2DD8S

Crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
192
structure length
192
Chain Sequence
NLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords IGG Heavy Chain
publication title Structure of Severe Acute Respiratory Syndrome Coronavirus Receptor-binding Domain Complexed with Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dd8S01
4ZPWR 2AJFE 4KQZA 5DO2A 3SCKE 3D0HE 3SCJE 4KR0B 4ZPTR 4L72B 3D0IE 4ZPVR 2DD8S 4ZS6A 2GHVC 4XAKA 4QZVB 4L3NA 3SCLE 2GHWA 3SCIE 3BGFA 3D0GE
chains in the Genus database with same CATH superfamily
4X62F 3K57A 4H4MB 1PBAA 4B9TA 3UVJA 2EKYA 1QSLA 3M9OB 2MKSA 2F9JA 2F7VA 4DL7A 2FJAB 5I3PA 2V5HG 1Y4ZB 5F9NA 3QFHA 5F9LA 4OI6A 4USIA 1RWNB 1RISA 5KT7A 3HZGA 1L3UA 2Y8WA 4S0MA 3DMJA 4OX8A 1HYSB 1M5PC 2XMUA 4OIXA 4LUBA 3AOBA 4PG8A 3G2XA 4CQ1A 3CJKA 4YY3J 1FI4A 3CO0P 1NNDA 4KIAA 2OPPA 1D8ZA 5KFOA 4OZ2A 3TUIC 2RNEA 1WNEA 1IKWB 2CVEA 1R3NA 5A6PA 1VISA 2IM2A 1DQAA 2RQ4A 5I42A 3BN7A 1WF0A 5DQIA 3KWMA 3VZIA 1QUVA 4N77A 2Y1RI 3TQEA 1LWCB 4ED2A 5F8NA 3DRXA 4RBUA 4DV2F 2KJWA 2OMOA 3T19A 2FVSA 4DR1J 3CSKA 1HQUB 2XEXA 4DFJA 1TVRB 1EARA 4F36A 2G1HA 1Y00A 1HBOA 2HVIA 4QWCA 4ED3A 4LJMA 2U2FA 2EI5A 3IBFB 4ECUA 1IWGA 2W2NP 3KFWX 1T9WA 4ZP7A 1TZ0A 4URSA 3MR6A 2CFXA 1KTVA 5GMKa 4YHHF 1N8RT 3RBXA 3MR5A 1U1OA 1VQPS 1H2TZ 1S1WB 1IBLF 3H4BA 1KDNA 1RTZA 2DHSA 1OYEA 7FDRA 3TZZA 2HHTA 4EBEA 4OYZA 3LUYA 3F73A 2KT2A 3I5BA 2M52A 4JI4F 3NY0A 2RQCA 4KGXB 3SSSA 4ELTA 4WKYA 2BE2B 4IO9Q 2J9EA 2J6TA 2B0GA 3EVWA 2Y1JA 2QLJB 3DOLB 2CJQA 2W8LA 1D8YA 2F63A 3OUYA 3MM6A 4LRAA 1PILA 1VRUB 3EDQB 1X4HA 1Q53A 4XAKA 1TMJA 4RW6A 5B08A 4AL5A 1RI7A 2E5JA 2IA0A 5LT5A 4X64J 3BGRB 3MEEB 2DHGA 1FDDA 2AW0A 3WIUA 3H5SA 3N01A 1YLXA 4J91A 4JI6F 2WVCA 2A0FB 2DGXA 2FJVA 2M9KA 4D3HA 3M32A 1FNXH 1BD6A 3G4SS 2CKWA 1C4CA 3KG0A 3ADAC 4I69A 2PMZD 3ELHA 2HNZA 1BUXA 1VI7A 2EK1A 2KN4A 4YN3B 4HEA9 1FJGJ 3EVOA 2Y9HA 3AD9C 1S5ZA 1WC3A 2C1EB 3L7PA 3UFCX 3KK1A 1KD1T 2KTQA 3GFXA 2DNMA 2UU9J 1I94F 3BJYA 5EHHA 3KLIA 2YX4A 2JLEA 1S9EB 4DZ6A 1XR7A 4Z7CA 4NLWA 3ET6B 4YR3A 1KEKA 1DTTB 1KLNA 5GAEU 3SCJE 3M2VA 1FE4A 5CCLA 1GXUA 3G8QA 3V6DA 3TUJC 5ETMA 4JB8B 5A2QU 4FVMA 2HGNA 1U47A 1RTIA 3RAQA 2VBWA 2U1AA 1IXKA 3MM7A 4O4RA 4JYAF 2DT9A 2YKMA 1XR5A 4OZJA 4FF1A 5T41A 1NB7A 4NXMJ 2GQ2A 3GG0A 3OJSA 4U6PA 2F1FA 3I0RB 3HHDA 4B9UA 1LW2A 4K2JA 1FNOA 3L7OA 4TU9A 3WIVA 2YH1A 4ED4A 4UUWA 2ZJPQ 1S6PB 5FLXY 2FJEB 4WTOB 2WTFA 4EUVA 1IBKF 4A8OA 3A8KA 5GADU 2EPIA 4DDFA 4PYDA 3VR1A 1PJ7A 5HSPA 1BQMA 3FKBA 3TAMB 5KG6A 1RHMB 3NAHA 1YBAA 5E3AA 5DG8A 4JI1F 4ZVUB 1UWBA 3UNYA 3GR1A 2HVZA 3ENWA 5IV4A 3D3CJ 3HMJG 2IRYA 4I6YA 2EXUA 2FJWA 4AQYF 2WZ1A 3IR5B 4OI3A 5HROA 2WCXA 4CNZA 3KK2A 3S7RA 3D28A 4PG5A 1T7PA 3LP1B 1R27B 3OD2A 5CA5A 3RRGA 1AROP 5EWEA 2G1DA 4FXDA 2BQRA 2RAQA 3NCQA 3Q8RB 2WOMB 5IWAF 3MURP 3FSXA 2BE7D 2JZ5A 3M1VB 1DQ8A 3PG9A 4BLGA 1M1KT 2VG7A 1H38A 3RU0A 3FMWA 4NEYA 1XBWA 4CYUA 2MHNA 2Z57B 4LT6A 3DYAA 4NEZA 1RTHA 1AT1B 5KAKA 2B7CB 2HRYA 1RHQB 1U24A 3K5MA 3S6EA 1UVJA 1R0AB 4LR7A 2YKOA 3MPUB 4EO6A 1BQNB 4EU0A 2RF2A 1NSPA 4G6VB 2BQ3A 3W8GA 1AB8A 2GQCA 4LF1A 4MAKA 2POKA 2JOQA 3E01A 1JLBA 1S6QA 1JLFB 2E5LF 3UR0A 3PFEA 2E7XA 2QIFA 4ZOSA 3W9JA 2DR5A 2UXCJ 1UJ5A 2YNFA 5KFSA 1XERA 3EDRB 2JEFA 2ZH8A 2OSQA 2H54B 2QE5A 1FKAF 3LO3A 1RQ0A 5MAOA 5KT5A 2YWWA 3G8TA 2W7OA 1GXTA 3MPWA 4WXOA 1C1BB 1OSDA 1W25A 4NX9A 4TQRA 3SYZA 1SH3A 1A7GE 1X8DA 4CLYA 3BYPA 1RKJA 3PCOB 4OHZA 3C8YA 2AQ4A 1BXNA 3N6MA 2QV6A 2DO4A 4OLOA 2UXBF 4RNMA 2E1CA 4RU9A 3O8WA 4OFZA 1RCXB 2Z56B 3ZTPA 3LGHA 2OUGA 1U6FA 4IR1A 4I6AA 1WUUA 4B3MF 1N36J 2H3EB 2NXUA 2GV1A 2I1RA 3TEGA 1U1NA 5J1NA 1KTQA 4ERDA 4B3TF 2DY1A 4LF9J 3MEDB 4Q2MA 2XMMA 1D1UA 1H98A 5L8RC 2COLA 1NKBA 4NLQA 4CWBA 3J7ZT 1X4DA 1OY8A 3EWGA 3D1QA 1U8SA 3T41A 2XWXA 2EKNA 3QWUA 4UTGA 3L95X 4IDKA 3EPGA 1S1TB 1H2VZ 2HLTA 2R4FA 2OD6A 3DDKA 3W2WA 1JNRB 3OSNA 2BJDA 1TR0A 2YWGA 3BV8A 4M1KA 1QD1A 4B3RJ 2EWHA 4NA1A 3CULA 3CVKA 3ITHA 2DXFA 2LFVA 5KFGA 2PFDA 5H9FJ 5JXSA 4FXWA 5CD4A 3IC1A 2WVBA 1PYOB 4DV7J 1DBDA 2UUBF 2Z30B 3RR8A 4B3OB 1CC8A 4CRJA 4QWAA 3CW2C 4QIFA 2CADA 4J90A 2RIJA 1N32J 4RW9A 2V4QA 1UEKA 3VVTA 3HDSA 2GVZA 2AF6A 4DX5A 3O44A 1VQ9S 4ES2A 2CDRB 2VKZG 3HX9A 5KFAA 1VR6A 3RTVA 2M2BA 1LNQA 1IBCB 2DIUA 2QO3A 4Q8FA 3CJTA 3O2IA 4FPIA 2MZRA 2HS0A 2R7XA 1H7XA 4J9KA 3LQVA 4OZ3A 1NEEA 4ED7A 5DRKA 4DBQA 4QIWD 1VRTB 4ICLA 4CLPA 3JQKA 1C0UA 4RNHA 4X4SA 3G6XA 3R5AA 4FNIA 3KLHA 2HZVA 2ZM6J 2GVDA 2XSJB 1EP4B 1WSVA 3FNNA 2DY9A 4DL0C 1LK7A 3A12A 2NS1B 2LVWA 3J81j 1SL2A 2BZ2A 2XLJA 4QU7A 5AXNA 4M5HA 3NRBA 2B51A 1OPZA 1RAIB 2DHHA 3OHAA 2KYXA 1S6UA 3AJDA 2XM3A 4WPAA 3THVA 3EZOA 4P71A 4KAIA 4LRCA 2JVRA 4WP3A 4OX6A 1WC0A 3DFEA 2P8IA 2VKRA 2ZHOA 4OJ3A 3ENVA 4PG4A 2A10A 1XEZA 3DLJA 4ZN1A 4XO0A 3NEKA 3KLFA 4LREA 4TNOA 2QFIA 2ZH7A 2VQFJ 1URRA 3CIZA 3OXGA 3T1HF 4IFVB 1BWEA 3R7SB 1RU2A 2J0SD 1RAEB 2XSFA 3D7SB 1S0VA 4GRSA 2JFKA 1T8EA 3UNGC 2CQIA 3MOZA 2KM8B 4LSZB 4IOBA 1JLQB 1IBMF 3W5ZA 1FRKA 3C6TB 3DRRB 3HO1A 5EX3A 5HBMB 3PY8A 2AYGA 2AJ4A 1KR4A 3LWLA 3LP0A 4B02A 3KHLA 3BZQA 4UUXA 5KFCA 2HURA 4P6QA 