4JUZA 3K58A 4LR9A 2OFHX 1RT3B 4ZJQA 1ZPVA 3MD3A 1T3OA 2MB0B 3NMAA 4ZVTB 3NG8A 1EJ7L 3A4TA 3TAQA 3KLIA 2J6SA 2QL5B 2ASYA 2F40A 3D1QA 4LF8J 1AA1B 1NDPA 3M2VA 4O4GA 1SKWA 3EM1A 2B4VA 2WSFC 4IOBA 1MMNA 1T05B 1NAQA 4V19X 2DIUA 5IC4B 1SL1A 1MSWD 3P3DA 1NB7A 1PBAA 4W90B 1A6LA 4M5JA 2HGLA 3ONQA 1S72S 4KPYA 1YBAA 3PX4A 3J7YU 4WPAA 2MJUA 1N5VA 1XBWA 3LH2S 1KEKA 3IR7B 1RWWB 2YKMB 4LFAJ 2IJNA 3BKTA 2BJ3A 2VFUA 5DJBA 1SXLA 2H65B 1U1KA 1R0CB 1GX5A 4KGVB 2HZAA 4WZMA 1W2IA 1RU1A 3D1HA 1D3WA 1WEYA 3QGGA 4M5HA 2C3OA 5HQMA 2P6SA 4ZN1A 1LEOA 3THVA 1GK8A 1KRPA 3N6NA 3HKWA 4I64A 5A0YA 4Z37A 2RB7A 4ZJOA 4DLEA 3RRGA 2HQGA 2KFNA 1NJIT 3IBFB 4A8MP 5B7WA 1HD1A 2XLKA 4FBUA 1S0MA 1WTFA 1IJFB 3I6PA 2GJIA 4LMZA 1RTHA 3GIIA 2AGPA 2PN6A 2COLA 1B0TA 2VOPA 5BYQA 4FYWB 4XDCA 3QIPA 1HI1A 1NK4A 2DB1A 3AQPA 2ZOFA 4IR1A 2FY1A 2EFPA 4J9OA 1B4SA 3POTA 3W8PA 3PKMA 4OZ5A 1NJXA 1JXEA 2KYZA 3CUNA 5KFJA 1BQXA 2CUYA 4ED1A 3H20A 2F4FA 1IWGA 3NGDA 2HHVA 2OPSB 5H9FK 2DGOA 2HURA 1QJHA 1ZM3A 2JEGA 2OD4A 5A8WB 3PG9A 1OIAA 1U1PA 4EMDA 1R8HA 4LT6A 2IAJB 2XBPA 2R9LA 1FWKA 1S0NA 2N3LA 1XMQJ 1HI8A 3DOMA 2XCPA 4OLOA 5BR8J 2VUGA 3H2UB 2ZH7A 4KKOA 2KZMA 5FJ4A 4QZVB 2GW8A 4USMA 3MM6A 4ZDNA 2YY3A 2C2EA 4X4OA 1VJWA 3OR1B 4AQYJ 3R2CJ 4LSNA 3CSKA 4M95A 1VQKS 2CPHA 3LTOA 2C3YA 2RILA 1HWKA 1JJ4A 2C2RA 3HMJG 1B0PA 2YBVA 1IQZA 3AH6A 2VONA 4LF8F 4NWBA 2C2MB 3GIKA 2BDPA 4B08A 4A4JA 3GG0A 3LW5C 4X66J 2IA6A 1Y00A 5ETQA 4UUXA 4FYDA 3QWUA 3D6HB 2GHPA 2KN4A 1YITS 1DAXA 4X4PA 4QIEA 4R8UB 3VAIA 1N33J 2B8PA 2MTLA 4ZJLA 5LOQA 1SQFA 3V81A 4WFYA 4HEA9 2ZHBA 3H59A 4IKAA 3LP2A 1P9QC 4CH1A 2ZH1A 4OI4A 3LPYA 4GRSA 2EFGA 2DRBA 2MZRA 3CJKA 1VMBA 4ELUA 3UDLA 2GQ2A 3CMAS 2DVIA 3FEXB 4LFAF 2PFDA 2IJRA 2DK2A 1PJ7A 5K9FA 5DLGA 1FTRA 4MIBA 4ZK7M 4ILMA 3FEZA 2D74B 5DZ6A 5ETVA 2D3UA 3H8YA 1FXDA 1WG5A 1X31C 1S9EA 4YOEA 4L3KA 2CG8A 2EFQA 1HHSA 1J5EJ 2V34A 1HBUB 3KWMA 2YWWA 2J6TA 2OMLA 2DXEA 2E9RX 2BUNA 2AJ4A 4WBFA 5EWEA 3CB4A 2NPIA 2RJZA 2BVZA 3AOCA 4NRTA 4QYRA 5ETRA 1S7IA 1Y5IB 5A76A 2R7WA 3OL9A 1BUXA 1V6HA 3VVUA 4L75A 2MQ8A 4AFFA 5A8KA 4MYUA 3RW6A 4ZKAA 4Y2KA 3MM5B 4HDGA 2XSJB 3N6LA 5F0UA 5HVHA 4DCOB 4A8SA 4MK9A 5A8WA 4DR1J 4BCAA 1XNRJ 3OR2B 3HVWA 3UQSA 1AZSB 3ZFVA 5ETKA 4O3SA 3ELHA 5IQ6A 1JLQB 1X5SA 5ADZA 2W2MP 4RUAA 2NSBA 2J76E 4DN9A 4LVOP 3QQCD 1VQ8S 2BACA 1YBUA 2EBGA 1VJQA 3P5TL 3BS9A 1UTAA 2J5AA 2C2DA 4YB6A 1TKTA 3MUTP 1GMVA 2ZBRA 1WI6A 