4O3RA 4LFAJ 1AXQA 4JI7J 3LF0A 3O6QA 1FKOA 4H4MA 2V9WA 1B0VA 1TL1A 4MKBA 2B9EA 4GMKA 2HVDA 2O5DA 1S0NA 2I9SA 1HNIA 4OYIA 1RYRA 2KYZA 3JQMA 2LXUA 1RTDA 3NS6A 2MSTA 2QGFB 2V34A 1CJKB 1GK8A 5KFVA 3JTPA 1S6OA 3PEHA 3DHXA 1VC5A 3R5JB 5HJYA 4NRTA 3A8IA 1T03A 2KG1A 5E5NA 1YI2S 1RAJA 1WG1A 1HW9A 4LRBA 1OO0B 3CB4A 3M8PA 1K1SA 1RADB 1YTYA 2C3UA 2BJ7A 4A8XA 1LW0B 4NLXA 3BGLA 1RXOB 1S1VB 1I51B 3JSRA 1OIAA 1WEZA 2APOA 4J9PA 3MZIA 2XC9A 1VJQA 1VHFA 2QLBB 1JQGA 3BF4A 2LQ8A 2D9OA 4C7QA 1RT2A 1JXEA 3KMQA 3R6LB 4YY3F 1NJIT 5HK4A 3JAMY 4AYBD 3GYGA 2RRNA 3DLHA 4B08A 2QN6B 1F0XA 3RRKA 2CPFA 4G1QB 1HBMA 1XN9A 2XLKA 2GW8A 4Y2IA 1WELA 1MMNA 2XY7A 3TWZA 2L41A 1TK8A 4DR1F 4QOTA 3N79A 1HI8A 1ACMB 1SC3B 2WSFC 2VDIA 4YB1P 3W9HA 3LWMA 2HQFA 4QPTA 4QYZJ 1P8GA 4U8YA 2XZTB 5A8WA 3M6VA 3Q86A 1VLYA 4K4SA 2XYPB 1HHSA 5D0EA 3CDBA 4M5KA 3W2VA 1PJ6A 4BDPA 4N8OA 3Q2TC 3JSYA 1Z2LA 3QT6A 4WZMA 1KOOA 2DEIA 4DV1J 2ADBA 4U7UD 3L09A 2JH3A 1CQMA 1Q16B 2M3DA 1UPMB 4OX7A 4PWDA 2LXFA 2G4BA 4J9LA 4C98A 4C3LA 3HSGA 3NBPB 3DOKB 4F3QA 2A3JA 2DNQA 3KJVA 1GMWD 1UZHA 2HHSA 5L38A 1RTJB 5DDOC 4ZVPB 4FPRA 5B0CA 2GJIA 2XYGB 4BBYA 2XMVA 4X4QA 5IC4B 3DU6A 2PEBA 2QA4G 2BM1A 4PZVA 2IAJB 4I2QB 4M5GA 4J5OA 1GH8A 1WHVA 3KJFB 2F9DA 4ETZA 3QZ7A 4OX9J 2XMJA 1P9QC 1JIHA 3TJ9A 5KG2A 4HTIA 2P6SA 4KYZA 2DHXA 1TL3B 3DXBA 3MCOA 3MF5A 3QYYA 3KLEA 5B0GA 3AD7C 3K0JA 2F5GA 2OMLA 1QTMA 1FJGF 2H48B 4ED6A 3FJ2A 3AT1B 2IIHA 3VAJA 5KFWA 2GO9A 2AGQA 3TVZA 1U1RA 1KOHA 4FYVB 2UU9F 4M5NA 3THTA 1QAXA 2QLWA 5CYQB 2W2OP 1U0HA 1WDTA 2W9CB 4DPWA 4CM2A 3BO2A 3FMBA 5IQ6A 3NNHA 1RJJA 3SI8A 2CJYB 4V19X 3PW2A 2HFUA 2UVVA 3TJAA 2VG5B 1M0SA 3BO3A 5DJBA 4U96A 4LFBJ 2R8IA 1NCLA 3SV3A 2J7WA 1WEXA 4R0JA 2XY6A 2CNKB 1VQ8S 4NXNJ 5IM0A 1DFDA 4OYWA 1ITPA 1YHQS 4NCGA 2CNOB 1X9WA 4ATNA 3QJLA 1R8CA 1X5SA 2HK3A 4LBPA 4IG3B 4MK8A 1AFIA 1CJTA 1N5SA 1BHNA 4NI2B 4F8RA 2G2OA 3KNGA 1YIJS 4K4UA 5CXTA 3S8SA 2OI2A 1UVIA 3LGMA 1K9MT 4LF4J 1C4AA 2FLLA 3LP1A 4TKTA 2I2YA 1KN6A 5AE3A 1N6QA 2DIVA 2GAHC 5A8RB 1F9FA 2B4PA 1IN0A 3TA1A 3SSQA 1RAFB 2GS8A 4ZPTR 1MU2A 2WOMA 1CLFA 4IO1A 1ZS6A 3UCGA 1VMBA 2JWNA 2AYMA 1RAHB 3X3UA 2GIQA 1S97A 1Y7PA 3D4JA 4O4GB 1YITS 1PIEA 3DOMB 1D9AA 3DLLQ 3SCLE 1S76D 1QAJA 3EYZA 4C8YA 1NH8A 3FK4A 2C2NA 2RS8A 3MPYA 1YG0A 2OGUA 4EZ9A 4ENOA 1SCJB 2MKYA 2ZDPA 2ALYB 1T05A 1VIXA 2OPRB 4LSNA 1LXNA 1TUGB 1DURA 2WW4A 5H9EK 2RHSB 3EUNA 2QT7A 5F3TA 3FBBA 5HVFA 3ZZTA 2I5JA 1REVA 2MZJA 4WFYA 5B0BA 1MLAA 3HT3A 5E3QA 3OFFA 4ZMMA 2AKWB 4QQBA 2VC1A 2QG9B 2L3MA 1TFYA 4XK8C 5A76A 4LR8A 5KOXA 4CO2A 3RYLA 3I6PA 1T9YA 1RT3B 2UXCF 5AXKA 5HQLA 4C9DA 4KSEB 1YRUA 3EE3A 3AFGA 2MXYA 5G0RA 2KU7A 5IT0A 4XPCA 3HM9A 1CBKA 5D3GB 4M5JA 3ZTRA 1VQ6S 1U4BA 2RD5C 4OYOA 3GIKA 4F3OA 4AUKA 1IKVB 2B4UA 1Q1KA 1FT8A 1C2PA 3N6NA 4U8VA 4NLUA 2DHAA 2XLIA 2GIRA 1RLDA 2YXLA 1VYAA 3MMCB 5IQQA 1EETB 1HFEL 2VFTA 2V67A 2EK6A 2CQ2A 1M90T 4R0EA 1K47A 3PX6A 2DCLA 2NUUG 5ETSA 2AJQA 1UJ6A 3OXLA 2LYVA 5A6WA 1D09B 4B9SA 1E6VB 2DITA 2V2QA 3J80Y 3N4WA 5ETPA 4NE9C 2ADCA 2ZZMA 2Y3YA 3BQ2A 5C2GA 1N36F 4KHPJ 1FJCA 4QR2A 1S1TA 4C8OA 3J7Z5 4JV5J 3QRQA 3C6UB 3R3TA 2E9ZA 3IM9A 1YQHA 2J76E 5C24B 3RB0A 4DWIA 4P7TA 2VIHA 4DG1B 4LF9F 1BQXA 3CMQA 2QSFA 4FKXA 1XMBA 3HFVA 5FD1A 3IS9A 5F8MA 4GKJJ 3IAS9 2UVRA 3J7YU 3T5KA 4WE1B 3U1LA 1S77D 3E8OA 3OVSA 3OPKA 2BKNA 3M7VA 5AXMA 4B3RF 5C42B 1QY7A 3WDOA 1Y5NB 2B43A 1WG5A 4HDHA 2VPZB 3FQKA 1HQEB 2JDJA 2I0XA 1VQNS 5GAHI 3W8PA 4G3IA 2MKIA 3ISZA 2XG8A 2DXEA 1U6ZA 1NAQA 1N32F 2PGCA 3CJRA 1C0TB 1X31C 3RAMA 3LH2S 3JTNA 2B4VA 4KBIA 3GIJA 3V6KA 5SZTA 1PG5B 2V2ZA 4DQPA 3QT8A 4C8NA 1Y5IB 2RKIB 2DH8A 3HULA 2OLWA 2AYBA 2HFSA 4UZCA 1B3TA 2XNQA 4O44A 2P9CA 2OPQB 2B3TB 2HQCA 2FLOA 4ID5A 4LIWA 5EX0A 5KG4A 2CRLA 1MSWD 3LPEA 1NLKL 4JI8J 4Y3CA 2LMIA 5KFFA 1HNVA 3MECA 1RWMB 2M8HA 4ZLLA 1NK8A 1S9GA 3L7UA 4MTPA 2P2CB 3CGIA 3P8BB 2ZM6F 3M6XA 5GAGU 3HVWA 4QU6A 1NK4A 3I55S 3OSPA 4WU2A 3CDWA 4FF2A 4DSEA 3ZZUA 2L9WA 3I87A 2D74B 1LWFB 2RQMA 3GYXB 2EG1A 1CS4A 4KGVB 3TVYA 1QSSA 4OYMA 2A6OA 1HMVB 2BMBA 1Q78A 4OZNA 1ZAVA 3OVAA 2C28A 3R2CJ 5JJBA 4ZKAA 1S12A 3CJ4A 2ZH9A 2LCWA 2ZE2B 1UVNA 3DLKB 4NASA 5FDLA 1OS5A 3H0PA 1UWAA 3VCDA 5HBMA 1VBXA 2ZZTA 4Y2CA 3HFKA 4ANEA 2KT5A 1QE1A 3OTDA 4MYTA 5DDPC 3MAHA 4DUTA 2B8PA 4ZVOB 2BOPA 4MK9A 4JBCA 3I5CA 1VCTA 1W2BR 1SUQB 2AX1A 5A8KB 5U47A 3Q8VA 3PJWA 2FVPA 2MJUA 4NYPA 4WP9A 4C11B 2N82B 4FN5A 3RJMB 3F41A 5J2QB 2IY5B 1U09A 2AD9A 3JSMA 1YJWS 3W65A 4X4TA 4PQAA 2HBYB 1Y3KA 3C14B 1RAOA 3Q89A 4WU3A 2RDIA 5K5MA 5FLXU 4ZK7M 1TKXB 1FKPB 1HNZJ 2RJZA 3M2UB 3N28A 4LFAF 2R7WA 3DDIA 4JI7F 2EVZA 4M5DB 2CZ9A 3P4UB 4DPXA 2AGOA 2MYFA 2GGPB 3CJ2A 1ZYQA 2CQDA 1Y10A 4ANDA 2UUTA 4DQSA 4Z2XA 3US5A 1SH0A 3J81U 3HKWA 3KMSA 3MHYA 3TA2A 2IDLA 1KHVA 3H2VE 2VA3A 1FRIA 2IC3A 5THWA 3CCZA 4ED8A 2EC2A 5K8PA 4YUDA 4USKA 1SIZA 3OFGA 3IRXA 2XO6A 2E9TA 3BH7B 4MFBB 1REGX 3Q8SB 4RW4B 3NAIA 1DAXA 2UXDJ 2CQHA 3EXCX 2W2QP 3BN4A 1TL7B 4MIAA 1YRTA 3T5HA 3KUGA 4KFBA 1CJUB 2LU2A 4YQWA 3HVRA 4L73A 3HVTA 5GVQA 1T9VA 1Q86T 4OJGA 3MM9B 3ZZYA 4FS2A 2ZZNA 1RKIA 1WWHA 4X2BA 1RT4B 4CLSA 2EFVA 3MD1A 