1S6QA 1HI0P 1XMQF 2MKYA 4PABA 4DJBA 1VQ6S 1RT1A 5BR8F 3TARA 5D0RA 3EXYA 1F1BB 1DBDA 2ALYB 5KG4A 5LMNJ 4IG0A 3I5BA 1S0OA 5DG7A 2DT9A 4AQYF 3HD2A 1HW8A 1HWJA 5F8IA 2YNHA 1XEZA 2GZOA 2OSQA 1CJUA 3NGSA 1O8BA 3QFHA 1RDRA 2V68A 3TJ8A 4RNMA 4ZITA 3R1HA 3JYTB 1DLOA 1JJCB 4ZPBA 4IFYB 4X66F 4USTA 3HFZB 2LXFA 3VAMA 1BLUA 3DOLA 4ID8A 1N33F 5I3UB 4C4WA 3R5CA 2VBXA 1FEHA 4N41A 4HHJA 1VFJA 3MMAA 3G4SS 2DHXA 2XO6A 2AD9A 1VQPS 1FF2A 2JC0A 1FJEB 3M8ZA 4YDXA 3H2VE 3W5YA 1ACMB 3UCZP 2H5EA 1YZ7A 3G9CA 3CULA 1L3SA 4N8NA 2OGUA 3HHEA 3LOUA 3HK2A 3W62A 1IKYA 3D54A 4MK8A 1FESA 2R7UA 1Y0HA 5F8JA 3WHIA 3CO0P 1KFSA 4WTYA 1J5EF 4GKJJ 4ANEA 4H4OA 2CPEA 2CAJA 3TZXA 4A8QA 1APSA 3D0HE 3Q8UA 1Q16B 3DDIA 3TVKA 3DYAA 3QGHA 1PYTA 1WKJA 4WK1A 2ZC3A 4ZLJA 3DI6B 1JLQA 5IQQA 2HK2A 5AXNA 5J2MB 3ETMA 3UW1A 2RRAA 4QYZK 1IVZA 2XYGB 2UV8G 1E6YB 1AB8A 5A2QU 2ROPA 1PILA 4I2PB 2HVIA 4DR1F 2W24A 1XNRF 2OTJS 3BO4A 1WOPA 3KUGA 3NBPB 3HHKA 2LU1A 2XSFA 3J7YI 3U7JA 3QJPA 3NS6A 4L76A 4Y2MA 3WQPA 1X0FA 4J9PA 2Z30B 1UMJA 3CCUS 1MROA 2QA1A 1TELA 1YJ7A 4HI2A 2PGCA 2CNNB 4WKYA 1JMTA 2LQ5A 1UA1A 5L1JA 1NKCA 2RDDA 1FVQA 1NUEA 3TVZA 4DCJB 3U1LA 3CCQS 1JLAA 2DH8A 1CJVA 4ZPCA 2O5DA 3MR7A 1GMWA 4KFBB 3IR6B 1U1NA 1RHUB 3JYTA 5AXMA 2HS4A 5LMNF 4IFYA 2OMOA 4LR8A 4YP3A 3PFOA 3IAS9 3M4XA 2BV3A 4DPYA 3BREA 3OTDA 3JQJA 5I3UA 3NP5A 1IBMJ 1VQMS 1FX4A 1LW0A 1KD1T 2BKOA 4WCEQ 4F4WA 2HVZA 2XLIA 3Q23A 3H5XA 2M3DA 3MURP 2LQJA 3TO8A 3A12A 4Y0FA 4F3OA 4PG6A 3EZUA 4PPZA 4RW8A 2B3TB 2AGOA 2CVIA 1TUWA 3G71S 3Q83A 5HLFB 1KVIA 4K4UA 4GC7A 2LEBA 2NREA 2WBMA 3LP1B 3BPDA 1R0AB 5LSLA 4F2RA 1YKWA 4DWIA 4LF2A 5AXLA 5D15A 2HIQA 3E01A 3BEGB 1MMLA 2QLXA 4RBTA 3TEGA 4B9UA 2B9YA 3W3SA 4FBTA 3TA0A 4IYQA 2LDYA 3AA9A 5I3QA 3SIPB 5CXTA 1X7VA 3T9NA 2G0JA 2O66A 3AD9C 1MU2B 5H9EJ 5CYQB 1Q4RA 5J2MA 2DY9A 1SUQA 4GKJF 1VQLS 4UF4A 3BN4A 3V5RA 3A3NB 1E6YA 3GPAA 3I56S 3JAMY 4IH6A 3GE9A 4M94A 2HPUA 3MF5A 3MPYA 4OJGA 3SV3A 3SQGB 4HL9A 4JBCA 2QYCA 5IT9U 3X3UA 3NY0A 1V5VA 2KH9A 4L73A 4QWCA 1U48A 4A8KA 4FYVB 1WHYA 2HRYA 1R31A 1YVFA 1KQKA 4CTAB 3H4BA 4DX5A 1B0VA 3DM2B 5JVHQ 4QCLA 4ECYA 4IQXA 1FRJA 4K4WA 4RJVA 1CS4A 2HQIA 3PRDA 1EX8A 2FY8A 1N5TA 3BM7A 2XZTB 1BWEA 2GMJA 2VG6A 4PG7A 3G82B 3KNGA 3D2WA 3E3XA 1HMVA 2HHQA 3J81j 1ZAXA 4O3PA 5KFHA 3GFYA 2W2OP 4RZRA 3H5YA 4IQMA 3N79A 5I4MA 1ULRA 3DLLQ 4RW9A 5A2QY 2AP6A 1L3TA 2GC8A 1VC5A 1FI4A 1N8RT 1EARA 3EDQB 4G3IA 3MEGB 