3R8YA 2NUHA 1B70B 2ZH3A 4CH1A 1N54B 4EZ6A 1RYSA 4ER8A 3BSCA 2CQ1A 3EZ5A 3RB3A 1FXLA 3VGVA 4LBHA 2KXHA 3JB9k 2DGQA 1FX4A 1RACB 2NPIA 1EQMA 4DV6F 4NLRA 1GMWA 4GC6A 3GV5B 3KDNA 1ZAWA 4J7CA 2X3DA 2F40A 1RE1B 3GTYX 2M5YA 4PXBA 2WBMA 3W63A 1GMVA 3FEZA 2GNKA 5DQHA 2V69A 1FCAA 4USHA 1F2GA 3HSZA 4N5SA 1W2IA 2MY7A 4RPFA 1DARA 4ZVHA 4PXCA 1EKRA 2LA6A 3V6HA 3M9NB 4C0HA 1FK9B 1Y3JA 5DM7Q 4BC9A 3IM8A 2XO7A 3N5FA 4DR2J 3C19A 4JOUA 1HBUB 1H7WA 2J5AA 3CCSS 3TX0A 5F41A 1A0OB 1WC1A 2R2TA 1VK8A 4P2XA 3QO9B 4LF6J 3FFIB 4DV1F 3M2RB 1RTJA 1SXLA 3LALA 3G6VA 5EDWA 1RT6B 4PXEA 3MM8B 1U48A 3MMAB 2AT1B 1TKTA 3S1TA 4LF5J 5EN1A 2F3JA 2GQQA 2DGWA 4I2QA 4CO3A 5C5JA 3CD6S 4PG6A 1KKHA 1MROA 1RT1A 3PX0A 5M2PA 2Q43A 3DKDA 5J2NB 2WK4A 1SVDA 3KUHA 1WEYA 1JJ4A 3IWNC 1WDDA 2E29A 3OFEA 4CH7A 2N7CA 3VQSA 3U1NA 2VBXA 1U2FA 1HD1A 2VBYA 5E3CA 1SJRA 3HXMA 5DM6Q 3QAEA 2IJRA 3HHLB 2UVWA 1SV5B 2M7SA 4OX9F 4DV3J 1TL4A 2H65B 2W9CA 3A8JA 1FXDA 4CM0A 3I82A 4P7VA 1VBZA 3OQ2A 4F0MA 4A46A 3TNVA 4CO1A 2ZH1A 2XS2A 5EGYA 5IC6B 2KVIA 1XWLA 2Y0BB 4GO7X 1IKXA 3M6UA 3FGVA 2AHOB 1VQMS 4RW8A 5EUHA 2L48A 5EWFA 3OVBA 4A8YA 3SFGA 4QR0A 2B4OA 2AGPA 5H9FK 4QR1A 1V3SA 3T9NA 2O67A 2FZCB 1AZSB 3CD5A 4AFFA 4QIGA 1N5QA 3TAQA 2I6WA 4DX8H 2HWIA 1SL1A 5J1PA 5T7LA 2X1GA 3VAHA 4LFBF 2W9AA 1U25A 4PUOB 1TP7A 3G6YA 1T02A 4LQ3A 4YP3A 2ZITA 3AJ2A 1U2RA 2MQPA 3I9ZA 1VHIA 2L08A 3H90A 4NXNF 1ULRA 2QEXS 2VF3A 2MLYA 4DR5J 3CF5Q 2VPYB 4K4XA 2CQCA 2VPWB 2ZBRA 1CJVB 4GVBA 2DGVA 2R2RA 3V81A 4MIWA 3PV8A 4FXVA 4LF4F 1C1CA 4HHJA 8ATCB 2HMIB 1QDUB 2ZKUA 3BQ0A 1JJHA 5I3QA 1FWKA 4K4VA 4ZCMA 3EGVA 4YDXA 3OLBA 1FXRA 2E7VA 3MWBA 3DRPA 4DV5J 3MAQA 2GFFA 1RWPB 3MUVP 3DHWC 4Q5VA 2IVFB 3B8HA 2ROGA 4USJC 1NJZA 2IYIA 1FDAA 1J5OB 3H5UA 3G96A 3GLJA 1FO1A 4K4YA 4BHQA 3NLCA 4QBUA 2AX0A 3M8QB 3WX8A 5C25B 2HZCA 1N5YB 5KFHA 4ZP8A 2ATCB 1X9MA 2ZBQA 4IG0A 4A48A 3OTOJ 5JMNA 4LVNP 3Q24A 5CD4H 3KYLA 4NYOA 1UA0A 1FX2A 4N47A 5B09A 1V3ZA 3SQGA 3P5TL 2PD1A 4IFYB 2PA8D 1T9UA 2BANA 2MGZA 1RHRB 1WC6A 2WONB 4FF3A 3FDSA 3QSYB 4M5IA 1WTBA 1ICEB 2IDEA 2LDYA 1AYEA 4X4RA 2CDQA 5D78A 2C2DA 4OZLA 1NPRA 1WHYA 4HHHA 5GAEI 1JX4A 1RT5B 3VAMA 3CDAA 2R8JA 2V8VA 3I31A 3PR4A 3QLHA 3GPAA 4R8UB 3H5YA 2GHVC 4B3SF 1S1UA 3M30B 4DLGA 5F8GA 3KK3B 2ZVSA 4F4KA 3I5AA 3SDEB 1P1LA 3UI3A 5K9FA 2F4VJ 1O8BA 1YZ6A 3D2WA 1VC6A 2LU1A 3PRBA 1TUVA 3PX4A 1TV6A 1RBLA 3PW4A 3MFIA 2YKQA 2BYCA 3NNAA 1E6YB 2OH2A 2ASJA 2D3O1 5T14A 4ZVFA 1XJWB 3CDUA 4OHYA 5GADI 2EW9A 2LQBA 3VAFA 3DLGB 4OYBA 2GMJA 2YNHA 1N52B 2R9LA 3C6UA 4A8MP 1YGYA 2R7SA 3K8WA 5KFIA 1QVFR 2NR0A 2HRTA 1MN9A 4R5PB 2XI2A 4HLBA 2J0WA 1DTQA 1U1MA 2DNRA 4LIRA 3KDOA 5DETA 1FWPA 1Y9OA 2KVQE 1FTCA 4B17A 3U1MA 4I67A 4AT1B 4HI1A 2ZBPA 3UD3P 2X51A 1HBNB 4DI6A 2GMHA 4JV5F 1WI6A 1UVLA 3CMES 3SXLA 1N0UA 4EO8A 2W9BA 1RU1A 1H3DA 1SKSA 5HATA 4FF4A 3UCZP 2V2VA 3G9CA 1QAIA 1W26A 4GKJF 2B9WA 3MM5A 2AYEA 4I7FB 5KG5A 3BKTA 5D4LA 4ZJLA 2VDHA 1YK9A 1HWKA 2ZWOA 3IA0A 3PRDA 3OFHA 3SV4A 2WVFA 3ZTSA 3OR2A 3KJNB 3V2UC 2H5IB 5F8IA 5KFZA 5JVHQ 4LBIA 3WX4A 4ELUA 1TU0B 3D0IE 3ZC4A 4X65F 4QYZK 2RKIA 1UEVA 2VL1A 1QUPA 3ETMA 1HI0P 1FHTA 4ECRA 4PQUB 2NLWA 2KHCA 4DPUA 4X66J 2JX2A 4W4MA 3UW1A 2L9NA 1WC4A 3ONQA 2R8HA 3D66A 2C42A 2ZOFA 1S7HA 2VQEJ 4KV8A 2K8GA 2LQJA 3G71S 4DSFA 2ZDOA 4CLFA 3V4IA 3I4HX 3KG1A 5KG7A 3Q8UA 4USTA 3GJRB 7FD1A 2RDJA 4KKOB 1M1HA 4A47A 3BGUA 1BMQB 1N33J 1KQSR 3W5YA 1FEHA 2HNDB 4CLKA 4MKYA 3CNQP 6AT1B 4GKKJ 2PEHA 3CC7S 1Z4UA 1YZ7A 1XTZA 1WI8A 3C16A 5J1EB 4Y34A 3UO0A 4NA2A 2VG6A 4EGLA 4AD6A 2KRRA 1P6TA 3HZEA 1TL5A 2O3DA 5HMYA 1SJ4P 4RO0A 2IVMA 1S10A 4UOHA 4WBFA 3A1YG 1Q8IA 4NZ0A 3R2DJ 3LGNA 5L1IA 2M70A 4USMA 3TQ1A 4K50A 3VGTA 2DXDA 1X5PA 5IZHA 3HVAA 1NB2A 5HQ8A 1AFJA 1BC6A 5A8KA 1NMEB 4W92B 3R6GB 4M63A 5I3UB 1JLCB 4IQMA 2HHWA 4ILMA 1JLEB 3QGIA 1D3WA 1RWWB 3HT0A 2MQLA 3UN5A 4C2MA 3TEHB 2LLZA 2NSBA 3DLEA 2HYIB 4RX6A 3DM2A 1JLGA 2MQOA 1KBRA 4Y00A 4TY8A 4JI2J 3X1LB 4HACB 3HJFA 4NZ7A 2HHQA 4ZP9A 2FYXA 4NLOA 1ZBTA 1H2UX 5A0YA 3A8EA 3CTRA 4QWBA 3P96A 4DS5A 3WHIA 4CLTA 4U9RA 3M05A 5D4PA 3UVJB 2X7IA 4Z37A 3GONA 4J9UE 1UP1A 3DCAA 1HNZF 4RW7A 2Y0SD 3VGUA 2FJBB 3GSDA 1R8BA 2RB7A 2MLZA 3QFWA 1MN7A 2ZJRQ 5DZ6A 1XR6A 3DMJB 3BBBA 3HKZD 5KFJA 1S7IA 1O0PA 1B7YB 3CJKB 2MY8A 4QW8A 2HHHJ 1HLWA 2YBVA 3PFOA 2OPPB 1XMQJ 3EZUA 1NBEB 3MM9A 3ZTQA 3M9MB 1ZTTA 2EFOA 2OEMA 2N3LA 2WSCC 1DQ9A 1XK8A 2E9RX 3SCIE 2H5EA 3UN3A 1WACA 1ZH5A 2JL9A 3GE9A 4QWDA 4ZITA 3T6JA 3K5NA 4YHHJ 1VBYA 4P72A 1U7LA 1HBOB 2QL7B 3DC2A 5BR8J 3FZ2A 2IBOA 5HVHA 1QJHA 1P1TA 3TZWA 2HNYB 4JI4J 4PWUA 4X4PA 3D9BA 5KOWA 2CA9A 2MLXA 2AEFA 3UCUP 2QLFB 2DH7A 1TAQA 3VWSA 2BJ1A 2DNGA 2ERRA 3BS9A 2BKOA 2XQCA 1KVIA 4OZ1A 5ETVA 2IBKA 3NP5A 2CNNB 1HBUA 3Q8QB 4P73A 4CO5A 1H74A 2Y1IA 1JB0C 2D3ZA 3FZBA 2P5VA 3QO9A 4Q0BB 2IJNA 3IR7B 1O51A 2LEPA 2HQGA 2CQGA 1Q79A 2GHPA 2FC8A 2R3VA 4DL3A 4DL6A 3ISND 3GU0A 2CYYA 4JI6J 1T9XA 3MM6B 3CO9A 3V4MA 3PKMA 2GMLA 1BWVA 4QCLA 4DR3F 4PEOA 3GSIA 2AEJA 3FRZA 1Y0HA 4RW6B 3CWJA 1R8PA 2R42A 4ZCIA 3E3XA 2PE8A 2BE9B 1JMTA 4YR0A 2M8DB 2WVEA 2RHQB 4YB5A 3OXFA 1S59A 2P9EA 2UUWA 4LF5F 1I94J 