2OPRA 2RT3A 1RCOB 3EJMA 4TNOA 1EETB 4CZCA 1B70B 3FQKA 5KFVA 3OL7A 1Q81T 1YJVA 1YRTA 5LMUJ 1JJHA 5HLFA 4QR2A 2CJ9A 1IBMF 3HCXA 1K1QA 4K4VA 3QT8A 4KGZB 3S1TA 4Y65A 4F4AA 3JB9k 3KK3B 4Q8EA 3IBCB 1BQMB 3UDEA 1XN9A 2V8GA 3L95X 5EWFA 1NJYA 4QWBA 1RAAB 2Q43A 4OX6A 1RWPB 4S0MA 2EWHA 2FJVA 7FDRA 1AROP 2BKNA 5KFWA 1M1HA 4N77A 3D3CJ 1IKVA 5DDPC 2ZEJA 1PYSB 1RP5A 5ETTA 2FLLA 4N76A 3JXOA 3Q8RB 1N6QB 3W5ZA 4HH0A 4USUA 4JYAJ 1SH2A 2XMJA 4CT9A 4CM0A 2JSXA 2QMUB 4XIUA 4O3OA 5LM7E 4NLPA 2GVZB 1U8SA 2CJAA 3BGRB 2G9OA 3A8EA 1SJQA 4USVA 5B08A 5IZHA 3UN2A 2XS2A 3SQGA 4OYBA 2GGPA 2QX0A 1N52B 5IXUA 2M7SA 5LXRA 1S0VA 3MGJA 3PO5A 3T1HJ 2ZM6J 2DNQA 3DLBA 2EPIA 3DM2A 3TP2A 2VHGA 2DNKA 2BZ2A 2JEIA 2F4VJ 3ILIA 2KTQA 4UZCA 1H6KX 1VBXA 1UFKA 4Y2CA 2H51B 5L1KA 2V50A 1KTQA 3CCRS 4ELTA 2B6AA 2VC0A 1FK9B 1RLDA 4N7TA 2YH0A 5T7LB 4OJ1A 3G8SA 1JLFB 4HI1A 5LJ3Y 1S99A 3KKFA 3D0GE 1ZZFA 2C22A 1NEEA 2YNIA 4ES1A 2I5JB 3MEGA 1DARA 3FCVA 4JI1J 2JFDA 4GVLA 3SV4A 3PJWA 4NL5A 4ECVA 3IR5B 1XNQJ 4QWAA 5L1IA 5HI7A 4CQ1A 5CD4H 5C42B 3RBXA 4G1QB 4ID5B 1RGVA 5HMXA 4AXIA 1Q0NA 1QAJA 1X4GA 2HHXA 4NA3A 4NLTA 5LMUF 2LMIA 2AW0A 2VU5A 2HWIA 1TVRB 2DO0A 3C15B 3JSRA 1P8GA 2GHWA 2VBZA 1O51A 2RQCA 2ZZNA 4P2FA 4DX7A 2X1GA 3DMJB 3VTIA 4CH7A 4CIOA 4IOCQ 3CJ0A 3Q22A 2WRMA 5C5JA 4CLSA 1RHQB 4I67A 1VS3A 1D9DA 4YMEA 2JWNA 1HA1A 4R25A 2GVZA 4UOCA 1YJRA 4TY8A 2HZVA 1LXNA 4DQQA 3MM8A 4UTGA 2UUAJ 2VIHA 2HG4A 2BE9B 3FBFA 3T5HA 2WHOA 3SCIE 3EPIA 2D9OA 4JYAF 1NHVA 3DXSX 2EI5A 3RR8A 4F3MA 1S76D 1JLGA 5F8MA 2IM0A 1BXNA 4CLZA 2CQGA 4U95A 5DQGA 2C2OB 4M5GA 2Q1LA 4EFAC 3MPVA 1GTHA 3VQSA 2LKZA 3MCNA 2VBYA 4MKVA 3CCZA 3I4HX 4DS4A 3T1HF 1WHVA 4WFAQ 2ZM6F 1HFEL 3RB0A 1EP4B 4CLKA 1RT2B 3DU5A 4DMZA 3IRXB 2UUBJ 4F50A 5G0RB 4NLDA 5F8GA 3PIOQ 1YG0A 1JLFA 5DGBA 3Q86A 2K1RB 1UWBB 2F4VF 3TVYA 4QIWD 1HBNB 1A0OB 3KXDA 1S4EA 4IDKA 4R0JA 4HLBA 1PAEX 3I9V9 3T19A 3QRPA 5BJRA 5IM0A 2FGOA 1FJGJ 4F02A 2CDQA 1NHKL 2I8EA 4WTOB 5GMDA 3BV8A 3D6TB 3LGHA 5D4NA 2FVRA 1VBKA 1SL2A 4I1TA 4J37A 2LQ9A 2CPDA 4KAIA 2GVDB 4OMFG 2UVUA 2GJ2A 1S1XB 1SH3A 5H1SV 4JI1F 3PW0A 1FKOA 2W2NP 1YJNS 2QA2A 4MK7A 2YQ0A 4WU3A 3HVTB 2HHSA 4YB1P 2JC1A 3JSMB 1NJWA 3D9BA 1XNQF 2MDAA 4NLWA 2QFIA 3PW4A 3C15A 3C6UA 4C8OA 3RJMB 5CHCB 4OX9J 1HWLA 3S8SA 2IBKA 2GFFA 2ZNZA 3GSIA 4B17A 2GIQA 4JP8A 2WBRA 3QGIA 3MEEB 9RUBA 1TR0A 1GH8A 2Y9HA 1K44A 1N88A 3SCJE 3HHNB 1F6TA 3DLEB 2CPZA 4BS2A 3PYGA 2LVWA 4P2XA 3QJLA 2XMMA 5I42B 1SPBP 2AJFE 4A8FA 4USIA 1X4HA 1M5VC 1JLEB 3DRSB 3CD0A 3CWJA 3HP6A 3RBZA 4NEZA 1OYDA 1RYRA 2ZJRQ 4HDHA 5ETSA 5F41A 2GQQA 2IFXA 2V4QA 1H2TZ 2H48B 4ED0A 1KVJA 3O1LA 2OPQA 3UPFA 4CI0B 3W9HA 2HNZA 1N32J 1S59A 4ZVSB 3L7UA 4OZ2A 6AT1B 2R42A 3EMTA 2UUAF 5DETA 2B43A 1H74A 4A8YA 1LWEB 2ZBCA 5T14A 3EVWA 3GTYX 4Q0BA 4YUDA 4C48A 4YQWA 3GV5B 2CQBA 3CJQA 2QIFA 3KG0A 1UVNA 3VCDA 1TZ0A 1F2GA 1UWBA 5KFLA 5D4OA 2UU9J 3BQ0A 2RS2A 4ES3A 1B3TA 4JI3J 1B64A 4ZLNA 1VYAA 2CVEA 3HLUA 4UQTA 3H5UA 2UUBF 2HQFA 1WUUA 3VZIA 3ZO7A 2ZJPQ 2XO7A 3ENWA 3DKDA 2KZZA 1IR0A 1GX6A 2W2QP 3ETOA 3Q8YA 4WE1A 2W7PA 3C46A 1FE0A 2KJWA 2GVDA 2AEMA 3NWGA 1T9XA 4CLYA 1FJGF 3CCTA 3HFKA 4XPEA 2CQCA 2WAQD 3RR7A 3ZZPA 4KPCA 3JSMA 3P6YC 2M8HA 1U0HA 4ECTA 4UOFA 2J8AA 1TL3A 2V4RA 4PXEA 1OPIA 4TXSA 4MFBA 3G87A 4ECRA 1RTIB 2HS0A 3OTBA 3RG6A 2OIHA 1W7WA 4AT1B 2FB0A 3PYEA 4PRFA 2VJVA 2MQPA 3MAAA 4ETXA 4ZPDA 1LWFB 4IR9A 3DLKA 2NXJA 2MSSA 3OT9A 1ZM4A 4B3TJ 2YQ1A 3QATA 2OP5A 4OZ1A 3D5MA 2LCWA 3DRSA 4USKA 2B9XA 2V2QA 4OX9F 2VKZG 4PWUA 1VI7A 3IN5A 1RHKB 2E1MC 3M6WA 3T41A 3UNGC 1RABB 3KHRA 4DV0J 3SDEA 1C1CA 3HVAA 3EX7B 3UDVA 2YX1A 3BSNA 4LF7J 2K3IA 1DFDA 4K59A 3LGNA 1F2HA 2MZTA 2E7XA 1U7LA 2A0FB 4ECWA 5AE2A 4DQIA 3R5BA 4RNNA 3OUYB 3NGTA 4LFBJ 4DL3A 3RAMA 3OQ2A 4X4NA 2KM8B 4CH0S 1HQ2A 1LWEA 3RBEA 3HHDA 2HMIA 1YZ6A 4DR5J 2KFZA 1WEZA 1X4EA 2B7CB 4MKYA 2E5GA 1VRTB 1A9NB 3KK2A 3CCSS 1JKHA 4DLGA 5CD4A 5IWAJ 3CE8A 3K5NA 1IQTA 1FVSA 2PSZA 1IKXA 3PIPQ 2ZH2A 1N32F 2Z58B 3ZZ0A 2RKIA 2KXNB 4M5DB 2OPPA 2W7AA 1Q86T 4JV5J 1Q79A 3L9ZA 2XI3A 1VLOA 3ZZYA 2HNDB 5E0OA 4PQUA 2NXNA 1TV6A 1XR7A 2KJVA 3RGIA 3HHLC 3KNAA 2P5VA 4ZCLA 4HTIA 3M05A 1S9FA 3AXKA 5E2QA 2A1BA 1S5ZA 2RRBA 2RUSA 4JI3F 3LQVA 2QGFB 3TNVA 4YB5A 4DV5J 3GJTB 4EK2A 2VASA 4WYWA 2BANA 3ET6B 3UDCA 4ZP9A 3PNIA 4OYIA 5FLXU 1PO6A 3LP0B 3JTOA 2LQBA 1PG5B 1RTIA 4P2SA 5DM7Q 2HFSA 5ITHA 1C0UA 5HVFA 3FZBA 1T8EA 5JXSA 1LWFA 3TW0A 1XK8A 3PRVA 2FJBB 1SB6A 1IR2A 3UR3C 4L74A 4GVBA 2DNMA 2RU3A 4WK3A 4U67Q 1MN9A 2YKQA 2VFVA 3TAMB 2D3ZA 3VGVA 2GX8A 3SZ2A 2W8LA 1VBYA 1QAIA 4ZVGA 4ZMMA 3KUHA 1K8AT 3UD5A 1BY9A 2HVHA 3ZTRA 1AUDA 4F7VA 2ZBPA 4B3TF 3DOKB 3TR5A 2XG8A 2D7SA 2YH1A 1VIXA 5IS2A 3K57A 3HF5A 1H73A 2OELA 1VQ9S 3UI3A 4DZ6A 5AXKA 1N5YB 1YIJS 3DXBA 2ZNYA 3QZ7A 2GCFA 1H98A 4DFPA 4DV0F 4HTJA 3GLJA 2CZ4A 2DNOA 4LF7F 4FZVA 4DPWA 1LW2A 1BMQB 2DGVA 2DNGA 5KFCA 