2CJKA 3CMAS 1IR1A 4V1Ak 2Z2YB 3M32B 4ILLA 4GVLA 1X4EA 4NLVA 1TMMA 4R25A 2OPSA 1U1QA 1LKZA 2PFFB 4CNYA 2HNZB 1A6LA 4KJIA 1JWWA 3K2YA 2BJ3A 2D3OR 2W1BA 1G7CB 2GJFA 3PACA 4F0HA 3T6BA 3KK1B 1EHWA 2GO8A 3MR7A 4JYAJ 1NJYA 2V8HA 3KLIB 5KTQA 3FRYA 4M95A 2XNRA 1PJ5A 1RLCL 5KT2A 3WC0A 4ALZA 2Z2LA 2E1PA 1FA0A 3CXCR 3LAKA 3VQTA 3ULHA 4I6WA 1EX8A 4EWTA 4JI5J 2YTCA 1LWEB 4DV3F 3M2VB 1T3OA 1Q81T 3Q2SC 2KXNB 3V6DB 4V19J 4FS1A 1UA1A 1MWQA 2KHDA 2HPUA 2V4JB 3BDPA 1KS2A 4WZQA 3MM7B 3HHEA 4L72B 5HLFA 1ZOTA 1VK3A 4K4WA 2YKMB 4YB7A 5BYQA 2IM3A 1EB0A 2B6AA 4LR9A 2P9GA 3QIPA 4WP8A 1A9NB 5D4OA 5I4MA 2CPYA 4C97A 1LW2B 3IG1A 3NMAA 4YDDB 2OSRA 4RJVA 4F02A 4DR7J 2CZ4A 3EGZA 1UW4A 2H4WB 2F65A 5HVGA 1OJ4A 4OV1A 4J9SA 1WOSA 2AJ0A 5B0AA 2CQ4A 1BQMB 4FNHA 5KT6A 2YQ3A 2JRSA 1M1GA 3EICA 4DSLA 3MEGB 5FJ4A 2R7UA 1Q95G 2IA6A 1CEZA 2NXEA 4XTTA 2B9XA 3W66A 1UWBB 5ETRA 4ZS6A 4O3QA 2NPFA 1F5AA 4WF9Q 5HROB 2K1RA 4I4BA 3WC2A 1OSCA 1OYDA 1H73A 3MMBB 5L39A 4DR5F 4ZJOA 4G1PA 1YJRA 3TRGA 2EFGA 3H20A 1J5EJ 4QPXA 5LSOA 3ENAA 1J27A 3K8VA 4J9OA 2R8GA 2HKEA 4M5MA 3MCNA 2RQKA 1EZZB 3SSRA 5CH7B 2C2EA 2JJ4D 2VG7B 3K7RA 1V6HA 1RBAA 3I0SA 4UOGA 4IR9A 2QMWA 2H1YA 4CYUB 1B4SA 2O66A 2RUGA 3PYFA 3DYAB 1RTHB 3MI7X 1XQIA 4DXLA 3PW5A 3HI9A 4KPCA 3LP2A 3TUPA 3AB4B 3LOUA 3JSBA 2HFZA 2PMHA 4WFBQ 2YNIA 2RF2B 1NSAA 3HD2A 2XHCA 2RU9A 2FHJD 3NL0A 4L74A 3OTOF 2C3OA 1KQFB 1NK9A 3E01B 5J2PA 1AA1B 1TKZA 1K73T 3KHGA 2CWXA 2VZ9A 2YNFB 3KLGA 2NXNA 1DLOA 2NREA 2DR9A 1T9TA 1NO8A 1WG4A 4ZPVR 4LF7J 2WAQD 3GILA 3DLBA 1XNRF 2F8MA 3BSNA 5K8NA 2NCKL 5HP1A 1VFJA 2VPXB 3B6BA 2VODA 2J9DA 3OV7A 3DXSX 1HL6A 3QT5A 3B82A 1SKRA 3KK3A 2MQNA 4DL2A 3SDEA 2FVRA 4XDCA 4B3MJ 3G82A 2WVDA 4OI4A 4DOZA 4A8KA 3C3LA 4KY3A 3GP9A 4USWA 2HQIA 2EFNA 2DGOA 2E5GA 4KB7A 1TTHB 4JI3F 3FBFA 5J2MB 2AWZA 3BSOA 4DCPB 2AJ2A 2PIIA 2F4VF 1TKDA 3D0GE 1RWKB 5CYMA 1VJWA 4IRDA 4IRCA 2YNGB 2OFHX 2HEKA 3PRVA 4DMZA 2LXIA 4U67Q 3Q22A 1Y5LB 4TYBA 2FHMA 3H98A 5AT1B 4TYAA 1NHVA 1HR0F 2KB2A 4KHRA 4DJBA 2UUBJ 5LXRA 4JUZA 4IDKB 2DRDA 2KT3A 3N5BA 2V0NA 1X9SA 3CCJS 4EFAC 1CULA 3W2WB 5BYSA 3BKUA 2DNZA 4JV1A 2V9KA 2QX0A 3IFEA 5LSRA 2C3MA 3AA8A 3ITHB 4QZVB 4QYRA 3C15A 2HQDA 5KFTA 4UF4A 3U7JA 4P2SA 1UFWA 1KONA 2K7KA 2AMCB 2PT0A 3GWCA 1JJCB 1TFWA 1ZA2B 3T5LA 1S4EA 2D9PA 4RW9B 2GJ2A 1X5TA 2R7VA 2V8PA 5LL6d 4I0WA 1S0OA 2GVZB 2DJWA 1FFSB 1I1GA 2YX1A 3LA0A 5E3RA 4ECVA 4ZHRA 4RBVA 2HAIA 2Z0GA 1KLMA 1CSJA 1OQ6A 2EFPA 1SBRA 3MCMA 3QGHA 3KHRA 5F8HA 5CCMA 3TZYA 4M8LA 3O5TB 1NM2A 4ELVA 4L3KA 2XZWA 2EBEA 5KFEA 4ICLB 2V50A 1C0UB 4HI2A 4OI0A 4C8ZA 5LJ5Y 4X66F 3QNWB 4K0KJ 3NGUA 3KLHB 4NLPA 2FPHX 3IP0A 5HMZA 3K17A 2XWYA 2VQEF 3AHPA 2VA2A 2PI5A 2LP4A 3RB6A 1GEHA 2UUAF 2BDPA 3OTBA 1URNA 3CC4S 2Z4PA 3QRRA 5K8MA 5M2UA 2N4DA 3BGOP 1OPIA 1SL0A 1N33F 1VGYA 3JS9A 1G1XA 3MGJA 3IO1A 2W01A 5AXLA 1JLAB 3QIDA 1Q8BA 1HYSA 1V9OA 3R7NB 4EEYA 3D6TB 4GKKF 4ZPAA 3UWTA 1U1LA 3TP2A 1RHJB 4MT1A 2RS2A 3KKFA 1SC4B 4QIVA 3BR8A 1ROFA 2HGMA 2MQMA 1IKWA 2Q6CA 4O3NA 1X4AA 3KLFB 3Q83A 3VAKA 4M5LA 2YKAA 2G0IA 3OL8A 1UMJA 2CAJA 4N7TA 5F0UA 1Q0NA 1WHWA 4P75A 3FEYB 1YBUA 2J9CA 1LWCA 1QTNB 3GB0A 1RBOB 3RW6A 2HK2A 3MEKA 1HQUA 3ZTOA 1TVRA 4ED1A 3QWPA 4DFKA 4LF8J 2ZH4A 2V2KA 3M8RA 1VIOA 3LP0B 2HBQB 1VOMA 2MMYA 1NXIA 3J7YI 4DPTA 4BS2A 1EKSA 4QWEA 2JEJA 1FKOB 3FSYA 3E51A 1TL1B 2C2OB 2DRAA 2J0XA 2F8HA 1DHMA 1PKUA 3H2LA 1S1WA 1QM9A 5DGBA 4NRUA 3E2EA 4JI2F 1KC8T 1PAUB 2DK2A 1HNIB 2PDAA 3B4DA 1RTDB 5D0HA 1FEEA 4LVOP 1NK6A 2XS5A 2G0CA 4I68A 2MHEA 2HIQA 1JNZB 2FDNA 1T03B 3T5JA 5IXUA 4B9NA 5HI7A 4C8LA 4DCOB 2QJ3A 3UDCA 1X60A 2PC6A 3M4XA 3EGNA 2BE2A 5K20B 3M8PB 3FUYA 1BGXT 2XMWA 4F4ZA 1UKUA 4OI2A 3HP6A 3H7HB 4C0OC 4NZ6A 3DOLA 1CQNA 3MTJA 5HQMA 5KG0A 1X4BA 3BH6B 4IH6A 2ZBCA 4CLLA 1SJ1A 1VRUA 3S01A 1Q5VA 9RUBA 1U45A 1YX2A 2NYHA 3HLUA 3PYGA 1HHTP 2UUCJ 1U2CA 2BKPA 1RT2B 2IJFA 2ASDA 1FVQA 4HDGA 3BGRA 4IOAQ 2ZBIA 3MEEA 2V6AA 4DLEA 2ILZA 2HHHF 4P74A 1YJ7A 3N0VA 1XMQF 5AE2A 1WKLA 4HH1A 4NCBA 1HBMB 2E1MC 1G2EA 2CPHA 2QYGA 2DNOA 4DV4J 2HNYA 3CCUS 2VC0A 1X4CA 4DU8A 2YPZA 4X64F 2KFZA 5GAGI 2QRRA 2H5JB 2AP6A 2DNYA 3LPYA 2A18A 2VBZA 2WW8A 4ZPWR 2J9DE 1KP6A 2YQ0A 5BR8F 1S9EA 2DEJA 3ET6A 4J9NA 1HPZB 1Q5YA 2ILYA 1DTTA 5A8WB 1FTRA 1ZETA 2H9ZA 2YWKA 4YB6A 4W90B 3P45B 4Q0BA 2FVCA 3ZXWA 4ZVGA 2VICA 1ZAXA 1RA7A 2KFNA 2HHUA 5BXIA 3W2VB 4LQ9A 2KKHA 3KXDA 5LMNJ 2HW3A 3CJQA 3L9ZA 1PSDA 4X84A 3EVMA 4DEZA 2E44A 4ZVTB 3NS7B 1ZPWX 4CDIA 1DJ0A 3I0RA 4DQQA 1RAAB 2DD8S 4WTYA 4PWDB 4Q2LA 3CJ0A 3VALA 2XB2D 2KL8A 2DNNA 1PBUA 3R1LA 1S6PA 4C6AA 3A3PB 3G86A 2C2RA 2KG0A 3HCXA 3NGKA 1EIYB 2XMAA 3KJVB 1FRLA 3D68A 2OD4A 2NZCA 1XMOJ 4NXMF 2VB6A 1NZAA 2PO4A 2XMTA 4CZCA 4DL4A 1YWXA 3KJQB 3P3DA 3TAMA 2DNLA 3H59A 1S57A 3PDNA 2BV3A 1KHWA 4PYAA 1WKJA 3A13A 1B0PA 3DI6B 3FVYA 4TY9A 2KJVA 3OJUA 3TO8A 2A2CA 4CLUA 9ATCB 1NK7A 4I56A 1VQ7S 5CHCB 2D69A 2DBBA 1KQKA 2N7YA 3KLEB 1NJWA 3UDLA 2RUSA 3QZ8A 2XULA 1NK5A 4N76A 2XTJP 1LWEA 3BYRA 4OZ0A 2KZMA 2ZOMA 2VH7A 3M1VA 2ASYA 5KT4A 2V4JA 2MZ1A 3OLAA 4L6V3 2B9YA 3BQ1A 3HPOA 3GMGA 1YDLA 2ZH2A 1RT7B 4PPZA 4EBCA 3FBCA 4ZJQA 1U0HB 5IT9U 