3QO9B 1AT1B 3J81U 2N4DA 4LFBF 3BSCA 3KHHA 4NA2A 4UQGA 2H54B 2AT1B 4OZNA 4F25A 4DR5F 2FGCA 2ZBQA 2BA9A 1OPZA 4Q2LA 4PWDA 5C24A 3KHLA 1S9GA 3M1VB 3LUYA 5IWAF 1JLCA 4HACB 2YWFA 2MPUA 1KLNA 1CC8A 3H7HB 1VC0A 1S1UB 4JV5F 2FHKA 2AYMA 1IKWB 4DQSA 4DQPA 4QIGA 4ICLA 4KO0B 1TUVA 3C6TA 5HAOA 3QT5A 1U2FA 3K8WA 2DR7A 3H42A 1WDDA 4URSA 2JX2A 3PZPA 3D66A 5CYMB 4USWA 4KB7A 1BE4A 4NLGA 1HQUB 2ZH9A 1VDHA 2BJEA 3IM9A 3R5DA 3EZ5A 3M8RA 2QL9B 3SFUA 1RAEB 4DV5F 4U7UK 4P10A 3R5GA 3MMBA 1U1QA 4ZHRB 3ZTPA 4IRCA 4BHQA 2ZH8A 3DDKA 5C7PA 4ECZA 2H4YB 4WU2A 3LAMA 4JOUA 5KFOA 1FD8A 3GSDA 4RW6B 2H5JB 3QGPA 4DL4A 1TL1A 3IS9A 1VBZA 3KK1A 1S7HA 4NRUA 4LQ9A 4NCAA 1MNEA 3FMBA 2BEFA 1NCLA 3CD5A 3R1LA 1SI9A 4I7FB 4YHHJ 3I0SB 3OTCA 4U7CA 2VH7A 5FLXY 3JQKA 2E7WA 8RUCA 1LWCA 3AB2B 2BYCA 1YRXA 2OH2A 1VC6A 2RSQA 1TMMA 4ECUA 2VDIA 2ZD1B 3JSYA 3VGUA 3Q8SB 3V6DA 2QLJB 2W1BA 4M5LA 4RO0A 3JTNA 2KKHA 4OYAA 5KTQA 3QO9A 2ZKUA 5KG1A 2WVDA 3DGPA 3MMCB 4MIWA 5T41A 3JSBA 5KG5A 3MUMP
chains in the Genus database with same CATH topology
5F8JA 4YY3F 4DF8A 1YJ9S 1Q78A 1H38A 1CG2A 5GAGU 1CEZA 3H25A 1KFSA 3JTPA 4WTYA 1J5EF 1CPZA 2ZC4A 2J0SD 2PT0A 1FDBA 4FVCA 4OX7A 4KHRA 3PR5B 3TANA 4H4OA 2R7XA 2ZKTA 3VAGA 2ASLA 1SJ3P 2LEAA 3N4WA 2CPEA 5HMYA 2FVPA 4F2SA 4A8QA 1X0PA 1SV5A 4BC7A 1KQSR 3CTRA 1APSA 3V81B 3D0HE 4NA1A 3B82A 4ED6A 2ROEA 1VOMA 1Q16B 2YNGA 3TVKA 5DQIA 3LP2B 4LUBA 5F0WA 3PEJA 1N0VC 3DYAA 3QGHA 2CRLA 4I68A 2AF6A 4WK1A 1NK6A 1ELOA 5J1EA 2XMTA 2ZC3A 4DV2F 4C0HA 3Q2TC 1LK7A 3DI6B 3VAJA 1JLQA 4QIVA 3CJKB 5KT3A 1RT5A 3V6JA 1XR6A 5E3QA 1RT6A 5IQQA 1D8ZA 4MKBA 4J9LA 4C8LA 3DRPA 2QSWA 1TFYA 3KLFA 4OI3A 3TUJC 5AXNA 1RJJA 2EK1A 3GMGA 5J2MB 2AYGA 5AE1A 1HW9A 3UW1A 5CYJA 5KG7A 2RRAA 4D3GA 1IBLF 3SI8A 4AE5A 4V19J 4KO0A 4Q2MA 4C9DA 1TL4A 2I9SA 3OXLA 2UP1A 2UV8G 4Q43A 3BN7A 1E6YB 4DPOA 2YQ3A 2ROPA 3M2RA 1ZM9A 1PILA 4W92B 1AFIA 1EETA 5IT9Y 4BWMA 2CJKA 3NNHA 4RNHA 3UR0A 1FRIA 2BRLA 1M5PC 4XDDA 2DRAA 1XWLA 2PEHA 4I2PB 2HVIA 3SXLA 4DR1F 2W24A 4LSLA 1XNRF 2OTJS 5DDRC 2FHMA 3BO4A 3PACA 1OSCA 2HZCA 5J2PB 4WXOA 2CPFA 3C66A 3MM7B 2D3OR 1VIOA 2V94A 3NBPB 5KFNA 3HHKA 1G7CB 1S9EB 2LU1A 2XSFA 3J7YI 3U7JA 3KG4A 3QJPA 2CJQA 3KLEA 3GB0A 2V8VA 3NS6A 4P6QA 2CQPA 4I56A 5D4LA 4HT7A 3CCVS 4Y2MA 1X0FA 5SZTA 2VFSA 4J9PA 1UMJA 5GADI 3CCUS 2BQRA 1JLBA 2V9KA 2IM1A 3M30A 4B9VA 1MROA 2QA1A 5M2PA 4HI2A 2GQCA 4CO0A 3L7PA 3N28A 2PGCA 3QZ8A 1AW0A 