2IHR1 4K4TA 3H5XA 4NLSA 1BLUA 4JI5F 3EJMA 3TUZC 1R0AA 3VVUA 3W1YC 1TUWA 1L3KA 3EPIA 3MCSA 4KC5A 3PZPA 1BQNA 5KG3A 1IQZA 2RSQA 3PYDA 1RZMA 2C2MB 4FBUA 4RLEA 2M0GB 1G3OA 3D5MA 1JLFA 1WF2A 1GX5A 4C8KA 1VC0A 4Q7AA 2NQPA 5IM0B 4FYYB 1WC5A 4L76A 4NCGB 3CD7A 3MEGA 1L3VA 4KH0B 1G6BA 1BY9A 2JLGA 2V8GA 1CJTB 4DR7F 1I5OB 3J81Y 3GFHA 3GIMA 1C1BA 1XC9A 3MMBA 1N6QB 2FHJA 3DRYA 5KG1A 2UVUA 2OFGX 1IWAA 4PWWA 3TARA 8AT1B 3BPSP 2G9OA 4CI0B 3UQSA 3NXZA 2OTJS 1MU2B 3R7BB 4LMZA 3NKYA 2IRUA 1VBKA 3ZNJ1 3TAPA 3VAGA 2W4CA 2ALZA 5AE1A 2ZUAA 2F8EX 4KGZB 2G2YA 4QJVA 2YWEA 4KGMA 3JTOA 3OW2R 4KO0B 1J5EF 1K0TA 4ZVSB 3GFZA 5RUBA 2OP5A 1BE4A 1GFWB 4OJHA 4OQJA 3LAMA 3M8ZA 3W64A 3P5BP 5E2QA 3CCES 5CYJA 4ZCLA 4DQRA 2J0QD 2X1AA 1T05B 2WB1D 4URQU 2V94A 3MEDA 2MKJA 4LSNB 3SZ2A 4RR5A 4C8MA 3VHQA 3UPFA 3JYTB 4WFXA 1NJXA 3FSIA 1N4LA 2I5JB 1REVB 1KRPA 3K5PA 1ZM9A 3CJ8A 3O1LA 4TN2A 5DLFA 3DRSB 2VFVA 1WJ9A 2LKZA 3FEXB 2O1PA 1Q7YT 4U7UK 4DSIA 1W7WA 4ZLNA 1UVMA 1IVZA 3DGPB 1UCNA 1EJ7L 3TI0A 3RG6A 3H42A 2HRUA 1HNWJ 4UOCA 2E7WA 4L3NA 2E1RA 4B3OA 2J7KA 3DDNA 4ZPCA 4LF7F 3SQOP 5SUHA 1RSCA 4M94A 3A3NB 3HHNB 5G0RB 1XIQA 4DL5A 4QW9A 4JV2A 3QJJA 5FIIA 4X4NA 4ILRA 1NK0A 4Y6IA 1AW0A 5J2MA 4F7VA 4DV7F 2D41A 2K7JA 1ZZNA 1GTHA 2AZ3A 3B4MA 3AXKA 3BB5A 4X4OA 1R0CB 3F0NA 2GA7A 3ISNC 2WB4A 2GZOA 4E8UA 1SKUB 4DS4A 2YNGA 3NG8A 1SIWB 2D3UA 1VRTA 1ZTWA 4NWBA 4OLPA 2MZSA 4DCJB 4Q44A 5DDQC 4DX6A 1X5OA 1CVJA 2KFYA 3PVXA 3PYEA 2MQ8A 1S4FA 1SJFA 4DUZJ 2XSJA 1EP4A 2FQQB 2HWTA 1FFGB 1T95A 3N6LA 4KGKA 1PC4A 1FD2A 3PO4A 1RWXB 3WZ0A 2KDOA 5HMXA 5KFMA 3VTIA 2RDDA 1WSRA 2VFUA 2BRKA 4PXDA 1N34J 5L1JA 5K14B 4CT9A 4PG7A 2CZVC 2ATLA 4OV6A 1RWOB 2KRBA 3UD5A 3ZNUA 4WFZA 2MEWA 4C3MA 4FYWB 3IS9B 3RW7A 2V68A 1R0BG 2ZFHA 3ILOA 2YKNB 4DR6J 3PHEA 1HD0A 3BPDA 3C2PA 1N56A 4Y2MA 4IKAA 4ECYA 2DGUA 2QLXA 3CCTA 2MPUA 1HKAA 1J2VA 3G6ES 4RKUC 4UOFA 4IFVA 2JHEA 3AD8C 2XGQA 1UZDA 4KQZA 2GCFA 2BR0A 3D3BJ 2HSEB 5IOLA 2J7UA 2Q6BA 1R8HA 4YS2A 4OHWA 4K8RA 2VFSA 2BM0A 4P2FA 2OTLS 1JJ2R 1JLQA 3KOAA 1F3VA 2AJFE 3C6TA 1NUEA 4B9MA 3GYNA 4LF2A 3DRRA 1NKEA 1F9HA 4USUA 1U0SA 2VQFF 2N3OA 3TOQA 2XMKA 4NLGA 4QIEA 1OY6A 3PKYA 3RBDA 5L9XA 2OKQA 1VQLS 4O44B 1EAYC 4CT8A 4ID5B 2VFRA 3BBCA 2XY5A 1L5UA 3AOCA 4WYWA 3NOCA 1FDBA 1KSPA 3K5OA 4OHXA 1SQFA 2J6UA 5MLCV 1HNVB 1CJKA 3MECB 1S9GB 2VONA 2Q79A 1JLAA 4K0KF 2DPIA 5KFKA 1M5VC 3GJTB 1ZM2A 1T11A 2Q3PA 1RDRA 3IGNA 5K8OA 3M8YA 5D0RA 5F8LA 2BJEA 5F0WA 4DN9A 1LW0A 4NLDA 4Y28C 1S1VA 1NPPA 2CPEA 4NYZA 1CS4B 4UT4A 2M88A 2JEIA 5ETKA 2R2UA 4CO4A 2JC1A 2BABA 1LFWA 2HFNA 2ACMA 4OYPA 3MMJA 2ZC3A 2YX7A 3GV8B 1JKHB 2DPJA 4I2PB 4RNFA 3LW5C 3GJQB 1RK8A 4XPEA 5FDLB 3MR2A 4HYKA 5D77A 2PMWA 1PC5A 2QMUB 1B99A 1U02A 1F9EB 4ECZA 3QAUA 4G1QA 4RWXA 1H6KX 1QE1B 4F4XA 2Z2MA 1MWZA 1HQ2A 5LMUJ 5ADZA 3GCXP 3SEOA 1B7FA 2ZKTA 4ES3A 1FNMA 5JUMA 3UD4P 5DG7A 1U1KA 1F5BA 4DQIA 1F60B 1PYSB 3JSMB 4KR0B 4LF8F 4PRFA 2NXCA 3H2UB 3AA9A 4EI2A 4ZN3A 1DRZA 3R5DA 3OL6A 4HR2A 4MIBA 3EMTA 3W7BA 1FVSA 1R43A 4N56A 3ILIA 2XZDB 1T0TV 4F0KA 4LRDA 1K44A 2BQUA 4I64A 2DVIA 2RH3A 4UY8T 1CC7A 3W5XA 2DNPA 3IGVA 4X4UA 2FGOA 1SKWA 5HAOA 5DDRC 4C4WA 2IC3B 3OBIA 3W60A 2DCUB 1RABB 5KFLA 3BEGB 2HHXA 3NBPA 5IV3A 1KQGB 4O0NA 2N4CA 3DOKA 3IRXB 3LANA 1VQYA 1RA6A 2MKHA 5E7OB 1IR0A 2OO4A 5LXYA 5D6GA 2LECA 2QA2A 2BX6A 2D1CA 3C66A 2YPYA 3H40A 2D7SA 2NZ4A 4KFBB 4NLYA 2OHDA 1F2HA 4NA3A 3HVTB 1HWUA 1IM4A 2UUCF 4DV6J 2HS3A 3AODA 2EC0A 1FWLA 4CLZA 4MK7A 2IAJA 5GMDA 2A2DA 3ZZ0A 5ETOA 1GXLA 5L46A 2A6MA 4K59A 4WXWA 2ZH6A 1QVGR 1TK0A 4OI1A 3HF5A 1TL3A 4HT5A 4ZLPA 1DY3A 1N48A 1HPZA 4LRFA 4DV4F 1Q82T 4DR4J 2ABYA 1HWLA 3OHBA 5KFPA 1R89A 3W62A 2FHKA 4Y0FA 5DLGA 2RILA 4WFAQ 5CYQA 5B0EA 3IN5A 1YRXA 1P9YA 4IH7A 3F44A 1FJ7A 2BUNA 2FLNA 2FIUA 4F67A 5D0GA 2I38A 4J37A 3RBEA 3RGIA 3W9IA 1FRHA 5KFUA 4ZVRB 1F3FA 4CO0A 1SI9A 4ES1A 3L3CA 2MJNA 2VG5A 1HNXJ 2OEJA 5DS7A 4KTQA 3CEDA 4JI0J 1WOPA 5LMNF 3CT9A 4WYLA 2Q1LA 1PCAA 1WF1A 4HKQA 1SQEA 2ZOGA 1YBTA 3HHLD 2IMWP 1TKTB 3GQCA 2CJBA 3AY0A 4IG3A 5LJ3Y 3PM9A 3DI6A 2K2PA 1MROB 3OTEA 4NI2A 1RT1B 1HHQA 2W8KA 3KTQA 2J8AA 1ZPVA 1GT8A 1SH2A 2SXLA 1QLNA 4IOCQ 1WTFA 1YJNS 1XMOF 3QQCD 3PJ9A 2JFDA 4IRKA 4JP8A 4E0DA 1VS3A 4AE5A 3PHTA 3AQOA 5A8RA 3MTKA 4E2FB 1T3NA 4GC7A 2LQ9A 3OL7A 3KG4A 4IYQA 2CPZA 1WHXA 4Y65A 3FCVA 2XCPA 3TANA 1FF2A 5DGAA 1KWMA 3FCHA 3R9LA 1UJ4A 3PTWA 2KM8C 2AIRB 3IBCB 1RT7A 4ZVQB 2ZD1B 4O4GA 2WHOA 3BM7A 4FZVA 4DUYJ 3M6WA 4DN0A 3DOMA 4ETXA 2DO0A 2IRXA 1FD8A 4Q8EA 4OYAA 2DGTA 3CCMS 3R5BA 2LQ5A 2BJ9A 2ZUGA 4PAAA 4O3OA 2OELA 1IKXB 2OPRA 3K5LA 3OT9A 1UW9A 1HA1A 2CNLB 3CPWR 1GTEA 1ZM3A 2ZVIA 4RW8B 4OJ1A 4KRWA 5KFXA 5E0OA 1SJ3P 2E1AA 4F25A 3MPVA 1VQSA 5IT4A 2CQ3A 3MDFA 2CG8A 4DPYA 3MAAB 1K0VA 2W2MP 2QL9B 3AOAA 2UV8A 1YJ9S 2BEFA 1D9DA 5T7LB 1GX6A 3QATA 1VQOS 3CC2S 3CJ3A 1RHKB 1RT3A 1FRXA 3CE8A 1H72C 3VZHA 3VAIA 2V4RA 2JNJA 2BW7A 6FDRA 1VDHA 4ECXA 4IQXA 1WKKA 1O5JA 2YH0A 3QPIA 4OYXA 1M5OC 2Z8QA 5D3GA 3NMRA 4RNNA 4L75A 4CTAB 2G0JA 4GVBB 4XDDA 2MSSA 3MFHA 3V81B 3GJSB 5ETNA 1MWYA 1C1CB 1IKVA 4ECWA 2YVSA 3NNCA 3RUBL 4EBDA 2IPOB 3R27A 5LM7E 2DKOB 4KO0A 4YOEA 1JXVA 4PPDA 1L3TA 1KNZA 3MMCA 5HANA 3TVKA 1EETA 1S0MA 3DRPB 4H54A 2JEGA 2O01C 2B56A 2XHWA 3POTB 2FGCA 4BC7A 5B0FA 4EYIB 4UW2A 4KT0C 2CPXA 2HFOA 4WCEQ 3NGDA 5C2CA 5AJ3J 1VQ5S 2W25A 4F50A 3O3LA 1E6VA 5M2RA 1N0VC 3TW0A 5HMWA 1UTAA 2W4DA 3JYTA 1IKYB 4C3KA 3KHHA 4IG0B 2PSZA 3UN2A 4G1IA 1MNEA 3G87A 3DRSA 4NMLA 2MDAA 3RB4A 1HARA 4D3GA 5C24A 4PR6A 3SQGB 1GQEA 4ZIWA 2CJAA 5DG9A 4DG1A 1K1QA 1NDPA 2BANB 5ETTA 4A8FA 3DGPA 2MGZB 4Q43A 1RWVB 4W98A 3ZO7A 2AU0A 1S1XB 2I8EA 3JAMU 1VQ4S 4WJBA 4J9MA 3CJSA 2CPDA 5KFNA 4ZLJA 4UZBA 2FZKB 3UDEA 4KHPF 3TZXA 3QJPA 1Z2ZA 4WE1A 5F3ZA 2K06A 5A2QY 3OR1B 3NOGA 5L1LA 4B3SJ 3NWRA 4RU2A 4O3PA 4U7CA 1N5VA 2HQ3A 3ZZRA 1UVKA 1FE0A 5C42A 5KFYA 1IQTA 2FZGB 1HNWF 1HQEA 3QLHB 3GZ7A 2BACA 1UL3A 1M5SA 2B5JB 3CUNA 4DF4A 4ZVEA 3A4TA 1S1UB 3H8YA 4WKRA 2JVOA 4H4OB 2C22A 1C0TA 1VLOA 3H4DA 3ZZPA 1RWUA 4AL7A 2RU3A 3V5RA 2CQ0A 5BJRA 3BBFA 4ZPBA 3QMQA 4DF8A 1TV6B 2KH9A 2GAGC 1XNQJ 4OHVA 1N88A 1OWXA 1EQ0A 1NZ8A 2DYAA 1G4CA 3PJXA 4TQSA 2VJUA 1VQKS 2MZTA 2BOAA 2HWHA 2OPQA 2HBZB 3A3OB 3D6FB 1UETA 4LFCJ 2YNHB 1L3SA 2HLUA 4FKYA 4EK2A 3K89A 4GO5X 3M8SA 2VD3A 1S72S 3T1YJ 5K14A 4TXSA 4IUFA 3ZZOA 1DTQB 4O3SA 2ZNYA 5IFMA 4DUZF 5E33A 2JSXA 2W24A 4F4AA 2W2PP 2YKNA 1Q7LB 1RCOB 1F1BB 3CCRS 1LWFA 3FBEA 4DSKA 2W9BB 2H4YB 4JI8F 1N34F 3NCRA 3J7A1 3IWXA 2VV5A 2FY8A 4WFNQ 1HMVA 5B7WA 4P9SA 2RVJA 3G8SA 3DNCA 3FC9A 5HJXA 3HSDA 3HD1A 3MUMP 3JQJA 1U1PA 3MM5B 4X65J 2PI4A 2ZE2A 4TLQA 4DR6F 2R2SA 3U27A 3PEJA 1D9FA 3DLKA 3VF0B 2K3KA 4LSLB 3TX8A 3OR2B 1X7VA 2KXFA 2JLFA 1RUSA 2CG4A 2DH9A 3CCVS 3CJ5A 3I9V9 1QSYA 1X4GA 2DTJA 2E5HA 4ZA1A 3CCQS 4DV0J 3ILJA 1SUQA 3CCWA 3H25A 1ZZFA 4ZIVA 2K3IA 3EXYA 4C11A 2XGPA 1F6TA 4RL1A 2G13A 5J2QA 2E5IA 5CQGA 4P2MA 6FD1A 1RB0A 2HVHA 2ZNZA 5KFQA 4X62J 4FVCA 3C14A 4MYUA 2Y1LB 2DR8A 1NSKL 4KV8B 2B7BB 3THPA 2LDIA 1TKXA 1FKPA 3V4IB 1FESA 3M2UA 3UDVA 2ZHAA 3IR6B 4ID8A 2DR6A 4RUHA 1GMUA 3VGSA 4M5DA 2FVQA 2OAUA 1U6BA 1YKWA 4MH8A 3EX7B 4HTJA 3TYTA 3BSAA 4PKDB 2NSCA 5L9NA 2QZ8A 2GGPA 2R7OA 1D0EA 2VJVA 2AEMA 2MZQA 3QBCA 3C16B 3BGFA 3KLVA 4C48A 3Q8YA 1NHUA 2VG6B 2B8QA 2MTLA 2RRBA 2H51B 3UE2A 1WOOA 4Y2AA 2LEBA 4DFMA 3WBZA 1JKHA 2MQQA 2RT3A 4I2PA 2FB0A 1PAEX 4MFBA 2L9DA 4C0BA 3D1HA 4CIOA 4RW4A 1PO6A 1CG2A 1IUJA 4HT7A 4DV2J 4FBTA 2QC3A 1GNKA 1TL7A 4WIQA 2G2ZA 3BR9A 1JXLA 1CJUA 1IJEB 2Z58B 3PNIA 4O0IA 2DGSA 4UQTA 4KHMA 3RR7A 1FRJA 3FCWA 3PW0A 3HSJA 2WSEC 2YQ1A 1RT4A 2QA1A 5I42B 1SJQA 2OEKA 4ANCA 2UXDF 1T94A 5D4NA 3MOJB 4AL6A 1NDCA 2YKPA 3DLEB 3F56A 3DM2B 1JLGB 1S48A 1SB6A 4Q45A 3J7AN 2MB0B 1IBLJ 3AAWB 5LMUF 4TY8B 3Q8PB 1GAOA 2QFJA 2GX8A 3D67A 2R7QA 2CIMA 1YJTA 5A0YB 3GV7B 2VOPA 3NGRA 1U49A 1AUDA 1LWXA 4A8SA 1OQ3A 2FUG9 2LA4A 1Z1ZA 2IM1A 3B54A 4O23A 3AJ1A 4ECSA 1N5TA 2CQBA 1PGZA 2FLPA 3BREA 1HWIA 3MR3A 4RW7B 3QGPA 4CLWA 4A4JA 2HG4A 1FK9A 2NYIA 4RBTA 4UY85 2GC8A 2FC9A 1V5IB 4KPYA 2OIHA 2FY1A 2CVIA 2DISA 3D6HB 2QTWA 3DGVA 4DSJA 4N41A 4K5SA 3FFIA 1R6VA 3M2RA 1U26A 2CPJA 3HHKA 5G4DA 4MKAA 2W7PA 1FJEB 1RT6A 4WIIA 3MM8A 3MMAA 3B78A 1U8WA 3CIMA 3ICLA 1UFLA 3W3SA 4F26A 3OUYB 2BRLA 4RWWA 4DR2F 1V3RA 4EYHB 1FDNA 4URGA 1IJFB 3SMZA 3IMQJ 2XYHB 4DX7A 4LF6F 1LOUA 5J2NA 4B9LA 2QSWA 3CCLS 2PN6A 1SC1B 1KVKA 3SFUA 1QAYA 2NXJA 2QYCA 3D1OA 1ELOA 1MW7A 2QL5B 1YJUA 3PO5A 2BW2A 1R31A 2IMOA 3J80U 1KFSA 4ZP6A 2CJXB 3HHLA 2HS4A 1SV5A 2ZJQQ 3AB2B 4FDFA 4FP9A 5E3PA 2V63A 4RNOA 1S99A 2RMLA 4IH5A 2HHPA 1V5VA 5DZ7A 3RZAA 1B0TA 4DR4F 2XI3A 2ROEA 4ZCKA 3FQLA 1NKCA 1NU4A 4DR3J 4AXIA 7AT1B 2ZHBA 5IS2A 2BVZA 1VRQC 1JK9B 1HI1A 1RTIB 4H4KA 3C46A 4F3MA 4ITSA 1IM6A 1IBKJ 1FERA 2RE1A 4PABA 4OMFG 1AZSA 5LSLA 1HW8A 2W4PA 4BWMA 4AXJA 4TVAB 3GR0A 3NGTA 3LTOA 1HNXF 3SIPB 2J8SA 4YR2A 2GIFA 3RBZA 1NH7A 2UV8G 4PUOA 4OL8A 4JI0F 1R8AA 5CAAA 2BJ8A 4JI1J 1IR2A 4FYXB 2Q66A 2Y8YA 3PXGa 4AQYJ 1YSJA 4YEAA 2X1BA 1M5HA 2R8KA 3QT7A 4WK3A 5HN0A 2OPSB 1B64A 1CJVA 3EM1A 5IWAJ 1LK5A 3PIOQ 2HMIA 2ZD1A 4F4YA 5HL7Q 4F4WA 2QMXA 3AH6A 2ZEJA 3KK2B 1MG7A 4N8NA 1F5CA 4DPOA 1SC6A 4KH1B 3PIPQ 3ILLA 1P27B 2UZAA 1NDKA 1KFDA 4ED5A 3PW7A 2EG2A 4HL9A 5B0DA 3MUTP 5KFDA 2E66A 4YFUA 3P6YC 1NPKA 5H1SV 2CQPA 2AV5A 3T9ZA 2HAFA 1TQLA 1UAWA 1M5KC 2W7AA 1J5OA 4RZRA 4ED0A 4Y2KA 4DUYF 2KI2A 3WQPA 3M8QA 5C25A 1NDLA 1N5YA 2C3YA 5HLFB 2ZWPA 5GAHU 4F2SA 4XIUA 5LOQA 3GCWP 3NS5A 4NPOA 2E5LJ 3MAAA 5ETQA 3VV2B 4DV5F 3D0HE 4K2XA 2DNHA 2B6AB 1DZ5A 3TA0A 4DU7A 3QIPB 3W61A 1X0FA 1YJVA 4IFYA 3BO4A 5CABA 3K58A 4RUAA 3IG1B 3R5CA 2Z2ZA 4OZ5A 3N9UC 1RGVA 2WONA 2BA9A 2IYGA 2UP1A 2RRAA 3Q23A 2VHGA 5KFBA 4HH0A 3ETOA 1TELA 1JLBB 1S6QB 3P49B 1S9FA 3HFZB 2HHVA 4KE5A 4ECQA 2XCAA 2DRBA 2HFVA 4K4ZA 4TU7A 1UPPA 4J9RA 4FYDA 3BDEA 3K59A 4J9QA 2IM0A 3QGGA 4Z7YA 2FJXA 3HK2A 1RT5A 4CTAA 2YWFA 3OL9A 4WK1A 3R97A 4BWJA 1OY9A 4R8UA 1R6YA 1APSA 2K1RB 4I1TA 2UXBJ 3L4BC 3U02A 1NHKL 2YY3A 3BKFA 3M30A 2WBRA 3ZFVA 2VOOA 3POTA 5D15A 4ZDNA 4ZPDA 2AZ1A 2DNKA 1LFPA 4K5RA 1NRKA 1E6YA 2F4FA 4TLRA 2FJDB 2XBPA 3V6JA 2KZZA 4B3TJ 3KNAA 3ENQA 5L1KA 3RAXA 4ECTA 2EBGA 1TK5A 1IKYA 3MD3A 3I0SB 4G65A 3DLGA 3IRWP 4NL5A 4USVA 2C2KB 4BCAA 3D54A 3LP2B 4CCHA 4NOHA 4RUBA 