5DRKA 1LQ9A 4WKYA 2OLWA 2MZJA 1KC8T 2EK6A 4CNYA 1JMTA 2LQ5A 2QEXS 1FRMA 5KFDA 3KK3A 2R7RA 2DGTA 2M5YA 3R3TA 2DNZA 4DG1A 1HNVB 1N5QA 2N7CA 1BQMA 4N56A 3RB6A 5KG2A 1UA1A 3NS5A 4E98A 5L1JA 2OKQA 1NKCA 1LW2B 1RK8A 2DO4A 2GO9A 2LXUA 3FCHA 2Q3PA 1FVQA 2OSRA 1UVJA 4OHWA 3TVZA 2EG1A 4DL6A 3KMQA 1HBOA 1LV5A 4O3NA 1S6UA 3U1LA 4X84A 2MYFA 2HFNA 3CCQS 1JLAA 2M70A 2DH8A 2KXHA 3RB4A 1GTEA 2A2DA 4ZPCA 1WWHA 4ZPTR 3SFGA 2O5DA 2M0GB 2DCUB 4QWDA 1HL6A 5A8KB 4KFBB 4RW6A 5K8OA 3B78A 3IR6B 1U1NA 2R8GA 3SMZA 2UXCF 1AXQA 2I1RA 3OXGA 3JYTA 5AXMA 2ROGA 2HS4A 2VPXB 5EGYA 4PWDB 1SBRA 5C24B 5LMNF 4IFYA 3W2VB 1WACA 3U27A 4O4RA 2OMOA 4YP3A 3PFOA 1S9GB 1N6QA 1TKXA 3IAS9 5CQGA 3M4XA 1JLCB 1S1TB 4NLVA 4NCBA 2IM3A 3RU0A 2BV3A 4OV1A 3BREA 2UZAA 4RNFA 3OTDA 2O3DA 4ECQA 1BD6A 5I3UA 3IG1B 2XMWA 3NP5A 1S6PB 3O5TB 1Q8BA 2CJBA 4K5RA 4WFNQ 4A48A 1VQMS 5E3RA 4NCGA 5MLCV 2XWXA 3BGLA 4I7FA 2IC3A 1LW0A 1WHWA 3T6JA 1KD1T 4G6VB 2UU9F 2JVOA 3FJ2A 4F3QA 3OHAA 5KG0A 4O3QA 3BGRA 5J2QB 4WCEQ 2ADCA 1RA6A 3DRRA 4F4WA 3CDBA 4NLOA 4ICLB 3GQCA 2HVZA 2XLIA 3C6TB 3WDOA 3Q23A 4UW2A 5HBMA 2M3DA 1QSSA 3H5XA 1R89A 1GXTA 2FJDB 3CIMA 3K8VA 3MURP 2LQJA 3TO8A 5B0BA 4QBUA 4Y0FA 2XLJA 2JOQA 4X65F 4F3OA 2V4JA 4PG6A 4NXMF 3H40A 1TKTB 1RKIA 1V3RA 3B4DA 2MZQA 3EZUA 4MYTA 1FXRA 4PPZA 4RW8A 5KT4A 4U6PA 2B3TB 2ZD1A 4RBUA 1U26A 4KBIA 2AGOA 5K14B 3BGFA 4A8WA 2CVIA 1GNKA 3LWLA 4H4MB 2W25A 3G71S 1S6QB 5CA5A 5L38A 5HLFB 1ROFA 5E5NA 1KVIA 4K4UA 2AX1A 2HQ3A 4FXWA 4KT0C 2CPJA 2LA6A 1URNA 4JV0A 4ALZA 2QMWA 4GC7A 3M8SA 2G4BA 1RT1B 4P7TA 2DTJA 2LEBA 1FJ7A 1UL3A 4YHHF 4IH7A 3ISZA 2VV5A 2HHWA 1RT4B 2NREA 2GA7A 4LIRA 2WBMA 4OJ3A 1VQSA 1QTMA 2FHJD 3WC2A 5KG3A 3CCWA 3LP1B 2LECA 4HT5A 1R0AB 1G1XA 5LSLA 2E29A 4JV1A 4F2RA 2E1AA 4OZJA 3FQLA 3FSIA 3QLHB 1Y7PA 4DWIA 4IG0B 3B8HA 3CDEA 3M9OB 3MMBB 1IUJA 4CCHA 5AXLA 4FXDA 2E66A 4C98A 3I82A 3WBZA 4CO4A 2DGXA 3KLGB 2X1FA 3DHWC 3I0RA 2RIJA 4K4XA 1NK9A 2HIQA 3E01A 3BEGB 1MMLA 1RTJA 1HBMB 2QLXA 4RBTA 4B9UA 2B9YA 3W3SA 1NKBA 1I6JA 3TA0A 4FBTA 2YNHB 4I6YA 2LXIA 3E8OA 4IYQA 2LDYA 3PW2A 3OV7A 3RTVA 3AA9A 5I3QA 1Q1KA 1C0TB 1QE1B 4O44B 1Y5NB 1NK7A 2FLOA 2MKSA 3V6HA 1S6OA 1UJ6A 1B7FA 3J7ZT 5CXTA 2RDIA 4ZP8A 1FK9A 1X7VA 5J1PA 3T9NA 2B51A 2O66A 3BSAA 4WYLA 5T7LA 1MU2B 2F9DA 3DNCA 3D1OA 1HQEB 4DX8H 1TL1B 5LXYA 1DLOB 1JJ2R 1WEXA 3IS9B 5H9EJ 3KK1B 5CYQB 4Z2XA 3RAXA 1NZAA 3OLBA 1Q4RA 3ISNC 5J2MA 3ULHA 1SUQA 5KFQA 2JLFA 1Q7YT 1K73T 4C8KA 1JIHA 1VQLS 4GKJF 3DOLB 2DISA 4ZS6A 2I5JA 3RYLA 1YI2S 3O3LA 3BN4A 3M32B 3V5RA 1E6YA 4P7VA 5CCLA 3I56S 5E3PA 3JAMY 2QE5A 4IH6A 3GE9A 3RAQA 1SL0A 4M94A 1YGYA 4B3OB 3U1MA 2FTRA 2E5HA 2HPUA 1FKPA 3PX6A 1ZETA 2XS5A 1URRA 5HO4A 2LLZA 4KV8B 4DR2F 3MMAB 3MF5A 2WONB 3MPYA 3MM7A 2KG1A 5EX0A 2DR8A 4OJGA 5A6PA 1LWCB 1VQNS 2E9ZA 1YJTA 3SV3A 3H5SA 3V6KA 2FDNA 2FHJA 2CQ2A 3SQGB 4HL9A 4JBCA 2QYCA 5C42A 3OVBA 2WB1D 4G1QA 4ID5A 2RUGA 3X3UA 4DOZA 1GT8A 2ZHOA 2Z2LA 3CC2S 1GXLA 4KC5A 2JVRA 4E8UA 2JHEA 2PDAA 2YWEA 4Q5VA 2KH9A 1PGZA 2VA3A 2Y1JA 1HNVA 5GAEI 3V6DB 3EGWB 4FN5A 2W4DA 2H9ZA 2LDIA 2NYIA 2P9CA 3M6XA 4QWCA 1C4AA 1T3NA 4A8KA 1U48A 2DHGA 3C3LA 1WHYA 2HRYA 5C25A 1R31A 1VRUB 1YVFA 3DU6A 2XY5A 1KQKA 4QQBA 4CTAB 3H4BA 1TK0A 1TKZB 5D3GB 1B0VA 3DM2B 2FJWA 3M6VA 4PG8A 5JVHQ 2R2SA 1FNOA 4ECYA 4IQXA 4QCLA 1PSDA 1IKYB 1FRJA 4J9QA 1SH0A 4YB7A 4K4WA 4IO9Q 1SQEA 2HQIA 1HARA 2HRUA 2XY6A 1TVRA 2M9KA 3PRDA 4ZCKA 4AXJA 2M52A 3GG1A 1N5TA 3BM7A 3ZZOA 4OLPA 2MGZA 1M0SA 2YWHA 2ASDA 3GILA 3DCAA 3MOZA 1BWEA 2GMJA 2VG6A 4PG7A 3CJ2A 3D2WA 3KNGA 1O5JA 4NOHA 4Y2AA 2X1BA 5L8RC 1U6ZA 4H4OB 3Q24A 3E3XA 1HMVA 1S1VA 2X3GA 1ZAXA 3T1AA 3K59A 2HHQA 4O3PA 2F3JA 2BBEA 1UJ4A 2DHAA 1Y5LB 5KFHA 4EZ9A 3GFYA 3K2YA 1R43A 5KFYA 2P6TA 3DMJA 3R5AA 3K7RA 1SV5B 5B0AA 5GAHI 4QW9A 4IRKA 4DL2A 4LF9F 4NLRA 1S1WB 2CPXA 2YNGB 4OIXA 4RZRA 3MR3A 3H5YA 1HPZA 3N5FA 3N79A 4IQMA 4WFZA 1XMOF 5I4MA 3DYAB 2W9AA 1ULRA 1N54B 4IOAQ 2EVZA 2P9EA 4NZ0A 3DLLQ 3IG1A 4K4TA 2J0XA 4Q7AA 5J1EB 4RW9A 1S6PA 5A2QY 1KR4A 1IXKA 4XO0A 2AP6A 4OZLA 2VQFF 1L3TA 3MR5A 2ZE2A 2FIUA 1RT6B 4WJBA 1R8CA 2GC8A 4DV7F 4DQRA 1FDDA 3DRPB 1VC5A 2KHDA 2L9WA 5U47A 2F9JA 3KLFB 3QAEA 1N8RT 4WF9Q 2L08A 1L3KA 2JL9A 3IO1A 4G3IA 2MQLA 3HZEA 3MEGB 4F8RA 5LL6d 2M4MA 2OPRA 2RT3A 1CQMA 2YWKA 5KFAA 1R27B 2RRNA 1TFWA 1UVLA 1OQ6A 3M2RB 4TNOA 5KFZA 1CSJA 2MHNA 2AQ4A 1EETB 3GR1A 4BBYA 4CZCA 3FQKA 5KFVA 2YWGA 3OL7A 1Q81T 3LO3A 3HJFA 1YJVA 4LSLB 1YRTA 4JI8F 1Y3JA 1SC6A 5K14A 1T03A 2CG4A 2QV6A 3N9UC 3T6BA 2MY8A 5F9LA 1JJHA 3R27A 4GO5X 4DFJA 5HLFA 4FNHA 4HYKA 2L3MA 1YQHA 4QR2A 4D3HA 2CJ9A 3KLEB 4DR4F 3MCSA 1IBMF 2E9TA 2AX0A 1X9SA 2CIMA 1QUVA 3L3CA 3CCLS 3AHPA 1K1QA 5HROB 2A3JA 4K4VA 1JLBB 1FCAA 1JK9B 2C42A 2W4PA 1MROB 3M30B 4J5OA 4PXBA 1ZYQA 5HP1B 2ZOGA 4PQAA 4TLQA 3S1TA 2V9WA 2L48A 1RT4A 2G1DA 4Y65A 1GXUA 2EW9A 4ZOSA 1U1LA 2R7VA 3CD7A 4TU8A 4GC6A 3JB9k 