4WWSA 3CDEA 3QRPA 1SQGA 3DU5A 5AJ3F 1SPBP 1Q8LA 3IAM9 4CH0S 4R5PA 3D6MB 2YNIB 1S1XA 2WRMA 4B9VA 1XNRJ 1MMLA 5EWGA 2CWKA 2EEYA 3Q0AA 2VASA 5KT3A 5J2PB 3IXQA 5ITHA 2OJ3A 1TKZB 3QSIA 1HBNA 3GFYA 3OR1A 4NCAA 1FFWB 3KLGB 1S49A 1DLOB 2CUYA 1OMSA 4PCQA 3T3FA 3PR5B 1MMDA 2YWHA 4NLTA 3CD0A 1CPZA 5HO4A 1I6JA 2XS7A 3SBMA 4TU8A 3R1HA 4P52A 4I7FA 4E98A 2B5JA 3R5GA 3IWLA 5HP1B 4JI3J 5D8HB 1R7IA 1Q4RA 2JC0A 4UQGA 4H4OA 2ROPA 5CZVA 4HHUA 4P10A 2VUGA 3GG1A 3RRHA 1S79A 3I96A 3G82B 2PA3A 4A8QA 5CZXA 3NGSA 5JVGQ 4X4VA 3I32A 1ZM4A 3IBWA 2ASLA 2CPIA 1NSQA 1X0PA 5ETLA 4PQUA 1UEUA 3GIIA 2FD2A 3M8WA 3ZZZA 2J6SA 1Q8KA 1HR0J 3I56S 2CJ9A 5DQGA 2HGLA 2C2ZB 2R7TA 5CYMB 4RUCA 1ZA1B 3HHLC 1XNQF 2KO1A 5BYRA 3TJ8A 4EMDA 4MKVA 4KKOA 3UR3C 4F04B 1WD6A 1O6XA 2HNDA 2EFQA 2MKCA 2HIYA 4LFCF 2FHOB 4JV0A 2ACYA 1HWJA 4F2RA 1KVJA 1LEOA 1LQ9A 2GVDB 3JXOA 1HIYA 3T1YF 3NCPA 2MKKA 3OTCA 5J1EA 5DO2A 2IVYA 1I3OB 5IT9Y 1CULB 4U95A 1LXJA 5H9EJ 2HVEA 2ZC4A 2HBRB 2AJ1A 3GIRA 4H4KC 3NWGA 1PYTA 2A1BA 3T1HJ 1FRMA 2V8DA 3C15B 4J9VA 2CXEA 8RUCA 1TAUA 4LSLA 1RAGB 3MPDA 1AUSL 5C7PA 4YMEA 2HZAA 1K8AT 2LEAA 5GMEA 1LV5A 4DFPA 1IBMJ 3SCKE 2P6TA 4DZDA 1X4FA 2DR7A 3T1AA 2QA4S 4DHVA 3DN9A 1RHUB 1Y11A 5I3UA 1JLCA 4NMXA 2R7RA 5F8JA 2X3GA 2DB1A 1JLEA 3MXHP 4ZHRB 4A8WA 3HJVA 1KLMB 5E41A 3I4PA 3AXMA 2ZH5A 4HVZA 4MJKA 2M4MA 3TR5A 1RP5A 3KUEA 3EGWB 1H0HB 1YVFA 2X1FA 2UUAJ 4DV0F 3AQPA 1UFKA 4HACA 2BBEA 2VU5A 4K7QA 2C3PA 2IFXA 1WORA 2GHWA 4CP5A 5KFRA 2FTRA 4MMOA 2BXJA
chains in the Genus database with same CATH topology
3MEGB 5FJ4A 4X62F 4HT5A 4ZLPA 3K57A 4H4MB 2R7UA 2IA6A 1CEZA 4B9TA 5FD1A 1N48A 3IS9A 1HPZA 5F8MA 2B9XA 4DV4F 2EKYA 3IAS9 1QSLA 2UVRA 3J7YU 1UWBB 3M9OB 4O3QA 4ZS6A 3T5KA 1Q82T 2MKSA 2F9JA 2F7VA 2ABYA 2NPFA 1F5AA 4DL7A 2FJAB 4WE1B 5I3PA 3U1LA 1S77D 1HWLA 3OHBA 4WF9Q 2V5HG 1Y4ZB 3E8OA 3OVSA 5HROB 3OPKA 5F9NA 5KFPA 1R89A 2K1RA 5F9LA 4I4BA 3WC2A 1OSCA 4OI6A 4USIA 1RISA 2FHKA 4Y0FA 5AXMA 5KT7A 5DLGA 2RILA 3MMBB 4B3RF 5C42B 5L39A 4DR5F 3HZGA 5CYQA 4WFAQ 1L3UA 1QY7A 5B0EA 3DMJA 4OX8A 1HYSB 3IN5A 4G1PA 1YJRA 3WDOA 3TRGA 2EFGA 1Y5NB 1YRXA 3H20A 2B43A 4QPXA 1M5PC 4IH7A 5LSOA 2XMUA 4OIXA 3F44A 1WG5A 4LUBA 4HDHA 1FJ7A 2BUNA 2VPZB 3FQKA 1HQEB 3K8VA 2JDJA 4J9OA 2FLNA 2R8GA 2I0XA 4PG8A 1VQNS 4CQ1A 2FIUA 4F67A 2RQKA 3CJKA 2I38A 4J37A 3RBEA 3SSRA 5GAHI 5CH7B 2C2EA 1NNDA 2JJ4D 1FRHA 4KIAA 4G3IA 2MKIA 2OPPA 5KFUA 1D8ZA 2VG7B 3K7RA 3ISZA 5KFOA 4CO0A 2XG8A 1V6HA 1SI9A 3TUIC 2RNEA 1WNEA 4ES1A 1IKWB 2CVEA 1R3NA 5A6PA 1U6ZA 1NAQA 3I0SA 3L3CA 2MJNA 2PGCA 1N32F 4IR9A 2VG5A 2QMWA 1C0TB 3RAMA 2IM2A 1DQAA 5DS7A 3LH2S 4KTQA 3JTNA 2O66A 2RUGA 2B4VA 2RQ4A 5I42A 4KBIA 3GIJA 3BN7A 3CEDA 1WF0A 3V6KA 5SZTA 5LMNF 3CT9A 3DYAB 4WYLA 1RTHB 2Q1LA 3MI7X 3PW5A 1WF1A 3HI9A 4HKQA 5DQIA 3LP2A 3KWMA 3VZIA 1QUVA 4N77A 2Y1RI 4DQPA 3AB4B 1LWCB 1SQEA 2ZOGA 4ED2A 5F8NA 3DRXA 3LOUA 4RBUA 4C8NA 4DV2F 1Y5IB 3JSBA 2HFZA 2KJWA 2OMOA 2DH8A 2RKIB 1TKTB 2PMHA 2OLWA 3HHLD 3T19A 2FVSA 2IMWP 3CSKA 2AYBA 3GQCA 4WFBQ 2YNIA 2CJBA 1HQUB 2RF2B 2XNQA 2XEXA 4O44A 4DFJA 2P9CA 1TVRB 2OPQB 2B3TB 3AY0A 2FLOA 4ID5A 4IG3A 4LIWA 5LJ3Y 1Y00A 2FHJD 2RU9A 3NL0A 1HBOA 5EX0A 2HVIA 4QWCA 3PM9A 2C3OA 1KQFB 3DI6A 3OTOF 1NK9A 5KG4A 4ED3A 3E01B 2CRLA 2K2PA 1MROB 3OTEA 5J2PA 1RT1B 1MSWD 1TKZA 4LJMA 2W8KA 1K73T 3KTQA 3KHGA 2J8AA 1ZPVA 2U2FA 1GT8A 2EI5A 2VZ9A 4ECUA 2YNFB 3KLGA 1SH2A 4Y3CA 1DLOA 2LMIA 2SXLA 4IOCQ 2DR9A 2NREA 1QLNA 1WTFA 3KFWX 1YJNS 5KFFA 1HNVA 1XMOF 4ZP7A 3MECA 2M8HA 1NO8A 2JFDA 4IRKA 1NK8A 1S9GA 1TZ0A 4URSA 1VS3A 1WG4A 4E0DA 4AE5A 4ZPVR 4MTPA 3AQOA 5A8RA 3MTKA 2WAQD 3CGIA 3GILA 1T3NA 3MR6A 4GC7A 2CFXA 3DLBA 1KTVA 5GMKa 2ZM6F 2LQ9A 3OL7A 4YHHF 1N8RT 3KG4A 3MR5A 4IYQA 3M6XA 1XNRF 5GAGU 2CPZA 3HVWA 4QU6A 1U1OA 1VQPS 1NK4A 2F8MA 3I55S 4WU2A 1H2TZ 1S1WB 3CDWA 3H4BA 1WHXA 3OSPA 3BSNA 1IBLF 4FF2A 4DSEA 4Y65A 2XCPA 3ZZUA 3TANA 2DHSA 5K8NA 2L9WA 7FDRA 5HP1A 1VFJA 2VPXB 1FF2A 3I87A 2VODA 5DGAA 2J9DA 2HHTA 3OV7A 2D74B 1LWFB 3DXSX 1HL6A 4EBEA 2RQMA 3FCHA 3B82A 1UJ4A 2KM8C 1SKRA 3LUYA 3GYXB 3KK3A 1RT7A 2EG1A 2MQNA 3F73A 2KT2A 3I5BA 4DL2A 2ZD1B 3TVYA 2M52A 4O4GA 3SDEA 2WHOA 1QSSA 4JI4F 2RQCA 3BM7A 4FZVA 2FVRA 1HMVB 4XDCA 3M6WA 4DN0A 3DOMA 1Q78A 4OZNA 3SSSA 1ZAVA 4ETXA 4ELTA 2DO0A 4WKYA 2BE2B 4OI4A 2IRXA 4IO9Q 1FD8A 2J9EA 3OVAA 4Q8EA 4DOZA 2C28A 2J6TA 2B0GA 5JJBA 4A8KA 4ZKAA 2DGTA 3CJ4A 2ZH9A 3CCMS 2LCWA 3C3LA 3R5BA 2Y1JA 2ZE2B 2LQ5A 2HQIA 2ZUGA 2EFNA 2DGOA 1UVNA 2E5GA 3DLKB 4KB7A 3DOLB 4JI3F 4O3OA 2CJQA 2W8LA 5J2MB 1D8YA 2AWZA 5FDLA 1IKXB 3OUYA 1OS5A 2OPRA 3MM6A 3BSOA 1PILA 3K5LA 3VCDA 5HBMA 1HA1A 3CPWR 1GTEA 1VBXA 1VRUB 2PIIA 4Y2CA 1X4HA 3HFKA 1Q53A 4XAKA 1ZM3A 2F4VF 4RW8B 2KT5A 1QE1A 3OTDA 4OJ1A 4RW6A 5B08A 4MYTA 5DDPC 4AL5A 1RI7A 4KRWA 3D0GE 3MAHA 5E0OA 5KFXA 1TKDA 1SJ3P 2BOPA 2E5JA 2IA0A 4MK9A 2E1AA 4JBCA 4F25A 3I5CA 5LT5A 5CYMA 3MPVA 1VQSA 1VJWA 5IT4A 3BGRB 1W2BR 4IRDA 4IRCA 2YNGB 1SUQB 2OFHX 2AX1A 3MEEB 2CQ3A 2DHGA 3MDFA 5A8KB 1FDDA 5U47A 3PJWA 1K0VA 2FVPA 4DMZA 2AW0A 2LXIA 3H5SA 2MJUA 3N01A 4NYPA 2UV8A 4U67Q 4C11B 3Q22A 2N82B 4JI6F 4FN5A 1Y5LB 1YJ9S 3F41A 