3KK3B 2QRRA 4IG3A 4Q8EA 5DQHA 4XPCA 1BQNB 1C2PA 4DG1B 1DTQA 2RF2B 1BQMB 3QLHA 3WX4A 4ED3A 4C8ZA 2F7VA 3HVRA 4DL0C 5IFMA 3CC4S 3DLGA 1XN9A 3KLGA 1X5PA 5JUMA 2BOPA 2YKNA 2GHVC 3AY0A 2V8GA 5CZVA 1HBMA 3L95X 5EWFA 1WTBA 1NJYA 2HNYA 4QWBA 1H2UX 2Q43A 4AL7A 1HBOB 1O0PA 3DRYA 1X9WA 1JLAB 4EO6A 3PY8A 1R8AA 2ILYA 4OX6A 3W7BA 4X4VA 3IFEA 1EP4A 1C0TA 2EWHA 4O44A 4GO7X 5HMZA 5LT5A 3MZIA 4YEAA 2FJVA 1RT2A 2UV8A 4A8XA 2BXJA 2WB4A 2FJEB 1VGYA 2DNHA 3IRXA 7FDRA 2B0GA 1AROP 3F44A 5G0RA 5KFWA 3J7A1 3AJ1A 4QYZJ 1GAOA 4N77A 1FHTA 1ZZNA 4RWXA 2DNYA 1IKVA 4ATNA 5DDPC 2V8HA 3AQOA 5J2NB 2K1RA 2HHHF 4B3RF 3H2LA 1RP5A 2DH9A 4EUVA 2FLLA 1KLMA 4N76A 2R8KA 1F60B 1U09A 3Q8RB 1N6QB 1NK8A 1HBNA 1TKXB 2MY7A 4HH0A 1REVA 1SH2A 3M32A 2YKAA 4L3NA 1X8DA 2XMJA 4CT9A 1X4BA 2JSXA 3DC2A 4C97A 4XIUA 3J7Z5 4O3OA 2B5JB 5LJ5Y 4JI4F 1WHXA 5DDQC 4ECXA 2J9DA 4NLPA 2IC3B 1LW0B 2FC8A 2R2RA 3CIZA 1U8SA 2CJAA 1U25A 2WONA 2Z2MA 3BGRB 1QVFR 2G9OA 1OWXA 3A8EA 2D9PA 2BE2A 5D4PA 3DRRB 5AJ3F 4A47A 1SJQA 4DR6F 3SYZA 3T3FA 1M5KC 2XNQA 3WC0A 3TOQA 5B08A 5HBMB 5IZHA 2OTLS 2QMXA 2WK4A 2XS2A 2CQIA 3NLCA 3SQGA 4RLEA 4DDFA 1UAWA 2GGPA 1N52B 1DURA 3OLAA 4BWJA 3ITHA 3T5KA 4H54A 5IXUA 2V4JB 2M7SA 5LXRA 1S0VA 2WTFA 2VPWB 3O44A 3MGJA 3PEHA 4RW8B 4BC9A 3BR9A 3TRGA 1NHUA 2KFYA 1HNXF 1QSLA 4I6AA 2BQUA 2NS1B 4M8LA 2RQKA 3PO5A 3OVSA 2UVWA 2PO4A 4CT8A 1S1XA 5G4DA 4ZCIA 3LWMA 1SJ1A 3TI0A 2DNQA 1HNIA 3KG1A 1R8BA 2Y1IA 2BRKA 3CJ5A 3DLBA 5D3GA 2EPIA 1A7GE 1S4FA 2F8HA 1XTZA 3DM2A 4U9RA 3NNCA 3TP2A 4IO1A 4DUYF 3HVTA 3NAHA 2DNKA 3TQ1A 1IN0A 2ZHAA 2BZ2A 2M2BA 2JEIA 2AYBA 2HFZA 1RTDA 3PW7A 4JV2A 5H9FJ 1TKDA 1CVJA 2FD2A 3SSRA 3ZZRA 4K50A 4OI6A 3TA1A 3HM9A 2KTQA 2IHR1 2VKRA 1DZ5A 1H6KX 1VBXA 3I0RB 2YNFA 3NRBA 5F3TA 1YJWS 1NH8A 3E01B 1SJFA 1RT7A 1RTJB 4KJIA 3KJVA 4Y2CA 3VAFA 3GFXA 1K0VA 1U45A 4OFZA 2KO1A 1F5BA 1C1BA 3I31A 2LYVA 3MMJA 3UCGA 2AYEA 2J9DE 2L9NA 4NYOA 3OJSA 2XY7A 4ILRA 1P6TA 5L1KA 1DTTA 2DBBA 1U2RA 1KTQA 2JLGA 1S1WA 3CCRS 3MEEA 4ELTA 3CEDA 3IGVA 2ASJA 2R2UA 3V4MA 1ZOTA 1Z2ZA 2B6AA 1QLNA 5A8RA 2VC0A 1FK9B 2AJQA 2VZ9A 3DLEA 2MJNA 2YH0A 4C0BA 4FF1A 4MJKA 4OJ1A 5T7LB 1Z2LA 2U2FA 1JLFB 4MKAA 1LK5A 3G8SA 1TK8A 1UW4A 1QSYA 4MTPA 4Q8FA 4TQSA 5I42A 4AL5A 4HI1A 5LJ3Y 2QZ8A 3CXCR 1FRHA 5IT4A 3T1YF 1S99A 3MWBA 4MIAA 3KKFA 3D0GE 1JLEA 5A6WA 1M5OC 1ZZFA 3Q0AA 2C22A 4TU7A 1RA7A 1SUQB 1YHQS 1NNDA 4QJVA 1NEEA 1S49A 2JH3A 2YNIA 3N01A 4QW8