2DGXA 5J2QB 2FJVA 2M9KA 1U09A 4TYBA 2AD9A 3JSMA 2FHMA 4D3HA 3H98A 3M32A 1D9DA 1FNXH 1YJWS 1BD6A 5T7LB 4X4TA 3G4SS 1GX6A 1VQOS 4PQAA 2CKWA 4TYAA 1C4CA 3KG0A 1Y3KA 3CC2S 3CJ3A 1NHVA 4I69A 1HR0F 4WU3A 2PMZD 2KB2A 2RDIA 2HNZA 5K5MA 1RT3A 1VI7A 2EK1A 4ZK7M 2KN4A 1FRXA 1TKXB 4KHRA 1FKPB 3CE8A 4DJBA 3VAIA 3VZHA 2RJZA 4HEA9 5LXRA 4JUZA 4IDKB 3M2UB 2KT3A 3N5BA 2V4RA 2V0NA 3N28A 4LFAF 1X9SA 3CCJS 4EFAC 2R7WA 3L7PA 3W2WB 5BYSA 6FDRA 4JI7F 2EVZA 3UFCX 3KK1A 4M5DB 1KD1T 2DNZA 4JV1A 2KTQA 3GFXA 2DNMA 4ECXA 2V9KA 1I94F 4IQXA 3IFEA 3BJYA 5LSRA 1O5JA 2C3MA 5EHHA 2YH0A 3KLIA 3QPIA 2YX4A 3AA8A 1M5OC 2Z8QA 5D3GA 3ITHB 4QZVB 4QYRA 4RNNA 2AGOA 3NMRA 2MYFA 2JLEA 1S9EB 4CTAB 1XR7A 5KFTA 2GGPB 3CJ2A 4NLWA 4XDDA 1ZYQA 2MSSA 4YR3A 2CQDA 3U7JA 3MFHA 1KEKA 3V81B 1MWYA 1DTTB 2UUTA 1KLNA 4P2SA 5GAEU 1UFWA 4DQSA 1C1CB 4Z2XA 1KONA 1IKVA 4ECWA 3US5A 2K7KA 1SH0A 3SCJE 3M2VA 2YVSA 3NNCA 3HKWA 1FE4A 5CCLA 1GXUA 3KMSA 4EBDA 3G8QA 3MHYA 2PT0A 3V6DA 3GWCA 3TUJC 3TA2A 1TFWA 3R27A 4FVMA 3T5LA 2HGNA 4KO0A 1U47A 1KHVA 1RTIA 3H2VE 2VA3A 4YOEA 3RAQA 1FRIA 2D9PA 2VBWA 4PPDA 2U1AA 2IC3A 1L3TA 1KNZA 5THWA 4RW9B 3CCZA 2GJ2A 1IXKA 1X5TA 3MMCA 3MM7A 4O4RA 3TVKA 1EETA 4ED8A 4JYAF 5K8PA 4YUDA 2R7VA 2DT9A 5LL6d 1S0MA 3DRPB 4H54A 2JEGA 1SIZA 4I0WA 2O01C 2B56A 3OFGA 3IRXA 2E9TA 2XHWA 3POTB 4MFBB 2FGCA 2YKMA 1S0OA 2DJWA 1XR5A 4OZJA 4BC7A 4FF1A 3Q8SB 4RW4B 3NAIA 5T41A 1I1GA 2YX1A 1DAXA 5B0FA 4UW2A 4EYIB 5E3RA 1NB7A 2CQHA 4KT0C 3EXCX 2CPXA 2HFOA 4WCEQ 4ECVA 3NGDA 3BN4A 4ZHRA 2GQ2A 3GG0A 4RBVA 4U6PA 2HAIA 2F1FA 2W25A 3I0RB 3OJSA 1VQ5S 3HHDA 4MIAA 4F50A 2Z0GA 4B9UA 1KLMA 1YRTA 1LW2A 1E6VA 1CSJA 1OQ6A 2EFPA 3O3LA 5M2RA 1FNOA 1SBRA 3T5HA 3L7OA 4TU9A 3QGHA 3KHRA 1N0VC 4KFBA 5F8HA 2YH1A 2LU2A 3TW0A 4YQWA 3HVRA 5CCMA 5HMWA 4UUWA 3HVTA 5GVQA 2ZJPQ 2W4DA 1S6PB 3JYTA 5FLXY 1Q86T 1IKYB 4M8LA 2FJEB 3O5TB 4OJGA 3MM9B 3ZZYA 2WTFA 4C3KA 4FS2A 3KHHA 4IG0B 4EUVA 2ZZNA 1RKIA 1WWHA 2PSZA 1IBKF 4X2BA 4G1IA 4A8OA 1RT4B 1MNEA 4ELVA 2EFVA 2XZWA 2EBEA 3DRSA 3MD1A 5KFEA 4NMLA 2MDAA 2NUHA 5GADU 2ZH3A 3RB4A 2EPIA 4ICLB 4CH1A 1N54B 1HARA 4DDFA 4EZ6A 4D3GA 1RYSA 3VR1A 5C24A 1C0UB 4PR6A 4HI2A 3SQGB 1GQEA 4OI0A 4C8ZA 2CJAA 5LJ5Y 1BQMA 5DG9A 4DG1A 1K1QA 3BSCA 4X66F 2BANB 4A8FA 3DGPA 2MGZB 3TAMB 3KLHB 2CQ1A 4NLPA 4Q43A 5KG6A 2FPHX 3EZ5A 3RB3A 1FXLA 2AU0A 5HMZA 1S1XB 2I8EA 2KXHA 3JB9k 2XWYA 1VQ4S 2DGQA 3NAHA 4WJBA 1YBAA 4J9MA 2NPIA 5E3AA 2VQEF 5DG8A 4DV6F 3AHPA 4JI1F 4NLRA 2CPDA 4GC6A 1UWBA 5KFNA 3GV5B 2VA2A 2PI5A 3GR1A 1ZAWA 2HVZA 4KHPF 3ENWA 3QJPA 3RB6A 3HMJG 1Z2ZA 2F40A 2IRYA 4I6YA 4WE1A 2FJWA 5F3ZA 4AQYF 2BDPA 2M5YA 3OTBA 4PXBA 2WBMA 5A2QY 3IR5B 4OI3A 5HROA 1URNA 2WCXA 4CNZA 3OR1B 3KK2A 3CC4S 5L1LA 3S7RA 2Z4PA 4RU2A 5K8MA 4O3PA 5M2UA 4U7CA 3D28A 2N4DA 4PG5A 1T7PA 3FEZA 1N5VA 1OPIA 3LP1B 1SL0A 2GNKA 2HQ3A 5DQHA 1N33F 1FCAA 4USHA 3ZZRA 1F2GA 1R27B 1UVKA 1FE0A 1VGYA 5C42A 5CA5A 3RRGA 3MGJA 1G1XA 1AROP 3IO1A 5AXLA 5KFYA 1JLAB 1W2IA 1Q8BA 3QIDA 4N5SA 5EWEA 2G1DA 1HYSA 1IQTA 4FXDA 1V9OA 2MY7A 4EEYA 1DARA 4ZVHA 2BQRA 4GKKF 1HNWF 1HQEA 4ZPAA 3QLHB 3NCQA 3Q8RB 3GZ7A 3UWTA 2BACA 2WOMB 1UL3A 5IWAF 4PXCA 3MURP 1M5SA 3FSXA 2LA6A 2B5JB 3TP2A 2JZ5A 3V6HA 1U1LA 3M1VB 1DQ8A 3M9NB 4C0HA 3CUNA 1FK9B 1M1KT 2RS2A 4DF4A 1Y3JA 3KKFA 4ZVEA 2VG7A 5DM7Q 4BC9A 1H38A 4QIVA 1S1UB 3BR8A 3N5FA 1ROFA 2HGMA 2XO7A 3H8YA 2MQMA 1IKWA 3RU0A 2Q6CA 4O3NA 4JOUA 1X4AA 4WKRA 2JVOA 3FMWA 4H4OB 3KLFB 1HBUB 1H7WA 2C22A 1C0TA 2J5AA 3H4DA 3ZZPA 3CCSS 3VAKA 1RWUA 1XBWA 4AL7A 2RU3A 5F41A 3V5RA 2MHNA 2R2TA 2YKAA 3OL8A 2CQ0A 1VK8A 3QO9B 1UMJA 5BJRA 4LT6A 4ZPBA 3QMQA 4DF8A 1TV6B 3DYAA 2KH9A 5F0UA 1RTHA 1WHWA 3FFIB 4DV1F 3FEYB 5KAKA 3M2RB 4OHVA 1N88A 1OWXA 2B7CB 1RTJA 1SXLA 2HRYA 1U24A 3LALA 2J9CA 3G6VA 3K5MA 3S6EA 5EDWA 1RT6B 1LWCA 4PXEA 3MM8B 1UVJA 1R0AB 1U48A 3MMAB 3PJXA 3GB0A 4TQSA 1TKTA 3S1TA 2YKOA 4EO6A 3RW6A 1BQNB 4EU0A 3MEKA 5EN1A 1HQUA 2RF2A 1VQKS 2F3JA 2MZTA 1TVRA 2HWHA 2OPQA 2GQQA 4G6VB 4ED1A 2BQ3A 3QWPA 2DGWA 4DFKA 2GQCA 4MAKA 2ZH4A 4I2QA 2POKA 1UETA 4CO3A 2JOQA 2YNHB 5C5JA 1L3SA 2V2KA 2HLUA 3CD6S 3E01A 4PG6A 1MROA 1JLBA 1RT1A 1S6QA 1JLFB 2E5LF 3UR0A 3PX0A 5M2PA 2Q43A 3M8RA 4GO5X 3M8SA 1VIOA 3LP0B 2E7XA 3PFEA 2QIFA 4ZOSA 2DR5A 2VD3A 5J2NB 1VOMA 1UJ5A 2MMYA 2YNFA 2WK4A 5KFSA 1S72S 1XERA 5K14A 1WEYA 1JJ4A 3IWNC 4TXSA 4IUFA 3J7YI 2JEFA 2E29A 3OFEA 3ZZOA 4BS2A 2ZH8A 1DTQB 4CH7A 4QWEA 2ZNYA 4O3SA 2JEJA 1FKOB 3FSYA 3E51A 2OSQA 5IFMA 2N7CA 2QE5A 1TL1B 1FKAF 4DUZF 5E33A 2DRAA 2J0XA 2F8HA 3VQSA 3U1NA 2JSXA 3LO3A 1RQ0A 5MAOA 2VBXA 5KT5A 1DHMA 3H2LA 1S1WA 1QM9A 1U2FA 2W24A 5DGBA 4NRUA 3E2EA 2YKNA 3G8TA 1HD1A 1Q7LB 4JI2F 1KC8T 2W7OA 1GXTA 2VBYA 2DK2A 5E3CA 1SJRA 3HXMA 3MPWA 1HNIB 2PDAA 5DM6Q 4WXOA 3B4DA 3QAEA 3CCRS 1C1BB 3HHLB 1LWFA 2UVWA 1RTDB 1OSDA 1SV5B 1W25A 2M7SA 4OX9F 1FEEA 4LVOP 1NK6A 4DSKA 4NX9A 2W9BB 4TQRA 4JI8F 3SYZA 1TL4A 1N34F 2XS5A 3NCRA 2G0CA 4I68A 3J7A1 2MHEA 3IWXA 1SH3A 2VV5A 2HIQA 1JNZB 1A7GE 2FDNA 1T03B 1X8DA 2W9CA 3T5JA 5IXUA 4WFNQ 4B9NA 5HI7A 4C8LA 1HMVA 1FXDA 5B7WA 2RVJA 3G8SA 3UDCA 3M4XA 2PC6A 3DNCA 3I82A 3EGNA 4P7VA 2BE2A 1VBZA 1RKJA